data_3CME
# 
_entry.id   3CME 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.313 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3CME         
NDB   RR0219       
RCSB  RCSB046951   
WWPDB D_1000046951 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3CMA 
_pdbx_database_related.details        
'THE STRUCTURE OF CCA AND CCA-PHE-CAP-BIO BOUND TO THE LARGE RIBOSOMAL SUBUNIT OF HALOARCULA MARISMORTUI' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        3CME 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2008-03-21 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Simonovic, M.' 1 
'Steitz, T.A.'  2 
# 
_citation.id                        primary 
_citation.title                     
;Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
;
_citation.journal_abbrev            Rna 
_citation.journal_volume            14 
_citation.page_first                2372 
_citation.page_last                 2378 
_citation.year                      2008 
_citation.journal_id_ASTM           RNARFU 
_citation.country                   UK 
_citation.journal_id_ISSN           1355-8382 
_citation.journal_id_CSD            2122 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18818369 
_citation.pdbx_database_id_DOI      10.1261/rna.1118908 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Simonovic, M.' 1 ? 
primary 'Steitz, T.A.'  2 ? 
# 
_cell.entry_id           3CME 
_cell.length_a           210.786 
_cell.length_b           297.778 
_cell.length_c           572.588 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3CME 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat '50S ribosomal protein L2P'   25354.688  1    ? ? ? ? 
2  polymer     nat '50S ribosomal protein L3P'   37396.395  1    ? ? ? ? 
3  polymer     nat '50S ribosomal protein L4P'   26457.068  1    ? ? ? ? 
4  polymer     nat '50S ribosomal protein L5P'   19551.693  1    ? ? ? ? 
5  polymer     nat '50S ribosomal protein L6P'   19961.719  1    ? ? ? ? 
6  polymer     nat '50S ribosomal protein L7Ae'  12791.941  1    ? ? ? ? 
7  polymer     nat '50S ribosomal protein L10E'  37213.805  1    ? ? ? ? 
8  polymer     nat '50S ribosomal protein L10e'  19942.734  1    ? ? ? ? 
9  polymer     nat '50S ribosomal protein L11P'  17097.547  1    ? ? ? ? 
10 polymer     nat '50S ribosomal protein L13P'  16249.214  1    ? ? ? ? 
11 polymer     nat '50S ribosomal protein L14P'  14216.233  1    ? ? ? ? 
12 polymer     nat '50S ribosomal protein L15P'  18005.367  1    ? ? ? ? 
13 polymer     nat '50S ribosomal protein L15e'  22404.301  1    ? ? ? ? 
14 polymer     nat '50S ribosomal protein L18P'  20640.939  1    ? ? ? ? 
15 polymer     nat '50S ribosomal protein L18e'  12438.915  1    ? ? ? ? 
16 polymer     nat '50S ribosomal protein L19e'  16796.514  1    ? ? ? ? 
17 polymer     nat '50S ribosomal protein L21e'  10567.801  1    ? ? ? ? 
18 polymer     nat '50S ribosomal protein L22P'  16966.945  1    ? ? ? ? 
19 polymer     nat '50S ribosomal protein L23P'  9612.537   1    ? ? ? ? 
20 polymer     nat '50S ribosomal protein L24P'  13670.955  1    ? ? ? ? 
21 polymer     nat '50S ribosomal protein L24e'  7364.915   1    ? ? ? ? 
22 polymer     nat '50S ribosomal protein L29P'  7889.863   1    ? ? ? ? 
23 polymer     nat '50S ribosomal protein L30P'  17062.885  1    ? ? ? ? 
24 polymer     nat '50S ribosomal protein L31e'  10384.613  1    ? ? ? ? 
25 polymer     nat '50S ribosomal protein L32e'  26326.613  1    ? ? ? ? 
26 polymer     nat '50S ribosomal protein L37Ae' 12900.325  1    ? ? ? ? 
27 polymer     nat '50S ribosomal protein L37e'  6330.203   1    ? ? ? ? 
28 polymer     nat '50S ribosomal protein L39e'  6133.090   1    ? ? ? ? 
29 polymer     nat '50S ribosomal protein L44E'  10815.245  1    ? ? ? ? 
30 polymer     nat '50S RIBOSOMAL RNA'           946463.500 1    ? ? ? ? 
31 polymer     nat '5S RIBOSOMAL RNA'            39303.402  1    ? ? ? ? 
32 polymer     syn 
;RNA (5'-R(*C*CP*A)-3')
;
894.612    1    ? ? ? ? 
33 polymer     syn 
;RNA (5'-R(*CP*CP*(8AN))-3')
;
893.627    1    ? ? ? ? 
34 non-polymer syn 'MAGNESIUM ION'               24.305     93   ? ? ? ? 
35 non-polymer syn 'CHLORIDE ION'                35.453     22   ? ? ? ? 
36 non-polymer syn 'STRONTIUM ION'               87.620     108  ? ? ? ? 
37 non-polymer syn 'SODIUM ION'                  22.990     75   ? ? ? ? 
38 non-polymer syn 'CADMIUM ION'                 112.411    5    ? ? ? ? 
39 non-polymer syn 'POTASSIUM ION'               39.098     2    ? ? ? ? 
40 non-polymer syn PHENYLALANINE                 165.189    1    ? ? ? ? 
41 non-polymer syn '6-AMINOHEXANOIC ACID'        131.173    1    ? ? ? ? 
42 water       nat water                         18.015     7808 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  'Hmal2, Hl4'                                                               
2  'Hmal3, Hl1'                                                               
3  'Hmal4, Hl6'                                                               
4  'Hmal5, Hl13'                                                              
5  'Hmal6, Hl10'                                                              
6  Hs6                                                                        
7  'Ribosomal protein L10, Acidic ribosomal protein P0 homolog, L10E, HMal10' 
8  Hmal11                                                                     
9  Hmal13                                                                     
10 'Hmal14, Hl27'                                                             
11 'Hmal15, Hl9'                                                              
12 '50S ribosomal protein LC12'                                               
13 'Hmal18, Hl12'                                                             
14 'Hl29, L19'                                                                
16 'Hmal19, Hl24'                                                             
17 Hl31                                                                       
18 'Hmal22, Hl23'                                                             
19 'Hmal23, Hl25, L21'                                                        
20 'Hmal24, Hl16, Hl15'                                                       
21 Hl21/Hl22                                                                  
22 'Hmal29, Hl33'                                                             
23 'Hmal30, Hl20, Hl16'                                                       
24 'L34, Hl30'                                                                
25 Hl5                                                                        
27 L35e                                                                       
28 'Hl39e, Hl46e'                                                             
29 'La, Hla'                                                                  
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)'   no no  
;MGRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDE
LQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVV
AGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGGNE
;
;MGRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDE
LQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVV
AGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGGNE
;
A ? 
2  'polypeptide(L)'   no no  
;MPQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPM
RAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKP
DVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNL
GPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPND
QPRLDPEVRYVSNESNQG
;
;MPQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPM
RAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKP
DVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNL
GPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPND
QPRLDPEVRYVSNESNQG
;
B ? 
3  'polypeptide(L)'   no no  
;MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKQDGRARRV
PQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEAL
DVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESAL
AEVAER
;
;MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKQDGRARRV
PQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEAL
DVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESAL
AEVAER
;
C ? 
4  'polypeptide(L)'   no no  
;MSSESESGGDFHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEM
AEEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNP
ADAVAFIESTYDVEVSE
;
;MSSESESGGDFHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEM
AEEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNP
ADAVAFIESTYDVEVSE
;
D ? 
5  'polypeptide(L)'   no no  
;MPRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEG
WEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDV
RVFQDGVYITRKPNRGDA
;
;MPRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEG
WEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDV
RVFQDGVYITRKPNRGDA
;
E ? 
6  'polypeptide(L)'   no no  
;MPVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQ
QDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
;
;MPVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQ
QDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
;
F ? 
7  'polypeptide(L)'   no no  
;MSAESERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDDVDDGLED
LNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGEVAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLS
DSTVLDTGEEVSQELSNVLNELGIEPKEVGLDLRAVFADGVLFEPEELELDIDEYRSDIQAAAGRAFNLSVNADYPTATT
APTMLQSDRGNAKSLALQAAIEDPEVVPDLVSKADAQVRALASQIDDEEALPEELQGVEADVATEEPTDDQDDDTASEDD
ADADDAAEEADDDDDDDEDAGDALGAMF
;
;MSAESERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDDVDDGLED
LNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGEVAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLS
DSTVLDTGEEVSQELSNVLNELGIEPKEVGLDLRAVFADGVLFEPEELELDIDEYRSDIQAAAGRAFNLSVNADYPTATT
APTMLQSDRGNAKSLALQAAIEDPEVVPDLVSKADAQVRALASQIDDEEALPEELQGVEADVATEEPTDDQDDDTASEDD
ADADDAAEEADDDDDDDEDAGDALGAMF
;
G ? 
8  'polypeptide(L)'   no no  
;MSDKPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKEL
GEEGDYKMTLRKFPHQVLRENKQATGAGADRVSDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKI
TPSCRIKVERGEELLIA
;
;MSDKPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKEL
GEEGDYKMTLRKFPHQVLRENKQATGAGADRVSDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKI
TPSCRIKVERGEELLIA
;
H ? 
9  'polypeptide(L)'   no no  
;MAGTIEVLVPGGEANPGPPLGPELGPTPVDVQAVVQEINDQTAAFDGTEVPVTVKYDDDGSFEIEVGVPPTAELIKDEAG
FETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIEGENPREFKERIDAGEYDDVFAAEA
QA
;
;MAGTIEVLVPGGEANPGPPLGPELGPTPVDVQAVVQEINDQTAAFDGTEVPVTVKYDDDGSFEIEVGVPPTAELIKDEAG
FETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIEGENPREFKERIDAGEYDDVFAAEA
QA
;
I ? 
10 'polypeptide(L)'   no no  
;MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFK
RTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW
;
;MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFK
RTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW
;
J ? 
11 'polypeptide(L)'   no no  
;MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRHPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPI
RRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV
;
;MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRHPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPI
RRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV
;
K ? 
12 'polypeptide(L)'   no no  
;MTSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAAD
DVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDA
DADEE
;
;MTSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAAD
DVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDA
DADEE
;
L ? 
13 'polypeptide(L)'   no no  
;MARSAYSYIRDAWKNPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKA
GRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRV
FRGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKGK
;
;MARSAYSYIRDAWKNPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKA
GRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRV
FRGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKGK
;
M ? 
14 'polypeptide(L)'   no no  
;MATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMP
SAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLY
SGDFDAADLPEHFDELRETLLDGDIEL
;
;MATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMP
SAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLY
SGDFDAADLPEHFDELRETLLDGDIEL
;
N ? 
15 'polypeptide(L)'   no no  
;MSKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAV
DFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
;
;MSKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAV
DFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
;
O ? 
16 'polypeptide(L)'   no no  
;MTDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGS
RKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDANHGDA
;
;MTDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGS
RKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDANHGDA
;
P ? 
17 'polypeptide(L)'   no no  
;MPSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGG
KEKTIIVTAAHLRRQE
;
;MPSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGG
KEKTIIVTAAHLRRQE
;
Q ? 
18 'polypeptide(L)'   no no  
;MGISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGR
YPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED
;
;MGISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGR
YPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED
;
R ? 
19 'polypeptide(L)'   no no  
;MSWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVAS
RIGVF
;
;MSWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVAS
RIGVF
;
S ? 
20 'polypeptide(L)'   no no  
;MSKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTL
EKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA
;
;MSKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTL
EKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA
;
T ? 
21 'polypeptide(L)'   no no  MPRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEAGEAEDEA 
MPRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEAGEAEDEA U ? 
22 'polypeptide(L)'   no no  MTVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGDLQENE 
MTVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGDLQENE V ? 
23 'polypeptide(L)'   no no  
;MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVD
DEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR
;
;MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVD
DEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR
;
W ? 
24 'polypeptide(L)'   no no  
;MSASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEE
EGEAIVEAETAE
;
;MSASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEE
EGEAIVEAETAE
;
X ? 
25 'polypeptide(L)'   no no  
;MADNEEDVEAEEEYTELTDISGVGPSKAESLREAGFESVEDVRGADQSALADVSGIGNALAARIKADVGGLEVESETEAE
VEEEGGEEAPDEDVETELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKG
KGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEVEVS
;
;MADNEEDVEAEEEYTELTDISGVGPSKAESLREAGFESVEDVRGADQSALADVSGIGNALAARIKADVGGLEVESETEAE
VEEEGGEEAPDEDVETELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKG
KGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEVEVS
;
Y ? 
26 'polypeptide(L)'   no no  
;MSPRARREPNLEGLMWPLGGQQTTMASKSGKTGSSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQ
CSYCDYKFTGGSYKPETPGGKTVRRSIRAALSEDEE
;
;MSPRARREPNLEGLMWPLGGQQTTMASKSGKTGSSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQ
CSYCDYKFTGGSYKPETPGGKTVRRSIRAALSEDEE
;
Z ? 
27 'polypeptide(L)'   no no  MTGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE 
MTGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE 1 ? 
28 'polypeptide(L)'   no no  MGKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE MGKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE 
2 ? 
29 'polypeptide(L)'   no no  
;MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLR
EGWRAGRLEFQE
;
;MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLR
EGWRAGRLEFQE
;
3 ? 
30 polyribonucleotide no yes 
;GUUGGCUACUAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCUGUGGGGA
GCCGCACGGAGGCGAAGAACCACAGAUUUCCGAAUGAGAAUCUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGA
ACUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAACGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCC
AAACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUUCACGAAGUCUCUUGGAAUAG
AGCGUGAUACAGGGUGACAACCCCGUACUGAAGACCAGUACGCUGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCC
CUCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGC
UGCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUU
GACGAAUGACCGAGACGCGAGUCUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUG(1MA)AAAACGAG
CCAGGGAGUGUGUCUGUAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUUG
CCCGAGGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGA
AGCGUGCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAA
GGCCCAUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAG
AGCGACCGAUUGGUGUGUCCGCCUCCGAGAGGAGUCGGCACACCUGUCAAACUCCAAACUUACAGACGCUGUUUGACGCG
GGGAUUCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUU
AAGUGUAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGC
GUAACAGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACU
CAUACUGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGCAGGGGCGAGAGCUCCUGUGGACCGAUUAGUGACGAA
AAUCCUGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUC
AGCUGAGGGUUAGCCGGUCCUAAGUCUCACCGCAACUCGACUGAGACGAAAUGGGAAACAGGUUAAUAUUCCUGUGCCAU
CAUGCAGUGAAAGUUGACGCCCUGGGGUCGAUCACGCCGGGCAUUCGCCCGGUCGAACCGUCCAACUCCGUGGAAGCCGU
AAUGGCAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUGAUGUCCG
UACCGAGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAG
UUAGUCCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUA
GUAACAACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUC
GUACAAGAGGACGAAGGACCUGUCAACGGCGGGGGUAACUAUGACCCUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGU
AGCGGCUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGU
CUGGAGACACCCAGGGGGAAGCGAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGACGUGGUCGCCGAUGUGCAG
CAUAGGUAGGAGUCGUUACAGAGGUACCCGCGCUAGCGGGCCACCCAGACAACAGUGAAAUACUACCCGUCGGUGACUGC
GACUCUCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCG
CCCUAUGGUCAUCUCAGCCGGGACAGAGACCCGGCGAAGAGUGCAAGAGCAAAAGAUGACUUGACAGUGUUCUUCCCAAC
GAGGAACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACC
CUAGGGAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCC
UGCCCGUGCAGAAGCGGGCAAGGGUGAGGU(OMU)(OMG)UUCGCCUAUUAAAGGAGGUCGUGAGCUGGG(UR3)U
(PSU)AGACCGUCGUGAGACAGGUCGGCUGCUAUCUACUGGGUGUGUAAUGGUGUCUGACAAGAACGACCGUAUAGUACG
AGAGGAACUACGGUUGGUGGCCACUGGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAA
GAGCUGAACGCAUCUAAGCUCGAAACCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGA
CUCGGGGUGUGCGCGUCGAGGUAACGAGACGUUAAGCCCACGAGCACUAACAGACCAAAGCCAUCAU
;
;GUUGGCUACUAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCUGUGGGGA
GCCGCACGGAGGCGAAGAACCACAGAUUUCCGAAUGAGAAUCUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGA
ACUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAACGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCC
AAACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUUCACGAAGUCUCUUGGAAUAG
AGCGUGAUACAGGGUGACAACCCCGUACUGAAGACCAGUACGCUGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCC
CUCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGC
UGCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUU
GACGAAUGACCGAGACGCGAGUCUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGAAAAACGAGCCAG
GGAGUGUGUCUGUAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUUGCCCG
AGGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCG
UGCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCC
CAUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCG
ACCGAUUGGUGUGUCCGCCUCCGAGAGGAGUCGGCACACCUGUCAAACUCCAAACUUACAGACGCUGUUUGACGCGGGGA
UUCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGU
GUAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAA
CAGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUA
CUGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGCAGGGGCGAGAGCUCCUGUGGACCGAUUAGUGACGAAAAUC
CUGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCU
GAGGGUUAGCCGGUCCUAAGUCUCACCGCAACUCGACUGAGACGAAAUGGGAAACAGGUUAAUAUUCCUGUGCCAUCAUG
CAGUGAAAGUUGACGCCCUGGGGUCGAUCACGCCGGGCAUUCGCCCGGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUG
GCAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUGAUGUCCGUACC
GAGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAG
UCCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAA
CAACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUAC
AAGAGGACGAAGGACCUGUCAACGGCGGGGGUAACUAUGACCCUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCG
GCUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGG
AGACACCCAGGGGGAAGCGAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGACGUGGUCGCCGAUGUGCAGCAUA
GGUAGGAGUCGUUACAGAGGUACCCGCGCUAGCGGGCCACCCAGACAACAGUGAAAUACUACCCGUCGGUGACUGCGACU
CUCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCU
AUGGUCAUCUCAGCCGGGACAGAGACCCGGCGAAGAGUGCAAGAGCAAAAGAUGACUUGACAGUGUUCUUCCCAACGAGG
AACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAG
GGAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCC
CGUGCAGAAGCGGGCAAGGGUGAGGUUGUUCGCCUAUUAAAGGAGGUCGUGAGCUGGGUUUAGACCGUCGUGAGACAGGU
CGGCUGCUAUCUACUGGGUGUGUAAUGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCAC
UGGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAA
ACCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAA
CGAGACGUUAAGCCCACGAGCACUAACAGACCAAAGCCAUCAU
;
0 ? 
31 polyribonucleotide no no  
;UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCAGGGAGUA
CUGGAGUGCGCGAGCCUCUGGGAAAUCCGGUUCGCCGCCACC
;
;UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCAGGGAGUA
CUGGAGUGCGCGAGCCUCUGGGAAAUCCGGUUCGCCGCCACC
;
9 ? 
32 polyribonucleotide no no  CCA CCA 5 ? 
33 polyribonucleotide no yes 'CC(8AN)' CCA 6 ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    MET n 
1  2    GLY n 
1  3    ARG n 
1  4    ARG n 
1  5    ILE n 
1  6    GLN n 
1  7    GLY n 
1  8    GLN n 
1  9    ARG n 
1  10   ARG n 
1  11   GLY n 
1  12   ARG n 
1  13   GLY n 
1  14   THR n 
1  15   SER n 
1  16   THR n 
1  17   PHE n 
1  18   ARG n 
1  19   ALA n 
1  20   PRO n 
1  21   SER n 
1  22   HIS n 
1  23   ARG n 
1  24   TYR n 
1  25   LYS n 
1  26   ALA n 
1  27   ASP n 
1  28   LEU n 
1  29   GLU n 
1  30   HIS n 
1  31   ARG n 
1  32   LYS n 
1  33   VAL n 
1  34   GLU n 
1  35   ASP n 
1  36   GLY n 
1  37   ASP n 
1  38   VAL n 
1  39   ILE n 
1  40   ALA n 
1  41   GLY n 
1  42   THR n 
1  43   VAL n 
1  44   VAL n 
1  45   ASP n 
1  46   ILE n 
1  47   GLU n 
1  48   HIS n 
1  49   ASP n 
1  50   PRO n 
1  51   ALA n 
1  52   ARG n 
1  53   SER n 
1  54   ALA n 
1  55   PRO n 
1  56   VAL n 
1  57   ALA n 
1  58   ALA n 
1  59   VAL n 
1  60   GLU n 
1  61   PHE n 
1  62   GLU n 
1  63   ASP n 
1  64   GLY n 
1  65   ASP n 
1  66   ARG n 
1  67   ARG n 
1  68   LEU n 
1  69   ILE n 
1  70   LEU n 
1  71   ALA n 
1  72   PRO n 
1  73   GLU n 
1  74   GLY n 
1  75   VAL n 
1  76   GLY n 
1  77   VAL n 
1  78   GLY n 
1  79   ASP n 
1  80   GLU n 
1  81   LEU n 
1  82   GLN n 
1  83   VAL n 
1  84   GLY n 
1  85   VAL n 
1  86   SER n 
1  87   ALA n 
1  88   GLU n 
1  89   ILE n 
1  90   ALA n 
1  91   PRO n 
1  92   GLY n 
1  93   ASN n 
1  94   THR n 
1  95   LEU n 
1  96   PRO n 
1  97   LEU n 
1  98   ALA n 
1  99   GLU n 
1  100  ILE n 
1  101  PRO n 
1  102  GLU n 
1  103  GLY n 
1  104  VAL n 
1  105  PRO n 
1  106  VAL n 
1  107  CYS n 
1  108  ASN n 
1  109  VAL n 
1  110  GLU n 
1  111  SER n 
1  112  SER n 
1  113  PRO n 
1  114  GLY n 
1  115  ASP n 
1  116  GLY n 
1  117  GLY n 
1  118  LYS n 
1  119  PHE n 
1  120  ALA n 
1  121  ARG n 
1  122  ALA n 
1  123  SER n 
1  124  GLY n 
1  125  VAL n 
1  126  ASN n 
1  127  ALA n 
1  128  GLN n 
1  129  LEU n 
1  130  LEU n 
1  131  THR n 
1  132  HIS n 
1  133  ASP n 
1  134  ARG n 
1  135  ASN n 
1  136  VAL n 
1  137  ALA n 
1  138  VAL n 
1  139  VAL n 
1  140  LYS n 
1  141  LEU n 
1  142  PRO n 
1  143  SER n 
1  144  GLY n 
1  145  GLU n 
1  146  MET n 
1  147  LYS n 
1  148  ARG n 
1  149  LEU n 
1  150  ASP n 
1  151  PRO n 
1  152  GLN n 
1  153  CYS n 
1  154  ARG n 
1  155  ALA n 
1  156  THR n 
1  157  ILE n 
1  158  GLY n 
1  159  VAL n 
1  160  VAL n 
1  161  ALA n 
1  162  GLY n 
1  163  GLY n 
1  164  GLY n 
1  165  ARG n 
1  166  THR n 
1  167  ASP n 
1  168  LYS n 
1  169  PRO n 
1  170  PHE n 
1  171  VAL n 
1  172  LYS n 
1  173  ALA n 
1  174  GLY n 
1  175  ASN n 
1  176  LYS n 
1  177  HIS n 
1  178  HIS n 
1  179  LYS n 
1  180  MET n 
1  181  LYS n 
1  182  ALA n 
1  183  ARG n 
1  184  GLY n 
1  185  THR n 
1  186  LYS n 
1  187  TRP n 
1  188  PRO n 
1  189  ASN n 
1  190  VAL n 
1  191  ARG n 
1  192  GLY n 
1  193  VAL n 
1  194  ALA n 
1  195  MET n 
1  196  ASN n 
1  197  ALA n 
1  198  VAL n 
1  199  ASP n 
1  200  HIS n 
1  201  PRO n 
1  202  PHE n 
1  203  GLY n 
1  204  GLY n 
1  205  GLY n 
1  206  GLY n 
1  207  ARG n 
1  208  GLN n 
1  209  HIS n 
1  210  PRO n 
1  211  GLY n 
1  212  LYS n 
1  213  PRO n 
1  214  LYS n 
1  215  SER n 
1  216  ILE n 
1  217  SER n 
1  218  ARG n 
1  219  ASN n 
1  220  ALA n 
1  221  PRO n 
1  222  PRO n 
1  223  GLY n 
1  224  ARG n 
1  225  LYS n 
1  226  VAL n 
1  227  GLY n 
1  228  ASP n 
1  229  ILE n 
1  230  ALA n 
1  231  SER n 
1  232  LYS n 
1  233  ARG n 
1  234  THR n 
1  235  GLY n 
1  236  ARG n 
1  237  GLY n 
1  238  GLY n 
1  239  ASN n 
1  240  GLU n 
2  1    MET n 
2  2    PRO n 
2  3    GLN n 
2  4    PRO n 
2  5    SER n 
2  6    ARG n 
2  7    PRO n 
2  8    ARG n 
2  9    LYS n 
2  10   GLY n 
2  11   SER n 
2  12   LEU n 
2  13   GLY n 
2  14   PHE n 
2  15   GLY n 
2  16   PRO n 
2  17   ARG n 
2  18   LYS n 
2  19   ARG n 
2  20   SER n 
2  21   THR n 
2  22   SER n 
2  23   GLU n 
2  24   THR n 
2  25   PRO n 
2  26   ARG n 
2  27   PHE n 
2  28   ASN n 
2  29   SER n 
2  30   TRP n 
2  31   PRO n 
2  32   SER n 
2  33   ASP n 
2  34   ASP n 
2  35   GLY n 
2  36   GLN n 
2  37   PRO n 
2  38   GLY n 
2  39   VAL n 
2  40   GLN n 
2  41   GLY n 
2  42   PHE n 
2  43   ALA n 
2  44   GLY n 
2  45   TYR n 
2  46   LYS n 
2  47   ALA n 
2  48   GLY n 
2  49   MET n 
2  50   THR n 
2  51   HIS n 
2  52   VAL n 
2  53   VAL n 
2  54   LEU n 
2  55   VAL n 
2  56   ASN n 
2  57   ASP n 
2  58   GLU n 
2  59   PRO n 
2  60   ASN n 
2  61   SER n 
2  62   PRO n 
2  63   ARG n 
2  64   GLU n 
2  65   GLY n 
2  66   MET n 
2  67   GLU n 
2  68   GLU n 
2  69   THR n 
2  70   VAL n 
2  71   PRO n 
2  72   VAL n 
2  73   THR n 
2  74   VAL n 
2  75   ILE n 
2  76   GLU n 
2  77   THR n 
2  78   PRO n 
2  79   PRO n 
2  80   MET n 
2  81   ARG n 
2  82   ALA n 
2  83   VAL n 
2  84   ALA n 
2  85   LEU n 
2  86   ARG n 
2  87   ALA n 
2  88   TYR n 
2  89   GLU n 
2  90   ASP n 
2  91   THR n 
2  92   PRO n 
2  93   TYR n 
2  94   GLY n 
2  95   GLN n 
2  96   ARG n 
2  97   PRO n 
2  98   LEU n 
2  99   THR n 
2  100  GLU n 
2  101  VAL n 
2  102  TRP n 
2  103  THR n 
2  104  ASP n 
2  105  GLU n 
2  106  PHE n 
2  107  HIS n 
2  108  SER n 
2  109  GLU n 
2  110  LEU n 
2  111  ASP n 
2  112  ARG n 
2  113  THR n 
2  114  LEU n 
2  115  ASP n 
2  116  VAL n 
2  117  PRO n 
2  118  GLU n 
2  119  ASP n 
2  120  HIS n 
2  121  ASP n 
2  122  PRO n 
2  123  ASP n 
2  124  ALA n 
2  125  ALA n 
2  126  GLU n 
2  127  GLU n 
2  128  GLN n 
2  129  ILE n 
2  130  ARG n 
2  131  ASP n 
2  132  ALA n 
2  133  HIS n 
2  134  GLU n 
2  135  ALA n 
2  136  GLY n 
2  137  ASP n 
2  138  LEU n 
2  139  GLY n 
2  140  ASP n 
2  141  LEU n 
2  142  ARG n 
2  143  LEU n 
2  144  ILE n 
2  145  THR n 
2  146  HIS n 
2  147  THR n 
2  148  VAL n 
2  149  PRO n 
2  150  ASP n 
2  151  ALA n 
2  152  VAL n 
2  153  PRO n 
2  154  SER n 
2  155  VAL n 
2  156  PRO n 
2  157  LYS n 
2  158  LYS n 
2  159  LYS n 
2  160  PRO n 
2  161  ASP n 
2  162  VAL n 
2  163  MET n 
2  164  GLU n 
2  165  THR n 
2  166  ARG n 
2  167  VAL n 
2  168  GLY n 
2  169  GLY n 
2  170  GLY n 
2  171  SER n 
2  172  VAL n 
2  173  SER n 
2  174  ASP n 
2  175  ARG n 
2  176  LEU n 
2  177  ASP n 
2  178  HIS n 
2  179  ALA n 
2  180  LEU n 
2  181  ASP n 
2  182  ILE n 
2  183  VAL n 
2  184  GLU n 
2  185  ASP n 
2  186  GLY n 
2  187  GLY n 
2  188  GLU n 
2  189  HIS n 
2  190  ALA n 
2  191  MET n 
2  192  ASN n 
2  193  ASP n 
2  194  ILE n 
2  195  PHE n 
2  196  ARG n 
2  197  ALA n 
2  198  GLY n 
2  199  GLU n 
2  200  TYR n 
2  201  ALA n 
2  202  ASP n 
2  203  VAL n 
2  204  ALA n 
2  205  GLY n 
2  206  VAL n 
2  207  THR n 
2  208  LYS n 
2  209  GLY n 
2  210  LYS n 
2  211  GLY n 
2  212  THR n 
2  213  GLN n 
2  214  GLY n 
2  215  PRO n 
2  216  VAL n 
2  217  LYS n 
2  218  ARG n 
2  219  TRP n 
2  220  GLY n 
2  221  VAL n 
2  222  GLN n 
2  223  LYS n 
2  224  ARG n 
2  225  LYS n 
2  226  GLY n 
2  227  LYS n 
2  228  HIS n 
2  229  ALA n 
2  230  ARG n 
2  231  GLN n 
2  232  GLY n 
2  233  TRP n 
2  234  ARG n 
2  235  ARG n 
2  236  ARG n 
2  237  ILE n 
2  238  GLY n 
2  239  ASN n 
2  240  LEU n 
2  241  GLY n 
2  242  PRO n 
2  243  TRP n 
2  244  ASN n 
2  245  PRO n 
2  246  SER n 
2  247  ARG n 
2  248  VAL n 
2  249  ARG n 
2  250  SER n 
2  251  THR n 
2  252  VAL n 
2  253  PRO n 
2  254  GLN n 
2  255  GLN n 
2  256  GLY n 
2  257  GLN n 
2  258  THR n 
2  259  GLY n 
2  260  TYR n 
2  261  HIS n 
2  262  GLN n 
2  263  ARG n 
2  264  THR n 
2  265  GLU n 
2  266  LEU n 
2  267  ASN n 
2  268  LYS n 
2  269  ARG n 
2  270  LEU n 
2  271  ILE n 
2  272  ASP n 
2  273  ILE n 
2  274  GLY n 
2  275  GLU n 
2  276  GLY n 
2  277  ASP n 
2  278  GLU n 
2  279  PRO n 
2  280  THR n 
2  281  VAL n 
2  282  ASP n 
2  283  GLY n 
2  284  GLY n 
2  285  PHE n 
2  286  VAL n 
2  287  ASN n 
2  288  TYR n 
2  289  GLY n 
2  290  GLU n 
2  291  VAL n 
2  292  ASP n 
2  293  GLY n 
2  294  PRO n 
2  295  TYR n 
2  296  THR n 
2  297  LEU n 
2  298  VAL n 
2  299  LYS n 
2  300  GLY n 
2  301  SER n 
2  302  VAL n 
2  303  PRO n 
2  304  GLY n 
2  305  PRO n 
2  306  ASP n 
2  307  LYS n 
2  308  ARG n 
2  309  LEU n 
2  310  VAL n 
2  311  ARG n 
2  312  PHE n 
2  313  ARG n 
2  314  PRO n 
2  315  ALA n 
2  316  VAL n 
2  317  ARG n 
2  318  PRO n 
2  319  ASN n 
2  320  ASP n 
2  321  GLN n 
2  322  PRO n 
2  323  ARG n 
2  324  LEU n 
2  325  ASP n 
2  326  PRO n 
2  327  GLU n 
2  328  VAL n 
2  329  ARG n 
2  330  TYR n 
2  331  VAL n 
2  332  SER n 
2  333  ASN n 
2  334  GLU n 
2  335  SER n 
2  336  ASN n 
2  337  GLN n 
2  338  GLY n 
3  1    MET n 
3  2    GLN n 
3  3    ALA n 
3  4    THR n 
3  5    ILE n 
3  6    TYR n 
3  7    ASP n 
3  8    LEU n 
3  9    ASP n 
3  10   GLY n 
3  11   ASN n 
3  12   THR n 
3  13   ASP n 
3  14   GLY n 
3  15   GLU n 
3  16   VAL n 
3  17   ASP n 
3  18   LEU n 
3  19   PRO n 
3  20   ASP n 
3  21   VAL n 
3  22   PHE n 
3  23   GLU n 
3  24   THR n 
3  25   PRO n 
3  26   VAL n 
3  27   ARG n 
3  28   SER n 
3  29   ASP n 
3  30   LEU n 
3  31   ILE n 
3  32   GLY n 
3  33   LYS n 
3  34   ALA n 
3  35   VAL n 
3  36   ARG n 
3  37   ALA n 
3  38   ALA n 
3  39   GLN n 
3  40   ALA n 
3  41   ASN n 
3  42   ARG n 
3  43   LYS n 
3  44   GLN n 
3  45   ASP n 
3  46   TYR n 
3  47   GLY n 
3  48   SER n 
3  49   ASP n 
3  50   GLU n 
3  51   TYR n 
3  52   ALA n 
3  53   GLY n 
3  54   LEU n 
3  55   ARG n 
3  56   THR n 
3  57   PRO n 
3  58   ALA n 
3  59   GLU n 
3  60   SER n 
3  61   PHE n 
3  62   GLY n 
3  63   SER n 
3  64   GLY n 
3  65   ARG n 
3  66   GLY n 
3  67   GLN n 
3  68   ALA n 
3  69   HIS n 
3  70   VAL n 
3  71   PRO n 
3  72   LYS n 
3  73   GLN n 
3  74   ASP n 
3  75   GLY n 
3  76   ARG n 
3  77   ALA n 
3  78   ARG n 
3  79   ARG n 
3  80   VAL n 
3  81   PRO n 
3  82   GLN n 
3  83   ALA n 
3  84   VAL n 
3  85   LYS n 
3  86   GLY n 
3  87   ARG n 
3  88   SER n 
3  89   ALA n 
3  90   HIS n 
3  91   PRO n 
3  92   PRO n 
3  93   LYS n 
3  94   THR n 
3  95   GLU n 
3  96   LYS n 
3  97   ASP n 
3  98   ARG n 
3  99   SER n 
3  100  LEU n 
3  101  ASP n 
3  102  LEU n 
3  103  ASN n 
3  104  ASP n 
3  105  LYS n 
3  106  GLU n 
3  107  ARG n 
3  108  GLN n 
3  109  LEU n 
3  110  ALA n 
3  111  VAL n 
3  112  ARG n 
3  113  SER n 
3  114  ALA n 
3  115  LEU n 
3  116  ALA n 
3  117  ALA n 
3  118  THR n 
3  119  ALA n 
3  120  ASP n 
3  121  ALA n 
3  122  ASP n 
3  123  LEU n 
3  124  VAL n 
3  125  ALA n 
3  126  ASP n 
3  127  ARG n 
3  128  GLY n 
3  129  HIS n 
3  130  GLU n 
3  131  PHE n 
3  132  ASP n 
3  133  ARG n 
3  134  ASP n 
3  135  GLU n 
3  136  VAL n 
3  137  PRO n 
3  138  VAL n 
3  139  VAL n 
3  140  VAL n 
3  141  SER n 
3  142  ASP n 
3  143  ASP n 
3  144  PHE n 
3  145  GLU n 
3  146  ASP n 
3  147  LEU n 
3  148  VAL n 
3  149  LYS n 
3  150  THR n 
3  151  GLN n 
3  152  GLU n 
3  153  VAL n 
3  154  VAL n 
3  155  SER n 
3  156  LEU n 
3  157  LEU n 
3  158  GLU n 
3  159  ALA n 
3  160  LEU n 
3  161  ASP n 
3  162  VAL n 
3  163  HIS n 
3  164  ALA n 
3  165  ASP n 
3  166  ILE n 
3  167  ASP n 
3  168  ARG n 
3  169  ALA n 
3  170  ASP n 
3  171  GLU n 
3  172  THR n 
3  173  LYS n 
3  174  ILE n 
3  175  LYS n 
3  176  ALA n 
3  177  GLY n 
3  178  GLN n 
3  179  GLY n 
3  180  SER n 
3  181  ALA n 
3  182  ARG n 
3  183  GLY n 
3  184  ARG n 
3  185  LYS n 
3  186  TYR n 
3  187  ARG n 
3  188  ARG n 
3  189  PRO n 
3  190  ALA n 
3  191  SER n 
3  192  ILE n 
3  193  LEU n 
3  194  PHE n 
3  195  VAL n 
3  196  THR n 
3  197  SER n 
3  198  ASP n 
3  199  GLU n 
3  200  PRO n 
3  201  SER n 
3  202  THR n 
3  203  ALA n 
3  204  ALA n 
3  205  ARG n 
3  206  ASN n 
3  207  LEU n 
3  208  ALA n 
3  209  GLY n 
3  210  ALA n 
3  211  ASP n 
3  212  VAL n 
3  213  ALA n 
3  214  THR n 
3  215  ALA n 
3  216  SER n 
3  217  GLU n 
3  218  VAL n 
3  219  ASN n 
3  220  THR n 
3  221  GLU n 
3  222  ASP n 
3  223  LEU n 
3  224  ALA n 
3  225  PRO n 
3  226  GLY n 
3  227  GLY n 
3  228  ALA n 
3  229  PRO n 
3  230  GLY n 
3  231  ARG n 
3  232  LEU n 
3  233  THR n 
3  234  VAL n 
3  235  PHE n 
3  236  THR n 
3  237  GLU n 
3  238  SER n 
3  239  ALA n 
3  240  LEU n 
3  241  ALA n 
3  242  GLU n 
3  243  VAL n 
3  244  ALA n 
3  245  GLU n 
3  246  ARG n 
4  1    MET n 
4  2    SER n 
4  3    SER n 
4  4    GLU n 
4  5    SER n 
4  6    GLU n 
4  7    SER n 
4  8    GLY n 
4  9    GLY n 
4  10   ASP n 
4  11   PHE n 
4  12   HIS n 
4  13   GLU n 
4  14   MET n 
4  15   ARG n 
4  16   GLU n 
4  17   PRO n 
4  18   ARG n 
4  19   ILE n 
4  20   GLU n 
4  21   LYS n 
4  22   VAL n 
4  23   VAL n 
4  24   VAL n 
4  25   HIS n 
4  26   MET n 
4  27   GLY n 
4  28   ILE n 
4  29   GLY n 
4  30   HIS n 
4  31   GLY n 
4  32   GLY n 
4  33   ARG n 
4  34   ASP n 
4  35   LEU n 
4  36   ALA n 
4  37   ASN n 
4  38   ALA n 
4  39   GLU n 
4  40   ASP n 
4  41   ILE n 
4  42   LEU n 
4  43   GLY n 
4  44   GLU n 
4  45   ILE n 
4  46   THR n 
4  47   GLY n 
4  48   GLN n 
4  49   MET n 
4  50   PRO n 
4  51   VAL n 
4  52   ARG n 
4  53   THR n 
4  54   LYS n 
4  55   ALA n 
4  56   LYS n 
4  57   ARG n 
4  58   THR n 
4  59   VAL n 
4  60   GLY n 
4  61   GLU n 
4  62   PHE n 
4  63   ASP n 
4  64   ILE n 
4  65   ARG n 
4  66   GLU n 
4  67   GLY n 
4  68   ASP n 
4  69   PRO n 
4  70   ILE n 
4  71   GLY n 
4  72   ALA n 
4  73   LYS n 
4  74   VAL n 
4  75   THR n 
4  76   LEU n 
4  77   ARG n 
4  78   ASP n 
4  79   GLU n 
4  80   MET n 
4  81   ALA n 
4  82   GLU n 
4  83   GLU n 
4  84   PHE n 
4  85   LEU n 
4  86   GLN n 
4  87   THR n 
4  88   ALA n 
4  89   LEU n 
4  90   PRO n 
4  91   LEU n 
4  92   ALA n 
4  93   GLU n 
4  94   LEU n 
4  95   ALA n 
4  96   THR n 
4  97   SER n 
4  98   GLN n 
4  99   PHE n 
4  100  ASP n 
4  101  ASP n 
4  102  THR n 
4  103  GLY n 
4  104  ASN n 
4  105  PHE n 
4  106  SER n 
4  107  PHE n 
4  108  GLY n 
4  109  VAL n 
4  110  GLU n 
4  111  GLU n 
4  112  HIS n 
4  113  THR n 
4  114  GLU n 
4  115  PHE n 
4  116  PRO n 
4  117  SER n 
4  118  GLN n 
4  119  GLU n 
4  120  TYR n 
4  121  ASP n 
4  122  PRO n 
4  123  SER n 
4  124  ILE n 
4  125  GLY n 
4  126  ILE n 
4  127  TYR n 
4  128  GLY n 
4  129  LEU n 
4  130  ASP n 
4  131  VAL n 
4  132  THR n 
4  133  VAL n 
4  134  ASN n 
4  135  LEU n 
4  136  VAL n 
4  137  ARG n 
4  138  PRO n 
4  139  GLY n 
4  140  TYR n 
4  141  ARG n 
4  142  VAL n 
4  143  ALA n 
4  144  LYS n 
4  145  ARG n 
4  146  ASP n 
4  147  LYS n 
4  148  ALA n 
4  149  SER n 
4  150  ARG n 
4  151  SER n 
4  152  ILE n 
4  153  PRO n 
4  154  THR n 
4  155  LYS n 
4  156  HIS n 
4  157  ARG n 
4  158  LEU n 
4  159  ASN n 
4  160  PRO n 
4  161  ALA n 
4  162  ASP n 
4  163  ALA n 
4  164  VAL n 
4  165  ALA n 
4  166  PHE n 
4  167  ILE n 
4  168  GLU n 
4  169  SER n 
4  170  THR n 
4  171  TYR n 
4  172  ASP n 
4  173  VAL n 
4  174  GLU n 
4  175  VAL n 
4  176  SER n 
4  177  GLU n 
5  1    MET n 
5  2    PRO n 
5  3    ARG n 
5  4    VAL n 
5  5    GLU n 
5  6    LEU n 
5  7    GLU n 
5  8    ILE n 
5  9    PRO n 
5  10   GLU n 
5  11   ASP n 
5  12   VAL n 
5  13   ASP n 
5  14   ALA n 
5  15   GLU n 
5  16   GLN n 
5  17   ASP n 
5  18   HIS n 
5  19   LEU n 
5  20   ASP n 
5  21   ILE n 
5  22   THR n 
5  23   VAL n 
5  24   GLU n 
5  25   GLY n 
5  26   ASP n 
5  27   ASN n 
5  28   GLY n 
5  29   SER n 
5  30   VAL n 
5  31   THR n 
5  32   ARG n 
5  33   ARG n 
5  34   LEU n 
5  35   TRP n 
5  36   TYR n 
5  37   PRO n 
5  38   ASP n 
5  39   ILE n 
5  40   ASP n 
5  41   VAL n 
5  42   SER n 
5  43   VAL n 
5  44   ASP n 
5  45   GLY n 
5  46   ASP n 
5  47   THR n 
5  48   VAL n 
5  49   VAL n 
5  50   ILE n 
5  51   GLU n 
5  52   SER n 
5  53   ASP n 
5  54   GLU n 
5  55   ASP n 
5  56   ASN n 
5  57   ALA n 
5  58   LYS n 
5  59   THR n 
5  60   MET n 
5  61   SER n 
5  62   THR n 
5  63   ILE n 
5  64   GLY n 
5  65   THR n 
5  66   PHE n 
5  67   GLN n 
5  68   SER n 
5  69   HIS n 
5  70   ILE n 
5  71   GLU n 
5  72   ASN n 
5  73   MET n 
5  74   PHE n 
5  75   HIS n 
5  76   GLY n 
5  77   VAL n 
5  78   THR n 
5  79   GLU n 
5  80   GLY n 
5  81   TRP n 
5  82   GLU n 
5  83   TYR n 
5  84   GLY n 
5  85   MET n 
5  86   GLU n 
5  87   VAL n 
5  88   PHE n 
5  89   TYR n 
5  90   SER n 
5  91   HIS n 
5  92   PHE n 
5  93   PRO n 
5  94   MET n 
5  95   GLN n 
5  96   VAL n 
5  97   ASN n 
5  98   VAL n 
5  99   GLU n 
5  100  GLY n 
5  101  ASP n 
5  102  GLU n 
5  103  VAL n 
5  104  VAL n 
5  105  ILE n 
5  106  GLU n 
5  107  ASN n 
5  108  PHE n 
5  109  LEU n 
5  110  GLY n 
5  111  GLU n 
5  112  LYS n 
5  113  ALA n 
5  114  PRO n 
5  115  ARG n 
5  116  ARG n 
5  117  THR n 
5  118  THR n 
5  119  ILE n 
5  120  HIS n 
5  121  GLY n 
5  122  ASP n 
5  123  THR n 
5  124  ASP n 
5  125  VAL n 
5  126  GLU n 
5  127  ILE n 
5  128  ASP n 
5  129  GLY n 
5  130  GLU n 
5  131  GLU n 
5  132  LEU n 
5  133  THR n 
5  134  VAL n 
5  135  SER n 
5  136  GLY n 
5  137  PRO n 
5  138  ASP n 
5  139  ILE n 
5  140  GLU n 
5  141  ALA n 
5  142  VAL n 
5  143  GLY n 
5  144  GLN n 
5  145  THR n 
5  146  ALA n 
5  147  ALA n 
5  148  ASP n 
5  149  ILE n 
5  150  GLU n 
5  151  GLN n 
5  152  LEU n 
5  153  THR n 
5  154  ARG n 
5  155  ILE n 
5  156  ASN n 
5  157  ASP n 
5  158  LYS n 
5  159  ASP n 
5  160  VAL n 
5  161  ARG n 
5  162  VAL n 
5  163  PHE n 
5  164  GLN n 
5  165  ASP n 
5  166  GLY n 
5  167  VAL n 
5  168  TYR n 
5  169  ILE n 
5  170  THR n 
5  171  ARG n 
5  172  LYS n 
5  173  PRO n 
5  174  ASN n 
5  175  ARG n 
5  176  GLY n 
5  177  ASP n 
5  178  ALA n 
6  1    MET n 
6  2    PRO n 
6  3    VAL n 
6  4    TYR n 
6  5    VAL n 
6  6    ASP n 
6  7    PHE n 
6  8    ASP n 
6  9    VAL n 
6  10   PRO n 
6  11   ALA n 
6  12   ASP n 
6  13   LEU n 
6  14   GLU n 
6  15   ASP n 
6  16   ASP n 
6  17   ALA n 
6  18   LEU n 
6  19   GLU n 
6  20   ALA n 
6  21   LEU n 
6  22   GLU n 
6  23   VAL n 
6  24   ALA n 
6  25   ARG n 
6  26   ASP n 
6  27   THR n 
6  28   GLY n 
6  29   ALA n 
6  30   VAL n 
6  31   LYS n 
6  32   LYS n 
6  33   GLY n 
6  34   THR n 
6  35   ASN n 
6  36   GLU n 
6  37   THR n 
6  38   THR n 
6  39   LYS n 
6  40   SER n 
6  41   ILE n 
6  42   GLU n 
6  43   ARG n 
6  44   GLY n 
6  45   SER n 
6  46   ALA n 
6  47   GLU n 
6  48   LEU n 
6  49   VAL n 
6  50   PHE n 
6  51   VAL n 
6  52   ALA n 
6  53   GLU n 
6  54   ASP n 
6  55   VAL n 
6  56   GLN n 
6  57   PRO n 
6  58   GLU n 
6  59   GLU n 
6  60   ILE n 
6  61   VAL n 
6  62   MET n 
6  63   HIS n 
6  64   ILE n 
6  65   PRO n 
6  66   GLU n 
6  67   LEU n 
6  68   ALA n 
6  69   ASP n 
6  70   GLU n 
6  71   LYS n 
6  72   GLY n 
6  73   VAL n 
6  74   PRO n 
6  75   PHE n 
6  76   ILE n 
6  77   PHE n 
6  78   VAL n 
6  79   GLU n 
6  80   GLN n 
6  81   GLN n 
6  82   ASP n 
6  83   ASP n 
6  84   LEU n 
6  85   GLY n 
6  86   HIS n 
6  87   ALA n 
6  88   ALA n 
6  89   GLY n 
6  90   LEU n 
6  91   GLU n 
6  92   VAL n 
6  93   GLY n 
6  94   SER n 
6  95   ALA n 
6  96   ALA n 
6  97   ALA n 
6  98   ALA n 
6  99   VAL n 
6  100  THR n 
6  101  ASP n 
6  102  ALA n 
6  103  GLY n 
6  104  GLU n 
6  105  ALA n 
6  106  ASP n 
6  107  ALA n 
6  108  ASP n 
6  109  VAL n 
6  110  GLU n 
6  111  ASP n 
6  112  ILE n 
6  113  ALA n 
6  114  ASP n 
6  115  LYS n 
6  116  VAL n 
6  117  GLU n 
6  118  GLU n 
6  119  LEU n 
6  120  ARG n 
7  1    MET n 
7  2    SER n 
7  3    ALA n 
7  4    GLU n 
7  5    SER n 
7  6    GLU n 
7  7    ARG n 
7  8    LYS n 
7  9    THR n 
7  10   GLU n 
7  11   THR n 
7  12   ILE n 
7  13   PRO n 
7  14   GLU n 
7  15   TRP n 
7  16   LYS n 
7  17   GLN n 
7  18   GLU n 
7  19   GLU n 
7  20   VAL n 
7  21   ASP n 
7  22   ALA n 
7  23   ILE n 
7  24   VAL n 
7  25   GLU n 
7  26   MET n 
7  27   ILE n 
7  28   GLU n 
7  29   SER n 
7  30   TYR n 
7  31   GLU n 
7  32   SER n 
7  33   VAL n 
7  34   GLY n 
7  35   VAL n 
7  36   VAL n 
7  37   ASN n 
7  38   ILE n 
7  39   ALA n 
7  40   GLY n 
7  41   ILE n 
7  42   PRO n 
7  43   SER n 
7  44   ARG n 
7  45   GLN n 
7  46   LEU n 
7  47   GLN n 
7  48   ASP n 
7  49   MET n 
7  50   ARG n 
7  51   ARG n 
7  52   ASP n 
7  53   LEU n 
7  54   HIS n 
7  55   GLY n 
7  56   THR n 
7  57   ALA n 
7  58   GLU n 
7  59   LEU n 
7  60   ARG n 
7  61   VAL n 
7  62   SER n 
7  63   ARG n 
7  64   ASN n 
7  65   THR n 
7  66   LEU n 
7  67   LEU n 
7  68   GLU n 
7  69   ARG n 
7  70   ALA n 
7  71   LEU n 
7  72   ASP n 
7  73   ASP n 
7  74   VAL n 
7  75   ASP n 
7  76   ASP n 
7  77   GLY n 
7  78   LEU n 
7  79   GLU n 
7  80   ASP n 
7  81   LEU n 
7  82   ASN n 
7  83   GLY n 
7  84   TYR n 
7  85   ILE n 
7  86   THR n 
7  87   GLY n 
7  88   GLN n 
7  89   VAL n 
7  90   GLY n 
7  91   LEU n 
7  92   ILE n 
7  93   GLY n 
7  94   THR n 
7  95   ASP n 
7  96   ASP n 
7  97   ASN n 
7  98   PRO n 
7  99   PHE n 
7  100  SER n 
7  101  LEU n 
7  102  PHE n 
7  103  GLN n 
7  104  GLU n 
7  105  LEU n 
7  106  GLU n 
7  107  ALA n 
7  108  SER n 
7  109  LYS n 
7  110  THR n 
7  111  PRO n 
7  112  ALA n 
7  113  PRO n 
7  114  ILE n 
7  115  GLY n 
7  116  ALA n 
7  117  GLY n 
7  118  GLU n 
7  119  VAL n 
7  120  ALA n 
7  121  PRO n 
7  122  ASN n 
7  123  ASP n 
7  124  ILE n 
7  125  VAL n 
7  126  ILE n 
7  127  PRO n 
7  128  GLU n 
7  129  GLY n 
7  130  ASP n 
7  131  THR n 
7  132  GLY n 
7  133  VAL n 
7  134  ASP n 
7  135  PRO n 
7  136  GLY n 
7  137  PRO n 
7  138  PHE n 
7  139  VAL n 
7  140  GLY n 
7  141  GLU n 
7  142  LEU n 
7  143  GLN n 
7  144  SER n 
7  145  VAL n 
7  146  GLY n 
7  147  ALA n 
7  148  ASP n 
7  149  ALA n 
7  150  ARG n 
7  151  ILE n 
7  152  GLN n 
7  153  GLU n 
7  154  GLY n 
7  155  SER n 
7  156  ILE n 
7  157  GLN n 
7  158  VAL n 
7  159  LEU n 
7  160  SER n 
7  161  ASP n 
7  162  SER n 
7  163  THR n 
7  164  VAL n 
7  165  LEU n 
7  166  ASP n 
7  167  THR n 
7  168  GLY n 
7  169  GLU n 
7  170  GLU n 
7  171  VAL n 
7  172  SER n 
7  173  GLN n 
7  174  GLU n 
7  175  LEU n 
7  176  SER n 
7  177  ASN n 
7  178  VAL n 
7  179  LEU n 
7  180  ASN n 
7  181  GLU n 
7  182  LEU n 
7  183  GLY n 
7  184  ILE n 
7  185  GLU n 
7  186  PRO n 
7  187  LYS n 
7  188  GLU n 
7  189  VAL n 
7  190  GLY n 
7  191  LEU n 
7  192  ASP n 
7  193  LEU n 
7  194  ARG n 
7  195  ALA n 
7  196  VAL n 
7  197  PHE n 
7  198  ALA n 
7  199  ASP n 
7  200  GLY n 
7  201  VAL n 
7  202  LEU n 
7  203  PHE n 
7  204  GLU n 
7  205  PRO n 
7  206  GLU n 
7  207  GLU n 
7  208  LEU n 
7  209  GLU n 
7  210  LEU n 
7  211  ASP n 
7  212  ILE n 
7  213  ASP n 
7  214  GLU n 
7  215  TYR n 
7  216  ARG n 
7  217  SER n 
7  218  ASP n 
7  219  ILE n 
7  220  GLN n 
7  221  ALA n 
7  222  ALA n 
7  223  ALA n 
7  224  GLY n 
7  225  ARG n 
7  226  ALA n 
7  227  PHE n 
7  228  ASN n 
7  229  LEU n 
7  230  SER n 
7  231  VAL n 
7  232  ASN n 
7  233  ALA n 
7  234  ASP n 
7  235  TYR n 
7  236  PRO n 
7  237  THR n 
7  238  ALA n 
7  239  THR n 
7  240  THR n 
7  241  ALA n 
7  242  PRO n 
7  243  THR n 
7  244  MET n 
7  245  LEU n 
7  246  GLN n 
7  247  SER n 
7  248  ASP n 
7  249  ARG n 
7  250  GLY n 
7  251  ASN n 
7  252  ALA n 
7  253  LYS n 
7  254  SER n 
7  255  LEU n 
7  256  ALA n 
7  257  LEU n 
7  258  GLN n 
7  259  ALA n 
7  260  ALA n 
7  261  ILE n 
7  262  GLU n 
7  263  ASP n 
7  264  PRO n 
7  265  GLU n 
7  266  VAL n 
7  267  VAL n 
7  268  PRO n 
7  269  ASP n 
7  270  LEU n 
7  271  VAL n 
7  272  SER n 
7  273  LYS n 
7  274  ALA n 
7  275  ASP n 
7  276  ALA n 
7  277  GLN n 
7  278  VAL n 
7  279  ARG n 
7  280  ALA n 
7  281  LEU n 
7  282  ALA n 
7  283  SER n 
7  284  GLN n 
7  285  ILE n 
7  286  ASP n 
7  287  ASP n 
7  288  GLU n 
7  289  GLU n 
7  290  ALA n 
7  291  LEU n 
7  292  PRO n 
7  293  GLU n 
7  294  GLU n 
7  295  LEU n 
7  296  GLN n 
7  297  GLY n 
7  298  VAL n 
7  299  GLU n 
7  300  ALA n 
7  301  ASP n 
7  302  VAL n 
7  303  ALA n 
7  304  THR n 
7  305  GLU n 
7  306  GLU n 
7  307  PRO n 
7  308  THR n 
7  309  ASP n 
7  310  ASP n 
7  311  GLN n 
7  312  ASP n 
7  313  ASP n 
7  314  ASP n 
7  315  THR n 
7  316  ALA n 
7  317  SER n 
7  318  GLU n 
7  319  ASP n 
7  320  ASP n 
7  321  ALA n 
7  322  ASP n 
7  323  ALA n 
7  324  ASP n 
7  325  ASP n 
7  326  ALA n 
7  327  ALA n 
7  328  GLU n 
7  329  GLU n 
7  330  ALA n 
7  331  ASP n 
7  332  ASP n 
7  333  ASP n 
7  334  ASP n 
7  335  ASP n 
7  336  ASP n 
7  337  ASP n 
7  338  GLU n 
7  339  ASP n 
7  340  ALA n 
7  341  GLY n 
7  342  ASP n 
7  343  ALA n 
7  344  LEU n 
7  345  GLY n 
7  346  ALA n 
7  347  MET n 
7  348  PHE n 
8  1    MET n 
8  2    SER n 
8  3    ASP n 
8  4    LYS n 
8  5    PRO n 
8  6    ALA n 
8  7    SER n 
8  8    MET n 
8  9    TYR n 
8  10   ARG n 
8  11   ASP n 
8  12   ILE n 
8  13   ASP n 
8  14   LYS n 
8  15   PRO n 
8  16   ALA n 
8  17   TYR n 
8  18   THR n 
8  19   ARG n 
8  20   ARG n 
8  21   GLU n 
8  22   TYR n 
8  23   ILE n 
8  24   THR n 
8  25   GLY n 
8  26   ILE n 
8  27   PRO n 
8  28   GLY n 
8  29   SER n 
8  30   LYS n 
8  31   ILE n 
8  32   ALA n 
8  33   GLN n 
8  34   HIS n 
8  35   LYS n 
8  36   MET n 
8  37   GLY n 
8  38   ARG n 
8  39   LYS n 
8  40   GLN n 
8  41   LYS n 
8  42   ASP n 
8  43   ALA n 
8  44   ASP n 
8  45   ASP n 
8  46   TYR n 
8  47   PRO n 
8  48   VAL n 
8  49   GLN n 
8  50   ILE n 
8  51   SER n 
8  52   LEU n 
8  53   ILE n 
8  54   VAL n 
8  55   GLU n 
8  56   GLU n 
8  57   THR n 
8  58   VAL n 
8  59   GLN n 
8  60   LEU n 
8  61   ARG n 
8  62   HIS n 
8  63   GLY n 
8  64   SER n 
8  65   LEU n 
8  66   GLU n 
8  67   ALA n 
8  68   SER n 
8  69   ARG n 
8  70   LEU n 
8  71   SER n 
8  72   ALA n 
8  73   ASN n 
8  74   ARG n 
8  75   HIS n 
8  76   LEU n 
8  77   ILE n 
8  78   LYS n 
8  79   GLU n 
8  80   LEU n 
8  81   GLY n 
8  82   GLU n 
8  83   GLU n 
8  84   GLY n 
8  85   ASP n 
8  86   TYR n 
8  87   LYS n 
8  88   MET n 
8  89   THR n 
8  90   LEU n 
8  91   ARG n 
8  92   LYS n 
8  93   PHE n 
8  94   PRO n 
8  95   HIS n 
8  96   GLN n 
8  97   VAL n 
8  98   LEU n 
8  99   ARG n 
8  100  GLU n 
8  101  ASN n 
8  102  LYS n 
8  103  GLN n 
8  104  ALA n 
8  105  THR n 
8  106  GLY n 
8  107  ALA n 
8  108  GLY n 
8  109  ALA n 
8  110  ASP n 
8  111  ARG n 
8  112  VAL n 
8  113  SER n 
8  114  ASP n 
8  115  GLY n 
8  116  MET n 
8  117  ARG n 
8  118  ALA n 
8  119  ALA n 
8  120  PHE n 
8  121  GLY n 
8  122  LYS n 
8  123  ILE n 
8  124  VAL n 
8  125  GLY n 
8  126  THR n 
8  127  ALA n 
8  128  ALA n 
8  129  ARG n 
8  130  VAL n 
8  131  GLN n 
8  132  ALA n 
8  133  GLY n 
8  134  GLU n 
8  135  GLN n 
8  136  LEU n 
8  137  PHE n 
8  138  THR n 
8  139  ALA n 
8  140  TYR n 
8  141  CYS n 
8  142  ASN n 
8  143  VAL n 
8  144  GLU n 
8  145  ASP n 
8  146  ALA n 
8  147  GLU n 
8  148  HIS n 
8  149  VAL n 
8  150  LYS n 
8  151  GLU n 
8  152  ALA n 
8  153  PHE n 
8  154  ARG n 
8  155  ARG n 
8  156  ALA n 
8  157  TYR n 
8  158  ASN n 
8  159  LYS n 
8  160  ILE n 
8  161  THR n 
8  162  PRO n 
8  163  SER n 
8  164  CYS n 
8  165  ARG n 
8  166  ILE n 
8  167  LYS n 
8  168  VAL n 
8  169  GLU n 
8  170  ARG n 
8  171  GLY n 
8  172  GLU n 
8  173  GLU n 
8  174  LEU n 
8  175  LEU n 
8  176  ILE n 
8  177  ALA n 
9  1    MET n 
9  2    ALA n 
9  3    GLY n 
9  4    THR n 
9  5    ILE n 
9  6    GLU n 
9  7    VAL n 
9  8    LEU n 
9  9    VAL n 
9  10   PRO n 
9  11   GLY n 
9  12   GLY n 
9  13   GLU n 
9  14   ALA n 
9  15   ASN n 
9  16   PRO n 
9  17   GLY n 
9  18   PRO n 
9  19   PRO n 
9  20   LEU n 
9  21   GLY n 
9  22   PRO n 
9  23   GLU n 
9  24   LEU n 
9  25   GLY n 
9  26   PRO n 
9  27   THR n 
9  28   PRO n 
9  29   VAL n 
9  30   ASP n 
9  31   VAL n 
9  32   GLN n 
9  33   ALA n 
9  34   VAL n 
9  35   VAL n 
9  36   GLN n 
9  37   GLU n 
9  38   ILE n 
9  39   ASN n 
9  40   ASP n 
9  41   GLN n 
9  42   THR n 
9  43   ALA n 
9  44   ALA n 
9  45   PHE n 
9  46   ASP n 
9  47   GLY n 
9  48   THR n 
9  49   GLU n 
9  50   VAL n 
9  51   PRO n 
9  52   VAL n 
9  53   THR n 
9  54   VAL n 
9  55   LYS n 
9  56   TYR n 
9  57   ASP n 
9  58   ASP n 
9  59   ASP n 
9  60   GLY n 
9  61   SER n 
9  62   PHE n 
9  63   GLU n 
9  64   ILE n 
9  65   GLU n 
9  66   VAL n 
9  67   GLY n 
9  68   VAL n 
9  69   PRO n 
9  70   PRO n 
9  71   THR n 
9  72   ALA n 
9  73   GLU n 
9  74   LEU n 
9  75   ILE n 
9  76   LYS n 
9  77   ASP n 
9  78   GLU n 
9  79   ALA n 
9  80   GLY n 
9  81   PHE n 
9  82   GLU n 
9  83   THR n 
9  84   GLY n 
9  85   SER n 
9  86   GLY n 
9  87   GLU n 
9  88   PRO n 
9  89   GLN n 
9  90   GLU n 
9  91   ASP n 
9  92   PHE n 
9  93   VAL n 
9  94   ALA n 
9  95   ASP n 
9  96   LEU n 
9  97   SER n 
9  98   VAL n 
9  99   ASP n 
9  100  GLN n 
9  101  VAL n 
9  102  LYS n 
9  103  GLN n 
9  104  ILE n 
9  105  ALA n 
9  106  GLU n 
9  107  GLN n 
9  108  LYS n 
9  109  HIS n 
9  110  PRO n 
9  111  ASP n 
9  112  LEU n 
9  113  LEU n 
9  114  SER n 
9  115  TYR n 
9  116  ASP n 
9  117  LEU n 
9  118  THR n 
9  119  ASN n 
9  120  ALA n 
9  121  ALA n 
9  122  LYS n 
9  123  GLU n 
9  124  VAL n 
9  125  VAL n 
9  126  GLY n 
9  127  THR n 
9  128  CYS n 
9  129  THR n 
9  130  SER n 
9  131  LEU n 
9  132  GLY n 
9  133  VAL n 
9  134  THR n 
9  135  ILE n 
9  136  GLU n 
9  137  GLY n 
9  138  GLU n 
9  139  ASN n 
9  140  PRO n 
9  141  ARG n 
9  142  GLU n 
9  143  PHE n 
9  144  LYS n 
9  145  GLU n 
9  146  ARG n 
9  147  ILE n 
9  148  ASP n 
9  149  ALA n 
9  150  GLY n 
9  151  GLU n 
9  152  TYR n 
9  153  ASP n 
9  154  ASP n 
9  155  VAL n 
9  156  PHE n 
9  157  ALA n 
9  158  ALA n 
9  159  GLU n 
9  160  ALA n 
9  161  GLN n 
9  162  ALA n 
10 1    MET n 
10 2    SER n 
10 3    VAL n 
10 4    ALA n 
10 5    GLU n 
10 6    PHE n 
10 7    ASP n 
10 8    ALA n 
10 9    ASP n 
10 10   VAL n 
10 11   ILE n 
10 12   VAL n 
10 13   ASP n 
10 14   ALA n 
10 15   ARG n 
10 16   ASP n 
10 17   CYS n 
10 18   ILE n 
10 19   MET n 
10 20   GLY n 
10 21   ARG n 
10 22   VAL n 
10 23   ALA n 
10 24   SER n 
10 25   GLN n 
10 26   VAL n 
10 27   ALA n 
10 28   GLU n 
10 29   GLN n 
10 30   ALA n 
10 31   LEU n 
10 32   ASP n 
10 33   GLY n 
10 34   GLU n 
10 35   THR n 
10 36   VAL n 
10 37   ALA n 
10 38   VAL n 
10 39   VAL n 
10 40   ASN n 
10 41   ALA n 
10 42   GLU n 
10 43   ARG n 
10 44   ALA n 
10 45   VAL n 
10 46   ILE n 
10 47   THR n 
10 48   GLY n 
10 49   ARG n 
10 50   GLU n 
10 51   GLU n 
10 52   GLN n 
10 53   ILE n 
10 54   VAL n 
10 55   GLU n 
10 56   LYS n 
10 57   TYR n 
10 58   GLU n 
10 59   LYS n 
10 60   ARG n 
10 61   VAL n 
10 62   ASP n 
10 63   ILE n 
10 64   GLY n 
10 65   ASN n 
10 66   ASP n 
10 67   ASN n 
10 68   GLY n 
10 69   TYR n 
10 70   PHE n 
10 71   TYR n 
10 72   PRO n 
10 73   LYS n 
10 74   ARG n 
10 75   PRO n 
10 76   ASP n 
10 77   GLY n 
10 78   ILE n 
10 79   PHE n 
10 80   LYS n 
10 81   ARG n 
10 82   THR n 
10 83   ILE n 
10 84   ARG n 
10 85   GLY n 
10 86   MET n 
10 87   LEU n 
10 88   PRO n 
10 89   HIS n 
10 90   LYS n 
10 91   LYS n 
10 92   GLN n 
10 93   ARG n 
10 94   GLY n 
10 95   ARG n 
10 96   GLU n 
10 97   ALA n 
10 98   PHE n 
10 99   GLU n 
10 100  SER n 
10 101  VAL n 
10 102  ARG n 
10 103  VAL n 
10 104  TYR n 
10 105  LEU n 
10 106  GLY n 
10 107  ASN n 
10 108  PRO n 
10 109  TYR n 
10 110  ASP n 
10 111  GLU n 
10 112  ASP n 
10 113  GLY n 
10 114  GLU n 
10 115  VAL n 
10 116  LEU n 
10 117  ASP n 
10 118  GLY n 
10 119  THR n 
10 120  SER n 
10 121  LEU n 
10 122  ASP n 
10 123  ARG n 
10 124  LEU n 
10 125  SER n 
10 126  ASN n 
10 127  ILE n 
10 128  LYS n 
10 129  PHE n 
10 130  VAL n 
10 131  THR n 
10 132  LEU n 
10 133  GLY n 
10 134  GLU n 
10 135  ILE n 
10 136  SER n 
10 137  GLU n 
10 138  THR n 
10 139  LEU n 
10 140  GLY n 
10 141  ALA n 
10 142  ASN n 
10 143  LYS n 
10 144  THR n 
10 145  TRP n 
11 1    MET n 
11 2    GLU n 
11 3    ALA n 
11 4    LEU n 
11 5    GLY n 
11 6    ALA n 
11 7    ASP n 
11 8    VAL n 
11 9    THR n 
11 10   GLN n 
11 11   GLY n 
11 12   LEU n 
11 13   GLU n 
11 14   LYS n 
11 15   GLY n 
11 16   SER n 
11 17   LEU n 
11 18   ILE n 
11 19   THR n 
11 20   CYS n 
11 21   ALA n 
11 22   ASP n 
11 23   ASN n 
11 24   THR n 
11 25   GLY n 
11 26   ALA n 
11 27   ARG n 
11 28   GLU n 
11 29   LEU n 
11 30   LYS n 
11 31   VAL n 
11 32   ILE n 
11 33   SER n 
11 34   VAL n 
11 35   HIS n 
11 36   GLY n 
11 37   TYR n 
11 38   SER n 
11 39   GLY n 
11 40   THR n 
11 41   LYS n 
11 42   ASN n 
11 43   ARG n 
11 44   HIS n 
11 45   PRO n 
11 46   LYS n 
11 47   ALA n 
11 48   GLY n 
11 49   LEU n 
11 50   GLY n 
11 51   ASP n 
11 52   LYS n 
11 53   ILE n 
11 54   THR n 
11 55   VAL n 
11 56   SER n 
11 57   VAL n 
11 58   THR n 
11 59   LYS n 
11 60   GLY n 
11 61   THR n 
11 62   PRO n 
11 63   GLU n 
11 64   MET n 
11 65   ARG n 
11 66   ARG n 
11 67   GLN n 
11 68   VAL n 
11 69   LEU n 
11 70   GLU n 
11 71   ALA n 
11 72   VAL n 
11 73   VAL n 
11 74   VAL n 
11 75   ARG n 
11 76   GLN n 
11 77   ARG n 
11 78   LYS n 
11 79   PRO n 
11 80   ILE n 
11 81   ARG n 
11 82   ARG n 
11 83   PRO n 
11 84   ASP n 
11 85   GLY n 
11 86   THR n 
11 87   ARG n 
11 88   VAL n 
11 89   LYS n 
11 90   PHE n 
11 91   GLU n 
11 92   ASP n 
11 93   ASN n 
11 94   ALA n 
11 95   ALA n 
11 96   VAL n 
11 97   ILE n 
11 98   VAL n 
11 99   ASP n 
11 100  GLU n 
11 101  ASN n 
11 102  GLU n 
11 103  ASP n 
11 104  PRO n 
11 105  ARG n 
11 106  GLY n 
11 107  THR n 
11 108  GLU n 
11 109  LEU n 
11 110  LYS n 
11 111  GLY n 
11 112  PRO n 
11 113  ILE n 
11 114  ALA n 
11 115  ARG n 
11 116  GLU n 
11 117  VAL n 
11 118  ALA n 
11 119  GLN n 
11 120  ARG n 
11 121  PHE n 
11 122  GLY n 
11 123  SER n 
11 124  VAL n 
11 125  ALA n 
11 126  SER n 
11 127  ALA n 
11 128  ALA n 
11 129  THR n 
11 130  MET n 
11 131  ILE n 
11 132  VAL n 
12 1    MET n 
12 2    THR n 
12 3    SER n 
12 4    LYS n 
12 5    LYS n 
12 6    LYS n 
12 7    ARG n 
12 8    GLN n 
12 9    ARG n 
12 10   GLY n 
12 11   SER n 
12 12   ARG n 
12 13   THR n 
12 14   HIS n 
12 15   GLY n 
12 16   GLY n 
12 17   GLY n 
12 18   SER n 
12 19   HIS n 
12 20   LYS n 
12 21   ASN n 
12 22   ARG n 
12 23   ARG n 
12 24   GLY n 
12 25   ALA n 
12 26   GLY n 
12 27   HIS n 
12 28   ARG n 
12 29   GLY n 
12 30   GLY n 
12 31   ARG n 
12 32   GLY n 
12 33   ASP n 
12 34   ALA n 
12 35   GLY n 
12 36   ARG n 
12 37   ASP n 
12 38   LYS n 
12 39   HIS n 
12 40   GLU n 
12 41   PHE n 
12 42   HIS n 
12 43   ASN n 
12 44   HIS n 
12 45   GLU n 
12 46   PRO n 
12 47   LEU n 
12 48   GLY n 
12 49   LYS n 
12 50   SER n 
12 51   GLY n 
12 52   PHE n 
12 53   LYS n 
12 54   ARG n 
12 55   PRO n 
12 56   GLN n 
12 57   LYS n 
12 58   VAL n 
12 59   GLN n 
12 60   GLU n 
12 61   GLU n 
12 62   ALA n 
12 63   ALA n 
12 64   THR n 
12 65   ILE n 
12 66   ASP n 
12 67   VAL n 
12 68   ARG n 
12 69   GLU n 
12 70   ILE n 
12 71   ASP n 
12 72   GLU n 
12 73   ASN n 
12 74   VAL n 
12 75   THR n 
12 76   LEU n 
12 77   LEU n 
12 78   ALA n 
12 79   ALA n 
12 80   ASP n 
12 81   ASP n 
12 82   VAL n 
12 83   ALA n 
12 84   GLU n 
12 85   VAL n 
12 86   GLU n 
12 87   ASP n 
12 88   GLY n 
12 89   GLY n 
12 90   PHE n 
12 91   ARG n 
12 92   VAL n 
12 93   ASP n 
12 94   VAL n 
12 95   ARG n 
12 96   ASP n 
12 97   VAL n 
12 98   VAL n 
12 99   GLU n 
12 100  GLU n 
12 101  ALA n 
12 102  ASP n 
12 103  ASP n 
12 104  ALA n 
12 105  ASP n 
12 106  TYR n 
12 107  VAL n 
12 108  LYS n 
12 109  VAL n 
12 110  LEU n 
12 111  GLY n 
12 112  ALA n 
12 113  GLY n 
12 114  GLN n 
12 115  VAL n 
12 116  ARG n 
12 117  HIS n 
12 118  GLU n 
12 119  LEU n 
12 120  THR n 
12 121  LEU n 
12 122  ILE n 
12 123  ALA n 
12 124  ASP n 
12 125  ASP n 
12 126  PHE n 
12 127  SER n 
12 128  GLU n 
12 129  GLY n 
12 130  ALA n 
12 131  ARG n 
12 132  GLU n 
12 133  LYS n 
12 134  VAL n 
12 135  GLU n 
12 136  GLY n 
12 137  ALA n 
12 138  GLY n 
12 139  GLY n 
12 140  SER n 
12 141  VAL n 
12 142  GLU n 
12 143  LEU n 
12 144  THR n 
12 145  ASP n 
12 146  LEU n 
12 147  GLY n 
12 148  GLU n 
12 149  GLU n 
12 150  ARG n 
12 151  GLN n 
12 152  ALA n 
12 153  GLU n 
12 154  ALA n 
12 155  GLU n 
12 156  GLU n 
12 157  THR n 
12 158  GLU n 
12 159  ASP n 
12 160  ALA n 
12 161  ASP n 
12 162  ALA n 
12 163  ASP n 
12 164  GLU n 
12 165  GLU n 
13 1    MET n 
13 2    ALA n 
13 3    ARG n 
13 4    SER n 
13 5    ALA n 
13 6    TYR n 
13 7    SER n 
13 8    TYR n 
13 9    ILE n 
13 10   ARG n 
13 11   ASP n 
13 12   ALA n 
13 13   TRP n 
13 14   LYS n 
13 15   ASN n 
13 16   PRO n 
13 17   GLY n 
13 18   ASP n 
13 19   GLY n 
13 20   GLN n 
13 21   LEU n 
13 22   ALA n 
13 23   GLU n 
13 24   LEU n 
13 25   GLN n 
13 26   TRP n 
13 27   GLN n 
13 28   ARG n 
13 29   GLN n 
13 30   GLN n 
13 31   GLU n 
13 32   TRP n 
13 33   ARG n 
13 34   ASN n 
13 35   GLU n 
13 36   GLY n 
13 37   ALA n 
13 38   VAL n 
13 39   GLU n 
13 40   ARG n 
13 41   ILE n 
13 42   GLU n 
13 43   ARG n 
13 44   PRO n 
13 45   THR n 
13 46   ARG n 
13 47   LEU n 
13 48   ASP n 
13 49   LYS n 
13 50   ALA n 
13 51   ARG n 
13 52   SER n 
13 53   GLN n 
13 54   GLY n 
13 55   TYR n 
13 56   LYS n 
13 57   ALA n 
13 58   LYS n 
13 59   GLN n 
13 60   GLY n 
13 61   VAL n 
13 62   ILE n 
13 63   VAL n 
13 64   ALA n 
13 65   ARG n 
13 66   VAL n 
13 67   SER n 
13 68   VAL n 
13 69   ARG n 
13 70   LYS n 
13 71   GLY n 
13 72   SER n 
13 73   ALA n 
13 74   ARG n 
13 75   LYS n 
13 76   ARG n 
13 77   ARG n 
13 78   HIS n 
13 79   LYS n 
13 80   ALA n 
13 81   GLY n 
13 82   ARG n 
13 83   ARG n 
13 84   SER n 
13 85   LYS n 
13 86   ARG n 
13 87   GLN n 
13 88   GLY n 
13 89   VAL n 
13 90   THR n 
13 91   ARG n 
13 92   ILE n 
13 93   THR n 
13 94   ARG n 
13 95   ARG n 
13 96   LYS n 
13 97   ASP n 
13 98   ILE n 
13 99   GLN n 
13 100  ARG n 
13 101  VAL n 
13 102  ALA n 
13 103  GLU n 
13 104  GLU n 
13 105  ARG n 
13 106  ALA n 
13 107  SER n 
13 108  ARG n 
13 109  THR n 
13 110  PHE n 
13 111  PRO n 
13 112  ASN n 
13 113  LEU n 
13 114  ARG n 
13 115  VAL n 
13 116  LEU n 
13 117  ASN n 
13 118  SER n 
13 119  TYR n 
13 120  SER n 
13 121  VAL n 
13 122  GLY n 
13 123  GLN n 
13 124  ASP n 
13 125  GLY n 
13 126  ARG n 
13 127  GLN n 
13 128  LYS n 
13 129  TRP n 
13 130  HIS n 
13 131  GLU n 
13 132  VAL n 
13 133  ILE n 
13 134  LEU n 
13 135  ILE n 
13 136  ASP n 
13 137  PRO n 
13 138  ASN n 
13 139  HIS n 
13 140  PRO n 
13 141  ALA n 
13 142  ILE n 
13 143  GLN n 
13 144  ASN n 
13 145  ASP n 
13 146  ASP n 
13 147  ASP n 
13 148  LEU n 
13 149  SER n 
13 150  TRP n 
13 151  ILE n 
13 152  CYS n 
13 153  ALA n 
13 154  ASP n 
13 155  ASP n 
13 156  GLN n 
13 157  ALA n 
13 158  ASP n 
13 159  ARG n 
13 160  VAL n 
13 161  PHE n 
13 162  ARG n 
13 163  GLY n 
13 164  LEU n 
13 165  THR n 
13 166  GLY n 
13 167  ALA n 
13 168  GLY n 
13 169  ARG n 
13 170  ARG n 
13 171  ASN n 
13 172  ARG n 
13 173  GLY n 
13 174  LEU n 
13 175  SER n 
13 176  GLY n 
13 177  LYS n 
13 178  GLY n 
13 179  LYS n 
13 180  GLY n 
13 181  SER n 
13 182  GLU n 
13 183  LYS n 
13 184  THR n 
13 185  ARG n 
13 186  PRO n 
13 187  SER n 
13 188  LEU n 
13 189  ARG n 
13 190  SER n 
13 191  ASN n 
13 192  GLY n 
13 193  GLY n 
13 194  LYS n 
13 195  GLY n 
13 196  LYS n 
14 1    MET n 
14 2    ALA n 
14 3    THR n 
14 4    GLY n 
14 5    PRO n 
14 6    ARG n 
14 7    TYR n 
14 8    LYS n 
14 9    VAL n 
14 10   PRO n 
14 11   MET n 
14 12   ARG n 
14 13   ARG n 
14 14   ARG n 
14 15   ARG n 
14 16   GLU n 
14 17   ALA n 
14 18   ARG n 
14 19   THR n 
14 20   ASP n 
14 21   TYR n 
14 22   HIS n 
14 23   GLN n 
14 24   ARG n 
14 25   LEU n 
14 26   ARG n 
14 27   LEU n 
14 28   LEU n 
14 29   LYS n 
14 30   SER n 
14 31   GLY n 
14 32   LYS n 
14 33   PRO n 
14 34   ARG n 
14 35   LEU n 
14 36   VAL n 
14 37   ALA n 
14 38   ARG n 
14 39   LYS n 
14 40   SER n 
14 41   ASN n 
14 42   LYS n 
14 43   HIS n 
14 44   VAL n 
14 45   ARG n 
14 46   ALA n 
14 47   GLN n 
14 48   LEU n 
14 49   VAL n 
14 50   THR n 
14 51   LEU n 
14 52   GLY n 
14 53   PRO n 
14 54   ASN n 
14 55   GLY n 
14 56   ASP n 
14 57   ASP n 
14 58   THR n 
14 59   LEU n 
14 60   ALA n 
14 61   SER n 
14 62   ALA n 
14 63   HIS n 
14 64   SER n 
14 65   SER n 
14 66   ASP n 
14 67   LEU n 
14 68   ALA n 
14 69   GLU n 
14 70   TYR n 
14 71   GLY n 
14 72   TRP n 
14 73   GLU n 
14 74   ALA n 
14 75   PRO n 
14 76   THR n 
14 77   GLY n 
14 78   ASN n 
14 79   MET n 
14 80   PRO n 
14 81   SER n 
14 82   ALA n 
14 83   TYR n 
14 84   LEU n 
14 85   THR n 
14 86   GLY n 
14 87   LEU n 
14 88   LEU n 
14 89   ALA n 
14 90   GLY n 
14 91   LEU n 
14 92   ARG n 
14 93   ALA n 
14 94   GLN n 
14 95   GLU n 
14 96   ALA n 
14 97   GLY n 
14 98   VAL n 
14 99   GLU n 
14 100  GLU n 
14 101  ALA n 
14 102  VAL n 
14 103  LEU n 
14 104  ASP n 
14 105  ILE n 
14 106  GLY n 
14 107  LEU n 
14 108  ASN n 
14 109  SER n 
14 110  PRO n 
14 111  THR n 
14 112  PRO n 
14 113  GLY n 
14 114  SER n 
14 115  LYS n 
14 116  VAL n 
14 117  PHE n 
14 118  ALA n 
14 119  ILE n 
14 120  GLN n 
14 121  GLU n 
14 122  GLY n 
14 123  ALA n 
14 124  ILE n 
14 125  ASP n 
14 126  ALA n 
14 127  GLY n 
14 128  LEU n 
14 129  ASP n 
14 130  ILE n 
14 131  PRO n 
14 132  HIS n 
14 133  ASN n 
14 134  ASP n 
14 135  ASP n 
14 136  VAL n 
14 137  LEU n 
14 138  ALA n 
14 139  ASP n 
14 140  TRP n 
14 141  GLN n 
14 142  ARG n 
14 143  THR n 
14 144  ARG n 
14 145  GLY n 
14 146  ALA n 
14 147  HIS n 
14 148  ILE n 
14 149  ALA n 
14 150  GLU n 
14 151  TYR n 
14 152  ASP n 
14 153  GLU n 
14 154  GLN n 
14 155  LEU n 
14 156  GLU n 
14 157  GLU n 
14 158  PRO n 
14 159  LEU n 
14 160  TYR n 
14 161  SER n 
14 162  GLY n 
14 163  ASP n 
14 164  PHE n 
14 165  ASP n 
14 166  ALA n 
14 167  ALA n 
14 168  ASP n 
14 169  LEU n 
14 170  PRO n 
14 171  GLU n 
14 172  HIS n 
14 173  PHE n 
14 174  ASP n 
14 175  GLU n 
14 176  LEU n 
14 177  ARG n 
14 178  GLU n 
14 179  THR n 
14 180  LEU n 
14 181  LEU n 
14 182  ASP n 
14 183  GLY n 
14 184  ASP n 
14 185  ILE n 
14 186  GLU n 
14 187  LEU n 
15 1    MET n 
15 2    SER n 
15 3    LYS n 
15 4    THR n 
15 5    ASN n 
15 6    PRO n 
15 7    ARG n 
15 8    LEU n 
15 9    SER n 
15 10   SER n 
15 11   LEU n 
15 12   ILE n 
15 13   ALA n 
15 14   ASP n 
15 15   LEU n 
15 16   LYS n 
15 17   SER n 
15 18   ALA n 
15 19   ALA n 
15 20   ARG n 
15 21   SER n 
15 22   SER n 
15 23   GLY n 
15 24   GLY n 
15 25   ALA n 
15 26   VAL n 
15 27   TRP n 
15 28   GLY n 
15 29   ASP n 
15 30   VAL n 
15 31   ALA n 
15 32   GLU n 
15 33   ARG n 
15 34   LEU n 
15 35   GLU n 
15 36   LYS n 
15 37   PRO n 
15 38   ARG n 
15 39   ARG n 
15 40   THR n 
15 41   HIS n 
15 42   ALA n 
15 43   GLU n 
15 44   VAL n 
15 45   ASN n 
15 46   LEU n 
15 47   GLY n 
15 48   ARG n 
15 49   ILE n 
15 50   GLU n 
15 51   ARG n 
15 52   TYR n 
15 53   ALA n 
15 54   GLN n 
15 55   GLU n 
15 56   ASP n 
15 57   GLU n 
15 58   THR n 
15 59   VAL n 
15 60   VAL n 
15 61   VAL n 
15 62   PRO n 
15 63   GLY n 
15 64   LYS n 
15 65   VAL n 
15 66   LEU n 
15 67   GLY n 
15 68   SER n 
15 69   GLY n 
15 70   VAL n 
15 71   LEU n 
15 72   GLN n 
15 73   LYS n 
15 74   ASP n 
15 75   VAL n 
15 76   THR n 
15 77   VAL n 
15 78   ALA n 
15 79   ALA n 
15 80   VAL n 
15 81   ASP n 
15 82   PHE n 
15 83   SER n 
15 84   GLY n 
15 85   THR n 
15 86   ALA n 
15 87   GLU n 
15 88   THR n 
15 89   LYS n 
15 90   ILE n 
15 91   ASP n 
15 92   GLN n 
15 93   VAL n 
15 94   GLY n 
15 95   GLU n 
15 96   ALA n 
15 97   VAL n 
15 98   SER n 
15 99   LEU n 
15 100  GLU n 
15 101  GLN n 
15 102  ALA n 
15 103  ILE n 
15 104  GLU n 
15 105  ASN n 
15 106  ASN n 
15 107  PRO n 
15 108  GLU n 
15 109  GLY n 
15 110  SER n 
15 111  HIS n 
15 112  VAL n 
15 113  ARG n 
15 114  VAL n 
15 115  ILE n 
15 116  ARG n 
16 1    MET n 
16 2    THR n 
16 3    ASP n 
16 4    LEU n 
16 5    SER n 
16 6    ALA n 
16 7    GLN n 
16 8    LYS n 
16 9    ARG n 
16 10   LEU n 
16 11   ALA n 
16 12   ALA n 
16 13   ASP n 
16 14   VAL n 
16 15   LEU n 
16 16   ASP n 
16 17   VAL n 
16 18   GLY n 
16 19   LYS n 
16 20   ASN n 
16 21   ARG n 
16 22   VAL n 
16 23   TRP n 
16 24   PHE n 
16 25   ASN n 
16 26   PRO n 
16 27   GLU n 
16 28   ARG n 
16 29   GLN n 
16 30   GLY n 
16 31   ASP n 
16 32   ILE n 
16 33   ALA n 
16 34   ASP n 
16 35   ALA n 
16 36   ILE n 
16 37   THR n 
16 38   ARG n 
16 39   GLU n 
16 40   ASP n 
16 41   VAL n 
16 42   ARG n 
16 43   GLU n 
16 44   LEU n 
16 45   VAL n 
16 46   ASP n 
16 47   GLU n 
16 48   GLY n 
16 49   ALA n 
16 50   ILE n 
16 51   GLN n 
16 52   ALA n 
16 53   LYS n 
16 54   ASP n 
16 55   LYS n 
16 56   LYS n 
16 57   GLY n 
16 58   ASN n 
16 59   SER n 
16 60   ARG n 
16 61   GLY n 
16 62   ARG n 
16 63   ALA n 
16 64   ARG n 
16 65   GLU n 
16 66   ARG n 
16 67   GLN n 
16 68   LYS n 
16 69   LYS n 
16 70   ARG n 
16 71   ALA n 
16 72   TYR n 
16 73   GLY n 
16 74   HIS n 
16 75   GLN n 
16 76   LYS n 
16 77   GLY n 
16 78   ALA n 
16 79   GLY n 
16 80   SER n 
16 81   ARG n 
16 82   LYS n 
16 83   GLY n 
16 84   LYS n 
16 85   ALA n 
16 86   GLY n 
16 87   ALA n 
16 88   ARG n 
16 89   GLN n 
16 90   ASN n 
16 91   SER n 
16 92   LYS n 
16 93   GLU n 
16 94   ASP n 
16 95   TRP n 
16 96   GLU n 
16 97   SER n 
16 98   ARG n 
16 99   ILE n 
16 100  ARG n 
16 101  ALA n 
16 102  GLN n 
16 103  ARG n 
16 104  THR n 
16 105  LYS n 
16 106  LEU n 
16 107  ARG n 
16 108  GLU n 
16 109  LEU n 
16 110  ARG n 
16 111  ASP n 
16 112  GLU n 
16 113  GLY n 
16 114  THR n 
16 115  LEU n 
16 116  SER n 
16 117  SER n 
16 118  SER n 
16 119  GLN n 
16 120  TYR n 
16 121  ARG n 
16 122  ASP n 
16 123  LEU n 
16 124  TYR n 
16 125  ASP n 
16 126  LYS n 
16 127  ALA n 
16 128  GLY n 
16 129  GLY n 
16 130  GLY n 
16 131  GLU n 
16 132  PHE n 
16 133  ASP n 
16 134  SER n 
16 135  VAL n 
16 136  ALA n 
16 137  ASP n 
16 138  LEU n 
16 139  GLU n 
16 140  ARG n 
16 141  TYR n 
16 142  ILE n 
16 143  ASP n 
16 144  ALA n 
16 145  ASN n 
16 146  HIS n 
16 147  GLY n 
16 148  ASP n 
16 149  ALA n 
17 1    MET n 
17 2    PRO n 
17 3    SER n 
17 4    SER n 
17 5    ASN n 
17 6    GLY n 
17 7    PRO n 
17 8    LEU n 
17 9    GLU n 
17 10   GLY n 
17 11   THR n 
17 12   ARG n 
17 13   GLY n 
17 14   LYS n 
17 15   LEU n 
17 16   LYS n 
17 17   ASN n 
17 18   LYS n 
17 19   PRO n 
17 20   ARG n 
17 21   ASP n 
17 22   ARG n 
17 23   GLY n 
17 24   THR n 
17 25   SER n 
17 26   PRO n 
17 27   PRO n 
17 28   GLN n 
17 29   ARG n 
17 30   ALA n 
17 31   VAL n 
17 32   GLU n 
17 33   GLU n 
17 34   PHE n 
17 35   ASP n 
17 36   ASP n 
17 37   GLY n 
17 38   GLU n 
17 39   LYS n 
17 40   VAL n 
17 41   HIS n 
17 42   LEU n 
17 43   LYS n 
17 44   ILE n 
17 45   ASP n 
17 46   PRO n 
17 47   SER n 
17 48   VAL n 
17 49   PRO n 
17 50   ASN n 
17 51   GLY n 
17 52   ARG n 
17 53   PHE n 
17 54   HIS n 
17 55   PRO n 
17 56   ARG n 
17 57   PHE n 
17 58   ASP n 
17 59   GLY n 
17 60   GLN n 
17 61   THR n 
17 62   GLY n 
17 63   THR n 
17 64   VAL n 
17 65   GLU n 
17 66   GLY n 
17 67   LYS n 
17 68   GLN n 
17 69   GLY n 
17 70   ASP n 
17 71   ALA n 
17 72   TYR n 
17 73   LYS n 
17 74   VAL n 
17 75   ASP n 
17 76   ILE n 
17 77   VAL n 
17 78   ASP n 
17 79   GLY n 
17 80   GLY n 
17 81   LYS n 
17 82   GLU n 
17 83   LYS n 
17 84   THR n 
17 85   ILE n 
17 86   ILE n 
17 87   VAL n 
17 88   THR n 
17 89   ALA n 
17 90   ALA n 
17 91   HIS n 
17 92   LEU n 
17 93   ARG n 
17 94   ARG n 
17 95   GLN n 
17 96   GLU n 
18 1    MET n 
18 2    GLY n 
18 3    ILE n 
18 4    SER n 
18 5    TYR n 
18 6    SER n 
18 7    VAL n 
18 8    GLU n 
18 9    ALA n 
18 10   ASP n 
18 11   PRO n 
18 12   ASP n 
18 13   THR n 
18 14   THR n 
18 15   ALA n 
18 16   LYS n 
18 17   ALA n 
18 18   MET n 
18 19   LEU n 
18 20   ARG n 
18 21   GLU n 
18 22   ARG n 
18 23   GLN n 
18 24   MET n 
18 25   SER n 
18 26   PHE n 
18 27   LYS n 
18 28   HIS n 
18 29   SER n 
18 30   LYS n 
18 31   ALA n 
18 32   ILE n 
18 33   ALA n 
18 34   ARG n 
18 35   GLU n 
18 36   ILE n 
18 37   LYS n 
18 38   GLY n 
18 39   LYS n 
18 40   THR n 
18 41   ALA n 
18 42   GLY n 
18 43   GLU n 
18 44   ALA n 
18 45   VAL n 
18 46   ASP n 
18 47   TYR n 
18 48   LEU n 
18 49   GLU n 
18 50   ALA n 
18 51   VAL n 
18 52   ILE n 
18 53   GLU n 
18 54   GLY n 
18 55   ASP n 
18 56   GLN n 
18 57   PRO n 
18 58   VAL n 
18 59   PRO n 
18 60   PHE n 
18 61   LYS n 
18 62   GLN n 
18 63   HIS n 
18 64   ASN n 
18 65   SER n 
18 66   GLY n 
18 67   VAL n 
18 68   GLY n 
18 69   HIS n 
18 70   LYS n 
18 71   SER n 
18 72   LYS n 
18 73   VAL n 
18 74   ASP n 
18 75   GLY n 
18 76   TRP n 
18 77   ASP n 
18 78   ALA n 
18 79   GLY n 
18 80   ARG n 
18 81   TYR n 
18 82   PRO n 
18 83   GLU n 
18 84   LYS n 
18 85   ALA n 
18 86   SER n 
18 87   LYS n 
18 88   ALA n 
18 89   PHE n 
18 90   LEU n 
18 91   ASP n 
18 92   LEU n 
18 93   LEU n 
18 94   GLU n 
18 95   ASN n 
18 96   ALA n 
18 97   VAL n 
18 98   GLY n 
18 99   ASN n 
18 100  ALA n 
18 101  ASP n 
18 102  HIS n 
18 103  GLN n 
18 104  GLY n 
18 105  PHE n 
18 106  ASP n 
18 107  GLY n 
18 108  GLU n 
18 109  ALA n 
18 110  MET n 
18 111  THR n 
18 112  ILE n 
18 113  LYS n 
18 114  HIS n 
18 115  VAL n 
18 116  ALA n 
18 117  ALA n 
18 118  HIS n 
18 119  LYS n 
18 120  VAL n 
18 121  GLY n 
18 122  GLU n 
18 123  GLN n 
18 124  GLN n 
18 125  GLY n 
18 126  ARG n 
18 127  LYS n 
18 128  PRO n 
18 129  ARG n 
18 130  ALA n 
18 131  MET n 
18 132  GLY n 
18 133  ARG n 
18 134  ALA n 
18 135  SER n 
18 136  ALA n 
18 137  TRP n 
18 138  ASN n 
18 139  SER n 
18 140  PRO n 
18 141  GLN n 
18 142  VAL n 
18 143  ASP n 
18 144  VAL n 
18 145  GLU n 
18 146  LEU n 
18 147  ILE n 
18 148  LEU n 
18 149  GLU n 
18 150  GLU n 
18 151  PRO n 
18 152  GLU n 
18 153  VAL n 
18 154  GLU n 
18 155  ASP n 
19 1    MET n 
19 2    SER n 
19 3    TRP n 
19 4    ASP n 
19 5    VAL n 
19 6    ILE n 
19 7    LYS n 
19 8    HIS n 
19 9    PRO n 
19 10   HIS n 
19 11   VAL n 
19 12   THR n 
19 13   GLU n 
19 14   LYS n 
19 15   ALA n 
19 16   MET n 
19 17   ASN n 
19 18   ASP n 
19 19   MET n 
19 20   ASP n 
19 21   PHE n 
19 22   GLN n 
19 23   ASN n 
19 24   LYS n 
19 25   LEU n 
19 26   GLN n 
19 27   PHE n 
19 28   ALA n 
19 29   VAL n 
19 30   ASP n 
19 31   ASP n 
19 32   ARG n 
19 33   ALA n 
19 34   SER n 
19 35   LYS n 
19 36   GLY n 
19 37   GLU n 
19 38   VAL n 
19 39   ALA n 
19 40   ASP n 
19 41   ALA n 
19 42   VAL n 
19 43   GLU n 
19 44   GLU n 
19 45   GLN n 
19 46   TYR n 
19 47   ASP n 
19 48   VAL n 
19 49   THR n 
19 50   VAL n 
19 51   GLU n 
19 52   GLN n 
19 53   VAL n 
19 54   ASN n 
19 55   THR n 
19 56   GLN n 
19 57   ASN n 
19 58   THR n 
19 59   MET n 
19 60   ASP n 
19 61   GLY n 
19 62   GLU n 
19 63   LYS n 
19 64   LYS n 
19 65   ALA n 
19 66   VAL n 
19 67   VAL n 
19 68   ARG n 
19 69   LEU n 
19 70   SER n 
19 71   GLU n 
19 72   ASP n 
19 73   ASP n 
19 74   ASP n 
19 75   ALA n 
19 76   GLN n 
19 77   GLU n 
19 78   VAL n 
19 79   ALA n 
19 80   SER n 
19 81   ARG n 
19 82   ILE n 
19 83   GLY n 
19 84   VAL n 
19 85   PHE n 
20 1    MET n 
20 2    SER n 
20 3    LYS n 
20 4    GLN n 
20 5    PRO n 
20 6    ASP n 
20 7    LYS n 
20 8    GLN n 
20 9    ARG n 
20 10   LYS n 
20 11   SER n 
20 12   GLN n 
20 13   ARG n 
20 14   ARG n 
20 15   ALA n 
20 16   PRO n 
20 17   LEU n 
20 18   HIS n 
20 19   GLU n 
20 20   ARG n 
20 21   HIS n 
20 22   LYS n 
20 23   GLN n 
20 24   VAL n 
20 25   ARG n 
20 26   ALA n 
20 27   THR n 
20 28   LEU n 
20 29   SER n 
20 30   ALA n 
20 31   ASP n 
20 32   LEU n 
20 33   ARG n 
20 34   GLU n 
20 35   GLU n 
20 36   TYR n 
20 37   GLY n 
20 38   GLN n 
20 39   ARG n 
20 40   ASN n 
20 41   VAL n 
20 42   ARG n 
20 43   VAL n 
20 44   ASN n 
20 45   ALA n 
20 46   GLY n 
20 47   ASP n 
20 48   THR n 
20 49   VAL n 
20 50   GLU n 
20 51   VAL n 
20 52   LEU n 
20 53   ARG n 
20 54   GLY n 
20 55   ASP n 
20 56   PHE n 
20 57   ALA n 
20 58   GLY n 
20 59   GLU n 
20 60   GLU n 
20 61   GLY n 
20 62   GLU n 
20 63   VAL n 
20 64   ILE n 
20 65   ASN n 
20 66   VAL n 
20 67   ASP n 
20 68   LEU n 
20 69   ASP n 
20 70   LYS n 
20 71   ALA n 
20 72   VAL n 
20 73   ILE n 
20 74   HIS n 
20 75   VAL n 
20 76   GLU n 
20 77   ASP n 
20 78   VAL n 
20 79   THR n 
20 80   LEU n 
20 81   GLU n 
20 82   LYS n 
20 83   THR n 
20 84   ASP n 
20 85   GLY n 
20 86   GLU n 
20 87   GLU n 
20 88   VAL n 
20 89   PRO n 
20 90   ARG n 
20 91   PRO n 
20 92   LEU n 
20 93   ASP n 
20 94   THR n 
20 95   SER n 
20 96   ASN n 
20 97   VAL n 
20 98   ARG n 
20 99   VAL n 
20 100  THR n 
20 101  ASP n 
20 102  LEU n 
20 103  ASP n 
20 104  LEU n 
20 105  GLU n 
20 106  ASP n 
20 107  GLU n 
20 108  LYS n 
20 109  ARG n 
20 110  GLU n 
20 111  ALA n 
20 112  ARG n 
20 113  LEU n 
20 114  GLU n 
20 115  SER n 
20 116  GLU n 
20 117  ASP n 
20 118  ASP n 
20 119  SER n 
20 120  ALA n 
21 1    MET n 
21 2    PRO n 
21 3    ARG n 
21 4    THR n 
21 5    ARG n 
21 6    GLU n 
21 7    CYS n 
21 8    ASP n 
21 9    TYR n 
21 10   CYS n 
21 11   GLY n 
21 12   THR n 
21 13   ASP n 
21 14   ILE n 
21 15   GLU n 
21 16   PRO n 
21 17   GLY n 
21 18   THR n 
21 19   GLY n 
21 20   THR n 
21 21   MET n 
21 22   PHE n 
21 23   VAL n 
21 24   HIS n 
21 25   LYS n 
21 26   ASP n 
21 27   GLY n 
21 28   ALA n 
21 29   THR n 
21 30   THR n 
21 31   HIS n 
21 32   PHE n 
21 33   CYS n 
21 34   SER n 
21 35   SER n 
21 36   LYS n 
21 37   CYS n 
21 38   GLU n 
21 39   ASN n 
21 40   ASN n 
21 41   ALA n 
21 42   ASP n 
21 43   LEU n 
21 44   GLY n 
21 45   ARG n 
21 46   GLU n 
21 47   ALA n 
21 48   ARG n 
21 49   ASN n 
21 50   LEU n 
21 51   GLU n 
21 52   TRP n 
21 53   THR n 
21 54   ASP n 
21 55   THR n 
21 56   ALA n 
21 57   ARG n 
21 58   GLY n 
21 59   GLU n 
21 60   ALA n 
21 61   GLY n 
21 62   GLU n 
21 63   ALA n 
21 64   GLU n 
21 65   ASP n 
21 66   GLU n 
21 67   ALA n 
22 1    MET n 
22 2    THR n 
22 3    VAL n 
22 4    LEU n 
22 5    HIS n 
22 6    VAL n 
22 7    GLN n 
22 8    GLU n 
22 9    ILE n 
22 10   ARG n 
22 11   ASP n 
22 12   MET n 
22 13   THR n 
22 14   PRO n 
22 15   ALA n 
22 16   GLU n 
22 17   ARG n 
22 18   GLU n 
22 19   ALA n 
22 20   GLU n 
22 21   LEU n 
22 22   ASP n 
22 23   ASP n 
22 24   LEU n 
22 25   LYS n 
22 26   THR n 
22 27   GLU n 
22 28   LEU n 
22 29   LEU n 
22 30   ASN n 
22 31   ALA n 
22 32   ARG n 
22 33   ALA n 
22 34   VAL n 
22 35   GLN n 
22 36   ALA n 
22 37   ALA n 
22 38   GLY n 
22 39   GLY n 
22 40   ALA n 
22 41   PRO n 
22 42   GLU n 
22 43   ASN n 
22 44   PRO n 
22 45   GLY n 
22 46   ARG n 
22 47   ILE n 
22 48   LYS n 
22 49   GLU n 
22 50   LEU n 
22 51   ARG n 
22 52   LYS n 
22 53   ALA n 
22 54   ILE n 
22 55   ALA n 
22 56   ARG n 
22 57   ILE n 
22 58   LYS n 
22 59   THR n 
22 60   ILE n 
22 61   GLN n 
22 62   GLY n 
22 63   GLU n 
22 64   GLU n 
22 65   GLY n 
22 66   ASP n 
22 67   LEU n 
22 68   GLN n 
22 69   GLU n 
22 70   ASN n 
22 71   GLU n 
23 1    MET n 
23 2    HIS n 
23 3    ALA n 
23 4    LEU n 
23 5    VAL n 
23 6    GLN n 
23 7    LEU n 
23 8    ARG n 
23 9    GLY n 
23 10   GLU n 
23 11   VAL n 
23 12   ASN n 
23 13   MET n 
23 14   HIS n 
23 15   THR n 
23 16   ASP n 
23 17   ILE n 
23 18   GLN n 
23 19   ASP n 
23 20   THR n 
23 21   LEU n 
23 22   GLU n 
23 23   MET n 
23 24   LEU n 
23 25   ASN n 
23 26   ILE n 
23 27   HIS n 
23 28   HIS n 
23 29   VAL n 
23 30   ASN n 
23 31   HIS n 
23 32   CYS n 
23 33   THR n 
23 34   LEU n 
23 35   VAL n 
23 36   PRO n 
23 37   GLU n 
23 38   THR n 
23 39   ASP n 
23 40   ALA n 
23 41   TYR n 
23 42   ARG n 
23 43   GLY n 
23 44   MET n 
23 45   VAL n 
23 46   ALA n 
23 47   LYS n 
23 48   VAL n 
23 49   ASN n 
23 50   ASP n 
23 51   PHE n 
23 52   VAL n 
23 53   ALA n 
23 54   PHE n 
23 55   GLY n 
23 56   GLU n 
23 57   PRO n 
23 58   SER n 
23 59   GLN n 
23 60   GLU n 
23 61   THR n 
23 62   LEU n 
23 63   GLU n 
23 64   THR n 
23 65   VAL n 
23 66   LEU n 
23 67   ALA n 
23 68   THR n 
23 69   ARG n 
23 70   ALA n 
23 71   GLU n 
23 72   PRO n 
23 73   LEU n 
23 74   GLU n 
23 75   GLY n 
23 76   ASP n 
23 77   ALA n 
23 78   ASP n 
23 79   VAL n 
23 80   ASP n 
23 81   ASP n 
23 82   GLU n 
23 83   TRP n 
23 84   VAL n 
23 85   ALA n 
23 86   GLU n 
23 87   HIS n 
23 88   THR n 
23 89   ASP n 
23 90   TYR n 
23 91   ASP n 
23 92   ASP n 
23 93   ILE n 
23 94   SER n 
23 95   GLY n 
23 96   LEU n 
23 97   ALA n 
23 98   PHE n 
23 99   ALA n 
23 100  LEU n 
23 101  LEU n 
23 102  SER n 
23 103  GLU n 
23 104  GLU n 
23 105  THR n 
23 106  THR n 
23 107  LEU n 
23 108  ARG n 
23 109  GLU n 
23 110  GLN n 
23 111  GLY n 
23 112  LEU n 
23 113  SER n 
23 114  PRO n 
23 115  THR n 
23 116  LEU n 
23 117  ARG n 
23 118  LEU n 
23 119  HIS n 
23 120  PRO n 
23 121  PRO n 
23 122  ARG n 
23 123  GLY n 
23 124  GLY n 
23 125  HIS n 
23 126  ASP n 
23 127  GLY n 
23 128  VAL n 
23 129  LYS n 
23 130  HIS n 
23 131  PRO n 
23 132  VAL n 
23 133  LYS n 
23 134  GLU n 
23 135  GLY n 
23 136  GLY n 
23 137  GLN n 
23 138  LEU n 
23 139  GLY n 
23 140  LYS n 
23 141  HIS n 
23 142  ASP n 
23 143  THR n 
23 144  GLU n 
23 145  GLY n 
23 146  ILE n 
23 147  ASP n 
23 148  ASP n 
23 149  LEU n 
23 150  LEU n 
23 151  GLU n 
23 152  ALA n 
23 153  MET n 
23 154  ARG n 
24 1    MET n 
24 2    SER n 
24 3    ALA n 
24 4    SER n 
24 5    ASP n 
24 6    PHE n 
24 7    GLU n 
24 8    GLU n 
24 9    ARG n 
24 10   VAL n 
24 11   VAL n 
24 12   THR n 
24 13   ILE n 
24 14   PRO n 
24 15   LEU n 
24 16   ARG n 
24 17   ASP n 
24 18   ALA n 
24 19   ARG n 
24 20   ALA n 
24 21   GLU n 
24 22   PRO n 
24 23   ASN n 
24 24   HIS n 
24 25   LYS n 
24 26   ARG n 
24 27   ALA n 
24 28   ASP n 
24 29   LYS n 
24 30   ALA n 
24 31   MET n 
24 32   ILE n 
24 33   LEU n 
24 34   ILE n 
24 35   ARG n 
24 36   GLU n 
24 37   HIS n 
24 38   LEU n 
24 39   ALA n 
24 40   LYS n 
24 41   HIS n 
24 42   PHE n 
24 43   SER n 
24 44   VAL n 
24 45   ASP n 
24 46   GLU n 
24 47   ASP n 
24 48   ALA n 
24 49   VAL n 
24 50   ARG n 
24 51   LEU n 
24 52   ASP n 
24 53   PRO n 
24 54   SER n 
24 55   ILE n 
24 56   ASN n 
24 57   GLU n 
24 58   ALA n 
24 59   ALA n 
24 60   TRP n 
24 61   ALA n 
24 62   ARG n 
24 63   GLY n 
24 64   ARG n 
24 65   ALA n 
24 66   ASN n 
24 67   THR n 
24 68   PRO n 
24 69   SER n 
24 70   LYS n 
24 71   ILE n 
24 72   ARG n 
24 73   VAL n 
24 74   ARG n 
24 75   ALA n 
24 76   ALA n 
24 77   ARG n 
24 78   PHE n 
24 79   GLU n 
24 80   GLU n 
24 81   GLU n 
24 82   GLY n 
24 83   GLU n 
24 84   ALA n 
24 85   ILE n 
24 86   VAL n 
24 87   GLU n 
24 88   ALA n 
24 89   GLU n 
24 90   THR n 
24 91   ALA n 
24 92   GLU n 
25 1    MET n 
25 2    ALA n 
25 3    ASP n 
25 4    ASN n 
25 5    GLU n 
25 6    GLU n 
25 7    ASP n 
25 8    VAL n 
25 9    GLU n 
25 10   ALA n 
25 11   GLU n 
25 12   GLU n 
25 13   GLU n 
25 14   TYR n 
25 15   THR n 
25 16   GLU n 
25 17   LEU n 
25 18   THR n 
25 19   ASP n 
25 20   ILE n 
25 21   SER n 
25 22   GLY n 
25 23   VAL n 
25 24   GLY n 
25 25   PRO n 
25 26   SER n 
25 27   LYS n 
25 28   ALA n 
25 29   GLU n 
25 30   SER n 
25 31   LEU n 
25 32   ARG n 
25 33   GLU n 
25 34   ALA n 
25 35   GLY n 
25 36   PHE n 
25 37   GLU n 
25 38   SER n 
25 39   VAL n 
25 40   GLU n 
25 41   ASP n 
25 42   VAL n 
25 43   ARG n 
25 44   GLY n 
25 45   ALA n 
25 46   ASP n 
25 47   GLN n 
25 48   SER n 
25 49   ALA n 
25 50   LEU n 
25 51   ALA n 
25 52   ASP n 
25 53   VAL n 
25 54   SER n 
25 55   GLY n 
25 56   ILE n 
25 57   GLY n 
25 58   ASN n 
25 59   ALA n 
25 60   LEU n 
25 61   ALA n 
25 62   ALA n 
25 63   ARG n 
25 64   ILE n 
25 65   LYS n 
25 66   ALA n 
25 67   ASP n 
25 68   VAL n 
25 69   GLY n 
25 70   GLY n 
25 71   LEU n 
25 72   GLU n 
25 73   VAL n 
25 74   GLU n 
25 75   SER n 
25 76   GLU n 
25 77   THR n 
25 78   GLU n 
25 79   ALA n 
25 80   GLU n 
25 81   VAL n 
25 82   GLU n 
25 83   GLU n 
25 84   GLU n 
25 85   GLY n 
25 86   GLY n 
25 87   GLU n 
25 88   GLU n 
25 89   ALA n 
25 90   PRO n 
25 91   ASP n 
25 92   GLU n 
25 93   ASP n 
25 94   VAL n 
25 95   GLU n 
25 96   THR n 
25 97   GLU n 
25 98   LEU n 
25 99   GLN n 
25 100  ALA n 
25 101  ARG n 
25 102  GLY n 
25 103  LEU n 
25 104  THR n 
25 105  GLU n 
25 106  LYS n 
25 107  THR n 
25 108  PRO n 
25 109  ASP n 
25 110  LEU n 
25 111  SER n 
25 112  ASP n 
25 113  GLU n 
25 114  ASP n 
25 115  ALA n 
25 116  ARG n 
25 117  LEU n 
25 118  LEU n 
25 119  THR n 
25 120  GLN n 
25 121  ARG n 
25 122  HIS n 
25 123  ARG n 
25 124  VAL n 
25 125  GLY n 
25 126  LYS n 
25 127  PRO n 
25 128  GLN n 
25 129  PHE n 
25 130  ASN n 
25 131  ARG n 
25 132  GLN n 
25 133  ASP n 
25 134  HIS n 
25 135  HIS n 
25 136  LYS n 
25 137  LYS n 
25 138  LYS n 
25 139  ARG n 
25 140  VAL n 
25 141  SER n 
25 142  THR n 
25 143  SER n 
25 144  TRP n 
25 145  ARG n 
25 146  LYS n 
25 147  PRO n 
25 148  ARG n 
25 149  GLY n 
25 150  GLN n 
25 151  LEU n 
25 152  SER n 
25 153  LYS n 
25 154  GLN n 
25 155  ARG n 
25 156  ARG n 
25 157  GLY n 
25 158  ILE n 
25 159  LYS n 
25 160  GLY n 
25 161  LYS n 
25 162  GLY n 
25 163  ASP n 
25 164  THR n 
25 165  VAL n 
25 166  GLU n 
25 167  ALA n 
25 168  GLY n 
25 169  PHE n 
25 170  ARG n 
25 171  SER n 
25 172  PRO n 
25 173  THR n 
25 174  ALA n 
25 175  VAL n 
25 176  ARG n 
25 177  GLY n 
25 178  LYS n 
25 179  HIS n 
25 180  PRO n 
25 181  SER n 
25 182  GLY n 
25 183  PHE n 
25 184  GLU n 
25 185  GLU n 
25 186  VAL n 
25 187  ARG n 
25 188  VAL n 
25 189  HIS n 
25 190  ASN n 
25 191  VAL n 
25 192  ASP n 
25 193  ASP n 
25 194  LEU n 
25 195  GLU n 
25 196  GLY n 
25 197  VAL n 
25 198  ASP n 
25 199  GLY n 
25 200  ASP n 
25 201  THR n 
25 202  GLU n 
25 203  ALA n 
25 204  VAL n 
25 205  ARG n 
25 206  ILE n 
25 207  ALA n 
25 208  SER n 
25 209  LYS n 
25 210  VAL n 
25 211  GLY n 
25 212  ALA n 
25 213  ARG n 
25 214  LYS n 
25 215  ARG n 
25 216  GLU n 
25 217  ARG n 
25 218  ILE n 
25 219  GLU n 
25 220  GLU n 
25 221  GLU n 
25 222  ALA n 
25 223  GLU n 
25 224  ASP n 
25 225  ALA n 
25 226  GLY n 
25 227  ILE n 
25 228  ARG n 
25 229  VAL n 
25 230  LEU n 
25 231  ASN n 
25 232  PRO n 
25 233  THR n 
25 234  TYR n 
25 235  VAL n 
25 236  GLU n 
25 237  VAL n 
25 238  GLU n 
25 239  VAL n 
25 240  SER n 
26 1    MET n 
26 2    SER n 
26 3    PRO n 
26 4    ARG n 
26 5    ALA n 
26 6    ARG n 
26 7    ARG n 
26 8    GLU n 
26 9    PRO n 
26 10   ASN n 
26 11   LEU n 
26 12   GLU n 
26 13   GLY n 
26 14   LEU n 
26 15   MET n 
26 16   TRP n 
26 17   PRO n 
26 18   LEU n 
26 19   GLY n 
26 20   GLY n 
26 21   GLN n 
26 22   GLN n 
26 23   THR n 
26 24   THR n 
26 25   MET n 
26 26   ALA n 
26 27   SER n 
26 28   LYS n 
26 29   SER n 
26 30   GLY n 
26 31   LYS n 
26 32   THR n 
26 33   GLY n 
26 34   SER n 
26 35   SER n 
26 36   GLY n 
26 37   ARG n 
26 38   PHE n 
26 39   GLY n 
26 40   ALA n 
26 41   ARG n 
26 42   TYR n 
26 43   GLY n 
26 44   ARG n 
26 45   VAL n 
26 46   SER n 
26 47   ARG n 
26 48   ARG n 
26 49   ARG n 
26 50   VAL n 
26 51   ALA n 
26 52   GLU n 
26 53   ILE n 
26 54   GLU n 
26 55   SER n 
26 56   GLU n 
26 57   MET n 
26 58   ASN n 
26 59   GLU n 
26 60   ASP n 
26 61   HIS n 
26 62   ALA n 
26 63   CYS n 
26 64   PRO n 
26 65   ASN n 
26 66   CYS n 
26 67   GLY n 
26 68   GLU n 
26 69   ASP n 
26 70   ARG n 
26 71   VAL n 
26 72   ASP n 
26 73   ARG n 
26 74   GLN n 
26 75   GLY n 
26 76   THR n 
26 77   GLY n 
26 78   ILE n 
26 79   TRP n 
26 80   GLN n 
26 81   CYS n 
26 82   SER n 
26 83   TYR n 
26 84   CYS n 
26 85   ASP n 
26 86   TYR n 
26 87   LYS n 
26 88   PHE n 
26 89   THR n 
26 90   GLY n 
26 91   GLY n 
26 92   SER n 
26 93   TYR n 
26 94   LYS n 
26 95   PRO n 
26 96   GLU n 
26 97   THR n 
26 98   PRO n 
26 99   GLY n 
26 100  GLY n 
26 101  LYS n 
26 102  THR n 
26 103  VAL n 
26 104  ARG n 
26 105  ARG n 
26 106  SER n 
26 107  ILE n 
26 108  ARG n 
26 109  ALA n 
26 110  ALA n 
26 111  LEU n 
26 112  SER n 
26 113  GLU n 
26 114  ASP n 
26 115  GLU n 
26 116  GLU n 
27 1    MET n 
27 2    THR n 
27 3    GLY n 
27 4    ALA n 
27 5    GLY n 
27 6    THR n 
27 7    PRO n 
27 8    SER n 
27 9    GLN n 
27 10   GLY n 
27 11   LYS n 
27 12   LYS n 
27 13   ASN n 
27 14   THR n 
27 15   THR n 
27 16   THR n 
27 17   HIS n 
27 18   THR n 
27 19   LYS n 
27 20   CYS n 
27 21   ARG n 
27 22   ARG n 
27 23   CYS n 
27 24   GLY n 
27 25   GLU n 
27 26   LYS n 
27 27   SER n 
27 28   TYR n 
27 29   HIS n 
27 30   THR n 
27 31   LYS n 
27 32   LYS n 
27 33   LYS n 
27 34   VAL n 
27 35   CYS n 
27 36   SER n 
27 37   SER n 
27 38   CYS n 
27 39   GLY n 
27 40   PHE n 
27 41   GLY n 
27 42   LYS n 
27 43   SER n 
27 44   ALA n 
27 45   LYS n 
27 46   ARG n 
27 47   ARG n 
27 48   ASP n 
27 49   TYR n 
27 50   GLU n 
27 51   TRP n 
27 52   GLN n 
27 53   SER n 
27 54   LYS n 
27 55   ALA n 
27 56   GLY n 
27 57   GLU n 
28 1    MET n 
28 2    GLY n 
28 3    LYS n 
28 4    LYS n 
28 5    SER n 
28 6    LYS n 
28 7    ALA n 
28 8    THR n 
28 9    LYS n 
28 10   LYS n 
28 11   ARG n 
28 12   LEU n 
28 13   ALA n 
28 14   LYS n 
28 15   LEU n 
28 16   ASP n 
28 17   ASN n 
28 18   GLN n 
28 19   ASN n 
28 20   SER n 
28 21   ARG n 
28 22   VAL n 
28 23   PRO n 
28 24   ALA n 
28 25   TRP n 
28 26   VAL n 
28 27   MET n 
28 28   LEU n 
28 29   LYS n 
28 30   THR n 
28 31   ASP n 
28 32   ARG n 
28 33   GLU n 
28 34   VAL n 
28 35   GLN n 
28 36   ARG n 
28 37   ASN n 
28 38   HIS n 
28 39   LYS n 
28 40   ARG n 
28 41   ARG n 
28 42   HIS n 
28 43   TRP n 
28 44   ARG n 
28 45   ARG n 
28 46   ASN n 
28 47   ASP n 
28 48   THR n 
28 49   ASP n 
28 50   GLU n 
29 1    MET n 
29 2    GLN n 
29 3    MET n 
29 4    PRO n 
29 5    ARG n 
29 6    ARG n 
29 7    PHE n 
29 8    ASN n 
29 9    THR n 
29 10   TYR n 
29 11   CYS n 
29 12   PRO n 
29 13   HIS n 
29 14   CYS n 
29 15   ASN n 
29 16   GLU n 
29 17   HIS n 
29 18   GLN n 
29 19   GLU n 
29 20   HIS n 
29 21   GLU n 
29 22   VAL n 
29 23   GLU n 
29 24   LYS n 
29 25   VAL n 
29 26   ARG n 
29 27   SER n 
29 28   GLY n 
29 29   ARG n 
29 30   GLN n 
29 31   THR n 
29 32   GLY n 
29 33   MET n 
29 34   LYS n 
29 35   TRP n 
29 36   ILE n 
29 37   ASP n 
29 38   ARG n 
29 39   GLN n 
29 40   ARG n 
29 41   GLU n 
29 42   ARG n 
29 43   ASN n 
29 44   SER n 
29 45   GLY n 
29 46   ILE n 
29 47   GLY n 
29 48   ASN n 
29 49   ASP n 
29 50   GLY n 
29 51   LYS n 
29 52   PHE n 
29 53   SER n 
29 54   LYS n 
29 55   VAL n 
29 56   PRO n 
29 57   GLY n 
29 58   GLY n 
29 59   ASP n 
29 60   LYS n 
29 61   PRO n 
29 62   THR n 
29 63   LYS n 
29 64   LYS n 
29 65   THR n 
29 66   ASP n 
29 67   LEU n 
29 68   LYS n 
29 69   TYR n 
29 70   ARG n 
29 71   CYS n 
29 72   GLY n 
29 73   GLU n 
29 74   CYS n 
29 75   GLY n 
29 76   LYS n 
29 77   ALA n 
29 78   HIS n 
29 79   LEU n 
29 80   ARG n 
29 81   GLU n 
29 82   GLY n 
29 83   TRP n 
29 84   ARG n 
29 85   ALA n 
29 86   GLY n 
29 87   ARG n 
29 88   LEU n 
29 89   GLU n 
29 90   PHE n 
29 91   GLN n 
29 92   GLU n 
30 1    G   n 
30 2    U   n 
30 3    U   n 
30 4    G   n 
30 5    G   n 
30 6    C   n 
30 7    U   n 
30 8    A   n 
30 9    C   n 
30 10   U   n 
30 11   A   n 
30 12   U   n 
30 13   G   n 
30 14   C   n 
30 15   C   n 
30 16   A   n 
30 17   G   n 
30 18   C   n 
30 19   U   n 
30 20   G   n 
30 21   G   n 
30 22   U   n 
30 23   G   n 
30 24   G   n 
30 25   A   n 
30 26   U   n 
30 27   U   n 
30 28   G   n 
30 29   C   n 
30 30   U   n 
30 31   C   n 
30 32   G   n 
30 33   G   n 
30 34   C   n 
30 35   U   n 
30 36   C   n 
30 37   A   n 
30 38   G   n 
30 39   G   n 
30 40   C   n 
30 41   G   n 
30 42   C   n 
30 43   U   n 
30 44   G   n 
30 45   A   n 
30 46   U   n 
30 47   G   n 
30 48   A   n 
30 49   A   n 
30 50   G   n 
30 51   G   n 
30 52   A   n 
30 53   C   n 
30 54   G   n 
30 55   U   n 
30 56   G   n 
30 57   C   n 
30 58   C   n 
30 59   A   n 
30 60   A   n 
30 61   G   n 
30 62   C   n 
30 63   U   n 
30 64   G   n 
30 65   C   n 
30 66   G   n 
30 67   A   n 
30 68   U   n 
30 69   A   n 
30 70   A   n 
30 71   G   n 
30 72   C   n 
30 73   U   n 
30 74   G   n 
30 75   U   n 
30 76   G   n 
30 77   G   n 
30 78   G   n 
30 79   G   n 
30 80   A   n 
30 81   G   n 
30 82   C   n 
30 83   C   n 
30 84   G   n 
30 85   C   n 
30 86   A   n 
30 87   C   n 
30 88   G   n 
30 89   G   n 
30 90   A   n 
30 91   G   n 
30 92   G   n 
30 93   C   n 
30 94   G   n 
30 95   A   n 
30 96   A   n 
30 97   G   n 
30 98   A   n 
30 99   A   n 
30 100  C   n 
30 101  C   n 
30 102  A   n 
30 103  C   n 
30 104  A   n 
30 105  G   n 
30 106  A   n 
30 107  U   n 
30 108  U   n 
30 109  U   n 
30 110  C   n 
30 111  C   n 
30 112  G   n 
30 113  A   n 
30 114  A   n 
30 115  U   n 
30 116  G   n 
30 117  A   n 
30 118  G   n 
30 119  A   n 
30 120  A   n 
30 121  U   n 
30 122  C   n 
30 123  U   n 
30 124  C   n 
30 125  U   n 
30 126  C   n 
30 127  U   n 
30 128  A   n 
30 129  A   n 
30 130  C   n 
30 131  A   n 
30 132  A   n 
30 133  U   n 
30 134  U   n 
30 135  G   n 
30 136  C   n 
30 137  U   n 
30 138  U   n 
30 139  C   n 
30 140  G   n 
30 141  C   n 
30 142  G   n 
30 143  C   n 
30 144  A   n 
30 145  A   n 
30 146  U   n 
30 147  G   n 
30 148  A   n 
30 149  G   n 
30 150  G   n 
30 151  A   n 
30 152  A   n 
30 153  C   n 
30 154  C   n 
30 155  C   n 
30 156  C   n 
30 157  G   n 
30 158  A   n 
30 159  G   n 
30 160  A   n 
30 161  A   n 
30 162  C   n 
30 163  U   n 
30 164  G   n 
30 165  A   n 
30 166  A   n 
30 167  A   n 
30 168  C   n 
30 169  A   n 
30 170  U   n 
30 171  C   n 
30 172  U   n 
30 173  C   n 
30 174  A   n 
30 175  G   n 
30 176  U   n 
30 177  A   n 
30 178  U   n 
30 179  C   n 
30 180  G   n 
30 181  G   n 
30 182  G   n 
30 183  A   n 
30 184  G   n 
30 185  G   n 
30 186  A   n 
30 187  A   n 
30 188  C   n 
30 189  A   n 
30 190  G   n 
30 191  A   n 
30 192  A   n 
30 193  A   n 
30 194  A   n 
30 195  C   n 
30 196  G   n 
30 197  C   n 
30 198  A   n 
30 199  A   n 
30 200  C   n 
30 201  G   n 
30 202  U   n 
30 203  G   n 
30 204  A   n 
30 205  U   n 
30 206  G   n 
30 207  U   n 
30 208  C   n 
30 209  G   n 
30 210  U   n 
30 211  U   n 
30 212  A   n 
30 213  G   n 
30 214  U   n 
30 215  A   n 
30 216  A   n 
30 217  C   n 
30 218  C   n 
30 219  G   n 
30 220  C   n 
30 221  G   n 
30 222  A   n 
30 223  G   n 
30 224  U   n 
30 225  G   n 
30 226  A   n 
30 227  A   n 
30 228  C   n 
30 229  G   n 
30 230  C   n 
30 231  G   n 
30 232  A   n 
30 233  U   n 
30 234  A   n 
30 235  C   n 
30 236  A   n 
30 237  G   n 
30 238  C   n 
30 239  C   n 
30 240  C   n 
30 241  A   n 
30 242  A   n 
30 243  A   n 
30 244  C   n 
30 245  C   n 
30 246  G   n 
30 247  A   n 
30 248  A   n 
30 249  G   n 
30 250  C   n 
30 251  C   n 
30 252  C   n 
30 253  U   n 
30 254  C   n 
30 255  A   n 
30 256  C   n 
30 257  G   n 
30 258  G   n 
30 259  G   n 
30 260  C   n 
30 261  A   n 
30 262  A   n 
30 263  U   n 
30 264  G   n 
30 265  U   n 
30 266  G   n 
30 267  G   n 
30 268  U   n 
30 269  G   n 
30 270  U   n 
30 271  C   n 
30 272  A   n 
30 273  G   n 
30 274  G   n 
30 275  G   n 
30 276  C   n 
30 277  U   n 
30 278  A   n 
30 279  C   n 
30 280  C   n 
30 281  U   n 
30 282  C   n 
30 283  U   n 
30 284  C   n 
30 285  A   n 
30 286  U   n 
30 287  C   n 
30 288  A   n 
30 289  G   n 
30 290  C   n 
30 291  C   n 
30 292  G   n 
30 293  A   n 
30 294  C   n 
30 295  C   n 
30 296  G   n 
30 297  U   n 
30 298  C   n 
30 299  U   n 
30 300  U   n 
30 301  C   n 
30 302  A   n 
30 303  C   n 
30 304  G   n 
30 305  A   n 
30 306  A   n 
30 307  G   n 
30 308  U   n 
30 309  C   n 
30 310  U   n 
30 311  C   n 
30 312  U   n 
30 313  U   n 
30 314  G   n 
30 315  G   n 
30 316  A   n 
30 317  A   n 
30 318  U   n 
30 319  A   n 
30 320  G   n 
30 321  A   n 
30 322  G   n 
30 323  C   n 
30 324  G   n 
30 325  U   n 
30 326  G   n 
30 327  A   n 
30 328  U   n 
30 329  A   n 
30 330  C   n 
30 331  A   n 
30 332  G   n 
30 333  G   n 
30 334  G   n 
30 335  U   n 
30 336  G   n 
30 337  A   n 
30 338  C   n 
30 339  A   n 
30 340  A   n 
30 341  C   n 
30 342  C   n 
30 343  C   n 
30 344  C   n 
30 345  G   n 
30 346  U   n 
30 347  A   n 
30 348  C   n 
30 349  U   n 
30 350  G   n 
30 351  A   n 
30 352  A   n 
30 353  G   n 
30 354  A   n 
30 355  C   n 
30 356  C   n 
30 357  A   n 
30 358  G   n 
30 359  U   n 
30 360  A   n 
30 361  C   n 
30 362  G   n 
30 363  C   n 
30 364  U   n 
30 365  G   n 
30 366  U   n 
30 367  G   n 
30 368  C   n 
30 369  G   n 
30 370  G   n 
30 371  U   n 
30 372  A   n 
30 373  G   n 
30 374  U   n 
30 375  G   n 
30 376  C   n 
30 377  C   n 
30 378  A   n 
30 379  G   n 
30 380  A   n 
30 381  G   n 
30 382  U   n 
30 383  A   n 
30 384  G   n 
30 385  C   n 
30 386  G   n 
30 387  G   n 
30 388  G   n 
30 389  G   n 
30 390  G   n 
30 391  U   n 
30 392  U   n 
30 393  G   n 
30 394  G   n 
30 395  A   n 
30 396  U   n 
30 397  A   n 
30 398  U   n 
30 399  C   n 
30 400  C   n 
30 401  C   n 
30 402  U   n 
30 403  C   n 
30 404  G   n 
30 405  C   n 
30 406  G   n 
30 407  A   n 
30 408  A   n 
30 409  U   n 
30 410  A   n 
30 411  A   n 
30 412  C   n 
30 413  G   n 
30 414  C   n 
30 415  A   n 
30 416  G   n 
30 417  G   n 
30 418  C   n 
30 419  A   n 
30 420  U   n 
30 421  C   n 
30 422  G   n 
30 423  A   n 
30 424  C   n 
30 425  U   n 
30 426  G   n 
30 427  C   n 
30 428  G   n 
30 429  A   n 
30 430  A   n 
30 431  G   n 
30 432  G   n 
30 433  C   n 
30 434  U   n 
30 435  A   n 
30 436  A   n 
30 437  A   n 
30 438  C   n 
30 439  A   n 
30 440  C   n 
30 441  A   n 
30 442  A   n 
30 443  C   n 
30 444  C   n 
30 445  U   n 
30 446  G   n 
30 447  A   n 
30 448  G   n 
30 449  A   n 
30 450  C   n 
30 451  C   n 
30 452  G   n 
30 453  A   n 
30 454  U   n 
30 455  A   n 
30 456  G   n 
30 457  U   n 
30 458  G   n 
30 459  A   n 
30 460  A   n 
30 461  C   n 
30 462  A   n 
30 463  A   n 
30 464  G   n 
30 465  U   n 
30 466  A   n 
30 467  G   n 
30 468  U   n 
30 469  G   n 
30 470  U   n 
30 471  G   n 
30 472  A   n 
30 473  A   n 
30 474  C   n 
30 475  G   n 
30 476  A   n 
30 477  A   n 
30 478  C   n 
30 479  G   n 
30 480  C   n 
30 481  U   n 
30 482  G   n 
30 483  C   n 
30 484  A   n 
30 485  A   n 
30 486  A   n 
30 487  G   n 
30 488  U   n 
30 489  A   n 
30 490  C   n 
30 491  C   n 
30 492  C   n 
30 493  U   n 
30 494  C   n 
30 495  A   n 
30 496  G   n 
30 497  A   n 
30 498  A   n 
30 499  G   n 
30 500  G   n 
30 501  G   n 
30 502  A   n 
30 503  G   n 
30 504  G   n 
30 505  C   n 
30 506  G   n 
30 507  A   n 
30 508  A   n 
30 509  A   n 
30 510  U   n 
30 511  A   n 
30 512  G   n 
30 513  A   n 
30 514  G   n 
30 515  C   n 
30 516  A   n 
30 517  U   n 
30 518  G   n 
30 519  A   n 
30 520  A   n 
30 521  A   n 
30 522  U   n 
30 523  C   n 
30 524  A   n 
30 525  G   n 
30 526  U   n 
30 527  U   n 
30 528  G   n 
30 529  G   n 
30 530  C   n 
30 531  G   n 
30 532  A   n 
30 533  U   n 
30 534  C   n 
30 535  G   n 
30 536  A   n 
30 537  G   n 
30 538  C   n 
30 539  G   n 
30 540  A   n 
30 541  C   n 
30 542  A   n 
30 543  G   n 
30 544  G   n 
30 545  G   n 
30 546  C   n 
30 547  A   n 
30 548  U   n 
30 549  A   n 
30 550  C   n 
30 551  A   n 
30 552  A   n 
30 553  G   n 
30 554  G   n 
30 555  U   n 
30 556  C   n 
30 557  C   n 
30 558  C   n 
30 559  U   n 
30 560  U   n 
30 561  G   n 
30 562  A   n 
30 563  C   n 
30 564  G   n 
30 565  A   n 
30 566  A   n 
30 567  U   n 
30 568  G   n 
30 569  A   n 
30 570  C   n 
30 571  C   n 
30 572  G   n 
30 573  A   n 
30 574  G   n 
30 575  A   n 
30 576  C   n 
30 577  G   n 
30 578  C   n 
30 579  G   n 
30 580  A   n 
30 581  G   n 
30 582  U   n 
30 583  C   n 
30 584  U   n 
30 585  C   n 
30 586  C   n 
30 587  A   n 
30 588  G   n 
30 589  U   n 
30 590  A   n 
30 591  A   n 
30 592  G   n 
30 593  A   n 
30 594  C   n 
30 595  U   n 
30 596  C   n 
30 597  A   n 
30 598  C   n 
30 599  G   n 
30 600  G   n 
30 601  G   n 
30 602  A   n 
30 603  A   n 
30 604  G   n 
30 605  C   n 
30 606  C   n 
30 607  G   n 
30 608  A   n 
30 609  U   n 
30 610  G   n 
30 611  U   n 
30 612  U   n 
30 613  C   n 
30 614  U   n 
30 615  G   n 
30 616  U   n 
30 617  C   n 
30 618  G   n 
30 619  U   n 
30 620  A   n 
30 621  C   n 
30 622  G   n 
30 623  U   n 
30 624  U   n 
30 625  U   n 
30 626  U   n 
30 627  G   n 
30 628  1MA n 
30 629  A   n 
30 630  A   n 
30 631  A   n 
30 632  A   n 
30 633  C   n 
30 634  G   n 
30 635  A   n 
30 636  G   n 
30 637  C   n 
30 638  C   n 
30 639  A   n 
30 640  G   n 
30 641  G   n 
30 642  G   n 
30 643  A   n 
30 644  G   n 
30 645  U   n 
30 646  G   n 
30 647  U   n 
30 648  G   n 
30 649  U   n 
30 650  C   n 
30 651  U   n 
30 652  G   n 
30 653  U   n 
30 654  A   n 
30 655  U   n 
30 656  G   n 
30 657  G   n 
30 658  C   n 
30 659  A   n 
30 660  A   n 
30 661  G   n 
30 662  U   n 
30 663  C   n 
30 664  U   n 
30 665  A   n 
30 666  A   n 
30 667  C   n 
30 668  C   n 
30 669  G   n 
30 670  G   n 
30 671  A   n 
30 672  G   n 
30 673  U   n 
30 674  A   n 
30 675  U   n 
30 676  C   n 
30 677  C   n 
30 678  G   n 
30 679  G   n 
30 680  G   n 
30 681  G   n 
30 682  A   n 
30 683  G   n 
30 684  G   n 
30 685  C   n 
30 686  A   n 
30 687  C   n 
30 688  A   n 
30 689  G   n 
30 690  G   n 
30 691  G   n 
30 692  A   n 
30 693  A   n 
30 694  A   n 
30 695  C   n 
30 696  C   n 
30 697  G   n 
30 698  A   n 
30 699  C   n 
30 700  A   n 
30 701  U   n 
30 702  G   n 
30 703  G   n 
30 704  C   n 
30 705  C   n 
30 706  G   n 
30 707  C   n 
30 708  A   n 
30 709  G   n 
30 710  G   n 
30 711  G   n 
30 712  C   n 
30 713  U   n 
30 714  U   n 
30 715  U   n 
30 716  G   n 
30 717  C   n 
30 718  C   n 
30 719  C   n 
30 720  G   n 
30 721  A   n 
30 722  G   n 
30 723  G   n 
30 724  G   n 
30 725  C   n 
30 726  C   n 
30 727  G   n 
30 728  C   n 
30 729  C   n 
30 730  G   n 
30 731  U   n 
30 732  C   n 
30 733  U   n 
30 734  U   n 
30 735  C   n 
30 736  A   n 
30 737  A   n 
30 738  G   n 
30 739  G   n 
30 740  G   n 
30 741  C   n 
30 742  G   n 
30 743  G   n 
30 744  G   n 
30 745  G   n 
30 746  A   n 
30 747  G   n 
30 748  C   n 
30 749  C   n 
30 750  A   n 
30 751  U   n 
30 752  G   n 
30 753  U   n 
30 754  G   n 
30 755  G   n 
30 756  A   n 
30 757  C   n 
30 758  A   n 
30 759  C   n 
30 760  G   n 
30 761  A   n 
30 762  C   n 
30 763  C   n 
30 764  C   n 
30 765  G   n 
30 766  A   n 
30 767  A   n 
30 768  U   n 
30 769  C   n 
30 770  C   n 
30 771  G   n 
30 772  G   n 
30 773  A   n 
30 774  C   n 
30 775  G   n 
30 776  A   n 
30 777  U   n 
30 778  C   n 
30 779  U   n 
30 780  A   n 
30 781  C   n 
30 782  G   n 
30 783  C   n 
30 784  A   n 
30 785  U   n 
30 786  G   n 
30 787  G   n 
30 788  A   n 
30 789  C   n 
30 790  A   n 
30 791  A   n 
30 792  G   n 
30 793  A   n 
30 794  U   n 
30 795  G   n 
30 796  A   n 
30 797  A   n 
30 798  G   n 
30 799  C   n 
30 800  G   n 
30 801  U   n 
30 802  G   n 
30 803  C   n 
30 804  C   n 
30 805  G   n 
30 806  A   n 
30 807  A   n 
30 808  A   n 
30 809  G   n 
30 810  G   n 
30 811  C   n 
30 812  A   n 
30 813  C   n 
30 814  G   n 
30 815  U   n 
30 816  G   n 
30 817  G   n 
30 818  A   n 
30 819  A   n 
30 820  G   n 
30 821  U   n 
30 822  C   n 
30 823  U   n 
30 824  G   n 
30 825  U   n 
30 826  U   n 
30 827  A   n 
30 828  G   n 
30 829  A   n 
30 830  G   n 
30 831  U   n 
30 832  U   n 
30 833  G   n 
30 834  G   n 
30 835  U   n 
30 836  G   n 
30 837  U   n 
30 838  C   n 
30 839  C   n 
30 840  U   n 
30 841  A   n 
30 842  C   n 
30 843  A   n 
30 844  A   n 
30 845  U   n 
30 846  A   n 
30 847  C   n 
30 848  C   n 
30 849  C   n 
30 850  U   n 
30 851  C   n 
30 852  U   n 
30 853  C   n 
30 854  G   n 
30 855  U   n 
30 856  G   n 
30 857  A   n 
30 858  U   n 
30 859  C   n 
30 860  U   n 
30 861  A   n 
30 862  U   n 
30 863  G   n 
30 864  U   n 
30 865  G   n 
30 866  U   n 
30 867  A   n 
30 868  G   n 
30 869  G   n 
30 870  G   n 
30 871  G   n 
30 872  U   n 
30 873  G   n 
30 874  A   n 
30 875  A   n 
30 876  A   n 
30 877  G   n 
30 878  G   n 
30 879  C   n 
30 880  C   n 
30 881  C   n 
30 882  A   n 
30 883  U   n 
30 884  C   n 
30 885  G   n 
30 886  A   n 
30 887  G   n 
30 888  U   n 
30 889  C   n 
30 890  C   n 
30 891  G   n 
30 892  G   n 
30 893  C   n 
30 894  A   n 
30 895  A   n 
30 896  C   n 
30 897  A   n 
30 898  G   n 
30 899  C   n 
30 900  U   n 
30 901  G   n 
30 902  G   n 
30 903  U   n 
30 904  U   n 
30 905  C   n 
30 906  C   n 
30 907  A   n 
30 908  A   n 
30 909  U   n 
30 910  C   n 
30 911  G   n 
30 912  A   n 
30 913  A   n 
30 914  A   n 
30 915  C   n 
30 916  A   n 
30 917  U   n 
30 918  G   n 
30 919  U   n 
30 920  C   n 
30 921  G   n 
30 922  A   n 
30 923  A   n 
30 924  G   n 
30 925  C   n 
30 926  A   n 
30 927  U   n 
30 928  G   n 
30 929  A   n 
30 930  C   n 
30 931  C   n 
30 932  U   n 
30 933  C   n 
30 934  C   n 
30 935  G   n 
30 936  C   n 
30 937  C   n 
30 938  G   n 
30 939  A   n 
30 940  G   n 
30 941  G   n 
30 942  U   n 
30 943  A   n 
30 944  G   n 
30 945  U   n 
30 946  C   n 
30 947  U   n 
30 948  G   n 
30 949  U   n 
30 950  G   n 
30 951  A   n 
30 952  G   n 
30 953  G   n 
30 954  U   n 
30 955  A   n 
30 956  G   n 
30 957  A   n 
30 958  G   n 
30 959  C   n 
30 960  G   n 
30 961  A   n 
30 962  C   n 
30 963  C   n 
30 964  G   n 
30 965  A   n 
30 966  U   n 
30 967  U   n 
30 968  G   n 
30 969  G   n 
30 970  U   n 
30 971  G   n 
30 972  U   n 
30 973  G   n 
30 974  U   n 
30 975  C   n 
30 976  C   n 
30 977  G   n 
30 978  C   n 
30 979  C   n 
30 980  U   n 
30 981  C   n 
30 982  C   n 
30 983  G   n 
30 984  A   n 
30 985  G   n 
30 986  A   n 
30 987  G   n 
30 988  G   n 
30 989  A   n 
30 990  G   n 
30 991  U   n 
30 992  C   n 
30 993  G   n 
30 994  G   n 
30 995  C   n 
30 996  A   n 
30 997  C   n 
30 998  A   n 
30 999  C   n 
30 1000 C   n 
30 1001 U   n 
30 1002 G   n 
30 1003 U   n 
30 1004 C   n 
30 1005 A   n 
30 1006 A   n 
30 1007 A   n 
30 1008 C   n 
30 1009 U   n 
30 1010 C   n 
30 1011 C   n 
30 1012 A   n 
30 1013 A   n 
30 1014 A   n 
30 1015 C   n 
30 1016 U   n 
30 1017 U   n 
30 1018 A   n 
30 1019 C   n 
30 1020 A   n 
30 1021 G   n 
30 1022 A   n 
30 1023 C   n 
30 1024 G   n 
30 1025 C   n 
30 1026 U   n 
30 1027 G   n 
30 1028 U   n 
30 1029 U   n 
30 1030 U   n 
30 1031 G   n 
30 1032 A   n 
30 1033 C   n 
30 1034 G   n 
30 1035 C   n 
30 1036 G   n 
30 1037 G   n 
30 1038 G   n 
30 1039 G   n 
30 1040 A   n 
30 1041 U   n 
30 1042 U   n 
30 1043 C   n 
30 1044 C   n 
30 1045 G   n 
30 1046 G   n 
30 1047 U   n 
30 1048 G   n 
30 1049 C   n 
30 1050 G   n 
30 1051 C   n 
30 1052 G   n 
30 1053 G   n 
30 1054 G   n 
30 1055 G   n 
30 1056 U   n 
30 1057 A   n 
30 1058 A   n 
30 1059 G   n 
30 1060 C   n 
30 1061 C   n 
30 1062 U   n 
30 1063 G   n 
30 1064 U   n 
30 1065 G   n 
30 1066 U   n 
30 1067 A   n 
30 1068 C   n 
30 1069 C   n 
30 1070 A   n 
30 1071 G   n 
30 1072 G   n 
30 1073 A   n 
30 1074 G   n 
30 1075 G   n 
30 1076 G   n 
30 1077 G   n 
30 1078 A   n 
30 1079 A   n 
30 1080 C   n 
30 1081 A   n 
30 1082 A   n 
30 1083 C   n 
30 1084 C   n 
30 1085 C   n 
30 1086 A   n 
30 1087 G   n 
30 1088 A   n 
30 1089 G   n 
30 1090 A   n 
30 1091 U   n 
30 1092 A   n 
30 1093 G   n 
30 1094 G   n 
30 1095 U   n 
30 1096 U   n 
30 1097 A   n 
30 1098 A   n 
30 1099 G   n 
30 1100 G   n 
30 1101 U   n 
30 1102 C   n 
30 1103 C   n 
30 1104 C   n 
30 1105 C   n 
30 1106 A   n 
30 1107 A   n 
30 1108 G   n 
30 1109 U   n 
30 1110 G   n 
30 1111 U   n 
30 1112 G   n 
30 1113 G   n 
30 1114 A   n 
30 1115 U   n 
30 1116 U   n 
30 1117 A   n 
30 1118 A   n 
30 1119 G   n 
30 1120 U   n 
30 1121 G   n 
30 1122 U   n 
30 1123 A   n 
30 1124 A   n 
30 1125 U   n 
30 1126 C   n 
30 1127 C   n 
30 1128 U   n 
30 1129 C   n 
30 1130 U   n 
30 1131 G   n 
30 1132 A   n 
30 1133 A   n 
30 1134 G   n 
30 1135 G   n 
30 1136 U   n 
30 1137 G   n 
30 1138 G   n 
30 1139 U   n 
30 1140 C   n 
30 1141 U   n 
30 1142 C   n 
30 1143 G   n 
30 1144 A   n 
30 1145 G   n 
30 1146 C   n 
30 1147 C   n 
30 1148 C   n 
30 1149 U   n 
30 1150 A   n 
30 1151 G   n 
30 1152 A   n 
30 1153 C   n 
30 1154 A   n 
30 1155 G   n 
30 1156 C   n 
30 1157 C   n 
30 1158 G   n 
30 1159 G   n 
30 1160 G   n 
30 1161 A   n 
30 1162 G   n 
30 1163 G   n 
30 1164 U   n 
30 1165 G   n 
30 1166 A   n 
30 1167 G   n 
30 1168 C   n 
30 1169 U   n 
30 1170 U   n 
30 1171 A   n 
30 1172 G   n 
30 1173 A   n 
30 1174 A   n 
30 1175 G   n 
30 1176 C   n 
30 1177 A   n 
30 1178 G   n 
30 1179 C   n 
30 1180 U   n 
30 1181 A   n 
30 1182 C   n 
30 1183 C   n 
30 1184 C   n 
30 1185 U   n 
30 1186 C   n 
30 1187 U   n 
30 1188 A   n 
30 1189 A   n 
30 1190 G   n 
30 1191 A   n 
30 1192 A   n 
30 1193 A   n 
30 1194 A   n 
30 1195 G   n 
30 1196 C   n 
30 1197 G   n 
30 1198 U   n 
30 1199 A   n 
30 1200 A   n 
30 1201 C   n 
30 1202 A   n 
30 1203 G   n 
30 1204 C   n 
30 1205 U   n 
30 1206 U   n 
30 1207 A   n 
30 1208 C   n 
30 1209 C   n 
30 1210 G   n 
30 1211 G   n 
30 1212 C   n 
30 1213 C   n 
30 1214 G   n 
30 1215 A   n 
30 1216 G   n 
30 1217 G   n 
30 1218 U   n 
30 1219 U   n 
30 1220 U   n 
30 1221 G   n 
30 1222 A   n 
30 1223 G   n 
30 1224 G   n 
30 1225 C   n 
30 1226 G   n 
30 1227 C   n 
30 1228 C   n 
30 1229 C   n 
30 1230 A   n 
30 1231 A   n 
30 1232 A   n 
30 1233 A   n 
30 1234 U   n 
30 1235 G   n 
30 1236 A   n 
30 1237 U   n 
30 1238 C   n 
30 1239 G   n 
30 1240 G   n 
30 1241 G   n 
30 1242 A   n 
30 1243 C   n 
30 1244 U   n 
30 1245 C   n 
30 1246 A   n 
30 1247 A   n 
30 1248 A   n 
30 1249 U   n 
30 1250 C   n 
30 1251 C   n 
30 1252 A   n 
30 1253 C   n 
30 1254 C   n 
30 1255 A   n 
30 1256 C   n 
30 1257 C   n 
30 1258 G   n 
30 1259 A   n 
30 1260 G   n 
30 1261 A   n 
30 1262 C   n 
30 1263 C   n 
30 1264 U   n 
30 1265 G   n 
30 1266 U   n 
30 1267 C   n 
30 1268 C   n 
30 1269 G   n 
30 1270 U   n 
30 1271 A   n 
30 1272 C   n 
30 1273 C   n 
30 1274 A   n 
30 1275 C   n 
30 1276 U   n 
30 1277 C   n 
30 1278 A   n 
30 1279 U   n 
30 1280 A   n 
30 1281 C   n 
30 1282 U   n 
30 1283 G   n 
30 1284 G   n 
30 1285 U   n 
30 1286 A   n 
30 1287 A   n 
30 1288 U   n 
30 1289 C   n 
30 1290 G   n 
30 1291 A   n 
30 1292 G   n 
30 1293 U   n 
30 1294 A   n 
30 1295 G   n 
30 1296 A   n 
30 1297 U   n 
30 1298 U   n 
30 1299 G   n 
30 1300 G   n 
30 1301 C   n 
30 1302 G   n 
30 1303 C   n 
30 1304 U   n 
30 1305 C   n 
30 1306 U   n 
30 1307 A   n 
30 1308 A   n 
30 1309 U   n 
30 1310 U   n 
30 1311 G   n 
30 1312 G   n 
30 1313 A   n 
30 1314 U   n 
30 1315 G   n 
30 1316 G   n 
30 1317 A   n 
30 1318 A   n 
30 1319 G   n 
30 1320 C   n 
30 1321 A   n 
30 1322 G   n 
30 1323 G   n 
30 1324 G   n 
30 1325 G   n 
30 1326 C   n 
30 1327 G   n 
30 1328 A   n 
30 1329 G   n 
30 1330 A   n 
30 1331 G   n 
30 1332 C   n 
30 1333 U   n 
30 1334 C   n 
30 1335 C   n 
30 1336 U   n 
30 1337 G   n 
30 1338 U   n 
30 1339 G   n 
30 1340 G   n 
30 1341 A   n 
30 1342 C   n 
30 1343 C   n 
30 1344 G   n 
30 1345 A   n 
30 1346 U   n 
30 1347 U   n 
30 1348 A   n 
30 1349 G   n 
30 1350 U   n 
30 1351 G   n 
30 1352 A   n 
30 1353 C   n 
30 1354 G   n 
30 1355 A   n 
30 1356 A   n 
30 1357 A   n 
30 1358 A   n 
30 1359 U   n 
30 1360 C   n 
30 1361 C   n 
30 1362 U   n 
30 1363 G   n 
30 1364 G   n 
30 1365 C   n 
30 1366 C   n 
30 1367 A   n 
30 1368 U   n 
30 1369 A   n 
30 1370 G   n 
30 1371 U   n 
30 1372 A   n 
30 1373 G   n 
30 1374 C   n 
30 1375 A   n 
30 1376 G   n 
30 1377 C   n 
30 1378 G   n 
30 1379 A   n 
30 1380 U   n 
30 1381 A   n 
30 1382 G   n 
30 1383 U   n 
30 1384 C   n 
30 1385 G   n 
30 1386 G   n 
30 1387 G   n 
30 1388 U   n 
30 1389 G   n 
30 1390 A   n 
30 1391 G   n 
30 1392 A   n 
30 1393 A   n 
30 1394 C   n 
30 1395 C   n 
30 1396 C   n 
30 1397 C   n 
30 1398 G   n 
30 1399 A   n 
30 1400 C   n 
30 1401 G   n 
30 1402 G   n 
30 1403 C   n 
30 1404 C   n 
30 1405 U   n 
30 1406 A   n 
30 1407 A   n 
30 1408 U   n 
30 1409 G   n 
30 1410 G   n 
30 1411 A   n 
30 1412 U   n 
30 1413 A   n 
30 1414 A   n 
30 1415 G   n 
30 1416 G   n 
30 1417 G   n 
30 1418 U   n 
30 1419 U   n 
30 1420 C   n 
30 1421 C   n 
30 1422 U   n 
30 1423 C   n 
30 1424 A   n 
30 1425 G   n 
30 1426 C   n 
30 1427 A   n 
30 1428 C   n 
30 1429 U   n 
30 1430 G   n 
30 1431 C   n 
30 1432 U   n 
30 1433 G   n 
30 1434 A   n 
30 1435 U   n 
30 1436 C   n 
30 1437 A   n 
30 1438 G   n 
30 1439 C   n 
30 1440 U   n 
30 1441 G   n 
30 1442 A   n 
30 1443 G   n 
30 1444 G   n 
30 1445 G   n 
30 1446 U   n 
30 1447 U   n 
30 1448 A   n 
30 1449 G   n 
30 1450 C   n 
30 1451 C   n 
30 1452 G   n 
30 1453 G   n 
30 1454 U   n 
30 1455 C   n 
30 1456 C   n 
30 1457 U   n 
30 1458 A   n 
30 1459 A   n 
30 1460 G   n 
30 1461 U   n 
30 1462 C   n 
30 1463 U   n 
30 1464 C   n 
30 1465 A   n 
30 1466 C   n 
30 1467 C   n 
30 1468 G   n 
30 1469 C   n 
30 1470 A   n 
30 1471 A   n 
30 1472 C   n 
30 1473 U   n 
30 1474 C   n 
30 1475 G   n 
30 1476 A   n 
30 1477 C   n 
30 1478 U   n 
30 1479 G   n 
30 1480 A   n 
30 1481 G   n 
30 1482 A   n 
30 1483 C   n 
30 1484 G   n 
30 1485 A   n 
30 1486 A   n 
30 1487 A   n 
30 1488 U   n 
30 1489 G   n 
30 1490 G   n 
30 1491 G   n 
30 1492 A   n 
30 1493 A   n 
30 1494 A   n 
30 1495 C   n 
30 1496 A   n 
30 1497 G   n 
30 1498 G   n 
30 1499 U   n 
30 1500 U   n 
30 1501 A   n 
30 1502 A   n 
30 1503 U   n 
30 1504 A   n 
30 1505 U   n 
30 1506 U   n 
30 1507 C   n 
30 1508 C   n 
30 1509 U   n 
30 1510 G   n 
30 1511 U   n 
30 1512 G   n 
30 1513 C   n 
30 1514 C   n 
30 1515 A   n 
30 1516 U   n 
30 1517 C   n 
30 1518 A   n 
30 1519 U   n 
30 1520 G   n 
30 1521 C   n 
30 1522 A   n 
30 1523 G   n 
30 1524 U   n 
30 1525 G   n 
30 1526 A   n 
30 1527 A   n 
30 1528 A   n 
30 1529 G   n 
30 1530 U   n 
30 1531 U   n 
30 1532 G   n 
30 1533 A   n 
30 1534 C   n 
30 1535 G   n 
30 1536 C   n 
30 1537 C   n 
30 1538 C   n 
30 1539 U   n 
30 1540 G   n 
30 1541 G   n 
30 1542 G   n 
30 1543 G   n 
30 1544 U   n 
30 1545 C   n 
30 1546 G   n 
30 1547 A   n 
30 1548 U   n 
30 1549 C   n 
30 1550 A   n 
30 1551 C   n 
30 1552 G   n 
30 1553 C   n 
30 1554 C   n 
30 1555 G   n 
30 1556 G   n 
30 1557 G   n 
30 1558 C   n 
30 1559 A   n 
30 1560 U   n 
30 1561 U   n 
30 1562 C   n 
30 1563 G   n 
30 1564 C   n 
30 1565 C   n 
30 1566 C   n 
30 1567 G   n 
30 1568 G   n 
30 1569 U   n 
30 1570 C   n 
30 1571 G   n 
30 1572 A   n 
30 1573 A   n 
30 1574 C   n 
30 1575 C   n 
30 1576 G   n 
30 1577 U   n 
30 1578 C   n 
30 1579 C   n 
30 1580 A   n 
30 1581 A   n 
30 1582 C   n 
30 1583 U   n 
30 1584 C   n 
30 1585 C   n 
30 1586 G   n 
30 1587 U   n 
30 1588 G   n 
30 1589 G   n 
30 1590 A   n 
30 1591 A   n 
30 1592 G   n 
30 1593 C   n 
30 1594 C   n 
30 1595 G   n 
30 1596 U   n 
30 1597 A   n 
30 1598 A   n 
30 1599 U   n 
30 1600 G   n 
30 1601 G   n 
30 1602 C   n 
30 1603 A   n 
30 1604 G   n 
30 1605 G   n 
30 1606 A   n 
30 1607 A   n 
30 1608 G   n 
30 1609 C   n 
30 1610 G   n 
30 1611 G   n 
30 1612 A   n 
30 1613 C   n 
30 1614 G   n 
30 1615 A   n 
30 1616 A   n 
30 1617 C   n 
30 1618 G   n 
30 1619 G   n 
30 1620 C   n 
30 1621 G   n 
30 1622 G   n 
30 1623 C   n 
30 1624 A   n 
30 1625 U   n 
30 1626 A   n 
30 1627 G   n 
30 1628 G   n 
30 1629 G   n 
30 1630 A   n 
30 1631 A   n 
30 1632 A   n 
30 1633 C   n 
30 1634 G   n 
30 1635 U   n 
30 1636 G   n 
30 1637 A   n 
30 1638 U   n 
30 1639 U   n 
30 1640 C   n 
30 1641 A   n 
30 1642 A   n 
30 1643 C   n 
30 1644 C   n 
30 1645 U   n 
30 1646 G   n 
30 1647 G   n 
30 1648 G   n 
30 1649 G   n 
30 1650 C   n 
30 1651 C   n 
30 1652 C   n 
30 1653 A   n 
30 1654 U   n 
30 1655 G   n 
30 1656 A   n 
30 1657 A   n 
30 1658 A   n 
30 1659 A   n 
30 1660 G   n 
30 1661 A   n 
30 1662 C   n 
30 1663 G   n 
30 1664 A   n 
30 1665 G   n 
30 1666 C   n 
30 1667 A   n 
30 1668 U   n 
30 1669 G   n 
30 1670 A   n 
30 1671 U   n 
30 1672 G   n 
30 1673 U   n 
30 1674 C   n 
30 1675 C   n 
30 1676 G   n 
30 1677 U   n 
30 1678 A   n 
30 1679 C   n 
30 1680 C   n 
30 1681 G   n 
30 1682 A   n 
30 1683 G   n 
30 1684 A   n 
30 1685 A   n 
30 1686 C   n 
30 1687 C   n 
30 1688 G   n 
30 1689 A   n 
30 1690 C   n 
30 1691 A   n 
30 1692 C   n 
30 1693 A   n 
30 1694 G   n 
30 1695 G   n 
30 1696 U   n 
30 1697 G   n 
30 1698 U   n 
30 1699 C   n 
30 1700 C   n 
30 1701 A   n 
30 1702 U   n 
30 1703 G   n 
30 1704 G   n 
30 1705 C   n 
30 1706 G   n 
30 1707 G   n 
30 1708 C   n 
30 1709 G   n 
30 1710 A   n 
30 1711 A   n 
30 1712 A   n 
30 1713 G   n 
30 1714 C   n 
30 1715 C   n 
30 1716 A   n 
30 1717 A   n 
30 1718 G   n 
30 1719 G   n 
30 1720 C   n 
30 1721 C   n 
30 1722 U   n 
30 1723 G   n 
30 1724 U   n 
30 1725 C   n 
30 1726 G   n 
30 1727 G   n 
30 1728 G   n 
30 1729 A   n 
30 1730 G   n 
30 1731 C   n 
30 1732 A   n 
30 1733 A   n 
30 1734 C   n 
30 1735 C   n 
30 1736 A   n 
30 1737 A   n 
30 1738 C   n 
30 1739 G   n 
30 1740 U   n 
30 1741 U   n 
30 1742 A   n 
30 1743 G   n 
30 1744 G   n 
30 1745 G   n 
30 1746 A   n 
30 1747 A   n 
30 1748 U   n 
30 1749 U   n 
30 1750 C   n 
30 1751 G   n 
30 1752 G   n 
30 1753 C   n 
30 1754 A   n 
30 1755 A   n 
30 1756 G   n 
30 1757 U   n 
30 1758 U   n 
30 1759 A   n 
30 1760 G   n 
30 1761 U   n 
30 1762 C   n 
30 1763 C   n 
30 1764 C   n 
30 1765 G   n 
30 1766 U   n 
30 1767 A   n 
30 1768 C   n 
30 1769 C   n 
30 1770 U   n 
30 1771 U   n 
30 1772 C   n 
30 1773 G   n 
30 1774 G   n 
30 1775 A   n 
30 1776 A   n 
30 1777 G   n 
30 1778 A   n 
30 1779 A   n 
30 1780 G   n 
30 1781 G   n 
30 1782 G   n 
30 1783 A   n 
30 1784 U   n 
30 1785 G   n 
30 1786 C   n 
30 1787 C   n 
30 1788 U   n 
30 1789 G   n 
30 1790 C   n 
30 1791 U   n 
30 1792 C   n 
30 1793 C   n 
30 1794 G   n 
30 1795 G   n 
30 1796 A   n 
30 1797 A   n 
30 1798 C   n 
30 1799 G   n 
30 1800 G   n 
30 1801 A   n 
30 1802 G   n 
30 1803 C   n 
30 1804 A   n 
30 1805 G   n 
30 1806 G   n 
30 1807 U   n 
30 1808 C   n 
30 1809 G   n 
30 1810 C   n 
30 1811 A   n 
30 1812 G   n 
30 1813 U   n 
30 1814 G   n 
30 1815 A   n 
30 1816 C   n 
30 1817 U   n 
30 1818 C   n 
30 1819 G   n 
30 1820 G   n 
30 1821 A   n 
30 1822 A   n 
30 1823 G   n 
30 1824 C   n 
30 1825 U   n 
30 1826 C   n 
30 1827 G   n 
30 1828 G   n 
30 1829 A   n 
30 1830 C   n 
30 1831 U   n 
30 1832 G   n 
30 1833 U   n 
30 1834 C   n 
30 1835 U   n 
30 1836 A   n 
30 1837 G   n 
30 1838 U   n 
30 1839 A   n 
30 1840 A   n 
30 1841 C   n 
30 1842 A   n 
30 1843 A   n 
30 1844 C   n 
30 1845 A   n 
30 1846 U   n 
30 1847 A   n 
30 1848 G   n 
30 1849 G   n 
30 1850 U   n 
30 1851 G   n 
30 1852 A   n 
30 1853 C   n 
30 1854 C   n 
30 1855 G   n 
30 1856 C   n 
30 1857 A   n 
30 1858 A   n 
30 1859 A   n 
30 1860 U   n 
30 1861 C   n 
30 1862 C   n 
30 1863 G   n 
30 1864 C   n 
30 1865 A   n 
30 1866 A   n 
30 1867 G   n 
30 1868 G   n 
30 1869 A   n 
30 1870 C   n 
30 1871 U   n 
30 1872 C   n 
30 1873 G   n 
30 1874 U   n 
30 1875 A   n 
30 1876 C   n 
30 1877 G   n 
30 1878 G   n 
30 1879 U   n 
30 1880 C   n 
30 1881 A   n 
30 1882 C   n 
30 1883 U   n 
30 1884 G   n 
30 1885 A   n 
30 1886 A   n 
30 1887 U   n 
30 1888 C   n 
30 1889 C   n 
30 1890 U   n 
30 1891 G   n 
30 1892 C   n 
30 1893 C   n 
30 1894 C   n 
30 1895 A   n 
30 1896 G   n 
30 1897 U   n 
30 1898 G   n 
30 1899 C   n 
30 1900 A   n 
30 1901 G   n 
30 1902 G   n 
30 1903 U   n 
30 1904 A   n 
30 1905 U   n 
30 1906 C   n 
30 1907 U   n 
30 1908 G   n 
30 1909 A   n 
30 1910 A   n 
30 1911 C   n 
30 1912 A   n 
30 1913 C   n 
30 1914 C   n 
30 1915 U   n 
30 1916 C   n 
30 1917 G   n 
30 1918 U   n 
30 1919 A   n 
30 1920 C   n 
30 1921 A   n 
30 1922 A   n 
30 1923 G   n 
30 1924 A   n 
30 1925 G   n 
30 1926 G   n 
30 1927 A   n 
30 1928 C   n 
30 1929 G   n 
30 1930 A   n 
30 1931 A   n 
30 1932 G   n 
30 1933 G   n 
30 1934 A   n 
30 1935 C   n 
30 1936 C   n 
30 1937 U   n 
30 1938 G   n 
30 1939 U   n 
30 1940 C   n 
30 1941 A   n 
30 1942 A   n 
30 1943 C   n 
30 1944 G   n 
30 1945 G   n 
30 1946 C   n 
30 1947 G   n 
30 1948 G   n 
30 1949 G   n 
30 1950 G   n 
30 1951 G   n 
30 1952 U   n 
30 1953 A   n 
30 1954 A   n 
30 1955 C   n 
30 1956 U   n 
30 1957 A   n 
30 1958 U   n 
30 1959 G   n 
30 1960 A   n 
30 1961 C   n 
30 1962 C   n 
30 1963 C   n 
30 1964 U   n 
30 1965 C   n 
30 1966 U   n 
30 1967 U   n 
30 1968 A   n 
30 1969 A   n 
30 1970 G   n 
30 1971 G   n 
30 1972 U   n 
30 1973 A   n 
30 1974 G   n 
30 1975 C   n 
30 1976 G   n 
30 1977 U   n 
30 1978 A   n 
30 1979 G   n 
30 1980 U   n 
30 1981 A   n 
30 1982 C   n 
30 1983 C   n 
30 1984 U   n 
30 1985 U   n 
30 1986 G   n 
30 1987 C   n 
30 1988 C   n 
30 1989 G   n 
30 1990 C   n 
30 1991 A   n 
30 1992 U   n 
30 1993 C   n 
30 1994 A   n 
30 1995 G   n 
30 1996 U   n 
30 1997 A   n 
30 1998 G   n 
30 1999 C   n 
30 2000 G   n 
30 2001 G   n 
30 2002 C   n 
30 2003 U   n 
30 2004 U   n 
30 2005 G   n 
30 2006 C   n 
30 2007 A   n 
30 2008 U   n 
30 2009 G   n 
30 2010 A   n 
30 2011 A   n 
30 2012 U   n 
30 2013 G   n 
30 2014 G   n 
30 2015 A   n 
30 2016 U   n 
30 2017 U   n 
30 2018 A   n 
30 2019 A   n 
30 2020 C   n 
30 2021 C   n 
30 2022 A   n 
30 2023 G   n 
30 2024 A   n 
30 2025 G   n 
30 2026 C   n 
30 2027 U   n 
30 2028 U   n 
30 2029 C   n 
30 2030 A   n 
30 2031 C   n 
30 2032 U   n 
30 2033 G   n 
30 2034 U   n 
30 2035 C   n 
30 2036 C   n 
30 2037 C   n 
30 2038 A   n 
30 2039 A   n 
30 2040 C   n 
30 2041 G   n 
30 2042 U   n 
30 2043 U   n 
30 2044 G   n 
30 2045 G   n 
30 2046 G   n 
30 2047 C   n 
30 2048 C   n 
30 2049 C   n 
30 2050 G   n 
30 2051 G   n 
30 2052 U   n 
30 2053 G   n 
30 2054 A   n 
30 2055 A   n 
30 2056 C   n 
30 2057 U   n 
30 2058 G   n 
30 2059 U   n 
30 2060 A   n 
30 2061 C   n 
30 2062 A   n 
30 2063 U   n 
30 2064 U   n 
30 2065 C   n 
30 2066 C   n 
30 2067 A   n 
30 2068 G   n 
30 2069 U   n 
30 2070 G   n 
30 2071 C   n 
30 2072 G   n 
30 2073 G   n 
30 2074 A   n 
30 2075 G   n 
30 2076 U   n 
30 2077 C   n 
30 2078 U   n 
30 2079 G   n 
30 2080 G   n 
30 2081 A   n 
30 2082 G   n 
30 2083 A   n 
30 2084 C   n 
30 2085 A   n 
30 2086 C   n 
30 2087 C   n 
30 2088 C   n 
30 2089 A   n 
30 2090 G   n 
30 2091 G   n 
30 2092 G   n 
30 2093 G   n 
30 2094 G   n 
30 2095 A   n 
30 2096 A   n 
30 2097 G   n 
30 2098 C   n 
30 2099 G   n 
30 2100 A   n 
30 2101 A   n 
30 2102 G   n 
30 2103 A   n 
30 2104 C   n 
30 2105 C   n 
30 2106 C   n 
30 2107 U   n 
30 2108 A   n 
30 2109 U   n 
30 2110 G   n 
30 2111 G   n 
30 2112 A   n 
30 2113 G   n 
30 2114 C   n 
30 2115 U   n 
30 2116 U   n 
30 2117 U   n 
30 2118 A   n 
30 2119 C   n 
30 2120 U   n 
30 2121 G   n 
30 2122 C   n 
30 2123 A   n 
30 2124 G   n 
30 2125 G   n 
30 2126 C   n 
30 2127 U   n 
30 2128 G   n 
30 2129 U   n 
30 2130 C   n 
30 2131 G   n 
30 2132 C   n 
30 2133 U   n 
30 2134 G   n 
30 2135 A   n 
30 2136 G   n 
30 2137 A   n 
30 2138 C   n 
30 2139 G   n 
30 2140 U   n 
30 2141 G   n 
30 2142 G   n 
30 2143 U   n 
30 2144 C   n 
30 2145 G   n 
30 2146 C   n 
30 2147 C   n 
30 2148 G   n 
30 2149 A   n 
30 2150 U   n 
30 2151 G   n 
30 2152 U   n 
30 2153 G   n 
30 2154 C   n 
30 2155 A   n 
30 2156 G   n 
30 2157 C   n 
30 2158 A   n 
30 2159 U   n 
30 2160 A   n 
30 2161 G   n 
30 2162 G   n 
30 2163 U   n 
30 2164 A   n 
30 2165 G   n 
30 2166 G   n 
30 2167 A   n 
30 2168 G   n 
30 2169 U   n 
30 2170 C   n 
30 2171 G   n 
30 2172 U   n 
30 2173 U   n 
30 2174 A   n 
30 2175 C   n 
30 2176 A   n 
30 2177 G   n 
30 2178 A   n 
30 2179 G   n 
30 2180 G   n 
30 2181 U   n 
30 2182 A   n 
30 2183 C   n 
30 2184 C   n 
30 2185 C   n 
30 2186 G   n 
30 2187 C   n 
30 2188 G   n 
30 2189 C   n 
30 2190 U   n 
30 2191 A   n 
30 2192 G   n 
30 2193 C   n 
30 2194 G   n 
30 2195 G   n 
30 2196 G   n 
30 2197 C   n 
30 2198 C   n 
30 2199 A   n 
30 2200 C   n 
30 2201 C   n 
30 2202 C   n 
30 2203 A   n 
30 2204 G   n 
30 2205 A   n 
30 2206 C   n 
30 2207 A   n 
30 2208 A   n 
30 2209 C   n 
30 2210 A   n 
30 2211 G   n 
30 2212 U   n 
30 2213 G   n 
30 2214 A   n 
30 2215 A   n 
30 2216 A   n 
30 2217 U   n 
30 2218 A   n 
30 2219 C   n 
30 2220 U   n 
30 2221 A   n 
30 2222 C   n 
30 2223 C   n 
30 2224 C   n 
30 2225 G   n 
30 2226 U   n 
30 2227 C   n 
30 2228 G   n 
30 2229 G   n 
30 2230 U   n 
30 2231 G   n 
30 2232 A   n 
30 2233 C   n 
30 2234 U   n 
30 2235 G   n 
30 2236 C   n 
30 2237 G   n 
30 2238 A   n 
30 2239 C   n 
30 2240 U   n 
30 2241 C   n 
30 2242 U   n 
30 2243 C   n 
30 2244 A   n 
30 2245 C   n 
30 2246 U   n 
30 2247 C   n 
30 2248 C   n 
30 2249 G   n 
30 2250 G   n 
30 2251 G   n 
30 2252 A   n 
30 2253 G   n 
30 2254 G   n 
30 2255 A   n 
30 2256 G   n 
30 2257 G   n 
30 2258 A   n 
30 2259 C   n 
30 2260 A   n 
30 2261 C   n 
30 2262 C   n 
30 2263 G   n 
30 2264 A   n 
30 2265 U   n 
30 2266 A   n 
30 2267 G   n 
30 2268 C   n 
30 2269 C   n 
30 2270 G   n 
30 2271 G   n 
30 2272 G   n 
30 2273 C   n 
30 2274 A   n 
30 2275 G   n 
30 2276 U   n 
30 2277 U   n 
30 2278 U   n 
30 2279 G   n 
30 2280 A   n 
30 2281 C   n 
30 2282 U   n 
30 2283 G   n 
30 2284 G   n 
30 2285 G   n 
30 2286 G   n 
30 2287 C   n 
30 2288 G   n 
30 2289 G   n 
30 2290 U   n 
30 2291 A   n 
30 2292 C   n 
30 2293 G   n 
30 2294 C   n 
30 2295 G   n 
30 2296 C   n 
30 2297 U   n 
30 2298 C   n 
30 2299 G   n 
30 2300 A   n 
30 2301 A   n 
30 2302 A   n 
30 2303 A   n 
30 2304 G   n 
30 2305 A   n 
30 2306 U   n 
30 2307 A   n 
30 2308 U   n 
30 2309 C   n 
30 2310 G   n 
30 2311 A   n 
30 2312 G   n 
30 2313 C   n 
30 2314 G   n 
30 2315 C   n 
30 2316 G   n 
30 2317 C   n 
30 2318 C   n 
30 2319 C   n 
30 2320 U   n 
30 2321 A   n 
30 2322 U   n 
30 2323 G   n 
30 2324 G   n 
30 2325 U   n 
30 2326 C   n 
30 2327 A   n 
30 2328 U   n 
30 2329 C   n 
30 2330 U   n 
30 2331 C   n 
30 2332 A   n 
30 2333 G   n 
30 2334 C   n 
30 2335 C   n 
30 2336 G   n 
30 2337 G   n 
30 2338 G   n 
30 2339 A   n 
30 2340 C   n 
30 2341 A   n 
30 2342 G   n 
30 2343 A   n 
30 2344 G   n 
30 2345 A   n 
30 2346 C   n 
30 2347 C   n 
30 2348 C   n 
30 2349 G   n 
30 2350 G   n 
30 2351 C   n 
30 2352 G   n 
30 2353 A   n 
30 2354 A   n 
30 2355 G   n 
30 2356 A   n 
30 2357 G   n 
30 2358 U   n 
30 2359 G   n 
30 2360 C   n 
30 2361 A   n 
30 2362 A   n 
30 2363 G   n 
30 2364 A   n 
30 2365 G   n 
30 2366 C   n 
30 2367 A   n 
30 2368 A   n 
30 2369 A   n 
30 2370 A   n 
30 2371 G   n 
30 2372 A   n 
30 2373 U   n 
30 2374 G   n 
30 2375 A   n 
30 2376 C   n 
30 2377 U   n 
30 2378 U   n 
30 2379 G   n 
30 2380 A   n 
30 2381 C   n 
30 2382 A   n 
30 2383 G   n 
30 2384 U   n 
30 2385 G   n 
30 2386 U   n 
30 2387 U   n 
30 2388 C   n 
30 2389 U   n 
30 2390 U   n 
30 2391 C   n 
30 2392 C   n 
30 2393 C   n 
30 2394 A   n 
30 2395 A   n 
30 2396 C   n 
30 2397 G   n 
30 2398 A   n 
30 2399 G   n 
30 2400 G   n 
30 2401 A   n 
30 2402 A   n 
30 2403 C   n 
30 2404 G   n 
30 2405 C   n 
30 2406 U   n 
30 2407 G   n 
30 2408 A   n 
30 2409 C   n 
30 2410 G   n 
30 2411 C   n 
30 2412 G   n 
30 2413 A   n 
30 2414 A   n 
30 2415 A   n 
30 2416 G   n 
30 2417 C   n 
30 2418 G   n 
30 2419 U   n 
30 2420 G   n 
30 2421 G   n 
30 2422 U   n 
30 2423 C   n 
30 2424 U   n 
30 2425 A   n 
30 2426 G   n 
30 2427 C   n 
30 2428 G   n 
30 2429 A   n 
30 2430 A   n 
30 2431 C   n 
30 2432 C   n 
30 2433 A   n 
30 2434 A   n 
30 2435 U   n 
30 2436 U   n 
30 2437 A   n 
30 2438 G   n 
30 2439 C   n 
30 2440 C   n 
30 2441 U   n 
30 2442 G   n 
30 2443 C   n 
30 2444 U   n 
30 2445 U   n 
30 2446 G   n 
30 2447 A   n 
30 2448 U   n 
30 2449 G   n 
30 2450 C   n 
30 2451 G   n 
30 2452 G   n 
30 2453 G   n 
30 2454 C   n 
30 2455 A   n 
30 2456 A   n 
30 2457 U   n 
30 2458 U   n 
30 2459 G   n 
30 2460 A   n 
30 2461 U   n 
30 2462 G   n 
30 2463 A   n 
30 2464 C   n 
30 2465 A   n 
30 2466 G   n 
30 2467 A   n 
30 2468 A   n 
30 2469 A   n 
30 2470 A   n 
30 2471 G   n 
30 2472 C   n 
30 2473 U   n 
30 2474 A   n 
30 2475 C   n 
30 2476 C   n 
30 2477 C   n 
30 2478 U   n 
30 2479 A   n 
30 2480 G   n 
30 2481 G   n 
30 2482 G   n 
30 2483 A   n 
30 2484 U   n 
30 2485 A   n 
30 2486 A   n 
30 2487 C   n 
30 2488 A   n 
30 2489 G   n 
30 2490 A   n 
30 2491 G   n 
30 2492 U   n 
30 2493 C   n 
30 2494 G   n 
30 2495 U   n 
30 2496 C   n 
30 2497 A   n 
30 2498 C   n 
30 2499 U   n 
30 2500 C   n 
30 2501 G   n 
30 2502 C   n 
30 2503 A   n 
30 2504 A   n 
30 2505 G   n 
30 2506 A   n 
30 2507 G   n 
30 2508 C   n 
30 2509 A   n 
30 2510 C   n 
30 2511 A   n 
30 2512 U   n 
30 2513 A   n 
30 2514 U   n 
30 2515 C   n 
30 2516 G   n 
30 2517 A   n 
30 2518 C   n 
30 2519 C   n 
30 2520 G   n 
30 2521 A   n 
30 2522 G   n 
30 2523 U   n 
30 2524 G   n 
30 2525 G   n 
30 2526 C   n 
30 2527 U   n 
30 2528 U   n 
30 2529 G   n 
30 2530 C   n 
30 2531 U   n 
30 2532 A   n 
30 2533 C   n 
30 2534 C   n 
30 2535 U   n 
30 2536 C   n 
30 2537 G   n 
30 2538 A   n 
30 2539 U   n 
30 2540 G   n 
30 2541 U   n 
30 2542 C   n 
30 2543 G   n 
30 2544 G   n 
30 2545 U   n 
30 2546 U   n 
30 2547 C   n 
30 2548 C   n 
30 2549 C   n 
30 2550 U   n 
30 2551 C   n 
30 2552 C   n 
30 2553 A   n 
30 2554 U   n 
30 2555 C   n 
30 2556 C   n 
30 2557 U   n 
30 2558 G   n 
30 2559 C   n 
30 2560 C   n 
30 2561 C   n 
30 2562 G   n 
30 2563 U   n 
30 2564 G   n 
30 2565 C   n 
30 2566 A   n 
30 2567 G   n 
30 2568 A   n 
30 2569 A   n 
30 2570 G   n 
30 2571 C   n 
30 2572 G   n 
30 2573 G   n 
30 2574 G   n 
30 2575 C   n 
30 2576 A   n 
30 2577 A   n 
30 2578 G   n 
30 2579 G   n 
30 2580 G   n 
30 2581 U   n 
30 2582 G   n 
30 2583 A   n 
30 2584 G   n 
30 2585 G   n 
30 2586 U   n 
30 2587 OMU n 
30 2588 OMG n 
30 2589 U   n 
30 2590 U   n 
30 2591 C   n 
30 2592 G   n 
30 2593 C   n 
30 2594 C   n 
30 2595 U   n 
30 2596 A   n 
30 2597 U   n 
30 2598 U   n 
30 2599 A   n 
30 2600 A   n 
30 2601 A   n 
30 2602 G   n 
30 2603 G   n 
30 2604 A   n 
30 2605 G   n 
30 2606 G   n 
30 2607 U   n 
30 2608 C   n 
30 2609 G   n 
30 2610 U   n 
30 2611 G   n 
30 2612 A   n 
30 2613 G   n 
30 2614 C   n 
30 2615 U   n 
30 2616 G   n 
30 2617 G   n 
30 2618 G   n 
30 2619 UR3 n 
30 2620 U   n 
30 2621 PSU n 
30 2622 A   n 
30 2623 G   n 
30 2624 A   n 
30 2625 C   n 
30 2626 C   n 
30 2627 G   n 
30 2628 U   n 
30 2629 C   n 
30 2630 G   n 
30 2631 U   n 
30 2632 G   n 
30 2633 A   n 
30 2634 G   n 
30 2635 A   n 
30 2636 C   n 
30 2637 A   n 
30 2638 G   n 
30 2639 G   n 
30 2640 U   n 
30 2641 C   n 
30 2642 G   n 
30 2643 G   n 
30 2644 C   n 
30 2645 U   n 
30 2646 G   n 
30 2647 C   n 
30 2648 U   n 
30 2649 A   n 
30 2650 U   n 
30 2651 C   n 
30 2652 U   n 
30 2653 A   n 
30 2654 C   n 
30 2655 U   n 
30 2656 G   n 
30 2657 G   n 
30 2658 G   n 
30 2659 U   n 
30 2660 G   n 
30 2661 U   n 
30 2662 G   n 
30 2663 U   n 
30 2664 A   n 
30 2665 A   n 
30 2666 U   n 
30 2667 G   n 
30 2668 G   n 
30 2669 U   n 
30 2670 G   n 
30 2671 U   n 
30 2672 C   n 
30 2673 U   n 
30 2674 G   n 
30 2675 A   n 
30 2676 C   n 
30 2677 A   n 
30 2678 A   n 
30 2679 G   n 
30 2680 A   n 
30 2681 A   n 
30 2682 C   n 
30 2683 G   n 
30 2684 A   n 
30 2685 C   n 
30 2686 C   n 
30 2687 G   n 
30 2688 U   n 
30 2689 A   n 
30 2690 U   n 
30 2691 A   n 
30 2692 G   n 
30 2693 U   n 
30 2694 A   n 
30 2695 C   n 
30 2696 G   n 
30 2697 A   n 
30 2698 G   n 
30 2699 A   n 
30 2700 G   n 
30 2701 G   n 
30 2702 A   n 
30 2703 A   n 
30 2704 C   n 
30 2705 U   n 
30 2706 A   n 
30 2707 C   n 
30 2708 G   n 
30 2709 G   n 
30 2710 U   n 
30 2711 U   n 
30 2712 G   n 
30 2713 G   n 
30 2714 U   n 
30 2715 G   n 
30 2716 G   n 
30 2717 C   n 
30 2718 C   n 
30 2719 A   n 
30 2720 C   n 
30 2721 U   n 
30 2722 G   n 
30 2723 G   n 
30 2724 U   n 
30 2725 G   n 
30 2726 U   n 
30 2727 A   n 
30 2728 C   n 
30 2729 C   n 
30 2730 G   n 
30 2731 G   n 
30 2732 U   n 
30 2733 U   n 
30 2734 G   n 
30 2735 U   n 
30 2736 U   n 
30 2737 C   n 
30 2738 G   n 
30 2739 A   n 
30 2740 G   n 
30 2741 A   n 
30 2742 G   n 
30 2743 A   n 
30 2744 G   n 
30 2745 C   n 
30 2746 A   n 
30 2747 C   n 
30 2748 G   n 
30 2749 U   n 
30 2750 G   n 
30 2751 C   n 
30 2752 C   n 
30 2753 G   n 
30 2754 G   n 
30 2755 G   n 
30 2756 U   n 
30 2757 A   n 
30 2758 G   n 
30 2759 C   n 
30 2760 C   n 
30 2761 A   n 
30 2762 C   n 
30 2763 G   n 
30 2764 C   n 
30 2765 C   n 
30 2766 A   n 
30 2767 C   n 
30 2768 A   n 
30 2769 C   n 
30 2770 G   n 
30 2771 G   n 
30 2772 G   n 
30 2773 G   n 
30 2774 U   n 
30 2775 A   n 
30 2776 A   n 
30 2777 G   n 
30 2778 A   n 
30 2779 G   n 
30 2780 C   n 
30 2781 U   n 
30 2782 G   n 
30 2783 A   n 
30 2784 A   n 
30 2785 C   n 
30 2786 G   n 
30 2787 C   n 
30 2788 A   n 
30 2789 U   n 
30 2790 C   n 
30 2791 U   n 
30 2792 A   n 
30 2793 A   n 
30 2794 G   n 
30 2795 C   n 
30 2796 U   n 
30 2797 C   n 
30 2798 G   n 
30 2799 A   n 
30 2800 A   n 
30 2801 A   n 
30 2802 C   n 
30 2803 C   n 
30 2804 C   n 
30 2805 A   n 
30 2806 C   n 
30 2807 U   n 
30 2808 U   n 
30 2809 G   n 
30 2810 G   n 
30 2811 A   n 
30 2812 A   n 
30 2813 A   n 
30 2814 A   n 
30 2815 G   n 
30 2816 A   n 
30 2817 G   n 
30 2818 A   n 
30 2819 C   n 
30 2820 A   n 
30 2821 C   n 
30 2822 C   n 
30 2823 G   n 
30 2824 C   n 
30 2825 C   n 
30 2826 G   n 
30 2827 A   n 
30 2828 G   n 
30 2829 G   n 
30 2830 U   n 
30 2831 C   n 
30 2832 C   n 
30 2833 C   n 
30 2834 G   n 
30 2835 C   n 
30 2836 G   n 
30 2837 U   n 
30 2838 A   n 
30 2839 C   n 
30 2840 A   n 
30 2841 A   n 
30 2842 G   n 
30 2843 A   n 
30 2844 C   n 
30 2845 G   n 
30 2846 C   n 
30 2847 G   n 
30 2848 G   n 
30 2849 U   n 
30 2850 C   n 
30 2851 G   n 
30 2852 A   n 
30 2853 U   n 
30 2854 A   n 
30 2855 G   n 
30 2856 A   n 
30 2857 C   n 
30 2858 U   n 
30 2859 C   n 
30 2860 G   n 
30 2861 G   n 
30 2862 G   n 
30 2863 G   n 
30 2864 U   n 
30 2865 G   n 
30 2866 U   n 
30 2867 G   n 
30 2868 C   n 
30 2869 G   n 
30 2870 C   n 
30 2871 G   n 
30 2872 U   n 
30 2873 C   n 
30 2874 G   n 
30 2875 A   n 
30 2876 G   n 
30 2877 G   n 
30 2878 U   n 
30 2879 A   n 
30 2880 A   n 
30 2881 C   n 
30 2882 G   n 
30 2883 A   n 
30 2884 G   n 
30 2885 A   n 
30 2886 C   n 
30 2887 G   n 
30 2888 U   n 
30 2889 U   n 
30 2890 A   n 
30 2891 A   n 
30 2892 G   n 
30 2893 C   n 
30 2894 C   n 
30 2895 C   n 
30 2896 A   n 
30 2897 C   n 
30 2898 G   n 
30 2899 A   n 
30 2900 G   n 
30 2901 C   n 
30 2902 A   n 
30 2903 C   n 
30 2904 U   n 
30 2905 A   n 
30 2906 A   n 
30 2907 C   n 
30 2908 A   n 
30 2909 G   n 
30 2910 A   n 
30 2911 C   n 
30 2912 C   n 
30 2913 A   n 
30 2914 A   n 
30 2915 A   n 
30 2916 G   n 
30 2917 C   n 
30 2918 C   n 
30 2919 A   n 
30 2920 U   n 
30 2921 C   n 
30 2922 A   n 
30 2923 U   n 
31 1    U   n 
31 2    U   n 
31 3    A   n 
31 4    G   n 
31 5    G   n 
31 6    C   n 
31 7    G   n 
31 8    G   n 
31 9    C   n 
31 10   C   n 
31 11   A   n 
31 12   C   n 
31 13   A   n 
31 14   G   n 
31 15   C   n 
31 16   G   n 
31 17   G   n 
31 18   U   n 
31 19   G   n 
31 20   G   n 
31 21   G   n 
31 22   G   n 
31 23   U   n 
31 24   U   n 
31 25   G   n 
31 26   C   n 
31 27   C   n 
31 28   U   n 
31 29   C   n 
31 30   C   n 
31 31   C   n 
31 32   G   n 
31 33   U   n 
31 34   A   n 
31 35   C   n 
31 36   C   n 
31 37   C   n 
31 38   A   n 
31 39   U   n 
31 40   C   n 
31 41   C   n 
31 42   C   n 
31 43   G   n 
31 44   A   n 
31 45   A   n 
31 46   C   n 
31 47   A   n 
31 48   C   n 
31 49   G   n 
31 50   G   n 
31 51   A   n 
31 52   A   n 
31 53   G   n 
31 54   A   n 
31 55   U   n 
31 56   A   n 
31 57   A   n 
31 58   G   n 
31 59   C   n 
31 60   C   n 
31 61   C   n 
31 62   A   n 
31 63   C   n 
31 64   C   n 
31 65   A   n 
31 66   G   n 
31 67   C   n 
31 68   G   n 
31 69   U   n 
31 70   U   n 
31 71   C   n 
31 72   C   n 
31 73   A   n 
31 74   G   n 
31 75   G   n 
31 76   G   n 
31 77   A   n 
31 78   G   n 
31 79   U   n 
31 80   A   n 
31 81   C   n 
31 82   U   n 
31 83   G   n 
31 84   G   n 
31 85   A   n 
31 86   G   n 
31 87   U   n 
31 88   G   n 
31 89   C   n 
31 90   G   n 
31 91   C   n 
31 92   G   n 
31 93   A   n 
31 94   G   n 
31 95   C   n 
31 96   C   n 
31 97   U   n 
31 98   C   n 
31 99   U   n 
31 100  G   n 
31 101  G   n 
31 102  G   n 
31 103  A   n 
31 104  A   n 
31 105  A   n 
31 106  U   n 
31 107  C   n 
31 108  C   n 
31 109  G   n 
31 110  G   n 
31 111  U   n 
31 112  U   n 
31 113  C   n 
31 114  G   n 
31 115  C   n 
31 116  C   n 
31 117  G   n 
31 118  C   n 
31 119  C   n 
31 120  A   n 
31 121  C   n 
31 122  C   n 
32 1    C   n 
32 2    C   n 
32 3    A   n 
33 1    C   n 
33 2    C   n 
33 3    8AN n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample ? ? 'Halobacterium marismortui' 'Haloarcula marismortui' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample ? ? 'Halobacterium marismortui' 'Haloarcula marismortui' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample ? ? 'Halobacterium marismortui' 'Haloarcula marismortui' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample ? ? 'Halobacterium marismortui' 'Haloarcula marismortui' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample ? ? 'Halobacterium marismortui' 'Haloarcula marismortui' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample ? ? 'Halobacterium marismortui' 'Haloarcula marismortui' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample ? ? 'Halobacterium marismortui' 'Haloarcula marismortui' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample ? ? 'Halobacterium marismortui' 'Haloarcula marismortui' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample ? ? 'Halobacterium marismortui' 'Haloarcula marismortui' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample ? ? 'Halobacterium marismortui' 'Haloarcula marismortui' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample ? ? 'Halobacterium marismortui' 'Haloarcula marismortui' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample ? ? 'Halobacterium marismortui' 'Haloarcula marismortui' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
13 1 sample ? ? 'Halobacterium marismortui' 'Haloarcula marismortui' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
14 1 sample ? ? 'Halobacterium marismortui' 'Haloarcula marismortui' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
15 1 sample ? ? 'Halobacterium marismortui' 'Haloarcula marismortui' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
16 1 sample ? ? 'Halobacterium marismortui' 'Haloarcula marismortui' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
17 1 sample ? ? 'Halobacterium marismortui' 'Haloarcula marismortui' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
18 1 sample ? ? 'Halobacterium marismortui' 'Haloarcula marismortui' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
19 1 sample ? ? 'Halobacterium marismortui' 'Haloarcula marismortui' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
20 1 sample ? ? 'Halobacterium marismortui' 'Haloarcula marismortui' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
21 1 sample ? ? 'Halobacterium marismortui' 'Haloarcula marismortui' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
22 1 sample ? ? 'Halobacterium marismortui' 'Haloarcula marismortui' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
23 1 sample ? ? 'Halobacterium marismortui' 'Haloarcula marismortui' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
24 1 sample ? ? 'Halobacterium marismortui' 'Haloarcula marismortui' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
25 1 sample ? ? 'Halobacterium marismortui' 'Haloarcula marismortui' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
26 1 sample ? ? 'Halobacterium marismortui' 'Haloarcula marismortui' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
27 1 sample ? ? 'Halobacterium marismortui' 'Haloarcula marismortui' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
28 1 sample ? ? 'Halobacterium marismortui' 'Haloarcula marismortui' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
29 1 sample ? ? 'Halobacterium marismortui' 'Haloarcula marismortui' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
30 1 sample ? ? 'Halobacterium marismortui' 'Haloarcula marismortui' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
31 1 sample ? ? 'Halobacterium marismortui' 'Haloarcula marismortui' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
32 1 sample ? ? 'synthetic construct' ? 32630 ? 
33 1 sample ? ? 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1  PDB 3CME        3CME    30 
;GUUGGCUACUAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCUGUGGGGA
GCCGCACGGAGGCGAAGAACCACAGAUUUCCGAAUGAGAAUCUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGA
ACUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAACGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCC
AAACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUUCACGAAGUCUCUUGGAAUAG
AGCGUGAUACAGGGUGACAACCCCGUACUGAAGACCAGUACGCUGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCC
CUCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGC
UGCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUU
GACGAAUGACCGAGACGCGAGUCUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGAAAAACGAGCCAG
GGAGUGUGUCUGUAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUUGCCCG
AGGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCG
UGCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCC
CAUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCG
ACCGAUUGGUGUGUCCGCCUCCGAGAGGAGUCGGCACACCUGUCAAACUCCAAACUUACAGACGCUGUUUGACGCGGGGA
UUCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGU
GUAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAA
CAGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUA
CUGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGCAGGGGCGAGAGCUCCUGUGGACCGAUUAGUGACGAAAAUC
CUGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCU
GAGGGUUAGCCGGUCCUAAGUCUCACCGCAACUCGACUGAGACGAAAUGGGAAACAGGUUAAUAUUCCUGUGCCAUCAUG
CAGUGAAAGUUGACGCCCUGGGGUCGAUCACGCCGGGCAUUCGCCCGGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUG
GCAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUGAUGUCCGUACC
GAGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAG
UCCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAA
CAACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUAC
AAGAGGACGAAGGACCUGUCAACGGCGGGGGUAACUAUGACCCUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCG
GCUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGG
AGACACCCAGGGGGAAGCGAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGACGUGGUCGCCGAUGUGCAGCAUA
GGUAGGAGUCGUUACAGAGGUACCCGCGCUAGCGGGCCACCCAGACAACAGUGAAAUACUACCCGUCGGUGACUGCGACU
CUCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCU
AUGGUCAUCUCAGCCGGGACAGAGACCCGGCGAAGAGUGCAAGAGCAAAAGAUGACUUGACAGUGUUCUUCCCAACGAGG
AACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAG
GGAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCC
CGUGCAGAAGCGGGCAAGGGUGAGGUUGUUCGCCUAUUAAAGGAGGUCGUGAGCUGGGUUUAGACCGUCGUGAGACAGGU
CGGCUGCUAUCUACUGGGUGUGUAAUGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCAC
UGGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAA
ACCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAA
CGAGACGUUAAGCCCACGAGCACUAACAGACCAAAGCCAUCAU
;
2634210 ? 
2  GB  AJ251081    6468293 31 
;UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCAGGGAGUA
CUGGAGUGCGCGAGCCUCUGGGAAAUCCGGUUCGCCGCCACC
;
1       ? 
3  PDB 3CME        3CME    32 CCA 74      ? 
4  PDB 3CME        3CME    33 CCA 74      ? 
5  UNP RL2_HALMA   P20276  1  
;MGRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDE
LQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVV
AGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGGNE

;
1       ? 
6  UNP RL3_HALMA   P20279  2  
;MPQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPM
RAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKP
DVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNL
GPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPND
QPRLDPEVRYVSNESNQG
;
1       ? 
7  UNP RL4_HALMA   P12735  3  
;MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKQDGRARRV
PQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEAL
DVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESAL
AEVAER
;
1       ? 
8  UNP RL5_HALMA   P14124  4  
;MSSESESGGDFHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEM
AEEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNP
ADAVAFIESTYDVEVSE
;
1       ? 
9  UNP RL6_HALMA   P14135  5  
;MPRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEG
WEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDV
RVFQDGVYITRKPNRGDA
;
1       ? 
10 UNP RL7A_HALMA  P12743  6  
;MPVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQ
QDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
;
1       ? 
11 UNP RLA0_HALMA  P15825  7  
;MSAESERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDDVDDGLED
LNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGEVAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLS
DSTVLDTGEEVSQELSNVLNELGIEPKEVGLDLRAVFADGVLFEPEELELDIDEYRSDIQAAAGRAFNLSVNADYPTATT
APTMLQSARGNAKSLALQAAIEDPEVVPDLVSKADAQVRALASQIDDEEALPEELQGVEADVATEEPTDDQDDDTASEDD
ADADDAAEEADDDDDDDEDAGDALGAMF
;
1       ? 
12 UNP RL10_HALMA  P60617  8  
;MSDKPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKEL
GEEGDYKMTLRKFPHQVLRENKQATGAGADRVSDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKI
TPSCRIKVERGEELLIA
;
1       ? 
13 UNP RL11_HALMA  P14122  9  
;MAGTIEVLVPGGEANPGPPLGPELGPTPVDVQAVVQEINDQTAAFDGTEVPVTVKYDDDGSFEIEVGVPPTAELIKDEAG
FETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIEGENPREFKERIDAGEYDDVFAAEA
QA
;
1       ? 
14 UNP RL13_HALMA  P29198  10 
;MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFK
RTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW
;
1       ? 
15 UNP RL14_HALMA  P22450  11 
;MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRHPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPI
RRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV
;
1       ? 
16 UNP RL15_HALMA  P12737  12 
;MTSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAAD
DVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDA
DADEE
;
1       ? 
17 UNP RL15E_HALMA P60618  13 
;MARSAYSYIRDAWKNPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKA
GRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRV
FRGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKGK
;
1       ? 
18 UNP RL18_HALMA  P14123  14 
;MATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMP
SAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLY
SGDFDAADLPEHFDELRETLLDGDIEL
;
1       ? 
19 UNP RL18E_HALMA P12733  15 
;MSKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAV
DFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
;
1       ? 
20 UNP RL19_HALMA  P14119  16 
;MTDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGS
RKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDANHGDA
;
1       ? 
21 UNP RL21_HALMA  P12734  17 
;MPSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGG
KEKTIIVTAAHLRRQE
;
1       ? 
22 UNP RL22_HALMA  P10970  18 
;MGISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGR
YPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED
;
1       ? 
23 UNP RL23_HALMA  P12732  19 
;MSWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVAS
RIGVF
;
1       ? 
24 UNP RL24_HALMA  P10972  20 
;MSKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTL
EKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA
;
1       ? 
25 UNP RL24E_HALMA P14116  21 MPRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEAGEAEDEA 1       ? 
26 UNP RL29_HALMA  P10971  22 MTVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGDLQENE 1       ? 
27 UNP RL30_HALMA  P14121  23 
;MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVD
DEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR
;
1       ? 
28 UNP RL31_HALMA  P18138  24 
;MSASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEE
EGEAIVEAETAE
;
1       ? 
29 UNP RL32_HALMA  P12736  25 
;MADNEEDVEAEEEYTELTDISGVGPSKAESLREAGFESVEDVRGADQSALADVSGIGNALAARIKADVGGLEVESETEAE
VEEEGGEEAPDEDVETELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKG
KGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEVEVS
E
;
1       ? 
30 PDB 3CME        3CME    26 
;MASKSGKTGSSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVR
RSIRAALSEDEE
;
1       ? 
31 UNP RL37_HALMA  P32410  27 MTGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE 1       ? 
32 UNP RL39_HALMA  P22452  28 MGKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE 1       ? 
33 UNP RL44_HALMA  P32411  29 
;MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLR
EGWRAGRLEFQE
;
1       ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  3CME 0 1 ? 2923 ? 3CME    1  ? 2923 ? 1  2923 
2  2  3CME 9 1 ? 122  ? 6468293 1  ? 122  ? 1  122  
3  3  3CME 5 1 ? 3    ? 3CME    74 ? 76   ? 74 76   
4  4  3CME 6 1 ? 3    ? 3CME    74 ? 76   ? 74 76   
5  5  3CME A 1 ? 240  ? P20276  1  ? 240  ? 0  239  
6  6  3CME B 1 ? 338  ? P20279  1  ? 338  ? 0  337  
7  7  3CME C 1 ? 246  ? P12735  1  ? 246  ? 1  246  
8  8  3CME D 1 ? 177  ? P14124  1  ? 177  ? 0  176  
9  9  3CME E 1 ? 178  ? P14135  1  ? 178  ? 0  177  
10 10 3CME F 1 ? 120  ? P12743  1  ? 120  ? 0  119  
11 11 3CME G 1 ? 348  ? P15825  1  ? 348  ? 1  348  
12 12 3CME H 1 ? 177  ? P60617  1  ? 177  ? 1  177  
13 13 3CME I 1 ? 162  ? P14122  1  ? 162  ? 0  161  
14 14 3CME J 1 ? 145  ? P29198  1  ? 145  ? 1  145  
15 15 3CME K 1 ? 132  ? P22450  1  ? 132  ? 1  132  
16 16 3CME L 1 ? 165  ? P12737  1  ? 165  ? 0  164  
17 17 3CME M 1 ? 196  ? P60618  1  ? 196  ? 0  195  
18 18 3CME N 1 ? 187  ? P14123  1  ? 187  ? 0  186  
19 19 3CME O 1 ? 116  ? P12733  1  ? 116  ? 0  115  
20 20 3CME P 1 ? 149  ? P14119  1  ? 149  ? 0  148  
21 21 3CME Q 1 ? 96   ? P12734  1  ? 96   ? 0  95   
22 22 3CME R 1 ? 155  ? P10970  1  ? 155  ? 0  154  
23 23 3CME S 1 ? 85   ? P12732  1  ? 85   ? 0  84   
24 24 3CME T 1 ? 120  ? P10972  1  ? 120  ? 0  119  
25 25 3CME U 1 ? 67   ? P14116  1  ? 67   ? 0  66   
26 26 3CME V 1 ? 71   ? P10971  1  ? 71   ? 0  70   
27 27 3CME W 1 ? 154  ? P14121  1  ? 154  ? 1  154  
28 28 3CME X 1 ? 92   ? P18138  1  ? 92   ? 0  91   
29 29 3CME Y 1 ? 240  ? P12736  1  ? 240  ? 0  239  
30 30 3CME Z 1 ? 116  ? 3CME    1  ? 116  ? 1  116  
31 31 3CME 1 1 ? 57   ? P32410  1  ? 57   ? 0  56   
32 32 3CME 2 1 ? 50   ? P22452  1  ? 50   ? 0  49   
33 33 3CME 3 1 ? 92   ? P32411  1  ? 92   ? 1  92   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
1MA 'RNA linking'       n "6-HYDRO-1-METHYLADENOSINE-5'-MONOPHOSPHATE"           ?                   'C11 H16 N5 O7 P' 361.248 
8AN 'RNA linking'       n 
;3'-amino-3'-deoxyadenosine 5'-(dihydrogen phosphate)
;
?                   'C10 H15 N6 O6 P' 346.236 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"                           ?                   'C10 H14 N5 O7 P' 347.221 
ACA 'peptide linking'   . '6-AMINOHEXANOIC ACID'                                 'AMINOCAPROIC ACID' 'C6 H13 N O2'     131.173 
ALA 'L-peptide linking' y ALANINE                                                ?                   'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                               ?                   'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                             ?                   'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                        ?                   'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"                            ?                   'C9 H14 N3 O8 P'  323.197 
CD  non-polymer         . 'CADMIUM ION'                                          ?                   'Cd 2'            112.411 
CL  non-polymer         . 'CHLORIDE ION'                                         ?                   'Cl -1'           35.453  
CYS 'L-peptide linking' y CYSTEINE                                               ?                   'C3 H7 N O2 S'    121.158 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"                           ?                   'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                                              ?                   'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                        ?                   'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                                ?                   'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                              ?                   'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                                  ?                   'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                             ?                   'C6 H13 N O2'     131.173 
K   non-polymer         . 'POTASSIUM ION'                                        ?                   'K 1'             39.098  
LEU 'L-peptide linking' y LEUCINE                                                ?                   'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                                 ?                   'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                             ?                   'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                        ?                   'Mg 2'            24.305  
NA  non-polymer         . 'SODIUM ION'                                           ?                   'Na 1'            22.990  
OMG 'RNA linking'       n "O2'-METHYLGUANOSINE-5'-MONOPHOSPHATE"                 ?                   'C11 H16 N5 O8 P' 377.247 
OMU 'RNA linking'       n 
;O2'-METHYLURIDINE 5'-MONOPHOSPHATE
;
?                   'C10 H15 N2 O9 P' 338.208 
PHE 'L-peptide linking' y PHENYLALANINE                                          ?                   'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                                ?                   'C5 H9 N O2'      115.130 
PSU 'RNA linking'       n "PSEUDOURIDINE-5'-MONOPHOSPHATE"                       ?                   'C9 H13 N2 O9 P'  324.181 
SER 'L-peptide linking' y SERINE                                                 ?                   'C3 H7 N O3'      105.093 
SR  non-polymer         . 'STRONTIUM ION'                                        ?                   'Sr 2'            87.620  
THR 'L-peptide linking' y THREONINE                                              ?                   'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                             ?                   'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                               ?                   'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"                             ?                   'C9 H13 N2 O9 P'  324.181 
UR3 'RNA linking'       n "3-METHYLURIDINE-5'-MONOPHOSHATE"                      ?                   'C10 H15 N2 O9 P' 338.208 
VAL 'L-peptide linking' y VALINE                                                 ?                   'C5 H11 N O2'     117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3CME 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      3.04 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   59.49 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              5.8 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'PEG 6000, KCL, NH4CL, MGCL2, KACETATE, pH 5.8, VAPOR DIFFUSION, HANGING DROP, temperature 292K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1  1 'PEG 6000' ? ? ? 
1 2  1 KCL        ? ? ? 
1 3  1 NH4CL      ? ? ? 
1 4  1 MGCL2      ? ? ? 
1 5  1 KACETATE   ? ? ? 
1 6  2 'PEG 6000' ? ? ? 
1 7  2 KCL        ? ? ? 
1 8  2 NH4CL      ? ? ? 
1 9  2 MGCL2      ? ? ? 
1 10 2 KACETATE   ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2007-11-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 24-ID-C' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-C 
# 
_reflns.entry_id                     3CME 
_reflns.d_resolution_high            2.950 
_reflns.d_resolution_low             70.000 
_reflns.number_obs                   369334 
_reflns.pdbx_Rmerge_I_obs            0.261 
_reflns.pdbx_netI_over_sigmaI        3.700 
_reflns.pdbx_chi_squared             1.369 
_reflns.pdbx_redundancy              7.100 
_reflns.percent_possible_obs         100.000 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.number_all                   369334 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.95 
_reflns_shell.d_res_low              3.06 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_chi_squared       0.768 
_reflns_shell.pdbx_redundancy        7.10 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      36740 
_reflns_shell.percent_possible_all   100.00 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3CME 
_refine.ls_d_res_high                            2.950 
_refine.ls_d_res_low                             49.820 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               49296.121 
_refine.pdbx_data_cutoff_low_absF                0.000 
_refine.ls_percent_reflns_obs                    90.200 
_refine.ls_number_reflns_obs                     335888 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.ls_R_factor_R_work                       0.198 
_refine.ls_R_factor_R_free                       0.255 
_refine.ls_percent_reflns_R_free                 1.000 
_refine.ls_number_reflns_R_free                  3262 
_refine.ls_R_factor_R_free_error                 0.004 
_refine.B_iso_mean                               56.400 
_refine.solvent_model_param_bsol                 45.044 
_refine.solvent_model_param_ksol                 0.302 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.aniso_B[1][1]                            -10.350 
_refine.aniso_B[2][2]                            -0.570 
_refine.aniso_B[3][3]                            10.930 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3CME 
_refine_analyze.Luzzati_coordinate_error_obs    0.330 
_refine_analyze.Luzzati_sigma_a_obs             0.540 
_refine_analyze.Luzzati_d_res_low_obs           5.000 
_refine_analyze.Luzzati_coordinate_error_free   0.430 
_refine_analyze.Luzzati_sigma_a_free            0.610 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        29352 
_refine_hist.pdbx_number_atoms_nucleic_acid   61710 
_refine_hist.pdbx_number_atoms_ligand         324 
_refine_hist.number_atoms_solvent             7808 
_refine_hist.number_atoms_total               99194 
_refine_hist.d_res_high                       2.950 
_refine_hist.d_res_low                        49.820 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           ? 0.006  ?     ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        ? 1.100  ?     ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d ? 15.600 ?     ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d ? 1.370  ?     ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        ? 1.150  1.500 ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       ? 2.010  2.000 ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        ? 1.450  2.000 ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       ? 2.300  2.500 ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.950 
_refine_ls_shell.d_res_low                        3.080 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.percent_reflns_obs               48.400 
_refine_ls_shell.number_reflns_R_work             31298 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.332 
_refine_ls_shell.R_factor_R_free                  0.369 
_refine_ls_shell.percent_reflns_R_free            1.000 
_refine_ls_shell.number_reflns_R_free             303 
_refine_ls_shell.R_factor_R_free_error            0.021 
_refine_ls_shell.number_reflns_all                31601 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3CME 
_struct.title                     
'The Structure of CA and CCA-PHE-CAP-BIO Bound to the Large Ribosomal Subunit of Haloarcula Marismortui' 
_struct.pdbx_descriptor           '50S ribosomal subunit' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3CME 
_struct_keywords.pdbx_keywords   RIBOSOME 
_struct_keywords.text            
'RIBOSOME 50S, PROTEIN-PROTEIN COMPLEX, RNA-RNA COMPLEX, PROTEIN-RNA COMPLEX, HYDROLYSIS OF PEPTIDYL-tRNA, RIBOSOME' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 11 ? 
L  N N 12 ? 
M  N N 13 ? 
N  N N 14 ? 
O  N N 15 ? 
P  N N 16 ? 
Q  N N 17 ? 
R  N N 18 ? 
S  N N 19 ? 
T  N N 20 ? 
U  N N 21 ? 
V  N N 22 ? 
W  N N 23 ? 
X  N N 24 ? 
Y  N N 25 ? 
Z  N N 26 ? 
AA N N 27 ? 
BA N N 28 ? 
CA N N 29 ? 
DA N N 30 ? 
EA N N 31 ? 
FA N N 32 ? 
GA N N 33 ? 
HA N N 34 ? 
IA N N 34 ? 
JA N N 34 ? 
KA N N 35 ? 
LA N N 36 ? 
MA N N 36 ? 
NA N N 36 ? 
OA N N 34 ? 
PA N N 34 ? 
QA N N 35 ? 
RA N N 36 ? 
SA N N 36 ? 
TA N N 34 ? 
UA N N 37 ? 
VA N N 36 ? 
WA N N 37 ? 
XA N N 36 ? 
YA N N 36 ? 
ZA N N 35 ? 
AB N N 37 ? 
BB N N 35 ? 
CB N N 35 ? 
DB N N 35 ? 
EB N N 34 ? 
FB N N 35 ? 
GB N N 35 ? 
HB N N 36 ? 
IB N N 37 ? 
JB N N 35 ? 
KB N N 35 ? 
LB N N 38 ? 
MB N N 35 ? 
NB N N 37 ? 
OB N N 35 ? 
PB N N 37 ? 
QB N N 35 ? 
RB N N 36 ? 
SB N N 37 ? 
TB N N 36 ? 
UB N N 36 ? 
VB N N 34 ? 
WB N N 38 ? 
XB N N 36 ? 
YB N N 34 ? 
ZB N N 35 ? 
AC N N 35 ? 
BC N N 38 ? 
CC N N 38 ? 
DC N N 36 ? 
EC N N 36 ? 
FC N N 34 ? 
GC N N 36 ? 
HC N N 38 ? 
IC N N 35 ? 
JC N N 36 ? 
KC N N 36 ? 
LC N N 34 ? 
MC N N 34 ? 
NC N N 34 ? 
OC N N 34 ? 
PC N N 34 ? 
QC N N 34 ? 
RC N N 34 ? 
SC N N 34 ? 
TC N N 34 ? 
UC N N 34 ? 
VC N N 34 ? 
WC N N 34 ? 
XC N N 34 ? 
YC N N 34 ? 
ZC N N 34 ? 
AD N N 34 ? 
BD N N 34 ? 
CD N N 34 ? 
DD N N 34 ? 
ED N N 34 ? 
FD N N 34 ? 
GD N N 34 ? 
HD N N 34 ? 
ID N N 34 ? 
JD N N 34 ? 
KD N N 34 ? 
LD N N 34 ? 
MD N N 34 ? 
ND N N 34 ? 
OD N N 34 ? 
PD N N 34 ? 
QD N N 34 ? 
RD N N 34 ? 
SD N N 34 ? 
TD N N 34 ? 
UD N N 34 ? 
VD N N 34 ? 
WD N N 34 ? 
XD N N 34 ? 
YD N N 34 ? 
ZD N N 34 ? 
AE N N 34 ? 
BE N N 34 ? 
CE N N 34 ? 
DE N N 34 ? 
EE N N 34 ? 
FE N N 34 ? 
GE N N 34 ? 
HE N N 34 ? 
IE N N 34 ? 
JE N N 34 ? 
KE N N 34 ? 
LE N N 34 ? 
ME N N 34 ? 
NE N N 34 ? 
OE N N 34 ? 
PE N N 34 ? 
QE N N 34 ? 
RE N N 34 ? 
SE N N 34 ? 
TE N N 34 ? 
UE N N 34 ? 
VE N N 34 ? 
WE N N 34 ? 
XE N N 34 ? 
YE N N 34 ? 
ZE N N 34 ? 
AF N N 34 ? 
BF N N 34 ? 
CF N N 34 ? 
DF N N 34 ? 
EF N N 34 ? 
FF N N 34 ? 
GF N N 34 ? 
HF N N 34 ? 
IF N N 34 ? 
JF N N 34 ? 
KF N N 34 ? 
LF N N 34 ? 
MF N N 34 ? 
NF N N 34 ? 
OF N N 34 ? 
PF N N 39 ? 
QF N N 39 ? 
RF N N 37 ? 
SF N N 37 ? 
TF N N 37 ? 
UF N N 37 ? 
VF N N 37 ? 
WF N N 37 ? 
XF N N 37 ? 
YF N N 37 ? 
ZF N N 37 ? 
AG N N 37 ? 
BG N N 37 ? 
CG N N 37 ? 
DG N N 37 ? 
EG N N 37 ? 
FG N N 37 ? 
GG N N 37 ? 
HG N N 37 ? 
IG N N 37 ? 
JG N N 37 ? 
KG N N 37 ? 
LG N N 37 ? 
MG N N 37 ? 
NG N N 37 ? 
OG N N 37 ? 
PG N N 37 ? 
QG N N 37 ? 
RG N N 37 ? 
SG N N 37 ? 
TG N N 37 ? 
UG N N 37 ? 
VG N N 37 ? 
WG N N 37 ? 
XG N N 37 ? 
YG N N 37 ? 
ZG N N 37 ? 
AH N N 37 ? 
BH N N 37 ? 
CH N N 37 ? 
DH N N 37 ? 
EH N N 37 ? 
FH N N 37 ? 
GH N N 37 ? 
HH N N 37 ? 
IH N N 37 ? 
JH N N 37 ? 
KH N N 37 ? 
LH N N 37 ? 
MH N N 37 ? 
NH N N 37 ? 
OH N N 37 ? 
PH N N 37 ? 
QH N N 37 ? 
RH N N 37 ? 
SH N N 37 ? 
TH N N 37 ? 
UH N N 37 ? 
VH N N 37 ? 
WH N N 37 ? 
XH N N 37 ? 
YH N N 37 ? 
ZH N N 37 ? 
AI N N 37 ? 
BI N N 37 ? 
CI N N 37 ? 
DI N N 37 ? 
EI N N 35 ? 
FI N N 35 ? 
GI N N 35 ? 
HI N N 35 ? 
II N N 35 ? 
JI N N 35 ? 
KI N N 36 ? 
LI N N 36 ? 
MI N N 36 ? 
NI N N 36 ? 
OI N N 36 ? 
PI N N 36 ? 
QI N N 36 ? 
RI N N 36 ? 
SI N N 36 ? 
TI N N 36 ? 
UI N N 36 ? 
VI N N 36 ? 
WI N N 36 ? 
XI N N 36 ? 
YI N N 36 ? 
ZI N N 36 ? 
AJ N N 36 ? 
BJ N N 36 ? 
CJ N N 36 ? 
DJ N N 36 ? 
EJ N N 36 ? 
FJ N N 36 ? 
GJ N N 36 ? 
HJ N N 36 ? 
IJ N N 36 ? 
JJ N N 36 ? 
KJ N N 36 ? 
LJ N N 36 ? 
MJ N N 36 ? 
NJ N N 36 ? 
OJ N N 36 ? 
PJ N N 36 ? 
QJ N N 36 ? 
RJ N N 36 ? 
SJ N N 36 ? 
TJ N N 36 ? 
UJ N N 36 ? 
VJ N N 36 ? 
WJ N N 36 ? 
XJ N N 36 ? 
YJ N N 36 ? 
ZJ N N 36 ? 
AK N N 36 ? 
BK N N 36 ? 
CK N N 36 ? 
DK N N 36 ? 
EK N N 36 ? 
FK N N 36 ? 
GK N N 36 ? 
HK N N 36 ? 
IK N N 36 ? 
JK N N 36 ? 
KK N N 36 ? 
LK N N 36 ? 
MK N N 36 ? 
NK N N 36 ? 
OK N N 36 ? 
PK N N 36 ? 
QK N N 36 ? 
RK N N 36 ? 
SK N N 36 ? 
TK N N 36 ? 
UK N N 36 ? 
VK N N 36 ? 
WK N N 36 ? 
XK N N 36 ? 
YK N N 36 ? 
ZK N N 36 ? 
AL N N 36 ? 
BL N N 36 ? 
CL N N 36 ? 
DL N N 36 ? 
EL N N 36 ? 
FL N N 36 ? 
GL N N 36 ? 
HL N N 36 ? 
IL N N 36 ? 
JL N N 36 ? 
KL N N 36 ? 
LL N N 36 ? 
ML N N 36 ? 
NL N N 36 ? 
OL N N 36 ? 
PL N N 36 ? 
QL N N 36 ? 
RL N N 36 ? 
SL N N 36 ? 
TL N N 34 ? 
UL N N 37 ? 
VL N N 37 ? 
WL N N 37 ? 
XL N N 36 ? 
YL N N 36 ? 
ZL N N 36 ? 
AM N N 40 ? 
BM N N 41 ? 
CM N N 42 ? 
DM N N 42 ? 
EM N N 42 ? 
FM N N 42 ? 
GM N N 42 ? 
HM N N 42 ? 
IM N N 42 ? 
JM N N 42 ? 
KM N N 42 ? 
LM N N 42 ? 
MM N N 42 ? 
NM N N 42 ? 
OM N N 42 ? 
PM N N 42 ? 
QM N N 42 ? 
RM N N 42 ? 
SM N N 42 ? 
TM N N 42 ? 
UM N N 42 ? 
VM N N 42 ? 
WM N N 42 ? 
XM N N 42 ? 
YM N N 42 ? 
ZM N N 42 ? 
AN N N 42 ? 
BN N N 42 ? 
CN N N 42 ? 
DN N N 42 ? 
EN N N 42 ? 
FN N N 42 ? 
GN N N 42 ? 
HN N N 42 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   ILE A  5   ? ARG A  12  ? ILE A 4   ARG A 11  1 ? 8  
HELX_P HELX_P2   2   GLY A  13  ? ARG A  18  ? GLY A 12  ARG A 17  5 ? 6  
HELX_P HELX_P3   3   PRO A  20  ? TYR A  24  ? PRO A 19  TYR A 23  5 ? 5  
HELX_P HELX_P4   4   LYS A  172 ? LYS A  181 ? LYS A 171 LYS A 180 1 ? 10 
HELX_P HELX_P5   5   ARG A  191 ? MET A  195 ? ARG A 190 MET A 194 5 ? 5  
HELX_P HELX_P6   6   ASN A  196 ? HIS A  200 ? ASN A 195 HIS A 199 5 ? 5  
HELX_P HELX_P7   7   GLU B  109 ? THR B  113 ? GLU B 108 THR B 112 5 ? 5  
HELX_P HELX_P8   8   ASP B  121 ? GLY B  136 ? ASP B 120 GLY B 135 1 ? 16 
HELX_P HELX_P9   9   SER B  171 ? GLY B  186 ? SER B 170 GLY B 185 1 ? 16 
HELX_P HELX_P10  10  ALA B  190 ? PHE B  195 ? ALA B 189 PHE B 194 1 ? 6  
HELX_P HELX_P11  11  GLY B  214 ? GLY B  220 ? GLY B 213 GLY B 219 1 ? 7  
HELX_P HELX_P12  12  LYS B  225 ? GLN B  231 ? LYS B 224 GLN B 230 5 ? 7  
HELX_P HELX_P13  13  PRO C  19  ? THR C  24  ? PRO C 19  THR C 24  5 ? 6  
HELX_P HELX_P14  14  ARG C  27  ? ARG C  42  ? ARG C 27  ARG C 42  1 ? 16 
HELX_P HELX_P15  15  ASN C  103 ? ALA C  117 ? ASN C 103 ALA C 117 1 ? 15 
HELX_P HELX_P16  16  ASP C  120 ? ARG C  127 ? ASP C 120 ARG C 127 1 ? 8  
HELX_P HELX_P17  17  SER C  141 ? LEU C  147 ? SER C 141 LEU C 147 5 ? 7  
HELX_P HELX_P18  18  LYS C  149 ? LEU C  160 ? LYS C 149 LEU C 160 1 ? 12 
HELX_P HELX_P19  19  HIS C  163 ? ASP C  170 ? HIS C 163 ASP C 170 1 ? 8  
HELX_P HELX_P20  20  GLY C  177 ? GLY C  183 ? GLY C 177 GLY C 183 5 ? 7  
HELX_P HELX_P21  21  SER C  201 ? ASN C  206 ? SER C 201 ASN C 206 1 ? 6  
HELX_P HELX_P22  22  ASN C  219 ? ALA C  224 ? ASN C 219 ALA C 224 1 ? 6  
HELX_P HELX_P23  23  PRO C  225 ? ALA C  228 ? PRO C 225 ALA C 228 5 ? 4  
HELX_P HELX_P24  24  GLU C  237 ? ALA C  244 ? GLU C 237 ALA C 244 1 ? 8  
HELX_P HELX_P25  25  ALA D  38  ? THR D  46  ? ALA D 37  THR D 45  1 ? 9  
HELX_P HELX_P26  26  ARG D  77  ? ASP D  78  ? ARG D 76  ASP D 77  1 ? 2  
HELX_P HELX_P27  27  GLU D  79  ? LEU D  89  ? GLU D 78  LEU D 88  1 ? 11 
HELX_P HELX_P28  28  PRO D  90  ? ALA D  92  ? PRO D 89  ALA D 91  5 ? 3  
HELX_P HELX_P29  29  ALA D  95  ? PHE D  99  ? ALA D 94  PHE D 98  5 ? 5  
HELX_P HELX_P30  30  GLY D  139 ? LYS D  144 ? GLY D 138 LYS D 143 5 ? 6  
HELX_P HELX_P31  31  ASN D  159 ? SER D  169 ? ASN D 158 SER D 168 1 ? 11 
HELX_P HELX_P32  32  ASN E  56  ? THR E  78  ? ASN E 55  THR E 77  1 ? 23 
HELX_P HELX_P33  33  ASN E  107 ? GLU E  111 ? ASN E 106 GLU E 110 5 ? 5  
HELX_P HELX_P34  34  ASP E  138 ? LEU E  152 ? ASP E 137 LEU E 151 1 ? 15 
HELX_P HELX_P35  35  PRO F  10  ? THR F  27  ? PRO F 9   THR F 26  1 ? 18 
HELX_P HELX_P36  36  GLY F  33  ? GLY F  44  ? GLY F 32  GLY F 43  1 ? 12 
HELX_P HELX_P37  37  GLU F  58  ? HIS F  63  ? GLU F 57  HIS F 62  1 ? 6  
HELX_P HELX_P38  38  HIS F  63  ? GLU F  70  ? HIS F 62  GLU F 69  1 ? 8  
HELX_P HELX_P39  39  GLN F  81  ? ALA F  88  ? GLN F 80  ALA F 87  1 ? 8  
HELX_P HELX_P40  40  ALA F  105 ? LEU F  119 ? ALA F 104 LEU F 118 1 ? 15 
HELX_P HELX_P41  41  GLU G  14  ? ILE G  27  ? GLU G 14  ILE G 27  1 ? 14 
HELX_P HELX_P42  42  ARG G  63  ? ASP G  72  ? ARG G 63  ASP G 72  1 ? 10 
HELX_P HELX_P43  43  PRO H  5   ? TYR H  9   ? PRO H 5   TYR H 9   5 ? 5  
HELX_P HELX_P44  44  ASP H  42  ? TYR H  46  ? ASP H 42  TYR H 46  5 ? 5  
HELX_P HELX_P45  45  HIS H  62  ? ILE H  77  ? HIS H 62  ILE H 77  1 ? 16 
HELX_P HELX_P46  46  LYS H  78  ? GLY H  81  ? LYS H 78  GLY H 81  1 ? 4  
HELX_P HELX_P47  47  ASP H  145 ? TYR H  157 ? ASP H 145 TYR H 157 1 ? 13 
HELX_P HELX_P48  48  PRO I  70  ? GLU I  78  ? PRO I 69  GLU I 77  1 ? 9  
HELX_P HELX_P49  49  VAL I  98  ? GLN I  103 ? VAL I 97  GLN I 102 1 ? 6  
HELX_P HELX_P50  50  ILE I  104 ? GLN I  107 ? ILE I 103 GLN I 106 5 ? 4  
HELX_P HELX_P51  51  ASP I  116 ? VAL I  125 ? ASP I 115 VAL I 124 1 ? 10 
HELX_P HELX_P52  52  ILE J  18  ? LEU J  31  ? ILE J 18  LEU J 31  1 ? 14 
HELX_P HELX_P53  53  ASN J  40  ? ARG J  43  ? ASN J 40  ARG J 43  5 ? 4  
HELX_P HELX_P54  54  ARG J  49  ? ILE J  63  ? ARG J 49  ILE J 63  1 ? 15 
HELX_P HELX_P55  55  GLY J  77  ? GLY J  77  ? GLY J 77  GLY J 77  1 ? 1  
HELX_P HELX_P56  56  ILE J  78  ? GLY J  85  ? ILE J 78  GLY J 85  1 ? 8  
HELX_P HELX_P57  57  LYS J  91  ? SER J  100 ? LYS J 91  SER J 100 1 ? 10 
HELX_P HELX_P58  58  LEU J  132 ? LEU J  139 ? LEU J 132 LEU J 139 1 ? 8  
HELX_P HELX_P59  59  ARG K  115 ? PHE K  121 ? ARG K 115 PHE K 121 1 ? 7  
HELX_P HELX_P60  60  PHE K  121 ? SER K  126 ? PHE K 121 SER K 126 1 ? 6  
HELX_P HELX_P61  61  SER L  3   ? GLN L  8   ? SER L 2   GLN L 7   1 ? 6  
HELX_P HELX_P62  62  GLY L  24  ? GLY L  29  ? GLY L 23  GLY L 28  5 ? 6  
HELX_P HELX_P63  63  VAL L  67  ? GLU L  72  ? VAL L 66  GLU L 71  1 ? 6  
HELX_P HELX_P64  64  ARG L  95  ? VAL L  97  ? ARG L 94  VAL L 96  5 ? 3  
HELX_P HELX_P65  65  SER L  127 ? GLY L  136 ? SER L 126 GLY L 135 1 ? 10 
HELX_P HELX_P66  66  SER M  4   ? LYS M  14  ? SER M 3   LYS M 13  1 ? 11 
HELX_P HELX_P67  67  ASP M  18  ? ARG M  33  ? ASP M 17  ARG M 32  1 ? 16 
HELX_P HELX_P68  68  ARG M  46  ? GLY M  54  ? ARG M 45  GLY M 53  1 ? 9  
HELX_P HELX_P69  69  ARG M  83  ? GLN M  87  ? ARG M 82  GLN M 86  5 ? 5  
HELX_P HELX_P70  70  ASP M  97  ? PHE M  110 ? ASP M 96  PHE M 109 1 ? 14 
HELX_P HELX_P71  71  HIS M  139 ? ASN M  144 ? HIS M 138 ASN M 143 1 ? 6  
HELX_P HELX_P72  72  LEU M  148 ? ALA M  157 ? LEU M 147 ALA M 156 5 ? 10 
HELX_P HELX_P73  73  ASP M  158 ? GLY M  163 ? ASP M 157 GLY M 162 5 ? 6  
HELX_P HELX_P74  74  THR M  165 ? ARG M  172 ? THR M 164 ARG M 171 1 ? 8  
HELX_P HELX_P75  75  LEU M  188 ? GLY M  192 ? LEU M 187 GLY M 191 5 ? 5  
HELX_P HELX_P76  76  MET N  11  ? GLU N  16  ? MET N 10  GLU N 15  1 ? 6  
HELX_P HELX_P77  77  ASP N  20  ? LYS N  29  ? ASP N 19  LYS N 28  1 ? 10 
HELX_P HELX_P78  78  SER N  65  ? GLY N  71  ? SER N 64  GLY N 70  5 ? 7  
HELX_P HELX_P79  79  ASN N  78  ? ASN N  78  ? ASN N 77  ASN N 77  1 ? 1  
HELX_P HELX_P80  80  MET N  79  ? ALA N  96  ? MET N 78  ALA N 95  1 ? 18 
HELX_P HELX_P81  81  SER N  114 ? ALA N  126 ? SER N 113 ALA N 125 1 ? 13 
HELX_P HELX_P82  82  ASN N  133 ? LEU N  137 ? ASN N 132 LEU N 136 5 ? 5  
HELX_P HELX_P83  83  ASP N  139 ? GLY N  145 ? ASP N 138 GLY N 144 1 ? 7  
HELX_P HELX_P84  84  GLY N  145 ? GLN N  154 ? GLY N 144 GLN N 153 1 ? 10 
HELX_P HELX_P85  85  PRO N  170 ? ASP N  182 ? PRO N 169 ASP N 181 1 ? 13 
HELX_P HELX_P86  86  ASN O  5   ? SER O  22  ? ASN O 4   SER O 21  1 ? 18 
HELX_P HELX_P87  87  VAL O  26  ? GLU O  35  ? VAL O 25  GLU O 34  1 ? 10 
HELX_P HELX_P88  88  PRO O  37  ? HIS O  41  ? PRO O 36  HIS O 40  5 ? 5  
HELX_P HELX_P89  89  LEU O  46  ? ALA O  53  ? LEU O 45  ALA O 52  1 ? 8  
HELX_P HELX_P90  90  SER O  83  ? GLY O  94  ? SER O 82  GLY O 93  1 ? 12 
HELX_P HELX_P91  91  SER O  98  ? ASN O  106 ? SER O 97  ASN O 105 1 ? 9  
HELX_P HELX_P92  92  LEU P  4   ? LEU P  15  ? LEU P 3   LEU P 14  1 ? 12 
HELX_P HELX_P93  93  GLY P  18  ? ASN P  20  ? GLY P 17  ASN P 19  5 ? 3  
HELX_P HELX_P94  94  ARG P  28  ? ASP P  34  ? ARG P 27  ASP P 33  1 ? 7  
HELX_P HELX_P95  95  THR P  37  ? GLU P  47  ? THR P 36  GLU P 46  1 ? 11 
HELX_P HELX_P96  96  ARG P  60  ? TYR P  72  ? ARG P 59  TYR P 71  1 ? 13 
HELX_P HELX_P97  97  GLY P  77  ? ALA P  78  ? GLY P 76  ALA P 77  5 ? 2  
HELX_P HELX_P98  98  GLY P  79  ? ARG P  81  ? GLY P 78  ARG P 80  5 ? 3  
HELX_P HELX_P99  99  LYS P  84  ? GLN P  89  ? LYS P 83  GLN P 88  1 ? 6  
HELX_P HELX_P100 100 ASN P  90  ? GLU P  112 ? ASN P 89  GLU P 111 1 ? 23 
HELX_P HELX_P101 101 SER P  116 ? GLY P  128 ? SER P 115 GLY P 127 1 ? 13 
HELX_P HELX_P102 102 SER P  134 ? ASP P  143 ? SER P 133 ASP P 142 1 ? 10 
HELX_P HELX_P103 103 LYS Q  18  ? ARG Q  22  ? LYS Q 17  ARG Q 21  5 ? 5  
HELX_P HELX_P104 104 PRO Q  26  ? GLU Q  32  ? PRO Q 25  GLU Q 31  1 ? 7  
HELX_P HELX_P105 105 HIS Q  54  ? ASP Q  58  ? HIS Q 53  ASP Q 57  5 ? 5  
HELX_P HELX_P106 106 THR Q  88  ? ALA Q  90  ? THR Q 87  ALA Q 89  5 ? 3  
HELX_P HELX_P107 107 SER R  25  ? LYS R  37  ? SER R 24  LYS R 36  1 ? 13 
HELX_P HELX_P108 108 THR R  40  ? GLU R  53  ? THR R 39  GLU R 52  1 ? 14 
HELX_P HELX_P109 109 PRO R  82  ? GLN R  103 ? PRO R 81  GLN R 102 1 ? 22 
HELX_P HELX_P110 110 ALA R  130 ? GLY R  132 ? ALA R 129 GLY R 131 5 ? 3  
HELX_P HELX_P111 111 THR S  12  ? PHE S  21  ? THR S 11  PHE S 20  1 ? 10 
HELX_P HELX_P112 112 SER S  34  ? ASP S  47  ? SER S 33  ASP S 46  1 ? 14 
HELX_P HELX_P113 113 VAL S  78  ? VAL S  78  ? VAL S 77  VAL S 77  5 ? 1  
HELX_P HELX_P114 114 ALA S  79  ? ILE S  82  ? ALA S 78  ILE S 81  5 ? 4  
HELX_P HELX_P115 115 GLN T  4   ? ARG T  14  ? GLN T 3   ARG T 13  1 ? 11 
HELX_P HELX_P116 116 PRO T  16  ? GLN T  23  ? PRO T 15  GLN T 22  5 ? 8  
HELX_P HELX_P117 117 SER T  29  ? GLY T  37  ? SER T 28  GLY T 36  1 ? 9  
HELX_P HELX_P118 118 ASP T  93  ? SER T  95  ? ASP T 92  SER T 94  5 ? 3  
HELX_P HELX_P119 119 ASP T  106 ? SER T  115 ? ASP T 105 SER T 114 1 ? 10 
HELX_P HELX_P120 120 SER U  34  ? LEU U  43  ? SER U 33  LEU U 42  1 ? 10 
HELX_P HELX_P121 121 GLU U  46  ? LEU U  50  ? GLU U 45  LEU U 49  5 ? 5  
HELX_P HELX_P122 122 HIS V  5   ? ASP V  11  ? HIS V 4   ASP V 10  1 ? 7  
HELX_P HELX_P123 123 THR V  13  ? ALA V  37  ? THR V 12  ALA V 36  1 ? 25 
HELX_P HELX_P124 124 GLY V  45  ? GLU V  64  ? GLY V 44  GLU V 63  1 ? 20 
HELX_P HELX_P125 125 HIS W  14  ? LEU W  24  ? HIS W 14  LEU W 24  1 ? 11 
HELX_P HELX_P126 126 THR W  38  ? VAL W  48  ? THR W 38  VAL W 48  1 ? 11 
HELX_P HELX_P127 127 SER W  58  ? ALA W  70  ? SER W 58  ALA W 70  1 ? 13 
HELX_P HELX_P128 128 ASP W  80  ? THR W  88  ? ASP W 80  THR W 88  1 ? 9  
HELX_P HELX_P129 129 ASP W  92  ? SER W  102 ? ASP W 92  SER W 102 1 ? 11 
HELX_P HELX_P130 130 PRO W  131 ? GLY W  135 ? PRO W 131 GLY W 135 5 ? 5  
HELX_P HELX_P131 131 ASP W  142 ? MET W  153 ? ASP W 142 MET W 153 1 ? 12 
HELX_P HELX_P132 132 LEU X  15  ? ALA X  20  ? LEU X 14  ALA X 19  5 ? 6  
HELX_P HELX_P133 133 PRO X  22  ? HIS X  24  ? PRO X 21  HIS X 23  5 ? 3  
HELX_P HELX_P134 134 LYS X  25  ? PHE X  42  ? LYS X 24  PHE X 41  1 ? 18 
HELX_P HELX_P135 135 ASP X  45  ? VAL X  49  ? ASP X 44  VAL X 48  5 ? 5  
HELX_P HELX_P136 136 ASP X  52  ? TRP X  60  ? ASP X 51  TRP X 59  1 ? 9  
HELX_P HELX_P137 137 SER Y  111 ? GLY Y  125 ? SER Y 110 GLY Y 124 1 ? 15 
HELX_P HELX_P138 138 GLU Y  166 ? ARG Y  170 ? GLU Y 165 ARG Y 169 5 ? 5  
HELX_P HELX_P139 139 ASN Y  190 ? LEU Y  194 ? ASN Y 189 LEU Y 193 5 ? 5  
HELX_P HELX_P140 140 GLY Y  211 ? ALA Y  225 ? GLY Y 210 ALA Y 224 1 ? 15 
HELX_P HELX_P141 141 SER Z  35  ? GLY Z  39  ? SER Z 35  GLY Z 39  5 ? 5  
HELX_P HELX_P142 142 GLY Z  43  ? GLU Z  59  ? GLY Z 43  GLU Z 59  1 ? 17 
HELX_P HELX_P143 143 THR Z  97  ? ARG Z  105 ? THR Z 97  ARG Z 105 1 ? 9  
HELX_P HELX_P144 144 GLY AA 5   ? GLY AA 10  ? GLY 1 4   GLY 1 9   1 ? 6  
HELX_P HELX_P145 145 TYR AA 49  ? SER AA 53  ? TYR 1 48  SER 1 52  5 ? 5  
HELX_P HELX_P146 146 SER BA 5   ? ASN BA 19  ? SER 2 4   ASN 2 18  1 ? 15 
HELX_P HELX_P147 147 PRO BA 23  ? THR BA 30  ? PRO 2 22  THR 2 29  1 ? 8  
HELX_P HELX_P148 148 LYS CA 34  ? ASN CA 43  ? LYS 3 34  ASN 3 43  1 ? 10 
HELX_P HELX_P149 149 ASP CA 49  ? LYS CA 54  ? ASP 3 49  LYS 3 54  5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1    covale both ? DA G   627  "O3'" ? ? ? 1_555 DA 1MA 628  P  ? ? 0 G   627  0 1MA 628  1_555 ? ? ? ? ? ? ? 1.612 ? 
covale2    covale both ? DA 1MA 628  "O3'" ? ? ? 1_555 DA A   629  P  ? ? 0 1MA 628  0 A   629  1_555 ? ? ? ? ? ? ? 1.602 ? 
covale3    covale both ? DA U   2586 "O3'" ? ? ? 1_555 DA OMU 2587 P  ? ? 0 U   2586 0 OMU 2587 1_555 ? ? ? ? ? ? ? 1.593 ? 
covale4    covale both ? DA OMU 2587 "O3'" ? ? ? 1_555 DA OMG 2588 P  ? ? 0 OMU 2587 0 OMG 2588 1_555 ? ? ? ? ? ? ? 1.603 ? 
covale5    covale both ? DA OMG 2588 "O3'" ? ? ? 1_555 DA U   2589 P  ? ? 0 OMG 2588 0 U   2589 1_555 ? ? ? ? ? ? ? 1.608 ? 
covale6    covale both ? DA G   2618 "O3'" ? ? ? 1_555 DA UR3 2619 P  ? ? 0 G   2618 0 UR3 2619 1_555 ? ? ? ? ? ? ? 1.613 ? 
covale7    covale both ? DA UR3 2619 "O3'" ? ? ? 1_555 DA U   2620 P  ? ? 0 UR3 2619 0 U   2620 1_555 ? ? ? ? ? ? ? 1.606 ? 
covale8    covale both ? DA U   2620 "O3'" ? ? ? 1_555 DA PSU 2621 P  ? ? 0 U   2620 0 PSU 2621 1_555 ? ? ? ? ? ? ? 1.597 ? 
covale9    covale both ? DA PSU 2621 "O3'" ? ? ? 1_555 DA A   2622 P  ? ? 0 PSU 2621 0 A   2622 1_555 ? ? ? ? ? ? ? 1.607 ? 
covale10   covale both ? GA C   2    "O3'" ? ? ? 1_555 GA 8AN 3    P  ? ? 6 C   75   6 8AN 76   1_555 ? ? ? ? ? ? ? 1.591 ? 
metalc1    metalc ?    ? A  ASN 189  O     ? ? ? 1_555 EE MG  .    MG ? ? A ASN 188  0 MG  8052 1_555 ? ? ? ? ? ? ? 2.307 ? 
metalc2    metalc ?    ? A  HIS 209  O     ? ? ? 1_555 LA SR  .    SR ? ? A HIS 208  A SR  8929 1_555 ? ? ? ? ? ? ? 2.730 ? 
metalc3    metalc ?    ? C  ASP 45   OD1   ? ? ? 1_555 UA NA  .    NA ? ? C ASP 45   C NA  8503 1_555 ? ? ? ? ? ? ? 2.806 ? 
metalc4    metalc ?    ? C  ARG 55   O     ? ? ? 1_555 NH NA  .    NA ? ? C ARG 55   0 NA  8558 1_555 ? ? ? ? ? ? ? 2.885 ? 
metalc5    metalc ?    ? C  LYS 96   O     ? ? ? 1_555 UA NA  .    NA ? ? C LYS 96   C NA  8503 1_555 ? ? ? ? ? ? ? 2.742 ? 
metalc6    metalc ?    ? H  ASP 13   O     ? ? ? 1_555 XA SR  .    SR ? ? H ASP 13   H SR  8907 1_555 ? ? ? ? ? ? ? 2.732 ? 
metalc7    metalc ?    ? J  VAL 61   O     ? ? ? 1_555 AB NA  .    NA ? ? J VAL 61   J NA  8538 1_555 ? ? ? ? ? ? ? 2.893 ? 
metalc8    metalc ?    ? J  ILE 63   O     ? ? ? 1_555 AB NA  .    NA ? ? J ILE 63   J NA  8538 1_555 ? ? ? ? ? ? ? 2.866 ? 
metalc9    metalc ?    ? J  TYR 69   O     ? ? ? 1_555 AB NA  .    NA ? ? J TYR 69   J NA  8538 1_555 ? ? ? ? ? ? ? 2.715 ? 
metalc10   metalc ?    ? L  ASP 37   O     ? ? ? 1_555 PJ SR  .    SR ? ? L ASP 36   0 SR  8940 1_555 ? ? ? ? ? ? ? 2.756 ? 
metalc11   metalc ?    ? M  SER 107  OG    ? ? ? 1_555 IB NA  .    NA ? ? M SER 106  M NA  8539 1_555 ? ? ? ? ? ? ? 2.784 ? 
metalc12   metalc ?    ? M  PRO 111  O     ? ? ? 1_555 IB NA  .    NA ? ? M PRO 110  M NA  8539 1_555 ? ? ? ? ? ? ? 2.748 ? 
metalc13   metalc ?    ? M  LEU 113  O     ? ? ? 1_555 IB NA  .    NA ? ? M LEU 112  M NA  8539 1_555 ? ? ? ? ? ? ? 2.880 ? 
metalc14   metalc ?    ? M  LYS 194  O     ? ? ? 1_555 LH NA  .    NA ? ? M LYS 193  0 NA  8556 1_555 ? ? ? ? ? ? ? 2.959 ? 
metalc15   metalc ?    ? Q  ASP 21   O     ? ? ? 1_555 NB NA  .    NA ? ? Q ASP 20   Q NA  8540 1_555 ? ? ? ? ? ? ? 2.789 ? 
metalc16   metalc ?    ? Q  GLY 23   O     ? ? ? 1_555 NB NA  .    NA ? ? Q GLY 22   Q NA  8540 1_555 ? ? ? ? ? ? ? 2.725 ? 
metalc17   metalc ?    ? Q  SER 25   OG    ? ? ? 1_555 NB NA  .    NA ? ? Q SER 24   Q NA  8540 1_555 ? ? ? ? ? ? ? 2.726 ? 
metalc18   metalc ?    ? Q  SER 47   OG    ? ? ? 1_555 NB NA  .    NA ? ? Q SER 46   Q NA  8540 1_555 ? ? ? ? ? ? ? 2.990 ? 
metalc19   metalc ?    ? R  GLN 62   O     ? ? ? 1_555 RB SR  .    SR ? ? R GLN 61   R SR  8912 1_555 ? ? ? ? ? ? ? 2.726 ? 
metalc20   metalc ?    ? R  SER 71   O     ? ? ? 1_555 PB NA  .    NA ? ? R SER 70   R NA  8532 1_555 ? ? ? ? ? ? ? 2.813 ? 
metalc21   metalc ?    ? R  VAL 73   O     ? ? ? 1_555 TG NA  .    NA ? ? R VAL 72   0 NA  8533 1_555 ? ? ? ? ? ? ? 2.855 ? 
metalc22   metalc ?    ? R  VAL 73   O     ? ? ? 1_555 PB NA  .    NA ? ? R VAL 72   R NA  8532 1_555 ? ? ? ? ? ? ? 2.894 ? 
metalc23   metalc ?    ? T  SER 95   OG    ? ? ? 1_555 XG NA  .    NA ? ? T SER 94   0 NA  8537 1_555 ? ? ? ? ? ? ? 2.858 ? 
metalc24   metalc ?    ? T  ASN 96   OD1   ? ? ? 1_555 XG NA  .    NA ? ? T ASN 95   0 NA  8537 1_555 ? ? ? ? ? ? ? 2.764 ? 
metalc25   metalc ?    ? T  LEU 113  O     ? ? ? 1_555 VB MG  .    MG ? ? T LEU 112  T MG  8057 1_555 ? ? ? ? ? ? ? 2.482 ? 
metalc26   metalc ?    ? AA LYS 11   O     ? ? ? 1_555 DC SR  .    SR ? ? 1 LYS 10   1 SR  8913 1_555 ? ? ? ? ? ? ? 2.726 ? 
metalc27   metalc ?    ? AA ASP 48   O     ? ? ? 1_555 EC SR  .    SR ? ? 1 ASP 47   1 SR  8952 1_555 ? ? ? ? ? ? ? 2.469 ? 
metalc28   metalc ?    ? BA TRP 43   O     ? ? ? 1_555 DG NA  .    NA ? ? 2 TRP 42   0 NA  8515 1_555 ? ? ? ? ? ? ? 2.671 ? 
metalc29   metalc ?    ? BA ASN 46   O     ? ? ? 1_555 DG NA  .    NA ? ? 2 ASN 45   0 NA  8515 1_555 ? ? ? ? ? ? ? 2.740 ? 
metalc30   metalc ?    ? DA C   40   "O2'" ? ? ? 1_555 VF NA  .    NA ? ? 0 C   40   0 NA  8506 1_555 ? ? ? ? ? ? ? 2.923 ? 
metalc31   metalc ?    ? DA C   40   O2    ? ? ? 1_555 VF NA  .    NA ? ? 0 C   40   0 NA  8506 1_555 ? ? ? ? ? ? ? 2.858 ? 
metalc32   metalc ?    ? DA G   41   "O4'" ? ? ? 1_555 VF NA  .    NA ? ? 0 G   41   0 NA  8506 1_555 ? ? ? ? ? ? ? 2.988 ? 
metalc33   metalc ?    ? DA G   56   O6    ? ? ? 1_555 LG NA  .    NA ? ? 0 G   56   0 NA  8524 1_555 ? ? ? ? ? ? ? 2.977 ? 
metalc34   metalc ?    ? DA A   59   N3    ? ? ? 1_555 LG NA  .    NA ? ? 0 A   59   0 NA  8524 1_555 ? ? ? ? ? ? ? 2.943 ? 
metalc35   metalc ?    ? DA G   61   N7    ? ? ? 1_555 LG NA  .    NA ? ? 0 G   61   0 NA  8524 1_555 ? ? ? ? ? ? ? 2.862 ? 
metalc36   metalc ?    ? DA C   85   OP1   ? ? ? 1_555 TB SR  .    SR ? ? 0 C   85   T SR  8911 1_555 ? ? ? ? ? ? ? 2.784 ? 
metalc37   metalc ?    ? DA U   107  O4    ? ? ? 1_555 MG NA  .    NA ? ? 0 U   107  0 NA  8525 1_555 ? ? ? ? ? ? ? 2.977 ? 
metalc38   metalc ?    ? DA U   108  O2    ? ? ? 1_555 MG NA  .    NA ? ? 0 U   108  0 NA  8525 1_555 ? ? ? ? ? ? ? 2.872 ? 
metalc39   metalc ?    ? DA C   130  O2    ? ? ? 1_555 HG NA  .    NA ? ? 0 C   130  0 NA  8520 1_555 ? ? ? ? ? ? ? 2.747 ? 
metalc40   metalc ?    ? DA U   146  O4    ? ? ? 1_555 HG NA  .    NA ? ? 0 U   146  0 NA  8520 1_555 ? ? ? ? ? ? ? 2.896 ? 
metalc41   metalc ?    ? DA A   165  OP2   ? ? ? 1_555 BG NA  .    NA ? ? 0 A   165  0 NA  8513 1_555 ? ? ? ? ? ? ? 2.855 ? 
metalc42   metalc ?    ? DA A   165  N7    ? ? ? 1_555 KE MG  .    MG ? ? 0 A   165  0 MG  8061 1_555 ? ? ? ? ? ? ? 2.374 ? 
metalc43   metalc ?    ? DA A   166  OP1   ? ? ? 1_555 GE MG  .    MG ? ? 0 A   166  0 MG  8055 1_555 ? ? ? ? ? ? ? 2.388 ? 
metalc44   metalc ?    ? DA A   166  "O2'" ? ? ? 1_555 BG NA  .    NA ? ? 0 A   166  0 NA  8513 1_555 ? ? ? ? ? ? ? 2.866 ? 
metalc45   metalc ?    ? DA C   168  OP2   ? ? ? 1_555 KE MG  .    MG ? ? 0 C   168  0 MG  8061 1_555 ? ? ? ? ? ? ? 2.459 ? 
metalc46   metalc ?    ? DA U   170  O2    ? ? ? 1_555 OG NA  .    NA ? ? 0 U   170  0 NA  8527 1_555 ? ? ? ? ? ? ? 2.772 ? 
metalc47   metalc ?    ? DA G   196  N7    ? ? ? 1_555 UH NA  .    NA ? ? 0 G   196  0 NA  8565 1_555 ? ? ? ? ? ? ? 2.942 ? 
metalc48   metalc ?    ? DA G   196  O6    ? ? ? 1_555 UH NA  .    NA ? ? 0 G   196  0 NA  8565 1_555 ? ? ? ? ? ? ? 2.851 ? 
metalc49   metalc ?    ? DA C   218  "O2'" ? ? ? 1_555 OG NA  .    NA ? ? 0 C   218  0 NA  8527 1_555 ? ? ? ? ? ? ? 2.968 ? 
metalc50   metalc ?    ? DA G   221  O6    ? ? ? 1_555 OG NA  .    NA ? ? 0 G   221  0 NA  8527 1_555 ? ? ? ? ? ? ? 2.982 ? 
metalc51   metalc ?    ? DA U   308  O4    ? ? ? 1_555 XG NA  .    NA ? ? 0 U   308  0 NA  8537 1_555 ? ? ? ? ? ? ? 2.878 ? 
metalc52   metalc ?    ? DA U   335  "O2'" ? ? ? 1_555 XG NA  .    NA ? ? 0 U   335  0 NA  8537 1_555 ? ? ? ? ? ? ? 2.939 ? 
metalc53   metalc ?    ? DA C   342  O2    ? ? ? 1_555 XG NA  .    NA ? ? 0 C   342  0 NA  8537 1_555 ? ? ? ? ? ? ? 2.851 ? 
metalc54   metalc ?    ? DA G   386  O6    ? ? ? 1_555 PG NA  .    NA ? ? 0 G   386  0 NA  8528 1_555 ? ? ? ? ? ? ? 2.914 ? 
metalc55   metalc ?    ? DA U   392  "O4'" ? ? ? 1_555 LH NA  .    NA ? ? 0 U   392  0 NA  8556 1_555 ? ? ? ? ? ? ? 2.921 ? 
metalc56   metalc ?    ? DA U   398  O2    ? ? ? 1_555 LH NA  .    NA ? ? 0 U   398  0 NA  8556 1_555 ? ? ? ? ? ? ? 2.919 ? 
metalc57   metalc ?    ? DA U   402  O4    ? ? ? 1_555 PG NA  .    NA ? ? 0 U   402  0 NA  8528 1_555 ? ? ? ? ? ? ? 2.996 ? 
metalc58   metalc ?    ? DA A   415  "O2'" ? ? ? 1_555 UH NA  .    NA ? ? 0 A   415  0 NA  8565 1_555 ? ? ? ? ? ? ? 2.974 ? 
metalc59   metalc ?    ? DA A   415  N3    ? ? ? 1_555 UH NA  .    NA ? ? 0 A   415  0 NA  8565 1_555 ? ? ? ? ? ? ? 2.972 ? 
metalc60   metalc ?    ? DA G   416  "O4'" ? ? ? 1_555 UH NA  .    NA ? ? 0 G   416  0 NA  8565 1_555 ? ? ? ? ? ? ? 2.892 ? 
metalc61   metalc ?    ? DA A   429  OP2   ? ? ? 1_555 ZK SR  .    SR ? ? 0 A   429  0 SR  8984 1_555 ? ? ? ? ? ? ? 2.633 ? 
metalc62   metalc ?    ? DA A   453  "O2'" ? ? ? 1_555 GH NA  .    NA ? ? 0 A   453  0 NA  8551 1_555 ? ? ? ? ? ? ? 2.941 ? 
metalc63   metalc ?    ? DA A   459  OP1   ? ? ? 1_555 OC MG  .    MG ? ? 0 A   459  0 MG  8004 1_555 ? ? ? ? ? ? ? 2.382 ? 
metalc64   metalc ?    ? DA G   475  OP2   ? ? ? 1_555 NH NA  .    NA ? ? 0 G   475  0 NA  8558 1_555 ? ? ? ? ? ? ? 2.904 ? 
metalc65   metalc ?    ? DA C   478  OP1   ? ? ? 1_555 GH NA  .    NA ? ? 0 C   478  0 NA  8551 1_555 ? ? ? ? ? ? ? 2.869 ? 
metalc66   metalc ?    ? DA G   479  OP2   ? ? ? 1_555 GH NA  .    NA ? ? 0 G   479  0 NA  8551 1_555 ? ? ? ? ? ? ? 2.947 ? 
metalc67   metalc ?    ? DA G   545  O6    ? ? ? 1_555 MH NA  .    NA ? ? 0 G   545  0 NA  8557 1_555 ? ? ? ? ? ? ? 2.830 ? 
metalc68   metalc ?    ? DA U   611  O4    ? ? ? 1_555 MH NA  .    NA ? ? 0 U   611  0 NA  8557 1_555 ? ? ? ? ? ? ? 2.912 ? 
metalc69   metalc ?    ? DA U   623  "O2'" ? ? ? 1_555 ZG NA  .    NA ? ? 0 U   623  0 NA  8542 1_555 ? ? ? ? ? ? ? 2.997 ? 
metalc70   metalc ?    ? DA U   623  O4    ? ? ? 1_555 RG NA  .    NA ? ? 0 U   623  0 NA  8530 1_555 ? ? ? ? ? ? ? 2.827 ? 
metalc71   metalc ?    ? DA 1MA 628  "O2'" ? ? ? 1_555 RG NA  .    NA ? ? 0 1MA 628  0 NA  8530 1_555 ? ? ? ? ? ? ? 2.915 ? 
metalc72   metalc ?    ? DA A   630  "O2'" ? ? ? 1_555 TF NA  .    NA ? ? 0 A   630  0 NA  8504 1_555 ? ? ? ? ? ? ? 2.964 ? 
metalc73   metalc ?    ? DA A   630  N3    ? ? ? 1_555 TF NA  .    NA ? ? 0 A   630  0 NA  8504 1_555 ? ? ? ? ? ? ? 2.720 ? 
metalc74   metalc ?    ? DA A   631  "O2'" ? ? ? 1_555 TF NA  .    NA ? ? 0 A   631  0 NA  8504 1_555 ? ? ? ? ? ? ? 2.816 ? 
metalc75   metalc ?    ? DA U   768  "O2'" ? ? ? 1_555 AH NA  .    NA ? ? 0 U   768  0 NA  8545 1_555 ? ? ? ? ? ? ? 2.997 ? 
metalc76   metalc ?    ? DA A   776  "O2'" ? ? ? 1_555 IG NA  .    NA ? ? 0 A   776  0 NA  8521 1_555 ? ? ? ? ? ? ? 2.889 ? 
metalc77   metalc ?    ? DA U   821  OP2   ? ? ? 1_555 KG NA  .    NA ? ? 0 U   821  0 NA  8523 1_555 ? ? ? ? ? ? ? 2.907 ? 
metalc78   metalc ?    ? DA C   822  OP2   ? ? ? 1_555 YJ SR  .    SR ? ? 0 C   822  0 SR  8949 1_555 ? ? ? ? ? ? ? 2.626 ? 
metalc79   metalc ?    ? DA G   824  N7    ? ? ? 1_555 KI SR  .    SR ? ? 0 G   824  0 SR  8901 1_555 ? ? ? ? ? ? ? 2.558 ? 
metalc80   metalc ?    ? DA U   831  O2    ? ? ? 1_555 YH NA  .    NA ? ? 0 U   831  0 NA  8569 1_555 ? ? ? ? ? ? ? 2.874 ? 
metalc81   metalc ?    ? DA G   836  OP1   ? ? ? 1_555 LI SR  .    SR ? ? 0 G   836  0 SR  8902 1_555 ? ? ? ? ? ? ? 2.643 ? 
metalc82   metalc ?    ? DA A   844  OP1   ? ? ? 1_555 VC MG  .    MG ? ? 0 A   844  0 MG  8011 1_555 ? ? ? ? ? ? ? 2.203 ? 
metalc83   metalc ?    ? DA G   854  OP1   ? ? ? 1_555 KG NA  .    NA ? ? 0 G   854  0 NA  8523 1_555 ? ? ? ? ? ? ? 2.911 ? 
metalc84   metalc ?    ? DA G   854  OP1   ? ? ? 1_555 YJ SR  .    SR ? ? 0 G   854  0 SR  8949 1_555 ? ? ? ? ? ? ? 2.633 ? 
metalc85   metalc ?    ? DA G   854  N7    ? ? ? 1_555 KI SR  .    SR ? ? 0 G   854  0 SR  8901 1_555 ? ? ? ? ? ? ? 2.452 ? 
metalc86   metalc ?    ? DA G   865  O6    ? ? ? 1_555 IG NA  .    NA ? ? 0 G   865  0 NA  8521 1_555 ? ? ? ? ? ? ? 2.789 ? 
metalc87   metalc ?    ? DA G   877  OP2   ? ? ? 1_555 NC MG  .    MG ? ? 0 G   877  0 MG  8003 1_555 ? ? ? ? ? ? ? 2.367 ? 
metalc88   metalc ?    ? DA C   896  O2    ? ? ? 1_555 CG NA  .    NA ? ? 0 C   896  0 NA  8514 1_555 ? ? ? ? ? ? ? 2.949 ? 
metalc89   metalc ?    ? DA A   914  "O3'" ? ? ? 1_555 YG NA  .    NA ? ? 0 A   914  0 NA  8541 1_555 ? ? ? ? ? ? ? 2.931 ? 
metalc90   metalc ?    ? DA U   919  OP1   ? ? ? 1_555 QC MG  .    MG ? ? 0 U   919  0 MG  8006 1_555 ? ? ? ? ? ? ? 2.454 ? 
metalc91   metalc ?    ? DA C   920  N3    ? ? ? 1_555 CH NA  .    NA ? ? 0 C   920  0 NA  8547 1_555 ? ? ? ? ? ? ? 2.827 ? 
metalc92   metalc ?    ? DA A   923  "O2'" ? ? ? 1_555 FH NA  .    NA ? ? 0 A   923  0 NA  8550 1_555 ? ? ? ? ? ? ? 2.722 ? 
metalc93   metalc ?    ? DA U   942  O4    ? ? ? 1_555 DH NA  .    NA ? ? 0 U   942  0 NA  8548 1_555 ? ? ? ? ? ? ? 2.697 ? 
metalc94   metalc ?    ? DA G   956  OP2   ? ? ? 1_555 ID MG  .    MG ? ? 0 G   956  0 MG  8026 1_555 ? ? ? ? ? ? ? 2.499 ? 
metalc95   metalc ?    ? DA G   1024 O6    ? ? ? 1_555 DH NA  .    NA ? ? 0 G   1024 0 NA  8548 1_555 ? ? ? ? ? ? ? 2.898 ? 
metalc96   metalc ?    ? DA C   1043 "O3'" ? ? ? 1_555 YG NA  .    NA ? ? 0 C   1043 0 NA  8541 1_555 ? ? ? ? ? ? ? 2.945 ? 
metalc97   metalc ?    ? DA A   1079 OP1   ? ? ? 1_555 CI NA  .    NA ? ? 0 A   1079 0 NA  8574 1_555 ? ? ? ? ? ? ? 2.936 ? 
metalc98   metalc ?    ? DA G   1121 OP2   ? ? ? 1_555 BD MG  .    MG ? ? 0 G   1121 0 MG  8018 1_555 ? ? ? ? ? ? ? 2.385 ? 
metalc99   metalc ?    ? DA A   1133 OP2   ? ? ? 1_555 EK SR  .    SR ? ? 0 A   1133 0 SR  8958 1_555 ? ? ? ? ? ? ? 2.752 ? 
metalc100  metalc ?    ? DA A   1287 OP1   ? ? ? 1_555 IE MG  .    MG ? ? 0 A   1287 0 MG  8058 1_555 ? ? ? ? ? ? ? 2.443 ? 
metalc101  metalc ?    ? DA G   1292 OP2   ? ? ? 1_555 MJ SR  .    SR ? ? 0 G   1292 0 SR  8936 1_555 ? ? ? ? ? ? ? 2.656 ? 
metalc102  metalc ?    ? DA U   1293 OP2   ? ? ? 1_555 WH NA  .    NA ? ? 0 U   1293 0 NA  8567 1_555 ? ? ? ? ? ? ? 2.786 ? 
metalc103  metalc ?    ? DA G   1354 OP1   ? ? ? 1_555 NI SR  .    SR ? ? 0 G   1354 0 SR  8904 1_555 ? ? ? ? ? ? ? 2.678 ? 
metalc104  metalc ?    ? DA C   1394 O2    ? ? ? 1_555 WF NA  .    NA ? ? 0 C   1394 0 NA  8507 1_555 ? ? ? ? ? ? ? 2.690 ? 
metalc105  metalc ?    ? DA G   1416 "O3'" ? ? ? 1_555 DG NA  .    NA ? ? 0 G   1416 0 NA  8515 1_555 ? ? ? ? ? ? ? 2.836 ? 
metalc106  metalc ?    ? DA C   1420 OP1   ? ? ? 1_555 VI SR  .    SR ? ? 0 C   1420 0 SR  8916 1_555 ? ? ? ? ? ? ? 2.737 ? 
metalc107  metalc ?    ? DA U   1432 O4    ? ? ? 1_555 WF NA  .    NA ? ? 0 U   1432 0 NA  8507 1_555 ? ? ? ? ? ? ? 2.724 ? 
metalc108  metalc ?    ? DA A   1448 OP2   ? ? ? 1_555 ED MG  .    MG ? ? 0 A   1448 0 MG  8021 1_555 ? ? ? ? ? ? ? 2.424 ? 
metalc109  metalc ?    ? DA G   1484 OP2   ? ? ? 1_555 UJ SR  .    SR ? ? 0 G   1484 0 SR  8945 1_555 ? ? ? ? ? ? ? 2.738 ? 
metalc110  metalc ?    ? DA G   1683 OP2   ? ? ? 1_555 QJ SR  .    SR ? ? 0 G   1683 0 SR  8941 1_555 ? ? ? ? ? ? ? 2.799 ? 
metalc111  metalc ?    ? DA A   1689 OP1   ? ? ? 1_555 VC MG  .    MG ? ? 0 A   1689 0 MG  8011 1_555 ? ? ? ? ? ? ? 2.283 ? 
metalc112  metalc ?    ? DA G   1706 N7    ? ? ? 1_555 SG NA  .    NA ? ? 0 G   1706 0 NA  8531 1_555 ? ? ? ? ? ? ? 2.955 ? 
metalc113  metalc ?    ? DA G   1706 O6    ? ? ? 1_555 SG NA  .    NA ? ? 0 G   1706 0 NA  8531 1_555 ? ? ? ? ? ? ? 2.838 ? 
metalc114  metalc ?    ? DA G   1707 O6    ? ? ? 1_555 SG NA  .    NA ? ? 0 G   1707 0 NA  8531 1_555 ? ? ? ? ? ? ? 2.764 ? 
metalc115  metalc ?    ? DA A   1717 OP2   ? ? ? 1_555 AJ SR  .    SR ? ? 0 A   1717 0 SR  8921 1_555 ? ? ? ? ? ? ? 2.746 ? 
metalc116  metalc ?    ? DA U   1724 "O2'" ? ? ? 1_555 WF NA  .    NA ? ? 0 U   1724 0 NA  8507 1_555 ? ? ? ? ? ? ? 2.932 ? 
metalc117  metalc ?    ? DA U   1724 O2    ? ? ? 1_555 WF NA  .    NA ? ? 0 U   1724 0 NA  8507 1_555 ? ? ? ? ? ? ? 2.937 ? 
metalc118  metalc ?    ? DA A   1747 OP2   ? ? ? 1_555 SI SR  .    SR ? ? 0 A   1747 0 SR  8910 1_555 ? ? ? ? ? ? ? 2.644 ? 
metalc119  metalc ?    ? DA U   1748 OP1   ? ? ? 1_555 GD MG  .    MG ? ? 0 U   1748 0 MG  8023 1_555 ? ? ? ? ? ? ? 2.419 ? 
metalc120  metalc ?    ? DA A   1755 OP1   ? ? ? 1_555 OI SR  .    SR ? ? 0 A   1755 0 SR  8905 1_555 ? ? ? ? ? ? ? 2.747 ? 
metalc121  metalc ?    ? DA C   1830 OP1   ? ? ? 1_555 XC MG  .    MG ? ? 0 C   1830 0 MG  8014 1_555 ? ? ? ? ? ? ? 2.470 ? 
metalc122  metalc ?    ? DA U   1831 "O3'" ? ? ? 1_555 KG NA  .    NA ? ? 0 U   1831 0 NA  8523 1_555 ? ? ? ? ? ? ? 2.907 ? 
metalc123  metalc ?    ? DA U   1831 "O2'" ? ? ? 1_555 KG NA  .    NA ? ? 0 U   1831 0 NA  8523 1_555 ? ? ? ? ? ? ? 2.735 ? 
metalc124  metalc ?    ? DA U   1838 OP1   ? ? ? 1_555 PC MG  .    MG ? ? 0 U   1838 0 MG  8005 1_555 ? ? ? ? ? ? ? 2.473 ? 
metalc125  metalc ?    ? DA A   1839 OP2   ? ? ? 1_555 PC MG  .    MG ? ? 0 A   1839 0 MG  8005 1_555 ? ? ? ? ? ? ? 2.500 ? 
metalc126  metalc ?    ? DA U   1846 OP2   ? ? ? 1_555 EE MG  .    MG ? ? 0 U   1846 0 MG  8052 1_555 ? ? ? ? ? ? ? 2.429 ? 
metalc127  metalc ?    ? DA C   1894 O2    ? ? ? 1_555 QG NA  .    NA ? ? 0 C   1894 0 NA  8529 1_555 ? ? ? ? ? ? ? 2.825 ? 
metalc128  metalc ?    ? DA G   1896 N7    ? ? ? 1_555 QG NA  .    NA ? ? 0 G   1896 0 NA  8529 1_555 ? ? ? ? ? ? ? 2.665 ? 
metalc129  metalc ?    ? DA G   1971 O6    ? ? ? 1_555 JG NA  .    NA ? ? 0 G   1971 0 NA  8522 1_555 ? ? ? ? ? ? ? 2.893 ? 
metalc130  metalc ?    ? DA U   2012 O4    ? ? ? 1_555 JG NA  .    NA ? ? 0 U   2012 0 NA  8522 1_555 ? ? ? ? ? ? ? 2.843 ? 
metalc131  metalc ?    ? DA G   2094 N7    ? ? ? 1_555 UF NA  .    NA ? ? 0 G   2094 0 NA  8505 1_555 ? ? ? ? ? ? ? 2.945 ? 
metalc132  metalc ?    ? DA U   2109 OP2   ? ? ? 1_555 FH NA  .    NA ? ? 0 U   2109 0 NA  8550 1_555 ? ? ? ? ? ? ? 2.808 ? 
metalc133  metalc ?    ? DA G   2110 OP2   ? ? ? 1_555 IH NA  .    NA ? ? 0 G   2110 0 NA  8553 1_555 ? ? ? ? ? ? ? 2.934 ? 
metalc134  metalc ?    ? DA G   2111 OP1   ? ? ? 1_555 IH NA  .    NA ? ? 0 G   2111 0 NA  8553 1_555 ? ? ? ? ? ? ? 2.938 ? 
metalc135  metalc ?    ? DA A   2112 N3    ? ? ? 1_555 GG NA  .    NA ? ? 0 A   2112 0 NA  8519 1_555 ? ? ? ? ? ? ? 2.965 ? 
metalc136  metalc ?    ? DA U   2277 OP1   ? ? ? 1_555 IH NA  .    NA ? ? 0 U   2277 0 NA  8553 1_555 ? ? ? ? ? ? ? 2.873 ? 
metalc137  metalc ?    ? DA U   2278 OP1   ? ? ? 1_555 CH NA  .    NA ? ? 0 U   2278 0 NA  8547 1_555 ? ? ? ? ? ? ? 2.868 ? 
metalc138  metalc ?    ? DA A   2302 OP1   ? ? ? 1_555 XJ SR  .    SR ? ? 0 A   2302 0 SR  8948 1_555 ? ? ? ? ? ? ? 2.777 ? 
metalc139  metalc ?    ? DA A   2303 OP1   ? ? ? 1_555 XJ SR  .    SR ? ? 0 A   2303 0 SR  8948 1_555 ? ? ? ? ? ? ? 2.788 ? 
metalc140  metalc ?    ? DA C   2464 OP1   ? ? ? 1_555 QC MG  .    MG ? ? 0 C   2464 0 MG  8006 1_555 ? ? ? ? ? ? ? 2.339 ? 
metalc141  metalc ?    ? DA A   2465 OP1   ? ? ? 1_555 QC MG  .    MG ? ? 0 A   2465 0 MG  8006 1_555 ? ? ? ? ? ? ? 2.377 ? 
metalc142  metalc ?    ? DA C   2475 N4    ? ? ? 1_555 GG NA  .    NA ? ? 0 C   2475 0 NA  8519 1_555 ? ? ? ? ? ? ? 2.907 ? 
metalc143  metalc ?    ? DA A   2483 OP1   ? ? ? 1_555 MC MG  .    MG ? ? 0 A   2483 0 MG  8002 1_555 ? ? ? ? ? ? ? 2.303 ? 
metalc144  metalc ?    ? DA G   2540 O6    ? ? ? 1_555 QE MG  .    MG ? ? 0 G   2540 0 MG  8067 1_555 ? ? ? ? ? ? ? 2.363 ? 
metalc145  metalc ?    ? DA G   2543 N7    ? ? ? 1_555 EG NA  .    NA ? ? 0 G   2543 0 NA  8516 1_555 ? ? ? ? ? ? ? 2.956 ? 
metalc146  metalc ?    ? DA G   2579 N7    ? ? ? 1_555 XF NA  .    NA ? ? 0 G   2579 0 NA  8508 1_555 ? ? ? ? ? ? ? 2.799 ? 
metalc147  metalc ?    ? DA G   2579 O6    ? ? ? 1_555 XF NA  .    NA ? ? 0 G   2579 0 NA  8508 1_555 ? ? ? ? ? ? ? 2.899 ? 
metalc148  metalc ?    ? DA G   2585 OP1   ? ? ? 1_555 SI SR  .    SR ? ? 0 G   2585 0 SR  8910 1_555 ? ? ? ? ? ? ? 2.701 ? 
metalc149  metalc ?    ? DA U   2586 O4    ? ? ? 1_555 ZH NA  .    NA ? ? 0 U   2586 0 NA  8570 1_555 ? ? ? ? ? ? ? 2.807 ? 
metalc150  metalc ?    ? DA U   2607 "O2'" ? ? ? 1_555 AG NA  .    NA ? ? 0 U   2607 0 NA  8512 1_555 ? ? ? ? ? ? ? 2.950 ? 
metalc151  metalc ?    ? DA C   2608 OP1   ? ? ? 1_555 CD MG  .    MG ? ? 0 C   2608 0 MG  8019 1_555 ? ? ? ? ? ? ? 2.289 ? 
metalc152  metalc ?    ? DA G   2609 OP1   ? ? ? 1_555 CD MG  .    MG ? ? 0 G   2609 0 MG  8019 1_555 ? ? ? ? ? ? ? 2.364 ? 
metalc153  metalc ?    ? DA U   2610 OP2   ? ? ? 1_555 CD MG  .    MG ? ? 0 U   2610 0 MG  8019 1_555 ? ? ? ? ? ? ? 2.252 ? 
metalc154  metalc ?    ? DA G   2611 OP1   ? ? ? 1_555 EH NA  .    NA ? ? 0 G   2611 0 NA  8549 1_555 ? ? ? ? ? ? ? 2.840 ? 
metalc155  metalc ?    ? DA U   2615 OP1   ? ? ? 1_555 LI SR  .    SR ? ? 0 U   2615 0 SR  8902 1_555 ? ? ? ? ? ? ? 2.616 ? 
metalc156  metalc ?    ? DA U   2615 O4    ? ? ? 1_555 FG NA  .    NA ? ? 0 U   2615 0 NA  8517 1_555 ? ? ? ? ? ? ? 2.860 ? 
metalc157  metalc ?    ? DA A   2624 OP1   ? ? ? 1_555 NC MG  .    MG ? ? 0 A   2624 0 MG  8003 1_555 ? ? ? ? ? ? ? 2.371 ? 
metalc158  metalc ?    ? DA U   2645 "O2'" ? ? ? 1_555 UG NA  .    NA ? ? 0 U   2645 0 NA  8534 1_555 ? ? ? ? ? ? ? 2.878 ? 
metalc159  metalc ?    ? DA A   2649 N1    ? ? ? 1_555 UF NA  .    NA ? ? 0 A   2649 0 NA  8505 1_555 ? ? ? ? ? ? ? 2.936 ? 
metalc160  metalc ?    ? DA U   2659 "O3'" ? ? ? 1_555 TG NA  .    NA ? ? 0 U   2659 0 NA  8533 1_555 ? ? ? ? ? ? ? 2.987 ? 
metalc161  metalc ?    ? DA G   2755 O6    ? ? ? 1_555 DJ SR  .    SR ? ? 0 G   2755 0 SR  8924 1_555 ? ? ? ? ? ? ? 2.732 ? 
metalc162  metalc ?    ? EA G   92   OP1   ? ? ? 1_555 UK SR  .    SR ? ? 9 G   92   0 SR  8978 1_555 ? ? ? ? ? ? ? 2.770 ? 
metalc163  metalc ?    ? LC MG  .    MG    ? ? ? 1_555 FN HOH .    O  ? ? 0 MG  8001 0 HOH 3751 1_555 ? ? ? ? ? ? ? 2.390 ? 
metalc164  metalc ?    ? LC MG  .    MG    ? ? ? 1_555 FN HOH .    O  ? ? 0 MG  8001 0 HOH 7070 1_555 ? ? ? ? ? ? ? 2.433 ? 
metalc165  metalc ?    ? NC MG  .    MG    ? ? ? 1_555 CM HOH .    O  ? ? 0 MG  8003 A HOH 8979 1_555 ? ? ? ? ? ? ? 2.475 ? 
metalc166  metalc ?    ? OC MG  .    MG    ? ? ? 1_555 FN HOH .    O  ? ? 0 MG  8004 0 HOH 9564 1_555 ? ? ? ? ? ? ? 2.495 ? 
metalc167  metalc ?    ? OC MG  .    MG    ? ? ? 1_555 FN HOH .    O  ? ? 0 MG  8004 0 HOH 3695 1_555 ? ? ? ? ? ? ? 2.398 ? 
metalc168  metalc ?    ? SC MG  .    MG    ? ? ? 1_555 FN HOH .    O  ? ? 0 MG  8008 0 HOH 3551 1_555 ? ? ? ? ? ? ? 2.467 ? 
metalc169  metalc ?    ? SC MG  .    MG    ? ? ? 1_555 FN HOH .    O  ? ? 0 MG  8008 0 HOH 2960 1_555 ? ? ? ? ? ? ? 2.483 ? 
metalc170  metalc ?    ? TC MG  .    MG    ? ? ? 1_555 FN HOH .    O  ? ? 0 MG  8009 0 HOH 2942 1_555 ? ? ? ? ? ? ? 2.187 ? 
metalc171  metalc ?    ? TC MG  .    MG    ? ? ? 1_555 FN HOH .    O  ? ? 0 MG  8009 0 HOH 4534 1_555 ? ? ? ? ? ? ? 2.304 ? 
metalc172  metalc ?    ? VC MG  .    MG    ? ? ? 1_555 FN HOH .    O  ? ? 0 MG  8011 0 HOH 4514 1_555 ? ? ? ? ? ? ? 2.372 ? 
metalc173  metalc ?    ? VC MG  .    MG    ? ? ? 1_555 FN HOH .    O  ? ? 0 MG  8011 0 HOH 2927 1_555 ? ? ? ? ? ? ? 2.403 ? 
metalc174  metalc ?    ? VC MG  .    MG    ? ? ? 1_555 FN HOH .    O  ? ? 0 MG  8011 0 HOH 9588 1_555 ? ? ? ? ? ? ? 2.457 ? 
metalc175  metalc ?    ? VC MG  .    MG    ? ? ? 1_555 FN HOH .    O  ? ? 0 MG  8011 0 HOH 2945 1_555 ? ? ? ? ? ? ? 2.351 ? 
metalc176  metalc ?    ? TA MG  .    MG    ? ? ? 1_555 EM HOH .    O  ? ? C MG  8012 C HOH 8561 1_555 ? ? ? ? ? ? ? 2.485 ? 
metalc177  metalc ?    ? TA MG  .    MG    ? ? ? 1_555 EM HOH .    O  ? ? C MG  8012 C HOH 8661 1_555 ? ? ? ? ? ? ? 2.270 ? 
metalc178  metalc ?    ? XC MG  .    MG    ? ? ? 1_555 FN HOH .    O  ? ? 0 MG  8014 0 HOH 3042 1_555 ? ? ? ? ? ? ? 2.476 ? 
metalc179  metalc ?    ? XC MG  .    MG    ? ? ? 1_555 FN HOH .    O  ? ? 0 MG  8014 0 HOH 3045 1_555 ? ? ? ? ? ? ? 2.486 ? 
metalc180  metalc ?    ? YC MG  .    MG    ? ? ? 1_555 FN HOH .    O  ? ? 0 MG  8015 0 HOH 3880 1_555 ? ? ? ? ? ? ? 2.480 ? 
metalc181  metalc ?    ? BD MG  .    MG    ? ? ? 1_555 FN HOH .    O  ? ? 0 MG  8018 0 HOH 9593 1_555 ? ? ? ? ? ? ? 2.424 ? 
metalc182  metalc ?    ? ED MG  .    MG    ? ? ? 1_555 UM HOH .    O  ? ? 0 MG  8021 S HOH 8545 1_555 ? ? ? ? ? ? ? 2.434 ? 
metalc183  metalc ?    ? GD MG  .    MG    ? ? ? 1_555 FN HOH .    O  ? ? 0 MG  8023 0 HOH 9567 1_555 ? ? ? ? ? ? ? 2.334 ? 
metalc184  metalc ?    ? KD MG  .    MG    ? ? ? 1_555 FN HOH .    O  ? ? 0 MG  8028 0 HOH 4518 1_555 ? ? ? ? ? ? ? 2.469 ? 
metalc185  metalc ?    ? KD MG  .    MG    ? ? ? 1_555 FN HOH .    O  ? ? 0 MG  8028 0 HOH 3202 1_555 ? ? ? ? ? ? ? 2.444 ? 
metalc186  metalc ?    ? KD MG  .    MG    ? ? ? 1_555 FN HOH .    O  ? ? 0 MG  8028 0 HOH 9611 1_555 ? ? ? ? ? ? ? 2.422 ? 
metalc187  metalc ?    ? KD MG  .    MG    ? ? ? 1_555 FN HOH .    O  ? ? 0 MG  8028 0 HOH 4566 1_555 ? ? ? ? ? ? ? 2.456 ? 
metalc188  metalc ?    ? OA MG  .    MG    ? ? ? 1_555 DM HOH .    O  ? ? B MG  8043 B HOH 9013 1_555 ? ? ? ? ? ? ? 2.442 ? 
metalc189  metalc ?    ? EE MG  .    MG    ? ? ? 1_555 FN HOH .    O  ? ? 0 MG  8052 0 HOH 9629 1_555 ? ? ? ? ? ? ? 2.469 ? 
metalc190  metalc ?    ? IE MG  .    MG    ? ? ? 1_555 FN HOH .    O  ? ? 0 MG  8058 0 HOH 9630 1_555 ? ? ? ? ? ? ? 2.344 ? 
metalc191  metalc ?    ? IE MG  .    MG    ? ? ? 1_555 YM HOH .    O  ? ? 0 MG  8058 W HOH 7873 1_555 ? ? ? ? ? ? ? 2.486 ? 
metalc192  metalc ?    ? IE MG  .    MG    ? ? ? 1_555 YM HOH .    O  ? ? 0 MG  8058 W HOH 7803 1_555 ? ? ? ? ? ? ? 2.387 ? 
metalc193  metalc ?    ? KE MG  .    MG    ? ? ? 1_555 FN HOH .    O  ? ? 0 MG  8061 0 HOH 4521 1_555 ? ? ? ? ? ? ? 2.316 ? 
metalc194  metalc ?    ? VE MG  .    MG    ? ? ? 1_555 FN HOH .    O  ? ? 0 MG  8072 0 HOH 4574 1_555 ? ? ? ? ? ? ? 2.491 ? 
metalc195  metalc ?    ? GF MG  .    MG    ? ? ? 1_555 LM HOH .    O  ? ? 0 MG  8084 J HOH 2219 1_555 ? ? ? ? ? ? ? 2.477 ? 
metalc196  metalc ?    ? JF MG  .    MG    ? ? ? 1_555 FN HOH .    O  ? ? 0 MG  8088 0 HOH 3049 1_555 ? ? ? ? ? ? ? 2.497 ? 
metalc197  metalc ?    ? JF MG  .    MG    ? ? ? 1_555 FN HOH .    O  ? ? 0 MG  8088 0 HOH 3251 1_555 ? ? ? ? ? ? ? 2.453 ? 
metalc198  metalc ?    ? RF NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? 0 NA  8501 0 HOH 5852 1_555 ? ? ? ? ? ? ? 2.994 ? 
metalc199  metalc ?    ? SF NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? 0 NA  8502 0 HOH 9593 1_555 ? ? ? ? ? ? ? 2.968 ? 
metalc200  metalc ?    ? WF NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? 0 NA  8507 0 HOH 3215 1_555 ? ? ? ? ? ? ? 2.672 ? 
metalc201  metalc ?    ? WF NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? 0 NA  8507 0 HOH 4315 1_555 ? ? ? ? ? ? ? 2.785 ? 
metalc202  metalc ?    ? ZF NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? 0 NA  8511 0 HOH 6918 1_555 ? ? ? ? ? ? ? 2.854 ? 
metalc203  metalc ?    ? ZF NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? 0 NA  8511 0 HOH 5948 1_555 ? ? ? ? ? ? ? 2.751 ? 
metalc204  metalc ?    ? ZF NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? 0 NA  8511 0 HOH 4726 1_555 ? ? ? ? ? ? ? 2.865 ? 
metalc205  metalc ?    ? AG NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? 0 NA  8512 0 HOH 4038 1_555 ? ? ? ? ? ? ? 2.989 ? 
metalc206  metalc ?    ? AG NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? 0 NA  8512 0 HOH 3252 1_555 ? ? ? ? ? ? ? 2.875 ? 
metalc207  metalc ?    ? CG NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? 0 NA  8514 0 HOH 2951 1_555 ? ? ? ? ? ? ? 2.916 ? 
metalc208  metalc ?    ? CG NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? 0 NA  8514 0 HOH 7169 1_555 ? ? ? ? ? ? ? 2.907 ? 
metalc209  metalc ?    ? DG NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? 0 NA  8515 0 HOH 3199 1_555 ? ? ? ? ? ? ? 2.971 ? 
metalc210  metalc ?    ? DG NA  .    NA    ? ? ? 1_555 DN HOH .    O  ? ? 0 NA  8515 2 HOH 4135 1_555 ? ? ? ? ? ? ? 2.777 ? 
metalc211  metalc ?    ? EG NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? 0 NA  8516 0 HOH 3133 1_555 ? ? ? ? ? ? ? 2.959 ? 
metalc212  metalc ?    ? EG NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? 0 NA  8516 0 HOH 4367 1_555 ? ? ? ? ? ? ? 2.839 ? 
metalc213  metalc ?    ? EG NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? 0 NA  8516 0 HOH 4819 1_555 ? ? ? ? ? ? ? 2.844 ? 
metalc214  metalc ?    ? FG NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? 0 NA  8517 0 HOH 3661 1_555 ? ? ? ? ? ? ? 2.892 ? 
metalc215  metalc ?    ? FG NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? 0 NA  8517 0 HOH 3011 1_555 ? ? ? ? ? ? ? 2.859 ? 
metalc216  metalc ?    ? GG NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? 0 NA  8519 0 HOH 5367 1_555 ? ? ? ? ? ? ? 2.892 ? 
metalc217  metalc ?    ? HG NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? 0 NA  8520 0 HOH 3407 1_555 ? ? ? ? ? ? ? 2.910 ? 
metalc218  metalc ?    ? NG NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? 0 NA  8526 0 HOH 3157 1_555 ? ? ? ? ? ? ? 2.863 ? 
metalc219  metalc ?    ? OG NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? 0 NA  8527 0 HOH 3220 1_555 ? ? ? ? ? ? ? 2.986 ? 
metalc220  metalc ?    ? PG NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? 0 NA  8528 0 HOH 7904 1_555 ? ? ? ? ? ? ? 2.995 ? 
metalc221  metalc ?    ? QG NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? 0 NA  8529 0 HOH 6119 1_555 ? ? ? ? ? ? ? 2.922 ? 
metalc222  metalc ?    ? RG NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? 0 NA  8530 0 HOH 3792 1_555 ? ? ? ? ? ? ? 2.867 ? 
metalc223  metalc ?    ? SG NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? 0 NA  8531 0 HOH 9178 1_555 ? ? ? ? ? ? ? 2.691 ? 
metalc224  metalc ?    ? SG NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? 0 NA  8531 0 HOH 9499 1_555 ? ? ? ? ? ? ? 2.868 ? 
metalc225  metalc ?    ? TG NA  .    NA    ? ? ? 1_555 TM HOH .    O  ? ? 0 NA  8533 R HOH 8921 1_555 ? ? ? ? ? ? ? 2.904 ? 
metalc226  metalc ?    ? VG NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? 0 NA  8535 0 HOH 7660 1_555 ? ? ? ? ? ? ? 2.967 ? 
metalc227  metalc ?    ? XG NA  .    NA    ? ? ? 1_555 VM HOH .    O  ? ? 0 NA  8537 T HOH 1124 1_555 ? ? ? ? ? ? ? 2.915 ? 
metalc228  metalc ?    ? CH NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? 0 NA  8547 0 HOH 3367 1_555 ? ? ? ? ? ? ? 2.944 ? 
metalc229  metalc ?    ? DH NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? 0 NA  8548 0 HOH 9310 1_555 ? ? ? ? ? ? ? 2.892 ? 
metalc230  metalc ?    ? DH NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? 0 NA  8548 0 HOH 7132 1_555 ? ? ? ? ? ? ? 2.863 ? 
metalc231  metalc ?    ? DH NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? 0 NA  8548 0 HOH 4887 1_555 ? ? ? ? ? ? ? 2.968 ? 
metalc232  metalc ?    ? EH NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? 0 NA  8549 0 HOH 4761 1_555 ? ? ? ? ? ? ? 2.880 ? 
metalc233  metalc ?    ? EH NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? 0 NA  8549 0 HOH 9589 1_555 ? ? ? ? ? ? ? 2.909 ? 
metalc234  metalc ?    ? GH NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? 0 NA  8551 0 HOH 6814 1_555 ? ? ? ? ? ? ? 2.957 ? 
metalc235  metalc ?    ? KH NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? 0 NA  8555 0 HOH 3734 1_555 ? ? ? ? ? ? ? 2.942 ? 
metalc236  metalc ?    ? MH NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? 0 NA  8557 0 HOH 4770 1_555 ? ? ? ? ? ? ? 2.794 ? 
metalc237  metalc ?    ? TH NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? 0 NA  8564 0 HOH 3915 1_555 ? ? ? ? ? ? ? 2.938 ? 
metalc238  metalc ?    ? VH NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? 0 NA  8566 0 HOH 3185 1_555 ? ? ? ? ? ? ? 2.920 ? 
metalc239  metalc ?    ? WH NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? 0 NA  8567 0 HOH 7196 1_555 ? ? ? ? ? ? ? 2.869 ? 
metalc240  metalc ?    ? XH NA  .    NA    ? ? ? 1_555 NM HOH .    O  ? ? 0 NA  8568 L HOH 9015 1_555 ? ? ? ? ? ? ? 2.901 ? 
metalc241  metalc ?    ? XH NA  .    NA    ? ? ? 1_555 NM HOH .    O  ? ? 0 NA  8568 L HOH 8984 1_555 ? ? ? ? ? ? ? 2.989 ? 
metalc242  metalc ?    ? YH NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? 0 NA  8569 0 HOH 4606 1_555 ? ? ? ? ? ? ? 2.891 ? 
metalc243  metalc ?    ? ZH NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? 0 NA  8570 0 HOH 4584 1_555 ? ? ? ? ? ? ? 2.989 ? 
metalc244  metalc ?    ? ZH NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? 0 NA  8570 0 HOH 3250 1_555 ? ? ? ? ? ? ? 2.823 ? 
metalc245  metalc ?    ? BI NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? 0 NA  8573 0 HOH 6123 1_555 ? ? ? ? ? ? ? 2.989 ? 
metalc246  metalc ?    ? KI SR  .    SR    ? ? ? 1_555 FN HOH .    O  ? ? 0 SR  8901 0 HOH 5179 1_555 ? ? ? ? ? ? ? 2.702 ? 
metalc247  metalc ?    ? MI SR  .    SR    ? ? ? 1_555 FN HOH .    O  ? ? 0 SR  8903 0 HOH 3310 1_555 ? ? ? ? ? ? ? 2.714 ? 
metalc248  metalc ?    ? JJ SR  .    SR    ? ? ? 1_555 FN HOH .    O  ? ? 0 SR  8933 0 HOH 4624 1_555 ? ? ? ? ? ? ? 2.723 ? 
metalc249  metalc ?    ? RJ SR  .    SR    ? ? ? 1_555 FN HOH .    O  ? ? 0 SR  8942 0 HOH 9703 1_555 ? ? ? ? ? ? ? 2.659 ? 
metalc250  metalc ?    ? WL NA  .    NA    ? ? ? 1_555 GN HOH .    O  ? ? 9 NA  8572 9 HOH 9132 1_555 ? ? ? ? ? ? ? 2.817 ? 
metalc251  metalc ?    ? UA NA  .    NA    ? ? ? 1_555 EM HOH .    O  ? ? C NA  8503 C HOH 8509 1_555 ? ? ? ? ? ? ? 2.988 ? 
metalc252  metalc ?    ? AB NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? J NA  8538 0 HOH 6622 1_555 ? ? ? ? ? ? ? 2.927 ? 
metalc253  metalc ?    ? AB NA  .    NA    ? ? ? 1_555 FN HOH .    O  ? ? J NA  8538 0 HOH 3397 1_555 ? ? ? ? ? ? ? 2.859 ? 
metalc254  metalc ?    ? NB NA  .    NA    ? ? ? 1_555 SM HOH .    O  ? ? Q NA  8540 Q HOH 1795 1_555 ? ? ? ? ? ? ? 2.939 ? 
hydrog1    hydrog ?    ? DA U   12   O4    ? ? ? 1_555 DA G   531  N2 ? ? 0 U   12   0 G   531  1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2    hydrog ?    ? DA G   13   N1    ? ? ? 1_555 DA C   530  N3 ? ? 0 G   13   0 C   530  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3    hydrog ?    ? DA G   13   N2    ? ? ? 1_555 DA C   530  O2 ? ? 0 G   13   0 C   530  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4    hydrog ?    ? DA G   13   O6    ? ? ? 1_555 DA C   530  N4 ? ? 0 G   13   0 C   530  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5    hydrog ?    ? DA C   14   N3    ? ? ? 1_555 DA G   529  N1 ? ? 0 C   14   0 G   529  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6    hydrog ?    ? DA C   14   N4    ? ? ? 1_555 DA G   529  O6 ? ? 0 C   14   0 G   529  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7    hydrog ?    ? DA C   14   O2    ? ? ? 1_555 DA G   529  N2 ? ? 0 C   14   0 G   529  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8    hydrog ?    ? DA C   15   N3    ? ? ? 1_555 DA G   528  N1 ? ? 0 C   15   0 G   528  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9    hydrog ?    ? DA C   15   N4    ? ? ? 1_555 DA G   528  O6 ? ? 0 C   15   0 G   528  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10   hydrog ?    ? DA C   15   O2    ? ? ? 1_555 DA G   528  N2 ? ? 0 C   15   0 G   528  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11   hydrog ?    ? DA A   16   N1    ? ? ? 1_555 DA U   527  N3 ? ? 0 A   16   0 U   527  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12   hydrog ?    ? DA A   16   N6    ? ? ? 1_555 DA U   527  O4 ? ? 0 A   16   0 U   527  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13   hydrog ?    ? DA G   17   N1    ? ? ? 1_555 DA U   526  O2 ? ? 0 G   17   0 U   526  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog14   hydrog ?    ? DA G   17   O6    ? ? ? 1_555 DA U   526  N3 ? ? 0 G   17   0 U   526  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog15   hydrog ?    ? DA C   18   N3    ? ? ? 1_555 DA G   525  N1 ? ? 0 C   18   0 G   525  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16   hydrog ?    ? DA C   18   N4    ? ? ? 1_555 DA G   525  O6 ? ? 0 C   18   0 G   525  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17   hydrog ?    ? DA C   18   O2    ? ? ? 1_555 DA G   525  N2 ? ? 0 C   18   0 G   525  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18   hydrog ?    ? DA U   19   N3    ? ? ? 1_555 DA A   524  N1 ? ? 0 U   19   0 A   524  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19   hydrog ?    ? DA U   19   O4    ? ? ? 1_555 DA A   524  N6 ? ? 0 U   19   0 A   524  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20   hydrog ?    ? DA G   20   N1    ? ? ? 1_555 DA C   523  N3 ? ? 0 G   20   0 C   523  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21   hydrog ?    ? DA G   20   N2    ? ? ? 1_555 DA C   523  O2 ? ? 0 G   20   0 C   523  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22   hydrog ?    ? DA G   20   O6    ? ? ? 1_555 DA C   523  N4 ? ? 0 G   20   0 C   523  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23   hydrog ?    ? DA G   21   N1    ? ? ? 1_555 DA U   522  O2 ? ? 0 G   21   0 U   522  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog24   hydrog ?    ? DA G   21   O6    ? ? ? 1_555 DA U   522  N3 ? ? 0 G   21   0 U   522  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog25   hydrog ?    ? DA U   22   O2    ? ? ? 1_555 DA A   521  N6 ? ? 0 U   22   0 A   521  1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog26   hydrog ?    ? DA G   23   N2    ? ? ? 1_555 DA A   520  N7 ? ? 0 G   23   0 A   520  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog27   hydrog ?    ? DA G   23   N3    ? ? ? 1_555 DA A   520  N6 ? ? 0 G   23   0 A   520  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog28   hydrog ?    ? DA G   24   N2    ? ? ? 1_555 DA A   519  N7 ? ? 0 G   24   0 A   519  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog29   hydrog ?    ? DA G   24   N3    ? ? ? 1_555 DA A   519  N6 ? ? 0 G   24   0 A   519  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog30   hydrog ?    ? DA A   25   N6    ? ? ? 1_555 DA G   518  N3 ? ? 0 A   25   0 G   518  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog31   hydrog ?    ? DA A   25   N7    ? ? ? 1_555 DA G   518  N2 ? ? 0 A   25   0 G   518  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog32   hydrog ?    ? DA U   26   N3    ? ? ? 1_555 DA U   517  O2 ? ? 0 U   26   0 U   517  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog33   hydrog ?    ? DA U   26   O4    ? ? ? 1_555 DA U   517  N3 ? ? 0 U   26   0 U   517  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog34   hydrog ?    ? DA U   27   N3    ? ? ? 1_555 DA A   516  N1 ? ? 0 U   27   0 A   516  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35   hydrog ?    ? DA U   27   O4    ? ? ? 1_555 DA A   516  N6 ? ? 0 U   27   0 A   516  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36   hydrog ?    ? DA G   28   N1    ? ? ? 1_555 DA C   480  N3 ? ? 0 G   28   0 C   480  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37   hydrog ?    ? DA G   28   N2    ? ? ? 1_555 DA C   480  O2 ? ? 0 G   28   0 C   480  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38   hydrog ?    ? DA G   28   O6    ? ? ? 1_555 DA C   480  N4 ? ? 0 G   28   0 C   480  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39   hydrog ?    ? DA C   29   N3    ? ? ? 1_555 DA G   479  N1 ? ? 0 C   29   0 G   479  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40   hydrog ?    ? DA C   29   N4    ? ? ? 1_555 DA G   479  O6 ? ? 0 C   29   0 G   479  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41   hydrog ?    ? DA C   29   O2    ? ? ? 1_555 DA G   479  N2 ? ? 0 C   29   0 G   479  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42   hydrog ?    ? DA U   30   N3    ? ? ? 1_555 DA A   453  N7 ? ? 0 U   30   0 A   453  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog43   hydrog ?    ? DA U   30   O2    ? ? ? 1_555 DA A   453  N6 ? ? 0 U   30   0 A   453  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog44   hydrog ?    ? DA G   32   N1    ? ? ? 1_555 DA C   451  N3 ? ? 0 G   32   0 C   451  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog45   hydrog ?    ? DA G   32   N2    ? ? ? 1_555 DA C   451  O2 ? ? 0 G   32   0 C   451  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog46   hydrog ?    ? DA G   32   O6    ? ? ? 1_555 DA C   451  N4 ? ? 0 G   32   0 C   451  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog47   hydrog ?    ? DA G   32   N2    ? ? ? 1_555 DA A   455  N1 ? ? 0 G   32   0 A   455  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog48   hydrog ?    ? DA G   32   N2    ? ? ? 1_555 DA G   456  N3 ? ? 0 G   32   0 G   456  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog49   hydrog ?    ? DA G   32   N3    ? ? ? 1_555 DA G   456  N2 ? ? 0 G   32   0 G   456  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog50   hydrog ?    ? DA G   33   N1    ? ? ? 1_555 DA C   450  N3 ? ? 0 G   33   0 C   450  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog51   hydrog ?    ? DA G   33   N2    ? ? ? 1_555 DA C   450  O2 ? ? 0 G   33   0 C   450  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog52   hydrog ?    ? DA G   33   O6    ? ? ? 1_555 DA C   450  N4 ? ? 0 G   33   0 C   450  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog53   hydrog ?    ? DA C   34   N3    ? ? ? 1_555 DA G   448  N1 ? ? 0 C   34   0 G   448  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog54   hydrog ?    ? DA C   34   N4    ? ? ? 1_555 DA G   448  O6 ? ? 0 C   34   0 G   448  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog55   hydrog ?    ? DA C   34   O2    ? ? ? 1_555 DA G   448  N2 ? ? 0 C   34   0 G   448  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog56   hydrog ?    ? DA U   35   N3    ? ? ? 1_555 DA A   447  N1 ? ? 0 U   35   0 A   447  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog57   hydrog ?    ? DA U   35   O4    ? ? ? 1_555 DA A   447  N6 ? ? 0 U   35   0 A   447  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog58   hydrog ?    ? DA C   36   N3    ? ? ? 1_555 DA G   446  N1 ? ? 0 C   36   0 G   446  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog59   hydrog ?    ? DA C   36   N4    ? ? ? 1_555 DA G   446  O6 ? ? 0 C   36   0 G   446  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog60   hydrog ?    ? DA C   36   O2    ? ? ? 1_555 DA G   446  N2 ? ? 0 C   36   0 G   446  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog61   hydrog ?    ? DA C   36   O2    ? ? ? 1_555 DA A   674  N6 ? ? 0 C   36   0 A   674  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog62   hydrog ?    ? DA A   37   N1    ? ? ? 1_555 DA U   445  N3 ? ? 0 A   37   0 U   445  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog63   hydrog ?    ? DA A   37   N6    ? ? ? 1_555 DA U   445  O4 ? ? 0 A   37   0 U   445  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog64   hydrog ?    ? DA G   38   N1    ? ? ? 1_555 DA C   444  N3 ? ? 0 G   38   0 C   444  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog65   hydrog ?    ? DA G   38   N2    ? ? ? 1_555 DA C   444  O2 ? ? 0 G   38   0 C   444  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog66   hydrog ?    ? DA G   38   O6    ? ? ? 1_555 DA C   444  N4 ? ? 0 G   38   0 C   444  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog67   hydrog ?    ? DA G   39   N1    ? ? ? 1_555 DA C   443  N3 ? ? 0 G   39   0 C   443  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog68   hydrog ?    ? DA G   39   N2    ? ? ? 1_555 DA C   443  O2 ? ? 0 G   39   0 C   443  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog69   hydrog ?    ? DA G   39   O6    ? ? ? 1_555 DA C   443  N4 ? ? 0 G   39   0 C   443  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog70   hydrog ?    ? DA C   40   N4    ? ? ? 1_555 DA A   441  N1 ? ? 0 C   40   0 A   441  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog71   hydrog ?    ? DA C   40   O2    ? ? ? 1_555 DA A   442  N6 ? ? 0 C   40   0 A   442  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog72   hydrog ?    ? DA G   41   N2    ? ? ? 1_555 DA A   151  N1 ? ? 0 G   41   0 A   151  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog73   hydrog ?    ? DA G   41   N1    ? ? ? 1_555 DA C   440  N3 ? ? 0 G   41   0 C   440  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog74   hydrog ?    ? DA G   41   N2    ? ? ? 1_555 DA C   440  O2 ? ? 0 G   41   0 C   440  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog75   hydrog ?    ? DA G   41   O6    ? ? ? 1_555 DA C   440  N4 ? ? 0 G   41   0 C   440  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog76   hydrog ?    ? DA C   42   N3    ? ? ? 1_555 DA G   149  N1 ? ? 0 C   42   0 G   149  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog77   hydrog ?    ? DA C   42   N4    ? ? ? 1_555 DA G   149  O6 ? ? 0 C   42   0 G   149  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog78   hydrog ?    ? DA C   42   O2    ? ? ? 1_555 DA G   149  N2 ? ? 0 C   42   0 G   149  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog79   hydrog ?    ? DA U   43   N3    ? ? ? 1_555 DA A   148  N1 ? ? 0 U   43   0 A   148  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog80   hydrog ?    ? DA U   43   O4    ? ? ? 1_555 DA A   148  N6 ? ? 0 U   43   0 A   148  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog81   hydrog ?    ? DA G   44   N2    ? ? ? 1_555 DA A   45   N1 ? ? 0 G   44   0 A   45   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog82   hydrog ?    ? DA A   45   N6    ? ? ? 1_555 DA U   115  O4 ? ? 0 A   45   0 U   115  1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog83   hydrog ?    ? DA A   45   N7    ? ? ? 1_555 DA U   115  N3 ? ? 0 A   45   0 U   115  1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog84   hydrog ?    ? DA G   47   N2    ? ? ? 1_555 DA A   113  N7 ? ? 0 G   47   0 A   113  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog85   hydrog ?    ? DA G   47   N3    ? ? ? 1_555 DA A   113  N6 ? ? 0 G   47   0 A   113  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog86   hydrog ?    ? DA A   48   N6    ? ? ? 1_555 DA A   114  N7 ? ? 0 A   48   0 A   114  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog87   hydrog ?    ? DA A   48   N7    ? ? ? 1_555 DA A   114  N6 ? ? 0 A   48   0 A   114  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog88   hydrog ?    ? DA A   49   N6    ? ? ? 1_555 DA G   112  N3 ? ? 0 A   49   0 G   112  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog89   hydrog ?    ? DA A   49   N7    ? ? ? 1_555 DA G   112  N2 ? ? 0 A   49   0 G   112  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog90   hydrog ?    ? DA G   50   N1    ? ? ? 1_555 DA C   111  N3 ? ? 0 G   50   0 C   111  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog91   hydrog ?    ? DA G   50   N2    ? ? ? 1_555 DA C   111  O2 ? ? 0 G   50   0 C   111  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog92   hydrog ?    ? DA G   50   O6    ? ? ? 1_555 DA C   111  N4 ? ? 0 G   50   0 C   111  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog93   hydrog ?    ? DA G   51   N1    ? ? ? 1_555 DA C   110  N3 ? ? 0 G   51   0 C   110  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog94   hydrog ?    ? DA G   51   N2    ? ? ? 1_555 DA C   110  O2 ? ? 0 G   51   0 C   110  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog95   hydrog ?    ? DA G   51   O6    ? ? ? 1_555 DA C   110  N4 ? ? 0 G   51   0 C   110  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog96   hydrog ?    ? DA G   51   N2    ? ? ? 1_555 DA U   121  O2 ? ? 0 G   51   0 U   121  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog97   hydrog ?    ? DA A   52   N1    ? ? ? 1_555 DA U   109  N3 ? ? 0 A   52   0 U   109  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog98   hydrog ?    ? DA A   52   N6    ? ? ? 1_555 DA U   109  O4 ? ? 0 A   52   0 U   109  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog99   hydrog ?    ? DA C   53   N3    ? ? ? 1_555 DA G   66   N1 ? ? 0 C   53   0 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog100  hydrog ?    ? DA C   53   N4    ? ? ? 1_555 DA G   66   O6 ? ? 0 C   53   0 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog101  hydrog ?    ? DA C   53   O2    ? ? ? 1_555 DA G   66   N2 ? ? 0 C   53   0 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog102  hydrog ?    ? DA G   54   N1    ? ? ? 1_555 DA C   65   N3 ? ? 0 G   54   0 C   65   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog103  hydrog ?    ? DA G   54   N2    ? ? ? 1_555 DA C   65   O2 ? ? 0 G   54   0 C   65   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog104  hydrog ?    ? DA G   54   O6    ? ? ? 1_555 DA C   65   N4 ? ? 0 G   54   0 C   65   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog105  hydrog ?    ? DA G   54   N2    ? ? ? 1_555 DA A   69   N3 ? ? 0 G   54   0 A   69   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog106  hydrog ?    ? DA U   55   N3    ? ? ? 1_555 DA G   64   O6 ? ? 0 U   55   0 G   64   1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog107  hydrog ?    ? DA U   55   O2    ? ? ? 1_555 DA G   64   N1 ? ? 0 U   55   0 G   64   1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog108  hydrog ?    ? DA G   56   O6    ? ? ? 1_555 DA C   62   N4 ? ? 0 G   56   0 C   62   1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog109  hydrog ?    ? DA G   56   N1    ? ? ? 1_555 DA G   84   O6 ? ? 0 G   56   0 G   84   1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog110  hydrog ?    ? DA G   56   N2    ? ? ? 1_555 DA G   84   N7 ? ? 0 G   56   0 G   84   1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog111  hydrog ?    ? DA C   57   N3    ? ? ? 1_555 DA G   89   N1 ? ? 0 C   57   0 G   89   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog112  hydrog ?    ? DA C   57   N4    ? ? ? 1_555 DA G   89   O6 ? ? 0 C   57   0 G   89   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog113  hydrog ?    ? DA C   57   O2    ? ? ? 1_555 DA G   89   N2 ? ? 0 C   57   0 G   89   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog114  hydrog ?    ? DA C   58   N3    ? ? ? 1_555 DA G   88   N1 ? ? 0 C   58   0 G   88   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog115  hydrog ?    ? DA C   58   N4    ? ? ? 1_555 DA G   88   O6 ? ? 0 C   58   0 G   88   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog116  hydrog ?    ? DA C   58   O2    ? ? ? 1_555 DA G   88   N2 ? ? 0 C   58   0 G   88   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog117  hydrog ?    ? DA A   59   N3    ? ? ? 1_555 DA A   60   N6 ? ? 0 A   59   0 A   60   1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog118  hydrog ?    ? DA A   59   N1    ? ? ? 1_555 DA C   85   N4 ? ? 0 A   59   0 C   85   1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog119  hydrog ?    ? DA A   60   N1    ? ? ? 1_555 DA A   86   N6 ? ? 0 A   60   0 A   86   1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog120  hydrog ?    ? DA A   60   N6    ? ? ? 1_555 DA A   86   N1 ? ? 0 A   60   0 A   86   1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog121  hydrog ?    ? DA G   61   N1    ? ? ? 1_555 DA C   85   N3 ? ? 0 G   61   0 C   85   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog122  hydrog ?    ? DA G   61   N2    ? ? ? 1_555 DA C   85   O2 ? ? 0 G   61   0 C   85   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog123  hydrog ?    ? DA G   61   O6    ? ? ? 1_555 DA C   85   N4 ? ? 0 G   61   0 C   85   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog124  hydrog ?    ? DA C   62   N3    ? ? ? 1_555 DA G   84   N1 ? ? 0 C   62   0 G   84   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog125  hydrog ?    ? DA C   62   N4    ? ? ? 1_555 DA G   84   O6 ? ? 0 C   62   0 G   84   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog126  hydrog ?    ? DA C   62   O2    ? ? ? 1_555 DA G   84   N2 ? ? 0 C   62   0 G   84   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog127  hydrog ?    ? DA U   63   N3    ? ? ? 1_555 DA A   70   N7 ? ? 0 U   63   0 A   70   1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog128  hydrog ?    ? DA G   66   N2    ? ? ? 1_555 DA A   67   N1 ? ? 0 G   66   0 A   67   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog129  hydrog ?    ? DA G   71   N1    ? ? ? 1_555 DA A   106  N1 ? ? 0 G   71   0 A   106  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog130  hydrog ?    ? DA G   71   O6    ? ? ? 1_555 DA A   106  N6 ? ? 0 G   71   0 A   106  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog131  hydrog ?    ? DA G   71   N1    ? ? ? 1_555 DA U   107  O2 ? ? 0 G   71   0 U   107  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog132  hydrog ?    ? DA C   72   N3    ? ? ? 1_555 DA G   105  N1 ? ? 0 C   72   0 G   105  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog133  hydrog ?    ? DA C   72   N4    ? ? ? 1_555 DA G   105  O6 ? ? 0 C   72   0 G   105  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog134  hydrog ?    ? DA C   72   O2    ? ? ? 1_555 DA G   105  N2 ? ? 0 C   72   0 G   105  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog135  hydrog ?    ? DA U   73   N3    ? ? ? 1_555 DA A   104  N1 ? ? 0 U   73   0 A   104  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog136  hydrog ?    ? DA U   73   O4    ? ? ? 1_555 DA A   104  N6 ? ? 0 U   73   0 A   104  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog137  hydrog ?    ? DA G   74   N1    ? ? ? 1_555 DA C   103  N3 ? ? 0 G   74   0 C   103  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog138  hydrog ?    ? DA G   74   N2    ? ? ? 1_555 DA C   103  O2 ? ? 0 G   74   0 C   103  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog139  hydrog ?    ? DA G   74   O6    ? ? ? 1_555 DA C   103  N4 ? ? 0 G   74   0 C   103  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog140  hydrog ?    ? DA U   75   N3    ? ? ? 1_555 DA A   102  N1 ? ? 0 U   75   0 A   102  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog141  hydrog ?    ? DA U   75   O4    ? ? ? 1_555 DA A   102  N6 ? ? 0 U   75   0 A   102  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog142  hydrog ?    ? DA G   76   N1    ? ? ? 1_555 DA C   101  O2 ? ? 0 G   76   0 C   101  1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog143  hydrog ?    ? DA G   77   N1    ? ? ? 1_555 DA C   100  N3 ? ? 0 G   77   0 C   100  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog144  hydrog ?    ? DA G   77   N2    ? ? ? 1_555 DA C   100  O2 ? ? 0 G   77   0 C   100  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog145  hydrog ?    ? DA G   77   O6    ? ? ? 1_555 DA C   100  N4 ? ? 0 G   77   0 C   100  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog146  hydrog ?    ? DA G   78   N2    ? ? ? 1_555 DA A   99   N7 ? ? 0 G   78   0 A   99   1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog147  hydrog ?    ? DA G   78   N3    ? ? ? 1_555 DA A   99   N6 ? ? 0 G   78   0 A   99   1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog148  hydrog ?    ? DA G   79   N2    ? ? ? 1_555 DA A   98   N7 ? ? 0 G   79   0 A   98   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog149  hydrog ?    ? DA A   80   N3    ? ? ? 1_555 DA G   94   N2 ? ? 0 A   80   0 G   94   1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog150  hydrog ?    ? DA A   80   N6    ? ? ? 1_555 DA G   97   N3 ? ? 0 A   80   0 G   97   1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog151  hydrog ?    ? DA A   80   N7    ? ? ? 1_555 DA G   97   N2 ? ? 0 A   80   0 G   97   1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog152  hydrog ?    ? DA G   81   N1    ? ? ? 1_555 DA C   93   N3 ? ? 0 G   81   0 C   93   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog153  hydrog ?    ? DA G   81   N2    ? ? ? 1_555 DA C   93   O2 ? ? 0 G   81   0 C   93   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog154  hydrog ?    ? DA G   81   O6    ? ? ? 1_555 DA C   93   N4 ? ? 0 G   81   0 C   93   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog155  hydrog ?    ? DA G   81   N2    ? ? ? 1_555 DA A   98   N3 ? ? 0 G   81   0 A   98   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog156  hydrog ?    ? DA C   82   N3    ? ? ? 1_555 DA G   92   N1 ? ? 0 C   82   0 G   92   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog157  hydrog ?    ? DA C   82   N4    ? ? ? 1_555 DA G   92   O6 ? ? 0 C   82   0 G   92   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog158  hydrog ?    ? DA C   82   O2    ? ? ? 1_555 DA G   92   N2 ? ? 0 C   82   0 G   92   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog159  hydrog ?    ? DA C   83   N3    ? ? ? 1_555 DA G   91   N1 ? ? 0 C   83   0 G   91   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog160  hydrog ?    ? DA C   83   N4    ? ? ? 1_555 DA G   91   O6 ? ? 0 C   83   0 G   91   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog161  hydrog ?    ? DA C   83   O2    ? ? ? 1_555 DA G   91   N2 ? ? 0 C   83   0 G   91   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog162  hydrog ?    ? DA G   116  N1    ? ? ? 1_555 DA C   124  N3 ? ? 0 G   116  0 C   124  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog163  hydrog ?    ? DA G   116  N2    ? ? ? 1_555 DA C   124  O2 ? ? 0 G   116  0 C   124  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog164  hydrog ?    ? DA G   116  O6    ? ? ? 1_555 DA C   124  N4 ? ? 0 G   116  0 C   124  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog165  hydrog ?    ? DA A   117  N1    ? ? ? 1_555 DA U   123  N3 ? ? 0 A   117  0 U   123  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog166  hydrog ?    ? DA A   117  N6    ? ? ? 1_555 DA U   123  O4 ? ? 0 A   117  0 U   123  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog167  hydrog ?    ? DA G   118  N1    ? ? ? 1_555 DA C   122  N3 ? ? 0 G   118  0 C   122  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog168  hydrog ?    ? DA G   118  N2    ? ? ? 1_555 DA C   122  O2 ? ? 0 G   118  0 C   122  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog169  hydrog ?    ? DA G   118  O6    ? ? ? 1_555 DA C   122  N4 ? ? 0 G   118  0 C   122  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog170  hydrog ?    ? DA U   125  N3    ? ? ? 1_555 DA A   129  N1 ? ? 0 U   125  0 A   129  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog171  hydrog ?    ? DA U   125  O4    ? ? ? 1_555 DA A   129  N6 ? ? 0 U   125  0 A   129  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog172  hydrog ?    ? DA A   131  N6    ? ? ? 1_555 DA G   147  N7 ? ? 0 A   131  0 G   147  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog173  hydrog ?    ? DA A   132  N1    ? ? ? 1_555 DA U   146  N3 ? ? 0 A   132  0 U   146  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog174  hydrog ?    ? DA A   132  N6    ? ? ? 1_555 DA U   146  O4 ? ? 0 A   132  0 U   146  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog175  hydrog ?    ? DA U   133  N3    ? ? ? 1_555 DA A   145  N1 ? ? 0 U   133  0 A   145  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog176  hydrog ?    ? DA U   133  O4    ? ? ? 1_555 DA A   145  N6 ? ? 0 U   133  0 A   145  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog177  hydrog ?    ? DA U   134  O4    ? ? ? 1_555 DA C   141  N4 ? ? 0 U   134  0 C   141  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog178  hydrog ?    ? DA U   134  N3    ? ? ? 1_555 DA A   144  N1 ? ? 0 U   134  0 A   144  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog179  hydrog ?    ? DA U   134  O4    ? ? ? 1_555 DA A   144  N6 ? ? 0 U   134  0 A   144  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog180  hydrog ?    ? DA G   135  N1    ? ? ? 1_555 DA C   143  N3 ? ? 0 G   135  0 C   143  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog181  hydrog ?    ? DA G   135  N2    ? ? ? 1_555 DA C   143  O2 ? ? 0 G   135  0 C   143  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog182  hydrog ?    ? DA G   135  O6    ? ? ? 1_555 DA C   143  N4 ? ? 0 G   135  0 C   143  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog183  hydrog ?    ? DA C   136  N3    ? ? ? 1_555 DA G   142  N1 ? ? 0 C   136  0 G   142  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog184  hydrog ?    ? DA C   136  N4    ? ? ? 1_555 DA G   142  O6 ? ? 0 C   136  0 G   142  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog185  hydrog ?    ? DA C   136  O2    ? ? ? 1_555 DA G   142  N2 ? ? 0 C   136  0 G   142  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog186  hydrog ?    ? DA U   137  O2    ? ? ? 1_555 DA G   140  N1 ? ? 0 U   137  0 G   140  1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog187  hydrog ?    ? DA C   141  O2    ? ? ? 1_555 DA C   143  N4 ? ? 0 C   141  0 C   143  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog188  hydrog ?    ? DA C   141  N3    ? ? ? 1_555 DA A   144  N6 ? ? 0 C   141  0 A   144  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog189  hydrog ?    ? DA A   152  N1    ? ? ? 1_555 DA G   185  N1 ? ? 0 A   152  0 G   185  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog190  hydrog ?    ? DA A   152  N6    ? ? ? 1_555 DA G   185  O6 ? ? 0 A   152  0 G   185  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog191  hydrog ?    ? DA C   153  N3    ? ? ? 1_555 DA G   184  N1 ? ? 0 C   153  0 G   184  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog192  hydrog ?    ? DA C   153  N4    ? ? ? 1_555 DA G   184  O6 ? ? 0 C   153  0 G   184  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog193  hydrog ?    ? DA C   153  O2    ? ? ? 1_555 DA G   184  N2 ? ? 0 C   153  0 G   184  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog194  hydrog ?    ? DA C   154  N3    ? ? ? 1_555 DA G   182  N1 ? ? 0 C   154  0 G   182  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog195  hydrog ?    ? DA C   154  N4    ? ? ? 1_555 DA G   182  O6 ? ? 0 C   154  0 G   182  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog196  hydrog ?    ? DA C   154  O2    ? ? ? 1_555 DA G   182  N2 ? ? 0 C   154  0 G   182  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog197  hydrog ?    ? DA C   155  N3    ? ? ? 1_555 DA G   181  N1 ? ? 0 C   155  0 G   181  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog198  hydrog ?    ? DA C   155  N4    ? ? ? 1_555 DA G   181  O6 ? ? 0 C   155  0 G   181  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog199  hydrog ?    ? DA C   155  O2    ? ? ? 1_555 DA G   181  N2 ? ? 0 C   155  0 G   181  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog200  hydrog ?    ? DA C   156  N3    ? ? ? 1_555 DA G   180  N1 ? ? 0 C   156  0 G   180  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog201  hydrog ?    ? DA C   156  N4    ? ? ? 1_555 DA G   180  O6 ? ? 0 C   156  0 G   180  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog202  hydrog ?    ? DA C   156  O2    ? ? ? 1_555 DA G   180  N2 ? ? 0 C   156  0 G   180  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog203  hydrog ?    ? DA G   157  N1    ? ? ? 1_555 DA C   179  N3 ? ? 0 G   157  0 C   179  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog204  hydrog ?    ? DA G   157  N2    ? ? ? 1_555 DA C   179  O2 ? ? 0 G   157  0 C   179  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog205  hydrog ?    ? DA G   157  O6    ? ? ? 1_555 DA C   179  N4 ? ? 0 G   157  0 C   179  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog206  hydrog ?    ? DA A   158  N1    ? ? ? 1_555 DA U   178  N3 ? ? 0 A   158  0 U   178  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog207  hydrog ?    ? DA A   158  N6    ? ? ? 1_555 DA U   178  O4 ? ? 0 A   158  0 U   178  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog208  hydrog ?    ? DA G   159  N2    ? ? ? 1_555 DA A   177  N7 ? ? 0 G   159  0 A   177  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog209  hydrog ?    ? DA G   159  N3    ? ? ? 1_555 DA A   177  N6 ? ? 0 G   159  0 A   177  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog210  hydrog ?    ? DA A   160  N6    ? ? ? 1_555 DA U   176  O2 ? ? 0 A   160  0 U   176  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog211  hydrog ?    ? DA A   160  N7    ? ? ? 1_555 DA U   176  N3 ? ? 0 A   160  0 U   176  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog212  hydrog ?    ? DA A   161  N6    ? ? ? 1_555 DA A   174  N7 ? ? 0 A   161  0 A   174  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog213  hydrog ?    ? DA A   161  N7    ? ? ? 1_555 DA A   174  N6 ? ? 0 A   161  0 A   174  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog214  hydrog ?    ? DA A   161  N3    ? ? ? 1_555 DA G   892  N2 ? ? 0 A   161  0 G   892  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog215  hydrog ?    ? DA C   162  N4    ? ? ? 1_555 DA C   173  O2 ? ? 0 C   162  0 C   173  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog216  hydrog ?    ? DA C   162  O2    ? ? ? 1_555 DA C   893  N4 ? ? 0 C   162  0 C   893  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog217  hydrog ?    ? DA U   163  N3    ? ? ? 1_555 DA U   172  O2 ? ? 0 U   163  0 U   172  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog218  hydrog ?    ? DA U   163  O4    ? ? ? 1_555 DA U   172  N3 ? ? 0 U   163  0 U   172  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog219  hydrog ?    ? DA G   164  N1    ? ? ? 1_555 DA C   171  N3 ? ? 0 G   164  0 C   171  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog220  hydrog ?    ? DA G   164  N2    ? ? ? 1_555 DA C   171  O2 ? ? 0 G   164  0 C   171  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog221  hydrog ?    ? DA G   164  O6    ? ? ? 1_555 DA C   171  N4 ? ? 0 G   164  0 C   171  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog222  hydrog ?    ? DA G   164  N2    ? ? ? 1_555 DA A   222  N3 ? ? 0 G   164  0 A   222  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog223  hydrog ?    ? DA A   165  N3    ? ? ? 1_555 DA G   221  N2 ? ? 0 A   165  0 G   221  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog224  hydrog ?    ? DA A   166  N1    ? ? ? 1_555 DA G   924  N2 ? ? 0 A   166  0 G   924  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog225  hydrog ?    ? DA A   166  N6    ? ? ? 1_555 DA G   924  N3 ? ? 0 A   166  0 G   924  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog226  hydrog ?    ? DA C   168  N3    ? ? ? 1_555 DA G   219  N1 ? ? 0 C   168  0 G   219  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog227  hydrog ?    ? DA C   168  N4    ? ? ? 1_555 DA G   219  O6 ? ? 0 C   168  0 G   219  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog228  hydrog ?    ? DA C   168  O2    ? ? ? 1_555 DA G   219  N2 ? ? 0 C   168  0 G   219  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog229  hydrog ?    ? DA U   170  N3    ? ? ? 1_555 DA G   221  O6 ? ? 0 U   170  0 G   221  1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog230  hydrog ?    ? DA C   171  O2    ? ? ? 1_555 DA G   221  N1 ? ? 0 C   171  0 G   221  1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog231  hydrog ?    ? DA G   175  N2    ? ? ? 1_555 DA U   176  O4 ? ? 0 G   175  0 U   176  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog232  hydrog ?    ? DA G   185  N2    ? ? ? 1_555 DA A   439  N1 ? ? 0 G   185  0 A   439  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog233  hydrog ?    ? DA G   190  N2    ? ? ? 1_555 DA A   435  N7 ? ? 0 G   190  0 A   435  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog234  hydrog ?    ? DA A   191  N6    ? ? ? 1_555 DA U   434  O2 ? ? 0 A   191  0 U   434  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog235  hydrog ?    ? DA A   191  N7    ? ? ? 1_555 DA U   434  N3 ? ? 0 A   191  0 U   434  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog236  hydrog ?    ? DA A   192  N6    ? ? ? 1_555 DA G   203  N3 ? ? 0 A   192  0 G   203  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog237  hydrog ?    ? DA A   192  N7    ? ? ? 1_555 DA G   203  N2 ? ? 0 A   192  0 G   203  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog238  hydrog ?    ? DA A   193  N3    ? ? ? 1_555 DA G   413  N2 ? ? 0 A   193  0 G   413  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog239  hydrog ?    ? DA A   194  N1    ? ? ? 1_555 DA U   202  N3 ? ? 0 A   194  0 U   202  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog240  hydrog ?    ? DA A   194  N6    ? ? ? 1_555 DA U   202  O4 ? ? 0 A   194  0 U   202  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog241  hydrog ?    ? DA C   195  N3    ? ? ? 1_555 DA G   201  N1 ? ? 0 C   195  0 G   201  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog242  hydrog ?    ? DA C   195  N4    ? ? ? 1_555 DA G   201  O6 ? ? 0 C   195  0 G   201  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog243  hydrog ?    ? DA C   195  O2    ? ? ? 1_555 DA G   201  N2 ? ? 0 C   195  0 G   201  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog244  hydrog ?    ? DA G   196  N2    ? ? ? 1_555 DA A   199  N7 ? ? 0 G   196  0 A   199  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog245  hydrog ?    ? DA G   196  N3    ? ? ? 1_555 DA A   199  N6 ? ? 0 G   196  0 A   199  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog246  hydrog ?    ? DA G   196  N1    ? ? ? 1_555 DA U   425  O2 ? ? 0 G   196  0 U   425  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog247  hydrog ?    ? DA A   198  N1    ? ? ? 1_555 DA G   416  N2 ? ? 0 A   198  0 G   416  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog248  hydrog ?    ? DA A   198  N6    ? ? ? 1_555 DA G   416  N3 ? ? 0 A   198  0 G   416  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog249  hydrog ?    ? DA A   204  N1    ? ? ? 1_555 DA A   436  N6 ? ? 0 A   204  0 A   436  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog250  hydrog ?    ? DA A   204  N6    ? ? ? 1_555 DA A   436  N1 ? ? 0 A   204  0 A   436  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog251  hydrog ?    ? DA U   205  O2    ? ? ? 1_555 DA A   436  N6 ? ? 0 U   205  0 A   436  1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog252  hydrog ?    ? DA U   205  N3    ? ? ? 1_555 DA A   437  N1 ? ? 0 U   205  0 A   437  1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog253  hydrog ?    ? DA U   205  O2    ? ? ? 1_555 DA A   437  N6 ? ? 0 U   205  0 A   437  1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog254  hydrog ?    ? DA G   206  N1    ? ? ? 1_555 DA U   233  O2 ? ? 0 G   206  0 U   233  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog255  hydrog ?    ? DA G   206  O6    ? ? ? 1_555 DA U   233  N3 ? ? 0 G   206  0 U   233  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog256  hydrog ?    ? DA U   207  N3    ? ? ? 1_555 DA A   232  N1 ? ? 0 U   207  0 A   232  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog257  hydrog ?    ? DA U   207  O4    ? ? ? 1_555 DA A   232  N6 ? ? 0 U   207  0 A   232  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog258  hydrog ?    ? DA C   208  N3    ? ? ? 1_555 DA G   231  N1 ? ? 0 C   208  0 G   231  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog259  hydrog ?    ? DA C   208  N4    ? ? ? 1_555 DA G   231  O6 ? ? 0 C   208  0 G   231  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog260  hydrog ?    ? DA C   208  O2    ? ? ? 1_555 DA G   231  N2 ? ? 0 C   208  0 G   231  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog261  hydrog ?    ? DA G   209  N1    ? ? ? 1_555 DA C   230  N3 ? ? 0 G   209  0 C   230  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog262  hydrog ?    ? DA G   209  N2    ? ? ? 1_555 DA C   230  O2 ? ? 0 G   209  0 C   230  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog263  hydrog ?    ? DA G   209  O6    ? ? ? 1_555 DA C   230  N4 ? ? 0 G   209  0 C   230  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog264  hydrog ?    ? DA G   209  N2    ? ? ? 1_555 DA A   682  N3 ? ? 0 G   209  0 A   682  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog265  hydrog ?    ? DA U   210  N3    ? ? ? 1_555 DA G   229  O6 ? ? 0 U   210  0 G   229  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog266  hydrog ?    ? DA U   210  O2    ? ? ? 1_555 DA G   229  N1 ? ? 0 U   210  0 G   229  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog267  hydrog ?    ? DA U   211  O2    ? ? ? 1_555 DA C   228  N4 ? ? 0 U   211  0 C   228  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog268  hydrog ?    ? DA A   212  N6    ? ? ? 1_555 DA A   227  N7 ? ? 0 A   212  0 A   227  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog269  hydrog ?    ? DA A   212  N7    ? ? ? 1_555 DA A   227  N6 ? ? 0 A   212  0 A   227  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog270  hydrog ?    ? DA G   213  N2    ? ? ? 1_555 DA U   214  O4 ? ? 0 G   213  0 U   214  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog271  hydrog ?    ? DA U   214  N3    ? ? ? 1_555 DA A   226  N7 ? ? 0 U   214  0 A   226  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog272  hydrog ?    ? DA U   214  O2    ? ? ? 1_555 DA A   226  N6 ? ? 0 U   214  0 A   226  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog273  hydrog ?    ? DA A   215  N6    ? ? ? 1_555 DA G   225  N3 ? ? 0 A   215  0 G   225  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog274  hydrog ?    ? DA A   215  N7    ? ? ? 1_555 DA G   225  N2 ? ? 0 A   215  0 G   225  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog275  hydrog ?    ? DA A   216  N1    ? ? ? 1_555 DA U   224  N3 ? ? 0 A   216  0 U   224  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog276  hydrog ?    ? DA A   216  N6    ? ? ? 1_555 DA U   224  O4 ? ? 0 A   216  0 U   224  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog277  hydrog ?    ? DA C   217  N3    ? ? ? 1_555 DA G   223  N1 ? ? 0 C   217  0 G   223  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog278  hydrog ?    ? DA C   217  N4    ? ? ? 1_555 DA G   223  O6 ? ? 0 C   217  0 G   223  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog279  hydrog ?    ? DA C   217  O2    ? ? ? 1_555 DA G   223  N2 ? ? 0 C   217  0 G   223  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog280  hydrog ?    ? DA C   218  O2    ? ? ? 1_555 DA A   222  N6 ? ? 0 C   218  0 A   222  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog281  hydrog ?    ? DA C   218  O2    ? ? ? 1_555 DA G   223  N1 ? ? 0 C   218  0 G   223  1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog282  hydrog ?    ? DA G   231  N2    ? ? ? 1_555 DA A   666  N3 ? ? 0 G   231  0 A   666  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog283  hydrog ?    ? DA G   237  N1    ? ? ? 1_555 DA C   433  N3 ? ? 0 G   237  0 C   433  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog284  hydrog ?    ? DA G   237  N2    ? ? ? 1_555 DA C   433  O2 ? ? 0 G   237  0 C   433  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog285  hydrog ?    ? DA G   237  O6    ? ? ? 1_555 DA C   433  N4 ? ? 0 G   237  0 C   433  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog286  hydrog ?    ? DA C   238  N3    ? ? ? 1_555 DA G   432  N1 ? ? 0 C   238  0 G   432  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog287  hydrog ?    ? DA C   238  N4    ? ? ? 1_555 DA G   432  O6 ? ? 0 C   238  0 G   432  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog288  hydrog ?    ? DA C   238  O2    ? ? ? 1_555 DA G   432  N2 ? ? 0 C   238  0 G   432  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog289  hydrog ?    ? DA C   239  N3    ? ? ? 1_555 DA G   431  N1 ? ? 0 C   239  0 G   431  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog290  hydrog ?    ? DA C   239  N4    ? ? ? 1_555 DA G   431  O6 ? ? 0 C   239  0 G   431  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog291  hydrog ?    ? DA C   239  O2    ? ? ? 1_555 DA G   431  N2 ? ? 0 C   239  0 G   431  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog292  hydrog ?    ? DA C   240  N3    ? ? ? 1_555 DA G   379  N1 ? ? 0 C   240  0 G   379  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog293  hydrog ?    ? DA C   240  N4    ? ? ? 1_555 DA G   379  O6 ? ? 0 C   240  0 G   379  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog294  hydrog ?    ? DA C   240  O2    ? ? ? 1_555 DA G   379  N2 ? ? 0 C   240  0 G   379  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog295  hydrog ?    ? DA A   241  N6    ? ? ? 1_555 DA U   270  O2 ? ? 0 A   241  0 U   270  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog296  hydrog ?    ? DA A   241  N7    ? ? ? 1_555 DA U   270  N3 ? ? 0 A   241  0 U   270  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog297  hydrog ?    ? DA A   242  N6    ? ? ? 1_555 DA G   269  N3 ? ? 0 A   242  0 G   269  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog298  hydrog ?    ? DA A   242  N7    ? ? ? 1_555 DA G   269  N2 ? ? 0 A   242  0 G   269  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog299  hydrog ?    ? DA A   243  N6    ? ? ? 1_555 DA U   268  O2 ? ? 0 A   243  0 U   268  1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog300  hydrog ?    ? DA A   243  N3    ? ? ? 1_555 DA G   274  N2 ? ? 0 A   243  0 G   274  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog301  hydrog ?    ? DA C   244  N3    ? ? ? 1_555 DA G   267  N1 ? ? 0 C   244  0 G   267  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog302  hydrog ?    ? DA C   244  N4    ? ? ? 1_555 DA G   267  O6 ? ? 0 C   244  0 G   267  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog303  hydrog ?    ? DA C   244  O2    ? ? ? 1_555 DA G   267  N2 ? ? 0 C   244  0 G   267  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog304  hydrog ?    ? DA C   245  N3    ? ? ? 1_555 DA G   266  N1 ? ? 0 C   245  0 G   266  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog305  hydrog ?    ? DA C   245  N4    ? ? ? 1_555 DA G   266  O6 ? ? 0 C   245  0 G   266  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog306  hydrog ?    ? DA C   245  O2    ? ? ? 1_555 DA G   266  N2 ? ? 0 C   245  0 G   266  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog307  hydrog ?    ? DA G   246  N2    ? ? ? 1_555 DA U   265  O4 ? ? 0 G   246  0 U   265  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog308  hydrog ?    ? DA A   247  N6    ? ? ? 1_555 DA G   264  N3 ? ? 0 A   247  0 G   264  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog309  hydrog ?    ? DA A   247  N7    ? ? ? 1_555 DA G   264  N2 ? ? 0 A   247  0 G   264  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog310  hydrog ?    ? DA A   248  N1    ? ? ? 1_555 DA U   265  N3 ? ? 0 A   248  0 U   265  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog311  hydrog ?    ? DA A   248  N6    ? ? ? 1_555 DA U   265  O4 ? ? 0 A   248  0 U   265  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog312  hydrog ?    ? DA G   249  N1    ? ? ? 1_555 DA C   260  N3 ? ? 0 G   249  0 C   260  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog313  hydrog ?    ? DA G   249  N2    ? ? ? 1_555 DA C   260  O2 ? ? 0 G   249  0 C   260  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog314  hydrog ?    ? DA G   249  O6    ? ? ? 1_555 DA C   260  N4 ? ? 0 G   249  0 C   260  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog315  hydrog ?    ? DA C   250  N3    ? ? ? 1_555 DA G   259  N1 ? ? 0 C   250  0 G   259  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog316  hydrog ?    ? DA C   250  N4    ? ? ? 1_555 DA G   259  O6 ? ? 0 C   250  0 G   259  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog317  hydrog ?    ? DA C   250  O2    ? ? ? 1_555 DA G   259  N2 ? ? 0 C   250  0 G   259  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog318  hydrog ?    ? DA C   251  N3    ? ? ? 1_555 DA G   258  N1 ? ? 0 C   251  0 G   258  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog319  hydrog ?    ? DA C   251  N4    ? ? ? 1_555 DA G   258  O6 ? ? 0 C   251  0 G   258  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog320  hydrog ?    ? DA C   251  O2    ? ? ? 1_555 DA G   258  N2 ? ? 0 C   251  0 G   258  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog321  hydrog ?    ? DA C   252  N3    ? ? ? 1_555 DA G   257  N1 ? ? 0 C   252  0 G   257  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog322  hydrog ?    ? DA C   252  N4    ? ? ? 1_555 DA G   257  O6 ? ? 0 C   252  0 G   257  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog323  hydrog ?    ? DA C   252  O2    ? ? ? 1_555 DA G   257  N2 ? ? 0 C   252  0 G   257  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog324  hydrog ?    ? DA U   253  O2    ? ? ? 1_555 DA C   256  N4 ? ? 0 U   253  0 C   256  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog325  hydrog ?    ? DA C   271  N4    ? ? ? 1_555 DA A   378  N1 ? ? 0 C   271  0 A   378  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog326  hydrog ?    ? DA G   273  N1    ? ? ? 1_555 DA C   377  N3 ? ? 0 G   273  0 C   377  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog327  hydrog ?    ? DA G   273  N2    ? ? ? 1_555 DA C   377  O2 ? ? 0 G   273  0 C   377  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog328  hydrog ?    ? DA G   273  O6    ? ? ? 1_555 DA C   377  N4 ? ? 0 G   273  0 C   377  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog329  hydrog ?    ? DA G   274  N1    ? ? ? 1_555 DA C   376  N3 ? ? 0 G   274  0 C   376  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog330  hydrog ?    ? DA G   274  N2    ? ? ? 1_555 DA C   376  O2 ? ? 0 G   274  0 C   376  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog331  hydrog ?    ? DA G   274  O6    ? ? ? 1_555 DA C   376  N4 ? ? 0 G   274  0 C   376  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog332  hydrog ?    ? DA G   275  N1    ? ? ? 1_555 DA U   374  O2 ? ? 0 G   275  0 U   374  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog333  hydrog ?    ? DA G   275  O6    ? ? ? 1_555 DA U   374  N3 ? ? 0 G   275  0 U   374  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog334  hydrog ?    ? DA C   276  N3    ? ? ? 1_555 DA G   373  N1 ? ? 0 C   276  0 G   373  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog335  hydrog ?    ? DA C   276  N4    ? ? ? 1_555 DA G   373  O6 ? ? 0 C   276  0 G   373  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog336  hydrog ?    ? DA C   276  O2    ? ? ? 1_555 DA G   373  N2 ? ? 0 C   276  0 G   373  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog337  hydrog ?    ? DA U   277  N3    ? ? ? 1_555 DA A   372  N1 ? ? 0 U   277  0 A   372  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog338  hydrog ?    ? DA U   277  O4    ? ? ? 1_555 DA A   372  N6 ? ? 0 U   277  0 A   372  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog339  hydrog ?    ? DA A   278  N1    ? ? ? 1_555 DA U   371  N3 ? ? 0 A   278  0 U   371  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog340  hydrog ?    ? DA A   278  N6    ? ? ? 1_555 DA U   371  O4 ? ? 0 A   278  0 U   371  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog341  hydrog ?    ? DA C   279  O2    ? ? ? 1_555 DA G   370  N2 ? ? 0 C   279  0 G   370  1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog342  hydrog ?    ? DA C   280  N3    ? ? ? 1_555 DA G   369  N1 ? ? 0 C   280  0 G   369  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog343  hydrog ?    ? DA C   280  N4    ? ? ? 1_555 DA G   369  O6 ? ? 0 C   280  0 G   369  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog344  hydrog ?    ? DA C   280  O2    ? ? ? 1_555 DA G   369  N2 ? ? 0 C   280  0 G   369  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog345  hydrog ?    ? DA C   282  O2    ? ? ? 1_555 DA C   368  N4 ? ? 0 C   282  0 C   368  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog346  hydrog ?    ? DA U   286  N3    ? ? ? 1_555 DA U   366  O2 ? ? 0 U   286  0 U   366  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog347  hydrog ?    ? DA U   286  O4    ? ? ? 1_555 DA U   366  N3 ? ? 0 U   286  0 U   366  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog348  hydrog ?    ? DA C   287  N3    ? ? ? 1_555 DA G   365  N1 ? ? 0 C   287  0 G   365  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog349  hydrog ?    ? DA C   287  N4    ? ? ? 1_555 DA G   365  O6 ? ? 0 C   287  0 G   365  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog350  hydrog ?    ? DA C   287  O2    ? ? ? 1_555 DA G   365  N2 ? ? 0 C   287  0 G   365  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog351  hydrog ?    ? DA A   288  N1    ? ? ? 1_555 DA U   364  N3 ? ? 0 A   288  0 U   364  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog352  hydrog ?    ? DA A   288  N6    ? ? ? 1_555 DA U   364  O4 ? ? 0 A   288  0 U   364  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog353  hydrog ?    ? DA G   289  N1    ? ? ? 1_555 DA C   363  N3 ? ? 0 G   289  0 C   363  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog354  hydrog ?    ? DA G   289  N2    ? ? ? 1_555 DA C   363  O2 ? ? 0 G   289  0 C   363  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog355  hydrog ?    ? DA G   289  O6    ? ? ? 1_555 DA C   363  N4 ? ? 0 G   289  0 C   363  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog356  hydrog ?    ? DA C   290  N3    ? ? ? 1_555 DA G   362  N1 ? ? 0 C   290  0 G   362  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog357  hydrog ?    ? DA C   290  N4    ? ? ? 1_555 DA G   362  O6 ? ? 0 C   290  0 G   362  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog358  hydrog ?    ? DA C   290  O2    ? ? ? 1_555 DA G   362  N2 ? ? 0 C   290  0 G   362  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog359  hydrog ?    ? DA C   291  N3    ? ? ? 1_555 DA C   361  N4 ? ? 0 C   291  0 C   361  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog360  hydrog ?    ? DA G   292  N2    ? ? ? 1_555 DA A   360  N7 ? ? 0 G   292  0 A   360  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog361  hydrog ?    ? DA G   292  N3    ? ? ? 1_555 DA A   360  N6 ? ? 0 G   292  0 A   360  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog362  hydrog ?    ? DA A   293  N6    ? ? ? 1_555 DA U   359  O2 ? ? 0 A   293  0 U   359  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog363  hydrog ?    ? DA A   293  N7    ? ? ? 1_555 DA U   359  N3 ? ? 0 A   293  0 U   359  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog364  hydrog ?    ? DA C   295  N4    ? ? ? 1_555 DA C   356  O2 ? ? 0 C   295  0 C   356  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog365  hydrog ?    ? DA G   296  N1    ? ? ? 1_555 DA C   355  N3 ? ? 0 G   296  0 C   355  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog366  hydrog ?    ? DA G   296  N2    ? ? ? 1_555 DA C   355  O2 ? ? 0 G   296  0 C   355  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog367  hydrog ?    ? DA G   296  O6    ? ? ? 1_555 DA C   355  N4 ? ? 0 G   296  0 C   355  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog368  hydrog ?    ? DA U   297  N3    ? ? ? 1_555 DA A   354  N1 ? ? 0 U   297  0 A   354  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog369  hydrog ?    ? DA U   297  O4    ? ? ? 1_555 DA A   354  N6 ? ? 0 U   297  0 A   354  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog370  hydrog ?    ? DA C   298  N3    ? ? ? 1_555 DA G   353  N1 ? ? 0 C   298  0 G   353  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog371  hydrog ?    ? DA C   298  N4    ? ? ? 1_555 DA G   353  O6 ? ? 0 C   298  0 G   353  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog372  hydrog ?    ? DA C   298  O2    ? ? ? 1_555 DA G   353  N2 ? ? 0 C   298  0 G   353  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog373  hydrog ?    ? DA U   299  N3    ? ? ? 1_555 DA A   352  N1 ? ? 0 U   299  0 A   352  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog374  hydrog ?    ? DA U   299  O4    ? ? ? 1_555 DA A   352  N6 ? ? 0 U   299  0 A   352  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog375  hydrog ?    ? DA U   300  N3    ? ? ? 1_555 DA A   351  N1 ? ? 0 U   300  0 A   351  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog376  hydrog ?    ? DA U   300  O4    ? ? ? 1_555 DA A   351  N6 ? ? 0 U   300  0 A   351  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog377  hydrog ?    ? DA C   301  N3    ? ? ? 1_555 DA G   350  N1 ? ? 0 C   301  0 G   350  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog378  hydrog ?    ? DA C   301  N4    ? ? ? 1_555 DA G   350  O6 ? ? 0 C   301  0 G   350  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog379  hydrog ?    ? DA C   301  O2    ? ? ? 1_555 DA G   350  N2 ? ? 0 C   301  0 G   350  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog380  hydrog ?    ? DA A   302  N1    ? ? ? 1_555 DA U   349  N3 ? ? 0 A   302  0 U   349  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog381  hydrog ?    ? DA A   302  N6    ? ? ? 1_555 DA U   349  O4 ? ? 0 A   302  0 U   349  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog382  hydrog ?    ? DA C   303  O2    ? ? ? 1_555 DA C   348  N4 ? ? 0 C   303  0 C   348  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog383  hydrog ?    ? DA G   304  N2    ? ? ? 1_555 DA A   347  N7 ? ? 0 G   304  0 A   347  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog384  hydrog ?    ? DA G   304  N3    ? ? ? 1_555 DA A   347  N6 ? ? 0 G   304  0 A   347  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog385  hydrog ?    ? DA A   305  N6    ? ? ? 1_555 DA G   345  O6 ? ? 0 A   305  0 G   345  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog386  hydrog ?    ? DA A   306  N6    ? ? ? 1_555 DA G   345  O6 ? ? 0 A   306  0 G   345  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog387  hydrog ?    ? DA G   307  N1    ? ? ? 1_555 DA C   323  N3 ? ? 0 G   307  0 C   323  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog388  hydrog ?    ? DA G   307  N2    ? ? ? 1_555 DA C   323  O2 ? ? 0 G   307  0 C   323  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog389  hydrog ?    ? DA G   307  O6    ? ? ? 1_555 DA C   323  N4 ? ? 0 G   307  0 C   323  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog390  hydrog ?    ? DA U   308  N3    ? ? ? 1_555 DA A   339  N1 ? ? 0 U   308  0 A   339  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog391  hydrog ?    ? DA U   308  O4    ? ? ? 1_555 DA A   339  N6 ? ? 0 U   308  0 A   339  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog392  hydrog ?    ? DA C   309  N3    ? ? ? 1_555 DA G   322  N1 ? ? 0 C   309  0 G   322  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog393  hydrog ?    ? DA C   309  N4    ? ? ? 1_555 DA G   322  O6 ? ? 0 C   309  0 G   322  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog394  hydrog ?    ? DA C   309  O2    ? ? ? 1_555 DA G   322  N2 ? ? 0 C   309  0 G   322  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog395  hydrog ?    ? DA U   310  N3    ? ? ? 1_555 DA A   321  N1 ? ? 0 U   310  0 A   321  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog396  hydrog ?    ? DA U   310  O4    ? ? ? 1_555 DA A   321  N6 ? ? 0 U   310  0 A   321  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog397  hydrog ?    ? DA C   311  N3    ? ? ? 1_555 DA G   320  N1 ? ? 0 C   311  0 G   320  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog398  hydrog ?    ? DA C   311  N4    ? ? ? 1_555 DA G   320  O6 ? ? 0 C   311  0 G   320  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog399  hydrog ?    ? DA C   311  O2    ? ? ? 1_555 DA G   320  N2 ? ? 0 C   311  0 G   320  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog400  hydrog ?    ? DA U   312  N3    ? ? ? 1_555 DA A   319  N1 ? ? 0 U   312  0 A   319  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog401  hydrog ?    ? DA U   312  O4    ? ? ? 1_555 DA A   319  N6 ? ? 0 U   312  0 A   319  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog402  hydrog ?    ? DA U   313  N3    ? ? ? 1_555 DA A   317  N7 ? ? 0 U   313  0 A   317  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog403  hydrog ?    ? DA U   313  O2    ? ? ? 1_555 DA A   317  N6 ? ? 0 U   313  0 A   317  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog404  hydrog ?    ? DA G   314  N2    ? ? ? 1_555 DA A   337  N1 ? ? 0 G   314  0 A   337  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog405  hydrog ?    ? DA G   314  N3    ? ? ? 1_555 DA A   337  N6 ? ? 0 G   314  0 A   337  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog406  hydrog ?    ? DA G   315  N2    ? ? ? 1_555 DA G   336  N3 ? ? 0 G   315  0 G   336  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog407  hydrog ?    ? DA G   315  N3    ? ? ? 1_555 DA G   336  N2 ? ? 0 G   315  0 G   336  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog408  hydrog ?    ? DA A   316  N6    ? ? ? 1_555 DA U   1314 O2 ? ? 0 A   316  0 U   1314 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog409  hydrog ?    ? DA G   324  N1    ? ? ? 1_555 DA C   341  N3 ? ? 0 G   324  0 C   341  1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog410  hydrog ?    ? DA U   325  N3    ? ? ? 1_555 DA A   340  N1 ? ? 0 U   325  0 A   340  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog411  hydrog ?    ? DA U   325  O4    ? ? ? 1_555 DA A   340  N6 ? ? 0 U   325  0 A   340  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog412  hydrog ?    ? DA G   326  N1    ? ? ? 1_555 DA C   330  N3 ? ? 0 G   326  0 C   330  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog413  hydrog ?    ? DA G   326  N2    ? ? ? 1_555 DA C   330  O2 ? ? 0 G   326  0 C   330  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog414  hydrog ?    ? DA G   326  O6    ? ? ? 1_555 DA C   330  N4 ? ? 0 G   326  0 C   330  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog415  hydrog ?    ? DA A   329  N3    ? ? ? 1_555 DA U   346  N3 ? ? 0 A   329  0 U   346  1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog416  hydrog ?    ? DA A   331  N6    ? ? ? 1_555 DA G   345  N3 ? ? 0 A   331  0 G   345  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog417  hydrog ?    ? DA A   331  N7    ? ? ? 1_555 DA G   345  N2 ? ? 0 A   331  0 G   345  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog418  hydrog ?    ? DA G   332  N1    ? ? ? 1_555 DA C   344  N3 ? ? 0 G   332  0 C   344  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog419  hydrog ?    ? DA G   332  N2    ? ? ? 1_555 DA C   344  O2 ? ? 0 G   332  0 C   344  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog420  hydrog ?    ? DA G   332  O6    ? ? ? 1_555 DA C   344  N4 ? ? 0 G   332  0 C   344  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog421  hydrog ?    ? DA G   333  N1    ? ? ? 1_555 DA C   343  N3 ? ? 0 G   333  0 C   343  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog422  hydrog ?    ? DA G   333  N2    ? ? ? 1_555 DA C   343  O2 ? ? 0 G   333  0 C   343  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog423  hydrog ?    ? DA G   333  O6    ? ? ? 1_555 DA C   343  N4 ? ? 0 G   333  0 C   343  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog424  hydrog ?    ? DA G   334  N1    ? ? ? 1_555 DA C   342  N3 ? ? 0 G   334  0 C   342  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog425  hydrog ?    ? DA G   334  N2    ? ? ? 1_555 DA C   342  O2 ? ? 0 G   334  0 C   342  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog426  hydrog ?    ? DA G   334  O6    ? ? ? 1_555 DA C   342  N4 ? ? 0 G   334  0 C   342  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog427  hydrog ?    ? DA U   335  N3    ? ? ? 1_555 DA A   339  N7 ? ? 0 U   335  0 A   339  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog428  hydrog ?    ? DA U   335  O2    ? ? ? 1_555 DA A   339  N6 ? ? 0 U   335  0 A   339  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog429  hydrog ?    ? DA G   358  N2    ? ? ? 1_555 DA U   359  O4 ? ? 0 G   358  0 U   359  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog430  hydrog ?    ? DA A   380  N6    ? ? ? 1_555 DA A   408  N7 ? ? 0 A   380  0 A   408  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog431  hydrog ?    ? DA A   380  N7    ? ? ? 1_555 DA A   408  N6 ? ? 0 A   380  0 A   408  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog432  hydrog ?    ? DA G   381  N2    ? ? ? 1_555 DA U   382  O4 ? ? 0 G   381  0 U   382  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog433  hydrog ?    ? DA U   382  N3    ? ? ? 1_555 DA A   407  N7 ? ? 0 U   382  0 A   407  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog434  hydrog ?    ? DA U   382  O2    ? ? ? 1_555 DA A   407  N6 ? ? 0 U   382  0 A   407  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog435  hydrog ?    ? DA A   383  N6    ? ? ? 1_555 DA G   406  N3 ? ? 0 A   383  0 G   406  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog436  hydrog ?    ? DA A   383  N7    ? ? ? 1_555 DA G   406  N2 ? ? 0 A   383  0 G   406  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog437  hydrog ?    ? DA G   384  N1    ? ? ? 1_555 DA C   405  N3 ? ? 0 G   384  0 C   405  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog438  hydrog ?    ? DA G   384  N2    ? ? ? 1_555 DA C   405  O2 ? ? 0 G   384  0 C   405  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog439  hydrog ?    ? DA G   384  O6    ? ? ? 1_555 DA C   405  N4 ? ? 0 G   384  0 C   405  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog440  hydrog ?    ? DA C   385  N3    ? ? ? 1_555 DA G   404  N1 ? ? 0 C   385  0 G   404  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog441  hydrog ?    ? DA C   385  N4    ? ? ? 1_555 DA G   404  O6 ? ? 0 C   385  0 G   404  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog442  hydrog ?    ? DA C   385  O2    ? ? ? 1_555 DA G   404  N2 ? ? 0 C   385  0 G   404  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog443  hydrog ?    ? DA G   386  N1    ? ? ? 1_555 DA C   403  N3 ? ? 0 G   386  0 C   403  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog444  hydrog ?    ? DA G   386  N2    ? ? ? 1_555 DA C   403  O2 ? ? 0 G   386  0 C   403  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog445  hydrog ?    ? DA G   386  O6    ? ? ? 1_555 DA C   403  N4 ? ? 0 G   386  0 C   403  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog446  hydrog ?    ? DA G   387  N1    ? ? ? 1_555 DA U   402  O2 ? ? 0 G   387  0 U   402  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog447  hydrog ?    ? DA G   387  O6    ? ? ? 1_555 DA U   402  N3 ? ? 0 G   387  0 U   402  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog448  hydrog ?    ? DA G   388  N1    ? ? ? 1_555 DA C   401  N3 ? ? 0 G   388  0 C   401  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog449  hydrog ?    ? DA G   388  N2    ? ? ? 1_555 DA C   401  O2 ? ? 0 G   388  0 C   401  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog450  hydrog ?    ? DA G   388  O6    ? ? ? 1_555 DA C   401  N4 ? ? 0 G   388  0 C   401  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog451  hydrog ?    ? DA G   389  N1    ? ? ? 1_555 DA C   400  N3 ? ? 0 G   389  0 C   400  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog452  hydrog ?    ? DA G   389  N2    ? ? ? 1_555 DA C   400  O2 ? ? 0 G   389  0 C   400  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog453  hydrog ?    ? DA G   389  O6    ? ? ? 1_555 DA C   400  N4 ? ? 0 G   389  0 C   400  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog454  hydrog ?    ? DA G   390  N1    ? ? ? 1_555 DA C   399  N3 ? ? 0 G   390  0 C   399  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog455  hydrog ?    ? DA G   390  N2    ? ? ? 1_555 DA C   399  O2 ? ? 0 G   390  0 C   399  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog456  hydrog ?    ? DA G   390  O6    ? ? ? 1_555 DA C   399  N4 ? ? 0 G   390  0 C   399  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog457  hydrog ?    ? DA U   391  N3    ? ? ? 1_555 DA U   398  O4 ? ? 0 U   391  0 U   398  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog458  hydrog ?    ? DA U   391  O2    ? ? ? 1_555 DA U   398  N3 ? ? 0 U   391  0 U   398  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog459  hydrog ?    ? DA G   394  N3    ? ? ? 1_555 DA G   417  N1 ? ? 0 G   394  0 G   417  1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog460  hydrog ?    ? DA U   396  O4    ? ? ? 1_555 DA G   2442 N2 ? ? 0 U   396  0 G   2442 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog461  hydrog ?    ? DA A   407  N6    ? ? ? 1_555 DA A   429  N1 ? ? 0 A   407  0 A   429  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog462  hydrog ?    ? DA A   408  N1    ? ? ? 1_555 DA A   429  N6 ? ? 0 A   408  0 A   429  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog463  hydrog ?    ? DA A   408  N6    ? ? ? 1_555 DA A   430  N1 ? ? 0 A   408  0 A   430  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog464  hydrog ?    ? DA C   412  N3    ? ? ? 1_555 DA G   428  N1 ? ? 0 C   412  0 G   428  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog465  hydrog ?    ? DA C   412  N4    ? ? ? 1_555 DA G   428  O6 ? ? 0 C   412  0 G   428  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog466  hydrog ?    ? DA C   412  O2    ? ? ? 1_555 DA G   428  N2 ? ? 0 C   412  0 G   428  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog467  hydrog ?    ? DA G   413  N1    ? ? ? 1_555 DA C   427  N3 ? ? 0 G   413  0 C   427  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog468  hydrog ?    ? DA G   413  N2    ? ? ? 1_555 DA C   427  O2 ? ? 0 G   413  0 C   427  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog469  hydrog ?    ? DA G   413  O6    ? ? ? 1_555 DA C   427  N4 ? ? 0 G   413  0 C   427  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog470  hydrog ?    ? DA C   414  N3    ? ? ? 1_555 DA G   426  N1 ? ? 0 C   414  0 G   426  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog471  hydrog ?    ? DA C   414  N4    ? ? ? 1_555 DA G   426  O6 ? ? 0 C   414  0 G   426  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog472  hydrog ?    ? DA C   414  O2    ? ? ? 1_555 DA G   426  N2 ? ? 0 C   414  0 G   426  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog473  hydrog ?    ? DA A   415  N1    ? ? ? 1_555 DA U   425  N3 ? ? 0 A   415  0 U   425  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog474  hydrog ?    ? DA A   415  N6    ? ? ? 1_555 DA U   425  O4 ? ? 0 A   415  0 U   425  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog475  hydrog ?    ? DA G   416  N1    ? ? ? 1_555 DA C   424  N3 ? ? 0 G   416  0 C   424  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog476  hydrog ?    ? DA G   416  N2    ? ? ? 1_555 DA C   424  O2 ? ? 0 G   416  0 C   424  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog477  hydrog ?    ? DA G   416  O6    ? ? ? 1_555 DA C   424  N4 ? ? 0 G   416  0 C   424  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog478  hydrog ?    ? DA C   418  N3    ? ? ? 1_555 DA G   2449 N1 ? ? 0 C   418  0 G   2449 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog479  hydrog ?    ? DA C   418  N4    ? ? ? 1_555 DA G   2449 O6 ? ? 0 C   418  0 G   2449 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog480  hydrog ?    ? DA C   418  O2    ? ? ? 1_555 DA G   2449 N2 ? ? 0 C   418  0 G   2449 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog481  hydrog ?    ? DA A   419  N3    ? ? ? 1_555 DA C   1920 N4 ? ? 0 A   419  0 C   1920 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog482  hydrog ?    ? DA A   419  N1    ? ? ? 1_555 DA U   2448 N3 ? ? 0 A   419  0 U   2448 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog483  hydrog ?    ? DA A   419  N6    ? ? ? 1_555 DA U   2448 O4 ? ? 0 A   419  0 U   2448 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog484  hydrog ?    ? DA U   420  N3    ? ? ? 1_555 DA A   2447 N1 ? ? 0 U   420  0 A   2447 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog485  hydrog ?    ? DA U   420  O4    ? ? ? 1_555 DA A   2447 N6 ? ? 0 U   420  0 A   2447 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog486  hydrog ?    ? DA C   421  N3    ? ? ? 1_555 DA G   2446 N1 ? ? 0 C   421  0 G   2446 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog487  hydrog ?    ? DA C   421  N4    ? ? ? 1_555 DA G   2446 O6 ? ? 0 C   421  0 G   2446 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog488  hydrog ?    ? DA C   421  O2    ? ? ? 1_555 DA G   2446 N2 ? ? 0 C   421  0 G   2446 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog489  hydrog ?    ? DA G   422  N1    ? ? ? 1_555 DA U   2445 O2 ? ? 0 G   422  0 U   2445 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog490  hydrog ?    ? DA G   422  O6    ? ? ? 1_555 DA U   2445 N3 ? ? 0 G   422  0 U   2445 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog491  hydrog ?    ? DA A   423  N1    ? ? ? 1_555 DA U   2444 N3 ? ? 0 A   423  0 U   2444 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog492  hydrog ?    ? DA A   423  N6    ? ? ? 1_555 DA U   2444 O4 ? ? 0 A   423  0 U   2444 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog493  hydrog ?    ? DA A   441  N3    ? ? ? 1_555 DA A   442  N6 ? ? 0 A   441  0 A   442  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog494  hydrog ?    ? DA A   449  N3    ? ? ? 1_555 DA G   1349 N2 ? ? 0 A   449  0 G   1349 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog495  hydrog ?    ? DA G   452  N2    ? ? ? 1_555 DA A   460  N1 ? ? 0 G   452  0 A   460  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog496  hydrog ?    ? DA G   452  N3    ? ? ? 1_555 DA A   460  N6 ? ? 0 G   452  0 A   460  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog497  hydrog ?    ? DA U   454  N3    ? ? ? 1_555 DA U   1362 O2 ? ? 0 U   454  0 U   1362 1_555 ? ? ? ? ? ? 'U-U MISPAIR' ? 
? 
hydrog498  hydrog ?    ? DA A   455  N1    ? ? ? 1_555 DA A   460  N6 ? ? 0 A   455  0 A   460  1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog499  hydrog ?    ? DA A   455  N6    ? ? ? 1_555 DA A   460  N7 ? ? 0 A   455  0 A   460  1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog500  hydrog ?    ? DA G   458  N2    ? ? ? 1_555 DA A   463  N3 ? ? 0 G   458  0 A   463  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog501  hydrog ?    ? DA A   463  N6    ? ? ? 1_555 DA A   477  N7 ? ? 0 A   463  0 A   477  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog502  hydrog ?    ? DA A   463  N7    ? ? ? 1_555 DA A   477  N6 ? ? 0 A   463  0 A   477  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog503  hydrog ?    ? DA G   464  N2    ? ? ? 1_555 DA U   465  O4 ? ? 0 G   464  0 U   465  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog504  hydrog ?    ? DA U   465  N3    ? ? ? 1_555 DA A   476  N7 ? ? 0 U   465  0 A   476  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog505  hydrog ?    ? DA U   465  O2    ? ? ? 1_555 DA A   476  N6 ? ? 0 U   465  0 A   476  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog506  hydrog ?    ? DA U   465  O2    ? ? ? 1_555 DA A   477  N6 ? ? 0 U   465  0 A   477  1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog507  hydrog ?    ? DA A   466  N6    ? ? ? 1_555 DA G   475  N3 ? ? 0 A   466  0 G   475  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog508  hydrog ?    ? DA A   466  N7    ? ? ? 1_555 DA G   475  N2 ? ? 0 A   466  0 G   475  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog509  hydrog ?    ? DA G   467  N1    ? ? ? 1_555 DA C   474  N3 ? ? 0 G   467  0 C   474  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog510  hydrog ?    ? DA G   467  N2    ? ? ? 1_555 DA C   474  O2 ? ? 0 G   467  0 C   474  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog511  hydrog ?    ? DA G   467  O6    ? ? ? 1_555 DA C   474  N4 ? ? 0 G   467  0 C   474  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog512  hydrog ?    ? DA U   468  N3    ? ? ? 1_555 DA A   473  N1 ? ? 0 U   468  0 A   473  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog513  hydrog ?    ? DA U   468  O4    ? ? ? 1_555 DA A   473  N6 ? ? 0 U   468  0 A   473  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog514  hydrog ?    ? DA G   469  N2    ? ? ? 1_555 DA A   472  N7 ? ? 0 G   469  0 A   472  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog515  hydrog ?    ? DA G   471  N2    ? ? ? 1_555 DA C   774  O2 ? ? 0 G   471  0 C   774  1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog516  hydrog ?    ? DA U   481  N3    ? ? ? 1_555 DA A   485  N7 ? ? 0 U   481  0 A   485  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog517  hydrog ?    ? DA U   481  O2    ? ? ? 1_555 DA A   485  N6 ? ? 0 U   481  0 A   485  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog518  hydrog ?    ? DA G   482  N2    ? ? ? 1_555 DA A   486  N7 ? ? 0 G   482  0 A   486  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog519  hydrog ?    ? DA G   482  N3    ? ? ? 1_555 DA A   486  N6 ? ? 0 G   482  0 A   486  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog520  hydrog ?    ? DA A   485  N1    ? ? ? 1_555 DA A   509  N6 ? ? 0 A   485  0 A   509  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog521  hydrog ?    ? DA A   485  N6    ? ? ? 1_555 DA A   509  N1 ? ? 0 A   485  0 A   509  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog522  hydrog ?    ? DA A   486  N1    ? ? ? 1_555 DA A   511  N6 ? ? 0 A   486  0 A   511  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog523  hydrog ?    ? DA A   486  N6    ? ? ? 1_555 DA A   511  N1 ? ? 0 A   486  0 A   511  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog524  hydrog ?    ? DA G   487  N3    ? ? ? 1_555 DA G   512  N2 ? ? 0 G   487  0 G   512  1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog525  hydrog ?    ? DA G   487  N1    ? ? ? 1_555 DA C   515  N3 ? ? 0 G   487  0 C   515  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog526  hydrog ?    ? DA G   487  N2    ? ? ? 1_555 DA C   515  O2 ? ? 0 G   487  0 C   515  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog527  hydrog ?    ? DA G   487  O6    ? ? ? 1_555 DA C   515  N4 ? ? 0 G   487  0 C   515  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog528  hydrog ?    ? DA U   488  O2    ? ? ? 1_555 DA G   503  N1 ? ? 0 U   488  0 G   503  1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog529  hydrog ?    ? DA A   489  N6    ? ? ? 1_555 DA G   503  N3 ? ? 0 A   489  0 G   503  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog530  hydrog ?    ? DA A   489  N7    ? ? ? 1_555 DA G   503  N2 ? ? 0 A   489  0 G   503  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog531  hydrog ?    ? DA C   490  N4    ? ? ? 1_555 DA A   502  N1 ? ? 0 C   490  0 A   502  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog532  hydrog ?    ? DA C   491  N3    ? ? ? 1_555 DA G   501  N1 ? ? 0 C   491  0 G   501  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog533  hydrog ?    ? DA C   491  N4    ? ? ? 1_555 DA G   501  O6 ? ? 0 C   491  0 G   501  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog534  hydrog ?    ? DA C   491  O2    ? ? ? 1_555 DA G   501  N2 ? ? 0 C   491  0 G   501  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog535  hydrog ?    ? DA C   491  N4    ? ? ? 1_555 DA A   502  N1 ? ? 0 C   491  0 A   502  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog536  hydrog ?    ? DA C   492  N3    ? ? ? 1_555 DA G   500  N1 ? ? 0 C   492  0 G   500  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog537  hydrog ?    ? DA C   492  N4    ? ? ? 1_555 DA G   500  O6 ? ? 0 C   492  0 G   500  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog538  hydrog ?    ? DA C   492  O2    ? ? ? 1_555 DA G   500  N2 ? ? 0 C   492  0 G   500  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog539  hydrog ?    ? DA U   493  N3    ? ? ? 1_555 DA G   499  O6 ? ? 0 U   493  0 G   499  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog540  hydrog ?    ? DA U   493  O2    ? ? ? 1_555 DA G   499  N1 ? ? 0 U   493  0 G   499  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog541  hydrog ?    ? DA G   504  N1    ? ? ? 1_555 DA G   512  O6 ? ? 0 G   504  0 G   512  1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog542  hydrog ?    ? DA C   505  O2    ? ? ? 1_555 DA A   509  N6 ? ? 0 C   505  0 A   509  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog543  hydrog ?    ? DA G   506  N2    ? ? ? 1_555 DA A   511  N7 ? ? 0 G   506  0 A   511  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog544  hydrog ?    ? DA G   506  N3    ? ? ? 1_555 DA A   511  N6 ? ? 0 G   506  0 A   511  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog545  hydrog ?    ? DA A   521  N3    ? ? ? 1_555 DA G   1364 N2 ? ? 0 A   521  0 G   1364 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog546  hydrog ?    ? DA A   532  N3    ? ? ? 1_555 DA G   2660 N2 ? ? 0 A   532  0 G   2660 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog547  hydrog ?    ? DA G   535  N7    ? ? ? 1_555 DA G   2082 N1 ? ? 0 G   535  0 G   2082 1_555 ? ? ? ? ? ? TYPE_7_PAIR ? ? 
hydrog548  hydrog ?    ? DA G   535  O6    ? ? ? 1_555 DA G   2082 N2 ? ? 0 G   535  0 G   2082 1_555 ? ? ? ? ? ? TYPE_7_PAIR ? ? 
hydrog549  hydrog ?    ? DA A   536  N3    ? ? ? 1_555 DA G   2075 N2 ? ? 0 A   536  0 G   2075 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog550  hydrog ?    ? DA G   537  N1    ? ? ? 1_555 DA U   2059 O2 ? ? 0 G   537  0 U   2059 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog551  hydrog ?    ? DA G   537  O6    ? ? ? 1_555 DA U   2059 N3 ? ? 0 G   537  0 U   2059 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog552  hydrog ?    ? DA C   538  N4    ? ? ? 1_555 DA A   2060 N3 ? ? 0 C   538  0 A   2060 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog553  hydrog ?    ? DA G   539  N1    ? ? ? 1_555 DA C   617  N3 ? ? 0 G   539  0 C   617  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog554  hydrog ?    ? DA G   539  N2    ? ? ? 1_555 DA C   617  O2 ? ? 0 G   539  0 C   617  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog555  hydrog ?    ? DA G   539  O6    ? ? ? 1_555 DA C   617  N4 ? ? 0 G   539  0 C   617  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog556  hydrog ?    ? DA A   540  N1    ? ? ? 1_555 DA U   616  N3 ? ? 0 A   540  0 U   616  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog557  hydrog ?    ? DA A   540  N6    ? ? ? 1_555 DA U   616  O4 ? ? 0 A   540  0 U   616  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog558  hydrog ?    ? DA C   541  N3    ? ? ? 1_555 DA G   615  N1 ? ? 0 C   541  0 G   615  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog559  hydrog ?    ? DA C   541  N4    ? ? ? 1_555 DA G   615  O6 ? ? 0 C   541  0 G   615  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog560  hydrog ?    ? DA C   541  O2    ? ? ? 1_555 DA G   615  N2 ? ? 0 C   541  0 G   615  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog561  hydrog ?    ? DA A   542  N1    ? ? ? 1_555 DA U   614  N3 ? ? 0 A   542  0 U   614  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog562  hydrog ?    ? DA A   542  N6    ? ? ? 1_555 DA U   614  O4 ? ? 0 A   542  0 U   614  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog563  hydrog ?    ? DA G   543  N1    ? ? ? 1_555 DA C   613  N3 ? ? 0 G   543  0 C   613  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog564  hydrog ?    ? DA G   543  N2    ? ? ? 1_555 DA C   613  O2 ? ? 0 G   543  0 C   613  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog565  hydrog ?    ? DA G   543  O6    ? ? ? 1_555 DA C   613  N4 ? ? 0 G   543  0 C   613  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog566  hydrog ?    ? DA G   544  N1    ? ? ? 1_555 DA U   612  O2 ? ? 0 G   544  0 U   612  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog567  hydrog ?    ? DA G   544  O6    ? ? ? 1_555 DA U   612  N3 ? ? 0 G   544  0 U   612  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog568  hydrog ?    ? DA G   545  N1    ? ? ? 1_555 DA U   611  O2 ? ? 0 G   545  0 U   611  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog569  hydrog ?    ? DA G   545  O6    ? ? ? 1_555 DA U   611  N3 ? ? 0 G   545  0 U   611  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog570  hydrog ?    ? DA C   546  N3    ? ? ? 1_555 DA G   610  N1 ? ? 0 C   546  0 G   610  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog571  hydrog ?    ? DA C   546  N4    ? ? ? 1_555 DA G   610  O6 ? ? 0 C   546  0 G   610  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog572  hydrog ?    ? DA C   546  O2    ? ? ? 1_555 DA G   610  N2 ? ? 0 C   546  0 G   610  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog573  hydrog ?    ? DA A   547  N1    ? ? ? 1_555 DA U   609  N3 ? ? 0 A   547  0 U   609  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog574  hydrog ?    ? DA A   547  N6    ? ? ? 1_555 DA U   609  O4 ? ? 0 A   547  0 U   609  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog575  hydrog ?    ? DA U   548  N3    ? ? ? 1_555 DA A   608  N1 ? ? 0 U   548  0 A   608  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog576  hydrog ?    ? DA U   548  O4    ? ? ? 1_555 DA A   608  N6 ? ? 0 U   548  0 A   608  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog577  hydrog ?    ? DA A   552  N3    ? ? ? 1_555 DA G   1323 N2 ? ? 0 A   552  0 G   1323 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog578  hydrog ?    ? DA G   553  N1    ? ? ? 1_555 DA C   606  N3 ? ? 0 G   553  0 C   606  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog579  hydrog ?    ? DA G   553  N2    ? ? ? 1_555 DA C   606  O2 ? ? 0 G   553  0 C   606  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog580  hydrog ?    ? DA G   553  O6    ? ? ? 1_555 DA C   606  N4 ? ? 0 G   553  0 C   606  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog581  hydrog ?    ? DA G   554  N1    ? ? ? 1_555 DA C   605  N3 ? ? 0 G   554  0 C   605  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog582  hydrog ?    ? DA G   554  N2    ? ? ? 1_555 DA C   605  O2 ? ? 0 G   554  0 C   605  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog583  hydrog ?    ? DA G   554  O6    ? ? ? 1_555 DA C   605  N4 ? ? 0 G   554  0 C   605  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog584  hydrog ?    ? DA U   555  N3    ? ? ? 1_555 DA A   602  N1 ? ? 0 U   555  0 A   602  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog585  hydrog ?    ? DA U   555  O4    ? ? ? 1_555 DA A   602  N6 ? ? 0 U   555  0 A   602  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog586  hydrog ?    ? DA C   556  N3    ? ? ? 1_555 DA G   601  N1 ? ? 0 C   556  0 G   601  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog587  hydrog ?    ? DA C   556  N4    ? ? ? 1_555 DA G   601  O6 ? ? 0 C   556  0 G   601  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog588  hydrog ?    ? DA C   556  O2    ? ? ? 1_555 DA G   601  N2 ? ? 0 C   556  0 G   601  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog589  hydrog ?    ? DA C   557  N3    ? ? ? 1_555 DA G   600  N1 ? ? 0 C   557  0 G   600  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog590  hydrog ?    ? DA C   557  N4    ? ? ? 1_555 DA G   600  O6 ? ? 0 C   557  0 G   600  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog591  hydrog ?    ? DA C   557  O2    ? ? ? 1_555 DA G   600  N2 ? ? 0 C   557  0 G   600  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog592  hydrog ?    ? DA C   558  N4    ? ? ? 1_555 DA G   599  O6 ? ? 0 C   558  0 G   599  1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog593  hydrog ?    ? DA C   558  O2    ? ? ? 1_555 DA G   600  N2 ? ? 0 C   558  0 G   600  1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog594  hydrog ?    ? DA U   559  O4    ? ? ? 1_555 DA C   598  N4 ? ? 0 U   559  0 C   598  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog595  hydrog ?    ? DA U   560  N3    ? ? ? 1_555 DA A   597  N1 ? ? 0 U   560  0 A   597  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog596  hydrog ?    ? DA U   560  O4    ? ? ? 1_555 DA A   597  N6 ? ? 0 U   560  0 A   597  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog597  hydrog ?    ? DA G   561  N1    ? ? ? 1_555 DA C   596  N3 ? ? 0 G   561  0 C   596  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog598  hydrog ?    ? DA G   561  N2    ? ? ? 1_555 DA C   596  O2 ? ? 0 G   561  0 C   596  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog599  hydrog ?    ? DA G   561  O6    ? ? ? 1_555 DA C   596  N4 ? ? 0 G   561  0 C   596  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog600  hydrog ?    ? DA A   562  N1    ? ? ? 1_555 DA U   595  N3 ? ? 0 A   562  0 U   595  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog601  hydrog ?    ? DA A   562  N6    ? ? ? 1_555 DA U   595  O4 ? ? 0 A   562  0 U   595  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog602  hydrog ?    ? DA C   563  N3    ? ? ? 1_555 DA C   594  N4 ? ? 0 C   563  0 C   594  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog603  hydrog ?    ? DA A   566  N6    ? ? ? 1_555 DA G   592  N3 ? ? 0 A   566  0 G   592  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog604  hydrog ?    ? DA A   566  N7    ? ? ? 1_555 DA G   592  N2 ? ? 0 A   566  0 G   592  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog605  hydrog ?    ? DA A   566  N3    ? ? ? 1_555 DA G   1093 N2 ? ? 0 A   566  0 G   1093 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog606  hydrog ?    ? DA U   567  N3    ? ? ? 1_555 DA A   591  N1 ? ? 0 U   567  0 A   591  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog607  hydrog ?    ? DA U   567  O4    ? ? ? 1_555 DA A   591  N6 ? ? 0 U   567  0 A   591  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog608  hydrog ?    ? DA G   568  N2    ? ? ? 1_555 DA A   590  N7 ? ? 0 G   568  0 A   590  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog609  hydrog ?    ? DA G   568  N3    ? ? ? 1_555 DA A   590  N6 ? ? 0 G   568  0 A   590  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog610  hydrog ?    ? DA A   569  N6    ? ? ? 1_555 DA U   589  O2 ? ? 0 A   569  0 U   589  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog611  hydrog ?    ? DA A   569  N7    ? ? ? 1_555 DA U   589  N3 ? ? 0 A   569  0 U   589  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog612  hydrog ?    ? DA C   571  N4    ? ? ? 1_555 DA C   586  O2 ? ? 0 C   571  0 C   586  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog613  hydrog ?    ? DA G   572  N1    ? ? ? 1_555 DA C   585  N3 ? ? 0 G   572  0 C   585  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog614  hydrog ?    ? DA G   572  N2    ? ? ? 1_555 DA C   585  O2 ? ? 0 G   572  0 C   585  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog615  hydrog ?    ? DA G   572  O6    ? ? ? 1_555 DA C   585  N4 ? ? 0 G   572  0 C   585  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog616  hydrog ?    ? DA A   573  N1    ? ? ? 1_555 DA U   584  N3 ? ? 0 A   573  0 U   584  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog617  hydrog ?    ? DA A   573  N6    ? ? ? 1_555 DA U   584  O4 ? ? 0 A   573  0 U   584  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog618  hydrog ?    ? DA G   574  N1    ? ? ? 1_555 DA C   583  N3 ? ? 0 G   574  0 C   583  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog619  hydrog ?    ? DA G   574  N2    ? ? ? 1_555 DA C   583  O2 ? ? 0 G   574  0 C   583  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog620  hydrog ?    ? DA G   574  O6    ? ? ? 1_555 DA C   583  N4 ? ? 0 G   574  0 C   583  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog621  hydrog ?    ? DA A   575  N1    ? ? ? 1_555 DA U   582  N3 ? ? 0 A   575  0 U   582  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog622  hydrog ?    ? DA A   575  N6    ? ? ? 1_555 DA U   582  O4 ? ? 0 A   575  0 U   582  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog623  hydrog ?    ? DA C   576  N3    ? ? ? 1_555 DA G   581  N1 ? ? 0 C   576  0 G   581  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog624  hydrog ?    ? DA C   576  N4    ? ? ? 1_555 DA G   581  O6 ? ? 0 C   576  0 G   581  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog625  hydrog ?    ? DA C   576  O2    ? ? ? 1_555 DA G   581  N2 ? ? 0 C   576  0 G   581  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog626  hydrog ?    ? DA G   577  N2    ? ? ? 1_555 DA A   580  N7 ? ? 0 G   577  0 A   580  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog627  hydrog ?    ? DA G   579  N2    ? ? ? 1_555 DA U   1111 O2 ? ? 0 G   579  0 U   1111 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog628  hydrog ?    ? DA A   580  N3    ? ? ? 1_555 DA G   1110 N2 ? ? 0 A   580  0 G   1110 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog629  hydrog ?    ? DA G   588  N2    ? ? ? 1_555 DA U   589  O4 ? ? 0 G   588  0 U   589  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog630  hydrog ?    ? DA G   604  N1    ? ? ? 1_555 DA G   607  O6 ? ? 0 G   604  0 G   607  1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog631  hydrog ?    ? DA G   604  N2    ? ? ? 1_555 DA G   607  N7 ? ? 0 G   604  0 G   607  1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog632  hydrog ?    ? DA U   619  N3    ? ? ? 1_555 DA A   2074 N1 ? ? 0 U   619  0 A   2074 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog633  hydrog ?    ? DA U   619  O4    ? ? ? 1_555 DA A   2074 N6 ? ? 0 U   619  0 A   2074 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog634  hydrog ?    ? DA A   620  N6    ? ? ? 1_555 DA A   635  N1 ? ? 0 A   620  0 A   635  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog635  hydrog ?    ? DA C   621  N3    ? ? ? 1_555 DA G   634  N1 ? ? 0 C   621  0 G   634  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog636  hydrog ?    ? DA C   621  N4    ? ? ? 1_555 DA G   634  O6 ? ? 0 C   621  0 G   634  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog637  hydrog ?    ? DA C   621  O2    ? ? ? 1_555 DA G   634  N2 ? ? 0 C   621  0 G   634  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog638  hydrog ?    ? DA G   622  N1    ? ? ? 1_555 DA C   633  N3 ? ? 0 G   622  0 C   633  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog639  hydrog ?    ? DA G   622  N2    ? ? ? 1_555 DA C   633  O2 ? ? 0 G   622  0 C   633  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog640  hydrog ?    ? DA G   622  O6    ? ? ? 1_555 DA C   633  N4 ? ? 0 G   622  0 C   633  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog641  hydrog ?    ? DA U   623  N3    ? ? ? 1_555 DA A   632  N1 ? ? 0 U   623  0 A   632  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog642  hydrog ?    ? DA U   623  O4    ? ? ? 1_555 DA A   632  N6 ? ? 0 U   623  0 A   632  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog643  hydrog ?    ? DA U   624  N3    ? ? ? 1_555 DA 1MA 628  N7 ? ? 0 U   624  0 1MA 628  1_555 ? ? ? ? ? ? 'U-1MA PAIR' ? ? 
hydrog644  hydrog ?    ? DA U   626  O2    ? ? ? 1_555 DA A   1081 N6 ? ? 0 U   626  0 A   1081 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog645  hydrog ?    ? DA A   629  N1    ? ? ? 1_555 DA G   2070 N2 ? ? 0 A   629  0 G   2070 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog646  hydrog ?    ? DA A   629  N6    ? ? ? 1_555 DA G   2070 N3 ? ? 0 A   629  0 G   2070 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog647  hydrog ?    ? DA G   636  N1    ? ? ? 1_555 DA C   1365 N3 ? ? 0 G   636  0 C   1365 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog648  hydrog ?    ? DA G   636  N2    ? ? ? 1_555 DA C   1365 O2 ? ? 0 G   636  0 C   1365 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog649  hydrog ?    ? DA G   636  O6    ? ? ? 1_555 DA C   1365 N4 ? ? 0 G   636  0 C   1365 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog650  hydrog ?    ? DA C   637  N3    ? ? ? 1_555 DA G   1364 N1 ? ? 0 C   637  0 G   1364 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog651  hydrog ?    ? DA C   637  N4    ? ? ? 1_555 DA G   1364 O6 ? ? 0 C   637  0 G   1364 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog652  hydrog ?    ? DA C   637  O2    ? ? ? 1_555 DA G   1364 N2 ? ? 0 C   637  0 G   1364 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog653  hydrog ?    ? DA C   638  N3    ? ? ? 1_555 DA G   1363 N1 ? ? 0 C   638  0 G   1363 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog654  hydrog ?    ? DA C   638  N4    ? ? ? 1_555 DA G   1363 O6 ? ? 0 C   638  0 G   1363 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog655  hydrog ?    ? DA C   638  O2    ? ? ? 1_555 DA G   1363 N2 ? ? 0 C   638  0 G   1363 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog656  hydrog ?    ? DA A   639  N1    ? ? ? 1_555 DA U   1362 N3 ? ? 0 A   639  0 U   1362 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog657  hydrog ?    ? DA A   639  N6    ? ? ? 1_555 DA U   1362 O4 ? ? 0 A   639  0 U   1362 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog658  hydrog ?    ? DA G   640  N1    ? ? ? 1_555 DA C   1361 N3 ? ? 0 G   640  0 C   1361 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog659  hydrog ?    ? DA G   640  N2    ? ? ? 1_555 DA C   1361 O2 ? ? 0 G   640  0 C   1361 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog660  hydrog ?    ? DA G   640  O6    ? ? ? 1_555 DA C   1361 N4 ? ? 0 G   640  0 C   1361 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog661  hydrog ?    ? DA G   641  N1    ? ? ? 1_555 DA C   1360 N3 ? ? 0 G   641  0 C   1360 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog662  hydrog ?    ? DA G   641  N2    ? ? ? 1_555 DA C   1360 O2 ? ? 0 G   641  0 C   1360 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog663  hydrog ?    ? DA G   641  O6    ? ? ? 1_555 DA C   1360 N4 ? ? 0 G   641  0 C   1360 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog664  hydrog ?    ? DA G   642  N2    ? ? ? 1_555 DA A   1358 N7 ? ? 0 G   642  0 A   1358 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog665  hydrog ?    ? DA G   642  N3    ? ? ? 1_555 DA A   1358 N6 ? ? 0 G   642  0 A   1358 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog666  hydrog ?    ? DA A   643  N3    ? ? ? 1_555 DA G   902  N2 ? ? 0 A   643  0 G   902  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog667  hydrog ?    ? DA A   643  N6    ? ? ? 1_555 DA A   1355 N7 ? ? 0 A   643  0 A   1355 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog668  hydrog ?    ? DA A   643  N7    ? ? ? 1_555 DA A   1355 N6 ? ? 0 A   643  0 A   1355 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog669  hydrog ?    ? DA G   644  N1    ? ? ? 1_555 DA U   903  O2 ? ? 0 G   644  0 U   903  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog670  hydrog ?    ? DA U   645  N3    ? ? ? 1_555 DA A   761  N3 ? ? 0 U   645  0 A   761  1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog671  hydrog ?    ? DA G   646  N1    ? ? ? 1_555 DA C   759  N3 ? ? 0 G   646  0 C   759  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog672  hydrog ?    ? DA G   646  N2    ? ? ? 1_555 DA C   759  O2 ? ? 0 G   646  0 C   759  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog673  hydrog ?    ? DA G   646  O6    ? ? ? 1_555 DA C   759  N4 ? ? 0 G   646  0 C   759  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog674  hydrog ?    ? DA U   647  N3    ? ? ? 1_555 DA A   758  N1 ? ? 0 U   647  0 A   758  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog675  hydrog ?    ? DA U   647  O4    ? ? ? 1_555 DA A   758  N6 ? ? 0 U   647  0 A   758  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog676  hydrog ?    ? DA G   648  N1    ? ? ? 1_555 DA C   757  N3 ? ? 0 G   648  0 C   757  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog677  hydrog ?    ? DA G   648  N2    ? ? ? 1_555 DA C   757  O2 ? ? 0 G   648  0 C   757  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog678  hydrog ?    ? DA G   648  O6    ? ? ? 1_555 DA C   757  N4 ? ? 0 G   648  0 C   757  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog679  hydrog ?    ? DA U   649  N3    ? ? ? 1_555 DA A   756  N1 ? ? 0 U   649  0 A   756  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog680  hydrog ?    ? DA U   649  O4    ? ? ? 1_555 DA A   756  N6 ? ? 0 U   649  0 A   756  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog681  hydrog ?    ? DA C   650  N3    ? ? ? 1_555 DA G   755  N1 ? ? 0 C   650  0 G   755  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog682  hydrog ?    ? DA C   650  N4    ? ? ? 1_555 DA G   755  O6 ? ? 0 C   650  0 G   755  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog683  hydrog ?    ? DA C   650  O2    ? ? ? 1_555 DA G   755  N2 ? ? 0 C   650  0 G   755  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog684  hydrog ?    ? DA U   651  N3    ? ? ? 1_555 DA G   754  O6 ? ? 0 U   651  0 G   754  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog685  hydrog ?    ? DA U   651  O2    ? ? ? 1_555 DA G   754  N1 ? ? 0 U   651  0 G   754  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog686  hydrog ?    ? DA G   652  N1    ? ? ? 1_555 DA U   753  O2 ? ? 0 G   652  0 U   753  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog687  hydrog ?    ? DA G   652  O6    ? ? ? 1_555 DA U   753  N3 ? ? 0 G   652  0 U   753  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog688  hydrog ?    ? DA U   653  N3    ? ? ? 1_555 DA G   752  O6 ? ? 0 U   653  0 G   752  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog689  hydrog ?    ? DA U   653  O2    ? ? ? 1_555 DA G   752  N1 ? ? 0 U   653  0 G   752  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog690  hydrog ?    ? DA A   654  N1    ? ? ? 1_555 DA U   751  N3 ? ? 0 A   654  0 U   751  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog691  hydrog ?    ? DA A   654  N6    ? ? ? 1_555 DA U   751  O4 ? ? 0 A   654  0 U   751  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog692  hydrog ?    ? DA U   655  N3    ? ? ? 1_555 DA A   750  N1 ? ? 0 U   655  0 A   750  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog693  hydrog ?    ? DA U   655  O4    ? ? ? 1_555 DA A   750  N6 ? ? 0 U   655  0 A   750  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog694  hydrog ?    ? DA G   656  N1    ? ? ? 1_555 DA C   749  N3 ? ? 0 G   656  0 C   749  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog695  hydrog ?    ? DA G   656  N2    ? ? ? 1_555 DA C   749  O2 ? ? 0 G   656  0 C   749  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog696  hydrog ?    ? DA G   656  O6    ? ? ? 1_555 DA C   749  N4 ? ? 0 G   656  0 C   749  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog697  hydrog ?    ? DA G   657  N1    ? ? ? 1_555 DA C   748  N3 ? ? 0 G   657  0 C   748  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog698  hydrog ?    ? DA G   657  N2    ? ? ? 1_555 DA C   748  O2 ? ? 0 G   657  0 C   748  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog699  hydrog ?    ? DA G   657  O6    ? ? ? 1_555 DA C   748  N4 ? ? 0 G   657  0 C   748  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog700  hydrog ?    ? DA C   658  N3    ? ? ? 1_555 DA G   747  N1 ? ? 0 C   658  0 G   747  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog701  hydrog ?    ? DA C   658  N4    ? ? ? 1_555 DA G   747  O6 ? ? 0 C   658  0 G   747  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog702  hydrog ?    ? DA C   658  O2    ? ? ? 1_555 DA G   747  N2 ? ? 0 C   658  0 G   747  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog703  hydrog ?    ? DA G   661  N1    ? ? ? 1_555 DA C   685  N3 ? ? 0 G   661  0 C   685  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog704  hydrog ?    ? DA G   661  N2    ? ? ? 1_555 DA C   685  O2 ? ? 0 G   661  0 C   685  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog705  hydrog ?    ? DA G   661  O6    ? ? ? 1_555 DA C   685  N4 ? ? 0 G   661  0 C   685  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog706  hydrog ?    ? DA U   662  N3    ? ? ? 1_555 DA G   684  O6 ? ? 0 U   662  0 G   684  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog707  hydrog ?    ? DA U   662  O2    ? ? ? 1_555 DA G   684  N1 ? ? 0 U   662  0 G   684  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog708  hydrog ?    ? DA C   663  N3    ? ? ? 1_555 DA G   683  N1 ? ? 0 C   663  0 G   683  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog709  hydrog ?    ? DA C   663  N4    ? ? ? 1_555 DA G   683  O6 ? ? 0 C   663  0 G   683  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog710  hydrog ?    ? DA C   663  O2    ? ? ? 1_555 DA G   683  N2 ? ? 0 C   663  0 G   683  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog711  hydrog ?    ? DA U   664  N3    ? ? ? 1_555 DA A   682  N7 ? ? 0 U   664  0 A   682  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog712  hydrog ?    ? DA U   664  O2    ? ? ? 1_555 DA A   682  N6 ? ? 0 U   664  0 A   682  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog713  hydrog ?    ? DA A   666  N6    ? ? ? 1_555 DA G   680  N3 ? ? 0 A   666  0 G   680  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog714  hydrog ?    ? DA A   666  N7    ? ? ? 1_555 DA G   680  N2 ? ? 0 A   666  0 G   680  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog715  hydrog ?    ? DA C   667  N3    ? ? ? 1_555 DA G   679  N1 ? ? 0 C   667  0 G   679  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog716  hydrog ?    ? DA C   667  N4    ? ? ? 1_555 DA G   679  O6 ? ? 0 C   667  0 G   679  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog717  hydrog ?    ? DA C   667  O2    ? ? ? 1_555 DA G   679  N2 ? ? 0 C   667  0 G   679  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog718  hydrog ?    ? DA C   668  N3    ? ? ? 1_555 DA G   678  N1 ? ? 0 C   668  0 G   678  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog719  hydrog ?    ? DA C   668  N4    ? ? ? 1_555 DA G   678  O6 ? ? 0 C   668  0 G   678  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog720  hydrog ?    ? DA C   668  O2    ? ? ? 1_555 DA G   678  N2 ? ? 0 C   668  0 G   678  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog721  hydrog ?    ? DA G   669  N1    ? ? ? 1_555 DA C   677  N3 ? ? 0 G   669  0 C   677  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog722  hydrog ?    ? DA G   669  N2    ? ? ? 1_555 DA C   677  O2 ? ? 0 G   669  0 C   677  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog723  hydrog ?    ? DA G   669  O6    ? ? ? 1_555 DA C   677  N4 ? ? 0 G   669  0 C   677  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog724  hydrog ?    ? DA G   670  N1    ? ? ? 1_555 DA C   676  N3 ? ? 0 G   670  0 C   676  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog725  hydrog ?    ? DA G   670  N2    ? ? ? 1_555 DA C   676  O2 ? ? 0 G   670  0 C   676  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog726  hydrog ?    ? DA G   670  O6    ? ? ? 1_555 DA C   676  N4 ? ? 0 G   670  0 C   676  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog727  hydrog ?    ? DA G   689  N1    ? ? ? 1_555 DA C   696  N3 ? ? 0 G   689  0 C   696  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog728  hydrog ?    ? DA G   689  N2    ? ? ? 1_555 DA C   696  O2 ? ? 0 G   689  0 C   696  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog729  hydrog ?    ? DA G   689  O6    ? ? ? 1_555 DA C   696  N4 ? ? 0 G   689  0 C   696  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog730  hydrog ?    ? DA G   690  N1    ? ? ? 1_555 DA C   695  N3 ? ? 0 G   690  0 C   695  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog731  hydrog ?    ? DA G   690  N2    ? ? ? 1_555 DA C   695  O2 ? ? 0 G   690  0 C   695  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog732  hydrog ?    ? DA G   690  O6    ? ? ? 1_555 DA C   695  N4 ? ? 0 G   690  0 C   695  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog733  hydrog ?    ? DA G   691  N2    ? ? ? 1_555 DA A   694  N7 ? ? 0 G   691  0 A   694  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog734  hydrog ?    ? DA A   692  N1    ? ? ? 1_555 DA G   2453 N2 ? ? 0 A   692  0 G   2453 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog735  hydrog ?    ? DA A   698  N3    ? ? ? 1_555 DA G   742  N2 ? ? 0 A   698  0 G   742  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog736  hydrog ?    ? DA C   699  N3    ? ? ? 1_555 DA G   727  N1 ? ? 0 C   699  0 G   727  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog737  hydrog ?    ? DA C   699  N4    ? ? ? 1_555 DA G   727  O6 ? ? 0 C   699  0 G   727  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog738  hydrog ?    ? DA C   699  O2    ? ? ? 1_555 DA G   727  N2 ? ? 0 C   699  0 G   727  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog739  hydrog ?    ? DA G   702  N1    ? ? ? 1_555 DA C   726  N3 ? ? 0 G   702  0 C   726  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog740  hydrog ?    ? DA G   702  N2    ? ? ? 1_555 DA C   726  O2 ? ? 0 G   702  0 C   726  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog741  hydrog ?    ? DA G   702  O6    ? ? ? 1_555 DA C   726  N4 ? ? 0 G   702  0 C   726  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog742  hydrog ?    ? DA G   702  N7    ? ? ? 1_555 DA G   744  N2 ? ? 0 G   702  0 G   744  1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog743  hydrog ?    ? DA G   702  O6    ? ? ? 1_555 DA G   744  N1 ? ? 0 G   702  0 G   744  1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog744  hydrog ?    ? DA G   703  N1    ? ? ? 1_555 DA C   725  N3 ? ? 0 G   703  0 C   725  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog745  hydrog ?    ? DA G   703  N2    ? ? ? 1_555 DA C   725  O2 ? ? 0 G   703  0 C   725  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog746  hydrog ?    ? DA G   703  O6    ? ? ? 1_555 DA C   725  N4 ? ? 0 G   703  0 C   725  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog747  hydrog ?    ? DA C   704  N3    ? ? ? 1_555 DA G   724  N1 ? ? 0 C   704  0 G   724  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog748  hydrog ?    ? DA C   704  N4    ? ? ? 1_555 DA G   724  O6 ? ? 0 C   704  0 G   724  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog749  hydrog ?    ? DA C   704  O2    ? ? ? 1_555 DA G   724  N2 ? ? 0 C   704  0 G   724  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog750  hydrog ?    ? DA C   705  N3    ? ? ? 1_555 DA G   723  N1 ? ? 0 C   705  0 G   723  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog751  hydrog ?    ? DA C   705  N4    ? ? ? 1_555 DA G   723  O6 ? ? 0 C   705  0 G   723  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog752  hydrog ?    ? DA C   705  O2    ? ? ? 1_555 DA G   723  N2 ? ? 0 C   705  0 G   723  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog753  hydrog ?    ? DA G   706  N2    ? ? ? 1_555 DA G   722  O6 ? ? 0 G   706  0 G   722  1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog754  hydrog ?    ? DA C   707  N3    ? ? ? 1_555 DA A   721  N6 ? ? 0 C   707  0 A   721  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog755  hydrog ?    ? DA C   707  N4    ? ? ? 1_555 DA A   721  N7 ? ? 0 C   707  0 A   721  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog756  hydrog ?    ? DA A   708  N6    ? ? ? 1_555 DA G   720  N3 ? ? 0 A   708  0 G   720  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog757  hydrog ?    ? DA A   708  N7    ? ? ? 1_555 DA G   720  N2 ? ? 0 A   708  0 G   720  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog758  hydrog ?    ? DA G   709  N1    ? ? ? 1_555 DA C   719  N3 ? ? 0 G   709  0 C   719  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog759  hydrog ?    ? DA G   709  N2    ? ? ? 1_555 DA C   719  O2 ? ? 0 G   709  0 C   719  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog760  hydrog ?    ? DA G   709  O6    ? ? ? 1_555 DA C   719  N4 ? ? 0 G   709  0 C   719  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog761  hydrog ?    ? DA G   710  N1    ? ? ? 1_555 DA C   718  N3 ? ? 0 G   710  0 C   718  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog762  hydrog ?    ? DA G   710  N2    ? ? ? 1_555 DA C   718  O2 ? ? 0 G   710  0 C   718  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog763  hydrog ?    ? DA G   710  O6    ? ? ? 1_555 DA C   718  N4 ? ? 0 G   710  0 C   718  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog764  hydrog ?    ? DA G   711  N1    ? ? ? 1_555 DA C   717  N3 ? ? 0 G   711  0 C   717  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog765  hydrog ?    ? DA G   711  N2    ? ? ? 1_555 DA C   717  O2 ? ? 0 G   711  0 C   717  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog766  hydrog ?    ? DA G   711  O6    ? ? ? 1_555 DA C   717  N4 ? ? 0 G   711  0 C   717  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog767  hydrog ?    ? DA C   712  N3    ? ? ? 1_555 DA G   716  N1 ? ? 0 C   712  0 G   716  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog768  hydrog ?    ? DA C   712  N4    ? ? ? 1_555 DA G   716  O6 ? ? 0 C   712  0 G   716  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog769  hydrog ?    ? DA C   712  O2    ? ? ? 1_555 DA G   716  N2 ? ? 0 C   712  0 G   716  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog770  hydrog ?    ? DA C   726  N4    ? ? ? 1_555 DA G   744  O6 ? ? 0 C   726  0 G   744  1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog771  hydrog ?    ? DA C   728  N3    ? ? ? 1_555 DA G   743  N1 ? ? 0 C   728  0 G   743  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog772  hydrog ?    ? DA C   728  N4    ? ? ? 1_555 DA G   743  O6 ? ? 0 C   728  0 G   743  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog773  hydrog ?    ? DA C   728  O2    ? ? ? 1_555 DA G   743  N2 ? ? 0 C   728  0 G   743  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog774  hydrog ?    ? DA C   729  N3    ? ? ? 1_555 DA G   742  N1 ? ? 0 C   729  0 G   742  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog775  hydrog ?    ? DA C   729  N4    ? ? ? 1_555 DA G   742  O6 ? ? 0 C   729  0 G   742  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog776  hydrog ?    ? DA C   729  O2    ? ? ? 1_555 DA G   742  N2 ? ? 0 C   729  0 G   742  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog777  hydrog ?    ? DA G   730  N1    ? ? ? 1_555 DA C   741  N3 ? ? 0 G   730  0 C   741  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog778  hydrog ?    ? DA G   730  N2    ? ? ? 1_555 DA C   741  O2 ? ? 0 G   730  0 C   741  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog779  hydrog ?    ? DA G   730  O6    ? ? ? 1_555 DA C   741  N4 ? ? 0 G   730  0 C   741  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog780  hydrog ?    ? DA U   731  N3    ? ? ? 1_555 DA G   740  O6 ? ? 0 U   731  0 G   740  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog781  hydrog ?    ? DA U   731  O2    ? ? ? 1_555 DA G   740  N1 ? ? 0 U   731  0 G   740  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog782  hydrog ?    ? DA C   732  N3    ? ? ? 1_555 DA G   739  N1 ? ? 0 C   732  0 G   739  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog783  hydrog ?    ? DA C   732  N4    ? ? ? 1_555 DA G   739  O6 ? ? 0 C   732  0 G   739  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog784  hydrog ?    ? DA C   732  O2    ? ? ? 1_555 DA G   739  N2 ? ? 0 C   732  0 G   739  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog785  hydrog ?    ? DA U   733  N3    ? ? ? 1_555 DA G   738  O6 ? ? 0 U   733  0 G   738  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog786  hydrog ?    ? DA U   733  O2    ? ? ? 1_555 DA G   738  N1 ? ? 0 U   733  0 G   738  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog787  hydrog ?    ? DA C   762  N3    ? ? ? 1_555 DA G   902  N1 ? ? 0 C   762  0 G   902  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog788  hydrog ?    ? DA C   762  N4    ? ? ? 1_555 DA G   902  O6 ? ? 0 C   762  0 G   902  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog789  hydrog ?    ? DA C   762  O2    ? ? ? 1_555 DA G   902  N2 ? ? 0 C   762  0 G   902  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog790  hydrog ?    ? DA C   763  N3    ? ? ? 1_555 DA G   901  N1 ? ? 0 C   763  0 G   901  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog791  hydrog ?    ? DA C   763  N4    ? ? ? 1_555 DA G   901  O6 ? ? 0 C   763  0 G   901  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog792  hydrog ?    ? DA C   763  O2    ? ? ? 1_555 DA G   901  N2 ? ? 0 C   763  0 G   901  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog793  hydrog ?    ? DA C   764  N4    ? ? ? 1_555 DA U   900  O4 ? ? 0 C   764  0 U   900  1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? 
hydrog794  hydrog ?    ? DA G   765  N1    ? ? ? 1_555 DA C   899  N3 ? ? 0 G   765  0 C   899  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog795  hydrog ?    ? DA G   765  N2    ? ? ? 1_555 DA C   899  O2 ? ? 0 G   765  0 C   899  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog796  hydrog ?    ? DA G   765  O6    ? ? ? 1_555 DA C   899  N4 ? ? 0 G   765  0 C   899  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog797  hydrog ?    ? DA A   766  N6    ? ? ? 1_555 DA C   896  N3 ? ? 0 A   766  0 C   896  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog798  hydrog ?    ? DA A   766  N7    ? ? ? 1_555 DA C   896  N4 ? ? 0 A   766  0 C   896  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog799  hydrog ?    ? DA A   767  N6    ? ? ? 1_555 DA A   895  N1 ? ? 0 A   767  0 A   895  1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog800  hydrog ?    ? DA A   767  N7    ? ? ? 1_555 DA A   895  N6 ? ? 0 A   767  0 A   895  1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog801  hydrog ?    ? DA A   767  N3    ? ? ? 1_555 DA G   2110 N2 ? ? 0 A   767  0 G   2110 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog802  hydrog ?    ? DA C   769  N3    ? ? ? 1_555 DA G   892  N1 ? ? 0 C   769  0 G   892  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog803  hydrog ?    ? DA C   769  N4    ? ? ? 1_555 DA G   892  O6 ? ? 0 C   769  0 G   892  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog804  hydrog ?    ? DA C   769  O2    ? ? ? 1_555 DA G   892  N2 ? ? 0 C   769  0 G   892  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog805  hydrog ?    ? DA C   770  N3    ? ? ? 1_555 DA G   891  N1 ? ? 0 C   770  0 G   891  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog806  hydrog ?    ? DA C   770  N4    ? ? ? 1_555 DA G   891  O6 ? ? 0 C   770  0 G   891  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog807  hydrog ?    ? DA C   770  O2    ? ? ? 1_555 DA G   891  N2 ? ? 0 C   770  0 G   891  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog808  hydrog ?    ? DA G   771  N1    ? ? ? 1_555 DA C   890  N3 ? ? 0 G   771  0 C   890  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog809  hydrog ?    ? DA G   771  N2    ? ? ? 1_555 DA C   890  O2 ? ? 0 G   771  0 C   890  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog810  hydrog ?    ? DA G   771  O6    ? ? ? 1_555 DA C   890  N4 ? ? 0 G   771  0 C   890  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog811  hydrog ?    ? DA G   772  N1    ? ? ? 1_555 DA C   889  N3 ? ? 0 G   772  0 C   889  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog812  hydrog ?    ? DA G   772  N2    ? ? ? 1_555 DA C   889  O2 ? ? 0 G   772  0 C   889  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog813  hydrog ?    ? DA G   772  O6    ? ? ? 1_555 DA C   889  N4 ? ? 0 G   772  0 C   889  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog814  hydrog ?    ? DA A   773  N1    ? ? ? 1_555 DA U   888  N3 ? ? 0 A   773  0 U   888  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog815  hydrog ?    ? DA A   773  N6    ? ? ? 1_555 DA U   888  O4 ? ? 0 A   773  0 U   888  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog816  hydrog ?    ? DA C   774  N3    ? ? ? 1_555 DA G   887  N1 ? ? 0 C   774  0 G   887  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog817  hydrog ?    ? DA C   774  N4    ? ? ? 1_555 DA G   887  O6 ? ? 0 C   774  0 G   887  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog818  hydrog ?    ? DA C   774  O2    ? ? ? 1_555 DA G   887  N2 ? ? 0 C   774  0 G   887  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog819  hydrog ?    ? DA G   775  N1    ? ? ? 1_555 DA G   868  N7 ? ? 0 G   775  0 G   868  1_555 ? ? ? ? ? ? TYPE_7_PAIR ? ? 
hydrog820  hydrog ?    ? DA G   775  N2    ? ? ? 1_555 DA G   868  O6 ? ? 0 G   775  0 G   868  1_555 ? ? ? ? ? ? TYPE_7_PAIR ? ? 
hydrog821  hydrog ?    ? DA A   776  N3    ? ? ? 1_555 DA U   779  N3 ? ? 0 A   776  0 U   779  1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog822  hydrog ?    ? DA A   776  N1    ? ? ? 1_555 DA G   871  N2 ? ? 0 A   776  0 G   871  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog823  hydrog ?    ? DA A   776  N6    ? ? ? 1_555 DA G   871  N3 ? ? 0 A   776  0 G   871  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog824  hydrog ?    ? DA C   778  O2    ? ? ? 1_555 DA A   1836 N6 ? ? 0 C   778  0 A   1836 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog825  hydrog ?    ? DA A   780  N1    ? ? ? 1_555 DA U   866  N3 ? ? 0 A   780  0 U   866  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog826  hydrog ?    ? DA A   780  N6    ? ? ? 1_555 DA U   866  O4 ? ? 0 A   780  0 U   866  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog827  hydrog ?    ? DA C   781  N3    ? ? ? 1_555 DA G   865  N1 ? ? 0 C   781  0 G   865  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog828  hydrog ?    ? DA C   781  N4    ? ? ? 1_555 DA G   865  O6 ? ? 0 C   781  0 G   865  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog829  hydrog ?    ? DA C   781  O2    ? ? ? 1_555 DA G   865  N2 ? ? 0 C   781  0 G   865  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog830  hydrog ?    ? DA G   782  N1    ? ? ? 1_555 DA U   864  O2 ? ? 0 G   782  0 U   864  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog831  hydrog ?    ? DA G   782  O6    ? ? ? 1_555 DA U   864  N3 ? ? 0 G   782  0 U   864  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog832  hydrog ?    ? DA C   783  N3    ? ? ? 1_555 DA G   863  N1 ? ? 0 C   783  0 G   863  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog833  hydrog ?    ? DA C   783  N4    ? ? ? 1_555 DA G   863  O6 ? ? 0 C   783  0 G   863  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog834  hydrog ?    ? DA C   783  O2    ? ? ? 1_555 DA G   863  N2 ? ? 0 C   783  0 G   863  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog835  hydrog ?    ? DA A   784  N1    ? ? ? 1_555 DA U   862  N3 ? ? 0 A   784  0 U   862  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog836  hydrog ?    ? DA A   784  N6    ? ? ? 1_555 DA U   862  O4 ? ? 0 A   784  0 U   862  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog837  hydrog ?    ? DA U   785  N3    ? ? ? 1_555 DA A   861  N1 ? ? 0 U   785  0 A   861  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog838  hydrog ?    ? DA U   785  O4    ? ? ? 1_555 DA A   861  N6 ? ? 0 U   785  0 A   861  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog839  hydrog ?    ? DA G   786  N1    ? ? ? 1_555 DA U   860  O2 ? ? 0 G   786  0 U   860  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog840  hydrog ?    ? DA G   786  O6    ? ? ? 1_555 DA U   860  N3 ? ? 0 G   786  0 U   860  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog841  hydrog ?    ? DA G   787  N1    ? ? ? 1_555 DA C   859  N3 ? ? 0 G   787  0 C   859  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog842  hydrog ?    ? DA G   787  N2    ? ? ? 1_555 DA C   859  O2 ? ? 0 G   787  0 C   859  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog843  hydrog ?    ? DA G   787  O6    ? ? ? 1_555 DA C   859  N4 ? ? 0 G   787  0 C   859  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog844  hydrog ?    ? DA A   788  N1    ? ? ? 1_555 DA U   858  N3 ? ? 0 A   788  0 U   858  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog845  hydrog ?    ? DA A   788  N6    ? ? ? 1_555 DA U   858  O4 ? ? 0 A   788  0 U   858  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog846  hydrog ?    ? DA C   789  N3    ? ? ? 1_555 DA G   856  N1 ? ? 0 C   789  0 G   856  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog847  hydrog ?    ? DA C   789  N4    ? ? ? 1_555 DA G   856  O6 ? ? 0 C   789  0 G   856  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog848  hydrog ?    ? DA C   789  O2    ? ? ? 1_555 DA G   856  N2 ? ? 0 C   789  0 G   856  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog849  hydrog ?    ? DA A   790  N6    ? ? ? 1_555 DA G   824  N3 ? ? 0 A   790  0 G   824  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog850  hydrog ?    ? DA A   790  N7    ? ? ? 1_555 DA G   824  N2 ? ? 0 A   790  0 G   824  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog851  hydrog ?    ? DA A   790  N1    ? ? ? 1_555 DA G   1709 N2 ? ? 0 A   790  0 G   1709 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog852  hydrog ?    ? DA A   791  N1    ? ? ? 1_555 DA U   823  N3 ? ? 0 A   791  0 U   823  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog853  hydrog ?    ? DA A   791  N6    ? ? ? 1_555 DA U   823  O4 ? ? 0 A   791  0 U   823  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog854  hydrog ?    ? DA G   792  N1    ? ? ? 1_555 DA C   822  N3 ? ? 0 G   792  0 C   822  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog855  hydrog ?    ? DA G   792  N2    ? ? ? 1_555 DA C   822  O2 ? ? 0 G   792  0 C   822  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog856  hydrog ?    ? DA G   792  O6    ? ? ? 1_555 DA C   822  N4 ? ? 0 G   792  0 C   822  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog857  hydrog ?    ? DA A   793  N1    ? ? ? 1_555 DA U   821  N3 ? ? 0 A   793  0 U   821  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog858  hydrog ?    ? DA A   793  N6    ? ? ? 1_555 DA U   821  O4 ? ? 0 A   793  0 U   821  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog859  hydrog ?    ? DA U   794  N3    ? ? ? 1_555 DA A   819  N1 ? ? 0 U   794  0 A   819  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog860  hydrog ?    ? DA U   794  O4    ? ? ? 1_555 DA A   819  N6 ? ? 0 U   794  0 A   819  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog861  hydrog ?    ? DA G   795  N2    ? ? ? 1_555 DA A   818  N7 ? ? 0 G   795  0 A   818  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog862  hydrog ?    ? DA G   795  N3    ? ? ? 1_555 DA A   818  N6 ? ? 0 G   795  0 A   818  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog863  hydrog ?    ? DA A   796  N6    ? ? ? 1_555 DA G   817  N3 ? ? 0 A   796  0 G   817  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog864  hydrog ?    ? DA A   796  N7    ? ? ? 1_555 DA G   817  N2 ? ? 0 A   796  0 G   817  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog865  hydrog ?    ? DA A   797  N6    ? ? ? 1_555 DA G   816  N3 ? ? 0 A   797  0 G   816  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog866  hydrog ?    ? DA A   797  N7    ? ? ? 1_555 DA G   816  N2 ? ? 0 A   797  0 G   816  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog867  hydrog ?    ? DA G   798  N1    ? ? ? 1_555 DA U   815  O2 ? ? 0 G   798  0 U   815  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog868  hydrog ?    ? DA G   798  O6    ? ? ? 1_555 DA U   815  N3 ? ? 0 G   798  0 U   815  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog869  hydrog ?    ? DA C   799  N3    ? ? ? 1_555 DA G   814  N1 ? ? 0 C   799  0 G   814  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog870  hydrog ?    ? DA C   799  N4    ? ? ? 1_555 DA G   814  O6 ? ? 0 C   799  0 G   814  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog871  hydrog ?    ? DA C   799  O2    ? ? ? 1_555 DA G   814  N2 ? ? 0 C   799  0 G   814  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog872  hydrog ?    ? DA G   800  N1    ? ? ? 1_555 DA C   813  N3 ? ? 0 G   800  0 C   813  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog873  hydrog ?    ? DA G   800  N2    ? ? ? 1_555 DA C   813  O2 ? ? 0 G   800  0 C   813  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog874  hydrog ?    ? DA G   800  O6    ? ? ? 1_555 DA C   813  N4 ? ? 0 G   800  0 C   813  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog875  hydrog ?    ? DA U   801  N3    ? ? ? 1_555 DA A   812  N1 ? ? 0 U   801  0 A   812  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog876  hydrog ?    ? DA U   801  O4    ? ? ? 1_555 DA A   812  N6 ? ? 0 U   801  0 A   812  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog877  hydrog ?    ? DA G   802  N1    ? ? ? 1_555 DA C   811  N3 ? ? 0 G   802  0 C   811  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog878  hydrog ?    ? DA G   802  N2    ? ? ? 1_555 DA C   811  O2 ? ? 0 G   802  0 C   811  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog879  hydrog ?    ? DA G   802  O6    ? ? ? 1_555 DA C   811  N4 ? ? 0 G   802  0 C   811  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog880  hydrog ?    ? DA C   803  N3    ? ? ? 1_555 DA G   810  N1 ? ? 0 C   803  0 G   810  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog881  hydrog ?    ? DA C   803  N4    ? ? ? 1_555 DA G   810  O6 ? ? 0 C   803  0 G   810  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog882  hydrog ?    ? DA C   803  O2    ? ? ? 1_555 DA G   810  N2 ? ? 0 C   803  0 G   810  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog883  hydrog ?    ? DA C   804  N3    ? ? ? 1_555 DA G   809  N1 ? ? 0 C   804  0 G   809  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog884  hydrog ?    ? DA C   804  N4    ? ? ? 1_555 DA G   809  O6 ? ? 0 C   804  0 G   809  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog885  hydrog ?    ? DA C   804  O2    ? ? ? 1_555 DA G   809  N2 ? ? 0 C   804  0 G   809  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog886  hydrog ?    ? DA G   805  N2    ? ? ? 1_555 DA A   808  N7 ? ? 0 G   805  0 A   808  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog887  hydrog ?    ? DA G   820  N1    ? ? ? 1_555 DA C   1830 N3 ? ? 0 G   820  0 C   1830 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog888  hydrog ?    ? DA G   820  N2    ? ? ? 1_555 DA C   1830 O2 ? ? 0 G   820  0 C   1830 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog889  hydrog ?    ? DA G   820  O6    ? ? ? 1_555 DA C   1830 N4 ? ? 0 G   820  0 C   1830 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog890  hydrog ?    ? DA G   824  N1    ? ? ? 1_555 DA U   826  O4 ? ? 0 G   824  0 U   826  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog891  hydrog ?    ? DA A   827  N6    ? ? ? 1_555 DA G   854  N3 ? ? 0 A   827  0 G   854  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog892  hydrog ?    ? DA A   827  N7    ? ? ? 1_555 DA G   854  N2 ? ? 0 A   827  0 G   854  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog893  hydrog ?    ? DA G   828  N1    ? ? ? 1_555 DA C   853  N3 ? ? 0 G   828  0 C   853  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog894  hydrog ?    ? DA G   828  N2    ? ? ? 1_555 DA C   853  O2 ? ? 0 G   828  0 C   853  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog895  hydrog ?    ? DA G   828  O6    ? ? ? 1_555 DA C   853  N4 ? ? 0 G   828  0 C   853  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog896  hydrog ?    ? DA A   829  N1    ? ? ? 1_555 DA U   852  N3 ? ? 0 A   829  0 U   852  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog897  hydrog ?    ? DA A   829  N6    ? ? ? 1_555 DA U   852  O4 ? ? 0 A   829  0 U   852  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog898  hydrog ?    ? DA G   830  N1    ? ? ? 1_555 DA C   851  N3 ? ? 0 G   830  0 C   851  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog899  hydrog ?    ? DA G   830  N2    ? ? ? 1_555 DA C   851  O2 ? ? 0 G   830  0 C   851  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog900  hydrog ?    ? DA G   830  O6    ? ? ? 1_555 DA C   851  N4 ? ? 0 G   830  0 C   851  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog901  hydrog ?    ? DA G   830  N2    ? ? ? 1_555 DA A   2022 N1 ? ? 0 G   830  0 A   2022 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog902  hydrog ?    ? DA U   832  N3    ? ? ? 1_555 DA U   850  O2 ? ? 0 U   832  0 U   850  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog903  hydrog ?    ? DA U   832  O4    ? ? ? 1_555 DA U   850  N3 ? ? 0 U   832  0 U   850  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog904  hydrog ?    ? DA G   833  N1    ? ? ? 1_555 DA C   849  N3 ? ? 0 G   833  0 C   849  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog905  hydrog ?    ? DA G   833  N2    ? ? ? 1_555 DA C   849  O2 ? ? 0 G   833  0 C   849  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog906  hydrog ?    ? DA G   833  O6    ? ? ? 1_555 DA C   849  N4 ? ? 0 G   833  0 C   849  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog907  hydrog ?    ? DA G   834  N1    ? ? ? 1_555 DA C   848  N3 ? ? 0 G   834  0 C   848  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog908  hydrog ?    ? DA G   834  N2    ? ? ? 1_555 DA C   848  O2 ? ? 0 G   834  0 C   848  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog909  hydrog ?    ? DA G   834  O6    ? ? ? 1_555 DA C   848  N4 ? ? 0 G   834  0 C   848  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog910  hydrog ?    ? DA G   836  N1    ? ? ? 1_555 DA C   847  N3 ? ? 0 G   836  0 C   847  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog911  hydrog ?    ? DA G   836  N2    ? ? ? 1_555 DA C   847  O2 ? ? 0 G   836  0 C   847  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog912  hydrog ?    ? DA G   836  O6    ? ? ? 1_555 DA C   847  N4 ? ? 0 G   836  0 C   847  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog913  hydrog ?    ? DA U   837  N3    ? ? ? 1_555 DA A   846  N1 ? ? 0 U   837  0 A   846  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog914  hydrog ?    ? DA U   837  O4    ? ? ? 1_555 DA A   846  N6 ? ? 0 U   837  0 A   846  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog915  hydrog ?    ? DA C   838  O2    ? ? ? 1_555 DA A   843  N6 ? ? 0 C   838  0 A   843  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog916  hydrog ?    ? DA U   840  N3    ? ? ? 1_555 DA A   2055 N3 ? ? 0 U   840  0 A   2055 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog917  hydrog ?    ? DA C   842  N4    ? ? ? 1_555 DA A   846  N3 ? ? 0 C   842  0 A   846  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog918  hydrog ?    ? DA A   857  N6    ? ? ? 1_555 DA U   1831 O4 ? ? 0 A   857  0 U   1831 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog919  hydrog ?    ? DA A   857  N7    ? ? ? 1_555 DA U   1831 N3 ? ? 0 A   857  0 U   1831 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog920  hydrog ?    ? DA A   857  N6    ? ? ? 1_555 DA A   1845 N3 ? ? 0 A   857  0 A   1845 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog921  hydrog ?    ? DA G   863  N2    ? ? ? 1_555 DA A   1459 N3 ? ? 0 G   863  0 A   1459 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog922  hydrog ?    ? DA A   867  N3    ? ? ? 1_555 DA G   870  N2 ? ? 0 A   867  0 G   870  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog923  hydrog ?    ? DA G   868  N1    ? ? ? 1_555 DA C   884  N3 ? ? 0 G   868  0 C   884  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog924  hydrog ?    ? DA G   868  N2    ? ? ? 1_555 DA C   884  O2 ? ? 0 G   868  0 C   884  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog925  hydrog ?    ? DA G   868  O6    ? ? ? 1_555 DA C   884  N4 ? ? 0 G   868  0 C   884  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog926  hydrog ?    ? DA G   870  N1    ? ? ? 1_555 DA C   880  N3 ? ? 0 G   870  0 C   880  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog927  hydrog ?    ? DA G   870  N2    ? ? ? 1_555 DA C   880  O2 ? ? 0 G   870  0 C   880  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog928  hydrog ?    ? DA G   870  O6    ? ? ? 1_555 DA C   880  N4 ? ? 0 G   870  0 C   880  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog929  hydrog ?    ? DA G   871  N1    ? ? ? 1_555 DA C   879  N3 ? ? 0 G   871  0 C   879  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog930  hydrog ?    ? DA G   871  N2    ? ? ? 1_555 DA C   879  O2 ? ? 0 G   871  0 C   879  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog931  hydrog ?    ? DA G   871  O6    ? ? ? 1_555 DA C   879  N4 ? ? 0 G   871  0 C   879  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog932  hydrog ?    ? DA U   872  N3    ? ? ? 1_555 DA G   878  O6 ? ? 0 U   872  0 G   878  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog933  hydrog ?    ? DA U   872  O2    ? ? ? 1_555 DA G   878  N1 ? ? 0 U   872  0 G   878  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog934  hydrog ?    ? DA G   873  N2    ? ? ? 1_555 DA A   876  N1 ? ? 0 G   873  0 A   876  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog935  hydrog ?    ? DA G   873  N3    ? ? ? 1_555 DA A   876  N6 ? ? 0 G   873  0 A   876  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog936  hydrog ?    ? DA A   874  N3    ? ? ? 1_555 DA G   1832 N2 ? ? 0 A   874  0 G   1832 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog937  hydrog ?    ? DA C   880  N4    ? ? ? 1_555 DA C   884  O2 ? ? 0 C   880  0 C   884  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog938  hydrog ?    ? DA G   885  N2    ? ? ? 1_555 DA G   2113 N3 ? ? 0 G   885  0 G   2113 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog939  hydrog ?    ? DA U   900  O2    ? ? ? 1_555 DA A   2101 N6 ? ? 0 U   900  0 A   2101 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog940  hydrog ?    ? DA C   905  N3    ? ? ? 1_555 DA G   1300 N1 ? ? 0 C   905  0 G   1300 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog941  hydrog ?    ? DA C   905  N4    ? ? ? 1_555 DA G   1300 O6 ? ? 0 C   905  0 G   1300 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog942  hydrog ?    ? DA C   905  O2    ? ? ? 1_555 DA G   1300 N2 ? ? 0 C   905  0 G   1300 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog943  hydrog ?    ? DA C   906  N3    ? ? ? 1_555 DA G   1299 N1 ? ? 0 C   906  0 G   1299 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog944  hydrog ?    ? DA C   906  N4    ? ? ? 1_555 DA G   1299 O6 ? ? 0 C   906  0 G   1299 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog945  hydrog ?    ? DA C   906  O2    ? ? ? 1_555 DA G   1299 N2 ? ? 0 C   906  0 G   1299 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog946  hydrog ?    ? DA C   906  O2    ? ? ? 1_555 DA G   1329 N2 ? ? 0 C   906  0 G   1329 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog947  hydrog ?    ? DA A   907  N1    ? ? ? 1_555 DA U   1298 N3 ? ? 0 A   907  0 U   1298 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog948  hydrog ?    ? DA A   907  N6    ? ? ? 1_555 DA U   1298 O4 ? ? 0 A   907  0 U   1298 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog949  hydrog ?    ? DA A   908  N1    ? ? ? 1_555 DA U   1297 N3 ? ? 0 A   908  0 U   1297 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog950  hydrog ?    ? DA A   908  N6    ? ? ? 1_555 DA U   1297 O4 ? ? 0 A   908  0 U   1297 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog951  hydrog ?    ? DA U   909  N3    ? ? ? 1_555 DA A   1296 N1 ? ? 0 U   909  0 A   1296 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog952  hydrog ?    ? DA U   909  O4    ? ? ? 1_555 DA A   1296 N6 ? ? 0 U   909  0 A   1296 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog953  hydrog ?    ? DA C   910  N3    ? ? ? 1_555 DA G   1295 N1 ? ? 0 C   910  0 G   1295 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog954  hydrog ?    ? DA C   910  N4    ? ? ? 1_555 DA G   1295 O6 ? ? 0 C   910  0 G   1295 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog955  hydrog ?    ? DA C   910  O2    ? ? ? 1_555 DA G   1295 N2 ? ? 0 C   910  0 G   1295 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog956  hydrog ?    ? DA G   911  N2    ? ? ? 1_555 DA A   1294 N7 ? ? 0 G   911  0 A   1294 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog957  hydrog ?    ? DA G   911  N3    ? ? ? 1_555 DA A   1294 N6 ? ? 0 G   911  0 A   1294 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog958  hydrog ?    ? DA A   912  N6    ? ? ? 1_555 DA U   1293 O2 ? ? 0 A   912  0 U   1293 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog959  hydrog ?    ? DA A   912  N7    ? ? ? 1_555 DA U   1293 N3 ? ? 0 A   912  0 U   1293 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog960  hydrog ?    ? DA A   913  N6    ? ? ? 1_555 DA G   1071 O6 ? ? 0 A   913  0 G   1071 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog961  hydrog ?    ? DA A   914  N6    ? ? ? 1_555 DA A   1070 N3 ? ? 0 A   914  0 A   1070 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog962  hydrog ?    ? DA C   915  N3    ? ? ? 1_555 DA G   928  N1 ? ? 0 C   915  0 G   928  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog963  hydrog ?    ? DA C   915  N4    ? ? ? 1_555 DA G   928  O6 ? ? 0 C   915  0 G   928  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog964  hydrog ?    ? DA C   915  O2    ? ? ? 1_555 DA G   928  N2 ? ? 0 C   915  0 G   928  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog965  hydrog ?    ? DA C   915  N4    ? ? ? 1_555 DA U   1042 O2 ? ? 0 C   915  0 U   1042 1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? 
hydrog966  hydrog ?    ? DA A   916  N1    ? ? ? 1_555 DA U   927  N3 ? ? 0 A   916  0 U   927  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog967  hydrog ?    ? DA A   916  N6    ? ? ? 1_555 DA U   927  O4 ? ? 0 A   916  0 U   927  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog968  hydrog ?    ? DA U   917  N3    ? ? ? 1_555 DA A   926  N1 ? ? 0 U   917  0 A   926  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog969  hydrog ?    ? DA U   917  O4    ? ? ? 1_555 DA A   926  N6 ? ? 0 U   917  0 A   926  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog970  hydrog ?    ? DA G   918  N1    ? ? ? 1_555 DA C   925  N3 ? ? 0 G   918  0 C   925  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog971  hydrog ?    ? DA G   918  N2    ? ? ? 1_555 DA C   925  O2 ? ? 0 G   918  0 C   925  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog972  hydrog ?    ? DA G   918  O6    ? ? ? 1_555 DA C   925  N4 ? ? 0 G   918  0 C   925  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog973  hydrog ?    ? DA U   919  N3    ? ? ? 1_555 DA G   924  O6 ? ? 0 U   919  0 G   924  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog974  hydrog ?    ? DA U   919  O2    ? ? ? 1_555 DA G   924  N1 ? ? 0 U   919  0 G   924  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog975  hydrog ?    ? DA G   921  O6    ? ? ? 1_555 DA G   2279 N2 ? ? 0 G   921  0 G   2279 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog976  hydrog ?    ? DA A   923  N6    ? ? ? 1_555 DA U   2107 O2 ? ? 0 A   923  0 U   2107 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog977  hydrog ?    ? DA A   923  N6    ? ? ? 1_555 DA G   2480 N3 ? ? 0 A   923  0 G   2480 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog978  hydrog ?    ? DA A   926  N6    ? ? ? 1_555 DA C   1043 N3 ? ? 0 A   926  0 C   1043 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog979  hydrog ?    ? DA A   926  N7    ? ? ? 1_555 DA C   1043 N4 ? ? 0 A   926  0 C   1043 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog980  hydrog ?    ? DA G   928  N2    ? ? ? 1_555 DA A   2394 N1 ? ? 0 G   928  0 A   2394 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog981  hydrog ?    ? DA A   929  N6    ? ? ? 1_555 DA U   1041 O4 ? ? 0 A   929  0 U   1041 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog982  hydrog ?    ? DA C   930  O2    ? ? ? 1_555 DA A   1040 N6 ? ? 0 C   930  0 A   1040 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog983  hydrog ?    ? DA C   931  N3    ? ? ? 1_555 DA G   1039 N1 ? ? 0 C   931  0 G   1039 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog984  hydrog ?    ? DA C   931  N4    ? ? ? 1_555 DA G   1039 O6 ? ? 0 C   931  0 G   1039 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog985  hydrog ?    ? DA C   931  O2    ? ? ? 1_555 DA G   1039 N2 ? ? 0 C   931  0 G   1039 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog986  hydrog ?    ? DA U   932  N3    ? ? ? 1_555 DA G   1038 O6 ? ? 0 U   932  0 G   1038 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog987  hydrog ?    ? DA U   932  O2    ? ? ? 1_555 DA G   1038 N1 ? ? 0 U   932  0 G   1038 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog988  hydrog ?    ? DA C   933  N3    ? ? ? 1_555 DA G   1037 N1 ? ? 0 C   933  0 G   1037 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog989  hydrog ?    ? DA C   933  N4    ? ? ? 1_555 DA G   1037 O6 ? ? 0 C   933  0 G   1037 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog990  hydrog ?    ? DA C   933  O2    ? ? ? 1_555 DA G   1037 N2 ? ? 0 C   933  0 G   1037 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog991  hydrog ?    ? DA C   934  N3    ? ? ? 1_555 DA G   1036 N1 ? ? 0 C   934  0 G   1036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog992  hydrog ?    ? DA C   934  N4    ? ? ? 1_555 DA G   1036 O6 ? ? 0 C   934  0 G   1036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog993  hydrog ?    ? DA C   934  O2    ? ? ? 1_555 DA G   1036 N2 ? ? 0 C   934  0 G   1036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog994  hydrog ?    ? DA G   935  N1    ? ? ? 1_555 DA C   1035 N3 ? ? 0 G   935  0 C   1035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog995  hydrog ?    ? DA G   935  N2    ? ? ? 1_555 DA C   1035 O2 ? ? 0 G   935  0 C   1035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog996  hydrog ?    ? DA G   935  O6    ? ? ? 1_555 DA C   1035 N4 ? ? 0 G   935  0 C   1035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog997  hydrog ?    ? DA C   936  N3    ? ? ? 1_555 DA G   1034 N1 ? ? 0 C   936  0 G   1034 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog998  hydrog ?    ? DA C   936  N4    ? ? ? 1_555 DA G   1034 O6 ? ? 0 C   936  0 G   1034 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog999  hydrog ?    ? DA C   936  O2    ? ? ? 1_555 DA G   1034 N2 ? ? 0 C   936  0 G   1034 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1000 hydrog ?    ? DA C   937  O2    ? ? ? 1_555 DA C   1033 N4 ? ? 0 C   937  0 C   1033 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1001 hydrog ?    ? DA G   938  N2    ? ? ? 1_555 DA A   1032 N7 ? ? 0 G   938  0 A   1032 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1002 hydrog ?    ? DA A   939  N3    ? ? ? 1_555 DA G   1027 N2 ? ? 0 A   939  0 G   1027 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1003 hydrog ?    ? DA A   939  N6    ? ? ? 1_555 DA G   1031 N3 ? ? 0 A   939  0 G   1031 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1004 hydrog ?    ? DA A   939  N7    ? ? ? 1_555 DA G   1031 N2 ? ? 0 A   939  0 G   1031 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1005 hydrog ?    ? DA G   940  N1    ? ? ? 1_555 DA U   1026 O2 ? ? 0 G   940  0 U   1026 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1006 hydrog ?    ? DA G   940  O6    ? ? ? 1_555 DA U   1026 N3 ? ? 0 G   940  0 U   1026 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1007 hydrog ?    ? DA G   940  N2    ? ? ? 1_555 DA A   1032 N3 ? ? 0 G   940  0 A   1032 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1008 hydrog ?    ? DA G   941  N1    ? ? ? 1_555 DA C   1025 N3 ? ? 0 G   941  0 C   1025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1009 hydrog ?    ? DA G   941  N2    ? ? ? 1_555 DA C   1025 O2 ? ? 0 G   941  0 C   1025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1010 hydrog ?    ? DA G   941  O6    ? ? ? 1_555 DA C   1025 N4 ? ? 0 G   941  0 C   1025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1011 hydrog ?    ? DA U   942  N3    ? ? ? 1_555 DA G   1024 O6 ? ? 0 U   942  0 G   1024 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1012 hydrog ?    ? DA U   942  O2    ? ? ? 1_555 DA G   1024 N1 ? ? 0 U   942  0 G   1024 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1013 hydrog ?    ? DA A   943  N6    ? ? ? 1_555 DA C   1025 O2 ? ? 0 A   943  0 C   1025 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1014 hydrog ?    ? DA G   944  N1    ? ? ? 1_555 DA C   1023 N3 ? ? 0 G   944  0 C   1023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1015 hydrog ?    ? DA G   944  N2    ? ? ? 1_555 DA C   1023 O2 ? ? 0 G   944  0 C   1023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1016 hydrog ?    ? DA G   944  O6    ? ? ? 1_555 DA C   1023 N4 ? ? 0 G   944  0 C   1023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1017 hydrog ?    ? DA U   945  N3    ? ? ? 1_555 DA A   1022 N1 ? ? 0 U   945  0 A   1022 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1018 hydrog ?    ? DA U   945  O4    ? ? ? 1_555 DA A   1022 N6 ? ? 0 U   945  0 A   1022 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1019 hydrog ?    ? DA C   946  N3    ? ? ? 1_555 DA G   1021 N1 ? ? 0 C   946  0 G   1021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1020 hydrog ?    ? DA C   946  N4    ? ? ? 1_555 DA G   1021 O6 ? ? 0 C   946  0 G   1021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1021 hydrog ?    ? DA C   946  O2    ? ? ? 1_555 DA G   1021 N2 ? ? 0 C   946  0 G   1021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1022 hydrog ?    ? DA U   947  N3    ? ? ? 1_555 DA A   1020 N1 ? ? 0 U   947  0 A   1020 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1023 hydrog ?    ? DA U   947  O4    ? ? ? 1_555 DA A   1020 N6 ? ? 0 U   947  0 A   1020 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1024 hydrog ?    ? DA G   948  N1    ? ? ? 1_555 DA C   1019 N3 ? ? 0 G   948  0 C   1019 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1025 hydrog ?    ? DA G   948  N2    ? ? ? 1_555 DA C   1019 O2 ? ? 0 G   948  0 C   1019 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1026 hydrog ?    ? DA G   948  O6    ? ? ? 1_555 DA C   1019 N4 ? ? 0 G   948  0 C   1019 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1027 hydrog ?    ? DA U   949  N3    ? ? ? 1_555 DA A   1018 N1 ? ? 0 U   949  0 A   1018 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1028 hydrog ?    ? DA U   949  O4    ? ? ? 1_555 DA A   1018 N6 ? ? 0 U   949  0 A   1018 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1029 hydrog ?    ? DA G   950  N1    ? ? ? 1_555 DA U   1017 O2 ? ? 0 G   950  0 U   1017 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1030 hydrog ?    ? DA G   950  O6    ? ? ? 1_555 DA U   1017 N3 ? ? 0 G   950  0 U   1017 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1031 hydrog ?    ? DA A   951  N1    ? ? ? 1_555 DA U   1016 N3 ? ? 0 A   951  0 U   1016 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1032 hydrog ?    ? DA A   951  N6    ? ? ? 1_555 DA U   1016 O4 ? ? 0 A   951  0 U   1016 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1033 hydrog ?    ? DA G   952  N1    ? ? ? 1_555 DA C   1015 N3 ? ? 0 G   952  0 C   1015 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1034 hydrog ?    ? DA G   952  N2    ? ? ? 1_555 DA C   1015 O2 ? ? 0 G   952  0 C   1015 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1035 hydrog ?    ? DA G   952  O6    ? ? ? 1_555 DA C   1015 N4 ? ? 0 G   952  0 C   1015 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1036 hydrog ?    ? DA G   953  N2    ? ? ? 1_555 DA U   954  O4 ? ? 0 G   953  0 U   954  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1037 hydrog ?    ? DA U   954  N3    ? ? ? 1_555 DA A   1013 N7 ? ? 0 U   954  0 A   1013 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1038 hydrog ?    ? DA U   954  O2    ? ? ? 1_555 DA A   1013 N6 ? ? 0 U   954  0 A   1013 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1039 hydrog ?    ? DA A   955  N6    ? ? ? 1_555 DA A   1012 N3 ? ? 0 A   955  0 A   1012 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1040 hydrog ?    ? DA G   956  N1    ? ? ? 1_555 DA C   1011 N3 ? ? 0 G   956  0 C   1011 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1041 hydrog ?    ? DA G   956  N2    ? ? ? 1_555 DA C   1011 O2 ? ? 0 G   956  0 C   1011 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1042 hydrog ?    ? DA G   956  O6    ? ? ? 1_555 DA C   1011 N4 ? ? 0 G   956  0 C   1011 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1043 hydrog ?    ? DA A   957  N1    ? ? ? 1_555 DA U   1009 N3 ? ? 0 A   957  0 U   1009 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1044 hydrog ?    ? DA A   957  N6    ? ? ? 1_555 DA U   1009 O4 ? ? 0 A   957  0 U   1009 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1045 hydrog ?    ? DA G   958  N2    ? ? ? 1_555 DA A   961  N1 ? ? 0 G   958  0 A   961  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1046 hydrog ?    ? DA G   958  N3    ? ? ? 1_555 DA A   961  N6 ? ? 0 G   958  0 A   961  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1047 hydrog ?    ? DA G   958  N1    ? ? ? 1_555 DA C   1008 N3 ? ? 0 G   958  0 C   1008 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1048 hydrog ?    ? DA G   958  N2    ? ? ? 1_555 DA C   1008 O2 ? ? 0 G   958  0 C   1008 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1049 hydrog ?    ? DA G   958  O6    ? ? ? 1_555 DA C   1008 N4 ? ? 0 G   958  0 C   1008 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1050 hydrog ?    ? DA C   959  O2    ? ? ? 1_555 DA C   962  N4 ? ? 0 C   959  0 C   962  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1051 hydrog ?    ? DA C   959  O2    ? ? ? 1_555 DA C   963  N4 ? ? 0 C   959  0 C   963  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1052 hydrog ?    ? DA C   959  N3    ? ? ? 1_555 DA A   1005 N6 ? ? 0 C   959  0 A   1005 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1053 hydrog ?    ? DA C   959  N4    ? ? ? 1_555 DA A   1005 N7 ? ? 0 C   959  0 A   1005 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1054 hydrog ?    ? DA C   962  N4    ? ? ? 1_555 DA C   1008 O2 ? ? 0 C   962  0 C   1008 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1055 hydrog ?    ? DA C   963  O2    ? ? ? 1_555 DA A   1005 N6 ? ? 0 C   963  0 A   1005 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1056 hydrog ?    ? DA G   964  N1    ? ? ? 1_555 DA C   1004 N3 ? ? 0 G   964  0 C   1004 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1057 hydrog ?    ? DA G   964  N2    ? ? ? 1_555 DA C   1004 O2 ? ? 0 G   964  0 C   1004 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1058 hydrog ?    ? DA G   964  O6    ? ? ? 1_555 DA C   1004 N4 ? ? 0 G   964  0 C   1004 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1059 hydrog ?    ? DA A   965  N1    ? ? ? 1_555 DA U   1003 N3 ? ? 0 A   965  0 U   1003 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1060 hydrog ?    ? DA A   965  N6    ? ? ? 1_555 DA U   1003 O4 ? ? 0 A   965  0 U   1003 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1061 hydrog ?    ? DA U   966  O2    ? ? ? 1_555 DA G   1002 N1 ? ? 0 U   966  0 G   1002 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog1062 hydrog ?    ? DA U   967  N3    ? ? ? 1_555 DA U   1001 O2 ? ? 0 U   967  0 U   1001 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1063 hydrog ?    ? DA U   967  O4    ? ? ? 1_555 DA U   1001 N3 ? ? 0 U   967  0 U   1001 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1064 hydrog ?    ? DA G   968  N1    ? ? ? 1_555 DA C   1000 N3 ? ? 0 G   968  0 C   1000 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1065 hydrog ?    ? DA G   968  N2    ? ? ? 1_555 DA C   1000 O2 ? ? 0 G   968  0 C   1000 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1066 hydrog ?    ? DA G   968  O6    ? ? ? 1_555 DA C   1000 N4 ? ? 0 G   968  0 C   1000 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1067 hydrog ?    ? DA G   968  N1    ? ? ? 1_555 DA U   1001 O2 ? ? 0 G   968  0 U   1001 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1068 hydrog ?    ? DA G   968  O6    ? ? ? 1_555 DA U   1001 N3 ? ? 0 G   968  0 U   1001 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1069 hydrog ?    ? DA G   969  N1    ? ? ? 1_555 DA C   999  N3 ? ? 0 G   969  0 C   999  1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1070 hydrog ?    ? DA G   969  N1    ? ? ? 1_555 DA C   1000 N3 ? ? 0 G   969  0 C   1000 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1071 hydrog ?    ? DA U   1009 O2    ? ? ? 1_555 DA C   1010 N4 ? ? 0 U   1009 0 C   1010 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog1072 hydrog ?    ? DA A   1014 N6    ? ? ? 1_555 DA A   2302 N7 ? ? 0 A   1014 0 A   2302 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1073 hydrog ?    ? DA A   1014 N7    ? ? ? 1_555 DA A   2302 N6 ? ? 0 A   1014 0 A   2302 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1074 hydrog ?    ? DA G   1045 N1    ? ? ? 1_555 DA C   1069 N3 ? ? 0 G   1045 0 C   1069 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1075 hydrog ?    ? DA G   1045 N2    ? ? ? 1_555 DA C   1069 O2 ? ? 0 G   1045 0 C   1069 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1076 hydrog ?    ? DA G   1045 O6    ? ? ? 1_555 DA C   1069 N4 ? ? 0 G   1045 0 C   1069 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1077 hydrog ?    ? DA G   1046 N1    ? ? ? 1_555 DA C   1068 N3 ? ? 0 G   1046 0 C   1068 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1078 hydrog ?    ? DA G   1046 N2    ? ? ? 1_555 DA C   1068 O2 ? ? 0 G   1046 0 C   1068 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1079 hydrog ?    ? DA G   1046 O6    ? ? ? 1_555 DA C   1068 N4 ? ? 0 G   1046 0 C   1068 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1080 hydrog ?    ? DA G   1046 N2    ? ? ? 1_555 DA A   1082 N3 ? ? 0 G   1046 0 A   1082 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1081 hydrog ?    ? DA U   1047 N3    ? ? ? 1_555 DA A   1067 N1 ? ? 0 U   1047 0 A   1067 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1082 hydrog ?    ? DA U   1047 O4    ? ? ? 1_555 DA A   1067 N6 ? ? 0 U   1047 0 A   1067 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1083 hydrog ?    ? DA G   1048 N1    ? ? ? 1_555 DA U   1066 O2 ? ? 0 G   1048 0 U   1066 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1084 hydrog ?    ? DA G   1048 O6    ? ? ? 1_555 DA U   1066 N3 ? ? 0 G   1048 0 U   1066 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1085 hydrog ?    ? DA C   1049 N3    ? ? ? 1_555 DA G   1065 N1 ? ? 0 C   1049 0 G   1065 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1086 hydrog ?    ? DA C   1049 N4    ? ? ? 1_555 DA G   1065 O6 ? ? 0 C   1049 0 G   1065 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1087 hydrog ?    ? DA C   1049 O2    ? ? ? 1_555 DA G   1065 N2 ? ? 0 C   1049 0 G   1065 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1088 hydrog ?    ? DA G   1050 N1    ? ? ? 1_555 DA U   1064 O2 ? ? 0 G   1050 0 U   1064 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1089 hydrog ?    ? DA G   1050 O6    ? ? ? 1_555 DA U   1064 N3 ? ? 0 G   1050 0 U   1064 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1090 hydrog ?    ? DA C   1051 N3    ? ? ? 1_555 DA G   1063 N1 ? ? 0 C   1051 0 G   1063 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1091 hydrog ?    ? DA C   1051 N4    ? ? ? 1_555 DA G   1063 O6 ? ? 0 C   1051 0 G   1063 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1092 hydrog ?    ? DA C   1051 O2    ? ? ? 1_555 DA G   1063 N2 ? ? 0 C   1051 0 G   1063 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1093 hydrog ?    ? DA G   1052 N1    ? ? ? 1_555 DA U   1062 O2 ? ? 0 G   1052 0 U   1062 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1094 hydrog ?    ? DA G   1052 O6    ? ? ? 1_555 DA U   1062 N3 ? ? 0 G   1052 0 U   1062 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1095 hydrog ?    ? DA G   1053 N1    ? ? ? 1_555 DA C   1061 N3 ? ? 0 G   1053 0 C   1061 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1096 hydrog ?    ? DA G   1053 N2    ? ? ? 1_555 DA C   1061 O2 ? ? 0 G   1053 0 C   1061 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1097 hydrog ?    ? DA G   1053 O6    ? ? ? 1_555 DA C   1061 N4 ? ? 0 G   1053 0 C   1061 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1098 hydrog ?    ? DA G   1054 N1    ? ? ? 1_555 DA C   1060 N3 ? ? 0 G   1054 0 C   1060 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1099 hydrog ?    ? DA G   1054 N2    ? ? ? 1_555 DA C   1060 O2 ? ? 0 G   1054 0 C   1060 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1100 hydrog ?    ? DA G   1054 O6    ? ? ? 1_555 DA C   1060 N4 ? ? 0 G   1054 0 C   1060 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1101 hydrog ?    ? DA G   1055 N2    ? ? ? 1_555 DA A   1058 N7 ? ? 0 G   1055 0 A   1058 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1102 hydrog ?    ? DA U   1056 O4    ? ? ? 1_555 DA G   2529 N2 ? ? 0 U   1056 0 G   2529 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog1103 hydrog ?    ? DA A   1058 N3    ? ? ? 1_555 DA G   2491 N2 ? ? 0 A   1058 0 G   2491 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1104 hydrog ?    ? DA G   1063 N2    ? ? ? 1_555 DA A   2301 N7 ? ? 0 G   1063 0 A   2301 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1105 hydrog ?    ? DA G   1072 N2    ? ? ? 1_555 DA A   1088 N7 ? ? 0 G   1072 0 A   1088 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1106 hydrog ?    ? DA G   1072 N3    ? ? ? 1_555 DA A   1088 N6 ? ? 0 G   1072 0 A   1088 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1107 hydrog ?    ? DA A   1073 N6    ? ? ? 1_555 DA A   1086 N3 ? ? 0 A   1073 0 A   1086 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1108 hydrog ?    ? DA A   1073 N7    ? ? ? 1_555 DA G   1087 N2 ? ? 0 A   1073 0 G   1087 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1109 hydrog ?    ? DA G   1074 N1    ? ? ? 1_555 DA C   1085 N3 ? ? 0 G   1074 0 C   1085 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1110 hydrog ?    ? DA G   1074 N2    ? ? ? 1_555 DA C   1085 O2 ? ? 0 G   1074 0 C   1085 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1111 hydrog ?    ? DA G   1074 O6    ? ? ? 1_555 DA C   1085 N4 ? ? 0 G   1074 0 C   1085 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1112 hydrog ?    ? DA G   1075 N1    ? ? ? 1_555 DA C   1084 N3 ? ? 0 G   1075 0 C   1084 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1113 hydrog ?    ? DA G   1075 N2    ? ? ? 1_555 DA C   1084 O2 ? ? 0 G   1075 0 C   1084 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1114 hydrog ?    ? DA G   1075 O6    ? ? ? 1_555 DA C   1084 N4 ? ? 0 G   1075 0 C   1084 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1115 hydrog ?    ? DA G   1075 N2    ? ? ? 1_555 DA A   1098 N3 ? ? 0 G   1075 0 A   1098 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1116 hydrog ?    ? DA G   1076 N1    ? ? ? 1_555 DA C   1083 N3 ? ? 0 G   1076 0 C   1083 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1117 hydrog ?    ? DA G   1076 N2    ? ? ? 1_555 DA C   1083 O2 ? ? 0 G   1076 0 C   1083 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1118 hydrog ?    ? DA G   1076 O6    ? ? ? 1_555 DA C   1083 N4 ? ? 0 G   1076 0 C   1083 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1119 hydrog ?    ? DA G   1076 N2    ? ? ? 1_555 EA U   87   O4 ? ? 0 G   1076 9 U   87   1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1120 hydrog ?    ? DA A   1079 N3    ? ? ? 1_555 DA G   2068 N2 ? ? 0 A   1079 0 G   2068 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1121 hydrog ?    ? DA C   1083 O2    ? ? ? 1_555 DA A   1124 N6 ? ? 0 C   1083 0 A   1124 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1122 hydrog ?    ? DA G   1089 N1    ? ? ? 1_555 DA C   1267 N3 ? ? 0 G   1089 0 C   1267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1123 hydrog ?    ? DA G   1089 N2    ? ? ? 1_555 DA C   1267 O2 ? ? 0 G   1089 0 C   1267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1124 hydrog ?    ? DA G   1089 O6    ? ? ? 1_555 DA C   1267 N4 ? ? 0 G   1089 0 C   1267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1125 hydrog ?    ? DA A   1090 N1    ? ? ? 1_555 DA U   1266 N3 ? ? 0 A   1090 0 U   1266 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1126 hydrog ?    ? DA A   1090 N6    ? ? ? 1_555 DA U   1266 O4 ? ? 0 A   1090 0 U   1266 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1127 hydrog ?    ? DA U   1091 N3    ? ? ? 1_555 DA G   1265 O6 ? ? 0 U   1091 0 G   1265 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1128 hydrog ?    ? DA U   1091 O2    ? ? ? 1_555 DA G   1265 N1 ? ? 0 U   1091 0 G   1265 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1129 hydrog ?    ? DA A   1092 N1    ? ? ? 1_555 DA U   1264 N3 ? ? 0 A   1092 0 U   1264 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1130 hydrog ?    ? DA G   1093 N1    ? ? ? 1_555 DA C   1263 N3 ? ? 0 G   1093 0 C   1263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1131 hydrog ?    ? DA G   1093 N2    ? ? ? 1_555 DA C   1263 O2 ? ? 0 G   1093 0 C   1263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1132 hydrog ?    ? DA G   1093 O6    ? ? ? 1_555 DA C   1263 N4 ? ? 0 G   1093 0 C   1263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1133 hydrog ?    ? DA G   1094 N1    ? ? ? 1_555 DA C   1262 N3 ? ? 0 G   1094 0 C   1262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1134 hydrog ?    ? DA G   1094 N2    ? ? ? 1_555 DA C   1262 O2 ? ? 0 G   1094 0 C   1262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1135 hydrog ?    ? DA G   1094 O6    ? ? ? 1_555 DA C   1262 N4 ? ? 0 G   1094 0 C   1262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1136 hydrog ?    ? DA U   1095 N3    ? ? ? 1_555 DA A   1261 N1 ? ? 0 U   1095 0 A   1261 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1137 hydrog ?    ? DA U   1095 O4    ? ? ? 1_555 DA A   1261 N6 ? ? 0 U   1095 0 A   1261 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1138 hydrog ?    ? DA U   1096 N3    ? ? ? 1_555 DA A   1259 N7 ? ? 0 U   1096 0 A   1259 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1139 hydrog ?    ? DA U   1096 O2    ? ? ? 1_555 DA A   1259 N6 ? ? 0 U   1096 0 A   1259 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1140 hydrog ?    ? DA A   1098 N6    ? ? ? 1_555 DA G   1258 N3 ? ? 0 A   1098 0 G   1258 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1141 hydrog ?    ? DA A   1098 N7    ? ? ? 1_555 DA G   1258 N2 ? ? 0 A   1098 0 G   1258 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1142 hydrog ?    ? DA G   1099 N1    ? ? ? 1_555 DA C   1257 N3 ? ? 0 G   1099 0 C   1257 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1143 hydrog ?    ? DA G   1099 N2    ? ? ? 1_555 DA C   1257 O2 ? ? 0 G   1099 0 C   1257 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1144 hydrog ?    ? DA G   1099 O6    ? ? ? 1_555 DA C   1257 N4 ? ? 0 G   1099 0 C   1257 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1145 hydrog ?    ? DA G   1100 N2    ? ? ? 1_555 DA A   1107 N3 ? ? 0 G   1100 0 A   1107 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1146 hydrog ?    ? DA G   1100 N1    ? ? ? 1_555 DA C   1256 N3 ? ? 0 G   1100 0 C   1256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1147 hydrog ?    ? DA G   1100 N2    ? ? ? 1_555 DA C   1256 O2 ? ? 0 G   1100 0 C   1256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1148 hydrog ?    ? DA G   1100 O6    ? ? ? 1_555 DA C   1256 N4 ? ? 0 G   1100 0 C   1256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1149 hydrog ?    ? DA U   1101 N3    ? ? ? 1_555 DA A   1255 N1 ? ? 0 U   1101 0 A   1255 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1150 hydrog ?    ? DA U   1101 O4    ? ? ? 1_555 DA A   1255 N6 ? ? 0 U   1101 0 A   1255 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1151 hydrog ?    ? DA C   1102 N3    ? ? ? 1_555 DA G   1241 N1 ? ? 0 C   1102 0 G   1241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1152 hydrog ?    ? DA C   1102 N4    ? ? ? 1_555 DA G   1241 O6 ? ? 0 C   1102 0 G   1241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1153 hydrog ?    ? DA C   1102 O2    ? ? ? 1_555 DA G   1241 N2 ? ? 0 C   1102 0 G   1241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1154 hydrog ?    ? DA C   1103 N3    ? ? ? 1_555 DA G   1240 N1 ? ? 0 C   1103 0 G   1240 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1155 hydrog ?    ? DA C   1103 N4    ? ? ? 1_555 DA G   1240 O6 ? ? 0 C   1103 0 G   1240 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1156 hydrog ?    ? DA C   1103 O2    ? ? ? 1_555 DA G   1240 N2 ? ? 0 C   1103 0 G   1240 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1157 hydrog ?    ? DA C   1104 N3    ? ? ? 1_555 DA G   1239 N1 ? ? 0 C   1104 0 G   1239 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1158 hydrog ?    ? DA C   1104 N4    ? ? ? 1_555 DA G   1239 O6 ? ? 0 C   1104 0 G   1239 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1159 hydrog ?    ? DA C   1104 O2    ? ? ? 1_555 DA G   1239 N2 ? ? 0 C   1104 0 G   1239 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1160 hydrog ?    ? DA C   1105 O2    ? ? ? 1_555 DA A   1106 N6 ? ? 0 C   1105 0 A   1106 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1161 hydrog ?    ? DA G   1108 N1    ? ? ? 1_555 DA C   1254 N3 ? ? 0 G   1108 0 C   1254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1162 hydrog ?    ? DA G   1108 N2    ? ? ? 1_555 DA C   1254 O2 ? ? 0 G   1108 0 C   1254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1163 hydrog ?    ? DA G   1108 O6    ? ? ? 1_555 DA C   1254 N4 ? ? 0 G   1108 0 C   1254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1164 hydrog ?    ? DA U   1109 N3    ? ? ? 1_555 DA A   1247 N7 ? ? 0 U   1109 0 A   1247 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog1165 hydrog ?    ? DA U   1109 O4    ? ? ? 1_555 DA A   1247 N6 ? ? 0 U   1109 0 A   1247 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog1166 hydrog ?    ? DA G   1110 N1    ? ? ? 1_555 DA C   1253 N3 ? ? 0 G   1110 0 C   1253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1167 hydrog ?    ? DA G   1110 N2    ? ? ? 1_555 DA C   1253 O2 ? ? 0 G   1110 0 C   1253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1168 hydrog ?    ? DA G   1110 O6    ? ? ? 1_555 DA C   1253 N4 ? ? 0 G   1110 0 C   1253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1169 hydrog ?    ? DA U   1111 N3    ? ? ? 1_555 DA A   1252 N1 ? ? 0 U   1111 0 A   1252 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1170 hydrog ?    ? DA U   1111 O4    ? ? ? 1_555 DA A   1252 N6 ? ? 0 U   1111 0 A   1252 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1171 hydrog ?    ? DA G   1112 N1    ? ? ? 1_555 DA C   1251 N3 ? ? 0 G   1112 0 C   1251 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1172 hydrog ?    ? DA G   1112 N2    ? ? ? 1_555 DA C   1251 O2 ? ? 0 G   1112 0 C   1251 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1173 hydrog ?    ? DA G   1112 O6    ? ? ? 1_555 DA C   1251 N4 ? ? 0 G   1112 0 C   1251 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1174 hydrog ?    ? DA G   1113 N1    ? ? ? 1_555 DA C   1250 N3 ? ? 0 G   1113 0 C   1250 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1175 hydrog ?    ? DA G   1113 N2    ? ? ? 1_555 DA C   1250 O2 ? ? 0 G   1113 0 C   1250 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1176 hydrog ?    ? DA G   1113 O6    ? ? ? 1_555 DA C   1250 N4 ? ? 0 G   1113 0 C   1250 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1177 hydrog ?    ? DA A   1114 N1    ? ? ? 1_555 DA U   1249 N3 ? ? 0 A   1114 0 U   1249 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1178 hydrog ?    ? DA A   1114 N6    ? ? ? 1_555 DA U   1249 O4 ? ? 0 A   1114 0 U   1249 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1179 hydrog ?    ? DA U   1115 N3    ? ? ? 1_555 DA A   1248 N1 ? ? 0 U   1115 0 A   1248 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1180 hydrog ?    ? DA U   1115 O4    ? ? ? 1_555 DA A   1248 N6 ? ? 0 U   1115 0 A   1248 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1181 hydrog ?    ? DA U   1116 O2    ? ? ? 1_555 DA A   1246 N6 ? ? 0 U   1116 0 A   1246 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1182 hydrog ?    ? DA A   1118 N6    ? ? ? 1_555 DA U   1244 O2 ? ? 0 A   1118 0 U   1244 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1183 hydrog ?    ? DA G   1119 N2    ? ? ? 1_555 DA U   1120 O4 ? ? 0 G   1119 0 U   1120 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1184 hydrog ?    ? DA G   1121 N1    ? ? ? 1_555 DA C   1243 N3 ? ? 0 G   1121 0 C   1243 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1185 hydrog ?    ? DA G   1121 N2    ? ? ? 1_555 DA C   1243 O2 ? ? 0 G   1121 0 C   1243 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1186 hydrog ?    ? DA G   1121 O6    ? ? ? 1_555 DA C   1243 N4 ? ? 0 G   1121 0 C   1243 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1187 hydrog ?    ? DA U   1122 N3    ? ? ? 1_555 DA A   1242 N1 ? ? 0 U   1122 0 A   1242 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1188 hydrog ?    ? DA U   1122 O4    ? ? ? 1_555 DA A   1242 N6 ? ? 0 U   1122 0 A   1242 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1189 hydrog ?    ? DA A   1132 N6    ? ? ? 1_555 DA A   1230 N7 ? ? 0 A   1132 0 A   1230 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1190 hydrog ?    ? DA A   1132 N7    ? ? ? 1_555 DA A   1230 N6 ? ? 0 A   1132 0 A   1230 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1191 hydrog ?    ? DA A   1133 N6    ? ? ? 1_555 DA C   1229 O2 ? ? 0 A   1133 0 C   1229 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1192 hydrog ?    ? DA A   1133 N3    ? ? ? 1_555 DA G   2520 N2 ? ? 0 A   1133 0 G   2520 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1193 hydrog ?    ? DA G   1134 N1    ? ? ? 1_555 DA C   1228 N3 ? ? 0 G   1134 0 C   1228 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1194 hydrog ?    ? DA G   1134 N2    ? ? ? 1_555 DA C   1228 O2 ? ? 0 G   1134 0 C   1228 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1195 hydrog ?    ? DA G   1134 O6    ? ? ? 1_555 DA C   1228 N4 ? ? 0 G   1134 0 C   1228 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1196 hydrog ?    ? DA G   1135 N1    ? ? ? 1_555 DA C   1227 N3 ? ? 0 G   1135 0 C   1227 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1197 hydrog ?    ? DA G   1135 N2    ? ? ? 1_555 DA C   1227 O2 ? ? 0 G   1135 0 C   1227 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1198 hydrog ?    ? DA G   1135 O6    ? ? ? 1_555 DA C   1227 N4 ? ? 0 G   1135 0 C   1227 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1199 hydrog ?    ? DA U   1136 N3    ? ? ? 1_555 DA G   1226 O6 ? ? 0 U   1136 0 G   1226 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1200 hydrog ?    ? DA U   1136 O2    ? ? ? 1_555 DA G   1226 N1 ? ? 0 U   1136 0 G   1226 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1201 hydrog ?    ? DA G   1138 N1    ? ? ? 1_555 DA C   1225 N3 ? ? 0 G   1138 0 C   1225 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1202 hydrog ?    ? DA G   1138 N2    ? ? ? 1_555 DA C   1225 O2 ? ? 0 G   1138 0 C   1225 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1203 hydrog ?    ? DA G   1138 O6    ? ? ? 1_555 DA C   1225 N4 ? ? 0 G   1138 0 C   1225 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1204 hydrog ?    ? DA U   1139 N3    ? ? ? 1_555 DA G   1224 O6 ? ? 0 U   1139 0 G   1224 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1205 hydrog ?    ? DA U   1139 O2    ? ? ? 1_555 DA G   1224 N1 ? ? 0 U   1139 0 G   1224 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1206 hydrog ?    ? DA C   1140 N3    ? ? ? 1_555 DA G   1223 N1 ? ? 0 C   1140 0 G   1223 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1207 hydrog ?    ? DA C   1140 N4    ? ? ? 1_555 DA G   1223 O6 ? ? 0 C   1140 0 G   1223 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1208 hydrog ?    ? DA C   1140 O2    ? ? ? 1_555 DA G   1223 N2 ? ? 0 C   1140 0 G   1223 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1209 hydrog ?    ? DA U   1141 N3    ? ? ? 1_555 DA A   1222 N1 ? ? 0 U   1141 0 A   1222 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1210 hydrog ?    ? DA U   1141 O4    ? ? ? 1_555 DA A   1222 N6 ? ? 0 U   1141 0 A   1222 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1211 hydrog ?    ? DA C   1142 N3    ? ? ? 1_555 DA G   1221 N1 ? ? 0 C   1142 0 G   1221 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1212 hydrog ?    ? DA C   1142 N4    ? ? ? 1_555 DA G   1221 O6 ? ? 0 C   1142 0 G   1221 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1213 hydrog ?    ? DA C   1142 O2    ? ? ? 1_555 DA G   1221 N2 ? ? 0 C   1142 0 G   1221 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1214 hydrog ?    ? DA G   1143 N1    ? ? ? 1_555 DA U   1220 O2 ? ? 0 G   1143 0 U   1220 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1215 hydrog ?    ? DA G   1143 O6    ? ? ? 1_555 DA U   1220 N3 ? ? 0 G   1143 0 U   1220 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1216 hydrog ?    ? DA A   1144 N1    ? ? ? 1_555 DA U   1219 N3 ? ? 0 A   1144 0 U   1219 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1217 hydrog ?    ? DA A   1144 N6    ? ? ? 1_555 DA U   1219 O4 ? ? 0 A   1144 0 U   1219 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1218 hydrog ?    ? DA G   1145 N1    ? ? ? 1_555 DA U   1218 O2 ? ? 0 G   1145 0 U   1218 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1219 hydrog ?    ? DA G   1145 O6    ? ? ? 1_555 DA U   1218 N3 ? ? 0 G   1145 0 U   1218 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1220 hydrog ?    ? DA C   1146 N3    ? ? ? 1_555 DA G   1217 N1 ? ? 0 C   1146 0 G   1217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1221 hydrog ?    ? DA C   1146 N4    ? ? ? 1_555 DA G   1217 O6 ? ? 0 C   1146 0 G   1217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1222 hydrog ?    ? DA C   1146 O2    ? ? ? 1_555 DA G   1217 N2 ? ? 0 C   1146 0 G   1217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1223 hydrog ?    ? DA C   1147 N3    ? ? ? 1_555 DA G   1216 N1 ? ? 0 C   1147 0 G   1216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1224 hydrog ?    ? DA C   1147 N4    ? ? ? 1_555 DA G   1216 O6 ? ? 0 C   1147 0 G   1216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1225 hydrog ?    ? DA C   1147 O2    ? ? ? 1_555 DA G   1216 N2 ? ? 0 C   1147 0 G   1216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1226 hydrog ?    ? DA G   1151 N2    ? ? ? 1_555 DA A   1215 N7 ? ? 0 G   1151 0 A   1215 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1227 hydrog ?    ? DA G   1151 N3    ? ? ? 1_555 DA A   1215 N6 ? ? 0 G   1151 0 A   1215 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1228 hydrog ?    ? DA A   1152 N7    ? ? ? 1_555 DA G   1214 N2 ? ? 0 A   1152 0 G   1214 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1229 hydrog ?    ? DA A   1152 N3    ? ? ? 1_555 DA G   1216 N2 ? ? 0 A   1152 0 G   1216 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1230 hydrog ?    ? DA C   1153 N4    ? ? ? 1_555 DA G   2786 O6 ? ? 0 C   1153 0 G   2786 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1231 hydrog ?    ? DA A   1154 N6    ? ? ? 1_555 DA C   1213 O2 ? ? 0 A   1154 0 C   1213 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1232 hydrog ?    ? DA G   1155 N1    ? ? ? 1_555 DA C   1212 N3 ? ? 0 G   1155 0 C   1212 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1233 hydrog ?    ? DA G   1155 N2    ? ? ? 1_555 DA C   1212 O2 ? ? 0 G   1155 0 C   1212 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1234 hydrog ?    ? DA G   1155 O6    ? ? ? 1_555 DA C   1212 N4 ? ? 0 G   1155 0 C   1212 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1235 hydrog ?    ? DA C   1156 N3    ? ? ? 1_555 DA G   1211 N1 ? ? 0 C   1156 0 G   1211 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1236 hydrog ?    ? DA C   1156 N4    ? ? ? 1_555 DA G   1211 O6 ? ? 0 C   1156 0 G   1211 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1237 hydrog ?    ? DA C   1156 O2    ? ? ? 1_555 DA G   1211 N2 ? ? 0 C   1156 0 G   1211 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1238 hydrog ?    ? DA C   1157 N3    ? ? ? 1_555 DA G   1210 N1 ? ? 0 C   1157 0 G   1210 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1239 hydrog ?    ? DA C   1157 N4    ? ? ? 1_555 DA G   1210 O6 ? ? 0 C   1157 0 G   1210 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1240 hydrog ?    ? DA C   1157 O2    ? ? ? 1_555 DA G   1210 N2 ? ? 0 C   1157 0 G   1210 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1241 hydrog ?    ? DA G   1158 N1    ? ? ? 1_555 DA C   1209 N3 ? ? 0 G   1158 0 C   1209 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1242 hydrog ?    ? DA G   1158 N2    ? ? ? 1_555 DA C   1209 O2 ? ? 0 G   1158 0 C   1209 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1243 hydrog ?    ? DA G   1158 O6    ? ? ? 1_555 DA C   1209 N4 ? ? 0 G   1158 0 C   1209 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1244 hydrog ?    ? DA G   1159 N1    ? ? ? 1_555 DA C   1208 N3 ? ? 0 G   1159 0 C   1208 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1245 hydrog ?    ? DA G   1159 N2    ? ? ? 1_555 DA C   1208 O2 ? ? 0 G   1159 0 C   1208 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1246 hydrog ?    ? DA G   1159 O6    ? ? ? 1_555 DA C   1208 N4 ? ? 0 G   1159 0 C   1208 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1247 hydrog ?    ? DA A   1161 N1    ? ? ? 1_555 DA U   1185 N3 ? ? 0 A   1161 0 U   1185 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1248 hydrog ?    ? DA A   1161 N6    ? ? ? 1_555 DA U   1185 O4 ? ? 0 A   1161 0 U   1185 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1249 hydrog ?    ? DA G   1162 N1    ? ? ? 1_555 DA C   1184 O2 ? ? 0 G   1162 0 C   1184 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1250 hydrog ?    ? DA G   1163 N2    ? ? ? 1_555 DA C   1183 O2 ? ? 0 G   1163 0 C   1183 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1251 hydrog ?    ? DA G   1163 N1    ? ? ? 1_555 DA C   1184 N3 ? ? 0 G   1163 0 C   1184 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1252 hydrog ?    ? DA A   1166 N6    ? ? ? 1_555 DA U   1180 O4 ? ? 0 A   1166 0 U   1180 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1253 hydrog ?    ? DA G   1167 N1    ? ? ? 1_555 DA C   1179 N3 ? ? 0 G   1167 0 C   1179 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1254 hydrog ?    ? DA G   1167 N2    ? ? ? 1_555 DA C   1179 O2 ? ? 0 G   1167 0 C   1179 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1255 hydrog ?    ? DA G   1167 O6    ? ? ? 1_555 DA C   1179 N4 ? ? 0 G   1167 0 C   1179 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1256 hydrog ?    ? DA C   1168 O2    ? ? ? 1_555 DA G   1178 N1 ? ? 0 C   1168 0 G   1178 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1257 hydrog ?    ? DA U   1169 O2    ? ? ? 1_555 DA A   1177 N6 ? ? 0 U   1169 0 A   1177 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1258 hydrog ?    ? DA A   1174 N6    ? ? ? 1_555 DA A   1200 N3 ? ? 0 A   1174 0 A   1200 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1259 hydrog ?    ? DA G   1175 O6    ? ? ? 1_555 DA C   1204 N4 ? ? 0 G   1175 0 C   1204 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1260 hydrog ?    ? DA C   1176 N3    ? ? ? 1_555 DA C   1196 N4 ? ? 0 C   1176 0 C   1196 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1261 hydrog ?    ? DA C   1176 N4    ? ? ? 1_555 DA G   1203 O6 ? ? 0 C   1176 0 G   1203 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1262 hydrog ?    ? DA C   1186 N3    ? ? ? 1_555 DA G   1190 N2 ? ? 0 C   1186 0 G   1190 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1263 hydrog ?    ? DA C   1186 O2    ? ? ? 1_555 DA G   1190 N1 ? ? 0 C   1186 0 G   1190 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1264 hydrog ?    ? DA U   1187 O2    ? ? ? 1_555 DA G   1190 N1 ? ? 0 U   1187 0 G   1190 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog1265 hydrog ?    ? DA A   1193 N3    ? ? ? 1_555 DA A   1194 N6 ? ? 0 A   1193 0 A   1194 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1266 hydrog ?    ? DA A   1194 N1    ? ? ? 1_555 DA U   1205 N3 ? ? 0 A   1194 0 U   1205 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1267 hydrog ?    ? DA A   1194 N6    ? ? ? 1_555 DA U   1205 O4 ? ? 0 A   1194 0 U   1205 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1268 hydrog ?    ? DA G   1195 N1    ? ? ? 1_555 DA C   1204 N3 ? ? 0 G   1195 0 C   1204 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1269 hydrog ?    ? DA C   1196 N3    ? ? ? 1_555 DA G   1203 N1 ? ? 0 C   1196 0 G   1203 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1270 hydrog ?    ? DA C   1196 N4    ? ? ? 1_555 DA G   1203 O6 ? ? 0 C   1196 0 G   1203 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1271 hydrog ?    ? DA C   1196 O2    ? ? ? 1_555 DA G   1203 N2 ? ? 0 C   1196 0 G   1203 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1272 hydrog ?    ? DA G   1197 N2    ? ? ? 1_555 DA A   1202 N7 ? ? 0 G   1197 0 A   1202 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1273 hydrog ?    ? DA G   1197 N3    ? ? ? 1_555 DA A   1202 N6 ? ? 0 G   1197 0 A   1202 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1274 hydrog ?    ? DA A   1231 N6    ? ? ? 1_555 DA C   2498 O2 ? ? 0 A   1231 0 C   2498 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1275 hydrog ?    ? DA A   1231 N6    ? ? ? 1_555 DA U   2523 O2 ? ? 0 A   1231 0 U   2523 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1276 hydrog ?    ? DA G   1235 N2    ? ? ? 1_555 DA A   1236 N7 ? ? 0 G   1235 0 A   1236 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1277 hydrog ?    ? DA G   1235 O6    ? ? ? 1_555 DA G   2080 N2 ? ? 0 G   1235 0 G   2080 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog1278 hydrog ?    ? DA C   1238 N4    ? ? ? 1_555 DA G   1241 N7 ? ? 0 C   1238 0 G   1241 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1279 hydrog ?    ? DA C   1268 N3    ? ? ? 1_555 DA G   1290 N1 ? ? 0 C   1268 0 G   1290 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1280 hydrog ?    ? DA C   1268 N4    ? ? ? 1_555 DA G   1290 O6 ? ? 0 C   1268 0 G   1290 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1281 hydrog ?    ? DA C   1268 O2    ? ? ? 1_555 DA G   1290 N2 ? ? 0 C   1268 0 G   1290 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1282 hydrog ?    ? DA G   1269 N1    ? ? ? 1_555 DA C   1289 N3 ? ? 0 G   1269 0 C   1289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1283 hydrog ?    ? DA G   1269 N2    ? ? ? 1_555 DA C   1289 O2 ? ? 0 G   1269 0 C   1289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1284 hydrog ?    ? DA G   1269 O6    ? ? ? 1_555 DA C   1289 N4 ? ? 0 G   1269 0 C   1289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1285 hydrog ?    ? DA U   1270 N3    ? ? ? 1_555 DA A   1286 N1 ? ? 0 U   1270 0 A   1286 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1286 hydrog ?    ? DA U   1270 O4    ? ? ? 1_555 DA A   1286 N6 ? ? 0 U   1270 0 A   1286 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1287 hydrog ?    ? DA A   1271 N1    ? ? ? 1_555 DA U   1285 N3 ? ? 0 A   1271 0 U   1285 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1288 hydrog ?    ? DA A   1271 N6    ? ? ? 1_555 DA U   1285 O4 ? ? 0 A   1271 0 U   1285 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1289 hydrog ?    ? DA C   1272 N3    ? ? ? 1_555 DA G   1284 N1 ? ? 0 C   1272 0 G   1284 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1290 hydrog ?    ? DA C   1272 N4    ? ? ? 1_555 DA G   1284 O6 ? ? 0 C   1272 0 G   1284 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1291 hydrog ?    ? DA C   1272 O2    ? ? ? 1_555 DA G   1284 N2 ? ? 0 C   1272 0 G   1284 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1292 hydrog ?    ? DA C   1273 N3    ? ? ? 1_555 DA G   1283 N1 ? ? 0 C   1273 0 G   1283 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1293 hydrog ?    ? DA C   1273 N4    ? ? ? 1_555 DA G   1283 O6 ? ? 0 C   1273 0 G   1283 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1294 hydrog ?    ? DA C   1273 O2    ? ? ? 1_555 DA G   1283 N2 ? ? 0 C   1273 0 G   1283 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1295 hydrog ?    ? DA A   1274 N1    ? ? ? 1_555 DA U   1282 N3 ? ? 0 A   1274 0 U   1282 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1296 hydrog ?    ? DA A   1274 N6    ? ? ? 1_555 DA U   1282 O4 ? ? 0 A   1274 0 U   1282 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1297 hydrog ?    ? DA C   1275 O2    ? ? ? 1_555 DA C   1281 N4 ? ? 0 C   1275 0 C   1281 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1298 hydrog ?    ? DA U   1276 O2    ? ? ? 1_555 DA A   1280 N6 ? ? 0 U   1276 0 A   1280 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1299 hydrog ?    ? DA G   1292 N2    ? ? ? 1_555 DA U   1293 O4 ? ? 0 G   1292 0 U   1293 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1300 hydrog ?    ? DA G   1300 N2    ? ? ? 1_555 DA A   1330 N3 ? ? 0 G   1300 0 A   1330 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1301 hydrog ?    ? DA C   1301 N3    ? ? ? 1_555 DA G   1354 N1 ? ? 0 C   1301 0 G   1354 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1302 hydrog ?    ? DA C   1301 N4    ? ? ? 1_555 DA G   1354 O6 ? ? 0 C   1301 0 G   1354 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1303 hydrog ?    ? DA C   1301 O2    ? ? ? 1_555 DA G   1354 N2 ? ? 0 C   1301 0 G   1354 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1304 hydrog ?    ? DA G   1302 N1    ? ? ? 1_555 DA C   1353 O2 ? ? 0 G   1302 0 C   1353 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1305 hydrog ?    ? DA C   1303 N3    ? ? ? 1_555 DA G   1351 N1 ? ? 0 C   1303 0 G   1351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1306 hydrog ?    ? DA C   1303 N4    ? ? ? 1_555 DA G   1351 O6 ? ? 0 C   1303 0 G   1351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1307 hydrog ?    ? DA C   1303 O2    ? ? ? 1_555 DA G   1351 N2 ? ? 0 C   1303 0 G   1351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1308 hydrog ?    ? DA U   1304 N3    ? ? ? 1_555 DA U   1350 O2 ? ? 0 U   1304 0 U   1350 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1309 hydrog ?    ? DA U   1304 O4    ? ? ? 1_555 DA U   1350 N3 ? ? 0 U   1304 0 U   1350 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1310 hydrog ?    ? DA C   1305 N3    ? ? ? 1_555 DA G   1349 N1 ? ? 0 C   1305 0 G   1349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1311 hydrog ?    ? DA C   1305 N4    ? ? ? 1_555 DA G   1349 O6 ? ? 0 C   1305 0 G   1349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1312 hydrog ?    ? DA C   1305 O2    ? ? ? 1_555 DA G   1349 N2 ? ? 0 C   1305 0 G   1349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1313 hydrog ?    ? DA U   1306 N3    ? ? ? 1_555 DA A   1348 N1 ? ? 0 U   1306 0 A   1348 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1314 hydrog ?    ? DA U   1306 O4    ? ? ? 1_555 DA A   1348 N6 ? ? 0 U   1306 0 A   1348 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1315 hydrog ?    ? DA A   1307 N1    ? ? ? 1_555 DA U   1347 N3 ? ? 0 A   1307 0 U   1347 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1316 hydrog ?    ? DA A   1307 N6    ? ? ? 1_555 DA U   1347 O4 ? ? 0 A   1307 0 U   1347 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1317 hydrog ?    ? DA A   1308 N1    ? ? ? 1_555 DA U   1346 N3 ? ? 0 A   1308 0 U   1346 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1318 hydrog ?    ? DA A   1308 N6    ? ? ? 1_555 DA U   1346 O4 ? ? 0 A   1308 0 U   1346 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1319 hydrog ?    ? DA U   1309 N3    ? ? ? 1_555 DA A   1345 N1 ? ? 0 U   1309 0 A   1345 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1320 hydrog ?    ? DA U   1309 O4    ? ? ? 1_555 DA A   1345 N6 ? ? 0 U   1309 0 A   1345 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1321 hydrog ?    ? DA U   1310 N3    ? ? ? 1_555 DA G   1344 O6 ? ? 0 U   1310 0 G   1344 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1322 hydrog ?    ? DA U   1310 O2    ? ? ? 1_555 DA G   1344 N1 ? ? 0 U   1310 0 G   1344 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1323 hydrog ?    ? DA G   1311 N1    ? ? ? 1_555 DA C   1343 N3 ? ? 0 G   1311 0 C   1343 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1324 hydrog ?    ? DA G   1311 N2    ? ? ? 1_555 DA C   1343 O2 ? ? 0 G   1311 0 C   1343 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1325 hydrog ?    ? DA G   1311 O6    ? ? ? 1_555 DA C   1343 N4 ? ? 0 G   1311 0 C   1343 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1326 hydrog ?    ? DA G   1312 N1    ? ? ? 1_555 DA C   1342 N3 ? ? 0 G   1312 0 C   1342 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1327 hydrog ?    ? DA G   1312 N2    ? ? ? 1_555 DA C   1342 O2 ? ? 0 G   1312 0 C   1342 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1328 hydrog ?    ? DA G   1312 O6    ? ? ? 1_555 DA C   1342 N4 ? ? 0 G   1312 0 C   1342 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1329 hydrog ?    ? DA G   1316 N2    ? ? ? 1_555 DA A   1341 N7 ? ? 0 G   1316 0 A   1341 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1330 hydrog ?    ? DA G   1316 N3    ? ? ? 1_555 DA A   1341 N6 ? ? 0 G   1316 0 A   1341 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1331 hydrog ?    ? DA A   1317 N6    ? ? ? 1_555 DA G   1340 N3 ? ? 0 A   1317 0 G   1340 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1332 hydrog ?    ? DA A   1317 N7    ? ? ? 1_555 DA G   1340 N2 ? ? 0 A   1317 0 G   1340 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1333 hydrog ?    ? DA A   1318 N6    ? ? ? 1_555 DA G   1339 N3 ? ? 0 A   1318 0 G   1339 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1334 hydrog ?    ? DA A   1318 N7    ? ? ? 1_555 DA G   1339 N2 ? ? 0 A   1318 0 G   1339 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1335 hydrog ?    ? DA G   1319 N1    ? ? ? 1_555 DA U   1338 O2 ? ? 0 G   1319 0 U   1338 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1336 hydrog ?    ? DA G   1319 O6    ? ? ? 1_555 DA U   1338 N3 ? ? 0 G   1319 0 U   1338 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1337 hydrog ?    ? DA C   1320 N3    ? ? ? 1_555 DA G   1337 N1 ? ? 0 C   1320 0 G   1337 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1338 hydrog ?    ? DA C   1320 N4    ? ? ? 1_555 DA G   1337 O6 ? ? 0 C   1320 0 G   1337 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1339 hydrog ?    ? DA C   1320 O2    ? ? ? 1_555 DA G   1337 N2 ? ? 0 C   1320 0 G   1337 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1340 hydrog ?    ? DA A   1321 N1    ? ? ? 1_555 DA U   1336 N3 ? ? 0 A   1321 0 U   1336 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1341 hydrog ?    ? DA A   1321 N6    ? ? ? 1_555 DA U   1336 O4 ? ? 0 A   1321 0 U   1336 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1342 hydrog ?    ? DA G   1322 N1    ? ? ? 1_555 DA C   1335 N3 ? ? 0 G   1322 0 C   1335 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1343 hydrog ?    ? DA G   1322 N2    ? ? ? 1_555 DA C   1335 O2 ? ? 0 G   1322 0 C   1335 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1344 hydrog ?    ? DA G   1322 O6    ? ? ? 1_555 DA C   1335 N4 ? ? 0 G   1322 0 C   1335 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1345 hydrog ?    ? DA G   1323 N1    ? ? ? 1_555 DA C   1334 N3 ? ? 0 G   1323 0 C   1334 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1346 hydrog ?    ? DA G   1323 N2    ? ? ? 1_555 DA C   1334 O2 ? ? 0 G   1323 0 C   1334 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1347 hydrog ?    ? DA G   1323 O6    ? ? ? 1_555 DA C   1334 N4 ? ? 0 G   1323 0 C   1334 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1348 hydrog ?    ? DA G   1324 N1    ? ? ? 1_555 DA U   1333 O2 ? ? 0 G   1324 0 U   1333 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1349 hydrog ?    ? DA G   1324 O6    ? ? ? 1_555 DA U   1333 N3 ? ? 0 G   1324 0 U   1333 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1350 hydrog ?    ? DA G   1325 N1    ? ? ? 1_555 DA C   1332 N3 ? ? 0 G   1325 0 C   1332 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1351 hydrog ?    ? DA G   1325 N2    ? ? ? 1_555 DA C   1332 O2 ? ? 0 G   1325 0 C   1332 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1352 hydrog ?    ? DA G   1325 O6    ? ? ? 1_555 DA C   1332 N4 ? ? 0 G   1325 0 C   1332 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1353 hydrog ?    ? DA C   1326 N3    ? ? ? 1_555 DA G   1331 N1 ? ? 0 C   1326 0 G   1331 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1354 hydrog ?    ? DA C   1326 N4    ? ? ? 1_555 DA G   1331 O6 ? ? 0 C   1326 0 G   1331 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1355 hydrog ?    ? DA C   1326 O2    ? ? ? 1_555 DA G   1331 N2 ? ? 0 C   1326 0 G   1331 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1356 hydrog ?    ? DA G   1327 N2    ? ? ? 1_555 DA A   1330 N7 ? ? 0 G   1327 0 A   1330 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1357 hydrog ?    ? DA C   1366 N3    ? ? ? 1_555 DA G   2058 N1 ? ? 0 C   1366 0 G   2058 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1358 hydrog ?    ? DA C   1366 N4    ? ? ? 1_555 DA G   2058 O6 ? ? 0 C   1366 0 G   2058 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1359 hydrog ?    ? DA C   1366 O2    ? ? ? 1_555 DA G   2058 N2 ? ? 0 C   1366 0 G   2058 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1360 hydrog ?    ? DA A   1367 N1    ? ? ? 1_555 DA U   2057 N3 ? ? 0 A   1367 0 U   2057 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1361 hydrog ?    ? DA A   1367 N6    ? ? ? 1_555 DA U   2057 O4 ? ? 0 A   1367 0 U   2057 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1362 hydrog ?    ? DA U   1368 O2    ? ? ? 1_555 DA C   2056 N4 ? ? 0 U   1368 0 C   2056 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog1363 hydrog ?    ? DA A   1369 N6    ? ? ? 1_555 DA A   2055 N7 ? ? 0 A   1369 0 A   2055 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1364 hydrog ?    ? DA A   1369 N7    ? ? ? 1_555 DA A   2055 N6 ? ? 0 A   1369 0 A   2055 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1365 hydrog ?    ? DA G   1370 N2    ? ? ? 1_555 DA U   1371 O4 ? ? 0 G   1370 0 U   1371 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1366 hydrog ?    ? DA U   1371 N3    ? ? ? 1_555 DA A   2054 N7 ? ? 0 U   1371 0 A   2054 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1367 hydrog ?    ? DA U   1371 O2    ? ? ? 1_555 DA A   2054 N6 ? ? 0 U   1371 0 A   2054 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1368 hydrog ?    ? DA A   1372 N6    ? ? ? 1_555 DA G   2053 N3 ? ? 0 A   1372 0 G   2053 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1369 hydrog ?    ? DA A   1372 N7    ? ? ? 1_555 DA G   2053 N2 ? ? 0 A   1372 0 G   2053 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1370 hydrog ?    ? DA G   1373 N2    ? ? ? 1_555 DA C   1431 O2 ? ? 0 G   1373 0 C   1431 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1371 hydrog ?    ? DA G   1373 N1    ? ? ? 1_555 DA U   2052 O2 ? ? 0 G   1373 0 U   2052 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1372 hydrog ?    ? DA G   1373 O6    ? ? ? 1_555 DA U   2052 N3 ? ? 0 G   1373 0 U   2052 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1373 hydrog ?    ? DA C   1374 N3    ? ? ? 1_555 DA G   2051 N1 ? ? 0 C   1374 0 G   2051 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1374 hydrog ?    ? DA C   1374 N4    ? ? ? 1_555 DA G   2051 O6 ? ? 0 C   1374 0 G   2051 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1375 hydrog ?    ? DA C   1374 O2    ? ? ? 1_555 DA G   2051 N2 ? ? 0 C   1374 0 G   2051 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1376 hydrog ?    ? DA C   1377 N3    ? ? ? 1_555 DA G   1683 N2 ? ? 0 C   1377 0 G   1683 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1377 hydrog ?    ? DA C   1377 O2    ? ? ? 1_555 DA G   1683 N1 ? ? 0 C   1377 0 G   1683 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1378 hydrog ?    ? DA A   1381 N3    ? ? ? 1_555 DA G   1401 N2 ? ? 0 A   1381 0 G   1401 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1379 hydrog ?    ? DA G   1382 N1    ? ? ? 1_555 DA C   1400 N3 ? ? 0 G   1382 0 C   1400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1380 hydrog ?    ? DA G   1382 N2    ? ? ? 1_555 DA C   1400 O2 ? ? 0 G   1382 0 C   1400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1381 hydrog ?    ? DA G   1382 O6    ? ? ? 1_555 DA C   1400 N4 ? ? 0 G   1382 0 C   1400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1382 hydrog ?    ? DA U   1383 N3    ? ? ? 1_555 DA A   1399 N1 ? ? 0 U   1383 0 A   1399 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1383 hydrog ?    ? DA U   1383 O4    ? ? ? 1_555 DA A   1399 N6 ? ? 0 U   1383 0 A   1399 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1384 hydrog ?    ? DA C   1384 N3    ? ? ? 1_555 DA G   1398 N1 ? ? 0 C   1384 0 G   1398 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1385 hydrog ?    ? DA C   1384 N4    ? ? ? 1_555 DA G   1398 O6 ? ? 0 C   1384 0 G   1398 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1386 hydrog ?    ? DA C   1384 O2    ? ? ? 1_555 DA G   1398 N2 ? ? 0 C   1384 0 G   1398 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1387 hydrog ?    ? DA G   1385 N1    ? ? ? 1_555 DA C   1397 N3 ? ? 0 G   1385 0 C   1397 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1388 hydrog ?    ? DA G   1385 N2    ? ? ? 1_555 DA C   1397 O2 ? ? 0 G   1385 0 C   1397 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1389 hydrog ?    ? DA G   1385 O6    ? ? ? 1_555 DA C   1397 N4 ? ? 0 G   1385 0 C   1397 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1390 hydrog ?    ? DA G   1386 N1    ? ? ? 1_555 DA C   1396 N3 ? ? 0 G   1386 0 C   1396 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1391 hydrog ?    ? DA G   1386 N2    ? ? ? 1_555 DA C   1396 O2 ? ? 0 G   1386 0 C   1396 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1392 hydrog ?    ? DA G   1386 O6    ? ? ? 1_555 DA C   1396 N4 ? ? 0 G   1386 0 C   1396 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1393 hydrog ?    ? DA G   1387 N1    ? ? ? 1_555 DA C   1395 N3 ? ? 0 G   1387 0 C   1395 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1394 hydrog ?    ? DA G   1387 N2    ? ? ? 1_555 DA C   1395 O2 ? ? 0 G   1387 0 C   1395 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1395 hydrog ?    ? DA G   1387 O6    ? ? ? 1_555 DA C   1395 N4 ? ? 0 G   1387 0 C   1395 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1396 hydrog ?    ? DA U   1388 N3    ? ? ? 1_555 DA A   1392 N7 ? ? 0 U   1388 0 A   1392 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1397 hydrog ?    ? DA U   1388 O2    ? ? ? 1_555 DA A   1392 N6 ? ? 0 U   1388 0 A   1392 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1398 hydrog ?    ? DA A   1393 N6    ? ? ? 1_555 DA C   1725 O2 ? ? 0 A   1393 0 C   1725 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1399 hydrog ?    ? DA C   1394 N3    ? ? ? 1_555 DA U   1432 N3 ? ? 0 C   1394 0 U   1432 1_555 ? ? ? ? ? ? TYPE_17_PAIR ? ? 
hydrog1400 hydrog ?    ? DA C   1394 N4    ? ? ? 1_555 DA U   1432 O2 ? ? 0 C   1394 0 U   1432 1_555 ? ? ? ? ? ? TYPE_17_PAIR ? ? 
hydrog1401 hydrog ?    ? DA G   1401 N1    ? ? ? 1_555 DA C   1721 N3 ? ? 0 G   1401 0 C   1721 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1402 hydrog ?    ? DA G   1401 N2    ? ? ? 1_555 DA C   1721 O2 ? ? 0 G   1401 0 C   1721 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1403 hydrog ?    ? DA G   1401 O6    ? ? ? 1_555 DA C   1721 N4 ? ? 0 G   1401 0 C   1721 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1404 hydrog ?    ? DA G   1402 N1    ? ? ? 1_555 DA C   1720 N3 ? ? 0 G   1402 0 C   1720 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1405 hydrog ?    ? DA G   1402 N2    ? ? ? 1_555 DA C   1720 O2 ? ? 0 G   1402 0 C   1720 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1406 hydrog ?    ? DA G   1402 O6    ? ? ? 1_555 DA C   1720 N4 ? ? 0 G   1402 0 C   1720 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1407 hydrog ?    ? DA C   1403 N3    ? ? ? 1_555 DA G   1719 N1 ? ? 0 C   1403 0 G   1719 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1408 hydrog ?    ? DA C   1403 N4    ? ? ? 1_555 DA G   1719 O6 ? ? 0 C   1403 0 G   1719 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1409 hydrog ?    ? DA C   1403 O2    ? ? ? 1_555 DA G   1719 N2 ? ? 0 C   1403 0 G   1719 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1410 hydrog ?    ? DA C   1404 N3    ? ? ? 1_555 DA G   1718 N1 ? ? 0 C   1404 0 G   1718 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1411 hydrog ?    ? DA C   1404 N4    ? ? ? 1_555 DA G   1718 O6 ? ? 0 C   1404 0 G   1718 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1412 hydrog ?    ? DA C   1404 O2    ? ? ? 1_555 DA G   1718 N2 ? ? 0 C   1404 0 G   1718 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1413 hydrog ?    ? DA U   1405 N3    ? ? ? 1_555 DA A   1716 N7 ? ? 0 U   1405 0 A   1716 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1414 hydrog ?    ? DA U   1405 O2    ? ? ? 1_555 DA A   1716 N6 ? ? 0 U   1405 0 A   1716 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1415 hydrog ?    ? DA A   1407 N1    ? ? ? 1_555 DA A   1717 N6 ? ? 0 A   1407 0 A   1717 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog1416 hydrog ?    ? DA A   1407 N6    ? ? ? 1_555 DA A   1717 N1 ? ? 0 A   1407 0 A   1717 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog1417 hydrog ?    ? DA A   1407 N1    ? ? ? 1_555 DA G   1718 N2 ? ? 0 A   1407 0 G   1718 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1418 hydrog ?    ? DA G   1409 N1    ? ? ? 1_555 DA C   1700 N3 ? ? 0 G   1409 0 C   1700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1419 hydrog ?    ? DA G   1409 N2    ? ? ? 1_555 DA C   1700 O2 ? ? 0 G   1409 0 C   1700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1420 hydrog ?    ? DA G   1409 O6    ? ? ? 1_555 DA C   1700 N4 ? ? 0 G   1409 0 C   1700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1421 hydrog ?    ? DA G   1410 N1    ? ? ? 1_555 DA C   1699 N3 ? ? 0 G   1410 0 C   1699 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1422 hydrog ?    ? DA G   1410 N2    ? ? ? 1_555 DA C   1699 O2 ? ? 0 G   1410 0 C   1699 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1423 hydrog ?    ? DA G   1410 O6    ? ? ? 1_555 DA C   1699 N4 ? ? 0 G   1410 0 C   1699 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1424 hydrog ?    ? DA A   1411 N1    ? ? ? 1_555 DA U   1698 N3 ? ? 0 A   1411 0 U   1698 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1425 hydrog ?    ? DA A   1411 N6    ? ? ? 1_555 DA U   1698 O4 ? ? 0 A   1411 0 U   1698 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1426 hydrog ?    ? DA U   1412 N3    ? ? ? 1_555 DA G   1697 O6 ? ? 0 U   1412 0 G   1697 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1427 hydrog ?    ? DA U   1412 O2    ? ? ? 1_555 DA G   1697 N1 ? ? 0 U   1412 0 G   1697 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1428 hydrog ?    ? DA A   1414 N6    ? ? ? 1_555 DA G   1681 N3 ? ? 0 A   1414 0 G   1681 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1429 hydrog ?    ? DA A   1414 N7    ? ? ? 1_555 DA G   1681 N2 ? ? 0 A   1414 0 G   1681 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1430 hydrog ?    ? DA A   1414 N1    ? ? ? 1_555 DA A   1682 N6 ? ? 0 A   1414 0 A   1682 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog1431 hydrog ?    ? DA A   1414 N6    ? ? ? 1_555 DA A   1682 N1 ? ? 0 A   1414 0 A   1682 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog1432 hydrog ?    ? DA G   1415 N1    ? ? ? 1_555 DA C   1680 N3 ? ? 0 G   1415 0 C   1680 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1433 hydrog ?    ? DA G   1415 N2    ? ? ? 1_555 DA C   1680 O2 ? ? 0 G   1415 0 C   1680 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1434 hydrog ?    ? DA G   1415 O6    ? ? ? 1_555 DA C   1680 N4 ? ? 0 G   1415 0 C   1680 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1435 hydrog ?    ? DA G   1416 N1    ? ? ? 1_555 DA C   1679 N3 ? ? 0 G   1416 0 C   1679 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1436 hydrog ?    ? DA G   1416 N2    ? ? ? 1_555 DA C   1679 O2 ? ? 0 G   1416 0 C   1679 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1437 hydrog ?    ? DA G   1416 O6    ? ? ? 1_555 DA C   1679 N4 ? ? 0 G   1416 0 C   1679 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1438 hydrog ?    ? DA G   1416 N2    ? ? ? 1_555 DA A   1685 N3 ? ? 0 G   1416 0 A   1685 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1439 hydrog ?    ? DA U   1418 N3    ? ? ? 1_555 DA U   1446 O4 ? ? 0 U   1418 0 U   1446 1_555 ? ? ? ? ? ? 'U-U MISPAIR' ? 
? 
hydrog1440 hydrog ?    ? DA U   1419 N3    ? ? ? 1_555 DA A   1678 N1 ? ? 0 U   1419 0 A   1678 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1441 hydrog ?    ? DA U   1419 O4    ? ? ? 1_555 DA A   1678 N6 ? ? 0 U   1419 0 A   1678 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1442 hydrog ?    ? DA C   1420 N3    ? ? ? 1_555 DA G   1444 N1 ? ? 0 C   1420 0 G   1444 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1443 hydrog ?    ? DA C   1420 N4    ? ? ? 1_555 DA G   1444 O6 ? ? 0 C   1420 0 G   1444 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1444 hydrog ?    ? DA C   1420 O2    ? ? ? 1_555 DA G   1444 N2 ? ? 0 C   1420 0 G   1444 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1445 hydrog ?    ? DA C   1421 N3    ? ? ? 1_555 DA G   1443 N1 ? ? 0 C   1421 0 G   1443 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1446 hydrog ?    ? DA C   1421 N4    ? ? ? 1_555 DA G   1443 O6 ? ? 0 C   1421 0 G   1443 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1447 hydrog ?    ? DA C   1421 O2    ? ? ? 1_555 DA G   1443 N2 ? ? 0 C   1421 0 G   1443 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1448 hydrog ?    ? DA U   1422 N3    ? ? ? 1_555 DA A   1442 N1 ? ? 0 U   1422 0 A   1442 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1449 hydrog ?    ? DA U   1422 O4    ? ? ? 1_555 DA A   1442 N6 ? ? 0 U   1422 0 A   1442 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1450 hydrog ?    ? DA C   1423 N3    ? ? ? 1_555 DA G   1441 N1 ? ? 0 C   1423 0 G   1441 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1451 hydrog ?    ? DA C   1423 N4    ? ? ? 1_555 DA G   1441 O6 ? ? 0 C   1423 0 G   1441 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1452 hydrog ?    ? DA C   1423 O2    ? ? ? 1_555 DA G   1441 N2 ? ? 0 C   1423 0 G   1441 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1453 hydrog ?    ? DA A   1424 N1    ? ? ? 1_555 DA U   1440 N3 ? ? 0 A   1424 0 U   1440 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1454 hydrog ?    ? DA A   1424 N6    ? ? ? 1_555 DA U   1440 O4 ? ? 0 A   1424 0 U   1440 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1455 hydrog ?    ? DA G   1425 N1    ? ? ? 1_555 DA C   1439 N3 ? ? 0 G   1425 0 C   1439 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1456 hydrog ?    ? DA G   1425 N2    ? ? ? 1_555 DA C   1439 O2 ? ? 0 G   1425 0 C   1439 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1457 hydrog ?    ? DA G   1425 O6    ? ? ? 1_555 DA C   1439 N4 ? ? 0 G   1425 0 C   1439 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1458 hydrog ?    ? DA C   1426 N3    ? ? ? 1_555 DA A   1437 N6 ? ? 0 C   1426 0 A   1437 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1459 hydrog ?    ? DA C   1426 N4    ? ? ? 1_555 DA A   1437 N7 ? ? 0 C   1426 0 A   1437 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1460 hydrog ?    ? DA C   1428 N4    ? ? ? 1_555 DA C   1439 O2 ? ? 0 C   1428 0 C   1439 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1461 hydrog ?    ? DA U   1429 N3    ? ? ? 1_555 DA A   1437 N1 ? ? 0 U   1429 0 A   1437 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1462 hydrog ?    ? DA U   1429 O4    ? ? ? 1_555 DA A   1437 N6 ? ? 0 U   1429 0 A   1437 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1463 hydrog ?    ? DA G   1430 N1    ? ? ? 1_555 DA C   1436 N3 ? ? 0 G   1430 0 C   1436 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1464 hydrog ?    ? DA G   1430 N2    ? ? ? 1_555 DA C   1436 O2 ? ? 0 G   1430 0 C   1436 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1465 hydrog ?    ? DA G   1430 O6    ? ? ? 1_555 DA C   1436 N4 ? ? 0 G   1430 0 C   1436 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1466 hydrog ?    ? DA G   1430 N3    ? ? ? 1_555 DA A   1691 N6 ? ? 0 G   1430 0 A   1691 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1467 hydrog ?    ? DA G   1444 N2    ? ? ? 1_555 DA A   1502 N3 ? ? 0 G   1444 0 A   1502 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1468 hydrog ?    ? DA A   1448 N6    ? ? ? 1_555 DA U   1677 O2 ? ? 0 A   1448 0 U   1677 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1469 hydrog ?    ? DA A   1448 N7    ? ? ? 1_555 DA U   1677 N3 ? ? 0 A   1448 0 U   1677 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1470 hydrog ?    ? DA G   1449 N2    ? ? ? 1_555 DA A   1493 N3 ? ? 0 G   1449 0 A   1493 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1471 hydrog ?    ? DA G   1449 N1    ? ? ? 1_555 DA C   1513 N3 ? ? 0 G   1449 0 C   1513 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1472 hydrog ?    ? DA G   1449 N2    ? ? ? 1_555 DA C   1513 O2 ? ? 0 G   1449 0 C   1513 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1473 hydrog ?    ? DA G   1449 O6    ? ? ? 1_555 DA C   1513 N4 ? ? 0 G   1449 0 C   1513 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1474 hydrog ?    ? DA C   1450 N3    ? ? ? 1_555 DA G   1512 N1 ? ? 0 C   1450 0 G   1512 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1475 hydrog ?    ? DA C   1450 N4    ? ? ? 1_555 DA G   1512 O6 ? ? 0 C   1450 0 G   1512 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1476 hydrog ?    ? DA C   1450 O2    ? ? ? 1_555 DA G   1512 N2 ? ? 0 C   1450 0 G   1512 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1477 hydrog ?    ? DA C   1451 N3    ? ? ? 1_555 DA G   1676 N1 ? ? 0 C   1451 0 G   1676 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1478 hydrog ?    ? DA C   1451 N4    ? ? ? 1_555 DA G   1676 O6 ? ? 0 C   1451 0 G   1676 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1479 hydrog ?    ? DA C   1451 O2    ? ? ? 1_555 DA G   1676 N2 ? ? 0 C   1451 0 G   1676 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1480 hydrog ?    ? DA G   1452 N2    ? ? ? 1_555 DA A   1486 N1 ? ? 0 G   1452 0 A   1486 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1481 hydrog ?    ? DA G   1452 N1    ? ? ? 1_555 DA C   1675 N3 ? ? 0 G   1452 0 C   1675 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1482 hydrog ?    ? DA G   1452 N2    ? ? ? 1_555 DA C   1675 O2 ? ? 0 G   1452 0 C   1675 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1483 hydrog ?    ? DA G   1452 O6    ? ? ? 1_555 DA C   1675 N4 ? ? 0 G   1452 0 C   1675 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1484 hydrog ?    ? DA G   1453 N1    ? ? ? 1_555 DA C   1674 N3 ? ? 0 G   1453 0 C   1674 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1485 hydrog ?    ? DA G   1453 N2    ? ? ? 1_555 DA C   1674 O2 ? ? 0 G   1453 0 C   1674 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1486 hydrog ?    ? DA G   1453 O6    ? ? ? 1_555 DA C   1674 N4 ? ? 0 G   1453 0 C   1674 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1487 hydrog ?    ? DA U   1454 O4    ? ? ? 1_555 DA G   1491 N2 ? ? 0 U   1454 0 G   1491 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog1488 hydrog ?    ? DA C   1455 N3    ? ? ? 1_555 DA G   1490 N1 ? ? 0 C   1455 0 G   1490 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1489 hydrog ?    ? DA C   1455 N4    ? ? ? 1_555 DA G   1490 O6 ? ? 0 C   1455 0 G   1490 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1490 hydrog ?    ? DA C   1455 O2    ? ? ? 1_555 DA G   1490 N2 ? ? 0 C   1455 0 G   1490 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1491 hydrog ?    ? DA C   1456 N3    ? ? ? 1_555 DA G   1489 N1 ? ? 0 C   1456 0 G   1489 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1492 hydrog ?    ? DA C   1456 N4    ? ? ? 1_555 DA G   1489 O6 ? ? 0 C   1456 0 G   1489 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1493 hydrog ?    ? DA C   1456 O2    ? ? ? 1_555 DA G   1489 N2 ? ? 0 C   1456 0 G   1489 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1494 hydrog ?    ? DA U   1457 N3    ? ? ? 1_555 DA A   1485 N7 ? ? 0 U   1457 0 A   1485 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1495 hydrog ?    ? DA U   1457 O2    ? ? ? 1_555 DA A   1485 N6 ? ? 0 U   1457 0 A   1485 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1496 hydrog ?    ? DA A   1459 N6    ? ? ? 1_555 DA G   1484 N3 ? ? 0 A   1459 0 G   1484 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1497 hydrog ?    ? DA A   1459 N7    ? ? ? 1_555 DA G   1484 N2 ? ? 0 A   1459 0 G   1484 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1498 hydrog ?    ? DA G   1460 N1    ? ? ? 1_555 DA C   1483 N3 ? ? 0 G   1460 0 C   1483 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1499 hydrog ?    ? DA G   1460 N2    ? ? ? 1_555 DA C   1483 O2 ? ? 0 G   1460 0 C   1483 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1500 hydrog ?    ? DA G   1460 O6    ? ? ? 1_555 DA C   1483 N4 ? ? 0 G   1460 0 C   1483 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1501 hydrog ?    ? DA U   1461 N3    ? ? ? 1_555 DA A   1482 N1 ? ? 0 U   1461 0 A   1482 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1502 hydrog ?    ? DA U   1461 O4    ? ? ? 1_555 DA A   1482 N6 ? ? 0 U   1461 0 A   1482 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1503 hydrog ?    ? DA C   1462 N3    ? ? ? 1_555 DA G   1481 N1 ? ? 0 C   1462 0 G   1481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1504 hydrog ?    ? DA C   1462 N4    ? ? ? 1_555 DA G   1481 O6 ? ? 0 C   1462 0 G   1481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1505 hydrog ?    ? DA C   1462 O2    ? ? ? 1_555 DA G   1481 N2 ? ? 0 C   1462 0 G   1481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1506 hydrog ?    ? DA U   1463 N3    ? ? ? 1_555 DA A   1480 N1 ? ? 0 U   1463 0 A   1480 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1507 hydrog ?    ? DA U   1463 O4    ? ? ? 1_555 DA A   1480 N6 ? ? 0 U   1463 0 A   1480 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1508 hydrog ?    ? DA C   1464 N3    ? ? ? 1_555 DA G   1479 N1 ? ? 0 C   1464 0 G   1479 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1509 hydrog ?    ? DA C   1464 N4    ? ? ? 1_555 DA G   1479 O6 ? ? 0 C   1464 0 G   1479 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1510 hydrog ?    ? DA C   1464 O2    ? ? ? 1_555 DA G   1479 N2 ? ? 0 C   1464 0 G   1479 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1511 hydrog ?    ? DA A   1465 N1    ? ? ? 1_555 DA U   1478 N3 ? ? 0 A   1465 0 U   1478 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1512 hydrog ?    ? DA A   1465 N6    ? ? ? 1_555 DA U   1478 O4 ? ? 0 A   1465 0 U   1478 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1513 hydrog ?    ? DA C   1466 O2    ? ? ? 1_555 DA C   1477 N4 ? ? 0 C   1466 0 C   1477 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1514 hydrog ?    ? DA C   1467 N3    ? ? ? 1_555 DA G   1475 N1 ? ? 0 C   1467 0 G   1475 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1515 hydrog ?    ? DA C   1467 N4    ? ? ? 1_555 DA G   1475 O6 ? ? 0 C   1467 0 G   1475 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1516 hydrog ?    ? DA C   1467 O2    ? ? ? 1_555 DA G   1475 N2 ? ? 0 C   1467 0 G   1475 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1517 hydrog ?    ? DA G   1468 N1    ? ? ? 1_555 DA C   1474 N3 ? ? 0 G   1468 0 C   1474 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1518 hydrog ?    ? DA G   1468 N2    ? ? ? 1_555 DA C   1474 O2 ? ? 0 G   1468 0 C   1474 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1519 hydrog ?    ? DA G   1468 O6    ? ? ? 1_555 DA C   1474 N4 ? ? 0 G   1468 0 C   1474 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1520 hydrog ?    ? DA G   1475 N2    ? ? ? 1_555 DA A   1866 N3 ? ? 0 G   1475 0 A   1866 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1521 hydrog ?    ? DA A   1485 N6    ? ? ? 1_555 DA A   1656 N1 ? ? 0 A   1485 0 A   1656 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1522 hydrog ?    ? DA A   1487 N3    ? ? ? 1_555 DA G   1697 N2 ? ? 0 A   1487 0 G   1697 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1523 hydrog ?    ? DA G   1489 N3    ? ? ? 1_555 DA A   1656 N6 ? ? 0 G   1489 0 A   1656 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1524 hydrog ?    ? DA G   1489 N2    ? ? ? 1_555 DA A   1657 N1 ? ? 0 G   1489 0 A   1657 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1525 hydrog ?    ? DA A   1492 N1    ? ? ? 1_555 DA G   1672 N2 ? ? 0 A   1492 0 G   1672 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1526 hydrog ?    ? DA A   1494 N1    ? ? ? 1_555 DA U   1511 N3 ? ? 0 A   1494 0 U   1511 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1527 hydrog ?    ? DA A   1494 N6    ? ? ? 1_555 DA U   1511 O4 ? ? 0 A   1494 0 U   1511 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1528 hydrog ?    ? DA C   1495 N3    ? ? ? 1_555 DA G   1510 N1 ? ? 0 C   1495 0 G   1510 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1529 hydrog ?    ? DA C   1495 N4    ? ? ? 1_555 DA G   1510 O6 ? ? 0 C   1495 0 G   1510 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1530 hydrog ?    ? DA C   1495 O2    ? ? ? 1_555 DA G   1510 N2 ? ? 0 C   1495 0 G   1510 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1531 hydrog ?    ? DA A   1496 N1    ? ? ? 1_555 DA U   1509 N3 ? ? 0 A   1496 0 U   1509 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1532 hydrog ?    ? DA A   1496 N6    ? ? ? 1_555 DA U   1509 O4 ? ? 0 A   1496 0 U   1509 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1533 hydrog ?    ? DA G   1497 N1    ? ? ? 1_555 DA C   1508 N3 ? ? 0 G   1497 0 C   1508 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1534 hydrog ?    ? DA G   1497 N2    ? ? ? 1_555 DA C   1508 O2 ? ? 0 G   1497 0 C   1508 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1535 hydrog ?    ? DA G   1497 O6    ? ? ? 1_555 DA C   1508 N4 ? ? 0 G   1497 0 C   1508 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1536 hydrog ?    ? DA G   1498 N1    ? ? ? 1_555 DA C   1507 N3 ? ? 0 G   1498 0 C   1507 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1537 hydrog ?    ? DA G   1498 N2    ? ? ? 1_555 DA C   1507 O2 ? ? 0 G   1498 0 C   1507 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1538 hydrog ?    ? DA G   1498 O6    ? ? ? 1_555 DA C   1507 N4 ? ? 0 G   1498 0 C   1507 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1539 hydrog ?    ? DA U   1499 N3    ? ? ? 1_555 DA A   1504 N7 ? ? 0 U   1499 0 A   1504 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1540 hydrog ?    ? DA U   1499 O2    ? ? ? 1_555 DA A   1504 N6 ? ? 0 U   1499 0 A   1504 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1541 hydrog ?    ? DA C   1514 N3    ? ? ? 1_555 DA G   1672 N1 ? ? 0 C   1514 0 G   1672 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1542 hydrog ?    ? DA C   1514 N4    ? ? ? 1_555 DA G   1672 O6 ? ? 0 C   1514 0 G   1672 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1543 hydrog ?    ? DA C   1514 O2    ? ? ? 1_555 DA G   1672 N2 ? ? 0 C   1514 0 G   1672 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1544 hydrog ?    ? DA A   1515 N1    ? ? ? 1_555 DA U   1671 N3 ? ? 0 A   1515 0 U   1671 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1545 hydrog ?    ? DA A   1515 N6    ? ? ? 1_555 DA U   1671 O4 ? ? 0 A   1515 0 U   1671 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1546 hydrog ?    ? DA U   1516 N3    ? ? ? 1_555 DA A   1670 N1 ? ? 0 U   1516 0 A   1670 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1547 hydrog ?    ? DA U   1516 O4    ? ? ? 1_555 DA A   1670 N6 ? ? 0 U   1516 0 A   1670 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1548 hydrog ?    ? DA C   1517 N3    ? ? ? 1_555 DA G   1669 N1 ? ? 0 C   1517 0 G   1669 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1549 hydrog ?    ? DA C   1517 N4    ? ? ? 1_555 DA G   1669 O6 ? ? 0 C   1517 0 G   1669 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1550 hydrog ?    ? DA C   1517 O2    ? ? ? 1_555 DA G   1669 N2 ? ? 0 C   1517 0 G   1669 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1551 hydrog ?    ? DA A   1518 N1    ? ? ? 1_555 DA U   1668 N3 ? ? 0 A   1518 0 U   1668 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1552 hydrog ?    ? DA A   1518 N6    ? ? ? 1_555 DA U   1668 O4 ? ? 0 A   1518 0 U   1668 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1553 hydrog ?    ? DA U   1519 N3    ? ? ? 1_555 DA A   1667 N1 ? ? 0 U   1519 0 A   1667 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1554 hydrog ?    ? DA U   1519 O4    ? ? ? 1_555 DA A   1667 N6 ? ? 0 U   1519 0 A   1667 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1555 hydrog ?    ? DA G   1520 N1    ? ? ? 1_555 DA C   1666 N3 ? ? 0 G   1520 0 C   1666 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1556 hydrog ?    ? DA G   1520 N2    ? ? ? 1_555 DA C   1666 O2 ? ? 0 G   1520 0 C   1666 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1557 hydrog ?    ? DA G   1520 O6    ? ? ? 1_555 DA C   1666 N4 ? ? 0 G   1520 0 C   1666 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1558 hydrog ?    ? DA C   1521 N3    ? ? ? 1_555 DA G   1665 N1 ? ? 0 C   1521 0 G   1665 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1559 hydrog ?    ? DA C   1521 N4    ? ? ? 1_555 DA G   1665 O6 ? ? 0 C   1521 0 G   1665 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1560 hydrog ?    ? DA C   1521 O2    ? ? ? 1_555 DA G   1665 N2 ? ? 0 C   1521 0 G   1665 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1561 hydrog ?    ? DA A   1527 N6    ? ? ? 1_555 DA A   1664 N7 ? ? 0 A   1527 0 A   1664 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1562 hydrog ?    ? DA A   1527 N7    ? ? ? 1_555 DA A   1664 N6 ? ? 0 A   1527 0 A   1664 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1563 hydrog ?    ? DA A   1528 N6    ? ? ? 1_555 DA G   1663 N3 ? ? 0 A   1528 0 G   1663 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1564 hydrog ?    ? DA A   1528 N7    ? ? ? 1_555 DA G   1663 N2 ? ? 0 A   1528 0 G   1663 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1565 hydrog ?    ? DA G   1529 N1    ? ? ? 1_555 DA C   1662 N3 ? ? 0 G   1529 0 C   1662 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1566 hydrog ?    ? DA G   1529 N2    ? ? ? 1_555 DA C   1662 O2 ? ? 0 G   1529 0 C   1662 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1567 hydrog ?    ? DA G   1529 O6    ? ? ? 1_555 DA C   1662 N4 ? ? 0 G   1529 0 C   1662 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1568 hydrog ?    ? DA U   1530 N3    ? ? ? 1_555 DA A   1661 N1 ? ? 0 U   1530 0 A   1661 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1569 hydrog ?    ? DA U   1530 O4    ? ? ? 1_555 DA A   1661 N6 ? ? 0 U   1530 0 A   1661 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1570 hydrog ?    ? DA U   1531 N3    ? ? ? 1_555 DA G   1660 O6 ? ? 0 U   1531 0 G   1660 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1571 hydrog ?    ? DA U   1531 O2    ? ? ? 1_555 DA G   1660 N1 ? ? 0 U   1531 0 G   1660 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1572 hydrog ?    ? DA G   1532 N2    ? ? ? 1_555 DA A   1659 N7 ? ? 0 G   1532 0 A   1659 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1573 hydrog ?    ? DA G   1532 N3    ? ? ? 1_555 DA A   1659 N6 ? ? 0 G   1532 0 A   1659 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1574 hydrog ?    ? DA A   1533 N6    ? ? ? 1_555 DA A   1658 N7 ? ? 0 A   1533 0 A   1658 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1575 hydrog ?    ? DA A   1533 N7    ? ? ? 1_555 DA A   1658 N6 ? ? 0 A   1533 0 A   1658 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1576 hydrog ?    ? DA C   1534 N4    ? ? ? 1_555 DA A   1657 N7 ? ? 0 C   1534 0 A   1657 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1577 hydrog ?    ? DA G   1535 N1    ? ? ? 1_555 DA C   1650 N3 ? ? 0 G   1535 0 C   1650 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1578 hydrog ?    ? DA G   1535 N2    ? ? ? 1_555 DA C   1650 O2 ? ? 0 G   1535 0 C   1650 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1579 hydrog ?    ? DA G   1535 O6    ? ? ? 1_555 DA C   1650 N4 ? ? 0 G   1535 0 C   1650 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1580 hydrog ?    ? DA C   1536 N3    ? ? ? 1_555 DA G   1649 N1 ? ? 0 C   1536 0 G   1649 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1581 hydrog ?    ? DA C   1536 N4    ? ? ? 1_555 DA G   1649 O6 ? ? 0 C   1536 0 G   1649 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1582 hydrog ?    ? DA C   1536 O2    ? ? ? 1_555 DA G   1649 N2 ? ? 0 C   1536 0 G   1649 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1583 hydrog ?    ? DA C   1537 N3    ? ? ? 1_555 DA G   1648 N1 ? ? 0 C   1537 0 G   1648 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1584 hydrog ?    ? DA C   1537 N4    ? ? ? 1_555 DA G   1648 O6 ? ? 0 C   1537 0 G   1648 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1585 hydrog ?    ? DA C   1537 O2    ? ? ? 1_555 DA G   1648 N2 ? ? 0 C   1537 0 G   1648 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1586 hydrog ?    ? DA C   1538 N3    ? ? ? 1_555 DA G   1647 N1 ? ? 0 C   1538 0 G   1647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1587 hydrog ?    ? DA C   1538 N4    ? ? ? 1_555 DA G   1647 O6 ? ? 0 C   1538 0 G   1647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1588 hydrog ?    ? DA C   1538 O2    ? ? ? 1_555 DA G   1647 N2 ? ? 0 C   1538 0 G   1647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1589 hydrog ?    ? DA U   1539 N3    ? ? ? 1_555 DA G   1646 O6 ? ? 0 U   1539 0 G   1646 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1590 hydrog ?    ? DA U   1539 O2    ? ? ? 1_555 DA G   1646 N1 ? ? 0 U   1539 0 G   1646 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1591 hydrog ?    ? DA G   1540 N1    ? ? ? 1_555 DA U   1645 O2 ? ? 0 G   1540 0 U   1645 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1592 hydrog ?    ? DA G   1540 O6    ? ? ? 1_555 DA U   1645 N3 ? ? 0 G   1540 0 U   1645 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1593 hydrog ?    ? DA G   1541 N1    ? ? ? 1_555 DA C   1644 N3 ? ? 0 G   1541 0 C   1644 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1594 hydrog ?    ? DA G   1541 N2    ? ? ? 1_555 DA C   1644 O2 ? ? 0 G   1541 0 C   1644 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1595 hydrog ?    ? DA G   1541 O6    ? ? ? 1_555 DA C   1644 N4 ? ? 0 G   1541 0 C   1644 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1596 hydrog ?    ? DA G   1542 N2    ? ? ? 1_555 DA A   1616 N3 ? ? 0 G   1542 0 A   1616 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1597 hydrog ?    ? DA G   1542 N1    ? ? ? 1_555 DA C   1643 N3 ? ? 0 G   1542 0 C   1643 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1598 hydrog ?    ? DA G   1542 N2    ? ? ? 1_555 DA C   1643 O2 ? ? 0 G   1542 0 C   1643 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1599 hydrog ?    ? DA G   1542 O6    ? ? ? 1_555 DA C   1643 N4 ? ? 0 G   1542 0 C   1643 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1600 hydrog ?    ? DA G   1543 N2    ? ? ? 1_555 DA A   1642 N7 ? ? 0 G   1543 0 A   1642 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1601 hydrog ?    ? DA G   1543 N3    ? ? ? 1_555 DA A   1642 N6 ? ? 0 G   1543 0 A   1642 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1602 hydrog ?    ? DA U   1544 N3    ? ? ? 1_555 DA A   1641 N7 ? ? 0 U   1544 0 A   1641 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1603 hydrog ?    ? DA U   1544 O2    ? ? ? 1_555 DA A   1641 N6 ? ? 0 U   1544 0 A   1641 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1604 hydrog ?    ? DA C   1545 N4    ? ? ? 1_555 DA C   1640 O2 ? ? 0 C   1545 0 C   1640 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1605 hydrog ?    ? DA C   1545 N3    ? ? ? 1_555 DA U   1702 N3 ? ? 0 C   1545 0 U   1702 1_555 ? ? ? ? ? ? TYPE_18_PAIR ? ? 
hydrog1606 hydrog ?    ? DA C   1545 N4    ? ? ? 1_555 DA U   1702 O4 ? ? 0 C   1545 0 U   1702 1_555 ? ? ? ? ? ? TYPE_18_PAIR ? ? 
hydrog1607 hydrog ?    ? DA G   1546 N1    ? ? ? 1_555 DA U   1639 O2 ? ? 0 G   1546 0 U   1639 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1608 hydrog ?    ? DA G   1546 O6    ? ? ? 1_555 DA U   1639 N3 ? ? 0 G   1546 0 U   1639 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1609 hydrog ?    ? DA A   1547 N1    ? ? ? 1_555 DA U   1638 N3 ? ? 0 A   1547 0 U   1638 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1610 hydrog ?    ? DA A   1547 N6    ? ? ? 1_555 DA U   1638 O4 ? ? 0 A   1547 0 U   1638 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1611 hydrog ?    ? DA U   1548 N3    ? ? ? 1_555 DA A   1637 N1 ? ? 0 U   1548 0 A   1637 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1612 hydrog ?    ? DA U   1548 O4    ? ? ? 1_555 DA A   1637 N6 ? ? 0 U   1548 0 A   1637 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1613 hydrog ?    ? DA C   1549 N3    ? ? ? 1_555 DA G   1636 N1 ? ? 0 C   1549 0 G   1636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1614 hydrog ?    ? DA C   1549 N4    ? ? ? 1_555 DA G   1636 O6 ? ? 0 C   1549 0 G   1636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1615 hydrog ?    ? DA C   1549 O2    ? ? ? 1_555 DA G   1636 N2 ? ? 0 C   1549 0 G   1636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1616 hydrog ?    ? DA A   1550 N1    ? ? ? 1_555 DA U   1635 N3 ? ? 0 A   1550 0 U   1635 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1617 hydrog ?    ? DA A   1550 N6    ? ? ? 1_555 DA U   1635 O4 ? ? 0 A   1550 0 U   1635 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1618 hydrog ?    ? DA C   1551 N3    ? ? ? 1_555 DA G   1634 N1 ? ? 0 C   1551 0 G   1634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1619 hydrog ?    ? DA C   1551 N4    ? ? ? 1_555 DA G   1634 O6 ? ? 0 C   1551 0 G   1634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1620 hydrog ?    ? DA C   1551 O2    ? ? ? 1_555 DA G   1634 N2 ? ? 0 C   1551 0 G   1634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1621 hydrog ?    ? DA G   1552 N1    ? ? ? 1_555 DA U   1569 O2 ? ? 0 G   1552 0 U   1569 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1622 hydrog ?    ? DA G   1552 O6    ? ? ? 1_555 DA U   1569 N3 ? ? 0 G   1552 0 U   1569 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1623 hydrog ?    ? DA C   1553 N3    ? ? ? 1_555 DA G   1568 N1 ? ? 0 C   1553 0 G   1568 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1624 hydrog ?    ? DA C   1553 N4    ? ? ? 1_555 DA G   1568 O6 ? ? 0 C   1553 0 G   1568 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1625 hydrog ?    ? DA C   1553 O2    ? ? ? 1_555 DA G   1568 N2 ? ? 0 C   1553 0 G   1568 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1626 hydrog ?    ? DA C   1554 N3    ? ? ? 1_555 DA G   1567 N1 ? ? 0 C   1554 0 G   1567 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1627 hydrog ?    ? DA C   1554 N4    ? ? ? 1_555 DA G   1567 O6 ? ? 0 C   1554 0 G   1567 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1628 hydrog ?    ? DA C   1554 O2    ? ? ? 1_555 DA G   1567 N2 ? ? 0 C   1554 0 G   1567 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1629 hydrog ?    ? DA G   1555 N1    ? ? ? 1_555 DA C   1566 N3 ? ? 0 G   1555 0 C   1566 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1630 hydrog ?    ? DA G   1555 N2    ? ? ? 1_555 DA C   1566 O2 ? ? 0 G   1555 0 C   1566 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1631 hydrog ?    ? DA G   1555 O6    ? ? ? 1_555 DA C   1566 N4 ? ? 0 G   1555 0 C   1566 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1632 hydrog ?    ? DA G   1556 N1    ? ? ? 1_555 DA C   1565 N3 ? ? 0 G   1556 0 C   1565 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1633 hydrog ?    ? DA G   1556 N2    ? ? ? 1_555 DA C   1565 O2 ? ? 0 G   1556 0 C   1565 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1634 hydrog ?    ? DA G   1556 O6    ? ? ? 1_555 DA C   1565 N4 ? ? 0 G   1556 0 C   1565 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1635 hydrog ?    ? DA G   1557 N1    ? ? ? 1_555 DA C   1564 N3 ? ? 0 G   1557 0 C   1564 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1636 hydrog ?    ? DA G   1557 N2    ? ? ? 1_555 DA C   1564 O2 ? ? 0 G   1557 0 C   1564 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1637 hydrog ?    ? DA G   1557 O6    ? ? ? 1_555 DA C   1564 N4 ? ? 0 G   1557 0 C   1564 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1638 hydrog ?    ? DA U   1561 N3    ? ? ? 1_555 DA A   2739 N1 ? ? 0 U   1561 0 A   2739 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1639 hydrog ?    ? DA U   1561 O4    ? ? ? 1_555 DA A   2739 N6 ? ? 0 U   1561 0 A   2739 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1640 hydrog ?    ? DA C   1562 N3    ? ? ? 1_555 DA G   2738 N1 ? ? 0 C   1562 0 G   2738 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1641 hydrog ?    ? DA C   1562 N4    ? ? ? 1_555 DA G   2738 O6 ? ? 0 C   1562 0 G   2738 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1642 hydrog ?    ? DA C   1562 O2    ? ? ? 1_555 DA G   2738 N2 ? ? 0 C   1562 0 G   2738 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1643 hydrog ?    ? DA G   1568 N2    ? ? ? 1_555 DA A   1632 N3 ? ? 0 G   1568 0 A   1632 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1644 hydrog ?    ? DA C   1570 N3    ? ? ? 1_555 DA G   1627 N1 ? ? 0 C   1570 0 G   1627 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1645 hydrog ?    ? DA C   1570 N4    ? ? ? 1_555 DA G   1627 O6 ? ? 0 C   1570 0 G   1627 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1646 hydrog ?    ? DA C   1570 O2    ? ? ? 1_555 DA G   1627 N2 ? ? 0 C   1570 0 G   1627 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1647 hydrog ?    ? DA G   1571 N2    ? ? ? 1_555 DA A   1626 N7 ? ? 0 G   1571 0 A   1626 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1648 hydrog ?    ? DA G   1571 N3    ? ? ? 1_555 DA A   1626 N6 ? ? 0 G   1571 0 A   1626 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1649 hydrog ?    ? DA A   1572 N6    ? ? ? 1_555 DA A   1624 N7 ? ? 0 A   1572 0 A   1624 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1650 hydrog ?    ? DA A   1572 N7    ? ? ? 1_555 DA A   1624 N6 ? ? 0 A   1572 0 A   1624 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1651 hydrog ?    ? DA C   1574 N3    ? ? ? 1_555 DA G   1622 N1 ? ? 0 C   1574 0 G   1622 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1652 hydrog ?    ? DA C   1574 N4    ? ? ? 1_555 DA G   1622 O6 ? ? 0 C   1574 0 G   1622 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1653 hydrog ?    ? DA C   1574 O2    ? ? ? 1_555 DA G   1622 N2 ? ? 0 C   1574 0 G   1622 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1654 hydrog ?    ? DA C   1575 N3    ? ? ? 1_555 DA G   1621 N1 ? ? 0 C   1575 0 G   1621 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1655 hydrog ?    ? DA C   1575 N4    ? ? ? 1_555 DA G   1621 O6 ? ? 0 C   1575 0 G   1621 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1656 hydrog ?    ? DA C   1575 O2    ? ? ? 1_555 DA G   1621 N2 ? ? 0 C   1575 0 G   1621 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1657 hydrog ?    ? DA G   1576 N1    ? ? ? 1_555 DA C   1620 N3 ? ? 0 G   1576 0 C   1620 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1658 hydrog ?    ? DA G   1576 N2    ? ? ? 1_555 DA C   1620 O2 ? ? 0 G   1576 0 C   1620 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1659 hydrog ?    ? DA G   1576 O6    ? ? ? 1_555 DA C   1620 N4 ? ? 0 G   1576 0 C   1620 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1660 hydrog ?    ? DA U   1577 N3    ? ? ? 1_555 DA G   1619 O6 ? ? 0 U   1577 0 G   1619 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1661 hydrog ?    ? DA U   1577 O2    ? ? ? 1_555 DA G   1619 N1 ? ? 0 U   1577 0 G   1619 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1662 hydrog ?    ? DA C   1578 N3    ? ? ? 1_555 DA G   1618 N1 ? ? 0 C   1578 0 G   1618 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1663 hydrog ?    ? DA C   1578 N4    ? ? ? 1_555 DA G   1618 O6 ? ? 0 C   1578 0 G   1618 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1664 hydrog ?    ? DA C   1578 O2    ? ? ? 1_555 DA G   1618 N2 ? ? 0 C   1578 0 G   1618 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1665 hydrog ?    ? DA C   1579 N3    ? ? ? 1_555 DA A   1616 N6 ? ? 0 C   1579 0 A   1616 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1666 hydrog ?    ? DA C   1579 N4    ? ? ? 1_555 DA A   1616 N7 ? ? 0 C   1579 0 A   1616 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1667 hydrog ?    ? DA C   1579 N3    ? ? ? 1_555 DA G   1618 N2 ? ? 0 C   1579 0 G   1618 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1668 hydrog ?    ? DA A   1581 N6    ? ? ? 1_555 DA G   1614 N3 ? ? 0 A   1581 0 G   1614 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1669 hydrog ?    ? DA A   1581 N7    ? ? ? 1_555 DA G   1614 N2 ? ? 0 A   1581 0 G   1614 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1670 hydrog ?    ? DA C   1582 N4    ? ? ? 1_555 DA C   1613 N3 ? ? 0 C   1582 0 C   1613 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1671 hydrog ?    ? DA U   1583 N3    ? ? ? 1_555 DA A   1612 N1 ? ? 0 U   1583 0 A   1612 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1672 hydrog ?    ? DA U   1583 O4    ? ? ? 1_555 DA A   1612 N6 ? ? 0 U   1583 0 A   1612 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1673 hydrog ?    ? DA C   1584 N3    ? ? ? 1_555 DA G   1611 N1 ? ? 0 C   1584 0 G   1611 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1674 hydrog ?    ? DA C   1584 N4    ? ? ? 1_555 DA G   1611 O6 ? ? 0 C   1584 0 G   1611 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1675 hydrog ?    ? DA C   1584 O2    ? ? ? 1_555 DA G   1611 N2 ? ? 0 C   1584 0 G   1611 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1676 hydrog ?    ? DA C   1585 N3    ? ? ? 1_555 DA G   1610 N1 ? ? 0 C   1585 0 G   1610 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1677 hydrog ?    ? DA C   1585 N4    ? ? ? 1_555 DA G   1610 O6 ? ? 0 C   1585 0 G   1610 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1678 hydrog ?    ? DA C   1585 O2    ? ? ? 1_555 DA G   1610 N2 ? ? 0 C   1585 0 G   1610 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1679 hydrog ?    ? DA G   1586 N1    ? ? ? 1_555 DA C   1609 N3 ? ? 0 G   1586 0 C   1609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1680 hydrog ?    ? DA G   1586 N2    ? ? ? 1_555 DA C   1609 O2 ? ? 0 G   1586 0 C   1609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1681 hydrog ?    ? DA G   1586 O6    ? ? ? 1_555 DA C   1609 N4 ? ? 0 G   1586 0 C   1609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1682 hydrog ?    ? DA U   1587 N3    ? ? ? 1_555 DA G   1608 O6 ? ? 0 U   1587 0 G   1608 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1683 hydrog ?    ? DA U   1587 O2    ? ? ? 1_555 DA G   1608 N1 ? ? 0 U   1587 0 G   1608 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1684 hydrog ?    ? DA G   1588 N2    ? ? ? 1_555 DA A   1607 N7 ? ? 0 G   1588 0 A   1607 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1685 hydrog ?    ? DA G   1588 N3    ? ? ? 1_555 DA A   1607 N6 ? ? 0 G   1588 0 A   1607 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1686 hydrog ?    ? DA G   1589 N2    ? ? ? 1_555 DA A   1606 N7 ? ? 0 G   1589 0 A   1606 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1687 hydrog ?    ? DA A   1590 N6    ? ? ? 1_555 DA G   1605 N3 ? ? 0 A   1590 0 G   1605 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1688 hydrog ?    ? DA A   1590 N7    ? ? ? 1_555 DA G   1605 N2 ? ? 0 A   1590 0 G   1605 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1689 hydrog ?    ? DA G   1592 N1    ? ? ? 1_555 DA C   1602 N3 ? ? 0 G   1592 0 C   1602 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1690 hydrog ?    ? DA G   1592 N2    ? ? ? 1_555 DA C   1602 O2 ? ? 0 G   1592 0 C   1602 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1691 hydrog ?    ? DA G   1592 O6    ? ? ? 1_555 DA C   1602 N4 ? ? 0 G   1592 0 C   1602 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1692 hydrog ?    ? DA C   1593 N3    ? ? ? 1_555 DA G   1601 N1 ? ? 0 C   1593 0 G   1601 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1693 hydrog ?    ? DA C   1593 N4    ? ? ? 1_555 DA G   1601 O6 ? ? 0 C   1593 0 G   1601 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1694 hydrog ?    ? DA C   1593 O2    ? ? ? 1_555 DA G   1601 N2 ? ? 0 C   1593 0 G   1601 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1695 hydrog ?    ? DA C   1594 N3    ? ? ? 1_555 DA G   1600 N1 ? ? 0 C   1594 0 G   1600 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1696 hydrog ?    ? DA C   1594 N4    ? ? ? 1_555 DA G   1600 O6 ? ? 0 C   1594 0 G   1600 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1697 hydrog ?    ? DA C   1594 O2    ? ? ? 1_555 DA G   1600 N2 ? ? 0 C   1594 0 G   1600 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1698 hydrog ?    ? DA G   1595 N2    ? ? ? 1_555 DA U   1599 O4 ? ? 0 G   1595 0 U   1599 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1699 hydrog ?    ? DA A   1597 N1    ? ? ? 1_555 DA G   1647 N2 ? ? 0 A   1597 0 G   1647 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1700 hydrog ?    ? DA A   1597 N6    ? ? ? 1_555 DA G   1647 N3 ? ? 0 A   1597 0 G   1647 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1701 hydrog ?    ? DA G   1628 N1    ? ? ? 1_555 DA C   1633 N3 ? ? 0 G   1628 0 C   1633 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1702 hydrog ?    ? DA G   1628 N2    ? ? ? 1_555 DA C   1633 O2 ? ? 0 G   1628 0 C   1633 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1703 hydrog ?    ? DA G   1628 O6    ? ? ? 1_555 DA C   1633 N4 ? ? 0 G   1628 0 C   1633 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1704 hydrog ?    ? DA G   1629 N2    ? ? ? 1_555 DA A   1632 N7 ? ? 0 G   1629 0 A   1632 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1705 hydrog ?    ? DA G   1629 N1    ? ? ? 1_555 DA C   1633 N3 ? ? 0 G   1629 0 C   1633 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1706 hydrog ?    ? DA C   1651 N3    ? ? ? 1_555 DA G   1655 N1 ? ? 0 C   1651 0 G   1655 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1707 hydrog ?    ? DA C   1651 N4    ? ? ? 1_555 DA G   1655 O6 ? ? 0 C   1651 0 G   1655 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1708 hydrog ?    ? DA C   1651 O2    ? ? ? 1_555 DA G   1655 N2 ? ? 0 C   1651 0 G   1655 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1709 hydrog ?    ? DA A   1682 N6    ? ? ? 1_555 DA U   1696 O2 ? ? 0 A   1682 0 U   1696 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1710 hydrog ?    ? DA A   1682 N7    ? ? ? 1_555 DA U   1696 N3 ? ? 0 A   1682 0 U   1696 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1711 hydrog ?    ? DA A   1684 N6    ? ? ? 1_555 DA U   1722 O4 ? ? 0 A   1684 0 U   1722 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog1712 hydrog ?    ? DA A   1684 N7    ? ? ? 1_555 DA U   1722 N3 ? ? 0 A   1684 0 U   1722 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog1713 hydrog ?    ? DA C   1686 N3    ? ? ? 1_555 DA G   1695 N1 ? ? 0 C   1686 0 G   1695 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1714 hydrog ?    ? DA C   1686 N4    ? ? ? 1_555 DA G   1695 O6 ? ? 0 C   1686 0 G   1695 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1715 hydrog ?    ? DA C   1686 O2    ? ? ? 1_555 DA G   1695 N2 ? ? 0 C   1686 0 G   1695 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1716 hydrog ?    ? DA C   1687 N3    ? ? ? 1_555 DA G   1694 N1 ? ? 0 C   1687 0 G   1694 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1717 hydrog ?    ? DA C   1687 N4    ? ? ? 1_555 DA G   1694 O6 ? ? 0 C   1687 0 G   1694 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1718 hydrog ?    ? DA C   1687 O2    ? ? ? 1_555 DA G   1694 N2 ? ? 0 C   1687 0 G   1694 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1719 hydrog ?    ? DA G   1703 N1    ? ? ? 1_555 DA C   1715 N3 ? ? 0 G   1703 0 C   1715 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1720 hydrog ?    ? DA G   1703 N2    ? ? ? 1_555 DA C   1715 O2 ? ? 0 G   1703 0 C   1715 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1721 hydrog ?    ? DA G   1703 O6    ? ? ? 1_555 DA C   1715 N4 ? ? 0 G   1703 0 C   1715 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1722 hydrog ?    ? DA G   1704 N1    ? ? ? 1_555 DA C   1714 N3 ? ? 0 G   1704 0 C   1714 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1723 hydrog ?    ? DA G   1704 N2    ? ? ? 1_555 DA C   1714 O2 ? ? 0 G   1704 0 C   1714 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1724 hydrog ?    ? DA G   1704 O6    ? ? ? 1_555 DA C   1714 N4 ? ? 0 G   1704 0 C   1714 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1725 hydrog ?    ? DA C   1705 N3    ? ? ? 1_555 DA G   1713 N1 ? ? 0 C   1705 0 G   1713 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1726 hydrog ?    ? DA C   1705 N4    ? ? ? 1_555 DA G   1713 O6 ? ? 0 C   1705 0 G   1713 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1727 hydrog ?    ? DA C   1705 O2    ? ? ? 1_555 DA G   1713 N2 ? ? 0 C   1705 0 G   1713 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1728 hydrog ?    ? DA G   1706 N2    ? ? ? 1_555 DA A   1712 N7 ? ? 0 G   1706 0 A   1712 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1729 hydrog ?    ? DA G   1706 N3    ? ? ? 1_555 DA A   1712 N6 ? ? 0 G   1706 0 A   1712 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1730 hydrog ?    ? DA G   1707 N2    ? ? ? 1_555 DA A   1711 N7 ? ? 0 G   1707 0 A   1711 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1731 hydrog ?    ? DA C   1725 N3    ? ? ? 1_555 DA G   2050 N1 ? ? 0 C   1725 0 G   2050 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1732 hydrog ?    ? DA C   1725 N4    ? ? ? 1_555 DA G   2050 O6 ? ? 0 C   1725 0 G   2050 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1733 hydrog ?    ? DA C   1725 O2    ? ? ? 1_555 DA G   2050 N2 ? ? 0 C   1725 0 G   2050 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1734 hydrog ?    ? DA G   1726 N1    ? ? ? 1_555 DA C   2049 N3 ? ? 0 G   1726 0 C   2049 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1735 hydrog ?    ? DA G   1726 N2    ? ? ? 1_555 DA C   2049 O2 ? ? 0 G   1726 0 C   2049 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1736 hydrog ?    ? DA G   1726 O6    ? ? ? 1_555 DA C   2049 N4 ? ? 0 G   1726 0 C   2049 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1737 hydrog ?    ? DA G   1727 N1    ? ? ? 1_555 DA C   2048 N3 ? ? 0 G   1727 0 C   2048 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1738 hydrog ?    ? DA G   1727 N2    ? ? ? 1_555 DA C   2048 O2 ? ? 0 G   1727 0 C   2048 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1739 hydrog ?    ? DA G   1727 O6    ? ? ? 1_555 DA C   2048 N4 ? ? 0 G   1727 0 C   2048 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1740 hydrog ?    ? DA G   1728 N1    ? ? ? 1_555 DA C   2047 N3 ? ? 0 G   1728 0 C   2047 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1741 hydrog ?    ? DA G   1728 N2    ? ? ? 1_555 DA C   2047 O2 ? ? 0 G   1728 0 C   2047 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1742 hydrog ?    ? DA G   1728 O6    ? ? ? 1_555 DA C   2047 N4 ? ? 0 G   1728 0 C   2047 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1743 hydrog ?    ? DA A   1733 N6    ? ? ? 1_555 DA G   2046 N3 ? ? 0 A   1733 0 G   2046 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1744 hydrog ?    ? DA A   1733 N7    ? ? ? 1_555 DA G   2046 N2 ? ? 0 A   1733 0 G   2046 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1745 hydrog ?    ? DA C   1734 N3    ? ? ? 1_555 DA G   2045 N1 ? ? 0 C   1734 0 G   2045 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1746 hydrog ?    ? DA C   1734 N4    ? ? ? 1_555 DA G   2045 O6 ? ? 0 C   1734 0 G   2045 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1747 hydrog ?    ? DA C   1734 O2    ? ? ? 1_555 DA G   2045 N2 ? ? 0 C   1734 0 G   2045 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1748 hydrog ?    ? DA C   1735 N3    ? ? ? 1_555 DA G   2044 N1 ? ? 0 C   1735 0 G   2044 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1749 hydrog ?    ? DA C   1735 N4    ? ? ? 1_555 DA G   2044 O6 ? ? 0 C   1735 0 G   2044 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1750 hydrog ?    ? DA C   1735 O2    ? ? ? 1_555 DA G   2044 N2 ? ? 0 C   1735 0 G   2044 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1751 hydrog ?    ? DA A   1736 N1    ? ? ? 1_555 DA U   2043 N3 ? ? 0 A   1736 0 U   2043 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1752 hydrog ?    ? DA A   1736 N6    ? ? ? 1_555 DA U   2043 O4 ? ? 0 A   1736 0 U   2043 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1753 hydrog ?    ? DA A   1737 N1    ? ? ? 1_555 DA U   2042 N3 ? ? 0 A   1737 0 U   2042 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1754 hydrog ?    ? DA A   1737 N6    ? ? ? 1_555 DA U   2042 O4 ? ? 0 A   1737 0 U   2042 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1755 hydrog ?    ? DA C   1738 N3    ? ? ? 1_555 DA G   2041 N1 ? ? 0 C   1738 0 G   2041 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1756 hydrog ?    ? DA C   1738 N4    ? ? ? 1_555 DA G   2041 O6 ? ? 0 C   1738 0 G   2041 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1757 hydrog ?    ? DA C   1738 O2    ? ? ? 1_555 DA G   2041 N2 ? ? 0 C   1738 0 G   2041 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1758 hydrog ?    ? DA G   1739 N1    ? ? ? 1_555 DA C   2040 N3 ? ? 0 G   1739 0 C   2040 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1759 hydrog ?    ? DA G   1739 N2    ? ? ? 1_555 DA C   2040 O2 ? ? 0 G   1739 0 C   2040 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1760 hydrog ?    ? DA G   1739 O6    ? ? ? 1_555 DA C   2040 N4 ? ? 0 G   1739 0 C   2040 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1761 hydrog ?    ? DA U   1740 N3    ? ? ? 1_555 DA A   2039 N1 ? ? 0 U   1740 0 A   2039 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1762 hydrog ?    ? DA U   1740 O4    ? ? ? 1_555 DA A   2039 N6 ? ? 0 U   1740 0 A   2039 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1763 hydrog ?    ? DA U   1741 N3    ? ? ? 1_555 DA A   2038 N1 ? ? 0 U   1741 0 A   2038 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1764 hydrog ?    ? DA U   1741 O4    ? ? ? 1_555 DA A   2038 N6 ? ? 0 U   1741 0 A   2038 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1765 hydrog ?    ? DA A   1742 N6    ? ? ? 1_555 DA G   2033 O6 ? ? 0 A   1742 0 G   2033 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1766 hydrog ?    ? DA A   1742 N1    ? ? ? 1_555 DA C   2037 N4 ? ? 0 A   1742 0 C   2037 1_555 ? ? ? ? ? ? TYPE_26_PAIR ? ? 
hydrog1767 hydrog ?    ? DA A   1742 N6    ? ? ? 1_555 DA C   2037 N3 ? ? 0 A   1742 0 C   2037 1_555 ? ? ? ? ? ? TYPE_26_PAIR ? ? 
hydrog1768 hydrog ?    ? DA G   1743 N1    ? ? ? 1_555 DA C   2036 N3 ? ? 0 G   1743 0 C   2036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1769 hydrog ?    ? DA G   1743 N2    ? ? ? 1_555 DA C   2036 O2 ? ? 0 G   1743 0 C   2036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1770 hydrog ?    ? DA G   1743 O6    ? ? ? 1_555 DA C   2036 N4 ? ? 0 G   1743 0 C   2036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1771 hydrog ?    ? DA G   1744 N1    ? ? ? 1_555 DA C   2035 N3 ? ? 0 G   1744 0 C   2035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1772 hydrog ?    ? DA G   1744 N2    ? ? ? 1_555 DA C   2035 O2 ? ? 0 G   1744 0 C   2035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1773 hydrog ?    ? DA G   1744 O6    ? ? ? 1_555 DA C   2035 N4 ? ? 0 G   1744 0 C   2035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1774 hydrog ?    ? DA G   1745 N2    ? ? ? 1_555 DA U   2034 O4 ? ? 0 G   1745 0 U   2034 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1775 hydrog ?    ? DA A   1746 N6    ? ? ? 1_555 DA U   2032 O2 ? ? 0 A   1746 0 U   2032 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1776 hydrog ?    ? DA A   1746 N7    ? ? ? 1_555 DA U   2032 N3 ? ? 0 A   1746 0 U   2032 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1777 hydrog ?    ? DA A   1747 N1    ? ? ? 1_555 DA U   2034 N3 ? ? 0 A   1747 0 U   2034 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1778 hydrog ?    ? DA A   1747 N6    ? ? ? 1_555 DA U   2034 O4 ? ? 0 A   1747 0 U   2034 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1779 hydrog ?    ? DA G   1752 N1    ? ? ? 1_555 DA C   2031 N3 ? ? 0 G   1752 0 C   2031 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1780 hydrog ?    ? DA G   1752 N2    ? ? ? 1_555 DA C   2031 O2 ? ? 0 G   1752 0 C   2031 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1781 hydrog ?    ? DA G   1752 O6    ? ? ? 1_555 DA C   2031 N4 ? ? 0 G   1752 0 C   2031 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1782 hydrog ?    ? DA G   1760 N1    ? ? ? 1_555 DA U   1784 O2 ? ? 0 G   1760 0 U   1784 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1783 hydrog ?    ? DA G   1760 O6    ? ? ? 1_555 DA U   1784 N3 ? ? 0 G   1760 0 U   1784 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1784 hydrog ?    ? DA U   1761 N3    ? ? ? 1_555 DA A   1783 N1 ? ? 0 U   1761 0 A   1783 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1785 hydrog ?    ? DA U   1761 O4    ? ? ? 1_555 DA A   1783 N6 ? ? 0 U   1761 0 A   1783 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1786 hydrog ?    ? DA C   1762 N3    ? ? ? 1_555 DA G   1782 N1 ? ? 0 C   1762 0 G   1782 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1787 hydrog ?    ? DA C   1762 N4    ? ? ? 1_555 DA G   1782 O6 ? ? 0 C   1762 0 G   1782 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1788 hydrog ?    ? DA C   1762 O2    ? ? ? 1_555 DA G   1782 N2 ? ? 0 C   1762 0 G   1782 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1789 hydrog ?    ? DA C   1763 N3    ? ? ? 1_555 DA G   1781 N1 ? ? 0 C   1763 0 G   1781 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1790 hydrog ?    ? DA C   1763 N4    ? ? ? 1_555 DA G   1781 O6 ? ? 0 C   1763 0 G   1781 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1791 hydrog ?    ? DA C   1763 O2    ? ? ? 1_555 DA G   1781 N2 ? ? 0 C   1763 0 G   1781 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1792 hydrog ?    ? DA C   1764 N3    ? ? ? 1_555 DA G   1780 N1 ? ? 0 C   1764 0 G   1780 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1793 hydrog ?    ? DA C   1764 N4    ? ? ? 1_555 DA G   1780 O6 ? ? 0 C   1764 0 G   1780 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1794 hydrog ?    ? DA C   1764 O2    ? ? ? 1_555 DA G   1780 N2 ? ? 0 C   1764 0 G   1780 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1795 hydrog ?    ? DA G   1765 N2    ? ? ? 1_555 DA A   1779 N7 ? ? 0 G   1765 0 A   1779 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1796 hydrog ?    ? DA G   1765 N3    ? ? ? 1_555 DA A   1779 N6 ? ? 0 G   1765 0 A   1779 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1797 hydrog ?    ? DA A   1767 N6    ? ? ? 1_555 DA A   1776 N7 ? ? 0 A   1767 0 A   1776 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1798 hydrog ?    ? DA A   1767 N7    ? ? ? 1_555 DA A   1776 N6 ? ? 0 A   1767 0 A   1776 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1799 hydrog ?    ? DA C   1768 N4    ? ? ? 1_555 DA A   1775 N3 ? ? 0 C   1768 0 A   1775 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1800 hydrog ?    ? DA C   1769 N3    ? ? ? 1_555 DA G   1774 N1 ? ? 0 C   1769 0 G   1774 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1801 hydrog ?    ? DA C   1769 N4    ? ? ? 1_555 DA G   1774 O6 ? ? 0 C   1769 0 G   1774 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1802 hydrog ?    ? DA C   1769 O2    ? ? ? 1_555 DA G   1774 N2 ? ? 0 C   1769 0 G   1774 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1803 hydrog ?    ? DA U   1770 O2    ? ? ? 1_555 DA G   1773 N1 ? ? 0 U   1770 0 G   1773 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog1804 hydrog ?    ? DA U   1771 N3    ? ? ? 1_555 DA A   1885 N1 ? ? 0 U   1771 0 A   1885 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1805 hydrog ?    ? DA U   1771 O4    ? ? ? 1_555 DA A   1885 N6 ? ? 0 U   1771 0 A   1885 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1806 hydrog ?    ? DA G   1785 N1    ? ? ? 1_555 DA U   1807 O2 ? ? 0 G   1785 0 U   1807 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1807 hydrog ?    ? DA G   1785 O6    ? ? ? 1_555 DA U   1807 N3 ? ? 0 G   1785 0 U   1807 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1808 hydrog ?    ? DA C   1786 N3    ? ? ? 1_555 DA G   1806 N1 ? ? 0 C   1786 0 G   1806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1809 hydrog ?    ? DA C   1786 N4    ? ? ? 1_555 DA G   1806 O6 ? ? 0 C   1786 0 G   1806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1810 hydrog ?    ? DA C   1786 O2    ? ? ? 1_555 DA G   1806 N2 ? ? 0 C   1786 0 G   1806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1811 hydrog ?    ? DA C   1787 N3    ? ? ? 1_555 DA G   1805 N1 ? ? 0 C   1787 0 G   1805 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1812 hydrog ?    ? DA C   1787 N4    ? ? ? 1_555 DA G   1805 O6 ? ? 0 C   1787 0 G   1805 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1813 hydrog ?    ? DA C   1787 O2    ? ? ? 1_555 DA G   1805 N2 ? ? 0 C   1787 0 G   1805 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1814 hydrog ?    ? DA U   1788 N3    ? ? ? 1_555 DA A   1804 N1 ? ? 0 U   1788 0 A   1804 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1815 hydrog ?    ? DA U   1788 O4    ? ? ? 1_555 DA A   1804 N6 ? ? 0 U   1788 0 A   1804 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1816 hydrog ?    ? DA G   1789 N1    ? ? ? 1_555 DA C   1803 N3 ? ? 0 G   1789 0 C   1803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1817 hydrog ?    ? DA G   1789 N2    ? ? ? 1_555 DA C   1803 O2 ? ? 0 G   1789 0 C   1803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1818 hydrog ?    ? DA G   1789 O6    ? ? ? 1_555 DA C   1803 N4 ? ? 0 G   1789 0 C   1803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1819 hydrog ?    ? DA C   1790 N3    ? ? ? 1_555 DA G   1802 N1 ? ? 0 C   1790 0 G   1802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1820 hydrog ?    ? DA C   1790 N4    ? ? ? 1_555 DA G   1802 O6 ? ? 0 C   1790 0 G   1802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1821 hydrog ?    ? DA C   1790 O2    ? ? ? 1_555 DA G   1802 N2 ? ? 0 C   1790 0 G   1802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1822 hydrog ?    ? DA U   1791 N3    ? ? ? 1_555 DA A   1801 N1 ? ? 0 U   1791 0 A   1801 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1823 hydrog ?    ? DA U   1791 O4    ? ? ? 1_555 DA A   1801 N6 ? ? 0 U   1791 0 A   1801 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1824 hydrog ?    ? DA C   1792 N3    ? ? ? 1_555 DA G   1800 N1 ? ? 0 C   1792 0 G   1800 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1825 hydrog ?    ? DA C   1792 N4    ? ? ? 1_555 DA G   1800 O6 ? ? 0 C   1792 0 G   1800 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1826 hydrog ?    ? DA C   1792 O2    ? ? ? 1_555 DA G   1800 N2 ? ? 0 C   1792 0 G   1800 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1827 hydrog ?    ? DA C   1793 N3    ? ? ? 1_555 DA G   1799 N1 ? ? 0 C   1793 0 G   1799 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1828 hydrog ?    ? DA C   1793 N4    ? ? ? 1_555 DA G   1799 O6 ? ? 0 C   1793 0 G   1799 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1829 hydrog ?    ? DA C   1793 O2    ? ? ? 1_555 DA G   1799 N2 ? ? 0 C   1793 0 G   1799 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1830 hydrog ?    ? DA G   1794 N2    ? ? ? 1_555 DA A   1797 N7 ? ? 0 G   1794 0 A   1797 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1831 hydrog ?    ? DA G   1805 N2    ? ? ? 1_555 DA A   2875 N3 ? ? 0 G   1805 0 A   2875 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1832 hydrog ?    ? DA G   1806 N2    ? ? ? 1_555 DA A   2883 N3 ? ? 0 G   1806 0 A   2883 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1833 hydrog ?    ? DA C   1808 N3    ? ? ? 1_555 DA G   1812 N1 ? ? 0 C   1808 0 G   1812 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1834 hydrog ?    ? DA C   1808 N4    ? ? ? 1_555 DA G   1812 O6 ? ? 0 C   1808 0 G   1812 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1835 hydrog ?    ? DA C   1808 O2    ? ? ? 1_555 DA G   1812 N2 ? ? 0 C   1808 0 G   1812 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1836 hydrog ?    ? DA C   1810 N4    ? ? ? 1_555 DA C   2752 O2 ? ? 0 C   1810 0 C   2752 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1837 hydrog ?    ? DA A   1811 N1    ? ? ? 1_555 DA G   2731 N2 ? ? 0 A   1811 0 G   2731 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1838 hydrog ?    ? DA A   1811 N6    ? ? ? 1_555 DA G   2731 N3 ? ? 0 A   1811 0 G   2731 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1839 hydrog ?    ? DA U   1813 N3    ? ? ? 1_555 DA U   1817 O4 ? ? 0 U   1813 0 U   1817 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1840 hydrog ?    ? DA U   1813 O2    ? ? ? 1_555 DA U   1817 N3 ? ? 0 U   1813 0 U   1817 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1841 hydrog ?    ? DA U   1813 N3    ? ? ? 1_555 DA C   1818 O2 ? ? 0 U   1813 0 C   1818 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog1842 hydrog ?    ? DA G   1820 N1    ? ? ? 1_555 DA C   2029 N3 ? ? 0 G   1820 0 C   2029 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1843 hydrog ?    ? DA G   1820 N2    ? ? ? 1_555 DA C   2029 O2 ? ? 0 G   1820 0 C   2029 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1844 hydrog ?    ? DA G   1820 O6    ? ? ? 1_555 DA C   2029 N4 ? ? 0 G   1820 0 C   2029 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1845 hydrog ?    ? DA A   1821 N1    ? ? ? 1_555 DA U   2028 N3 ? ? 0 A   1821 0 U   2028 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1846 hydrog ?    ? DA A   1821 N6    ? ? ? 1_555 DA U   2028 O4 ? ? 0 A   1821 0 U   2028 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1847 hydrog ?    ? DA A   1822 N1    ? ? ? 1_555 DA U   2027 N3 ? ? 0 A   1822 0 U   2027 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1848 hydrog ?    ? DA A   1822 N6    ? ? ? 1_555 DA U   2027 O4 ? ? 0 A   1822 0 U   2027 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1849 hydrog ?    ? DA G   1823 N1    ? ? ? 1_555 DA C   2026 N3 ? ? 0 G   1823 0 C   2026 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1850 hydrog ?    ? DA G   1823 N2    ? ? ? 1_555 DA C   2026 O2 ? ? 0 G   1823 0 C   2026 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1851 hydrog ?    ? DA G   1823 O6    ? ? ? 1_555 DA C   2026 N4 ? ? 0 G   1823 0 C   2026 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1852 hydrog ?    ? DA C   1824 N3    ? ? ? 1_555 DA G   2025 N1 ? ? 0 C   1824 0 G   2025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1853 hydrog ?    ? DA C   1824 N4    ? ? ? 1_555 DA G   2025 O6 ? ? 0 C   1824 0 G   2025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1854 hydrog ?    ? DA C   1824 O2    ? ? ? 1_555 DA G   2025 N2 ? ? 0 C   1824 0 G   2025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1855 hydrog ?    ? DA U   1825 N3    ? ? ? 1_555 DA A   2024 N1 ? ? 0 U   1825 0 A   2024 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1856 hydrog ?    ? DA U   1825 O4    ? ? ? 1_555 DA A   2024 N6 ? ? 0 U   1825 0 A   2024 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1857 hydrog ?    ? DA C   1826 N3    ? ? ? 1_555 DA G   2023 N1 ? ? 0 C   1826 0 G   2023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1858 hydrog ?    ? DA C   1826 N4    ? ? ? 1_555 DA G   2023 O6 ? ? 0 C   1826 0 G   2023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1859 hydrog ?    ? DA C   1826 O2    ? ? ? 1_555 DA G   2023 N2 ? ? 0 C   1826 0 G   2023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1860 hydrog ?    ? DA G   1827 N1    ? ? ? 1_555 DA C   2021 N3 ? ? 0 G   1827 0 C   2021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1861 hydrog ?    ? DA G   1827 N2    ? ? ? 1_555 DA C   2021 O2 ? ? 0 G   1827 0 C   2021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1862 hydrog ?    ? DA G   1827 O6    ? ? ? 1_555 DA C   2021 N4 ? ? 0 G   1827 0 C   2021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1863 hydrog ?    ? DA G   1828 N1    ? ? ? 1_555 DA C   2020 N3 ? ? 0 G   1828 0 C   2020 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1864 hydrog ?    ? DA G   1828 N2    ? ? ? 1_555 DA C   2020 O2 ? ? 0 G   1828 0 C   2020 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1865 hydrog ?    ? DA G   1828 O6    ? ? ? 1_555 DA C   2020 N4 ? ? 0 G   1828 0 C   2020 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1866 hydrog ?    ? DA A   1829 N3    ? ? ? 1_555 DA A   2018 N6 ? ? 0 A   1829 0 A   2018 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1867 hydrog ?    ? DA C   1830 N4    ? ? ? 1_555 DA U   1846 O2 ? ? 0 C   1830 0 U   1846 1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? 
hydrog1868 hydrog ?    ? DA G   1832 N1    ? ? ? 1_555 DA C   1844 N3 ? ? 0 G   1832 0 C   1844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1869 hydrog ?    ? DA G   1832 N2    ? ? ? 1_555 DA C   1844 O2 ? ? 0 G   1832 0 C   1844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1870 hydrog ?    ? DA G   1832 O6    ? ? ? 1_555 DA C   1844 N4 ? ? 0 G   1832 0 C   1844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1871 hydrog ?    ? DA U   1833 N3    ? ? ? 1_555 DA A   1843 N1 ? ? 0 U   1833 0 A   1843 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1872 hydrog ?    ? DA U   1833 O4    ? ? ? 1_555 DA A   1843 N6 ? ? 0 U   1833 0 A   1843 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1873 hydrog ?    ? DA C   1834 O2    ? ? ? 1_555 DA C   1841 N4 ? ? 0 C   1834 0 C   1841 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1874 hydrog ?    ? DA U   1835 O4    ? ? ? 1_555 DA C   1841 N4 ? ? 0 U   1835 0 C   1841 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog1875 hydrog ?    ? DA U   1838 N3    ? ? ? 1_555 DA PSU 2621 O2 ? ? 0 U   1838 0 PSU 2621 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1876 hydrog ?    ? DA U   1838 O4    ? ? ? 1_555 DA PSU 2621 N3 ? ? 0 U   1838 0 PSU 2621 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1877 hydrog ?    ? DA A   1839 N3    ? ? ? 1_555 DA G   2642 N2 ? ? 0 A   1839 0 G   2642 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1878 hydrog ?    ? DA C   1841 O2    ? ? ? 1_555 DA G   2623 N2 ? ? 0 C   1841 0 G   2623 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1879 hydrog ?    ? DA A   1847 N6    ? ? ? 1_555 DA G   1884 N3 ? ? 0 A   1847 0 G   1884 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1880 hydrog ?    ? DA A   1847 N7    ? ? ? 1_555 DA G   1884 N2 ? ? 0 A   1847 0 G   1884 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1881 hydrog ?    ? DA G   1848 N1    ? ? ? 1_555 DA U   1883 O2 ? ? 0 G   1848 0 U   1883 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1882 hydrog ?    ? DA G   1848 O6    ? ? ? 1_555 DA U   1883 N3 ? ? 0 G   1848 0 U   1883 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1883 hydrog ?    ? DA G   1849 N1    ? ? ? 1_555 DA C   1882 N3 ? ? 0 G   1849 0 C   1882 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1884 hydrog ?    ? DA G   1849 N2    ? ? ? 1_555 DA C   1882 O2 ? ? 0 G   1849 0 C   1882 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1885 hydrog ?    ? DA G   1849 O6    ? ? ? 1_555 DA C   1882 N4 ? ? 0 G   1849 0 C   1882 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1886 hydrog ?    ? DA G   1849 N2    ? ? ? 1_555 DA A   1941 N3 ? ? 0 G   1849 0 A   1941 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1887 hydrog ?    ? DA U   1850 N3    ? ? ? 1_555 DA A   1881 N1 ? ? 0 U   1850 0 A   1881 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1888 hydrog ?    ? DA U   1850 O4    ? ? ? 1_555 DA A   1881 N6 ? ? 0 U   1850 0 A   1881 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1889 hydrog ?    ? DA G   1851 N1    ? ? ? 1_555 DA C   1880 N3 ? ? 0 G   1851 0 C   1880 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1890 hydrog ?    ? DA G   1851 N2    ? ? ? 1_555 DA C   1880 O2 ? ? 0 G   1851 0 C   1880 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1891 hydrog ?    ? DA G   1851 O6    ? ? ? 1_555 DA C   1880 N4 ? ? 0 G   1851 0 C   1880 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1892 hydrog ?    ? DA A   1852 N1    ? ? ? 1_555 DA U   1879 N3 ? ? 0 A   1852 0 U   1879 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1893 hydrog ?    ? DA A   1852 N6    ? ? ? 1_555 DA U   1879 O4 ? ? 0 A   1852 0 U   1879 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1894 hydrog ?    ? DA C   1853 N3    ? ? ? 1_555 DA G   1878 N1 ? ? 0 C   1853 0 G   1878 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1895 hydrog ?    ? DA C   1853 N4    ? ? ? 1_555 DA G   1878 O6 ? ? 0 C   1853 0 G   1878 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1896 hydrog ?    ? DA C   1853 O2    ? ? ? 1_555 DA G   1878 N2 ? ? 0 C   1853 0 G   1878 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1897 hydrog ?    ? DA C   1854 N3    ? ? ? 1_555 DA G   1877 N1 ? ? 0 C   1854 0 G   1877 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1898 hydrog ?    ? DA C   1854 N4    ? ? ? 1_555 DA G   1877 O6 ? ? 0 C   1854 0 G   1877 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1899 hydrog ?    ? DA C   1854 O2    ? ? ? 1_555 DA G   1877 N2 ? ? 0 C   1854 0 G   1877 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1900 hydrog ?    ? DA G   1855 N2    ? ? ? 1_555 DA U   1874 O2 ? ? 0 G   1855 0 U   1874 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1901 hydrog ?    ? DA C   1856 N3    ? ? ? 1_555 DA G   1873 N2 ? ? 0 C   1856 0 G   1873 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1902 hydrog ?    ? DA C   1856 O2    ? ? ? 1_555 DA G   1873 N1 ? ? 0 C   1856 0 G   1873 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1903 hydrog ?    ? DA C   1856 N4    ? ? ? 1_555 DA A   1875 N7 ? ? 0 C   1856 0 A   1875 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1904 hydrog ?    ? DA A   1857 N6    ? ? ? 1_555 DA U   2246 O2 ? ? 0 A   1857 0 U   2246 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1905 hydrog ?    ? DA A   1858 N6    ? ? ? 1_555 DA U   1871 O4 ? ? 0 A   1858 0 U   1871 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1906 hydrog ?    ? DA A   1859 N6    ? ? ? 1_555 DA C   1870 O2 ? ? 0 A   1859 0 C   1870 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1907 hydrog ?    ? DA A   1859 N3    ? ? ? 1_555 DA G   1878 N2 ? ? 0 A   1859 0 G   1878 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1908 hydrog ?    ? DA U   1860 N3    ? ? ? 1_555 DA A   1869 N1 ? ? 0 U   1860 0 A   1869 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1909 hydrog ?    ? DA U   1860 O4    ? ? ? 1_555 DA A   1869 N6 ? ? 0 U   1860 0 A   1869 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1910 hydrog ?    ? DA C   1861 N3    ? ? ? 1_555 DA G   1868 N1 ? ? 0 C   1861 0 G   1868 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1911 hydrog ?    ? DA C   1861 N4    ? ? ? 1_555 DA G   1868 O6 ? ? 0 C   1861 0 G   1868 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1912 hydrog ?    ? DA C   1861 O2    ? ? ? 1_555 DA G   1868 N2 ? ? 0 C   1861 0 G   1868 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1913 hydrog ?    ? DA C   1862 N3    ? ? ? 1_555 DA G   1867 N1 ? ? 0 C   1862 0 G   1867 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1914 hydrog ?    ? DA C   1862 N4    ? ? ? 1_555 DA G   1867 O6 ? ? 0 C   1862 0 G   1867 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1915 hydrog ?    ? DA C   1862 O2    ? ? ? 1_555 DA G   1867 N2 ? ? 0 C   1862 0 G   1867 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1916 hydrog ?    ? DA G   1863 N2    ? ? ? 1_555 DA A   1866 N7 ? ? 0 G   1863 0 A   1866 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1917 hydrog ?    ? DA A   1885 N6    ? ? ? 1_555 DA U   2017 O2 ? ? 0 A   1885 0 U   2017 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1918 hydrog ?    ? DA A   1886 N6    ? ? ? 1_555 DA U   2016 O2 ? ? 0 A   1886 0 U   2016 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1919 hydrog ?    ? DA U   1887 N3    ? ? ? 1_555 DA A   2015 N1 ? ? 0 U   1887 0 A   2015 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1920 hydrog ?    ? DA U   1887 O4    ? ? ? 1_555 DA A   2015 N6 ? ? 0 U   1887 0 A   2015 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1921 hydrog ?    ? DA C   1888 N3    ? ? ? 1_555 DA G   2014 N1 ? ? 0 C   1888 0 G   2014 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1922 hydrog ?    ? DA C   1888 N4    ? ? ? 1_555 DA G   2014 O6 ? ? 0 C   1888 0 G   2014 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1923 hydrog ?    ? DA C   1888 O2    ? ? ? 1_555 DA G   2014 N2 ? ? 0 C   1888 0 G   2014 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1924 hydrog ?    ? DA C   1889 N3    ? ? ? 1_555 DA G   2013 N1 ? ? 0 C   1889 0 G   2013 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1925 hydrog ?    ? DA C   1889 N4    ? ? ? 1_555 DA G   2013 O6 ? ? 0 C   1889 0 G   2013 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1926 hydrog ?    ? DA C   1889 O2    ? ? ? 1_555 DA G   2013 N2 ? ? 0 C   1889 0 G   2013 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1927 hydrog ?    ? DA U   1890 O4    ? ? ? 1_555 DA A   1941 N6 ? ? 0 U   1890 0 A   1941 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1928 hydrog ?    ? DA U   1890 N3    ? ? ? 1_555 DA A   2011 N7 ? ? 0 U   1890 0 A   2011 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog1929 hydrog ?    ? DA U   1890 O4    ? ? ? 1_555 DA A   2011 N6 ? ? 0 U   1890 0 A   2011 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog1930 hydrog ?    ? DA G   1891 N1    ? ? ? 1_555 DA C   1946 N3 ? ? 0 G   1891 0 C   1946 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1931 hydrog ?    ? DA G   1891 N2    ? ? ? 1_555 DA C   1946 O2 ? ? 0 G   1891 0 C   1946 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1932 hydrog ?    ? DA G   1891 O6    ? ? ? 1_555 DA C   1946 N4 ? ? 0 G   1891 0 C   1946 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1933 hydrog ?    ? DA C   1892 N3    ? ? ? 1_555 DA G   1945 N1 ? ? 0 C   1892 0 G   1945 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1934 hydrog ?    ? DA C   1892 N4    ? ? ? 1_555 DA G   1945 O6 ? ? 0 C   1892 0 G   1945 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1935 hydrog ?    ? DA C   1892 O2    ? ? ? 1_555 DA G   1945 N2 ? ? 0 C   1892 0 G   1945 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1936 hydrog ?    ? DA C   1893 N3    ? ? ? 1_555 DA G   1944 N1 ? ? 0 C   1893 0 G   1944 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1937 hydrog ?    ? DA C   1893 N4    ? ? ? 1_555 DA G   1944 O6 ? ? 0 C   1893 0 G   1944 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1938 hydrog ?    ? DA C   1893 O2    ? ? ? 1_555 DA G   1944 N2 ? ? 0 C   1893 0 G   1944 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1939 hydrog ?    ? DA C   1894 N3    ? ? ? 1_555 DA A   1942 N6 ? ? 0 C   1894 0 A   1942 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1940 hydrog ?    ? DA C   1894 N4    ? ? ? 1_555 DA A   1942 N7 ? ? 0 C   1894 0 A   1942 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1941 hydrog ?    ? DA G   1896 N1    ? ? ? 1_555 DA C   1943 N3 ? ? 0 G   1896 0 C   1943 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1942 hydrog ?    ? DA G   1896 N2    ? ? ? 1_555 DA C   1943 O2 ? ? 0 G   1896 0 C   1943 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1943 hydrog ?    ? DA G   1896 O6    ? ? ? 1_555 DA C   1943 N4 ? ? 0 G   1896 0 C   1943 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1944 hydrog ?    ? DA U   1897 N3    ? ? ? 1_555 DA A   1942 N1 ? ? 0 U   1897 0 A   1942 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1945 hydrog ?    ? DA U   1897 O4    ? ? ? 1_555 DA A   1942 N6 ? ? 0 U   1897 0 A   1942 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1946 hydrog ?    ? DA G   1898 N1    ? ? ? 1_555 DA U   1939 O2 ? ? 0 G   1898 0 U   1939 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1947 hydrog ?    ? DA G   1898 O6    ? ? ? 1_555 DA U   1939 N3 ? ? 0 G   1898 0 U   1939 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1948 hydrog ?    ? DA C   1899 N3    ? ? ? 1_555 DA G   1938 N1 ? ? 0 C   1899 0 G   1938 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1949 hydrog ?    ? DA C   1899 N4    ? ? ? 1_555 DA G   1938 O6 ? ? 0 C   1899 0 G   1938 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1950 hydrog ?    ? DA C   1899 O2    ? ? ? 1_555 DA G   1938 N2 ? ? 0 C   1899 0 G   1938 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1951 hydrog ?    ? DA A   1900 N1    ? ? ? 1_555 DA U   1937 N3 ? ? 0 A   1900 0 U   1937 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1952 hydrog ?    ? DA A   1900 N6    ? ? ? 1_555 DA U   1937 O4 ? ? 0 A   1900 0 U   1937 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1953 hydrog ?    ? DA G   1901 N1    ? ? ? 1_555 DA C   1936 N3 ? ? 0 G   1901 0 C   1936 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1954 hydrog ?    ? DA G   1901 N2    ? ? ? 1_555 DA C   1936 O2 ? ? 0 G   1901 0 C   1936 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1955 hydrog ?    ? DA G   1901 O6    ? ? ? 1_555 DA C   1936 N4 ? ? 0 G   1901 0 C   1936 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1956 hydrog ?    ? DA G   1902 N1    ? ? ? 1_555 DA C   1935 N3 ? ? 0 G   1902 0 C   1935 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1957 hydrog ?    ? DA G   1902 N2    ? ? ? 1_555 DA C   1935 O2 ? ? 0 G   1902 0 C   1935 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1958 hydrog ?    ? DA G   1902 O6    ? ? ? 1_555 DA C   1935 N4 ? ? 0 G   1902 0 C   1935 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1959 hydrog ?    ? DA U   1903 O2    ? ? ? 1_555 DA A   1934 N6 ? ? 0 U   1903 0 A   1934 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1960 hydrog ?    ? DA U   1905 N3    ? ? ? 1_555 DA A   1934 N1 ? ? 0 U   1905 0 A   1934 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1961 hydrog ?    ? DA U   1905 O4    ? ? ? 1_555 DA A   1934 N6 ? ? 0 U   1905 0 A   1934 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1962 hydrog ?    ? DA C   1906 N3    ? ? ? 1_555 DA G   1933 N1 ? ? 0 C   1906 0 G   1933 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1963 hydrog ?    ? DA C   1906 N4    ? ? ? 1_555 DA G   1933 O6 ? ? 0 C   1906 0 G   1933 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1964 hydrog ?    ? DA C   1906 O2    ? ? ? 1_555 DA G   1933 N2 ? ? 0 C   1906 0 G   1933 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1965 hydrog ?    ? DA U   1907 N3    ? ? ? 1_555 DA G   1932 O6 ? ? 0 U   1907 0 G   1932 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1966 hydrog ?    ? DA U   1907 O2    ? ? ? 1_555 DA G   1932 N1 ? ? 0 U   1907 0 G   1932 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1967 hydrog ?    ? DA G   1908 N2    ? ? ? 1_555 DA A   1931 N7 ? ? 0 G   1908 0 A   1931 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1968 hydrog ?    ? DA G   1908 N3    ? ? ? 1_555 DA A   1931 N6 ? ? 0 G   1908 0 A   1931 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1969 hydrog ?    ? DA A   1910 N3    ? ? ? 1_555 DA G   2128 N2 ? ? 0 A   1910 0 G   2128 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1970 hydrog ?    ? DA A   1912 N6    ? ? ? 1_555 DA A   1927 N1 ? ? 0 A   1912 0 A   1927 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1971 hydrog ?    ? DA C   1913 N3    ? ? ? 1_555 DA G   1926 N1 ? ? 0 C   1913 0 G   1926 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1972 hydrog ?    ? DA C   1913 N4    ? ? ? 1_555 DA G   1926 O6 ? ? 0 C   1913 0 G   1926 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1973 hydrog ?    ? DA C   1913 O2    ? ? ? 1_555 DA G   1926 N2 ? ? 0 C   1913 0 G   1926 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1974 hydrog ?    ? DA C   1914 O2    ? ? ? 1_555 DA G   1925 N2 ? ? 0 C   1914 0 G   1925 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1975 hydrog ?    ? DA U   1915 N3    ? ? ? 1_555 DA A   1924 N1 ? ? 0 U   1915 0 A   1924 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1976 hydrog ?    ? DA U   1915 O4    ? ? ? 1_555 DA A   1924 N6 ? ? 0 U   1915 0 A   1924 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1977 hydrog ?    ? DA C   1916 N3    ? ? ? 1_555 DA G   1923 N1 ? ? 0 C   1916 0 G   1923 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1978 hydrog ?    ? DA C   1916 N4    ? ? ? 1_555 DA G   1923 O6 ? ? 0 C   1916 0 G   1923 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1979 hydrog ?    ? DA C   1916 O2    ? ? ? 1_555 DA G   1923 N2 ? ? 0 C   1916 0 G   1923 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1980 hydrog ?    ? DA G   1917 N2    ? ? ? 1_555 DA A   1922 N7 ? ? 0 G   1917 0 A   1922 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1981 hydrog ?    ? DA A   1931 N3    ? ? ? 1_555 DA G   2267 N2 ? ? 0 A   1931 0 G   2267 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1982 hydrog ?    ? DA C   1940 O2    ? ? ? 1_555 DA C   1943 N4 ? ? 0 C   1940 0 C   1943 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1983 hydrog ?    ? DA G   1944 N2    ? ? ? 1_555 DA A   1968 N1 ? ? 0 G   1944 0 A   1968 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1984 hydrog ?    ? DA G   1945 N2    ? ? ? 1_555 DA A   1969 N3 ? ? 0 G   1945 0 A   1969 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1985 hydrog ?    ? DA G   1947 N1    ? ? ? 1_555 DA C   1965 N3 ? ? 0 G   1947 0 C   1965 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1986 hydrog ?    ? DA G   1947 N2    ? ? ? 1_555 DA C   1965 O2 ? ? 0 G   1947 0 C   1965 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1987 hydrog ?    ? DA G   1947 O6    ? ? ? 1_555 DA C   1965 N4 ? ? 0 G   1947 0 C   1965 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1988 hydrog ?    ? DA G   1948 N1    ? ? ? 1_555 DA U   1964 O2 ? ? 0 G   1948 0 U   1964 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1989 hydrog ?    ? DA G   1948 O6    ? ? ? 1_555 DA U   1964 N3 ? ? 0 G   1948 0 U   1964 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1990 hydrog ?    ? DA U   1966 N3    ? ? ? 1_555 DA G   1970 O6 ? ? 0 U   1966 0 G   1970 1_555 ? ? ? ? ? ? TYPE_27_PAIR ? ? 
hydrog1991 hydrog ?    ? DA U   1966 O4    ? ? ? 1_555 DA G   1970 N1 ? ? 0 U   1966 0 G   1970 1_555 ? ? ? ? ? ? TYPE_27_PAIR ? ? 
hydrog1992 hydrog ?    ? DA G   1971 N2    ? ? ? 1_555 DA U   1972 O4 ? ? 0 G   1971 0 U   1972 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1993 hydrog ?    ? DA U   1972 N3    ? ? ? 1_555 DA A   2010 N7 ? ? 0 U   1972 0 A   2010 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1994 hydrog ?    ? DA A   1973 N6    ? ? ? 1_555 DA G   2009 N3 ? ? 0 A   1973 0 G   2009 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1995 hydrog ?    ? DA A   1973 N7    ? ? ? 1_555 DA G   2009 N2 ? ? 0 A   1973 0 G   2009 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1996 hydrog ?    ? DA G   1974 N1    ? ? ? 1_555 DA U   2008 O2 ? ? 0 G   1974 0 U   2008 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1997 hydrog ?    ? DA G   1974 O6    ? ? ? 1_555 DA U   2008 N3 ? ? 0 G   1974 0 U   2008 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1998 hydrog ?    ? DA C   1975 N3    ? ? ? 1_555 DA G   2005 N1 ? ? 0 C   1975 0 G   2005 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1999 hydrog ?    ? DA C   1975 N4    ? ? ? 1_555 DA G   2005 O6 ? ? 0 C   1975 0 G   2005 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2000 hydrog ?    ? DA C   1975 O2    ? ? ? 1_555 DA G   2005 N2 ? ? 0 C   1975 0 G   2005 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2001 hydrog ?    ? DA U   1977 N3    ? ? ? 1_555 DA U   1984 O4 ? ? 0 U   1977 0 U   1984 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2002 hydrog ?    ? DA U   1977 O2    ? ? ? 1_555 DA U   1984 N3 ? ? 0 U   1977 0 U   1984 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2003 hydrog ?    ? DA A   1978 N1    ? ? ? 1_555 DA G   2005 N2 ? ? 0 A   1978 0 G   2005 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2004 hydrog ?    ? DA G   1979 N2    ? ? ? 1_555 DA U   2640 O2 ? ? 0 G   1979 0 U   2640 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2005 hydrog ?    ? DA A   1981 N3    ? ? ? 1_555 DA C   1983 N4 ? ? 0 A   1981 0 C   1983 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2006 hydrog ?    ? DA G   1986 N1    ? ? ? 1_555 DA C   2002 N3 ? ? 0 G   1986 0 C   2002 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2007 hydrog ?    ? DA G   1986 N2    ? ? ? 1_555 DA C   2002 O2 ? ? 0 G   1986 0 C   2002 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2008 hydrog ?    ? DA G   1986 O6    ? ? ? 1_555 DA C   2002 N4 ? ? 0 G   1986 0 C   2002 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2009 hydrog ?    ? DA C   1987 N3    ? ? ? 1_555 DA G   2001 N1 ? ? 0 C   1987 0 G   2001 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2010 hydrog ?    ? DA C   1987 N4    ? ? ? 1_555 DA G   2001 O6 ? ? 0 C   1987 0 G   2001 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2011 hydrog ?    ? DA C   1987 O2    ? ? ? 1_555 DA G   2001 N2 ? ? 0 C   1987 0 G   2001 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2012 hydrog ?    ? DA C   1988 N3    ? ? ? 1_555 DA G   2000 N1 ? ? 0 C   1988 0 G   2000 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2013 hydrog ?    ? DA C   1988 N4    ? ? ? 1_555 DA G   2000 O6 ? ? 0 C   1988 0 G   2000 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2014 hydrog ?    ? DA C   1988 O2    ? ? ? 1_555 DA G   2000 N2 ? ? 0 C   1988 0 G   2000 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2015 hydrog ?    ? DA G   1989 N1    ? ? ? 1_555 DA C   1999 N3 ? ? 0 G   1989 0 C   1999 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2016 hydrog ?    ? DA G   1989 N2    ? ? ? 1_555 DA C   1999 O2 ? ? 0 G   1989 0 C   1999 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2017 hydrog ?    ? DA G   1989 O6    ? ? ? 1_555 DA C   1999 N4 ? ? 0 G   1989 0 C   1999 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2018 hydrog ?    ? DA C   1990 N3    ? ? ? 1_555 DA G   1998 N1 ? ? 0 C   1990 0 G   1998 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2019 hydrog ?    ? DA C   1990 N4    ? ? ? 1_555 DA G   1998 O6 ? ? 0 C   1990 0 G   1998 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2020 hydrog ?    ? DA C   1990 O2    ? ? ? 1_555 DA G   1998 N2 ? ? 0 C   1990 0 G   1998 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2021 hydrog ?    ? DA A   1991 N3    ? ? ? 1_555 DA A   1997 N6 ? ? 0 A   1991 0 A   1997 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2022 hydrog ?    ? DA A   1994 N3    ? ? ? 1_555 DA G   2584 N2 ? ? 0 A   1994 0 G   2584 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2023 hydrog ?    ? DA U   1996 O4    ? ? ? 1_555 DA C   2591 N4 ? ? 0 U   1996 0 C   2591 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2024 hydrog ?    ? DA A   2010 N3    ? ? ? 1_555 DA G   2013 N2 ? ? 0 A   2010 0 G   2013 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2025 hydrog ?    ? DA G   2033 N1    ? ? ? 1_555 DA C   2037 O2 ? ? 0 G   2033 0 C   2037 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2026 hydrog ?    ? DA G   2041 N2    ? ? ? 1_555 DA U   2726 O4 ? ? 0 G   2041 0 U   2726 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2027 hydrog ?    ? DA A   2054 N1    ? ? ? 1_555 DA U   2648 N3 ? ? 0 A   2054 0 U   2648 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2028 hydrog ?    ? DA A   2054 N6    ? ? ? 1_555 DA U   2648 O2 ? ? 0 A   2054 0 U   2648 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2029 hydrog ?    ? DA A   2060 N1    ? ? ? 1_555 DA U   2076 N3 ? ? 0 A   2060 0 U   2076 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2030 hydrog ?    ? DA A   2060 N6    ? ? ? 1_555 DA U   2076 O4 ? ? 0 A   2060 0 U   2076 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2031 hydrog ?    ? DA C   2061 N3    ? ? ? 1_555 DA G   2075 N1 ? ? 0 C   2061 0 G   2075 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2032 hydrog ?    ? DA C   2061 N4    ? ? ? 1_555 DA G   2075 O6 ? ? 0 C   2061 0 G   2075 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2033 hydrog ?    ? DA C   2061 O2    ? ? ? 1_555 DA G   2075 N2 ? ? 0 C   2061 0 G   2075 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2034 hydrog ?    ? DA U   2063 N3    ? ? ? 1_555 DA A   2083 N3 ? ? 0 U   2063 0 A   2083 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2035 hydrog ?    ? DA U   2064 N3    ? ? ? 1_555 DA A   2081 N1 ? ? 0 U   2064 0 A   2081 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2036 hydrog ?    ? DA U   2064 O4    ? ? ? 1_555 DA A   2081 N6 ? ? 0 U   2064 0 A   2081 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2037 hydrog ?    ? DA C   2065 N3    ? ? ? 1_555 DA G   2080 N1 ? ? 0 C   2065 0 G   2080 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2038 hydrog ?    ? DA C   2065 N4    ? ? ? 1_555 DA G   2080 O6 ? ? 0 C   2065 0 G   2080 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2039 hydrog ?    ? DA C   2065 O2    ? ? ? 1_555 DA G   2080 N2 ? ? 0 C   2065 0 G   2080 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2040 hydrog ?    ? DA C   2066 N3    ? ? ? 1_555 DA G   2079 N1 ? ? 0 C   2066 0 G   2079 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2041 hydrog ?    ? DA C   2066 N4    ? ? ? 1_555 DA G   2079 O6 ? ? 0 C   2066 0 G   2079 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2042 hydrog ?    ? DA C   2066 O2    ? ? ? 1_555 DA G   2079 N2 ? ? 0 C   2066 0 G   2079 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2043 hydrog ?    ? DA A   2067 N1    ? ? ? 1_555 DA U   2078 N3 ? ? 0 A   2067 0 U   2078 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2044 hydrog ?    ? DA A   2067 N6    ? ? ? 1_555 DA U   2078 O4 ? ? 0 A   2067 0 U   2078 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2045 hydrog ?    ? DA G   2068 N1    ? ? ? 1_555 DA C   2077 N3 ? ? 0 G   2068 0 C   2077 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2046 hydrog ?    ? DA G   2068 N2    ? ? ? 1_555 DA C   2077 O2 ? ? 0 G   2068 0 C   2077 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2047 hydrog ?    ? DA G   2068 O6    ? ? ? 1_555 DA C   2077 N4 ? ? 0 G   2068 0 C   2077 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2048 hydrog ?    ? DA U   2069 N3    ? ? ? 1_555 DA A   2074 N7 ? ? 0 U   2069 0 A   2074 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2049 hydrog ?    ? DA U   2069 O2    ? ? ? 1_555 DA A   2074 N6 ? ? 0 U   2069 0 A   2074 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2050 hydrog ?    ? DA G   2072 N2    ? ? ? 1_555 DA A   2490 N3 ? ? 0 G   2072 0 A   2490 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2051 hydrog ?    ? DA C   2084 N3    ? ? ? 1_555 DA G   2660 N1 ? ? 0 C   2084 0 G   2660 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2052 hydrog ?    ? DA C   2084 N4    ? ? ? 1_555 DA G   2660 O6 ? ? 0 C   2084 0 G   2660 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2053 hydrog ?    ? DA C   2084 O2    ? ? ? 1_555 DA G   2660 N2 ? ? 0 C   2084 0 G   2660 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2054 hydrog ?    ? DA A   2085 N1    ? ? ? 1_555 DA U   2659 N3 ? ? 0 A   2085 0 U   2659 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2055 hydrog ?    ? DA A   2085 N6    ? ? ? 1_555 DA U   2659 O4 ? ? 0 A   2085 0 U   2659 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2056 hydrog ?    ? DA C   2086 N3    ? ? ? 1_555 DA G   2658 N1 ? ? 0 C   2086 0 G   2658 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2057 hydrog ?    ? DA C   2086 N4    ? ? ? 1_555 DA G   2658 O6 ? ? 0 C   2086 0 G   2658 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2058 hydrog ?    ? DA C   2086 O2    ? ? ? 1_555 DA G   2658 N2 ? ? 0 C   2086 0 G   2658 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2059 hydrog ?    ? DA C   2087 N3    ? ? ? 1_555 DA G   2657 N1 ? ? 0 C   2087 0 G   2657 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2060 hydrog ?    ? DA C   2087 N4    ? ? ? 1_555 DA G   2657 O6 ? ? 0 C   2087 0 G   2657 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2061 hydrog ?    ? DA C   2087 O2    ? ? ? 1_555 DA G   2657 N2 ? ? 0 C   2087 0 G   2657 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2062 hydrog ?    ? DA C   2088 N3    ? ? ? 1_555 DA G   2656 N1 ? ? 0 C   2088 0 G   2656 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2063 hydrog ?    ? DA C   2088 N4    ? ? ? 1_555 DA G   2656 O6 ? ? 0 C   2088 0 G   2656 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2064 hydrog ?    ? DA C   2088 O2    ? ? ? 1_555 DA G   2656 N2 ? ? 0 C   2088 0 G   2656 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2065 hydrog ?    ? DA C   2088 O2    ? ? ? 1_555 DA A   2840 N6 ? ? 0 C   2088 0 A   2840 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2066 hydrog ?    ? DA A   2089 N1    ? ? ? 1_555 DA U   2655 N3 ? ? 0 A   2089 0 U   2655 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2067 hydrog ?    ? DA A   2089 N6    ? ? ? 1_555 DA U   2655 O4 ? ? 0 A   2089 0 U   2655 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2068 hydrog ?    ? DA G   2090 N1    ? ? ? 1_555 DA C   2654 N3 ? ? 0 G   2090 0 C   2654 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2069 hydrog ?    ? DA G   2090 N2    ? ? ? 1_555 DA C   2654 O2 ? ? 0 G   2090 0 C   2654 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2070 hydrog ?    ? DA G   2090 O6    ? ? ? 1_555 DA C   2654 N4 ? ? 0 G   2090 0 C   2654 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2071 hydrog ?    ? DA G   2091 N1    ? ? ? 1_555 DA A   2653 N1 ? ? 0 G   2091 0 A   2653 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2072 hydrog ?    ? DA G   2091 O6    ? ? ? 1_555 DA A   2653 N6 ? ? 0 G   2091 0 A   2653 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2073 hydrog ?    ? DA G   2091 N2    ? ? ? 1_555 DA C   2654 O2 ? ? 0 G   2091 0 C   2654 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2074 hydrog ?    ? DA G   2092 N2    ? ? ? 1_555 DA G   2093 O6 ? ? 0 G   2092 0 G   2093 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog2075 hydrog ?    ? DA G   2092 N2    ? ? ? 1_555 DA U   2652 O4 ? ? 0 G   2092 0 U   2652 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2076 hydrog ?    ? DA G   2093 N1    ? ? ? 1_555 DA U   2652 O2 ? ? 0 G   2093 0 U   2652 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2077 hydrog ?    ? DA G   2093 O6    ? ? ? 1_555 DA U   2652 N3 ? ? 0 G   2093 0 U   2652 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2078 hydrog ?    ? DA G   2094 N1    ? ? ? 1_555 DA C   2651 N3 ? ? 0 G   2094 0 C   2651 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2079 hydrog ?    ? DA G   2094 N2    ? ? ? 1_555 DA C   2651 O2 ? ? 0 G   2094 0 C   2651 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2080 hydrog ?    ? DA G   2094 O6    ? ? ? 1_555 DA C   2651 N4 ? ? 0 G   2094 0 C   2651 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2081 hydrog ?    ? DA A   2095 N6    ? ? ? 1_555 DA A   2612 N1 ? ? 0 A   2095 0 A   2612 1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog2082 hydrog ?    ? DA A   2095 N7    ? ? ? 1_555 DA A   2612 N6 ? ? 0 A   2095 0 A   2612 1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog2083 hydrog ?    ? DA A   2095 N1    ? ? ? 1_555 DA U   2650 N3 ? ? 0 A   2095 0 U   2650 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2084 hydrog ?    ? DA A   2095 N6    ? ? ? 1_555 DA U   2650 O4 ? ? 0 A   2095 0 U   2650 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2085 hydrog ?    ? DA G   2097 N1    ? ? ? 1_555 DA C   2647 N3 ? ? 0 G   2097 0 C   2647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2086 hydrog ?    ? DA G   2097 N2    ? ? ? 1_555 DA C   2647 O2 ? ? 0 G   2097 0 C   2647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2087 hydrog ?    ? DA G   2097 O6    ? ? ? 1_555 DA C   2647 N4 ? ? 0 G   2097 0 C   2647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2088 hydrog ?    ? DA C   2098 N3    ? ? ? 1_555 DA G   2646 N1 ? ? 0 C   2098 0 G   2646 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2089 hydrog ?    ? DA C   2098 N4    ? ? ? 1_555 DA G   2646 O6 ? ? 0 C   2098 0 G   2646 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2090 hydrog ?    ? DA C   2098 O2    ? ? ? 1_555 DA G   2646 N2 ? ? 0 C   2098 0 G   2646 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2091 hydrog ?    ? DA G   2102 N1    ? ? ? 1_555 DA A   2486 N1 ? ? 0 G   2102 0 A   2486 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2092 hydrog ?    ? DA G   2102 O6    ? ? ? 1_555 DA A   2486 N6 ? ? 0 G   2102 0 A   2486 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2093 hydrog ?    ? DA C   2104 N3    ? ? ? 1_555 DA A   2485 N6 ? ? 0 C   2104 0 A   2485 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2094 hydrog ?    ? DA C   2104 N4    ? ? ? 1_555 DA C   2536 O2 ? ? 0 C   2104 0 C   2536 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2095 hydrog ?    ? DA C   2105 N3    ? ? ? 1_555 DA G   2481 N1 ? ? 0 C   2105 0 G   2481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2096 hydrog ?    ? DA C   2105 N4    ? ? ? 1_555 DA G   2481 O6 ? ? 0 C   2105 0 G   2481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2097 hydrog ?    ? DA C   2105 O2    ? ? ? 1_555 DA G   2481 N2 ? ? 0 C   2105 0 G   2481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2098 hydrog ?    ? DA C   2106 N3    ? ? ? 1_555 DA G   2480 N1 ? ? 0 C   2106 0 G   2480 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2099 hydrog ?    ? DA C   2106 N4    ? ? ? 1_555 DA G   2480 O6 ? ? 0 C   2106 0 G   2480 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2100 hydrog ?    ? DA C   2106 O2    ? ? ? 1_555 DA G   2480 N2 ? ? 0 C   2106 0 G   2480 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2101 hydrog ?    ? DA U   2107 N3    ? ? ? 1_555 DA A   2479 N1 ? ? 0 U   2107 0 A   2479 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2102 hydrog ?    ? DA U   2107 O4    ? ? ? 1_555 DA A   2479 N6 ? ? 0 U   2107 0 A   2479 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2103 hydrog ?    ? DA A   2108 N1    ? ? ? 1_555 DA U   2478 N3 ? ? 0 A   2108 0 U   2478 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2104 hydrog ?    ? DA A   2108 N6    ? ? ? 1_555 DA U   2478 O4 ? ? 0 A   2108 0 U   2478 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2105 hydrog ?    ? DA U   2109 N3    ? ? ? 1_555 DA A   2467 N1 ? ? 0 U   2109 0 A   2467 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2106 hydrog ?    ? DA U   2109 O2    ? ? ? 1_555 DA A   2467 N6 ? ? 0 U   2109 0 A   2467 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2107 hydrog ?    ? DA G   2110 N1    ? ? ? 1_555 DA C   2477 N3 ? ? 0 G   2110 0 C   2477 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2108 hydrog ?    ? DA G   2110 N2    ? ? ? 1_555 DA C   2477 O2 ? ? 0 G   2110 0 C   2477 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2109 hydrog ?    ? DA G   2110 O6    ? ? ? 1_555 DA C   2477 N4 ? ? 0 G   2110 0 C   2477 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2110 hydrog ?    ? DA G   2111 N1    ? ? ? 1_555 DA C   2476 N3 ? ? 0 G   2111 0 C   2476 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2111 hydrog ?    ? DA G   2111 N2    ? ? ? 1_555 DA C   2476 O2 ? ? 0 G   2111 0 C   2476 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2112 hydrog ?    ? DA G   2111 O6    ? ? ? 1_555 DA C   2476 N4 ? ? 0 G   2111 0 C   2476 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2113 hydrog ?    ? DA A   2112 N1    ? ? ? 1_555 DA U   2473 N3 ? ? 0 A   2112 0 U   2473 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2114 hydrog ?    ? DA A   2112 N6    ? ? ? 1_555 DA U   2473 O4 ? ? 0 A   2112 0 U   2473 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2115 hydrog ?    ? DA G   2113 N1    ? ? ? 1_555 DA C   2472 N3 ? ? 0 G   2113 0 C   2472 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2116 hydrog ?    ? DA G   2113 N2    ? ? ? 1_555 DA C   2472 O2 ? ? 0 G   2113 0 C   2472 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2117 hydrog ?    ? DA G   2113 O6    ? ? ? 1_555 DA C   2472 N4 ? ? 0 G   2113 0 C   2472 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2118 hydrog ?    ? DA G   2113 N3    ? ? ? 1_555 DA C   2475 N4 ? ? 0 G   2113 0 C   2475 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2119 hydrog ?    ? DA C   2114 N3    ? ? ? 1_555 DA G   2471 N1 ? ? 0 C   2114 0 G   2471 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2120 hydrog ?    ? DA C   2114 N4    ? ? ? 1_555 DA G   2471 O6 ? ? 0 C   2114 0 G   2471 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2121 hydrog ?    ? DA C   2114 O2    ? ? ? 1_555 DA G   2471 N2 ? ? 0 C   2114 0 G   2471 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2122 hydrog ?    ? DA U   2115 N3    ? ? ? 1_555 DA A   2470 N1 ? ? 0 U   2115 0 A   2470 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2123 hydrog ?    ? DA U   2115 O4    ? ? ? 1_555 DA A   2470 N6 ? ? 0 U   2115 0 A   2470 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2124 hydrog ?    ? DA U   2115 O2    ? ? ? 1_555 DA G   2632 N2 ? ? 0 U   2115 0 G   2632 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2125 hydrog ?    ? DA U   2116 N3    ? ? ? 1_555 DA A   2118 N7 ? ? 0 U   2116 0 A   2118 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2126 hydrog ?    ? DA A   2118 N6    ? ? ? 1_555 DA G   2271 O6 ? ? 0 A   2118 0 G   2271 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2127 hydrog ?    ? DA A   2118 N6    ? ? ? 1_555 DA G   2275 O6 ? ? 0 A   2118 0 G   2275 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2128 hydrog ?    ? DA A   2118 N1    ? ? ? 1_555 DA U   2276 N3 ? ? 0 A   2118 0 U   2276 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2129 hydrog ?    ? DA A   2118 N6    ? ? ? 1_555 DA U   2276 O4 ? ? 0 A   2118 0 U   2276 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2130 hydrog ?    ? DA C   2119 N4    ? ? ? 1_555 DA G   2271 O6 ? ? 0 C   2119 0 G   2271 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2131 hydrog ?    ? DA C   2119 N3    ? ? ? 1_555 DA G   2275 N1 ? ? 0 C   2119 0 G   2275 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2132 hydrog ?    ? DA C   2119 N4    ? ? ? 1_555 DA G   2275 O6 ? ? 0 C   2119 0 G   2275 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2133 hydrog ?    ? DA C   2119 O2    ? ? ? 1_555 DA G   2275 N2 ? ? 0 C   2119 0 G   2275 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2134 hydrog ?    ? DA U   2120 N3    ? ? ? 1_555 DA A   2274 N1 ? ? 0 U   2120 0 A   2274 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2135 hydrog ?    ? DA U   2120 O4    ? ? ? 1_555 DA A   2274 N6 ? ? 0 U   2120 0 A   2274 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2136 hydrog ?    ? DA G   2121 N1    ? ? ? 1_555 DA C   2273 N3 ? ? 0 G   2121 0 C   2273 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2137 hydrog ?    ? DA G   2121 N2    ? ? ? 1_555 DA C   2273 O2 ? ? 0 G   2121 0 C   2273 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2138 hydrog ?    ? DA G   2121 O6    ? ? ? 1_555 DA C   2273 N4 ? ? 0 G   2121 0 C   2273 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2139 hydrog ?    ? DA C   2122 N3    ? ? ? 1_555 DA G   2272 N1 ? ? 0 C   2122 0 G   2272 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2140 hydrog ?    ? DA C   2122 N4    ? ? ? 1_555 DA G   2272 O6 ? ? 0 C   2122 0 G   2272 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2141 hydrog ?    ? DA C   2122 O2    ? ? ? 1_555 DA G   2272 N2 ? ? 0 C   2122 0 G   2272 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2142 hydrog ?    ? DA A   2123 N6    ? ? ? 1_555 DA G   2270 N3 ? ? 0 A   2123 0 G   2270 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2143 hydrog ?    ? DA A   2123 N7    ? ? ? 1_555 DA G   2270 N2 ? ? 0 A   2123 0 G   2270 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2144 hydrog ?    ? DA G   2124 N1    ? ? ? 1_555 DA C   2269 N3 ? ? 0 G   2124 0 C   2269 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2145 hydrog ?    ? DA G   2124 N2    ? ? ? 1_555 DA C   2269 O2 ? ? 0 G   2124 0 C   2269 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2146 hydrog ?    ? DA G   2124 O6    ? ? ? 1_555 DA C   2269 N4 ? ? 0 G   2124 0 C   2269 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2147 hydrog ?    ? DA G   2125 N1    ? ? ? 1_555 DA C   2268 N3 ? ? 0 G   2125 0 C   2268 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2148 hydrog ?    ? DA G   2125 N2    ? ? ? 1_555 DA C   2268 O2 ? ? 0 G   2125 0 C   2268 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2149 hydrog ?    ? DA G   2125 O6    ? ? ? 1_555 DA C   2268 N4 ? ? 0 G   2125 0 C   2268 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2150 hydrog ?    ? DA C   2126 N3    ? ? ? 1_555 DA G   2267 N1 ? ? 0 C   2126 0 G   2267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2151 hydrog ?    ? DA C   2126 N4    ? ? ? 1_555 DA G   2267 O6 ? ? 0 C   2126 0 G   2267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2152 hydrog ?    ? DA C   2126 O2    ? ? ? 1_555 DA G   2267 N2 ? ? 0 C   2126 0 G   2267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2153 hydrog ?    ? DA U   2127 N3    ? ? ? 1_555 DA A   2266 N1 ? ? 0 U   2127 0 A   2266 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2154 hydrog ?    ? DA U   2127 O4    ? ? ? 1_555 DA A   2266 N6 ? ? 0 U   2127 0 A   2266 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2155 hydrog ?    ? DA G   2128 N1    ? ? ? 1_555 DA U   2265 O2 ? ? 0 G   2128 0 U   2265 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2156 hydrog ?    ? DA G   2128 O6    ? ? ? 1_555 DA U   2265 N3 ? ? 0 G   2128 0 U   2265 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2157 hydrog ?    ? DA U   2129 N3    ? ? ? 1_555 DA A   2264 N1 ? ? 0 U   2129 0 A   2264 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2158 hydrog ?    ? DA U   2129 O4    ? ? ? 1_555 DA A   2264 N6 ? ? 0 U   2129 0 A   2264 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2159 hydrog ?    ? DA C   2130 N3    ? ? ? 1_555 DA G   2263 N1 ? ? 0 C   2130 0 G   2263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2160 hydrog ?    ? DA C   2130 N4    ? ? ? 1_555 DA G   2263 O6 ? ? 0 C   2130 0 G   2263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2161 hydrog ?    ? DA C   2130 O2    ? ? ? 1_555 DA G   2263 N2 ? ? 0 C   2130 0 G   2263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2162 hydrog ?    ? DA G   2131 N1    ? ? ? 1_555 DA C   2262 N3 ? ? 0 G   2131 0 C   2262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2163 hydrog ?    ? DA G   2131 N2    ? ? ? 1_555 DA C   2262 O2 ? ? 0 G   2131 0 C   2262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2164 hydrog ?    ? DA G   2131 O6    ? ? ? 1_555 DA C   2262 N4 ? ? 0 G   2131 0 C   2262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2165 hydrog ?    ? DA C   2132 O2    ? ? ? 1_555 DA C   2261 N4 ? ? 0 C   2132 0 C   2261 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2166 hydrog ?    ? DA U   2133 O4    ? ? ? 1_555 DA A   2260 N6 ? ? 0 U   2133 0 A   2260 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2167 hydrog ?    ? DA G   2134 N1    ? ? ? 1_555 DA C   2241 N3 ? ? 0 G   2134 0 C   2241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2168 hydrog ?    ? DA G   2134 N2    ? ? ? 1_555 DA C   2241 O2 ? ? 0 G   2134 0 C   2241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2169 hydrog ?    ? DA G   2134 O6    ? ? ? 1_555 DA C   2241 N4 ? ? 0 G   2134 0 C   2241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2170 hydrog ?    ? DA A   2135 N1    ? ? ? 1_555 DA U   2240 N3 ? ? 0 A   2135 0 U   2240 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog2171 hydrog ?    ? DA G   2136 N1    ? ? ? 1_555 DA C   2239 O2 ? ? 0 G   2136 0 C   2239 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2172 hydrog ?    ? DA U   2242 N3    ? ? ? 1_555 DA A   2258 N7 ? ? 0 U   2242 0 A   2258 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2173 hydrog ?    ? DA U   2242 O2    ? ? ? 1_555 DA A   2258 N6 ? ? 0 U   2242 0 A   2258 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2174 hydrog ?    ? DA A   2244 N7    ? ? ? 1_555 DA G   2257 N2 ? ? 0 A   2244 0 G   2257 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2175 hydrog ?    ? DA C   2245 N3    ? ? ? 1_555 DA G   2256 N1 ? ? 0 C   2245 0 G   2256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2176 hydrog ?    ? DA C   2245 N4    ? ? ? 1_555 DA G   2256 O6 ? ? 0 C   2245 0 G   2256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2177 hydrog ?    ? DA C   2245 O2    ? ? ? 1_555 DA G   2256 N2 ? ? 0 C   2245 0 G   2256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2178 hydrog ?    ? DA U   2246 N3    ? ? ? 1_555 DA A   2255 N1 ? ? 0 U   2246 0 A   2255 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2179 hydrog ?    ? DA U   2246 O4    ? ? ? 1_555 DA A   2255 N6 ? ? 0 U   2246 0 A   2255 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2180 hydrog ?    ? DA C   2247 N3    ? ? ? 1_555 DA G   2254 N1 ? ? 0 C   2247 0 G   2254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2181 hydrog ?    ? DA C   2247 N4    ? ? ? 1_555 DA G   2254 O6 ? ? 0 C   2247 0 G   2254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2182 hydrog ?    ? DA C   2247 O2    ? ? ? 1_555 DA G   2254 N2 ? ? 0 C   2247 0 G   2254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2183 hydrog ?    ? DA C   2248 N3    ? ? ? 1_555 DA G   2253 N1 ? ? 0 C   2248 0 G   2253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2184 hydrog ?    ? DA C   2248 N4    ? ? ? 1_555 DA G   2253 O6 ? ? 0 C   2248 0 G   2253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2185 hydrog ?    ? DA C   2248 O2    ? ? ? 1_555 DA G   2253 N2 ? ? 0 C   2248 0 G   2253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2186 hydrog ?    ? DA U   2276 O4    ? ? ? 1_555 DA A   2470 N6 ? ? 0 U   2276 0 A   2470 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2187 hydrog ?    ? DA U   2277 N3    ? ? ? 1_555 DA A   2470 N7 ? ? 0 U   2277 0 A   2470 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog2188 hydrog ?    ? DA U   2277 O4    ? ? ? 1_555 DA A   2470 N6 ? ? 0 U   2277 0 A   2470 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog2189 hydrog ?    ? DA U   2278 N3    ? ? ? 1_555 DA G   2471 N7 ? ? 0 U   2278 0 G   2471 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2190 hydrog ?    ? DA G   2279 N1    ? ? ? 1_555 DA C   2292 N3 ? ? 0 G   2279 0 C   2292 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2191 hydrog ?    ? DA G   2279 N2    ? ? ? 1_555 DA C   2292 O2 ? ? 0 G   2279 0 C   2292 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2192 hydrog ?    ? DA G   2279 O6    ? ? ? 1_555 DA C   2292 N4 ? ? 0 G   2279 0 C   2292 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2193 hydrog ?    ? DA A   2280 N1    ? ? ? 1_555 DA U   2290 N3 ? ? 0 A   2280 0 U   2290 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2194 hydrog ?    ? DA A   2280 N6    ? ? ? 1_555 DA U   2290 O4 ? ? 0 A   2280 0 U   2290 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2195 hydrog ?    ? DA C   2281 N3    ? ? ? 1_555 DA G   2289 N1 ? ? 0 C   2281 0 G   2289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2196 hydrog ?    ? DA C   2281 N4    ? ? ? 1_555 DA G   2289 O6 ? ? 0 C   2281 0 G   2289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2197 hydrog ?    ? DA C   2281 O2    ? ? ? 1_555 DA G   2289 N2 ? ? 0 C   2281 0 G   2289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2198 hydrog ?    ? DA G   2284 O6    ? ? ? 1_555 GA C   2    N4 ? ? 0 G   2284 6 C   75   1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2199 hydrog ?    ? DA G   2285 N1    ? ? ? 1_555 GA C   1    N3 ? ? 0 G   2285 6 C   74   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2200 hydrog ?    ? DA G   2285 N2    ? ? ? 1_555 GA C   1    O2 ? ? 0 G   2285 6 C   74   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2201 hydrog ?    ? DA G   2285 O6    ? ? ? 1_555 GA C   1    N4 ? ? 0 G   2285 6 C   74   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2202 hydrog ?    ? DA G   2288 N1    ? ? ? 1_555 DA C   2309 N3 ? ? 0 G   2288 0 C   2309 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2203 hydrog ?    ? DA G   2288 N2    ? ? ? 1_555 DA C   2309 O2 ? ? 0 G   2288 0 C   2309 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2204 hydrog ?    ? DA G   2288 O6    ? ? ? 1_555 DA C   2309 N4 ? ? 0 G   2288 0 C   2309 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2205 hydrog ?    ? DA G   2289 N2    ? ? ? 1_555 DA A   2291 N1 ? ? 0 G   2289 0 A   2291 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2206 hydrog ?    ? DA G   2293 N1    ? ? ? 1_555 DA C   2315 N3 ? ? 0 G   2293 0 C   2315 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2207 hydrog ?    ? DA G   2293 N2    ? ? ? 1_555 DA C   2315 O2 ? ? 0 G   2293 0 C   2315 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2208 hydrog ?    ? DA G   2293 O6    ? ? ? 1_555 DA C   2315 N4 ? ? 0 G   2293 0 C   2315 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2209 hydrog ?    ? DA C   2294 N3    ? ? ? 1_555 DA G   2314 N1 ? ? 0 C   2294 0 G   2314 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2210 hydrog ?    ? DA C   2294 N4    ? ? ? 1_555 DA G   2314 O6 ? ? 0 C   2294 0 G   2314 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2211 hydrog ?    ? DA C   2294 O2    ? ? ? 1_555 DA G   2314 N2 ? ? 0 C   2294 0 G   2314 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2212 hydrog ?    ? DA G   2295 N1    ? ? ? 1_555 DA C   2313 N3 ? ? 0 G   2295 0 C   2313 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2213 hydrog ?    ? DA G   2295 N2    ? ? ? 1_555 DA C   2313 O2 ? ? 0 G   2295 0 C   2313 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2214 hydrog ?    ? DA G   2295 O6    ? ? ? 1_555 DA C   2313 N4 ? ? 0 G   2295 0 C   2313 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2215 hydrog ?    ? DA G   2295 N2    ? ? ? 1_555 DA A   2361 N3 ? ? 0 G   2295 0 A   2361 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2216 hydrog ?    ? DA C   2296 N3    ? ? ? 1_555 DA G   2312 N1 ? ? 0 C   2296 0 G   2312 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2217 hydrog ?    ? DA C   2296 N4    ? ? ? 1_555 DA G   2312 O6 ? ? 0 C   2296 0 G   2312 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2218 hydrog ?    ? DA C   2296 O2    ? ? ? 1_555 DA G   2312 N2 ? ? 0 C   2296 0 G   2312 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2219 hydrog ?    ? DA U   2297 N3    ? ? ? 1_555 DA A   2311 N1 ? ? 0 U   2297 0 A   2311 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2220 hydrog ?    ? DA U   2297 O4    ? ? ? 1_555 DA A   2311 N6 ? ? 0 U   2297 0 A   2311 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2221 hydrog ?    ? DA C   2298 N3    ? ? ? 1_555 DA G   2310 N1 ? ? 0 C   2298 0 G   2310 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2222 hydrog ?    ? DA C   2298 N4    ? ? ? 1_555 DA G   2310 O6 ? ? 0 C   2298 0 G   2310 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2223 hydrog ?    ? DA C   2298 O2    ? ? ? 1_555 DA G   2310 N2 ? ? 0 C   2298 0 G   2310 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2224 hydrog ?    ? DA G   2299 N2    ? ? ? 1_555 DA U   2308 O4 ? ? 0 G   2299 0 U   2308 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2225 hydrog ?    ? DA A   2300 N6    ? ? ? 1_555 DA A   2307 N7 ? ? 0 A   2300 0 A   2307 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2226 hydrog ?    ? DA A   2300 N7    ? ? ? 1_555 DA A   2307 N6 ? ? 0 A   2300 0 A   2307 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2227 hydrog ?    ? DA A   2301 N1    ? ? ? 1_555 DA U   2306 N3 ? ? 0 A   2301 0 U   2306 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2228 hydrog ?    ? DA A   2301 N6    ? ? ? 1_555 DA U   2306 O2 ? ? 0 A   2301 0 U   2306 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2229 hydrog ?    ? DA G   2314 N2    ? ? ? 1_555 DA A   2425 N3 ? ? 0 G   2314 0 A   2425 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2230 hydrog ?    ? DA G   2316 N1    ? ? ? 1_555 DA C   2464 N3 ? ? 0 G   2316 0 C   2464 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2231 hydrog ?    ? DA G   2316 N2    ? ? ? 1_555 DA C   2464 O2 ? ? 0 G   2316 0 C   2464 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2232 hydrog ?    ? DA G   2316 O6    ? ? ? 1_555 DA C   2464 N4 ? ? 0 G   2316 0 C   2464 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2233 hydrog ?    ? DA C   2317 N3    ? ? ? 1_555 DA G   2359 N1 ? ? 0 C   2317 0 G   2359 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2234 hydrog ?    ? DA C   2317 N4    ? ? ? 1_555 DA G   2359 O6 ? ? 0 C   2317 0 G   2359 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2235 hydrog ?    ? DA C   2317 O2    ? ? ? 1_555 DA G   2359 N2 ? ? 0 C   2317 0 G   2359 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2236 hydrog ?    ? DA C   2318 N3    ? ? ? 1_555 DA G   2421 N1 ? ? 0 C   2318 0 G   2421 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2237 hydrog ?    ? DA C   2318 N4    ? ? ? 1_555 DA G   2421 O6 ? ? 0 C   2318 0 G   2421 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2238 hydrog ?    ? DA C   2318 O2    ? ? ? 1_555 DA G   2421 N2 ? ? 0 C   2318 0 G   2421 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2239 hydrog ?    ? DA C   2319 N3    ? ? ? 1_555 DA G   2420 N1 ? ? 0 C   2319 0 G   2420 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2240 hydrog ?    ? DA C   2319 N4    ? ? ? 1_555 DA G   2420 O6 ? ? 0 C   2319 0 G   2420 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2241 hydrog ?    ? DA C   2319 O2    ? ? ? 1_555 DA G   2420 N2 ? ? 0 C   2319 0 G   2420 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2242 hydrog ?    ? DA A   2321 N1    ? ? ? 1_555 DA U   2378 N3 ? ? 0 A   2321 0 U   2378 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2243 hydrog ?    ? DA A   2321 N6    ? ? ? 1_555 DA U   2378 O2 ? ? 0 A   2321 0 U   2378 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2244 hydrog ?    ? DA A   2321 N6    ? ? ? 1_555 DA A   2380 N7 ? ? 0 A   2321 0 A   2380 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2245 hydrog ?    ? DA G   2323 N1    ? ? ? 1_555 DA U   2377 O2 ? ? 0 G   2323 0 U   2377 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2246 hydrog ?    ? DA G   2323 O6    ? ? ? 1_555 DA U   2377 N3 ? ? 0 G   2323 0 U   2377 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2247 hydrog ?    ? DA G   2324 N1    ? ? ? 1_555 DA C   2376 N3 ? ? 0 G   2324 0 C   2376 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2248 hydrog ?    ? DA G   2324 N2    ? ? ? 1_555 DA C   2376 O2 ? ? 0 G   2324 0 C   2376 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2249 hydrog ?    ? DA G   2324 O6    ? ? ? 1_555 DA C   2376 N4 ? ? 0 G   2324 0 C   2376 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2250 hydrog ?    ? DA U   2325 N3    ? ? ? 1_555 DA A   2375 N1 ? ? 0 U   2325 0 A   2375 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2251 hydrog ?    ? DA U   2325 O4    ? ? ? 1_555 DA A   2375 N6 ? ? 0 U   2325 0 A   2375 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2252 hydrog ?    ? DA C   2326 N3    ? ? ? 1_555 DA G   2374 N1 ? ? 0 C   2326 0 G   2374 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2253 hydrog ?    ? DA C   2326 N4    ? ? ? 1_555 DA G   2374 O6 ? ? 0 C   2326 0 G   2374 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2254 hydrog ?    ? DA C   2326 O2    ? ? ? 1_555 DA G   2374 N2 ? ? 0 C   2326 0 G   2374 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2255 hydrog ?    ? DA A   2327 N1    ? ? ? 1_555 DA U   2373 N3 ? ? 0 A   2327 0 U   2373 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2256 hydrog ?    ? DA A   2327 N6    ? ? ? 1_555 DA U   2373 O4 ? ? 0 A   2327 0 U   2373 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2257 hydrog ?    ? DA U   2328 N3    ? ? ? 1_555 DA A   2372 N1 ? ? 0 U   2328 0 A   2372 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2258 hydrog ?    ? DA U   2328 O4    ? ? ? 1_555 DA A   2372 N6 ? ? 0 U   2328 0 A   2372 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2259 hydrog ?    ? DA C   2329 N3    ? ? ? 1_555 DA G   2371 N1 ? ? 0 C   2329 0 G   2371 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2260 hydrog ?    ? DA C   2329 N4    ? ? ? 1_555 DA G   2371 O6 ? ? 0 C   2329 0 G   2371 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2261 hydrog ?    ? DA C   2329 O2    ? ? ? 1_555 DA G   2371 N2 ? ? 0 C   2329 0 G   2371 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2262 hydrog ?    ? DA U   2330 N3    ? ? ? 1_555 DA A   2369 N7 ? ? 0 U   2330 0 A   2369 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2263 hydrog ?    ? DA U   2330 O2    ? ? ? 1_555 DA A   2369 N6 ? ? 0 U   2330 0 A   2369 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2264 hydrog ?    ? DA C   2331 N3    ? ? ? 1_555 DA G   2355 N1 ? ? 0 C   2331 0 G   2355 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2265 hydrog ?    ? DA C   2331 N4    ? ? ? 1_555 DA G   2355 O6 ? ? 0 C   2331 0 G   2355 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2266 hydrog ?    ? DA C   2331 O2    ? ? ? 1_555 DA G   2355 N2 ? ? 0 C   2331 0 G   2355 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2267 hydrog ?    ? DA A   2332 N7    ? ? ? 1_555 DA G   2352 N2 ? ? 0 A   2332 0 G   2352 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2268 hydrog ?    ? DA G   2333 N1    ? ? ? 1_555 DA C   2351 N3 ? ? 0 G   2333 0 C   2351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2269 hydrog ?    ? DA G   2333 N2    ? ? ? 1_555 DA C   2351 O2 ? ? 0 G   2333 0 C   2351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2270 hydrog ?    ? DA G   2333 O6    ? ? ? 1_555 DA C   2351 N4 ? ? 0 G   2333 0 C   2351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2271 hydrog ?    ? DA C   2334 N3    ? ? ? 1_555 DA G   2350 N1 ? ? 0 C   2334 0 G   2350 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2272 hydrog ?    ? DA C   2334 N4    ? ? ? 1_555 DA G   2350 O6 ? ? 0 C   2334 0 G   2350 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2273 hydrog ?    ? DA C   2334 O2    ? ? ? 1_555 DA G   2350 N2 ? ? 0 C   2334 0 G   2350 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2274 hydrog ?    ? DA C   2335 N3    ? ? ? 1_555 DA G   2349 N1 ? ? 0 C   2335 0 G   2349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2275 hydrog ?    ? DA C   2335 N4    ? ? ? 1_555 DA G   2349 O6 ? ? 0 C   2335 0 G   2349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2276 hydrog ?    ? DA C   2335 O2    ? ? ? 1_555 DA G   2349 N2 ? ? 0 C   2335 0 G   2349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2277 hydrog ?    ? DA G   2336 N1    ? ? ? 1_555 DA C   2348 N3 ? ? 0 G   2336 0 C   2348 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2278 hydrog ?    ? DA G   2336 N2    ? ? ? 1_555 DA C   2348 O2 ? ? 0 G   2336 0 C   2348 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2279 hydrog ?    ? DA G   2336 O6    ? ? ? 1_555 DA C   2348 N4 ? ? 0 G   2336 0 C   2348 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2280 hydrog ?    ? DA G   2337 N1    ? ? ? 1_555 DA C   2347 N3 ? ? 0 G   2337 0 C   2347 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2281 hydrog ?    ? DA G   2337 N2    ? ? ? 1_555 DA C   2347 O2 ? ? 0 G   2337 0 C   2347 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2282 hydrog ?    ? DA G   2337 O6    ? ? ? 1_555 DA C   2347 N4 ? ? 0 G   2337 0 C   2347 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2283 hydrog ?    ? DA G   2338 N1    ? ? ? 1_555 DA C   2346 N3 ? ? 0 G   2338 0 C   2346 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2284 hydrog ?    ? DA G   2338 N2    ? ? ? 1_555 DA C   2346 O2 ? ? 0 G   2338 0 C   2346 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2285 hydrog ?    ? DA G   2338 O6    ? ? ? 1_555 DA C   2346 N4 ? ? 0 G   2338 0 C   2346 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2286 hydrog ?    ? DA A   2356 N1    ? ? ? 1_555 DA A   2369 N6 ? ? 0 A   2356 0 A   2369 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog2287 hydrog ?    ? DA A   2356 N6    ? ? ? 1_555 DA A   2369 N1 ? ? 0 A   2356 0 A   2369 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog2288 hydrog ?    ? DA G   2357 N1    ? ? ? 1_555 DA C   2366 N3 ? ? 0 G   2357 0 C   2366 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2289 hydrog ?    ? DA G   2357 N2    ? ? ? 1_555 DA C   2366 O2 ? ? 0 G   2357 0 C   2366 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2290 hydrog ?    ? DA G   2357 O6    ? ? ? 1_555 DA C   2366 N4 ? ? 0 G   2357 0 C   2366 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2291 hydrog ?    ? DA U   2358 N3    ? ? ? 1_555 DA G   2365 O6 ? ? 0 U   2358 0 G   2365 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2292 hydrog ?    ? DA U   2358 O2    ? ? ? 1_555 DA G   2365 N1 ? ? 0 U   2358 0 G   2365 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2293 hydrog ?    ? DA C   2360 N3    ? ? ? 1_555 DA G   2426 N1 ? ? 0 C   2360 0 G   2426 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2294 hydrog ?    ? DA C   2360 N4    ? ? ? 1_555 DA G   2426 O6 ? ? 0 C   2360 0 G   2426 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2295 hydrog ?    ? DA C   2360 O2    ? ? ? 1_555 DA G   2426 N2 ? ? 0 C   2360 0 G   2426 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2296 hydrog ?    ? DA A   2362 N1    ? ? ? 1_555 DA U   2424 N3 ? ? 0 A   2362 0 U   2424 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2297 hydrog ?    ? DA A   2362 N6    ? ? ? 1_555 DA U   2424 O4 ? ? 0 A   2362 0 U   2424 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2298 hydrog ?    ? DA G   2363 N1    ? ? ? 1_555 DA C   2423 N3 ? ? 0 G   2363 0 C   2423 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2299 hydrog ?    ? DA G   2363 N2    ? ? ? 1_555 DA C   2423 O2 ? ? 0 G   2363 0 C   2423 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2300 hydrog ?    ? DA G   2363 O6    ? ? ? 1_555 DA C   2423 N4 ? ? 0 G   2363 0 C   2423 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2301 hydrog ?    ? DA A   2364 N1    ? ? ? 1_555 DA U   2422 N3 ? ? 0 A   2364 0 U   2422 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2302 hydrog ?    ? DA A   2364 N6    ? ? ? 1_555 DA U   2422 O4 ? ? 0 A   2364 0 U   2422 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2303 hydrog ?    ? DA G   2365 N2    ? ? ? 1_555 DA A   2370 N3 ? ? 0 G   2365 0 A   2370 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2304 hydrog ?    ? DA G   2379 O6    ? ? ? 1_555 DA A   2408 N6 ? ? 0 G   2379 0 A   2408 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2305 hydrog ?    ? DA C   2381 N3    ? ? ? 1_555 DA G   2407 N1 ? ? 0 C   2381 0 G   2407 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2306 hydrog ?    ? DA C   2381 N4    ? ? ? 1_555 DA G   2407 O6 ? ? 0 C   2381 0 G   2407 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2307 hydrog ?    ? DA C   2381 O2    ? ? ? 1_555 DA G   2407 N2 ? ? 0 C   2381 0 G   2407 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2308 hydrog ?    ? DA A   2382 N1    ? ? ? 1_555 DA U   2406 N3 ? ? 0 A   2382 0 U   2406 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2309 hydrog ?    ? DA A   2382 N6    ? ? ? 1_555 DA U   2406 O4 ? ? 0 A   2382 0 U   2406 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2310 hydrog ?    ? DA G   2383 N1    ? ? ? 1_555 DA C   2405 N3 ? ? 0 G   2383 0 C   2405 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2311 hydrog ?    ? DA G   2383 N2    ? ? ? 1_555 DA C   2405 O2 ? ? 0 G   2383 0 C   2405 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2312 hydrog ?    ? DA G   2383 O6    ? ? ? 1_555 DA C   2405 N4 ? ? 0 G   2383 0 C   2405 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2313 hydrog ?    ? DA U   2384 N3    ? ? ? 1_555 DA G   2404 O6 ? ? 0 U   2384 0 G   2404 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2314 hydrog ?    ? DA U   2384 O2    ? ? ? 1_555 DA G   2404 N1 ? ? 0 U   2384 0 G   2404 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2315 hydrog ?    ? DA G   2385 N1    ? ? ? 1_555 DA C   2403 N3 ? ? 0 G   2385 0 C   2403 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2316 hydrog ?    ? DA G   2385 N2    ? ? ? 1_555 DA C   2403 O2 ? ? 0 G   2385 0 C   2403 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2317 hydrog ?    ? DA G   2385 O6    ? ? ? 1_555 DA C   2403 N4 ? ? 0 G   2385 0 C   2403 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2318 hydrog ?    ? DA U   2386 N3    ? ? ? 1_555 DA A   2402 N1 ? ? 0 U   2386 0 A   2402 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2319 hydrog ?    ? DA U   2386 O4    ? ? ? 1_555 DA A   2402 N6 ? ? 0 U   2386 0 A   2402 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2320 hydrog ?    ? DA U   2387 N3    ? ? ? 1_555 DA A   2401 N1 ? ? 0 U   2387 0 A   2401 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2321 hydrog ?    ? DA U   2387 O4    ? ? ? 1_555 DA A   2401 N6 ? ? 0 U   2387 0 A   2401 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2322 hydrog ?    ? DA C   2388 N3    ? ? ? 1_555 DA G   2400 N1 ? ? 0 C   2388 0 G   2400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2323 hydrog ?    ? DA C   2388 N4    ? ? ? 1_555 DA G   2400 O6 ? ? 0 C   2388 0 G   2400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2324 hydrog ?    ? DA C   2388 O2    ? ? ? 1_555 DA G   2400 N2 ? ? 0 C   2388 0 G   2400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2325 hydrog ?    ? DA U   2389 N3    ? ? ? 1_555 DA G   2399 O6 ? ? 0 U   2389 0 G   2399 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2326 hydrog ?    ? DA U   2389 O2    ? ? ? 1_555 DA G   2399 N1 ? ? 0 U   2389 0 G   2399 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2327 hydrog ?    ? DA U   2390 O2    ? ? ? 1_555 DA A   2398 N6 ? ? 0 U   2390 0 A   2398 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2328 hydrog ?    ? DA C   2391 N4    ? ? ? 1_555 DA G   2397 N7 ? ? 0 C   2391 0 G   2397 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2329 hydrog ?    ? DA C   2409 N3    ? ? ? 1_555 DA G   2418 N1 ? ? 0 C   2409 0 G   2418 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2330 hydrog ?    ? DA C   2409 N4    ? ? ? 1_555 DA G   2418 O6 ? ? 0 C   2409 0 G   2418 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2331 hydrog ?    ? DA C   2409 O2    ? ? ? 1_555 DA G   2418 N2 ? ? 0 C   2409 0 G   2418 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2332 hydrog ?    ? DA G   2410 N1    ? ? ? 1_555 DA C   2417 N3 ? ? 0 G   2410 0 C   2417 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2333 hydrog ?    ? DA G   2410 N2    ? ? ? 1_555 DA C   2417 O2 ? ? 0 G   2410 0 C   2417 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2334 hydrog ?    ? DA G   2410 O6    ? ? ? 1_555 DA C   2417 N4 ? ? 0 G   2410 0 C   2417 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2335 hydrog ?    ? DA C   2411 N3    ? ? ? 1_555 DA G   2416 N1 ? ? 0 C   2411 0 G   2416 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2336 hydrog ?    ? DA C   2411 N4    ? ? ? 1_555 DA G   2416 O6 ? ? 0 C   2411 0 G   2416 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2337 hydrog ?    ? DA C   2411 O2    ? ? ? 1_555 DA G   2416 N2 ? ? 0 C   2411 0 G   2416 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2338 hydrog ?    ? DA G   2412 N2    ? ? ? 1_555 DA A   2415 N7 ? ? 0 G   2412 0 A   2415 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2339 hydrog ?    ? DA C   2427 N4    ? ? ? 1_555 DA G   2462 O6 ? ? 0 C   2427 0 G   2462 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2340 hydrog ?    ? DA G   2428 N2    ? ? ? 1_555 DA G   2466 N3 ? ? 0 G   2428 0 G   2466 1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog2341 hydrog ?    ? DA G   2428 N3    ? ? ? 1_555 DA G   2466 N2 ? ? 0 G   2428 0 G   2466 1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog2342 hydrog ?    ? DA A   2429 N6    ? ? ? 1_555 DA U   2461 O2 ? ? 0 A   2429 0 U   2461 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2343 hydrog ?    ? DA A   2429 N7    ? ? ? 1_555 DA U   2461 N3 ? ? 0 A   2429 0 U   2461 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2344 hydrog ?    ? DA A   2430 N6    ? ? ? 1_555 DA A   2460 N1 ? ? 0 A   2430 0 A   2460 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2345 hydrog ?    ? DA C   2432 N3    ? ? ? 1_555 DA G   2459 N1 ? ? 0 C   2432 0 G   2459 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2346 hydrog ?    ? DA C   2432 N4    ? ? ? 1_555 DA G   2459 O6 ? ? 0 C   2432 0 G   2459 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2347 hydrog ?    ? DA C   2432 O2    ? ? ? 1_555 DA G   2459 N2 ? ? 0 C   2432 0 G   2459 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2348 hydrog ?    ? DA A   2433 N1    ? ? ? 1_555 DA U   2458 N3 ? ? 0 A   2433 0 U   2458 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2349 hydrog ?    ? DA A   2433 N6    ? ? ? 1_555 DA U   2458 O4 ? ? 0 A   2433 0 U   2458 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2350 hydrog ?    ? DA A   2434 N1    ? ? ? 1_555 DA U   2457 N3 ? ? 0 A   2434 0 U   2457 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2351 hydrog ?    ? DA A   2434 N6    ? ? ? 1_555 DA U   2457 O4 ? ? 0 A   2434 0 U   2457 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2352 hydrog ?    ? DA U   2435 N3    ? ? ? 1_555 DA A   2456 N1 ? ? 0 U   2435 0 A   2456 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2353 hydrog ?    ? DA U   2435 O4    ? ? ? 1_555 DA A   2456 N6 ? ? 0 U   2435 0 A   2456 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2354 hydrog ?    ? DA U   2436 N3    ? ? ? 1_555 DA A   2455 N1 ? ? 0 U   2436 0 A   2455 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2355 hydrog ?    ? DA U   2436 O4    ? ? ? 1_555 DA A   2455 N6 ? ? 0 U   2436 0 A   2455 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2356 hydrog ?    ? DA G   2438 N1    ? ? ? 1_555 DA C   2454 N3 ? ? 0 G   2438 0 C   2454 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2357 hydrog ?    ? DA G   2438 N2    ? ? ? 1_555 DA C   2454 O2 ? ? 0 G   2438 0 C   2454 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2358 hydrog ?    ? DA G   2438 O6    ? ? ? 1_555 DA C   2454 N4 ? ? 0 G   2438 0 C   2454 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2359 hydrog ?    ? DA C   2439 N3    ? ? ? 1_555 DA G   2453 N1 ? ? 0 C   2439 0 G   2453 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2360 hydrog ?    ? DA C   2439 N4    ? ? ? 1_555 DA G   2453 O6 ? ? 0 C   2439 0 G   2453 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2361 hydrog ?    ? DA C   2439 O2    ? ? ? 1_555 DA G   2453 N2 ? ? 0 C   2439 0 G   2453 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2362 hydrog ?    ? DA C   2440 N3    ? ? ? 1_555 DA G   2452 N1 ? ? 0 C   2440 0 G   2452 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2363 hydrog ?    ? DA C   2440 N4    ? ? ? 1_555 DA G   2452 O6 ? ? 0 C   2440 0 G   2452 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2364 hydrog ?    ? DA C   2440 O2    ? ? ? 1_555 DA G   2452 N2 ? ? 0 C   2440 0 G   2452 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2365 hydrog ?    ? DA U   2441 N3    ? ? ? 1_555 DA G   2451 O6 ? ? 0 U   2441 0 G   2451 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2366 hydrog ?    ? DA U   2441 O2    ? ? ? 1_555 DA G   2451 N1 ? ? 0 U   2441 0 G   2451 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2367 hydrog ?    ? DA G   2442 N1    ? ? ? 1_555 DA C   2450 N3 ? ? 0 G   2442 0 C   2450 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2368 hydrog ?    ? DA G   2442 N2    ? ? ? 1_555 DA C   2450 O2 ? ? 0 G   2442 0 C   2450 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2369 hydrog ?    ? DA G   2442 O6    ? ? ? 1_555 DA C   2450 N4 ? ? 0 G   2442 0 C   2450 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2370 hydrog ?    ? DA G   2471 N2    ? ? ? 1_555 DA A   2633 N3 ? ? 0 G   2471 0 A   2633 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2371 hydrog ?    ? DA U   2473 O2    ? ? ? 1_555 DA C   2475 N4 ? ? 0 U   2473 0 C   2475 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2372 hydrog ?    ? DA G   2480 N2    ? ? ? 1_555 DA U   2484 O4 ? ? 0 G   2480 0 U   2484 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2373 hydrog ?    ? DA G   2482 O6    ? ? ? 1_555 DA A   2486 N6 ? ? 0 G   2482 0 A   2486 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2374 hydrog ?    ? DA A   2485 N6    ? ? ? 1_555 DA C   2536 N3 ? ? 0 A   2485 0 C   2536 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog2375 hydrog ?    ? DA A   2485 N7    ? ? ? 1_555 DA C   2536 N4 ? ? 0 A   2485 0 C   2536 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog2376 hydrog ?    ? DA C   2487 N4    ? ? ? 1_555 DA U   2535 O4 ? ? 0 C   2487 0 U   2535 1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? 
hydrog2377 hydrog ?    ? DA A   2488 N1    ? ? ? 1_555 DA C   2534 N4 ? ? 0 A   2488 0 C   2534 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2378 hydrog ?    ? DA G   2489 N1    ? ? ? 1_555 DA C   2533 N3 ? ? 0 G   2489 0 C   2533 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2379 hydrog ?    ? DA G   2489 N2    ? ? ? 1_555 DA C   2533 O2 ? ? 0 G   2489 0 C   2533 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2380 hydrog ?    ? DA G   2489 O6    ? ? ? 1_555 DA C   2533 N4 ? ? 0 G   2489 0 C   2533 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2381 hydrog ?    ? DA A   2490 N1    ? ? ? 1_555 DA U   2531 N3 ? ? 0 A   2490 0 U   2531 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2382 hydrog ?    ? DA A   2490 N6    ? ? ? 1_555 DA U   2531 O4 ? ? 0 A   2490 0 U   2531 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2383 hydrog ?    ? DA G   2491 N1    ? ? ? 1_555 DA C   2530 N3 ? ? 0 G   2491 0 C   2530 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2384 hydrog ?    ? DA G   2491 N2    ? ? ? 1_555 DA C   2530 O2 ? ? 0 G   2491 0 C   2530 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2385 hydrog ?    ? DA G   2491 O6    ? ? ? 1_555 DA C   2530 N4 ? ? 0 G   2491 0 C   2530 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2386 hydrog ?    ? DA U   2492 N3    ? ? ? 1_555 DA G   2529 O6 ? ? 0 U   2492 0 G   2529 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2387 hydrog ?    ? DA U   2492 O2    ? ? ? 1_555 DA G   2529 N1 ? ? 0 U   2492 0 G   2529 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2388 hydrog ?    ? DA G   2494 N1    ? ? ? 1_555 DA U   2528 O2 ? ? 0 G   2494 0 U   2528 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2389 hydrog ?    ? DA G   2494 O6    ? ? ? 1_555 DA U   2528 N3 ? ? 0 G   2494 0 U   2528 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2390 hydrog ?    ? DA U   2495 O4    ? ? ? 1_555 DA G   2525 N1 ? ? 0 U   2495 0 G   2525 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2391 hydrog ?    ? DA U   2495 N3    ? ? ? 1_555 DA U   2527 O4 ? ? 0 U   2495 0 U   2527 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2392 hydrog ?    ? DA U   2495 O2    ? ? ? 1_555 DA U   2527 N3 ? ? 0 U   2495 0 U   2527 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2393 hydrog ?    ? DA C   2496 N3    ? ? ? 1_555 DA G   2524 N1 ? ? 0 C   2496 0 G   2524 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2394 hydrog ?    ? DA C   2496 N4    ? ? ? 1_555 DA G   2524 O6 ? ? 0 C   2496 0 G   2524 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2395 hydrog ?    ? DA C   2496 O2    ? ? ? 1_555 DA G   2524 N2 ? ? 0 C   2496 0 G   2524 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2396 hydrog ?    ? DA A   2497 N1    ? ? ? 1_555 DA U   2523 N3 ? ? 0 A   2497 0 U   2523 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2397 hydrog ?    ? DA A   2497 N6    ? ? ? 1_555 DA U   2523 O4 ? ? 0 A   2497 0 U   2523 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2398 hydrog ?    ? DA C   2498 N3    ? ? ? 1_555 DA G   2522 N1 ? ? 0 C   2498 0 G   2522 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2399 hydrog ?    ? DA C   2498 N4    ? ? ? 1_555 DA G   2522 O6 ? ? 0 C   2498 0 G   2522 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2400 hydrog ?    ? DA C   2498 O2    ? ? ? 1_555 DA G   2522 N2 ? ? 0 C   2498 0 G   2522 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2401 hydrog ?    ? DA U   2499 N3    ? ? ? 1_555 DA A   2521 N1 ? ? 0 U   2499 0 A   2521 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2402 hydrog ?    ? DA U   2499 O4    ? ? ? 1_555 DA A   2521 N6 ? ? 0 U   2499 0 A   2521 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2403 hydrog ?    ? DA C   2500 N3    ? ? ? 1_555 DA G   2520 N1 ? ? 0 C   2500 0 G   2520 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2404 hydrog ?    ? DA C   2500 N4    ? ? ? 1_555 DA G   2520 O6 ? ? 0 C   2500 0 G   2520 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2405 hydrog ?    ? DA C   2500 O2    ? ? ? 1_555 DA G   2520 N2 ? ? 0 C   2500 0 G   2520 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2406 hydrog ?    ? DA G   2501 N1    ? ? ? 1_555 DA C   2519 N3 ? ? 0 G   2501 0 C   2519 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2407 hydrog ?    ? DA G   2501 N2    ? ? ? 1_555 DA C   2519 O2 ? ? 0 G   2501 0 C   2519 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2408 hydrog ?    ? DA G   2501 O6    ? ? ? 1_555 DA C   2519 N4 ? ? 0 G   2501 0 C   2519 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2409 hydrog ?    ? DA C   2502 O2    ? ? ? 1_555 DA C   2518 N4 ? ? 0 C   2502 0 C   2518 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2410 hydrog ?    ? DA A   2503 N3    ? ? ? 1_555 DA A   2517 N6 ? ? 0 A   2503 0 A   2517 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2411 hydrog ?    ? DA A   2504 N6    ? ? ? 1_555 DA G   2516 N3 ? ? 0 A   2504 0 G   2516 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2412 hydrog ?    ? DA A   2504 N7    ? ? ? 1_555 DA G   2516 N2 ? ? 0 A   2504 0 G   2516 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2413 hydrog ?    ? DA G   2505 N1    ? ? ? 1_555 DA C   2515 N3 ? ? 0 G   2505 0 C   2515 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2414 hydrog ?    ? DA G   2505 N2    ? ? ? 1_555 DA C   2515 O2 ? ? 0 G   2505 0 C   2515 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2415 hydrog ?    ? DA G   2505 O6    ? ? ? 1_555 DA C   2515 N4 ? ? 0 G   2505 0 C   2515 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2416 hydrog ?    ? DA A   2506 N1    ? ? ? 1_555 DA U   2514 N3 ? ? 0 A   2506 0 U   2514 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2417 hydrog ?    ? DA A   2506 N6    ? ? ? 1_555 DA U   2514 O4 ? ? 0 A   2506 0 U   2514 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2418 hydrog ?    ? DA G   2507 N2    ? ? ? 1_555 DA A   2513 N7 ? ? 0 G   2507 0 A   2513 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2419 hydrog ?    ? DA G   2507 N3    ? ? ? 1_555 DA A   2513 N6 ? ? 0 G   2507 0 A   2513 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2420 hydrog ?    ? DA C   2510 N3    ? ? ? 1_555 DA G   2564 N2 ? ? 0 C   2510 0 G   2564 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2421 hydrog ?    ? DA C   2510 O2    ? ? ? 1_555 DA G   2564 N1 ? ? 0 C   2510 0 G   2564 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2422 hydrog ?    ? DA G   2525 N2    ? ? ? 1_555 DA U   2527 O4 ? ? 0 G   2525 0 U   2527 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2423 hydrog ?    ? DA A   2532 N3    ? ? ? 1_555 DA C   2533 N4 ? ? 0 A   2532 0 C   2533 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2424 hydrog ?    ? DA G   2540 N2    ? ? ? 1_555 DA U   2541 O4 ? ? 0 G   2540 0 U   2541 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2425 hydrog ?    ? DA G   2540 N1    ? ? ? 1_555 DA U   2645 O2 ? ? 0 G   2540 0 U   2645 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2426 hydrog ?    ? DA U   2541 N3    ? ? ? 1_555 DA G   2618 O6 ? ? 0 U   2541 0 G   2618 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2427 hydrog ?    ? DA U   2541 O2    ? ? ? 1_555 DA G   2618 N1 ? ? 0 U   2541 0 G   2618 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2428 hydrog ?    ? DA C   2542 O2    ? ? ? 1_555 DA OMG 2588 N2 ? ? 0 C   2542 0 OMG 2588 1_555 ? ? ? ? ? ? 'C-OMG PAIR' ? ? 
hydrog2429 hydrog ?    ? DA C   2542 N3    ? ? ? 1_555 DA G   2617 N1 ? ? 0 C   2542 0 G   2617 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2430 hydrog ?    ? DA C   2542 N4    ? ? ? 1_555 DA G   2617 O6 ? ? 0 C   2542 0 G   2617 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2431 hydrog ?    ? DA C   2542 O2    ? ? ? 1_555 DA G   2617 N2 ? ? 0 C   2542 0 G   2617 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2432 hydrog ?    ? DA G   2543 N1    ? ? ? 1_555 DA U   2615 O2 ? ? 0 G   2543 0 U   2615 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2433 hydrog ?    ? DA G   2543 O6    ? ? ? 1_555 DA U   2615 N3 ? ? 0 G   2543 0 U   2615 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2434 hydrog ?    ? DA G   2544 N1    ? ? ? 1_555 DA C   2614 N3 ? ? 0 G   2544 0 C   2614 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2435 hydrog ?    ? DA G   2544 N2    ? ? ? 1_555 DA C   2614 O2 ? ? 0 G   2544 0 C   2614 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2436 hydrog ?    ? DA G   2544 O6    ? ? ? 1_555 DA C   2614 N4 ? ? 0 G   2544 0 C   2614 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2437 hydrog ?    ? DA U   2545 N3    ? ? ? 1_555 DA G   2613 O6 ? ? 0 U   2545 0 G   2613 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2438 hydrog ?    ? DA U   2545 O2    ? ? ? 1_555 DA G   2613 N1 ? ? 0 U   2545 0 G   2613 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2439 hydrog ?    ? DA U   2546 N3    ? ? ? 1_555 DA U   2610 O2 ? ? 0 U   2546 0 U   2610 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2440 hydrog ?    ? DA U   2546 O4    ? ? ? 1_555 DA U   2610 N3 ? ? 0 U   2546 0 U   2610 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2441 hydrog ?    ? DA C   2547 N3    ? ? ? 1_555 DA G   2609 N1 ? ? 0 C   2547 0 G   2609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2442 hydrog ?    ? DA C   2547 N4    ? ? ? 1_555 DA G   2609 O6 ? ? 0 C   2547 0 G   2609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2443 hydrog ?    ? DA C   2547 O2    ? ? ? 1_555 DA G   2609 N2 ? ? 0 C   2547 0 G   2609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2444 hydrog ?    ? DA C   2548 N3    ? ? ? 1_555 DA G   2606 N1 ? ? 0 C   2548 0 G   2606 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2445 hydrog ?    ? DA C   2548 N4    ? ? ? 1_555 DA G   2606 O6 ? ? 0 C   2548 0 G   2606 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2446 hydrog ?    ? DA C   2548 O2    ? ? ? 1_555 DA G   2606 N2 ? ? 0 C   2548 0 G   2606 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2447 hydrog ?    ? DA C   2549 N3    ? ? ? 1_555 DA G   2605 N1 ? ? 0 C   2549 0 G   2605 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2448 hydrog ?    ? DA C   2549 N4    ? ? ? 1_555 DA G   2605 O6 ? ? 0 C   2549 0 G   2605 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2449 hydrog ?    ? DA C   2549 O2    ? ? ? 1_555 DA G   2605 N2 ? ? 0 C   2549 0 G   2605 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2450 hydrog ?    ? DA U   2550 N3    ? ? ? 1_555 DA A   2604 N1 ? ? 0 U   2550 0 A   2604 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2451 hydrog ?    ? DA U   2550 O4    ? ? ? 1_555 DA A   2604 N6 ? ? 0 U   2550 0 A   2604 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2452 hydrog ?    ? DA C   2551 N3    ? ? ? 1_555 DA G   2603 N1 ? ? 0 C   2551 0 G   2603 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2453 hydrog ?    ? DA C   2551 N4    ? ? ? 1_555 DA G   2603 O6 ? ? 0 C   2551 0 G   2603 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2454 hydrog ?    ? DA C   2551 O2    ? ? ? 1_555 DA G   2603 N2 ? ? 0 C   2551 0 G   2603 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2455 hydrog ?    ? DA C   2552 N3    ? ? ? 1_555 DA G   2602 N1 ? ? 0 C   2552 0 G   2602 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2456 hydrog ?    ? DA C   2552 N4    ? ? ? 1_555 DA G   2602 O6 ? ? 0 C   2552 0 G   2602 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2457 hydrog ?    ? DA C   2552 O2    ? ? ? 1_555 DA G   2602 N2 ? ? 0 C   2552 0 G   2602 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2458 hydrog ?    ? DA C   2552 O2    ? ? ? 1_555 DA G   2603 N2 ? ? 0 C   2552 0 G   2603 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2459 hydrog ?    ? DA U   2554 O2    ? ? ? 1_555 DA C   2556 N4 ? ? 0 U   2554 0 C   2556 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2460 hydrog ?    ? DA C   2555 N4    ? ? ? 1_555 DA A   2577 N1 ? ? 0 C   2555 0 A   2577 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2461 hydrog ?    ? DA C   2555 N3    ? ? ? 1_555 DA G   2580 N1 ? ? 0 C   2555 0 G   2580 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2462 hydrog ?    ? DA C   2555 N4    ? ? ? 1_555 DA G   2580 O6 ? ? 0 C   2555 0 G   2580 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2463 hydrog ?    ? DA C   2555 O2    ? ? ? 1_555 DA G   2580 N2 ? ? 0 C   2555 0 G   2580 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2464 hydrog ?    ? DA C   2556 N3    ? ? ? 1_555 DA G   2579 N1 ? ? 0 C   2556 0 G   2579 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2465 hydrog ?    ? DA C   2556 N4    ? ? ? 1_555 DA G   2579 O6 ? ? 0 C   2556 0 G   2579 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2466 hydrog ?    ? DA C   2556 O2    ? ? ? 1_555 DA G   2579 N2 ? ? 0 C   2556 0 G   2579 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2467 hydrog ?    ? DA U   2557 N3    ? ? ? 1_555 DA G   2578 O6 ? ? 0 U   2557 0 G   2578 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2468 hydrog ?    ? DA U   2557 O2    ? ? ? 1_555 DA G   2578 N1 ? ? 0 U   2557 0 G   2578 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2469 hydrog ?    ? DA G   2558 N1    ? ? ? 1_555 DA C   2575 N3 ? ? 0 G   2558 0 C   2575 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2470 hydrog ?    ? DA G   2558 N2    ? ? ? 1_555 DA C   2575 O2 ? ? 0 G   2558 0 C   2575 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2471 hydrog ?    ? DA G   2558 O6    ? ? ? 1_555 DA C   2575 N4 ? ? 0 G   2558 0 C   2575 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2472 hydrog ?    ? DA C   2559 N3    ? ? ? 1_555 DA G   2574 N1 ? ? 0 C   2559 0 G   2574 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2473 hydrog ?    ? DA C   2559 N4    ? ? ? 1_555 DA G   2574 O6 ? ? 0 C   2559 0 G   2574 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2474 hydrog ?    ? DA C   2559 O2    ? ? ? 1_555 DA G   2574 N2 ? ? 0 C   2559 0 G   2574 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2475 hydrog ?    ? DA C   2560 N3    ? ? ? 1_555 DA G   2573 N1 ? ? 0 C   2560 0 G   2573 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2476 hydrog ?    ? DA C   2560 N4    ? ? ? 1_555 DA G   2573 O6 ? ? 0 C   2560 0 G   2573 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2477 hydrog ?    ? DA C   2560 O2    ? ? ? 1_555 DA G   2573 N2 ? ? 0 C   2560 0 G   2573 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2478 hydrog ?    ? DA C   2561 N3    ? ? ? 1_555 DA G   2572 N1 ? ? 0 C   2561 0 G   2572 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2479 hydrog ?    ? DA C   2561 N4    ? ? ? 1_555 DA G   2572 O6 ? ? 0 C   2561 0 G   2572 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2480 hydrog ?    ? DA C   2561 O2    ? ? ? 1_555 DA G   2572 N2 ? ? 0 C   2561 0 G   2572 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2481 hydrog ?    ? DA G   2562 N1    ? ? ? 1_555 DA C   2571 N3 ? ? 0 G   2562 0 C   2571 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2482 hydrog ?    ? DA G   2562 N2    ? ? ? 1_555 DA C   2571 O2 ? ? 0 G   2562 0 C   2571 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2483 hydrog ?    ? DA G   2562 O6    ? ? ? 1_555 DA C   2571 N4 ? ? 0 G   2562 0 C   2571 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2484 hydrog ?    ? DA U   2563 N3    ? ? ? 1_555 DA G   2570 O6 ? ? 0 U   2563 0 G   2570 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2485 hydrog ?    ? DA U   2563 O2    ? ? ? 1_555 DA G   2570 N1 ? ? 0 U   2563 0 G   2570 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2486 hydrog ?    ? DA A   2566 N1    ? ? ? 1_555 DA A   2699 N6 ? ? 0 A   2566 0 A   2699 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog2487 hydrog ?    ? DA A   2566 N6    ? ? ? 1_555 DA A   2699 N1 ? ? 0 A   2566 0 A   2699 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog2488 hydrog ?    ? DA A   2566 N1    ? ? ? 1_555 DA G   2700 N2 ? ? 0 A   2566 0 G   2700 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2489 hydrog ?    ? DA G   2567 N2    ? ? ? 1_555 DA G   2700 N3 ? ? 0 G   2567 0 G   2700 1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog2490 hydrog ?    ? DA G   2567 N3    ? ? ? 1_555 DA G   2700 N2 ? ? 0 G   2567 0 G   2700 1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog2491 hydrog ?    ? DA G   2574 N2    ? ? ? 1_555 DA A   2776 N3 ? ? 0 G   2574 0 A   2776 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2492 hydrog ?    ? DA A   2576 N3    ? ? ? 1_555 DA A   2800 N6 ? ? 0 A   2576 0 A   2800 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2493 hydrog ?    ? DA G   2580 N2    ? ? ? 1_555 DA A   2600 N3 ? ? 0 G   2580 0 A   2600 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2494 hydrog ?    ? DA U   2581 N3    ? ? ? 1_555 DA G   2602 N7 ? ? 0 U   2581 0 G   2602 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2495 hydrog ?    ? DA G   2582 N1    ? ? ? 1_555 DA A   2596 N1 ? ? 0 G   2582 0 A   2596 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2496 hydrog ?    ? DA G   2582 O6    ? ? ? 1_555 DA A   2596 N6 ? ? 0 G   2582 0 A   2596 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2497 hydrog ?    ? DA A   2583 N1    ? ? ? 1_555 DA U   2595 N3 ? ? 0 A   2583 0 U   2595 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2498 hydrog ?    ? DA A   2583 N6    ? ? ? 1_555 DA U   2595 O4 ? ? 0 A   2583 0 U   2595 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2499 hydrog ?    ? DA G   2584 N1    ? ? ? 1_555 DA C   2594 N3 ? ? 0 G   2584 0 C   2594 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2500 hydrog ?    ? DA G   2584 N2    ? ? ? 1_555 DA C   2594 O2 ? ? 0 G   2584 0 C   2594 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2501 hydrog ?    ? DA G   2584 O6    ? ? ? 1_555 DA C   2594 N4 ? ? 0 G   2584 0 C   2594 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2502 hydrog ?    ? DA G   2585 N1    ? ? ? 1_555 DA C   2593 N3 ? ? 0 G   2585 0 C   2593 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2503 hydrog ?    ? DA G   2585 N2    ? ? ? 1_555 DA C   2593 O2 ? ? 0 G   2585 0 C   2593 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2504 hydrog ?    ? DA G   2585 O6    ? ? ? 1_555 DA C   2593 N4 ? ? 0 G   2585 0 C   2593 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2505 hydrog ?    ? DA U   2586 O4    ? ? ? 1_555 DA G   2592 N1 ? ? 0 U   2586 0 G   2592 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2506 hydrog ?    ? DA OMU 2587 O2    ? ? ? 1_555 DA C   2591 N4 ? ? 0 OMU 2587 0 C   2591 1_555 ? ? ? ? ? ? 'OMU-C MISPAIR' 
?     ? 
hydrog2507 hydrog ?    ? DA OMG 2588 N1    ? ? ? 1_555 FA A   3    N1 ? ? 0 OMG 2588 5 A   76   1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2508 hydrog ?    ? DA OMG 2588 O6    ? ? ? 1_555 FA A   3    N6 ? ? 0 OMG 2588 5 A   76   1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2509 hydrog ?    ? DA U   2589 O2    ? ? ? 1_555 FA A   3    N6 ? ? 0 U   2589 5 A   76   1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2510 hydrog ?    ? DA U   2597 N3    ? ? ? 1_555 DA A   2601 N7 ? ? 0 U   2597 0 A   2601 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2511 hydrog ?    ? DA U   2597 O2    ? ? ? 1_555 DA A   2601 N6 ? ? 0 U   2597 0 A   2601 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2512 hydrog ?    ? DA A   2622 N6    ? ? ? 1_555 DA G   2643 N3 ? ? 0 A   2622 0 G   2643 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2513 hydrog ?    ? DA A   2622 N7    ? ? ? 1_555 DA G   2643 N2 ? ? 0 A   2622 0 G   2643 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2514 hydrog ?    ? DA G   2623 N1    ? ? ? 1_555 DA C   2641 N3 ? ? 0 G   2623 0 C   2641 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2515 hydrog ?    ? DA G   2623 N2    ? ? ? 1_555 DA C   2641 O2 ? ? 0 G   2623 0 C   2641 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2516 hydrog ?    ? DA G   2623 O6    ? ? ? 1_555 DA C   2641 N4 ? ? 0 G   2623 0 C   2641 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2517 hydrog ?    ? DA A   2624 N1    ? ? ? 1_555 DA U   2640 N3 ? ? 0 A   2624 0 U   2640 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2518 hydrog ?    ? DA A   2624 N6    ? ? ? 1_555 DA U   2640 O4 ? ? 0 A   2624 0 U   2640 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2519 hydrog ?    ? DA C   2625 N3    ? ? ? 1_555 DA G   2639 N1 ? ? 0 C   2625 0 G   2639 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2520 hydrog ?    ? DA C   2625 N4    ? ? ? 1_555 DA G   2639 O6 ? ? 0 C   2625 0 G   2639 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2521 hydrog ?    ? DA C   2625 O2    ? ? ? 1_555 DA G   2639 N2 ? ? 0 C   2625 0 G   2639 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2522 hydrog ?    ? DA C   2626 N3    ? ? ? 1_555 DA G   2638 N1 ? ? 0 C   2626 0 G   2638 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2523 hydrog ?    ? DA C   2626 N4    ? ? ? 1_555 DA G   2638 O6 ? ? 0 C   2626 0 G   2638 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2524 hydrog ?    ? DA C   2626 O2    ? ? ? 1_555 DA G   2638 N2 ? ? 0 C   2626 0 G   2638 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2525 hydrog ?    ? DA G   2627 N1    ? ? ? 1_555 DA C   2636 N3 ? ? 0 G   2627 0 C   2636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2526 hydrog ?    ? DA G   2627 N2    ? ? ? 1_555 DA C   2636 O2 ? ? 0 G   2627 0 C   2636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2527 hydrog ?    ? DA G   2627 O6    ? ? ? 1_555 DA C   2636 N4 ? ? 0 G   2627 0 C   2636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2528 hydrog ?    ? DA U   2628 N3    ? ? ? 1_555 DA A   2635 N1 ? ? 0 U   2628 0 A   2635 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2529 hydrog ?    ? DA U   2628 O4    ? ? ? 1_555 DA A   2635 N6 ? ? 0 U   2628 0 A   2635 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2530 hydrog ?    ? DA C   2629 N3    ? ? ? 1_555 DA G   2634 N1 ? ? 0 C   2629 0 G   2634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2531 hydrog ?    ? DA C   2629 N4    ? ? ? 1_555 DA G   2634 O6 ? ? 0 C   2629 0 G   2634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2532 hydrog ?    ? DA C   2629 O2    ? ? ? 1_555 DA G   2634 N2 ? ? 0 C   2629 0 G   2634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2533 hydrog ?    ? DA G   2630 N2    ? ? ? 1_555 DA A   2633 N7 ? ? 0 G   2630 0 A   2633 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2534 hydrog ?    ? DA A   2637 N6    ? ? ? 1_555 GA 8AN 3    N7 ? ? 0 A   2637 6 8AN 76   1_555 ? ? ? ? ? ? 'A-8AN MISPAIR' 
?     ? 
hydrog2535 hydrog ?    ? DA A   2649 N3    ? ? ? 1_555 DA C   2651 N4 ? ? 0 A   2649 0 C   2651 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2536 hydrog ?    ? DA G   2657 N2    ? ? ? 1_555 DA A   2841 N1 ? ? 0 G   2657 0 A   2841 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog2537 hydrog ?    ? DA G   2657 N3    ? ? ? 1_555 DA A   2841 N6 ? ? 0 G   2657 0 A   2841 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog2538 hydrog ?    ? DA U   2661 O2    ? ? ? 1_555 DA A   2812 N6 ? ? 0 U   2661 0 A   2812 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2539 hydrog ?    ? DA G   2662 N2    ? ? ? 1_555 DA A   2816 N3 ? ? 0 G   2662 0 A   2816 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2540 hydrog ?    ? DA G   2667 N1    ? ? ? 1_555 DA C   2822 N3 ? ? 0 G   2667 0 C   2822 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2541 hydrog ?    ? DA G   2667 N2    ? ? ? 1_555 DA C   2822 O2 ? ? 0 G   2667 0 C   2822 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2542 hydrog ?    ? DA G   2667 O6    ? ? ? 1_555 DA C   2822 N4 ? ? 0 G   2667 0 C   2822 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2543 hydrog ?    ? DA G   2667 N2    ? ? ? 1_555 DA A   2827 N3 ? ? 0 G   2667 0 A   2827 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2544 hydrog ?    ? DA G   2668 O6    ? ? ? 1_555 DA A   2820 N6 ? ? 0 G   2668 0 A   2820 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2545 hydrog ?    ? DA G   2668 N1    ? ? ? 1_555 DA C   2821 N3 ? ? 0 G   2668 0 C   2821 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2546 hydrog ?    ? DA G   2668 N2    ? ? ? 1_555 DA C   2821 O2 ? ? 0 G   2668 0 C   2821 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2547 hydrog ?    ? DA G   2668 O6    ? ? ? 1_555 DA C   2821 N4 ? ? 0 G   2668 0 C   2821 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2548 hydrog ?    ? DA U   2669 N3    ? ? ? 1_555 DA A   2820 N1 ? ? 0 U   2669 0 A   2820 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2549 hydrog ?    ? DA U   2669 O4    ? ? ? 1_555 DA A   2820 N6 ? ? 0 U   2669 0 A   2820 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2550 hydrog ?    ? DA G   2670 N1    ? ? ? 1_555 DA C   2819 N3 ? ? 0 G   2670 0 C   2819 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2551 hydrog ?    ? DA G   2670 N2    ? ? ? 1_555 DA C   2819 O2 ? ? 0 G   2670 0 C   2819 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2552 hydrog ?    ? DA G   2670 O6    ? ? ? 1_555 DA C   2819 N4 ? ? 0 G   2670 0 C   2819 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2553 hydrog ?    ? DA U   2671 N3    ? ? ? 1_555 DA A   2818 N1 ? ? 0 U   2671 0 A   2818 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2554 hydrog ?    ? DA U   2671 O4    ? ? ? 1_555 DA A   2818 N6 ? ? 0 U   2671 0 A   2818 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2555 hydrog ?    ? DA C   2672 N3    ? ? ? 1_555 DA G   2817 N1 ? ? 0 C   2672 0 G   2817 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2556 hydrog ?    ? DA C   2672 N4    ? ? ? 1_555 DA G   2817 O6 ? ? 0 C   2672 0 G   2817 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2557 hydrog ?    ? DA C   2672 O2    ? ? ? 1_555 DA G   2817 N2 ? ? 0 C   2672 0 G   2817 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2558 hydrog ?    ? DA U   2673 N3    ? ? ? 1_555 DA A   2811 N7 ? ? 0 U   2673 0 A   2811 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2559 hydrog ?    ? DA U   2673 O2    ? ? ? 1_555 DA A   2811 N6 ? ? 0 U   2673 0 A   2811 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2560 hydrog ?    ? DA G   2674 N2    ? ? ? 1_555 DA A   2813 N7 ? ? 0 G   2674 0 A   2813 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2561 hydrog ?    ? DA G   2674 N3    ? ? ? 1_555 DA A   2813 N6 ? ? 0 G   2674 0 A   2813 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2562 hydrog ?    ? DA A   2675 N6    ? ? ? 1_555 DA G   2810 N3 ? ? 0 A   2675 0 G   2810 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2563 hydrog ?    ? DA A   2675 N7    ? ? ? 1_555 DA G   2810 N2 ? ? 0 A   2675 0 G   2810 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2564 hydrog ?    ? DA C   2676 N3    ? ? ? 1_555 DA G   2809 N1 ? ? 0 C   2676 0 G   2809 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2565 hydrog ?    ? DA C   2676 N4    ? ? ? 1_555 DA G   2809 O6 ? ? 0 C   2676 0 G   2809 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2566 hydrog ?    ? DA C   2676 O2    ? ? ? 1_555 DA G   2809 N2 ? ? 0 C   2676 0 G   2809 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2567 hydrog ?    ? DA A   2677 N1    ? ? ? 1_555 DA U   2808 N3 ? ? 0 A   2677 0 U   2808 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2568 hydrog ?    ? DA A   2677 N6    ? ? ? 1_555 DA U   2808 O4 ? ? 0 A   2677 0 U   2808 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2569 hydrog ?    ? DA A   2678 N1    ? ? ? 1_555 DA U   2807 N3 ? ? 0 A   2678 0 U   2807 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2570 hydrog ?    ? DA A   2678 N6    ? ? ? 1_555 DA U   2807 O4 ? ? 0 A   2678 0 U   2807 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2571 hydrog ?    ? DA G   2679 N1    ? ? ? 1_555 DA C   2806 N3 ? ? 0 G   2679 0 C   2806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2572 hydrog ?    ? DA G   2679 N2    ? ? ? 1_555 DA C   2806 O2 ? ? 0 G   2679 0 C   2806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2573 hydrog ?    ? DA G   2679 O6    ? ? ? 1_555 DA C   2806 N4 ? ? 0 G   2679 0 C   2806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2574 hydrog ?    ? DA A   2680 N1    ? ? ? 1_555 DA G   2712 N2 ? ? 0 A   2680 0 G   2712 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2575 hydrog ?    ? DA A   2681 N3    ? ? ? 1_555 DA G   2713 N2 ? ? 0 A   2681 0 G   2713 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2576 hydrog ?    ? DA C   2682 N3    ? ? ? 1_555 DA G   2712 N1 ? ? 0 C   2682 0 G   2712 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2577 hydrog ?    ? DA C   2682 N4    ? ? ? 1_555 DA G   2712 O6 ? ? 0 C   2682 0 G   2712 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2578 hydrog ?    ? DA C   2682 O2    ? ? ? 1_555 DA G   2712 N2 ? ? 0 C   2682 0 G   2712 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2579 hydrog ?    ? DA G   2683 N1    ? ? ? 1_555 DA U   2711 O2 ? ? 0 G   2683 0 U   2711 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2580 hydrog ?    ? DA G   2683 O6    ? ? ? 1_555 DA U   2711 N3 ? ? 0 G   2683 0 U   2711 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2581 hydrog ?    ? DA A   2684 N1    ? ? ? 1_555 DA U   2710 N3 ? ? 0 A   2684 0 U   2710 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2582 hydrog ?    ? DA A   2684 N6    ? ? ? 1_555 DA U   2710 O4 ? ? 0 A   2684 0 U   2710 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2583 hydrog ?    ? DA C   2685 N3    ? ? ? 1_555 DA G   2709 N1 ? ? 0 C   2685 0 G   2709 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2584 hydrog ?    ? DA C   2685 N4    ? ? ? 1_555 DA G   2709 O6 ? ? 0 C   2685 0 G   2709 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2585 hydrog ?    ? DA C   2685 O2    ? ? ? 1_555 DA G   2709 N2 ? ? 0 C   2685 0 G   2709 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2586 hydrog ?    ? DA C   2686 N3    ? ? ? 1_555 DA G   2708 N1 ? ? 0 C   2686 0 G   2708 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2587 hydrog ?    ? DA C   2686 N4    ? ? ? 1_555 DA G   2708 O6 ? ? 0 C   2686 0 G   2708 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2588 hydrog ?    ? DA C   2686 O2    ? ? ? 1_555 DA G   2708 N2 ? ? 0 C   2686 0 G   2708 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2589 hydrog ?    ? DA G   2687 N1    ? ? ? 1_555 DA C   2707 N3 ? ? 0 G   2687 0 C   2707 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2590 hydrog ?    ? DA G   2687 N2    ? ? ? 1_555 DA C   2707 O2 ? ? 0 G   2687 0 C   2707 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2591 hydrog ?    ? DA G   2687 O6    ? ? ? 1_555 DA C   2707 N4 ? ? 0 G   2687 0 C   2707 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2592 hydrog ?    ? DA U   2688 N3    ? ? ? 1_555 DA A   2706 N1 ? ? 0 U   2688 0 A   2706 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2593 hydrog ?    ? DA U   2688 O4    ? ? ? 1_555 DA A   2706 N6 ? ? 0 U   2688 0 A   2706 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2594 hydrog ?    ? DA A   2689 N1    ? ? ? 1_555 DA U   2705 N3 ? ? 0 A   2689 0 U   2705 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2595 hydrog ?    ? DA A   2689 N6    ? ? ? 1_555 DA U   2705 O4 ? ? 0 A   2689 0 U   2705 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2596 hydrog ?    ? DA U   2690 O2    ? ? ? 1_555 DA C   2704 N4 ? ? 0 U   2690 0 C   2704 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2597 hydrog ?    ? DA A   2691 N6    ? ? ? 1_555 DA A   2703 N7 ? ? 0 A   2691 0 A   2703 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2598 hydrog ?    ? DA A   2691 N7    ? ? ? 1_555 DA A   2703 N6 ? ? 0 A   2691 0 A   2703 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2599 hydrog ?    ? DA G   2692 N2    ? ? ? 1_555 DA U   2693 O4 ? ? 0 G   2692 0 U   2693 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2600 hydrog ?    ? DA U   2693 N3    ? ? ? 1_555 DA A   2702 N7 ? ? 0 U   2693 0 A   2702 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2601 hydrog ?    ? DA U   2693 O2    ? ? ? 1_555 DA A   2702 N6 ? ? 0 U   2693 0 A   2702 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2602 hydrog ?    ? DA A   2694 N6    ? ? ? 1_555 DA G   2701 N3 ? ? 0 A   2694 0 G   2701 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2603 hydrog ?    ? DA A   2694 N7    ? ? ? 1_555 DA G   2701 N2 ? ? 0 A   2694 0 G   2701 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2604 hydrog ?    ? DA C   2695 N3    ? ? ? 1_555 DA G   2700 N1 ? ? 0 C   2695 0 G   2700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2605 hydrog ?    ? DA C   2695 N4    ? ? ? 1_555 DA G   2700 O6 ? ? 0 C   2695 0 G   2700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2606 hydrog ?    ? DA C   2695 O2    ? ? ? 1_555 DA G   2700 N2 ? ? 0 C   2695 0 G   2700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2607 hydrog ?    ? DA G   2696 N2    ? ? ? 1_555 DA A   2699 N7 ? ? 0 G   2696 0 A   2699 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2608 hydrog ?    ? DA G   2713 N1    ? ? ? 1_555 DA C   2767 N3 ? ? 0 G   2713 0 C   2767 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2609 hydrog ?    ? DA G   2713 N2    ? ? ? 1_555 DA C   2767 O2 ? ? 0 G   2713 0 C   2767 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2610 hydrog ?    ? DA G   2713 O6    ? ? ? 1_555 DA C   2767 N4 ? ? 0 G   2713 0 C   2767 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2611 hydrog ?    ? DA U   2714 N3    ? ? ? 1_555 DA A   2766 N1 ? ? 0 U   2714 0 A   2766 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2612 hydrog ?    ? DA U   2714 O4    ? ? ? 1_555 DA A   2766 N6 ? ? 0 U   2714 0 A   2766 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2613 hydrog ?    ? DA G   2715 N1    ? ? ? 1_555 DA C   2765 N3 ? ? 0 G   2715 0 C   2765 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2614 hydrog ?    ? DA G   2715 N2    ? ? ? 1_555 DA C   2765 O2 ? ? 0 G   2715 0 C   2765 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2615 hydrog ?    ? DA G   2715 O6    ? ? ? 1_555 DA C   2765 N4 ? ? 0 G   2715 0 C   2765 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2616 hydrog ?    ? DA G   2716 N1    ? ? ? 1_555 DA C   2764 N3 ? ? 0 G   2716 0 C   2764 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2617 hydrog ?    ? DA G   2716 N2    ? ? ? 1_555 DA C   2764 O2 ? ? 0 G   2716 0 C   2764 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2618 hydrog ?    ? DA G   2716 O6    ? ? ? 1_555 DA C   2764 N4 ? ? 0 G   2716 0 C   2764 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2619 hydrog ?    ? DA C   2717 N3    ? ? ? 1_555 DA G   2763 N1 ? ? 0 C   2717 0 G   2763 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2620 hydrog ?    ? DA C   2717 N4    ? ? ? 1_555 DA G   2763 O6 ? ? 0 C   2717 0 G   2763 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2621 hydrog ?    ? DA C   2717 O2    ? ? ? 1_555 DA G   2763 N2 ? ? 0 C   2717 0 G   2763 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2622 hydrog ?    ? DA C   2718 N3    ? ? ? 1_555 DA A   2761 N6 ? ? 0 C   2718 0 A   2761 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog2623 hydrog ?    ? DA C   2718 N4    ? ? ? 1_555 DA A   2761 N7 ? ? 0 C   2718 0 A   2761 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog2624 hydrog ?    ? DA C   2720 N4    ? ? ? 1_555 DA G   2763 N3 ? ? 0 C   2720 0 G   2763 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2625 hydrog ?    ? DA U   2721 N3    ? ? ? 1_555 DA A   2761 N1 ? ? 0 U   2721 0 A   2761 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2626 hydrog ?    ? DA U   2721 O4    ? ? ? 1_555 DA A   2761 N6 ? ? 0 U   2721 0 A   2761 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2627 hydrog ?    ? DA G   2722 N1    ? ? ? 1_555 DA C   2760 O2 ? ? 0 G   2722 0 C   2760 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2628 hydrog ?    ? DA G   2723 N1    ? ? ? 1_555 DA C   2759 N3 ? ? 0 G   2723 0 C   2759 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2629 hydrog ?    ? DA G   2723 N2    ? ? ? 1_555 DA C   2759 O2 ? ? 0 G   2723 0 C   2759 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2630 hydrog ?    ? DA G   2723 O6    ? ? ? 1_555 DA C   2759 N4 ? ? 0 G   2723 0 C   2759 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2631 hydrog ?    ? DA U   2724 N3    ? ? ? 1_555 DA G   2758 O6 ? ? 0 U   2724 0 G   2758 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2632 hydrog ?    ? DA U   2724 O2    ? ? ? 1_555 DA G   2758 N1 ? ? 0 U   2724 0 G   2758 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2633 hydrog ?    ? DA G   2725 N2    ? ? ? 1_555 DA A   2757 N7 ? ? 0 G   2725 0 A   2757 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2634 hydrog ?    ? DA G   2725 N3    ? ? ? 1_555 DA A   2757 N6 ? ? 0 G   2725 0 A   2757 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2635 hydrog ?    ? DA A   2727 N7    ? ? ? 1_555 DA G   2755 N2 ? ? 0 A   2727 0 G   2755 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2636 hydrog ?    ? DA C   2728 N3    ? ? ? 1_555 DA G   2754 N1 ? ? 0 C   2728 0 G   2754 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2637 hydrog ?    ? DA C   2728 N4    ? ? ? 1_555 DA G   2754 O6 ? ? 0 C   2728 0 G   2754 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2638 hydrog ?    ? DA C   2728 O2    ? ? ? 1_555 DA G   2754 N2 ? ? 0 C   2728 0 G   2754 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2639 hydrog ?    ? DA C   2729 N3    ? ? ? 1_555 DA G   2753 N1 ? ? 0 C   2729 0 G   2753 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2640 hydrog ?    ? DA C   2729 N4    ? ? ? 1_555 DA G   2753 O6 ? ? 0 C   2729 0 G   2753 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2641 hydrog ?    ? DA C   2729 O2    ? ? ? 1_555 DA G   2753 N2 ? ? 0 C   2729 0 G   2753 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2642 hydrog ?    ? DA G   2730 N1    ? ? ? 1_555 DA C   2752 N3 ? ? 0 G   2730 0 C   2752 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2643 hydrog ?    ? DA G   2730 N2    ? ? ? 1_555 DA C   2752 O2 ? ? 0 G   2730 0 C   2752 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2644 hydrog ?    ? DA G   2730 O6    ? ? ? 1_555 DA C   2752 N4 ? ? 0 G   2730 0 C   2752 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2645 hydrog ?    ? DA G   2731 N1    ? ? ? 1_555 DA C   2751 N3 ? ? 0 G   2731 0 C   2751 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2646 hydrog ?    ? DA G   2731 N2    ? ? ? 1_555 DA C   2751 O2 ? ? 0 G   2731 0 C   2751 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2647 hydrog ?    ? DA G   2731 O6    ? ? ? 1_555 DA C   2751 N4 ? ? 0 G   2731 0 C   2751 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2648 hydrog ?    ? DA U   2732 N3    ? ? ? 1_555 DA G   2750 O6 ? ? 0 U   2732 0 G   2750 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2649 hydrog ?    ? DA U   2732 O2    ? ? ? 1_555 DA G   2750 N1 ? ? 0 U   2732 0 G   2750 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2650 hydrog ?    ? DA U   2733 N3    ? ? ? 1_555 DA A   2746 N1 ? ? 0 U   2733 0 A   2746 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2651 hydrog ?    ? DA U   2733 O4    ? ? ? 1_555 DA A   2746 N6 ? ? 0 U   2733 0 A   2746 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2652 hydrog ?    ? DA G   2734 N1    ? ? ? 1_555 DA C   2745 N3 ? ? 0 G   2734 0 C   2745 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2653 hydrog ?    ? DA G   2734 N2    ? ? ? 1_555 DA C   2745 O2 ? ? 0 G   2734 0 C   2745 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2654 hydrog ?    ? DA G   2734 O6    ? ? ? 1_555 DA C   2745 N4 ? ? 0 G   2734 0 C   2745 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2655 hydrog ?    ? DA U   2735 N3    ? ? ? 1_555 DA G   2744 O6 ? ? 0 U   2735 0 G   2744 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2656 hydrog ?    ? DA U   2735 O2    ? ? ? 1_555 DA G   2744 N1 ? ? 0 U   2735 0 G   2744 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2657 hydrog ?    ? DA U   2736 N3    ? ? ? 1_555 DA A   2743 N1 ? ? 0 U   2736 0 A   2743 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2658 hydrog ?    ? DA U   2736 O4    ? ? ? 1_555 DA A   2743 N6 ? ? 0 U   2736 0 A   2743 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2659 hydrog ?    ? DA C   2737 N3    ? ? ? 1_555 DA G   2742 N1 ? ? 0 C   2737 0 G   2742 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2660 hydrog ?    ? DA C   2737 N4    ? ? ? 1_555 DA G   2742 O6 ? ? 0 C   2737 0 G   2742 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2661 hydrog ?    ? DA C   2737 O2    ? ? ? 1_555 DA G   2742 N2 ? ? 0 C   2737 0 G   2742 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2662 hydrog ?    ? DA U   2756 N3    ? ? ? 1_555 DA A   2896 N1 ? ? 0 U   2756 0 A   2896 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2663 hydrog ?    ? DA C   2769 N4    ? ? ? 1_555 DA A   2805 N3 ? ? 0 C   2769 0 A   2805 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2664 hydrog ?    ? DA G   2770 N1    ? ? ? 1_555 DA C   2804 O2 ? ? 0 G   2770 0 C   2804 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2665 hydrog ?    ? DA G   2771 N1    ? ? ? 1_555 DA C   2803 N3 ? ? 0 G   2771 0 C   2803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2666 hydrog ?    ? DA G   2771 N2    ? ? ? 1_555 DA C   2803 O2 ? ? 0 G   2771 0 C   2803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2667 hydrog ?    ? DA G   2771 O6    ? ? ? 1_555 DA C   2803 N4 ? ? 0 G   2771 0 C   2803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2668 hydrog ?    ? DA G   2772 N1    ? ? ? 1_555 DA C   2802 N3 ? ? 0 G   2772 0 C   2802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2669 hydrog ?    ? DA G   2772 N2    ? ? ? 1_555 DA C   2802 O2 ? ? 0 G   2772 0 C   2802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2670 hydrog ?    ? DA G   2772 O6    ? ? ? 1_555 DA C   2802 N4 ? ? 0 G   2772 0 C   2802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2671 hydrog ?    ? DA G   2773 N1    ? ? ? 1_555 DA A   2801 N1 ? ? 0 G   2773 0 A   2801 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2672 hydrog ?    ? DA G   2773 O6    ? ? ? 1_555 DA A   2801 N6 ? ? 0 G   2773 0 A   2801 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2673 hydrog ?    ? DA U   2774 N3    ? ? ? 1_555 DA A   2799 N7 ? ? 0 U   2774 0 A   2799 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2674 hydrog ?    ? DA U   2774 O2    ? ? ? 1_555 DA A   2799 N6 ? ? 0 U   2774 0 A   2799 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2675 hydrog ?    ? DA A   2776 N6    ? ? ? 1_555 DA G   2798 N3 ? ? 0 A   2776 0 G   2798 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2676 hydrog ?    ? DA A   2776 N7    ? ? ? 1_555 DA G   2798 N2 ? ? 0 A   2776 0 G   2798 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2677 hydrog ?    ? DA G   2777 N1    ? ? ? 1_555 DA C   2797 N3 ? ? 0 G   2777 0 C   2797 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2678 hydrog ?    ? DA G   2777 N2    ? ? ? 1_555 DA C   2797 O2 ? ? 0 G   2777 0 C   2797 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2679 hydrog ?    ? DA G   2777 O6    ? ? ? 1_555 DA C   2797 N4 ? ? 0 G   2777 0 C   2797 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2680 hydrog ?    ? DA A   2778 N1    ? ? ? 1_555 DA U   2796 N3 ? ? 0 A   2778 0 U   2796 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2681 hydrog ?    ? DA A   2778 N6    ? ? ? 1_555 DA U   2796 O4 ? ? 0 A   2778 0 U   2796 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2682 hydrog ?    ? DA G   2779 N1    ? ? ? 1_555 DA C   2795 N3 ? ? 0 G   2779 0 C   2795 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2683 hydrog ?    ? DA G   2779 N2    ? ? ? 1_555 DA C   2795 O2 ? ? 0 G   2779 0 C   2795 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2684 hydrog ?    ? DA G   2779 O6    ? ? ? 1_555 DA C   2795 N4 ? ? 0 G   2779 0 C   2795 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2685 hydrog ?    ? DA C   2780 N3    ? ? ? 1_555 DA G   2794 N1 ? ? 0 C   2780 0 G   2794 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2686 hydrog ?    ? DA C   2780 N4    ? ? ? 1_555 DA G   2794 O6 ? ? 0 C   2780 0 G   2794 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2687 hydrog ?    ? DA C   2780 O2    ? ? ? 1_555 DA G   2794 N2 ? ? 0 C   2780 0 G   2794 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2688 hydrog ?    ? DA U   2781 N3    ? ? ? 1_555 DA U   2791 O4 ? ? 0 U   2781 0 U   2791 1_555 ? ? ? ? ? ? 'U-U MISPAIR' ? 
? 
hydrog2689 hydrog ?    ? DA U   2781 O2    ? ? ? 1_555 DA A   2793 N6 ? ? 0 U   2781 0 A   2793 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2690 hydrog ?    ? DA G   2782 N2    ? ? ? 1_555 DA A   2792 N7 ? ? 0 G   2782 0 A   2792 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2691 hydrog ?    ? DA G   2782 N3    ? ? ? 1_555 DA A   2792 N6 ? ? 0 G   2782 0 A   2792 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2692 hydrog ?    ? DA A   2783 N6    ? ? ? 1_555 DA U   2789 O2 ? ? 0 A   2783 0 U   2789 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2693 hydrog ?    ? DA A   2783 N7    ? ? ? 1_555 DA U   2789 N3 ? ? 0 A   2783 0 U   2789 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2694 hydrog ?    ? DA A   2784 N6    ? ? ? 1_555 DA A   2788 N1 ? ? 0 A   2784 0 A   2788 1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog2695 hydrog ?    ? DA A   2784 N7    ? ? ? 1_555 DA A   2788 N6 ? ? 0 A   2784 0 A   2788 1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog2696 hydrog ?    ? DA C   2785 O2    ? ? ? 1_555 DA C   2787 N4 ? ? 0 C   2785 0 C   2787 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2697 hydrog ?    ? DA U   2791 O4    ? ? ? 1_555 DA A   2793 N6 ? ? 0 U   2791 0 A   2793 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2698 hydrog ?    ? DA A   2812 N1    ? ? ? 1_555 DA A   2814 N6 ? ? 0 A   2812 0 A   2814 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2699 hydrog ?    ? DA G   2823 N2    ? ? ? 1_555 DA A   2914 N3 ? ? 0 G   2823 0 A   2914 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2700 hydrog ?    ? DA G   2826 N2    ? ? ? 1_555 DA A   2914 N7 ? ? 0 G   2826 0 A   2914 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2701 hydrog ?    ? DA A   2827 N6    ? ? ? 1_555 DA A   2913 N3 ? ? 0 A   2827 0 A   2913 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2702 hydrog ?    ? DA G   2828 N2    ? ? ? 1_555 DA C   2912 O2 ? ? 0 G   2828 0 C   2912 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2703 hydrog ?    ? DA G   2829 N1    ? ? ? 1_555 DA C   2911 N3 ? ? 0 G   2829 0 C   2911 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2704 hydrog ?    ? DA U   2830 N3    ? ? ? 1_555 DA A   2910 N1 ? ? 0 U   2830 0 A   2910 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2705 hydrog ?    ? DA U   2830 O4    ? ? ? 1_555 DA A   2910 N6 ? ? 0 U   2830 0 A   2910 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2706 hydrog ?    ? DA C   2831 O2    ? ? ? 1_555 DA G   2909 N2 ? ? 0 C   2831 0 G   2909 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2707 hydrog ?    ? DA C   2832 N3    ? ? ? 1_555 DA G   2848 N1 ? ? 0 C   2832 0 G   2848 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2708 hydrog ?    ? DA C   2832 N4    ? ? ? 1_555 DA G   2848 O6 ? ? 0 C   2832 0 G   2848 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2709 hydrog ?    ? DA C   2832 O2    ? ? ? 1_555 DA G   2848 N2 ? ? 0 C   2832 0 G   2848 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2710 hydrog ?    ? DA C   2832 O2    ? ? ? 1_555 DA A   2908 N6 ? ? 0 C   2832 0 A   2908 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2711 hydrog ?    ? DA C   2833 N3    ? ? ? 1_555 DA G   2847 N1 ? ? 0 C   2833 0 G   2847 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2712 hydrog ?    ? DA C   2833 N4    ? ? ? 1_555 DA G   2847 O6 ? ? 0 C   2833 0 G   2847 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2713 hydrog ?    ? DA C   2833 O2    ? ? ? 1_555 DA G   2847 N2 ? ? 0 C   2833 0 G   2847 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2714 hydrog ?    ? DA G   2834 N1    ? ? ? 1_555 DA C   2846 N3 ? ? 0 G   2834 0 C   2846 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2715 hydrog ?    ? DA G   2834 N2    ? ? ? 1_555 DA C   2846 O2 ? ? 0 G   2834 0 C   2846 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2716 hydrog ?    ? DA G   2834 O6    ? ? ? 1_555 DA C   2846 N4 ? ? 0 G   2834 0 C   2846 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2717 hydrog ?    ? DA C   2835 N3    ? ? ? 1_555 DA G   2845 N1 ? ? 0 C   2835 0 G   2845 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2718 hydrog ?    ? DA C   2835 N4    ? ? ? 1_555 DA G   2845 O6 ? ? 0 C   2835 0 G   2845 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2719 hydrog ?    ? DA C   2835 O2    ? ? ? 1_555 DA G   2845 N2 ? ? 0 C   2835 0 G   2845 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2720 hydrog ?    ? DA G   2836 N1    ? ? ? 1_555 DA C   2844 N3 ? ? 0 G   2836 0 C   2844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2721 hydrog ?    ? DA G   2836 N2    ? ? ? 1_555 DA C   2844 O2 ? ? 0 G   2836 0 C   2844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2722 hydrog ?    ? DA G   2836 O6    ? ? ? 1_555 DA C   2844 N4 ? ? 0 G   2836 0 C   2844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2723 hydrog ?    ? DA A   2838 N3    ? ? ? 1_555 DA A   2843 N6 ? ? 0 A   2838 0 A   2843 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2724 hydrog ?    ? DA G   2847 N2    ? ? ? 1_555 DA A   2906 N3 ? ? 0 G   2847 0 A   2906 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2725 hydrog ?    ? DA G   2851 N2    ? ? ? 1_555 DA A   2906 N7 ? ? 0 G   2851 0 A   2906 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2726 hydrog ?    ? DA G   2851 N3    ? ? ? 1_555 DA A   2906 N6 ? ? 0 G   2851 0 A   2906 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2727 hydrog ?    ? DA A   2852 N1    ? ? ? 1_555 DA C   2903 N4 ? ? 0 A   2852 0 C   2903 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2728 hydrog ?    ? DA U   2853 O4    ? ? ? 1_555 DA A   2902 N6 ? ? 0 U   2853 0 A   2902 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2729 hydrog ?    ? DA U   2853 N3    ? ? ? 1_555 DA A   2905 N1 ? ? 0 U   2853 0 A   2905 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2730 hydrog ?    ? DA U   2853 O4    ? ? ? 1_555 DA A   2905 N6 ? ? 0 U   2853 0 A   2905 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2731 hydrog ?    ? DA A   2854 N1    ? ? ? 1_555 DA U   2904 N3 ? ? 0 A   2854 0 U   2904 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2732 hydrog ?    ? DA A   2854 N6    ? ? ? 1_555 DA U   2904 O4 ? ? 0 A   2854 0 U   2904 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2733 hydrog ?    ? DA G   2855 N1    ? ? ? 1_555 DA C   2903 N3 ? ? 0 G   2855 0 C   2903 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2734 hydrog ?    ? DA G   2855 N2    ? ? ? 1_555 DA C   2903 O2 ? ? 0 G   2855 0 C   2903 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2735 hydrog ?    ? DA G   2855 O6    ? ? ? 1_555 DA C   2903 N4 ? ? 0 G   2855 0 C   2903 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2736 hydrog ?    ? DA A   2856 N6    ? ? ? 1_555 DA C   2901 O2 ? ? 0 A   2856 0 C   2901 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2737 hydrog ?    ? DA C   2857 N3    ? ? ? 1_555 DA G   2900 N1 ? ? 0 C   2857 0 G   2900 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2738 hydrog ?    ? DA C   2857 N4    ? ? ? 1_555 DA G   2900 O6 ? ? 0 C   2857 0 G   2900 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2739 hydrog ?    ? DA C   2857 O2    ? ? ? 1_555 DA G   2900 N2 ? ? 0 C   2857 0 G   2900 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2740 hydrog ?    ? DA U   2858 N3    ? ? ? 1_555 DA A   2899 N1 ? ? 0 U   2858 0 A   2899 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2741 hydrog ?    ? DA U   2858 O4    ? ? ? 1_555 DA A   2899 N6 ? ? 0 U   2858 0 A   2899 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2742 hydrog ?    ? DA C   2859 N3    ? ? ? 1_555 DA G   2898 N1 ? ? 0 C   2859 0 G   2898 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2743 hydrog ?    ? DA C   2859 N4    ? ? ? 1_555 DA G   2898 O6 ? ? 0 C   2859 0 G   2898 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2744 hydrog ?    ? DA C   2859 O2    ? ? ? 1_555 DA G   2898 N2 ? ? 0 C   2859 0 G   2898 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2745 hydrog ?    ? DA G   2860 N1    ? ? ? 1_555 DA C   2897 N3 ? ? 0 G   2860 0 C   2897 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2746 hydrog ?    ? DA G   2861 N1    ? ? ? 1_555 DA C   2895 N3 ? ? 0 G   2861 0 C   2895 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2747 hydrog ?    ? DA G   2861 N2    ? ? ? 1_555 DA C   2895 O2 ? ? 0 G   2861 0 C   2895 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2748 hydrog ?    ? DA G   2861 O6    ? ? ? 1_555 DA C   2895 N4 ? ? 0 G   2861 0 C   2895 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2749 hydrog ?    ? DA G   2861 N2    ? ? ? 1_555 DA C   2897 N3 ? ? 0 G   2861 0 C   2897 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2750 hydrog ?    ? DA G   2862 N1    ? ? ? 1_555 DA C   2894 N3 ? ? 0 G   2862 0 C   2894 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2751 hydrog ?    ? DA G   2862 N2    ? ? ? 1_555 DA C   2894 O2 ? ? 0 G   2862 0 C   2894 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2752 hydrog ?    ? DA G   2862 O6    ? ? ? 1_555 DA C   2894 N4 ? ? 0 G   2862 0 C   2894 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2753 hydrog ?    ? DA G   2863 N1    ? ? ? 1_555 DA C   2893 N3 ? ? 0 G   2863 0 C   2893 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2754 hydrog ?    ? DA G   2863 N2    ? ? ? 1_555 DA C   2893 O2 ? ? 0 G   2863 0 C   2893 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2755 hydrog ?    ? DA G   2863 O6    ? ? ? 1_555 DA C   2893 N4 ? ? 0 G   2863 0 C   2893 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2756 hydrog ?    ? DA U   2864 N3    ? ? ? 1_555 DA G   2892 O6 ? ? 0 U   2864 0 G   2892 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2757 hydrog ?    ? DA U   2864 O2    ? ? ? 1_555 DA G   2892 N1 ? ? 0 U   2864 0 G   2892 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2758 hydrog ?    ? DA G   2865 N2    ? ? ? 1_555 DA A   2891 N7 ? ? 0 G   2865 0 A   2891 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2759 hydrog ?    ? DA G   2865 N3    ? ? ? 1_555 DA A   2891 N6 ? ? 0 G   2865 0 A   2891 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2760 hydrog ?    ? DA C   2868 N4    ? ? ? 1_555 DA U   2889 O4 ? ? 0 C   2868 0 U   2889 1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? 
hydrog2761 hydrog ?    ? DA G   2869 N1    ? ? ? 1_555 DA U   2888 O2 ? ? 0 G   2869 0 U   2888 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2762 hydrog ?    ? DA G   2869 O6    ? ? ? 1_555 DA U   2888 N3 ? ? 0 G   2869 0 U   2888 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2763 hydrog ?    ? DA C   2870 N3    ? ? ? 1_555 DA G   2887 N1 ? ? 0 C   2870 0 G   2887 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2764 hydrog ?    ? DA C   2870 N4    ? ? ? 1_555 DA G   2887 O6 ? ? 0 C   2870 0 G   2887 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2765 hydrog ?    ? DA C   2870 O2    ? ? ? 1_555 DA G   2887 N2 ? ? 0 C   2870 0 G   2887 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2766 hydrog ?    ? DA G   2871 N1    ? ? ? 1_555 DA C   2886 N3 ? ? 0 G   2871 0 C   2886 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2767 hydrog ?    ? DA G   2871 N2    ? ? ? 1_555 DA C   2886 O2 ? ? 0 G   2871 0 C   2886 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2768 hydrog ?    ? DA G   2871 O6    ? ? ? 1_555 DA C   2886 N4 ? ? 0 G   2871 0 C   2886 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2769 hydrog ?    ? DA U   2872 N3    ? ? ? 1_555 DA A   2885 N1 ? ? 0 U   2872 0 A   2885 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2770 hydrog ?    ? DA U   2872 O4    ? ? ? 1_555 DA A   2885 N6 ? ? 0 U   2872 0 A   2885 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2771 hydrog ?    ? DA C   2873 N3    ? ? ? 1_555 DA G   2884 N1 ? ? 0 C   2873 0 G   2884 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2772 hydrog ?    ? DA C   2873 N4    ? ? ? 1_555 DA G   2884 O6 ? ? 0 C   2873 0 G   2884 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2773 hydrog ?    ? DA C   2873 O2    ? ? ? 1_555 DA G   2884 N2 ? ? 0 C   2873 0 G   2884 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2774 hydrog ?    ? DA G   2874 N2    ? ? ? 1_555 DA A   2883 N7 ? ? 0 G   2874 0 A   2883 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2775 hydrog ?    ? DA G   2874 N3    ? ? ? 1_555 DA A   2883 N6 ? ? 0 G   2874 0 A   2883 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2776 hydrog ?    ? DA A   2875 N6    ? ? ? 1_555 DA G   2882 N3 ? ? 0 A   2875 0 G   2882 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2777 hydrog ?    ? DA A   2875 N7    ? ? ? 1_555 DA G   2882 N2 ? ? 0 A   2875 0 G   2882 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2778 hydrog ?    ? DA G   2876 N1    ? ? ? 1_555 DA C   2881 N3 ? ? 0 G   2876 0 C   2881 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2779 hydrog ?    ? DA G   2876 N2    ? ? ? 1_555 DA C   2881 O2 ? ? 0 G   2876 0 C   2881 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2780 hydrog ?    ? DA G   2876 O6    ? ? ? 1_555 DA C   2881 N4 ? ? 0 G   2876 0 C   2881 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2781 hydrog ?    ? DA G   2877 N2    ? ? ? 1_555 DA A   2880 N7 ? ? 0 G   2877 0 A   2880 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2782 hydrog ?    ? DA A   2902 N7    ? ? ? 1_555 DA A   2905 N6 ? ? 0 A   2902 0 A   2905 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2783 hydrog ?    ? EA A   3    N3    ? ? ? 1_555 EA G   21   N2 ? ? 9 A   3    9 G   21   1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2784 hydrog ?    ? EA A   3    N6    ? ? ? 1_555 EA G   25   O6 ? ? 9 A   3    9 G   25   1_555 ? ? ? ? ? ? TYPE_9_PAIR ? ? 
hydrog2785 hydrog ?    ? EA A   3    N7    ? ? ? 1_555 EA G   25   N1 ? ? 9 A   3    9 G   25   1_555 ? ? ? ? ? ? TYPE_9_PAIR ? ? 
hydrog2786 hydrog ?    ? EA G   4    N1    ? ? ? 1_555 EA C   119  N3 ? ? 9 G   4    9 C   119  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2787 hydrog ?    ? EA G   4    N2    ? ? ? 1_555 EA C   119  O2 ? ? 9 G   4    9 C   119  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2788 hydrog ?    ? EA G   4    O6    ? ? ? 1_555 EA C   119  N4 ? ? 9 G   4    9 C   119  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2789 hydrog ?    ? EA G   5    N1    ? ? ? 1_555 EA C   118  N3 ? ? 9 G   5    9 C   118  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2790 hydrog ?    ? EA G   5    N2    ? ? ? 1_555 EA C   118  O2 ? ? 9 G   5    9 C   118  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2791 hydrog ?    ? EA G   5    O6    ? ? ? 1_555 EA C   118  N4 ? ? 9 G   5    9 C   118  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2792 hydrog ?    ? EA C   6    N3    ? ? ? 1_555 EA G   117  N1 ? ? 9 C   6    9 G   117  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2793 hydrog ?    ? EA C   6    N4    ? ? ? 1_555 EA G   117  O6 ? ? 9 C   6    9 G   117  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2794 hydrog ?    ? EA C   6    O2    ? ? ? 1_555 EA G   117  N2 ? ? 9 C   6    9 G   117  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2795 hydrog ?    ? EA G   7    N1    ? ? ? 1_555 EA C   116  N3 ? ? 9 G   7    9 C   116  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2796 hydrog ?    ? EA G   7    N2    ? ? ? 1_555 EA C   116  O2 ? ? 9 G   7    9 C   116  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2797 hydrog ?    ? EA G   7    O6    ? ? ? 1_555 EA C   116  N4 ? ? 9 G   7    9 C   116  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2798 hydrog ?    ? EA G   8    N1    ? ? ? 1_555 EA C   115  N3 ? ? 9 G   8    9 C   115  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2799 hydrog ?    ? EA G   8    N2    ? ? ? 1_555 EA C   115  O2 ? ? 9 G   8    9 C   115  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2800 hydrog ?    ? EA G   8    O6    ? ? ? 1_555 EA C   115  N4 ? ? 9 G   8    9 C   115  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2801 hydrog ?    ? EA C   9    N3    ? ? ? 1_555 EA G   114  N1 ? ? 9 C   9    9 G   114  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2802 hydrog ?    ? EA C   9    N4    ? ? ? 1_555 EA G   114  O6 ? ? 9 C   9    9 G   114  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2803 hydrog ?    ? EA C   9    O2    ? ? ? 1_555 EA G   114  N2 ? ? 9 C   9    9 G   114  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2804 hydrog ?    ? EA A   11   N3    ? ? ? 1_555 EA G   68   N2 ? ? 9 A   11   9 G   68   1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2805 hydrog ?    ? EA G   14   N1    ? ? ? 1_555 EA C   67   N3 ? ? 9 G   14   9 C   67   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2806 hydrog ?    ? EA G   14   N2    ? ? ? 1_555 EA C   67   O2 ? ? 9 G   14   9 C   67   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2807 hydrog ?    ? EA G   14   O6    ? ? ? 1_555 EA C   67   N4 ? ? 9 G   14   9 C   67   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2808 hydrog ?    ? EA C   15   N3    ? ? ? 1_555 EA G   66   N1 ? ? 9 C   15   9 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2809 hydrog ?    ? EA C   15   N4    ? ? ? 1_555 EA G   66   O6 ? ? 9 C   15   9 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2810 hydrog ?    ? EA C   15   O2    ? ? ? 1_555 EA G   66   N2 ? ? 9 C   15   9 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2811 hydrog ?    ? EA C   15   N4    ? ? ? 1_555 EA C   113  O2 ? ? 9 C   15   9 C   113  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2812 hydrog ?    ? EA G   16   N1    ? ? ? 1_555 EA C   64   N3 ? ? 9 G   16   9 C   64   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2813 hydrog ?    ? EA G   16   N2    ? ? ? 1_555 EA C   64   O2 ? ? 9 G   16   9 C   64   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2814 hydrog ?    ? EA G   16   O6    ? ? ? 1_555 EA C   64   N4 ? ? 9 G   16   9 C   64   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2815 hydrog ?    ? EA G   17   N1    ? ? ? 1_555 EA C   63   N3 ? ? 9 G   17   9 C   63   1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2816 hydrog ?    ? EA U   18   N3    ? ? ? 1_555 EA A   62   N1 ? ? 9 U   18   9 A   62   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2817 hydrog ?    ? EA U   18   O4    ? ? ? 1_555 EA A   62   N6 ? ? 9 U   18   9 A   62   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2818 hydrog ?    ? EA G   19   N1    ? ? ? 1_555 EA C   61   N3 ? ? 9 G   19   9 C   61   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2819 hydrog ?    ? EA G   19   N2    ? ? ? 1_555 EA C   61   O2 ? ? 9 G   19   9 C   61   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2820 hydrog ?    ? EA G   19   O6    ? ? ? 1_555 EA C   61   N4 ? ? 9 G   19   9 C   61   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2821 hydrog ?    ? EA G   20   N1    ? ? ? 1_555 EA C   60   N3 ? ? 9 G   20   9 C   60   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2822 hydrog ?    ? EA G   20   N2    ? ? ? 1_555 EA C   60   O2 ? ? 9 G   20   9 C   60   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2823 hydrog ?    ? EA G   20   O6    ? ? ? 1_555 EA C   60   N4 ? ? 9 G   20   9 C   60   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2824 hydrog ?    ? EA G   21   N1    ? ? ? 1_555 EA C   59   N3 ? ? 9 G   21   9 C   59   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2825 hydrog ?    ? EA G   21   N2    ? ? ? 1_555 EA C   59   O2 ? ? 9 G   21   9 C   59   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2826 hydrog ?    ? EA G   21   O6    ? ? ? 1_555 EA C   59   N4 ? ? 9 G   21   9 C   59   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2827 hydrog ?    ? EA G   22   N2    ? ? ? 1_555 EA C   26   N3 ? ? 9 G   22   9 C   26   1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2828 hydrog ?    ? EA G   22   N1    ? ? ? 1_555 EA G   58   O6 ? ? 9 G   22   9 G   58   1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog2829 hydrog ?    ? EA C   27   N4    ? ? ? 1_555 EA U   55   O4 ? ? 9 C   27   9 U   55   1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? 
hydrog2830 hydrog ?    ? EA C   27   O2    ? ? ? 1_555 EA G   58   N1 ? ? 9 C   27   9 G   58   1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2831 hydrog ?    ? EA U   28   N3    ? ? ? 1_555 EA A   54   N1 ? ? 9 U   28   9 A   54   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2832 hydrog ?    ? EA U   28   O4    ? ? ? 1_555 EA A   54   N6 ? ? 9 U   28   9 A   54   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2833 hydrog ?    ? EA U   28   O2    ? ? ? 1_555 EA A   57   N6 ? ? 9 U   28   9 A   57   1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2834 hydrog ?    ? EA C   29   N3    ? ? ? 1_555 EA G   53   N1 ? ? 9 C   29   9 G   53   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2835 hydrog ?    ? EA C   29   N4    ? ? ? 1_555 EA G   53   O6 ? ? 9 C   29   9 G   53   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2836 hydrog ?    ? EA C   29   O2    ? ? ? 1_555 EA G   53   N2 ? ? 9 C   29   9 G   53   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2837 hydrog ?    ? EA C   29   O2    ? ? ? 1_555 EA A   56   N6 ? ? 9 C   29   9 A   56   1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2838 hydrog ?    ? EA C   30   N3    ? ? ? 1_555 EA G   50   N1 ? ? 9 C   30   9 G   50   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2839 hydrog ?    ? EA C   30   N4    ? ? ? 1_555 EA G   50   O6 ? ? 9 C   30   9 G   50   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2840 hydrog ?    ? EA C   30   O2    ? ? ? 1_555 EA G   50   N2 ? ? 9 C   30   9 G   50   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2841 hydrog ?    ? EA C   30   O2    ? ? ? 1_555 EA A   52   N6 ? ? 9 C   30   9 A   52   1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2842 hydrog ?    ? EA C   31   N3    ? ? ? 1_555 EA G   49   N1 ? ? 9 C   31   9 G   49   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2843 hydrog ?    ? EA C   31   N4    ? ? ? 1_555 EA G   49   O6 ? ? 9 C   31   9 G   49   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2844 hydrog ?    ? EA C   31   O2    ? ? ? 1_555 EA G   49   N2 ? ? 9 C   31   9 G   49   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2845 hydrog ?    ? EA G   32   N1    ? ? ? 1_555 EA C   48   N3 ? ? 9 G   32   9 C   48   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2846 hydrog ?    ? EA G   32   N2    ? ? ? 1_555 EA C   48   O2 ? ? 9 G   32   9 C   48   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2847 hydrog ?    ? EA G   32   O6    ? ? ? 1_555 EA C   48   N4 ? ? 9 G   32   9 C   48   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2848 hydrog ?    ? EA U   33   O2    ? ? ? 1_555 EA C   35   N4 ? ? 9 U   33   9 C   35   1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2849 hydrog ?    ? EA U   33   N3    ? ? ? 1_555 EA A   47   N1 ? ? 9 U   33   9 A   47   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2850 hydrog ?    ? EA U   33   O4    ? ? ? 1_555 EA A   47   N6 ? ? 9 U   33   9 A   47   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2851 hydrog ?    ? EA A   34   N6    ? ? ? 1_555 EA C   48   O2 ? ? 9 A   34   9 C   48   1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2852 hydrog ?    ? EA C   35   N4    ? ? ? 1_555 EA C   48   O2 ? ? 9 C   35   9 C   48   1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2853 hydrog ?    ? EA C   36   N4    ? ? ? 1_555 EA A   47   N3 ? ? 9 C   36   9 A   47   1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2854 hydrog ?    ? EA C   37   N3    ? ? ? 1_555 EA G   43   N1 ? ? 9 C   37   9 G   43   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2855 hydrog ?    ? EA C   37   N4    ? ? ? 1_555 EA G   43   O6 ? ? 9 C   37   9 G   43   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2856 hydrog ?    ? EA C   37   O2    ? ? ? 1_555 EA G   43   N2 ? ? 9 C   37   9 G   43   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2857 hydrog ?    ? EA A   38   N3    ? ? ? 1_555 EA A   45   N6 ? ? 9 A   38   9 A   45   1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2858 hydrog ?    ? EA U   39   O2    ? ? ? 1_555 EA A   44   N6 ? ? 9 U   39   9 A   44   1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2859 hydrog ?    ? EA G   43   N2    ? ? ? 1_555 EA C   46   N3 ? ? 9 G   43   9 C   46   1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2860 hydrog ?    ? EA A   51   N3    ? ? ? 1_555 EA A   52   N6 ? ? 9 A   51   9 A   52   1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2861 hydrog ?    ? EA A   54   N3    ? ? ? 1_555 EA A   56   N6 ? ? 9 A   54   9 A   56   1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2862 hydrog ?    ? EA A   65   N3    ? ? ? 1_555 EA C   67   N4 ? ? 9 A   65   9 C   67   1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2863 hydrog ?    ? EA G   66   O6    ? ? ? 1_555 EA C   113  N4 ? ? 9 G   66   9 C   113  1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2864 hydrog ?    ? EA U   69   N3    ? ? ? 1_555 EA U   112  O2 ? ? 9 U   69   9 U   112  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2865 hydrog ?    ? EA U   69   O4    ? ? ? 1_555 EA U   112  N3 ? ? 9 U   69   9 U   112  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2866 hydrog ?    ? EA U   70   N3    ? ? ? 1_555 EA U   111  O2 ? ? 9 U   70   9 U   111  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2867 hydrog ?    ? EA U   70   O4    ? ? ? 1_555 EA U   111  N3 ? ? 9 U   70   9 U   111  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2868 hydrog ?    ? EA C   71   N3    ? ? ? 1_555 EA G   110  N1 ? ? 9 C   71   9 G   110  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2869 hydrog ?    ? EA C   71   N4    ? ? ? 1_555 EA G   110  O6 ? ? 9 C   71   9 G   110  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2870 hydrog ?    ? EA C   71   O2    ? ? ? 1_555 EA G   110  N2 ? ? 9 C   71   9 G   110  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2871 hydrog ?    ? EA C   72   N3    ? ? ? 1_555 EA G   109  N1 ? ? 9 C   72   9 G   109  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2872 hydrog ?    ? EA C   72   N4    ? ? ? 1_555 EA G   109  O6 ? ? 9 C   72   9 G   109  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2873 hydrog ?    ? EA C   72   O2    ? ? ? 1_555 EA G   109  N2 ? ? 9 C   72   9 G   109  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2874 hydrog ?    ? EA A   73   N6    ? ? ? 1_555 EA C   108  N3 ? ? 9 A   73   9 C   108  1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2875 hydrog ?    ? EA G   74   N1    ? ? ? 1_555 EA C   107  N3 ? ? 9 G   74   9 C   107  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2876 hydrog ?    ? EA G   74   N2    ? ? ? 1_555 EA C   107  O2 ? ? 9 G   74   9 C   107  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2877 hydrog ?    ? EA G   74   O6    ? ? ? 1_555 EA C   107  N4 ? ? 9 G   74   9 C   107  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2878 hydrog ?    ? EA G   75   N2    ? ? ? 1_555 EA U   106  O2 ? ? 9 G   75   9 U   106  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2879 hydrog ?    ? EA G   76   N2    ? ? ? 1_555 EA A   105  N7 ? ? 9 G   76   9 A   105  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2880 hydrog ?    ? EA G   76   N3    ? ? ? 1_555 EA A   105  N6 ? ? 9 G   76   9 A   105  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2881 hydrog ?    ? EA A   77   N6    ? ? ? 1_555 EA A   104  N7 ? ? 9 A   77   9 A   104  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2882 hydrog ?    ? EA A   77   N7    ? ? ? 1_555 EA A   104  N6 ? ? 9 A   77   9 A   104  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2883 hydrog ?    ? EA G   78   N2    ? ? ? 1_555 EA U   79   O4 ? ? 9 G   78   9 U   79   1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2884 hydrog ?    ? EA U   79   N3    ? ? ? 1_555 EA A   103  N7 ? ? 9 U   79   9 A   103  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2885 hydrog ?    ? EA U   79   O2    ? ? ? 1_555 EA A   103  N6 ? ? 9 U   79   9 A   103  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2886 hydrog ?    ? EA A   80   N6    ? ? ? 1_555 EA G   102  N3 ? ? 9 A   80   9 G   102  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2887 hydrog ?    ? EA A   80   N7    ? ? ? 1_555 EA G   102  N2 ? ? 9 A   80   9 G   102  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2888 hydrog ?    ? EA C   81   N3    ? ? ? 1_555 EA G   101  N1 ? ? 9 C   81   9 G   101  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2889 hydrog ?    ? EA C   81   N4    ? ? ? 1_555 EA G   101  O6 ? ? 9 C   81   9 G   101  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2890 hydrog ?    ? EA C   81   O2    ? ? ? 1_555 EA G   101  N2 ? ? 9 C   81   9 G   101  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2891 hydrog ?    ? EA U   82   N3    ? ? ? 1_555 EA G   100  O6 ? ? 9 U   82   9 G   100  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2892 hydrog ?    ? EA U   82   O2    ? ? ? 1_555 EA G   100  N1 ? ? 9 U   82   9 G   100  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2893 hydrog ?    ? EA G   83   N1    ? ? ? 1_555 EA U   99   O2 ? ? 9 G   83   9 U   99   1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2894 hydrog ?    ? EA G   83   O6    ? ? ? 1_555 EA U   99   N3 ? ? 9 G   83   9 U   99   1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2895 hydrog ?    ? EA G   84   N1    ? ? ? 1_555 EA C   98   N3 ? ? 9 G   84   9 C   98   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2896 hydrog ?    ? EA G   84   N2    ? ? ? 1_555 EA C   98   O2 ? ? 9 G   84   9 C   98   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2897 hydrog ?    ? EA G   84   O6    ? ? ? 1_555 EA C   98   N4 ? ? 9 G   84   9 C   98   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2898 hydrog ?    ? EA A   85   N1    ? ? ? 1_555 EA U   97   N3 ? ? 9 A   85   9 U   97   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2899 hydrog ?    ? EA A   85   N6    ? ? ? 1_555 EA U   97   O4 ? ? 9 A   85   9 U   97   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2900 hydrog ?    ? EA G   86   N1    ? ? ? 1_555 EA C   96   N3 ? ? 9 G   86   9 C   96   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2901 hydrog ?    ? EA G   86   N2    ? ? ? 1_555 EA C   96   O2 ? ? 9 G   86   9 C   96   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2902 hydrog ?    ? EA G   86   O6    ? ? ? 1_555 EA C   96   N4 ? ? 9 G   86   9 C   96   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2903 hydrog ?    ? EA G   88   N1    ? ? ? 1_555 EA C   95   N3 ? ? 9 G   88   9 C   95   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2904 hydrog ?    ? EA G   88   N2    ? ? ? 1_555 EA C   95   O2 ? ? 9 G   88   9 C   95   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2905 hydrog ?    ? EA G   88   O6    ? ? ? 1_555 EA C   95   N4 ? ? 9 G   88   9 C   95   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2906 hydrog ?    ? EA C   89   N3    ? ? ? 1_555 EA G   94   N1 ? ? 9 C   89   9 G   94   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2907 hydrog ?    ? EA C   89   N4    ? ? ? 1_555 EA G   94   O6 ? ? 9 C   89   9 G   94   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2908 hydrog ?    ? EA C   89   O2    ? ? ? 1_555 EA G   94   N2 ? ? 9 C   89   9 G   94   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2909 hydrog ?    ? EA G   90   N2    ? ? ? 1_555 EA A   93   N7 ? ? 9 G   90   9 A   93   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TRP 187 A . ? TRP 186 A PRO 188 A ? PRO 187 A 1 1.18  
2 GLY 15  B . ? GLY 14  B PRO 16  B ? PRO 15  B 1 -0.37 
3 ASN 244 B . ? ASN 243 B PRO 245 B ? PRO 244 B 1 -0.01 
4 VAL 136 C . ? VAL 136 C PRO 137 C ? PRO 137 C 1 0.19  
5 GLN 56  F . ? GLN 55  F PRO 57  F ? PRO 56  F 1 -0.43 
6 ARG 185 M . ? ARG 184 M PRO 186 M ? PRO 185 M 1 -1.05 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 4 ? 
B  ? 6 ? 
C  ? 2 ? 
D  ? 5 ? 
E  ? 5 ? 
F  ? 8 ? 
G  ? 2 ? 
H  ? 2 ? 
I  ? 2 ? 
J  ? 4 ? 
K  ? 2 ? 
L  ? 5 ? 
M  ? 3 ? 
N  ? 3 ? 
O  ? 4 ? 
P  ? 3 ? 
Q  ? 4 ? 
R  ? 5 ? 
S  ? 5 ? 
T  ? 3 ? 
U  ? 2 ? 
V  ? 3 ? 
W  ? 2 ? 
X  ? 2 ? 
Y  ? 6 ? 
Z  ? 4 ? 
AA ? 2 ? 
AB ? 2 ? 
AC ? 3 ? 
AD ? 4 ? 
AE ? 4 ? 
AF ? 4 ? 
AG ? 3 ? 
AH ? 2 ? 
AI ? 2 ? 
AJ ? 3 ? 
AK ? 3 ? 
AL ? 2 ? 
AM ? 2 ? 
AN ? 4 ? 
AO ? 6 ? 
AP ? 2 ? 
AQ ? 5 ? 
AR ? 4 ? 
AS ? 2 ? 
AT ? 2 ? 
AU ? 4 ? 
AV ? 2 ? 
AW ? 2 ? 
AX ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
A  3 4 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? anti-parallel 
B  3 4 ? anti-parallel 
B  4 5 ? anti-parallel 
B  5 6 ? anti-parallel 
C  1 2 ? parallel      
D  1 2 ? anti-parallel 
D  2 3 ? anti-parallel 
D  3 4 ? anti-parallel 
D  4 5 ? anti-parallel 
E  1 2 ? anti-parallel 
E  2 3 ? anti-parallel 
E  3 4 ? anti-parallel 
E  4 5 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
F  4 5 ? anti-parallel 
F  5 6 ? anti-parallel 
F  6 7 ? anti-parallel 
F  7 8 ? anti-parallel 
G  1 2 ? anti-parallel 
H  1 2 ? anti-parallel 
I  1 2 ? anti-parallel 
J  1 2 ? parallel      
J  2 3 ? parallel      
J  3 4 ? parallel      
K  1 2 ? anti-parallel 
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
L  3 4 ? anti-parallel 
L  4 5 ? anti-parallel 
M  1 2 ? anti-parallel 
M  2 3 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? anti-parallel 
O  1 2 ? anti-parallel 
O  2 3 ? anti-parallel 
O  3 4 ? anti-parallel 
P  1 2 ? anti-parallel 
P  2 3 ? anti-parallel 
Q  1 2 ? anti-parallel 
Q  2 3 ? anti-parallel 
Q  3 4 ? parallel      
R  1 2 ? anti-parallel 
R  2 3 ? anti-parallel 
R  3 4 ? anti-parallel 
R  4 5 ? anti-parallel 
S  1 2 ? anti-parallel 
S  2 3 ? anti-parallel 
S  3 4 ? anti-parallel 
S  4 5 ? anti-parallel 
T  1 2 ? anti-parallel 
T  2 3 ? anti-parallel 
U  1 2 ? parallel      
V  1 2 ? parallel      
V  2 3 ? parallel      
W  1 2 ? anti-parallel 
X  1 2 ? anti-parallel 
Y  1 2 ? anti-parallel 
Y  2 3 ? anti-parallel 
Y  3 4 ? anti-parallel 
Y  4 5 ? anti-parallel 
Y  5 6 ? parallel      
Z  1 2 ? anti-parallel 
Z  2 3 ? parallel      
Z  3 4 ? anti-parallel 
AA 1 2 ? parallel      
AB 1 2 ? parallel      
AC 1 2 ? parallel      
AC 2 3 ? parallel      
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AD 3 4 ? anti-parallel 
AE 1 2 ? anti-parallel 
AE 2 3 ? anti-parallel 
AE 3 4 ? parallel      
AF 1 2 ? parallel      
AF 2 3 ? parallel      
AF 3 4 ? parallel      
AG 1 2 ? parallel      
AG 2 3 ? parallel      
AH 1 2 ? anti-parallel 
AI 1 2 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AJ 2 3 ? anti-parallel 
AK 1 2 ? anti-parallel 
AK 2 3 ? anti-parallel 
AL 1 2 ? anti-parallel 
AM 1 2 ? anti-parallel 
AN 1 2 ? anti-parallel 
AN 2 3 ? anti-parallel 
AN 3 4 ? anti-parallel 
AO 1 2 ? anti-parallel 
AO 2 3 ? parallel      
AO 3 4 ? anti-parallel 
AO 4 5 ? anti-parallel 
AO 5 6 ? anti-parallel 
AP 1 2 ? anti-parallel 
AQ 1 2 ? anti-parallel 
AQ 2 3 ? anti-parallel 
AQ 3 4 ? anti-parallel 
AQ 4 5 ? parallel      
AR 1 2 ? anti-parallel 
AR 2 3 ? anti-parallel 
AR 3 4 ? parallel      
AS 1 2 ? anti-parallel 
AT 1 2 ? parallel      
AU 1 2 ? anti-parallel 
AU 2 3 ? anti-parallel 
AU 3 4 ? anti-parallel 
AV 1 2 ? anti-parallel 
AW 1 2 ? parallel      
AX 1 2 ? anti-parallel 
AX 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 ASP A  65  ? ILE A  69  ? ASP A 64  ILE A 68  
A  2 PRO A  55  ? PHE A  61  ? PRO A 54  PHE A 60  
A  3 ALA A  40  ? HIS A  48  ? ALA A 39  HIS A 47  
A  4 GLU A  80  ? GLN A  82  ? GLU A 79  GLN A 81  
B  1 THR A  94  ? PRO A  96  ? THR A 93  PRO A 95  
B  2 ARG A  154 ? ILE A  157 ? ARG A 153 ILE A 156 
B  3 VAL A  104 ? CYS A  107 ? VAL A 103 CYS A 106 
B  4 ALA A  127 ? THR A  131 ? ALA A 126 THR A 130 
B  5 ALA A  137 ? LYS A  140 ? ALA A 136 LYS A 139 
B  6 MET A  146 ? LEU A  149 ? MET A 145 LEU A 148 
C  1 SER A  215 ? ILE A  216 ? SER A 214 ILE A 215 
C  2 ASP A  228 ? ILE A  229 ? ASP A 227 ILE A 228 
D  1 GLY B  38  ? VAL B  39  ? GLY B 37  VAL B 38  
D  2 VAL B  162 ? GLY B  168 ? VAL B 161 GLY B 167 
D  3 LEU B  138 ? HIS B  146 ? LEU B 137 HIS B 145 
D  4 MET B  80  ? THR B  91  ? MET B 79  THR B 90  
D  5 GLY B  94  ? VAL B  101 ? GLY B 93  VAL B 100 
E  1 GLY B  38  ? VAL B  39  ? GLY B 37  VAL B 38  
E  2 VAL B  162 ? GLY B  168 ? VAL B 161 GLY B 167 
E  3 LEU B  138 ? HIS B  146 ? LEU B 137 HIS B 145 
E  4 MET B  80  ? THR B  91  ? MET B 79  THR B 90  
E  5 GLU B  188 ? HIS B  189 ? GLU B 187 HIS B 188 
F  1 TYR B  330 ? VAL B  331 ? TYR B 329 VAL B 330 
F  2 PHE B  42  ? VAL B  53  ? PHE B 41  VAL B 52  
F  3 LEU B  309 ? PRO B  314 ? LEU B 308 PRO B 313 
F  4 TYR B  200 ? VAL B  206 ? TYR B 199 VAL B 205 
F  5 GLN B  262 ? GLY B  276 ? GLN B 261 GLY B 275 
F  6 GLY B  293 ? LYS B  299 ? GLY B 292 LYS B 298 
F  7 THR B  69  ? GLU B  76  ? THR B 68  GLU B 75  
F  8 PHE B  42  ? VAL B  53  ? PHE B 41  VAL B 52  
G  1 GLY B  209 ? GLN B  213 ? GLY B 208 GLN B 212 
G  2 GLY B  256 ? GLY B  259 ? GLY B 255 GLY B 258 
H  1 GLN C  2   ? ASP C  7   ? GLN C 2   ASP C 7   
H  2 ASN C  11  ? ASP C  17  ? ASN C 11  ASP C 17  
I  1 GLU C  59  ? SER C  60  ? GLU C 59  SER C 60  
I  2 PRO C  71  ? LYS C  72  ? PRO C 71  LYS C 72  
J  1 VAL C  138 ? VAL C  140 ? VAL C 138 VAL C 140 
J  2 THR C  233 ? THR C  236 ? THR C 233 THR C 236 
J  3 LEU C  193 ? THR C  196 ? LEU C 193 THR C 196 
J  4 ASP C  211 ? THR C  214 ? ASP C 211 THR C 214 
K  1 LYS C  173 ? ILE C  174 ? LYS C 173 ILE C 174 
K  2 TYR C  186 ? ARG C  187 ? TYR C 186 ARG C 187 
L  1 VAL D  51  ? THR D  53  ? VAL D 50  THR D 52  
L  2 GLY D  71  ? LEU D  76  ? GLY D 70  LEU D 75  
L  3 ILE D  19  ? HIS D  25  ? ILE D 18  HIS D 24  
L  4 ASP D  130 ? LEU D  135 ? ASP D 129 LEU D 134 
L  5 PHE D  105 ? PHE D  107 ? PHE D 104 PHE D 106 
M  1 ARG E  3   ? GLU E  7   ? ARG E 2   GLU E 6   
M  2 THR E  47  ? GLU E  51  ? THR E 46  GLU E 50  
M  3 ASP E  40  ? VAL E  43  ? ASP E 39  VAL E 42  
N  1 ASP E  13  ? ASP E  17  ? ASP E 12  ASP E 16  
N  2 ASP E  20  ? GLY E  25  ? ASP E 19  GLY E 24  
N  3 GLY E  28  ? ARG E  33  ? GLY E 27  ARG E 32  
O  1 ASP E  124 ? ASP E  128 ? ASP E 123 ASP E 127 
O  2 GLU E  131 ? GLY E  136 ? GLU E 130 GLY E 135 
O  3 TRP E  81  ? PHE E  88  ? TRP E 80  PHE E 87  
O  4 GLY E  166 ? ARG E  171 ? GLY E 165 ARG E 170 
P  1 GLN E  95  ? VAL E  98  ? GLN E 94  VAL E 97  
P  2 GLU E  102 ? GLU E  106 ? GLU E 101 GLU E 105 
P  3 ARG E  115 ? THR E  118 ? ARG E 114 THR E 117 
Q  1 LYS F  31  ? LYS F  32  ? LYS F 30  LYS F 31  
Q  2 ALA F  96  ? ALA F  98  ? ALA F 95  ALA F 97  
Q  3 VAL F  49  ? ALA F  52  ? VAL F 48  ALA F 51  
Q  4 PHE F  75  ? VAL F  78  ? PHE F 74  VAL F 77  
R  1 LYS H  35  ? GLY H  37  ? LYS H 35  GLY H 37  
R  2 LYS H  87  ? THR H  89  ? LYS H 87  THR H 89  
R  3 GLN H  135 ? CYS H  141 ? GLN H 135 CYS H 141 
R  4 VAL H  48  ? VAL H  54  ? VAL H 48  VAL H 54  
R  5 CYS H  164 ? ARG H  165 ? CYS H 164 ARG H 165 
S  1 LYS H  35  ? GLY H  37  ? LYS H 35  GLY H 37  
S  2 LYS H  87  ? THR H  89  ? LYS H 87  THR H 89  
S  3 GLN H  135 ? CYS H  141 ? GLN H 135 CYS H 141 
S  4 VAL H  48  ? VAL H  54  ? VAL H 48  VAL H 54  
S  5 VAL H  168 ? ARG H  170 ? VAL H 168 ARG H 170 
T  1 VAL H  58  ? ARG H  61  ? VAL H 58  ARG H 61  
T  2 LYS H  122 ? VAL H  130 ? LYS H 122 VAL H 130 
T  3 GLN H  96  ? GLU H  100 ? GLN H 96  GLU H 100 
U  1 ASP I  95  ? LEU I  96  ? ASP I 94  LEU I 95  
U  2 THR I  134 ? ILE I  135 ? THR I 133 ILE I 134 
V  1 VAL J  10  ? ASP J  13  ? VAL J 10  ASP J 13  
V  2 VAL J  36  ? VAL J  39  ? VAL J 36  VAL J 39  
V  3 VAL J  101 ? VAL J  103 ? VAL J 101 VAL J 103 
W  1 VAL J  45  ? THR J  47  ? VAL J 45  THR J 47  
W  2 PHE J  129 ? THR J  131 ? PHE J 129 THR J 131 
X  1 LEU K  12  ? GLU K  13  ? LEU K 12  GLU K 13  
X  2 LYS K  46  ? ALA K  47  ? LYS K 46  ALA K 47  
Y  1 LEU K  17  ? CYS K  20  ? LEU K 17  CYS K 20  
Y  2 ALA K  26  ? VAL K  34  ? ALA K 26  VAL K 34  
Y  3 LYS K  52  ? GLY K  60  ? LYS K 52  GLY K 60  
Y  4 VAL K  68  ? ARG K  75  ? VAL K 68  ARG K 75  
Y  5 ALA K  94  ? VAL K  98  ? ALA K 94  VAL K 98  
Y  6 LEU K  17  ? CYS K  20  ? LEU K 17  CYS K 20  
Z  1 ILE K  80  ? ARG K  81  ? ILE K 80  ARG K 81  
Z  2 ARG K  87  ? PHE K  90  ? ARG K 87  PHE K 90  
Z  3 THR U  20  ? VAL U  23  ? THR U 19  VAL U 22  
Z  4 THR U  29  ? PHE U  32  ? THR U 28  PHE U 31  
AA 1 PRO K  112 ? ALA K  114 ? PRO K 112 ALA K 114 
AA 2 MET K  130 ? VAL K  132 ? MET K 130 VAL K 132 
AB 1 ALA L  62  ? ASP L  66  ? ALA L 61  ASP L 65  
AB 2 TYR L  106 ? LEU L  110 ? TYR L 105 LEU L 109 
AC 1 ARG L  91  ? ASP L  93  ? ARG L 90  ASP L 92  
AC 2 THR L  120 ? ALA L  123 ? THR L 119 ALA L 122 
AC 3 SER L  140 ? LEU L  143 ? SER L 139 LEU L 142 
AD 1 VAL M  38  ? ILE M  41  ? VAL M 37  ILE M 40  
AD 2 VAL M  61  ? ARG M  69  ? VAL M 60  ARG M 68  
AD 3 GLN M  127 ? ILE M  135 ? GLN M 126 ILE M 134 
AD 4 ARG M  114 ? ASP M  124 ? ARG M 113 ASP M 123 
AE 1 ASP N  57  ? HIS N  63  ? ASP N 56  HIS N 62  
AE 2 VAL N  44  ? THR N  50  ? VAL N 43  THR N 49  
AE 3 ARG N  34  ? LYS N  39  ? ARG N 33  LYS N 38  
AE 4 VAL N  102 ? ASP N  104 ? VAL N 101 ASP N 103 
AF 1 ALA O  42  ? ASN O  45  ? ALA O 41  ASN O 44  
AF 2 THR O  58  ? LEU O  66  ? THR O 57  LEU O 65  
AF 3 THR O  76  ? PHE O  82  ? THR O 75  PHE O 81  
AF 4 GLU O  95  ? ALA O  96  ? GLU O 94  ALA O 95  
AG 1 ALA O  42  ? ASN O  45  ? ALA O 41  ASN O 44  
AG 2 THR O  58  ? LEU O  66  ? THR O 57  LEU O 65  
AG 3 VAL O  112 ? VAL O  114 ? VAL O 111 VAL O 113 
AH 1 VAL P  22  ? PHE P  24  ? VAL P 21  PHE P 23  
AH 2 ILE P  50  ? ALA P  52  ? ILE P 49  ALA P 51  
AI 1 VAL Q  40  ? LEU Q  42  ? VAL Q 39  LEU Q 41  
AI 2 LEU Q  92  ? ARG Q  94  ? LEU Q 91  ARG Q 93  
AJ 1 THR Q  63  ? GLN Q  68  ? THR Q 62  GLN Q 67  
AJ 2 ALA Q  71  ? ASP Q  78  ? ALA Q 70  ASP Q 77  
AJ 3 LYS Q  81  ? VAL Q  87  ? LYS Q 80  VAL Q 86  
AK 1 THR R  14  ? GLN R  23  ? THR R 13  GLN R 22  
AK 2 SER R  139 ? GLU R  149 ? SER R 138 GLU R 148 
AK 3 THR R  111 ? GLN R  123 ? THR R 110 GLN R 122 
AL 1 VAL R  58  ? PRO R  59  ? VAL R 57  PRO R 58  
AL 2 GLY R  79  ? ARG R  80  ? GLY R 78  ARG R 79  
AM 1 ARG R  126 ? PRO R  128 ? ARG R 125 PRO R 127 
AM 2 ALA R  134 ? ALA R  136 ? ALA R 133 ALA R 135 
AN 1 ILE S  6   ? PRO S  9   ? ILE S 5   PRO S 8   
AN 2 LYS S  24  ? VAL S  29  ? LYS S 23  VAL S 28  
AN 3 LYS S  63  ? LEU S  69  ? LYS S 62  LEU S 68  
AN 4 VAL S  50  ? ASN S  57  ? VAL S 49  ASN S 56  
AO 1 ASN T  40  ? ARG T  42  ? ASN T 39  ARG T 41  
AO 2 ARG T  25  ? LEU T  28  ? ARG T 24  LEU T 27  
AO 3 VAL T  97  ? ASP T  101 ? VAL T 96  ASP T 100 
AO 4 THR T  48  ? VAL T  51  ? THR T 47  VAL T 50  
AO 5 GLU T  60  ? ASP T  67  ? GLU T 59  ASP T 66  
AO 6 VAL T  72  ? VAL T  75  ? VAL T 71  VAL T 74  
AP 1 THR T  79  ? GLU T  81  ? THR T 78  GLU T 80  
AP 2 GLU T  87  ? PRO T  89  ? GLU T 86  PRO T 88  
AQ 1 THR W  115 ? ARG W  117 ? THR W 115 ARG W 117 
AQ 2 HIS W  31  ? VAL W  35  ? HIS W 31  VAL W 35  
AQ 3 HIS W  2   ? GLN W  6   ? HIS W 2   GLN W 6   
AQ 4 VAL W  52  ? GLY W  55  ? VAL W 52  GLY W 55  
AQ 5 GLY W  139 ? HIS W  141 ? GLY W 139 HIS W 141 
AR 1 ARG X  9   ? THR X  12  ? ARG X 8   THR X 11  
AR 2 ARG X  72  ? PHE X  78  ? ARG X 71  PHE X 77  
AR 3 GLU X  83  ? GLU X  87  ? GLU X 82  GLU X 86  
AR 4 ARG X  50  ? LEU X  51  ? ARG X 49  LEU X 50  
AS 1 GLU Y  97  ? ALA Y  100 ? GLU Y 96  ALA Y 99  
AS 2 TYR Y  234 ? VAL Y  237 ? TYR Y 233 VAL Y 236 
AT 1 GLU Y  184 ? VAL Y  188 ? GLU Y 183 VAL Y 187 
AT 2 GLU Y  202 ? ILE Y  206 ? GLU Y 201 ILE Y 205 
AU 1 HIS Z  61  ? ALA Z  62  ? HIS Z 61  ALA Z 62  
AU 2 ASP Z  69  ? ARG Z  73  ? ASP Z 69  ARG Z 73  
AU 3 ILE Z  78  ? CYS Z  81  ? ILE Z 78  CYS Z 81  
AU 4 LYS Z  87  ? THR Z  89  ? LYS Z 87  THR Z 89  
AV 1 HIS AA 17  ? THR AA 18  ? HIS 1 16  THR 1 17  
AV 2 TYR AA 28  ? HIS AA 29  ? TYR 1 27  HIS 1 28  
AW 1 GLN CA 2   ? PRO CA 4   ? GLN 3 2   PRO 3 4   
AW 2 GLU CA 89  ? GLN CA 91  ? GLU 3 89  GLN 3 91  
AX 1 ARG CA 6   ? CYS CA 11  ? ARG 3 6   CYS 3 11  
AX 2 GLU CA 16  ? LYS CA 24  ? GLU 3 16  LYS 3 24  
AX 3 LEU CA 67  ? CYS CA 71  ? LEU 3 67  CYS 3 71  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 O ASP A  65  ? O ASP A 64  N PHE A  61  ? N PHE A 60  
A  2 3 O VAL A  56  ? O VAL A 55  N GLU A  47  ? N GLU A 46  
A  3 4 N GLY A  41  ? N GLY A 40  O LEU A  81  ? O LEU A 80  
B  1 2 N LEU A  95  ? N LEU A 94  O ALA A  155 ? O ALA A 154 
B  2 3 O THR A  156 ? O THR A 155 N CYS A  107 ? N CYS A 106 
B  3 4 N VAL A  106 ? N VAL A 105 O ALA A  127 ? O ALA A 126 
B  4 5 N GLN A  128 ? N GLN A 127 O LYS A  140 ? O LYS A 139 
B  5 6 N ALA A  137 ? N ALA A 136 O LEU A  149 ? O LEU A 148 
C  1 2 N ILE A  216 ? N ILE A 215 O ASP A  228 ? O ASP A 227 
D  1 2 N GLY B  38  ? N GLY B 37  O GLY B  168 ? O GLY B 167 
D  2 3 O VAL B  167 ? O VAL B 166 N LEU B  141 ? N LEU B 140 
D  3 4 O GLY B  139 ? O GLY B 138 N TYR B  88  ? N TYR B 87  
D  4 5 N ALA B  87  ? N ALA B 86  O LEU B  98  ? O LEU B 97  
E  1 2 N GLY B  38  ? N GLY B 37  O GLY B  168 ? O GLY B 167 
E  2 3 O VAL B  167 ? O VAL B 166 N LEU B  141 ? N LEU B 140 
E  3 4 O GLY B  139 ? O GLY B 138 N TYR B  88  ? N TYR B 87  
E  4 5 N MET B  80  ? N MET B 79  O HIS B  189 ? O HIS B 188 
F  1 2 O TYR B  330 ? O TYR B 329 N VAL B  53  ? N VAL B 52  
F  2 3 N PHE B  42  ? N PHE B 41  O PHE B  312 ? O PHE B 311 
F  3 4 O ARG B  313 ? O ARG B 312 N ASP B  202 ? N ASP B 201 
F  4 5 N ALA B  201 ? N ALA B 200 O LYS B  268 ? O LYS B 267 
F  5 6 N ASP B  272 ? N ASP B 271 O LEU B  297 ? O LEU B 296 
F  6 7 O THR B  296 ? O THR B 295 N ILE B  75  ? N ILE B 74  
F  7 8 O VAL B  72  ? O VAL B 71  N THR B  50  ? N THR B 49  
G  1 2 N LYS B  210 ? N LYS B 209 O THR B  258 ? O THR B 257 
H  1 2 N ALA C  3   ? N ALA C 3   O VAL C  16  ? O VAL C 16  
I  1 2 N GLU C  59  ? N GLU C 59  O LYS C  72  ? O LYS C 72  
J  1 2 N VAL C  138 ? N VAL C 138 O PHE C  235 ? O PHE C 235 
J  2 3 O VAL C  234 ? O VAL C 234 N VAL C  195 ? N VAL C 195 
J  3 4 N PHE C  194 ? N PHE C 194 O ALA C  213 ? O ALA C 213 
K  1 2 N LYS C  173 ? N LYS C 173 O ARG C  187 ? O ARG C 187 
L  1 2 N VAL D  51  ? N VAL D 50  O LYS D  73  ? O LYS D 72  
L  2 3 O LEU D  76  ? O LEU D 75  N VAL D  22  ? N VAL D 21  
L  3 4 N LYS D  21  ? N LYS D 20  O ASN D  134 ? O ASN D 133 
L  4 5 O VAL D  131 ? O VAL D 130 N PHE D  107 ? N PHE D 106 
M  1 2 N LEU E  6   ? N LEU E 5   O VAL E  48  ? O VAL E 47  
M  2 3 O VAL E  49  ? O VAL E 48  N SER E  42  ? N SER E 41  
N  1 2 N GLU E  15  ? N GLU E 14  O THR E  22  ? O THR E 21  
N  2 3 N VAL E  23  ? N VAL E 22  O VAL E  30  ? O VAL E 29  
O  1 2 N ASP E  124 ? N ASP E 123 O SER E  135 ? O SER E 134 
O  2 3 O VAL E  134 ? O VAL E 133 N TYR E  83  ? N TYR E 82  
O  3 4 N GLY E  84  ? N GLY E 83  O THR E  170 ? O THR E 169 
P  1 2 N ASN E  97  ? N ASN E 96  O VAL E  104 ? O VAL E 103 
P  2 3 N ILE E  105 ? N ILE E 104 O ARG E  115 ? O ARG E 114 
Q  1 2 N LYS F  31  ? N LYS F 30  O ALA F  98  ? O ALA F 97  
Q  2 3 O ALA F  97  ? O ALA F 96  N PHE F  50  ? N PHE F 49  
Q  3 4 N VAL F  49  ? N VAL F 48  O ILE F  76  ? O ILE F 75  
R  1 2 N MET H  36  ? N MET H 36  O MET H  88  ? O MET H 88  
R  2 3 N THR H  89  ? N THR H 89  O THR H  138 ? O THR H 138 
R  3 4 O PHE H  137 ? O PHE H 137 N LEU H  52  ? N LEU H 52  
R  4 5 N ILE H  53  ? N ILE H 53  O ARG H  165 ? O ARG H 165 
S  1 2 N MET H  36  ? N MET H 36  O MET H  88  ? O MET H 88  
S  2 3 N THR H  89  ? N THR H 89  O THR H  138 ? O THR H 138 
S  3 4 O PHE H  137 ? O PHE H 137 N LEU H  52  ? N LEU H 52  
S  4 5 N GLN H  49  ? N GLN H 49  O GLU H  169 ? O GLU H 169 
T  1 2 N VAL H  58  ? N VAL H 58  O VAL H  130 ? O VAL H 130 
T  2 3 O ALA H  127 ? O ALA H 127 N GLN H  96  ? N GLN H 96  
U  1 2 N LEU I  96  ? N LEU I 95  O THR I  134 ? O THR I 133 
V  1 2 N VAL J  12  ? N VAL J 12  O VAL J  39  ? O VAL J 39  
V  2 3 N VAL J  38  ? N VAL J 38  O ARG J  102 ? O ARG J 102 
W  1 2 N ILE J  46  ? N ILE J 46  O VAL J  130 ? O VAL J 130 
X  1 2 N LEU K  12  ? N LEU K 12  O ALA K  47  ? O ALA K 47  
Y  1 2 N ILE K  18  ? N ILE K 18  O LEU K  29  ? O LEU K 29  
Y  2 3 N ILE K  32  ? N ILE K 32  O THR K  54  ? O THR K 54  
Y  3 4 N VAL K  55  ? N VAL K 55  O LEU K  69  ? O LEU K 69  
Y  4 5 N ARG K  75  ? N ARG K 75  O ALA K  94  ? O ALA K 94  
Y  5 6 O ALA K  95  ? O ALA K 95  N THR K  19  ? N THR K 19  
Z  1 2 N ILE K  80  ? N ILE K 80  O VAL K  88  ? O VAL K 88  
Z  2 3 N LYS K  89  ? N LYS K 89  O VAL U  23  ? O VAL U 22  
Z  3 4 N PHE U  22  ? N PHE U 21  O THR U  30  ? O THR U 29  
AA 1 2 N ILE K  113 ? N ILE K 113 O VAL K  132 ? O VAL K 132 
AB 1 2 N ILE L  65  ? N ILE L 64  O LEU L  110 ? O LEU L 109 
AC 1 2 N VAL L  92  ? N VAL L 91  O THR L  120 ? O THR L 119 
AC 2 3 N LEU L  121 ? N LEU L 120 O GLU L  142 ? O GLU L 141 
AD 1 2 N ILE M  41  ? N ILE M 40  O VAL M  63  ? O VAL M 62  
AD 2 3 N ALA M  64  ? N ALA M 63  O VAL M  132 ? O VAL M 131 
AD 3 4 O ILE M  133 ? O ILE M 132 N ASN M  117 ? N ASN M 116 
AE 1 2 O ASP N  57  ? O ASP N 56  N THR N  50  ? N THR N 49  
AE 2 3 O VAL N  49  ? O VAL N 48  N ARG N  34  ? N ARG N 33  
AE 3 4 N ALA N  37  ? N ALA N 36  O ASP N  104 ? O ASP N 103 
AF 1 2 N VAL O  44  ? N VAL O 43  O LEU O  66  ? O LEU O 65  
AF 2 3 N VAL O  59  ? N VAL O 58  O ALA O  78  ? O ALA O 77  
AF 3 4 O VAL O  77  ? O VAL O 76  N GLU O  95  ? N GLU O 94  
AG 1 2 N VAL O  44  ? N VAL O 43  O LEU O  66  ? O LEU O 65  
AG 2 3 N VAL O  60  ? N VAL O 59  O ARG O  113 ? O ARG O 112 
AH 1 2 N TRP P  23  ? N TRP P 22  O GLN P  51  ? O GLN P 50  
AI 1 2 N HIS Q  41  ? N HIS Q 40  O ARG Q  93  ? O ARG Q 92  
AJ 1 2 N GLU Q  65  ? N GLU Q 64  O LYS Q  73  ? O LYS Q 72  
AJ 2 3 N VAL Q  74  ? N VAL Q 73  O ILE Q  85  ? O ILE Q 84  
AK 1 2 N ARG R  22  ? N ARG R 21  O VAL R  142 ? O VAL R 141 
AK 2 3 O GLN R  141 ? O GLN R 140 N GLY R  121 ? N GLY R 120 
AL 1 2 N VAL R  58  ? N VAL R 57  O ARG R  80  ? O ARG R 79  
AM 1 2 N LYS R  127 ? N LYS R 126 O SER R  135 ? O SER R 134 
AN 1 2 N HIS S  8   ? N HIS S 7   O ALA S  28  ? O ALA S 27  
AN 2 3 N VAL S  29  ? N VAL S 28  O LYS S  63  ? O LYS S 62  
AN 3 4 O ARG S  68  ? O ARG S 67  N GLU S  51  ? N GLU S 50  
AO 1 2 O VAL T  41  ? O VAL T 40  N ALA T  26  ? N ALA T 25  
AO 2 3 N THR T  27  ? N THR T 26  O VAL T  99  ? O VAL T 98  
AO 3 4 O THR T  100 ? O THR T 99  N THR T  48  ? N THR T 47  
AO 4 5 N VAL T  49  ? N VAL T 48  O GLY T  61  ? O GLY T 60  
AO 5 6 N ASN T  65  ? N ASN T 64  O HIS T  74  ? O HIS T 73  
AP 1 2 N LEU T  80  ? N LEU T 79  O VAL T  88  ? O VAL T 87  
AQ 1 2 O LEU W  116 ? O LEU W 116 N CYS W  32  ? N CYS W 32  
AQ 2 3 O THR W  33  ? O THR W 33  N LEU W  4   ? N LEU W 4   
AQ 3 4 N ALA W  3   ? N ALA W 3   O GLY W  55  ? O GLY W 55  
AQ 4 5 N VAL W  52  ? N VAL W 52  O GLY W  139 ? O GLY W 139 
AR 1 2 N VAL X  11  ? N VAL X 10  O VAL X  73  ? O VAL X 72  
AR 2 3 N PHE X  78  ? N PHE X 77  O GLU X  83  ? O GLU X 82  
AR 3 4 O ALA X  84  ? O ALA X 83  N ARG X  50  ? N ARG X 49  
AS 1 2 N GLN Y  99  ? N GLN Y 98  O VAL Y  235 ? O VAL Y 234 
AT 1 2 N VAL Y  186 ? N VAL Y 185 O ARG Y  205 ? O ARG Y 204 
AU 1 2 N HIS Z  61  ? N HIS Z 61  O VAL Z  71  ? O VAL Z 71  
AU 2 3 N ASP Z  72  ? N ASP Z 72  O GLN Z  80  ? O GLN Z 80  
AU 3 4 N TRP Z  79  ? N TRP Z 79  O PHE Z  88  ? O PHE Z 88  
AV 1 2 N THR AA 18  ? N THR 1 17  O TYR AA 28  ? O TYR 1 27  
AW 1 2 N MET CA 3   ? N MET 3 3   O GLN CA 91  ? O GLN 3 91  
AX 1 2 N PHE CA 7   ? N PHE 3 7   O HIS CA 20  ? O HIS 3 20  
AX 2 3 N GLU CA 23  ? N GLU 3 23  O LYS CA 68  ? O LYS 3 68  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE PHE 6 77' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ACA 6 78' 
AC3 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 08001' 
AC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A8025' 
AC5 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 08002' 
AC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A8044' 
AC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 08003' 
AC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 08004' 
AC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 08005' 
BC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 08006' 
BC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 08007' 
BC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 08008' 
BC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG B8043' 
BC5 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 08009' 
BC6 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 08010' 
BC7 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE MG 08011' 
BC8 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG C8012' 
BC9 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 08013' 
CC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 08014' 
CC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG 08015' 
CC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 08016' 
CC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE NA H8518' 
CC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG 08017' 
CC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SR H8907' 
CC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG 08018' 
CC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 08019' 
CC9 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL J8816' 
DC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 08020' 
DC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 08021' 
DC3 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE MG 08022' 
DC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 08023' 
DC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG 08024' 
DC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG 08026' 
DC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG 08027' 
DC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 08028' 
DC9 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG 08029' 
EC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG 08030' 
EC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG 08031' 
EC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG 08032' 
EC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 08033' 
EC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG 08034' 
EC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG 08035' 
EC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG 08036' 
EC8 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG 08037' 
EC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG 08039' 
FC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SR T8911' 
FC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MG 08040' 
FC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SR T8939' 
FC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 08041' 
FC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SR Y9002' 
FC6 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MG 08045' 
FC7 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 08046' 
FC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 08047' 
FC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG 08048' 
GC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG 08049' 
GC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 08050' 
GC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 08052' 
GC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG 08053' 
GC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG 08055' 
GC6 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SR 38953' 
GC7 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 08056' 
GC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 08058' 
GC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 08059' 
HC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 08061' 
HC2 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE MG 08062' 
HC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG 08063' 
HC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG 08064' 
HC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 08065' 
HC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG 08066' 
HC7 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 08067' 
HC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG 08068' 
HC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG 08069' 
IC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG 08070' 
IC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 08071' 
IC3 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 08072' 
IC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG 08073' 
IC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 08075' 
IC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG 08076' 
IC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 08077' 
IC8 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG 08078' 
IC9 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG 08079' 
JC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG 08080' 
JC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG 08081' 
JC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG 08082' 
JC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 08083' 
JC5 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 08084' 
JC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG 08085' 
JC7 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE MG 08087' 
JC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 08088' 
JC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 08089' 
KC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 08090' 
KC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG 08091' 
KC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG 08092' 
KC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG 08093' 
KC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE K 08401'  
KC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE K 08402'  
KC7 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA 08501' 
KC8 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 08502' 
KC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 08504' 
LC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 08505' 
LC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 08506' 
LC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 08507' 
LC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA 08508' 
LC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA 08509' 
LC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 08511' 
LC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 08512' 
LC8 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA 08513' 
LC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 08514' 
MC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 08515' 
MC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 08516' 
MC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 08517' 
MC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 08519' 
MC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 08520' 
MC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 08521' 
MC7 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA 08522' 
MC8 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 08523' 
MC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 08524' 
NC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA 08525' 
NC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 08526' 
NC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 08527' 
NC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 08528' 
NC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 08529' 
NC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 08530' 
NC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 08531' 
NC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 08533' 
NC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 08534' 
OC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 08535' 
OC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 08536' 
OC3 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE NA 08537' 
OC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 08541' 
OC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA 08542' 
OC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 08545' 
OC7 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA 08546' 
OC8 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 08547' 
OC9 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA 08548' 
PC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 08549' 
PC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 08550' 
PC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 08551' 
PC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA 08552' 
PC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA 08553' 
PC6 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE NA 08554' 
PC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 08555' 
PC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 08556' 
PC9 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA 08557' 
QC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 08558' 
QC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 08559' 
QC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 08560' 
QC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE NA 08561' 
QC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE NA 08562' 
QC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 08563' 
QC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 08564' 
QC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 08565' 
QC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 08566' 
RC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 08567' 
RC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 08568' 
RC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 08569' 
RC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 08570' 
RC5 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE NA 08571' 
RC6 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE NA 08573' 
RC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 08574' 
RC8 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 08575' 
RC9 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL 08803' 
SC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL 08805' 
SC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL 08812' 
SC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CL 08813' 
SC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL 08815' 
SC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL 08822' 
SC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SR 08901' 
SC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SR 08902' 
SC8 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SR 08903' 
SC9 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SR 08904' 
TC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SR 08905' 
TC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SR 08906' 
TC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SR 08908' 
TC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SR 08909' 
TC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SR 08910' 
TC6 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SR 08915' 
TC7 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SR 08916' 
TC8 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SR 08917' 
TC9 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SR 08918' 
UC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SR 08919' 
UC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE SR 08920' 
UC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SR 08921' 
UC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE SR 08922' 
UC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SR 08923' 
UC6 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SR 08924' 
UC7 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE SR 08925' 
UC8 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SR 08926' 
UC9 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SR 08927' 
VC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SR 08928' 
VC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SR 08931' 
VC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SR 08933' 
VC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SR 08934' 
VC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SR 08935' 
VC6 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SR 08936' 
VC7 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE SR 08937' 
VC8 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SR 08940' 
VC9 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SR 08941' 
WC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SR 08942' 
WC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SR 08943' 
WC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SR 08944' 
WC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SR 08945' 
WC5 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE SR 08946' 
WC6 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE SR 08947' 
WC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SR 08948' 
WC8 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SR 08949' 
WC9 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE SR 08951' 
XC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SR 08954' 
XC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SR 08955' 
XC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SR 08956' 
XC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SR 08957' 
XC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SR 08958' 
XC6 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE SR 08959' 
XC7 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE SR 08960' 
XC8 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SR 08961' 
XC9 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SR 08962' 
YC1 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE SR 08963' 
YC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE SR 08964' 
YC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SR 08965' 
YC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SR 08966' 
YC5 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE SR 08967' 
YC6 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SR 08970' 
YC7 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE SR 08973' 
YC8 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE SR 08974' 
YC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SR 08975' 
ZC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SR 08978' 
ZC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SR 08979' 
ZC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SR 08981' 
ZC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SR 08982' 
ZC5 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE SR 08983' 
ZC6 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SR 08984' 
ZC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SR 08985' 
ZC8 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SR 08986' 
ZC9 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE SR 08988' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 4 A   DA 2486 ? A   0 2486 . ? 1_555 ? 
2   AC1 4 U   DA 2620 ? U   0 2620 . ? 1_555 ? 
3   AC1 4 8AN GA 3    ? 8AN 6 76   . ? 1_555 ? 
4   AC1 4 ACA BM .    ? ACA 6 78   . ? 1_555 ? 
5   AC2 4 G   DA 2102 ? G   0 2102 . ? 1_555 ? 
6   AC2 4 A   DA 2486 ? A   0 2486 . ? 1_555 ? 
7   AC2 4 G   DA 2540 ? G   0 2540 . ? 1_555 ? 
8   AC2 4 PHE AM .    ? PHE 6 77   . ? 1_555 ? 
9   AC3 7 A   DA 2486 ? A   0 2486 . ? 1_555 ? 
10  AC3 7 C   DA 2487 ? C   0 2487 . ? 1_555 ? 
11  AC3 7 HOH FN .    ? HOH 0 3505 . ? 1_555 ? 
12  AC3 7 HOH FN .    ? HOH 0 3751 . ? 1_555 ? 
13  AC3 7 HOH FN .    ? HOH 0 5650 . ? 1_555 ? 
14  AC3 7 HOH FN .    ? HOH 0 7070 . ? 1_555 ? 
15  AC3 7 HOH FN .    ? HOH 0 9175 . ? 1_555 ? 
16  AC4 6 U   DA 2115 ? U   0 2115 . ? 1_555 ? 
17  AC4 6 HOH FN .    ? HOH 0 3905 . ? 1_555 ? 
18  AC4 6 HOH FN .    ? HOH 0 4617 . ? 1_555 ? 
19  AC4 6 HOH FN .    ? HOH 0 5076 . ? 1_555 ? 
20  AC4 6 ALA A  197  ? ALA A 196  . ? 1_555 ? 
21  AC4 6 HOH CM .    ? HOH A 9110 . ? 1_555 ? 
22  AC5 7 G   DA 627  ? G   0 627  . ? 1_555 ? 
23  AC5 7 A   DA 2483 ? A   0 2483 . ? 1_555 ? 
24  AC5 7 C   DA 2534 ? C   0 2534 . ? 1_555 ? 
25  AC5 7 U   DA 2535 ? U   0 2535 . ? 1_555 ? 
26  AC5 7 HOH FN .    ? HOH 0 3182 . ? 1_555 ? 
27  AC5 7 HOH FN .    ? HOH 0 9557 . ? 1_555 ? 
28  AC5 7 HOH FN .    ? HOH 0 9558 . ? 1_555 ? 
29  AC6 6 U   DA 1883 ? U   0 1883 . ? 1_555 ? 
30  AC6 6 U   DA 2012 ? U   0 2012 . ? 1_555 ? 
31  AC6 6 G   DA 2013 ? G   0 2013 . ? 1_555 ? 
32  AC6 6 HOH FN .    ? HOH 0 5889 . ? 1_555 ? 
33  AC6 6 HOH FN .    ? HOH 0 9683 . ? 1_555 ? 
34  AC6 6 GLN A  208  ? GLN A 207  . ? 1_555 ? 
35  AC7 6 A   DA 876  ? A   0 876  . ? 1_555 ? 
36  AC7 6 G   DA 877  ? G   0 877  . ? 1_555 ? 
37  AC7 6 A   DA 2624 ? A   0 2624 . ? 1_555 ? 
38  AC7 6 HOH FN .    ? HOH 0 4558 . ? 1_555 ? 
39  AC7 6 HOH CM .    ? HOH A 8979 . ? 1_555 ? 
40  AC7 6 HOH CM .    ? HOH A 9008 . ? 1_555 ? 
41  AC8 6 G   DA 456  ? G   0 456  . ? 1_555 ? 
42  AC8 6 A   DA 459  ? A   0 459  . ? 1_555 ? 
43  AC8 6 HOH FN .    ? HOH 0 2968 . ? 1_555 ? 
44  AC8 6 HOH FN .    ? HOH 0 3695 . ? 1_555 ? 
45  AC8 6 HOH FN .    ? HOH 0 4673 . ? 1_555 ? 
46  AC8 6 HOH FN .    ? HOH 0 9564 . ? 1_555 ? 
47  AC9 6 A   DA 1836 ? A   0 1836 . ? 1_555 ? 
48  AC9 6 G   DA 1837 ? G   0 1837 . ? 1_555 ? 
49  AC9 6 U   DA 1838 ? U   0 1838 . ? 1_555 ? 
50  AC9 6 A   DA 1839 ? A   0 1839 . ? 1_555 ? 
51  AC9 6 HOH FN .    ? HOH 0 4505 . ? 1_555 ? 
52  AC9 6 HOH FN .    ? HOH 0 9580 . ? 1_555 ? 
53  BC1 7 U   DA 919  ? U   0 919  . ? 1_555 ? 
54  BC1 7 C   DA 2464 ? C   0 2464 . ? 1_555 ? 
55  BC1 7 A   DA 2465 ? A   0 2465 . ? 1_555 ? 
56  BC1 7 HOH FN .    ? HOH 0 3460 . ? 1_555 ? 
57  BC1 7 HOH FN .    ? HOH 0 4522 . ? 1_555 ? 
58  BC1 7 HOH FN .    ? HOH 0 9573 . ? 1_555 ? 
59  BC1 7 HOH FN .    ? HOH 0 9652 . ? 1_555 ? 
60  BC2 6 U   DA 2610 ? U   0 2610 . ? 1_555 ? 
61  BC2 6 G   DA 2611 ? G   0 2611 . ? 1_555 ? 
62  BC2 6 A   DA 2612 ? A   0 2612 . ? 1_555 ? 
63  BC2 6 NA  EH .    ? NA  0 8549 . ? 1_555 ? 
64  BC2 6 HOH FN .    ? HOH 0 9250 . ? 1_555 ? 
65  BC2 6 HOH FN .    ? HOH 0 9574 . ? 1_555 ? 
66  BC3 6 G   DA 28   ? G   0 28   . ? 1_555 ? 
67  BC3 6 G   DA 1344 ? G   0 1344 . ? 1_555 ? 
68  BC3 6 HOH FN .    ? HOH 0 2960 . ? 1_555 ? 
69  BC3 6 HOH FN .    ? HOH 0 3551 . ? 1_555 ? 
70  BC3 6 HOH FN .    ? HOH 0 4540 . ? 1_555 ? 
71  BC3 6 HOH FN .    ? HOH 0 9653 . ? 1_555 ? 
72  BC4 6 C   DA 2720 ? C   0 2720 . ? 1_555 ? 
73  BC4 6 A   DA 2757 ? A   0 2757 . ? 1_555 ? 
74  BC4 6 HOH FN .    ? HOH 0 9636 . ? 1_555 ? 
75  BC4 6 ASN B  336  ? ASN B 335  . ? 1_555 ? 
76  BC4 6 GLY B  338  ? GLY B 337  . ? 1_555 ? 
77  BC4 6 HOH DM .    ? HOH B 9013 . ? 1_555 ? 
78  BC5 7 G   DA 877  ? G   0 877  . ? 1_555 ? 
79  BC5 7 G   DA 2623 ? G   0 2623 . ? 1_555 ? 
80  BC5 7 A   DA 2624 ? A   0 2624 . ? 1_555 ? 
81  BC5 7 HOH FN .    ? HOH 0 2942 . ? 1_555 ? 
82  BC5 7 HOH FN .    ? HOH 0 4534 . ? 1_555 ? 
83  BC5 7 HOH FN .    ? HOH 0 4547 . ? 1_555 ? 
84  BC5 7 HOH CM .    ? HOH A 9108 . ? 1_555 ? 
85  BC6 7 A   DA 2101 ? A   0 2101 . ? 1_555 ? 
86  BC6 7 G   DA 2102 ? G   0 2102 . ? 1_555 ? 
87  BC6 7 G   DA 2537 ? G   0 2537 . ? 1_555 ? 
88  BC6 7 HOH FN .    ? HOH 0 2955 . ? 1_555 ? 
89  BC6 7 HOH FN .    ? HOH 0 3746 . ? 1_555 ? 
90  BC6 7 HOH FN .    ? HOH 0 4551 . ? 1_555 ? 
91  BC6 7 HOH FN .    ? HOH 0 5050 . ? 1_555 ? 
92  BC7 8 A   DA 843  ? A   0 843  . ? 1_555 ? 
93  BC7 8 A   DA 844  ? A   0 844  . ? 1_555 ? 
94  BC7 8 G   DA 1688 ? G   0 1688 . ? 1_555 ? 
95  BC7 8 A   DA 1689 ? A   0 1689 . ? 1_555 ? 
96  BC7 8 HOH FN .    ? HOH 0 2927 . ? 1_555 ? 
97  BC7 8 HOH FN .    ? HOH 0 2945 . ? 1_555 ? 
98  BC7 8 HOH FN .    ? HOH 0 4514 . ? 1_555 ? 
99  BC7 8 HOH FN .    ? HOH 0 9588 . ? 1_555 ? 
100 BC8 7 G   DA 456  ? G   0 456  . ? 1_555 ? 
101 BC8 7 HOH FN .    ? HOH 0 3330 . ? 1_555 ? 
102 BC8 7 HOH FN .    ? HOH 0 9565 . ? 1_555 ? 
103 BC8 7 GLY C  86   ? GLY C 86   . ? 1_555 ? 
104 BC8 7 HOH EM .    ? HOH C 8561 . ? 1_555 ? 
105 BC8 7 HOH EM .    ? HOH C 8565 . ? 1_555 ? 
106 BC8 7 HOH EM .    ? HOH C 8661 . ? 1_555 ? 
107 BC9 7 A   DA 1941 ? A   0 1941 . ? 1_555 ? 
108 BC9 7 A   DA 2011 ? A   0 2011 . ? 1_555 ? 
109 BC9 7 HOH FN .    ? HOH 0 5037 . ? 1_555 ? 
110 BC9 7 HOH FN .    ? HOH 0 9070 . ? 1_555 ? 
111 BC9 7 HOH FN .    ? HOH 0 9584 . ? 1_555 ? 
112 BC9 7 HOH FN .    ? HOH 0 9585 . ? 1_555 ? 
113 BC9 7 HOH FN .    ? HOH 0 9586 . ? 1_555 ? 
114 CC1 6 C   DA 1830 ? C   0 1830 . ? 1_555 ? 
115 CC1 6 HOH FN .    ? HOH 0 3042 . ? 1_555 ? 
116 CC1 6 HOH FN .    ? HOH 0 3045 . ? 1_555 ? 
117 CC1 6 HOH FN .    ? HOH 0 3119 . ? 1_555 ? 
118 CC1 6 HOH FN .    ? HOH 0 9568 . ? 1_555 ? 
119 CC1 6 HOH FN .    ? HOH 0 9587 . ? 1_555 ? 
120 CC2 5 G   DA 2304 ? G   0 2304 . ? 1_555 ? 
121 CC2 5 HOH FN .    ? HOH 0 3880 . ? 1_555 ? 
122 CC2 5 HOH FN .    ? HOH 0 4530 . ? 1_555 ? 
123 CC2 5 HOH FN .    ? HOH 0 4531 . ? 1_555 ? 
124 CC2 5 HOH FN .    ? HOH 0 9571 . ? 1_555 ? 
125 CC3 6 G   DA 2097 ? G   0 2097 . ? 1_555 ? 
126 CC3 6 G   DA 2540 ? G   0 2540 . ? 1_555 ? 
127 CC3 6 HOH FN .    ? HOH 0 3032 . ? 1_555 ? 
128 CC3 6 HOH FN .    ? HOH 0 3370 . ? 1_555 ? 
129 CC3 6 HOH FN .    ? HOH 0 4761 . ? 1_555 ? 
130 CC3 6 HOH FN .    ? HOH 0 9576 . ? 1_555 ? 
131 CC4 2 C   DA 2287 ? C   0 2287 . ? 1_555 ? 
132 CC4 2 ARG H  117  ? ARG H 117  . ? 1_555 ? 
133 CC5 3 A   DA 1381 ? A   0 1381 . ? 1_555 ? 
134 CC5 3 HOH FN .    ? HOH 0 5998 . ? 1_555 ? 
135 CC5 3 HOH FN .    ? HOH 0 9655 . ? 1_555 ? 
136 CC6 5 G   DA 1055 ? G   0 1055 . ? 1_555 ? 
137 CC6 5 HOH FN .    ? HOH 0 4718 . ? 1_555 ? 
138 CC6 5 HOH FN .    ? HOH 0 5711 . ? 1_555 ? 
139 CC6 5 HOH FN .    ? HOH 0 7185 . ? 1_555 ? 
140 CC6 5 ASP H  13   ? ASP H 13   . ? 1_555 ? 
141 CC7 5 U   DA 1120 ? U   0 1120 . ? 1_555 ? 
142 CC7 5 G   DA 1121 ? G   0 1121 . ? 1_555 ? 
143 CC7 5 HOH FN .    ? HOH 0 5055 . ? 1_555 ? 
144 CC7 5 HOH FN .    ? HOH 0 9592 . ? 1_555 ? 
145 CC7 5 HOH FN .    ? HOH 0 9593 . ? 1_555 ? 
146 CC8 6 C   DA 2608 ? C   0 2608 . ? 1_555 ? 
147 CC8 6 G   DA 2609 ? G   0 2609 . ? 1_555 ? 
148 CC8 6 U   DA 2610 ? U   0 2610 . ? 1_555 ? 
149 CC8 6 HOH FN .    ? HOH 0 3307 . ? 1_555 ? 
150 CC8 6 HOH FN .    ? HOH 0 9594 . ? 1_555 ? 
151 CC8 6 HOH FN .    ? HOH 0 9595 . ? 1_555 ? 
152 CC9 3 G   DA 1119 ? G   0 1119 . ? 1_555 ? 
153 CC9 3 C   DA 1243 ? C   0 1243 . ? 1_555 ? 
154 CC9 3 LYS J  56   ? LYS J 56   . ? 1_555 ? 
155 DC1 7 C   DA 240  ? C   0 240  . ? 1_555 ? 
156 DC1 7 G   DA 269  ? G   0 269  . ? 1_555 ? 
157 DC1 7 HOH FN .    ? HOH 0 4498 . ? 1_555 ? 
158 DC1 7 HOH FN .    ? HOH 0 4763 . ? 1_555 ? 
159 DC1 7 HOH FN .    ? HOH 0 4904 . ? 1_555 ? 
160 DC1 7 HOH FN .    ? HOH 0 5042 . ? 1_555 ? 
161 DC1 7 HOH FN .    ? HOH 0 9657 . ? 1_555 ? 
162 DC2 6 A   DA 1448 ? A   0 1448 . ? 1_555 ? 
163 DC2 6 U   DA 1677 ? U   0 1677 . ? 1_555 ? 
164 DC2 6 HOH FN .    ? HOH 0 4570 . ? 1_555 ? 
165 DC2 6 HOH FN .    ? HOH 0 4592 . ? 1_555 ? 
166 DC2 6 HOH FN .    ? HOH 0 4603 . ? 1_555 ? 
167 DC2 6 HOH UM .    ? HOH S 8545 . ? 1_555 ? 
168 DC3 8 U   DA 1503 ? U   0 1503 . ? 1_555 ? 
169 DC3 8 A   DA 1504 ? A   0 1504 . ? 1_555 ? 
170 DC3 8 C   DA 1679 ? C   0 1679 . ? 1_555 ? 
171 DC3 8 HOH FN .    ? HOH 0 9583 . ? 1_555 ? 
172 DC3 8 HOH FN .    ? HOH 0 9598 . ? 1_555 ? 
173 DC3 8 HOH FN .    ? HOH 0 9599 . ? 1_555 ? 
174 DC3 8 HOH FN .    ? HOH 0 9600 . ? 1_555 ? 
175 DC3 8 HOH FN .    ? HOH 0 9601 . ? 1_555 ? 
176 DC4 6 U   DA 1748 ? U   0 1748 . ? 1_555 ? 
177 DC4 6 U   DA 1749 ? U   0 1749 . ? 1_555 ? 
178 DC4 6 HOH FN .    ? HOH 0 4532 . ? 1_555 ? 
179 DC4 6 HOH FN .    ? HOH 0 9566 . ? 1_555 ? 
180 DC4 6 HOH FN .    ? HOH 0 9567 . ? 1_555 ? 
181 DC4 6 HOH FN .    ? HOH 0 9577 . ? 1_555 ? 
182 DC5 5 U   DA 777  ? U   0 777  . ? 1_555 ? 
183 DC5 5 C   DA 778  ? C   0 778  . ? 1_555 ? 
184 DC5 5 HOH FN .    ? HOH 0 4182 . ? 1_555 ? 
185 DC5 5 SR  KJ .    ? SR  0 8934 . ? 1_555 ? 
186 DC5 5 HOH CN .    ? HOH 1 7770 . ? 1_555 ? 
187 DC6 4 G   DA 956  ? G   0 956  . ? 1_555 ? 
188 DC6 4 HOH FN .    ? HOH 0 3282 . ? 1_555 ? 
189 DC6 4 HOH FN .    ? HOH 0 4563 . ? 1_555 ? 
190 DC6 4 HOH FN .    ? HOH 0 9607 . ? 1_555 ? 
191 DC7 4 A   DA 2553 ? A   0 2553 . ? 1_555 ? 
192 DC7 4 HOH FN .    ? HOH 0 4043 . ? 1_555 ? 
193 DC7 4 HOH FN .    ? HOH 0 4541 . ? 1_555 ? 
194 DC7 4 HOH FN .    ? HOH 0 9661 . ? 1_555 ? 
195 DC8 6 HOH FN .    ? HOH 0 3202 . ? 1_555 ? 
196 DC8 6 HOH FN .    ? HOH 0 4518 . ? 1_555 ? 
197 DC8 6 HOH FN .    ? HOH 0 4542 . ? 1_555 ? 
198 DC8 6 HOH FN .    ? HOH 0 4564 . ? 1_555 ? 
199 DC8 6 HOH FN .    ? HOH 0 4566 . ? 1_555 ? 
200 DC8 6 HOH FN .    ? HOH 0 9611 . ? 1_555 ? 
201 DC9 3 U   DA 115  ? U   0 115  . ? 1_555 ? 
202 DC9 3 G   DA 118  ? G   0 118  . ? 1_555 ? 
203 DC9 3 HOH FN .    ? HOH 0 3829 . ? 1_555 ? 
204 EC1 5 U   DA 391  ? U   0 391  . ? 1_555 ? 
205 EC1 5 U   DA 392  ? U   0 392  . ? 1_555 ? 
206 EC1 5 HOH FN .    ? HOH 0 5525 . ? 1_555 ? 
207 EC1 5 HOH FN .    ? HOH 0 9663 . ? 1_555 ? 
208 EC1 5 HOH OM .    ? HOH M 8944 . ? 1_555 ? 
209 EC2 5 G   DA 196  ? G   0 196  . ? 1_555 ? 
210 EC2 5 A   DA 227  ? A   0 227  . ? 1_555 ? 
211 EC2 5 C   DA 228  ? C   0 228  . ? 1_555 ? 
212 EC2 5 HOH FN .    ? HOH 0 4996 . ? 1_555 ? 
213 EC2 5 HOH FN .    ? HOH 0 5087 . ? 1_555 ? 
214 EC3 4 U   DA 1309 ? U   0 1309 . ? 1_555 ? 
215 EC3 4 U   DA 1346 ? U   0 1346 . ? 1_555 ? 
216 EC3 4 HOH FN .    ? HOH 0 3351 . ? 1_555 ? 
217 EC3 4 HOH FN .    ? HOH 0 9614 . ? 1_555 ? 
218 EC4 6 G   DA 795  ? G   0 795  . ? 1_555 ? 
219 EC4 6 G   DA 816  ? G   0 816  . ? 1_555 ? 
220 EC4 6 G   DA 817  ? G   0 817  . ? 1_555 ? 
221 EC4 6 HOH FN .    ? HOH 0 3731 . ? 1_555 ? 
222 EC4 6 HOH FN .    ? HOH 0 9240 . ? 1_555 ? 
223 EC4 6 HOH RM .    ? HOH P 7841 . ? 1_555 ? 
224 EC5 5 C   DA 2048 ? C   0 2048 . ? 1_555 ? 
225 EC5 5 A   DA 2089 ? A   0 2089 . ? 1_555 ? 
226 EC5 5 HOH FN .    ? HOH 0 4203 . ? 1_555 ? 
227 EC5 5 HOH FN .    ? HOH 0 9615 . ? 1_555 ? 
228 EC5 5 GLY R  66   ? GLY R 65   . ? 1_555 ? 
229 EC6 4 G   DA 1979 ? G   0 1979 . ? 1_555 ? 
230 EC6 4 HOH FN .    ? HOH 0 9616 . ? 1_555 ? 
231 EC6 4 HOH FN .    ? HOH 0 9664 . ? 1_555 ? 
232 EC6 4 HOH FN .    ? HOH 0 9666 . ? 1_555 ? 
233 EC7 4 G   DA 1794 ? G   0 1794 . ? 1_555 ? 
234 EC7 4 HOH FN .    ? HOH 0 9129 . ? 1_555 ? 
235 EC7 4 HOH FN .    ? HOH 0 9667 . ? 1_555 ? 
236 EC7 4 HOH FN .    ? HOH 0 9668 . ? 1_555 ? 
237 EC8 5 A   DA 1098 ? A   0 1098 . ? 1_555 ? 
238 EC8 5 G   DA 1099 ? G   0 1099 . ? 1_555 ? 
239 EC8 5 HOH FN .    ? HOH 0 4037 . ? 1_555 ? 
240 EC8 5 HOH FN .    ? HOH 0 5383 . ? 1_555 ? 
241 EC8 5 HOH FN .    ? HOH 0 9679 . ? 1_555 ? 
242 EC9 4 G   DA 641  ? G   0 641  . ? 1_555 ? 
243 EC9 4 A   DA 1355 ? A   0 1355 . ? 1_555 ? 
244 EC9 4 HOH FN .    ? HOH 0 4992 . ? 1_555 ? 
245 EC9 4 HOH FN .    ? HOH 0 9617 . ? 1_555 ? 
246 FC1 4 C   DA 85   ? C   0 85   . ? 1_555 ? 
247 FC1 4 A   DA 86   ? A   0 86   . ? 1_555 ? 
248 FC1 4 C   DA 87   ? C   0 87   . ? 1_555 ? 
249 FC1 4 ASP T  69   ? ASP T 68   . ? 1_555 ? 
250 FC2 2 U   DA 1125 ? U   0 1125 . ? 1_555 ? 
251 FC2 2 SR  UK .    ? SR  0 8978 . ? 1_555 ? 
252 FC3 3 G   DA 84   ? G   0 84   . ? 1_555 ? 
253 FC3 3 C   DA 85   ? C   0 85   . ? 1_555 ? 
254 FC3 3 ASP T  69   ? ASP T 68   . ? 1_555 ? 
255 FC4 6 C   DA 162  ? C   0 162  . ? 1_555 ? 
256 FC4 6 U   DA 2276 ? U   0 2276 . ? 1_555 ? 
257 FC4 6 HOH FN .    ? HOH 0 3347 . ? 1_555 ? 
258 FC4 6 HOH FN .    ? HOH 0 9570 . ? 1_555 ? 
259 FC4 6 HOH FN .    ? HOH 0 9619 . ? 1_555 ? 
260 FC4 6 HOH FN .    ? HOH 0 9620 . ? 1_555 ? 
261 FC5 2 A   DA 1317 ? A   0 1317 . ? 1_555 ? 
262 FC5 2 SER Y  208  ? SER Y 207  . ? 1_555 ? 
263 FC6 1 HOH FN .    ? HOH 0 9621 . ? 1_555 ? 
264 FC7 7 G   DA 2617 ? G   0 2617 . ? 1_555 ? 
265 FC7 7 G   DA 2618 ? G   0 2618 . ? 1_555 ? 
266 FC7 7 G   DA 2642 ? G   0 2642 . ? 1_555 ? 
267 FC7 7 HOH FN .    ? HOH 0 2959 . ? 1_555 ? 
268 FC7 7 MG  PE .    ? MG  0 8066 . ? 1_555 ? 
269 FC7 7 HOH FN .    ? HOH 0 9578 . ? 1_555 ? 
270 FC7 7 HOH FN .    ? HOH 0 9590 . ? 1_555 ? 
271 FC8 6 U   DA 172  ? U   0 172  . ? 1_555 ? 
272 FC8 6 U   DA 224  ? U   0 224  . ? 1_555 ? 
273 FC8 6 G   DA 393  ? G   0 393  . ? 1_555 ? 
274 FC8 6 HOH FN .    ? HOH 0 3606 . ? 1_555 ? 
275 FC8 6 HOH FN .    ? HOH 0 4694 . ? 1_555 ? 
276 FC8 6 HOH FN .    ? HOH 0 9625 . ? 1_555 ? 
277 FC9 4 A   DA 1369 ? A   0 1369 . ? 1_555 ? 
278 FC9 4 U   DA 2650 ? U   0 2650 . ? 1_555 ? 
279 FC9 4 HOH FN .    ? HOH 0 9627 . ? 1_555 ? 
280 FC9 4 HOH FN .    ? HOH 0 9628 . ? 1_555 ? 
281 GC1 4 HOH FN .    ? HOH 0 5068 . ? 1_555 ? 
282 GC1 4 HOH FN .    ? HOH 0 7839 . ? 1_555 ? 
283 GC1 4 HOH FN .    ? HOH 0 9257 . ? 1_555 ? 
284 GC1 4 HOH FN .    ? HOH 0 9635 . ? 1_555 ? 
285 GC2 7 G   DA 782  ? G   0 782  . ? 1_555 ? 
286 GC2 7 C   DA 783  ? C   0 783  . ? 1_555 ? 
287 GC2 7 HOH FN .    ? HOH 0 4860 . ? 1_555 ? 
288 GC2 7 HOH CM .    ? HOH A 8990 . ? 1_555 ? 
289 GC2 7 HOH CM .    ? HOH A 9030 . ? 1_555 ? 
290 GC2 7 HOH CM .    ? HOH A 9078 . ? 1_555 ? 
291 GC2 7 HOH CM .    ? HOH A 9111 . ? 1_555 ? 
292 GC3 6 A   DA 1845 ? A   0 1845 . ? 1_555 ? 
293 GC3 6 U   DA 1846 ? U   0 1846 . ? 1_555 ? 
294 GC3 6 G   DA 1884 ? G   0 1884 . ? 1_555 ? 
295 GC3 6 HOH FN .    ? HOH 0 9629 . ? 1_555 ? 
296 GC3 6 ASN A  189  ? ASN A 188  . ? 1_555 ? 
297 GC3 6 ARG A  191  ? ARG A 190  . ? 1_555 ? 
298 GC4 5 HOH FN .    ? HOH 0 4643 . ? 1_555 ? 
299 GC4 5 HOH FN .    ? HOH 0 5705 . ? 1_555 ? 
300 GC4 5 HOH FN .    ? HOH 0 7508 . ? 1_555 ? 
301 GC4 5 HOH FN .    ? HOH 0 7513 . ? 1_555 ? 
302 GC4 5 HOH GM .    ? HOH E 920  . ? 1_555 ? 
303 GC5 5 A   DA 166  ? A   0 166  . ? 1_555 ? 
304 GC5 5 G   DA 219  ? G   0 219  . ? 1_555 ? 
305 GC5 5 HOH FN .    ? HOH 0 3043 . ? 1_555 ? 
306 GC5 5 HOH FN .    ? HOH 0 4707 . ? 1_555 ? 
307 GC5 5 HOH FN .    ? HOH 0 5840 . ? 1_555 ? 
308 GC6 2 U   DA 391  ? U   0 391  . ? 1_555 ? 
309 GC6 2 ARG CA 42   ? ARG 3 42   . ? 1_555 ? 
310 GC7 7 G   DA 953  ? G   0 953  . ? 1_555 ? 
311 GC7 7 U   DA 954  ? U   0 954  . ? 1_555 ? 
312 GC7 7 C   DA 2298 ? C   0 2298 . ? 1_555 ? 
313 GC7 7 HOH FN .    ? HOH 0 4141 . ? 1_555 ? 
314 GC7 7 HOH FN .    ? HOH 0 4884 . ? 1_555 ? 
315 GC7 7 HOH FN .    ? HOH 0 9632 . ? 1_555 ? 
316 GC7 7 HOH FN .    ? HOH 0 9687 . ? 1_555 ? 
317 GC8 6 A   DA 1286 ? A   0 1286 . ? 1_555 ? 
318 GC8 6 A   DA 1287 ? A   0 1287 . ? 1_555 ? 
319 GC8 6 HOH FN .    ? HOH 0 9630 . ? 1_555 ? 
320 GC8 6 HOH YM .    ? HOH W 7803 . ? 1_555 ? 
321 GC8 6 HOH YM .    ? HOH W 7873 . ? 1_555 ? 
322 GC8 6 HOH YM .    ? HOH W 7874 . ? 1_555 ? 
323 GC9 6 A   DA 907  ? A   0 907  . ? 1_555 ? 
324 GC9 6 A   DA 908  ? A   0 908  . ? 1_555 ? 
325 GC9 6 HOH FN .    ? HOH 0 4529 . ? 1_555 ? 
326 GC9 6 HOH FN .    ? HOH 0 4806 . ? 1_555 ? 
327 GC9 6 HOH FN .    ? HOH 0 5820 . ? 1_555 ? 
328 GC9 6 HOH FN .    ? HOH 0 9631 . ? 1_555 ? 
329 HC1 7 G   DA 164  ? G   0 164  . ? 1_555 ? 
330 HC1 7 A   DA 165  ? A   0 165  . ? 1_555 ? 
331 HC1 7 A   DA 167  ? A   0 167  . ? 1_555 ? 
332 HC1 7 C   DA 168  ? C   0 168  . ? 1_555 ? 
333 HC1 7 HOH FN .    ? HOH 0 4504 . ? 1_555 ? 
334 HC1 7 HOH FN .    ? HOH 0 4509 . ? 1_555 ? 
335 HC1 7 HOH FN .    ? HOH 0 4521 . ? 1_555 ? 
336 HC2 8 A   DA 1684 ? A   0 1684 . ? 1_555 ? 
337 HC2 8 C   DA 1692 ? C   0 1692 . ? 1_555 ? 
338 HC2 8 U   DA 1724 ? U   0 1724 . ? 1_555 ? 
339 HC2 8 HOH FN .    ? HOH 0 5092 . ? 1_555 ? 
340 HC2 8 HOH FN .    ? HOH 0 5381 . ? 1_555 ? 
341 HC2 8 HOH FN .    ? HOH 0 7518 . ? 1_555 ? 
342 HC2 8 HOH FN .    ? HOH 0 9641 . ? 1_555 ? 
343 HC2 8 HOH FN .    ? HOH 0 9690 . ? 1_555 ? 
344 HC3 4 C   DA 1423 ? C   0 1423 . ? 1_555 ? 
345 HC3 4 HOH FN .    ? HOH 0 6031 . ? 1_555 ? 
346 HC3 4 HOH FN .    ? HOH 0 6113 . ? 1_555 ? 
347 HC3 4 HOH RM .    ? HOH P 7890 . ? 1_555 ? 
348 HC4 4 A   DA 1754 ? A   0 1754 . ? 1_555 ? 
349 HC4 4 HOH FN .    ? HOH 0 5038 . ? 1_555 ? 
350 HC4 4 HOH FN .    ? HOH 0 9642 . ? 1_555 ? 
351 HC4 4 HOH FN .    ? HOH 0 9691 . ? 1_555 ? 
352 HC5 6 A   DA 1742 ? A   0 1742 . ? 1_555 ? 
353 HC5 6 G   DA 1743 ? G   0 1743 . ? 1_555 ? 
354 HC5 6 G   DA 1744 ? G   0 1744 . ? 1_555 ? 
355 HC5 6 G   DA 1745 ? G   0 1745 . ? 1_555 ? 
356 HC5 6 HOH FN .    ? HOH 0 3171 . ? 1_555 ? 
357 HC5 6 HOH FN .    ? HOH 0 4527 . ? 1_555 ? 
358 HC6 4 G   DA 2642 ? G   0 2642 . ? 1_555 ? 
359 HC6 4 HOH FN .    ? HOH 0 5247 . ? 1_555 ? 
360 HC6 4 HOH FN .    ? HOH 0 5373 . ? 1_555 ? 
361 HC6 4 MG  ZD .    ? MG  0 8046 . ? 1_555 ? 
362 HC7 7 G   DA 2540 ? G   0 2540 . ? 1_555 ? 
363 HC7 7 G   DA 2611 ? G   0 2611 . ? 1_555 ? 
364 HC7 7 G   DA 2646 ? G   0 2646 . ? 1_555 ? 
365 HC7 7 HOH FN .    ? HOH 0 2987 . ? 1_555 ? 
366 HC7 7 HOH FN .    ? HOH 0 3214 . ? 1_555 ? 
367 HC7 7 HOH FN .    ? HOH 0 5181 . ? 1_555 ? 
368 HC7 7 NA  UG .    ? NA  0 8534 . ? 1_555 ? 
369 HC8 4 C   DA 515  ? C   0 515  . ? 1_555 ? 
370 HC8 4 A   DA 516  ? A   0 516  . ? 1_555 ? 
371 HC8 4 G   DA 518  ? G   0 518  . ? 1_555 ? 
372 HC8 4 HOH FN .    ? HOH 0 9692 . ? 1_555 ? 
373 HC9 4 A   DA 2103 ? A   0 2103 . ? 1_555 ? 
374 HC9 4 U   DA 2478 ? U   0 2478 . ? 1_555 ? 
375 HC9 4 HOH FN .    ? HOH 0 4687 . ? 1_555 ? 
376 HC9 4 HOH FN .    ? HOH 0 6839 . ? 1_555 ? 
377 IC1 5 G   DA 918  ? G   0 918  . ? 1_555 ? 
378 IC1 5 HOH FN .    ? HOH 0 3015 . ? 1_555 ? 
379 IC1 5 HOH FN .    ? HOH 0 3460 . ? 1_555 ? 
380 IC1 5 HOH FN .    ? HOH 0 7334 . ? 1_555 ? 
381 IC1 5 HOH FN .    ? HOH 0 9647 . ? 1_555 ? 
382 IC2 6 C   DA 1844 ? C   0 1844 . ? 1_555 ? 
383 IC2 6 HOH FN .    ? HOH 0 4537 . ? 1_555 ? 
384 IC2 6 HOH FN .    ? HOH 0 4552 . ? 1_555 ? 
385 IC2 6 HOH FN .    ? HOH 0 4655 . ? 1_555 ? 
386 IC2 6 HOH FN .    ? HOH 0 9694 . ? 1_555 ? 
387 IC2 6 HOH CM .    ? HOH A 8994 . ? 1_555 ? 
388 IC3 7 G   DA 627  ? G   0 627  . ? 1_555 ? 
389 IC3 7 A   DA 1070 ? A   0 1070 . ? 1_555 ? 
390 IC3 7 G   DA 1071 ? G   0 1071 . ? 1_555 ? 
391 IC3 7 HOH FN .    ? HOH 0 3599 . ? 1_555 ? 
392 IC3 7 HOH FN .    ? HOH 0 4543 . ? 1_555 ? 
393 IC3 7 HOH FN .    ? HOH 0 4574 . ? 1_555 ? 
394 IC3 7 HOH FN .    ? HOH 0 4614 . ? 1_555 ? 
395 IC4 3 U   DA 1096 ? U   0 1096 . ? 1_555 ? 
396 IC4 3 C   DA 1257 ? C   0 1257 . ? 1_555 ? 
397 IC4 3 G   DA 1258 ? G   0 1258 . ? 1_555 ? 
398 IC5 6 G   DA 1848 ? G   0 1848 . ? 1_555 ? 
399 IC5 6 G   DA 1849 ? G   0 1849 . ? 1_555 ? 
400 IC5 6 HOH FN .    ? HOH 0 4555 . ? 1_555 ? 
401 IC5 6 HOH FN .    ? HOH 0 4593 . ? 1_555 ? 
402 IC5 6 HOH FN .    ? HOH 0 4725 . ? 1_555 ? 
403 IC5 6 HOH FN .    ? HOH 0 4756 . ? 1_555 ? 
404 IC6 5 U   DA 862  ? U   0 862  . ? 1_555 ? 
405 IC6 5 G   DA 863  ? G   0 863  . ? 1_555 ? 
406 IC6 5 HOH FN .    ? HOH 0 3540 . ? 1_555 ? 
407 IC6 5 HOH FN .    ? HOH 0 4565 . ? 1_555 ? 
408 IC6 5 HOH FN .    ? HOH 0 4568 . ? 1_555 ? 
409 IC7 6 A   DA 907  ? A   0 907  . ? 1_555 ? 
410 IC7 6 HOH FN .    ? HOH 0 3859 . ? 1_555 ? 
411 IC7 6 HOH FN .    ? HOH 0 4272 . ? 1_555 ? 
412 IC7 6 HOH FN .    ? HOH 0 4576 . ? 1_555 ? 
413 IC7 6 HOH FN .    ? HOH 0 4639 . ? 1_555 ? 
414 IC7 6 HOH AN .    ? HOH Y 8870 . ? 1_555 ? 
415 IC8 3 A   DA 2612 ? A   0 2612 . ? 1_555 ? 
416 IC8 3 U   DA 2648 ? U   0 2648 . ? 1_555 ? 
417 IC8 3 HOH FN .    ? HOH 0 4571 . ? 1_555 ? 
418 IC9 3 U   DA 2107 ? U   0 2107 . ? 1_555 ? 
419 IC9 3 U   DA 2282 ? U   0 2282 . ? 1_555 ? 
420 IC9 3 G   DA 2285 ? G   0 2285 . ? 1_555 ? 
421 JC1 5 A   DA 2433 ? A   0 2433 . ? 1_555 ? 
422 JC1 5 A   DA 2434 ? A   0 2434 . ? 1_555 ? 
423 JC1 5 U   DA 2458 ? U   0 2458 . ? 1_555 ? 
424 JC1 5 HOH FN .    ? HOH 0 3811 . ? 1_555 ? 
425 JC1 5 HOH FN .    ? HOH 0 4560 . ? 1_555 ? 
426 JC2 3 A   DA 2577 ? A   0 2577 . ? 1_555 ? 
427 JC2 3 G   DA 2578 ? G   0 2578 . ? 1_555 ? 
428 JC2 3 G   DA 2579 ? G   0 2579 . ? 1_555 ? 
429 JC3 3 C   DA 2104 ? C   0 2104 . ? 1_555 ? 
430 JC3 3 C   DA 2105 ? C   0 2105 . ? 1_555 ? 
431 JC3 3 HOH FN .    ? HOH 0 9560 . ? 1_555 ? 
432 JC4 6 G   DA 817  ? G   0 817  . ? 1_555 ? 
433 JC4 6 HOH FN .    ? HOH 0 4493 . ? 1_555 ? 
434 JC4 6 HOH FN .    ? HOH 0 6872 . ? 1_555 ? 
435 JC4 6 HOH FN .    ? HOH 0 9240 . ? 1_555 ? 
436 JC4 6 SER P  91   ? SER P 90   . ? 1_555 ? 
437 JC4 6 HOH RM .    ? HOH P 7841 . ? 1_555 ? 
438 JC5 7 C   DA 1103 ? C   0 1103 . ? 1_555 ? 
439 JC5 7 C   DA 1104 ? C   0 1104 . ? 1_555 ? 
440 JC5 7 A   DA 1106 ? A   0 1106 . ? 1_555 ? 
441 JC5 7 A   DA 1107 ? A   0 1107 . ? 1_555 ? 
442 JC5 7 HOH FN .    ? HOH 0 9671 . ? 1_555 ? 
443 JC5 7 HOH LM .    ? HOH J 2219 . ? 1_555 ? 
444 JC5 7 HOH LM .    ? HOH J 7852 . ? 1_555 ? 
445 JC6 5 U   DA 1977 ? U   0 1977 . ? 1_555 ? 
446 JC6 5 G   DA 2001 ? G   0 2001 . ? 1_555 ? 
447 JC6 5 C   DA 2002 ? C   0 2002 . ? 1_555 ? 
448 JC6 5 HOH FN .    ? HOH 0 9674 . ? 1_555 ? 
449 JC6 5 HOH FN .    ? HOH 0 9675 . ? 1_555 ? 
450 JC7 8 U   DA 903  ? U   0 903  . ? 1_555 ? 
451 JC7 8 U   DA 904  ? U   0 904  . ? 1_555 ? 
452 JC7 8 A   DA 1356 ? A   0 1356 . ? 1_555 ? 
453 JC7 8 A   DA 1357 ? A   0 1357 . ? 1_555 ? 
454 JC7 8 HOH FN .    ? HOH 0 3422 . ? 1_555 ? 
455 JC7 8 HOH FN .    ? HOH 0 5230 . ? 1_555 ? 
456 JC7 8 HOH FN .    ? HOH 0 6270 . ? 1_555 ? 
457 JC7 8 HOH FN .    ? HOH 0 6890 . ? 1_555 ? 
458 JC8 6 A   DA 187  ? A   0 187  . ? 1_555 ? 
459 JC8 6 HOH FN .    ? HOH 0 3049 . ? 1_555 ? 
460 JC8 6 HOH FN .    ? HOH 0 3251 . ? 1_555 ? 
461 JC8 6 HOH FN .    ? HOH 0 3482 . ? 1_555 ? 
462 JC8 6 HOH FN .    ? HOH 0 4619 . ? 1_555 ? 
463 JC8 6 HOH FN .    ? HOH 0 4659 . ? 1_555 ? 
464 JC9 6 A   DA 2112 ? A   0 2112 . ? 1_555 ? 
465 JC9 6 HOH FN .    ? HOH 0 3502 . ? 1_555 ? 
466 JC9 6 HOH FN .    ? HOH 0 4644 . ? 1_555 ? 
467 JC9 6 HOH FN .    ? HOH 0 6989 . ? 1_555 ? 
468 JC9 6 HOH FN .    ? HOH 0 7249 . ? 1_555 ? 
469 JC9 6 SR  GL .    ? SR  0 8992 . ? 1_555 ? 
470 KC1 6 A   DA 2430 ? A   0 2430 . ? 1_555 ? 
471 KC1 6 A   DA 2468 ? A   0 2468 . ? 1_555 ? 
472 KC1 6 HOH FN .    ? HOH 0 3264 . ? 1_555 ? 
473 KC1 6 HOH FN .    ? HOH 0 3364 . ? 1_555 ? 
474 KC1 6 HOH FN .    ? HOH 0 5701 . ? 1_555 ? 
475 KC1 6 LYS CA 54   ? LYS 3 54   . ? 1_555 ? 
476 KC2 3 HOH FN .    ? HOH 0 4804 . ? 1_555 ? 
477 KC2 3 HOH FN .    ? HOH 0 5174 . ? 1_555 ? 
478 KC2 3 MG  NF .    ? MG  0 8092 . ? 1_555 ? 
479 KC3 5 U   DA 1850 ? U   0 1850 . ? 1_555 ? 
480 KC3 5 HOH FN .    ? HOH 0 4582 . ? 1_555 ? 
481 KC3 5 HOH FN .    ? HOH 0 4756 . ? 1_555 ? 
482 KC3 5 HOH FN .    ? HOH 0 4804 . ? 1_555 ? 
483 KC3 5 MG  MF .    ? MG  0 8091 . ? 1_555 ? 
484 KC4 4 A   DA 1840 ? A   0 1840 . ? 1_555 ? 
485 KC4 4 C   DA 1841 ? C   0 1841 . ? 1_555 ? 
486 KC4 4 A   DA 2022 ? A   0 2022 . ? 1_555 ? 
487 KC4 4 HOH FN .    ? HOH 0 5519 . ? 1_555 ? 
488 KC5 3 G   DA 2102 ? G   0 2102 . ? 1_555 ? 
489 KC5 3 G   DA 2482 ? G   0 2482 . ? 1_555 ? 
490 KC5 3 C   DA 2536 ? C   0 2536 . ? 1_555 ? 
491 KC6 4 C   DA 162  ? C   0 162  . ? 1_555 ? 
492 KC6 4 U   DA 163  ? U   0 163  . ? 1_555 ? 
493 KC6 4 U   DA 172  ? U   0 172  . ? 1_555 ? 
494 KC6 4 ARG M  83   ? ARG M 82   . ? 1_555 ? 
495 KC7 3 G   DA 1071 ? G   0 1071 . ? 1_555 ? 
496 KC7 3 HOH FN .    ? HOH 0 4651 . ? 1_555 ? 
497 KC7 3 HOH FN .    ? HOH 0 5852 . ? 1_555 ? 
498 KC8 5 G   DA 1119 ? G   0 1119 . ? 1_555 ? 
499 KC8 5 U   DA 1120 ? U   0 1120 . ? 1_555 ? 
500 KC8 5 G   DA 1121 ? G   0 1121 . ? 1_555 ? 
501 KC8 5 U   DA 1122 ? U   0 1122 . ? 1_555 ? 
502 KC8 5 HOH FN .    ? HOH 0 9593 . ? 1_555 ? 
503 KC9 4 A   DA 630  ? A   0 630  . ? 1_555 ? 
504 KC9 4 A   DA 631  ? A   0 631  . ? 1_555 ? 
505 KC9 4 A   DA 2074 ? A   0 2074 . ? 1_555 ? 
506 KC9 4 HOH FN .    ? HOH 0 4978 . ? 1_555 ? 
507 LC1 4 G   DA 2092 ? G   0 2092 . ? 1_555 ? 
508 LC1 4 G   DA 2093 ? G   0 2093 . ? 1_555 ? 
509 LC1 4 G   DA 2094 ? G   0 2094 . ? 1_555 ? 
510 LC1 4 A   DA 2649 ? A   0 2649 . ? 1_555 ? 
511 LC2 4 C   DA 40   ? C   0 40   . ? 1_555 ? 
512 LC2 4 G   DA 41   ? G   0 41   . ? 1_555 ? 
513 LC2 4 A   DA 442  ? A   0 442  . ? 1_555 ? 
514 LC2 4 C   DA 443  ? C   0 443  . ? 1_555 ? 
515 LC3 5 C   DA 1394 ? C   0 1394 . ? 1_555 ? 
516 LC3 5 U   DA 1432 ? U   0 1432 . ? 1_555 ? 
517 LC3 5 U   DA 1724 ? U   0 1724 . ? 1_555 ? 
518 LC3 5 HOH FN .    ? HOH 0 3215 . ? 1_555 ? 
519 LC3 5 HOH FN .    ? HOH 0 4315 . ? 1_555 ? 
520 LC4 3 A   DA 2577 ? A   0 2577 . ? 1_555 ? 
521 LC4 3 G   DA 2578 ? G   0 2578 . ? 1_555 ? 
522 LC4 3 G   DA 2579 ? G   0 2579 . ? 1_555 ? 
523 LC5 3 U   DA 2523 ? U   0 2523 . ? 1_555 ? 
524 LC5 3 G   DA 2524 ? G   0 2524 . ? 1_555 ? 
525 LC5 3 HOH FN .    ? HOH 0 7217 . ? 1_555 ? 
526 LC6 5 G   DA 2399 ? G   0 2399 . ? 1_555 ? 
527 LC6 5 HOH FN .    ? HOH 0 3869 . ? 1_555 ? 
528 LC6 5 HOH FN .    ? HOH 0 4726 . ? 1_555 ? 
529 LC6 5 HOH FN .    ? HOH 0 5948 . ? 1_555 ? 
530 LC6 5 HOH FN .    ? HOH 0 6918 . ? 1_555 ? 
531 LC7 5 U   DA 2541 ? U   0 2541 . ? 1_555 ? 
532 LC7 5 U   DA 2607 ? U   0 2607 . ? 1_555 ? 
533 LC7 5 HOH FN .    ? HOH 0 3252 . ? 1_555 ? 
534 LC7 5 HOH FN .    ? HOH 0 4038 . ? 1_555 ? 
535 LC7 5 TRP B  243  ? TRP B 242  . ? 1_555 ? 
536 LC8 3 A   DA 165  ? A   0 165  . ? 1_555 ? 
537 LC8 3 A   DA 166  ? A   0 166  . ? 1_555 ? 
538 LC8 3 A   DA 167  ? A   0 167  . ? 1_555 ? 
539 LC9 4 C   DA 896  ? C   0 896  . ? 1_555 ? 
540 LC9 4 A   DA 897  ? A   0 897  . ? 1_555 ? 
541 LC9 4 HOH FN .    ? HOH 0 2951 . ? 1_555 ? 
542 LC9 4 HOH FN .    ? HOH 0 7169 . ? 1_555 ? 
543 MC1 6 G   DA 1416 ? G   0 1416 . ? 1_555 ? 
544 MC1 6 G   DA 1417 ? G   0 1417 . ? 1_555 ? 
545 MC1 6 HOH FN .    ? HOH 0 3199 . ? 1_555 ? 
546 MC1 6 TRP BA 43   ? TRP 2 42   . ? 1_555 ? 
547 MC1 6 ASN BA 46   ? ASN 2 45   . ? 1_555 ? 
548 MC1 6 HOH DN .    ? HOH 2 4135 . ? 1_555 ? 
549 MC2 5 G   DA 2543 ? G   0 2543 . ? 1_555 ? 
550 MC2 5 HOH FN .    ? HOH 0 3133 . ? 1_555 ? 
551 MC2 5 HOH FN .    ? HOH 0 4367 . ? 1_555 ? 
552 MC2 5 HOH FN .    ? HOH 0 4819 . ? 1_555 ? 
553 MC2 5 NA  FG .    ? NA  0 8517 . ? 1_555 ? 
554 MC3 6 G   DA 2543 ? G   0 2543 . ? 1_555 ? 
555 MC3 6 G   DA 2544 ? G   0 2544 . ? 1_555 ? 
556 MC3 6 U   DA 2615 ? U   0 2615 . ? 1_555 ? 
557 MC3 6 HOH FN .    ? HOH 0 3011 . ? 1_555 ? 
558 MC3 6 HOH FN .    ? HOH 0 3661 . ? 1_555 ? 
559 MC3 6 NA  EG .    ? NA  0 8516 . ? 1_555 ? 
560 MC4 5 G   DA 885  ? G   0 885  . ? 1_555 ? 
561 MC4 5 A   DA 2112 ? A   0 2112 . ? 1_555 ? 
562 MC4 5 C   DA 2475 ? C   0 2475 . ? 1_555 ? 
563 MC4 5 C   DA 2476 ? C   0 2476 . ? 1_555 ? 
564 MC4 5 HOH FN .    ? HOH 0 5367 . ? 1_555 ? 
565 MC5 6 A   DA 45   ? A   0 45   . ? 1_555 ? 
566 MC5 6 C   DA 130  ? C   0 130  . ? 1_555 ? 
567 MC5 6 U   DA 146  ? U   0 146  . ? 1_555 ? 
568 MC5 6 G   DA 147  ? G   0 147  . ? 1_555 ? 
569 MC5 6 HOH FN .    ? HOH 0 3407 . ? 1_555 ? 
570 MC5 6 HOH FN .    ? HOH 0 4204 . ? 1_555 ? 
571 MC6 5 A   DA 776  ? A   0 776  . ? 1_555 ? 
572 MC6 5 A   DA 780  ? A   0 780  . ? 1_555 ? 
573 MC6 5 U   DA 864  ? U   0 864  . ? 1_555 ? 
574 MC6 5 G   DA 865  ? G   0 865  . ? 1_555 ? 
575 MC6 5 SR  KJ .    ? SR  0 8934 . ? 1_555 ? 
576 MC7 3 G   DA 1971 ? G   0 1971 . ? 1_555 ? 
577 MC7 3 G   DA 2009 ? G   0 2009 . ? 1_555 ? 
578 MC7 3 U   DA 2012 ? U   0 2012 . ? 1_555 ? 
579 MC8 5 U   DA 821  ? U   0 821  . ? 1_555 ? 
580 MC8 5 C   DA 853  ? C   0 853  . ? 1_555 ? 
581 MC8 5 G   DA 854  ? G   0 854  . ? 1_555 ? 
582 MC8 5 U   DA 1831 ? U   0 1831 . ? 1_555 ? 
583 MC8 5 G   DA 1832 ? G   0 1832 . ? 1_555 ? 
584 MC9 4 G   DA 56   ? G   0 56   . ? 1_555 ? 
585 MC9 4 A   DA 59   ? A   0 59   . ? 1_555 ? 
586 MC9 4 A   DA 60   ? A   0 60   . ? 1_555 ? 
587 MC9 4 G   DA 61   ? G   0 61   . ? 1_555 ? 
588 NC1 3 G   DA 66   ? G   0 66   . ? 1_555 ? 
589 NC1 3 U   DA 107  ? U   0 107  . ? 1_555 ? 
590 NC1 3 U   DA 108  ? U   0 108  . ? 1_555 ? 
591 NC2 4 G   DA 140  ? G   0 140  . ? 1_555 ? 
592 NC2 4 C   DA 141  ? C   0 141  . ? 1_555 ? 
593 NC2 4 G   DA 142  ? G   0 142  . ? 1_555 ? 
594 NC2 4 HOH FN .    ? HOH 0 3157 . ? 1_555 ? 
595 NC3 6 U   DA 170  ? U   0 170  . ? 1_555 ? 
596 NC3 6 C   DA 171  ? C   0 171  . ? 1_555 ? 
597 NC3 6 C   DA 218  ? C   0 218  . ? 1_555 ? 
598 NC3 6 G   DA 221  ? G   0 221  . ? 1_555 ? 
599 NC3 6 HOH FN .    ? HOH 0 3220 . ? 1_555 ? 
600 NC3 6 HOH FN .    ? HOH 0 3464 . ? 1_555 ? 
601 NC4 4 G   DA 386  ? G   0 386  . ? 1_555 ? 
602 NC4 4 G   DA 387  ? G   0 387  . ? 1_555 ? 
603 NC4 4 U   DA 402  ? U   0 402  . ? 1_555 ? 
604 NC4 4 HOH FN .    ? HOH 0 7904 . ? 1_555 ? 
605 NC5 5 C   DA 1894 ? C   0 1894 . ? 1_555 ? 
606 NC5 5 A   DA 1895 ? A   0 1895 . ? 1_555 ? 
607 NC5 5 G   DA 1896 ? G   0 1896 . ? 1_555 ? 
608 NC5 5 U   DA 1897 ? U   0 1897 . ? 1_555 ? 
609 NC5 5 HOH FN .    ? HOH 0 6119 . ? 1_555 ? 
610 NC6 6 G   DA 622  ? G   0 622  . ? 1_555 ? 
611 NC6 6 U   DA 623  ? U   0 623  . ? 1_555 ? 
612 NC6 6 1MA DA 628  ? 1MA 0 628  . ? 1_555 ? 
613 NC6 6 A   DA 630  ? A   0 630  . ? 1_555 ? 
614 NC6 6 HOH FN .    ? HOH 0 3792 . ? 1_555 ? 
615 NC6 6 LEU Y  151  ? LEU Y 150  . ? 1_555 ? 
616 NC7 6 C   DA 1705 ? C   0 1705 . ? 1_555 ? 
617 NC7 6 G   DA 1706 ? G   0 1706 . ? 1_555 ? 
618 NC7 6 G   DA 1707 ? G   0 1707 . ? 1_555 ? 
619 NC7 6 HOH FN .    ? HOH 0 6208 . ? 1_555 ? 
620 NC7 6 HOH FN .    ? HOH 0 9178 . ? 1_555 ? 
621 NC7 6 HOH FN .    ? HOH 0 9499 . ? 1_555 ? 
622 NC8 6 U   DA 2659 ? U   0 2659 . ? 1_555 ? 
623 NC8 6 G   DA 2660 ? G   0 2660 . ? 1_555 ? 
624 NC8 6 VAL R  73   ? VAL R 72   . ? 1_555 ? 
625 NC8 6 TRP R  76   ? TRP R 75   . ? 1_555 ? 
626 NC8 6 NA  PB .    ? NA  R 8532 . ? 1_555 ? 
627 NC8 6 HOH TM .    ? HOH R 8921 . ? 1_555 ? 
628 NC9 6 G   DA 2540 ? G   0 2540 . ? 1_555 ? 
629 NC9 6 G   DA 2616 ? G   0 2616 . ? 1_555 ? 
630 NC9 6 U   DA 2645 ? U   0 2645 . ? 1_555 ? 
631 NC9 6 HOH FN .    ? HOH 0 3129 . ? 1_555 ? 
632 NC9 6 HOH FN .    ? HOH 0 3941 . ? 1_555 ? 
633 NC9 6 MG  QE .    ? MG  0 8067 . ? 1_555 ? 
634 OC1 6 U   DA 1740 ? U   0 1740 . ? 1_555 ? 
635 OC1 6 U   DA 1741 ? U   0 1741 . ? 1_555 ? 
636 OC1 6 G   DA 2033 ? G   0 2033 . ? 1_555 ? 
637 OC1 6 HOH FN .    ? HOH 0 6229 . ? 1_555 ? 
638 OC1 6 HOH FN .    ? HOH 0 7133 . ? 1_555 ? 
639 OC1 6 HOH FN .    ? HOH 0 7660 . ? 1_555 ? 
640 OC2 4 G   DA 681  ? G   0 681  . ? 1_555 ? 
641 OC2 4 A   DA 682  ? A   0 682  . ? 1_555 ? 
642 OC2 4 G   DA 683  ? G   0 683  . ? 1_555 ? 
643 OC2 4 HOH FN .    ? HOH 0 9700 . ? 1_555 ? 
644 OC3 8 U   DA 308  ? U   0 308  . ? 1_555 ? 
645 OC3 8 G   DA 334  ? G   0 334  . ? 1_555 ? 
646 OC3 8 U   DA 335  ? U   0 335  . ? 1_555 ? 
647 OC3 8 A   DA 339  ? A   0 339  . ? 1_555 ? 
648 OC3 8 C   DA 342  ? C   0 342  . ? 1_555 ? 
649 OC3 8 SER T  95   ? SER T 94   . ? 1_555 ? 
650 OC3 8 ASN T  96   ? ASN T 95   . ? 1_555 ? 
651 OC3 8 HOH VM .    ? HOH T 1124 . ? 1_555 ? 
652 OC4 5 A   DA 914  ? A   0 914  . ? 1_555 ? 
653 OC4 5 C   DA 915  ? C   0 915  . ? 1_555 ? 
654 OC4 5 C   DA 1043 ? C   0 1043 . ? 1_555 ? 
655 OC4 5 C   DA 1044 ? C   0 1044 . ? 1_555 ? 
656 OC4 5 G   DA 1045 ? G   0 1045 . ? 1_555 ? 
657 OC5 3 U   DA 623  ? U   0 623  . ? 1_555 ? 
658 OC5 3 C   DA 633  ? C   0 633  . ? 1_555 ? 
659 OC5 3 G   DA 901  ? G   0 901  . ? 1_555 ? 
660 OC6 5 U   DA 768  ? U   0 768  . ? 1_555 ? 
661 OC6 5 C   DA 769  ? C   0 769  . ? 1_555 ? 
662 OC6 5 G   DA 2111 ? G   0 2111 . ? 1_555 ? 
663 OC6 5 A   DA 2112 ? A   0 2112 . ? 1_555 ? 
664 OC6 5 HOH FN .    ? HOH 0 5702 . ? 1_555 ? 
665 OC7 3 G   DA 1119 ? G   0 1119 . ? 1_555 ? 
666 OC7 3 C   DA 1243 ? C   0 1243 . ? 1_555 ? 
667 OC7 3 THR J  47   ? THR J 47   . ? 1_555 ? 
668 OC8 5 C   DA 920  ? C   0 920  . ? 1_555 ? 
669 OC8 5 U   DA 2278 ? U   0 2278 . ? 1_555 ? 
670 OC8 5 G   DA 2279 ? G   0 2279 . ? 1_555 ? 
671 OC8 5 A   DA 2463 ? A   0 2463 . ? 1_555 ? 
672 OC8 5 HOH FN .    ? HOH 0 3367 . ? 1_555 ? 
673 OC9 7 G   DA 941  ? G   0 941  . ? 1_555 ? 
674 OC9 7 U   DA 942  ? U   0 942  . ? 1_555 ? 
675 OC9 7 G   DA 1024 ? G   0 1024 . ? 1_555 ? 
676 OC9 7 C   DA 1025 ? C   0 1025 . ? 1_555 ? 
677 OC9 7 HOH FN .    ? HOH 0 4887 . ? 1_555 ? 
678 OC9 7 HOH FN .    ? HOH 0 7132 . ? 1_555 ? 
679 OC9 7 HOH FN .    ? HOH 0 9310 . ? 1_555 ? 
680 PC1 6 G   DA 2611 ? G   0 2611 . ? 1_555 ? 
681 PC1 6 A   DA 2612 ? A   0 2612 . ? 1_555 ? 
682 PC1 6 HOH FN .    ? HOH 0 4630 . ? 1_555 ? 
683 PC1 6 HOH FN .    ? HOH 0 4761 . ? 1_555 ? 
684 PC1 6 MG  RC .    ? MG  0 8007 . ? 1_555 ? 
685 PC1 6 HOH FN .    ? HOH 0 9589 . ? 1_555 ? 
686 PC2 5 G   DA 898  ? G   0 898  . ? 1_555 ? 
687 PC2 5 A   DA 922  ? A   0 922  . ? 1_555 ? 
688 PC2 5 A   DA 923  ? A   0 923  . ? 1_555 ? 
689 PC2 5 G   DA 924  ? G   0 924  . ? 1_555 ? 
690 PC2 5 U   DA 2109 ? U   0 2109 . ? 1_555 ? 
691 PC3 5 A   DA 453  ? A   0 453  . ? 1_555 ? 
692 PC3 5 U   DA 454  ? U   0 454  . ? 1_555 ? 
693 PC3 5 C   DA 478  ? C   0 478  . ? 1_555 ? 
694 PC3 5 G   DA 479  ? G   0 479  . ? 1_555 ? 
695 PC3 5 HOH FN .    ? HOH 0 6814 . ? 1_555 ? 
696 PC4 3 U   DA 837  ? U   0 837  . ? 1_555 ? 
697 PC4 3 GLN B  231  ? GLN B 230  . ? 1_555 ? 
698 PC4 3 GLY B  232  ? GLY B 231  . ? 1_555 ? 
699 PC5 3 G   DA 2110 ? G   0 2110 . ? 1_555 ? 
700 PC5 3 G   DA 2111 ? G   0 2111 . ? 1_555 ? 
701 PC5 3 U   DA 2277 ? U   0 2277 . ? 1_555 ? 
702 PC6 2 U   DA 1359 ? U   0 1359 . ? 1_555 ? 
703 PC6 2 C   DA 1360 ? C   0 1360 . ? 1_555 ? 
704 PC7 4 C   DA 2056 ? C   0 2056 . ? 1_555 ? 
705 PC7 4 U   DA 2057 ? U   0 2057 . ? 1_555 ? 
706 PC7 4 HOH FN .    ? HOH 0 3734 . ? 1_555 ? 
707 PC7 4 HOH FN .    ? HOH 0 5910 . ? 1_555 ? 
708 PC8 6 U   DA 391  ? U   0 391  . ? 1_555 ? 
709 PC8 6 U   DA 392  ? U   0 392  . ? 1_555 ? 
710 PC8 6 U   DA 398  ? U   0 398  . ? 1_555 ? 
711 PC8 6 C   DA 399  ? C   0 399  . ? 1_555 ? 
712 PC8 6 LYS M  194  ? LYS M 193  . ? 1_555 ? 
713 PC8 6 GLY M  195  ? GLY M 194  . ? 1_555 ? 
714 PC9 7 G   DA 545  ? G   0 545  . ? 1_555 ? 
715 PC9 7 G   DA 610  ? G   0 610  . ? 1_555 ? 
716 PC9 7 U   DA 611  ? U   0 611  . ? 1_555 ? 
717 PC9 7 HOH FN .    ? HOH 0 3786 . ? 1_555 ? 
718 PC9 7 HOH FN .    ? HOH 0 3804 . ? 1_555 ? 
719 PC9 7 HOH FN .    ? HOH 0 4712 . ? 1_555 ? 
720 PC9 7 HOH FN .    ? HOH 0 4770 . ? 1_555 ? 
721 QC1 4 G   DA 464  ? G   0 464  . ? 1_555 ? 
722 QC1 4 G   DA 475  ? G   0 475  . ? 1_555 ? 
723 QC1 4 HOH FN .    ? HOH 0 5366 . ? 1_555 ? 
724 QC1 4 ARG C  55   ? ARG C 55   . ? 1_555 ? 
725 QC2 5 A   DA 797  ? A   0 797  . ? 1_555 ? 
726 QC2 5 G   DA 798  ? G   0 798  . ? 1_555 ? 
727 QC2 5 C   DA 799  ? C   0 799  . ? 1_555 ? 
728 QC2 5 G   DA 814  ? G   0 814  . ? 1_555 ? 
729 QC2 5 G   DA 816  ? G   0 816  . ? 1_555 ? 
730 QC3 4 U   DA 392  ? U   0 392  . ? 1_555 ? 
731 QC3 4 A   DA 395  ? A   0 395  . ? 1_555 ? 
732 QC3 4 HOH FN .    ? HOH 0 3668 . ? 1_555 ? 
733 QC3 4 ARG CA 42   ? ARG 3 42   . ? 1_555 ? 
734 QC4 2 G   DA 1832 ? G   0 1832 . ? 1_555 ? 
735 QC4 2 A   DA 2022 ? A   0 2022 . ? 1_555 ? 
736 QC5 2 U   DA 2492 ? U   0 2492 . ? 1_555 ? 
737 QC5 2 C   DA 2493 ? C   0 2493 . ? 1_555 ? 
738 QC6 4 U   DA 919  ? U   0 919  . ? 1_555 ? 
739 QC6 4 G   DA 921  ? G   0 921  . ? 1_555 ? 
740 QC6 4 A   DA 922  ? A   0 922  . ? 1_555 ? 
741 QC6 4 G   DA 924  ? G   0 924  . ? 1_555 ? 
742 QC7 6 U   DA 1577 ? U   0 1577 . ? 1_555 ? 
743 QC7 6 G   DA 1618 ? G   0 1618 . ? 1_555 ? 
744 QC7 6 HOH FN .    ? HOH 0 3915 . ? 1_555 ? 
745 QC7 6 HOH FN .    ? HOH 0 4165 . ? 1_555 ? 
746 QC7 6 HOH FN .    ? HOH 0 5801 . ? 1_555 ? 
747 QC7 6 HOH FN .    ? HOH 0 9133 . ? 1_555 ? 
748 QC8 4 G   DA 196  ? G   0 196  . ? 1_555 ? 
749 QC8 4 A   DA 415  ? A   0 415  . ? 1_555 ? 
750 QC8 4 G   DA 416  ? G   0 416  . ? 1_555 ? 
751 QC8 4 HOH FN .    ? HOH 0 3816 . ? 1_555 ? 
752 QC9 6 G   DA 868  ? G   0 868  . ? 1_555 ? 
753 QC9 6 G   DA 869  ? G   0 869  . ? 1_555 ? 
754 QC9 6 A   DA 886  ? A   0 886  . ? 1_555 ? 
755 QC9 6 G   DA 887  ? G   0 887  . ? 1_555 ? 
756 QC9 6 HOH FN .    ? HOH 0 3185 . ? 1_555 ? 
757 QC9 6 HOH FN .    ? HOH 0 4790 . ? 1_555 ? 
758 RC1 4 U   DA 1293 ? U   0 1293 . ? 1_555 ? 
759 RC1 4 G   DA 1295 ? G   0 1295 . ? 1_555 ? 
760 RC1 4 HOH FN .    ? HOH 0 7196 . ? 1_555 ? 
761 RC1 4 HOH AN .    ? HOH Y 8866 . ? 1_555 ? 
762 RC2 6 C   DA 762  ? C   0 762  . ? 1_555 ? 
763 RC2 6 G   DA 902  ? G   0 902  . ? 1_555 ? 
764 RC2 6 U   DA 903  ? U   0 903  . ? 1_555 ? 
765 RC2 6 HIS L  19   ? HIS L 18   . ? 1_555 ? 
766 RC2 6 HOH NM .    ? HOH L 8984 . ? 1_555 ? 
767 RC2 6 HOH NM .    ? HOH L 9015 . ? 1_555 ? 
768 RC3 6 U   DA 831  ? U   0 831  . ? 1_555 ? 
769 RC3 6 U   DA 832  ? U   0 832  . ? 1_555 ? 
770 RC3 6 G   DA 833  ? G   0 833  . ? 1_555 ? 
771 RC3 6 C   DA 849  ? C   0 849  . ? 1_555 ? 
772 RC3 6 U   DA 850  ? U   0 850  . ? 1_555 ? 
773 RC3 6 HOH FN .    ? HOH 0 4606 . ? 1_555 ? 
774 RC4 6 G   DA 2585 ? G   0 2585 . ? 1_555 ? 
775 RC4 6 U   DA 2586 ? U   0 2586 . ? 1_555 ? 
776 RC4 6 OMU DA 2587 ? OMU 0 2587 . ? 1_555 ? 
777 RC4 6 G   DA 2592 ? G   0 2592 . ? 1_555 ? 
778 RC4 6 HOH FN .    ? HOH 0 3250 . ? 1_555 ? 
779 RC4 6 HOH FN .    ? HOH 0 4584 . ? 1_555 ? 
780 RC5 1 G   DA 2772 ? G   0 2772 . ? 1_555 ? 
781 RC6 2 C   DA 197  ? C   0 197  . ? 1_555 ? 
782 RC6 2 HOH FN .    ? HOH 0 6123 . ? 1_555 ? 
783 RC7 4 G   DA 1077 ? G   0 1077 . ? 1_555 ? 
784 RC7 4 A   DA 1079 ? A   0 1079 . ? 1_555 ? 
785 RC7 4 C   DA 1080 ? C   0 1080 . ? 1_555 ? 
786 RC7 4 HOH FN .    ? HOH 0 9492 . ? 1_555 ? 
787 RC8 5 U   DA 12   ? U   0 12   . ? 1_555 ? 
788 RC8 5 C   DA 2086 ? C   0 2086 . ? 1_555 ? 
789 RC8 5 C   DA 2087 ? C   0 2087 . ? 1_555 ? 
790 RC8 5 ASN R  64   ? ASN R 63   . ? 1_555 ? 
791 RC8 5 SR  RB .    ? SR  R 8912 . ? 1_555 ? 
792 RC9 2 G   DA 1452 ? G   0 1452 . ? 1_555 ? 
793 RC9 2 G   DA 1676 ? G   0 1676 . ? 1_555 ? 
794 SC1 2 C   DA 197  ? C   0 197  . ? 1_555 ? 
795 SC1 2 G   DA 201  ? G   0 201  . ? 1_555 ? 
796 SC2 4 G   DA 2582 ? G   0 2582 . ? 1_555 ? 
797 SC2 4 A   DA 2596 ? A   0 2596 . ? 1_555 ? 
798 SC2 4 LYS K  14   ? LYS K 14   . ? 1_555 ? 
799 SC2 4 SER K  33   ? SER K 33   . ? 1_555 ? 
800 SC3 5 G   DA 1300 ? G   0 1300 . ? 1_555 ? 
801 SC3 5 A   DA 1328 ? A   0 1328 . ? 1_555 ? 
802 SC3 5 G   DA 1329 ? G   0 1329 . ? 1_555 ? 
803 SC3 5 HOH FN .    ? HOH 0 5541 . ? 1_555 ? 
804 SC3 5 HOH FN .    ? HOH 0 5833 . ? 1_555 ? 
805 SC4 3 A   DA 1597 ? A   0 1597 . ? 1_555 ? 
806 SC4 3 A   DA 1598 ? A   0 1598 . ? 1_555 ? 
807 SC4 3 G   DA 1646 ? G   0 1646 . ? 1_555 ? 
808 SC5 2 G   DA 1072 ? G   0 1072 . ? 1_555 ? 
809 SC5 2 G   DA 1087 ? G   0 1087 . ? 1_555 ? 
810 SC6 4 G   DA 824  ? G   0 824  . ? 1_555 ? 
811 SC6 4 G   DA 854  ? G   0 854  . ? 1_555 ? 
812 SC6 4 HOH FN .    ? HOH 0 5179 . ? 1_555 ? 
813 SC6 4 HOH FN .    ? HOH 0 5310 . ? 1_555 ? 
814 SC7 5 G   DA 836  ? G   0 836  . ? 1_555 ? 
815 SC7 5 U   DA 2615 ? U   0 2615 . ? 1_555 ? 
816 SC7 5 HOH FN .    ? HOH 0 3276 . ? 1_555 ? 
817 SC7 5 GLN B  231  ? GLN B 230  . ? 1_555 ? 
818 SC7 5 HOH DM .    ? HOH B 8996 . ? 1_555 ? 
819 SC8 5 G   DA 1489 ? G   0 1489 . ? 1_555 ? 
820 SC8 5 G   DA 1491 ? G   0 1491 . ? 1_555 ? 
821 SC8 5 HOH FN .    ? HOH 0 3310 . ? 1_555 ? 
822 SC8 5 HOH FN .    ? HOH 0 4847 . ? 1_555 ? 
823 SC8 5 HOH FN .    ? HOH 0 7030 . ? 1_555 ? 
824 SC9 5 A   DA 643  ? A   0 643  . ? 1_555 ? 
825 SC9 5 C   DA 1353 ? C   0 1353 . ? 1_555 ? 
826 SC9 5 G   DA 1354 ? G   0 1354 . ? 1_555 ? 
827 SC9 5 HOH FN .    ? HOH 0 3345 . ? 1_555 ? 
828 SC9 5 HOH FN .    ? HOH 0 7423 . ? 1_555 ? 
829 TC1 3 A   DA 1755 ? A   0 1755 . ? 1_555 ? 
830 TC1 3 HOH FN .    ? HOH 0 7996 . ? 1_555 ? 
831 TC1 3 HOH FN .    ? HOH 0 9408 . ? 1_555 ? 
832 TC2 2 C   DA 893  ? C   0 893  . ? 1_555 ? 
833 TC2 2 HOH FN .    ? HOH 0 7126 . ? 1_555 ? 
834 TC3 6 U   DA 146  ? U   0 146  . ? 1_555 ? 
835 TC3 6 G   DA 147  ? G   0 147  . ? 1_555 ? 
836 TC3 6 G   DA 182  ? G   0 182  . ? 1_555 ? 
837 TC3 6 A   DA 183  ? A   0 183  . ? 1_555 ? 
838 TC3 6 ASP M  158  ? ASP M 157  . ? 1_555 ? 
839 TC3 6 HOH OM .    ? HOH M 8941 . ? 1_555 ? 
840 TC4 5 HOH FN .    ? HOH 0 4658 . ? 1_555 ? 
841 TC4 5 HOH FN .    ? HOH 0 6373 . ? 1_555 ? 
842 TC4 5 HOH FN .    ? HOH 0 7011 . ? 1_555 ? 
843 TC4 5 HOH FN .    ? HOH 0 7435 . ? 1_555 ? 
844 TC4 5 HOH FN .    ? HOH 0 9649 . ? 1_555 ? 
845 TC5 5 A   DA 1747 ? A   0 1747 . ? 1_555 ? 
846 TC5 5 U   DA 1748 ? U   0 1748 . ? 1_555 ? 
847 TC5 5 U   DA 1749 ? U   0 1749 . ? 1_555 ? 
848 TC5 5 G   DA 2585 ? G   0 2585 . ? 1_555 ? 
849 TC5 5 HOH FN .    ? HOH 0 3591 . ? 1_555 ? 
850 TC6 2 U   DA 664  ? U   0 664  . ? 1_555 ? 
851 TC6 2 G   DA 681  ? G   0 681  . ? 1_555 ? 
852 TC7 3 C   DA 1420 ? C   0 1420 . ? 1_555 ? 
853 TC7 3 C   DA 1421 ? C   0 1421 . ? 1_555 ? 
854 TC7 3 G   DA 1438 ? G   0 1438 . ? 1_555 ? 
855 TC8 2 U   DA 454  ? U   0 454  . ? 1_555 ? 
856 TC8 2 C   DA 478  ? C   0 478  . ? 1_555 ? 
857 TC9 3 A   DA 1504 ? A   0 1504 . ? 1_555 ? 
858 TC9 3 A   DA 1678 ? A   0 1678 . ? 1_555 ? 
859 TC9 3 C   DA 1679 ? C   0 1679 . ? 1_555 ? 
860 UC1 3 G   DA 2543 ? G   0 2543 . ? 1_555 ? 
861 UC1 3 C   DA 2608 ? C   0 2608 . ? 1_555 ? 
862 UC1 3 HOH FN .    ? HOH 0 7226 . ? 1_555 ? 
863 UC2 1 HOH FN .    ? HOH 0 3642 . ? 1_555 ? 
864 UC3 2 A   DA 1717 ? A   0 1717 . ? 1_555 ? 
865 UC3 2 G   DA 1718 ? G   0 1718 . ? 1_555 ? 
866 UC4 1 G   DA 471  ? G   0 471  . ? 1_555 ? 
867 UC5 3 G   DA 1059 ? G   0 1059 . ? 1_555 ? 
868 UC5 3 C   DA 1127 ? C   0 1127 . ? 1_555 ? 
869 UC5 3 HOH FN .    ? HOH 0 5753 . ? 1_555 ? 
870 UC6 3 G   DA 2725 ? G   0 2725 . ? 1_555 ? 
871 UC6 3 G   DA 2755 ? G   0 2755 . ? 1_555 ? 
872 UC6 3 HOH FN .    ? HOH 0 4705 . ? 1_555 ? 
873 UC7 1 G   DA 503  ? G   0 503  . ? 1_555 ? 
874 UC8 3 G   DA 724  ? G   0 724  . ? 1_555 ? 
875 UC8 3 HOH FN .    ? HOH 0 6644 . ? 1_555 ? 
876 UC8 3 HOH FN .    ? HOH 0 7300 . ? 1_555 ? 
877 UC9 2 A   DA 2553 ? A   0 2553 . ? 1_555 ? 
878 UC9 2 HOH FN .    ? HOH 0 4541 . ? 1_555 ? 
879 VC1 3 U   DA 1109 ? U   0 1109 . ? 1_555 ? 
880 VC1 3 G   DA 1110 ? G   0 1110 . ? 1_555 ? 
881 VC1 3 A   DA 1247 ? A   0 1247 . ? 1_555 ? 
882 VC2 2 G   DA 1543 ? G   0 1543 . ? 1_555 ? 
883 VC2 2 HOH FN .    ? HOH 0 6954 . ? 1_555 ? 
884 VC3 4 U   DA 10   ? U   0 10   . ? 1_555 ? 
885 VC3 4 A   DA 532  ? A   0 532  . ? 1_555 ? 
886 VC3 4 U   DA 533  ? U   0 533  . ? 1_555 ? 
887 VC3 4 HOH FN .    ? HOH 0 4624 . ? 1_555 ? 
888 VC4 4 U   DA 777  ? U   0 777  . ? 1_555 ? 
889 VC4 4 U   DA 864  ? U   0 864  . ? 1_555 ? 
890 VC4 4 MG  HD .    ? MG  0 8024 . ? 1_555 ? 
891 VC4 4 NA  IG .    ? NA  0 8521 . ? 1_555 ? 
892 VC5 3 G   DA 2421 ? G   0 2421 . ? 1_555 ? 
893 VC5 3 U   DA 2422 ? U   0 2422 . ? 1_555 ? 
894 VC5 3 C   DA 2423 ? C   0 2423 . ? 1_555 ? 
895 VC6 2 A   DA 1291 ? A   0 1291 . ? 1_555 ? 
896 VC6 2 G   DA 1292 ? G   0 1292 . ? 1_555 ? 
897 VC7 1 HOH FN .    ? HOH 0 5182 . ? 1_555 ? 
898 VC8 3 A   DA 2465 ? A   0 2465 . ? 1_555 ? 
899 VC8 3 G   DA 2466 ? G   0 2466 . ? 1_555 ? 
900 VC8 3 ASP L  37   ? ASP L 36   . ? 1_555 ? 
901 VC9 2 G   DA 1683 ? G   0 1683 . ? 1_555 ? 
902 VC9 2 U   DA 1696 ? U   0 1696 . ? 1_555 ? 
903 WC1 3 C   DA 2745 ? C   0 2745 . ? 1_555 ? 
904 WC1 3 G   DA 2750 ? G   0 2750 . ? 1_555 ? 
905 WC1 3 HOH FN .    ? HOH 0 9703 . ? 1_555 ? 
906 WC2 3 A   DA 1885 ? A   0 1885 . ? 1_555 ? 
907 WC2 3 A   DA 1886 ? A   0 1886 . ? 1_555 ? 
908 WC2 3 U   DA 1887 ? U   0 1887 . ? 1_555 ? 
909 WC3 2 U   DA 2016 ? U   0 2016 . ? 1_555 ? 
910 WC3 2 HOH FN .    ? HOH 0 9216 . ? 1_555 ? 
911 WC4 2 C   DA 1455 ? C   0 1455 . ? 1_555 ? 
912 WC4 2 G   DA 1484 ? G   0 1484 . ? 1_555 ? 
913 WC5 1 G   DA 2091 ? G   0 2091 . ? 1_555 ? 
914 WC6 1 C   DA 1690 ? C   0 1690 . ? 1_555 ? 
915 WC7 4 A   DA 2302 ? A   0 2302 . ? 1_555 ? 
916 WC7 4 A   DA 2303 ? A   0 2303 . ? 1_555 ? 
917 WC7 4 HOH FN .    ? HOH 0 4535 . ? 1_555 ? 
918 WC7 4 HOH FN .    ? HOH 0 5750 . ? 1_555 ? 
919 WC8 5 U   DA 821  ? U   0 821  . ? 1_555 ? 
920 WC8 5 C   DA 822  ? C   0 822  . ? 1_555 ? 
921 WC8 5 G   DA 854  ? G   0 854  . ? 1_555 ? 
922 WC8 5 U   DA 855  ? U   0 855  . ? 1_555 ? 
923 WC8 5 HOH FN .    ? HOH 0 4645 . ? 1_555 ? 
924 WC9 1 G   DA 2696 ? G   0 2696 . ? 1_555 ? 
925 XC1 3 G   DA 2810 ? G   0 2810 . ? 1_555 ? 
926 XC1 3 HOH FN .    ? HOH 0 9416 . ? 1_555 ? 
927 XC1 3 ASN B  28   ? ASN B 27   . ? 1_555 ? 
928 XC2 2 U   DA 2557 ? U   0 2557 . ? 1_555 ? 
929 XC2 2 HOH FN .    ? HOH 0 3970 . ? 1_555 ? 
930 XC3 2 A   DA 682  ? A   0 682  . ? 1_555 ? 
931 XC3 2 G   DA 683  ? G   0 683  . ? 1_555 ? 
932 XC4 3 C   DA 1462 ? C   0 1462 . ? 1_555 ? 
933 XC4 3 U   DA 1463 ? U   0 1463 . ? 1_555 ? 
934 XC4 3 GLY AA 41   ? GLY 1 40   . ? 1_555 ? 
935 XC5 4 A   DA 1133 ? A   0 1133 . ? 1_555 ? 
936 XC5 4 G   DA 1134 ? G   0 1134 . ? 1_555 ? 
937 XC5 4 HOH FN .    ? HOH 0 3341 . ? 1_555 ? 
938 XC5 4 HOH FN .    ? HOH 0 5677 . ? 1_555 ? 
939 XC6 1 U   DA 1972 ? U   0 1972 . ? 1_555 ? 
940 XC7 1 G   DA 1113 ? G   0 1113 . ? 1_555 ? 
941 XC8 2 G   DA 1444 ? G   0 1444 . ? 1_555 ? 
942 XC8 2 HOH UM .    ? HOH S 8534 . ? 1_555 ? 
943 XC9 5 U   DA 1432 ? U   0 1432 . ? 1_555 ? 
944 XC9 5 G   DA 1433 ? G   0 1433 . ? 1_555 ? 
945 XC9 5 U   DA 1724 ? U   0 1724 . ? 1_555 ? 
946 XC9 5 HOH FN .    ? HOH 0 3215 . ? 1_555 ? 
947 XC9 5 HOH FN .    ? HOH 0 4484 . ? 1_555 ? 
948 YC1 1 G   DA 2284 ? G   0 2284 . ? 1_555 ? 
949 YC2 1 G   DA 2777 ? G   0 2777 . ? 1_555 ? 
950 YC3 3 A   DA 1815 ? A   0 1815 . ? 1_555 ? 
951 YC3 3 HOH FN .    ? HOH 0 9244 . ? 1_555 ? 
952 YC3 3 HOH FN .    ? HOH 0 9374 . ? 1_555 ? 
953 YC4 2 C   DA 235  ? C   0 235  . ? 1_555 ? 
954 YC4 2 HOH FN .    ? HOH 0 7012 . ? 1_555 ? 
955 YC5 1 U   DA 2690 ? U   0 2690 . ? 1_555 ? 
956 YC6 2 A   DA 565  ? A   0 565  . ? 1_555 ? 
957 YC6 2 G   DA 592  ? G   0 592  . ? 1_555 ? 
958 YC7 1 HOH FN .    ? HOH 0 9277 . ? 1_555 ? 
959 YC8 1 U   DA 1835 ? U   0 1835 . ? 1_555 ? 
960 YC9 4 C   DA 1894 ? C   0 1894 . ? 1_555 ? 
961 YC9 4 U   DA 1897 ? U   0 1897 . ? 1_555 ? 
962 YC9 4 G   DA 1898 ? G   0 1898 . ? 1_555 ? 
963 YC9 4 U   DA 1939 ? U   0 1939 . ? 1_555 ? 
964 ZC1 5 C   DA 1129 ? C   0 1129 . ? 1_555 ? 
965 ZC1 5 HOH FN .    ? HOH 0 4516 . ? 1_555 ? 
966 ZC1 5 MG  WD .    ? MG  0 8040 . ? 1_555 ? 
967 ZC1 5 C   EA 91   ? C   9 91   . ? 1_555 ? 
968 ZC1 5 G   EA 92   ? G   9 92   . ? 1_555 ? 
969 ZC2 4 G   DA 2639 ? G   0 2639 . ? 1_555 ? 
970 ZC2 4 U   DA 2640 ? U   0 2640 . ? 1_555 ? 
971 ZC2 4 HOH FN .    ? HOH 0 4399 . ? 1_555 ? 
972 ZC2 4 HOH FN .    ? HOH 0 7472 . ? 1_555 ? 
973 ZC3 2 A   DA 1291 ? A   0 1291 . ? 1_555 ? 
974 ZC3 2 HOH FN .    ? HOH 0 5845 . ? 1_555 ? 
975 ZC4 5 A   DA 1746 ? A   0 1746 . ? 1_555 ? 
976 ZC4 5 A   DA 1747 ? A   0 1747 . ? 1_555 ? 
977 ZC4 5 U   DA 1748 ? U   0 1748 . ? 1_555 ? 
978 ZC4 5 U   DA 1749 ? U   0 1749 . ? 1_555 ? 
979 ZC4 5 G   DA 1752 ? G   0 1752 . ? 1_555 ? 
980 ZC5 1 HOH FN .    ? HOH 0 5152 . ? 1_555 ? 
981 ZC6 3 A   DA 378  ? A   0 378  . ? 1_555 ? 
982 ZC6 3 G   DA 379  ? G   0 379  . ? 1_555 ? 
983 ZC6 3 A   DA 429  ? A   0 429  . ? 1_555 ? 
984 ZC7 5 U   DA 2663 ? U   0 2663 . ? 1_555 ? 
985 ZC7 5 A   DA 2811 ? A   0 2811 . ? 1_555 ? 
986 ZC7 5 A   DA 2812 ? A   0 2812 . ? 1_555 ? 
987 ZC7 5 A   DA 2816 ? A   0 2816 . ? 1_555 ? 
988 ZC7 5 G   DA 2817 ? G   0 2817 . ? 1_555 ? 
989 ZC8 2 C   DA 1103 ? C   0 1103 . ? 1_555 ? 
990 ZC8 2 GLU J  28   ? GLU J 28   . ? 1_555 ? 
991 ZC9 1 G   DA 2700 ? G   0 2700 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3CME 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.000000 
_database_PDB_matrix.origx_vector[2]   0.000000 
_database_PDB_matrix.origx_vector[3]   0.000000 
# 
_atom_sites.entry_id                    3CME 
_atom_sites.fract_transf_matrix[1][1]   0.004744 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.003358 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.001746 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CD 
CL 
K  
MG 
N  
NA 
O  
P  
S  
SR 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . GLY A  1  2    ? 89.345  117.305 69.212  1.00 34.64  ? 1    GLY A N     1 
ATOM   2     C  CA    . GLY A  1  2    ? 89.610  118.543 69.972  1.00 35.78  ? 1    GLY A CA    1 
ATOM   3     C  C     . GLY A  1  2    ? 89.705  119.746 69.055  1.00 37.03  ? 1    GLY A C     1 
ATOM   4     O  O     . GLY A  1  2    ? 88.911  119.884 68.124  1.00 37.33  ? 1    GLY A O     1 
ATOM   5     N  N     . ARG A  1  3    ? 90.676  120.617 69.319  1.00 37.27  ? 2    ARG A N     1 
ATOM   6     C  CA    . ARG A  1  3    ? 90.883  121.814 68.513  1.00 36.99  ? 2    ARG A CA    1 
ATOM   7     C  C     . ARG A  1  3    ? 92.328  121.827 68.025  1.00 36.74  ? 2    ARG A C     1 
ATOM   8     O  O     . ARG A  1  3    ? 93.220  121.351 68.721  1.00 36.91  ? 2    ARG A O     1 
ATOM   9     C  CB    . ARG A  1  3    ? 90.610  123.067 69.354  1.00 37.73  ? 2    ARG A CB    1 
ATOM   10    C  CG    . ARG A  1  3    ? 89.271  123.057 70.079  1.00 37.33  ? 2    ARG A CG    1 
ATOM   11    C  CD    . ARG A  1  3    ? 89.245  124.070 71.220  1.00 37.93  ? 2    ARG A CD    1 
ATOM   12    N  NE    . ARG A  1  3    ? 88.906  125.420 70.786  1.00 37.23  ? 2    ARG A NE    1 
ATOM   13    C  CZ    . ARG A  1  3    ? 88.821  126.465 71.603  1.00 38.02  ? 2    ARG A CZ    1 
ATOM   14    N  NH1   . ARG A  1  3    ? 89.056  126.328 72.902  1.00 38.26  ? 2    ARG A NH1   1 
ATOM   15    N  NH2   . ARG A  1  3    ? 88.483  127.650 71.123  1.00 39.07  ? 2    ARG A NH2   1 
ATOM   16    N  N     . ARG A  1  4    ? 92.559  122.362 66.830  1.00 36.54  ? 3    ARG A N     1 
ATOM   17    C  CA    . ARG A  1  4    ? 93.911  122.431 66.285  1.00 36.69  ? 3    ARG A CA    1 
ATOM   18    C  C     . ARG A  1  4    ? 94.757  123.178 67.308  1.00 37.04  ? 3    ARG A C     1 
ATOM   19    O  O     . ARG A  1  4    ? 94.331  124.212 67.813  1.00 37.69  ? 3    ARG A O     1 
ATOM   20    C  CB    . ARG A  1  4    ? 93.925  123.220 64.973  1.00 36.86  ? 3    ARG A CB    1 
ATOM   21    C  CG    . ARG A  1  4    ? 92.685  123.052 64.135  1.00 37.29  ? 3    ARG A CG    1 
ATOM   22    C  CD    . ARG A  1  4    ? 92.895  122.150 62.939  1.00 37.28  ? 3    ARG A CD    1 
ATOM   23    N  NE    . ARG A  1  4    ? 93.295  122.900 61.752  1.00 36.76  ? 3    ARG A NE    1 
ATOM   24    C  CZ    . ARG A  1  4    ? 93.057  122.509 60.504  1.00 36.90  ? 3    ARG A CZ    1 
ATOM   25    N  NH1   . ARG A  1  4    ? 92.418  121.377 60.258  1.00 38.56  ? 3    ARG A NH1   1 
ATOM   26    N  NH2   . ARG A  1  4    ? 93.457  123.253 59.491  1.00 38.67  ? 3    ARG A NH2   1 
ATOM   27    N  N     . ILE A  1  5    ? 95.944  122.670 67.625  1.00 37.28  ? 4    ILE A N     1 
ATOM   28    C  CA    . ILE A  1  5    ? 96.795  123.365 68.580  1.00 36.77  ? 4    ILE A CA    1 
ATOM   29    C  C     . ILE A  1  5    ? 97.445  124.592 67.921  1.00 37.97  ? 4    ILE A C     1 
ATOM   30    O  O     . ILE A  1  5    ? 97.450  124.731 66.696  1.00 38.80  ? 4    ILE A O     1 
ATOM   31    C  CB    . ILE A  1  5    ? 97.864  122.427 69.157  1.00 34.45  ? 4    ILE A CB    1 
ATOM   32    C  CG1   . ILE A  1  5    ? 98.749  121.878 68.049  1.00 35.17  ? 4    ILE A CG1   1 
ATOM   33    C  CG2   . ILE A  1  5    ? 97.193  121.272 69.848  1.00 34.90  ? 4    ILE A CG2   1 
ATOM   34    C  CD1   . ILE A  1  5    ? 99.793  120.894 68.548  1.00 34.67  ? 4    ILE A CD1   1 
ATOM   35    N  N     . GLN A  1  6    ? 97.965  125.493 68.744  1.00 39.79  ? 5    GLN A N     1 
ATOM   36    C  CA    . GLN A  1  6    ? 98.583  126.719 68.268  1.00 40.06  ? 5    GLN A CA    1 
ATOM   37    C  C     . GLN A  1  6    ? 99.548  126.462 67.128  1.00 39.31  ? 5    GLN A C     1 
ATOM   38    O  O     . GLN A  1  6    ? 99.558  127.199 66.145  1.00 40.47  ? 5    GLN A O     1 
ATOM   39    C  CB    . GLN A  1  6    ? 99.294  127.417 69.433  1.00 42.29  ? 5    GLN A CB    1 
ATOM   40    C  CG    . GLN A  1  6    ? 100.184 128.605 69.058  1.00 45.67  ? 5    GLN A CG    1 
ATOM   41    C  CD    . GLN A  1  6    ? 100.635 129.411 70.275  1.00 46.09  ? 5    GLN A CD    1 
ATOM   42    O  OE1   . GLN A  1  6    ? 99.885  130.243 70.792  1.00 46.51  ? 5    GLN A OE1   1 
ATOM   43    N  NE2   . GLN A  1  6    ? 101.854 129.151 70.748  1.00 45.73  ? 5    GLN A NE2   1 
ATOM   44    N  N     . GLY A  1  7    ? 100.353 125.412 67.256  1.00 39.26  ? 6    GLY A N     1 
ATOM   45    C  CA    . GLY A  1  7    ? 101.313 125.088 66.216  1.00 39.36  ? 6    GLY A CA    1 
ATOM   46    C  C     . GLY A  1  7    ? 100.701 125.005 64.828  1.00 40.03  ? 6    GLY A C     1 
ATOM   47    O  O     . GLY A  1  7    ? 101.345 125.372 63.840  1.00 40.76  ? 6    GLY A O     1 
ATOM   48    N  N     . GLN A  1  8    ? 99.459  124.522 64.755  1.00 40.35  ? 7    GLN A N     1 
ATOM   49    C  CA    . GLN A  1  8    ? 98.739  124.379 63.492  1.00 38.48  ? 7    GLN A CA    1 
ATOM   50    C  C     . GLN A  1  8    ? 98.169  125.711 63.060  1.00 36.62  ? 7    GLN A C     1 
ATOM   51    O  O     . GLN A  1  8    ? 97.995  125.957 61.872  1.00 36.25  ? 7    GLN A O     1 
ATOM   52    C  CB    . GLN A  1  8    ? 97.617  123.356 63.634  1.00 39.50  ? 7    GLN A CB    1 
ATOM   53    C  CG    . GLN A  1  8    ? 98.122  121.947 63.903  1.00 41.98  ? 7    GLN A CG    1 
ATOM   54    C  CD    . GLN A  1  8    ? 97.001  120.931 64.050  1.00 44.23  ? 7    GLN A CD    1 
ATOM   55    O  OE1   . GLN A  1  8    ? 96.120  121.080 64.898  1.00 45.66  ? 7    GLN A OE1   1 
ATOM   56    N  NE2   . GLN A  1  8    ? 97.034  119.889 63.225  1.00 43.19  ? 7    GLN A NE2   1 
ATOM   57    N  N     . ARG A  1  9    ? 97.873  126.569 64.029  1.00 35.50  ? 8    ARG A N     1 
ATOM   58    C  CA    . ARG A  1  9    ? 97.360  127.893 63.716  1.00 35.76  ? 8    ARG A CA    1 
ATOM   59    C  C     . ARG A  1  9    ? 98.427  128.653 62.923  1.00 34.15  ? 8    ARG A C     1 
ATOM   60    O  O     . ARG A  1  9    ? 98.125  129.259 61.901  1.00 34.52  ? 8    ARG A O     1 
ATOM   61    C  CB    . ARG A  1  9    ? 97.014  128.661 64.997  1.00 38.48  ? 8    ARG A CB    1 
ATOM   62    C  CG    . ARG A  1  9    ? 95.563  128.535 65.462  1.00 42.21  ? 8    ARG A CG    1 
ATOM   63    C  CD    . ARG A  1  9    ? 95.191  127.102 65.822  1.00 46.57  ? 8    ARG A CD    1 
ATOM   64    N  NE    . ARG A  1  9    ? 93.815  126.978 66.316  1.00 50.23  ? 8    ARG A NE    1 
ATOM   65    C  CZ    . ARG A  1  9    ? 93.469  126.978 67.604  1.00 52.08  ? 8    ARG A CZ    1 
ATOM   66    N  NH1   . ARG A  1  9    ? 94.397  127.098 68.548  1.00 52.69  ? 8    ARG A NH1   1 
ATOM   67    N  NH2   . ARG A  1  9    ? 92.195  126.842 67.955  1.00 51.33  ? 8    ARG A NH2   1 
ATOM   68    N  N     . ARG A  1  10   ? 99.674  128.609 63.390  1.00 31.90  ? 9    ARG A N     1 
ATOM   69    C  CA    . ARG A  1  10   ? 100.779 129.286 62.709  1.00 30.34  ? 9    ARG A CA    1 
ATOM   70    C  C     . ARG A  1  10   ? 100.754 129.053 61.201  1.00 28.86  ? 9    ARG A C     1 
ATOM   71    O  O     . ARG A  1  10   ? 100.795 129.995 60.405  1.00 28.95  ? 9    ARG A O     1 
ATOM   72    C  CB    . ARG A  1  10   ? 102.124 128.779 63.219  1.00 31.24  ? 9    ARG A CB    1 
ATOM   73    C  CG    . ARG A  1  10   ? 102.441 129.087 64.644  1.00 34.55  ? 9    ARG A CG    1 
ATOM   74    C  CD    . ARG A  1  10   ? 103.785 128.462 65.061  1.00 37.07  ? 9    ARG A CD    1 
ATOM   75    N  NE    . ARG A  1  10   ? 104.935 128.994 64.329  1.00 34.63  ? 9    ARG A NE    1 
ATOM   76    C  CZ    . ARG A  1  10   ? 105.531 128.372 63.321  1.00 33.62  ? 9    ARG A CZ    1 
ATOM   77    N  NH1   . ARG A  1  10   ? 105.097 127.193 62.916  1.00 33.64  ? 9    ARG A NH1   1 
ATOM   78    N  NH2   . ARG A  1  10   ? 106.565 128.934 62.719  1.00 34.78  ? 9    ARG A NH2   1 
ATOM   79    N  N     . GLY A  1  11   ? 100.717 127.783 60.819  1.00 25.56  ? 10   GLY A N     1 
ATOM   80    C  CA    . GLY A  1  11   ? 100.710 127.442 59.419  1.00 24.10  ? 10   GLY A CA    1 
ATOM   81    C  C     . GLY A  1  11   ? 99.773  128.293 58.596  1.00 23.94  ? 10   GLY A C     1 
ATOM   82    O  O     . GLY A  1  11   ? 100.119 128.676 57.491  1.00 24.38  ? 10   GLY A O     1 
ATOM   83    N  N     . ARG A  1  12   ? 98.595  128.604 59.129  1.00 23.67  ? 11   ARG A N     1 
ATOM   84    C  CA    . ARG A  1  12   ? 97.622  129.397 58.389  1.00 24.02  ? 11   ARG A CA    1 
ATOM   85    C  C     . ARG A  1  12   ? 98.113  130.766 57.954  1.00 23.21  ? 11   ARG A C     1 
ATOM   86    O  O     . ARG A  1  12   ? 97.519  131.394 57.073  1.00 22.59  ? 11   ARG A O     1 
ATOM   87    C  CB    . ARG A  1  12   ? 96.317  129.512 59.180  1.00 23.65  ? 11   ARG A CB    1 
ATOM   88    C  CG    . ARG A  1  12   ? 95.490  128.241 59.063  1.00 25.69  ? 11   ARG A CG    1 
ATOM   89    C  CD    . ARG A  1  12   ? 94.136  128.295 59.749  1.00 28.93  ? 11   ARG A CD    1 
ATOM   90    N  NE    . ARG A  1  12   ? 93.112  129.081 59.047  1.00 30.90  ? 11   ARG A NE    1 
ATOM   91    C  CZ    . ARG A  1  12   ? 92.957  130.400 59.158  1.00 32.01  ? 11   ARG A CZ    1 
ATOM   92    N  NH1   . ARG A  1  12   ? 93.765  131.106 59.943  1.00 32.55  ? 11   ARG A NH1   1 
ATOM   93    N  NH2   . ARG A  1  12   ? 91.975  131.012 58.503  1.00 31.04  ? 11   ARG A NH2   1 
ATOM   94    N  N     . GLY A  1  13   ? 99.208  131.218 58.553  1.00 23.96  ? 12   GLY A N     1 
ATOM   95    C  CA    . GLY A  1  13   ? 99.761  132.506 58.186  1.00 25.04  ? 12   GLY A CA    1 
ATOM   96    C  C     . GLY A  1  13   ? 98.782  133.671 58.250  1.00 26.47  ? 12   GLY A C     1 
ATOM   97    O  O     . GLY A  1  13   ? 98.592  134.391 57.260  1.00 27.18  ? 12   GLY A O     1 
ATOM   98    N  N     . THR A  1  14   ? 98.145  133.860 59.404  1.00 25.34  ? 13   THR A N     1 
ATOM   99    C  CA    . THR A  1  14   ? 97.230  134.977 59.569  1.00 24.39  ? 13   THR A CA    1 
ATOM   100   C  C     . THR A  1  14   ? 98.074  136.123 60.102  1.00 25.66  ? 13   THR A C     1 
ATOM   101   O  O     . THR A  1  14   ? 99.277  135.978 60.289  1.00 27.46  ? 13   THR A O     1 
ATOM   102   C  CB    . THR A  1  14   ? 96.192  134.685 60.603  1.00 24.07  ? 13   THR A CB    1 
ATOM   103   O  OG1   . THR A  1  14   ? 96.850  134.485 61.856  1.00 26.46  ? 13   THR A OG1   1 
ATOM   104   C  CG2   . THR A  1  14   ? 95.411  133.455 60.241  1.00 21.47  ? 13   THR A CG2   1 
ATOM   105   N  N     . SER A  1  15   ? 97.450  137.259 60.368  1.00 27.39  ? 14   SER A N     1 
ATOM   106   C  CA    . SER A  1  15   ? 98.174  138.412 60.892  1.00 27.12  ? 14   SER A CA    1 
ATOM   107   C  C     . SER A  1  15   ? 99.020  138.004 62.098  1.00 28.62  ? 14   SER A C     1 
ATOM   108   O  O     . SER A  1  15   ? 100.241 138.017 62.045  1.00 29.41  ? 14   SER A O     1 
ATOM   109   C  CB    . SER A  1  15   ? 97.176  139.488 61.303  1.00 26.24  ? 14   SER A CB    1 
ATOM   110   O  OG    . SER A  1  15   ? 97.737  140.774 61.237  1.00 26.10  ? 14   SER A OG    1 
ATOM   111   N  N     . THR A  1  16   ? 98.347  137.623 63.175  1.00 31.17  ? 15   THR A N     1 
ATOM   112   C  CA    . THR A  1  16   ? 98.987  137.215 64.421  1.00 33.79  ? 15   THR A CA    1 
ATOM   113   C  C     . THR A  1  16   ? 100.269 136.396 64.299  1.00 34.40  ? 15   THR A C     1 
ATOM   114   O  O     . THR A  1  16   ? 101.153 136.503 65.143  1.00 35.29  ? 15   THR A O     1 
ATOM   115   C  CB    . THR A  1  16   ? 98.005  136.402 65.302  1.00 36.18  ? 15   THR A CB    1 
ATOM   116   O  OG1   . THR A  1  16   ? 96.824  137.179 65.544  1.00 39.71  ? 15   THR A OG1   1 
ATOM   117   C  CG2   . THR A  1  16   ? 98.649  136.037 66.640  1.00 34.45  ? 15   THR A CG2   1 
ATOM   118   N  N     . PHE A  1  17   ? 100.380 135.577 63.264  1.00 35.63  ? 16   PHE A N     1 
ATOM   119   C  CA    . PHE A  1  17   ? 101.562 134.741 63.125  1.00 36.53  ? 16   PHE A CA    1 
ATOM   120   C  C     . PHE A  1  17   ? 102.542 135.192 62.058  1.00 37.92  ? 16   PHE A C     1 
ATOM   121   O  O     . PHE A  1  17   ? 103.512 134.498 61.773  1.00 39.42  ? 16   PHE A O     1 
ATOM   122   C  CB    . PHE A  1  17   ? 101.154 133.288 62.867  1.00 37.72  ? 16   PHE A CB    1 
ATOM   123   C  CG    . PHE A  1  17   ? 100.415 132.647 64.017  1.00 40.60  ? 16   PHE A CG    1 
ATOM   124   C  CD1   . PHE A  1  17   ? 99.027  132.679 64.082  1.00 40.87  ? 16   PHE A CD1   1 
ATOM   125   C  CD2   . PHE A  1  17   ? 101.112 132.019 65.046  1.00 42.43  ? 16   PHE A CD2   1 
ATOM   126   C  CE1   . PHE A  1  17   ? 98.345  132.096 65.153  1.00 41.59  ? 16   PHE A CE1   1 
ATOM   127   C  CE2   . PHE A  1  17   ? 100.436 131.428 66.127  1.00 41.58  ? 16   PHE A CE2   1 
ATOM   128   C  CZ    . PHE A  1  17   ? 99.053  131.470 66.176  1.00 41.90  ? 16   PHE A CZ    1 
ATOM   129   N  N     . ARG A  1  18   ? 102.303 136.359 61.473  1.00 38.64  ? 17   ARG A N     1 
ATOM   130   C  CA    . ARG A  1  18   ? 103.195 136.880 60.442  1.00 38.31  ? 17   ARG A CA    1 
ATOM   131   C  C     . ARG A  1  18   ? 104.212 137.886 60.978  1.00 38.88  ? 17   ARG A C     1 
ATOM   132   O  O     . ARG A  1  18   ? 103.979 138.538 61.998  1.00 39.72  ? 17   ARG A O     1 
ATOM   133   C  CB    . ARG A  1  18   ? 102.386 137.552 59.339  1.00 38.18  ? 17   ARG A CB    1 
ATOM   134   C  CG    . ARG A  1  18   ? 102.183 136.715 58.110  1.00 38.10  ? 17   ARG A CG    1 
ATOM   135   C  CD    . ARG A  1  18   ? 101.397 137.511 57.105  1.00 37.52  ? 17   ARG A CD    1 
ATOM   136   N  NE    . ARG A  1  18   ? 99.992  137.608 57.474  1.00 37.07  ? 17   ARG A NE    1 
ATOM   137   C  CZ    . ARG A  1  18   ? 99.203  138.611 57.112  1.00 37.53  ? 17   ARG A CZ    1 
ATOM   138   N  NH1   . ARG A  1  18   ? 99.698  139.595 56.382  1.00 38.40  ? 17   ARG A NH1   1 
ATOM   139   N  NH2   . ARG A  1  18   ? 97.924  138.630 57.462  1.00 38.70  ? 17   ARG A NH2   1 
ATOM   140   N  N     . ALA A  1  19   ? 105.336 138.002 60.274  1.00 38.01  ? 18   ALA A N     1 
ATOM   141   C  CA    . ALA A  1  19   ? 106.394 138.940 60.624  1.00 36.55  ? 18   ALA A CA    1 
ATOM   142   C  C     . ALA A  1  19   ? 105.984 140.291 60.035  1.00 36.23  ? 18   ALA A C     1 
ATOM   143   O  O     . ALA A  1  19   ? 105.330 140.338 58.999  1.00 35.72  ? 18   ALA A O     1 
ATOM   144   C  CB    . ALA A  1  19   ? 107.716 138.475 60.026  1.00 35.78  ? 18   ALA A CB    1 
ATOM   145   N  N     . PRO A  1  20   ? 106.364 141.406 60.683  1.00 37.67  ? 19   PRO A N     1 
ATOM   146   C  CA    . PRO A  1  20   ? 106.014 142.746 60.200  1.00 37.65  ? 19   PRO A CA    1 
ATOM   147   C  C     . PRO A  1  20   ? 106.866 143.164 59.004  1.00 38.83  ? 19   PRO A C     1 
ATOM   148   O  O     . PRO A  1  20   ? 107.511 144.205 59.033  1.00 39.48  ? 19   PRO A O     1 
ATOM   149   C  CB    . PRO A  1  20   ? 106.288 143.609 61.415  1.00 37.67  ? 19   PRO A CB    1 
ATOM   150   C  CG    . PRO A  1  20   ? 107.552 142.988 61.935  1.00 37.00  ? 19   PRO A CG    1 
ATOM   151   C  CD    . PRO A  1  20   ? 107.241 141.499 61.865  1.00 37.38  ? 19   PRO A CD    1 
ATOM   152   N  N     . SER A  1  21   ? 106.856 142.347 57.960  1.00 39.32  ? 20   SER A N     1 
ATOM   153   C  CA    . SER A  1  21   ? 107.644 142.594 56.763  1.00 39.94  ? 20   SER A CA    1 
ATOM   154   C  C     . SER A  1  21   ? 107.501 144.000 56.220  1.00 41.84  ? 20   SER A C     1 
ATOM   155   O  O     . SER A  1  21   ? 108.485 144.604 55.792  1.00 42.91  ? 20   SER A O     1 
ATOM   156   C  CB    . SER A  1  21   ? 107.247 141.616 55.669  1.00 39.98  ? 20   SER A CB    1 
ATOM   157   O  OG    . SER A  1  21   ? 106.995 140.342 56.215  1.00 40.43  ? 20   SER A OG    1 
ATOM   158   N  N     . HIS A  1  22   ? 106.277 144.520 56.222  1.00 42.73  ? 21   HIS A N     1 
ATOM   159   C  CA    . HIS A  1  22   ? 106.039 145.862 55.701  1.00 45.37  ? 21   HIS A CA    1 
ATOM   160   C  C     . HIS A  1  22   ? 106.919 146.891 56.410  1.00 47.29  ? 21   HIS A C     1 
ATOM   161   O  O     . HIS A  1  22   ? 107.097 148.017 55.942  1.00 48.97  ? 21   HIS A O     1 
ATOM   162   C  CB    . HIS A  1  22   ? 104.564 146.248 55.862  1.00 44.72  ? 21   HIS A CB    1 
ATOM   163   C  CG    . HIS A  1  22   ? 104.129 146.409 57.286  1.00 45.26  ? 21   HIS A CG    1 
ATOM   164   N  ND1   . HIS A  1  22   ? 104.151 145.373 58.195  1.00 45.99  ? 21   HIS A ND1   1 
ATOM   165   C  CD2   . HIS A  1  22   ? 103.660 147.488 57.957  1.00 44.87  ? 21   HIS A CD2   1 
ATOM   166   C  CE1   . HIS A  1  22   ? 103.713 145.806 59.363  1.00 45.07  ? 21   HIS A CE1   1 
ATOM   167   N  NE2   . HIS A  1  22   ? 103.409 147.086 59.246  1.00 43.85  ? 21   HIS A NE2   1 
ATOM   168   N  N     . ARG A  1  23   ? 107.481 146.489 57.540  1.00 49.23  ? 22   ARG A N     1 
ATOM   169   C  CA    . ARG A  1  23   ? 108.321 147.372 58.325  1.00 49.94  ? 22   ARG A CA    1 
ATOM   170   C  C     . ARG A  1  23   ? 109.788 146.985 58.229  1.00 50.39  ? 22   ARG A C     1 
ATOM   171   O  O     . ARG A  1  23   ? 110.638 147.622 58.852  1.00 51.00  ? 22   ARG A O     1 
ATOM   172   C  CB    . ARG A  1  23   ? 107.873 147.325 59.780  1.00 48.41  ? 22   ARG A CB    1 
ATOM   173   C  CG    . ARG A  1  23   ? 107.647 148.678 60.383  1.00 49.32  ? 22   ARG A CG    1 
ATOM   174   C  CD    . ARG A  1  23   ? 107.477 148.530 61.859  1.00 49.78  ? 22   ARG A CD    1 
ATOM   175   N  NE    . ARG A  1  23   ? 106.447 147.554 62.176  1.00 49.90  ? 22   ARG A NE    1 
ATOM   176   C  CZ    . ARG A  1  23   ? 106.499 146.750 63.232  1.00 50.41  ? 22   ARG A CZ    1 
ATOM   177   N  NH1   . ARG A  1  23   ? 107.535 146.808 64.060  1.00 48.45  ? 22   ARG A NH1   1 
ATOM   178   N  NH2   . ARG A  1  23   ? 105.510 145.901 63.465  1.00 50.54  ? 22   ARG A NH2   1 
ATOM   179   N  N     . TYR A  1  24   ? 110.078 145.940 57.454  1.00 52.04  ? 23   TYR A N     1 
ATOM   180   C  CA    . TYR A  1  24   ? 111.443 145.457 57.285  1.00 53.16  ? 23   TYR A CA    1 
ATOM   181   C  C     . TYR A  1  24   ? 112.181 146.196 56.185  1.00 54.24  ? 23   TYR A C     1 
ATOM   182   O  O     . TYR A  1  24   ? 111.578 146.642 55.212  1.00 53.24  ? 23   TYR A O     1 
ATOM   183   C  CB    . TYR A  1  24   ? 111.443 143.952 57.016  1.00 52.75  ? 23   TYR A CB    1 
ATOM   184   C  CG    . TYR A  1  24   ? 111.175 143.128 58.253  1.00 53.35  ? 23   TYR A CG    1 
ATOM   185   C  CD1   . TYR A  1  24   ? 111.368 141.750 58.256  1.00 54.26  ? 23   TYR A CD1   1 
ATOM   186   C  CD2   . TYR A  1  24   ? 110.747 143.732 59.431  1.00 54.03  ? 23   TYR A CD2   1 
ATOM   187   C  CE1   . TYR A  1  24   ? 111.142 140.993 59.406  1.00 55.16  ? 23   TYR A CE1   1 
ATOM   188   C  CE2   . TYR A  1  24   ? 110.518 142.992 60.580  1.00 55.12  ? 23   TYR A CE2   1 
ATOM   189   C  CZ    . TYR A  1  24   ? 110.716 141.627 60.564  1.00 55.62  ? 23   TYR A CZ    1 
ATOM   190   O  OH    . TYR A  1  24   ? 110.483 140.906 61.712  1.00 56.67  ? 23   TYR A OH    1 
ATOM   191   N  N     . LYS A  1  25   ? 113.494 146.318 56.353  1.00 57.29  ? 24   LYS A N     1 
ATOM   192   C  CA    . LYS A  1  25   ? 114.335 147.043 55.406  1.00 60.57  ? 24   LYS A CA    1 
ATOM   193   C  C     . LYS A  1  25   ? 114.691 146.324 54.103  1.00 62.50  ? 24   LYS A C     1 
ATOM   194   O  O     . LYS A  1  25   ? 113.883 146.304 53.172  1.00 64.23  ? 24   LYS A O     1 
ATOM   195   C  CB    . LYS A  1  25   ? 115.598 147.533 56.125  1.00 60.67  ? 24   LYS A CB    1 
ATOM   196   C  CG    . LYS A  1  25   ? 115.287 148.657 57.107  1.00 61.23  ? 24   LYS A CG    1 
ATOM   197   C  CD    . LYS A  1  25   ? 116.509 149.188 57.839  1.00 62.33  ? 24   LYS A CD    1 
ATOM   198   C  CE    . LYS A  1  25   ? 116.112 150.373 58.719  1.00 62.40  ? 24   LYS A CE    1 
ATOM   199   N  NZ    . LYS A  1  25   ? 117.202 150.864 59.604  1.00 62.11  ? 24   LYS A NZ    1 
ATOM   200   N  N     . ALA A  1  26   ? 115.888 145.753 54.016  1.00 63.02  ? 25   ALA A N     1 
ATOM   201   C  CA    . ALA A  1  26   ? 116.280 145.066 52.792  1.00 63.83  ? 25   ALA A CA    1 
ATOM   202   C  C     . ALA A  1  26   ? 116.723 143.645 53.055  1.00 65.63  ? 25   ALA A C     1 
ATOM   203   O  O     . ALA A  1  26   ? 116.915 143.245 54.202  1.00 67.22  ? 25   ALA A O     1 
ATOM   204   C  CB    . ALA A  1  26   ? 117.378 145.826 52.094  1.00 63.59  ? 25   ALA A CB    1 
ATOM   205   N  N     . ASP A  1  27   ? 116.893 142.889 51.977  1.00 66.34  ? 26   ASP A N     1 
ATOM   206   C  CA    . ASP A  1  27   ? 117.287 141.490 52.064  1.00 66.20  ? 26   ASP A CA    1 
ATOM   207   C  C     . ASP A  1  27   ? 118.760 141.281 51.727  1.00 66.43  ? 26   ASP A C     1 
ATOM   208   O  O     . ASP A  1  27   ? 119.101 140.730 50.686  1.00 67.65  ? 26   ASP A O     1 
ATOM   209   C  CB    . ASP A  1  27   ? 116.401 140.655 51.132  1.00 67.84  ? 26   ASP A CB    1 
ATOM   210   C  CG    . ASP A  1  27   ? 116.795 140.780 49.670  1.00 68.08  ? 26   ASP A CG    1 
ATOM   211   O  OD1   . ASP A  1  27   ? 117.044 141.909 49.199  1.00 69.30  ? 26   ASP A OD1   1 
ATOM   212   O  OD2   . ASP A  1  27   ? 116.851 139.737 48.989  1.00 68.30  ? 26   ASP A OD2   1 
ATOM   213   N  N     . LEU A  1  28   ? 119.617 141.721 52.638  1.00 65.37  ? 27   LEU A N     1 
ATOM   214   C  CA    . LEU A  1  28   ? 121.072 141.625 52.531  1.00 64.59  ? 27   LEU A CA    1 
ATOM   215   C  C     . LEU A  1  28   ? 121.638 140.530 51.615  1.00 64.82  ? 27   LEU A C     1 
ATOM   216   O  O     . LEU A  1  28   ? 122.192 139.541 52.092  1.00 65.22  ? 27   LEU A O     1 
ATOM   217   C  CB    . LEU A  1  28   ? 121.639 141.439 53.936  1.00 63.84  ? 27   LEU A CB    1 
ATOM   218   C  CG    . LEU A  1  28   ? 120.783 142.085 55.028  1.00 61.70  ? 27   LEU A CG    1 
ATOM   219   C  CD1   . LEU A  1  28   ? 121.272 141.649 56.388  1.00 61.51  ? 27   LEU A CD1   1 
ATOM   220   C  CD2   . LEU A  1  28   ? 120.820 143.589 54.885  1.00 59.95  ? 27   LEU A CD2   1 
ATOM   221   N  N     . GLU A  1  29   ? 121.519 140.717 50.305  1.00 65.78  ? 28   GLU A N     1 
ATOM   222   C  CA    . GLU A  1  29   ? 122.030 139.749 49.338  1.00 66.42  ? 28   GLU A CA    1 
ATOM   223   C  C     . GLU A  1  29   ? 123.270 140.306 48.661  1.00 65.97  ? 28   GLU A C     1 
ATOM   224   O  O     . GLU A  1  29   ? 123.399 141.518 48.498  1.00 66.14  ? 28   GLU A O     1 
ATOM   225   C  CB    . GLU A  1  29   ? 120.978 139.447 48.265  1.00 68.22  ? 28   GLU A CB    1 
ATOM   226   C  CG    . GLU A  1  29   ? 119.920 138.425 48.664  1.00 71.64  ? 28   GLU A CG    1 
ATOM   227   C  CD    . GLU A  1  29   ? 118.953 138.086 47.528  1.00 73.80  ? 28   GLU A CD    1 
ATOM   228   O  OE1   . GLU A  1  29   ? 118.104 137.190 47.727  1.00 75.22  ? 28   GLU A OE1   1 
ATOM   229   O  OE2   . GLU A  1  29   ? 119.033 138.709 46.443  1.00 74.84  ? 28   GLU A OE2   1 
ATOM   230   N  N     . HIS A  1  30   ? 124.181 139.421 48.266  1.00 65.76  ? 29   HIS A N     1 
ATOM   231   C  CA    . HIS A  1  30   ? 125.400 139.844 47.590  1.00 65.97  ? 29   HIS A CA    1 
ATOM   232   C  C     . HIS A  1  30   ? 125.065 140.408 46.225  1.00 69.10  ? 29   HIS A C     1 
ATOM   233   O  O     . HIS A  1  30   ? 124.231 139.855 45.511  1.00 69.14  ? 29   HIS A O     1 
ATOM   234   C  CB    . HIS A  1  30   ? 126.347 138.671 47.373  1.00 61.46  ? 29   HIS A CB    1 
ATOM   235   C  CG    . HIS A  1  30   ? 126.840 138.045 48.632  1.00 57.53  ? 29   HIS A CG    1 
ATOM   236   N  ND1   . HIS A  1  30   ? 127.233 138.786 49.724  1.00 56.78  ? 29   HIS A ND1   1 
ATOM   237   C  CD2   . HIS A  1  30   ? 127.049 136.749 48.958  1.00 56.18  ? 29   HIS A CD2   1 
ATOM   238   C  CE1   . HIS A  1  30   ? 127.663 137.971 50.670  1.00 56.34  ? 29   HIS A CE1   1 
ATOM   239   N  NE2   . HIS A  1  30   ? 127.563 136.730 50.230  1.00 55.92  ? 29   HIS A NE2   1 
ATOM   240   N  N     . ARG A  1  31   ? 125.718 141.502 45.855  1.00 73.16  ? 30   ARG A N     1 
ATOM   241   C  CA    . ARG A  1  31   ? 125.487 142.087 44.548  1.00 77.50  ? 30   ARG A CA    1 
ATOM   242   C  C     . ARG A  1  31   ? 125.824 141.065 43.482  1.00 80.71  ? 30   ARG A C     1 
ATOM   243   O  O     . ARG A  1  31   ? 126.425 140.027 43.767  1.00 80.44  ? 30   ARG A O     1 
ATOM   244   C  CB    . ARG A  1  31   ? 126.360 143.316 44.334  1.00 78.65  ? 30   ARG A CB    1 
ATOM   245   C  CG    . ARG A  1  31   ? 125.705 144.599 44.770  1.00 81.61  ? 30   ARG A CG    1 
ATOM   246   C  CD    . ARG A  1  31   ? 126.316 145.789 44.048  1.00 83.00  ? 30   ARG A CD    1 
ATOM   247   N  NE    . ARG A  1  31   ? 126.331 145.594 42.602  1.00 83.04  ? 30   ARG A NE    1 
ATOM   248   C  CZ    . ARG A  1  31   ? 126.643 146.545 41.733  1.00 83.34  ? 30   ARG A CZ    1 
ATOM   249   N  NH1   . ARG A  1  31   ? 126.960 147.758 42.164  1.00 83.74  ? 30   ARG A NH1   1 
ATOM   250   N  NH2   . ARG A  1  31   ? 126.643 146.283 40.435  1.00 84.11  ? 30   ARG A NH2   1 
ATOM   251   N  N     . LYS A  1  32   ? 125.438 141.362 42.251  1.00 84.19  ? 31   LYS A N     1 
ATOM   252   C  CA    . LYS A  1  32   ? 125.719 140.463 41.154  1.00 88.58  ? 31   LYS A CA    1 
ATOM   253   C  C     . LYS A  1  32   ? 126.685 141.118 40.176  1.00 91.31  ? 31   LYS A C     1 
ATOM   254   O  O     . LYS A  1  32   ? 126.482 142.253 39.741  1.00 92.44  ? 31   LYS A O     1 
ATOM   255   C  CB    . LYS A  1  32   ? 124.404 140.033 40.500  1.00 90.10  ? 31   LYS A CB    1 
ATOM   256   C  CG    . LYS A  1  32   ? 123.664 139.046 41.406  1.00 93.38  ? 31   LYS A CG    1 
ATOM   257   C  CD    . LYS A  1  32   ? 122.180 138.869 41.104  1.00 95.85  ? 31   LYS A CD    1 
ATOM   258   C  CE    . LYS A  1  32   ? 121.516 138.019 42.208  1.00 96.21  ? 31   LYS A CE    1 
ATOM   259   N  NZ    . LYS A  1  32   ? 120.037 137.840 42.064  1.00 96.11  ? 31   LYS A NZ    1 
ATOM   260   N  N     . VAL A  1  33   ? 127.758 140.390 39.870  1.00 93.71  ? 32   VAL A N     1 
ATOM   261   C  CA    . VAL A  1  33   ? 128.817 140.851 38.976  1.00 95.27  ? 32   VAL A CA    1 
ATOM   262   C  C     . VAL A  1  33   ? 129.033 139.883 37.806  1.00 96.60  ? 32   VAL A C     1 
ATOM   263   O  O     . VAL A  1  33   ? 128.857 138.670 37.946  1.00 97.03  ? 32   VAL A O     1 
ATOM   264   C  CB    . VAL A  1  33   ? 130.143 140.999 39.763  1.00 94.80  ? 32   VAL A CB    1 
ATOM   265   C  CG1   . VAL A  1  33   ? 131.266 141.410 38.840  1.00 95.67  ? 32   VAL A CG1   1 
ATOM   266   C  CG2   . VAL A  1  33   ? 129.970 142.018 40.871  1.00 94.17  ? 32   VAL A CG2   1 
ATOM   267   N  N     . GLU A  1  34   ? 129.413 140.431 36.655  1.00 97.76  ? 33   GLU A N     1 
ATOM   268   C  CA    . GLU A  1  34   ? 129.663 139.635 35.455  1.00 99.58  ? 33   GLU A CA    1 
ATOM   269   C  C     . GLU A  1  34   ? 131.006 138.942 35.655  1.00 99.90  ? 33   GLU A C     1 
ATOM   270   O  O     . GLU A  1  34   ? 131.205 137.784 35.279  1.00 99.28  ? 33   GLU A O     1 
ATOM   271   C  CB    . GLU A  1  34   ? 129.740 140.550 34.229  1.00 100.04 ? 33   GLU A CB    1 
ATOM   272   C  CG    . GLU A  1  34   ? 128.712 141.674 34.207  1.00 100.91 ? 33   GLU A CG    1 
ATOM   273   C  CD    . GLU A  1  34   ? 128.813 142.578 35.425  1.00 101.57 ? 33   GLU A CD    1 
ATOM   274   O  OE1   . GLU A  1  34   ? 127.917 142.514 36.295  1.00 101.15 ? 33   GLU A OE1   1 
ATOM   275   O  OE2   . GLU A  1  34   ? 129.798 143.341 35.516  1.00 102.30 ? 33   GLU A OE2   1 
ATOM   276   N  N     . ASP A  1  35   ? 131.912 139.701 36.259  1.00 101.22 ? 34   ASP A N     1 
ATOM   277   C  CA    . ASP A  1  35   ? 133.273 139.295 36.586  1.00 102.83 ? 34   ASP A CA    1 
ATOM   278   C  C     . ASP A  1  35   ? 134.075 140.598 36.605  1.00 103.89 ? 34   ASP A C     1 
ATOM   279   O  O     . ASP A  1  35   ? 133.545 141.654 36.963  1.00 104.16 ? 34   ASP A O     1 
ATOM   280   C  CB    . ASP A  1  35   ? 133.846 138.333 35.537  1.00 102.19 ? 34   ASP A CB    1 
ATOM   281   C  CG    . ASP A  1  35   ? 135.039 137.536 36.063  1.00 102.10 ? 34   ASP A CG    1 
ATOM   282   O  OD1   . ASP A  1  35   ? 136.042 138.151 36.478  1.00 101.47 ? 34   ASP A OD1   1 
ATOM   283   O  OD2   . ASP A  1  35   ? 134.978 136.289 36.065  1.00 102.72 ? 34   ASP A OD2   1 
ATOM   284   N  N     . GLY A  1  36   ? 135.342 140.536 36.215  1.00 104.61 ? 35   GLY A N     1 
ATOM   285   C  CA    . GLY A  1  36   ? 136.157 141.736 36.212  1.00 104.60 ? 35   GLY A CA    1 
ATOM   286   C  C     . GLY A  1  36   ? 136.403 142.269 37.611  1.00 104.50 ? 35   GLY A C     1 
ATOM   287   O  O     . GLY A  1  36   ? 137.399 142.954 37.844  1.00 105.09 ? 35   GLY A O     1 
ATOM   288   N  N     . ASP A  1  37   ? 135.500 141.957 38.541  1.00 103.61 ? 36   ASP A N     1 
ATOM   289   C  CA    . ASP A  1  37   ? 135.624 142.408 39.924  1.00 102.67 ? 36   ASP A CA    1 
ATOM   290   C  C     . ASP A  1  37   ? 135.539 143.922 40.083  1.00 101.49 ? 36   ASP A C     1 
ATOM   291   O  O     . ASP A  1  37   ? 135.342 144.412 41.193  1.00 100.60 ? 36   ASP A O     1 
ATOM   292   C  CB    . ASP A  1  37   ? 136.946 141.914 40.528  1.00 103.92 ? 36   ASP A CB    1 
ATOM   293   C  CG    . ASP A  1  37   ? 137.466 142.827 41.640  1.00 104.21 ? 36   ASP A CG    1 
ATOM   294   O  OD1   . ASP A  1  37   ? 136.836 142.910 42.713  1.00 104.99 ? 36   ASP A OD1   1 
ATOM   295   O  OD2   . ASP A  1  37   ? 138.510 143.473 41.437  1.00 104.74 ? 36   ASP A OD2   1 
ATOM   296   N  N     . VAL A  1  38   ? 135.694 144.661 38.984  1.00 100.68 ? 37   VAL A N     1 
ATOM   297   C  CA    . VAL A  1  38   ? 135.641 146.123 39.049  1.00 98.89  ? 37   VAL A CA    1 
ATOM   298   C  C     . VAL A  1  38   ? 134.335 146.609 39.660  1.00 96.44  ? 37   VAL A C     1 
ATOM   299   O  O     . VAL A  1  38   ? 133.524 147.260 38.993  1.00 97.58  ? 37   VAL A O     1 
ATOM   300   C  CB    . VAL A  1  38   ? 135.834 146.807 37.648  1.00 99.23  ? 37   VAL A CB    1 
ATOM   301   C  CG1   . VAL A  1  38   ? 137.314 146.836 37.281  1.00 99.35  ? 37   VAL A CG1   1 
ATOM   302   C  CG2   . VAL A  1  38   ? 135.036 146.081 36.574  1.00 98.76  ? 37   VAL A CG2   1 
ATOM   303   N  N     . ILE A  1  39   ? 134.152 146.280 40.938  1.00 92.10  ? 38   ILE A N     1 
ATOM   304   C  CA    . ILE A  1  39   ? 132.979 146.668 41.697  1.00 87.01  ? 38   ILE A CA    1 
ATOM   305   C  C     . ILE A  1  39   ? 133.364 147.027 43.120  1.00 83.56  ? 38   ILE A C     1 
ATOM   306   O  O     . ILE A  1  39   ? 133.804 146.181 43.898  1.00 82.70  ? 38   ILE A O     1 
ATOM   307   C  CB    . ILE A  1  39   ? 131.920 145.550 41.706  1.00 86.79  ? 38   ILE A CB    1 
ATOM   308   C  CG1   . ILE A  1  39   ? 130.837 145.880 40.681  1.00 87.07  ? 38   ILE A CG1   1 
ATOM   309   C  CG2   . ILE A  1  39   ? 131.291 145.409 43.083  1.00 87.50  ? 38   ILE A CG2   1 
ATOM   310   C  CD1   . ILE A  1  39   ? 130.163 147.222 40.919  1.00 85.77  ? 38   ILE A CD1   1 
ATOM   311   N  N     . ALA A  1  40   ? 133.210 148.303 43.440  1.00 79.95  ? 39   ALA A N     1 
ATOM   312   C  CA    . ALA A  1  40   ? 133.521 148.804 44.765  1.00 76.15  ? 39   ALA A CA    1 
ATOM   313   C  C     . ALA A  1  40   ? 132.515 149.896 45.072  1.00 73.56  ? 39   ALA A C     1 
ATOM   314   O  O     . ALA A  1  40   ? 131.842 150.406 44.171  1.00 72.73  ? 39   ALA A O     1 
ATOM   315   C  CB    . ALA A  1  40   ? 134.938 149.359 44.805  1.00 75.38  ? 39   ALA A CB    1 
ATOM   316   N  N     . GLY A  1  41   ? 132.409 150.238 46.351  1.00 71.18  ? 40   GLY A N     1 
ATOM   317   C  CA    . GLY A  1  41   ? 131.483 151.269 46.779  1.00 67.63  ? 40   GLY A CA    1 
ATOM   318   C  C     . GLY A  1  41   ? 131.953 151.895 48.073  1.00 64.97  ? 40   GLY A C     1 
ATOM   319   O  O     . GLY A  1  41   ? 132.966 151.483 48.643  1.00 63.85  ? 40   GLY A O     1 
ATOM   320   N  N     . THR A  1  42   ? 131.222 152.890 48.551  1.00 62.50  ? 41   THR A N     1 
ATOM   321   C  CA    . THR A  1  42   ? 131.617 153.540 49.785  1.00 61.54  ? 41   THR A CA    1 
ATOM   322   C  C     . THR A  1  42   ? 130.504 153.472 50.811  1.00 60.05  ? 41   THR A C     1 
ATOM   323   O  O     . THR A  1  42   ? 129.344 153.742 50.491  1.00 59.59  ? 41   THR A O     1 
ATOM   324   C  CB    . THR A  1  42   ? 131.963 155.009 49.542  1.00 62.40  ? 41   THR A CB    1 
ATOM   325   O  OG1   . THR A  1  42   ? 132.628 155.130 48.279  1.00 63.89  ? 41   THR A OG1   1 
ATOM   326   C  CG2   . THR A  1  42   ? 132.883 155.530 50.649  1.00 61.05  ? 41   THR A CG2   1 
ATOM   327   N  N     . VAL A  1  43   ? 130.864 153.116 52.042  1.00 57.94  ? 42   VAL A N     1 
ATOM   328   C  CA    . VAL A  1  43   ? 129.889 153.023 53.120  1.00 56.62  ? 42   VAL A CA    1 
ATOM   329   C  C     . VAL A  1  43   ? 129.333 154.405 53.470  1.00 55.43  ? 42   VAL A C     1 
ATOM   330   O  O     . VAL A  1  43   ? 129.911 155.156 54.251  1.00 56.00  ? 42   VAL A O     1 
ATOM   331   C  CB    . VAL A  1  43   ? 130.507 152.388 54.370  1.00 57.33  ? 42   VAL A CB    1 
ATOM   332   C  CG1   . VAL A  1  43   ? 129.432 152.162 55.414  1.00 58.89  ? 42   VAL A CG1   1 
ATOM   333   C  CG2   . VAL A  1  43   ? 131.154 151.074 54.012  1.00 57.92  ? 42   VAL A CG2   1 
ATOM   334   N  N     . VAL A  1  44   ? 128.191 154.718 52.876  1.00 53.76  ? 43   VAL A N     1 
ATOM   335   C  CA    . VAL A  1  44   ? 127.514 155.988 53.061  1.00 51.83  ? 43   VAL A CA    1 
ATOM   336   C  C     . VAL A  1  44   ? 126.819 156.142 54.421  1.00 52.37  ? 43   VAL A C     1 
ATOM   337   O  O     . VAL A  1  44   ? 126.694 157.253 54.931  1.00 52.45  ? 43   VAL A O     1 
ATOM   338   C  CB    . VAL A  1  44   ? 126.481 156.174 51.927  1.00 51.43  ? 43   VAL A CB    1 
ATOM   339   C  CG1   . VAL A  1  44   ? 125.790 157.523 52.032  1.00 50.97  ? 43   VAL A CG1   1 
ATOM   340   C  CG2   . VAL A  1  44   ? 127.173 156.015 50.589  1.00 50.17  ? 43   VAL A CG2   1 
ATOM   341   N  N     . ASP A  1  45   ? 126.363 155.038 55.010  1.00 52.69  ? 44   ASP A N     1 
ATOM   342   C  CA    . ASP A  1  45   ? 125.675 155.107 56.301  1.00 51.73  ? 44   ASP A CA    1 
ATOM   343   C  C     . ASP A  1  45   ? 125.583 153.737 56.960  1.00 50.27  ? 44   ASP A C     1 
ATOM   344   O  O     . ASP A  1  45   ? 125.692 152.714 56.290  1.00 50.55  ? 44   ASP A O     1 
ATOM   345   C  CB    . ASP A  1  45   ? 124.264 155.687 56.095  1.00 53.09  ? 44   ASP A CB    1 
ATOM   346   C  CG    . ASP A  1  45   ? 123.546 156.017 57.410  1.00 55.74  ? 44   ASP A CG    1 
ATOM   347   O  OD1   . ASP A  1  45   ? 124.188 156.007 58.482  1.00 57.82  ? 44   ASP A OD1   1 
ATOM   348   O  OD2   . ASP A  1  45   ? 122.328 156.307 57.368  1.00 55.94  ? 44   ASP A OD2   1 
ATOM   349   N  N     . ILE A  1  46   ? 125.407 153.735 58.279  1.00 49.59  ? 45   ILE A N     1 
ATOM   350   C  CA    . ILE A  1  46   ? 125.259 152.511 59.068  1.00 49.25  ? 45   ILE A CA    1 
ATOM   351   C  C     . ILE A  1  46   ? 123.842 152.528 59.634  1.00 49.43  ? 45   ILE A C     1 
ATOM   352   O  O     . ILE A  1  46   ? 123.453 153.494 60.289  1.00 49.80  ? 45   ILE A O     1 
ATOM   353   C  CB    . ILE A  1  46   ? 126.254 152.468 60.242  1.00 48.36  ? 45   ILE A CB    1 
ATOM   354   C  CG1   . ILE A  1  46   ? 127.687 152.433 59.709  1.00 48.89  ? 45   ILE A CG1   1 
ATOM   355   C  CG2   . ILE A  1  46   ? 125.979 151.261 61.117  1.00 48.20  ? 45   ILE A CG2   1 
ATOM   356   C  CD1   . ILE A  1  46   ? 127.966 151.295 58.737  1.00 49.07  ? 45   ILE A CD1   1 
ATOM   357   N  N     . GLU A  1  47   ? 123.071 151.472 59.381  1.00 49.83  ? 46   GLU A N     1 
ATOM   358   C  CA    . GLU A  1  47   ? 121.694 151.412 59.861  1.00 49.74  ? 46   GLU A CA    1 
ATOM   359   C  C     . GLU A  1  47   ? 121.336 150.200 60.696  1.00 49.77  ? 46   GLU A C     1 
ATOM   360   O  O     . GLU A  1  47   ? 122.005 149.176 60.656  1.00 49.15  ? 46   GLU A O     1 
ATOM   361   C  CB    . GLU A  1  47   ? 120.719 151.465 58.692  1.00 50.33  ? 46   GLU A CB    1 
ATOM   362   C  CG    . GLU A  1  47   ? 120.786 152.723 57.873  1.00 52.54  ? 46   GLU A CG    1 
ATOM   363   C  CD    . GLU A  1  47   ? 119.669 152.799 56.850  1.00 54.88  ? 46   GLU A CD    1 
ATOM   364   O  OE1   . GLU A  1  47   ? 119.727 153.691 55.974  1.00 56.57  ? 46   GLU A OE1   1 
ATOM   365   O  OE2   . GLU A  1  47   ? 118.731 151.972 56.923  1.00 55.08  ? 46   GLU A OE2   1 
ATOM   366   N  N     . HIS A  1  48   ? 120.251 150.344 61.446  1.00 50.45  ? 47   HIS A N     1 
ATOM   367   C  CA    . HIS A  1  48   ? 119.716 149.286 62.291  1.00 50.38  ? 47   HIS A CA    1 
ATOM   368   C  C     . HIS A  1  48   ? 118.882 148.397 61.368  1.00 50.57  ? 47   HIS A C     1 
ATOM   369   O  O     . HIS A  1  48   ? 118.349 148.874 60.365  1.00 50.14  ? 47   HIS A O     1 
ATOM   370   C  CB    . HIS A  1  48   ? 118.812 149.900 63.370  1.00 52.03  ? 47   HIS A CB    1 
ATOM   371   C  CG    . HIS A  1  48   ? 117.991 148.899 64.125  1.00 53.73  ? 47   HIS A CG    1 
ATOM   372   N  ND1   . HIS A  1  48   ? 118.503 148.136 65.154  1.00 55.54  ? 47   HIS A ND1   1 
ATOM   373   C  CD2   . HIS A  1  48   ? 116.697 148.523 63.987  1.00 53.88  ? 47   HIS A CD2   1 
ATOM   374   C  CE1   . HIS A  1  48   ? 117.560 147.334 65.618  1.00 54.57  ? 47   HIS A CE1   1 
ATOM   375   N  NE2   . HIS A  1  48   ? 116.455 147.549 64.927  1.00 55.09  ? 47   HIS A NE2   1 
ATOM   376   N  N     . ASP A  1  49   ? 118.785 147.108 61.685  1.00 49.00  ? 48   ASP A N     1 
ATOM   377   C  CA    . ASP A  1  49   ? 117.977 146.191 60.879  1.00 46.35  ? 48   ASP A CA    1 
ATOM   378   C  C     . ASP A  1  49   ? 116.949 145.509 61.782  1.00 44.09  ? 48   ASP A C     1 
ATOM   379   O  O     . ASP A  1  49   ? 117.276 144.611 62.563  1.00 42.38  ? 48   ASP A O     1 
ATOM   380   C  CB    . ASP A  1  49   ? 118.862 145.161 60.183  1.00 47.49  ? 48   ASP A CB    1 
ATOM   381   C  CG    . ASP A  1  49   ? 118.065 144.151 59.387  1.00 47.90  ? 48   ASP A CG    1 
ATOM   382   O  OD1   . ASP A  1  49   ? 116.943 144.490 58.940  1.00 48.18  ? 48   ASP A OD1   1 
ATOM   383   O  OD2   . ASP A  1  49   ? 118.574 143.023 59.202  1.00 46.71  ? 48   ASP A OD2   1 
ATOM   384   N  N     . PRO A  1  50   ? 115.685 145.940 61.674  1.00 42.60  ? 49   PRO A N     1 
ATOM   385   C  CA    . PRO A  1  50   ? 114.525 145.463 62.429  1.00 42.24  ? 49   PRO A CA    1 
ATOM   386   C  C     . PRO A  1  50   ? 114.410 143.957 62.493  1.00 41.16  ? 49   PRO A C     1 
ATOM   387   O  O     . PRO A  1  50   ? 114.144 143.390 63.551  1.00 41.74  ? 49   PRO A O     1 
ATOM   388   C  CB    . PRO A  1  50   ? 113.344 146.082 61.683  1.00 42.56  ? 49   PRO A CB    1 
ATOM   389   C  CG    . PRO A  1  50   ? 113.923 147.315 61.076  1.00 43.17  ? 49   PRO A CG    1 
ATOM   390   C  CD    . PRO A  1  50   ? 115.248 146.814 60.571  1.00 43.03  ? 49   PRO A CD    1 
ATOM   391   N  N     . ALA A  1  51   ? 114.611 143.314 61.350  1.00 40.39  ? 50   ALA A N     1 
ATOM   392   C  CA    . ALA A  1  51   ? 114.506 141.869 61.258  1.00 38.49  ? 50   ALA A CA    1 
ATOM   393   C  C     . ALA A  1  51   ? 115.647 141.096 61.923  1.00 37.98  ? 50   ALA A C     1 
ATOM   394   O  O     . ALA A  1  51   ? 115.453 139.959 62.357  1.00 38.03  ? 50   ALA A O     1 
ATOM   395   C  CB    . ALA A  1  51   ? 114.385 141.469 59.804  1.00 38.62  ? 50   ALA A CB    1 
ATOM   396   N  N     . ARG A  1  52   ? 116.831 141.696 62.017  1.00 36.94  ? 51   ARG A N     1 
ATOM   397   C  CA    . ARG A  1  52   ? 117.945 140.990 62.626  1.00 36.49  ? 51   ARG A CA    1 
ATOM   398   C  C     . ARG A  1  52   ? 118.501 141.606 63.911  1.00 37.33  ? 51   ARG A C     1 
ATOM   399   O  O     . ARG A  1  52   ? 119.415 141.045 64.511  1.00 36.81  ? 51   ARG A O     1 
ATOM   400   C  CB    . ARG A  1  52   ? 119.076 140.818 61.611  1.00 37.46  ? 51   ARG A CB    1 
ATOM   401   C  CG    . ARG A  1  52   ? 118.618 140.291 60.265  1.00 38.96  ? 51   ARG A CG    1 
ATOM   402   C  CD    . ARG A  1  52   ? 119.770 139.816 59.372  1.00 40.09  ? 51   ARG A CD    1 
ATOM   403   N  NE    . ARG A  1  52   ? 120.913 140.729 59.316  1.00 38.85  ? 51   ARG A NE    1 
ATOM   404   C  CZ    . ARG A  1  52   ? 121.933 140.690 60.166  1.00 38.50  ? 51   ARG A CZ    1 
ATOM   405   N  NH1   . ARG A  1  52   ? 121.951 139.788 61.133  1.00 39.99  ? 51   ARG A NH1   1 
ATOM   406   N  NH2   . ARG A  1  52   ? 122.936 141.542 60.050  1.00 37.00  ? 51   ARG A NH2   1 
ATOM   407   N  N     . SER A  1  53   ? 117.956 142.735 64.352  1.00 37.26  ? 52   SER A N     1 
ATOM   408   C  CA    . SER A  1  53   ? 118.452 143.364 65.579  1.00 38.16  ? 52   SER A CA    1 
ATOM   409   C  C     . SER A  1  53   ? 119.967 143.476 65.533  1.00 39.72  ? 52   SER A C     1 
ATOM   410   O  O     . SER A  1  53   ? 120.648 143.244 66.535  1.00 41.33  ? 52   SER A O     1 
ATOM   411   C  CB    . SER A  1  53   ? 118.068 142.551 66.818  1.00 37.38  ? 52   SER A CB    1 
ATOM   412   O  OG    . SER A  1  53   ? 116.699 142.697 67.124  1.00 38.26  ? 52   SER A OG    1 
ATOM   413   N  N     . ALA A  1  54   ? 120.487 143.814 64.360  1.00 39.39  ? 53   ALA A N     1 
ATOM   414   C  CA    . ALA A  1  54   ? 121.916 143.969 64.165  1.00 38.30  ? 53   ALA A CA    1 
ATOM   415   C  C     . ALA A  1  54   ? 122.099 145.116 63.194  1.00 38.40  ? 53   ALA A C     1 
ATOM   416   O  O     . ALA A  1  54   ? 121.196 145.432 62.420  1.00 38.94  ? 53   ALA A O     1 
ATOM   417   C  CB    . ALA A  1  54   ? 122.507 142.704 63.591  1.00 38.41  ? 53   ALA A CB    1 
ATOM   418   N  N     . PRO A  1  55   ? 123.263 145.774 63.234  1.00 38.71  ? 54   PRO A N     1 
ATOM   419   C  CA    . PRO A  1  55   ? 123.489 146.888 62.316  1.00 37.95  ? 54   PRO A CA    1 
ATOM   420   C  C     . PRO A  1  55   ? 123.741 146.368 60.914  1.00 37.48  ? 54   PRO A C     1 
ATOM   421   O  O     . PRO A  1  55   ? 124.137 145.228 60.732  1.00 37.95  ? 54   PRO A O     1 
ATOM   422   C  CB    . PRO A  1  55   ? 124.700 147.580 62.920  1.00 38.03  ? 54   PRO A CB    1 
ATOM   423   C  CG    . PRO A  1  55   ? 125.465 146.431 63.527  1.00 38.88  ? 54   PRO A CG    1 
ATOM   424   C  CD    . PRO A  1  55   ? 124.382 145.630 64.184  1.00 38.75  ? 54   PRO A CD    1 
ATOM   425   N  N     . VAL A  1  56   ? 123.494 147.206 59.923  1.00 38.49  ? 55   VAL A N     1 
ATOM   426   C  CA    . VAL A  1  56   ? 123.696 146.835 58.532  1.00 39.52  ? 55   VAL A CA    1 
ATOM   427   C  C     . VAL A  1  56   ? 124.154 148.102 57.825  1.00 42.19  ? 55   VAL A C     1 
ATOM   428   O  O     . VAL A  1  56   ? 123.660 149.186 58.126  1.00 43.03  ? 55   VAL A O     1 
ATOM   429   C  CB    . VAL A  1  56   ? 122.393 146.356 57.906  1.00 37.83  ? 55   VAL A CB    1 
ATOM   430   C  CG1   . VAL A  1  56   ? 121.347 147.456 58.007  1.00 38.53  ? 55   VAL A CG1   1 
ATOM   431   C  CG2   . VAL A  1  56   ? 122.622 145.985 56.467  1.00 37.13  ? 55   VAL A CG2   1 
ATOM   432   N  N     . ALA A  1  57   ? 125.086 147.977 56.887  1.00 43.87  ? 56   ALA A N     1 
ATOM   433   C  CA    . ALA A  1  57   ? 125.598 149.150 56.193  1.00 45.90  ? 56   ALA A CA    1 
ATOM   434   C  C     . ALA A  1  57   ? 124.925 149.457 54.871  1.00 47.86  ? 56   ALA A C     1 
ATOM   435   O  O     . ALA A  1  57   ? 124.384 148.573 54.217  1.00 47.84  ? 56   ALA A O     1 
ATOM   436   C  CB    . ALA A  1  57   ? 127.088 149.005 55.975  1.00 46.05  ? 56   ALA A CB    1 
ATOM   437   N  N     . ALA A  1  58   ? 124.967 150.733 54.497  1.00 51.32  ? 57   ALA A N     1 
ATOM   438   C  CA    . ALA A  1  58   ? 124.411 151.218 53.237  1.00 54.78  ? 57   ALA A CA    1 
ATOM   439   C  C     . ALA A  1  58   ? 125.623 151.546 52.372  1.00 56.92  ? 57   ALA A C     1 
ATOM   440   O  O     . ALA A  1  58   ? 126.588 152.134 52.853  1.00 57.23  ? 57   ALA A O     1 
ATOM   441   C  CB    . ALA A  1  58   ? 123.580 152.469 53.472  1.00 53.44  ? 57   ALA A CB    1 
ATOM   442   N  N     . VAL A  1  59   ? 125.580 151.172 51.101  1.00 59.45  ? 58   VAL A N     1 
ATOM   443   C  CA    . VAL A  1  59   ? 126.709 151.417 50.218  1.00 61.86  ? 58   VAL A CA    1 
ATOM   444   C  C     . VAL A  1  59   ? 126.315 152.058 48.890  1.00 65.13  ? 58   VAL A C     1 
ATOM   445   O  O     . VAL A  1  59   ? 125.219 151.830 48.377  1.00 65.92  ? 58   VAL A O     1 
ATOM   446   C  CB    . VAL A  1  59   ? 127.448 150.089 49.916  1.00 59.37  ? 58   VAL A CB    1 
ATOM   447   C  CG1   . VAL A  1  59   ? 128.682 150.342 49.081  1.00 59.08  ? 58   VAL A CG1   1 
ATOM   448   C  CG2   . VAL A  1  59   ? 127.824 149.408 51.203  1.00 59.09  ? 58   VAL A CG2   1 
ATOM   449   N  N     . GLU A  1  60   ? 127.215 152.877 48.349  1.00 68.87  ? 59   GLU A N     1 
ATOM   450   C  CA    . GLU A  1  60   ? 127.012 153.512 47.047  1.00 71.15  ? 59   GLU A CA    1 
ATOM   451   C  C     . GLU A  1  60   ? 128.115 152.968 46.144  1.00 71.50  ? 59   GLU A C     1 
ATOM   452   O  O     . GLU A  1  60   ? 129.283 153.333 46.286  1.00 70.93  ? 59   GLU A O     1 
ATOM   453   C  CB    . GLU A  1  60   ? 127.116 155.037 47.146  1.00 74.58  ? 59   GLU A CB    1 
ATOM   454   C  CG    . GLU A  1  60   ? 125.806 155.732 47.533  1.00 79.50  ? 59   GLU A CG    1 
ATOM   455   C  CD    . GLU A  1  60   ? 125.898 157.259 47.488  1.00 82.19  ? 59   GLU A CD    1 
ATOM   456   O  OE1   . GLU A  1  60   ? 126.239 157.810 46.413  1.00 83.16  ? 59   GLU A OE1   1 
ATOM   457   O  OE2   . GLU A  1  60   ? 125.621 157.906 48.528  1.00 83.15  ? 59   GLU A OE2   1 
ATOM   458   N  N     . PHE A  1  61   ? 127.738 152.077 45.232  1.00 71.68  ? 60   PHE A N     1 
ATOM   459   C  CA    . PHE A  1  61   ? 128.686 151.453 44.315  1.00 72.12  ? 60   PHE A CA    1 
ATOM   460   C  C     . PHE A  1  61   ? 129.017 152.281 43.083  1.00 73.17  ? 60   PHE A C     1 
ATOM   461   O  O     . PHE A  1  61   ? 128.185 153.031 42.582  1.00 73.80  ? 60   PHE A O     1 
ATOM   462   C  CB    . PHE A  1  61   ? 128.161 150.087 43.872  1.00 72.24  ? 60   PHE A CB    1 
ATOM   463   C  CG    . PHE A  1  61   ? 128.110 149.077 44.973  1.00 72.05  ? 60   PHE A CG    1 
ATOM   464   C  CD1   . PHE A  1  61   ? 127.127 149.147 45.951  1.00 71.26  ? 60   PHE A CD1   1 
ATOM   465   C  CD2   . PHE A  1  61   ? 129.075 148.074 45.055  1.00 71.15  ? 60   PHE A CD2   1 
ATOM   466   C  CE1   . PHE A  1  61   ? 127.106 148.236 46.997  1.00 71.50  ? 60   PHE A CE1   1 
ATOM   467   C  CE2   . PHE A  1  61   ? 129.066 147.156 46.097  1.00 70.26  ? 60   PHE A CE2   1 
ATOM   468   C  CZ    . PHE A  1  61   ? 128.082 147.235 47.071  1.00 71.31  ? 60   PHE A CZ    1 
ATOM   469   N  N     . GLU A  1  62   ? 130.239 152.122 42.590  1.00 73.41  ? 61   GLU A N     1 
ATOM   470   C  CA    . GLU A  1  62   ? 130.704 152.846 41.416  1.00 74.93  ? 61   GLU A CA    1 
ATOM   471   C  C     . GLU A  1  62   ? 129.652 153.034 40.323  1.00 74.19  ? 61   GLU A C     1 
ATOM   472   O  O     . GLU A  1  62   ? 129.546 154.115 39.742  1.00 74.79  ? 61   GLU A O     1 
ATOM   473   C  CB    . GLU A  1  62   ? 131.912 152.130 40.813  1.00 78.29  ? 61   GLU A CB    1 
ATOM   474   C  CG    . GLU A  1  62   ? 133.133 152.074 41.711  1.00 82.18  ? 61   GLU A CG    1 
ATOM   475   C  CD    . GLU A  1  62   ? 134.238 151.208 41.126  1.00 84.07  ? 61   GLU A CD    1 
ATOM   476   O  OE1   . GLU A  1  62   ? 134.668 151.477 39.983  1.00 85.73  ? 61   GLU A OE1   1 
ATOM   477   O  OE2   . GLU A  1  62   ? 134.675 150.256 41.811  1.00 85.37  ? 61   GLU A OE2   1 
ATOM   478   N  N     . ASP A  1  63   ? 128.883 151.988 40.037  1.00 73.47  ? 62   ASP A N     1 
ATOM   479   C  CA    . ASP A  1  63   ? 127.871 152.067 38.990  1.00 73.51  ? 62   ASP A CA    1 
ATOM   480   C  C     . ASP A  1  63   ? 126.520 152.598 39.442  1.00 73.71  ? 62   ASP A C     1 
ATOM   481   O  O     . ASP A  1  63   ? 125.483 152.194 38.924  1.00 74.33  ? 62   ASP A O     1 
ATOM   482   C  CB    . ASP A  1  63   ? 127.691 150.706 38.320  1.00 72.73  ? 62   ASP A CB    1 
ATOM   483   C  CG    . ASP A  1  63   ? 127.519 149.591 39.314  1.00 72.52  ? 62   ASP A CG    1 
ATOM   484   O  OD1   . ASP A  1  63   ? 128.474 149.321 40.065  1.00 72.87  ? 62   ASP A OD1   1 
ATOM   485   O  OD2   . ASP A  1  63   ? 126.432 148.986 39.348  1.00 73.08  ? 62   ASP A OD2   1 
ATOM   486   N  N     . GLY A  1  64   ? 126.541 153.506 40.410  1.00 74.62  ? 63   GLY A N     1 
ATOM   487   C  CA    . GLY A  1  64   ? 125.314 154.113 40.900  1.00 75.05  ? 63   GLY A CA    1 
ATOM   488   C  C     . GLY A  1  64   ? 124.340 153.262 41.694  1.00 75.22  ? 63   GLY A C     1 
ATOM   489   O  O     . GLY A  1  64   ? 123.138 153.513 41.651  1.00 75.15  ? 63   GLY A O     1 
ATOM   490   N  N     . ASP A  1  65   ? 124.837 152.271 42.426  1.00 75.85  ? 64   ASP A N     1 
ATOM   491   C  CA    . ASP A  1  65   ? 123.959 151.420 43.219  1.00 76.14  ? 64   ASP A CA    1 
ATOM   492   C  C     . ASP A  1  65   ? 124.009 151.664 44.719  1.00 74.72  ? 64   ASP A C     1 
ATOM   493   O  O     . ASP A  1  65   ? 125.025 151.439 45.374  1.00 75.02  ? 64   ASP A O     1 
ATOM   494   C  CB    . ASP A  1  65   ? 124.246 149.950 42.939  1.00 78.98  ? 64   ASP A CB    1 
ATOM   495   C  CG    . ASP A  1  65   ? 123.282 149.363 41.944  1.00 81.91  ? 64   ASP A CG    1 
ATOM   496   O  OD1   . ASP A  1  65   ? 122.058 149.447 42.199  1.00 82.93  ? 64   ASP A OD1   1 
ATOM   497   O  OD2   . ASP A  1  65   ? 123.741 148.825 40.912  1.00 84.31  ? 64   ASP A OD2   1 
ATOM   498   N  N     . ARG A  1  66   ? 122.887 152.126 45.252  1.00 72.88  ? 65   ARG A N     1 
ATOM   499   C  CA    . ARG A  1  66   ? 122.750 152.398 46.672  1.00 71.51  ? 65   ARG A CA    1 
ATOM   500   C  C     . ARG A  1  66   ? 121.970 151.213 47.243  1.00 70.06  ? 65   ARG A C     1 
ATOM   501   O  O     . ARG A  1  66   ? 120.785 151.038 46.946  1.00 71.84  ? 65   ARG A O     1 
ATOM   502   C  CB    . ARG A  1  66   ? 121.994 153.721 46.860  1.00 72.45  ? 65   ARG A CB    1 
ATOM   503   C  CG    . ARG A  1  66   ? 121.634 154.058 48.291  1.00 73.98  ? 65   ARG A CG    1 
ATOM   504   C  CD    . ARG A  1  66   ? 122.836 153.978 49.213  1.00 75.65  ? 65   ARG A CD    1 
ATOM   505   N  NE    . ARG A  1  66   ? 122.455 154.174 50.610  1.00 76.81  ? 65   ARG A NE    1 
ATOM   506   C  CZ    . ARG A  1  66   ? 121.959 155.308 51.096  1.00 77.32  ? 65   ARG A CZ    1 
ATOM   507   N  NH1   . ARG A  1  66   ? 121.786 156.352 50.291  1.00 77.28  ? 65   ARG A NH1   1 
ATOM   508   N  NH2   . ARG A  1  66   ? 121.633 155.395 52.382  1.00 76.78  ? 65   ARG A NH2   1 
ATOM   509   N  N     . ARG A  1  67   ? 122.637 150.394 48.054  1.00 67.16  ? 66   ARG A N     1 
ATOM   510   C  CA    . ARG A  1  67   ? 122.011 149.200 48.618  1.00 63.23  ? 66   ARG A CA    1 
ATOM   511   C  C     . ARG A  1  67   ? 122.532 148.830 50.012  1.00 59.59  ? 66   ARG A C     1 
ATOM   512   O  O     . ARG A  1  67   ? 123.715 148.981 50.292  1.00 59.74  ? 66   ARG A O     1 
ATOM   513   C  CB    . ARG A  1  67   ? 122.255 148.037 47.655  1.00 64.92  ? 66   ARG A CB    1 
ATOM   514   C  CG    . ARG A  1  67   ? 121.793 148.327 46.217  1.00 68.75  ? 66   ARG A CG    1 
ATOM   515   C  CD    . ARG A  1  67   ? 122.443 147.425 45.150  1.00 69.20  ? 66   ARG A CD    1 
ATOM   516   N  NE    . ARG A  1  67   ? 122.143 146.010 45.341  1.00 68.44  ? 66   ARG A NE    1 
ATOM   517   C  CZ    . ARG A  1  67   ? 122.702 145.253 46.277  1.00 68.16  ? 66   ARG A CZ    1 
ATOM   518   N  NH1   . ARG A  1  67   ? 123.599 145.771 47.109  1.00 66.82  ? 66   ARG A NH1   1 
ATOM   519   N  NH2   . ARG A  1  67   ? 122.353 143.981 46.387  1.00 69.07  ? 66   ARG A NH2   1 
ATOM   520   N  N     . LEU A  1  68   ? 121.653 148.350 50.887  1.00 54.74  ? 67   LEU A N     1 
ATOM   521   C  CA    . LEU A  1  68   ? 122.076 147.947 52.228  1.00 50.81  ? 67   LEU A CA    1 
ATOM   522   C  C     . LEU A  1  68   ? 122.924 146.680 52.123  1.00 49.39  ? 67   LEU A C     1 
ATOM   523   O  O     . LEU A  1  68   ? 122.847 145.979 51.119  1.00 50.25  ? 67   LEU A O     1 
ATOM   524   C  CB    . LEU A  1  68   ? 120.857 147.694 53.116  1.00 46.95  ? 67   LEU A CB    1 
ATOM   525   C  CG    . LEU A  1  68   ? 120.163 148.927 53.687  1.00 42.66  ? 67   LEU A CG    1 
ATOM   526   C  CD1   . LEU A  1  68   ? 118.865 148.534 54.313  1.00 40.66  ? 67   LEU A CD1   1 
ATOM   527   C  CD2   . LEU A  1  68   ? 121.056 149.584 54.714  1.00 41.95  ? 67   LEU A CD2   1 
ATOM   528   N  N     . ILE A  1  69   ? 123.727 146.381 53.144  1.00 48.04  ? 68   ILE A N     1 
ATOM   529   C  CA    . ILE A  1  69   ? 124.579 145.191 53.089  1.00 48.05  ? 68   ILE A CA    1 
ATOM   530   C  C     . ILE A  1  69   ? 124.859 144.541 54.438  1.00 47.53  ? 68   ILE A C     1 
ATOM   531   O  O     . ILE A  1  69   ? 125.060 145.230 55.433  1.00 48.88  ? 68   ILE A O     1 
ATOM   532   C  CB    . ILE A  1  69   ? 125.934 145.516 52.407  1.00 48.69  ? 68   ILE A CB    1 
ATOM   533   C  CG1   . ILE A  1  69   ? 126.344 144.348 51.516  1.00 51.94  ? 68   ILE A CG1   1 
ATOM   534   C  CG2   . ILE A  1  69   ? 127.031 145.755 53.451  1.00 46.92  ? 68   ILE A CG2   1 
ATOM   535   C  CD1   . ILE A  1  69   ? 127.492 144.661 50.576  1.00 54.20  ? 68   ILE A CD1   1 
ATOM   536   N  N     . LEU A  1  70   ? 124.876 143.211 54.469  1.00 46.51  ? 69   LEU A N     1 
ATOM   537   C  CA    . LEU A  1  70   ? 125.146 142.486 55.709  1.00 45.57  ? 69   LEU A CA    1 
ATOM   538   C  C     . LEU A  1  70   ? 126.565 142.848 56.114  1.00 45.77  ? 69   LEU A C     1 
ATOM   539   O  O     . LEU A  1  70   ? 127.538 142.376 55.528  1.00 46.68  ? 69   LEU A O     1 
ATOM   540   C  CB    . LEU A  1  70   ? 125.000 140.971 55.494  1.00 46.21  ? 69   LEU A CB    1 
ATOM   541   C  CG    . LEU A  1  70   ? 125.266 139.977 56.637  1.00 45.75  ? 69   LEU A CG    1 
ATOM   542   C  CD1   . LEU A  1  70   ? 125.359 140.676 57.973  1.00 46.86  ? 69   LEU A CD1   1 
ATOM   543   C  CD2   . LEU A  1  70   ? 124.153 138.952 56.663  1.00 45.60  ? 69   LEU A CD2   1 
ATOM   544   N  N     . ALA A  1  71   ? 126.669 143.687 57.133  1.00 44.27  ? 70   ALA A N     1 
ATOM   545   C  CA    . ALA A  1  71   ? 127.951 144.173 57.593  1.00 42.54  ? 70   ALA A CA    1 
ATOM   546   C  C     . ALA A  1  71   ? 128.670 143.406 58.697  1.00 42.98  ? 70   ALA A C     1 
ATOM   547   O  O     . ALA A  1  71   ? 128.128 143.171 59.776  1.00 41.96  ? 70   ALA A O     1 
ATOM   548   C  CB    . ALA A  1  71   ? 127.795 145.607 58.011  1.00 42.48  ? 70   ALA A CB    1 
ATOM   549   N  N     . PRO A  1  72   ? 129.921 143.011 58.435  1.00 43.54  ? 71   PRO A N     1 
ATOM   550   C  CA    . PRO A  1  72   ? 130.701 142.286 59.437  1.00 43.40  ? 71   PRO A CA    1 
ATOM   551   C  C     . PRO A  1  72   ? 131.141 143.336 60.450  1.00 43.17  ? 71   PRO A C     1 
ATOM   552   O  O     . PRO A  1  72   ? 131.218 144.521 60.124  1.00 42.36  ? 71   PRO A O     1 
ATOM   553   C  CB    . PRO A  1  72   ? 131.898 141.757 58.645  1.00 43.61  ? 71   PRO A CB    1 
ATOM   554   C  CG    . PRO A  1  72   ? 131.428 141.775 57.213  1.00 44.39  ? 71   PRO A CG    1 
ATOM   555   C  CD    . PRO A  1  72   ? 130.619 143.030 57.139  1.00 43.50  ? 71   PRO A CD    1 
ATOM   556   N  N     . GLU A  1  73   ? 131.438 142.914 61.671  1.00 44.56  ? 72   GLU A N     1 
ATOM   557   C  CA    . GLU A  1  73   ? 131.880 143.855 62.692  1.00 44.22  ? 72   GLU A CA    1 
ATOM   558   C  C     . GLU A  1  73   ? 133.042 144.681 62.161  1.00 43.46  ? 72   GLU A C     1 
ATOM   559   O  O     . GLU A  1  73   ? 133.843 144.208 61.361  1.00 44.19  ? 72   GLU A O     1 
ATOM   560   C  CB    . GLU A  1  73   ? 132.321 143.101 63.939  1.00 44.83  ? 72   GLU A CB    1 
ATOM   561   C  CG    . GLU A  1  73   ? 133.088 143.944 64.923  1.00 46.81  ? 72   GLU A CG    1 
ATOM   562   C  CD    . GLU A  1  73   ? 133.561 143.136 66.109  1.00 48.14  ? 72   GLU A CD    1 
ATOM   563   O  OE1   . GLU A  1  73   ? 134.421 143.637 66.860  1.00 49.67  ? 72   GLU A OE1   1 
ATOM   564   O  OE2   . GLU A  1  73   ? 133.066 142.004 66.290  1.00 47.98  ? 72   GLU A OE2   1 
ATOM   565   N  N     . GLY A  1  74   ? 133.133 145.923 62.601  1.00 42.85  ? 73   GLY A N     1 
ATOM   566   C  CA    . GLY A  1  74   ? 134.224 146.754 62.143  1.00 41.79  ? 73   GLY A CA    1 
ATOM   567   C  C     . GLY A  1  74   ? 134.090 147.270 60.727  1.00 41.12  ? 73   GLY A C     1 
ATOM   568   O  O     . GLY A  1  74   ? 134.915 146.965 59.874  1.00 41.26  ? 73   GLY A O     1 
ATOM   569   N  N     . VAL A  1  75   ? 133.039 148.042 60.479  1.00 41.41  ? 74   VAL A N     1 
ATOM   570   C  CA    . VAL A  1  75   ? 132.793 148.654 59.174  1.00 41.52  ? 74   VAL A CA    1 
ATOM   571   C  C     . VAL A  1  75   ? 132.223 150.031 59.498  1.00 42.94  ? 74   VAL A C     1 
ATOM   572   O  O     . VAL A  1  75   ? 131.262 150.151 60.265  1.00 42.76  ? 74   VAL A O     1 
ATOM   573   C  CB    . VAL A  1  75   ? 131.767 147.850 58.318  1.00 40.33  ? 74   VAL A CB    1 
ATOM   574   C  CG1   . VAL A  1  75   ? 131.471 148.584 57.019  1.00 37.42  ? 74   VAL A CG1   1 
ATOM   575   C  CG2   . VAL A  1  75   ? 132.324 146.479 58.002  1.00 40.12  ? 74   VAL A CG2   1 
ATOM   576   N  N     . GLY A  1  76   ? 132.832 151.069 58.935  1.00 42.94  ? 75   GLY A N     1 
ATOM   577   C  CA    . GLY A  1  76   ? 132.365 152.412 59.209  1.00 44.70  ? 75   GLY A CA    1 
ATOM   578   C  C     . GLY A  1  76   ? 132.089 153.232 57.969  1.00 46.04  ? 75   GLY A C     1 
ATOM   579   O  O     . GLY A  1  76   ? 132.474 152.855 56.859  1.00 46.53  ? 75   GLY A O     1 
ATOM   580   N  N     . VAL A  1  77   ? 131.400 154.352 58.147  1.00 45.92  ? 76   VAL A N     1 
ATOM   581   C  CA    . VAL A  1  77   ? 131.111 155.206 57.016  1.00 46.32  ? 76   VAL A CA    1 
ATOM   582   C  C     . VAL A  1  77   ? 132.450 155.672 56.470  1.00 46.56  ? 76   VAL A C     1 
ATOM   583   O  O     . VAL A  1  77   ? 133.384 155.940 57.235  1.00 46.09  ? 76   VAL A O     1 
ATOM   584   C  CB    . VAL A  1  77   ? 130.289 156.430 57.427  1.00 46.82  ? 76   VAL A CB    1 
ATOM   585   C  CG1   . VAL A  1  77   ? 130.062 157.332 56.217  1.00 45.96  ? 76   VAL A CG1   1 
ATOM   586   C  CG2   . VAL A  1  77   ? 128.970 155.984 58.023  1.00 47.22  ? 76   VAL A CG2   1 
ATOM   587   N  N     . GLY A  1  78   ? 132.541 155.755 55.148  1.00 46.23  ? 77   GLY A N     1 
ATOM   588   C  CA    . GLY A  1  78   ? 133.773 156.192 54.525  1.00 46.35  ? 77   GLY A CA    1 
ATOM   589   C  C     . GLY A  1  78   ? 134.635 155.034 54.067  1.00 46.14  ? 77   GLY A C     1 
ATOM   590   O  O     . GLY A  1  78   ? 134.846 154.834 52.868  1.00 45.85  ? 77   GLY A O     1 
ATOM   591   C  CA    . ASP A  1  79   ? 135.684 152.454 54.188  1.00 71.66  ? 78   ASP A CA    1 
ATOM   592   C  C     . ASP A  1  79   ? 135.078 152.145 52.826  1.00 70.87  ? 78   ASP A C     1 
ATOM   593   O  O     . ASP A  1  79   ? 133.903 152.427 52.565  1.00 70.16  ? 78   ASP A O     1 
ATOM   594   C  CB    . ASP A  1  79   ? 134.826 151.865 55.301  1.00 73.55  ? 78   ASP A CB    1 
ATOM   595   C  CG    . ASP A  1  79   ? 135.239 152.361 56.671  1.00 75.78  ? 78   ASP A CG    1 
ATOM   596   O  OD1   . ASP A  1  79   ? 135.011 153.560 56.957  1.00 76.72  ? 78   ASP A OD1   1 
ATOM   597   O  OD2   . ASP A  1  79   ? 135.798 151.556 57.453  1.00 75.98  ? 78   ASP A OD2   1 
ATOM   598   N  N     . GLU A  1  80   ? 135.911 151.580 51.958  1.00 69.93  ? 79   GLU A N     1 
ATOM   599   C  CA    . GLU A  1  80   ? 135.516 151.203 50.611  1.00 68.62  ? 79   GLU A CA    1 
ATOM   600   C  C     . GLU A  1  80   ? 135.528 149.687 50.589  1.00 66.74  ? 79   GLU A C     1 
ATOM   601   O  O     . GLU A  1  80   ? 136.521 149.063 50.966  1.00 66.03  ? 79   GLU A O     1 
ATOM   602   C  CB    . GLU A  1  80   ? 136.524 151.733 49.592  1.00 69.77  ? 79   GLU A CB    1 
ATOM   603   C  CG    . GLU A  1  80   ? 136.144 151.484 48.140  1.00 70.92  ? 79   GLU A CG    1 
ATOM   604   C  CD    . GLU A  1  80   ? 137.346 151.504 47.209  1.00 71.33  ? 79   GLU A CD    1 
ATOM   605   O  OE1   . GLU A  1  80   ? 138.112 152.496 47.228  1.00 71.36  ? 79   GLU A OE1   1 
ATOM   606   O  OE2   . GLU A  1  80   ? 137.521 150.521 46.455  1.00 71.09  ? 79   GLU A OE2   1 
ATOM   607   N  N     . LEU A  1  81   ? 134.421 149.102 50.150  1.00 65.30  ? 80   LEU A N     1 
ATOM   608   C  CA    . LEU A  1  81   ? 134.293 147.655 50.094  1.00 63.66  ? 80   LEU A CA    1 
ATOM   609   C  C     . LEU A  1  81   ? 134.361 147.182 48.648  1.00 63.46  ? 80   LEU A C     1 
ATOM   610   O  O     . LEU A  1  81   ? 134.120 147.954 47.717  1.00 62.68  ? 80   LEU A O     1 
ATOM   611   C  CB    . LEU A  1  81   ? 132.971 147.238 50.739  1.00 61.26  ? 80   LEU A CB    1 
ATOM   612   C  CG    . LEU A  1  81   ? 132.790 147.776 52.163  1.00 59.01  ? 80   LEU A CG    1 
ATOM   613   C  CD1   . LEU A  1  81   ? 131.322 147.765 52.529  1.00 58.48  ? 80   LEU A CD1   1 
ATOM   614   C  CD2   . LEU A  1  81   ? 133.614 146.960 53.144  1.00 57.40  ? 80   LEU A CD2   1 
ATOM   615   N  N     . GLN A  1  82   ? 134.697 145.910 48.467  1.00 63.64  ? 81   GLN A N     1 
ATOM   616   C  CA    . GLN A  1  82   ? 134.815 145.339 47.135  1.00 64.19  ? 81   GLN A CA    1 
ATOM   617   C  C     . GLN A  1  82   ? 134.137 143.982 47.046  1.00 63.66  ? 81   GLN A C     1 
ATOM   618   O  O     . GLN A  1  82   ? 134.124 143.215 48.008  1.00 62.80  ? 81   GLN A O     1 
ATOM   619   C  CB    . GLN A  1  82   ? 136.290 145.200 46.765  1.00 65.90  ? 81   GLN A CB    1 
ATOM   620   C  CG    . GLN A  1  82   ? 137.095 146.449 47.052  1.00 67.42  ? 81   GLN A CG    1 
ATOM   621   C  CD    . GLN A  1  82   ? 138.583 146.238 46.883  1.00 68.63  ? 81   GLN A CD    1 
ATOM   622   O  OE1   . GLN A  1  82   ? 139.073 145.106 46.926  1.00 69.26  ? 81   GLN A OE1   1 
ATOM   623   N  NE2   . GLN A  1  82   ? 139.317 147.335 46.712  1.00 69.16  ? 81   GLN A NE2   1 
ATOM   624   N  N     . VAL A  1  83   ? 133.575 143.698 45.877  1.00 63.27  ? 82   VAL A N     1 
ATOM   625   C  CA    . VAL A  1  83   ? 132.893 142.441 45.637  1.00 63.33  ? 82   VAL A CA    1 
ATOM   626   C  C     . VAL A  1  83   ? 133.263 141.869 44.283  1.00 62.92  ? 82   VAL A C     1 
ATOM   627   O  O     . VAL A  1  83   ? 132.867 142.395 43.247  1.00 62.78  ? 82   VAL A O     1 
ATOM   628   C  CB    . VAL A  1  83   ? 131.377 142.617 45.673  1.00 64.51  ? 82   VAL A CB    1 
ATOM   629   C  CG1   . VAL A  1  83   ? 130.696 141.272 45.415  1.00 65.61  ? 82   VAL A CG1   1 
ATOM   630   C  CG2   . VAL A  1  83   ? 130.958 143.194 47.015  1.00 65.26  ? 82   VAL A CG2   1 
ATOM   631   N  N     . GLY A  1  84   ? 134.017 140.780 44.301  1.00 63.19  ? 83   GLY A N     1 
ATOM   632   C  CA    . GLY A  1  84   ? 134.432 140.145 43.065  1.00 63.52  ? 83   GLY A CA    1 
ATOM   633   C  C     . GLY A  1  84   ? 135.548 139.164 43.339  1.00 64.03  ? 83   GLY A C     1 
ATOM   634   O  O     . GLY A  1  84   ? 136.090 139.127 44.447  1.00 63.53  ? 83   GLY A O     1 
ATOM   635   N  N     . VAL A  1  85   ? 135.901 138.372 42.334  1.00 64.56  ? 84   VAL A N     1 
ATOM   636   C  CA    . VAL A  1  85   ? 136.961 137.383 42.490  1.00 65.08  ? 84   VAL A CA    1 
ATOM   637   C  C     . VAL A  1  85   ? 138.283 138.040 42.892  1.00 66.11  ? 84   VAL A C     1 
ATOM   638   O  O     . VAL A  1  85   ? 139.006 137.536 43.754  1.00 65.97  ? 84   VAL A O     1 
ATOM   639   C  CB    . VAL A  1  85   ? 137.191 136.614 41.185  1.00 64.18  ? 84   VAL A CB    1 
ATOM   640   C  CG1   . VAL A  1  85   ? 137.926 135.327 41.478  1.00 64.15  ? 84   VAL A CG1   1 
ATOM   641   C  CG2   . VAL A  1  85   ? 135.869 136.344 40.493  1.00 64.31  ? 84   VAL A CG2   1 
ATOM   642   N  N     . SER A  1  86   ? 138.578 139.178 42.265  1.00 66.83  ? 85   SER A N     1 
ATOM   643   C  CA    . SER A  1  86   ? 139.813 139.919 42.510  1.00 66.70  ? 85   SER A CA    1 
ATOM   644   C  C     . SER A  1  86   ? 139.776 140.839 43.719  1.00 67.16  ? 85   SER A C     1 
ATOM   645   O  O     . SER A  1  86   ? 140.800 141.402 44.095  1.00 68.01  ? 85   SER A O     1 
ATOM   646   C  CB    . SER A  1  86   ? 140.165 140.754 41.284  1.00 65.61  ? 85   SER A CB    1 
ATOM   647   O  OG    . SER A  1  86   ? 139.993 139.996 40.106  1.00 67.10  ? 85   SER A OG    1 
ATOM   648   N  N     . ALA A  1  87   ? 138.606 141.009 44.319  1.00 67.18  ? 86   ALA A N     1 
ATOM   649   C  CA    . ALA A  1  87   ? 138.491 141.882 45.479  1.00 66.70  ? 86   ALA A CA    1 
ATOM   650   C  C     . ALA A  1  87   ? 139.591 141.590 46.505  1.00 66.01  ? 86   ALA A C     1 
ATOM   651   O  O     . ALA A  1  87   ? 140.114 140.475 46.581  1.00 65.21  ? 86   ALA A O     1 
ATOM   652   C  CB    . ALA A  1  87   ? 137.116 141.726 46.112  1.00 68.06  ? 86   ALA A CB    1 
ATOM   653   N  N     . GLU A  1  88   ? 139.935 142.604 47.288  1.00 64.70  ? 87   GLU A N     1 
ATOM   654   C  CA    . GLU A  1  88   ? 140.975 142.491 48.294  1.00 63.90  ? 87   GLU A CA    1 
ATOM   655   C  C     . GLU A  1  88   ? 140.578 141.593 49.457  1.00 61.72  ? 87   GLU A C     1 
ATOM   656   O  O     . GLU A  1  88   ? 139.443 141.629 49.911  1.00 61.48  ? 87   GLU A O     1 
ATOM   657   C  CB    . GLU A  1  88   ? 141.320 143.880 48.814  1.00 67.76  ? 87   GLU A CB    1 
ATOM   658   C  CG    . GLU A  1  88   ? 142.796 144.195 48.782  1.00 73.44  ? 87   GLU A CG    1 
ATOM   659   C  CD    . GLU A  1  88   ? 143.099 145.605 49.265  1.00 76.70  ? 87   GLU A CD    1 
ATOM   660   O  OE1   . GLU A  1  88   ? 142.756 145.928 50.428  1.00 77.87  ? 87   GLU A OE1   1 
ATOM   661   O  OE2   . GLU A  1  88   ? 143.682 146.387 48.478  1.00 78.23  ? 87   GLU A OE2   1 
ATOM   662   N  N     . ILE A  1  89   ? 141.529 140.796 49.935  1.00 59.70  ? 88   ILE A N     1 
ATOM   663   C  CA    . ILE A  1  89   ? 141.305 139.875 51.051  1.00 58.58  ? 88   ILE A CA    1 
ATOM   664   C  C     . ILE A  1  89   ? 141.243 140.629 52.377  1.00 57.60  ? 88   ILE A C     1 
ATOM   665   O  O     . ILE A  1  89   ? 142.031 140.388 53.294  1.00 56.86  ? 88   ILE A O     1 
ATOM   666   C  CB    . ILE A  1  89   ? 142.430 138.794 51.119  1.00 58.56  ? 88   ILE A CB    1 
ATOM   667   C  CG1   . ILE A  1  89   ? 142.383 137.925 49.860  1.00 59.58  ? 88   ILE A CG1   1 
ATOM   668   C  CG2   . ILE A  1  89   ? 142.263 137.909 52.353  1.00 56.23  ? 88   ILE A CG2   1 
ATOM   669   C  CD1   . ILE A  1  89   ? 143.483 136.885 49.777  1.00 62.10  ? 88   ILE A CD1   1 
ATOM   670   N  N     . ALA A  1  90   ? 140.289 141.544 52.470  1.00 56.66  ? 89   ALA A N     1 
ATOM   671   C  CA    . ALA A  1  90   ? 140.123 142.336 53.671  1.00 56.71  ? 89   ALA A CA    1 
ATOM   672   C  C     . ALA A  1  90   ? 138.677 142.313 54.128  1.00 57.35  ? 89   ALA A C     1 
ATOM   673   O  O     . ALA A  1  90   ? 137.771 142.103 53.331  1.00 58.50  ? 89   ALA A O     1 
ATOM   674   C  CB    . ALA A  1  90   ? 140.556 143.753 53.403  1.00 56.22  ? 89   ALA A CB    1 
ATOM   675   N  N     . PRO A  1  91   ? 138.441 142.539 55.426  1.00 57.88  ? 90   PRO A N     1 
ATOM   676   C  CA    . PRO A  1  91   ? 137.095 142.548 56.002  1.00 57.56  ? 90   PRO A CA    1 
ATOM   677   C  C     . PRO A  1  91   ? 136.112 143.335 55.158  1.00 57.59  ? 90   PRO A C     1 
ATOM   678   O  O     . PRO A  1  91   ? 136.497 144.268 54.459  1.00 57.78  ? 90   PRO A O     1 
ATOM   679   C  CB    . PRO A  1  91   ? 137.312 143.197 57.359  1.00 57.22  ? 90   PRO A CB    1 
ATOM   680   C  CG    . PRO A  1  91   ? 138.656 142.684 57.737  1.00 58.35  ? 90   PRO A CG    1 
ATOM   681   C  CD    . PRO A  1  91   ? 139.449 142.834 56.459  1.00 58.12  ? 90   PRO A CD    1 
ATOM   682   N  N     . GLY A  1  92   ? 134.844 142.946 55.222  1.00 58.06  ? 91   GLY A N     1 
ATOM   683   C  CA    . GLY A  1  92   ? 133.814 143.649 54.480  1.00 58.47  ? 91   GLY A CA    1 
ATOM   684   C  C     . GLY A  1  92   ? 133.858 143.476 52.976  1.00 58.88  ? 91   GLY A C     1 
ATOM   685   O  O     . GLY A  1  92   ? 133.084 144.101 52.252  1.00 59.75  ? 91   GLY A O     1 
ATOM   686   N  N     . ASN A  1  93   ? 134.761 142.644 52.483  1.00 58.02  ? 92   ASN A N     1 
ATOM   687   C  CA    . ASN A  1  93   ? 134.807 142.445 51.052  1.00 58.64  ? 92   ASN A CA    1 
ATOM   688   C  C     . ASN A  1  93   ? 134.176 141.113 50.694  1.00 58.48  ? 92   ASN A C     1 
ATOM   689   O  O     . ASN A  1  93   ? 134.299 140.133 51.433  1.00 57.99  ? 92   ASN A O     1 
ATOM   690   C  CB    . ASN A  1  93   ? 136.246 142.513 50.530  1.00 58.89  ? 92   ASN A CB    1 
ATOM   691   C  CG    . ASN A  1  93   ? 136.780 143.929 50.481  1.00 59.06  ? 92   ASN A CG    1 
ATOM   692   O  OD1   . ASN A  1  93   ? 136.013 144.893 50.408  1.00 59.45  ? 92   ASN A OD1   1 
ATOM   693   N  ND2   . ASN A  1  93   ? 138.101 144.063 50.501  1.00 58.80  ? 92   ASN A ND2   1 
ATOM   694   N  N     . THR A  1  94   ? 133.489 141.086 49.559  1.00 58.20  ? 93   THR A N     1 
ATOM   695   C  CA    . THR A  1  94   ? 132.836 139.874 49.106  1.00 58.84  ? 93   THR A CA    1 
ATOM   696   C  C     . THR A  1  94   ? 133.507 139.269 47.884  1.00 58.23  ? 93   THR A C     1 
ATOM   697   O  O     . THR A  1  94   ? 133.824 139.959 46.920  1.00 57.85  ? 93   THR A O     1 
ATOM   698   C  CB    . THR A  1  94   ? 131.365 140.134 48.771  1.00 59.67  ? 93   THR A CB    1 
ATOM   699   O  OG1   . THR A  1  94   ? 130.694 140.625 49.937  1.00 62.28  ? 93   THR A OG1   1 
ATOM   700   C  CG2   . THR A  1  94   ? 130.694 138.850 48.307  1.00 59.05  ? 93   THR A CG2   1 
ATOM   701   N  N     . LEU A  1  95   ? 133.711 137.960 47.944  1.00 58.24  ? 94   LEU A N     1 
ATOM   702   C  CA    . LEU A  1  95   ? 134.333 137.214 46.866  1.00 57.29  ? 94   LEU A CA    1 
ATOM   703   C  C     . LEU A  1  95   ? 134.134 135.715 47.106  1.00 57.07  ? 94   LEU A C     1 
ATOM   704   O  O     . LEU A  1  95   ? 133.953 135.269 48.247  1.00 55.74  ? 94   LEU A O     1 
ATOM   705   C  CB    . LEU A  1  95   ? 135.830 137.557 46.768  1.00 57.52  ? 94   LEU A CB    1 
ATOM   706   C  CG    . LEU A  1  95   ? 136.770 137.404 47.971  1.00 57.80  ? 94   LEU A CG    1 
ATOM   707   C  CD1   . LEU A  1  95   ? 138.202 137.591 47.511  1.00 57.74  ? 94   LEU A CD1   1 
ATOM   708   C  CD2   . LEU A  1  95   ? 136.433 138.415 49.055  1.00 57.68  ? 94   LEU A CD2   1 
ATOM   709   N  N     . PRO A  1  96   ? 134.143 134.919 46.025  1.00 56.42  ? 95   PRO A N     1 
ATOM   710   C  CA    . PRO A  1  96   ? 133.961 133.474 46.158  1.00 55.87  ? 95   PRO A CA    1 
ATOM   711   C  C     . PRO A  1  96   ? 134.873 132.856 47.204  1.00 54.85  ? 95   PRO A C     1 
ATOM   712   O  O     . PRO A  1  96   ? 135.954 133.367 47.473  1.00 53.45  ? 95   PRO A O     1 
ATOM   713   C  CB    . PRO A  1  96   ? 134.243 132.956 44.744  1.00 55.71  ? 95   PRO A CB    1 
ATOM   714   C  CG    . PRO A  1  96   ? 135.050 134.057 44.105  1.00 55.13  ? 95   PRO A CG    1 
ATOM   715   C  CD    . PRO A  1  96   ? 134.375 135.285 44.618  1.00 55.72  ? 95   PRO A CD    1 
ATOM   716   N  N     . LEU A  1  97   ? 134.419 131.761 47.803  1.00 55.47  ? 96   LEU A N     1 
ATOM   717   C  CA    . LEU A  1  97   ? 135.203 131.068 48.815  1.00 56.18  ? 96   LEU A CA    1 
ATOM   718   C  C     . LEU A  1  97   ? 136.488 130.565 48.200  1.00 56.68  ? 96   LEU A C     1 
ATOM   719   O  O     . LEU A  1  97   ? 137.348 130.031 48.890  1.00 57.11  ? 96   LEU A O     1 
ATOM   720   C  CB    . LEU A  1  97   ? 134.422 129.889 49.381  1.00 54.51  ? 96   LEU A CB    1 
ATOM   721   C  CG    . LEU A  1  97   ? 133.507 130.244 50.543  1.00 54.27  ? 96   LEU A CG    1 
ATOM   722   C  CD1   . LEU A  1  97   ? 132.569 129.092 50.839  1.00 55.10  ? 96   LEU A CD1   1 
ATOM   723   C  CD2   . LEU A  1  97   ? 134.360 130.578 51.746  1.00 53.33  ? 96   LEU A CD2   1 
ATOM   724   N  N     . ALA A  1  98   ? 136.605 130.738 46.890  1.00 58.07  ? 97   ALA A N     1 
ATOM   725   C  CA    . ALA A  1  98   ? 137.782 130.299 46.156  1.00 58.72  ? 97   ALA A CA    1 
ATOM   726   C  C     . ALA A  1  98   ? 138.977 131.216 46.398  1.00 58.33  ? 97   ALA A C     1 
ATOM   727   O  O     . ALA A  1  98   ? 140.077 130.741 46.659  1.00 57.65  ? 97   ALA A O     1 
ATOM   728   C  CB    . ALA A  1  98   ? 137.461 130.234 44.667  1.00 59.47  ? 97   ALA A CB    1 
ATOM   729   N  N     . GLU A  1  99   ? 138.753 132.525 46.309  1.00 58.47  ? 98   GLU A N     1 
ATOM   730   C  CA    . GLU A  1  99   ? 139.810 133.510 46.507  1.00 59.90  ? 98   GLU A CA    1 
ATOM   731   C  C     . GLU A  1  99   ? 140.089 133.784 47.979  1.00 60.24  ? 98   GLU A C     1 
ATOM   732   O  O     . GLU A  1  99   ? 141.076 134.436 48.329  1.00 59.02  ? 98   GLU A O     1 
ATOM   733   C  CB    . GLU A  1  99   ? 139.434 134.823 45.833  1.00 61.20  ? 98   GLU A CB    1 
ATOM   734   C  CG    . GLU A  1  99   ? 138.969 134.670 44.410  1.00 65.44  ? 98   GLU A CG    1 
ATOM   735   C  CD    . GLU A  1  99   ? 139.939 133.879 43.561  1.00 67.97  ? 98   GLU A CD    1 
ATOM   736   O  OE1   . GLU A  1  99   ? 141.140 134.230 43.547  1.00 69.37  ? 98   GLU A OE1   1 
ATOM   737   O  OE2   . GLU A  1  99   ? 139.495 132.911 42.907  1.00 69.04  ? 98   GLU A OE2   1 
ATOM   738   N  N     . ILE A  1  100  ? 139.207 133.296 48.842  1.00 61.51  ? 99   ILE A N     1 
ATOM   739   C  CA    . ILE A  1  100  ? 139.369 133.510 50.268  1.00 61.71  ? 99   ILE A CA    1 
ATOM   740   C  C     . ILE A  1  100  ? 140.461 132.602 50.798  1.00 61.92  ? 99   ILE A C     1 
ATOM   741   O  O     . ILE A  1  100  ? 140.405 131.389 50.649  1.00 61.27  ? 99   ILE A O     1 
ATOM   742   C  CB    . ILE A  1  100  ? 138.059 133.223 51.050  1.00 62.53  ? 99   ILE A CB    1 
ATOM   743   C  CG1   . ILE A  1  100  ? 136.896 134.011 50.441  1.00 61.09  ? 99   ILE A CG1   1 
ATOM   744   C  CG2   . ILE A  1  100  ? 138.238 133.614 52.523  1.00 62.64  ? 99   ILE A CG2   1 
ATOM   745   C  CD1   . ILE A  1  100  ? 137.080 135.508 50.507  1.00 60.54  ? 99   ILE A CD1   1 
ATOM   746   N  N     . PRO A  1  101  ? 141.483 133.187 51.419  1.00 62.81  ? 100  PRO A N     1 
ATOM   747   C  CA    . PRO A  1  101  ? 142.571 132.378 51.959  1.00 63.44  ? 100  PRO A CA    1 
ATOM   748   C  C     . PRO A  1  101  ? 142.044 131.469 53.059  1.00 64.11  ? 100  PRO A C     1 
ATOM   749   O  O     . PRO A  1  101  ? 141.172 131.864 53.832  1.00 63.85  ? 100  PRO A O     1 
ATOM   750   C  CB    . PRO A  1  101  ? 143.541 133.424 52.487  1.00 63.59  ? 100  PRO A CB    1 
ATOM   751   C  CG    . PRO A  1  101  ? 142.624 134.537 52.904  1.00 63.42  ? 100  PRO A CG    1 
ATOM   752   C  CD    . PRO A  1  101  ? 141.665 134.609 51.750  1.00 63.06  ? 100  PRO A CD    1 
ATOM   753   N  N     . GLU A  1  102  ? 142.569 130.251 53.120  1.00 64.86  ? 101  GLU A N     1 
ATOM   754   C  CA    . GLU A  1  102  ? 142.144 129.306 54.138  1.00 65.31  ? 101  GLU A CA    1 
ATOM   755   C  C     . GLU A  1  102  ? 142.305 129.975 55.498  1.00 65.23  ? 101  GLU A C     1 
ATOM   756   O  O     . GLU A  1  102  ? 143.124 130.879 55.654  1.00 65.55  ? 101  GLU A O     1 
ATOM   757   C  CB    . GLU A  1  102  ? 142.990 128.032 54.052  1.00 66.03  ? 101  GLU A CB    1 
ATOM   758   C  CG    . GLU A  1  102  ? 143.031 127.432 52.638  1.00 68.19  ? 101  GLU A CG    1 
ATOM   759   C  CD    . GLU A  1  102  ? 143.726 126.073 52.568  1.00 69.23  ? 101  GLU A CD    1 
ATOM   760   O  OE1   . GLU A  1  102  ? 144.879 125.962 53.038  1.00 69.69  ? 101  GLU A OE1   1 
ATOM   761   O  OE2   . GLU A  1  102  ? 143.122 125.114 52.030  1.00 69.57  ? 101  GLU A OE2   1 
ATOM   762   N  N     . GLY A  1  103  ? 141.496 129.549 56.467  1.00 65.45  ? 102  GLY A N     1 
ATOM   763   C  CA    . GLY A  1  103  ? 141.558 130.107 57.811  1.00 64.01  ? 102  GLY A CA    1 
ATOM   764   C  C     . GLY A  1  103  ? 141.215 131.580 57.885  1.00 62.80  ? 102  GLY A C     1 
ATOM   765   O  O     . GLY A  1  103  ? 142.023 132.392 58.330  1.00 63.10  ? 102  GLY A O     1 
ATOM   766   N  N     . VAL A  1  104  ? 140.009 131.927 57.458  1.00 61.76  ? 103  VAL A N     1 
ATOM   767   C  CA    . VAL A  1  104  ? 139.569 133.316 57.463  1.00 60.81  ? 103  VAL A CA    1 
ATOM   768   C  C     . VAL A  1  104  ? 138.079 133.430 57.787  1.00 59.70  ? 103  VAL A C     1 
ATOM   769   O  O     . VAL A  1  104  ? 137.234 133.019 56.993  1.00 59.03  ? 103  VAL A O     1 
ATOM   770   C  CB    . VAL A  1  104  ? 139.849 133.972 56.084  1.00 61.08  ? 103  VAL A CB    1 
ATOM   771   C  CG1   . VAL A  1  104  ? 139.222 135.355 56.000  1.00 60.71  ? 103  VAL A CG1   1 
ATOM   772   C  CG2   . VAL A  1  104  ? 141.341 134.060 55.864  1.00 60.79  ? 103  VAL A CG2   1 
ATOM   773   N  N     . PRO A  1  105  ? 137.741 133.982 58.970  1.00 58.29  ? 104  PRO A N     1 
ATOM   774   C  CA    . PRO A  1  105  ? 136.342 134.143 59.379  1.00 57.17  ? 104  PRO A CA    1 
ATOM   775   C  C     . PRO A  1  105  ? 135.498 134.780 58.287  1.00 55.88  ? 104  PRO A C     1 
ATOM   776   O  O     . PRO A  1  105  ? 135.811 135.861 57.786  1.00 55.65  ? 104  PRO A O     1 
ATOM   777   C  CB    . PRO A  1  105  ? 136.449 135.014 60.622  1.00 56.80  ? 104  PRO A CB    1 
ATOM   778   C  CG    . PRO A  1  105  ? 137.693 134.481 61.254  1.00 57.97  ? 104  PRO A CG    1 
ATOM   779   C  CD    . PRO A  1  105  ? 138.644 134.382 60.063  1.00 58.30  ? 104  PRO A CD    1 
ATOM   780   N  N     . VAL A  1  106  ? 134.424 134.091 57.924  1.00 53.95  ? 105  VAL A N     1 
ATOM   781   C  CA    . VAL A  1  106  ? 133.531 134.558 56.880  1.00 52.01  ? 105  VAL A CA    1 
ATOM   782   C  C     . VAL A  1  106  ? 132.094 134.602 57.394  1.00 50.56  ? 105  VAL A C     1 
ATOM   783   O  O     . VAL A  1  106  ? 131.789 134.063 58.459  1.00 50.69  ? 105  VAL A O     1 
ATOM   784   C  CB    . VAL A  1  106  ? 133.614 133.621 55.668  1.00 52.20  ? 105  VAL A CB    1 
ATOM   785   C  CG1   . VAL A  1  106  ? 132.814 134.179 54.528  1.00 52.92  ? 105  VAL A CG1   1 
ATOM   786   C  CG2   . VAL A  1  106  ? 135.056 133.442 55.253  1.00 52.71  ? 105  VAL A CG2   1 
ATOM   787   N  N     . CYS A  1  107  ? 131.216 135.256 56.642  1.00 48.08  ? 106  CYS A N     1 
ATOM   788   C  CA    . CYS A  1  107  ? 129.815 135.355 57.022  1.00 46.89  ? 106  CYS A CA    1 
ATOM   789   C  C     . CYS A  1  107  ? 128.945 135.594 55.793  1.00 46.14  ? 106  CYS A C     1 
ATOM   790   O  O     . CYS A  1  107  ? 129.441 136.001 54.748  1.00 46.08  ? 106  CYS A O     1 
ATOM   791   C  CB    . CYS A  1  107  ? 129.623 136.485 58.029  1.00 46.97  ? 106  CYS A CB    1 
ATOM   792   S  SG    . CYS A  1  107  ? 130.224 138.064 57.446  1.00 46.29  ? 106  CYS A SG    1 
ATOM   793   N  N     . ASN A  1  108  ? 127.647 135.340 55.925  1.00 45.22  ? 107  ASN A N     1 
ATOM   794   C  CA    . ASN A  1  108  ? 126.717 135.514 54.819  1.00 44.04  ? 107  ASN A CA    1 
ATOM   795   C  C     . ASN A  1  108  ? 127.258 134.666 53.679  1.00 43.84  ? 107  ASN A C     1 
ATOM   796   O  O     . ASN A  1  108  ? 127.626 135.167 52.618  1.00 44.25  ? 107  ASN A O     1 
ATOM   797   C  CB    . ASN A  1  108  ? 126.640 136.989 54.416  1.00 44.33  ? 107  ASN A CB    1 
ATOM   798   C  CG    . ASN A  1  108  ? 125.441 137.295 53.532  1.00 46.05  ? 107  ASN A CG    1 
ATOM   799   O  OD1   . ASN A  1  108  ? 124.490 136.512 53.460  1.00 47.39  ? 107  ASN A OD1   1 
ATOM   800   N  ND2   . ASN A  1  108  ? 125.470 138.449 52.867  1.00 44.94  ? 107  ASN A ND2   1 
ATOM   801   N  N     . VAL A  1  109  ? 127.316 133.365 53.933  1.00 42.84  ? 108  VAL A N     1 
ATOM   802   C  CA    . VAL A  1  109  ? 127.813 132.385 52.982  1.00 41.33  ? 108  VAL A CA    1 
ATOM   803   C  C     . VAL A  1  109  ? 126.681 131.791 52.139  1.00 42.26  ? 108  VAL A C     1 
ATOM   804   O  O     . VAL A  1  109  ? 125.628 131.432 52.672  1.00 42.16  ? 108  VAL A O     1 
ATOM   805   C  CB    . VAL A  1  109  ? 128.509 131.244 53.731  1.00 39.98  ? 108  VAL A CB    1 
ATOM   806   C  CG1   . VAL A  1  109  ? 129.084 130.247 52.743  1.00 40.62  ? 108  VAL A CG1   1 
ATOM   807   C  CG2   . VAL A  1  109  ? 129.578 131.809 54.649  1.00 38.42  ? 108  VAL A CG2   1 
ATOM   808   N  N     . GLU A  1  110  ? 126.907 131.681 50.828  1.00 41.88  ? 109  GLU A N     1 
ATOM   809   C  CA    . GLU A  1  110  ? 125.915 131.119 49.913  1.00 40.75  ? 109  GLU A CA    1 
ATOM   810   C  C     . GLU A  1  110  ? 125.886 129.610 49.969  1.00 40.85  ? 109  GLU A C     1 
ATOM   811   O  O     . GLU A  1  110  ? 126.928 128.959 50.104  1.00 39.46  ? 109  GLU A O     1 
ATOM   812   C  CB    . GLU A  1  110  ? 126.210 131.509 48.478  1.00 40.94  ? 109  GLU A CB    1 
ATOM   813   C  CG    . GLU A  1  110  ? 125.977 132.947 48.171  1.00 45.37  ? 109  GLU A CG    1 
ATOM   814   C  CD    . GLU A  1  110  ? 126.185 133.234 46.711  1.00 48.25  ? 109  GLU A CD    1 
ATOM   815   O  OE1   . GLU A  1  110  ? 127.246 132.826 46.191  1.00 50.43  ? 109  GLU A OE1   1 
ATOM   816   O  OE2   . GLU A  1  110  ? 125.298 133.861 46.089  1.00 48.42  ? 109  GLU A OE2   1 
ATOM   817   N  N     . SER A  1  111  ? 124.687 129.055 49.846  1.00 40.94  ? 110  SER A N     1 
ATOM   818   C  CA    . SER A  1  111  ? 124.530 127.615 49.867  1.00 41.94  ? 110  SER A CA    1 
ATOM   819   C  C     . SER A  1  111  ? 124.853 127.130 48.469  1.00 42.48  ? 110  SER A C     1 
ATOM   820   O  O     . SER A  1  111  ? 125.561 126.141 48.284  1.00 44.23  ? 110  SER A O     1 
ATOM   821   C  CB    . SER A  1  111  ? 123.110 127.239 50.237  1.00 41.79  ? 110  SER A CB    1 
ATOM   822   O  OG    . SER A  1  111  ? 123.105 125.963 50.844  1.00 43.82  ? 110  SER A OG    1 
ATOM   823   N  N     . SER A  1  112  ? 124.335 127.844 47.483  1.00 41.99  ? 111  SER A N     1 
ATOM   824   C  CA    . SER A  1  112  ? 124.598 127.527 46.088  1.00 42.73  ? 111  SER A CA    1 
ATOM   825   C  C     . SER A  1  112  ? 125.176 128.813 45.483  1.00 42.98  ? 111  SER A C     1 
ATOM   826   O  O     . SER A  1  112  ? 124.625 129.898 45.673  1.00 44.35  ? 111  SER A O     1 
ATOM   827   C  CB    . SER A  1  112  ? 123.290 127.128 45.384  1.00 42.92  ? 111  SER A CB    1 
ATOM   828   O  OG    . SER A  1  112  ? 123.499 126.732 44.034  1.00 43.13  ? 111  SER A OG    1 
ATOM   829   N  N     . PRO A  1  113  ? 126.301 128.718 44.759  1.00 42.23  ? 112  PRO A N     1 
ATOM   830   C  CA    . PRO A  1  113  ? 126.855 129.943 44.183  1.00 42.88  ? 112  PRO A CA    1 
ATOM   831   C  C     . PRO A  1  113  ? 125.832 130.774 43.392  1.00 42.72  ? 112  PRO A C     1 
ATOM   832   O  O     . PRO A  1  113  ? 125.297 130.322 42.376  1.00 42.63  ? 112  PRO A O     1 
ATOM   833   C  CB    . PRO A  1  113  ? 128.000 129.417 43.315  1.00 41.57  ? 112  PRO A CB    1 
ATOM   834   C  CG    . PRO A  1  113  ? 127.535 128.073 42.928  1.00 40.75  ? 112  PRO A CG    1 
ATOM   835   C  CD    . PRO A  1  113  ? 127.002 127.542 44.224  1.00 42.34  ? 112  PRO A CD    1 
ATOM   836   N  N     . GLY A  1  114  ? 125.563 131.984 43.880  1.00 42.54  ? 113  GLY A N     1 
ATOM   837   C  CA    . GLY A  1  114  ? 124.621 132.871 43.219  1.00 42.86  ? 113  GLY A CA    1 
ATOM   838   C  C     . GLY A  1  114  ? 123.397 133.274 44.027  1.00 43.63  ? 113  GLY A C     1 
ATOM   839   O  O     . GLY A  1  114  ? 122.744 134.263 43.692  1.00 42.35  ? 113  GLY A O     1 
ATOM   840   N  N     . ASP A  1  115  ? 123.087 132.534 45.095  1.00 44.60  ? 114  ASP A N     1 
ATOM   841   C  CA    . ASP A  1  115  ? 121.900 132.828 45.907  1.00 45.86  ? 114  ASP A CA    1 
ATOM   842   C  C     . ASP A  1  115  ? 121.959 134.071 46.799  1.00 44.90  ? 114  ASP A C     1 
ATOM   843   O  O     . ASP A  1  115  ? 120.951 134.472 47.384  1.00 44.94  ? 114  ASP A O     1 
ATOM   844   C  CB    . ASP A  1  115  ? 121.502 131.608 46.752  1.00 46.61  ? 114  ASP A CB    1 
ATOM   845   C  CG    . ASP A  1  115  ? 122.552 131.222 47.763  1.00 47.82  ? 114  ASP A CG    1 
ATOM   846   O  OD1   . ASP A  1  115  ? 123.207 132.131 48.316  1.00 48.80  ? 114  ASP A OD1   1 
ATOM   847   O  OD2   . ASP A  1  115  ? 122.703 130.006 48.018  1.00 48.34  ? 114  ASP A OD2   1 
ATOM   848   N  N     . GLY A  1  116  ? 123.137 134.673 46.910  1.00 44.67  ? 115  GLY A N     1 
ATOM   849   C  CA    . GLY A  1  116  ? 123.269 135.882 47.701  1.00 43.14  ? 115  GLY A CA    1 
ATOM   850   C  C     . GLY A  1  116  ? 123.411 135.726 49.197  1.00 41.97  ? 115  GLY A C     1 
ATOM   851   O  O     . GLY A  1  116  ? 123.103 136.650 49.944  1.00 42.16  ? 115  GLY A O     1 
ATOM   852   N  N     . GLY A  1  117  ? 123.870 134.565 49.644  1.00 41.75  ? 116  GLY A N     1 
ATOM   853   C  CA    . GLY A  1  117  ? 124.049 134.353 51.069  1.00 40.83  ? 116  GLY A CA    1 
ATOM   854   C  C     . GLY A  1  117  ? 122.934 133.607 51.778  1.00 40.22  ? 116  GLY A C     1 
ATOM   855   O  O     . GLY A  1  117  ? 121.748 133.817 51.512  1.00 40.98  ? 116  GLY A O     1 
ATOM   856   N  N     . LYS A  1  118  ? 123.328 132.730 52.696  1.00 39.27  ? 117  LYS A N     1 
ATOM   857   C  CA    . LYS A  1  118  ? 122.384 131.939 53.469  1.00 37.69  ? 117  LYS A CA    1 
ATOM   858   C  C     . LYS A  1  118  ? 122.883 131.733 54.900  1.00 37.47  ? 117  LYS A C     1 
ATOM   859   O  O     . LYS A  1  118  ? 122.190 132.073 55.863  1.00 37.47  ? 117  LYS A O     1 
ATOM   860   C  CB    . LYS A  1  118  ? 122.174 130.573 52.813  1.00 37.15  ? 117  LYS A CB    1 
ATOM   861   C  CG    . LYS A  1  118  ? 121.604 130.615 51.412  1.00 36.31  ? 117  LYS A CG    1 
ATOM   862   C  CD    . LYS A  1  118  ? 120.164 131.080 51.395  1.00 36.65  ? 117  LYS A CD    1 
ATOM   863   C  CE    . LYS A  1  118  ? 119.594 131.015 49.981  1.00 37.42  ? 117  LYS A CE    1 
ATOM   864   N  NZ    . LYS A  1  118  ? 118.174 131.461 49.879  1.00 36.36  ? 117  LYS A NZ    1 
ATOM   865   N  N     . PHE A  1  119  ? 124.094 131.197 55.033  1.00 36.39  ? 118  PHE A N     1 
ATOM   866   C  CA    . PHE A  1  119  ? 124.657 130.904 56.344  1.00 36.81  ? 118  PHE A CA    1 
ATOM   867   C  C     . PHE A  1  119  ? 125.408 132.026 57.061  1.00 36.22  ? 118  PHE A C     1 
ATOM   868   O  O     . PHE A  1  119  ? 125.870 132.994 56.446  1.00 35.33  ? 118  PHE A O     1 
ATOM   869   C  CB    . PHE A  1  119  ? 125.567 129.678 56.247  1.00 39.10  ? 118  PHE A CB    1 
ATOM   870   C  CG    . PHE A  1  119  ? 124.996 128.575 55.418  1.00 41.50  ? 118  PHE A CG    1 
ATOM   871   C  CD1   . PHE A  1  119  ? 125.213 128.542 54.044  1.00 43.47  ? 118  PHE A CD1   1 
ATOM   872   C  CD2   . PHE A  1  119  ? 124.187 127.604 55.995  1.00 41.73  ? 118  PHE A CD2   1 
ATOM   873   C  CE1   . PHE A  1  119  ? 124.629 127.554 53.251  1.00 44.27  ? 118  PHE A CE1   1 
ATOM   874   C  CE2   . PHE A  1  119  ? 123.598 126.615 55.217  1.00 43.27  ? 118  PHE A CE2   1 
ATOM   875   C  CZ    . PHE A  1  119  ? 123.818 126.589 53.838  1.00 44.20  ? 118  PHE A CZ    1 
ATOM   876   N  N     . ALA A  1  120  ? 125.532 131.855 58.380  1.00 36.00  ? 119  ALA A N     1 
ATOM   877   C  CA    . ALA A  1  120  ? 126.207 132.802 59.265  1.00 33.56  ? 119  ALA A CA    1 
ATOM   878   C  C     . ALA A  1  120  ? 125.813 134.229 58.918  1.00 32.77  ? 119  ALA A C     1 
ATOM   879   O  O     . ALA A  1  120  ? 126.516 134.907 58.178  1.00 31.92  ? 119  ALA A O     1 
ATOM   880   C  CB    . ALA A  1  120  ? 127.715 132.628 59.162  1.00 31.78  ? 119  ALA A CB    1 
ATOM   881   N  N     . ARG A  1  121  ? 124.677 134.678 59.441  1.00 32.37  ? 120  ARG A N     1 
ATOM   882   C  CA    . ARG A  1  121  ? 124.214 136.030 59.171  1.00 32.94  ? 120  ARG A CA    1 
ATOM   883   C  C     . ARG A  1  121  ? 123.625 136.691 60.405  1.00 34.89  ? 120  ARG A C     1 
ATOM   884   O  O     . ARG A  1  121  ? 123.185 137.836 60.340  1.00 36.38  ? 120  ARG A O     1 
ATOM   885   C  CB    . ARG A  1  121  ? 123.160 136.029 58.085  1.00 30.13  ? 120  ARG A CB    1 
ATOM   886   C  CG    . ARG A  1  121  ? 123.409 135.043 56.990  1.00 30.18  ? 120  ARG A CG    1 
ATOM   887   C  CD    . ARG A  1  121  ? 122.859 135.595 55.707  1.00 30.57  ? 120  ARG A CD    1 
ATOM   888   N  NE    . ARG A  1  121  ? 121.774 136.532 55.973  1.00 29.38  ? 120  ARG A NE    1 
ATOM   889   C  CZ    . ARG A  1  121  ? 121.333 137.430 55.101  1.00 28.25  ? 120  ARG A CZ    1 
ATOM   890   N  NH1   . ARG A  1  121  ? 121.881 137.514 53.896  1.00 26.72  ? 120  ARG A NH1   1 
ATOM   891   N  NH2   . ARG A  1  121  ? 120.364 138.261 55.447  1.00 27.87  ? 120  ARG A NH2   1 
ATOM   892   N  N     . ALA A  1  122  ? 123.609 135.971 61.523  1.00 35.51  ? 121  ALA A N     1 
ATOM   893   C  CA    . ALA A  1  122  ? 123.069 136.514 62.758  1.00 36.10  ? 121  ALA A CA    1 
ATOM   894   C  C     . ALA A  1  122  ? 124.134 137.303 63.505  1.00 37.04  ? 121  ALA A C     1 
ATOM   895   O  O     . ALA A  1  122  ? 125.308 137.271 63.149  1.00 38.16  ? 121  ALA A O     1 
ATOM   896   C  CB    . ALA A  1  122  ? 122.548 135.400 63.627  1.00 35.65  ? 121  ALA A CB    1 
ATOM   897   N  N     . SER A  1  123  ? 123.713 138.006 64.549  1.00 37.75  ? 122  SER A N     1 
ATOM   898   C  CA    . SER A  1  123  ? 124.609 138.822 65.345  1.00 38.24  ? 122  SER A CA    1 
ATOM   899   C  C     . SER A  1  123  ? 125.850 138.089 65.793  1.00 39.67  ? 122  SER A C     1 
ATOM   900   O  O     . SER A  1  123  ? 125.768 136.989 66.329  1.00 40.60  ? 122  SER A O     1 
ATOM   901   C  CB    . SER A  1  123  ? 123.883 139.352 66.577  1.00 37.31  ? 122  SER A CB    1 
ATOM   902   O  OG    . SER A  1  123  ? 122.849 140.247 66.212  1.00 37.28  ? 122  SER A OG    1 
ATOM   903   N  N     . GLY A  1  124  ? 126.996 138.715 65.548  1.00 41.58  ? 123  GLY A N     1 
ATOM   904   C  CA    . GLY A  1  124  ? 128.282 138.182 65.959  1.00 44.14  ? 123  GLY A CA    1 
ATOM   905   C  C     . GLY A  1  124  ? 128.788 136.840 65.473  1.00 45.86  ? 123  GLY A C     1 
ATOM   906   O  O     . GLY A  1  124  ? 129.897 136.454 65.836  1.00 45.70  ? 123  GLY A O     1 
ATOM   907   N  N     . VAL A  1  125  ? 128.020 136.126 64.657  1.00 49.03  ? 124  VAL A N     1 
ATOM   908   C  CA    . VAL A  1  125  ? 128.476 134.813 64.189  1.00 51.90  ? 124  VAL A CA    1 
ATOM   909   C  C     . VAL A  1  125  ? 129.464 134.847 63.032  1.00 53.39  ? 124  VAL A C     1 
ATOM   910   O  O     . VAL A  1  125  ? 129.680 135.888 62.404  1.00 53.51  ? 124  VAL A O     1 
ATOM   911   C  CB    . VAL A  1  125  ? 127.292 133.896 63.780  1.00 51.71  ? 124  VAL A CB    1 
ATOM   912   C  CG1   . VAL A  1  125  ? 126.514 133.485 65.017  1.00 52.21  ? 124  VAL A CG1   1 
ATOM   913   C  CG2   . VAL A  1  125  ? 126.387 134.610 62.778  1.00 51.02  ? 124  VAL A CG2   1 
ATOM   914   N  N     . ASN A  1  126  ? 130.061 133.691 62.756  1.00 55.54  ? 125  ASN A N     1 
ATOM   915   C  CA    . ASN A  1  126  ? 131.018 133.584 61.668  1.00 57.59  ? 125  ASN A CA    1 
ATOM   916   C  C     . ASN A  1  126  ? 131.286 132.143 61.254  1.00 58.27  ? 125  ASN A C     1 
ATOM   917   O  O     . ASN A  1  126  ? 131.380 131.240 62.095  1.00 58.71  ? 125  ASN A O     1 
ATOM   918   C  CB    . ASN A  1  126  ? 132.339 134.245 62.063  1.00 58.61  ? 125  ASN A CB    1 
ATOM   919   C  CG    . ASN A  1  126  ? 133.261 133.308 62.828  1.00 59.20  ? 125  ASN A CG    1 
ATOM   920   O  OD1   . ASN A  1  126  ? 133.961 132.482 62.235  1.00 58.59  ? 125  ASN A OD1   1 
ATOM   921   N  ND2   . ASN A  1  126  ? 133.261 133.429 64.152  1.00 60.24  ? 125  ASN A ND2   1 
ATOM   922   N  N     . ALA A  1  127  ? 131.395 131.943 59.944  1.00 59.15  ? 126  ALA A N     1 
ATOM   923   C  CA    . ALA A  1  127  ? 131.698 130.640 59.375  1.00 59.59  ? 126  ALA A CA    1 
ATOM   924   C  C     . ALA A  1  127  ? 133.223 130.629 59.280  1.00 59.81  ? 126  ALA A C     1 
ATOM   925   O  O     . ALA A  1  127  ? 133.844 131.685 59.166  1.00 60.00  ? 126  ALA A O     1 
ATOM   926   C  CB    . ALA A  1  127  ? 131.071 130.520 57.993  1.00 59.02  ? 126  ALA A CB    1 
ATOM   927   N  N     . GLN A  1  128  ? 133.831 129.452 59.334  1.00 60.85  ? 127  GLN A N     1 
ATOM   928   C  CA    . GLN A  1  128  ? 135.286 129.370 59.269  1.00 63.25  ? 127  GLN A CA    1 
ATOM   929   C  C     . GLN A  1  128  ? 135.766 128.611 58.043  1.00 63.54  ? 127  GLN A C     1 
ATOM   930   O  O     . GLN A  1  128  ? 135.681 127.384 58.002  1.00 64.31  ? 127  GLN A O     1 
ATOM   931   C  CB    . GLN A  1  128  ? 135.831 128.672 60.516  1.00 63.62  ? 127  GLN A CB    1 
ATOM   932   C  CG    . GLN A  1  128  ? 137.334 128.693 60.616  1.00 64.16  ? 127  GLN A CG    1 
ATOM   933   C  CD    . GLN A  1  128  ? 137.847 130.065 60.982  1.00 66.71  ? 127  GLN A CD    1 
ATOM   934   O  OE1   . GLN A  1  128  ? 137.660 130.524 62.110  1.00 67.66  ? 127  GLN A OE1   1 
ATOM   935   N  NE2   . GLN A  1  128  ? 138.488 130.738 60.027  1.00 67.14  ? 127  GLN A NE2   1 
ATOM   936   N  N     . LEU A  1  129  ? 136.271 129.328 57.045  1.00 63.91  ? 128  LEU A N     1 
ATOM   937   C  CA    . LEU A  1  129  ? 136.769 128.662 55.850  1.00 64.59  ? 128  LEU A CA    1 
ATOM   938   C  C     . LEU A  1  129  ? 138.032 127.913 56.244  1.00 65.19  ? 128  LEU A C     1 
ATOM   939   O  O     . LEU A  1  129  ? 139.026 128.523 56.624  1.00 64.76  ? 128  LEU A O     1 
ATOM   940   C  CB    . LEU A  1  129  ? 137.078 129.675 54.751  1.00 64.02  ? 128  LEU A CB    1 
ATOM   941   C  CG    . LEU A  1  129  ? 137.581 129.067 53.440  1.00 62.82  ? 128  LEU A CG    1 
ATOM   942   C  CD1   . LEU A  1  129  ? 136.691 127.907 53.041  1.00 64.57  ? 128  LEU A CD1   1 
ATOM   943   C  CD2   . LEU A  1  129  ? 137.599 130.123 52.359  1.00 62.09  ? 128  LEU A CD2   1 
ATOM   944   N  N     . LEU A  1  130  ? 137.980 126.589 56.150  1.00 66.22  ? 129  LEU A N     1 
ATOM   945   C  CA    . LEU A  1  130  ? 139.100 125.734 56.533  1.00 67.24  ? 129  LEU A CA    1 
ATOM   946   C  C     . LEU A  1  130  ? 139.891 125.153 55.369  1.00 68.43  ? 129  LEU A C     1 
ATOM   947   O  O     . LEU A  1  130  ? 141.096 125.361 55.253  1.00 68.54  ? 129  LEU A O     1 
ATOM   948   C  CB    . LEU A  1  130  ? 138.589 124.567 57.379  1.00 66.11  ? 129  LEU A CB    1 
ATOM   949   C  CG    . LEU A  1  130  ? 137.800 124.856 58.652  1.00 66.26  ? 129  LEU A CG    1 
ATOM   950   C  CD1   . LEU A  1  130  ? 137.144 123.580 59.144  1.00 65.43  ? 129  LEU A CD1   1 
ATOM   951   C  CD2   . LEU A  1  130  ? 138.726 125.431 59.705  1.00 66.80  ? 129  LEU A CD2   1 
ATOM   952   N  N     . THR A  1  131  ? 139.196 124.414 54.513  1.00 70.03  ? 130  THR A N     1 
ATOM   953   C  CA    . THR A  1  131  ? 139.821 123.744 53.386  1.00 71.46  ? 130  THR A CA    1 
ATOM   954   C  C     . THR A  1  131  ? 139.537 124.324 52.007  1.00 73.47  ? 130  THR A C     1 
ATOM   955   O  O     . THR A  1  131  ? 138.456 124.842 51.724  1.00 73.13  ? 130  THR A O     1 
ATOM   956   C  CB    . THR A  1  131  ? 139.423 122.252 53.376  1.00 71.21  ? 130  THR A CB    1 
ATOM   957   O  OG1   . THR A  1  131  ? 139.959 121.610 54.538  1.00 71.06  ? 130  THR A OG1   1 
ATOM   958   C  CG2   . THR A  1  131  ? 139.942 121.556 52.129  1.00 71.80  ? 130  THR A CG2   1 
ATOM   959   N  N     . HIS A  1  132  ? 140.542 124.220 51.150  1.00 75.51  ? 131  HIS A N     1 
ATOM   960   C  CA    . HIS A  1  132  ? 140.442 124.683 49.786  1.00 76.70  ? 131  HIS A CA    1 
ATOM   961   C  C     . HIS A  1  132  ? 140.592 123.474 48.892  1.00 77.67  ? 131  HIS A C     1 
ATOM   962   O  O     . HIS A  1  132  ? 141.110 122.437 49.306  1.00 77.91  ? 131  HIS A O     1 
ATOM   963   C  CB    . HIS A  1  132  ? 141.537 125.692 49.479  1.00 77.60  ? 131  HIS A CB    1 
ATOM   964   C  CG    . HIS A  1  132  ? 141.010 127.048 49.147  1.00 77.89  ? 131  HIS A CG    1 
ATOM   965   N  ND1   . HIS A  1  132  ? 140.208 127.760 50.010  1.00 77.50  ? 131  HIS A ND1   1 
ATOM   966   C  CD2   . HIS A  1  132  ? 141.147 127.812 48.038  1.00 78.77  ? 131  HIS A CD2   1 
ATOM   967   C  CE1   . HIS A  1  132  ? 139.871 128.906 49.446  1.00 78.29  ? 131  HIS A CE1   1 
ATOM   968   N  NE2   . HIS A  1  132  ? 140.427 128.963 48.250  1.00 78.49  ? 131  HIS A NE2   1 
ATOM   969   N  N     . ASP A  1  133  ? 140.159 123.623 47.652  1.00 78.65  ? 132  ASP A N     1 
ATOM   970   C  CA    . ASP A  1  133  ? 140.200 122.532 46.700  1.00 78.84  ? 132  ASP A CA    1 
ATOM   971   C  C     . ASP A  1  133  ? 139.832 123.175 45.371  1.00 79.93  ? 132  ASP A C     1 
ATOM   972   O  O     . ASP A  1  133  ? 139.525 124.368 45.305  1.00 79.23  ? 132  ASP A O     1 
ATOM   973   C  CB    . ASP A  1  133  ? 139.144 121.494 47.117  1.00 77.55  ? 132  ASP A CB    1 
ATOM   974   C  CG    . ASP A  1  133  ? 139.290 120.161 46.415  1.00 74.65  ? 132  ASP A CG    1 
ATOM   975   O  OD1   . ASP A  1  133  ? 139.143 120.107 45.178  1.00 73.78  ? 132  ASP A OD1   1 
ATOM   976   O  OD2   . ASP A  1  133  ? 139.535 119.158 47.116  1.00 72.32  ? 132  ASP A OD2   1 
ATOM   977   N  N     . ARG A  1  134  ? 139.878 122.387 44.313  1.00 82.43  ? 133  ARG A N     1 
ATOM   978   C  CA    . ARG A  1  134  ? 139.524 122.878 42.994  1.00 84.31  ? 133  ARG A CA    1 
ATOM   979   C  C     . ARG A  1  134  ? 138.081 122.426 42.766  1.00 83.48  ? 133  ARG A C     1 
ATOM   980   O  O     . ARG A  1  134  ? 137.465 122.728 41.741  1.00 83.59  ? 133  ARG A O     1 
ATOM   981   C  CB    . ARG A  1  134  ? 140.459 122.258 41.945  1.00 86.86  ? 133  ARG A CB    1 
ATOM   982   C  CG    . ARG A  1  134  ? 141.939 122.530 42.201  1.00 90.29  ? 133  ARG A CG    1 
ATOM   983   C  CD    . ARG A  1  134  ? 142.839 121.753 41.242  1.00 94.39  ? 133  ARG A CD    1 
ATOM   984   N  NE    . ARG A  1  134  ? 144.245 122.157 41.352  1.00 97.53  ? 133  ARG A NE    1 
ATOM   985   C  CZ    . ARG A  1  134  ? 145.259 121.558 40.729  1.00 98.10  ? 133  ARG A CZ    1 
ATOM   986   N  NH1   . ARG A  1  134  ? 145.041 120.513 39.941  1.00 99.51  ? 133  ARG A NH1   1 
ATOM   987   N  NH2   . ARG A  1  134  ? 146.497 122.006 40.888  1.00 98.09  ? 133  ARG A NH2   1 
ATOM   988   N  N     . ASN A  1  135  ? 137.537 121.718 43.752  1.00 81.89  ? 134  ASN A N     1 
ATOM   989   C  CA    . ASN A  1  135  ? 136.188 121.196 43.635  1.00 80.50  ? 134  ASN A CA    1 
ATOM   990   C  C     . ASN A  1  135  ? 135.288 121.413 44.839  1.00 78.18  ? 134  ASN A C     1 
ATOM   991   O  O     . ASN A  1  135  ? 134.068 121.363 44.705  1.00 78.86  ? 134  ASN A O     1 
ATOM   992   C  CB    . ASN A  1  135  ? 136.249 119.698 43.349  1.00 83.17  ? 134  ASN A CB    1 
ATOM   993   C  CG    . ASN A  1  135  ? 137.264 119.354 42.283  1.00 85.37  ? 134  ASN A CG    1 
ATOM   994   O  OD1   . ASN A  1  135  ? 137.128 119.762 41.124  1.00 86.70  ? 134  ASN A OD1   1 
ATOM   995   N  ND2   . ASN A  1  135  ? 138.297 118.604 42.668  1.00 85.86  ? 134  ASN A ND2   1 
ATOM   996   N  N     . VAL A  1  136  ? 135.857 121.651 46.013  1.00 74.19  ? 135  VAL A N     1 
ATOM   997   C  CA    . VAL A  1  136  ? 134.998 121.820 47.168  1.00 71.07  ? 135  VAL A CA    1 
ATOM   998   C  C     . VAL A  1  136  ? 135.589 122.572 48.338  1.00 69.38  ? 135  VAL A C     1 
ATOM   999   O  O     . VAL A  1  136  ? 136.666 122.232 48.827  1.00 69.78  ? 135  VAL A O     1 
ATOM   1000  C  CB    . VAL A  1  136  ? 134.539 120.456 47.683  1.00 71.28  ? 135  VAL A CB    1 
ATOM   1001  C  CG1   . VAL A  1  136  ? 135.744 119.651 48.125  1.00 72.18  ? 135  VAL A CG1   1 
ATOM   1002  C  CG2   . VAL A  1  136  ? 133.569 120.629 48.835  1.00 72.17  ? 135  VAL A CG2   1 
ATOM   1003  N  N     . ALA A  1  137  ? 134.857 123.581 48.804  1.00 66.99  ? 136  ALA A N     1 
ATOM   1004  C  CA    . ALA A  1  137  ? 135.279 124.381 49.946  1.00 63.79  ? 136  ALA A CA    1 
ATOM   1005  C  C     . ALA A  1  137  ? 134.586 123.878 51.203  1.00 61.97  ? 136  ALA A C     1 
ATOM   1006  O  O     . ALA A  1  137  ? 133.359 123.841 51.276  1.00 60.97  ? 136  ALA A O     1 
ATOM   1007  C  CB    . ALA A  1  137  ? 134.943 125.839 49.721  1.00 63.00  ? 136  ALA A CB    1 
ATOM   1008  N  N     . VAL A  1  138  ? 135.390 123.480 52.183  1.00 60.74  ? 137  VAL A N     1 
ATOM   1009  C  CA    . VAL A  1  138  ? 134.888 122.984 53.458  1.00 58.73  ? 137  VAL A CA    1 
ATOM   1010  C  C     . VAL A  1  138  ? 134.837 124.103 54.488  1.00 57.99  ? 137  VAL A C     1 
ATOM   1011  O  O     . VAL A  1  138  ? 135.866 124.529 55.019  1.00 58.79  ? 137  VAL A O     1 
ATOM   1012  C  CB    . VAL A  1  138  ? 135.780 121.863 54.016  1.00 58.62  ? 137  VAL A CB    1 
ATOM   1013  C  CG1   . VAL A  1  138  ? 135.448 121.607 55.476  1.00 58.26  ? 137  VAL A CG1   1 
ATOM   1014  C  CG2   . VAL A  1  138  ? 135.575 120.600 53.212  1.00 60.04  ? 137  VAL A CG2   1 
ATOM   1015  N  N     . VAL A  1  139  ? 133.629 124.572 54.769  1.00 55.67  ? 138  VAL A N     1 
ATOM   1016  C  CA    . VAL A  1  139  ? 133.426 125.631 55.737  1.00 53.30  ? 138  VAL A CA    1 
ATOM   1017  C  C     . VAL A  1  139  ? 132.870 125.070 57.033  1.00 51.65  ? 138  VAL A C     1 
ATOM   1018  O  O     . VAL A  1  139  ? 132.015 124.192 57.006  1.00 52.31  ? 138  VAL A O     1 
ATOM   1019  C  CB    . VAL A  1  139  ? 132.439 126.658 55.194  1.00 52.59  ? 138  VAL A CB    1 
ATOM   1020  C  CG1   . VAL A  1  139  ? 131.929 127.539 56.310  1.00 52.90  ? 138  VAL A CG1   1 
ATOM   1021  C  CG2   . VAL A  1  139  ? 133.115 127.489 54.141  1.00 53.67  ? 138  VAL A CG2   1 
ATOM   1022  N  N     . LYS A  1  140  ? 133.367 125.553 58.166  1.00 50.02  ? 139  LYS A N     1 
ATOM   1023  C  CA    . LYS A  1  140  ? 132.840 125.107 59.445  1.00 49.51  ? 139  LYS A CA    1 
ATOM   1024  C  C     . LYS A  1  140  ? 131.787 126.138 59.825  1.00 48.98  ? 139  LYS A C     1 
ATOM   1025  O  O     . LYS A  1  140  ? 132.107 127.311 60.020  1.00 48.94  ? 139  LYS A O     1 
ATOM   1026  C  CB    . LYS A  1  140  ? 133.918 125.081 60.518  1.00 50.90  ? 139  LYS A CB    1 
ATOM   1027  C  CG    . LYS A  1  140  ? 133.382 124.597 61.852  1.00 52.44  ? 139  LYS A CG    1 
ATOM   1028  C  CD    . LYS A  1  140  ? 134.282 124.971 63.015  1.00 54.20  ? 139  LYS A CD    1 
ATOM   1029  C  CE    . LYS A  1  140  ? 133.687 124.474 64.327  1.00 56.73  ? 139  LYS A CE    1 
ATOM   1030  N  NZ    . LYS A  1  140  ? 134.407 124.957 65.545  1.00 59.50  ? 139  LYS A NZ    1 
ATOM   1031  N  N     . LEU A  1  141  ? 130.534 125.703 59.925  1.00 49.04  ? 140  LEU A N     1 
ATOM   1032  C  CA    . LEU A  1  141  ? 129.424 126.603 60.246  1.00 48.67  ? 140  LEU A CA    1 
ATOM   1033  C  C     . LEU A  1  141  ? 129.328 126.984 61.722  1.00 48.32  ? 140  LEU A C     1 
ATOM   1034  O  O     . LEU A  1  141  ? 129.828 126.269 62.594  1.00 48.08  ? 140  LEU A O     1 
ATOM   1035  C  CB    . LEU A  1  141  ? 128.106 125.988 59.761  1.00 47.85  ? 140  LEU A CB    1 
ATOM   1036  C  CG    . LEU A  1  141  ? 128.061 125.864 58.232  1.00 46.99  ? 140  LEU A CG    1 
ATOM   1037  C  CD1   . LEU A  1  141  ? 126.776 125.192 57.781  1.00 46.59  ? 140  LEU A CD1   1 
ATOM   1038  C  CD2   . LEU A  1  141  ? 128.193 127.256 57.621  1.00 46.11  ? 140  LEU A CD2   1 
ATOM   1039  N  N     . PRO A  1  142  ? 128.679 128.124 62.020  1.00 47.43  ? 141  PRO A N     1 
ATOM   1040  C  CA    . PRO A  1  142  ? 128.526 128.603 63.397  1.00 48.21  ? 141  PRO A CA    1 
ATOM   1041  C  C     . PRO A  1  142  ? 127.981 127.586 64.399  1.00 48.11  ? 141  PRO A C     1 
ATOM   1042  O  O     . PRO A  1  142  ? 128.065 127.798 65.609  1.00 48.74  ? 141  PRO A O     1 
ATOM   1043  C  CB    . PRO A  1  142  ? 127.640 129.843 63.242  1.00 47.10  ? 141  PRO A CB    1 
ATOM   1044  C  CG    . PRO A  1  142  ? 126.907 129.594 61.970  1.00 48.35  ? 141  PRO A CG    1 
ATOM   1045  C  CD    . PRO A  1  142  ? 127.945 128.989 61.082  1.00 47.51  ? 141  PRO A CD    1 
ATOM   1046  N  N     . SER A  1  143  ? 127.438 126.480 63.892  1.00 48.22  ? 142  SER A N     1 
ATOM   1047  C  CA    . SER A  1  143  ? 126.904 125.419 64.744  1.00 47.39  ? 142  SER A CA    1 
ATOM   1048  C  C     . SER A  1  143  ? 127.983 124.351 64.961  1.00 48.25  ? 142  SER A C     1 
ATOM   1049  O  O     . SER A  1  143  ? 127.732 123.313 65.579  1.00 47.61  ? 142  SER A O     1 
ATOM   1050  C  CB    . SER A  1  143  ? 125.683 124.770 64.090  1.00 46.01  ? 142  SER A CB    1 
ATOM   1051  O  OG    . SER A  1  143  ? 126.070 123.868 63.068  1.00 45.44  ? 142  SER A OG    1 
ATOM   1052  N  N     . GLY A  1  144  ? 129.181 124.613 64.442  1.00 48.91  ? 143  GLY A N     1 
ATOM   1053  C  CA    . GLY A  1  144  ? 130.277 123.671 64.578  1.00 49.94  ? 143  GLY A CA    1 
ATOM   1054  C  C     . GLY A  1  144  ? 130.280 122.618 63.482  1.00 51.16  ? 143  GLY A C     1 
ATOM   1055  O  O     . GLY A  1  144  ? 131.191 121.790 63.389  1.00 52.15  ? 143  GLY A O     1 
ATOM   1056  N  N     . GLU A  1  145  ? 129.255 122.641 62.641  1.00 51.66  ? 144  GLU A N     1 
ATOM   1057  C  CA    . GLU A  1  145  ? 129.157 121.675 61.563  1.00 52.59  ? 144  GLU A CA    1 
ATOM   1058  C  C     . GLU A  1  145  ? 130.107 121.966 60.406  1.00 52.56  ? 144  GLU A C     1 
ATOM   1059  O  O     . GLU A  1  145  ? 130.284 123.118 60.005  1.00 52.30  ? 144  GLU A O     1 
ATOM   1060  C  CB    . GLU A  1  145  ? 127.725 121.624 61.034  1.00 53.91  ? 144  GLU A CB    1 
ATOM   1061  C  CG    . GLU A  1  145  ? 127.613 120.953 59.674  1.00 54.40  ? 144  GLU A CG    1 
ATOM   1062  C  CD    . GLU A  1  145  ? 126.189 120.844 59.179  1.00 54.11  ? 144  GLU A CD    1 
ATOM   1063  O  OE1   . GLU A  1  145  ? 126.015 120.675 57.952  1.00 54.04  ? 144  GLU A OE1   1 
ATOM   1064  O  OE2   . GLU A  1  145  ? 125.257 120.916 60.013  1.00 53.80  ? 144  GLU A OE2   1 
ATOM   1065  N  N     . MET A  1  146  ? 130.710 120.903 59.878  1.00 52.38  ? 145  MET A N     1 
ATOM   1066  C  CA    . MET A  1  146  ? 131.629 120.989 58.747  1.00 51.45  ? 145  MET A CA    1 
ATOM   1067  C  C     . MET A  1  146  ? 130.780 120.827 57.503  1.00 50.24  ? 145  MET A C     1 
ATOM   1068  O  O     . MET A  1  146  ? 130.364 119.719 57.179  1.00 50.57  ? 145  MET A O     1 
ATOM   1069  C  CB    . MET A  1  146  ? 132.642 119.856 58.808  1.00 52.70  ? 145  MET A CB    1 
ATOM   1070  C  CG    . MET A  1  146  ? 133.408 119.790 60.111  1.00 55.76  ? 145  MET A CG    1 
ATOM   1071  S  SD    . MET A  1  146  ? 134.688 121.052 60.240  1.00 59.72  ? 145  MET A SD    1 
ATOM   1072  C  CE    . MET A  1  146  ? 136.203 120.011 60.048  1.00 59.75  ? 145  MET A CE    1 
ATOM   1073  N  N     . LYS A  1  147  ? 130.520 121.933 56.818  1.00 49.03  ? 146  LYS A N     1 
ATOM   1074  C  CA    . LYS A  1  147  ? 129.698 121.927 55.610  1.00 49.48  ? 146  LYS A CA    1 
ATOM   1075  C  C     . LYS A  1  147  ? 130.556 122.036 54.363  1.00 49.17  ? 146  LYS A C     1 
ATOM   1076  O  O     . LYS A  1  147  ? 131.456 122.866 54.303  1.00 50.65  ? 146  LYS A O     1 
ATOM   1077  C  CB    . LYS A  1  147  ? 128.731 123.107 55.648  1.00 50.35  ? 146  LYS A CB    1 
ATOM   1078  C  CG    . LYS A  1  147  ? 127.863 123.258 54.425  1.00 49.12  ? 146  LYS A CG    1 
ATOM   1079  C  CD    . LYS A  1  147  ? 126.474 122.739 54.713  1.00 49.98  ? 146  LYS A CD    1 
ATOM   1080  C  CE    . LYS A  1  147  ? 125.539 123.032 53.560  1.00 50.08  ? 146  LYS A CE    1 
ATOM   1081  N  NZ    . LYS A  1  147  ? 124.160 122.634 53.891  1.00 47.76  ? 146  LYS A NZ    1 
ATOM   1082  N  N     . ARG A  1  148  ? 130.277 121.208 53.365  1.00 49.57  ? 147  ARG A N     1 
ATOM   1083  C  CA    . ARG A  1  148  ? 131.048 121.247 52.128  1.00 51.22  ? 147  ARG A CA    1 
ATOM   1084  C  C     . ARG A  1  148  ? 130.328 122.115 51.103  1.00 50.72  ? 147  ARG A C     1 
ATOM   1085  O  O     . ARG A  1  148  ? 129.138 121.933 50.853  1.00 51.32  ? 147  ARG A O     1 
ATOM   1086  C  CB    . ARG A  1  148  ? 131.261 119.825 51.604  1.00 52.12  ? 147  ARG A CB    1 
ATOM   1087  C  CG    . ARG A  1  148  ? 132.286 119.046 52.422  1.00 55.59  ? 147  ARG A CG    1 
ATOM   1088  C  CD    . ARG A  1  148  ? 132.234 117.547 52.167  1.00 58.93  ? 147  ARG A CD    1 
ATOM   1089  N  NE    . ARG A  1  148  ? 133.539 116.990 51.805  1.00 61.00  ? 147  ARG A NE    1 
ATOM   1090  C  CZ    . ARG A  1  148  ? 134.022 116.956 50.565  1.00 62.27  ? 147  ARG A CZ    1 
ATOM   1091  N  NH1   . ARG A  1  148  ? 133.310 117.447 49.554  1.00 61.96  ? 147  ARG A NH1   1 
ATOM   1092  N  NH2   . ARG A  1  148  ? 135.217 116.428 50.331  1.00 63.76  ? 147  ARG A NH2   1 
ATOM   1093  N  N     . LEU A  1  149  ? 131.048 123.063 50.511  1.00 50.37  ? 148  LEU A N     1 
ATOM   1094  C  CA    . LEU A  1  149  ? 130.426 123.968 49.552  1.00 51.28  ? 148  LEU A CA    1 
ATOM   1095  C  C     . LEU A  1  149  ? 131.152 124.130 48.234  1.00 50.62  ? 148  LEU A C     1 
ATOM   1096  O  O     . LEU A  1  149  ? 132.369 123.978 48.159  1.00 50.72  ? 148  LEU A O     1 
ATOM   1097  C  CB    . LEU A  1  149  ? 130.267 125.350 50.182  1.00 52.32  ? 148  LEU A CB    1 
ATOM   1098  C  CG    . LEU A  1  149  ? 129.357 125.441 51.407  1.00 53.79  ? 148  LEU A CG    1 
ATOM   1099  C  CD1   . LEU A  1  149  ? 129.498 126.820 52.037  1.00 53.57  ? 148  LEU A CD1   1 
ATOM   1100  C  CD2   . LEU A  1  149  ? 127.913 125.157 50.996  1.00 53.81  ? 148  LEU A CD2   1 
ATOM   1101  N  N     . ASP A  1  150  ? 130.389 124.443 47.193  1.00 49.74  ? 149  ASP A N     1 
ATOM   1102  C  CA    . ASP A  1  150  ? 130.965 124.677 45.881  1.00 49.28  ? 149  ASP A CA    1 
ATOM   1103  C  C     . ASP A  1  150  ? 131.898 125.842 46.152  1.00 49.03  ? 149  ASP A C     1 
ATOM   1104  O  O     . ASP A  1  150  ? 131.470 126.859 46.702  1.00 49.61  ? 149  ASP A O     1 
ATOM   1105  C  CB    . ASP A  1  150  ? 129.881 125.117 44.891  1.00 50.55  ? 149  ASP A CB    1 
ATOM   1106  C  CG    . ASP A  1  150  ? 130.442 125.504 43.524  1.00 51.54  ? 149  ASP A CG    1 
ATOM   1107  O  OD1   . ASP A  1  150  ? 131.594 125.982 43.452  1.00 53.45  ? 149  ASP A OD1   1 
ATOM   1108  O  OD2   . ASP A  1  150  ? 129.721 125.351 42.515  1.00 51.88  ? 149  ASP A OD2   1 
ATOM   1109  N  N     . PRO A  1  151  ? 133.190 125.705 45.810  1.00 47.26  ? 150  PRO A N     1 
ATOM   1110  C  CA    . PRO A  1  151  ? 134.111 126.818 46.057  1.00 46.34  ? 150  PRO A CA    1 
ATOM   1111  C  C     . PRO A  1  151  ? 133.739 128.118 45.340  1.00 45.13  ? 150  PRO A C     1 
ATOM   1112  O  O     . PRO A  1  151  ? 134.304 129.169 45.610  1.00 43.93  ? 150  PRO A O     1 
ATOM   1113  C  CB    . PRO A  1  151  ? 135.473 126.247 45.637  1.00 45.89  ? 150  PRO A CB    1 
ATOM   1114  C  CG    . PRO A  1  151  ? 135.136 125.031 44.815  1.00 45.00  ? 150  PRO A CG    1 
ATOM   1115  C  CD    . PRO A  1  151  ? 133.928 124.478 45.476  1.00 45.79  ? 150  PRO A CD    1 
ATOM   1116  N  N     . GLN A  1  152  ? 132.767 128.043 44.444  1.00 46.59  ? 151  GLN A N     1 
ATOM   1117  C  CA    . GLN A  1  152  ? 132.315 129.219 43.716  1.00 51.06  ? 151  GLN A CA    1 
ATOM   1118  C  C     . GLN A  1  152  ? 131.289 130.016 44.529  1.00 52.17  ? 151  GLN A C     1 
ATOM   1119  O  O     . GLN A  1  152  ? 130.744 131.014 44.056  1.00 51.36  ? 151  GLN A O     1 
ATOM   1120  C  CB    . GLN A  1  152  ? 131.704 128.801 42.377  1.00 53.29  ? 151  GLN A CB    1 
ATOM   1121  C  CG    . GLN A  1  152  ? 132.095 129.712 41.233  1.00 56.24  ? 151  GLN A CG    1 
ATOM   1122  C  CD    . GLN A  1  152  ? 133.599 129.941 41.194  1.00 58.78  ? 151  GLN A CD    1 
ATOM   1123  O  OE1   . GLN A  1  152  ? 134.381 128.988 41.199  1.00 60.25  ? 151  GLN A OE1   1 
ATOM   1124  N  NE2   . GLN A  1  152  ? 134.011 131.208 41.160  1.00 59.59  ? 151  GLN A NE2   1 
ATOM   1125  N  N     . CYS A  1  153  ? 131.033 129.560 45.754  1.00 55.02  ? 152  CYS A N     1 
ATOM   1126  C  CA    . CYS A  1  153  ? 130.086 130.209 46.659  1.00 57.07  ? 152  CYS A CA    1 
ATOM   1127  C  C     . CYS A  1  153  ? 130.689 131.448 47.312  1.00 58.12  ? 152  CYS A C     1 
ATOM   1128  O  O     . CYS A  1  153  ? 131.626 131.356 48.114  1.00 57.14  ? 152  CYS A O     1 
ATOM   1129  C  CB    . CYS A  1  153  ? 129.637 129.235 47.752  1.00 57.21  ? 152  CYS A CB    1 
ATOM   1130  S  SG    . CYS A  1  153  ? 128.341 128.084 47.259  1.00 58.97  ? 152  CYS A SG    1 
ATOM   1131  N  N     . ARG A  1  154  ? 130.132 132.606 46.972  1.00 60.28  ? 153  ARG A N     1 
ATOM   1132  C  CA    . ARG A  1  154  ? 130.601 133.876 47.505  1.00 62.80  ? 153  ARG A CA    1 
ATOM   1133  C  C     . ARG A  1  154  ? 130.240 134.102 48.973  1.00 61.80  ? 153  ARG A C     1 
ATOM   1134  O  O     . ARG A  1  154  ? 129.216 133.621 49.457  1.00 61.93  ? 153  ARG A O     1 
ATOM   1135  C  CB    . ARG A  1  154  ? 130.038 135.024 46.673  1.00 65.30  ? 153  ARG A CB    1 
ATOM   1136  C  CG    . ARG A  1  154  ? 130.447 135.000 45.212  1.00 71.02  ? 153  ARG A CG    1 
ATOM   1137  C  CD    . ARG A  1  154  ? 130.254 136.376 44.572  1.00 76.34  ? 153  ARG A CD    1 
ATOM   1138  N  NE    . ARG A  1  154  ? 128.948 136.562 43.937  1.00 80.68  ? 153  ARG A NE    1 
ATOM   1139  C  CZ    . ARG A  1  154  ? 127.772 136.388 44.537  1.00 82.69  ? 153  ARG A CZ    1 
ATOM   1140  N  NH1   . ARG A  1  154  ? 127.712 136.014 45.808  1.00 84.14  ? 153  ARG A NH1   1 
ATOM   1141  N  NH2   . ARG A  1  154  ? 126.647 136.593 43.863  1.00 84.26  ? 153  ARG A NH2   1 
ATOM   1142  N  N     . ALA A  1  155  ? 131.087 134.845 49.676  1.00 60.01  ? 154  ALA A N     1 
ATOM   1143  C  CA    . ALA A  1  155  ? 130.844 135.151 51.081  1.00 58.16  ? 154  ALA A CA    1 
ATOM   1144  C  C     . ALA A  1  155  ? 131.661 136.381 51.494  1.00 56.81  ? 154  ALA A C     1 
ATOM   1145  O  O     . ALA A  1  155  ? 132.489 136.862 50.717  1.00 56.93  ? 154  ALA A O     1 
ATOM   1146  C  CB    . ALA A  1  155  ? 131.198 133.948 51.941  1.00 57.24  ? 154  ALA A CB    1 
ATOM   1147  N  N     . THR A  1  156  ? 131.422 136.889 52.704  1.00 54.69  ? 155  THR A N     1 
ATOM   1148  C  CA    . THR A  1  156  ? 132.127 138.071 53.206  1.00 52.01  ? 155  THR A CA    1 
ATOM   1149  C  C     . THR A  1  156  ? 133.120 137.814 54.346  1.00 52.24  ? 155  THR A C     1 
ATOM   1150  O  O     . THR A  1  156  ? 132.894 136.976 55.224  1.00 52.15  ? 155  THR A O     1 
ATOM   1151  C  CB    . THR A  1  156  ? 131.134 139.127 53.665  1.00 50.74  ? 155  THR A CB    1 
ATOM   1152  O  OG1   . THR A  1  156  ? 130.405 139.602 52.529  1.00 49.41  ? 155  THR A OG1   1 
ATOM   1153  C  CG2   . THR A  1  156  ? 131.854 140.284 54.334  1.00 50.59  ? 155  THR A CG2   1 
ATOM   1154  N  N     . ILE A  1  157  ? 134.218 138.562 54.335  1.00 51.52  ? 156  ILE A N     1 
ATOM   1155  C  CA    . ILE A  1  157  ? 135.247 138.400 55.348  1.00 51.21  ? 156  ILE A CA    1 
ATOM   1156  C  C     . ILE A  1  157  ? 134.934 139.153 56.629  1.00 51.52  ? 156  ILE A C     1 
ATOM   1157  O  O     . ILE A  1  157  ? 134.379 140.250 56.604  1.00 51.35  ? 156  ILE A O     1 
ATOM   1158  C  CB    . ILE A  1  157  ? 136.597 138.852 54.816  1.00 50.28  ? 156  ILE A CB    1 
ATOM   1159  C  CG1   . ILE A  1  157  ? 136.879 138.143 53.489  1.00 50.33  ? 156  ILE A CG1   1 
ATOM   1160  C  CG2   . ILE A  1  157  ? 137.673 138.532 55.826  1.00 49.08  ? 156  ILE A CG2   1 
ATOM   1161  C  CD1   . ILE A  1  157  ? 137.990 138.766 52.678  1.00 50.06  ? 156  ILE A CD1   1 
ATOM   1162  N  N     . GLY A  1  158  ? 135.311 138.548 57.749  1.00 51.49  ? 157  GLY A N     1 
ATOM   1163  C  CA    . GLY A  1  158  ? 135.046 139.136 59.043  1.00 52.15  ? 157  GLY A CA    1 
ATOM   1164  C  C     . GLY A  1  158  ? 133.917 138.343 59.670  1.00 52.68  ? 157  GLY A C     1 
ATOM   1165  O  O     . GLY A  1  158  ? 133.559 137.284 59.169  1.00 53.24  ? 157  GLY A O     1 
ATOM   1166  N  N     . VAL A  1  159  ? 133.360 138.842 60.765  1.00 53.18  ? 158  VAL A N     1 
ATOM   1167  C  CA    . VAL A  1  159  ? 132.256 138.171 61.440  1.00 52.30  ? 158  VAL A CA    1 
ATOM   1168  C  C     . VAL A  1  159  ? 131.094 139.156 61.463  1.00 51.96  ? 158  VAL A C     1 
ATOM   1169  O  O     . VAL A  1  159  ? 131.312 140.365 61.368  1.00 52.59  ? 158  VAL A O     1 
ATOM   1170  C  CB    . VAL A  1  159  ? 132.640 137.791 62.877  1.00 52.53  ? 158  VAL A CB    1 
ATOM   1171  C  CG1   . VAL A  1  159  ? 133.896 136.953 62.857  1.00 52.80  ? 158  VAL A CG1   1 
ATOM   1172  C  CG2   . VAL A  1  159  ? 132.865 139.040 63.712  1.00 53.43  ? 158  VAL A CG2   1 
ATOM   1173  N  N     . VAL A  1  160  ? 129.868 138.652 61.592  1.00 51.04  ? 159  VAL A N     1 
ATOM   1174  C  CA    . VAL A  1  160  ? 128.683 139.520 61.600  1.00 49.55  ? 159  VAL A CA    1 
ATOM   1175  C  C     . VAL A  1  160  ? 128.675 140.531 62.747  1.00 47.99  ? 159  VAL A C     1 
ATOM   1176  O  O     . VAL A  1  160  ? 128.996 140.202 63.886  1.00 47.77  ? 159  VAL A O     1 
ATOM   1177  C  CB    . VAL A  1  160  ? 127.383 138.688 61.658  1.00 49.09  ? 159  VAL A CB    1 
ATOM   1178  C  CG1   . VAL A  1  160  ? 126.185 139.566 61.345  1.00 47.51  ? 159  VAL A CG1   1 
ATOM   1179  C  CG2   . VAL A  1  160  ? 127.465 137.539 60.674  1.00 49.66  ? 159  VAL A CG2   1 
ATOM   1180  N  N     . ALA A  1  161  ? 128.302 141.767 62.437  1.00 46.22  ? 160  ALA A N     1 
ATOM   1181  C  CA    . ALA A  1  161  ? 128.264 142.823 63.440  1.00 45.24  ? 160  ALA A CA    1 
ATOM   1182  C  C     . ALA A  1  161  ? 127.319 142.506 64.602  1.00 44.94  ? 160  ALA A C     1 
ATOM   1183  O  O     . ALA A  1  161  ? 126.500 141.590 64.523  1.00 45.35  ? 160  ALA A O     1 
ATOM   1184  C  CB    . ALA A  1  161  ? 127.853 144.143 62.783  1.00 44.30  ? 160  ALA A CB    1 
ATOM   1185  N  N     . GLY A  1  162  ? 127.455 143.265 65.685  1.00 43.81  ? 161  GLY A N     1 
ATOM   1186  C  CA    . GLY A  1  162  ? 126.587 143.094 66.834  1.00 41.80  ? 161  GLY A CA    1 
ATOM   1187  C  C     . GLY A  1  162  ? 126.897 141.957 67.779  1.00 41.18  ? 161  GLY A C     1 
ATOM   1188  O  O     . GLY A  1  162  ? 126.024 141.528 68.528  1.00 41.54  ? 161  GLY A O     1 
ATOM   1189  N  N     . GLY A  1  163  ? 128.130 141.466 67.754  1.00 40.97  ? 162  GLY A N     1 
ATOM   1190  C  CA    . GLY A  1  163  ? 128.497 140.379 68.641  1.00 39.25  ? 162  GLY A CA    1 
ATOM   1191  C  C     . GLY A  1  163  ? 128.100 140.629 70.089  1.00 38.80  ? 162  GLY A C     1 
ATOM   1192  O  O     . GLY A  1  163  ? 128.072 141.775 70.541  1.00 38.22  ? 162  GLY A O     1 
ATOM   1193  N  N     . GLY A  1  164  ? 127.771 139.548 70.799  1.00 38.69  ? 163  GLY A N     1 
ATOM   1194  C  CA    . GLY A  1  164  ? 127.396 139.617 72.202  1.00 38.23  ? 163  GLY A CA    1 
ATOM   1195  C  C     . GLY A  1  164  ? 125.980 140.012 72.580  1.00 37.81  ? 163  GLY A C     1 
ATOM   1196  O  O     . GLY A  1  164  ? 125.643 140.077 73.765  1.00 35.79  ? 163  GLY A O     1 
ATOM   1197  N  N     . ARG A  1  165  ? 125.141 140.263 71.583  1.00 39.59  ? 164  ARG A N     1 
ATOM   1198  C  CA    . ARG A  1  165  ? 123.764 140.682 71.830  1.00 41.80  ? 164  ARG A CA    1 
ATOM   1199  C  C     . ARG A  1  165  ? 123.036 139.783 72.830  1.00 42.24  ? 164  ARG A C     1 
ATOM   1200  O  O     . ARG A  1  165  ? 122.100 140.202 73.518  1.00 42.52  ? 164  ARG A O     1 
ATOM   1201  C  CB    . ARG A  1  165  ? 122.990 140.707 70.514  1.00 41.34  ? 164  ARG A CB    1 
ATOM   1202  C  CG    . ARG A  1  165  ? 121.563 141.185 70.658  1.00 41.95  ? 164  ARG A CG    1 
ATOM   1203  C  CD    . ARG A  1  165  ? 120.764 140.778 69.448  1.00 43.17  ? 164  ARG A CD    1 
ATOM   1204  N  NE    . ARG A  1  165  ? 120.915 139.346 69.247  1.00 45.56  ? 164  ARG A NE    1 
ATOM   1205  C  CZ    . ARG A  1  165  ? 120.443 138.680 68.207  1.00 46.55  ? 164  ARG A CZ    1 
ATOM   1206  N  NH1   . ARG A  1  165  ? 119.775 139.320 67.258  1.00 49.43  ? 164  ARG A NH1   1 
ATOM   1207  N  NH2   . ARG A  1  165  ? 120.661 137.376 68.108  1.00 47.48  ? 164  ARG A NH2   1 
ATOM   1208  N  N     . THR A  1  166  ? 123.494 138.545 72.903  1.00 42.14  ? 165  THR A N     1 
ATOM   1209  C  CA    . THR A  1  166  ? 122.912 137.543 73.772  1.00 41.44  ? 165  THR A CA    1 
ATOM   1210  C  C     . THR A  1  166  ? 123.430 137.597 75.217  1.00 42.05  ? 165  THR A C     1 
ATOM   1211  O  O     . THR A  1  166  ? 122.875 136.951 76.106  1.00 41.57  ? 165  THR A O     1 
ATOM   1212  C  CB    . THR A  1  166  ? 123.161 136.152 73.126  1.00 41.01  ? 165  THR A CB    1 
ATOM   1213  O  OG1   . THR A  1  166  ? 122.108 135.885 72.194  1.00 39.74  ? 165  THR A OG1   1 
ATOM   1214  C  CG2   . THR A  1  166  ? 123.249 135.035 74.159  1.00 41.95  ? 165  THR A CG2   1 
ATOM   1215  N  N     . ASP A  1  167  ? 124.464 138.393 75.461  1.00 42.39  ? 166  ASP A N     1 
ATOM   1216  C  CA    . ASP A  1  167  ? 125.049 138.469 76.798  1.00 43.69  ? 166  ASP A CA    1 
ATOM   1217  C  C     . ASP A  1  167  ? 124.234 139.204 77.845  1.00 42.93  ? 166  ASP A C     1 
ATOM   1218  O  O     . ASP A  1  167  ? 124.367 138.950 79.040  1.00 42.85  ? 166  ASP A O     1 
ATOM   1219  C  CB    . ASP A  1  167  ? 126.421 139.127 76.735  1.00 47.22  ? 166  ASP A CB    1 
ATOM   1220  C  CG    . ASP A  1  167  ? 127.276 138.573 75.634  1.00 49.74  ? 166  ASP A CG    1 
ATOM   1221  O  OD1   . ASP A  1  167  ? 127.445 137.335 75.563  1.00 50.41  ? 166  ASP A OD1   1 
ATOM   1222  O  OD2   . ASP A  1  167  ? 127.784 139.388 74.841  1.00 51.63  ? 166  ASP A OD2   1 
ATOM   1223  N  N     . LYS A  1  168  ? 123.401 140.127 77.406  1.00 41.99  ? 167  LYS A N     1 
ATOM   1224  C  CA    . LYS A  1  168  ? 122.615 140.895 78.342  1.00 42.09  ? 167  LYS A CA    1 
ATOM   1225  C  C     . LYS A  1  168  ? 121.238 140.274 78.470  1.00 40.25  ? 167  LYS A C     1 
ATOM   1226  O  O     . LYS A  1  168  ? 120.570 140.038 77.466  1.00 39.91  ? 167  LYS A O     1 
ATOM   1227  C  CB    . LYS A  1  168  ? 122.514 142.334 77.835  1.00 46.57  ? 167  LYS A CB    1 
ATOM   1228  C  CG    . LYS A  1  168  ? 121.938 143.361 78.811  1.00 50.84  ? 167  LYS A CG    1 
ATOM   1229  C  CD    . LYS A  1  168  ? 121.736 144.703 78.102  1.00 52.95  ? 167  LYS A CD    1 
ATOM   1230  C  CE    . LYS A  1  168  ? 121.003 145.701 78.976  1.00 55.75  ? 167  LYS A CE    1 
ATOM   1231  N  NZ    . LYS A  1  168  ? 120.378 146.791 78.165  1.00 57.76  ? 167  LYS A NZ    1 
ATOM   1232  N  N     . PRO A  1  169  ? 120.800 139.982 79.707  1.00 37.69  ? 168  PRO A N     1 
ATOM   1233  C  CA    . PRO A  1  169  ? 119.481 139.387 79.935  1.00 37.62  ? 168  PRO A CA    1 
ATOM   1234  C  C     . PRO A  1  169  ? 118.384 140.387 79.602  1.00 37.31  ? 168  PRO A C     1 
ATOM   1235  O  O     . PRO A  1  169  ? 118.618 141.597 79.626  1.00 38.50  ? 168  PRO A O     1 
ATOM   1236  C  CB    . PRO A  1  169  ? 119.513 139.050 81.419  1.00 35.98  ? 168  PRO A CB    1 
ATOM   1237  C  CG    . PRO A  1  169  ? 120.392 140.109 81.979  1.00 35.87  ? 168  PRO A CG    1 
ATOM   1238  C  CD    . PRO A  1  169  ? 121.519 140.150 80.980  1.00 37.28  ? 168  PRO A CD    1 
ATOM   1239  N  N     . PHE A  1  170  ? 117.196 139.889 79.274  1.00 36.65  ? 169  PHE A N     1 
ATOM   1240  C  CA    . PHE A  1  170  ? 116.074 140.769 78.958  1.00 36.19  ? 169  PHE A CA    1 
ATOM   1241  C  C     . PHE A  1  170  ? 115.558 141.432 80.228  1.00 35.42  ? 169  PHE A C     1 
ATOM   1242  O  O     . PHE A  1  170  ? 114.926 142.485 80.185  1.00 34.01  ? 169  PHE A O     1 
ATOM   1243  C  CB    . PHE A  1  170  ? 114.938 139.977 78.329  1.00 36.13  ? 169  PHE A CB    1 
ATOM   1244  C  CG    . PHE A  1  170  ? 115.076 139.787 76.857  1.00 37.36  ? 169  PHE A CG    1 
ATOM   1245  C  CD1   . PHE A  1  170  ? 115.414 138.548 76.329  1.00 38.77  ? 169  PHE A CD1   1 
ATOM   1246  C  CD2   . PHE A  1  170  ? 114.832 140.844 75.988  1.00 37.15  ? 169  PHE A CD2   1 
ATOM   1247  C  CE1   . PHE A  1  170  ? 115.496 138.360 74.945  1.00 39.27  ? 169  PHE A CE1   1 
ATOM   1248  C  CE2   . PHE A  1  170  ? 114.911 140.669 74.605  1.00 38.06  ? 169  PHE A CE2   1 
ATOM   1249  C  CZ    . PHE A  1  170  ? 115.245 139.424 74.082  1.00 38.64  ? 169  PHE A CZ    1 
ATOM   1250  N  N     . VAL A  1  171  ? 115.839 140.793 81.359  1.00 34.83  ? 170  VAL A N     1 
ATOM   1251  C  CA    . VAL A  1  171  ? 115.408 141.270 82.664  1.00 33.67  ? 170  VAL A CA    1 
ATOM   1252  C  C     . VAL A  1  171  ? 113.894 141.289 82.779  1.00 32.41  ? 170  VAL A C     1 
ATOM   1253  O  O     . VAL A  1  171  ? 113.335 140.710 83.708  1.00 30.69  ? 170  VAL A O     1 
ATOM   1254  C  CB    . VAL A  1  171  ? 115.912 142.683 82.962  1.00 33.71  ? 170  VAL A CB    1 
ATOM   1255  C  CG1   . VAL A  1  171  ? 115.641 143.023 84.423  1.00 33.67  ? 170  VAL A CG1   1 
ATOM   1256  C  CG2   . VAL A  1  171  ? 117.385 142.779 82.660  1.00 34.92  ? 170  VAL A CG2   1 
ATOM   1257  N  N     . LYS A  1  172  ? 113.224 141.943 81.836  1.00 31.42  ? 171  LYS A N     1 
ATOM   1258  C  CA    . LYS A  1  172  ? 111.774 142.012 81.911  1.00 32.21  ? 171  LYS A CA    1 
ATOM   1259  C  C     . LYS A  1  172  ? 110.946 141.712 80.666  1.00 32.76  ? 171  LYS A C     1 
ATOM   1260  O  O     . LYS A  1  172  ? 111.366 141.953 79.529  1.00 32.28  ? 171  LYS A O     1 
ATOM   1261  C  CB    . LYS A  1  172  ? 111.365 143.363 82.486  1.00 30.92  ? 171  LYS A CB    1 
ATOM   1262  C  CG    . LYS A  1  172  ? 112.370 144.459 82.268  1.00 28.31  ? 171  LYS A CG    1 
ATOM   1263  C  CD    . LYS A  1  172  ? 111.840 145.738 82.832  1.00 25.67  ? 171  LYS A CD    1 
ATOM   1264  C  CE    . LYS A  1  172  ? 112.238 146.884 81.961  1.00 26.95  ? 171  LYS A CE    1 
ATOM   1265  N  NZ    . LYS A  1  172  ? 111.168 147.898 81.968  1.00 29.25  ? 171  LYS A NZ    1 
ATOM   1266  N  N     . ALA A  1  173  ? 109.754 141.177 80.920  1.00 32.88  ? 172  ALA A N     1 
ATOM   1267  C  CA    . ALA A  1  173  ? 108.813 140.809 79.880  1.00 33.35  ? 172  ALA A CA    1 
ATOM   1268  C  C     . ALA A  1  173  ? 108.713 141.925 78.850  1.00 34.44  ? 172  ALA A C     1 
ATOM   1269  O  O     . ALA A  1  173  ? 108.889 141.708 77.647  1.00 32.84  ? 172  ALA A O     1 
ATOM   1270  C  CB    . ALA A  1  173  ? 107.461 140.537 80.498  1.00 32.16  ? 172  ALA A CB    1 
ATOM   1271  N  N     . GLY A  1  174  ? 108.442 143.128 79.332  1.00 36.13  ? 173  GLY A N     1 
ATOM   1272  C  CA    . GLY A  1  174  ? 108.333 144.255 78.434  1.00 38.92  ? 173  GLY A CA    1 
ATOM   1273  C  C     . GLY A  1  174  ? 109.430 144.275 77.380  1.00 40.48  ? 173  GLY A C     1 
ATOM   1274  O  O     . GLY A  1  174  ? 109.169 144.569 76.212  1.00 41.31  ? 173  GLY A O     1 
ATOM   1275  N  N     . ASN A  1  175  ? 110.662 143.962 77.769  1.00 40.57  ? 174  ASN A N     1 
ATOM   1276  C  CA    . ASN A  1  175  ? 111.743 143.983 76.797  1.00 40.14  ? 174  ASN A CA    1 
ATOM   1277  C  C     . ASN A  1  175  ? 111.539 142.890 75.773  1.00 38.41  ? 174  ASN A C     1 
ATOM   1278  O  O     . ASN A  1  175  ? 111.663 143.127 74.570  1.00 38.67  ? 174  ASN A O     1 
ATOM   1279  C  CB    . ASN A  1  175  ? 113.094 143.807 77.477  1.00 41.91  ? 174  ASN A CB    1 
ATOM   1280  C  CG    . ASN A  1  175  ? 113.388 144.908 78.462  1.00 43.80  ? 174  ASN A CG    1 
ATOM   1281  O  OD1   . ASN A  1  175  ? 113.023 146.067 78.250  1.00 44.77  ? 174  ASN A OD1   1 
ATOM   1282  N  ND2   . ASN A  1  175  ? 114.066 144.559 79.545  1.00 45.99  ? 174  ASN A ND2   1 
ATOM   1283  N  N     . LYS A  1  176  ? 111.222 141.692 76.251  1.00 35.50  ? 175  LYS A N     1 
ATOM   1284  C  CA    . LYS A  1  176  ? 110.996 140.578 75.349  1.00 32.06  ? 175  LYS A CA    1 
ATOM   1285  C  C     . LYS A  1  176  ? 109.902 141.033 74.424  1.00 30.19  ? 175  LYS A C     1 
ATOM   1286  O  O     . LYS A  1  176  ? 110.000 140.925 73.206  1.00 29.35  ? 175  LYS A O     1 
ATOM   1287  C  CB    . LYS A  1  176  ? 110.534 139.360 76.131  1.00 30.53  ? 175  LYS A CB    1 
ATOM   1288  C  CG    . LYS A  1  176  ? 111.312 138.111 75.830  1.00 30.19  ? 175  LYS A CG    1 
ATOM   1289  C  CD    . LYS A  1  176  ? 110.986 137.564 74.471  1.00 30.18  ? 175  LYS A CD    1 
ATOM   1290  C  CE    . LYS A  1  176  ? 111.870 136.367 74.200  1.00 31.97  ? 175  LYS A CE    1 
ATOM   1291  N  NZ    . LYS A  1  176  ? 111.946 135.471 75.384  1.00 31.25  ? 175  LYS A NZ    1 
ATOM   1292  N  N     . HIS A  1  177  ? 108.865 141.573 75.041  1.00 29.28  ? 176  HIS A N     1 
ATOM   1293  C  CA    . HIS A  1  177  ? 107.701 142.064 74.338  1.00 29.59  ? 176  HIS A CA    1 
ATOM   1294  C  C     . HIS A  1  177  ? 108.056 142.890 73.112  1.00 30.97  ? 176  HIS A C     1 
ATOM   1295  O  O     . HIS A  1  177  ? 107.543 142.651 72.015  1.00 30.68  ? 176  HIS A O     1 
ATOM   1296  C  CB    . HIS A  1  177  ? 106.866 142.903 75.291  1.00 27.03  ? 176  HIS A CB    1 
ATOM   1297  C  CG    . HIS A  1  177  ? 105.824 143.722 74.609  1.00 25.88  ? 176  HIS A CG    1 
ATOM   1298  N  ND1   . HIS A  1  177  ? 104.590 143.219 74.268  1.00 26.42  ? 176  HIS A ND1   1 
ATOM   1299  C  CD2   . HIS A  1  177  ? 105.838 145.006 74.185  1.00 25.81  ? 176  HIS A CD2   1 
ATOM   1300  C  CE1   . HIS A  1  177  ? 103.886 144.160 73.666  1.00 26.62  ? 176  HIS A CE1   1 
ATOM   1301  N  NE2   . HIS A  1  177  ? 104.620 145.254 73.602  1.00 26.56  ? 176  HIS A NE2   1 
ATOM   1302  N  N     . HIS A  1  178  ? 108.931 143.869 73.312  1.00 33.54  ? 177  HIS A N     1 
ATOM   1303  C  CA    . HIS A  1  178  ? 109.342 144.757 72.235  1.00 35.67  ? 177  HIS A CA    1 
ATOM   1304  C  C     . HIS A  1  178  ? 110.136 144.031 71.163  1.00 36.38  ? 177  HIS A C     1 
ATOM   1305  O  O     . HIS A  1  178  ? 109.909 144.242 69.974  1.00 37.66  ? 177  HIS A O     1 
ATOM   1306  C  CB    . HIS A  1  178  ? 110.144 145.939 72.793  1.00 36.33  ? 177  HIS A CB    1 
ATOM   1307  C  CG    . HIS A  1  178  ? 109.326 146.878 73.629  1.00 40.04  ? 177  HIS A CG    1 
ATOM   1308  N  ND1   . HIS A  1  178  ? 108.211 147.530 73.143  1.00 41.52  ? 177  HIS A ND1   1 
ATOM   1309  C  CD2   . HIS A  1  178  ? 109.463 147.280 74.916  1.00 40.82  ? 177  HIS A CD2   1 
ATOM   1310  C  CE1   . HIS A  1  178  ? 107.698 148.294 74.092  1.00 40.12  ? 177  HIS A CE1   1 
ATOM   1311  N  NE2   . HIS A  1  178  ? 108.440 148.161 75.177  1.00 41.30  ? 177  HIS A NE2   1 
ATOM   1312  N  N     . LYS A  1  179  ? 111.067 143.178 71.565  1.00 36.66  ? 178  LYS A N     1 
ATOM   1313  C  CA    . LYS A  1  179  ? 111.829 142.459 70.567  1.00 36.82  ? 178  LYS A CA    1 
ATOM   1314  C  C     . LYS A  1  179  ? 110.862 141.615 69.768  1.00 38.42  ? 178  LYS A C     1 
ATOM   1315  O  O     . LYS A  1  179  ? 110.884 141.607 68.534  1.00 39.42  ? 178  LYS A O     1 
ATOM   1316  C  CB    . LYS A  1  179  ? 112.861 141.528 71.198  1.00 36.14  ? 178  LYS A CB    1 
ATOM   1317  C  CG    . LYS A  1  179  ? 113.431 140.565 70.170  1.00 35.30  ? 178  LYS A CG    1 
ATOM   1318  C  CD    . LYS A  1  179  ? 114.664 139.849 70.640  1.00 36.94  ? 178  LYS A CD    1 
ATOM   1319  C  CE    . LYS A  1  179  ? 115.408 139.299 69.431  1.00 38.52  ? 178  LYS A CE    1 
ATOM   1320  N  NZ    . LYS A  1  179  ? 116.595 138.462 69.793  1.00 41.17  ? 178  LYS A NZ    1 
ATOM   1321  N  N     . MET A  1  180  ? 110.005 140.907 70.495  1.00 39.51  ? 179  MET A N     1 
ATOM   1322  C  CA    . MET A  1  180  ? 109.041 140.014 69.885  1.00 38.75  ? 179  MET A CA    1 
ATOM   1323  C  C     . MET A  1  180  ? 108.129 140.695 68.906  1.00 38.54  ? 179  MET A C     1 
ATOM   1324  O  O     . MET A  1  180  ? 107.867 140.173 67.827  1.00 38.84  ? 179  MET A O     1 
ATOM   1325  C  CB    . MET A  1  180  ? 108.218 139.317 70.957  1.00 38.96  ? 179  MET A CB    1 
ATOM   1326  C  CG    . MET A  1  180  ? 108.199 137.816 70.765  1.00 41.36  ? 179  MET A CG    1 
ATOM   1327  S  SD    . MET A  1  180  ? 109.830 137.042 70.923  1.00 44.01  ? 179  MET A SD    1 
ATOM   1328  C  CE    . MET A  1  180  ? 110.652 137.524 69.411  1.00 43.71  ? 179  MET A CE    1 
ATOM   1329  N  N     . LYS A  1  181  ? 107.647 141.868 69.284  1.00 38.86  ? 180  LYS A N     1 
ATOM   1330  C  CA    . LYS A  1  181  ? 106.756 142.623 68.424  1.00 39.05  ? 180  LYS A CA    1 
ATOM   1331  C  C     . LYS A  1  181  ? 107.438 142.990 67.092  1.00 38.96  ? 180  LYS A C     1 
ATOM   1332  O  O     . LYS A  1  181  ? 106.853 143.668 66.249  1.00 38.84  ? 180  LYS A O     1 
ATOM   1333  C  CB    . LYS A  1  181  ? 106.271 143.872 69.180  1.00 39.40  ? 180  LYS A CB    1 
ATOM   1334  C  CG    . LYS A  1  181  ? 105.252 144.690 68.431  1.00 40.88  ? 180  LYS A CG    1 
ATOM   1335  C  CD    . LYS A  1  181  ? 104.359 145.494 69.355  1.00 42.87  ? 180  LYS A CD    1 
ATOM   1336  C  CE    . LYS A  1  181  ? 103.355 146.301 68.519  1.00 45.00  ? 180  LYS A CE    1 
ATOM   1337  N  NZ    . LYS A  1  181  ? 102.315 147.042 69.304  1.00 43.59  ? 180  LYS A NZ    1 
ATOM   1338  N  N     . ALA A  1  182  ? 108.664 142.507 66.894  1.00 38.94  ? 181  ALA A N     1 
ATOM   1339  C  CA    . ALA A  1  182  ? 109.432 142.794 65.680  1.00 38.73  ? 181  ALA A CA    1 
ATOM   1340  C  C     . ALA A  1  182  ? 109.865 141.532 64.947  1.00 39.30  ? 181  ALA A C     1 
ATOM   1341  O  O     . ALA A  1  182  ? 110.909 141.510 64.292  1.00 38.97  ? 181  ALA A O     1 
ATOM   1342  C  CB    . ALA A  1  182  ? 110.657 143.614 66.038  1.00 38.21  ? 181  ALA A CB    1 
ATOM   1343  N  N     . ARG A  1  183  ? 109.060 140.482 65.056  1.00 40.81  ? 182  ARG A N     1 
ATOM   1344  C  CA    . ARG A  1  183  ? 109.364 139.204 64.420  1.00 40.98  ? 182  ARG A CA    1 
ATOM   1345  C  C     . ARG A  1  183  ? 108.071 138.469 64.119  1.00 40.91  ? 182  ARG A C     1 
ATOM   1346  O  O     . ARG A  1  183  ? 107.014 138.854 64.601  1.00 42.50  ? 182  ARG A O     1 
ATOM   1347  C  CB    . ARG A  1  183  ? 110.208 138.345 65.359  1.00 40.01  ? 182  ARG A CB    1 
ATOM   1348  C  CG    . ARG A  1  183  ? 111.535 138.949 65.761  1.00 38.47  ? 182  ARG A CG    1 
ATOM   1349  C  CD    . ARG A  1  183  ? 112.531 138.920 64.620  1.00 39.42  ? 182  ARG A CD    1 
ATOM   1350  N  NE    . ARG A  1  183  ? 113.895 139.079 65.116  1.00 41.64  ? 182  ARG A NE    1 
ATOM   1351  C  CZ    . ARG A  1  183  ? 114.463 140.245 65.404  1.00 41.13  ? 182  ARG A CZ    1 
ATOM   1352  N  NH1   . ARG A  1  183  ? 113.792 141.374 65.232  1.00 40.60  ? 182  ARG A NH1   1 
ATOM   1353  N  NH2   . ARG A  1  183  ? 115.694 140.279 65.895  1.00 40.59  ? 182  ARG A NH2   1 
ATOM   1354  N  N     . GLY A  1  184  ? 108.154 137.410 63.326  1.00 41.75  ? 183  GLY A N     1 
ATOM   1355  C  CA    . GLY A  1  184  ? 106.958 136.646 63.023  1.00 43.56  ? 183  GLY A CA    1 
ATOM   1356  C  C     . GLY A  1  184  ? 106.759 135.620 64.120  1.00 44.65  ? 183  GLY A C     1 
ATOM   1357  O  O     . GLY A  1  184  ? 106.799 134.414 63.877  1.00 44.83  ? 183  GLY A O     1 
ATOM   1358  N  N     . THR A  1  185  ? 106.547 136.098 65.342  1.00 45.84  ? 184  THR A N     1 
ATOM   1359  C  CA    . THR A  1  185  ? 106.376 135.203 66.482  1.00 46.03  ? 184  THR A CA    1 
ATOM   1360  C  C     . THR A  1  185  ? 105.217 135.615 67.370  1.00 45.46  ? 184  THR A C     1 
ATOM   1361  O  O     . THR A  1  185  ? 105.024 136.802 67.625  1.00 45.96  ? 184  THR A O     1 
ATOM   1362  C  CB    . THR A  1  185  ? 107.629 135.194 67.386  1.00 45.94  ? 184  THR A CB    1 
ATOM   1363  O  OG1   . THR A  1  185  ? 108.804 134.976 66.597  1.00 47.90  ? 184  THR A OG1   1 
ATOM   1364  C  CG2   . THR A  1  185  ? 107.518 134.090 68.426  1.00 46.19  ? 184  THR A CG2   1 
ATOM   1365  N  N     . LYS A  1  186  ? 104.457 134.625 67.837  1.00 44.09  ? 185  LYS A N     1 
ATOM   1366  C  CA    . LYS A  1  186  ? 103.351 134.862 68.764  1.00 41.55  ? 185  LYS A CA    1 
ATOM   1367  C  C     . LYS A  1  186  ? 103.954 134.665 70.171  1.00 41.47  ? 185  LYS A C     1 
ATOM   1368  O  O     . LYS A  1  186  ? 104.584 133.630 70.449  1.00 41.73  ? 185  LYS A O     1 
ATOM   1369  C  CB    . LYS A  1  186  ? 102.212 133.866 68.509  1.00 40.04  ? 185  LYS A CB    1 
ATOM   1370  C  CG    . LYS A  1  186  ? 101.178 133.780 69.621  1.00 38.49  ? 185  LYS A CG    1 
ATOM   1371  C  CD    . LYS A  1  186  ? 100.488 135.110 69.856  1.00 40.30  ? 185  LYS A CD    1 
ATOM   1372  C  CE    . LYS A  1  186  ? 99.566  135.067 71.078  1.00 40.23  ? 185  LYS A CE    1 
ATOM   1373  N  NZ    . LYS A  1  186  ? 98.759  136.314 71.228  1.00 38.40  ? 185  LYS A NZ    1 
ATOM   1374  N  N     . TRP A  1  187  ? 103.775 135.662 71.037  1.00 37.95  ? 186  TRP A N     1 
ATOM   1375  C  CA    . TRP A  1  187  ? 104.323 135.636 72.396  1.00 36.14  ? 186  TRP A CA    1 
ATOM   1376  C  C     . TRP A  1  187  ? 103.352 136.410 73.306  1.00 36.43  ? 186  TRP A C     1 
ATOM   1377  O  O     . TRP A  1  187  ? 102.629 137.291 72.835  1.00 38.06  ? 186  TRP A O     1 
ATOM   1378  C  CB    . TRP A  1  187  ? 105.706 136.318 72.353  1.00 35.96  ? 186  TRP A CB    1 
ATOM   1379  C  CG    . TRP A  1  187  ? 106.453 136.439 73.652  1.00 34.53  ? 186  TRP A CG    1 
ATOM   1380  C  CD1   . TRP A  1  187  ? 107.353 135.552 74.174  1.00 35.05  ? 186  TRP A CD1   1 
ATOM   1381  C  CD2   . TRP A  1  187  ? 106.346 137.504 74.602  1.00 33.15  ? 186  TRP A CD2   1 
ATOM   1382  N  NE1   . TRP A  1  187  ? 107.811 135.999 75.392  1.00 34.51  ? 186  TRP A NE1   1 
ATOM   1383  C  CE2   . TRP A  1  187  ? 107.204 137.194 75.678  1.00 33.57  ? 186  TRP A CE2   1 
ATOM   1384  C  CE3   . TRP A  1  187  ? 105.602 138.689 74.650  1.00 32.41  ? 186  TRP A CE3   1 
ATOM   1385  C  CZ2   . TRP A  1  187  ? 107.335 138.023 76.790  1.00 33.03  ? 186  TRP A CZ2   1 
ATOM   1386  C  CZ3   . TRP A  1  187  ? 105.731 139.510 75.754  1.00 31.85  ? 186  TRP A CZ3   1 
ATOM   1387  C  CH2   . TRP A  1  187  ? 106.590 139.172 76.811  1.00 33.05  ? 186  TRP A CH2   1 
ATOM   1388  N  N     . PRO A  1  188  ? 103.314 136.101 74.613  1.00 33.21  ? 187  PRO A N     1 
ATOM   1389  C  CA    . PRO A  1  188  ? 104.086 135.124 75.371  1.00 33.65  ? 187  PRO A CA    1 
ATOM   1390  C  C     . PRO A  1  188  ? 103.639 133.697 75.116  1.00 33.63  ? 187  PRO A C     1 
ATOM   1391  O  O     . PRO A  1  188  ? 102.799 133.443 74.260  1.00 34.75  ? 187  PRO A O     1 
ATOM   1392  C  CB    . PRO A  1  188  ? 103.848 135.554 76.808  1.00 32.76  ? 187  PRO A CB    1 
ATOM   1393  C  CG    . PRO A  1  188  ? 102.432 136.012 76.762  1.00 32.25  ? 187  PRO A CG    1 
ATOM   1394  C  CD    . PRO A  1  188  ? 102.401 136.836 75.500  1.00 32.13  ? 187  PRO A CD    1 
ATOM   1395  N  N     . ASN A  1  189  ? 104.186 132.768 75.887  1.00 34.27  ? 188  ASN A N     1 
ATOM   1396  C  CA    . ASN A  1  189  ? 103.870 131.364 75.712  1.00 34.68  ? 188  ASN A CA    1 
ATOM   1397  C  C     . ASN A  1  189  ? 103.165 130.715 76.891  1.00 33.02  ? 188  ASN A C     1 
ATOM   1398  O  O     . ASN A  1  189  ? 103.588 130.829 78.029  1.00 33.10  ? 188  ASN A O     1 
ATOM   1399  C  CB    . ASN A  1  189  ? 105.155 130.601 75.414  1.00 39.09  ? 188  ASN A CB    1 
ATOM   1400  C  CG    . ASN A  1  189  ? 105.981 131.259 74.324  1.00 42.95  ? 188  ASN A CG    1 
ATOM   1401  O  OD1   . ASN A  1  189  ? 105.460 131.624 73.266  1.00 45.64  ? 188  ASN A OD1   1 
ATOM   1402  N  ND2   . ASN A  1  189  ? 107.284 131.402 74.572  1.00 43.96  ? 188  ASN A ND2   1 
ATOM   1403  N  N     . VAL A  1  190  ? 102.086 130.016 76.595  1.00 30.57  ? 189  VAL A N     1 
ATOM   1404  C  CA    . VAL A  1  190  ? 101.323 129.321 77.600  1.00 28.40  ? 189  VAL A CA    1 
ATOM   1405  C  C     . VAL A  1  190  ? 101.689 127.857 77.446  1.00 29.29  ? 189  VAL A C     1 
ATOM   1406  O  O     . VAL A  1  190  ? 101.511 127.290 76.369  1.00 28.50  ? 189  VAL A O     1 
ATOM   1407  C  CB    . VAL A  1  190  ? 99.834  129.500 77.331  1.00 28.04  ? 189  VAL A CB    1 
ATOM   1408  C  CG1   . VAL A  1  190  ? 99.026  128.567 78.201  1.00 29.08  ? 189  VAL A CG1   1 
ATOM   1409  C  CG2   . VAL A  1  190  ? 99.447  130.941 77.561  1.00 27.00  ? 189  VAL A CG2   1 
ATOM   1410  N  N     . ARG A  1  191  ? 102.205 127.245 78.508  1.00 29.91  ? 190  ARG A N     1 
ATOM   1411  C  CA    . ARG A  1  191  ? 102.584 125.834 78.450  1.00 29.86  ? 190  ARG A CA    1 
ATOM   1412  C  C     . ARG A  1  191  ? 101.377 124.982 78.106  1.00 30.10  ? 190  ARG A C     1 
ATOM   1413  O  O     . ARG A  1  191  ? 100.253 125.275 78.521  1.00 28.48  ? 190  ARG A O     1 
ATOM   1414  C  CB    . ARG A  1  191  ? 103.163 125.366 79.783  1.00 30.17  ? 190  ARG A CB    1 
ATOM   1415  C  CG    . ARG A  1  191  ? 104.196 126.291 80.364  1.00 31.41  ? 190  ARG A CG    1 
ATOM   1416  C  CD    . ARG A  1  191  ? 103.618 127.052 81.529  1.00 32.11  ? 190  ARG A CD    1 
ATOM   1417  N  NE    . ARG A  1  191  ? 103.458 126.188 82.688  1.00 34.12  ? 190  ARG A NE    1 
ATOM   1418  C  CZ    . ARG A  1  191  ? 102.591 126.410 83.666  1.00 36.37  ? 190  ARG A CZ    1 
ATOM   1419  N  NH1   . ARG A  1  191  ? 101.799 127.471 83.624  1.00 37.09  ? 190  ARG A NH1   1 
ATOM   1420  N  NH2   . ARG A  1  191  ? 102.518 125.572 84.689  1.00 37.30  ? 190  ARG A NH2   1 
ATOM   1421  N  N     . GLY A  1  192  ? 101.615 123.926 77.340  1.00 31.89  ? 191  GLY A N     1 
ATOM   1422  C  CA    . GLY A  1  192  ? 100.527 123.053 76.944  1.00 33.27  ? 191  GLY A CA    1 
ATOM   1423  C  C     . GLY A  1  192  ? 99.891  122.487 78.183  1.00 33.35  ? 191  GLY A C     1 
ATOM   1424  O  O     . GLY A  1  192  ? 98.683  122.604 78.401  1.00 33.16  ? 191  GLY A O     1 
ATOM   1425  N  N     . VAL A  1  193  ? 100.745 121.884 78.997  1.00 32.76  ? 192  VAL A N     1 
ATOM   1426  C  CA    . VAL A  1  193  ? 100.370 121.274 80.258  1.00 33.39  ? 192  VAL A CA    1 
ATOM   1427  C  C     . VAL A  1  193  ? 99.352  122.085 81.049  1.00 32.86  ? 192  VAL A C     1 
ATOM   1428  O  O     . VAL A  1  193  ? 98.600  121.528 81.837  1.00 34.58  ? 192  VAL A O     1 
ATOM   1429  C  CB    . VAL A  1  193  ? 101.633 121.050 81.119  1.00 34.23  ? 192  VAL A CB    1 
ATOM   1430  C  CG1   . VAL A  1  193  ? 101.347 121.347 82.554  1.00 36.09  ? 192  VAL A CG1   1 
ATOM   1431  C  CG2   . VAL A  1  193  ? 102.112 119.612 80.969  1.00 35.79  ? 192  VAL A CG2   1 
ATOM   1432  N  N     . ALA A  1  194  ? 99.322  123.393 80.831  1.00 31.65  ? 193  ALA A N     1 
ATOM   1433  C  CA    . ALA A  1  194  ? 98.404  124.259 81.549  1.00 30.39  ? 193  ALA A CA    1 
ATOM   1434  C  C     . ALA A  1  194  ? 97.155  124.646 80.763  1.00 30.96  ? 193  ALA A C     1 
ATOM   1435  O  O     . ALA A  1  194  ? 96.520  125.661 81.062  1.00 31.14  ? 193  ALA A O     1 
ATOM   1436  C  CB    . ALA A  1  194  ? 99.136  125.498 81.989  1.00 30.91  ? 193  ALA A CB    1 
ATOM   1437  N  N     . MET A  1  195  ? 96.805  123.852 79.756  1.00 30.69  ? 194  MET A N     1 
ATOM   1438  C  CA    . MET A  1  195  ? 95.616  124.126 78.951  1.00 30.59  ? 194  MET A CA    1 
ATOM   1439  C  C     . MET A  1  195  ? 94.602  122.985 79.083  1.00 30.54  ? 194  MET A C     1 
ATOM   1440  O  O     . MET A  1  195  ? 94.837  121.999 79.784  1.00 30.45  ? 194  MET A O     1 
ATOM   1441  C  CB    . MET A  1  195  ? 95.983  124.275 77.479  1.00 31.33  ? 194  MET A CB    1 
ATOM   1442  C  CG    . MET A  1  195  ? 97.145  125.186 77.202  1.00 33.90  ? 194  MET A CG    1 
ATOM   1443  S  SD    . MET A  1  195  ? 97.298  125.489 75.431  1.00 35.39  ? 194  MET A SD    1 
ATOM   1444  C  CE    . MET A  1  195  ? 98.462  124.281 74.991  1.00 34.75  ? 194  MET A CE    1 
ATOM   1445  N  N     . ASN A  1  196  ? 93.471  123.121 78.404  1.00 29.90  ? 195  ASN A N     1 
ATOM   1446  C  CA    . ASN A  1  196  ? 92.460  122.084 78.446  1.00 29.89  ? 195  ASN A CA    1 
ATOM   1447  C  C     . ASN A  1  196  ? 92.914  120.940 77.553  1.00 31.13  ? 195  ASN A C     1 
ATOM   1448  O  O     . ASN A  1  196  ? 93.730  121.128 76.645  1.00 31.16  ? 195  ASN A O     1 
ATOM   1449  C  CB    . ASN A  1  196  ? 91.121  122.641 77.985  1.00 28.80  ? 195  ASN A CB    1 
ATOM   1450  C  CG    . ASN A  1  196  ? 90.588  123.684 78.933  1.00 28.73  ? 195  ASN A CG    1 
ATOM   1451  O  OD1   . ASN A  1  196  ? 90.920  123.671 80.112  1.00 28.01  ? 195  ASN A OD1   1 
ATOM   1452  N  ND2   . ASN A  1  196  ? 89.750  124.583 78.433  1.00 27.84  ? 195  ASN A ND2   1 
ATOM   1453  N  N     . ALA A  1  197  ? 92.402  119.747 77.817  1.00 30.94  ? 196  ALA A N     1 
ATOM   1454  C  CA    . ALA A  1  197  ? 92.798  118.596 77.032  1.00 30.45  ? 196  ALA A CA    1 
ATOM   1455  C  C     . ALA A  1  197  ? 92.415  118.829 75.591  1.00 31.38  ? 196  ALA A C     1 
ATOM   1456  O  O     . ALA A  1  197  ? 93.056  118.322 74.677  1.00 32.78  ? 196  ALA A O     1 
ATOM   1457  C  CB    . ALA A  1  197  ? 92.121  117.351 77.554  1.00 30.53  ? 196  ALA A CB    1 
ATOM   1458  N  N     . VAL A  1  198  ? 91.371  119.617 75.389  1.00 31.90  ? 197  VAL A N     1 
ATOM   1459  C  CA    . VAL A  1  198  ? 90.886  119.885 74.046  1.00 31.89  ? 197  VAL A CA    1 
ATOM   1460  C  C     . VAL A  1  198  ? 91.840  120.739 73.229  1.00 31.94  ? 197  VAL A C     1 
ATOM   1461  O  O     . VAL A  1  198  ? 91.804  120.695 72.003  1.00 33.75  ? 197  VAL A O     1 
ATOM   1462  C  CB    . VAL A  1  198  ? 89.505  120.585 74.087  1.00 32.02  ? 197  VAL A CB    1 
ATOM   1463  C  CG1   . VAL A  1  198  ? 89.651  121.998 74.614  1.00 31.29  ? 197  VAL A CG1   1 
ATOM   1464  C  CG2   . VAL A  1  198  ? 88.881  120.589 72.714  1.00 31.45  ? 197  VAL A CG2   1 
ATOM   1465  N  N     . ASP A  1  199  ? 92.707  121.493 73.900  1.00 31.35  ? 198  ASP A N     1 
ATOM   1466  C  CA    . ASP A  1  199  ? 93.625  122.391 73.203  1.00 31.21  ? 198  ASP A CA    1 
ATOM   1467  C  C     . ASP A  1  199  ? 95.055  121.917 73.026  1.00 30.80  ? 198  ASP A C     1 
ATOM   1468  O  O     . ASP A  1  199  ? 95.834  122.548 72.311  1.00 32.17  ? 198  ASP A O     1 
ATOM   1469  C  CB    . ASP A  1  199  ? 93.655  123.752 73.901  1.00 31.33  ? 198  ASP A CB    1 
ATOM   1470  C  CG    . ASP A  1  199  ? 92.324  124.473 73.839  1.00 32.16  ? 198  ASP A CG    1 
ATOM   1471  O  OD1   . ASP A  1  199  ? 91.789  124.635 72.721  1.00 30.29  ? 198  ASP A OD1   1 
ATOM   1472  O  OD2   . ASP A  1  199  ? 91.817  124.885 74.908  1.00 32.36  ? 198  ASP A OD2   1 
ATOM   1473  N  N     . HIS A  1  200  ? 95.418  120.819 73.665  1.00 30.61  ? 199  HIS A N     1 
ATOM   1474  C  CA    . HIS A  1  200  ? 96.782  120.347 73.539  1.00 30.32  ? 199  HIS A CA    1 
ATOM   1475  C  C     . HIS A  1  200  ? 96.925  118.944 74.080  1.00 30.62  ? 199  HIS A C     1 
ATOM   1476  O  O     . HIS A  1  200  ? 96.283  118.581 75.058  1.00 31.35  ? 199  HIS A O     1 
ATOM   1477  C  CB    . HIS A  1  200  ? 97.707  121.274 74.311  1.00 29.66  ? 199  HIS A CB    1 
ATOM   1478  C  CG    . HIS A  1  200  ? 99.156  120.959 74.142  1.00 29.90  ? 199  HIS A CG    1 
ATOM   1479  N  ND1   . HIS A  1  200  ? 99.916  121.477 73.116  1.00 30.12  ? 199  HIS A ND1   1 
ATOM   1480  C  CD2   . HIS A  1  200  ? 99.976  120.145 74.844  1.00 28.99  ? 199  HIS A CD2   1 
ATOM   1481  C  CE1   . HIS A  1  200  ? 101.142 120.994 73.194  1.00 29.61  ? 199  HIS A CE1   1 
ATOM   1482  N  NE2   . HIS A  1  200  ? 101.204 120.183 74.233  1.00 29.94  ? 199  HIS A NE2   1 
ATOM   1483  N  N     . PRO A  1  201  ? 97.779  118.130 73.453  1.00 31.43  ? 200  PRO A N     1 
ATOM   1484  C  CA    . PRO A  1  201  ? 97.948  116.768 73.949  1.00 32.44  ? 200  PRO A CA    1 
ATOM   1485  C  C     . PRO A  1  201  ? 98.145  116.758 75.457  1.00 32.20  ? 200  PRO A C     1 
ATOM   1486  O  O     . PRO A  1  201  ? 97.658  115.876 76.146  1.00 32.11  ? 200  PRO A O     1 
ATOM   1487  C  CB    . PRO A  1  201  ? 99.182  116.290 73.197  1.00 32.93  ? 200  PRO A CB    1 
ATOM   1488  C  CG    . PRO A  1  201  ? 99.018  116.964 71.867  1.00 32.68  ? 200  PRO A CG    1 
ATOM   1489  C  CD    . PRO A  1  201  ? 98.616  118.365 72.263  1.00 32.78  ? 200  PRO A CD    1 
ATOM   1490  N  N     . PHE A  1  202  ? 98.836  117.769 75.961  1.00 31.60  ? 201  PHE A N     1 
ATOM   1491  C  CA    . PHE A  1  202  ? 99.117  117.868 77.380  1.00 31.40  ? 201  PHE A CA    1 
ATOM   1492  C  C     . PHE A  1  202  ? 98.048  118.525 78.233  1.00 31.78  ? 201  PHE A C     1 
ATOM   1493  O  O     . PHE A  1  202  ? 98.195  118.600 79.433  1.00 33.42  ? 201  PHE A O     1 
ATOM   1494  C  CB    . PHE A  1  202  ? 100.431 118.623 77.593  1.00 31.53  ? 201  PHE A CB    1 
ATOM   1495  C  CG    . PHE A  1  202  ? 101.644 117.907 77.075  1.00 29.13  ? 201  PHE A CG    1 
ATOM   1496  C  CD1   . PHE A  1  202  ? 102.842 118.587 76.922  1.00 28.57  ? 201  PHE A CD1   1 
ATOM   1497  C  CD2   . PHE A  1  202  ? 101.604 116.556 76.778  1.00 28.00  ? 201  PHE A CD2   1 
ATOM   1498  C  CE1   . PHE A  1  202  ? 103.982 117.934 76.484  1.00 28.43  ? 201  PHE A CE1   1 
ATOM   1499  C  CE2   . PHE A  1  202  ? 102.739 115.893 76.340  1.00 27.44  ? 201  PHE A CE2   1 
ATOM   1500  C  CZ    . PHE A  1  202  ? 103.932 116.585 76.194  1.00 27.72  ? 201  PHE A CZ    1 
ATOM   1501  N  N     . GLY A  1  203  ? 96.979  119.019 77.642  1.00 33.21  ? 202  GLY A N     1 
ATOM   1502  C  CA    . GLY A  1  203  ? 95.974  119.659 78.469  1.00 35.79  ? 202  GLY A CA    1 
ATOM   1503  C  C     . GLY A  1  203  ? 95.314  118.728 79.473  1.00 37.92  ? 202  GLY A C     1 
ATOM   1504  O  O     . GLY A  1  203  ? 95.705  117.571 79.610  1.00 36.27  ? 202  GLY A O     1 
ATOM   1505  N  N     . GLY A  1  204  ? 94.323  119.255 80.188  1.00 40.60  ? 203  GLY A N     1 
ATOM   1506  C  CA    . GLY A  1  204  ? 93.571  118.473 81.153  1.00 45.85  ? 203  GLY A CA    1 
ATOM   1507  C  C     . GLY A  1  204  ? 94.282  117.985 82.398  1.00 50.24  ? 203  GLY A C     1 
ATOM   1508  O  O     . GLY A  1  204  ? 95.394  118.414 82.693  1.00 52.99  ? 203  GLY A O     1 
ATOM   1509  N  N     . GLY A  1  205  ? 93.618  117.094 83.137  1.00 52.04  ? 204  GLY A N     1 
ATOM   1510  C  CA    . GLY A  1  205  ? 94.179  116.530 84.353  1.00 52.82  ? 204  GLY A CA    1 
ATOM   1511  C  C     . GLY A  1  205  ? 94.264  117.495 85.518  1.00 53.97  ? 204  GLY A C     1 
ATOM   1512  O  O     . GLY A  1  205  ? 94.971  118.501 85.438  1.00 54.08  ? 204  GLY A O     1 
ATOM   1513  N  N     . GLY A  1  206  ? 93.546  117.183 86.598  1.00 54.55  ? 205  GLY A N     1 
ATOM   1514  C  CA    . GLY A  1  206  ? 93.552  118.028 87.788  1.00 54.01  ? 205  GLY A CA    1 
ATOM   1515  C  C     . GLY A  1  206  ? 94.815  118.856 87.922  1.00 52.49  ? 205  GLY A C     1 
ATOM   1516  O  O     . GLY A  1  206  ? 94.826  120.037 87.576  1.00 52.91  ? 205  GLY A O     1 
ATOM   1517  N  N     . ARG A  1  207  ? 95.877  118.248 88.431  1.00 50.38  ? 206  ARG A N     1 
ATOM   1518  C  CA    . ARG A  1  207  ? 97.143  118.948 88.552  1.00 48.88  ? 206  ARG A CA    1 
ATOM   1519  C  C     . ARG A  1  207  ? 97.760  118.876 87.156  1.00 45.78  ? 206  ARG A C     1 
ATOM   1520  O  O     . ARG A  1  207  ? 97.366  118.038 86.340  1.00 44.03  ? 206  ARG A O     1 
ATOM   1521  C  CB    . ARG A  1  207  ? 98.042  118.249 89.579  1.00 53.31  ? 206  ARG A CB    1 
ATOM   1522  C  CG    . ARG A  1  207  ? 98.371  116.793 89.221  1.00 59.37  ? 206  ARG A CG    1 
ATOM   1523  C  CD    . ARG A  1  207  ? 98.914  116.006 90.414  1.00 63.57  ? 206  ARG A CD    1 
ATOM   1524  N  NE    . ARG A  1  207  ? 98.997  114.568 90.143  1.00 66.66  ? 206  ARG A NE    1 
ATOM   1525  C  CZ    . ARG A  1  207  ? 99.899  114.004 89.342  1.00 68.61  ? 206  ARG A CZ    1 
ATOM   1526  N  NH1   . ARG A  1  207  ? 100.805 114.761 88.725  1.00 68.76  ? 206  ARG A NH1   1 
ATOM   1527  N  NH2   . ARG A  1  207  ? 99.904  112.684 89.167  1.00 67.75  ? 206  ARG A NH2   1 
ATOM   1528  N  N     . GLN A  1  208  ? 98.717  119.756 86.880  1.00 42.82  ? 207  GLN A N     1 
ATOM   1529  C  CA    . GLN A  1  208  ? 99.376  119.788 85.582  1.00 40.15  ? 207  GLN A CA    1 
ATOM   1530  C  C     . GLN A  1  208  ? 100.461 118.728 85.488  1.00 40.24  ? 207  GLN A C     1 
ATOM   1531  O  O     . GLN A  1  208  ? 101.133 118.436 86.475  1.00 42.90  ? 207  GLN A O     1 
ATOM   1532  C  CB    . GLN A  1  208  ? 99.988  121.162 85.344  1.00 35.38  ? 207  GLN A CB    1 
ATOM   1533  C  CG    . GLN A  1  208  ? 99.054  122.293 85.650  1.00 32.03  ? 207  GLN A CG    1 
ATOM   1534  C  CD    . GLN A  1  208  ? 99.605  123.624 85.237  1.00 29.76  ? 207  GLN A CD    1 
ATOM   1535  O  OE1   . GLN A  1  208  ? 100.795 123.878 85.370  1.00 31.32  ? 207  GLN A OE1   1 
ATOM   1536  N  NE2   . GLN A  1  208  ? 98.738  124.494 84.747  1.00 27.29  ? 207  GLN A NE2   1 
ATOM   1537  N  N     . HIS A  1  209  ? 100.627 118.159 84.297  1.00 40.57  ? 208  HIS A N     1 
ATOM   1538  C  CA    . HIS A  1  209  ? 101.630 117.126 84.040  1.00 40.72  ? 208  HIS A CA    1 
ATOM   1539  C  C     . HIS A  1  209  ? 101.227 116.428 82.749  1.00 40.06  ? 208  HIS A C     1 
ATOM   1540  O  O     . HIS A  1  209  ? 100.153 115.857 82.661  1.00 41.07  ? 208  HIS A O     1 
ATOM   1541  C  CB    . HIS A  1  209  ? 101.653 116.104 85.180  1.00 40.53  ? 208  HIS A CB    1 
ATOM   1542  C  CG    . HIS A  1  209  ? 100.363 115.364 85.344  1.00 41.53  ? 208  HIS A CG    1 
ATOM   1543  N  ND1   . HIS A  1  209  ? 100.231 114.022 85.050  1.00 42.72  ? 208  HIS A ND1   1 
ATOM   1544  C  CD2   . HIS A  1  209  ? 99.130  115.793 85.699  1.00 42.08  ? 208  HIS A CD2   1 
ATOM   1545  C  CE1   . HIS A  1  209  ? 98.972  113.658 85.214  1.00 42.49  ? 208  HIS A CE1   1 
ATOM   1546  N  NE2   . HIS A  1  209  ? 98.282  114.715 85.607  1.00 43.45  ? 208  HIS A NE2   1 
ATOM   1547  N  N     . PRO A  1  210  ? 102.090 116.441 81.734  1.00 39.74  ? 209  PRO A N     1 
ATOM   1548  C  CA    . PRO A  1  210  ? 101.696 115.768 80.493  1.00 40.80  ? 209  PRO A CA    1 
ATOM   1549  C  C     . PRO A  1  210  ? 101.174 114.348 80.748  1.00 42.22  ? 209  PRO A C     1 
ATOM   1550  O  O     . PRO A  1  210  ? 101.596 113.679 81.694  1.00 43.38  ? 209  PRO A O     1 
ATOM   1551  C  CB    . PRO A  1  210  ? 102.989 115.763 79.695  1.00 40.28  ? 209  PRO A CB    1 
ATOM   1552  C  CG    . PRO A  1  210  ? 104.015 115.581 80.775  1.00 39.60  ? 209  PRO A CG    1 
ATOM   1553  C  CD    . PRO A  1  210  ? 103.553 116.576 81.809  1.00 39.39  ? 209  PRO A CD    1 
ATOM   1554  N  N     . GLY A  1  211  ? 100.262 113.888 79.905  1.00 41.55  ? 210  GLY A N     1 
ATOM   1555  C  CA    . GLY A  1  211  ? 99.723  112.549 80.064  1.00 42.59  ? 210  GLY A CA    1 
ATOM   1556  C  C     . GLY A  1  211  ? 100.705 111.435 79.721  1.00 42.93  ? 210  GLY A C     1 
ATOM   1557  O  O     . GLY A  1  211  ? 100.866 110.489 80.488  1.00 43.33  ? 210  GLY A O     1 
ATOM   1558  N  N     . LYS A  1  212  ? 101.359 111.547 78.570  1.00 42.60  ? 211  LYS A N     1 
ATOM   1559  C  CA    . LYS A  1  212  ? 102.318 110.549 78.118  1.00 43.80  ? 211  LYS A CA    1 
ATOM   1560  C  C     . LYS A  1  212  ? 103.730 111.088 78.246  1.00 42.97  ? 211  LYS A C     1 
ATOM   1561  O  O     . LYS A  1  212  ? 103.955 112.100 78.898  1.00 41.90  ? 211  LYS A O     1 
ATOM   1562  C  CB    . LYS A  1  212  ? 102.074 110.207 76.640  1.00 47.07  ? 211  LYS A CB    1 
ATOM   1563  C  CG    . LYS A  1  212  ? 100.730 109.542 76.298  1.00 52.22  ? 211  LYS A CG    1 
ATOM   1564  C  CD    . LYS A  1  212  ? 100.653 109.164 74.800  1.00 52.78  ? 211  LYS A CD    1 
ATOM   1565  C  CE    . LYS A  1  212  ? 99.298  108.585 74.416  1.00 53.06  ? 211  LYS A CE    1 
ATOM   1566  N  NZ    . LYS A  1  212  ? 99.183  108.403 72.938  1.00 54.54  ? 211  LYS A NZ    1 
ATOM   1567  N  N     . PRO A  1  213  ? 104.713 110.379 77.666  1.00 43.11  ? 212  PRO A N     1 
ATOM   1568  C  CA    . PRO A  1  213  ? 106.086 110.873 77.740  1.00 43.48  ? 212  PRO A CA    1 
ATOM   1569  C  C     . PRO A  1  213  ? 106.182 111.973 76.684  1.00 44.05  ? 212  PRO A C     1 
ATOM   1570  O  O     . PRO A  1  213  ? 105.374 112.009 75.758  1.00 44.28  ? 212  PRO A O     1 
ATOM   1571  C  CB    . PRO A  1  213  ? 106.918 109.634 77.398  1.00 43.24  ? 212  PRO A CB    1 
ATOM   1572  C  CG    . PRO A  1  213  ? 106.026 108.860 76.523  1.00 42.71  ? 212  PRO A CG    1 
ATOM   1573  C  CD    . PRO A  1  213  ? 104.713 108.967 77.247  1.00 42.66  ? 212  PRO A CD    1 
ATOM   1574  N  N     . LYS A  1  214  ? 107.158 112.862 76.810  1.00 43.71  ? 213  LYS A N     1 
ATOM   1575  C  CA    . LYS A  1  214  ? 107.281 113.962 75.866  1.00 43.05  ? 213  LYS A CA    1 
ATOM   1576  C  C     . LYS A  1  214  ? 108.036 113.673 74.572  1.00 42.23  ? 213  LYS A C     1 
ATOM   1577  O  O     . LYS A  1  214  ? 107.980 114.471 73.638  1.00 43.46  ? 213  LYS A O     1 
ATOM   1578  C  CB    . LYS A  1  214  ? 107.916 115.160 76.564  1.00 44.98  ? 213  LYS A CB    1 
ATOM   1579  C  CG    . LYS A  1  214  ? 107.272 115.507 77.890  1.00 46.51  ? 213  LYS A CG    1 
ATOM   1580  C  CD    . LYS A  1  214  ? 107.864 116.774 78.455  1.00 47.50  ? 213  LYS A CD    1 
ATOM   1581  C  CE    . LYS A  1  214  ? 109.364 116.650 78.620  1.00 49.50  ? 213  LYS A CE    1 
ATOM   1582  N  NZ    . LYS A  1  214  ? 109.991 117.981 78.851  1.00 50.83  ? 213  LYS A NZ    1 
ATOM   1583  N  N     . SER A  1  215  ? 108.745 112.555 74.495  1.00 39.96  ? 214  SER A N     1 
ATOM   1584  C  CA    . SER A  1  215  ? 109.474 112.255 73.270  1.00 38.73  ? 214  SER A CA    1 
ATOM   1585  C  C     . SER A  1  215  ? 108.546 111.646 72.245  1.00 37.79  ? 214  SER A C     1 
ATOM   1586  O  O     . SER A  1  215  ? 108.170 110.492 72.356  1.00 38.76  ? 214  SER A O     1 
ATOM   1587  C  CB    . SER A  1  215  ? 110.622 111.301 73.547  1.00 37.93  ? 214  SER A CB    1 
ATOM   1588  O  OG    . SER A  1  215  ? 111.500 111.874 74.491  1.00 38.59  ? 214  SER A OG    1 
ATOM   1589  N  N     . ILE A  1  216  ? 108.182 112.435 71.242  1.00 37.34  ? 215  ILE A N     1 
ATOM   1590  C  CA    . ILE A  1  216  ? 107.283 111.984 70.188  1.00 35.79  ? 215  ILE A CA    1 
ATOM   1591  C  C     . ILE A  1  216  ? 108.042 111.528 68.919  1.00 37.42  ? 215  ILE A C     1 
ATOM   1592  O  O     . ILE A  1  216  ? 109.160 111.966 68.648  1.00 38.32  ? 215  ILE A O     1 
ATOM   1593  C  CB    . ILE A  1  216  ? 106.277 113.117 69.863  1.00 33.93  ? 215  ILE A CB    1 
ATOM   1594  C  CG1   . ILE A  1  216  ? 105.189 112.613 68.922  1.00 31.26  ? 215  ILE A CG1   1 
ATOM   1595  C  CG2   . ILE A  1  216  ? 107.017 114.329 69.333  1.00 33.64  ? 215  ILE A CG2   1 
ATOM   1596  C  CD1   . ILE A  1  216  ? 104.314 111.548 69.542  1.00 30.12  ? 215  ILE A CD1   1 
ATOM   1597  N  N     . SER A  1  217  ? 107.430 110.634 68.153  1.00 38.48  ? 216  SER A N     1 
ATOM   1598  C  CA    . SER A  1  217  ? 108.030 110.101 66.933  1.00 39.07  ? 216  SER A CA    1 
ATOM   1599  C  C     . SER A  1  217  ? 108.051 111.107 65.792  1.00 39.19  ? 216  SER A C     1 
ATOM   1600  O  O     . SER A  1  217  ? 107.195 111.984 65.716  1.00 39.43  ? 216  SER A O     1 
ATOM   1601  C  CB    . SER A  1  217  ? 107.257 108.859 66.489  1.00 40.07  ? 216  SER A CB    1 
ATOM   1602  O  OG    . SER A  1  217  ? 107.752 108.349 65.264  1.00 43.38  ? 216  SER A OG    1 
ATOM   1603  N  N     . ARG A  1  218  ? 109.024 110.973 64.897  1.00 39.35  ? 217  ARG A N     1 
ATOM   1604  C  CA    . ARG A  1  218  ? 109.127 111.872 63.751  1.00 40.72  ? 217  ARG A CA    1 
ATOM   1605  C  C     . ARG A  1  218  ? 107.904 111.753 62.864  1.00 40.75  ? 217  ARG A C     1 
ATOM   1606  O  O     . ARG A  1  218  ? 107.475 112.726 62.249  1.00 41.64  ? 217  ARG A O     1 
ATOM   1607  C  CB    . ARG A  1  218  ? 110.352 111.533 62.909  1.00 41.59  ? 217  ARG A CB    1 
ATOM   1608  C  CG    . ARG A  1  218  ? 111.448 112.560 62.963  1.00 43.15  ? 217  ARG A CG    1 
ATOM   1609  C  CD    . ARG A  1  218  ? 111.214 113.735 62.047  1.00 43.01  ? 217  ARG A CD    1 
ATOM   1610  N  NE    . ARG A  1  218  ? 111.791 114.954 62.611  1.00 48.53  ? 217  ARG A NE    1 
ATOM   1611  C  CZ    . ARG A  1  218  ? 112.966 115.026 63.241  1.00 52.09  ? 217  ARG A CZ    1 
ATOM   1612  N  NH1   . ARG A  1  218  ? 113.724 113.946 63.402  1.00 53.35  ? 217  ARG A NH1   1 
ATOM   1613  N  NH2   . ARG A  1  218  ? 113.391 116.186 63.724  1.00 53.79  ? 217  ARG A NH2   1 
ATOM   1614  N  N     . ASN A  1  219  ? 107.355 110.546 62.791  1.00 40.60  ? 218  ASN A N     1 
ATOM   1615  C  CA    . ASN A  1  219  ? 106.199 110.286 61.956  1.00 39.94  ? 218  ASN A CA    1 
ATOM   1616  C  C     . ASN A  1  219  ? 104.934 110.867 62.545  1.00 39.33  ? 218  ASN A C     1 
ATOM   1617  O  O     . ASN A  1  219  ? 103.940 111.003 61.839  1.00 40.04  ? 218  ASN A O     1 
ATOM   1618  C  CB    . ASN A  1  219  ? 106.031 108.786 61.764  1.00 42.02  ? 218  ASN A CB    1 
ATOM   1619  C  CG    . ASN A  1  219  ? 107.342 108.093 61.462  1.00 45.48  ? 218  ASN A CG    1 
ATOM   1620  O  OD1   . ASN A  1  219  ? 108.113 108.534 60.599  1.00 47.25  ? 218  ASN A OD1   1 
ATOM   1621  N  ND2   . ASN A  1  219  ? 107.605 106.996 62.169  1.00 44.98  ? 218  ASN A ND2   1 
ATOM   1622  N  N     . ALA A  1  220  ? 104.973 111.203 63.834  1.00 37.27  ? 219  ALA A N     1 
ATOM   1623  C  CA    . ALA A  1  220  ? 103.821 111.773 64.530  1.00 33.93  ? 219  ALA A CA    1 
ATOM   1624  C  C     . ALA A  1  220  ? 103.188 112.870 63.679  1.00 34.68  ? 219  ALA A C     1 
ATOM   1625  O  O     . ALA A  1  220  ? 103.874 113.764 63.189  1.00 34.64  ? 219  ALA A O     1 
ATOM   1626  C  CB    . ALA A  1  220  ? 104.251 112.331 65.867  1.00 33.45  ? 219  ALA A CB    1 
ATOM   1627  N  N     . PRO A  1  221  ? 101.863 112.822 63.496  1.00 34.49  ? 220  PRO A N     1 
ATOM   1628  C  CA    . PRO A  1  221  ? 101.199 113.838 62.686  1.00 29.36  ? 220  PRO A CA    1 
ATOM   1629  C  C     . PRO A  1  221  ? 101.110 115.206 63.334  1.00 32.25  ? 220  PRO A C     1 
ATOM   1630  O  O     . PRO A  1  221  ? 101.268 115.357 64.545  1.00 31.76  ? 220  PRO A O     1 
ATOM   1631  C  CB    . PRO A  1  221  ? 99.822  113.240 62.463  1.00 32.01  ? 220  PRO A CB    1 
ATOM   1632  C  CG    . PRO A  1  221  ? 99.561  112.589 63.767  1.00 32.40  ? 220  PRO A CG    1 
ATOM   1633  C  CD    . PRO A  1  221  ? 100.878 111.873 64.041  1.00 32.74  ? 220  PRO A CD    1 
ATOM   1634  N  N     . PRO A  1  222  ? 100.877 116.234 62.516  1.00 34.89  ? 221  PRO A N     1 
ATOM   1635  C  CA    . PRO A  1  222  ? 100.757 117.592 63.029  1.00 29.98  ? 221  PRO A CA    1 
ATOM   1636  C  C     . PRO A  1  222  ? 99.510  117.645 63.896  1.00 31.87  ? 221  PRO A C     1 
ATOM   1637  O  O     . PRO A  1  222  ? 98.410  117.345 63.435  1.00 32.72  ? 221  PRO A O     1 
ATOM   1638  C  CB    . PRO A  1  222  ? 100.612 118.424 61.762  1.00 32.40  ? 221  PRO A CB    1 
ATOM   1639  C  CG    . PRO A  1  222  ? 99.981  117.455 60.790  1.00 33.17  ? 221  PRO A CG    1 
ATOM   1640  C  CD    . PRO A  1  222  ? 100.793 116.225 61.047  1.00 31.96  ? 221  PRO A CD    1 
ATOM   1641  N  N     . GLY A  1  223  ? 99.695  118.027 65.151  1.00 31.69  ? 222  GLY A N     1 
ATOM   1642  C  CA    . GLY A  1  223  ? 98.593  118.103 66.079  1.00 29.29  ? 222  GLY A CA    1 
ATOM   1643  C  C     . GLY A  1  223  ? 99.002  117.194 67.204  1.00 30.04  ? 222  GLY A C     1 
ATOM   1644  O  O     . GLY A  1  223  ? 98.613  117.377 68.352  1.00 30.27  ? 222  GLY A O     1 
ATOM   1645  N  N     . ARG A  1  224  ? 99.817  116.207 66.869  1.00 31.49  ? 223  ARG A N     1 
ATOM   1646  C  CA    . ARG A  1  224  ? 100.277 115.264 67.867  1.00 33.69  ? 223  ARG A CA    1 
ATOM   1647  C  C     . ARG A  1  224  ? 101.741 115.469 68.168  1.00 33.31  ? 223  ARG A C     1 
ATOM   1648  O  O     . ARG A  1  224  ? 102.197 115.196 69.274  1.00 32.72  ? 223  ARG A O     1 
ATOM   1649  C  CB    . ARG A  1  224  ? 100.071 113.829 67.399  1.00 36.34  ? 223  ARG A CB    1 
ATOM   1650  C  CG    . ARG A  1  224  ? 100.377 112.848 68.501  1.00 42.52  ? 223  ARG A CG    1 
ATOM   1651  C  CD    . ARG A  1  224  ? 100.355 111.395 68.064  1.00 48.33  ? 223  ARG A CD    1 
ATOM   1652  N  NE    . ARG A  1  224  ? 100.220 110.544 69.247  1.00 55.13  ? 223  ARG A NE    1 
ATOM   1653  C  CZ    . ARG A  1  224  ? 100.338 109.223 69.252  1.00 57.00  ? 223  ARG A CZ    1 
ATOM   1654  N  NH1   . ARG A  1  224  ? 100.604 108.582 68.120  1.00 59.90  ? 223  ARG A NH1   1 
ATOM   1655  N  NH2   . ARG A  1  224  ? 100.172 108.547 70.386  1.00 56.90  ? 223  ARG A NH2   1 
ATOM   1656  N  N     . LYS A  1  225  ? 102.472 115.952 67.172  1.00 34.24  ? 224  LYS A N     1 
ATOM   1657  C  CA    . LYS A  1  225  ? 103.905 116.177 67.309  1.00 35.49  ? 224  LYS A CA    1 
ATOM   1658  C  C     . LYS A  1  225  ? 104.247 117.370 68.190  1.00 33.98  ? 224  LYS A C     1 
ATOM   1659  O  O     . LYS A  1  225  ? 104.515 118.457 67.687  1.00 34.86  ? 224  LYS A O     1 
ATOM   1660  C  CB    . LYS A  1  225  ? 104.534 116.370 65.924  1.00 37.30  ? 224  LYS A CB    1 
ATOM   1661  C  CG    . LYS A  1  225  ? 106.013 116.682 65.968  1.00 38.39  ? 224  LYS A CG    1 
ATOM   1662  C  CD    . LYS A  1  225  ? 106.542 117.083 64.608  1.00 40.84  ? 224  LYS A CD    1 
ATOM   1663  C  CE    . LYS A  1  225  ? 106.637 115.898 63.679  1.00 41.51  ? 224  LYS A CE    1 
ATOM   1664  N  NZ    . LYS A  1  225  ? 107.409 116.245 62.454  1.00 42.33  ? 224  LYS A NZ    1 
ATOM   1665  N  N     . VAL A  1  226  ? 104.247 117.166 69.502  1.00 32.53  ? 225  VAL A N     1 
ATOM   1666  C  CA    . VAL A  1  226  ? 104.562 118.242 70.433  1.00 32.64  ? 225  VAL A CA    1 
ATOM   1667  C  C     . VAL A  1  226  ? 105.581 117.772 71.451  1.00 33.32  ? 225  VAL A C     1 
ATOM   1668  O  O     . VAL A  1  226  ? 105.890 116.589 71.515  1.00 33.85  ? 225  VAL A O     1 
ATOM   1669  C  CB    . VAL A  1  226  ? 103.320 118.714 71.202  1.00 31.43  ? 225  VAL A CB    1 
ATOM   1670  C  CG1   . VAL A  1  226  ? 102.253 119.186 70.236  1.00 32.79  ? 225  VAL A CG1   1 
ATOM   1671  C  CG2   . VAL A  1  226  ? 102.801 117.596 72.077  1.00 31.38  ? 225  VAL A CG2   1 
ATOM   1672  N  N     . GLY A  1  227  ? 106.090 118.705 72.252  1.00 35.19  ? 226  GLY A N     1 
ATOM   1673  C  CA    . GLY A  1  227  ? 107.075 118.371 73.271  1.00 35.74  ? 226  GLY A CA    1 
ATOM   1674  C  C     . GLY A  1  227  ? 108.469 118.100 72.721  1.00 36.40  ? 226  GLY A C     1 
ATOM   1675  O  O     . GLY A  1  227  ? 109.058 118.947 72.036  1.00 37.10  ? 226  GLY A O     1 
ATOM   1676  N  N     . ASP A  1  228  ? 109.002 116.917 73.018  1.00 35.52  ? 227  ASP A N     1 
ATOM   1677  C  CA    . ASP A  1  228  ? 110.323 116.546 72.542  1.00 35.49  ? 227  ASP A CA    1 
ATOM   1678  C  C     . ASP A  1  228  ? 110.251 115.745 71.250  1.00 35.89  ? 227  ASP A C     1 
ATOM   1679  O  O     . ASP A  1  228  ? 109.987 114.547 71.256  1.00 36.21  ? 227  ASP A O     1 
ATOM   1680  C  CB    . ASP A  1  228  ? 111.048 115.776 73.627  1.00 35.15  ? 227  ASP A CB    1 
ATOM   1681  C  CG    . ASP A  1  228  ? 111.096 116.548 74.917  1.00 37.54  ? 227  ASP A CG    1 
ATOM   1682  O  OD1   . ASP A  1  228  ? 111.212 117.790 74.833  1.00 37.56  ? 227  ASP A OD1   1 
ATOM   1683  O  OD2   . ASP A  1  228  ? 111.021 115.931 76.001  1.00 37.60  ? 227  ASP A OD2   1 
ATOM   1684  N  N     . ILE A  1  229  ? 110.491 116.436 70.141  1.00 35.61  ? 228  ILE A N     1 
ATOM   1685  C  CA    . ILE A  1  229  ? 110.442 115.844 68.816  1.00 34.58  ? 228  ILE A CA    1 
ATOM   1686  C  C     . ILE A  1  229  ? 111.621 114.939 68.494  1.00 36.08  ? 228  ILE A C     1 
ATOM   1687  O  O     . ILE A  1  229  ? 112.776 115.349 68.583  1.00 37.18  ? 228  ILE A O     1 
ATOM   1688  C  CB    . ILE A  1  229  ? 110.382 116.942 67.731  1.00 32.35  ? 228  ILE A CB    1 
ATOM   1689  C  CG1   . ILE A  1  229  ? 109.182 117.845 67.983  1.00 31.70  ? 228  ILE A CG1   1 
ATOM   1690  C  CG2   . ILE A  1  229  ? 110.296 116.317 66.342  1.00 30.87  ? 228  ILE A CG2   1 
ATOM   1691  C  CD1   . ILE A  1  229  ? 109.098 118.994 67.028  1.00 31.17  ? 228  ILE A CD1   1 
ATOM   1692  N  N     . ALA A  1  230  ? 111.318 113.707 68.110  1.00 37.25  ? 229  ALA A N     1 
ATOM   1693  C  CA    . ALA A  1  230  ? 112.341 112.754 67.722  1.00 38.49  ? 229  ALA A CA    1 
ATOM   1694  C  C     . ALA A  1  230  ? 113.611 112.905 68.535  1.00 39.37  ? 229  ALA A C     1 
ATOM   1695  O  O     . ALA A  1  230  ? 114.705 112.802 67.985  1.00 40.56  ? 229  ALA A O     1 
ATOM   1696  C  CB    . ALA A  1  230  ? 112.657 112.934 66.246  1.00 37.32  ? 229  ALA A CB    1 
ATOM   1697  N  N     . SER A  1  231  ? 113.477 113.143 69.834  1.00 40.26  ? 230  SER A N     1 
ATOM   1698  C  CA    . SER A  1  231  ? 114.651 113.315 70.682  1.00 42.57  ? 230  SER A CA    1 
ATOM   1699  C  C     . SER A  1  231  ? 115.564 112.097 70.644  1.00 45.85  ? 230  SER A C     1 
ATOM   1700  O  O     . SER A  1  231  ? 115.098 110.966 70.691  1.00 47.76  ? 230  SER A O     1 
ATOM   1701  C  CB    . SER A  1  231  ? 114.231 113.576 72.122  1.00 39.92  ? 230  SER A CB    1 
ATOM   1702  O  OG    . SER A  1  231  ? 113.634 112.427 72.682  1.00 36.78  ? 230  SER A OG    1 
ATOM   1703  N  N     . LYS A  1  232  ? 116.870 112.328 70.557  1.00 49.70  ? 231  LYS A N     1 
ATOM   1704  C  CA    . LYS A  1  232  ? 117.825 111.230 70.538  1.00 53.18  ? 231  LYS A CA    1 
ATOM   1705  C  C     . LYS A  1  232  ? 118.197 110.910 71.983  1.00 54.06  ? 231  LYS A C     1 
ATOM   1706  O  O     . LYS A  1  232  ? 118.936 109.965 72.258  1.00 55.33  ? 231  LYS A O     1 
ATOM   1707  C  CB    . LYS A  1  232  ? 119.058 111.627 69.731  1.00 54.96  ? 231  LYS A CB    1 
ATOM   1708  C  CG    . LYS A  1  232  ? 118.715 112.068 68.313  1.00 59.16  ? 231  LYS A CG    1 
ATOM   1709  C  CD    . LYS A  1  232  ? 119.951 112.471 67.521  1.00 62.15  ? 231  LYS A CD    1 
ATOM   1710  C  CE    . LYS A  1  232  ? 119.596 113.264 66.264  1.00 64.06  ? 231  LYS A CE    1 
ATOM   1711  N  NZ    . LYS A  1  232  ? 119.077 114.637 66.587  1.00 65.59  ? 231  LYS A NZ    1 
ATOM   1712  N  N     . ARG A  1  233  ? 117.666 111.718 72.899  1.00 55.15  ? 232  ARG A N     1 
ATOM   1713  C  CA    . ARG A  1  233  ? 117.884 111.570 74.334  1.00 55.50  ? 232  ARG A CA    1 
ATOM   1714  C  C     . ARG A  1  233  ? 117.348 112.791 75.060  1.00 56.38  ? 232  ARG A C     1 
ATOM   1715  O  O     . ARG A  1  233  ? 116.935 113.766 74.439  1.00 55.61  ? 232  ARG A O     1 
ATOM   1716  C  CB    . ARG A  1  233  ? 119.367 111.418 74.662  1.00 54.47  ? 232  ARG A CB    1 
ATOM   1717  C  CG    . ARG A  1  233  ? 120.199 112.629 74.317  1.00 54.97  ? 232  ARG A CG    1 
ATOM   1718  C  CD    . ARG A  1  233  ? 121.568 112.525 74.949  1.00 55.90  ? 232  ARG A CD    1 
ATOM   1719  N  NE    . ARG A  1  233  ? 121.520 112.792 76.384  1.00 56.54  ? 232  ARG A NE    1 
ATOM   1720  C  CZ    . ARG A  1  233  ? 122.433 112.371 77.253  1.00 56.36  ? 232  ARG A CZ    1 
ATOM   1721  N  NH1   . ARG A  1  233  ? 123.467 111.650 76.835  1.00 55.65  ? 232  ARG A NH1   1 
ATOM   1722  N  NH2   . ARG A  1  233  ? 122.319 112.688 78.536  1.00 55.84  ? 232  ARG A NH2   1 
ATOM   1723  N  N     . THR A  1  234  ? 117.365 112.733 76.383  1.00 59.26  ? 233  THR A N     1 
ATOM   1724  C  CA    . THR A  1  234  ? 116.878 113.834 77.201  1.00 61.62  ? 233  THR A CA    1 
ATOM   1725  C  C     . THR A  1  234  ? 117.755 113.992 78.437  1.00 63.05  ? 233  THR A C     1 
ATOM   1726  O  O     . THR A  1  234  ? 118.696 113.223 78.644  1.00 62.68  ? 233  THR A O     1 
ATOM   1727  C  CB    . THR A  1  234  ? 115.428 113.588 77.659  1.00 62.36  ? 233  THR A CB    1 
ATOM   1728  O  OG1   . THR A  1  234  ? 115.391 112.458 78.538  1.00 63.75  ? 233  THR A OG1   1 
ATOM   1729  C  CG2   . THR A  1  234  ? 114.531 113.307 76.464  1.00 61.66  ? 233  THR A CG2   1 
ATOM   1730  N  N     . GLY A  1  235  ? 117.436 114.990 79.254  1.00 64.81  ? 234  GLY A N     1 
ATOM   1731  C  CA    . GLY A  1  235  ? 118.201 115.231 80.465  1.00 66.55  ? 234  GLY A CA    1 
ATOM   1732  C  C     . GLY A  1  235  ? 119.494 115.975 80.197  1.00 68.06  ? 234  GLY A C     1 
ATOM   1733  O  O     . GLY A  1  235  ? 119.676 116.557 79.124  1.00 67.08  ? 234  GLY A O     1 
ATOM   1734  N  N     . ARG A  1  236  ? 120.392 115.954 81.178  1.00 70.38  ? 235  ARG A N     1 
ATOM   1735  C  CA    . ARG A  1  236  ? 121.685 116.624 81.065  1.00 72.62  ? 235  ARG A CA    1 
ATOM   1736  C  C     . ARG A  1  236  ? 122.815 115.685 81.473  1.00 74.63  ? 235  ARG A C     1 
ATOM   1737  O  O     . ARG A  1  236  ? 123.990 115.973 81.241  1.00 74.99  ? 235  ARG A O     1 
ATOM   1738  C  CB    . ARG A  1  236  ? 121.727 117.859 81.959  1.00 71.84  ? 235  ARG A CB    1 
ATOM   1739  C  CG    . ARG A  1  236  ? 120.548 118.793 81.805  1.00 71.20  ? 235  ARG A CG    1 
ATOM   1740  C  CD    . ARG A  1  236  ? 120.750 120.020 82.669  1.00 70.78  ? 235  ARG A CD    1 
ATOM   1741  N  NE    . ARG A  1  236  ? 121.791 120.898 82.136  1.00 69.27  ? 235  ARG A NE    1 
ATOM   1742  C  CZ    . ARG A  1  236  ? 122.556 121.687 82.884  1.00 67.93  ? 235  ARG A CZ    1 
ATOM   1743  N  NH1   . ARG A  1  236  ? 122.403 121.701 84.201  1.00 67.18  ? 235  ARG A NH1   1 
ATOM   1744  N  NH2   . ARG A  1  236  ? 123.461 122.475 82.316  1.00 67.03  ? 235  ARG A NH2   1 
ATOM   1745  N  N     . GLY A  1  237  ? 122.452 114.569 82.094  1.00 76.50  ? 236  GLY A N     1 
ATOM   1746  C  CA    . GLY A  1  237  ? 123.452 113.608 82.515  1.00 79.40  ? 236  GLY A CA    1 
ATOM   1747  C  C     . GLY A  1  237  ? 123.455 112.393 81.606  1.00 81.13  ? 236  GLY A C     1 
ATOM   1748  O  O     . GLY A  1  237  ? 122.417 112.042 81.042  1.00 81.65  ? 236  GLY A O     1 
ATOM   1749  N  N     . GLY A  1  238  ? 124.620 111.760 81.456  1.00 82.32  ? 237  GLY A N     1 
ATOM   1750  C  CA    . GLY A  1  238  ? 124.736 110.574 80.616  1.00 82.95  ? 237  GLY A CA    1 
ATOM   1751  C  C     . GLY A  1  238  ? 125.888 110.597 79.618  1.00 83.47  ? 237  GLY A C     1 
ATOM   1752  O  O     . GLY A  1  238  ? 125.699 110.134 78.465  1.00 83.32  ? 237  GLY A O     1 
ATOM   1753  N  N     . PRO B  2  2    ? 72.942  126.210 123.076 1.00 73.32  ? 1    PRO B N     1 
ATOM   1754  C  CA    . PRO B  2  2    ? 71.635  125.515 123.178 1.00 72.82  ? 1    PRO B CA    1 
ATOM   1755  C  C     . PRO B  2  2    ? 70.537  126.536 123.454 1.00 72.07  ? 1    PRO B C     1 
ATOM   1756  O  O     . PRO B  2  2    ? 69.549  126.230 124.120 1.00 72.96  ? 1    PRO B O     1 
ATOM   1757  C  CB    . PRO B  2  2    ? 71.735  124.520 124.327 1.00 72.20  ? 1    PRO B CB    1 
ATOM   1758  C  CG    . PRO B  2  2    ? 73.249  124.338 124.446 1.00 73.38  ? 1    PRO B CG    1 
ATOM   1759  C  CD    . PRO B  2  2    ? 73.846  125.719 124.128 1.00 73.40  ? 1    PRO B CD    1 
ATOM   1760  N  N     . GLN B  2  3    ? 70.725  127.748 122.939 1.00 70.26  ? 2    GLN B N     1 
ATOM   1761  C  CA    . GLN B  2  3    ? 69.765  128.831 123.121 1.00 67.47  ? 2    GLN B CA    1 
ATOM   1762  C  C     . GLN B  2  3    ? 69.577  129.186 124.586 1.00 63.72  ? 2    GLN B C     1 
ATOM   1763  O  O     . GLN B  2  3    ? 68.868  128.507 125.325 1.00 63.77  ? 2    GLN B O     1 
ATOM   1764  C  CB    . GLN B  2  3    ? 68.411  128.459 122.508 1.00 69.81  ? 2    GLN B CB    1 
ATOM   1765  C  CG    . GLN B  2  3    ? 68.311  128.632 120.994 1.00 73.84  ? 2    GLN B CG    1 
ATOM   1766  C  CD    . GLN B  2  3    ? 68.258  130.096 120.556 1.00 76.69  ? 2    GLN B CD    1 
ATOM   1767  O  OE1   . GLN B  2  3    ? 67.787  130.965 121.296 1.00 78.36  ? 2    GLN B OE1   1 
ATOM   1768  N  NE2   . GLN B  2  3    ? 68.715  130.366 119.335 1.00 77.33  ? 2    GLN B NE2   1 
ATOM   1769  N  N     . PRO B  2  4    ? 70.232  130.256 125.034 1.00 60.34  ? 3    PRO B N     1 
ATOM   1770  C  CA    . PRO B  2  4    ? 70.084  130.650 126.433 1.00 58.70  ? 3    PRO B CA    1 
ATOM   1771  C  C     . PRO B  2  4    ? 68.618  130.967 126.708 1.00 56.83  ? 3    PRO B C     1 
ATOM   1772  O  O     . PRO B  2  4    ? 67.871  131.291 125.786 1.00 55.88  ? 3    PRO B O     1 
ATOM   1773  C  CB    . PRO B  2  4    ? 70.969  131.887 126.527 1.00 59.17  ? 3    PRO B CB    1 
ATOM   1774  C  CG    . PRO B  2  4    ? 72.032  131.604 125.518 1.00 59.21  ? 3    PRO B CG    1 
ATOM   1775  C  CD    . PRO B  2  4    ? 71.256  131.068 124.359 1.00 59.30  ? 3    PRO B CD    1 
ATOM   1776  N  N     . SER B  2  5    ? 68.211  130.873 127.968 1.00 55.56  ? 4    SER B N     1 
ATOM   1777  C  CA    . SER B  2  5    ? 66.835  131.169 128.351 1.00 54.28  ? 4    SER B CA    1 
ATOM   1778  C  C     . SER B  2  5    ? 66.629  132.675 128.346 1.00 52.98  ? 4    SER B C     1 
ATOM   1779  O  O     . SER B  2  5    ? 67.580  133.435 128.489 1.00 53.45  ? 4    SER B O     1 
ATOM   1780  C  CB    . SER B  2  5    ? 66.545  130.617 129.744 1.00 54.90  ? 4    SER B CB    1 
ATOM   1781  O  OG    . SER B  2  5    ? 66.745  129.215 129.786 1.00 57.84  ? 4    SER B OG    1 
ATOM   1782  N  N     . ARG B  2  6    ? 65.390  133.110 128.187 1.00 51.99  ? 5    ARG B N     1 
ATOM   1783  C  CA    . ARG B  2  6    ? 65.110  134.535 128.161 1.00 52.17  ? 5    ARG B CA    1 
ATOM   1784  C  C     . ARG B  2  6    ? 63.614  134.816 128.270 1.00 50.76  ? 5    ARG B C     1 
ATOM   1785  O  O     . ARG B  2  6    ? 62.823  134.382 127.434 1.00 51.15  ? 5    ARG B O     1 
ATOM   1786  C  CB    . ARG B  2  6    ? 65.662  135.138 126.869 1.00 54.08  ? 5    ARG B CB    1 
ATOM   1787  C  CG    . ARG B  2  6    ? 65.158  136.537 126.555 1.00 58.24  ? 5    ARG B CG    1 
ATOM   1788  C  CD    . ARG B  2  6    ? 64.646  136.618 125.111 1.00 61.81  ? 5    ARG B CD    1 
ATOM   1789  N  NE    . ARG B  2  6    ? 63.605  135.621 124.851 1.00 63.96  ? 5    ARG B NE    1 
ATOM   1790  C  CZ    . ARG B  2  6    ? 63.052  135.393 123.663 1.00 64.46  ? 5    ARG B CZ    1 
ATOM   1791  N  NH1   . ARG B  2  6    ? 63.431  136.098 122.606 1.00 65.96  ? 5    ARG B NH1   1 
ATOM   1792  N  NH2   . ARG B  2  6    ? 62.130  134.446 123.528 1.00 63.92  ? 5    ARG B NH2   1 
ATOM   1793  N  N     . PRO B  2  7    ? 63.205  135.542 129.316 1.00 49.06  ? 6    PRO B N     1 
ATOM   1794  C  CA    . PRO B  2  7    ? 61.792  135.885 129.536 1.00 48.39  ? 6    PRO B CA    1 
ATOM   1795  C  C     . PRO B  2  7    ? 61.182  136.575 128.311 1.00 45.70  ? 6    PRO B C     1 
ATOM   1796  O  O     . PRO B  2  7    ? 61.862  137.360 127.651 1.00 46.30  ? 6    PRO B O     1 
ATOM   1797  C  CB    . PRO B  2  7    ? 61.856  136.808 130.752 1.00 48.47  ? 6    PRO B CB    1 
ATOM   1798  C  CG    . PRO B  2  7    ? 63.027  136.252 131.517 1.00 49.72  ? 6    PRO B CG    1 
ATOM   1799  C  CD    . PRO B  2  7    ? 64.047  136.006 130.433 1.00 49.13  ? 6    PRO B CD    1 
ATOM   1800  N  N     . ARG B  2  8    ? 59.915  136.299 127.997 1.00 42.18  ? 7    ARG B N     1 
ATOM   1801  C  CA    . ARG B  2  8    ? 59.332  136.952 126.838 1.00 38.80  ? 7    ARG B CA    1 
ATOM   1802  C  C     . ARG B  2  8    ? 59.358  138.454 127.013 1.00 37.79  ? 7    ARG B C     1 
ATOM   1803  O  O     . ARG B  2  8    ? 59.568  138.953 128.111 1.00 38.14  ? 7    ARG B O     1 
ATOM   1804  C  CB    . ARG B  2  8    ? 57.911  136.434 126.530 1.00 38.64  ? 7    ARG B CB    1 
ATOM   1805  C  CG    . ARG B  2  8    ? 56.931  136.242 127.677 1.00 38.99  ? 7    ARG B CG    1 
ATOM   1806  C  CD    . ARG B  2  8    ? 56.029  137.463 127.946 1.00 40.04  ? 7    ARG B CD    1 
ATOM   1807  N  NE    . ARG B  2  8    ? 55.485  138.125 126.753 1.00 40.02  ? 7    ARG B NE    1 
ATOM   1808  C  CZ    . ARG B  2  8    ? 54.855  137.511 125.755 1.00 39.44  ? 7    ARG B CZ    1 
ATOM   1809  N  NH1   . ARG B  2  8    ? 54.682  136.201 125.784 1.00 40.00  ? 7    ARG B NH1   1 
ATOM   1810  N  NH2   . ARG B  2  8    ? 54.395  138.210 124.725 1.00 37.79  ? 7    ARG B NH2   1 
ATOM   1811  N  N     . LYS B  2  9    ? 59.182  139.180 125.919 1.00 38.30  ? 8    LYS B N     1 
ATOM   1812  C  CA    . LYS B  2  9    ? 59.213  140.640 125.962 1.00 38.12  ? 8    LYS B CA    1 
ATOM   1813  C  C     . LYS B  2  9    ? 57.891  141.264 126.370 1.00 36.99  ? 8    LYS B C     1 
ATOM   1814  O  O     . LYS B  2  9    ? 56.872  141.076 125.711 1.00 35.52  ? 8    LYS B O     1 
ATOM   1815  C  CB    . LYS B  2  9    ? 59.633  141.188 124.601 1.00 38.05  ? 8    LYS B CB    1 
ATOM   1816  C  CG    . LYS B  2  9    ? 60.826  140.465 124.012 1.00 40.88  ? 8    LYS B CG    1 
ATOM   1817  C  CD    . LYS B  2  9    ? 62.062  140.577 124.891 1.00 41.70  ? 8    LYS B CD    1 
ATOM   1818  C  CE    . LYS B  2  9    ? 63.179  139.697 124.371 1.00 42.24  ? 8    LYS B CE    1 
ATOM   1819  N  NZ    . LYS B  2  9    ? 64.453  139.970 125.077 1.00 46.01  ? 8    LYS B NZ    1 
ATOM   1820  N  N     . GLY B  2  10   ? 57.919  142.012 127.466 1.00 36.89  ? 9    GLY B N     1 
ATOM   1821  C  CA    . GLY B  2  10   ? 56.716  142.665 127.943 1.00 37.09  ? 9    GLY B CA    1 
ATOM   1822  C  C     . GLY B  2  10   ? 55.749  141.763 128.695 1.00 37.06  ? 9    GLY B C     1 
ATOM   1823  O  O     . GLY B  2  10   ? 55.822  140.530 128.608 1.00 34.88  ? 9    GLY B O     1 
ATOM   1824  N  N     . SER B  2  11   ? 54.838  142.391 129.438 1.00 36.56  ? 10   SER B N     1 
ATOM   1825  C  CA    . SER B  2  11   ? 53.847  141.662 130.209 1.00 34.41  ? 10   SER B CA    1 
ATOM   1826  C  C     . SER B  2  11   ? 52.632  141.385 129.352 1.00 34.16  ? 10   SER B C     1 
ATOM   1827  O  O     . SER B  2  11   ? 52.218  142.218 128.549 1.00 32.84  ? 10   SER B O     1 
ATOM   1828  C  CB    . SER B  2  11   ? 53.420  142.458 131.440 1.00 35.11  ? 10   SER B CB    1 
ATOM   1829  O  OG    . SER B  2  11   ? 52.363  141.796 132.113 1.00 35.20  ? 10   SER B OG    1 
ATOM   1830  N  N     . LEU B  2  12   ? 52.071  140.199 129.538 1.00 34.42  ? 11   LEU B N     1 
ATOM   1831  C  CA    . LEU B  2  12   ? 50.897  139.758 128.807 1.00 34.11  ? 11   LEU B CA    1 
ATOM   1832  C  C     . LEU B  2  12   ? 49.694  140.040 129.691 1.00 36.09  ? 11   LEU B C     1 
ATOM   1833  O  O     . LEU B  2  12   ? 48.584  139.599 129.399 1.00 37.59  ? 11   LEU B O     1 
ATOM   1834  C  CB    . LEU B  2  12   ? 51.001  138.257 128.542 1.00 32.83  ? 11   LEU B CB    1 
ATOM   1835  C  CG    . LEU B  2  12   ? 51.086  137.712 127.114 1.00 32.22  ? 11   LEU B CG    1 
ATOM   1836  C  CD1   . LEU B  2  12   ? 51.923  138.617 126.235 1.00 31.49  ? 11   LEU B CD1   1 
ATOM   1837  C  CD2   . LEU B  2  12   ? 51.662  136.301 127.169 1.00 29.91  ? 11   LEU B CD2   1 
ATOM   1838  N  N     . GLY B  2  13   ? 49.924  140.787 130.768 1.00 36.97  ? 12   GLY B N     1 
ATOM   1839  C  CA    . GLY B  2  13   ? 48.855  141.096 131.697 1.00 37.12  ? 12   GLY B CA    1 
ATOM   1840  C  C     . GLY B  2  13   ? 48.140  142.420 131.524 1.00 36.85  ? 12   GLY B C     1 
ATOM   1841  O  O     . GLY B  2  13   ? 47.135  142.656 132.185 1.00 38.21  ? 12   GLY B O     1 
ATOM   1842  N  N     . PHE B  2  14   ? 48.635  143.290 130.656 1.00 36.49  ? 13   PHE B N     1 
ATOM   1843  C  CA    . PHE B  2  14   ? 47.980  144.579 130.451 1.00 37.63  ? 13   PHE B CA    1 
ATOM   1844  C  C     . PHE B  2  14   ? 47.318  144.639 129.086 1.00 37.69  ? 13   PHE B C     1 
ATOM   1845  O  O     . PHE B  2  14   ? 47.216  145.706 128.479 1.00 37.48  ? 13   PHE B O     1 
ATOM   1846  C  CB    . PHE B  2  14   ? 48.986  145.726 130.561 1.00 38.10  ? 13   PHE B CB    1 
ATOM   1847  C  CG    . PHE B  2  14   ? 49.677  145.804 131.885 1.00 39.20  ? 13   PHE B CG    1 
ATOM   1848  C  CD1   . PHE B  2  14   ? 50.724  144.941 132.189 1.00 39.95  ? 13   PHE B CD1   1 
ATOM   1849  C  CD2   . PHE B  2  14   ? 49.277  146.739 132.833 1.00 39.28  ? 13   PHE B CD2   1 
ATOM   1850  C  CE1   . PHE B  2  14   ? 51.367  145.006 133.419 1.00 39.39  ? 13   PHE B CE1   1 
ATOM   1851  C  CE2   . PHE B  2  14   ? 49.909  146.814 134.064 1.00 39.86  ? 13   PHE B CE2   1 
ATOM   1852  C  CZ    . PHE B  2  14   ? 50.959  145.945 134.359 1.00 40.02  ? 13   PHE B CZ    1 
ATOM   1853  N  N     . GLY B  2  15   ? 46.856  143.493 128.609 1.00 38.04  ? 14   GLY B N     1 
ATOM   1854  C  CA    . GLY B  2  15   ? 46.243  143.458 127.300 1.00 37.77  ? 14   GLY B CA    1 
ATOM   1855  C  C     . GLY B  2  15   ? 44.744  143.300 127.259 1.00 37.54  ? 14   GLY B C     1 
ATOM   1856  O  O     . GLY B  2  15   ? 44.110  143.111 128.290 1.00 37.87  ? 14   GLY B O     1 
ATOM   1857  N  N     . PRO B  2  16   ? 44.146  143.420 126.063 1.00 38.31  ? 15   PRO B N     1 
ATOM   1858  C  CA    . PRO B  2  16   ? 44.934  143.701 124.862 1.00 37.26  ? 15   PRO B CA    1 
ATOM   1859  C  C     . PRO B  2  16   ? 45.433  145.127 124.991 1.00 37.50  ? 15   PRO B C     1 
ATOM   1860  O  O     . PRO B  2  16   ? 44.901  145.892 125.792 1.00 38.04  ? 15   PRO B O     1 
ATOM   1861  C  CB    . PRO B  2  16   ? 43.925  143.520 123.733 1.00 37.01  ? 15   PRO B CB    1 
ATOM   1862  C  CG    . PRO B  2  16   ? 42.637  143.897 124.370 1.00 38.13  ? 15   PRO B CG    1 
ATOM   1863  C  CD    . PRO B  2  16   ? 42.725  143.239 125.723 1.00 38.80  ? 15   PRO B CD    1 
ATOM   1864  N  N     . ARG B  2  17   ? 46.456  145.486 124.230 1.00 36.01  ? 16   ARG B N     1 
ATOM   1865  C  CA    . ARG B  2  17   ? 46.994  146.825 124.322 1.00 35.79  ? 16   ARG B CA    1 
ATOM   1866  C  C     . ARG B  2  17   ? 46.246  147.784 123.417 1.00 36.68  ? 16   ARG B C     1 
ATOM   1867  O  O     . ARG B  2  17   ? 46.810  148.273 122.446 1.00 38.77  ? 16   ARG B O     1 
ATOM   1868  C  CB    . ARG B  2  17   ? 48.464  146.808 123.948 1.00 34.60  ? 16   ARG B CB    1 
ATOM   1869  C  CG    . ARG B  2  17   ? 49.400  147.300 125.035 1.00 34.58  ? 16   ARG B CG    1 
ATOM   1870  C  CD    . ARG B  2  17   ? 49.682  146.237 126.084 1.00 32.58  ? 16   ARG B CD    1 
ATOM   1871  N  NE    . ARG B  2  17   ? 51.059  146.349 126.557 1.00 31.33  ? 16   ARG B NE    1 
ATOM   1872  C  CZ    . ARG B  2  17   ? 51.637  145.503 127.400 1.00 30.34  ? 16   ARG B CZ    1 
ATOM   1873  N  NH1   . ARG B  2  17   ? 50.953  144.477 127.878 1.00 30.70  ? 16   ARG B NH1   1 
ATOM   1874  N  NH2   . ARG B  2  17   ? 52.909  145.665 127.739 1.00 28.49  ? 16   ARG B NH2   1 
ATOM   1875  N  N     . LYS B  2  18   ? 44.987  148.068 123.752 1.00 37.30  ? 17   LYS B N     1 
ATOM   1876  C  CA    . LYS B  2  18   ? 44.135  148.959 122.957 1.00 38.36  ? 17   LYS B CA    1 
ATOM   1877  C  C     . LYS B  2  18   ? 43.947  150.328 123.595 1.00 39.30  ? 17   LYS B C     1 
ATOM   1878  O  O     . LYS B  2  18   ? 44.375  150.553 124.720 1.00 41.38  ? 17   LYS B O     1 
ATOM   1879  C  CB    . LYS B  2  18   ? 42.765  148.326 122.793 1.00 37.82  ? 17   LYS B CB    1 
ATOM   1880  C  CG    . LYS B  2  18   ? 42.093  148.062 124.130 1.00 40.02  ? 17   LYS B CG    1 
ATOM   1881  C  CD    . LYS B  2  18   ? 40.688  147.509 123.968 1.00 41.22  ? 17   LYS B CD    1 
ATOM   1882  C  CE    . LYS B  2  18   ? 39.765  148.548 123.364 1.00 42.39  ? 17   LYS B CE    1 
ATOM   1883  N  NZ    . LYS B  2  18   ? 38.407  148.002 123.144 1.00 42.10  ? 17   LYS B NZ    1 
ATOM   1884  N  N     . ARG B  2  19   ? 43.293  151.241 122.879 1.00 40.62  ? 18   ARG B N     1 
ATOM   1885  C  CA    . ARG B  2  19   ? 43.030  152.580 123.413 1.00 40.41  ? 18   ARG B CA    1 
ATOM   1886  C  C     . ARG B  2  19   ? 41.950  152.438 124.466 1.00 40.59  ? 18   ARG B C     1 
ATOM   1887  O  O     . ARG B  2  19   ? 41.081  151.568 124.358 1.00 40.31  ? 18   ARG B O     1 
ATOM   1888  C  CB    . ARG B  2  19   ? 42.540  153.528 122.323 1.00 39.02  ? 18   ARG B CB    1 
ATOM   1889  C  CG    . ARG B  2  19   ? 43.548  153.794 121.244 1.00 40.99  ? 18   ARG B CG    1 
ATOM   1890  C  CD    . ARG B  2  19   ? 42.942  154.647 120.155 1.00 45.03  ? 18   ARG B CD    1 
ATOM   1891  N  NE    . ARG B  2  19   ? 43.882  154.892 119.065 1.00 49.04  ? 18   ARG B NE    1 
ATOM   1892  C  CZ    . ARG B  2  19   ? 43.601  155.606 117.979 1.00 50.12  ? 18   ARG B CZ    1 
ATOM   1893  N  NH1   . ARG B  2  19   ? 42.402  156.156 117.832 1.00 50.63  ? 18   ARG B NH1   1 
ATOM   1894  N  NH2   . ARG B  2  19   ? 44.517  155.759 117.032 1.00 49.79  ? 18   ARG B NH2   1 
ATOM   1895  N  N     . SER B  2  20   ? 42.002  153.295 125.479 1.00 41.60  ? 19   SER B N     1 
ATOM   1896  C  CA    . SER B  2  20   ? 41.037  153.246 126.568 1.00 41.67  ? 19   SER B CA    1 
ATOM   1897  C  C     . SER B  2  20   ? 39.687  153.870 126.233 1.00 42.46  ? 19   SER B C     1 
ATOM   1898  O  O     . SER B  2  20   ? 39.597  154.907 125.574 1.00 41.36  ? 19   SER B O     1 
ATOM   1899  C  CB    . SER B  2  20   ? 41.617  153.919 127.812 1.00 40.47  ? 19   SER B CB    1 
ATOM   1900  O  OG    . SER B  2  20   ? 40.854  153.603 128.963 1.00 39.58  ? 19   SER B OG    1 
ATOM   1901  N  N     . THR B  2  21   ? 38.636  153.210 126.699 1.00 44.61  ? 20   THR B N     1 
ATOM   1902  C  CA    . THR B  2  21   ? 37.279  153.669 126.489 1.00 45.87  ? 20   THR B CA    1 
ATOM   1903  C  C     . THR B  2  21   ? 37.069  154.955 127.280 1.00 46.95  ? 20   THR B C     1 
ATOM   1904  O  O     . THR B  2  21   ? 36.621  155.963 126.736 1.00 49.36  ? 20   THR B O     1 
ATOM   1905  C  CB    . THR B  2  21   ? 36.277  152.626 126.983 1.00 46.92  ? 20   THR B CB    1 
ATOM   1906  O  OG1   . THR B  2  21   ? 36.442  151.410 126.240 1.00 47.17  ? 20   THR B OG1   1 
ATOM   1907  C  CG2   . THR B  2  21   ? 34.849  153.148 126.831 1.00 48.78  ? 20   THR B CG2   1 
ATOM   1908  N  N     . SER B  2  22   ? 37.395  154.916 128.569 1.00 46.73  ? 21   SER B N     1 
ATOM   1909  C  CA    . SER B  2  22   ? 37.236  156.083 129.431 1.00 46.51  ? 21   SER B CA    1 
ATOM   1910  C  C     . SER B  2  22   ? 38.568  156.714 129.759 1.00 45.99  ? 21   SER B C     1 
ATOM   1911  O  O     . SER B  2  22   ? 39.454  156.042 130.280 1.00 46.52  ? 21   SER B O     1 
ATOM   1912  C  CB    . SER B  2  22   ? 36.564  155.701 130.756 1.00 47.22  ? 21   SER B CB    1 
ATOM   1913  O  OG    . SER B  2  22   ? 35.198  155.364 130.594 1.00 49.15  ? 21   SER B OG    1 
ATOM   1914  N  N     . GLU B  2  23   ? 38.716  158.000 129.460 1.00 45.57  ? 22   GLU B N     1 
ATOM   1915  C  CA    . GLU B  2  23   ? 39.954  158.689 129.802 1.00 44.52  ? 22   GLU B CA    1 
ATOM   1916  C  C     . GLU B  2  23   ? 39.920  158.836 131.328 1.00 42.91  ? 22   GLU B C     1 
ATOM   1917  O  O     . GLU B  2  23   ? 40.949  159.011 131.978 1.00 41.30  ? 22   GLU B O     1 
ATOM   1918  C  CB    . GLU B  2  23   ? 40.021  160.061 129.134 1.00 46.11  ? 22   GLU B CB    1 
ATOM   1919  C  CG    . GLU B  2  23   ? 41.368  160.757 129.278 1.00 45.98  ? 22   GLU B CG    1 
ATOM   1920  C  CD    . GLU B  2  23   ? 41.504  161.926 128.322 1.00 47.69  ? 22   GLU B CD    1 
ATOM   1921  O  OE1   . GLU B  2  23   ? 41.357  161.704 127.098 1.00 48.03  ? 22   GLU B OE1   1 
ATOM   1922  O  OE2   . GLU B  2  23   ? 41.754  163.061 128.786 1.00 46.89  ? 22   GLU B OE2   1 
ATOM   1923  N  N     . THR B  2  24   ? 38.717  158.777 131.892 1.00 41.04  ? 23   THR B N     1 
ATOM   1924  C  CA    . THR B  2  24   ? 38.567  158.839 133.338 1.00 39.23  ? 23   THR B CA    1 
ATOM   1925  C  C     . THR B  2  24   ? 38.838  157.412 133.807 1.00 37.23  ? 23   THR B C     1 
ATOM   1926  O  O     . THR B  2  24   ? 38.212  156.457 133.350 1.00 36.53  ? 23   THR B O     1 
ATOM   1927  C  CB    . THR B  2  24   ? 37.139  159.281 133.766 1.00 38.87  ? 23   THR B CB    1 
ATOM   1928  O  OG1   . THR B  2  24   ? 36.992  160.694 133.569 1.00 36.44  ? 23   THR B OG1   1 
ATOM   1929  C  CG2   . THR B  2  24   ? 36.892  158.955 135.237 1.00 37.09  ? 23   THR B CG2   1 
ATOM   1930  N  N     . PRO B  2  25   ? 39.800  157.250 134.710 1.00 35.69  ? 24   PRO B N     1 
ATOM   1931  C  CA    . PRO B  2  25   ? 40.121  155.912 135.200 1.00 35.21  ? 24   PRO B CA    1 
ATOM   1932  C  C     . PRO B  2  25   ? 38.931  155.298 135.904 1.00 34.37  ? 24   PRO B C     1 
ATOM   1933  O  O     . PRO B  2  25   ? 38.076  156.025 136.413 1.00 34.83  ? 24   PRO B O     1 
ATOM   1934  C  CB    . PRO B  2  25   ? 41.281  156.169 136.147 1.00 36.46  ? 24   PRO B CB    1 
ATOM   1935  C  CG    . PRO B  2  25   ? 41.887  157.461 135.623 1.00 36.69  ? 24   PRO B CG    1 
ATOM   1936  C  CD    . PRO B  2  25   ? 40.685  158.266 135.300 1.00 35.77  ? 24   PRO B CD    1 
ATOM   1937  N  N     . ARG B  2  26   ? 38.883  153.964 135.934 1.00 33.42  ? 25   ARG B N     1 
ATOM   1938  C  CA    . ARG B  2  26   ? 37.794  153.225 136.584 1.00 33.05  ? 25   ARG B CA    1 
ATOM   1939  C  C     . ARG B  2  26   ? 38.296  152.092 137.490 1.00 33.03  ? 25   ARG B C     1 
ATOM   1940  O  O     . ARG B  2  26   ? 38.499  150.975 137.028 1.00 32.74  ? 25   ARG B O     1 
ATOM   1941  C  CB    . ARG B  2  26   ? 36.859  152.631 135.534 1.00 32.23  ? 25   ARG B CB    1 
ATOM   1942  C  CG    . ARG B  2  26   ? 36.381  153.608 134.476 1.00 32.15  ? 25   ARG B CG    1 
ATOM   1943  C  CD    . ARG B  2  26   ? 35.561  154.724 135.059 1.00 31.32  ? 25   ARG B CD    1 
ATOM   1944  N  NE    . ARG B  2  26   ? 34.897  155.477 134.007 1.00 33.03  ? 25   ARG B NE    1 
ATOM   1945  C  CZ    . ARG B  2  26   ? 33.982  156.412 134.224 1.00 33.92  ? 25   ARG B CZ    1 
ATOM   1946  N  NH1   . ARG B  2  26   ? 33.617  156.718 135.463 1.00 33.58  ? 25   ARG B NH1   1 
ATOM   1947  N  NH2   . ARG B  2  26   ? 33.421  157.030 133.196 1.00 35.77  ? 25   ARG B NH2   1 
ATOM   1948  N  N     . PHE B  2  27   ? 38.470  152.385 138.777 1.00 33.88  ? 26   PHE B N     1 
ATOM   1949  C  CA    . PHE B  2  27   ? 38.957  151.415 139.753 1.00 35.71  ? 26   PHE B CA    1 
ATOM   1950  C  C     . PHE B  2  27   ? 38.212  150.107 139.732 1.00 38.61  ? 26   PHE B C     1 
ATOM   1951  O  O     . PHE B  2  27   ? 36.991  150.089 139.889 1.00 40.14  ? 26   PHE B O     1 
ATOM   1952  C  CB    . PHE B  2  27   ? 38.861  151.970 141.174 1.00 33.23  ? 26   PHE B CB    1 
ATOM   1953  C  CG    . PHE B  2  27   ? 39.906  152.980 141.499 1.00 31.01  ? 26   PHE B CG    1 
ATOM   1954  C  CD1   . PHE B  2  27   ? 39.607  154.326 141.505 1.00 29.63  ? 26   PHE B CD1   1 
ATOM   1955  C  CD2   . PHE B  2  27   ? 41.201  152.582 141.791 1.00 31.38  ? 26   PHE B CD2   1 
ATOM   1956  C  CE1   . PHE B  2  27   ? 40.585  155.268 141.798 1.00 30.96  ? 26   PHE B CE1   1 
ATOM   1957  C  CE2   . PHE B  2  27   ? 42.185  153.516 142.085 1.00 32.37  ? 26   PHE B CE2   1 
ATOM   1958  C  CZ    . PHE B  2  27   ? 41.874  154.865 142.087 1.00 31.08  ? 26   PHE B CZ    1 
ATOM   1959  N  N     . ASN B  2  28   ? 38.939  149.006 139.566 1.00 41.83  ? 27   ASN B N     1 
ATOM   1960  C  CA    . ASN B  2  28   ? 38.289  147.703 139.555 1.00 46.18  ? 27   ASN B CA    1 
ATOM   1961  C  C     . ASN B  2  28   ? 38.381  147.052 140.930 1.00 47.52  ? 27   ASN B C     1 
ATOM   1962  O  O     . ASN B  2  28   ? 38.073  145.874 141.089 1.00 48.08  ? 27   ASN B O     1 
ATOM   1963  C  CB    . ASN B  2  28   ? 38.925  146.774 138.523 1.00 47.57  ? 27   ASN B CB    1 
ATOM   1964  C  CG    . ASN B  2  28   ? 40.228  146.192 139.001 1.00 49.97  ? 27   ASN B CG    1 
ATOM   1965  O  OD1   . ASN B  2  28   ? 40.646  145.120 138.558 1.00 50.18  ? 27   ASN B OD1   1 
ATOM   1966  N  ND2   . ASN B  2  28   ? 40.888  146.901 139.911 1.00 52.08  ? 27   ASN B ND2   1 
ATOM   1967  N  N     . SER B  2  29   ? 38.812  147.817 141.924 1.00 49.19  ? 28   SER B N     1 
ATOM   1968  C  CA    . SER B  2  29   ? 38.932  147.286 143.268 1.00 51.17  ? 28   SER B CA    1 
ATOM   1969  C  C     . SER B  2  29   ? 38.854  148.392 144.301 1.00 51.37  ? 28   SER B C     1 
ATOM   1970  O  O     . SER B  2  29   ? 39.382  149.486 144.090 1.00 50.80  ? 28   SER B O     1 
ATOM   1971  C  CB    . SER B  2  29   ? 40.253  146.538 143.412 1.00 54.01  ? 28   SER B CB    1 
ATOM   1972  O  OG    . SER B  2  29   ? 40.506  146.189 144.764 1.00 59.61  ? 28   SER B OG    1 
ATOM   1973  N  N     . TRP B  2  30   ? 38.191  148.092 145.417 1.00 52.19  ? 29   TRP B N     1 
ATOM   1974  C  CA    . TRP B  2  30   ? 38.022  149.050 146.508 1.00 52.30  ? 29   TRP B CA    1 
ATOM   1975  C  C     . TRP B  2  30   ? 38.485  148.498 147.849 1.00 51.78  ? 29   TRP B C     1 
ATOM   1976  O  O     . TRP B  2  30   ? 38.413  147.290 148.097 1.00 51.68  ? 29   TRP B O     1 
ATOM   1977  C  CB    . TRP B  2  30   ? 36.554  149.466 146.641 1.00 52.36  ? 29   TRP B CB    1 
ATOM   1978  C  CG    . TRP B  2  30   ? 35.991  150.118 145.433 1.00 51.20  ? 29   TRP B CG    1 
ATOM   1979  C  CD1   . TRP B  2  30   ? 35.184  149.551 144.497 1.00 50.60  ? 29   TRP B CD1   1 
ATOM   1980  C  CD2   . TRP B  2  30   ? 36.216  151.462 145.010 1.00 51.40  ? 29   TRP B CD2   1 
ATOM   1981  N  NE1   . TRP B  2  30   ? 34.891  150.459 143.512 1.00 50.85  ? 29   TRP B NE1   1 
ATOM   1982  C  CE2   . TRP B  2  30   ? 35.514  151.643 143.802 1.00 51.10  ? 29   TRP B CE2   1 
ATOM   1983  C  CE3   . TRP B  2  30   ? 36.946  152.535 145.536 1.00 51.76  ? 29   TRP B CE3   1 
ATOM   1984  C  CZ2   . TRP B  2  30   ? 35.517  152.855 143.106 1.00 51.96  ? 29   TRP B CZ2   1 
ATOM   1985  C  CZ3   . TRP B  2  30   ? 36.950  153.743 144.841 1.00 53.59  ? 29   TRP B CZ3   1 
ATOM   1986  C  CH2   . TRP B  2  30   ? 36.239  153.891 143.638 1.00 52.52  ? 29   TRP B CH2   1 
ATOM   1987  N  N     . PRO B  2  31   ? 38.946  149.388 148.742 1.00 52.01  ? 30   PRO B N     1 
ATOM   1988  C  CA    . PRO B  2  31   ? 39.426  149.009 150.075 1.00 52.93  ? 30   PRO B CA    1 
ATOM   1989  C  C     . PRO B  2  31   ? 38.437  148.145 150.876 1.00 54.19  ? 30   PRO B C     1 
ATOM   1990  O  O     . PRO B  2  31   ? 37.317  147.870 150.431 1.00 52.34  ? 30   PRO B O     1 
ATOM   1991  C  CB    . PRO B  2  31   ? 39.694  150.359 150.734 1.00 52.23  ? 30   PRO B CB    1 
ATOM   1992  C  CG    . PRO B  2  31   ? 40.113  151.214 149.573 1.00 51.29  ? 30   PRO B CG    1 
ATOM   1993  C  CD    . PRO B  2  31   ? 39.104  150.837 148.521 1.00 51.40  ? 30   PRO B CD    1 
ATOM   1994  N  N     . SER B  2  32   ? 38.873  147.711 152.055 1.00 55.87  ? 31   SER B N     1 
ATOM   1995  C  CA    . SER B  2  32   ? 38.043  146.887 152.918 1.00 57.56  ? 31   SER B CA    1 
ATOM   1996  C  C     . SER B  2  32   ? 37.309  147.760 153.926 1.00 60.16  ? 31   SER B C     1 
ATOM   1997  O  O     . SER B  2  32   ? 37.716  148.887 154.200 1.00 59.99  ? 31   SER B O     1 
ATOM   1998  C  CB    . SER B  2  32   ? 38.901  145.850 153.638 1.00 56.55  ? 31   SER B CB    1 
ATOM   1999  O  OG    . SER B  2  32   ? 39.996  146.465 154.287 1.00 55.32  ? 31   SER B OG    1 
ATOM   2000  N  N     . ASP B  2  33   ? 36.229  147.227 154.481 1.00 63.16  ? 32   ASP B N     1 
ATOM   2001  C  CA    . ASP B  2  33   ? 35.407  147.957 155.440 1.00 66.66  ? 32   ASP B CA    1 
ATOM   2002  C  C     . ASP B  2  33   ? 35.851  147.825 156.899 1.00 69.08  ? 32   ASP B C     1 
ATOM   2003  O  O     . ASP B  2  33   ? 35.709  146.762 157.509 1.00 69.14  ? 32   ASP B O     1 
ATOM   2004  C  CB    . ASP B  2  33   ? 33.961  147.486 155.299 1.00 67.33  ? 32   ASP B CB    1 
ATOM   2005  C  CG    . ASP B  2  33   ? 33.470  147.547 153.867 1.00 66.90  ? 32   ASP B CG    1 
ATOM   2006  O  OD1   . ASP B  2  33   ? 33.265  148.669 153.350 1.00 66.58  ? 32   ASP B OD1   1 
ATOM   2007  O  OD2   . ASP B  2  33   ? 33.299  146.468 153.259 1.00 66.81  ? 32   ASP B OD2   1 
ATOM   2008  N  N     . ASP B  2  34   ? 36.355  148.919 157.466 1.00 72.15  ? 33   ASP B N     1 
ATOM   2009  C  CA    . ASP B  2  34   ? 36.815  148.902 158.851 1.00 75.48  ? 33   ASP B CA    1 
ATOM   2010  C  C     . ASP B  2  34   ? 36.183  149.945 159.765 1.00 76.07  ? 33   ASP B C     1 
ATOM   2011  O  O     . ASP B  2  34   ? 35.055  149.790 160.254 1.00 75.58  ? 33   ASP B O     1 
ATOM   2012  C  CB    . ASP B  2  34   ? 38.325  149.098 158.902 1.00 77.54  ? 33   ASP B CB    1 
ATOM   2013  C  CG    . ASP B  2  34   ? 39.055  148.185 157.966 1.00 80.62  ? 33   ASP B CG    1 
ATOM   2014  O  OD1   . ASP B  2  34   ? 38.885  146.948 158.087 1.00 81.52  ? 33   ASP B OD1   1 
ATOM   2015  O  OD2   . ASP B  2  34   ? 39.802  148.711 157.110 1.00 84.03  ? 33   ASP B OD2   1 
ATOM   2016  N  N     . GLY B  2  35   ? 36.954  151.005 159.998 1.00 77.19  ? 34   GLY B N     1 
ATOM   2017  C  CA    . GLY B  2  35   ? 36.534  152.083 160.869 1.00 77.87  ? 34   GLY B CA    1 
ATOM   2018  C  C     . GLY B  2  35   ? 35.298  152.807 160.403 1.00 77.74  ? 34   GLY B C     1 
ATOM   2019  O  O     . GLY B  2  35   ? 34.509  152.281 159.621 1.00 78.00  ? 34   GLY B O     1 
ATOM   2020  N  N     . GLN B  2  36   ? 35.127  154.025 160.899 1.00 77.41  ? 35   GLN B N     1 
ATOM   2021  C  CA    . GLN B  2  36   ? 33.978  154.824 160.527 1.00 77.06  ? 35   GLN B CA    1 
ATOM   2022  C  C     . GLN B  2  36   ? 33.837  154.789 159.015 1.00 74.98  ? 35   GLN B C     1 
ATOM   2023  O  O     . GLN B  2  36   ? 34.825  154.641 158.293 1.00 74.58  ? 35   GLN B O     1 
ATOM   2024  C  CB    . GLN B  2  36   ? 34.166  156.268 160.986 1.00 79.02  ? 35   GLN B CB    1 
ATOM   2025  C  CG    . GLN B  2  36   ? 34.540  156.414 162.450 1.00 82.10  ? 35   GLN B CG    1 
ATOM   2026  C  CD    . GLN B  2  36   ? 34.750  157.867 162.849 1.00 83.75  ? 35   GLN B CD    1 
ATOM   2027  O  OE1   . GLN B  2  36   ? 35.566  158.581 162.252 1.00 83.75  ? 35   GLN B OE1   1 
ATOM   2028  N  NE2   . GLN B  2  36   ? 34.013  158.314 163.864 1.00 84.60  ? 35   GLN B NE2   1 
ATOM   2029  N  N     . PRO B  2  37   ? 32.600  154.892 158.516 1.00 72.96  ? 36   PRO B N     1 
ATOM   2030  C  CA    . PRO B  2  37   ? 32.385  154.875 157.072 1.00 71.07  ? 36   PRO B CA    1 
ATOM   2031  C  C     . PRO B  2  37   ? 33.091  156.068 156.450 1.00 69.43  ? 36   PRO B C     1 
ATOM   2032  O  O     . PRO B  2  37   ? 33.572  156.949 157.160 1.00 69.65  ? 36   PRO B O     1 
ATOM   2033  C  CB    . PRO B  2  37   ? 30.872  154.966 156.960 1.00 71.38  ? 36   PRO B CB    1 
ATOM   2034  C  CG    . PRO B  2  37   ? 30.419  154.207 158.161 1.00 72.02  ? 36   PRO B CG    1 
ATOM   2035  C  CD    . PRO B  2  37   ? 31.317  154.782 159.228 1.00 72.88  ? 36   PRO B CD    1 
ATOM   2036  N  N     . GLY B  2  38   ? 33.154  156.096 155.126 1.00 67.35  ? 37   GLY B N     1 
ATOM   2037  C  CA    . GLY B  2  38   ? 33.806  157.200 154.452 1.00 64.13  ? 37   GLY B CA    1 
ATOM   2038  C  C     . GLY B  2  38   ? 34.024  156.849 153.002 1.00 62.19  ? 37   GLY B C     1 
ATOM   2039  O  O     . GLY B  2  38   ? 34.193  155.680 152.667 1.00 62.48  ? 37   GLY B O     1 
ATOM   2040  N  N     . VAL B  2  39   ? 34.008  157.855 152.137 1.00 60.25  ? 38   VAL B N     1 
ATOM   2041  C  CA    . VAL B  2  39   ? 34.215  157.623 150.715 1.00 58.74  ? 38   VAL B CA    1 
ATOM   2042  C  C     . VAL B  2  39   ? 35.615  157.072 150.488 1.00 56.30  ? 38   VAL B C     1 
ATOM   2043  O  O     . VAL B  2  39   ? 36.589  157.551 151.078 1.00 55.27  ? 38   VAL B O     1 
ATOM   2044  C  CB    . VAL B  2  39   ? 34.062  158.917 149.908 1.00 60.08  ? 38   VAL B CB    1 
ATOM   2045  C  CG1   . VAL B  2  39   ? 34.239  158.621 148.432 1.00 60.35  ? 38   VAL B CG1   1 
ATOM   2046  C  CG2   . VAL B  2  39   ? 32.700  159.534 150.172 1.00 61.09  ? 38   VAL B CG2   1 
ATOM   2047  N  N     . GLN B  2  40   ? 35.714  156.074 149.618 1.00 52.93  ? 39   GLN B N     1 
ATOM   2048  C  CA    . GLN B  2  40   ? 36.995  155.446 149.343 1.00 50.27  ? 39   GLN B CA    1 
ATOM   2049  C  C     . GLN B  2  40   ? 37.664  155.896 148.054 1.00 48.78  ? 39   GLN B C     1 
ATOM   2050  O  O     . GLN B  2  40   ? 37.891  155.094 147.154 1.00 48.50  ? 39   GLN B O     1 
ATOM   2051  C  CB    . GLN B  2  40   ? 36.821  153.930 149.332 1.00 49.74  ? 39   GLN B CB    1 
ATOM   2052  C  CG    . GLN B  2  40   ? 36.272  153.393 150.626 1.00 48.84  ? 39   GLN B CG    1 
ATOM   2053  C  CD    . GLN B  2  40   ? 36.120  151.893 150.607 1.00 50.41  ? 39   GLN B CD    1 
ATOM   2054  O  OE1   . GLN B  2  40   ? 35.305  151.343 149.858 1.00 50.08  ? 39   GLN B OE1   1 
ATOM   2055  N  NE2   . GLN B  2  40   ? 36.907  151.213 151.435 1.00 50.79  ? 39   GLN B NE2   1 
ATOM   2056  N  N     . GLY B  2  41   ? 37.996  157.178 147.973 1.00 46.27  ? 40   GLY B N     1 
ATOM   2057  C  CA    . GLY B  2  41   ? 38.645  157.671 146.779 1.00 43.89  ? 40   GLY B CA    1 
ATOM   2058  C  C     . GLY B  2  41   ? 38.331  159.121 146.512 1.00 43.04  ? 40   GLY B C     1 
ATOM   2059  O  O     . GLY B  2  41   ? 37.334  159.647 147.002 1.00 41.14  ? 40   GLY B O     1 
ATOM   2060  N  N     . PHE B  2  42   ? 39.192  159.758 145.723 1.00 42.97  ? 41   PHE B N     1 
ATOM   2061  C  CA    . PHE B  2  42   ? 39.043  161.165 145.361 1.00 42.29  ? 41   PHE B CA    1 
ATOM   2062  C  C     . PHE B  2  42   ? 39.753  161.403 144.017 1.00 40.44  ? 41   PHE B C     1 
ATOM   2063  O  O     . PHE B  2  42   ? 40.390  160.497 143.484 1.00 40.63  ? 41   PHE B O     1 
ATOM   2064  C  CB    . PHE B  2  42   ? 39.662  162.026 146.456 1.00 42.94  ? 41   PHE B CB    1 
ATOM   2065  C  CG    . PHE B  2  42   ? 39.273  163.473 146.389 1.00 45.48  ? 41   PHE B CG    1 
ATOM   2066  C  CD1   . PHE B  2  42   ? 37.993  163.878 146.760 1.00 44.63  ? 41   PHE B CD1   1 
ATOM   2067  C  CD2   . PHE B  2  42   ? 40.201  164.440 145.980 1.00 47.30  ? 41   PHE B CD2   1 
ATOM   2068  C  CE1   . PHE B  2  42   ? 37.639  165.218 146.731 1.00 45.36  ? 41   PHE B CE1   1 
ATOM   2069  C  CE2   . PHE B  2  42   ? 39.858  165.791 145.945 1.00 46.81  ? 41   PHE B CE2   1 
ATOM   2070  C  CZ    . PHE B  2  42   ? 38.575  166.181 146.322 1.00 47.15  ? 41   PHE B CZ    1 
ATOM   2071  N  N     . ALA B  2  43   ? 39.651  162.607 143.464 1.00 38.54  ? 42   ALA B N     1 
ATOM   2072  C  CA    . ALA B  2  43   ? 40.301  162.876 142.191 1.00 38.77  ? 42   ALA B CA    1 
ATOM   2073  C  C     . ALA B  2  43   ? 40.993  164.243 142.055 1.00 39.91  ? 42   ALA B C     1 
ATOM   2074  O  O     . ALA B  2  43   ? 40.657  165.215 142.743 1.00 41.57  ? 42   ALA B O     1 
ATOM   2075  C  CB    . ALA B  2  43   ? 39.299  162.692 141.065 1.00 36.57  ? 42   ALA B CB    1 
ATOM   2076  N  N     . GLY B  2  44   ? 41.964  164.303 141.149 1.00 40.01  ? 43   GLY B N     1 
ATOM   2077  C  CA    . GLY B  2  44   ? 42.686  165.537 140.912 1.00 39.63  ? 43   GLY B CA    1 
ATOM   2078  C  C     . GLY B  2  44   ? 43.134  165.644 139.467 1.00 39.57  ? 43   GLY B C     1 
ATOM   2079  O  O     . GLY B  2  44   ? 42.794  164.800 138.637 1.00 38.71  ? 43   GLY B O     1 
ATOM   2080  N  N     . TYR B  2  45   ? 43.888  166.695 139.163 1.00 39.41  ? 44   TYR B N     1 
ATOM   2081  C  CA    . TYR B  2  45   ? 44.397  166.916 137.818 1.00 40.23  ? 44   TYR B CA    1 
ATOM   2082  C  C     . TYR B  2  45   ? 45.902  167.108 137.897 1.00 40.34  ? 44   TYR B C     1 
ATOM   2083  O  O     . TYR B  2  45   ? 46.395  167.935 138.662 1.00 39.34  ? 44   TYR B O     1 
ATOM   2084  C  CB    . TYR B  2  45   ? 43.734  168.143 137.168 1.00 41.23  ? 44   TYR B CB    1 
ATOM   2085  C  CG    . TYR B  2  45   ? 42.272  167.934 136.806 1.00 41.29  ? 44   TYR B CG    1 
ATOM   2086  C  CD1   . TYR B  2  45   ? 41.252  168.161 137.738 1.00 40.81  ? 44   TYR B CD1   1 
ATOM   2087  C  CD2   . TYR B  2  45   ? 41.912  167.458 135.546 1.00 40.83  ? 44   TYR B CD2   1 
ATOM   2088  C  CE1   . TYR B  2  45   ? 39.908  167.914 137.420 1.00 40.52  ? 44   TYR B CE1   1 
ATOM   2089  C  CE2   . TYR B  2  45   ? 40.575  167.211 135.222 1.00 41.14  ? 44   TYR B CE2   1 
ATOM   2090  C  CZ    . TYR B  2  45   ? 39.581  167.438 136.160 1.00 39.96  ? 44   TYR B CZ    1 
ATOM   2091  O  OH    . TYR B  2  45   ? 38.275  167.182 135.832 1.00 36.66  ? 44   TYR B OH    1 
ATOM   2092  N  N     . LYS B  2  46   ? 46.629  166.320 137.109 1.00 41.60  ? 45   LYS B N     1 
ATOM   2093  C  CA    . LYS B  2  46   ? 48.083  166.384 137.096 1.00 40.82  ? 45   LYS B CA    1 
ATOM   2094  C  C     . LYS B  2  46   ? 48.574  167.738 136.635 1.00 40.42  ? 45   LYS B C     1 
ATOM   2095  O  O     . LYS B  2  46   ? 48.044  168.308 135.686 1.00 40.00  ? 45   LYS B O     1 
ATOM   2096  C  CB    . LYS B  2  46   ? 48.664  165.287 136.202 1.00 40.57  ? 45   LYS B CB    1 
ATOM   2097  C  CG    . LYS B  2  46   ? 50.172  165.380 136.043 1.00 42.69  ? 45   LYS B CG    1 
ATOM   2098  C  CD    . LYS B  2  46   ? 50.802  164.086 135.518 1.00 43.77  ? 45   LYS B CD    1 
ATOM   2099  C  CE    . LYS B  2  46   ? 52.315  164.255 135.369 1.00 44.40  ? 45   LYS B CE    1 
ATOM   2100  N  NZ    . LYS B  2  46   ? 53.041  162.961 135.261 1.00 45.86  ? 45   LYS B NZ    1 
ATOM   2101  N  N     . ALA B  2  47   ? 49.588  168.246 137.328 1.00 41.01  ? 46   ALA B N     1 
ATOM   2102  C  CA    . ALA B  2  47   ? 50.174  169.540 137.020 1.00 40.64  ? 46   ALA B CA    1 
ATOM   2103  C  C     . ALA B  2  47   ? 51.608  169.381 136.552 1.00 41.40  ? 46   ALA B C     1 
ATOM   2104  O  O     . ALA B  2  47   ? 52.003  169.977 135.552 1.00 41.70  ? 46   ALA B O     1 
ATOM   2105  C  CB    . ALA B  2  47   ? 50.128  170.430 138.242 1.00 39.48  ? 46   ALA B CB    1 
ATOM   2106  N  N     . GLY B  2  48   ? 52.383  168.576 137.279 1.00 42.56  ? 47   GLY B N     1 
ATOM   2107  C  CA    . GLY B  2  48   ? 53.780  168.358 136.931 1.00 43.91  ? 47   GLY B CA    1 
ATOM   2108  C  C     . GLY B  2  48   ? 54.603  167.792 138.078 1.00 44.80  ? 47   GLY B C     1 
ATOM   2109  O  O     . GLY B  2  48   ? 54.054  167.184 138.997 1.00 46.02  ? 47   GLY B O     1 
ATOM   2110  N  N     . MET B  2  49   ? 55.918  167.993 138.036 1.00 44.93  ? 48   MET B N     1 
ATOM   2111  C  CA    . MET B  2  49   ? 56.794  167.476 139.085 1.00 46.49  ? 48   MET B CA    1 
ATOM   2112  C  C     . MET B  2  49   ? 57.843  168.462 139.587 1.00 46.87  ? 48   MET B C     1 
ATOM   2113  O  O     . MET B  2  49   ? 58.146  169.454 138.925 1.00 47.69  ? 48   MET B O     1 
ATOM   2114  C  CB    . MET B  2  49   ? 57.543  166.244 138.590 1.00 47.21  ? 48   MET B CB    1 
ATOM   2115  C  CG    . MET B  2  49   ? 56.714  165.017 138.356 1.00 48.45  ? 48   MET B CG    1 
ATOM   2116  S  SD    . MET B  2  49   ? 57.815  163.684 137.834 1.00 50.82  ? 48   MET B SD    1 
ATOM   2117  C  CE    . MET B  2  49   ? 58.516  163.197 139.409 1.00 49.92  ? 48   MET B CE    1 
ATOM   2118  N  N     . THR B  2  50   ? 58.400  168.144 140.757 1.00 45.72  ? 49   THR B N     1 
ATOM   2119  C  CA    . THR B  2  50   ? 59.458  168.910 141.421 1.00 45.22  ? 49   THR B CA    1 
ATOM   2120  C  C     . THR B  2  50   ? 59.937  168.030 142.548 1.00 45.52  ? 49   THR B C     1 
ATOM   2121  O  O     . THR B  2  50   ? 59.215  167.129 142.976 1.00 45.24  ? 49   THR B O     1 
ATOM   2122  C  CB    . THR B  2  50   ? 58.974  170.197 142.107 1.00 44.96  ? 49   THR B CB    1 
ATOM   2123  O  OG1   . THR B  2  50   ? 57.806  169.909 142.880 1.00 45.40  ? 49   THR B OG1   1 
ATOM   2124  C  CG2   . THR B  2  50   ? 58.696  171.285 141.104 1.00 46.07  ? 49   THR B CG2   1 
ATOM   2125  N  N     . HIS B  2  51   ? 61.148  168.281 143.037 1.00 45.72  ? 50   HIS B N     1 
ATOM   2126  C  CA    . HIS B  2  51   ? 61.635  167.490 144.152 1.00 45.14  ? 50   HIS B CA    1 
ATOM   2127  C  C     . HIS B  2  51   ? 61.238  168.184 145.441 1.00 44.98  ? 50   HIS B C     1 
ATOM   2128  O  O     . HIS B  2  51   ? 60.673  169.283 145.428 1.00 45.36  ? 50   HIS B O     1 
ATOM   2129  C  CB    . HIS B  2  51   ? 63.155  167.266 144.091 1.00 43.43  ? 50   HIS B CB    1 
ATOM   2130  C  CG    . HIS B  2  51   ? 63.962  168.513 143.933 1.00 42.60  ? 50   HIS B CG    1 
ATOM   2131  N  ND1   . HIS B  2  51   ? 64.086  169.168 142.728 1.00 43.54  ? 50   HIS B ND1   1 
ATOM   2132  C  CD2   . HIS B  2  51   ? 64.732  169.195 144.814 1.00 43.76  ? 50   HIS B CD2   1 
ATOM   2133  C  CE1   . HIS B  2  51   ? 64.903  170.198 142.871 1.00 44.97  ? 50   HIS B CE1   1 
ATOM   2134  N  NE2   . HIS B  2  51   ? 65.309  170.237 144.128 1.00 44.24  ? 50   HIS B NE2   1 
ATOM   2135  N  N     . VAL B  2  52   ? 61.528  167.542 146.558 1.00 44.16  ? 51   VAL B N     1 
ATOM   2136  C  CA    . VAL B  2  52   ? 61.164  168.109 147.833 1.00 44.17  ? 51   VAL B CA    1 
ATOM   2137  C  C     . VAL B  2  52   ? 61.974  167.351 148.873 1.00 43.11  ? 51   VAL B C     1 
ATOM   2138  O  O     . VAL B  2  52   ? 61.977  166.128 148.879 1.00 42.66  ? 51   VAL B O     1 
ATOM   2139  C  CB    . VAL B  2  52   ? 59.629  167.941 148.038 1.00 43.67  ? 51   VAL B CB    1 
ATOM   2140  C  CG1   . VAL B  2  52   ? 59.276  166.476 148.156 1.00 45.12  ? 51   VAL B CG1   1 
ATOM   2141  C  CG2   . VAL B  2  52   ? 59.157  168.706 149.234 1.00 43.37  ? 51   VAL B CG2   1 
ATOM   2142  N  N     . VAL B  2  53   ? 62.689  168.071 149.732 1.00 43.63  ? 52   VAL B N     1 
ATOM   2143  C  CA    . VAL B  2  53   ? 63.502  167.415 150.755 1.00 43.90  ? 52   VAL B CA    1 
ATOM   2144  C  C     . VAL B  2  53   ? 62.652  167.053 151.957 1.00 43.49  ? 52   VAL B C     1 
ATOM   2145  O  O     . VAL B  2  53   ? 61.860  167.865 152.424 1.00 43.22  ? 52   VAL B O     1 
ATOM   2146  C  CB    . VAL B  2  53   ? 64.657  168.306 151.247 1.00 42.70  ? 52   VAL B CB    1 
ATOM   2147  C  CG1   . VAL B  2  53   ? 65.690  167.455 151.941 1.00 41.39  ? 52   VAL B CG1   1 
ATOM   2148  C  CG2   . VAL B  2  53   ? 65.283  169.046 150.090 1.00 43.62  ? 52   VAL B CG2   1 
ATOM   2149  N  N     . LEU B  2  54   ? 62.820  165.828 152.442 1.00 43.65  ? 53   LEU B N     1 
ATOM   2150  C  CA    . LEU B  2  54   ? 62.074  165.341 153.591 1.00 45.22  ? 53   LEU B CA    1 
ATOM   2151  C  C     . LEU B  2  54   ? 63.023  164.712 154.584 1.00 47.80  ? 53   LEU B C     1 
ATOM   2152  O  O     . LEU B  2  54   ? 64.129  164.306 154.224 1.00 46.67  ? 53   LEU B O     1 
ATOM   2153  C  CB    . LEU B  2  54   ? 61.047  164.289 153.170 1.00 45.14  ? 53   LEU B CB    1 
ATOM   2154  C  CG    . LEU B  2  54   ? 59.716  164.719 152.550 1.00 45.40  ? 53   LEU B CG    1 
ATOM   2155  C  CD1   . LEU B  2  54   ? 59.953  165.612 151.345 1.00 45.80  ? 53   LEU B CD1   1 
ATOM   2156  C  CD2   . LEU B  2  54   ? 58.934  163.478 152.157 1.00 44.47  ? 53   LEU B CD2   1 
ATOM   2157  N  N     . VAL B  2  55   ? 62.578  164.632 155.835 1.00 51.02  ? 54   VAL B N     1 
ATOM   2158  C  CA    . VAL B  2  55   ? 63.377  164.037 156.897 1.00 54.76  ? 54   VAL B CA    1 
ATOM   2159  C  C     . VAL B  2  55   ? 63.043  162.553 157.006 1.00 57.19  ? 54   VAL B C     1 
ATOM   2160  O  O     . VAL B  2  55   ? 61.950  162.176 157.428 1.00 56.74  ? 54   VAL B O     1 
ATOM   2161  C  CB    . VAL B  2  55   ? 63.113  164.712 158.257 1.00 54.10  ? 54   VAL B CB    1 
ATOM   2162  C  CG1   . VAL B  2  55   ? 63.995  164.084 159.320 1.00 53.90  ? 54   VAL B CG1   1 
ATOM   2163  C  CG2   . VAL B  2  55   ? 63.395  166.197 158.164 1.00 53.62  ? 54   VAL B CG2   1 
ATOM   2164  N  N     . ASN B  2  56   ? 64.003  161.720 156.621 1.00 61.10  ? 55   ASN B N     1 
ATOM   2165  C  CA    . ASN B  2  56   ? 63.836  160.277 156.647 1.00 65.07  ? 55   ASN B CA    1 
ATOM   2166  C  C     . ASN B  2  56   ? 62.895  159.815 157.751 1.00 67.46  ? 55   ASN B C     1 
ATOM   2167  O  O     . ASN B  2  56   ? 63.237  159.792 158.930 1.00 67.70  ? 55   ASN B O     1 
ATOM   2168  C  CB    . ASN B  2  56   ? 65.188  159.597 156.796 1.00 65.42  ? 55   ASN B CB    1 
ATOM   2169  C  CG    . ASN B  2  56   ? 65.116  158.127 156.504 1.00 65.32  ? 55   ASN B CG    1 
ATOM   2170  O  OD1   . ASN B  2  56   ? 64.402  157.388 157.178 1.00 66.44  ? 55   ASN B OD1   1 
ATOM   2171  N  ND2   . ASN B  2  56   ? 65.847  157.690 155.487 1.00 65.32  ? 55   ASN B ND2   1 
ATOM   2172  N  N     . ASP B  2  57   ? 61.701  159.435 157.330 1.00 70.63  ? 56   ASP B N     1 
ATOM   2173  C  CA    . ASP B  2  57   ? 60.641  158.989 158.211 1.00 73.65  ? 56   ASP B CA    1 
ATOM   2174  C  C     . ASP B  2  57   ? 60.808  157.553 158.739 1.00 75.95  ? 56   ASP B C     1 
ATOM   2175  O  O     . ASP B  2  57   ? 60.794  157.318 159.946 1.00 76.04  ? 56   ASP B O     1 
ATOM   2176  C  CB    . ASP B  2  57   ? 59.335  159.119 157.439 1.00 74.78  ? 56   ASP B CB    1 
ATOM   2177  C  CG    . ASP B  2  57   ? 58.136  158.960 158.306 1.00 76.50  ? 56   ASP B CG    1 
ATOM   2178  O  OD1   . ASP B  2  57   ? 58.035  157.915 158.983 1.00 77.55  ? 56   ASP B OD1   1 
ATOM   2179  O  OD2   . ASP B  2  57   ? 57.294  159.883 158.305 1.00 78.58  ? 56   ASP B OD2   1 
ATOM   2180  N  N     . GLU B  2  58   ? 60.952  156.608 157.810 1.00 78.89  ? 57   GLU B N     1 
ATOM   2181  C  CA    . GLU B  2  58   ? 61.106  155.170 158.076 1.00 80.28  ? 57   GLU B CA    1 
ATOM   2182  C  C     . GLU B  2  58   ? 62.047  154.817 159.232 1.00 79.62  ? 57   GLU B C     1 
ATOM   2183  O  O     . GLU B  2  58   ? 63.237  155.115 159.192 1.00 79.11  ? 57   GLU B O     1 
ATOM   2184  C  CB    . GLU B  2  58   ? 61.582  154.495 156.791 1.00 83.70  ? 57   GLU B CB    1 
ATOM   2185  C  CG    . GLU B  2  58   ? 61.318  153.011 156.682 1.00 88.89  ? 57   GLU B CG    1 
ATOM   2186  C  CD    . GLU B  2  58   ? 61.265  152.557 155.221 1.00 92.52  ? 57   GLU B CD    1 
ATOM   2187  O  OE1   . GLU B  2  58   ? 62.227  152.842 154.464 1.00 93.63  ? 57   GLU B OE1   1 
ATOM   2188  O  OE2   . GLU B  2  58   ? 60.256  151.920 154.830 1.00 93.87  ? 57   GLU B OE2   1 
ATOM   2189  N  N     . PRO B  2  59   ? 61.517  154.153 160.271 1.00 79.24  ? 58   PRO B N     1 
ATOM   2190  C  CA    . PRO B  2  59   ? 62.253  153.735 161.470 1.00 78.44  ? 58   PRO B CA    1 
ATOM   2191  C  C     . PRO B  2  59   ? 63.277  152.617 161.286 1.00 77.81  ? 58   PRO B C     1 
ATOM   2192  O  O     . PRO B  2  59   ? 64.173  152.450 162.116 1.00 78.09  ? 58   PRO B O     1 
ATOM   2193  C  CB    . PRO B  2  59   ? 61.138  153.336 162.426 1.00 78.40  ? 58   PRO B CB    1 
ATOM   2194  C  CG    . PRO B  2  59   ? 60.141  152.740 161.502 1.00 78.90  ? 58   PRO B CG    1 
ATOM   2195  C  CD    . PRO B  2  59   ? 60.107  153.741 160.367 1.00 79.37  ? 58   PRO B CD    1 
ATOM   2196  N  N     . ASN B  2  60   ? 63.143  151.841 160.217 1.00 76.83  ? 59   ASN B N     1 
ATOM   2197  C  CA    . ASN B  2  60   ? 64.093  150.764 159.967 1.00 75.38  ? 59   ASN B CA    1 
ATOM   2198  C  C     . ASN B  2  60   ? 65.208  151.250 159.066 1.00 74.09  ? 59   ASN B C     1 
ATOM   2199  O  O     . ASN B  2  60   ? 66.015  150.460 158.583 1.00 73.57  ? 59   ASN B O     1 
ATOM   2200  C  CB    . ASN B  2  60   ? 63.406  149.566 159.317 1.00 76.01  ? 59   ASN B CB    1 
ATOM   2201  C  CG    . ASN B  2  60   ? 62.612  148.748 160.304 1.00 75.44  ? 59   ASN B CG    1 
ATOM   2202  O  OD1   . ASN B  2  60   ? 63.149  148.272 161.305 1.00 75.09  ? 59   ASN B OD1   1 
ATOM   2203  N  ND2   . ASN B  2  60   ? 61.326  148.573 160.026 1.00 75.08  ? 59   ASN B ND2   1 
ATOM   2204  N  N     . SER B  2  61   ? 65.244  152.557 158.839 1.00 73.42  ? 60   SER B N     1 
ATOM   2205  C  CA    . SER B  2  61   ? 66.268  153.151 157.997 1.00 71.99  ? 60   SER B CA    1 
ATOM   2206  C  C     . SER B  2  61   ? 67.453  153.668 158.780 1.00 71.94  ? 60   SER B C     1 
ATOM   2207  O  O     . SER B  2  61   ? 67.310  154.432 159.731 1.00 71.38  ? 60   SER B O     1 
ATOM   2208  C  CB    . SER B  2  61   ? 65.712  154.306 157.183 1.00 71.62  ? 60   SER B CB    1 
ATOM   2209  O  OG    . SER B  2  61   ? 66.788  155.065 156.662 1.00 70.55  ? 60   SER B OG    1 
ATOM   2210  N  N     . PRO B  2  62   ? 68.652  153.260 158.372 1.00 72.56  ? 61   PRO B N     1 
ATOM   2211  C  CA    . PRO B  2  62   ? 69.880  153.687 159.035 1.00 72.92  ? 61   PRO B CA    1 
ATOM   2212  C  C     . PRO B  2  62   ? 69.985  155.195 158.893 1.00 72.67  ? 61   PRO B C     1 
ATOM   2213  O  O     . PRO B  2  62   ? 70.770  155.852 159.578 1.00 73.46  ? 61   PRO B O     1 
ATOM   2214  C  CB    . PRO B  2  62   ? 70.963  152.968 158.240 1.00 73.59  ? 61   PRO B CB    1 
ATOM   2215  C  CG    . PRO B  2  62   ? 70.256  151.748 157.712 1.00 73.60  ? 61   PRO B CG    1 
ATOM   2216  C  CD    . PRO B  2  62   ? 68.944  152.319 157.279 1.00 73.21  ? 61   PRO B CD    1 
ATOM   2217  N  N     . ARG B  2  63   ? 69.175  155.735 157.990 1.00 71.47  ? 62   ARG B N     1 
ATOM   2218  C  CA    . ARG B  2  63   ? 69.181  157.161 157.723 1.00 70.24  ? 62   ARG B CA    1 
ATOM   2219  C  C     . ARG B  2  63   ? 68.103  157.929 158.462 1.00 68.81  ? 62   ARG B C     1 
ATOM   2220  O  O     . ARG B  2  63   ? 68.033  159.150 158.349 1.00 67.94  ? 62   ARG B O     1 
ATOM   2221  C  CB    . ARG B  2  63   ? 69.030  157.412 156.222 1.00 71.00  ? 62   ARG B CB    1 
ATOM   2222  C  CG    . ARG B  2  63   ? 70.203  156.941 155.376 1.00 71.28  ? 62   ARG B CG    1 
ATOM   2223  C  CD    . ARG B  2  63   ? 70.016  157.377 153.933 1.00 71.44  ? 62   ARG B CD    1 
ATOM   2224  N  NE    . ARG B  2  63   ? 69.664  158.794 153.843 1.00 72.10  ? 62   ARG B NE    1 
ATOM   2225  C  CZ    . ARG B  2  63   ? 70.454  159.796 154.219 1.00 72.40  ? 62   ARG B CZ    1 
ATOM   2226  N  NH1   . ARG B  2  63   ? 71.661  159.549 154.716 1.00 72.55  ? 62   ARG B NH1   1 
ATOM   2227  N  NH2   . ARG B  2  63   ? 70.035  161.050 154.101 1.00 72.10  ? 62   ARG B NH2   1 
ATOM   2228  N  N     . GLU B  2  64   ? 67.273  157.220 159.221 1.00 68.12  ? 63   GLU B N     1 
ATOM   2229  C  CA    . GLU B  2  64   ? 66.182  157.856 159.956 1.00 66.99  ? 63   GLU B CA    1 
ATOM   2230  C  C     . GLU B  2  64   ? 66.592  159.182 160.595 1.00 66.11  ? 63   GLU B C     1 
ATOM   2231  O  O     . GLU B  2  64   ? 67.609  159.266 161.289 1.00 65.77  ? 63   GLU B O     1 
ATOM   2232  C  CB    . GLU B  2  64   ? 65.640  156.918 161.033 1.00 67.07  ? 63   GLU B CB    1 
ATOM   2233  C  CG    . GLU B  2  64   ? 64.323  157.389 161.622 1.00 69.41  ? 63   GLU B CG    1 
ATOM   2234  C  CD    . GLU B  2  64   ? 63.847  156.530 162.783 1.00 71.26  ? 63   GLU B CD    1 
ATOM   2235  O  OE1   . GLU B  2  64   ? 62.660  156.650 163.168 1.00 71.05  ? 63   GLU B OE1   1 
ATOM   2236  O  OE2   . GLU B  2  64   ? 64.659  155.741 163.318 1.00 73.39  ? 63   GLU B OE2   1 
ATOM   2237  N  N     . GLY B  2  65   ? 65.794  160.216 160.343 1.00 64.68  ? 64   GLY B N     1 
ATOM   2238  C  CA    . GLY B  2  65   ? 66.069  161.530 160.890 1.00 62.22  ? 64   GLY B CA    1 
ATOM   2239  C  C     . GLY B  2  65   ? 67.055  162.355 160.087 1.00 61.44  ? 64   GLY B C     1 
ATOM   2240  O  O     . GLY B  2  65   ? 67.663  163.272 160.626 1.00 61.87  ? 64   GLY B O     1 
ATOM   2241  N  N     . MET B  2  66   ? 67.227  162.045 158.805 1.00 60.88  ? 65   MET B N     1 
ATOM   2242  C  CA    . MET B  2  66   ? 68.158  162.802 157.970 1.00 59.92  ? 65   MET B CA    1 
ATOM   2243  C  C     . MET B  2  66   ? 67.503  163.334 156.705 1.00 60.17  ? 65   MET B C     1 
ATOM   2244  O  O     . MET B  2  66   ? 66.515  162.777 156.224 1.00 58.66  ? 65   MET B O     1 
ATOM   2245  C  CB    . MET B  2  66   ? 69.356  161.942 157.574 1.00 59.80  ? 65   MET B CB    1 
ATOM   2246  C  CG    . MET B  2  66   ? 70.144  161.383 158.731 1.00 60.59  ? 65   MET B CG    1 
ATOM   2247  S  SD    . MET B  2  66   ? 71.800  160.865 158.228 1.00 63.54  ? 65   MET B SD    1 
ATOM   2248  C  CE    . MET B  2  66   ? 71.541  159.168 157.742 1.00 60.96  ? 65   MET B CE    1 
ATOM   2249  N  N     . GLU B  2  67   ? 68.069  164.413 156.169 1.00 61.08  ? 66   GLU B N     1 
ATOM   2250  C  CA    . GLU B  2  67   ? 67.560  165.038 154.949 1.00 62.60  ? 66   GLU B CA    1 
ATOM   2251  C  C     . GLU B  2  67   ? 67.464  164.000 153.831 1.00 63.11  ? 66   GLU B C     1 
ATOM   2252  O  O     . GLU B  2  67   ? 68.189  163.000 153.835 1.00 64.23  ? 66   GLU B O     1 
ATOM   2253  C  CB    . GLU B  2  67   ? 68.491  166.172 154.493 1.00 63.92  ? 66   GLU B CB    1 
ATOM   2254  C  CG    . GLU B  2  67   ? 68.689  167.312 155.491 1.00 64.83  ? 66   GLU B CG    1 
ATOM   2255  C  CD    . GLU B  2  67   ? 67.445  168.153 155.685 1.00 64.79  ? 66   GLU B CD    1 
ATOM   2256  O  OE1   . GLU B  2  67   ? 66.415  167.591 156.107 1.00 66.02  ? 66   GLU B OE1   1 
ATOM   2257  O  OE2   . GLU B  2  67   ? 67.498  169.374 155.416 1.00 64.01  ? 66   GLU B OE2   1 
ATOM   2258  N  N     . GLU B  2  68   ? 66.587  164.247 152.862 1.00 62.55  ? 67   GLU B N     1 
ATOM   2259  C  CA    . GLU B  2  68   ? 66.414  163.312 151.761 1.00 60.14  ? 67   GLU B CA    1 
ATOM   2260  C  C     . GLU B  2  68   ? 65.528  163.903 150.683 1.00 58.96  ? 67   GLU B C     1 
ATOM   2261  O  O     . GLU B  2  68   ? 64.351  164.169 150.925 1.00 58.95  ? 67   GLU B O     1 
ATOM   2262  C  CB    . GLU B  2  68   ? 65.780  162.032 152.284 1.00 60.32  ? 67   GLU B CB    1 
ATOM   2263  C  CG    . GLU B  2  68   ? 66.265  160.784 151.610 1.00 61.43  ? 67   GLU B CG    1 
ATOM   2264  C  CD    . GLU B  2  68   ? 65.793  159.547 152.330 1.00 62.75  ? 67   GLU B CD    1 
ATOM   2265  O  OE1   . GLU B  2  68   ? 64.575  159.275 152.302 1.00 63.56  ? 67   GLU B OE1   1 
ATOM   2266  O  OE2   . GLU B  2  68   ? 66.637  158.856 152.936 1.00 63.42  ? 67   GLU B OE2   1 
ATOM   2267  N  N     . THR B  2  69   ? 66.098  164.103 149.497 1.00 57.90  ? 68   THR B N     1 
ATOM   2268  C  CA    . THR B  2  69   ? 65.360  164.656 148.361 1.00 55.98  ? 68   THR B CA    1 
ATOM   2269  C  C     . THR B  2  69   ? 64.444  163.584 147.769 1.00 54.20  ? 68   THR B C     1 
ATOM   2270  O  O     . THR B  2  69   ? 64.890  162.490 147.432 1.00 54.15  ? 68   THR B O     1 
ATOM   2271  C  CB    . THR B  2  69   ? 66.305  165.137 147.231 1.00 55.25  ? 68   THR B CB    1 
ATOM   2272  O  OG1   . THR B  2  69   ? 67.383  165.905 147.775 1.00 54.45  ? 68   THR B OG1   1 
ATOM   2273  C  CG2   . THR B  2  69   ? 65.541  166.006 146.259 1.00 56.20  ? 68   THR B CG2   1 
ATOM   2274  N  N     . VAL B  2  70   ? 63.164  163.900 147.642 1.00 52.84  ? 69   VAL B N     1 
ATOM   2275  C  CA    . VAL B  2  70   ? 62.207  162.958 147.085 1.00 50.68  ? 69   VAL B CA    1 
ATOM   2276  C  C     . VAL B  2  70   ? 61.502  163.599 145.895 1.00 50.70  ? 69   VAL B C     1 
ATOM   2277  O  O     . VAL B  2  70   ? 61.065  164.754 145.966 1.00 50.46  ? 69   VAL B O     1 
ATOM   2278  C  CB    . VAL B  2  70   ? 61.159  162.556 148.133 1.00 49.71  ? 69   VAL B CB    1 
ATOM   2279  C  CG1   . VAL B  2  70   ? 60.144  161.629 147.520 1.00 50.35  ? 69   VAL B CG1   1 
ATOM   2280  C  CG2   . VAL B  2  70   ? 61.833  161.890 149.310 1.00 48.74  ? 69   VAL B CG2   1 
ATOM   2281  N  N     . PRO B  2  71   ? 61.396  162.863 144.775 1.00 50.24  ? 70   PRO B N     1 
ATOM   2282  C  CA    . PRO B  2  71   ? 60.738  163.370 143.567 1.00 49.60  ? 70   PRO B CA    1 
ATOM   2283  C  C     . PRO B  2  71   ? 59.240  163.417 143.839 1.00 48.49  ? 70   PRO B C     1 
ATOM   2284  O  O     . PRO B  2  71   ? 58.657  162.436 144.316 1.00 48.31  ? 70   PRO B O     1 
ATOM   2285  C  CB    . PRO B  2  71   ? 61.094  162.328 142.508 1.00 49.85  ? 70   PRO B CB    1 
ATOM   2286  C  CG    . PRO B  2  71   ? 62.296  161.620 143.076 1.00 50.52  ? 70   PRO B CG    1 
ATOM   2287  C  CD    . PRO B  2  71   ? 61.962  161.529 144.531 1.00 50.46  ? 70   PRO B CD    1 
ATOM   2288  N  N     . VAL B  2  72   ? 58.613  164.545 143.538 1.00 46.34  ? 71   VAL B N     1 
ATOM   2289  C  CA    . VAL B  2  72   ? 57.196  164.673 143.803 1.00 45.66  ? 71   VAL B CA    1 
ATOM   2290  C  C     . VAL B  2  72   ? 56.383  165.167 142.615 1.00 45.27  ? 71   VAL B C     1 
ATOM   2291  O  O     . VAL B  2  72   ? 56.817  166.042 141.863 1.00 45.46  ? 71   VAL B O     1 
ATOM   2292  C  CB    . VAL B  2  72   ? 56.977  165.604 145.025 1.00 44.55  ? 71   VAL B CB    1 
ATOM   2293  C  CG1   . VAL B  2  72   ? 56.123  166.806 144.649 1.00 44.11  ? 71   VAL B CG1   1 
ATOM   2294  C  CG2   . VAL B  2  72   ? 56.337  164.822 146.154 1.00 44.95  ? 71   VAL B CG2   1 
ATOM   2295  N  N     . THR B  2  73   ? 55.203  164.584 142.439 1.00 45.24  ? 72   THR B N     1 
ATOM   2296  C  CA    . THR B  2  73   ? 54.321  165.005 141.365 1.00 45.41  ? 72   THR B CA    1 
ATOM   2297  C  C     . THR B  2  73   ? 53.218  165.828 142.000 1.00 44.45  ? 72   THR B C     1 
ATOM   2298  O  O     . THR B  2  73   ? 52.508  165.364 142.890 1.00 42.06  ? 72   THR B O     1 
ATOM   2299  C  CB    . THR B  2  73   ? 53.665  163.827 140.633 1.00 45.78  ? 72   THR B CB    1 
ATOM   2300  O  OG1   . THR B  2  73   ? 54.668  162.917 140.170 1.00 47.75  ? 72   THR B OG1   1 
ATOM   2301  C  CG2   . THR B  2  73   ? 52.876  164.339 139.437 1.00 44.73  ? 72   THR B CG2   1 
ATOM   2302  N  N     . VAL B  2  74   ? 53.091  167.065 141.550 1.00 45.44  ? 73   VAL B N     1 
ATOM   2303  C  CA    . VAL B  2  74   ? 52.066  167.939 142.076 1.00 47.03  ? 73   VAL B CA    1 
ATOM   2304  C  C     . VAL B  2  74   ? 50.755  167.621 141.379 1.00 47.63  ? 73   VAL B C     1 
ATOM   2305  O  O     . VAL B  2  74   ? 50.711  167.416 140.166 1.00 47.70  ? 73   VAL B O     1 
ATOM   2306  C  CB    . VAL B  2  74   ? 52.420  169.417 141.838 1.00 47.28  ? 73   VAL B CB    1 
ATOM   2307  C  CG1   . VAL B  2  74   ? 51.335  170.307 142.411 1.00 47.32  ? 73   VAL B CG1   1 
ATOM   2308  C  CG2   . VAL B  2  74   ? 53.768  169.738 142.472 1.00 48.17  ? 73   VAL B CG2   1 
ATOM   2309  N  N     . ILE B  2  75   ? 49.687  167.567 142.158 1.00 48.89  ? 74   ILE B N     1 
ATOM   2310  C  CA    . ILE B  2  75   ? 48.369  167.284 141.621 1.00 49.80  ? 74   ILE B CA    1 
ATOM   2311  C  C     . ILE B  2  75   ? 47.366  168.242 142.219 1.00 49.61  ? 74   ILE B C     1 
ATOM   2312  O  O     . ILE B  2  75   ? 47.252  168.334 143.440 1.00 49.62  ? 74   ILE B O     1 
ATOM   2313  C  CB    . ILE B  2  75   ? 47.928  165.837 141.948 1.00 49.98  ? 74   ILE B CB    1 
ATOM   2314  C  CG1   . ILE B  2  75   ? 48.518  164.881 140.912 1.00 50.47  ? 74   ILE B CG1   1 
ATOM   2315  C  CG2   . ILE B  2  75   ? 46.408  165.734 141.975 1.00 49.00  ? 74   ILE B CG2   1 
ATOM   2316  C  CD1   . ILE B  2  75   ? 48.005  163.462 141.024 1.00 51.51  ? 74   ILE B CD1   1 
ATOM   2317  N  N     . GLU B  2  76   ? 46.652  168.966 141.365 1.00 49.81  ? 75   GLU B N     1 
ATOM   2318  C  CA    . GLU B  2  76   ? 45.639  169.887 141.853 1.00 50.52  ? 75   GLU B CA    1 
ATOM   2319  C  C     . GLU B  2  76   ? 44.430  169.050 142.222 1.00 51.80  ? 75   GLU B C     1 
ATOM   2320  O  O     . GLU B  2  76   ? 43.769  168.486 141.356 1.00 52.22  ? 75   GLU B O     1 
ATOM   2321  C  CB    . GLU B  2  76   ? 45.251  170.909 140.788 1.00 49.41  ? 75   GLU B CB    1 
ATOM   2322  C  CG    . GLU B  2  76   ? 46.363  171.862 140.414 1.00 49.36  ? 75   GLU B CG    1 
ATOM   2323  C  CD    . GLU B  2  76   ? 45.840  173.221 139.996 1.00 49.66  ? 75   GLU B CD    1 
ATOM   2324  O  OE1   . GLU B  2  76   ? 45.430  174.001 140.884 1.00 50.04  ? 75   GLU B OE1   1 
ATOM   2325  O  OE2   . GLU B  2  76   ? 45.830  173.506 138.783 1.00 49.16  ? 75   GLU B OE2   1 
ATOM   2326  N  N     . THR B  2  77   ? 44.152  168.962 143.516 1.00 52.84  ? 76   THR B N     1 
ATOM   2327  C  CA    . THR B  2  77   ? 43.031  168.177 144.000 1.00 53.54  ? 76   THR B CA    1 
ATOM   2328  C  C     . THR B  2  77   ? 41.954  169.033 144.633 1.00 55.76  ? 76   THR B C     1 
ATOM   2329  O  O     . THR B  2  77   ? 41.514  168.759 145.751 1.00 57.21  ? 76   THR B O     1 
ATOM   2330  C  CB    . THR B  2  77   ? 43.490  167.160 145.034 1.00 52.99  ? 76   THR B CB    1 
ATOM   2331  O  OG1   . THR B  2  77   ? 44.537  167.734 145.826 1.00 51.19  ? 76   THR B OG1   1 
ATOM   2332  C  CG2   . THR B  2  77   ? 43.976  165.906 144.357 1.00 53.28  ? 76   THR B CG2   1 
ATOM   2333  N  N     . PRO B  2  78   ? 41.502  170.076 143.922 1.00 56.20  ? 77   PRO B N     1 
ATOM   2334  C  CA    . PRO B  2  78   ? 40.461  170.949 144.467 1.00 55.58  ? 77   PRO B CA    1 
ATOM   2335  C  C     . PRO B  2  78   ? 39.445  170.115 145.220 1.00 55.36  ? 77   PRO B C     1 
ATOM   2336  O  O     . PRO B  2  78   ? 38.713  169.342 144.608 1.00 55.58  ? 77   PRO B O     1 
ATOM   2337  C  CB    . PRO B  2  78   ? 39.858  171.578 143.221 1.00 56.29  ? 77   PRO B CB    1 
ATOM   2338  C  CG    . PRO B  2  78   ? 41.035  171.671 142.309 1.00 57.45  ? 77   PRO B CG    1 
ATOM   2339  C  CD    . PRO B  2  78   ? 41.705  170.336 142.487 1.00 56.05  ? 77   PRO B CD    1 
ATOM   2340  C  CA    . PRO B  2  79   ? 36.911  169.378 146.573 1.00 44.43  ? 78   PRO B CA    1 
ATOM   2341  C  C     . PRO B  2  79   ? 36.050  169.039 145.358 1.00 44.61  ? 78   PRO B C     1 
ATOM   2342  O  O     . PRO B  2  79   ? 36.111  169.715 144.324 1.00 43.78  ? 78   PRO B O     1 
ATOM   2343  C  CB    . PRO B  2  79   ? 36.495  170.710 147.190 1.00 44.56  ? 78   PRO B CB    1 
ATOM   2344  C  CG    . PRO B  2  79   ? 37.594  171.664 146.834 1.00 44.58  ? 78   PRO B CG    1 
ATOM   2345  C  CD    . PRO B  2  79   ? 37.354  172.131 145.416 1.00 45.50  ? 78   PRO B CD    1 
ATOM   2346  N  N     . MET B  2  80   ? 35.262  167.973 145.491 1.00 45.21  ? 79   MET B N     1 
ATOM   2347  C  CA    . MET B  2  80   ? 34.380  167.512 144.423 1.00 45.72  ? 79   MET B CA    1 
ATOM   2348  C  C     . MET B  2  80   ? 32.975  167.382 144.992 1.00 46.74  ? 79   MET B C     1 
ATOM   2349  O  O     . MET B  2  80   ? 32.779  167.517 146.198 1.00 46.80  ? 79   MET B O     1 
ATOM   2350  C  CB    . MET B  2  80   ? 34.843  166.149 143.898 1.00 44.06  ? 79   MET B CB    1 
ATOM   2351  C  CG    . MET B  2  80   ? 36.351  166.008 143.765 1.00 42.44  ? 79   MET B CG    1 
ATOM   2352  S  SD    . MET B  2  80   ? 36.904  164.441 143.069 1.00 41.95  ? 79   MET B SD    1 
ATOM   2353  C  CE    . MET B  2  80   ? 35.738  163.305 143.720 1.00 39.29  ? 79   MET B CE    1 
ATOM   2354  N  N     . ARG B  2  81   ? 31.999  167.114 144.128 1.00 47.41  ? 80   ARG B N     1 
ATOM   2355  C  CA    . ARG B  2  81   ? 30.618  166.976 144.571 1.00 46.89  ? 80   ARG B CA    1 
ATOM   2356  C  C     . ARG B  2  81   ? 30.145  165.529 144.567 1.00 47.86  ? 80   ARG B C     1 
ATOM   2357  O  O     . ARG B  2  81   ? 30.022  164.924 143.508 1.00 49.22  ? 80   ARG B O     1 
ATOM   2358  C  CB    . ARG B  2  81   ? 29.690  167.798 143.675 1.00 45.57  ? 80   ARG B CB    1 
ATOM   2359  C  CG    . ARG B  2  81   ? 30.057  169.262 143.578 1.00 46.31  ? 80   ARG B CG    1 
ATOM   2360  C  CD    . ARG B  2  81   ? 29.873  169.995 144.907 1.00 46.64  ? 80   ARG B CD    1 
ATOM   2361  N  NE    . ARG B  2  81   ? 30.734  171.178 144.991 1.00 47.79  ? 80   ARG B NE    1 
ATOM   2362  C  CZ    . ARG B  2  81   ? 30.472  172.360 144.437 1.00 47.17  ? 80   ARG B CZ    1 
ATOM   2363  N  NH1   . ARG B  2  81   ? 29.351  172.551 143.753 1.00 46.70  ? 80   ARG B NH1   1 
ATOM   2364  N  NH2   . ARG B  2  81   ? 31.358  173.346 144.541 1.00 46.99  ? 80   ARG B NH2   1 
ATOM   2365  N  N     . ALA B  2  82   ? 29.896  164.970 145.749 1.00 48.96  ? 81   ALA B N     1 
ATOM   2366  C  CA    . ALA B  2  82   ? 29.387  163.602 145.847 1.00 48.93  ? 81   ALA B CA    1 
ATOM   2367  C  C     . ALA B  2  82   ? 27.910  163.763 145.545 1.00 48.04  ? 81   ALA B C     1 
ATOM   2368  O  O     . ALA B  2  82   ? 27.066  163.640 146.425 1.00 49.00  ? 81   ALA B O     1 
ATOM   2369  C  CB    . ALA B  2  82   ? 29.581  163.051 147.255 1.00 49.42  ? 81   ALA B CB    1 
ATOM   2370  N  N     . VAL B  2  83   ? 27.626  164.051 144.283 1.00 47.81  ? 82   VAL B N     1 
ATOM   2371  C  CA    . VAL B  2  83   ? 26.284  164.303 143.784 1.00 47.57  ? 82   VAL B CA    1 
ATOM   2372  C  C     . VAL B  2  83   ? 25.147  163.305 144.060 1.00 47.86  ? 82   VAL B C     1 
ATOM   2373  O  O     . VAL B  2  83   ? 23.996  163.715 144.253 1.00 48.53  ? 82   VAL B O     1 
ATOM   2374  C  CB    . VAL B  2  83   ? 26.368  164.612 142.274 1.00 46.80  ? 82   VAL B CB    1 
ATOM   2375  C  CG1   . VAL B  2  83   ? 25.276  163.891 141.514 1.00 46.99  ? 82   VAL B CG1   1 
ATOM   2376  C  CG2   . VAL B  2  83   ? 26.276  166.123 142.067 1.00 45.44  ? 82   VAL B CG2   1 
ATOM   2377  N  N     . ALA B  2  84   ? 25.433  162.011 144.084 1.00 47.15  ? 83   ALA B N     1 
ATOM   2378  C  CA    . ALA B  2  84   ? 24.359  161.059 144.345 1.00 46.95  ? 83   ALA B CA    1 
ATOM   2379  C  C     . ALA B  2  84   ? 24.823  159.796 145.045 1.00 47.24  ? 83   ALA B C     1 
ATOM   2380  O  O     . ALA B  2  84   ? 26.017  159.502 145.095 1.00 47.95  ? 83   ALA B O     1 
ATOM   2381  C  CB    . ALA B  2  84   ? 23.658  160.701 143.046 1.00 47.48  ? 83   ALA B CB    1 
ATOM   2382  N  N     . LEU B  2  85   ? 23.863  159.051 145.582 1.00 46.32  ? 84   LEU B N     1 
ATOM   2383  C  CA    . LEU B  2  85   ? 24.147  157.810 146.282 1.00 45.19  ? 84   LEU B CA    1 
ATOM   2384  C  C     . LEU B  2  85   ? 23.448  156.672 145.561 1.00 44.91  ? 84   LEU B C     1 
ATOM   2385  O  O     . LEU B  2  85   ? 22.232  156.553 145.596 1.00 46.21  ? 84   LEU B O     1 
ATOM   2386  C  CB    . LEU B  2  85   ? 23.663  157.910 147.736 1.00 45.48  ? 84   LEU B CB    1 
ATOM   2387  C  CG    . LEU B  2  85   ? 23.777  156.737 148.722 1.00 45.47  ? 84   LEU B CG    1 
ATOM   2388  C  CD1   . LEU B  2  85   ? 22.567  155.822 148.637 1.00 44.07  ? 84   LEU B CD1   1 
ATOM   2389  C  CD2   . LEU B  2  85   ? 25.055  155.981 148.445 1.00 46.10  ? 84   LEU B CD2   1 
ATOM   2390  N  N     . ARG B  2  86   ? 24.219  155.848 144.876 1.00 44.71  ? 85   ARG B N     1 
ATOM   2391  C  CA    . ARG B  2  86   ? 23.642  154.725 144.168 1.00 45.68  ? 85   ARG B CA    1 
ATOM   2392  C  C     . ARG B  2  86   ? 23.683  153.530 145.119 1.00 46.67  ? 85   ARG B C     1 
ATOM   2393  O  O     . ARG B  2  86   ? 24.481  153.510 146.055 1.00 48.14  ? 85   ARG B O     1 
ATOM   2394  C  CB    . ARG B  2  86   ? 24.450  154.451 142.902 1.00 43.90  ? 85   ARG B CB    1 
ATOM   2395  C  CG    . ARG B  2  86   ? 24.044  153.208 142.163 1.00 44.84  ? 85   ARG B CG    1 
ATOM   2396  C  CD    . ARG B  2  86   ? 24.762  153.120 140.842 1.00 46.26  ? 85   ARG B CD    1 
ATOM   2397  N  NE    . ARG B  2  86   ? 24.199  154.037 139.860 1.00 47.65  ? 85   ARG B NE    1 
ATOM   2398  C  CZ    . ARG B  2  86   ? 24.776  154.334 138.700 1.00 49.17  ? 85   ARG B CZ    1 
ATOM   2399  N  NH1   . ARG B  2  86   ? 25.944  153.793 138.371 1.00 48.06  ? 85   ARG B NH1   1 
ATOM   2400  N  NH2   . ARG B  2  86   ? 24.178  155.166 137.859 1.00 50.55  ? 85   ARG B NH2   1 
ATOM   2401  N  N     . ALA B  2  87   ? 22.810  152.551 144.903 1.00 46.71  ? 86   ALA B N     1 
ATOM   2402  C  CA    . ALA B  2  87   ? 22.773  151.371 145.757 1.00 46.63  ? 86   ALA B CA    1 
ATOM   2403  C  C     . ALA B  2  87   ? 22.635  150.121 144.907 1.00 46.67  ? 86   ALA B C     1 
ATOM   2404  O  O     . ALA B  2  87   ? 21.757  150.043 144.050 1.00 47.18  ? 86   ALA B O     1 
ATOM   2405  C  CB    . ALA B  2  87   ? 21.619  151.465 146.733 1.00 46.88  ? 86   ALA B CB    1 
ATOM   2406  N  N     . TYR B  2  88   ? 23.508  149.149 145.155 1.00 46.20  ? 87   TYR B N     1 
ATOM   2407  C  CA    . TYR B  2  88   ? 23.515  147.893 144.417 1.00 45.35  ? 87   TYR B CA    1 
ATOM   2408  C  C     . TYR B  2  88   ? 22.880  146.797 145.242 1.00 45.44  ? 87   TYR B C     1 
ATOM   2409  O  O     . TYR B  2  88   ? 23.031  146.777 146.456 1.00 45.94  ? 87   TYR B O     1 
ATOM   2410  C  CB    . TYR B  2  88   ? 24.952  147.495 144.086 1.00 44.75  ? 87   TYR B CB    1 
ATOM   2411  C  CG    . TYR B  2  88   ? 25.656  148.442 143.140 1.00 45.14  ? 87   TYR B CG    1 
ATOM   2412  C  CD1   . TYR B  2  88   ? 26.017  149.731 143.536 1.00 43.93  ? 87   TYR B CD1   1 
ATOM   2413  C  CD2   . TYR B  2  88   ? 25.962  148.048 141.843 1.00 46.14  ? 87   TYR B CD2   1 
ATOM   2414  C  CE1   . TYR B  2  88   ? 26.667  150.601 142.662 1.00 43.61  ? 87   TYR B CE1   1 
ATOM   2415  C  CE2   . TYR B  2  88   ? 26.609  148.905 140.965 1.00 45.70  ? 87   TYR B CE2   1 
ATOM   2416  C  CZ    . TYR B  2  88   ? 26.962  150.178 141.374 1.00 44.67  ? 87   TYR B CZ    1 
ATOM   2417  O  OH    . TYR B  2  88   ? 27.622  151.003 140.485 1.00 43.28  ? 87   TYR B OH    1 
ATOM   2418  N  N     . GLU B  2  89   ? 22.162  145.890 144.595 1.00 45.83  ? 88   GLU B N     1 
ATOM   2419  C  CA    . GLU B  2  89   ? 21.549  144.794 145.325 1.00 47.83  ? 88   GLU B CA    1 
ATOM   2420  C  C     . GLU B  2  89   ? 22.259  143.519 144.916 1.00 49.18  ? 88   GLU B C     1 
ATOM   2421  O  O     . GLU B  2  89   ? 22.973  143.509 143.927 1.00 50.92  ? 88   GLU B O     1 
ATOM   2422  C  CB    . GLU B  2  89   ? 20.071  144.678 144.989 1.00 49.06  ? 88   GLU B CB    1 
ATOM   2423  C  CG    . GLU B  2  89   ? 19.775  144.076 143.634 1.00 51.60  ? 88   GLU B CG    1 
ATOM   2424  C  CD    . GLU B  2  89   ? 18.349  143.550 143.544 1.00 53.20  ? 88   GLU B CD    1 
ATOM   2425  O  OE1   . GLU B  2  89   ? 17.974  142.708 144.393 1.00 53.68  ? 88   GLU B OE1   1 
ATOM   2426  O  OE2   . GLU B  2  89   ? 17.608  143.973 142.628 1.00 52.96  ? 88   GLU B OE2   1 
ATOM   2427  N  N     . ASP B  2  90   ? 22.075  142.442 145.667 1.00 50.52  ? 89   ASP B N     1 
ATOM   2428  C  CA    . ASP B  2  90   ? 22.726  141.184 145.319 1.00 51.82  ? 89   ASP B CA    1 
ATOM   2429  C  C     . ASP B  2  90   ? 21.806  140.292 144.499 1.00 53.41  ? 89   ASP B C     1 
ATOM   2430  O  O     . ASP B  2  90   ? 20.629  140.142 144.821 1.00 54.80  ? 89   ASP B O     1 
ATOM   2431  C  CB    . ASP B  2  90   ? 23.186  140.446 146.577 1.00 51.67  ? 89   ASP B CB    1 
ATOM   2432  C  CG    . ASP B  2  90   ? 24.368  141.127 147.248 1.00 52.06  ? 89   ASP B CG    1 
ATOM   2433  O  OD1   . ASP B  2  90   ? 25.260  141.608 146.515 1.00 50.81  ? 89   ASP B OD1   1 
ATOM   2434  O  OD2   . ASP B  2  90   ? 24.413  141.170 148.499 1.00 51.65  ? 89   ASP B OD2   1 
ATOM   2435  N  N     . THR B  2  91   ? 22.351  139.702 143.437 1.00 54.06  ? 90   THR B N     1 
ATOM   2436  C  CA    . THR B  2  91   ? 21.574  138.836 142.563 1.00 53.73  ? 90   THR B CA    1 
ATOM   2437  C  C     . THR B  2  91   ? 22.374  137.608 142.140 1.00 54.53  ? 90   THR B C     1 
ATOM   2438  O  O     . THR B  2  91   ? 23.586  137.553 142.326 1.00 53.33  ? 90   THR B O     1 
ATOM   2439  C  CB    . THR B  2  91   ? 21.155  139.587 141.290 1.00 55.13  ? 90   THR B CB    1 
ATOM   2440  O  OG1   . THR B  2  91   ? 22.125  139.359 140.258 1.00 56.69  ? 90   THR B OG1   1 
ATOM   2441  C  CG2   . THR B  2  91   ? 21.067  141.087 141.565 1.00 55.60  ? 90   THR B CG2   1 
ATOM   2442  N  N     . PRO B  2  92   ? 21.693  136.604 141.562 1.00 56.06  ? 91   PRO B N     1 
ATOM   2443  C  CA    . PRO B  2  92   ? 22.262  135.341 141.075 1.00 55.47  ? 91   PRO B CA    1 
ATOM   2444  C  C     . PRO B  2  92   ? 23.287  135.584 139.988 1.00 55.77  ? 91   PRO B C     1 
ATOM   2445  O  O     . PRO B  2  92   ? 24.021  134.676 139.597 1.00 56.64  ? 91   PRO B O     1 
ATOM   2446  C  CB    . PRO B  2  92   ? 21.051  134.605 140.515 1.00 56.06  ? 91   PRO B CB    1 
ATOM   2447  C  CG    . PRO B  2  92   ? 19.956  135.079 141.372 1.00 58.00  ? 91   PRO B CG    1 
ATOM   2448  C  CD    . PRO B  2  92   ? 20.225  136.563 141.477 1.00 57.18  ? 91   PRO B CD    1 
ATOM   2449  N  N     . TYR B  2  93   ? 23.321  136.812 139.490 1.00 54.54  ? 92   TYR B N     1 
ATOM   2450  C  CA    . TYR B  2  93   ? 24.252  137.159 138.440 1.00 54.05  ? 92   TYR B CA    1 
ATOM   2451  C  C     . TYR B  2  93   ? 25.175  138.243 138.926 1.00 53.60  ? 92   TYR B C     1 
ATOM   2452  O  O     . TYR B  2  93   ? 25.875  138.882 138.136 1.00 54.77  ? 92   TYR B O     1 
ATOM   2453  C  CB    . TYR B  2  93   ? 23.482  137.607 137.213 1.00 54.77  ? 92   TYR B CB    1 
ATOM   2454  C  CG    . TYR B  2  93   ? 22.323  136.690 136.967 1.00 55.81  ? 92   TYR B CG    1 
ATOM   2455  C  CD1   . TYR B  2  93   ? 21.064  136.982 137.475 1.00 55.47  ? 92   TYR B CD1   1 
ATOM   2456  C  CD2   . TYR B  2  93   ? 22.501  135.484 136.295 1.00 56.84  ? 92   TYR B CD2   1 
ATOM   2457  C  CE1   . TYR B  2  93   ? 20.012  136.097 137.322 1.00 55.68  ? 92   TYR B CE1   1 
ATOM   2458  C  CE2   . TYR B  2  93   ? 21.455  134.591 136.138 1.00 56.80  ? 92   TYR B CE2   1 
ATOM   2459  C  CZ    . TYR B  2  93   ? 20.214  134.905 136.656 1.00 56.20  ? 92   TYR B CZ    1 
ATOM   2460  O  OH    . TYR B  2  93   ? 19.177  134.019 136.512 1.00 58.34  ? 92   TYR B OH    1 
ATOM   2461  N  N     . GLY B  2  94   ? 25.168  138.441 140.241 1.00 52.27  ? 93   GLY B N     1 
ATOM   2462  C  CA    . GLY B  2  94   ? 26.030  139.437 140.843 1.00 51.08  ? 93   GLY B CA    1 
ATOM   2463  C  C     . GLY B  2  94   ? 25.351  140.731 141.224 1.00 49.91  ? 93   GLY B C     1 
ATOM   2464  O  O     . GLY B  2  94   ? 24.125  140.833 141.244 1.00 49.12  ? 93   GLY B O     1 
ATOM   2465  N  N     . GLN B  2  95   ? 26.162  141.731 141.532 1.00 49.27  ? 94   GLN B N     1 
ATOM   2466  C  CA    . GLN B  2  95   ? 25.619  143.011 141.916 1.00 49.79  ? 94   GLN B CA    1 
ATOM   2467  C  C     . GLN B  2  95   ? 24.983  143.693 140.714 1.00 49.72  ? 94   GLN B C     1 
ATOM   2468  O  O     . GLN B  2  95   ? 25.395  143.482 139.573 1.00 50.19  ? 94   GLN B O     1 
ATOM   2469  C  CB    . GLN B  2  95   ? 26.715  143.888 142.522 1.00 49.17  ? 94   GLN B CB    1 
ATOM   2470  C  CG    . GLN B  2  95   ? 27.426  143.221 143.686 1.00 52.10  ? 94   GLN B CG    1 
ATOM   2471  C  CD    . GLN B  2  95   ? 28.158  144.204 144.583 1.00 53.39  ? 94   GLN B CD    1 
ATOM   2472  O  OE1   . GLN B  2  95   ? 28.945  145.029 144.114 1.00 54.67  ? 94   GLN B OE1   1 
ATOM   2473  N  NE2   . GLN B  2  95   ? 27.907  144.114 145.888 1.00 54.23  ? 94   GLN B NE2   1 
ATOM   2474  N  N     . ARG B  2  96   ? 23.953  144.486 140.988 1.00 49.03  ? 95   ARG B N     1 
ATOM   2475  C  CA    . ARG B  2  96   ? 23.234  145.230 139.974 1.00 48.26  ? 95   ARG B CA    1 
ATOM   2476  C  C     . ARG B  2  96   ? 22.684  146.481 140.619 1.00 47.52  ? 95   ARG B C     1 
ATOM   2477  O  O     . ARG B  2  96   ? 22.110  146.430 141.710 1.00 47.79  ? 95   ARG B O     1 
ATOM   2478  C  CB    . ARG B  2  96   ? 22.074  144.417 139.406 1.00 49.77  ? 95   ARG B CB    1 
ATOM   2479  C  CG    . ARG B  2  96   ? 22.493  143.192 138.613 1.00 53.54  ? 95   ARG B CG    1 
ATOM   2480  C  CD    . ARG B  2  96   ? 21.389  142.775 137.645 1.00 55.64  ? 95   ARG B CD    1 
ATOM   2481  N  NE    . ARG B  2  96   ? 21.743  141.611 136.834 1.00 56.03  ? 95   ARG B NE    1 
ATOM   2482  C  CZ    . ARG B  2  96   ? 20.979  141.128 135.860 1.00 55.96  ? 95   ARG B CZ    1 
ATOM   2483  N  NH1   . ARG B  2  96   ? 19.823  141.709 135.579 1.00 56.96  ? 95   ARG B NH1   1 
ATOM   2484  N  NH2   . ARG B  2  96   ? 21.368  140.066 135.170 1.00 55.77  ? 95   ARG B NH2   1 
ATOM   2485  N  N     . PRO B  2  97   ? 22.866  147.630 139.960 1.00 46.33  ? 96   PRO B N     1 
ATOM   2486  C  CA    . PRO B  2  97   ? 22.382  148.914 140.466 1.00 45.59  ? 96   PRO B CA    1 
ATOM   2487  C  C     . PRO B  2  97   ? 20.881  148.853 140.760 1.00 45.85  ? 96   PRO B C     1 
ATOM   2488  O  O     . PRO B  2  97   ? 20.098  148.369 139.946 1.00 45.96  ? 96   PRO B O     1 
ATOM   2489  C  CB    . PRO B  2  97   ? 22.727  149.867 139.330 1.00 45.82  ? 96   PRO B CB    1 
ATOM   2490  C  CG    . PRO B  2  97   ? 23.968  149.263 138.768 1.00 43.77  ? 96   PRO B CG    1 
ATOM   2491  C  CD    . PRO B  2  97   ? 23.632  147.813 138.716 1.00 45.01  ? 96   PRO B CD    1 
ATOM   2492  N  N     . LEU B  2  98   ? 20.482  149.348 141.925 1.00 47.09  ? 97   LEU B N     1 
ATOM   2493  C  CA    . LEU B  2  98   ? 19.082  149.317 142.332 1.00 48.06  ? 97   LEU B CA    1 
ATOM   2494  C  C     . LEU B  2  98   ? 18.413  150.683 142.171 1.00 48.34  ? 97   LEU B C     1 
ATOM   2495  O  O     . LEU B  2  98   ? 17.406  150.803 141.480 1.00 47.97  ? 97   LEU B O     1 
ATOM   2496  C  CB    . LEU B  2  98   ? 19.002  148.836 143.784 1.00 48.88  ? 97   LEU B CB    1 
ATOM   2497  C  CG    . LEU B  2  98   ? 17.686  148.389 144.417 1.00 49.07  ? 97   LEU B CG    1 
ATOM   2498  C  CD1   . LEU B  2  98   ? 17.973  147.823 145.797 1.00 49.97  ? 97   LEU B CD1   1 
ATOM   2499  C  CD2   . LEU B  2  98   ? 16.730  149.558 144.523 1.00 49.84  ? 97   LEU B CD2   1 
ATOM   2500  N  N     . THR B  2  99   ? 18.972  151.705 142.813 1.00 49.77  ? 98   THR B N     1 
ATOM   2501  C  CA    . THR B  2  99   ? 18.440  153.065 142.728 1.00 51.69  ? 98   THR B CA    1 
ATOM   2502  C  C     . THR B  2  99   ? 19.409  154.109 143.238 1.00 53.13  ? 98   THR B C     1 
ATOM   2503  O  O     . THR B  2  99   ? 20.461  153.794 143.794 1.00 54.33  ? 98   THR B O     1 
ATOM   2504  C  CB    . THR B  2  99   ? 17.175  153.257 143.543 1.00 51.30  ? 98   THR B CB    1 
ATOM   2505  O  OG1   . THR B  2  99   ? 17.353  152.656 144.830 1.00 52.92  ? 98   THR B OG1   1 
ATOM   2506  C  CG2   . THR B  2  99   ? 15.985  152.679 142.825 1.00 51.99  ? 98   THR B CG2   1 
ATOM   2507  N  N     . GLU B  2  100  ? 19.025  155.365 143.079 1.00 53.94  ? 99   GLU B N     1 
ATOM   2508  C  CA    . GLU B  2  100  ? 19.876  156.449 143.501 1.00 55.90  ? 99   GLU B CA    1 
ATOM   2509  C  C     . GLU B  2  100  ? 19.108  157.564 144.180 1.00 56.03  ? 99   GLU B C     1 
ATOM   2510  O  O     . GLU B  2  100  ? 17.938  157.815 143.881 1.00 55.87  ? 99   GLU B O     1 
ATOM   2511  C  CB    . GLU B  2  100  ? 20.621  157.005 142.289 1.00 58.73  ? 99   GLU B CB    1 
ATOM   2512  C  CG    . GLU B  2  100  ? 21.616  156.035 141.685 1.00 62.54  ? 99   GLU B CG    1 
ATOM   2513  C  CD    . GLU B  2  100  ? 21.824  156.259 140.201 1.00 64.19  ? 99   GLU B CD    1 
ATOM   2514  O  OE1   . GLU B  2  100  ? 22.114  157.408 139.802 1.00 66.05  ? 99   GLU B OE1   1 
ATOM   2515  O  OE2   . GLU B  2  100  ? 21.697  155.282 139.434 1.00 65.06  ? 99   GLU B OE2   1 
ATOM   2516  N  N     . VAL B  2  101  ? 19.795  158.231 145.096 1.00 56.05  ? 100  VAL B N     1 
ATOM   2517  C  CA    . VAL B  2  101  ? 19.243  159.349 145.832 1.00 56.77  ? 100  VAL B CA    1 
ATOM   2518  C  C     . VAL B  2  101  ? 20.066  160.563 145.392 1.00 56.88  ? 100  VAL B C     1 
ATOM   2519  O  O     . VAL B  2  101  ? 21.286  160.572 145.533 1.00 56.49  ? 100  VAL B O     1 
ATOM   2520  C  CB    . VAL B  2  101  ? 19.394  159.112 147.350 1.00 57.34  ? 100  VAL B CB    1 
ATOM   2521  C  CG1   . VAL B  2  101  ? 18.629  160.170 148.126 1.00 58.95  ? 100  VAL B CG1   1 
ATOM   2522  C  CG2   . VAL B  2  101  ? 18.894  157.720 147.709 1.00 55.97  ? 100  VAL B CG2   1 
ATOM   2523  N  N     . TRP B  2  102  ? 19.406  161.578 144.844 1.00 58.00  ? 101  TRP B N     1 
ATOM   2524  C  CA    . TRP B  2  102  ? 20.114  162.763 144.370 1.00 59.61  ? 101  TRP B CA    1 
ATOM   2525  C  C     . TRP B  2  102  ? 19.951  164.002 145.222 1.00 62.19  ? 101  TRP B C     1 
ATOM   2526  O  O     . TRP B  2  102  ? 19.674  163.909 146.414 1.00 63.92  ? 101  TRP B O     1 
ATOM   2527  C  CB    . TRP B  2  102  ? 19.699  163.061 142.941 1.00 58.67  ? 101  TRP B CB    1 
ATOM   2528  C  CG    . TRP B  2  102  ? 20.324  162.113 141.998 1.00 57.68  ? 101  TRP B CG    1 
ATOM   2529  C  CD1   . TRP B  2  102  ? 20.151  160.761 141.958 1.00 57.90  ? 101  TRP B CD1   1 
ATOM   2530  C  CD2   . TRP B  2  102  ? 21.316  162.421 141.023 1.00 57.17  ? 101  TRP B CD2   1 
ATOM   2531  N  NE1   . TRP B  2  102  ? 20.984  160.203 141.022 1.00 57.74  ? 101  TRP B NE1   1 
ATOM   2532  C  CE2   . TRP B  2  102  ? 21.711  161.203 140.431 1.00 57.85  ? 101  TRP B CE2   1 
ATOM   2533  C  CE3   . TRP B  2  102  ? 21.913  163.610 140.591 1.00 56.54  ? 101  TRP B CE3   1 
ATOM   2534  C  CZ2   . TRP B  2  102  ? 22.681  161.139 139.432 1.00 57.71  ? 101  TRP B CZ2   1 
ATOM   2535  C  CZ3   . TRP B  2  102  ? 22.873  163.549 139.602 1.00 57.14  ? 101  TRP B CZ3   1 
ATOM   2536  C  CH2   . TRP B  2  102  ? 23.250  162.319 139.031 1.00 58.25  ? 101  TRP B CH2   1 
ATOM   2537  N  N     . THR B  2  103  ? 20.133  165.171 144.620 1.00 63.80  ? 102  THR B N     1 
ATOM   2538  C  CA    . THR B  2  103  ? 20.006  166.405 145.381 1.00 66.15  ? 102  THR B CA    1 
ATOM   2539  C  C     . THR B  2  103  ? 19.259  167.495 144.625 1.00 67.98  ? 102  THR B C     1 
ATOM   2540  O  O     . THR B  2  103  ? 18.513  167.212 143.687 1.00 68.77  ? 102  THR B O     1 
ATOM   2541  C  CB    . THR B  2  103  ? 21.393  166.949 145.803 1.00 65.65  ? 102  THR B CB    1 
ATOM   2542  O  OG1   . THR B  2  103  ? 22.099  167.419 144.653 1.00 65.78  ? 102  THR B OG1   1 
ATOM   2543  C  CG2   . THR B  2  103  ? 22.214  165.861 146.466 1.00 65.42  ? 102  THR B CG2   1 
ATOM   2544  N  N     . ASP B  2  104  ? 19.457  168.737 145.057 1.00 69.55  ? 103  ASP B N     1 
ATOM   2545  C  CA    . ASP B  2  104  ? 18.821  169.893 144.444 1.00 72.32  ? 103  ASP B CA    1 
ATOM   2546  C  C     . ASP B  2  104  ? 19.900  170.896 144.072 1.00 73.61  ? 103  ASP B C     1 
ATOM   2547  O  O     . ASP B  2  104  ? 19.758  171.659 143.116 1.00 73.69  ? 103  ASP B O     1 
ATOM   2548  C  CB    . ASP B  2  104  ? 17.833  170.529 145.422 1.00 74.37  ? 103  ASP B CB    1 
ATOM   2549  C  CG    . ASP B  2  104  ? 17.984  169.990 146.835 1.00 77.28  ? 103  ASP B CG    1 
ATOM   2550  O  OD1   . ASP B  2  104  ? 17.767  168.774 147.032 1.00 79.37  ? 103  ASP B OD1   1 
ATOM   2551  O  OD2   . ASP B  2  104  ? 18.321  170.778 147.749 1.00 78.23  ? 103  ASP B OD2   1 
ATOM   2552  N  N     . GLU B  2  105  ? 20.983  170.890 144.843 1.00 75.27  ? 104  GLU B N     1 
ATOM   2553  C  CA    . GLU B  2  105  ? 22.106  171.785 144.589 1.00 76.14  ? 104  GLU B CA    1 
ATOM   2554  C  C     . GLU B  2  105  ? 23.158  171.062 143.768 1.00 74.48  ? 104  GLU B C     1 
ATOM   2555  O  O     . GLU B  2  105  ? 23.826  170.153 144.262 1.00 73.63  ? 104  GLU B O     1 
ATOM   2556  C  CB    . GLU B  2  105  ? 22.722  172.272 145.904 1.00 78.60  ? 104  GLU B CB    1 
ATOM   2557  C  CG    . GLU B  2  105  ? 21.971  173.424 146.551 1.00 82.35  ? 104  GLU B CG    1 
ATOM   2558  C  CD    . GLU B  2  105  ? 22.594  173.861 147.862 1.00 84.83  ? 104  GLU B CD    1 
ATOM   2559  O  OE1   . GLU B  2  105  ? 23.818  174.119 147.885 1.00 86.78  ? 104  GLU B OE1   1 
ATOM   2560  O  OE2   . GLU B  2  105  ? 21.857  173.950 148.869 1.00 85.93  ? 104  GLU B OE2   1 
ATOM   2561  N  N     . PHE B  2  106  ? 23.282  171.463 142.506 1.00 73.57  ? 105  PHE B N     1 
ATOM   2562  C  CA    . PHE B  2  106  ? 24.252  170.873 141.588 1.00 72.33  ? 105  PHE B CA    1 
ATOM   2563  C  C     . PHE B  2  106  ? 25.178  171.992 141.139 1.00 72.42  ? 105  PHE B C     1 
ATOM   2564  O  O     . PHE B  2  106  ? 24.853  173.165 141.321 1.00 73.40  ? 105  PHE B O     1 
ATOM   2565  C  CB    . PHE B  2  106  ? 23.554  170.284 140.355 1.00 69.29  ? 105  PHE B CB    1 
ATOM   2566  C  CG    . PHE B  2  106  ? 22.449  169.323 140.674 1.00 64.90  ? 105  PHE B CG    1 
ATOM   2567  C  CD1   . PHE B  2  106  ? 21.128  169.730 140.632 1.00 63.55  ? 105  PHE B CD1   1 
ATOM   2568  C  CD2   . PHE B  2  106  ? 22.731  168.005 140.991 1.00 64.42  ? 105  PHE B CD2   1 
ATOM   2569  C  CE1   . PHE B  2  106  ? 20.103  168.836 140.898 1.00 63.04  ? 105  PHE B CE1   1 
ATOM   2570  C  CE2   . PHE B  2  106  ? 21.711  167.104 141.259 1.00 63.57  ? 105  PHE B CE2   1 
ATOM   2571  C  CZ    . PHE B  2  106  ? 20.395  167.521 141.210 1.00 62.57  ? 105  PHE B CZ    1 
ATOM   2572  N  N     . HIS B  2  107  ? 26.317  171.642 140.543 1.00 72.24  ? 106  HIS B N     1 
ATOM   2573  C  CA    . HIS B  2  107  ? 27.251  172.662 140.081 1.00 71.25  ? 106  HIS B CA    1 
ATOM   2574  C  C     . HIS B  2  107  ? 26.720  173.397 138.858 1.00 70.52  ? 106  HIS B C     1 
ATOM   2575  O  O     . HIS B  2  107  ? 26.044  172.811 138.012 1.00 70.70  ? 106  HIS B O     1 
ATOM   2576  C  CB    . HIS B  2  107  ? 28.612  172.057 139.762 1.00 71.35  ? 106  HIS B CB    1 
ATOM   2577  C  CG    . HIS B  2  107  ? 29.659  173.085 139.480 1.00 71.93  ? 106  HIS B CG    1 
ATOM   2578  N  ND1   . HIS B  2  107  ? 30.214  173.262 138.232 1.00 72.14  ? 106  HIS B ND1   1 
ATOM   2579  C  CD2   . HIS B  2  107  ? 30.215  174.027 140.278 1.00 71.79  ? 106  HIS B CD2   1 
ATOM   2580  C  CE1   . HIS B  2  107  ? 31.068  174.269 138.272 1.00 72.44  ? 106  HIS B CE1   1 
ATOM   2581  N  NE2   . HIS B  2  107  ? 31.086  174.751 139.502 1.00 72.16  ? 106  HIS B NE2   1 
ATOM   2582  N  N     . SER B  2  108  ? 27.047  174.682 138.772 1.00 69.56  ? 107  SER B N     1 
ATOM   2583  C  CA    . SER B  2  108  ? 26.592  175.548 137.685 1.00 69.76  ? 107  SER B CA    1 
ATOM   2584  C  C     . SER B  2  108  ? 26.842  175.096 136.245 1.00 68.71  ? 107  SER B C     1 
ATOM   2585  O  O     . SER B  2  108  ? 26.351  175.730 135.304 1.00 67.93  ? 107  SER B O     1 
ATOM   2586  C  CB    . SER B  2  108  ? 27.184  176.943 137.866 1.00 71.59  ? 107  SER B CB    1 
ATOM   2587  O  OG    . SER B  2  108  ? 28.594  176.899 137.768 1.00 73.61  ? 107  SER B OG    1 
ATOM   2588  N  N     . GLU B  2  109  ? 27.597  174.016 136.061 1.00 67.80  ? 108  GLU B N     1 
ATOM   2589  C  CA    . GLU B  2  109  ? 27.880  173.534 134.712 1.00 66.70  ? 108  GLU B CA    1 
ATOM   2590  C  C     . GLU B  2  109  ? 27.867  172.027 134.560 1.00 64.67  ? 108  GLU B C     1 
ATOM   2591  O  O     . GLU B  2  109  ? 28.289  171.484 133.537 1.00 64.25  ? 108  GLU B O     1 
ATOM   2592  C  CB    . GLU B  2  109  ? 29.209  174.100 134.236 1.00 66.90  ? 108  GLU B CB    1 
ATOM   2593  C  CG    . GLU B  2  109  ? 29.063  175.532 133.827 1.00 69.33  ? 108  GLU B CG    1 
ATOM   2594  C  CD    . GLU B  2  109  ? 30.374  176.229 133.722 1.00 72.08  ? 108  GLU B CD    1 
ATOM   2595  O  OE1   . GLU B  2  109  ? 31.081  176.305 134.749 1.00 73.13  ? 108  GLU B OE1   1 
ATOM   2596  O  OE2   . GLU B  2  109  ? 30.694  176.703 132.613 1.00 75.20  ? 108  GLU B OE2   1 
ATOM   2597  N  N     . LEU B  2  110  ? 27.352  171.354 135.576 1.00 62.70  ? 109  LEU B N     1 
ATOM   2598  C  CA    . LEU B  2  110  ? 27.279  169.913 135.555 1.00 61.04  ? 109  LEU B CA    1 
ATOM   2599  C  C     . LEU B  2  110  ? 26.416  169.466 134.386 1.00 60.61  ? 109  LEU B C     1 
ATOM   2600  O  O     . LEU B  2  110  ? 26.349  168.279 134.075 1.00 60.47  ? 109  LEU B O     1 
ATOM   2601  C  CB    . LEU B  2  110  ? 26.694  169.423 136.874 1.00 60.10  ? 109  LEU B CB    1 
ATOM   2602  C  CG    . LEU B  2  110  ? 26.642  167.918 137.109 1.00 59.55  ? 109  LEU B CG    1 
ATOM   2603  C  CD1   . LEU B  2  110  ? 27.900  167.256 136.584 1.00 59.63  ? 109  LEU B CD1   1 
ATOM   2604  C  CD2   . LEU B  2  110  ? 26.474  167.673 138.596 1.00 58.98  ? 109  LEU B CD2   1 
ATOM   2605  N  N     . ASP B  2  111  ? 25.766  170.434 133.741 1.00 60.54  ? 110  ASP B N     1 
ATOM   2606  C  CA    . ASP B  2  111  ? 24.886  170.177 132.601 1.00 59.47  ? 110  ASP B CA    1 
ATOM   2607  C  C     . ASP B  2  111  ? 25.647  170.138 131.284 1.00 57.57  ? 110  ASP B C     1 
ATOM   2608  O  O     . ASP B  2  111  ? 25.050  170.107 130.202 1.00 56.68  ? 110  ASP B O     1 
ATOM   2609  C  CB    . ASP B  2  111  ? 23.779  171.234 132.529 1.00 62.48  ? 110  ASP B CB    1 
ATOM   2610  C  CG    . ASP B  2  111  ? 24.320  172.649 132.393 1.00 65.56  ? 110  ASP B CG    1 
ATOM   2611  O  OD1   . ASP B  2  111  ? 25.050  173.110 133.300 1.00 66.94  ? 110  ASP B OD1   1 
ATOM   2612  O  OD2   . ASP B  2  111  ? 24.008  173.305 131.376 1.00 68.34  ? 110  ASP B OD2   1 
ATOM   2613  N  N     . ARG B  2  112  ? 26.970  170.161 131.386 1.00 54.76  ? 111  ARG B N     1 
ATOM   2614  C  CA    . ARG B  2  112  ? 27.821  170.083 130.214 1.00 51.95  ? 111  ARG B CA    1 
ATOM   2615  C  C     . ARG B  2  112  ? 28.126  168.606 130.002 1.00 51.42  ? 111  ARG B C     1 
ATOM   2616  O  O     . ARG B  2  112  ? 28.764  168.235 129.019 1.00 51.02  ? 111  ARG B O     1 
ATOM   2617  C  CB    . ARG B  2  112  ? 29.124  170.848 130.441 1.00 50.58  ? 111  ARG B CB    1 
ATOM   2618  C  CG    . ARG B  2  112  ? 29.081  172.325 130.094 1.00 49.76  ? 111  ARG B CG    1 
ATOM   2619  C  CD    . ARG B  2  112  ? 30.317  173.014 130.654 1.00 50.80  ? 111  ARG B CD    1 
ATOM   2620  N  NE    . ARG B  2  112  ? 30.478  174.416 130.261 1.00 50.47  ? 111  ARG B NE    1 
ATOM   2621  C  CZ    . ARG B  2  112  ? 31.086  174.825 129.150 1.00 49.86  ? 111  ARG B CZ    1 
ATOM   2622  N  NH1   . ARG B  2  112  ? 31.592  173.946 128.298 1.00 51.06  ? 111  ARG B NH1   1 
ATOM   2623  N  NH2   . ARG B  2  112  ? 31.224  176.118 128.907 1.00 48.98  ? 111  ARG B NH2   1 
ATOM   2624  N  N     . THR B  2  113  ? 27.658  167.770 130.928 1.00 50.78  ? 112  THR B N     1 
ATOM   2625  C  CA    . THR B  2  113  ? 27.895  166.332 130.855 1.00 51.84  ? 112  THR B CA    1 
ATOM   2626  C  C     . THR B  2  113  ? 26.652  165.497 131.124 1.00 52.27  ? 112  THR B C     1 
ATOM   2627  O  O     . THR B  2  113  ? 26.525  164.391 130.613 1.00 52.14  ? 112  THR B O     1 
ATOM   2628  C  CB    . THR B  2  113  ? 28.957  165.875 131.868 1.00 52.32  ? 112  THR B CB    1 
ATOM   2629  O  OG1   . THR B  2  113  ? 30.016  166.837 131.938 1.00 54.75  ? 112  THR B OG1   1 
ATOM   2630  C  CG2   . THR B  2  113  ? 29.541  164.537 131.439 1.00 52.19  ? 112  THR B CG2   1 
ATOM   2631  N  N     . LEU B  2  114  ? 25.743  166.010 131.942 1.00 53.93  ? 113  LEU B N     1 
ATOM   2632  C  CA    . LEU B  2  114  ? 24.530  165.270 132.266 1.00 55.22  ? 113  LEU B CA    1 
ATOM   2633  C  C     . LEU B  2  114  ? 23.280  166.090 132.041 1.00 57.25  ? 113  LEU B C     1 
ATOM   2634  O  O     . LEU B  2  114  ? 23.325  167.280 131.715 1.00 58.36  ? 113  LEU B O     1 
ATOM   2635  C  CB    . LEU B  2  114  ? 24.510  164.857 133.732 1.00 53.38  ? 113  LEU B CB    1 
ATOM   2636  C  CG    . LEU B  2  114  ? 25.796  164.509 134.454 1.00 52.82  ? 113  LEU B CG    1 
ATOM   2637  C  CD1   . LEU B  2  114  ? 25.465  164.215 135.895 1.00 52.36  ? 113  LEU B CD1   1 
ATOM   2638  C  CD2   . LEU B  2  114  ? 26.453  163.324 133.797 1.00 53.16  ? 113  LEU B CD2   1 
ATOM   2639  N  N     . ASP B  2  115  ? 22.155  165.418 132.230 1.00 59.11  ? 114  ASP B N     1 
ATOM   2640  C  CA    . ASP B  2  115  ? 20.858  166.041 132.128 1.00 60.95  ? 114  ASP B CA    1 
ATOM   2641  C  C     . ASP B  2  115  ? 20.453  166.145 133.582 1.00 62.15  ? 114  ASP B C     1 
ATOM   2642  O  O     . ASP B  2  115  ? 19.788  165.267 134.125 1.00 62.48  ? 114  ASP B O     1 
ATOM   2643  C  CB    . ASP B  2  115  ? 19.905  165.152 131.341 1.00 61.42  ? 114  ASP B CB    1 
ATOM   2644  C  CG    . ASP B  2  115  ? 20.181  165.201 129.861 1.00 62.41  ? 114  ASP B CG    1 
ATOM   2645  O  OD1   . ASP B  2  115  ? 20.389  166.332 129.369 1.00 63.66  ? 114  ASP B OD1   1 
ATOM   2646  O  OD2   . ASP B  2  115  ? 20.190  164.137 129.197 1.00 62.41  ? 114  ASP B OD2   1 
ATOM   2647  N  N     . VAL B  2  116  ? 20.914  167.212 134.220 1.00 63.43  ? 115  VAL B N     1 
ATOM   2648  C  CA    . VAL B  2  116  ? 20.639  167.439 135.625 1.00 64.31  ? 115  VAL B CA    1 
ATOM   2649  C  C     . VAL B  2  116  ? 19.197  167.111 135.946 1.00 64.86  ? 115  VAL B C     1 
ATOM   2650  O  O     . VAL B  2  116  ? 18.294  167.444 135.181 1.00 64.21  ? 115  VAL B O     1 
ATOM   2651  C  CB    . VAL B  2  116  ? 20.907  168.897 136.017 1.00 64.63  ? 115  VAL B CB    1 
ATOM   2652  C  CG1   . VAL B  2  116  ? 20.786  169.048 137.515 1.00 66.19  ? 115  VAL B CG1   1 
ATOM   2653  C  CG2   . VAL B  2  116  ? 22.286  169.322 135.546 1.00 64.56  ? 115  VAL B CG2   1 
ATOM   2654  N  N     . PRO B  2  117  ? 18.966  166.428 137.073 1.00 66.32  ? 116  PRO B N     1 
ATOM   2655  C  CA    . PRO B  2  117  ? 17.607  166.067 137.472 1.00 67.44  ? 116  PRO B CA    1 
ATOM   2656  C  C     . PRO B  2  117  ? 16.791  167.306 137.820 1.00 69.01  ? 116  PRO B C     1 
ATOM   2657  O  O     . PRO B  2  117  ? 17.317  168.267 138.381 1.00 68.18  ? 116  PRO B O     1 
ATOM   2658  C  CB    . PRO B  2  117  ? 17.831  165.163 138.683 1.00 66.84  ? 116  PRO B CB    1 
ATOM   2659  C  CG    . PRO B  2  117  ? 19.142  164.523 138.383 1.00 66.85  ? 116  PRO B CG    1 
ATOM   2660  C  CD    . PRO B  2  117  ? 19.953  165.700 137.888 1.00 66.95  ? 116  PRO B CD    1 
ATOM   2661  N  N     . GLU B  2  118  ? 15.508  167.277 137.473 1.00 71.47  ? 117  GLU B N     1 
ATOM   2662  C  CA    . GLU B  2  118  ? 14.609  168.387 137.760 1.00 74.18  ? 117  GLU B CA    1 
ATOM   2663  C  C     . GLU B  2  118  ? 13.446  167.902 138.619 1.00 74.79  ? 117  GLU B C     1 
ATOM   2664  O  O     . GLU B  2  118  ? 12.872  168.671 139.395 1.00 74.72  ? 117  GLU B O     1 
ATOM   2665  C  CB    . GLU B  2  118  ? 14.075  168.990 136.464 1.00 76.88  ? 117  GLU B CB    1 
ATOM   2666  C  CG    . GLU B  2  118  ? 15.150  169.503 135.535 1.00 81.06  ? 117  GLU B CG    1 
ATOM   2667  C  CD    . GLU B  2  118  ? 14.575  170.260 134.355 1.00 84.11  ? 117  GLU B CD    1 
ATOM   2668  O  OE1   . GLU B  2  118  ? 13.962  171.331 134.577 1.00 85.82  ? 117  GLU B OE1   1 
ATOM   2669  O  OE2   . GLU B  2  118  ? 14.731  169.780 133.209 1.00 86.63  ? 117  GLU B OE2   1 
ATOM   2670  N  N     . ASP B  2  119  ? 13.105  166.624 138.467 1.00 74.83  ? 118  ASP B N     1 
ATOM   2671  C  CA    . ASP B  2  119  ? 12.025  166.008 139.228 1.00 74.96  ? 118  ASP B CA    1 
ATOM   2672  C  C     . ASP B  2  119  ? 12.495  164.660 139.730 1.00 74.25  ? 118  ASP B C     1 
ATOM   2673  O  O     . ASP B  2  119  ? 12.423  163.663 139.014 1.00 73.07  ? 118  ASP B O     1 
ATOM   2674  C  CB    . ASP B  2  119  ? 10.777  165.819 138.359 1.00 77.42  ? 118  ASP B CB    1 
ATOM   2675  C  CG    . ASP B  2  119  ? 10.134  167.139 137.959 1.00 78.98  ? 118  ASP B CG    1 
ATOM   2676  O  OD1   . ASP B  2  119  ? 9.826   167.955 138.857 1.00 80.10  ? 118  ASP B OD1   1 
ATOM   2677  O  OD2   . ASP B  2  119  ? 9.931   167.360 136.744 1.00 80.69  ? 118  ASP B OD2   1 
ATOM   2678  N  N     . HIS B  2  120  ? 12.975  164.640 140.968 1.00 74.48  ? 119  HIS B N     1 
ATOM   2679  C  CA    . HIS B  2  120  ? 13.479  163.417 141.582 1.00 74.70  ? 119  HIS B CA    1 
ATOM   2680  C  C     . HIS B  2  120  ? 12.830  163.172 142.941 1.00 73.97  ? 119  HIS B C     1 
ATOM   2681  O  O     . HIS B  2  120  ? 12.398  164.111 143.617 1.00 74.08  ? 119  HIS B O     1 
ATOM   2682  C  CB    . HIS B  2  120  ? 15.005  163.507 141.741 1.00 75.17  ? 119  HIS B CB    1 
ATOM   2683  C  CG    . HIS B  2  120  ? 15.626  162.298 142.374 1.00 75.93  ? 119  HIS B CG    1 
ATOM   2684  N  ND1   . HIS B  2  120  ? 15.411  161.017 141.909 1.00 76.18  ? 119  HIS B ND1   1 
ATOM   2685  C  CD2   . HIS B  2  120  ? 16.482  162.179 143.419 1.00 76.03  ? 119  HIS B CD2   1 
ATOM   2686  C  CE1   . HIS B  2  120  ? 16.108  160.162 142.638 1.00 76.01  ? 119  HIS B CE1   1 
ATOM   2687  N  NE2   . HIS B  2  120  ? 16.767  160.842 143.561 1.00 76.09  ? 119  HIS B NE2   1 
ATOM   2688  N  N     . ASP B  2  121  ? 12.763  161.903 143.330 1.00 73.03  ? 120  ASP B N     1 
ATOM   2689  C  CA    . ASP B  2  121  ? 12.181  161.528 144.609 1.00 72.66  ? 120  ASP B CA    1 
ATOM   2690  C  C     . ASP B  2  121  ? 13.229  160.857 145.487 1.00 71.20  ? 120  ASP B C     1 
ATOM   2691  O  O     . ASP B  2  121  ? 13.304  159.631 145.552 1.00 70.79  ? 120  ASP B O     1 
ATOM   2692  C  CB    . ASP B  2  121  ? 11.024  160.566 144.408 1.00 75.05  ? 120  ASP B CB    1 
ATOM   2693  C  CG    . ASP B  2  121  ? 10.251  160.335 145.683 1.00 78.13  ? 120  ASP B CG    1 
ATOM   2694  O  OD1   . ASP B  2  121  ? 10.878  160.325 146.770 1.00 79.50  ? 120  ASP B OD1   1 
ATOM   2695  O  OD2   . ASP B  2  121  ? 9.019   160.155 145.599 1.00 79.87  ? 120  ASP B OD2   1 
ATOM   2696  N  N     . PRO B  2  122  ? 14.032  161.658 146.197 1.00 69.52  ? 121  PRO B N     1 
ATOM   2697  C  CA    . PRO B  2  122  ? 15.096  161.181 147.084 1.00 68.75  ? 121  PRO B CA    1 
ATOM   2698  C  C     . PRO B  2  122  ? 14.609  160.230 148.161 1.00 68.09  ? 121  PRO B C     1 
ATOM   2699  O  O     . PRO B  2  122  ? 15.271  159.244 148.495 1.00 67.63  ? 121  PRO B O     1 
ATOM   2700  C  CB    . PRO B  2  122  ? 15.640  162.468 147.696 1.00 68.78  ? 121  PRO B CB    1 
ATOM   2701  C  CG    . PRO B  2  122  ? 15.308  163.505 146.675 1.00 69.36  ? 121  PRO B CG    1 
ATOM   2702  C  CD    . PRO B  2  122  ? 13.923  163.122 146.264 1.00 68.69  ? 121  PRO B CD    1 
ATOM   2703  N  N     . ASP B  2  123  ? 13.440  160.537 148.700 1.00 67.41  ? 122  ASP B N     1 
ATOM   2704  C  CA    . ASP B  2  123  ? 12.886  159.743 149.772 1.00 67.31  ? 122  ASP B CA    1 
ATOM   2705  C  C     . ASP B  2  123  ? 12.343  158.396 149.342 1.00 66.09  ? 122  ASP B C     1 
ATOM   2706  O  O     . ASP B  2  123  ? 12.475  157.417 150.072 1.00 66.83  ? 122  ASP B O     1 
ATOM   2707  C  CB    . ASP B  2  123  ? 11.835  160.568 150.503 1.00 67.91  ? 122  ASP B CB    1 
ATOM   2708  C  CG    . ASP B  2  123  ? 12.371  161.932 150.908 1.00 69.30  ? 122  ASP B CG    1 
ATOM   2709  O  OD1   . ASP B  2  123  ? 12.468  162.814 150.027 1.00 71.04  ? 122  ASP B OD1   1 
ATOM   2710  O  OD2   . ASP B  2  123  ? 12.720  162.116 152.095 1.00 68.58  ? 122  ASP B OD2   1 
ATOM   2711  N  N     . ALA B  2  124  ? 11.747  158.331 148.159 1.00 64.53  ? 123  ALA B N     1 
ATOM   2712  C  CA    . ALA B  2  124  ? 11.222  157.062 147.672 1.00 63.18  ? 123  ALA B CA    1 
ATOM   2713  C  C     . ALA B  2  124  ? 12.413  156.156 147.402 1.00 62.57  ? 123  ALA B C     1 
ATOM   2714  O  O     . ALA B  2  124  ? 12.398  154.960 147.699 1.00 60.90  ? 123  ALA B O     1 
ATOM   2715  C  CB    . ALA B  2  124  ? 10.431  157.279 146.398 1.00 62.11  ? 123  ALA B CB    1 
ATOM   2716  N  N     . ALA B  2  125  ? 13.450  156.755 146.831 1.00 63.19  ? 124  ALA B N     1 
ATOM   2717  C  CA    . ALA B  2  125  ? 14.667  156.041 146.509 1.00 63.66  ? 124  ALA B CA    1 
ATOM   2718  C  C     . ALA B  2  125  ? 15.256  155.549 147.810 1.00 63.98  ? 124  ALA B C     1 
ATOM   2719  O  O     . ALA B  2  125  ? 15.514  154.356 147.970 1.00 64.25  ? 124  ALA B O     1 
ATOM   2720  C  CB    . ALA B  2  125  ? 15.635  156.965 145.810 1.00 63.70  ? 124  ALA B CB    1 
ATOM   2721  N  N     . GLU B  2  126  ? 15.467  156.475 148.742 1.00 64.58  ? 125  GLU B N     1 
ATOM   2722  C  CA    . GLU B  2  126  ? 16.010  156.112 150.042 1.00 65.32  ? 125  GLU B CA    1 
ATOM   2723  C  C     . GLU B  2  126  ? 15.138  155.001 150.581 1.00 64.54  ? 125  GLU B C     1 
ATOM   2724  O  O     . GLU B  2  126  ? 15.621  153.942 150.972 1.00 64.72  ? 125  GLU B O     1 
ATOM   2725  C  CB    . GLU B  2  126  ? 15.957  157.287 151.012 1.00 66.24  ? 125  GLU B CB    1 
ATOM   2726  C  CG    . GLU B  2  126  ? 16.475  156.919 152.397 1.00 69.26  ? 125  GLU B CG    1 
ATOM   2727  C  CD    . GLU B  2  126  ? 16.314  158.033 153.411 1.00 70.96  ? 125  GLU B CD    1 
ATOM   2728  O  OE1   . GLU B  2  126  ? 16.648  159.192 153.084 1.00 72.53  ? 125  GLU B OE1   1 
ATOM   2729  O  OE2   . GLU B  2  126  ? 15.865  157.746 154.542 1.00 72.33  ? 125  GLU B OE2   1 
ATOM   2730  N  N     . GLU B  2  127  ? 13.838  155.271 150.588 1.00 64.61  ? 126  GLU B N     1 
ATOM   2731  C  CA    . GLU B  2  127  ? 12.833  154.333 151.058 1.00 64.41  ? 126  GLU B CA    1 
ATOM   2732  C  C     . GLU B  2  127  ? 13.188  152.940 150.554 1.00 62.71  ? 126  GLU B C     1 
ATOM   2733  O  O     . GLU B  2  127  ? 13.512  152.043 151.337 1.00 63.03  ? 126  GLU B O     1 
ATOM   2734  C  CB    . GLU B  2  127  ? 11.463  154.765 150.521 1.00 66.42  ? 126  GLU B CB    1 
ATOM   2735  C  CG    . GLU B  2  127  ? 10.242  154.110 151.165 1.00 70.62  ? 126  GLU B CG    1 
ATOM   2736  C  CD    . GLU B  2  127  ? 8.916   154.692 150.648 1.00 72.92  ? 126  GLU B CD    1 
ATOM   2737  O  OE1   . GLU B  2  127  ? 8.674   155.912 150.826 1.00 72.81  ? 126  GLU B OE1   1 
ATOM   2738  O  OE2   . GLU B  2  127  ? 8.116   153.928 150.059 1.00 74.33  ? 126  GLU B OE2   1 
ATOM   2739  N  N     . GLN B  2  128  ? 13.150  152.781 149.236 1.00 61.04  ? 127  GLN B N     1 
ATOM   2740  C  CA    . GLN B  2  128  ? 13.443  151.509 148.582 1.00 59.00  ? 127  GLN B CA    1 
ATOM   2741  C  C     . GLN B  2  128  ? 14.751  150.855 149.000 1.00 56.98  ? 127  GLN B C     1 
ATOM   2742  O  O     . GLN B  2  128  ? 14.837  149.634 149.154 1.00 56.39  ? 127  GLN B O     1 
ATOM   2743  C  CB    . GLN B  2  128  ? 13.448  151.703 147.071 1.00 58.77  ? 127  GLN B CB    1 
ATOM   2744  C  CG    . GLN B  2  128  ? 14.031  150.537 146.329 1.00 58.16  ? 127  GLN B CG    1 
ATOM   2745  C  CD    . GLN B  2  128  ? 13.675  150.572 144.880 1.00 57.70  ? 127  GLN B CD    1 
ATOM   2746  O  OE1   . GLN B  2  128  ? 13.756  151.618 144.248 1.00 58.39  ? 127  GLN B OE1   1 
ATOM   2747  N  NE2   . GLN B  2  128  ? 13.275  149.428 144.335 1.00 58.03  ? 127  GLN B NE2   1 
ATOM   2748  N  N     . ILE B  2  129  ? 15.774  151.675 149.158 1.00 55.11  ? 128  ILE B N     1 
ATOM   2749  C  CA    . ILE B  2  129  ? 17.076  151.184 149.557 1.00 53.86  ? 128  ILE B CA    1 
ATOM   2750  C  C     . ILE B  2  129  ? 16.983  150.575 150.954 1.00 54.40  ? 128  ILE B C     1 
ATOM   2751  O  O     . ILE B  2  129  ? 17.393  149.434 151.175 1.00 54.18  ? 128  ILE B O     1 
ATOM   2752  C  CB    . ILE B  2  129  ? 18.100  152.342 149.522 1.00 51.93  ? 128  ILE B CB    1 
ATOM   2753  C  CG1   . ILE B  2  129  ? 18.214  152.852 148.082 1.00 50.83  ? 128  ILE B CG1   1 
ATOM   2754  C  CG2   . ILE B  2  129  ? 19.444  151.892 150.061 1.00 50.30  ? 128  ILE B CG2   1 
ATOM   2755  C  CD1   . ILE B  2  129  ? 19.097  154.036 147.908 1.00 50.42  ? 128  ILE B CD1   1 
ATOM   2756  N  N     . ARG B  2  130  ? 16.412  151.331 151.886 1.00 54.40  ? 129  ARG B N     1 
ATOM   2757  C  CA    . ARG B  2  130  ? 16.278  150.876 153.257 1.00 54.33  ? 129  ARG B CA    1 
ATOM   2758  C  C     . ARG B  2  130  ? 15.523  149.562 153.337 1.00 56.08  ? 129  ARG B C     1 
ATOM   2759  O  O     . ARG B  2  130  ? 15.823  148.726 154.186 1.00 55.65  ? 129  ARG B O     1 
ATOM   2760  C  CB    . ARG B  2  130  ? 15.602  151.958 154.094 1.00 53.96  ? 129  ARG B CB    1 
ATOM   2761  C  CG    . ARG B  2  130  ? 16.197  153.354 153.846 1.00 53.22  ? 129  ARG B CG    1 
ATOM   2762  C  CD    . ARG B  2  130  ? 16.010  154.285 155.028 1.00 50.20  ? 129  ARG B CD    1 
ATOM   2763  N  NE    . ARG B  2  130  ? 16.962  153.976 156.089 1.00 48.90  ? 129  ARG B NE    1 
ATOM   2764  C  CZ    . ARG B  2  130  ? 18.031  154.715 156.372 1.00 48.09  ? 129  ARG B CZ    1 
ATOM   2765  N  NH1   . ARG B  2  130  ? 18.284  155.815 155.674 1.00 47.25  ? 129  ARG B NH1   1 
ATOM   2766  N  NH2   . ARG B  2  130  ? 18.849  154.349 157.349 1.00 46.00  ? 129  ARG B NH2   1 
ATOM   2767  N  N     . ASP B  2  131  ? 14.545  149.371 152.456 1.00 58.75  ? 130  ASP B N     1 
ATOM   2768  C  CA    . ASP B  2  131  ? 13.798  148.111 152.428 1.00 60.90  ? 130  ASP B CA    1 
ATOM   2769  C  C     . ASP B  2  131  ? 14.772  147.030 151.986 1.00 62.27  ? 130  ASP B C     1 
ATOM   2770  O  O     . ASP B  2  131  ? 14.773  145.918 152.513 1.00 62.58  ? 130  ASP B O     1 
ATOM   2771  C  CB    . ASP B  2  131  ? 12.648  148.160 151.421 1.00 60.69  ? 130  ASP B CB    1 
ATOM   2772  C  CG    . ASP B  2  131  ? 11.531  149.063 151.859 1.00 61.17  ? 130  ASP B CG    1 
ATOM   2773  O  OD1   . ASP B  2  131  ? 11.591  149.565 153.003 1.00 62.08  ? 130  ASP B OD1   1 
ATOM   2774  O  OD2   . ASP B  2  131  ? 10.591  149.265 151.061 1.00 61.27  ? 130  ASP B OD2   1 
ATOM   2775  N  N     . ALA B  2  132  ? 15.594  147.372 150.999 1.00 63.43  ? 131  ALA B N     1 
ATOM   2776  C  CA    . ALA B  2  132  ? 16.584  146.449 150.475 1.00 64.53  ? 131  ALA B CA    1 
ATOM   2777  C  C     . ALA B  2  132  ? 17.473  145.977 151.610 1.00 65.54  ? 131  ALA B C     1 
ATOM   2778  O  O     . ALA B  2  132  ? 17.746  144.785 151.730 1.00 66.08  ? 131  ALA B O     1 
ATOM   2779  C  CB    . ALA B  2  132  ? 17.413  147.131 149.409 1.00 65.39  ? 131  ALA B CB    1 
ATOM   2780  N  N     . HIS B  2  133  ? 17.922  146.914 152.442 1.00 66.33  ? 132  HIS B N     1 
ATOM   2781  C  CA    . HIS B  2  133  ? 18.768  146.576 153.581 1.00 67.11  ? 132  HIS B CA    1 
ATOM   2782  C  C     . HIS B  2  133  ? 17.994  145.618 154.489 1.00 69.08  ? 132  HIS B C     1 
ATOM   2783  O  O     . HIS B  2  133  ? 18.537  144.601 154.921 1.00 69.12  ? 132  HIS B O     1 
ATOM   2784  C  CB    . HIS B  2  133  ? 19.152  147.841 154.348 1.00 65.94  ? 132  HIS B CB    1 
ATOM   2785  C  CG    . HIS B  2  133  ? 20.163  147.615 155.430 1.00 65.59  ? 132  HIS B CG    1 
ATOM   2786  N  ND1   . HIS B  2  133  ? 20.631  146.363 155.762 1.00 66.19  ? 132  HIS B ND1   1 
ATOM   2787  C  CD2   . HIS B  2  133  ? 20.781  148.481 156.269 1.00 64.86  ? 132  HIS B CD2   1 
ATOM   2788  C  CE1   . HIS B  2  133  ? 21.492  146.465 156.759 1.00 65.51  ? 132  HIS B CE1   1 
ATOM   2789  N  NE2   . HIS B  2  133  ? 21.601  147.740 157.085 1.00 64.45  ? 132  HIS B NE2   1 
ATOM   2790  N  N     . GLU B  2  134  ? 16.729  145.945 154.770 1.00 71.31  ? 133  GLU B N     1 
ATOM   2791  C  CA    . GLU B  2  134  ? 15.869  145.096 155.605 1.00 72.77  ? 133  GLU B CA    1 
ATOM   2792  C  C     . GLU B  2  134  ? 15.805  143.723 154.976 1.00 72.01  ? 133  GLU B C     1 
ATOM   2793  O  O     . GLU B  2  134  ? 15.967  142.710 155.645 1.00 72.75  ? 133  GLU B O     1 
ATOM   2794  C  CB    . GLU B  2  134  ? 14.434  145.617 155.663 1.00 76.25  ? 133  GLU B CB    1 
ATOM   2795  C  CG    . GLU B  2  134  ? 14.196  146.885 156.454 1.00 81.13  ? 133  GLU B CG    1 
ATOM   2796  C  CD    . GLU B  2  134  ? 12.708  147.150 156.647 1.00 83.40  ? 133  GLU B CD    1 
ATOM   2797  O  OE1   . GLU B  2  134  ? 12.048  146.321 157.316 1.00 84.96  ? 133  GLU B OE1   1 
ATOM   2798  O  OE2   . GLU B  2  134  ? 12.198  148.170 156.127 1.00 83.95  ? 133  GLU B OE2   1 
ATOM   2799  N  N     . ALA B  2  135  ? 15.528  143.707 153.680 1.00 71.97  ? 134  ALA B N     1 
ATOM   2800  C  CA    . ALA B  2  135  ? 15.445  142.470 152.928 1.00 71.65  ? 134  ALA B CA    1 
ATOM   2801  C  C     . ALA B  2  135  ? 16.761  141.723 153.091 1.00 71.24  ? 134  ALA B C     1 
ATOM   2802  O  O     . ALA B  2  135  ? 16.780  140.499 153.230 1.00 71.75  ? 134  ALA B O     1 
ATOM   2803  C  CB    . ALA B  2  135  ? 15.195  142.775 151.456 1.00 71.51  ? 134  ALA B CB    1 
ATOM   2804  N  N     . GLY B  2  136  ? 17.857  142.476 153.081 1.00 70.65  ? 135  GLY B N     1 
ATOM   2805  C  CA    . GLY B  2  136  ? 19.174  141.884 153.217 1.00 69.86  ? 135  GLY B CA    1 
ATOM   2806  C  C     . GLY B  2  136  ? 19.813  141.685 151.857 1.00 68.94  ? 135  GLY B C     1 
ATOM   2807  O  O     . GLY B  2  136  ? 20.863  141.048 151.736 1.00 70.12  ? 135  GLY B O     1 
ATOM   2808  N  N     . ASP B  2  137  ? 19.174  142.235 150.829 1.00 67.02  ? 136  ASP B N     1 
ATOM   2809  C  CA    . ASP B  2  137  ? 19.667  142.118 149.467 1.00 65.08  ? 136  ASP B CA    1 
ATOM   2810  C  C     . ASP B  2  137  ? 20.585  143.262 149.077 1.00 63.39  ? 136  ASP B C     1 
ATOM   2811  O  O     . ASP B  2  137  ? 21.038  143.327 147.940 1.00 64.65  ? 136  ASP B O     1 
ATOM   2812  C  CB    . ASP B  2  137  ? 18.500  142.075 148.483 1.00 66.03  ? 136  ASP B CB    1 
ATOM   2813  C  CG    . ASP B  2  137  ? 17.623  140.856 148.669 1.00 67.56  ? 136  ASP B CG    1 
ATOM   2814  O  OD1   . ASP B  2  137  ? 18.155  139.726 148.600 1.00 67.28  ? 136  ASP B OD1   1 
ATOM   2815  O  OD2   . ASP B  2  137  ? 16.399  141.029 148.877 1.00 68.30  ? 136  ASP B OD2   1 
ATOM   2816  N  N     . LEU B  2  138  ? 20.861  144.168 150.006 1.00 61.14  ? 137  LEU B N     1 
ATOM   2817  C  CA    . LEU B  2  138  ? 21.721  145.299 149.691 1.00 58.94  ? 137  LEU B CA    1 
ATOM   2818  C  C     . LEU B  2  138  ? 23.133  144.835 149.373 1.00 58.42  ? 137  LEU B C     1 
ATOM   2819  O  O     . LEU B  2  138  ? 23.760  144.156 150.183 1.00 58.72  ? 137  LEU B O     1 
ATOM   2820  C  CB    . LEU B  2  138  ? 21.766  146.283 150.860 1.00 57.85  ? 137  LEU B CB    1 
ATOM   2821  C  CG    . LEU B  2  138  ? 22.504  147.598 150.594 1.00 57.07  ? 137  LEU B CG    1 
ATOM   2822  C  CD1   . LEU B  2  138  ? 21.677  148.446 149.657 1.00 57.19  ? 137  LEU B CD1   1 
ATOM   2823  C  CD2   . LEU B  2  138  ? 22.741  148.349 151.890 1.00 56.26  ? 137  LEU B CD2   1 
ATOM   2824  N  N     . GLY B  2  139  ? 23.620  145.195 148.187 1.00 58.56  ? 138  GLY B N     1 
ATOM   2825  C  CA    . GLY B  2  139  ? 24.972  144.836 147.779 1.00 57.94  ? 138  GLY B CA    1 
ATOM   2826  C  C     . GLY B  2  139  ? 25.913  145.765 148.514 1.00 56.86  ? 138  GLY B C     1 
ATOM   2827  O  O     . GLY B  2  139  ? 26.159  145.566 149.704 1.00 58.01  ? 138  GLY B O     1 
ATOM   2828  N  N     . ASP B  2  140  ? 26.453  146.768 147.830 1.00 55.01  ? 139  ASP B N     1 
ATOM   2829  C  CA    . ASP B  2  140  ? 27.311  147.729 148.515 1.00 54.73  ? 139  ASP B CA    1 
ATOM   2830  C  C     . ASP B  2  140  ? 26.748  149.125 148.228 1.00 52.10  ? 139  ASP B C     1 
ATOM   2831  O  O     . ASP B  2  140  ? 25.667  149.243 147.648 1.00 50.83  ? 139  ASP B O     1 
ATOM   2832  C  CB    . ASP B  2  140  ? 28.784  147.600 148.080 1.00 55.81  ? 139  ASP B CB    1 
ATOM   2833  C  CG    . ASP B  2  140  ? 29.018  148.054 146.663 1.00 58.83  ? 139  ASP B CG    1 
ATOM   2834  O  OD1   . ASP B  2  140  ? 28.456  147.423 145.744 1.00 61.90  ? 139  ASP B OD1   1 
ATOM   2835  O  OD2   . ASP B  2  140  ? 29.760  149.042 146.464 1.00 58.69  ? 139  ASP B OD2   1 
ATOM   2836  N  N     . LEU B  2  141  ? 27.462  150.167 148.649 1.00 49.93  ? 140  LEU B N     1 
ATOM   2837  C  CA    . LEU B  2  141  ? 27.017  151.547 148.459 1.00 48.54  ? 140  LEU B CA    1 
ATOM   2838  C  C     . LEU B  2  141  ? 28.132  152.421 147.904 1.00 46.94  ? 140  LEU B C     1 
ATOM   2839  O  O     . LEU B  2  141  ? 29.261  152.366 148.391 1.00 49.25  ? 140  LEU B O     1 
ATOM   2840  C  CB    . LEU B  2  141  ? 26.540  152.121 149.795 1.00 49.35  ? 140  LEU B CB    1 
ATOM   2841  C  CG    . LEU B  2  141  ? 25.387  151.374 150.469 1.00 49.72  ? 140  LEU B CG    1 
ATOM   2842  C  CD1   . LEU B  2  141  ? 25.266  151.824 151.908 1.00 49.67  ? 140  LEU B CD1   1 
ATOM   2843  C  CD2   . LEU B  2  141  ? 24.088  151.616 149.707 1.00 50.36  ? 140  LEU B CD2   1 
ATOM   2844  N  N     . ARG B  2  142  ? 27.822  153.236 146.900 1.00 43.27  ? 141  ARG B N     1 
ATOM   2845  C  CA    . ARG B  2  142  ? 28.829  154.100 146.298 1.00 41.36  ? 141  ARG B CA    1 
ATOM   2846  C  C     . ARG B  2  142  ? 28.203  155.425 145.904 1.00 42.24  ? 141  ARG B C     1 
ATOM   2847  O  O     . ARG B  2  142  ? 26.999  155.492 145.684 1.00 43.19  ? 141  ARG B O     1 
ATOM   2848  C  CB    . ARG B  2  142  ? 29.415  153.428 145.065 1.00 40.21  ? 141  ARG B CB    1 
ATOM   2849  C  CG    . ARG B  2  142  ? 29.687  151.938 145.237 1.00 40.11  ? 141  ARG B CG    1 
ATOM   2850  C  CD    . ARG B  2  142  ? 30.243  151.354 143.965 1.00 38.72  ? 141  ARG B CD    1 
ATOM   2851  N  NE    . ARG B  2  142  ? 30.290  149.899 143.967 1.00 37.60  ? 141  ARG B NE    1 
ATOM   2852  C  CZ    . ARG B  2  142  ? 30.553  149.180 142.879 1.00 39.23  ? 141  ARG B CZ    1 
ATOM   2853  N  NH1   . ARG B  2  142  ? 30.781  149.801 141.729 1.00 37.86  ? 141  ARG B NH1   1 
ATOM   2854  N  NH2   . ARG B  2  142  ? 30.596  147.849 142.933 1.00 38.77  ? 141  ARG B NH2   1 
ATOM   2855  N  N     . LEU B  2  143  ? 29.020  156.471 145.802 1.00 42.69  ? 142  LEU B N     1 
ATOM   2856  C  CA    . LEU B  2  143  ? 28.539  157.808 145.448 1.00 42.90  ? 142  LEU B CA    1 
ATOM   2857  C  C     . LEU B  2  143  ? 28.890  158.269 144.040 1.00 43.82  ? 142  LEU B C     1 
ATOM   2858  O  O     . LEU B  2  143  ? 30.061  158.288 143.667 1.00 43.75  ? 142  LEU B O     1 
ATOM   2859  C  CB    . LEU B  2  143  ? 29.108  158.847 146.410 1.00 43.21  ? 142  LEU B CB    1 
ATOM   2860  C  CG    . LEU B  2  143  ? 28.831  158.789 147.908 1.00 44.75  ? 142  LEU B CG    1 
ATOM   2861  C  CD1   . LEU B  2  143  ? 29.598  159.917 148.587 1.00 44.39  ? 142  LEU B CD1   1 
ATOM   2862  C  CD2   . LEU B  2  143  ? 27.337  158.926 148.173 1.00 45.06  ? 142  LEU B CD2   1 
ATOM   2863  N  N     . ILE B  2  144  ? 27.882  158.649 143.262 1.00 45.01  ? 143  ILE B N     1 
ATOM   2864  C  CA    . ILE B  2  144  ? 28.134  159.164 141.920 1.00 46.91  ? 143  ILE B CA    1 
ATOM   2865  C  C     . ILE B  2  144  ? 28.860  160.468 142.212 1.00 47.83  ? 143  ILE B C     1 
ATOM   2866  O  O     . ILE B  2  144  ? 28.325  161.324 142.923 1.00 49.13  ? 143  ILE B O     1 
ATOM   2867  C  CB    . ILE B  2  144  ? 26.835  159.503 141.169 1.00 46.66  ? 143  ILE B CB    1 
ATOM   2868  C  CG1   . ILE B  2  144  ? 26.008  158.237 140.940 1.00 46.61  ? 143  ILE B CG1   1 
ATOM   2869  C  CG2   . ILE B  2  144  ? 27.173  160.158 139.832 1.00 46.55  ? 143  ILE B CG2   1 
ATOM   2870  C  CD1   . ILE B  2  144  ? 26.557  157.326 139.855 1.00 47.82  ? 143  ILE B CD1   1 
ATOM   2871  N  N     . THR B  2  145  ? 30.062  160.637 141.668 1.00 47.58  ? 144  THR B N     1 
ATOM   2872  C  CA    . THR B  2  145  ? 30.821  161.842 141.958 1.00 47.18  ? 144  THR B CA    1 
ATOM   2873  C  C     . THR B  2  145  ? 31.490  162.510 140.774 1.00 47.45  ? 144  THR B C     1 
ATOM   2874  O  O     . THR B  2  145  ? 32.072  161.839 139.924 1.00 49.60  ? 144  THR B O     1 
ATOM   2875  C  CB    . THR B  2  145  ? 31.889  161.536 142.987 1.00 46.18  ? 144  THR B CB    1 
ATOM   2876  O  OG1   . THR B  2  145  ? 31.284  160.901 144.116 1.00 46.59  ? 144  THR B OG1   1 
ATOM   2877  C  CG2   . THR B  2  145  ? 32.565  162.801 143.430 1.00 47.99  ? 144  THR B CG2   1 
ATOM   2878  N  N     . HIS B  2  146  ? 31.418  163.837 140.729 1.00 46.42  ? 145  HIS B N     1 
ATOM   2879  C  CA    . HIS B  2  146  ? 32.039  164.583 139.649 1.00 45.56  ? 145  HIS B CA    1 
ATOM   2880  C  C     . HIS B  2  146  ? 32.994  165.642 140.171 1.00 45.87  ? 145  HIS B C     1 
ATOM   2881  O  O     . HIS B  2  146  ? 32.841  166.149 141.284 1.00 46.94  ? 145  HIS B O     1 
ATOM   2882  C  CB    . HIS B  2  146  ? 30.991  165.261 138.776 1.00 45.49  ? 145  HIS B CB    1 
ATOM   2883  C  CG    . HIS B  2  146  ? 30.536  166.586 139.296 1.00 44.73  ? 145  HIS B CG    1 
ATOM   2884  N  ND1   . HIS B  2  146  ? 29.489  166.720 140.181 1.00 45.68  ? 145  HIS B ND1   1 
ATOM   2885  C  CD2   . HIS B  2  146  ? 30.988  167.837 139.056 1.00 44.69  ? 145  HIS B CD2   1 
ATOM   2886  C  CE1   . HIS B  2  146  ? 29.313  167.998 140.462 1.00 46.59  ? 145  HIS B CE1   1 
ATOM   2887  N  NE2   . HIS B  2  146  ? 30.211  168.698 139.792 1.00 47.26  ? 145  HIS B NE2   1 
ATOM   2888  N  N     . THR B  2  147  ? 33.969  165.986 139.336 1.00 45.62  ? 146  THR B N     1 
ATOM   2889  C  CA    . THR B  2  147  ? 34.980  166.977 139.672 1.00 43.54  ? 146  THR B CA    1 
ATOM   2890  C  C     . THR B  2  147  ? 34.546  168.370 139.208 1.00 41.41  ? 146  THR B C     1 
ATOM   2891  O  O     . THR B  2  147  ? 33.559  168.506 138.493 1.00 39.92  ? 146  THR B O     1 
ATOM   2892  C  CB    . THR B  2  147  ? 36.344  166.580 139.034 1.00 43.03  ? 146  THR B CB    1 
ATOM   2893  O  OG1   . THR B  2  147  ? 36.280  166.710 137.609 1.00 43.57  ? 146  THR B OG1   1 
ATOM   2894  C  CG2   . THR B  2  147  ? 36.666  165.129 139.356 1.00 41.40  ? 146  THR B CG2   1 
ATOM   2895  N  N     . VAL B  2  148  ? 35.287  169.393 139.627 1.00 40.97  ? 147  VAL B N     1 
ATOM   2896  C  CA    . VAL B  2  148  ? 34.989  170.782 139.276 1.00 41.89  ? 147  VAL B CA    1 
ATOM   2897  C  C     . VAL B  2  148  ? 36.103  171.427 138.445 1.00 42.78  ? 147  VAL B C     1 
ATOM   2898  O  O     . VAL B  2  148  ? 36.834  172.288 138.944 1.00 42.99  ? 147  VAL B O     1 
ATOM   2899  C  CB    . VAL B  2  148  ? 34.805  171.639 140.541 1.00 41.00  ? 147  VAL B CB    1 
ATOM   2900  C  CG1   . VAL B  2  148  ? 34.438  173.060 140.153 1.00 39.92  ? 147  VAL B CG1   1 
ATOM   2901  C  CG2   . VAL B  2  148  ? 33.750  171.021 141.443 1.00 39.88  ? 147  VAL B CG2   1 
ATOM   2902  N  N     . PRO B  2  149  ? 36.230  171.037 137.162 1.00 43.03  ? 148  PRO B N     1 
ATOM   2903  C  CA    . PRO B  2  149  ? 37.240  171.538 136.216 1.00 43.83  ? 148  PRO B CA    1 
ATOM   2904  C  C     . PRO B  2  149  ? 37.531  173.034 136.279 1.00 43.22  ? 148  PRO B C     1 
ATOM   2905  O  O     . PRO B  2  149  ? 38.632  173.472 135.956 1.00 41.86  ? 148  PRO B O     1 
ATOM   2906  C  CB    . PRO B  2  149  ? 36.671  171.128 134.866 1.00 43.89  ? 148  PRO B CB    1 
ATOM   2907  C  CG    . PRO B  2  149  ? 36.008  169.822 135.185 1.00 44.92  ? 148  PRO B CG    1 
ATOM   2908  C  CD    . PRO B  2  149  ? 35.290  170.124 136.483 1.00 44.41  ? 148  PRO B CD    1 
ATOM   2909  N  N     . ASP B  2  150  ? 36.538  173.812 136.689 1.00 44.81  ? 149  ASP B N     1 
ATOM   2910  C  CA    . ASP B  2  150  ? 36.679  175.258 136.788 1.00 47.71  ? 149  ASP B CA    1 
ATOM   2911  C  C     . ASP B  2  150  ? 37.634  175.718 137.869 1.00 48.08  ? 149  ASP B C     1 
ATOM   2912  O  O     . ASP B  2  150  ? 38.371  176.684 137.682 1.00 48.83  ? 149  ASP B O     1 
ATOM   2913  C  CB    . ASP B  2  150  ? 35.319  175.896 137.028 1.00 50.00  ? 149  ASP B CB    1 
ATOM   2914  C  CG    . ASP B  2  150  ? 34.630  176.270 135.745 1.00 53.25  ? 149  ASP B CG    1 
ATOM   2915  O  OD1   . ASP B  2  150  ? 35.112  175.820 134.682 1.00 55.24  ? 149  ASP B OD1   1 
ATOM   2916  O  OD2   . ASP B  2  150  ? 33.613  177.006 135.797 1.00 55.08  ? 149  ASP B OD2   1 
ATOM   2917  N  N     . ALA B  2  151  ? 37.611  175.042 139.011 1.00 48.78  ? 150  ALA B N     1 
ATOM   2918  C  CA    . ALA B  2  151  ? 38.493  175.405 140.111 1.00 48.26  ? 150  ALA B CA    1 
ATOM   2919  C  C     . ALA B  2  151  ? 39.927  175.459 139.593 1.00 47.95  ? 150  ALA B C     1 
ATOM   2920  O  O     . ALA B  2  151  ? 40.746  176.241 140.071 1.00 48.23  ? 150  ALA B O     1 
ATOM   2921  C  CB    . ALA B  2  151  ? 38.371  174.383 141.233 1.00 47.75  ? 150  ALA B CB    1 
ATOM   2922  N  N     . VAL B  2  152  ? 40.215  174.625 138.600 1.00 47.19  ? 151  VAL B N     1 
ATOM   2923  C  CA    . VAL B  2  152  ? 41.542  174.570 138.017 1.00 46.75  ? 151  VAL B CA    1 
ATOM   2924  C  C     . VAL B  2  152  ? 41.619  175.414 136.754 1.00 46.25  ? 151  VAL B C     1 
ATOM   2925  O  O     . VAL B  2  152  ? 41.047  175.069 135.718 1.00 45.68  ? 151  VAL B O     1 
ATOM   2926  C  CB    . VAL B  2  152  ? 41.948  173.120 137.678 1.00 47.36  ? 151  VAL B CB    1 
ATOM   2927  C  CG1   . VAL B  2  152  ? 43.385  173.087 137.165 1.00 46.98  ? 151  VAL B CG1   1 
ATOM   2928  C  CG2   . VAL B  2  152  ? 41.804  172.239 138.908 1.00 46.97  ? 151  VAL B CG2   1 
ATOM   2929  N  N     . PRO B  2  153  ? 42.322  176.548 136.837 1.00 45.80  ? 152  PRO B N     1 
ATOM   2930  C  CA    . PRO B  2  153  ? 42.514  177.489 135.735 1.00 46.17  ? 152  PRO B CA    1 
ATOM   2931  C  C     . PRO B  2  153  ? 43.447  176.954 134.656 1.00 46.59  ? 152  PRO B C     1 
ATOM   2932  O  O     . PRO B  2  153  ? 43.341  177.337 133.492 1.00 47.29  ? 152  PRO B O     1 
ATOM   2933  C  CB    . PRO B  2  153  ? 43.099  178.715 136.428 1.00 45.63  ? 152  PRO B CB    1 
ATOM   2934  C  CG    . PRO B  2  153  ? 42.560  178.613 137.813 1.00 45.73  ? 152  PRO B CG    1 
ATOM   2935  C  CD    . PRO B  2  153  ? 42.733  177.162 138.109 1.00 45.48  ? 152  PRO B CD    1 
ATOM   2936  N  N     . SER B  2  154  ? 44.364  176.073 135.039 1.00 46.32  ? 153  SER B N     1 
ATOM   2937  C  CA    . SER B  2  154  ? 45.304  175.523 134.078 1.00 48.31  ? 153  SER B CA    1 
ATOM   2938  C  C     . SER B  2  154  ? 44.699  174.469 133.157 1.00 49.92  ? 153  SER B C     1 
ATOM   2939  O  O     . SER B  2  154  ? 45.280  174.150 132.116 1.00 51.11  ? 153  SER B O     1 
ATOM   2940  C  CB    . SER B  2  154  ? 46.516  174.946 134.800 1.00 48.29  ? 153  SER B CB    1 
ATOM   2941  O  OG    . SER B  2  154  ? 47.266  175.982 135.409 1.00 48.10  ? 153  SER B OG    1 
ATOM   2942  N  N     . VAL B  2  155  ? 43.537  173.934 133.532 1.00 50.31  ? 154  VAL B N     1 
ATOM   2943  C  CA    . VAL B  2  155  ? 42.856  172.926 132.719 1.00 51.06  ? 154  VAL B CA    1 
ATOM   2944  C  C     . VAL B  2  155  ? 41.667  173.568 132.015 1.00 51.80  ? 154  VAL B C     1 
ATOM   2945  O  O     . VAL B  2  155  ? 40.740  174.036 132.669 1.00 53.34  ? 154  VAL B O     1 
ATOM   2946  C  CB    . VAL B  2  155  ? 42.358  171.762 133.581 1.00 50.43  ? 154  VAL B CB    1 
ATOM   2947  C  CG1   . VAL B  2  155  ? 41.630  170.756 132.719 1.00 49.72  ? 154  VAL B CG1   1 
ATOM   2948  C  CG2   . VAL B  2  155  ? 43.534  171.101 134.280 1.00 50.49  ? 154  VAL B CG2   1 
ATOM   2949  N  N     . PRO B  2  156  ? 41.674  173.577 130.668 1.00 52.64  ? 155  PRO B N     1 
ATOM   2950  C  CA    . PRO B  2  156  ? 40.650  174.148 129.782 1.00 52.38  ? 155  PRO B CA    1 
ATOM   2951  C  C     . PRO B  2  156  ? 39.213  173.795 130.093 1.00 52.83  ? 155  PRO B C     1 
ATOM   2952  O  O     . PRO B  2  156  ? 38.377  174.676 130.327 1.00 52.56  ? 155  PRO B O     1 
ATOM   2953  C  CB    . PRO B  2  156  ? 41.056  173.635 128.403 1.00 51.90  ? 155  PRO B CB    1 
ATOM   2954  C  CG    . PRO B  2  156  ? 42.518  173.517 128.515 1.00 53.43  ? 155  PRO B CG    1 
ATOM   2955  C  CD    . PRO B  2  156  ? 42.680  172.861 129.869 1.00 53.08  ? 155  PRO B CD    1 
ATOM   2956  N  N     . LYS B  2  157  ? 38.930  172.499 130.079 1.00 52.31  ? 156  LYS B N     1 
ATOM   2957  C  CA    . LYS B  2  157  ? 37.583  172.016 130.322 1.00 51.98  ? 156  LYS B CA    1 
ATOM   2958  C  C     . LYS B  2  157  ? 36.915  172.574 131.578 1.00 51.11  ? 156  LYS B C     1 
ATOM   2959  O  O     . LYS B  2  157  ? 37.559  172.851 132.593 1.00 49.92  ? 156  LYS B O     1 
ATOM   2960  C  CB    . LYS B  2  157  ? 37.573  170.479 130.346 1.00 51.38  ? 156  LYS B CB    1 
ATOM   2961  C  CG    . LYS B  2  157  ? 38.533  169.866 131.335 1.00 51.24  ? 156  LYS B CG    1 
ATOM   2962  C  CD    . LYS B  2  157  ? 38.829  168.403 131.019 1.00 51.29  ? 156  LYS B CD    1 
ATOM   2963  C  CE    . LYS B  2  157  ? 37.702  167.467 131.410 1.00 51.78  ? 156  LYS B CE    1 
ATOM   2964  N  NZ    . LYS B  2  157  ? 38.200  166.058 131.439 1.00 50.29  ? 156  LYS B NZ    1 
ATOM   2965  N  N     . LYS B  2  158  ? 35.605  172.755 131.462 1.00 50.01  ? 157  LYS B N     1 
ATOM   2966  C  CA    . LYS B  2  158  ? 34.767  173.242 132.537 1.00 49.68  ? 157  LYS B CA    1 
ATOM   2967  C  C     . LYS B  2  158  ? 33.787  172.103 132.734 1.00 48.86  ? 157  LYS B C     1 
ATOM   2968  O  O     . LYS B  2  158  ? 33.121  171.993 133.762 1.00 49.79  ? 157  LYS B O     1 
ATOM   2969  C  CB    . LYS B  2  158  ? 34.030  174.495 132.093 1.00 50.53  ? 157  LYS B CB    1 
ATOM   2970  C  CG    . LYS B  2  158  ? 34.949  175.582 131.591 1.00 51.88  ? 157  LYS B CG    1 
ATOM   2971  C  CD    . LYS B  2  158  ? 34.181  176.609 130.798 1.00 51.61  ? 157  LYS B CD    1 
ATOM   2972  C  CE    . LYS B  2  158  ? 35.133  177.503 130.059 1.00 52.22  ? 157  LYS B CE    1 
ATOM   2973  N  NZ    . LYS B  2  158  ? 34.473  178.092 128.872 1.00 55.88  ? 157  LYS B NZ    1 
ATOM   2974  N  N     . LYS B  2  159  ? 33.715  171.253 131.718 1.00 47.24  ? 158  LYS B N     1 
ATOM   2975  C  CA    . LYS B  2  159  ? 32.853  170.085 131.729 1.00 47.59  ? 158  LYS B CA    1 
ATOM   2976  C  C     . LYS B  2  159  ? 33.342  169.130 132.827 1.00 47.28  ? 158  LYS B C     1 
ATOM   2977  O  O     . LYS B  2  159  ? 34.463  168.638 132.775 1.00 48.00  ? 158  LYS B O     1 
ATOM   2978  C  CB    . LYS B  2  159  ? 32.931  169.423 130.358 1.00 48.19  ? 158  LYS B CB    1 
ATOM   2979  C  CG    . LYS B  2  159  ? 32.222  168.106 130.231 1.00 49.90  ? 158  LYS B CG    1 
ATOM   2980  C  CD    . LYS B  2  159  ? 32.449  167.564 128.832 1.00 53.11  ? 158  LYS B CD    1 
ATOM   2981  C  CE    . LYS B  2  159  ? 31.881  166.158 128.650 1.00 56.90  ? 158  LYS B CE    1 
ATOM   2982  N  NZ    . LYS B  2  159  ? 30.388  166.078 128.768 1.00 58.99  ? 158  LYS B NZ    1 
ATOM   2983  N  N     . PRO B  2  160  ? 32.509  168.865 133.842 1.00 46.42  ? 159  PRO B N     1 
ATOM   2984  C  CA    . PRO B  2  160  ? 32.869  167.973 134.947 1.00 46.34  ? 159  PRO B CA    1 
ATOM   2985  C  C     . PRO B  2  160  ? 33.210  166.565 134.490 1.00 46.41  ? 159  PRO B C     1 
ATOM   2986  O  O     . PRO B  2  160  ? 32.886  166.174 133.366 1.00 46.61  ? 159  PRO B O     1 
ATOM   2987  C  CB    . PRO B  2  160  ? 31.619  167.979 135.817 1.00 45.80  ? 159  PRO B CB    1 
ATOM   2988  C  CG    . PRO B  2  160  ? 31.033  169.299 135.548 1.00 46.31  ? 159  PRO B CG    1 
ATOM   2989  C  CD    . PRO B  2  160  ? 31.166  169.415 134.057 1.00 46.65  ? 159  PRO B CD    1 
ATOM   2990  N  N     . ASP B  2  161  ? 33.850  165.812 135.381 1.00 45.42  ? 160  ASP B N     1 
ATOM   2991  C  CA    . ASP B  2  161  ? 34.248  164.435 135.117 1.00 45.65  ? 160  ASP B CA    1 
ATOM   2992  C  C     . ASP B  2  161  ? 33.598  163.492 136.134 1.00 46.29  ? 160  ASP B C     1 
ATOM   2993  O  O     . ASP B  2  161  ? 34.072  163.366 137.267 1.00 46.40  ? 160  ASP B O     1 
ATOM   2994  C  CB    . ASP B  2  161  ? 35.775  164.302 135.191 1.00 46.79  ? 160  ASP B CB    1 
ATOM   2995  C  CG    . ASP B  2  161  ? 36.485  164.847 133.950 1.00 47.09  ? 160  ASP B CG    1 
ATOM   2996  O  OD1   . ASP B  2  161  ? 36.097  164.461 132.824 1.00 47.73  ? 160  ASP B OD1   1 
ATOM   2997  O  OD2   . ASP B  2  161  ? 37.442  165.644 134.100 1.00 45.70  ? 160  ASP B OD2   1 
ATOM   2998  N  N     . VAL B  2  162  ? 32.523  162.822 135.724 1.00 46.17  ? 161  VAL B N     1 
ATOM   2999  C  CA    . VAL B  2  162  ? 31.804  161.906 136.607 1.00 45.58  ? 161  VAL B CA    1 
ATOM   3000  C  C     . VAL B  2  162  ? 32.477  160.554 136.788 1.00 44.75  ? 161  VAL B C     1 
ATOM   3001  O  O     . VAL B  2  162  ? 33.210  160.087 135.931 1.00 44.88  ? 161  VAL B O     1 
ATOM   3002  C  CB    . VAL B  2  162  ? 30.375  161.660 136.105 1.00 46.28  ? 161  VAL B CB    1 
ATOM   3003  C  CG1   . VAL B  2  162  ? 29.572  160.885 137.155 1.00 46.70  ? 161  VAL B CG1   1 
ATOM   3004  C  CG2   . VAL B  2  162  ? 29.714  162.986 135.786 1.00 46.05  ? 161  VAL B CG2   1 
ATOM   3005  N  N     . MET B  2  163  ? 32.195  159.919 137.916 1.00 45.61  ? 162  MET B N     1 
ATOM   3006  C  CA    . MET B  2  163  ? 32.773  158.623 138.251 1.00 45.61  ? 162  MET B CA    1 
ATOM   3007  C  C     . MET B  2  163  ? 32.143  158.125 139.547 1.00 45.64  ? 162  MET B C     1 
ATOM   3008  O  O     . MET B  2  163  ? 31.622  158.916 140.335 1.00 46.38  ? 162  MET B O     1 
ATOM   3009  C  CB    . MET B  2  163  ? 34.277  158.776 138.430 1.00 46.33  ? 162  MET B CB    1 
ATOM   3010  C  CG    . MET B  2  163  ? 34.644  159.962 139.301 1.00 44.33  ? 162  MET B CG    1 
ATOM   3011  S  SD    . MET B  2  163  ? 36.159  160.734 138.761 1.00 43.60  ? 162  MET B SD    1 
ATOM   3012  C  CE    . MET B  2  163  ? 37.046  160.735 140.220 1.00 41.23  ? 162  MET B CE    1 
ATOM   3013  N  N     . GLU B  2  164  ? 32.197  156.821 139.770 1.00 44.37  ? 163  GLU B N     1 
ATOM   3014  C  CA    . GLU B  2  164  ? 31.609  156.238 140.963 1.00 44.74  ? 163  GLU B CA    1 
ATOM   3015  C  C     . GLU B  2  164  ? 32.700  155.883 141.969 1.00 46.02  ? 163  GLU B C     1 
ATOM   3016  O  O     . GLU B  2  164  ? 33.794  155.477 141.584 1.00 46.44  ? 163  GLU B O     1 
ATOM   3017  C  CB    . GLU B  2  164  ? 30.817  154.995 140.564 1.00 43.43  ? 163  GLU B CB    1 
ATOM   3018  C  CG    . GLU B  2  164  ? 29.669  154.660 141.473 1.00 43.54  ? 163  GLU B CG    1 
ATOM   3019  C  CD    . GLU B  2  164  ? 28.808  153.528 140.938 1.00 42.80  ? 163  GLU B CD    1 
ATOM   3020  O  OE1   . GLU B  2  164  ? 28.172  153.686 139.876 1.00 42.63  ? 163  GLU B OE1   1 
ATOM   3021  O  OE2   . GLU B  2  164  ? 28.770  152.469 141.585 1.00 42.75  ? 163  GLU B OE2   1 
ATOM   3022  N  N     . THR B  2  165  ? 32.420  156.058 143.257 1.00 47.37  ? 164  THR B N     1 
ATOM   3023  C  CA    . THR B  2  165  ? 33.407  155.731 144.285 1.00 49.33  ? 164  THR B CA    1 
ATOM   3024  C  C     . THR B  2  165  ? 32.729  155.118 145.493 1.00 50.26  ? 164  THR B C     1 
ATOM   3025  O  O     . THR B  2  165  ? 32.068  155.814 146.250 1.00 50.98  ? 164  THR B O     1 
ATOM   3026  C  CB    . THR B  2  165  ? 34.173  156.961 144.753 1.00 49.31  ? 164  THR B CB    1 
ATOM   3027  O  OG1   . THR B  2  165  ? 34.746  157.626 143.620 1.00 50.70  ? 164  THR B OG1   1 
ATOM   3028  C  CG2   . THR B  2  165  ? 35.281  156.547 145.714 1.00 48.33  ? 164  THR B CG2   1 
ATOM   3029  N  N     . ARG B  2  166  ? 32.912  153.813 145.673 1.00 51.82  ? 165  ARG B N     1 
ATOM   3030  C  CA    . ARG B  2  166  ? 32.287  153.088 146.768 1.00 52.03  ? 165  ARG B CA    1 
ATOM   3031  C  C     . ARG B  2  166  ? 32.518  153.665 148.145 1.00 52.41  ? 165  ARG B C     1 
ATOM   3032  O  O     . ARG B  2  166  ? 33.541  154.293 148.412 1.00 52.62  ? 165  ARG B O     1 
ATOM   3033  C  CB    . ARG B  2  166  ? 32.726  151.627 146.757 1.00 51.86  ? 165  ARG B CB    1 
ATOM   3034  C  CG    . ARG B  2  166  ? 32.175  150.818 147.923 1.00 52.51  ? 165  ARG B CG    1 
ATOM   3035  C  CD    . ARG B  2  166  ? 32.260  149.344 147.620 1.00 52.87  ? 165  ARG B CD    1 
ATOM   3036  N  NE    . ARG B  2  166  ? 31.885  148.484 148.739 1.00 52.36  ? 165  ARG B NE    1 
ATOM   3037  C  CZ    . ARG B  2  166  ? 32.630  148.309 149.822 1.00 51.33  ? 165  ARG B CZ    1 
ATOM   3038  N  NH1   . ARG B  2  166  ? 33.790  148.940 149.943 1.00 50.55  ? 165  ARG B NH1   1 
ATOM   3039  N  NH2   . ARG B  2  166  ? 32.222  147.482 150.771 1.00 51.77  ? 165  ARG B NH2   1 
ATOM   3040  N  N     . VAL B  2  167  ? 31.542  153.444 149.016 1.00 53.09  ? 166  VAL B N     1 
ATOM   3041  C  CA    . VAL B  2  167  ? 31.610  153.919 150.382 1.00 54.50  ? 166  VAL B CA    1 
ATOM   3042  C  C     . VAL B  2  167  ? 31.728  152.715 151.290 1.00 55.30  ? 166  VAL B C     1 
ATOM   3043  O  O     . VAL B  2  167  ? 30.858  151.850 151.294 1.00 55.68  ? 166  VAL B O     1 
ATOM   3044  C  CB    . VAL B  2  167  ? 30.344  154.708 150.782 1.00 55.16  ? 166  VAL B CB    1 
ATOM   3045  C  CG1   . VAL B  2  167  ? 30.459  155.146 152.240 1.00 56.13  ? 166  VAL B CG1   1 
ATOM   3046  C  CG2   . VAL B  2  167  ? 30.161  155.922 149.872 1.00 54.22  ? 166  VAL B CG2   1 
ATOM   3047  N  N     . GLY B  2  168  ? 32.817  152.663 152.046 1.00 56.39  ? 167  GLY B N     1 
ATOM   3048  C  CA    . GLY B  2  168  ? 33.039  151.569 152.972 1.00 58.31  ? 167  GLY B CA    1 
ATOM   3049  C  C     . GLY B  2  168  ? 33.142  152.164 154.358 1.00 59.69  ? 167  GLY B C     1 
ATOM   3050  O  O     . GLY B  2  168  ? 33.312  153.379 154.493 1.00 59.10  ? 167  GLY B O     1 
ATOM   3051  N  N     . GLY B  2  169  ? 33.034  151.337 155.391 1.00 60.78  ? 168  GLY B N     1 
ATOM   3052  C  CA    . GLY B  2  169  ? 33.125  151.880 156.733 1.00 63.34  ? 168  GLY B CA    1 
ATOM   3053  C  C     . GLY B  2  169  ? 32.599  150.989 157.832 1.00 64.65  ? 168  GLY B C     1 
ATOM   3054  O  O     . GLY B  2  169  ? 33.088  149.881 158.025 1.00 66.62  ? 168  GLY B O     1 
ATOM   3055  N  N     . GLY B  2  170  ? 31.608  151.466 158.571 1.00 65.04  ? 169  GLY B N     1 
ATOM   3056  C  CA    . GLY B  2  170  ? 31.071  150.648 159.640 1.00 65.78  ? 169  GLY B CA    1 
ATOM   3057  C  C     . GLY B  2  170  ? 30.118  149.599 159.105 1.00 66.12  ? 169  GLY B C     1 
ATOM   3058  O  O     . GLY B  2  170  ? 30.412  148.903 158.135 1.00 65.55  ? 169  GLY B O     1 
ATOM   3059  N  N     . SER B  2  171  ? 28.970  149.475 159.757 1.00 66.86  ? 170  SER B N     1 
ATOM   3060  C  CA    . SER B  2  171  ? 27.959  148.531 159.325 1.00 68.05  ? 170  SER B CA    1 
ATOM   3061  C  C     . SER B  2  171  ? 27.201  149.256 158.217 1.00 67.88  ? 170  SER B C     1 
ATOM   3062  O  O     . SER B  2  171  ? 27.098  150.486 158.231 1.00 67.44  ? 170  SER B O     1 
ATOM   3063  C  CB    . SER B  2  171  ? 27.011  148.210 160.478 1.00 68.82  ? 170  SER B CB    1 
ATOM   3064  O  OG    . SER B  2  171  ? 26.250  149.357 160.824 1.00 70.15  ? 170  SER B OG    1 
ATOM   3065  N  N     . VAL B  2  172  ? 26.682  148.503 157.256 1.00 67.32  ? 171  VAL B N     1 
ATOM   3066  C  CA    . VAL B  2  172  ? 25.944  149.099 156.154 1.00 67.24  ? 171  VAL B CA    1 
ATOM   3067  C  C     . VAL B  2  172  ? 25.011  150.189 156.656 1.00 67.40  ? 171  VAL B C     1 
ATOM   3068  O  O     . VAL B  2  172  ? 25.012  151.307 156.138 1.00 66.99  ? 171  VAL B O     1 
ATOM   3069  C  CB    . VAL B  2  172  ? 25.117  148.046 155.429 1.00 66.74  ? 171  VAL B CB    1 
ATOM   3070  C  CG1   . VAL B  2  172  ? 26.019  147.167 154.591 1.00 67.79  ? 171  VAL B CG1   1 
ATOM   3071  C  CG2   . VAL B  2  172  ? 24.394  147.202 156.445 1.00 68.47  ? 171  VAL B CG2   1 
ATOM   3072  N  N     . SER B  2  173  ? 24.224  149.855 157.675 1.00 67.89  ? 172  SER B N     1 
ATOM   3073  C  CA    . SER B  2  173  ? 23.275  150.792 158.261 1.00 67.69  ? 172  SER B CA    1 
ATOM   3074  C  C     . SER B  2  173  ? 23.937  152.122 158.531 1.00 67.32  ? 172  SER B C     1 
ATOM   3075  O  O     . SER B  2  173  ? 23.419  153.166 158.151 1.00 67.40  ? 172  SER B O     1 
ATOM   3076  C  CB    . SER B  2  173  ? 22.716  150.235 159.567 1.00 68.71  ? 172  SER B CB    1 
ATOM   3077  O  OG    . SER B  2  173  ? 22.010  149.030 159.337 1.00 71.04  ? 172  SER B OG    1 
ATOM   3078  N  N     . ASP B  2  174  ? 25.094  152.076 159.181 1.00 66.97  ? 173  ASP B N     1 
ATOM   3079  C  CA    . ASP B  2  174  ? 25.830  153.287 159.512 1.00 66.75  ? 173  ASP B CA    1 
ATOM   3080  C  C     . ASP B  2  174  ? 26.372  154.049 158.310 1.00 66.01  ? 173  ASP B C     1 
ATOM   3081  O  O     . ASP B  2  174  ? 26.199  155.265 158.230 1.00 64.81  ? 173  ASP B O     1 
ATOM   3082  C  CB    . ASP B  2  174  ? 26.960  152.956 160.487 1.00 68.50  ? 173  ASP B CB    1 
ATOM   3083  C  CG    . ASP B  2  174  ? 26.461  152.786 161.913 1.00 70.25  ? 173  ASP B CG    1 
ATOM   3084  O  OD1   . ASP B  2  174  ? 26.205  153.814 162.578 1.00 71.32  ? 173  ASP B OD1   1 
ATOM   3085  O  OD2   . ASP B  2  174  ? 26.308  151.631 162.366 1.00 70.74  ? 173  ASP B OD2   1 
ATOM   3086  N  N     . ARG B  2  175  ? 27.015  153.354 157.370 1.00 65.78  ? 174  ARG B N     1 
ATOM   3087  C  CA    . ARG B  2  175  ? 27.555  154.040 156.195 1.00 65.08  ? 174  ARG B CA    1 
ATOM   3088  C  C     . ARG B  2  175  ? 26.489  154.403 155.180 1.00 63.80  ? 174  ARG B C     1 
ATOM   3089  O  O     . ARG B  2  175  ? 26.716  155.258 154.331 1.00 62.56  ? 174  ARG B O     1 
ATOM   3090  C  CB    . ARG B  2  175  ? 28.658  153.227 155.504 1.00 65.30  ? 174  ARG B CB    1 
ATOM   3091  C  CG    . ARG B  2  175  ? 28.251  151.899 154.926 1.00 65.77  ? 174  ARG B CG    1 
ATOM   3092  C  CD    . ARG B  2  175  ? 29.231  151.479 153.830 1.00 65.71  ? 174  ARG B CD    1 
ATOM   3093  N  NE    . ARG B  2  175  ? 29.215  150.037 153.612 1.00 65.50  ? 174  ARG B NE    1 
ATOM   3094  C  CZ    . ARG B  2  175  ? 29.895  149.172 154.354 1.00 65.29  ? 174  ARG B CZ    1 
ATOM   3095  N  NH1   . ARG B  2  175  ? 30.653  149.610 155.352 1.00 63.93  ? 174  ARG B NH1   1 
ATOM   3096  N  NH2   . ARG B  2  175  ? 29.794  147.871 154.119 1.00 65.38  ? 174  ARG B NH2   1 
ATOM   3097  N  N     . LEU B  2  176  ? 25.334  153.750 155.252 1.00 63.83  ? 175  LEU B N     1 
ATOM   3098  C  CA    . LEU B  2  176  ? 24.257  154.083 154.334 1.00 64.45  ? 175  LEU B CA    1 
ATOM   3099  C  C     . LEU B  2  176  ? 23.882  155.500 154.711 1.00 65.79  ? 175  LEU B C     1 
ATOM   3100  O  O     . LEU B  2  176  ? 23.615  156.343 153.853 1.00 65.26  ? 175  LEU B O     1 
ATOM   3101  C  CB    . LEU B  2  176  ? 23.045  153.175 154.535 1.00 63.14  ? 175  LEU B CB    1 
ATOM   3102  C  CG    . LEU B  2  176  ? 21.892  153.433 153.551 1.00 62.85  ? 175  LEU B CG    1 
ATOM   3103  C  CD1   . LEU B  2  176  ? 20.863  152.328 153.675 1.00 63.25  ? 175  LEU B CD1   1 
ATOM   3104  C  CD2   . LEU B  2  176  ? 21.241  154.775 153.812 1.00 61.60  ? 175  LEU B CD2   1 
ATOM   3105  N  N     . ASP B  2  177  ? 23.870  155.743 156.018 1.00 67.47  ? 176  ASP B N     1 
ATOM   3106  C  CA    . ASP B  2  177  ? 23.535  157.049 156.561 1.00 69.36  ? 176  ASP B CA    1 
ATOM   3107  C  C     . ASP B  2  177  ? 24.630  158.052 156.250 1.00 69.49  ? 176  ASP B C     1 
ATOM   3108  O  O     . ASP B  2  177  ? 24.354  159.168 155.808 1.00 68.83  ? 176  ASP B O     1 
ATOM   3109  C  CB    . ASP B  2  177  ? 23.350  156.953 158.069 1.00 72.13  ? 176  ASP B CB    1 
ATOM   3110  C  CG    . ASP B  2  177  ? 22.164  156.102 158.455 1.00 74.39  ? 176  ASP B CG    1 
ATOM   3111  O  OD1   . ASP B  2  177  ? 21.028  156.466 158.076 1.00 75.82  ? 176  ASP B OD1   1 
ATOM   3112  O  OD2   . ASP B  2  177  ? 22.369  155.073 159.137 1.00 75.99  ? 176  ASP B OD2   1 
ATOM   3113  N  N     . HIS B  2  178  ? 25.873  157.653 156.491 1.00 69.41  ? 177  HIS B N     1 
ATOM   3114  C  CA    . HIS B  2  178  ? 27.002  158.527 156.223 1.00 69.91  ? 177  HIS B CA    1 
ATOM   3115  C  C     . HIS B  2  178  ? 26.923  159.023 154.786 1.00 70.73  ? 177  HIS B C     1 
ATOM   3116  O  O     . HIS B  2  178  ? 27.257  160.167 154.492 1.00 70.88  ? 177  HIS B O     1 
ATOM   3117  C  CB    . HIS B  2  178  ? 28.310  157.781 156.424 1.00 70.03  ? 177  HIS B CB    1 
ATOM   3118  C  CG    . HIS B  2  178  ? 29.515  158.643 156.245 1.00 70.48  ? 177  HIS B CG    1 
ATOM   3119  N  ND1   . HIS B  2  178  ? 29.785  159.719 157.062 1.00 70.67  ? 177  HIS B ND1   1 
ATOM   3120  C  CD2   . HIS B  2  178  ? 30.513  158.604 155.332 1.00 71.50  ? 177  HIS B CD2   1 
ATOM   3121  C  CE1   . HIS B  2  178  ? 30.899  160.306 156.660 1.00 71.84  ? 177  HIS B CE1   1 
ATOM   3122  N  NE2   . HIS B  2  178  ? 31.361  159.649 155.612 1.00 71.96  ? 177  HIS B NE2   1 
ATOM   3123  N  N     . ALA B  2  179  ? 26.479  158.145 153.894 1.00 71.56  ? 178  ALA B N     1 
ATOM   3124  C  CA    . ALA B  2  179  ? 26.335  158.482 152.484 1.00 71.89  ? 178  ALA B CA    1 
ATOM   3125  C  C     . ALA B  2  179  ? 25.288  159.574 152.319 1.00 72.09  ? 178  ALA B C     1 
ATOM   3126  O  O     . ALA B  2  179  ? 25.612  160.714 151.986 1.00 72.86  ? 178  ALA B O     1 
ATOM   3127  C  CB    . ALA B  2  179  ? 25.922  157.251 151.693 1.00 72.25  ? 178  ALA B CB    1 
ATOM   3128  N  N     . LEU B  2  180  ? 24.030  159.212 152.553 1.00 71.91  ? 179  LEU B N     1 
ATOM   3129  C  CA    . LEU B  2  180  ? 22.932  160.155 152.430 1.00 72.49  ? 179  LEU B CA    1 
ATOM   3130  C  C     . LEU B  2  180  ? 23.296  161.502 153.022 1.00 73.15  ? 179  LEU B C     1 
ATOM   3131  O  O     . LEU B  2  180  ? 23.103  162.531 152.387 1.00 72.68  ? 179  LEU B O     1 
ATOM   3132  C  CB    . LEU B  2  180  ? 21.687  159.607 153.118 1.00 71.90  ? 179  LEU B CB    1 
ATOM   3133  C  CG    . LEU B  2  180  ? 21.036  158.416 152.417 1.00 72.16  ? 179  LEU B CG    1 
ATOM   3134  C  CD1   . LEU B  2  180  ? 19.983  157.806 153.333 1.00 71.75  ? 179  LEU B CD1   1 
ATOM   3135  C  CD2   . LEU B  2  180  ? 20.433  158.862 151.085 1.00 70.33  ? 179  LEU B CD2   1 
ATOM   3136  N  N     . ASP B  2  181  ? 23.831  161.497 154.235 1.00 75.55  ? 180  ASP B N     1 
ATOM   3137  C  CA    . ASP B  2  181  ? 24.220  162.746 154.876 1.00 78.55  ? 180  ASP B CA    1 
ATOM   3138  C  C     . ASP B  2  181  ? 25.072  163.540 153.892 1.00 78.55  ? 180  ASP B C     1 
ATOM   3139  O  O     . ASP B  2  181  ? 24.689  164.628 153.461 1.00 79.12  ? 180  ASP B O     1 
ATOM   3140  C  CB    . ASP B  2  181  ? 25.012  162.473 156.161 1.00 81.13  ? 180  ASP B CB    1 
ATOM   3141  C  CG    . ASP B  2  181  ? 24.215  161.667 157.179 1.00 84.18  ? 180  ASP B CG    1 
ATOM   3142  O  OD1   . ASP B  2  181  ? 23.035  162.010 157.426 1.00 85.35  ? 180  ASP B OD1   1 
ATOM   3143  O  OD2   . ASP B  2  181  ? 24.769  160.697 157.740 1.00 85.78  ? 180  ASP B OD2   1 
ATOM   3144  N  N     . ILE B  2  182  ? 26.222  162.978 153.536 1.00 78.22  ? 181  ILE B N     1 
ATOM   3145  C  CA    . ILE B  2  182  ? 27.125  163.613 152.591 1.00 77.95  ? 181  ILE B CA    1 
ATOM   3146  C  C     . ILE B  2  182  ? 26.315  164.215 151.453 1.00 78.41  ? 181  ILE B C     1 
ATOM   3147  O  O     . ILE B  2  182  ? 26.045  165.413 151.427 1.00 78.34  ? 181  ILE B O     1 
ATOM   3148  C  CB    . ILE B  2  182  ? 28.113  162.587 151.989 1.00 77.59  ? 181  ILE B CB    1 
ATOM   3149  C  CG1   . ILE B  2  182  ? 29.024  162.028 153.083 1.00 76.94  ? 181  ILE B CG1   1 
ATOM   3150  C  CG2   . ILE B  2  182  ? 28.934  163.240 150.892 1.00 77.71  ? 181  ILE B CG2   1 
ATOM   3151  C  CD1   . ILE B  2  182  ? 30.037  161.019 152.592 1.00 75.79  ? 181  ILE B CD1   1 
ATOM   3152  N  N     . VAL B  2  183  ? 25.921  163.356 150.523 1.00 79.46  ? 182  VAL B N     1 
ATOM   3153  C  CA    . VAL B  2  183  ? 25.147  163.754 149.358 1.00 80.86  ? 182  VAL B CA    1 
ATOM   3154  C  C     . VAL B  2  183  ? 24.218  164.945 149.595 1.00 82.22  ? 182  VAL B C     1 
ATOM   3155  O  O     . VAL B  2  183  ? 24.306  165.955 148.895 1.00 82.47  ? 182  VAL B O     1 
ATOM   3156  C  CB    . VAL B  2  183  ? 24.294  162.574 148.846 1.00 80.44  ? 182  VAL B CB    1 
ATOM   3157  C  CG1   . VAL B  2  183  ? 23.727  162.899 147.476 1.00 80.74  ? 182  VAL B CG1   1 
ATOM   3158  C  CG2   . VAL B  2  183  ? 25.127  161.307 148.800 1.00 79.63  ? 182  VAL B CG2   1 
ATOM   3159  N  N     . GLU B  2  184  ? 23.336  164.823 150.585 1.00 83.89  ? 183  GLU B N     1 
ATOM   3160  C  CA    . GLU B  2  184  ? 22.357  165.868 150.899 1.00 84.77  ? 183  GLU B CA    1 
ATOM   3161  C  C     . GLU B  2  184  ? 22.879  167.304 150.786 1.00 83.42  ? 183  GLU B C     1 
ATOM   3162  O  O     . GLU B  2  184  ? 22.477  168.041 149.884 1.00 83.23  ? 183  GLU B O     1 
ATOM   3163  C  CB    . GLU B  2  184  ? 21.758  165.646 152.302 1.00 86.42  ? 183  GLU B CB    1 
ATOM   3164  C  CG    . GLU B  2  184  ? 21.090  164.272 152.535 1.00 90.29  ? 183  GLU B CG    1 
ATOM   3165  C  CD    . GLU B  2  184  ? 19.865  163.989 151.652 1.00 92.38  ? 183  GLU B CD    1 
ATOM   3166  O  OE1   . GLU B  2  184  ? 19.986  163.999 150.405 1.00 92.69  ? 183  GLU B OE1   1 
ATOM   3167  O  OE2   . GLU B  2  184  ? 18.775  163.738 152.215 1.00 93.62  ? 183  GLU B OE2   1 
ATOM   3168  N  N     . ASP B  2  185  ? 23.773  167.694 151.691 1.00 82.31  ? 184  ASP B N     1 
ATOM   3169  C  CA    . ASP B  2  185  ? 24.329  169.051 151.701 1.00 81.38  ? 184  ASP B CA    1 
ATOM   3170  C  C     . ASP B  2  185  ? 24.505  169.631 150.299 1.00 79.31  ? 184  ASP B C     1 
ATOM   3171  O  O     . ASP B  2  185  ? 23.793  170.549 149.894 1.00 79.17  ? 184  ASP B O     1 
ATOM   3172  C  CB    . ASP B  2  185  ? 25.685  169.068 152.416 1.00 83.30  ? 184  ASP B CB    1 
ATOM   3173  C  CG    . ASP B  2  185  ? 25.903  167.849 153.293 1.00 85.53  ? 184  ASP B CG    1 
ATOM   3174  O  OD1   . ASP B  2  185  ? 25.002  167.514 154.096 1.00 87.05  ? 184  ASP B OD1   1 
ATOM   3175  O  OD2   . ASP B  2  185  ? 26.986  167.231 153.182 1.00 86.32  ? 184  ASP B OD2   1 
ATOM   3176  N  N     . GLY B  2  186  ? 25.477  169.086 149.577 1.00 77.25  ? 185  GLY B N     1 
ATOM   3177  C  CA    . GLY B  2  186  ? 25.774  169.517 148.223 1.00 73.23  ? 185  GLY B CA    1 
ATOM   3178  C  C     . GLY B  2  186  ? 26.713  168.486 147.629 1.00 70.21  ? 185  GLY B C     1 
ATOM   3179  O  O     . GLY B  2  186  ? 27.030  168.512 146.437 1.00 69.16  ? 185  GLY B O     1 
ATOM   3180  N  N     . GLY B  2  187  ? 27.145  167.567 148.492 1.00 67.90  ? 186  GLY B N     1 
ATOM   3181  C  CA    . GLY B  2  187  ? 28.050  166.502 148.105 1.00 64.42  ? 186  GLY B CA    1 
ATOM   3182  C  C     . GLY B  2  187  ? 29.490  166.969 148.144 1.00 62.17  ? 186  GLY B C     1 
ATOM   3183  O  O     . GLY B  2  187  ? 30.410  166.205 147.860 1.00 61.56  ? 186  GLY B O     1 
ATOM   3184  N  N     . GLU B  2  188  ? 29.683  168.228 148.519 1.00 60.01  ? 187  GLU B N     1 
ATOM   3185  C  CA    . GLU B  2  188  ? 31.012  168.827 148.562 1.00 58.41  ? 187  GLU B CA    1 
ATOM   3186  C  C     . GLU B  2  188  ? 31.997  168.278 149.586 1.00 57.25  ? 187  GLU B C     1 
ATOM   3187  O  O     . GLU B  2  188  ? 31.985  168.684 150.741 1.00 57.80  ? 187  GLU B O     1 
ATOM   3188  C  CB    . GLU B  2  188  ? 30.882  170.330 148.761 1.00 57.22  ? 187  GLU B CB    1 
ATOM   3189  C  CG    . GLU B  2  188  ? 32.203  171.035 148.863 1.00 57.85  ? 187  GLU B CG    1 
ATOM   3190  C  CD    . GLU B  2  188  ? 32.067  172.502 148.575 1.00 59.45  ? 187  GLU B CD    1 
ATOM   3191  O  OE1   . GLU B  2  188  ? 33.076  173.232 148.668 1.00 60.59  ? 187  GLU B OE1   1 
ATOM   3192  O  OE2   . GLU B  2  188  ? 30.940  172.926 148.248 1.00 60.95  ? 187  GLU B OE2   1 
ATOM   3193  N  N     . HIS B  2  189  ? 32.867  167.372 149.149 1.00 56.33  ? 188  HIS B N     1 
ATOM   3194  C  CA    . HIS B  2  189  ? 33.877  166.788 150.028 1.00 54.97  ? 188  HIS B CA    1 
ATOM   3195  C  C     . HIS B  2  189  ? 35.265  167.182 149.553 1.00 53.83  ? 188  HIS B C     1 
ATOM   3196  O  O     . HIS B  2  189  ? 35.415  167.720 148.458 1.00 54.07  ? 188  HIS B O     1 
ATOM   3197  C  CB    . HIS B  2  189  ? 33.743  165.264 150.062 1.00 56.17  ? 188  HIS B CB    1 
ATOM   3198  C  CG    . HIS B  2  189  ? 33.661  164.631 148.710 1.00 58.71  ? 188  HIS B CG    1 
ATOM   3199  N  ND1   . HIS B  2  189  ? 32.761  165.041 147.749 1.00 60.18  ? 188  HIS B ND1   1 
ATOM   3200  C  CD2   . HIS B  2  189  ? 34.351  163.601 148.164 1.00 59.50  ? 188  HIS B CD2   1 
ATOM   3201  C  CE1   . HIS B  2  189  ? 32.901  164.292 146.670 1.00 60.38  ? 188  HIS B CE1   1 
ATOM   3202  N  NE2   . HIS B  2  189  ? 33.858  163.410 146.896 1.00 60.04  ? 188  HIS B NE2   1 
ATOM   3203  N  N     . ALA B  2  190  ? 36.277  166.926 150.374 1.00 51.71  ? 189  ALA B N     1 
ATOM   3204  C  CA    . ALA B  2  190  ? 37.642  167.280 150.009 1.00 50.57  ? 189  ALA B CA    1 
ATOM   3205  C  C     . ALA B  2  190  ? 38.629  166.154 150.265 1.00 50.77  ? 189  ALA B C     1 
ATOM   3206  O  O     . ALA B  2  190  ? 38.326  165.190 150.967 1.00 50.94  ? 189  ALA B O     1 
ATOM   3207  C  CB    . ALA B  2  190  ? 38.074  168.517 150.763 1.00 49.56  ? 189  ALA B CB    1 
ATOM   3208  N  N     . MET B  2  191  ? 39.817  166.291 149.686 1.00 50.62  ? 190  MET B N     1 
ATOM   3209  C  CA    . MET B  2  191  ? 40.867  165.297 149.834 1.00 49.66  ? 190  MET B CA    1 
ATOM   3210  C  C     . MET B  2  191  ? 41.165  165.065 151.311 1.00 49.94  ? 190  MET B C     1 
ATOM   3211  O  O     . MET B  2  191  ? 41.438  163.941 151.734 1.00 48.46  ? 190  MET B O     1 
ATOM   3212  C  CB    . MET B  2  191  ? 42.130  165.765 149.109 1.00 48.92  ? 190  MET B CB    1 
ATOM   3213  C  CG    . MET B  2  191  ? 43.285  164.781 149.195 1.00 49.64  ? 190  MET B CG    1 
ATOM   3214  S  SD    . MET B  2  191  ? 43.617  163.882 147.672 1.00 49.77  ? 190  MET B SD    1 
ATOM   3215  C  CE    . MET B  2  191  ? 42.511  162.598 147.774 1.00 50.56  ? 190  MET B CE    1 
ATOM   3216  N  N     . ASN B  2  192  ? 41.108  166.145 152.085 1.00 51.26  ? 191  ASN B N     1 
ATOM   3217  C  CA    . ASN B  2  192  ? 41.355  166.096 153.520 1.00 52.50  ? 191  ASN B CA    1 
ATOM   3218  C  C     . ASN B  2  192  ? 40.456  165.078 154.179 1.00 53.03  ? 191  ASN B C     1 
ATOM   3219  O  O     . ASN B  2  192  ? 40.904  164.269 154.988 1.00 53.40  ? 191  ASN B O     1 
ATOM   3220  C  CB    . ASN B  2  192  ? 41.072  167.448 154.156 1.00 54.42  ? 191  ASN B CB    1 
ATOM   3221  C  CG    . ASN B  2  192  ? 42.039  168.504 153.720 1.00 57.10  ? 191  ASN B CG    1 
ATOM   3222  O  OD1   . ASN B  2  192  ? 43.248  168.364 153.902 1.00 60.23  ? 191  ASN B OD1   1 
ATOM   3223  N  ND2   . ASN B  2  192  ? 41.519  169.579 153.143 1.00 58.90  ? 191  ASN B ND2   1 
ATOM   3224  N  N     . ASP B  2  193  ? 39.175  165.150 153.832 1.00 53.02  ? 192  ASP B N     1 
ATOM   3225  C  CA    . ASP B  2  193  ? 38.147  164.265 154.366 1.00 53.20  ? 192  ASP B CA    1 
ATOM   3226  C  C     . ASP B  2  193  ? 38.454  162.773 154.214 1.00 52.96  ? 192  ASP B C     1 
ATOM   3227  O  O     . ASP B  2  193  ? 38.030  161.963 155.036 1.00 53.28  ? 192  ASP B O     1 
ATOM   3228  C  CB    . ASP B  2  193  ? 36.812  164.568 153.680 1.00 54.25  ? 192  ASP B CB    1 
ATOM   3229  C  CG    . ASP B  2  193  ? 36.313  165.968 153.965 1.00 55.01  ? 192  ASP B CG    1 
ATOM   3230  O  OD1   . ASP B  2  193  ? 37.150  166.847 154.254 1.00 55.38  ? 192  ASP B OD1   1 
ATOM   3231  O  OD2   . ASP B  2  193  ? 35.083  166.193 153.886 1.00 56.26  ? 192  ASP B OD2   1 
ATOM   3232  N  N     . ILE B  2  194  ? 39.199  162.412 153.173 1.00 52.54  ? 193  ILE B N     1 
ATOM   3233  C  CA    . ILE B  2  194  ? 39.507  161.012 152.912 1.00 51.05  ? 193  ILE B CA    1 
ATOM   3234  C  C     . ILE B  2  194  ? 40.952  160.590 153.151 1.00 50.52  ? 193  ILE B C     1 
ATOM   3235  O  O     . ILE B  2  194  ? 41.207  159.509 153.680 1.00 48.07  ? 193  ILE B O     1 
ATOM   3236  C  CB    . ILE B  2  194  ? 39.122  160.678 151.476 1.00 51.03  ? 193  ILE B CB    1 
ATOM   3237  C  CG1   . ILE B  2  194  ? 37.702  161.186 151.219 1.00 51.99  ? 193  ILE B CG1   1 
ATOM   3238  C  CG2   . ILE B  2  194  ? 39.193  159.188 151.250 1.00 51.15  ? 193  ILE B CG2   1 
ATOM   3239  C  CD1   . ILE B  2  194  ? 37.227  161.039 149.802 1.00 54.29  ? 193  ILE B CD1   1 
ATOM   3240  N  N     . PHE B  2  195  ? 41.895  161.446 152.771 1.00 51.24  ? 194  PHE B N     1 
ATOM   3241  C  CA    . PHE B  2  195  ? 43.308  161.127 152.928 1.00 51.92  ? 194  PHE B CA    1 
ATOM   3242  C  C     . PHE B  2  195  ? 44.074  162.113 153.789 1.00 52.71  ? 194  PHE B C     1 
ATOM   3243  O  O     . PHE B  2  195  ? 43.859  163.317 153.696 1.00 54.26  ? 194  PHE B O     1 
ATOM   3244  C  CB    . PHE B  2  195  ? 44.007  161.084 151.563 1.00 51.55  ? 194  PHE B CB    1 
ATOM   3245  C  CG    . PHE B  2  195  ? 43.366  160.165 150.569 1.00 51.19  ? 194  PHE B CG    1 
ATOM   3246  C  CD1   . PHE B  2  195  ? 42.178  160.516 149.943 1.00 51.00  ? 194  PHE B CD1   1 
ATOM   3247  C  CD2   . PHE B  2  195  ? 43.959  158.949 150.247 1.00 51.10  ? 194  PHE B CD2   1 
ATOM   3248  C  CE1   . PHE B  2  195  ? 41.588  159.676 149.006 1.00 50.88  ? 194  PHE B CE1   1 
ATOM   3249  C  CE2   . PHE B  2  195  ? 43.377  158.095 149.311 1.00 51.10  ? 194  PHE B CE2   1 
ATOM   3250  C  CZ    . PHE B  2  195  ? 42.189  158.461 148.688 1.00 51.46  ? 194  PHE B CZ    1 
ATOM   3251  N  N     . ARG B  2  196  ? 44.973  161.593 154.620 1.00 52.85  ? 195  ARG B N     1 
ATOM   3252  C  CA    . ARG B  2  196  ? 45.837  162.429 155.443 1.00 52.93  ? 195  ARG B CA    1 
ATOM   3253  C  C     . ARG B  2  196  ? 47.255  162.187 154.921 1.00 52.33  ? 195  ARG B C     1 
ATOM   3254  O  O     . ARG B  2  196  ? 47.596  161.065 154.548 1.00 52.58  ? 195  ARG B O     1 
ATOM   3255  C  CB    . ARG B  2  196  ? 45.765  162.049 156.929 1.00 54.22  ? 195  ARG B CB    1 
ATOM   3256  C  CG    . ARG B  2  196  ? 47.018  162.503 157.699 1.00 57.84  ? 195  ARG B CG    1 
ATOM   3257  C  CD    . ARG B  2  196  ? 46.751  163.203 159.032 1.00 59.08  ? 195  ARG B CD    1 
ATOM   3258  N  NE    . ARG B  2  196  ? 46.590  162.270 160.145 1.00 59.70  ? 195  ARG B NE    1 
ATOM   3259  C  CZ    . ARG B  2  196  ? 46.988  162.522 161.390 1.00 59.41  ? 195  ARG B CZ    1 
ATOM   3260  N  NH1   . ARG B  2  196  ? 47.575  163.676 161.674 1.00 59.57  ? 195  ARG B NH1   1 
ATOM   3261  N  NH2   . ARG B  2  196  ? 46.792  161.626 162.351 1.00 58.60  ? 195  ARG B NH2   1 
ATOM   3262  N  N     . ALA B  2  197  ? 48.074  163.234 154.887 1.00 51.65  ? 196  ALA B N     1 
ATOM   3263  C  CA    . ALA B  2  197  ? 49.449  163.119 154.410 1.00 50.74  ? 196  ALA B CA    1 
ATOM   3264  C  C     . ALA B  2  197  ? 50.157  161.949 155.086 1.00 50.58  ? 196  ALA B C     1 
ATOM   3265  O  O     . ALA B  2  197  ? 49.865  161.615 156.231 1.00 51.64  ? 196  ALA B O     1 
ATOM   3266  C  CB    . ALA B  2  197  ? 50.206  164.419 154.681 1.00 50.58  ? 196  ALA B CB    1 
ATOM   3267  N  N     . GLY B  2  198  ? 51.082  161.319 154.373 1.00 50.41  ? 197  GLY B N     1 
ATOM   3268  C  CA    . GLY B  2  198  ? 51.809  160.202 154.943 1.00 49.27  ? 197  GLY B CA    1 
ATOM   3269  C  C     . GLY B  2  198  ? 51.211  158.836 154.662 1.00 49.12  ? 197  GLY B C     1 
ATOM   3270  O  O     . GLY B  2  198  ? 51.873  157.825 154.877 1.00 48.27  ? 197  GLY B O     1 
ATOM   3271  N  N     . GLU B  2  199  ? 49.968  158.791 154.187 1.00 49.65  ? 198  GLU B N     1 
ATOM   3272  C  CA    . GLU B  2  199  ? 49.315  157.514 153.892 1.00 50.26  ? 198  GLU B CA    1 
ATOM   3273  C  C     . GLU B  2  199  ? 49.625  157.039 152.481 1.00 50.59  ? 198  GLU B C     1 
ATOM   3274  O  O     . GLU B  2  199  ? 50.029  157.833 151.628 1.00 51.57  ? 198  GLU B O     1 
ATOM   3275  C  CB    . GLU B  2  199  ? 47.801  157.639 154.027 1.00 50.67  ? 198  GLU B CB    1 
ATOM   3276  C  CG    . GLU B  2  199  ? 47.298  157.945 155.409 1.00 51.66  ? 198  GLU B CG    1 
ATOM   3277  C  CD    . GLU B  2  199  ? 45.784  157.992 155.460 1.00 52.44  ? 198  GLU B CD    1 
ATOM   3278  O  OE1   . GLU B  2  199  ? 45.192  158.830 154.747 1.00 52.98  ? 198  GLU B OE1   1 
ATOM   3279  O  OE2   . GLU B  2  199  ? 45.186  157.191 156.207 1.00 51.80  ? 198  GLU B OE2   1 
ATOM   3280  N  N     . TYR B  2  200  ? 49.422  155.745 152.238 1.00 49.29  ? 199  TYR B N     1 
ATOM   3281  C  CA    . TYR B  2  200  ? 49.663  155.163 150.921 1.00 48.73  ? 199  TYR B CA    1 
ATOM   3282  C  C     . TYR B  2  200  ? 48.367  155.012 150.162 1.00 47.57  ? 199  TYR B C     1 
ATOM   3283  O  O     . TYR B  2  200  ? 47.381  154.488 150.680 1.00 46.67  ? 199  TYR B O     1 
ATOM   3284  C  CB    . TYR B  2  200  ? 50.330  153.787 151.033 1.00 50.92  ? 199  TYR B CB    1 
ATOM   3285  C  CG    . TYR B  2  200  ? 51.774  153.853 151.450 1.00 53.11  ? 199  TYR B CG    1 
ATOM   3286  C  CD1   . TYR B  2  200  ? 52.273  153.011 152.445 1.00 54.66  ? 199  TYR B CD1   1 
ATOM   3287  C  CD2   . TYR B  2  200  ? 52.630  154.799 150.898 1.00 53.55  ? 199  TYR B CD2   1 
ATOM   3288  C  CE1   . TYR B  2  200  ? 53.591  153.123 152.890 1.00 55.55  ? 199  TYR B CE1   1 
ATOM   3289  C  CE2   . TYR B  2  200  ? 53.943  154.917 151.332 1.00 55.79  ? 199  TYR B CE2   1 
ATOM   3290  C  CZ    . TYR B  2  200  ? 54.419  154.085 152.331 1.00 56.49  ? 199  TYR B CZ    1 
ATOM   3291  O  OH    . TYR B  2  200  ? 55.712  154.248 152.787 1.00 57.71  ? 199  TYR B OH    1 
ATOM   3292  N  N     . ALA B  2  201  ? 48.380  155.467 148.918 1.00 46.73  ? 200  ALA B N     1 
ATOM   3293  C  CA    . ALA B  2  201  ? 47.205  155.382 148.070 1.00 45.16  ? 200  ALA B CA    1 
ATOM   3294  C  C     . ALA B  2  201  ? 47.555  154.765 146.734 1.00 43.89  ? 200  ALA B C     1 
ATOM   3295  O  O     . ALA B  2  201  ? 48.726  154.634 146.374 1.00 44.31  ? 200  ALA B O     1 
ATOM   3296  C  CB    . ALA B  2  201  ? 46.626  156.768 147.846 1.00 45.27  ? 200  ALA B CB    1 
ATOM   3297  N  N     . ASP B  2  202  ? 46.521  154.376 146.005 1.00 41.97  ? 201  ASP B N     1 
ATOM   3298  C  CA    . ASP B  2  202  ? 46.698  153.824 144.679 1.00 39.89  ? 201  ASP B CA    1 
ATOM   3299  C  C     . ASP B  2  202  ? 46.247  154.947 143.759 1.00 39.22  ? 201  ASP B C     1 
ATOM   3300  O  O     . ASP B  2  202  ? 45.324  155.693 144.083 1.00 39.95  ? 201  ASP B O     1 
ATOM   3301  C  CB    . ASP B  2  202  ? 45.840  152.575 144.508 1.00 38.35  ? 201  ASP B CB    1 
ATOM   3302  C  CG    . ASP B  2  202  ? 46.218  151.488 145.491 1.00 37.82  ? 201  ASP B CG    1 
ATOM   3303  O  OD1   . ASP B  2  202  ? 47.405  151.446 145.874 1.00 36.48  ? 201  ASP B OD1   1 
ATOM   3304  O  OD2   . ASP B  2  202  ? 45.351  150.674 145.875 1.00 36.03  ? 201  ASP B OD2   1 
ATOM   3305  N  N     . VAL B  2  203  ? 46.921  155.103 142.633 1.00 38.09  ? 202  VAL B N     1 
ATOM   3306  C  CA    . VAL B  2  203  ? 46.560  156.163 141.709 1.00 37.91  ? 202  VAL B CA    1 
ATOM   3307  C  C     . VAL B  2  203  ? 46.269  155.554 140.348 1.00 38.69  ? 202  VAL B C     1 
ATOM   3308  O  O     . VAL B  2  203  ? 47.028  154.706 139.866 1.00 39.46  ? 202  VAL B O     1 
ATOM   3309  C  CB    . VAL B  2  203  ? 47.702  157.180 141.573 1.00 36.74  ? 202  VAL B CB    1 
ATOM   3310  C  CG1   . VAL B  2  203  ? 47.245  158.365 140.757 1.00 35.82  ? 202  VAL B CG1   1 
ATOM   3311  C  CG2   . VAL B  2  203  ? 48.167  157.611 142.944 1.00 35.01  ? 202  VAL B CG2   1 
ATOM   3312  N  N     . ALA B  2  204  ? 45.162  155.967 139.738 1.00 37.07  ? 203  ALA B N     1 
ATOM   3313  C  CA    . ALA B  2  204  ? 44.801  155.451 138.429 1.00 35.47  ? 203  ALA B CA    1 
ATOM   3314  C  C     . ALA B  2  204  ? 44.863  156.580 137.420 1.00 34.76  ? 203  ALA B C     1 
ATOM   3315  O  O     . ALA B  2  204  ? 44.845  157.746 137.785 1.00 34.85  ? 203  ALA B O     1 
ATOM   3316  C  CB    . ALA B  2  204  ? 43.411  154.852 138.466 1.00 34.23  ? 203  ALA B CB    1 
ATOM   3317  N  N     . GLY B  2  205  ? 44.960  156.226 136.148 1.00 34.85  ? 204  GLY B N     1 
ATOM   3318  C  CA    . GLY B  2  205  ? 45.008  157.233 135.109 1.00 35.55  ? 204  GLY B CA    1 
ATOM   3319  C  C     . GLY B  2  205  ? 45.257  156.616 133.750 1.00 36.77  ? 204  GLY B C     1 
ATOM   3320  O  O     . GLY B  2  205  ? 45.782  155.509 133.658 1.00 38.26  ? 204  GLY B O     1 
ATOM   3321  N  N     . VAL B  2  206  ? 44.863  157.306 132.690 1.00 36.41  ? 205  VAL B N     1 
ATOM   3322  C  CA    . VAL B  2  206  ? 45.119  156.791 131.359 1.00 37.33  ? 205  VAL B CA    1 
ATOM   3323  C  C     . VAL B  2  206  ? 46.473  157.344 130.931 1.00 38.33  ? 205  VAL B C     1 
ATOM   3324  O  O     . VAL B  2  206  ? 46.663  158.556 130.832 1.00 38.16  ? 205  VAL B O     1 
ATOM   3325  C  CB    . VAL B  2  206  ? 44.047  157.232 130.361 1.00 37.60  ? 205  VAL B CB    1 
ATOM   3326  C  CG1   . VAL B  2  206  ? 44.463  156.862 128.950 1.00 37.49  ? 205  VAL B CG1   1 
ATOM   3327  C  CG2   . VAL B  2  206  ? 42.740  156.557 130.699 1.00 39.11  ? 205  VAL B CG2   1 
ATOM   3328  N  N     . THR B  2  207  ? 47.415  156.440 130.691 1.00 38.97  ? 206  THR B N     1 
ATOM   3329  C  CA    . THR B  2  207  ? 48.767  156.807 130.293 1.00 39.27  ? 206  THR B CA    1 
ATOM   3330  C  C     . THR B  2  207  ? 48.858  157.762 129.124 1.00 39.05  ? 206  THR B C     1 
ATOM   3331  O  O     . THR B  2  207  ? 47.897  157.955 128.375 1.00 38.95  ? 206  THR B O     1 
ATOM   3332  C  CB    . THR B  2  207  ? 49.574  155.570 129.922 1.00 39.72  ? 206  THR B CB    1 
ATOM   3333  O  OG1   . THR B  2  207  ? 48.841  154.791 128.970 1.00 39.13  ? 206  THR B OG1   1 
ATOM   3334  C  CG2   . THR B  2  207  ? 49.833  154.741 131.147 1.00 41.88  ? 206  THR B CG2   1 
ATOM   3335  N  N     . LYS B  2  208  ? 50.033  158.362 128.976 1.00 39.45  ? 207  LYS B N     1 
ATOM   3336  C  CA    . LYS B  2  208  ? 50.269  159.269 127.871 1.00 40.54  ? 207  LYS B CA    1 
ATOM   3337  C  C     . LYS B  2  208  ? 50.188  158.397 126.633 1.00 41.40  ? 207  LYS B C     1 
ATOM   3338  O  O     . LYS B  2  208  ? 50.724  157.287 126.617 1.00 41.48  ? 207  LYS B O     1 
ATOM   3339  C  CB    . LYS B  2  208  ? 51.659  159.895 127.973 1.00 38.88  ? 207  LYS B CB    1 
ATOM   3340  C  CG    . LYS B  2  208  ? 51.923  160.574 129.302 1.00 38.06  ? 207  LYS B CG    1 
ATOM   3341  C  CD    . LYS B  2  208  ? 53.352  161.106 129.402 1.00 37.43  ? 207  LYS B CD    1 
ATOM   3342  C  CE    . LYS B  2  208  ? 53.598  162.320 128.521 1.00 35.41  ? 207  LYS B CE    1 
ATOM   3343  N  NZ    . LYS B  2  208  ? 54.910  162.937 128.857 1.00 33.35  ? 207  LYS B NZ    1 
ATOM   3344  N  N     . GLY B  2  209  ? 49.494  158.883 125.609 1.00 43.13  ? 208  GLY B N     1 
ATOM   3345  C  CA    . GLY B  2  209  ? 49.369  158.118 124.380 1.00 44.15  ? 208  GLY B CA    1 
ATOM   3346  C  C     . GLY B  2  209  ? 50.561  158.344 123.469 1.00 44.01  ? 208  GLY B C     1 
ATOM   3347  O  O     . GLY B  2  209  ? 51.095  159.449 123.402 1.00 44.09  ? 208  GLY B O     1 
ATOM   3348  N  N     . LYS B  2  210  ? 50.991  157.306 122.766 1.00 43.85  ? 209  LYS B N     1 
ATOM   3349  C  CA    . LYS B  2  210  ? 52.131  157.458 121.882 1.00 43.69  ? 209  LYS B CA    1 
ATOM   3350  C  C     . LYS B  2  210  ? 51.793  156.979 120.485 1.00 45.02  ? 209  LYS B C     1 
ATOM   3351  O  O     . LYS B  2  210  ? 52.636  156.412 119.787 1.00 45.89  ? 209  LYS B O     1 
ATOM   3352  C  CB    . LYS B  2  210  ? 53.320  156.699 122.455 1.00 41.02  ? 209  LYS B CB    1 
ATOM   3353  C  CG    . LYS B  2  210  ? 53.708  157.229 123.817 1.00 40.61  ? 209  LYS B CG    1 
ATOM   3354  C  CD    . LYS B  2  210  ? 54.848  156.466 124.438 1.00 41.10  ? 209  LYS B CD    1 
ATOM   3355  C  CE    . LYS B  2  210  ? 55.062  156.895 125.882 1.00 39.90  ? 209  LYS B CE    1 
ATOM   3356  N  NZ    . LYS B  2  210  ? 55.364  158.337 125.986 1.00 39.90  ? 209  LYS B NZ    1 
ATOM   3357  N  N     . GLY B  2  211  ? 50.551  157.238 120.078 1.00 45.59  ? 210  GLY B N     1 
ATOM   3358  C  CA    . GLY B  2  211  ? 50.093  156.820 118.768 1.00 44.61  ? 210  GLY B CA    1 
ATOM   3359  C  C     . GLY B  2  211  ? 50.488  155.378 118.554 1.00 44.47  ? 210  GLY B C     1 
ATOM   3360  O  O     . GLY B  2  211  ? 50.555  154.596 119.506 1.00 44.50  ? 210  GLY B O     1 
ATOM   3361  N  N     . THR B  2  212  ? 50.760  155.012 117.312 1.00 43.99  ? 211  THR B N     1 
ATOM   3362  C  CA    . THR B  2  212  ? 51.160  153.645 117.037 1.00 43.90  ? 211  THR B CA    1 
ATOM   3363  C  C     . THR B  2  212  ? 52.663  153.558 117.165 1.00 41.55  ? 211  THR B C     1 
ATOM   3364  O  O     . THR B  2  212  ? 53.364  154.498 116.819 1.00 42.65  ? 211  THR B O     1 
ATOM   3365  C  CB    . THR B  2  212  ? 50.771  153.221 115.617 1.00 45.39  ? 211  THR B CB    1 
ATOM   3366  O  OG1   . THR B  2  212  ? 51.262  154.191 114.686 1.00 46.68  ? 211  THR B OG1   1 
ATOM   3367  C  CG2   . THR B  2  212  ? 49.264  153.107 115.491 1.00 46.09  ? 211  THR B CG2   1 
ATOM   3368  N  N     . GLN B  2  213  ? 53.151  152.437 117.675 1.00 39.66  ? 212  GLN B N     1 
ATOM   3369  C  CA    . GLN B  2  213  ? 54.579  152.233 117.816 1.00 38.11  ? 212  GLN B CA    1 
ATOM   3370  C  C     . GLN B  2  213  ? 54.921  150.783 117.484 1.00 37.09  ? 212  GLN B C     1 
ATOM   3371  O  O     . GLN B  2  213  ? 54.040  149.925 117.411 1.00 35.32  ? 212  GLN B O     1 
ATOM   3372  C  CB    . GLN B  2  213  ? 55.026  152.585 119.232 1.00 37.73  ? 212  GLN B CB    1 
ATOM   3373  C  CG    . GLN B  2  213  ? 54.838  154.058 119.617 1.00 39.70  ? 212  GLN B CG    1 
ATOM   3374  C  CD    . GLN B  2  213  ? 55.821  155.012 118.941 1.00 41.41  ? 212  GLN B CD    1 
ATOM   3375  O  OE1   . GLN B  2  213  ? 57.007  154.715 118.814 1.00 44.34  ? 212  GLN B OE1   1 
ATOM   3376  N  NE2   . GLN B  2  213  ? 55.329  156.176 118.526 1.00 41.35  ? 212  GLN B NE2   1 
ATOM   3377  N  N     . GLY B  2  214  ? 56.206  150.522 117.274 1.00 37.81  ? 213  GLY B N     1 
ATOM   3378  C  CA    . GLY B  2  214  ? 56.659  149.186 116.929 1.00 36.57  ? 213  GLY B CA    1 
ATOM   3379  C  C     . GLY B  2  214  ? 56.945  148.282 118.110 1.00 36.22  ? 213  GLY B C     1 
ATOM   3380  O  O     . GLY B  2  214  ? 56.904  148.710 119.257 1.00 34.35  ? 213  GLY B O     1 
ATOM   3381  N  N     . PRO B  2  215  ? 57.263  147.010 117.841 1.00 37.45  ? 214  PRO B N     1 
ATOM   3382  C  CA    . PRO B  2  215  ? 57.570  145.969 118.833 1.00 37.82  ? 214  PRO B CA    1 
ATOM   3383  C  C     . PRO B  2  215  ? 58.681  146.378 119.791 1.00 38.01  ? 214  PRO B C     1 
ATOM   3384  O  O     . PRO B  2  215  ? 58.577  146.209 121.005 1.00 37.46  ? 214  PRO B O     1 
ATOM   3385  C  CB    . PRO B  2  215  ? 57.995  144.780 117.972 1.00 38.63  ? 214  PRO B CB    1 
ATOM   3386  C  CG    . PRO B  2  215  ? 57.344  145.043 116.639 1.00 39.09  ? 214  PRO B CG    1 
ATOM   3387  C  CD    . PRO B  2  215  ? 57.496  146.520 116.472 1.00 37.17  ? 214  PRO B CD    1 
ATOM   3388  N  N     . VAL B  2  216  ? 59.757  146.897 119.217 1.00 37.68  ? 215  VAL B N     1 
ATOM   3389  C  CA    . VAL B  2  216  ? 60.909  147.333 119.982 1.00 38.04  ? 215  VAL B CA    1 
ATOM   3390  C  C     . VAL B  2  216  ? 60.504  148.214 121.155 1.00 38.09  ? 215  VAL B C     1 
ATOM   3391  O  O     . VAL B  2  216  ? 60.790  147.902 122.312 1.00 38.90  ? 215  VAL B O     1 
ATOM   3392  C  CB    . VAL B  2  216  ? 61.889  148.081 119.071 1.00 37.28  ? 215  VAL B CB    1 
ATOM   3393  C  CG1   . VAL B  2  216  ? 62.834  148.938 119.894 1.00 37.59  ? 215  VAL B CG1   1 
ATOM   3394  C  CG2   . VAL B  2  216  ? 62.671  147.072 118.254 1.00 37.89  ? 215  VAL B CG2   1 
ATOM   3395  N  N     . LYS B  2  217  ? 59.835  149.317 120.851 1.00 36.57  ? 216  LYS B N     1 
ATOM   3396  C  CA    . LYS B  2  217  ? 59.387  150.237 121.883 1.00 34.11  ? 216  LYS B CA    1 
ATOM   3397  C  C     . LYS B  2  217  ? 58.237  149.612 122.652 1.00 34.33  ? 216  LYS B C     1 
ATOM   3398  O  O     . LYS B  2  217  ? 58.313  149.425 123.862 1.00 36.92  ? 216  LYS B O     1 
ATOM   3399  C  CB    . LYS B  2  217  ? 58.931  151.544 121.240 1.00 32.60  ? 216  LYS B CB    1 
ATOM   3400  C  CG    . LYS B  2  217  ? 58.422  152.583 122.202 1.00 30.66  ? 216  LYS B CG    1 
ATOM   3401  C  CD    . LYS B  2  217  ? 58.119  153.880 121.479 1.00 30.17  ? 216  LYS B CD    1 
ATOM   3402  C  CE    . LYS B  2  217  ? 57.422  154.870 122.390 1.00 30.74  ? 216  LYS B CE    1 
ATOM   3403  N  NZ    . LYS B  2  217  ? 58.164  155.057 123.670 1.00 33.65  ? 216  LYS B NZ    1 
ATOM   3404  N  N     . ARG B  2  218  ? 57.187  149.266 121.922 1.00 33.95  ? 217  ARG B N     1 
ATOM   3405  C  CA    . ARG B  2  218  ? 55.972  148.685 122.478 1.00 33.41  ? 217  ARG B CA    1 
ATOM   3406  C  C     . ARG B  2  218  ? 56.094  147.399 123.278 1.00 32.54  ? 217  ARG B C     1 
ATOM   3407  O  O     . ARG B  2  218  ? 55.283  147.141 124.167 1.00 32.15  ? 217  ARG B O     1 
ATOM   3408  C  CB    . ARG B  2  218  ? 54.964  148.457 121.350 1.00 35.31  ? 217  ARG B CB    1 
ATOM   3409  C  CG    . ARG B  2  218  ? 53.593  147.944 121.805 1.00 36.09  ? 217  ARG B CG    1 
ATOM   3410  C  CD    . ARG B  2  218  ? 52.646  147.921 120.625 1.00 34.46  ? 217  ARG B CD    1 
ATOM   3411  N  NE    . ARG B  2  218  ? 51.250  148.056 121.004 1.00 30.49  ? 217  ARG B NE    1 
ATOM   3412  C  CZ    . ARG B  2  218  ? 50.328  147.163 120.685 1.00 31.46  ? 217  ARG B CZ    1 
ATOM   3413  N  NH1   . ARG B  2  218  ? 50.668  146.081 120.001 1.00 30.22  ? 217  ARG B NH1   1 
ATOM   3414  N  NH2   . ARG B  2  218  ? 49.064  147.363 121.020 1.00 32.66  ? 217  ARG B NH2   1 
ATOM   3415  N  N     . TRP B  2  219  ? 57.080  146.573 122.960 1.00 32.65  ? 218  TRP B N     1 
ATOM   3416  C  CA    . TRP B  2  219  ? 57.215  145.322 123.684 1.00 33.25  ? 218  TRP B CA    1 
ATOM   3417  C  C     . TRP B  2  219  ? 58.621  145.040 124.175 1.00 32.62  ? 218  TRP B C     1 
ATOM   3418  O  O     . TRP B  2  219  ? 58.890  143.978 124.743 1.00 33.58  ? 218  TRP B O     1 
ATOM   3419  C  CB    . TRP B  2  219  ? 56.719  144.163 122.827 1.00 32.03  ? 218  TRP B CB    1 
ATOM   3420  C  CG    . TRP B  2  219  ? 55.256  144.199 122.573 1.00 31.23  ? 218  TRP B CG    1 
ATOM   3421  C  CD1   . TRP B  2  219  ? 54.619  144.656 121.450 1.00 31.64  ? 218  TRP B CD1   1 
ATOM   3422  C  CD2   . TRP B  2  219  ? 54.238  143.727 123.448 1.00 31.62  ? 218  TRP B CD2   1 
ATOM   3423  N  NE1   . TRP B  2  219  ? 53.261  144.486 121.572 1.00 31.18  ? 218  TRP B NE1   1 
ATOM   3424  C  CE2   . TRP B  2  219  ? 53.000  143.916 122.791 1.00 32.19  ? 218  TRP B CE2   1 
ATOM   3425  C  CE3   . TRP B  2  219  ? 54.250  143.154 124.726 1.00 30.87  ? 218  TRP B CE3   1 
ATOM   3426  C  CZ2   . TRP B  2  219  ? 51.784  143.553 123.372 1.00 30.95  ? 218  TRP B CZ2   1 
ATOM   3427  C  CZ3   . TRP B  2  219  ? 53.047  142.792 125.301 1.00 30.43  ? 218  TRP B CZ3   1 
ATOM   3428  C  CH2   . TRP B  2  219  ? 51.826  142.993 124.621 1.00 31.30  ? 218  TRP B CH2   1 
ATOM   3429  N  N     . GLY B  2  220  ? 59.517  145.992 123.960 1.00 32.10  ? 219  GLY B N     1 
ATOM   3430  C  CA    . GLY B  2  220  ? 60.875  145.818 124.424 1.00 32.64  ? 219  GLY B CA    1 
ATOM   3431  C  C     . GLY B  2  220  ? 61.609  144.671 123.773 1.00 32.92  ? 219  GLY B C     1 
ATOM   3432  O  O     . GLY B  2  220  ? 62.348  143.947 124.436 1.00 34.25  ? 219  GLY B O     1 
ATOM   3433  N  N     . VAL B  2  221  ? 61.401  144.504 122.475 1.00 32.79  ? 220  VAL B N     1 
ATOM   3434  C  CA    . VAL B  2  221  ? 62.068  143.459 121.724 1.00 33.01  ? 220  VAL B CA    1 
ATOM   3435  C  C     . VAL B  2  221  ? 63.345  144.094 121.171 1.00 35.12  ? 220  VAL B C     1 
ATOM   3436  O  O     . VAL B  2  221  ? 63.338  145.276 120.799 1.00 36.05  ? 220  VAL B O     1 
ATOM   3437  C  CB    . VAL B  2  221  ? 61.173  142.970 120.585 1.00 31.57  ? 220  VAL B CB    1 
ATOM   3438  C  CG1   . VAL B  2  221  ? 59.890  142.406 121.155 1.00 29.92  ? 220  VAL B CG1   1 
ATOM   3439  C  CG2   . VAL B  2  221  ? 60.860  144.113 119.646 1.00 29.70  ? 220  VAL B CG2   1 
ATOM   3440  N  N     . GLN B  2  222  ? 64.433  143.322 121.131 1.00 36.25  ? 221  GLN B N     1 
ATOM   3441  C  CA    . GLN B  2  222  ? 65.731  143.812 120.654 1.00 36.37  ? 221  GLN B CA    1 
ATOM   3442  C  C     . GLN B  2  222  ? 65.717  144.338 119.242 1.00 36.74  ? 221  GLN B C     1 
ATOM   3443  O  O     . GLN B  2  222  ? 64.956  143.858 118.407 1.00 38.02  ? 221  GLN B O     1 
ATOM   3444  C  CB    . GLN B  2  222  ? 66.773  142.710 120.654 1.00 36.29  ? 221  GLN B CB    1 
ATOM   3445  C  CG    . GLN B  2  222  ? 66.891  141.902 121.901 1.00 40.09  ? 221  GLN B CG    1 
ATOM   3446  C  CD    . GLN B  2  222  ? 68.158  141.080 121.887 1.00 40.13  ? 221  GLN B CD    1 
ATOM   3447  O  OE1   . GLN B  2  222  ? 68.629  140.679 120.817 1.00 38.17  ? 221  GLN B OE1   1 
ATOM   3448  N  NE2   . GLN B  2  222  ? 68.720  140.820 123.069 1.00 39.94  ? 221  GLN B NE2   1 
ATOM   3449  N  N     . LYS B  2  223  ? 66.575  145.315 118.969 1.00 37.59  ? 222  LYS B N     1 
ATOM   3450  C  CA    . LYS B  2  223  ? 66.686  145.826 117.613 1.00 37.65  ? 222  LYS B CA    1 
ATOM   3451  C  C     . LYS B  2  223  ? 67.472  144.711 116.942 1.00 38.16  ? 222  LYS B C     1 
ATOM   3452  O  O     . LYS B  2  223  ? 67.986  143.826 117.630 1.00 38.23  ? 222  LYS B O     1 
ATOM   3453  C  CB    . LYS B  2  223  ? 67.542  147.087 117.542 1.00 36.79  ? 222  LYS B CB    1 
ATOM   3454  C  CG    . LYS B  2  223  ? 67.011  148.288 118.260 1.00 36.93  ? 222  LYS B CG    1 
ATOM   3455  C  CD    . LYS B  2  223  ? 67.496  149.560 117.563 1.00 37.29  ? 222  LYS B CD    1 
ATOM   3456  C  CE    . LYS B  2  223  ? 69.004  149.575 117.393 1.00 37.59  ? 222  LYS B CE    1 
ATOM   3457  N  NZ    . LYS B  2  223  ? 69.500  150.843 116.796 1.00 38.63  ? 222  LYS B NZ    1 
ATOM   3458  N  N     . ARG B  2  224  ? 67.563  144.734 115.615 1.00 38.56  ? 223  ARG B N     1 
ATOM   3459  C  CA    . ARG B  2  224  ? 68.356  143.725 114.928 1.00 37.67  ? 223  ARG B CA    1 
ATOM   3460  C  C     . ARG B  2  224  ? 69.811  144.114 115.223 1.00 35.64  ? 223  ARG B C     1 
ATOM   3461  O  O     . ARG B  2  224  ? 70.156  145.303 115.252 1.00 35.26  ? 223  ARG B O     1 
ATOM   3462  C  CB    . ARG B  2  224  ? 68.057  143.724 113.426 1.00 38.10  ? 223  ARG B CB    1 
ATOM   3463  C  CG    . ARG B  2  224  ? 66.604  143.366 113.114 1.00 39.59  ? 223  ARG B CG    1 
ATOM   3464  C  CD    . ARG B  2  224  ? 66.494  142.316 112.016 1.00 38.00  ? 223  ARG B CD    1 
ATOM   3465  N  NE    . ARG B  2  224  ? 65.120  141.857 111.840 1.00 37.49  ? 223  ARG B NE    1 
ATOM   3466  C  CZ    . ARG B  2  224  ? 64.781  140.781 111.139 1.00 38.04  ? 223  ARG B CZ    1 
ATOM   3467  N  NH1   . ARG B  2  224  ? 65.718  140.058 110.546 1.00 36.95  ? 223  ARG B NH1   1 
ATOM   3468  N  NH2   . ARG B  2  224  ? 63.509  140.411 111.047 1.00 37.31  ? 223  ARG B NH2   1 
ATOM   3469  N  N     . LYS B  2  225  ? 70.655  143.117 115.465 1.00 33.71  ? 224  LYS B N     1 
ATOM   3470  C  CA    . LYS B  2  225  ? 72.034  143.382 115.815 1.00 31.00  ? 224  LYS B CA    1 
ATOM   3471  C  C     . LYS B  2  225  ? 73.040  143.169 114.709 1.00 30.81  ? 224  LYS B C     1 
ATOM   3472  O  O     . LYS B  2  225  ? 72.776  142.488 113.720 1.00 31.79  ? 224  LYS B O     1 
ATOM   3473  C  CB    . LYS B  2  225  ? 72.425  142.532 117.028 1.00 28.66  ? 224  LYS B CB    1 
ATOM   3474  C  CG    . LYS B  2  225  ? 71.588  142.792 118.278 1.00 23.40  ? 224  LYS B CG    1 
ATOM   3475  C  CD    . LYS B  2  225  ? 71.737  144.221 118.729 1.00 20.25  ? 224  LYS B CD    1 
ATOM   3476  C  CE    . LYS B  2  225  ? 70.534  144.667 119.511 1.00 19.38  ? 224  LYS B CE    1 
ATOM   3477  N  NZ    . LYS B  2  225  ? 70.440  146.146 119.593 1.00 15.75  ? 224  LYS B NZ    1 
ATOM   3478  N  N     . GLY B  2  226  ? 74.204  143.778 114.905 1.00 32.42  ? 225  GLY B N     1 
ATOM   3479  C  CA    . GLY B  2  226  ? 75.305  143.671 113.971 1.00 31.87  ? 225  GLY B CA    1 
ATOM   3480  C  C     . GLY B  2  226  ? 74.936  143.734 112.506 1.00 31.98  ? 225  GLY B C     1 
ATOM   3481  O  O     . GLY B  2  226  ? 74.275  144.669 112.053 1.00 32.27  ? 225  GLY B O     1 
ATOM   3482  N  N     . LYS B  2  227  ? 75.370  142.723 111.763 1.00 30.54  ? 226  LYS B N     1 
ATOM   3483  C  CA    . LYS B  2  227  ? 75.119  142.671 110.339 1.00 28.01  ? 226  LYS B CA    1 
ATOM   3484  C  C     . LYS B  2  227  ? 73.644  142.588 110.002 1.00 27.09  ? 226  LYS B C     1 
ATOM   3485  O  O     . LYS B  2  227  ? 73.215  143.099 108.969 1.00 26.77  ? 226  LYS B O     1 
ATOM   3486  C  CB    . LYS B  2  227  ? 75.863  141.489 109.720 1.00 27.59  ? 226  LYS B CB    1 
ATOM   3487  C  CG    . LYS B  2  227  ? 75.726  141.429 108.218 1.00 28.56  ? 226  LYS B CG    1 
ATOM   3488  C  CD    . LYS B  2  227  ? 76.606  140.356 107.604 1.00 29.59  ? 226  LYS B CD    1 
ATOM   3489  C  CE    . LYS B  2  227  ? 78.077  140.717 107.669 1.00 28.34  ? 226  LYS B CE    1 
ATOM   3490  N  NZ    . LYS B  2  227  ? 78.913  139.690 106.981 1.00 28.10  ? 226  LYS B NZ    1 
ATOM   3491  N  N     . HIS B  2  228  ? 72.867  141.961 110.877 1.00 26.14  ? 227  HIS B N     1 
ATOM   3492  C  CA    . HIS B  2  228  ? 71.439  141.807 110.640 1.00 26.47  ? 227  HIS B CA    1 
ATOM   3493  C  C     . HIS B  2  228  ? 70.731  143.156 110.581 1.00 27.26  ? 227  HIS B C     1 
ATOM   3494  O  O     . HIS B  2  228  ? 69.718  143.322 109.882 1.00 28.78  ? 227  HIS B O     1 
ATOM   3495  C  CB    . HIS B  2  228  ? 70.840  140.914 111.716 1.00 25.49  ? 227  HIS B CB    1 
ATOM   3496  C  CG    . HIS B  2  228  ? 71.488  139.567 111.794 1.00 26.95  ? 227  HIS B CG    1 
ATOM   3497  N  ND1   . HIS B  2  228  ? 71.404  138.641 110.777 1.00 28.46  ? 227  HIS B ND1   1 
ATOM   3498  C  CD2   . HIS B  2  228  ? 72.267  139.002 112.750 1.00 27.44  ? 227  HIS B CD2   1 
ATOM   3499  C  CE1   . HIS B  2  228  ? 72.103  137.566 111.101 1.00 27.39  ? 227  HIS B CE1   1 
ATOM   3500  N  NE2   . HIS B  2  228  ? 72.636  137.759 112.294 1.00 26.21  ? 227  HIS B NE2   1 
ATOM   3501  N  N     . ALA B  2  229  ? 71.292  144.128 111.288 1.00 27.02  ? 228  ALA B N     1 
ATOM   3502  C  CA    . ALA B  2  229  ? 70.743  145.472 111.314 1.00 27.07  ? 228  ALA B CA    1 
ATOM   3503  C  C     . ALA B  2  229  ? 70.936  146.220 109.993 1.00 27.06  ? 228  ALA B C     1 
ATOM   3504  O  O     . ALA B  2  229  ? 70.336  147.264 109.781 1.00 27.80  ? 228  ALA B O     1 
ATOM   3505  C  CB    . ALA B  2  229  ? 71.388  146.246 112.422 1.00 26.36  ? 228  ALA B CB    1 
ATOM   3506  N  N     . ARG B  2  230  ? 71.763  145.685 109.103 1.00 28.64  ? 229  ARG B N     1 
ATOM   3507  C  CA    . ARG B  2  230  ? 72.045  146.340 107.828 1.00 32.51  ? 229  ARG B CA    1 
ATOM   3508  C  C     . ARG B  2  230  ? 71.413  145.704 106.587 1.00 32.59  ? 229  ARG B C     1 
ATOM   3509  O  O     . ARG B  2  230  ? 71.462  146.278 105.489 1.00 33.47  ? 229  ARG B O     1 
ATOM   3510  C  CB    . ARG B  2  230  ? 73.559  146.383 107.611 1.00 31.34  ? 229  ARG B CB    1 
ATOM   3511  C  CG    . ARG B  2  230  ? 74.241  147.683 107.992 1.00 31.17  ? 229  ARG B CG    1 
ATOM   3512  C  CD    . ARG B  2  230  ? 75.746  147.589 107.770 1.00 29.38  ? 229  ARG B CD    1 
ATOM   3513  N  NE    . ARG B  2  230  ? 76.405  146.805 108.809 1.00 29.32  ? 229  ARG B NE    1 
ATOM   3514  C  CZ    . ARG B  2  230  ? 77.211  145.773 108.580 1.00 29.15  ? 229  ARG B CZ    1 
ATOM   3515  N  NH1   . ARG B  2  230  ? 77.469  145.379 107.340 1.00 27.28  ? 229  ARG B NH1   1 
ATOM   3516  N  NH2   . ARG B  2  230  ? 77.767  145.140 109.600 1.00 27.83  ? 229  ARG B NH2   1 
ATOM   3517  N  N     . GLN B  2  231  ? 70.817  144.529 106.749 1.00 33.38  ? 230  GLN B N     1 
ATOM   3518  C  CA    . GLN B  2  231  ? 70.261  143.827 105.604 1.00 34.25  ? 230  GLN B CA    1 
ATOM   3519  C  C     . GLN B  2  231  ? 68.939  144.344 105.042 1.00 32.58  ? 230  GLN B C     1 
ATOM   3520  O  O     . GLN B  2  231  ? 68.614  144.101 103.882 1.00 31.86  ? 230  GLN B O     1 
ATOM   3521  C  CB    . GLN B  2  231  ? 70.171  142.338 105.946 1.00 34.45  ? 230  GLN B CB    1 
ATOM   3522  C  CG    . GLN B  2  231  ? 71.487  141.759 106.476 1.00 32.20  ? 230  GLN B CG    1 
ATOM   3523  C  CD    . GLN B  2  231  ? 72.690  142.299 105.724 1.00 32.94  ? 230  GLN B CD    1 
ATOM   3524  O  OE1   . GLN B  2  231  ? 72.755  142.213 104.502 1.00 33.34  ? 230  GLN B OE1   1 
ATOM   3525  N  NE2   . GLN B  2  231  ? 73.643  142.871 106.451 1.00 34.10  ? 230  GLN B NE2   1 
ATOM   3526  N  N     . GLY B  2  232  ? 68.189  145.072 105.858 1.00 35.19  ? 231  GLY B N     1 
ATOM   3527  C  CA    . GLY B  2  232  ? 66.910  145.612 105.421 1.00 35.22  ? 231  GLY B CA    1 
ATOM   3528  C  C     . GLY B  2  232  ? 65.910  145.540 106.557 1.00 35.76  ? 231  GLY B C     1 
ATOM   3529  O  O     . GLY B  2  232  ? 64.783  146.022 106.447 1.00 35.97  ? 231  GLY B O     1 
ATOM   3530  N  N     . TRP B  2  233  ? 66.339  144.922 107.654 1.00 36.52  ? 232  TRP B N     1 
ATOM   3531  C  CA    . TRP B  2  233  ? 65.516  144.764 108.843 1.00 36.50  ? 232  TRP B CA    1 
ATOM   3532  C  C     . TRP B  2  233  ? 66.278  145.353 110.024 1.00 37.22  ? 232  TRP B C     1 
ATOM   3533  O  O     . TRP B  2  233  ? 67.353  144.873 110.373 1.00 38.37  ? 232  TRP B O     1 
ATOM   3534  C  CB    . TRP B  2  233  ? 65.240  143.286 109.090 1.00 35.21  ? 232  TRP B CB    1 
ATOM   3535  C  CG    . TRP B  2  233  ? 64.429  142.632 108.009 1.00 36.13  ? 232  TRP B CG    1 
ATOM   3536  C  CD1   . TRP B  2  233  ? 63.103  142.317 108.061 1.00 36.81  ? 232  TRP B CD1   1 
ATOM   3537  C  CD2   . TRP B  2  233  ? 64.889  142.204 106.722 1.00 35.41  ? 232  TRP B CD2   1 
ATOM   3538  N  NE1   . TRP B  2  233  ? 62.709  141.714 106.891 1.00 36.69  ? 232  TRP B NE1   1 
ATOM   3539  C  CE2   . TRP B  2  233  ? 63.791  141.633 106.049 1.00 34.94  ? 232  TRP B CE2   1 
ATOM   3540  C  CE3   . TRP B  2  233  ? 66.126  142.243 106.068 1.00 33.89  ? 232  TRP B CE3   1 
ATOM   3541  C  CZ2   . TRP B  2  233  ? 63.886  141.116 104.767 1.00 33.48  ? 232  TRP B CZ2   1 
ATOM   3542  C  CZ3   . TRP B  2  233  ? 66.218  141.732 104.797 1.00 31.63  ? 232  TRP B CZ3   1 
ATOM   3543  C  CH2   . TRP B  2  233  ? 65.106  141.174 104.159 1.00 31.92  ? 232  TRP B CH2   1 
ATOM   3544  N  N     . ARG B  2  234  ? 65.724  146.404 110.621 1.00 36.31  ? 233  ARG B N     1 
ATOM   3545  C  CA    . ARG B  2  234  ? 66.345  147.070 111.754 1.00 34.28  ? 233  ARG B CA    1 
ATOM   3546  C  C     . ARG B  2  234  ? 65.527  146.884 113.013 1.00 34.81  ? 233  ARG B C     1 
ATOM   3547  O  O     . ARG B  2  234  ? 66.071  146.531 114.058 1.00 36.55  ? 233  ARG B O     1 
ATOM   3548  C  CB    . ARG B  2  234  ? 66.495  148.566 111.483 1.00 34.24  ? 233  ARG B CB    1 
ATOM   3549  C  CG    . ARG B  2  234  ? 67.562  148.923 110.479 1.00 31.59  ? 233  ARG B CG    1 
ATOM   3550  C  CD    . ARG B  2  234  ? 67.609  150.412 110.255 1.00 30.80  ? 233  ARG B CD    1 
ATOM   3551  N  NE    . ARG B  2  234  ? 68.618  150.739 109.263 1.00 32.44  ? 233  ARG B NE    1 
ATOM   3552  C  CZ    . ARG B  2  234  ? 69.923  150.619 109.475 1.00 34.26  ? 233  ARG B CZ    1 
ATOM   3553  N  NH1   . ARG B  2  234  ? 70.353  150.192 110.653 1.00 35.34  ? 233  ARG B NH1   1 
ATOM   3554  N  NH2   . ARG B  2  234  ? 70.795  150.896 108.508 1.00 32.80  ? 233  ARG B NH2   1 
ATOM   3555  N  N     . ARG B  2  235  ? 64.223  147.133 112.918 1.00 33.86  ? 234  ARG B N     1 
ATOM   3556  C  CA    . ARG B  2  235  ? 63.339  146.990 114.069 1.00 31.83  ? 234  ARG B CA    1 
ATOM   3557  C  C     . ARG B  2  235  ? 62.160  146.058 113.792 1.00 32.18  ? 234  ARG B C     1 
ATOM   3558  O  O     . ARG B  2  235  ? 61.011  146.432 114.021 1.00 33.90  ? 234  ARG B O     1 
ATOM   3559  C  CB    . ARG B  2  235  ? 62.809  148.356 114.501 1.00 28.62  ? 234  ARG B CB    1 
ATOM   3560  C  CG    . ARG B  2  235  ? 63.735  149.483 114.164 1.00 28.58  ? 234  ARG B CG    1 
ATOM   3561  C  CD    . ARG B  2  235  ? 63.234  150.805 114.704 1.00 29.73  ? 234  ARG B CD    1 
ATOM   3562  N  NE    . ARG B  2  235  ? 63.852  151.130 115.985 1.00 30.53  ? 234  ARG B NE    1 
ATOM   3563  C  CZ    . ARG B  2  235  ? 63.206  151.177 117.144 1.00 31.04  ? 234  ARG B CZ    1 
ATOM   3564  N  NH1   . ARG B  2  235  ? 61.903  150.921 117.194 1.00 31.07  ? 234  ARG B NH1   1 
ATOM   3565  N  NH2   . ARG B  2  235  ? 63.865  151.474 118.256 1.00 30.09  ? 234  ARG B NH2   1 
ATOM   3566  N  N     . ARG B  2  236  ? 62.447  144.857 113.288 1.00 31.66  ? 235  ARG B N     1 
ATOM   3567  C  CA    . ARG B  2  236  ? 61.416  143.853 113.008 1.00 30.62  ? 235  ARG B CA    1 
ATOM   3568  C  C     . ARG B  2  236  ? 61.833  142.552 113.668 1.00 30.08  ? 235  ARG B C     1 
ATOM   3569  O  O     . ARG B  2  236  ? 62.953  142.088 113.467 1.00 30.15  ? 235  ARG B O     1 
ATOM   3570  C  CB    . ARG B  2  236  ? 61.271  143.610 111.515 1.00 30.85  ? 235  ARG B CB    1 
ATOM   3571  C  CG    . ARG B  2  236  ? 60.800  144.796 110.720 1.00 34.54  ? 235  ARG B CG    1 
ATOM   3572  C  CD    . ARG B  2  236  ? 60.560  144.350 109.304 1.00 37.09  ? 235  ARG B CD    1 
ATOM   3573  N  NE    . ARG B  2  236  ? 60.329  145.456 108.386 1.00 39.91  ? 235  ARG B NE    1 
ATOM   3574  C  CZ    . ARG B  2  236  ? 60.367  145.332 107.062 1.00 40.54  ? 235  ARG B CZ    1 
ATOM   3575  N  NH1   . ARG B  2  236  ? 60.626  144.155 106.502 1.00 40.04  ? 235  ARG B NH1   1 
ATOM   3576  N  NH2   . ARG B  2  236  ? 60.158  146.388 106.295 1.00 42.36  ? 235  ARG B NH2   1 
ATOM   3577  N  N