data_3CMT
# 
_entry.id   3CMT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.283 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3CMT         
NDB   PD1107       
RCSB  RCSB046964   
WWPDB D_1000046964 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3CMU . unspecified 
PDB 3CMV . unspecified 
PDB 3CMW . unspecified 
PDB 3CMX . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3CMT 
_pdbx_database_status.recvd_initial_deposition_date   2008-03-24 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chen, Z.'        1 
'Yang, H.'        2 
'Pavletich, N.P.' 3 
# 
_citation.id                        primary 
_citation.title                     'Mechanism of homologous recombination from the RecA-ssDNA/dsDNA structures.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            453 
_citation.page_first                489 
_citation.page_last                 494 
_citation.year                      2008 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18497818 
_citation.pdbx_database_id_DOI      10.1038/nature06971 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chen, Z.'        1 
primary 'Yang, H.'        2 
primary 'Pavletich, N.P.' 3 
# 
_cell.entry_id           3CMT 
_cell.length_a           159.000 
_cell.length_b           300.500 
_cell.length_c           80.100 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3CMT 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 
;DNA (5'-D(*DTP*DTP*DTP*DTP*DTP*DCP*DCP*DCP*DAP*DCP*DCP*DTP*DTP*DTP*DT)-3')
;
4451.894   2  ? ? ? CBHII 
2 polymer     syn 
;DNA (5'-D(P*DGP*DGP*DTP*DGP*DGP*DG)-3')
;
1905.264   2  ? ? ? ?     
3 polymer     man 'Protein recA'                                                               182240.656 2  ? ? ? ?     
4 non-polymer syn 'MAGNESIUM ION'                                                              24.305     10 ? ? ? ?     
5 non-polymer syn 'TETRAFLUOROALUMINATE ION'                                                   102.975    10 ? ? ? ?     
6 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE"                                                   427.201    10 ? ? ? ?     
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        'Recombinase A' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DT)(DT)(DT)(DT)(DT)(DC)(DC)(DC)(DA)(DC)(DC)(DT)(DT)(DT)(DT)' TTTTTCCCACCTTTT B,E ? 
2 polydeoxyribonucleotide no no '(DG)(DG)(DT)(DG)(DG)(DG)' GGTGGG C,F ? 
3 'polypeptide(L)'        no no 
;GAMHGEDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYAR
KLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQS
NTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYG
EGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRELLLSNPNSTTGSTGSGTTGS
TGSMAIDENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLT
LQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIE
GEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGEN
VVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETA
KEIEKKVRELLLSNPNSTTGSTGSMGHTTGSMSAIDENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSL
DIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALE
ICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPE
TTTGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKA
GAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRELLLSNPNSTTGSTGSASGSSTGSMSAIDENKQKALAAALGQI
EKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEH
ALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRK
LAGNLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQ
AEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRELLLSNPNSTTGS
TGSMSGRTGSMSAIDENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPE
SSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAA
LTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRI
GAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQGKANATAW
LKDNPETAKEIEKKVRELLLSNPNST
;
;GAMHGEDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYAR
KLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQS
NTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYG
EGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRELLLSNPNSTTGSTGSGTTGS
TGSMAIDENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLT
LQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIE
GEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGEN
VVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETA
KEIEKKVRELLLSNPNSTTGSTGSMGHTTGSMSAIDENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSL
DIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALE
ICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPE
TTTGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKA
GAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRELLLSNPNSTTGSTGSASGSSTGSMSAIDENKQKALAAALGQI
EKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEH
ALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRK
LAGNLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQ
AEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRELLLSNPNSTTGS
TGSMSGRTGSMSAIDENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPE
SSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAA
LTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRI
GAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQGKANATAW
LKDNPETAKEIEKKVRELLLSNPNST
;
A,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    DT  n 
1 2    DT  n 
1 3    DT  n 
1 4    DT  n 
1 5    DT  n 
1 6    DC  n 
1 7    DC  n 
1 8    DC  n 
1 9    DA  n 
1 10   DC  n 
1 11   DC  n 
1 12   DT  n 
1 13   DT  n 
1 14   DT  n 
1 15   DT  n 
2 1    DG  n 
2 2    DG  n 
2 3    DT  n 
2 4    DG  n 
2 5    DG  n 
2 6    DG  n 
3 1    GLY n 
3 2    ALA n 
3 3    MET n 
3 4    HIS n 
3 5    GLY n 
3 6    GLU n 
3 7    ASP n 
3 8    ARG n 
3 9    SER n 
3 10   MET n 
3 11   ASP n 
3 12   VAL n 
3 13   GLU n 
3 14   THR n 
3 15   ILE n 
3 16   SER n 
3 17   THR n 
3 18   GLY n 
3 19   SER n 
3 20   LEU n 
3 21   SER n 
3 22   LEU n 
3 23   ASP n 
3 24   ILE n 
3 25   ALA n 
3 26   LEU n 
3 27   GLY n 
3 28   ALA n 
3 29   GLY n 
3 30   GLY n 
3 31   LEU n 
3 32   PRO n 
3 33   MET n 
3 34   GLY n 
3 35   ARG n 
3 36   ILE n 
3 37   VAL n 
3 38   GLU n 
3 39   ILE n 
3 40   TYR n 
3 41   GLY n 
3 42   PRO n 
3 43   GLU n 
3 44   SER n 
3 45   SER n 
3 46   GLY n 
3 47   LYS n 
3 48   THR n 
3 49   THR n 
3 50   LEU n 
3 51   THR n 
3 52   LEU n 
3 53   GLN n 
3 54   VAL n 
3 55   ILE n 
3 56   ALA n 
3 57   ALA n 
3 58   ALA n 
3 59   GLN n 
3 60   ARG n 
3 61   GLU n 
3 62   GLY n 
3 63   LYS n 
3 64   THR n 
3 65   CYS n 
3 66   ALA n 
3 67   PHE n 
3 68   ILE n 
3 69   ASP n 
3 70   ALA n 
3 71   GLU n 
3 72   HIS n 
3 73   ALA n 
3 74   LEU n 
3 75   ASP n 
3 76   PRO n 
3 77   ILE n 
3 78   TYR n 
3 79   ALA n 
3 80   ARG n 
3 81   LYS n 
3 82   LEU n 
3 83   GLY n 
3 84   VAL n 
3 85   ASP n 
3 86   ILE n 
3 87   ASP n 
3 88   ASN n 
3 89   LEU n 
3 90   LEU n 
3 91   CYS n 
3 92   SER n 
3 93   GLN n 
3 94   PRO n 
3 95   ASP n 
3 96   THR n 
3 97   GLY n 
3 98   GLU n 
3 99   GLN n 
3 100  ALA n 
3 101  LEU n 
3 102  GLU n 
3 103  ILE n 
3 104  CYS n 
3 105  ASP n 
3 106  ALA n 
3 107  LEU n 
3 108  ALA n 
3 109  ARG n 
3 110  SER n 
3 111  GLY n 
3 112  ALA n 
3 113  VAL n 
3 114  ASP n 
3 115  VAL n 
3 116  ILE n 
3 117  VAL n 
3 118  VAL n 
3 119  ASP n 
3 120  SER n 
3 121  VAL n 
3 122  ALA n 
3 123  ALA n 
3 124  LEU n 
3 125  THR n 
3 126  PRO n 
3 127  LYS n 
3 128  ALA n 
3 129  GLU n 
3 130  ILE n 
3 131  GLU n 
3 132  GLY n 
3 133  GLU n 
3 134  ILE n 
3 135  GLY n 
3 136  ASP n 
3 137  SER n 
3 138  HIS n 
3 139  MET n 
3 140  GLY n 
3 141  LEU n 
3 142  ALA n 
3 143  ALA n 
3 144  ARG n 
3 145  MET n 
3 146  MET n 
3 147  SER n 
3 148  GLN n 
3 149  ALA n 
3 150  MET n 
3 151  ARG n 
3 152  LYS n 
3 153  LEU n 
3 154  ALA n 
3 155  GLY n 
3 156  ASN n 
3 157  LEU n 
3 158  LYS n 
3 159  GLN n 
3 160  SER n 
3 161  ASN n 
3 162  THR n 
3 163  LEU n 
3 164  LEU n 
3 165  ILE n 
3 166  PHE n 
3 167  ILE n 
3 168  ASN n 
3 169  GLN n 
3 170  ILE n 
3 171  ARG n 
3 172  MET n 
3 173  LYS n 
3 174  ILE n 
3 175  GLY n 
3 176  VAL n 
3 177  MET n 
3 178  PHE n 
3 179  GLY n 
3 180  ASN n 
3 181  PRO n 
3 182  GLU n 
3 183  THR n 
3 184  THR n 
3 185  THR n 
3 186  GLY n 
3 187  GLY n 
3 188  ASN n 
3 189  ALA n 
3 190  LEU n 
3 191  LYS n 
3 192  PHE n 
3 193  TYR n 
3 194  ALA n 
3 195  SER n 
3 196  VAL n 
3 197  ARG n 
3 198  LEU n 
3 199  ASP n 
3 200  ILE n 
3 201  ARG n 
3 202  ARG n 
3 203  ILE n 
3 204  GLY n 
3 205  ALA n 
3 206  VAL n 
3 207  LYS n 
3 208  GLU n 
3 209  GLY n 
3 210  GLU n 
3 211  ASN n 
3 212  VAL n 
3 213  VAL n 
3 214  GLY n 
3 215  SER n 
3 216  GLU n 
3 217  THR n 
3 218  ARG n 
3 219  VAL n 
3 220  LYS n 
3 221  VAL n 
3 222  VAL n 
3 223  LYS n 
3 224  ASN n 
3 225  LYS n 
3 226  ILE n 
3 227  ALA n 
3 228  ALA n 
3 229  PRO n 
3 230  PHE n 
3 231  LYS n 
3 232  GLN n 
3 233  ALA n 
3 234  GLU n 
3 235  PHE n 
3 236  GLN n 
3 237  ILE n 
3 238  LEU n 
3 239  TYR n 
3 240  GLY n 
3 241  GLU n 
3 242  GLY n 
3 243  ILE n 
3 244  ASN n 
3 245  PHE n 
3 246  TYR n 
3 247  GLY n 
3 248  GLU n 
3 249  LEU n 
3 250  VAL n 
3 251  ASP n 
3 252  LEU n 
3 253  GLY n 
3 254  VAL n 
3 255  LYS n 
3 256  GLU n 
3 257  LYS n 
3 258  LEU n 
3 259  ILE n 
3 260  GLU n 
3 261  LYS n 
3 262  ALA n 
3 263  GLY n 
3 264  ALA n 
3 265  TRP n 
3 266  TYR n 
3 267  SER n 
3 268  TYR n 
3 269  LYS n 
3 270  GLY n 
3 271  GLU n 
3 272  LYS n 
3 273  ILE n 
3 274  GLY n 
3 275  GLN n 
3 276  GLY n 
3 277  LYS n 
3 278  ALA n 
3 279  ASN n 
3 280  ALA n 
3 281  THR n 
3 282  ALA n 
3 283  TRP n 
3 284  LEU n 
3 285  LYS n 
3 286  ASP n 
3 287  ASN n 
3 288  PRO n 
3 289  GLU n 
3 290  THR n 
3 291  ALA n 
3 292  LYS n 
3 293  GLU n 
3 294  ILE n 
3 295  GLU n 
3 296  LYS n 
3 297  LYS n 
3 298  VAL n 
3 299  ARG n 
3 300  GLU n 
3 301  LEU n 
3 302  LEU n 
3 303  LEU n 
3 304  SER n 
3 305  ASN n 
3 306  PRO n 
3 307  ASN n 
3 308  SER n 
3 309  THR n 
3 310  THR n 
3 311  GLY n 
3 312  SER n 
3 313  THR n 
3 314  GLY n 
3 315  SER n 
3 316  GLY n 
3 317  THR n 
3 318  THR n 
3 319  GLY n 
3 320  SER n 
3 321  THR n 
3 322  GLY n 
3 323  SER n 
3 324  MET n 
3 325  ALA n 
3 326  ILE n 
3 327  ASP n 
3 328  GLU n 
3 329  ASN n 
3 330  LYS n 
3 331  GLN n 
3 332  LYS n 
3 333  ALA n 
3 334  LEU n 
3 335  ALA n 
3 336  ALA n 
3 337  ALA n 
3 338  LEU n 
3 339  GLY n 
3 340  GLN n 
3 341  ILE n 
3 342  GLU n 
3 343  LYS n 
3 344  GLN n 
3 345  PHE n 
3 346  GLY n 
3 347  LYS n 
3 348  GLY n 
3 349  SER n 
3 350  ILE n 
3 351  MET n 
3 352  ARG n 
3 353  LEU n 
3 354  GLY n 
3 355  GLU n 
3 356  ASP n 
3 357  ARG n 
3 358  SER n 
3 359  MET n 
3 360  ASP n 
3 361  VAL n 
3 362  GLU n 
3 363  THR n 
3 364  ILE n 
3 365  SER n 
3 366  THR n 
3 367  GLY n 
3 368  SER n 
3 369  LEU n 
3 370  SER n 
3 371  LEU n 
3 372  ASP n 
3 373  ILE n 
3 374  ALA n 
3 375  LEU n 
3 376  GLY n 
3 377  ALA n 
3 378  GLY n 
3 379  GLY n 
3 380  LEU n 
3 381  PRO n 
3 382  MET n 
3 383  GLY n 
3 384  ARG n 
3 385  ILE n 
3 386  VAL n 
3 387  GLU n 
3 388  ILE n 
3 389  TYR n 
3 390  GLY n 
3 391  PRO n 
3 392  GLU n 
3 393  SER n 
3 394  SER n 
3 395  GLY n 
3 396  LYS n 
3 397  THR n 
3 398  THR n 
3 399  LEU n 
3 400  THR n 
3 401  LEU n 
3 402  GLN n 
3 403  VAL n 
3 404  ILE n 
3 405  ALA n 
3 406  ALA n 
3 407  ALA n 
3 408  GLN n 
3 409  ARG n 
3 410  GLU n 
3 411  GLY n 
3 412  LYS n 
3 413  THR n 
3 414  CYS n 
3 415  ALA n 
3 416  PHE n 
3 417  ILE n 
3 418  ASP n 
3 419  ALA n 
3 420  GLU n 
3 421  HIS n 
3 422  ALA n 
3 423  LEU n 
3 424  ASP n 
3 425  PRO n 
3 426  ILE n 
3 427  TYR n 
3 428  ALA n 
3 429  ARG n 
3 430  LYS n 
3 431  LEU n 
3 432  GLY n 
3 433  VAL n 
3 434  ASP n 
3 435  ILE n 
3 436  ASP n 
3 437  ASN n 
3 438  LEU n 
3 439  LEU n 
3 440  CYS n 
3 441  SER n 
3 442  GLN n 
3 443  PRO n 
3 444  ASP n 
3 445  THR n 
3 446  GLY n 
3 447  GLU n 
3 448  GLN n 
3 449  ALA n 
3 450  LEU n 
3 451  GLU n 
3 452  ILE n 
3 453  CYS n 
3 454  ASP n 
3 455  ALA n 
3 456  LEU n 
3 457  ALA n 
3 458  ARG n 
3 459  SER n 
3 460  GLY n 
3 461  ALA n 
3 462  VAL n 
3 463  ASP n 
3 464  VAL n 
3 465  ILE n 
3 466  VAL n 
3 467  VAL n 
3 468  ASP n 
3 469  SER n 
3 470  VAL n 
3 471  ALA n 
3 472  ALA n 
3 473  LEU n 
3 474  THR n 
3 475  PRO n 
3 476  LYS n 
3 477  ALA n 
3 478  GLU n 
3 479  ILE n 
3 480  GLU n 
3 481  GLY n 
3 482  GLU n 
3 483  ILE n 
3 484  GLY n 
3 485  ASP n 
3 486  SER n 
3 487  HIS n 
3 488  MET n 
3 489  GLY n 
3 490  LEU n 
3 491  ALA n 
3 492  ALA n 
3 493  ARG n 
3 494  MET n 
3 495  MET n 
3 496  SER n 
3 497  GLN n 
3 498  ALA n 
3 499  MET n 
3 500  ARG n 
3 501  LYS n 
3 502  LEU n 
3 503  ALA n 
3 504  GLY n 
3 505  ASN n 
3 506  LEU n 
3 507  LYS n 
3 508  GLN n 
3 509  SER n 
3 510  ASN n 
3 511  THR n 
3 512  LEU n 
3 513  LEU n 
3 514  ILE n 
3 515  PHE n 
3 516  ILE n 
3 517  ASN n 
3 518  GLN n 
3 519  ILE n 
3 520  ARG n 
3 521  MET n 
3 522  LYS n 
3 523  ILE n 
3 524  GLY n 
3 525  VAL n 
3 526  MET n 
3 527  PHE n 
3 528  GLY n 
3 529  ASN n 
3 530  PRO n 
3 531  GLU n 
3 532  THR n 
3 533  THR n 
3 534  THR n 
3 535  GLY n 
3 536  GLY n 
3 537  ASN n 
3 538  ALA n 
3 539  LEU n 
3 540  LYS n 
3 541  PHE n 
3 542  TYR n 
3 543  ALA n 
3 544  SER n 
3 545  VAL n 
3 546  ARG n 
3 547  LEU n 
3 548  ASP n 
3 549  ILE n 
3 550  ARG n 
3 551  ARG n 
3 552  ILE n 
3 553  GLY n 
3 554  ALA n 
3 555  VAL n 
3 556  LYS n 
3 557  GLU n 
3 558  GLY n 
3 559  GLU n 
3 560  ASN n 
3 561  VAL n 
3 562  VAL n 
3 563  GLY n 
3 564  SER n 
3 565  GLU n 
3 566  THR n 
3 567  ARG n 
3 568  VAL n 
3 569  LYS n 
3 570  VAL n 
3 571  VAL n 
3 572  LYS n 
3 573  ASN n 
3 574  LYS n 
3 575  ILE n 
3 576  ALA n 
3 577  ALA n 
3 578  PRO n 
3 579  PHE n 
3 580  LYS n 
3 581  GLN n 
3 582  ALA n 
3 583  GLU n 
3 584  PHE n 
3 585  GLN n 
3 586  ILE n 
3 587  LEU n 
3 588  TYR n 
3 589  GLY n 
3 590  GLU n 
3 591  GLY n 
3 592  ILE n 
3 593  ASN n 
3 594  PHE n 
3 595  TYR n 
3 596  GLY n 
3 597  GLU n 
3 598  LEU n 
3 599  VAL n 
3 600  ASP n 
3 601  LEU n 
3 602  GLY n 
3 603  VAL n 
3 604  LYS n 
3 605  GLU n 
3 606  LYS n 
3 607  LEU n 
3 608  ILE n 
3 609  GLU n 
3 610  LYS n 
3 611  ALA n 
3 612  GLY n 
3 613  ALA n 
3 614  TRP n 
3 615  TYR n 
3 616  SER n 
3 617  TYR n 
3 618  LYS n 
3 619  GLY n 
3 620  GLU n 
3 621  LYS n 
3 622  ILE n 
3 623  GLY n 
3 624  GLN n 
3 625  GLY n 
3 626  LYS n 
3 627  ALA n 
3 628  ASN n 
3 629  ALA n 
3 630  THR n 
3 631  ALA n 
3 632  TRP n 
3 633  LEU n 
3 634  LYS n 
3 635  ASP n 
3 636  ASN n 
3 637  PRO n 
3 638  GLU n 
3 639  THR n 
3 640  ALA n 
3 641  LYS n 
3 642  GLU n 
3 643  ILE n 
3 644  GLU n 
3 645  LYS n 
3 646  LYS n 
3 647  VAL n 
3 648  ARG n 
3 649  GLU n 
3 650  LEU n 
3 651  LEU n 
3 652  LEU n 
3 653  SER n 
3 654  ASN n 
3 655  PRO n 
3 656  ASN n 
3 657  SER n 
3 658  THR n 
3 659  THR n 
3 660  GLY n 
3 661  SER n 
3 662  THR n 
3 663  GLY n 
3 664  SER n 
3 665  MET n 
3 666  GLY n 
3 667  HIS n 
3 668  THR n 
3 669  THR n 
3 670  GLY n 
3 671  SER n 
3 672  MET n 
3 673  SER n 
3 674  ALA n 
3 675  ILE n 
3 676  ASP n 
3 677  GLU n 
3 678  ASN n 
3 679  LYS n 
3 680  GLN n 
3 681  LYS n 
3 682  ALA n 
3 683  LEU n 
3 684  ALA n 
3 685  ALA n 
3 686  ALA n 
3 687  LEU n 
3 688  GLY n 
3 689  GLN n 
3 690  ILE n 
3 691  GLU n 
3 692  LYS n 
3 693  GLN n 
3 694  PHE n 
3 695  GLY n 
3 696  LYS n 
3 697  GLY n 
3 698  SER n 
3 699  ILE n 
3 700  MET n 
3 701  ARG n 
3 702  LEU n 
3 703  GLY n 
3 704  GLU n 
3 705  ASP n 
3 706  ARG n 
3 707  SER n 
3 708  MET n 
3 709  ASP n 
3 710  VAL n 
3 711  GLU n 
3 712  THR n 
3 713  ILE n 
3 714  SER n 
3 715  THR n 
3 716  GLY n 
3 717  SER n 
3 718  LEU n 
3 719  SER n 
3 720  LEU n 
3 721  ASP n 
3 722  ILE n 
3 723  ALA n 
3 724  LEU n 
3 725  GLY n 
3 726  ALA n 
3 727  GLY n 
3 728  GLY n 
3 729  LEU n 
3 730  PRO n 
3 731  MET n 
3 732  GLY n 
3 733  ARG n 
3 734  ILE n 
3 735  VAL n 
3 736  GLU n 
3 737  ILE n 
3 738  TYR n 
3 739  GLY n 
3 740  PRO n 
3 741  GLU n 
3 742  SER n 
3 743  SER n 
3 744  GLY n 
3 745  LYS n 
3 746  THR n 
3 747  THR n 
3 748  LEU n 
3 749  THR n 
3 750  LEU n 
3 751  GLN n 
3 752  VAL n 
3 753  ILE n 
3 754  ALA n 
3 755  ALA n 
3 756  ALA n 
3 757  GLN n 
3 758  ARG n 
3 759  GLU n 
3 760  GLY n 
3 761  LYS n 
3 762  THR n 
3 763  CYS n 
3 764  ALA n 
3 765  PHE n 
3 766  ILE n 
3 767  ASP n 
3 768  ALA n 
3 769  GLU n 
3 770  HIS n 
3 771  ALA n 
3 772  LEU n 
3 773  ASP n 
3 774  PRO n 
3 775  ILE n 
3 776  TYR n 
3 777  ALA n 
3 778  ARG n 
3 779  LYS n 
3 780  LEU n 
3 781  GLY n 
3 782  VAL n 
3 783  ASP n 
3 784  ILE n 
3 785  ASP n 
3 786  ASN n 
3 787  LEU n 
3 788  LEU n 
3 789  CYS n 
3 790  SER n 
3 791  GLN n 
3 792  PRO n 
3 793  ASP n 
3 794  THR n 
3 795  GLY n 
3 796  GLU n 
3 797  GLN n 
3 798  ALA n 
3 799  LEU n 
3 800  GLU n 
3 801  ILE n 
3 802  CYS n 
3 803  ASP n 
3 804  ALA n 
3 805  LEU n 
3 806  ALA n 
3 807  ARG n 
3 808  SER n 
3 809  GLY n 
3 810  ALA n 
3 811  VAL n 
3 812  ASP n 
3 813  VAL n 
3 814  ILE n 
3 815  VAL n 
3 816  VAL n 
3 817  ASP n 
3 818  SER n 
3 819  VAL n 
3 820  ALA n 
3 821  ALA n 
3 822  LEU n 
3 823  THR n 
3 824  PRO n 
3 825  LYS n 
3 826  ALA n 
3 827  GLU n 
3 828  ILE n 
3 829  GLU n 
3 830  GLY n 
3 831  GLU n 
3 832  ILE n 
3 833  GLY n 
3 834  ASP n 
3 835  SER n 
3 836  HIS n 
3 837  MET n 
3 838  GLY n 
3 839  LEU n 
3 840  ALA n 
3 841  ALA n 
3 842  ARG n 
3 843  MET n 
3 844  MET n 
3 845  SER n 
3 846  GLN n 
3 847  ALA n 
3 848  MET n 
3 849  ARG n 
3 850  LYS n 
3 851  LEU n 
3 852  ALA n 
3 853  GLY n 
3 854  ASN n 
3 855  LEU n 
3 856  LYS n 
3 857  GLN n 
3 858  SER n 
3 859  ASN n 
3 860  THR n 
3 861  LEU n 
3 862  LEU n 
3 863  ILE n 
3 864  PHE n 
3 865  ILE n 
3 866  ASN n 
3 867  GLN n 
3 868  ILE n 
3 869  ARG n 
3 870  MET n 
3 871  LYS n 
3 872  ILE n 
3 873  GLY n 
3 874  VAL n 
3 875  MET n 
3 876  PHE n 
3 877  GLY n 
3 878  ASN n 
3 879  PRO n 
3 880  GLU n 
3 881  THR n 
3 882  THR n 
3 883  THR n 
3 884  GLY n 
3 885  GLY n 
3 886  ASN n 
3 887  ALA n 
3 888  LEU n 
3 889  LYS n 
3 890  PHE n 
3 891  TYR n 
3 892  ALA n 
3 893  SER n 
3 894  VAL n 
3 895  ARG n 
3 896  LEU n 
3 897  ASP n 
3 898  ILE n 
3 899  ARG n 
3 900  ARG n 
3 901  ILE n 
3 902  GLY n 
3 903  ALA n 
3 904  VAL n 
3 905  LYS n 
3 906  GLU n 
3 907  GLY n 
3 908  GLU n 
3 909  ASN n 
3 910  VAL n 
3 911  VAL n 
3 912  GLY n 
3 913  SER n 
3 914  GLU n 
3 915  THR n 
3 916  ARG n 
3 917  VAL n 
3 918  LYS n 
3 919  VAL n 
3 920  VAL n 
3 921  LYS n 
3 922  ASN n 
3 923  LYS n 
3 924  ILE n 
3 925  ALA n 
3 926  ALA n 
3 927  PRO n 
3 928  PHE n 
3 929  LYS n 
3 930  GLN n 
3 931  ALA n 
3 932  GLU n 
3 933  PHE n 
3 934  GLN n 
3 935  ILE n 
3 936  LEU n 
3 937  TYR n 
3 938  GLY n 
3 939  GLU n 
3 940  GLY n 
3 941  ILE n 
3 942  ASN n 
3 943  PHE n 
3 944  TYR n 
3 945  GLY n 
3 946  GLU n 
3 947  LEU n 
3 948  VAL n 
3 949  ASP n 
3 950  LEU n 
3 951  GLY n 
3 952  VAL n 
3 953  LYS n 
3 954  GLU n 
3 955  LYS n 
3 956  LEU n 
3 957  ILE n 
3 958  GLU n 
3 959  LYS n 
3 960  ALA n 
3 961  GLY n 
3 962  ALA n 
3 963  TRP n 
3 964  TYR n 
3 965  SER n 
3 966  TYR n 
3 967  LYS n 
3 968  GLY n 
3 969  GLU n 
3 970  LYS n 
3 971  ILE n 
3 972  GLY n 
3 973  GLN n 
3 974  GLY n 
3 975  LYS n 
3 976  ALA n 
3 977  ASN n 
3 978  ALA n 
3 979  THR n 
3 980  ALA n 
3 981  TRP n 
3 982  LEU n 
3 983  LYS n 
3 984  ASP n 
3 985  ASN n 
3 986  PRO n 
3 987  GLU n 
3 988  THR n 
3 989  ALA n 
3 990  LYS n 
3 991  GLU n 
3 992  ILE n 
3 993  GLU n 
3 994  LYS n 
3 995  LYS n 
3 996  VAL n 
3 997  ARG n 
3 998  GLU n 
3 999  LEU n 
3 1000 LEU n 
3 1001 LEU n 
3 1002 SER n 
3 1003 ASN n 
3 1004 PRO n 
3 1005 ASN n 
3 1006 SER n 
3 1007 THR n 
3 1008 THR n 
3 1009 GLY n 
3 1010 SER n 
3 1011 THR n 
3 1012 GLY n 
3 1013 SER n 
3 1014 ALA n 
3 1015 SER n 
3 1016 GLY n 
3 1017 SER n 
3 1018 SER n 
3 1019 THR n 
3 1020 GLY n 
3 1021 SER n 
3 1022 MET n 
3 1023 SER n 
3 1024 ALA n 
3 1025 ILE n 
3 1026 ASP n 
3 1027 GLU n 
3 1028 ASN n 
3 1029 LYS n 
3 1030 GLN n 
3 1031 LYS n 
3 1032 ALA n 
3 1033 LEU n 
3 1034 ALA n 
3 1035 ALA n 
3 1036 ALA n 
3 1037 LEU n 
3 1038 GLY n 
3 1039 GLN n 
3 1040 ILE n 
3 1041 GLU n 
3 1042 LYS n 
3 1043 GLN n 
3 1044 PHE n 
3 1045 GLY n 
3 1046 LYS n 
3 1047 GLY n 
3 1048 SER n 
3 1049 ILE n 
3 1050 MET n 
3 1051 ARG n 
3 1052 LEU n 
3 1053 GLY n 
3 1054 GLU n 
3 1055 ASP n 
3 1056 ARG n 
3 1057 SER n 
3 1058 MET n 
3 1059 ASP n 
3 1060 VAL n 
3 1061 GLU n 
3 1062 THR n 
3 1063 ILE n 
3 1064 SER n 
3 1065 THR n 
3 1066 GLY n 
3 1067 SER n 
3 1068 LEU n 
3 1069 SER n 
3 1070 LEU n 
3 1071 ASP n 
3 1072 ILE n 
3 1073 ALA n 
3 1074 LEU n 
3 1075 GLY n 
3 1076 ALA n 
3 1077 GLY n 
3 1078 GLY n 
3 1079 LEU n 
3 1080 PRO n 
3 1081 MET n 
3 1082 GLY n 
3 1083 ARG n 
3 1084 ILE n 
3 1085 VAL n 
3 1086 GLU n 
3 1087 ILE n 
3 1088 TYR n 
3 1089 GLY n 
3 1090 PRO n 
3 1091 GLU n 
3 1092 SER n 
3 1093 SER n 
3 1094 GLY n 
3 1095 LYS n 
3 1096 THR n 
3 1097 THR n 
3 1098 LEU n 
3 1099 THR n 
3 1100 LEU n 
3 1101 GLN n 
3 1102 VAL n 
3 1103 ILE n 
3 1104 ALA n 
3 1105 ALA n 
3 1106 ALA n 
3 1107 GLN n 
3 1108 ARG n 
3 1109 GLU n 
3 1110 GLY n 
3 1111 LYS n 
3 1112 THR n 
3 1113 CYS n 
3 1114 ALA n 
3 1115 PHE n 
3 1116 ILE n 
3 1117 ASP n 
3 1118 ALA n 
3 1119 GLU n 
3 1120 HIS n 
3 1121 ALA n 
3 1122 LEU n 
3 1123 ASP n 
3 1124 PRO n 
3 1125 ILE n 
3 1126 TYR n 
3 1127 ALA n 
3 1128 ARG n 
3 1129 LYS n 
3 1130 LEU n 
3 1131 GLY n 
3 1132 VAL n 
3 1133 ASP n 
3 1134 ILE n 
3 1135 ASP n 
3 1136 ASN n 
3 1137 LEU n 
3 1138 LEU n 
3 1139 CYS n 
3 1140 SER n 
3 1141 GLN n 
3 1142 PRO n 
3 1143 ASP n 
3 1144 THR n 
3 1145 GLY n 
3 1146 GLU n 
3 1147 GLN n 
3 1148 ALA n 
3 1149 LEU n 
3 1150 GLU n 
3 1151 ILE n 
3 1152 CYS n 
3 1153 ASP n 
3 1154 ALA n 
3 1155 LEU n 
3 1156 ALA n 
3 1157 ARG n 
3 1158 SER n 
3 1159 GLY n 
3 1160 ALA n 
3 1161 VAL n 
3 1162 ASP n 
3 1163 VAL n 
3 1164 ILE n 
3 1165 VAL n 
3 1166 VAL n 
3 1167 ASP n 
3 1168 SER n 
3 1169 VAL n 
3 1170 ALA n 
3 1171 ALA n 
3 1172 LEU n 
3 1173 THR n 
3 1174 PRO n 
3 1175 LYS n 
3 1176 ALA n 
3 1177 GLU n 
3 1178 ILE n 
3 1179 GLU n 
3 1180 GLY n 
3 1181 GLU n 
3 1182 ILE n 
3 1183 GLY n 
3 1184 ASP n 
3 1185 SER n 
3 1186 HIS n 
3 1187 MET n 
3 1188 GLY n 
3 1189 LEU n 
3 1190 ALA n 
3 1191 ALA n 
3 1192 ARG n 
3 1193 MET n 
3 1194 MET n 
3 1195 SER n 
3 1196 GLN n 
3 1197 ALA n 
3 1198 MET n 
3 1199 ARG n 
3 1200 LYS n 
3 1201 LEU n 
3 1202 ALA n 
3 1203 GLY n 
3 1204 ASN n 
3 1205 LEU n 
3 1206 LYS n 
3 1207 GLN n 
3 1208 SER n 
3 1209 ASN n 
3 1210 THR n 
3 1211 LEU n 
3 1212 LEU n 
3 1213 ILE n 
3 1214 PHE n 
3 1215 ILE n 
3 1216 ASN n 
3 1217 GLN n 
3 1218 ILE n 
3 1219 ARG n 
3 1220 MET n 
3 1221 LYS n 
3 1222 ILE n 
3 1223 GLY n 
3 1224 VAL n 
3 1225 MET n 
3 1226 PHE n 
3 1227 GLY n 
3 1228 ASN n 
3 1229 PRO n 
3 1230 GLU n 
3 1231 THR n 
3 1232 THR n 
3 1233 THR n 
3 1234 GLY n 
3 1235 GLY n 
3 1236 ASN n 
3 1237 ALA n 
3 1238 LEU n 
3 1239 LYS n 
3 1240 PHE n 
3 1241 TYR n 
3 1242 ALA n 
3 1243 SER n 
3 1244 VAL n 
3 1245 ARG n 
3 1246 LEU n 
3 1247 ASP n 
3 1248 ILE n 
3 1249 ARG n 
3 1250 ARG n 
3 1251 ILE n 
3 1252 GLY n 
3 1253 ALA n 
3 1254 VAL n 
3 1255 LYS n 
3 1256 GLU n 
3 1257 GLY n 
3 1258 GLU n 
3 1259 ASN n 
3 1260 VAL n 
3 1261 VAL n 
3 1262 GLY n 
3 1263 SER n 
3 1264 GLU n 
3 1265 THR n 
3 1266 ARG n 
3 1267 VAL n 
3 1268 LYS n 
3 1269 VAL n 
3 1270 VAL n 
3 1271 LYS n 
3 1272 ASN n 
3 1273 LYS n 
3 1274 ILE n 
3 1275 ALA n 
3 1276 ALA n 
3 1277 PRO n 
3 1278 PHE n 
3 1279 LYS n 
3 1280 GLN n 
3 1281 ALA n 
3 1282 GLU n 
3 1283 PHE n 
3 1284 GLN n 
3 1285 ILE n 
3 1286 LEU n 
3 1287 TYR n 
3 1288 GLY n 
3 1289 GLU n 
3 1290 GLY n 
3 1291 ILE n 
3 1292 ASN n 
3 1293 PHE n 
3 1294 TYR n 
3 1295 GLY n 
3 1296 GLU n 
3 1297 LEU n 
3 1298 VAL n 
3 1299 ASP n 
3 1300 LEU n 
3 1301 GLY n 
3 1302 VAL n 
3 1303 LYS n 
3 1304 GLU n 
3 1305 LYS n 
3 1306 LEU n 
3 1307 ILE n 
3 1308 GLU n 
3 1309 LYS n 
3 1310 ALA n 
3 1311 GLY n 
3 1312 ALA n 
3 1313 TRP n 
3 1314 TYR n 
3 1315 SER n 
3 1316 TYR n 
3 1317 LYS n 
3 1318 GLY n 
3 1319 GLU n 
3 1320 LYS n 
3 1321 ILE n 
3 1322 GLY n 
3 1323 GLN n 
3 1324 GLY n 
3 1325 LYS n 
3 1326 ALA n 
3 1327 ASN n 
3 1328 ALA n 
3 1329 THR n 
3 1330 ALA n 
3 1331 TRP n 
3 1332 LEU n 
3 1333 LYS n 
3 1334 ASP n 
3 1335 ASN n 
3 1336 PRO n 
3 1337 GLU n 
3 1338 THR n 
3 1339 ALA n 
3 1340 LYS n 
3 1341 GLU n 
3 1342 ILE n 
3 1343 GLU n 
3 1344 LYS n 
3 1345 LYS n 
3 1346 VAL n 
3 1347 ARG n 
3 1348 GLU n 
3 1349 LEU n 
3 1350 LEU n 
3 1351 LEU n 
3 1352 SER n 
3 1353 ASN n 
3 1354 PRO n 
3 1355 ASN n 
3 1356 SER n 
3 1357 THR n 
3 1358 THR n 
3 1359 GLY n 
3 1360 SER n 
3 1361 THR n 
3 1362 GLY n 
3 1363 SER n 
3 1364 MET n 
3 1365 SER n 
3 1366 GLY n 
3 1367 ARG n 
3 1368 THR n 
3 1369 GLY n 
3 1370 SER n 
3 1371 MET n 
3 1372 SER n 
3 1373 ALA n 
3 1374 ILE n 
3 1375 ASP n 
3 1376 GLU n 
3 1377 ASN n 
3 1378 LYS n 
3 1379 GLN n 
3 1380 LYS n 
3 1381 ALA n 
3 1382 LEU n 
3 1383 ALA n 
3 1384 ALA n 
3 1385 ALA n 
3 1386 LEU n 
3 1387 GLY n 
3 1388 GLN n 
3 1389 ILE n 
3 1390 GLU n 
3 1391 LYS n 
3 1392 GLN n 
3 1393 PHE n 
3 1394 GLY n 
3 1395 LYS n 
3 1396 GLY n 
3 1397 SER n 
3 1398 ILE n 
3 1399 MET n 
3 1400 ARG n 
3 1401 LEU n 
3 1402 GLY n 
3 1403 GLU n 
3 1404 ASP n 
3 1405 ARG n 
3 1406 SER n 
3 1407 MET n 
3 1408 ASP n 
3 1409 VAL n 
3 1410 GLU n 
3 1411 THR n 
3 1412 ILE n 
3 1413 SER n 
3 1414 THR n 
3 1415 GLY n 
3 1416 SER n 
3 1417 LEU n 
3 1418 SER n 
3 1419 LEU n 
3 1420 ASP n 
3 1421 ILE n 
3 1422 ALA n 
3 1423 LEU n 
3 1424 GLY n 
3 1425 ALA n 
3 1426 GLY n 
3 1427 GLY n 
3 1428 LEU n 
3 1429 PRO n 
3 1430 MET n 
3 1431 GLY n 
3 1432 ARG n 
3 1433 ILE n 
3 1434 VAL n 
3 1435 GLU n 
3 1436 ILE n 
3 1437 TYR n 
3 1438 GLY n 
3 1439 PRO n 
3 1440 GLU n 
3 1441 SER n 
3 1442 SER n 
3 1443 GLY n 
3 1444 LYS n 
3 1445 THR n 
3 1446 THR n 
3 1447 LEU n 
3 1448 THR n 
3 1449 LEU n 
3 1450 GLN n 
3 1451 VAL n 
3 1452 ILE n 
3 1453 ALA n 
3 1454 ALA n 
3 1455 ALA n 
3 1456 GLN n 
3 1457 ARG n 
3 1458 GLU n 
3 1459 GLY n 
3 1460 LYS n 
3 1461 THR n 
3 1462 CYS n 
3 1463 ALA n 
3 1464 PHE n 
3 1465 ILE n 
3 1466 ASP n 
3 1467 ALA n 
3 1468 GLU n 
3 1469 HIS n 
3 1470 ALA n 
3 1471 LEU n 
3 1472 ASP n 
3 1473 PRO n 
3 1474 ILE n 
3 1475 TYR n 
3 1476 ALA n 
3 1477 ARG n 
3 1478 LYS n 
3 1479 LEU n 
3 1480 GLY n 
3 1481 VAL n 
3 1482 ASP n 
3 1483 ILE n 
3 1484 ASP n 
3 1485 ASN n 
3 1486 LEU n 
3 1487 LEU n 
3 1488 CYS n 
3 1489 SER n 
3 1490 GLN n 
3 1491 PRO n 
3 1492 ASP n 
3 1493 THR n 
3 1494 GLY n 
3 1495 GLU n 
3 1496 GLN n 
3 1497 ALA n 
3 1498 LEU n 
3 1499 GLU n 
3 1500 ILE n 
3 1501 CYS n 
3 1502 ASP n 
3 1503 ALA n 
3 1504 LEU n 
3 1505 ALA n 
3 1506 ARG n 
3 1507 SER n 
3 1508 GLY n 
3 1509 ALA n 
3 1510 VAL n 
3 1511 ASP n 
3 1512 VAL n 
3 1513 ILE n 
3 1514 VAL n 
3 1515 VAL n 
3 1516 ASP n 
3 1517 SER n 
3 1518 VAL n 
3 1519 ALA n 
3 1520 ALA n 
3 1521 LEU n 
3 1522 THR n 
3 1523 PRO n 
3 1524 LYS n 
3 1525 ALA n 
3 1526 GLU n 
3 1527 ILE n 
3 1528 GLU n 
3 1529 GLY n 
3 1530 GLU n 
3 1531 ILE n 
3 1532 GLY n 
3 1533 ASP n 
3 1534 SER n 
3 1535 HIS n 
3 1536 MET n 
3 1537 GLY n 
3 1538 LEU n 
3 1539 ALA n 
3 1540 ALA n 
3 1541 ARG n 
3 1542 MET n 
3 1543 MET n 
3 1544 SER n 
3 1545 GLN n 
3 1546 ALA n 
3 1547 MET n 
3 1548 ARG n 
3 1549 LYS n 
3 1550 LEU n 
3 1551 ALA n 
3 1552 GLY n 
3 1553 ASN n 
3 1554 LEU n 
3 1555 LYS n 
3 1556 GLN n 
3 1557 SER n 
3 1558 ASN n 
3 1559 THR n 
3 1560 LEU n 
3 1561 LEU n 
3 1562 ILE n 
3 1563 PHE n 
3 1564 ILE n 
3 1565 ASN n 
3 1566 GLN n 
3 1567 ILE n 
3 1568 ARG n 
3 1569 MET n 
3 1570 LYS n 
3 1571 ILE n 
3 1572 GLY n 
3 1573 VAL n 
3 1574 MET n 
3 1575 PHE n 
3 1576 GLY n 
3 1577 ASN n 
3 1578 PRO n 
3 1579 GLU n 
3 1580 THR n 
3 1581 THR n 
3 1582 THR n 
3 1583 GLY n 
3 1584 GLY n 
3 1585 ASN n 
3 1586 ALA n 
3 1587 LEU n 
3 1588 LYS n 
3 1589 PHE n 
3 1590 TYR n 
3 1591 ALA n 
3 1592 SER n 
3 1593 VAL n 
3 1594 ARG n 
3 1595 LEU n 
3 1596 ASP n 
3 1597 ILE n 
3 1598 ARG n 
3 1599 ARG n 
3 1600 ILE n 
3 1601 GLY n 
3 1602 ALA n 
3 1603 VAL n 
3 1604 LYS n 
3 1605 GLU n 
3 1606 GLY n 
3 1607 GLU n 
3 1608 ASN n 
3 1609 VAL n 
3 1610 VAL n 
3 1611 GLY n 
3 1612 SER n 
3 1613 GLU n 
3 1614 THR n 
3 1615 ARG n 
3 1616 VAL n 
3 1617 LYS n 
3 1618 VAL n 
3 1619 VAL n 
3 1620 LYS n 
3 1621 ASN n 
3 1622 LYS n 
3 1623 ILE n 
3 1624 ALA n 
3 1625 ALA n 
3 1626 PRO n 
3 1627 PHE n 
3 1628 LYS n 
3 1629 GLN n 
3 1630 ALA n 
3 1631 GLU n 
3 1632 PHE n 
3 1633 GLN n 
3 1634 ILE n 
3 1635 LEU n 
3 1636 TYR n 
3 1637 GLY n 
3 1638 GLU n 
3 1639 GLY n 
3 1640 ILE n 
3 1641 ASN n 
3 1642 PHE n 
3 1643 TYR n 
3 1644 GLY n 
3 1645 GLU n 
3 1646 LEU n 
3 1647 VAL n 
3 1648 ASP n 
3 1649 LEU n 
3 1650 GLY n 
3 1651 VAL n 
3 1652 LYS n 
3 1653 GLU n 
3 1654 LYS n 
3 1655 LEU n 
3 1656 ILE n 
3 1657 GLU n 
3 1658 LYS n 
3 1659 ALA n 
3 1660 GLY n 
3 1661 ALA n 
3 1662 TRP n 
3 1663 TYR n 
3 1664 SER n 
3 1665 TYR n 
3 1666 LYS n 
3 1667 GLY n 
3 1668 GLU n 
3 1669 LYS n 
3 1670 ILE n 
3 1671 GLY n 
3 1672 GLN n 
3 1673 GLY n 
3 1674 LYS n 
3 1675 ALA n 
3 1676 ASN n 
3 1677 ALA n 
3 1678 THR n 
3 1679 ALA n 
3 1680 TRP n 
3 1681 LEU n 
3 1682 LYS n 
3 1683 ASP n 
3 1684 ASN n 
3 1685 PRO n 
3 1686 GLU n 
3 1687 THR n 
3 1688 ALA n 
3 1689 LYS n 
3 1690 GLU n 
3 1691 ILE n 
3 1692 GLU n 
3 1693 LYS n 
3 1694 LYS n 
3 1695 VAL n 
3 1696 ARG n 
3 1697 GLU n 
3 1698 LEU n 
3 1699 LEU n 
3 1700 LEU n 
3 1701 SER n 
3 1702 ASN n 
3 1703 PRO n 
3 1704 ASN n 
3 1705 SER n 
3 1706 THR n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
3 1 sample ? 5    309  ? ? cbhII ? ? ? ? ? ? 'Escherichia coli' ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 3 sample ? 674  1007 ? ? cbhII ? ? ? ? ? ? 'Escherichia coli' ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 2 sample ? 325  658  ? ? cbhII ? ? ? ? ? ? 'Escherichia coli' ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 5 sample ? 1373 1706 ? ? cbhII ? ? ? ? ? ? 'Escherichia coli' ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 4 sample ? 1024 1357 ? ? cbhII ? ? ? ? ? ? 'Escherichia coli' ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 3CMT   1 PDB 3CMT       1 TTTTCCCACCTTTTT ? 
2 3CMT   2 PDB 3CMT       1 GGTGGG ? 
3 P0A7G6 3 UNP RECA_ECOLI 2 
;GEDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGV
DIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLL
IFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGIN
FYGELVDLGVKEKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRELLLSNPNST
;
? 
3 P0A7G6 4 UNP RECA_ECOLI 2 
;AIDENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVI
AAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEIG
DSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGS
ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIE
KKVRELLLSNPNST
;
? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 3CMT B 1    ? 15   ? 3CMT   1  ? 15  ? 999  1013 
2  2 3CMT C 1    ? 6    ? 3CMT   1  ? 6   ? 2007 2012 
3  1 3CMT E 1    ? 15   ? 3CMT   1  ? 15  ? 999  1013 
4  2 3CMT F 1    ? 6    ? 3CMT   1  ? 6   ? 2007 2012 
5  3 3CMT A 5    ? 309  ? P0A7G6 31 ? 335 ? 30   334  
6  3 3CMT D 5    ? 309  ? P0A7G6 31 ? 335 ? 30   334  
7  4 3CMT A 325  ? 658  ? P0A7G6 2  ? 335 ? 1001 1334 
8  4 3CMT D 325  ? 658  ? P0A7G6 2  ? 335 ? 1001 1334 
9  4 3CMT A 674  ? 1007 ? P0A7G6 2  ? 335 ? 2001 2334 
10 4 3CMT D 674  ? 1007 ? P0A7G6 2  ? 335 ? 2001 2334 
11 4 3CMT A 1024 ? 1357 ? P0A7G6 2  ? 335 ? 3001 3334 
12 4 3CMT D 1024 ? 1357 ? P0A7G6 2  ? 335 ? 3001 3334 
13 4 3CMT A 1373 ? 1706 ? P0A7G6 2  ? 335 ? 4001 4334 
14 4 3CMT D 1373 ? 1706 ? P0A7G6 2  ? 335 ? 4001 4334 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
5 3CMT GLY A 1    ? UNP P0A7G6 ? ? linker 26   1   
5 3CMT ALA A 2    ? UNP P0A7G6 ? ? linker 27   2   
5 3CMT MET A 3    ? UNP P0A7G6 ? ? linker 28   3   
5 3CMT HIS A 4    ? UNP P0A7G6 ? ? linker 29   4   
5 3CMT THR A 310  ? UNP P0A7G6 ? ? linker 986  5   
5 3CMT GLY A 311  ? UNP P0A7G6 ? ? linker 987  6   
5 3CMT SER A 312  ? UNP P0A7G6 ? ? linker 988  7   
5 3CMT THR A 313  ? UNP P0A7G6 ? ? linker 989  8   
5 3CMT GLY A 314  ? UNP P0A7G6 ? ? linker 990  9   
5 3CMT SER A 315  ? UNP P0A7G6 ? ? linker 991  10  
5 3CMT GLY A 316  ? UNP P0A7G6 ? ? linker 992  11  
5 3CMT THR A 317  ? UNP P0A7G6 ? ? linker 993  12  
5 3CMT THR A 318  ? UNP P0A7G6 ? ? linker 994  13  
5 3CMT GLY A 319  ? UNP P0A7G6 ? ? linker 995  14  
5 3CMT SER A 320  ? UNP P0A7G6 ? ? linker 996  15  
5 3CMT THR A 321  ? UNP P0A7G6 ? ? linker 997  16  
5 3CMT GLY A 322  ? UNP P0A7G6 ? ? linker 998  17  
5 3CMT SER A 323  ? UNP P0A7G6 ? ? linker 999  18  
5 3CMT MET A 324  ? UNP P0A7G6 ? ? linker 1000 19  
5 3CMT THR A 659  ? UNP P0A7G6 ? ? linker 1986 20  
5 3CMT GLY A 660  ? UNP P0A7G6 ? ? linker 1987 21  
5 3CMT SER A 661  ? UNP P0A7G6 ? ? linker 1988 22  
5 3CMT THR A 662  ? UNP P0A7G6 ? ? linker 1989 23  
5 3CMT GLY A 663  ? UNP P0A7G6 ? ? linker 1990 24  
5 3CMT SER A 664  ? UNP P0A7G6 ? ? linker 1991 25  
5 3CMT MET A 665  ? UNP P0A7G6 ? ? linker 1992 26  
5 3CMT GLY A 666  ? UNP P0A7G6 ? ? linker 1993 27  
5 3CMT HIS A 667  ? UNP P0A7G6 ? ? linker 1994 28  
5 3CMT THR A 668  ? UNP P0A7G6 ? ? linker 1995 29  
5 3CMT THR A 669  ? UNP P0A7G6 ? ? linker 1996 30  
5 3CMT GLY A 670  ? UNP P0A7G6 ? ? linker 1997 31  
5 3CMT SER A 671  ? UNP P0A7G6 ? ? linker 1998 32  
5 3CMT MET A 672  ? UNP P0A7G6 ? ? linker 1999 33  
5 3CMT SER A 673  ? UNP P0A7G6 ? ? linker 2000 34  
5 3CMT THR A 1008 ? UNP P0A7G6 ? ? linker 2985 35  
5 3CMT GLY A 1009 ? UNP P0A7G6 ? ? linker 2986 36  
5 3CMT SER A 1010 ? UNP P0A7G6 ? ? linker 2987 37  
5 3CMT THR A 1011 ? UNP P0A7G6 ? ? linker 2988 38  
5 3CMT GLY A 1012 ? UNP P0A7G6 ? ? linker 2989 39  
5 3CMT SER A 1013 ? UNP P0A7G6 ? ? linker 2990 40  
5 3CMT ALA A 1014 ? UNP P0A7G6 ? ? linker 2991 41  
5 3CMT SER A 1015 ? UNP P0A7G6 ? ? linker 2992 42  
5 3CMT GLY A 1016 ? UNP P0A7G6 ? ? linker 2993 43  
5 3CMT SER A 1017 ? UNP P0A7G6 ? ? linker 2994 44  
5 3CMT SER A 1018 ? UNP P0A7G6 ? ? linker 2995 45  
5 3CMT THR A 1019 ? UNP P0A7G6 ? ? linker 2996 46  
5 3CMT GLY A 1020 ? UNP P0A7G6 ? ? linker 2997 47  
5 3CMT SER A 1021 ? UNP P0A7G6 ? ? linker 2998 48  
5 3CMT MET A 1022 ? UNP P0A7G6 ? ? linker 2999 49  
5 3CMT SER A 1023 ? UNP P0A7G6 ? ? linker 3000 50  
5 3CMT THR A 1358 ? UNP P0A7G6 ? ? linker 3986 51  
5 3CMT GLY A 1359 ? UNP P0A7G6 ? ? linker 3987 52  
5 3CMT SER A 1360 ? UNP P0A7G6 ? ? linker 3988 53  
5 3CMT THR A 1361 ? UNP P0A7G6 ? ? linker 3989 54  
5 3CMT GLY A 1362 ? UNP P0A7G6 ? ? linker 3990 55  
5 3CMT SER A 1363 ? UNP P0A7G6 ? ? linker 3991 56  
5 3CMT MET A 1364 ? UNP P0A7G6 ? ? linker 3992 57  
5 3CMT SER A 1365 ? UNP P0A7G6 ? ? linker 3993 58  
5 3CMT GLY A 1366 ? UNP P0A7G6 ? ? linker 3994 59  
5 3CMT ARG A 1367 ? UNP P0A7G6 ? ? linker 3995 60  
5 3CMT THR A 1368 ? UNP P0A7G6 ? ? linker 3996 61  
5 3CMT GLY A 1369 ? UNP P0A7G6 ? ? linker 3997 62  
5 3CMT SER A 1370 ? UNP P0A7G6 ? ? linker 3998 63  
5 3CMT MET A 1371 ? UNP P0A7G6 ? ? linker 3999 64  
5 3CMT SER A 1372 ? UNP P0A7G6 ? ? linker 4000 65  
6 3CMT GLY D 1    ? UNP P0A7G6 ? ? linker 26   66  
6 3CMT ALA D 2    ? UNP P0A7G6 ? ? linker 27   67  
6 3CMT MET D 3    ? UNP P0A7G6 ? ? linker 28   68  
6 3CMT HIS D 4    ? UNP P0A7G6 ? ? linker 29   69  
6 3CMT THR D 310  ? UNP P0A7G6 ? ? linker 986  70  
6 3CMT GLY D 311  ? UNP P0A7G6 ? ? linker 987  71  
6 3CMT SER D 312  ? UNP P0A7G6 ? ? linker 988  72  
6 3CMT THR D 313  ? UNP P0A7G6 ? ? linker 989  73  
6 3CMT GLY D 314  ? UNP P0A7G6 ? ? linker 990  74  
6 3CMT SER D 315  ? UNP P0A7G6 ? ? linker 991  75  
6 3CMT GLY D 316  ? UNP P0A7G6 ? ? linker 992  76  
6 3CMT THR D 317  ? UNP P0A7G6 ? ? linker 993  77  
6 3CMT THR D 318  ? UNP P0A7G6 ? ? linker 994  78  
6 3CMT GLY D 319  ? UNP P0A7G6 ? ? linker 995  79  
6 3CMT SER D 320  ? UNP P0A7G6 ? ? linker 996  80  
6 3CMT THR D 321  ? UNP P0A7G6 ? ? linker 997  81  
6 3CMT GLY D 322  ? UNP P0A7G6 ? ? linker 998  82  
6 3CMT SER D 323  ? UNP P0A7G6 ? ? linker 999  83  
6 3CMT MET D 324  ? UNP P0A7G6 ? ? linker 1000 84  
6 3CMT THR D 659  ? UNP P0A7G6 ? ? linker 1986 85  
6 3CMT GLY D 660  ? UNP P0A7G6 ? ? linker 1987 86  
6 3CMT SER D 661  ? UNP P0A7G6 ? ? linker 1988 87  
6 3CMT THR D 662  ? UNP P0A7G6 ? ? linker 1989 88  
6 3CMT GLY D 663  ? UNP P0A7G6 ? ? linker 1990 89  
6 3CMT SER D 664  ? UNP P0A7G6 ? ? linker 1991 90  
6 3CMT MET D 665  ? UNP P0A7G6 ? ? linker 1992 91  
6 3CMT GLY D 666  ? UNP P0A7G6 ? ? linker 1993 92  
6 3CMT HIS D 667  ? UNP P0A7G6 ? ? linker 1994 93  
6 3CMT THR D 668  ? UNP P0A7G6 ? ? linker 1995 94  
6 3CMT THR D 669  ? UNP P0A7G6 ? ? linker 1996 95  
6 3CMT GLY D 670  ? UNP P0A7G6 ? ? linker 1997 96  
6 3CMT SER D 671  ? UNP P0A7G6 ? ? linker 1998 97  
6 3CMT MET D 672  ? UNP P0A7G6 ? ? linker 1999 98  
6 3CMT SER D 673  ? UNP P0A7G6 ? ? linker 2000 99  
6 3CMT THR D 1008 ? UNP P0A7G6 ? ? linker 2985 100 
6 3CMT GLY D 1009 ? UNP P0A7G6 ? ? linker 2986 101 
6 3CMT SER D 1010 ? UNP P0A7G6 ? ? linker 2987 102 
6 3CMT THR D 1011 ? UNP P0A7G6 ? ? linker 2988 103 
6 3CMT GLY D 1012 ? UNP P0A7G6 ? ? linker 2989 104 
6 3CMT SER D 1013 ? UNP P0A7G6 ? ? linker 2990 105 
6 3CMT ALA D 1014 ? UNP P0A7G6 ? ? linker 2991 106 
6 3CMT SER D 1015 ? UNP P0A7G6 ? ? linker 2992 107 
6 3CMT GLY D 1016 ? UNP P0A7G6 ? ? linker 2993 108 
6 3CMT SER D 1017 ? UNP P0A7G6 ? ? linker 2994 109 
6 3CMT SER D 1018 ? UNP P0A7G6 ? ? linker 2995 110 
6 3CMT THR D 1019 ? UNP P0A7G6 ? ? linker 2996 111 
6 3CMT GLY D 1020 ? UNP P0A7G6 ? ? linker 2997 112 
6 3CMT SER D 1021 ? UNP P0A7G6 ? ? linker 2998 113 
6 3CMT MET D 1022 ? UNP P0A7G6 ? ? linker 2999 114 
6 3CMT SER D 1023 ? UNP P0A7G6 ? ? linker 3000 115 
6 3CMT THR D 1358 ? UNP P0A7G6 ? ? linker 3986 116 
6 3CMT GLY D 1359 ? UNP P0A7G6 ? ? linker 3987 117 
6 3CMT SER D 1360 ? UNP P0A7G6 ? ? linker 3988 118 
6 3CMT THR D 1361 ? UNP P0A7G6 ? ? linker 3989 119 
6 3CMT GLY D 1362 ? UNP P0A7G6 ? ? linker 3990 120 
6 3CMT SER D 1363 ? UNP P0A7G6 ? ? linker 3991 121 
6 3CMT MET D 1364 ? UNP P0A7G6 ? ? linker 3992 122 
6 3CMT SER D 1365 ? UNP P0A7G6 ? ? linker 3993 123 
6 3CMT GLY D 1366 ? UNP P0A7G6 ? ? linker 3994 124 
6 3CMT ARG D 1367 ? UNP P0A7G6 ? ? linker 3995 125 
6 3CMT THR D 1368 ? UNP P0A7G6 ? ? linker 3996 126 
6 3CMT GLY D 1369 ? UNP P0A7G6 ? ? linker 3997 127 
6 3CMT SER D 1370 ? UNP P0A7G6 ? ? linker 3998 128 
6 3CMT MET D 1371 ? UNP P0A7G6 ? ? linker 3999 129 
6 3CMT SER D 1372 ? UNP P0A7G6 ? ? linker 4000 130 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ADP non-polymer         n "ADENOSINE-5'-DIPHOSPHATE"           ? 'C10 H15 N5 O10 P2' 427.201 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'        89.093  
ALF non-polymer         . 'TETRAFLUOROALUMINATE ION'           ? 'Al F4 -1'          102.975 
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          3CMT 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.54 
_exptl_crystal.density_percent_sol   51.51 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;the RecA5 fusion protein was incubated with a 1.5-fold molar excess of the primary d(T5C3AC2T4) oligonucleotide in protein buffer supplemented with 2 mM ADP, 10 mM MgCl2 and 8 mM AlF4, pH 6.0, for 30 min, followed by the addition of 2-fold molar excess of the complementary d(G2TG3) oligonucleotide. The crystals grew from 50 mM Tris-Cl, 9% (w/v) PVP K15, 32% (v/v) MPD, 100 mM magnesium acetate, 10 mM DTT, pH 8.0.
;
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1  1 ADP                 ? ? ? 
1 2  1 MgCl2               ? ? ? 
1 3  1 AlF4                ? ? ? 
1 4  1 Tris-Cl             ? ? ? 
1 5  1 'PVP K15'           ? ? ? 
1 6  1 MPD                 ? ? ? 
1 7  1 'magnesium acetate' ? ? ? 
1 8  1 '10 mM DTT'         ? ? ? 
1 9  2 Tris-Cl             ? ? ? 
1 10 2 'PVP K15'           ? ? ? 
1 11 2 MPD                 ? ? ? 
1 12 2 'magnesium acetate' ? ? ? 
1 13 2 '10 mM DTT'         ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               ? 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   2007-07-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 24-ID-C' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-C 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     3CMT 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             40.000 
_reflns.d_resolution_high            3.150 
_reflns.number_obs                   59390 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 3CMT 
_refine.ls_number_reflns_obs                     59390 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             40.00 
_refine.ls_d_res_high                            3.15 
_refine.ls_percent_reflns_obs                    89.9 
_refine.ls_R_factor_obs                          0.218 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.217 
_refine.ls_R_factor_R_free                       0.243 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.000 
_refine.ls_number_reflns_R_free                  1231 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.920 
_refine.correlation_coeff_Fo_to_Fc_free          0.902 
_refine.B_iso_mean                               50.72 
_refine.aniso_B[1][1]                            1.53000 
_refine.aniso_B[2][2]                            -0.63000 
_refine.aniso_B[3][3]                            -0.91000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.521 
_refine.overall_SU_ML                            0.373 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             45.573 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        24250 
_refine_hist.pdbx_number_atoms_nucleic_acid   732 
_refine_hist.pdbx_number_atoms_ligand         330 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               25312 
_refine_hist.d_res_high                       3.15 
_refine_hist.d_res_low                        40.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.008  0.022  ? 25702 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.170  2.034  ? 34754 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.156  5.000  ? 3204  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       36.392 25.399 ? 991   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       19.073 15.000 ? 4615  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       15.721 15.000 ? 136   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.073  0.200  ? 3987  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.003  0.020  ? 18422 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.201  0.200  ? 11326 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.307  0.200  ? 17338 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.125  0.200  ? 851   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          0.056  0.200  ? 1     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.421  0.200  ? 96    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.559  0.200  ? 1     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.845  1.250  ? 16183 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.498  2.000  ? 25245 'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.643  2.000  ? 10759 'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.706  3.000  ? 9509  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       3.15 
_refine_ls_shell.d_res_low                        3.23 
_refine_ls_shell.number_reflns_R_work             4009 
_refine_ls_shell.R_factor_R_work                  0.3400 
_refine_ls_shell.percent_reflns_obs               83.35 
_refine_ls_shell.R_factor_R_free                  0.4040 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             77 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3CMT 
_struct.title                     'Mechanism of homologous recombination from the RecA-ssDNA/dsDNA structures' 
_struct.pdbx_descriptor           'PROTEIN recA/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3CMT 
_struct_keywords.pdbx_keywords   recombination/DNA 
_struct_keywords.text            
;homologous recombination, ATP-binding, Cytoplasm, DNA damage, DNA recombination, DNA repair, DNA-binding, Nucleotide-binding, SOS response, Stress response, recombination-DNA COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 1 ? 
D  N N 2 ? 
E  N N 3 ? 
F  N N 3 ? 
G  N N 4 ? 
H  N N 5 ? 
I  N N 4 ? 
J  N N 5 ? 
K  N N 4 ? 
L  N N 5 ? 
M  N N 4 ? 
N  N N 5 ? 
O  N N 4 ? 
P  N N 5 ? 
Q  N N 6 ? 
R  N N 6 ? 
S  N N 6 ? 
T  N N 6 ? 
U  N N 6 ? 
V  N N 4 ? 
W  N N 5 ? 
X  N N 4 ? 
Y  N N 5 ? 
Z  N N 4 ? 
AA N N 5 ? 
BA N N 4 ? 
CA N N 5 ? 
DA N N 4 ? 
EA N N 5 ? 
FA N N 6 ? 
GA N N 6 ? 
HA N N 6 ? 
IA N N 6 ? 
JA N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   SER E 19   ? LEU E 26   ? SER A 44   LEU A 51   1 ? 8  
HELX_P HELX_P2   2   GLY E 46   ? ARG E 60   ? GLY A 71   ARG A 85   1 ? 15 
HELX_P HELX_P3   3   ASP E 75   ? LEU E 82   ? ASP A 100  LEU A 107  1 ? 8  
HELX_P HELX_P4   4   THR E 96   ? GLY E 111  ? THR A 121  GLY A 136  1 ? 16 
HELX_P HELX_P5   5   PRO E 126  ? GLY E 132  ? PRO A 151  GLY A 157  1 ? 7  
HELX_P HELX_P6   6   GLY E 140  ? ASN E 161  ? GLY A 165  ASN A 186  1 ? 22 
HELX_P HELX_P7   7   ASN E 188  ? TYR E 193  ? ASN A 213  TYR A 218  1 ? 6  
HELX_P HELX_P8   8   ASN E 244  ? GLU E 256  ? ASN A 269  GLU A 281  1 ? 13 
HELX_P HELX_P9   9   GLY E 276  ? ASN E 287  ? GLY A 301  ASN A 312  1 ? 12 
HELX_P HELX_P10  10  ASN E 287  ? LEU E 303  ? ASN A 312  LEU A 328  1 ? 17 
HELX_P HELX_P11  11  ILE E 326  ? GLY E 346  ? ILE A 1002 GLY A 1022 1 ? 21 
HELX_P HELX_P12  12  GLY E 354  ? ASP E 360  ? GLY A 1030 ASP A 1036 5 ? 7  
HELX_P HELX_P13  13  SER E 368  ? LEU E 375  ? SER A 1044 LEU A 1051 1 ? 8  
HELX_P HELX_P14  14  GLY E 395  ? ARG E 409  ? GLY A 1071 ARG A 1085 1 ? 15 
HELX_P HELX_P15  15  ASP E 424  ? LEU E 431  ? ASP A 1100 LEU A 1107 1 ? 8  
HELX_P HELX_P16  16  THR E 445  ? GLY E 460  ? THR A 1121 GLY A 1136 1 ? 16 
HELX_P HELX_P17  17  PRO E 475  ? GLY E 481  ? PRO A 1151 GLY A 1157 1 ? 7  
HELX_P HELX_P18  18  GLY E 489  ? ASN E 510  ? GLY A 1165 ASN A 1186 1 ? 22 
HELX_P HELX_P19  19  ASN E 537  ? TYR E 542  ? ASN A 1213 TYR A 1218 1 ? 6  
HELX_P HELX_P20  20  ASN E 593  ? GLU E 605  ? ASN A 1269 GLU A 1281 1 ? 13 
HELX_P HELX_P21  21  GLY E 625  ? ASN E 636  ? GLY A 1301 ASN A 1312 1 ? 12 
HELX_P HELX_P22  22  ASN E 636  ? LEU E 652  ? ASN A 1312 LEU A 1328 1 ? 17 
HELX_P HELX_P23  23  ILE E 675  ? GLY E 695  ? ILE A 2002 GLY A 2022 1 ? 21 
HELX_P HELX_P24  24  GLY E 703  ? ASP E 709  ? GLY A 2030 ASP A 2036 5 ? 7  
HELX_P HELX_P25  25  SER E 717  ? LEU E 724  ? SER A 2044 LEU A 2051 1 ? 8  
HELX_P HELX_P26  26  GLY E 744  ? ARG E 758  ? GLY A 2071 ARG A 2085 1 ? 15 
HELX_P HELX_P27  27  ASP E 773  ? LEU E 780  ? ASP A 2100 LEU A 2107 1 ? 8  
HELX_P HELX_P28  28  ASP E 783  ? ASN E 786  ? ASP A 2110 ASN A 2113 5 ? 4  
HELX_P HELX_P29  29  THR E 794  ? GLY E 809  ? THR A 2121 GLY A 2136 1 ? 16 
HELX_P HELX_P30  30  PRO E 824  ? GLY E 830  ? PRO A 2151 GLY A 2157 1 ? 7  
HELX_P HELX_P31  31  GLY E 838  ? ASN E 859  ? GLY A 2165 ASN A 2186 1 ? 22 
HELX_P HELX_P32  32  ASN E 886  ? TYR E 891  ? ASN A 2213 TYR A 2218 1 ? 6  
HELX_P HELX_P33  33  ASN E 942  ? GLU E 954  ? ASN A 2269 GLU A 2281 1 ? 13 
HELX_P HELX_P34  34  GLY E 974  ? ASN E 985  ? GLY A 2301 ASN A 2312 1 ? 12 
HELX_P HELX_P35  35  ASN E 985  ? LEU E 1001 ? ASN A 2312 LEU A 2328 1 ? 17 
HELX_P HELX_P36  36  ILE E 1025 ? GLY E 1045 ? ILE A 3002 GLY A 3022 1 ? 21 
HELX_P HELX_P37  37  GLY E 1053 ? ASP E 1059 ? GLY A 3030 ASP A 3036 5 ? 7  
HELX_P HELX_P38  38  SER E 1067 ? LEU E 1074 ? SER A 3044 LEU A 3051 1 ? 8  
HELX_P HELX_P39  39  GLY E 1094 ? ARG E 1108 ? GLY A 3071 ARG A 3085 1 ? 15 
HELX_P HELX_P40  40  ASP E 1123 ? LEU E 1130 ? ASP A 3100 LEU A 3107 1 ? 8  
HELX_P HELX_P41  41  ASP E 1133 ? ASN E 1136 ? ASP A 3110 ASN A 3113 5 ? 4  
HELX_P HELX_P42  42  THR E 1144 ? GLY E 1159 ? THR A 3121 GLY A 3136 1 ? 16 
HELX_P HELX_P43  43  PRO E 1174 ? GLY E 1180 ? PRO A 3151 GLY A 3157 1 ? 7  
HELX_P HELX_P44  44  GLY E 1188 ? ASN E 1209 ? GLY A 3165 ASN A 3186 1 ? 22 
HELX_P HELX_P45  45  ASN E 1236 ? TYR E 1241 ? ASN A 3213 TYR A 3218 1 ? 6  
HELX_P HELX_P46  46  ASN E 1292 ? GLU E 1304 ? ASN A 3269 GLU A 3281 1 ? 13 
HELX_P HELX_P47  47  GLY E 1324 ? ASN E 1335 ? GLY A 3301 ASN A 3312 1 ? 12 
HELX_P HELX_P48  48  ASN E 1335 ? LEU E 1351 ? ASN A 3312 LEU A 3328 1 ? 17 
HELX_P HELX_P49  49  ILE E 1374 ? GLY E 1394 ? ILE A 4002 GLY A 4022 1 ? 21 
HELX_P HELX_P50  50  GLY E 1402 ? ASP E 1408 ? GLY A 4030 ASP A 4036 5 ? 7  
HELX_P HELX_P51  51  SER E 1416 ? LEU E 1423 ? SER A 4044 LEU A 4051 1 ? 8  
HELX_P HELX_P52  52  GLY E 1443 ? ARG E 1457 ? GLY A 4071 ARG A 4085 1 ? 15 
HELX_P HELX_P53  53  ASP E 1472 ? LEU E 1479 ? ASP A 4100 LEU A 4107 1 ? 8  
HELX_P HELX_P54  54  ASP E 1482 ? LEU E 1486 ? ASP A 4110 LEU A 4114 5 ? 5  
HELX_P HELX_P55  55  THR E 1493 ? GLY E 1508 ? THR A 4121 GLY A 4136 1 ? 16 
HELX_P HELX_P56  56  GLY E 1537 ? ASN E 1558 ? GLY A 4165 ASN A 4186 1 ? 22 
HELX_P HELX_P57  57  ASN E 1585 ? TYR E 1590 ? ASN A 4213 TYR A 4218 1 ? 6  
HELX_P HELX_P58  58  ASN E 1641 ? GLU E 1653 ? ASN A 4269 GLU A 4281 1 ? 13 
HELX_P HELX_P59  59  GLY E 1673 ? ASN E 1684 ? GLY A 4301 ASN A 4312 1 ? 12 
HELX_P HELX_P60  60  ASN E 1684 ? LEU E 1700 ? ASN A 4312 LEU A 4328 1 ? 17 
HELX_P HELX_P61  61  SER F 19   ? LEU F 26   ? SER D 44   LEU D 51   1 ? 8  
HELX_P HELX_P62  62  GLY F 46   ? ARG F 60   ? GLY D 71   ARG D 85   1 ? 15 
HELX_P HELX_P63  63  ASP F 75   ? LEU F 82   ? ASP D 100  LEU D 107  1 ? 8  
HELX_P HELX_P64  64  THR F 96   ? GLY F 111  ? THR D 121  GLY D 136  1 ? 16 
HELX_P HELX_P65  65  PRO F 126  ? GLY F 132  ? PRO D 151  GLY D 157  1 ? 7  
HELX_P HELX_P66  66  GLY F 140  ? ASN F 161  ? GLY D 165  ASN D 186  1 ? 22 
HELX_P HELX_P67  67  ASN F 188  ? TYR F 193  ? ASN D 213  TYR D 218  1 ? 6  
HELX_P HELX_P68  68  ASN F 244  ? GLU F 256  ? ASN D 269  GLU D 281  1 ? 13 
HELX_P HELX_P69  69  GLY F 276  ? ASN F 287  ? GLY D 301  ASN D 312  1 ? 12 
HELX_P HELX_P70  70  ASN F 287  ? LEU F 303  ? ASN D 312  LEU D 328  1 ? 17 
HELX_P HELX_P71  71  ILE F 326  ? GLY F 346  ? ILE D 1002 GLY D 1022 1 ? 21 
HELX_P HELX_P72  72  GLY F 354  ? ASP F 360  ? GLY D 1030 ASP D 1036 5 ? 7  
HELX_P HELX_P73  73  SER F 368  ? LEU F 375  ? SER D 1044 LEU D 1051 1 ? 8  
HELX_P HELX_P74  74  GLY F 395  ? ARG F 409  ? GLY D 1071 ARG D 1085 1 ? 15 
HELX_P HELX_P75  75  ASP F 424  ? LEU F 431  ? ASP D 1100 LEU D 1107 1 ? 8  
HELX_P HELX_P76  76  THR F 445  ? GLY F 460  ? THR D 1121 GLY D 1136 1 ? 16 
HELX_P HELX_P77  77  PRO F 475  ? GLY F 481  ? PRO D 1151 GLY D 1157 1 ? 7  
HELX_P HELX_P78  78  GLY F 489  ? ASN F 510  ? GLY D 1165 ASN D 1186 1 ? 22 
HELX_P HELX_P79  79  ASN F 537  ? TYR F 542  ? ASN D 1213 TYR D 1218 1 ? 6  
HELX_P HELX_P80  80  ASN F 593  ? GLU F 605  ? ASN D 1269 GLU D 1281 1 ? 13 
HELX_P HELX_P81  81  GLY F 625  ? ASN F 636  ? GLY D 1301 ASN D 1312 1 ? 12 
HELX_P HELX_P82  82  ASN F 636  ? LEU F 652  ? ASN D 1312 LEU D 1328 1 ? 17 
HELX_P HELX_P83  83  ILE F 675  ? GLY F 695  ? ILE D 2002 GLY D 2022 1 ? 21 
HELX_P HELX_P84  84  GLY F 703  ? ASP F 709  ? GLY D 2030 ASP D 2036 5 ? 7  
HELX_P HELX_P85  85  SER F 717  ? LEU F 724  ? SER D 2044 LEU D 2051 1 ? 8  
HELX_P HELX_P86  86  GLY F 744  ? ARG F 758  ? GLY D 2071 ARG D 2085 1 ? 15 
HELX_P HELX_P87  87  ASP F 773  ? LEU F 780  ? ASP D 2100 LEU D 2107 1 ? 8  
HELX_P HELX_P88  88  THR F 794  ? GLY F 809  ? THR D 2121 GLY D 2136 1 ? 16 
HELX_P HELX_P89  89  PRO F 824  ? GLY F 830  ? PRO D 2151 GLY D 2157 1 ? 7  
HELX_P HELX_P90  90  GLY F 838  ? ASN F 859  ? GLY D 2165 ASN D 2186 1 ? 22 
HELX_P HELX_P91  91  ASN F 886  ? TYR F 891  ? ASN D 2213 TYR D 2218 1 ? 6  
HELX_P HELX_P92  92  ASN F 942  ? GLU F 954  ? ASN D 2269 GLU D 2281 1 ? 13 
HELX_P HELX_P93  93  GLY F 974  ? ASN F 985  ? GLY D 2301 ASN D 2312 1 ? 12 
HELX_P HELX_P94  94  ASN F 985  ? LEU F 1001 ? ASN D 2312 LEU D 2328 1 ? 17 
HELX_P HELX_P95  95  ILE F 1025 ? GLY F 1045 ? ILE D 3002 GLY D 3022 1 ? 21 
HELX_P HELX_P96  96  GLY F 1053 ? ASP F 1059 ? GLY D 3030 ASP D 3036 5 ? 7  
HELX_P HELX_P97  97  SER F 1067 ? LEU F 1074 ? SER D 3044 LEU D 3051 1 ? 8  
HELX_P HELX_P98  98  GLY F 1094 ? ARG F 1108 ? GLY D 3071 ARG D 3085 1 ? 15 
HELX_P HELX_P99  99  ASP F 1123 ? LEU F 1130 ? ASP D 3100 LEU D 3107 1 ? 8  
HELX_P HELX_P100 100 THR F 1144 ? GLY F 1159 ? THR D 3121 GLY D 3136 1 ? 16 
HELX_P HELX_P101 101 PRO F 1174 ? GLY F 1180 ? PRO D 3151 GLY D 3157 1 ? 7  
HELX_P HELX_P102 102 GLY F 1188 ? ASN F 1209 ? GLY D 3165 ASN D 3186 1 ? 22 
HELX_P HELX_P103 103 ASN F 1236 ? TYR F 1241 ? ASN D 3213 TYR D 3218 1 ? 6  
HELX_P HELX_P104 104 ASN F 1292 ? GLU F 1304 ? ASN D 3269 GLU D 3281 1 ? 13 
HELX_P HELX_P105 105 GLY F 1324 ? ASN F 1335 ? GLY D 3301 ASN D 3312 1 ? 12 
HELX_P HELX_P106 106 ASN F 1335 ? LEU F 1351 ? ASN D 3312 LEU D 3328 1 ? 17 
HELX_P HELX_P107 107 ILE F 1374 ? GLY F 1394 ? ILE D 4002 GLY D 4022 1 ? 21 
HELX_P HELX_P108 108 GLY F 1402 ? ASP F 1408 ? GLY D 4030 ASP D 4036 5 ? 7  
HELX_P HELX_P109 109 SER F 1416 ? LEU F 1423 ? SER D 4044 LEU D 4051 1 ? 8  
HELX_P HELX_P110 110 GLY F 1443 ? ARG F 1457 ? GLY D 4071 ARG D 4085 1 ? 15 
HELX_P HELX_P111 111 ASP F 1472 ? LEU F 1479 ? ASP D 4100 LEU D 4107 1 ? 8  
HELX_P HELX_P112 112 ASP F 1482 ? LEU F 1486 ? ASP D 4110 LEU D 4114 5 ? 5  
HELX_P HELX_P113 113 THR F 1493 ? GLY F 1508 ? THR D 4121 GLY D 4136 1 ? 16 
HELX_P HELX_P114 114 GLY F 1537 ? ASN F 1558 ? GLY D 4165 ASN D 4186 1 ? 22 
HELX_P HELX_P115 115 ASN F 1585 ? TYR F 1590 ? ASN D 4213 TYR D 4218 1 ? 6  
HELX_P HELX_P116 116 ASN F 1641 ? GLU F 1653 ? ASN D 4269 GLU D 4281 1 ? 13 
HELX_P HELX_P117 117 GLY F 1673 ? ASN F 1684 ? GLY D 4301 ASN D 4312 1 ? 12 
HELX_P HELX_P118 118 ASN F 1684 ? LEU F 1700 ? ASN D 4312 LEU D 4328 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? E  THR 48   OG1 ? ? ? 1_555 G  MG  . MG  ? ? A THR 73   A MG  500  1_555 ? ? ? ? ? ? ?            2.145 ? 
metalc2  metalc ? ? E  THR 397  OG1 ? ? ? 1_555 I  MG  . MG  ? ? A THR 1073 A MG  1500 1_555 ? ? ? ? ? ? ?            2.149 ? 
metalc3  metalc ? ? E  THR 746  OG1 ? ? ? 1_555 K  MG  . MG  ? ? A THR 2073 A MG  2500 1_555 ? ? ? ? ? ? ?            2.125 ? 
metalc4  metalc ? ? E  THR 1096 OG1 ? ? ? 1_555 M  MG  . MG  ? ? A THR 3073 A MG  3500 1_555 ? ? ? ? ? ? ?            2.123 ? 
metalc5  metalc ? ? E  THR 1445 OG1 ? ? ? 1_555 O  MG  . MG  ? ? A THR 4073 A MG  4500 1_555 ? ? ? ? ? ? ?            2.193 ? 
metalc6  metalc ? ? F  THR 48   OG1 ? ? ? 1_555 V  MG  . MG  ? ? D THR 73   D MG  500  1_555 ? ? ? ? ? ? ?            2.123 ? 
metalc7  metalc ? ? F  THR 397  OG1 ? ? ? 1_555 X  MG  . MG  ? ? D THR 1073 D MG  1500 1_555 ? ? ? ? ? ? ?            2.141 ? 
metalc8  metalc ? ? F  THR 746  OG1 ? ? ? 1_555 Z  MG  . MG  ? ? D THR 2073 D MG  2500 1_555 ? ? ? ? ? ? ?            2.121 ? 
metalc9  metalc ? ? F  THR 1096 OG1 ? ? ? 1_555 BA MG  . MG  ? ? D THR 3073 D MG  3500 1_555 ? ? ? ? ? ? ?            2.110 ? 
metalc10 metalc ? ? F  THR 1445 OG1 ? ? ? 1_555 DA MG  . MG  ? ? D THR 4073 D MG  4500 1_555 ? ? ? ? ? ? ?            2.187 ? 
metalc11 metalc ? ? G  MG  .    MG  ? ? ? 1_555 Q  ADP . O1B ? ? A MG  500  A ADP 502  1_555 ? ? ? ? ? ? ?            2.190 ? 
metalc12 metalc ? ? I  MG  .    MG  ? ? ? 1_555 R  ADP . O1B ? ? A MG  1500 A ADP 1502 1_555 ? ? ? ? ? ? ?            2.176 ? 
metalc13 metalc ? ? K  MG  .    MG  ? ? ? 1_555 S  ADP . O1B ? ? A MG  2500 A ADP 2502 1_555 ? ? ? ? ? ? ?            2.176 ? 
metalc14 metalc ? ? M  MG  .    MG  ? ? ? 1_555 T  ADP . O1B ? ? A MG  3500 A ADP 3502 1_555 ? ? ? ? ? ? ?            2.179 ? 
metalc15 metalc ? ? O  MG  .    MG  ? ? ? 1_555 U  ADP . O1B ? ? A MG  4500 A ADP 4502 1_555 ? ? ? ? ? ? ?            2.058 ? 
metalc16 metalc ? ? V  MG  .    MG  ? ? ? 1_555 FA ADP . O1B ? ? D MG  500  D ADP 502  1_555 ? ? ? ? ? ? ?            2.218 ? 
metalc17 metalc ? ? X  MG  .    MG  ? ? ? 1_555 GA ADP . O1B ? ? D MG  1500 D ADP 1502 1_555 ? ? ? ? ? ? ?            2.221 ? 
metalc18 metalc ? ? Z  MG  .    MG  ? ? ? 1_555 HA ADP . O1B ? ? D MG  2500 D ADP 2502 1_555 ? ? ? ? ? ? ?            2.209 ? 
metalc19 metalc ? ? BA MG  .    MG  ? ? ? 1_555 IA ADP . O1B ? ? D MG  3500 D ADP 3502 1_555 ? ? ? ? ? ? ?            2.179 ? 
metalc20 metalc ? ? DA MG  .    MG  ? ? ? 1_555 JA ADP . O1B ? ? D MG  4500 D ADP 4502 1_555 ? ? ? ? ? ? ?            2.172 ? 
hydrog1  hydrog ? ? A  DC  6    N4  ? ? ? 1_555 B  DG  5 O6  ? ? B DC  1004 C DG  2011 1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog2  hydrog ? ? A  DC  6    N3  ? ? ? 1_555 B  DG  6 N1  ? ? B DC  1004 C DG  2012 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A  DC  6    N4  ? ? ? 1_555 B  DG  6 O6  ? ? B DC  1004 C DG  2012 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A  DC  6    O2  ? ? ? 1_555 B  DG  6 N2  ? ? B DC  1004 C DG  2012 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A  DC  7    N3  ? ? ? 1_555 B  DG  5 N1  ? ? B DC  1005 C DG  2011 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A  DC  7    N4  ? ? ? 1_555 B  DG  5 O6  ? ? B DC  1005 C DG  2011 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A  DC  7    O2  ? ? ? 1_555 B  DG  5 N2  ? ? B DC  1005 C DG  2011 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A  DC  8    N3  ? ? ? 1_555 B  DG  4 N1  ? ? B DC  1006 C DG  2010 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A  DC  8    N4  ? ? ? 1_555 B  DG  4 O6  ? ? B DC  1006 C DG  2010 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A  DC  8    O2  ? ? ? 1_555 B  DG  4 N2  ? ? B DC  1006 C DG  2010 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A  DA  9    N1  ? ? ? 1_555 B  DT  3 N3  ? ? B DA  1007 C DT  2009 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A  DA  9    N6  ? ? ? 1_555 B  DT  3 O4  ? ? B DA  1007 C DT  2009 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A  DC  10   N3  ? ? ? 1_555 B  DG  2 N1  ? ? B DC  1008 C DG  2008 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A  DC  10   N4  ? ? ? 1_555 B  DG  2 O6  ? ? B DC  1008 C DG  2008 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A  DC  10   O2  ? ? ? 1_555 B  DG  2 N2  ? ? B DC  1008 C DG  2008 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A  DC  11   N3  ? ? ? 1_555 B  DG  1 N1  ? ? B DC  1009 C DG  2007 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A  DC  11   N4  ? ? ? 1_555 B  DG  1 O6  ? ? B DC  1009 C DG  2007 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A  DC  11   O2  ? ? ? 1_555 B  DG  1 N2  ? ? B DC  1009 C DG  2007 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? C  DC  6    N4  ? ? ? 1_555 D  DG  5 O6  ? ? E DC  1004 F DG  2011 1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog20 hydrog ? ? C  DC  6    N3  ? ? ? 1_555 D  DG  6 N1  ? ? E DC  1004 F DG  2012 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? C  DC  6    N4  ? ? ? 1_555 D  DG  6 O6  ? ? E DC  1004 F DG  2012 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? C  DC  6    O2  ? ? ? 1_555 D  DG  6 N2  ? ? E DC  1004 F DG  2012 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? C  DC  7    N3  ? ? ? 1_555 D  DG  5 N1  ? ? E DC  1005 F DG  2011 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? C  DC  7    N4  ? ? ? 1_555 D  DG  5 O6  ? ? E DC  1005 F DG  2011 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? C  DC  7    O2  ? ? ? 1_555 D  DG  5 N2  ? ? E DC  1005 F DG  2011 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? C  DC  8    N3  ? ? ? 1_555 D  DG  4 N1  ? ? E DC  1006 F DG  2010 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? C  DC  8    N4  ? ? ? 1_555 D  DG  4 O6  ? ? E DC  1006 F DG  2010 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? C  DC  8    O2  ? ? ? 1_555 D  DG  4 N2  ? ? E DC  1006 F DG  2010 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? C  DA  9    N1  ? ? ? 1_555 D  DT  3 N3  ? ? E DA  1007 F DT  2009 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? C  DA  9    N6  ? ? ? 1_555 D  DT  3 O4  ? ? E DA  1007 F DT  2009 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? C  DC  10   N3  ? ? ? 1_555 D  DG  2 N1  ? ? E DC  1008 F DG  2008 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? C  DC  10   N4  ? ? ? 1_555 D  DG  2 O6  ? ? E DC  1008 F DG  2008 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? C  DC  10   O2  ? ? ? 1_555 D  DG  2 N2  ? ? E DC  1008 F DG  2008 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? C  DC  11   N3  ? ? ? 1_555 D  DG  1 N1  ? ? E DC  1009 F DG  2007 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? C  DC  11   N4  ? ? ? 1_555 D  DG  1 O6  ? ? E DC  1009 F DG  2007 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? C  DC  11   O2  ? ? ? 1_555 D  DG  1 N2  ? ? E DC  1009 F DG  2007 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 2  ? 
B  ? 10 ? 
C  ? 2  ? 
D  ? 3  ? 
E  ? 2  ? 
F  ? 10 ? 
G  ? 2  ? 
H  ? 3  ? 
I  ? 2  ? 
J  ? 10 ? 
K  ? 2  ? 
L  ? 3  ? 
M  ? 2  ? 
N  ? 10 ? 
O  ? 2  ? 
P  ? 3  ? 
Q  ? 2  ? 
R  ? 9  ? 
S  ? 2  ? 
T  ? 3  ? 
U  ? 2  ? 
V  ? 10 ? 
W  ? 2  ? 
X  ? 3  ? 
Y  ? 2  ? 
Z  ? 10 ? 
AA ? 2  ? 
AB ? 3  ? 
AC ? 2  ? 
AD ? 10 ? 
AE ? 2  ? 
AF ? 3  ? 
AG ? 2  ? 
AH ? 10 ? 
AI ? 2  ? 
AJ ? 3  ? 
AK ? 2  ? 
AL ? 9  ? 
AM ? 2  ? 
AN ? 3  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2  ? anti-parallel 
B  1 2  ? anti-parallel 
B  2 3  ? anti-parallel 
B  3 4  ? anti-parallel 
B  4 5  ? parallel      
B  5 6  ? parallel      
B  6 7  ? parallel      
B  7 8  ? parallel      
B  8 9  ? parallel      
B  9 10 ? anti-parallel 
C  1 2  ? anti-parallel 
D  1 2  ? anti-parallel 
D  2 3  ? anti-parallel 
E  1 2  ? anti-parallel 
F  1 2  ? anti-parallel 
F  2 3  ? anti-parallel 
F  3 4  ? anti-parallel 
F  4 5  ? parallel      
F  5 6  ? parallel      
F  6 7  ? parallel      
F  7 8  ? parallel      
F  8 9  ? parallel      
F  9 10 ? anti-parallel 
G  1 2  ? anti-parallel 
H  1 2  ? anti-parallel 
H  2 3  ? anti-parallel 
I  1 2  ? anti-parallel 
J  1 2  ? anti-parallel 
J  2 3  ? anti-parallel 
J  3 4  ? anti-parallel 
J  4 5  ? parallel      
J  5 6  ? parallel      
J  6 7  ? parallel      
J  7 8  ? parallel      
J  8 9  ? parallel      
J  9 10 ? anti-parallel 
K  1 2  ? anti-parallel 
L  1 2  ? anti-parallel 
L  2 3  ? anti-parallel 
M  1 2  ? anti-parallel 
N  1 2  ? anti-parallel 
N  2 3  ? anti-parallel 
N  3 4  ? anti-parallel 
N  4 5  ? parallel      
N  5 6  ? parallel      
N  6 7  ? parallel      
N  7 8  ? parallel      
N  8 9  ? parallel      
N  9 10 ? anti-parallel 
O  1 2  ? anti-parallel 
P  1 2  ? anti-parallel 
P  2 3  ? anti-parallel 
Q  1 2  ? anti-parallel 
R  1 2  ? parallel      
R  2 3  ? parallel      
R  3 4  ? parallel      
R  4 5  ? parallel      
R  5 6  ? parallel      
R  6 7  ? anti-parallel 
R  7 8  ? anti-parallel 
R  8 9  ? anti-parallel 
S  1 2  ? anti-parallel 
T  1 2  ? anti-parallel 
T  2 3  ? anti-parallel 
U  1 2  ? anti-parallel 
V  1 2  ? anti-parallel 
V  2 3  ? anti-parallel 
V  3 4  ? anti-parallel 
V  4 5  ? parallel      
V  5 6  ? parallel      
V  6 7  ? parallel      
V  7 8  ? parallel      
V  8 9  ? parallel      
V  9 10 ? anti-parallel 
W  1 2  ? anti-parallel 
X  1 2  ? anti-parallel 
X  2 3  ? anti-parallel 
Y  1 2  ? anti-parallel 
Z  1 2  ? anti-parallel 
Z  2 3  ? anti-parallel 
Z  3 4  ? anti-parallel 
Z  4 5  ? parallel      
Z  5 6  ? parallel      
Z  6 7  ? parallel      
Z  7 8  ? parallel      
Z  8 9  ? parallel      
Z  9 10 ? anti-parallel 
AA 1 2  ? anti-parallel 
AB 1 2  ? anti-parallel 
AB 2 3  ? anti-parallel 
AC 1 2  ? anti-parallel 
AD 1 2  ? anti-parallel 
AD 2 3  ? anti-parallel 
AD 3 4  ? anti-parallel 
AD 4 5  ? parallel      
AD 5 6  ? parallel      
AD 6 7  ? parallel      
AD 7 8  ? parallel      
AD 8 9  ? parallel      
AD 9 10 ? anti-parallel 
AE 1 2  ? anti-parallel 
AF 1 2  ? anti-parallel 
AF 2 3  ? anti-parallel 
AG 1 2  ? anti-parallel 
AH 1 2  ? anti-parallel 
AH 2 3  ? anti-parallel 
AH 3 4  ? anti-parallel 
AH 4 5  ? parallel      
AH 5 6  ? parallel      
AH 6 7  ? parallel      
AH 7 8  ? parallel      
AH 8 9  ? parallel      
AH 9 10 ? anti-parallel 
AI 1 2  ? anti-parallel 
AJ 1 2  ? anti-parallel 
AJ 2 3  ? anti-parallel 
AK 1 2  ? anti-parallel 
AL 1 2  ? parallel      
AL 2 3  ? parallel      
AL 3 4  ? parallel      
AL 4 5  ? parallel      
AL 5 6  ? parallel      
AL 6 7  ? anti-parallel 
AL 7 8  ? anti-parallel 
AL 8 9  ? anti-parallel 
AM 1 2  ? anti-parallel 
AN 1 2  ? anti-parallel 
AN 2 3  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1  THR E 14   ? ILE E 15   ? THR A 39   ILE A 40   
A  2  LEU E 31   ? PRO E 32   ? LEU A 56   PRO A 57   
B  1  GLY E 242  ? ILE E 243  ? GLY A 267  ILE A 268  
B  2  GLN E 232  ? LEU E 238  ? GLN A 257  LEU A 263  
B  3  ASN E 211  ? ASN E 224  ? ASN A 236  ASN A 249  
B  4  ALA E 194  ? GLU E 208  ? ALA A 219  GLU A 233  
B  5  ILE E 36   ? TYR E 40   ? ILE A 61   TYR A 65   
B  6  LEU E 163  ? ASN E 168  ? LEU A 188  ASN A 193  
B  7  VAL E 115  ? VAL E 118  ? VAL A 140  VAL A 143  
B  8  CYS E 65   ? ILE E 68   ? CYS A 90   ILE A 93   
B  9  LEU E 90   ? SER E 92   ? LEU A 115  SER A 117  
B  10 MET E 351  ? ARG E 352  ? MET A 1027 ARG A 1028 
C  1  ILE E 170  ? MET E 172  ? ILE A 195  MET A 197  
C  2  GLU E 182  ? THR E 184  ? GLU A 207  THR A 209  
D  1  GLU E 260  ? ALA E 262  ? GLU A 285  ALA A 287  
D  2  TRP E 265  ? TYR E 268  ? TRP A 290  TYR A 293  
D  3  GLU E 271  ? GLN E 275  ? GLU A 296  GLN A 300  
E  1  THR E 363  ? ILE E 364  ? THR A 1039 ILE A 1040 
E  2  LEU E 380  ? PRO E 381  ? LEU A 1056 PRO A 1057 
F  1  GLY E 591  ? ILE E 592  ? GLY A 1267 ILE A 1268 
F  2  GLN E 581  ? LEU E 587  ? GLN A 1257 LEU A 1263 
F  3  ASN E 560  ? ASN E 573  ? ASN A 1236 ASN A 1249 
F  4  ALA E 543  ? GLU E 557  ? ALA A 1219 GLU A 1233 
F  5  ILE E 385  ? TYR E 389  ? ILE A 1061 TYR A 1065 
F  6  LEU E 512  ? ASN E 517  ? LEU A 1188 ASN A 1193 
F  7  VAL E 464  ? VAL E 467  ? VAL A 1140 VAL A 1143 
F  8  CYS E 414  ? ILE E 417  ? CYS A 1090 ILE A 1093 
F  9  LEU E 439  ? SER E 441  ? LEU A 1115 SER A 1117 
F  10 MET E 700  ? ARG E 701  ? MET A 2027 ARG A 2028 
G  1  ILE E 519  ? MET E 521  ? ILE A 1195 MET A 1197 
G  2  GLU E 531  ? THR E 533  ? GLU A 1207 THR A 1209 
H  1  GLU E 609  ? ALA E 611  ? GLU A 1285 ALA A 1287 
H  2  TRP E 614  ? TYR E 617  ? TRP A 1290 TYR A 1293 
H  3  GLU E 620  ? GLN E 624  ? GLU A 1296 GLN A 1300 
I  1  THR E 712  ? ILE E 713  ? THR A 2039 ILE A 2040 
I  2  LEU E 729  ? PRO E 730  ? LEU A 2056 PRO A 2057 
J  1  GLY E 940  ? ILE E 941  ? GLY A 2267 ILE A 2268 
J  2  GLN E 930  ? LEU E 936  ? GLN A 2257 LEU A 2263 
J  3  ASN E 909  ? ASN E 922  ? ASN A 2236 ASN A 2249 
J  4  ALA E 892  ? GLU E 906  ? ALA A 2219 GLU A 2233 
J  5  ILE E 734  ? TYR E 738  ? ILE A 2061 TYR A 2065 
J  6  LEU E 861  ? ASN E 866  ? LEU A 2188 ASN A 2193 
J  7  VAL E 813  ? VAL E 816  ? VAL A 2140 VAL A 2143 
J  8  CYS E 763  ? ILE E 766  ? CYS A 2090 ILE A 2093 
J  9  LEU E 788  ? SER E 790  ? LEU A 2115 SER A 2117 
J  10 ILE E 1049 ? ARG E 1051 ? ILE A 3026 ARG A 3028 
K  1  ILE E 868  ? MET E 870  ? ILE A 2195 MET A 2197 
K  2  GLU E 880  ? THR E 882  ? GLU A 2207 THR A 2209 
L  1  GLU E 958  ? ALA E 960  ? GLU A 2285 ALA A 2287 
L  2  TRP E 963  ? TYR E 966  ? TRP A 2290 TYR A 2293 
L  3  GLU E 969  ? GLN E 973  ? GLU A 2296 GLN A 2300 
M  1  THR E 1062 ? ILE E 1063 ? THR A 3039 ILE A 3040 
M  2  LEU E 1079 ? PRO E 1080 ? LEU A 3056 PRO A 3057 
N  1  GLY E 1290 ? ILE E 1291 ? GLY A 3267 ILE A 3268 
N  2  GLN E 1280 ? LEU E 1286 ? GLN A 3257 LEU A 3263 
N  3  ASN E 1259 ? ASN E 1272 ? ASN A 3236 ASN A 3249 
N  4  ALA E 1242 ? GLU E 1256 ? ALA A 3219 GLU A 3233 
N  5  ILE E 1084 ? TYR E 1088 ? ILE A 3061 TYR A 3065 
N  6  LEU E 1211 ? ASN E 1216 ? LEU A 3188 ASN A 3193 
N  7  VAL E 1163 ? VAL E 1166 ? VAL A 3140 VAL A 3143 
N  8  CYS E 1113 ? ILE E 1116 ? CYS A 3090 ILE A 3093 
N  9  LEU E 1138 ? SER E 1140 ? LEU A 3115 SER A 3117 
N  10 MET E 1399 ? ARG E 1400 ? MET A 4027 ARG A 4028 
O  1  ILE E 1218 ? MET E 1220 ? ILE A 3195 MET A 3197 
O  2  GLU E 1230 ? THR E 1232 ? GLU A 3207 THR A 3209 
P  1  GLU E 1308 ? ALA E 1310 ? GLU A 3285 ALA A 3287 
P  2  TRP E 1313 ? TYR E 1316 ? TRP A 3290 TYR A 3293 
P  3  GLU E 1319 ? GLN E 1323 ? GLU A 3296 GLN A 3300 
Q  1  THR E 1411 ? ILE E 1412 ? THR A 4039 ILE A 4040 
Q  2  LEU E 1428 ? PRO E 1429 ? LEU A 4056 PRO A 4057 
R  1  LEU E 1487 ? SER E 1489 ? LEU A 4115 SER A 4117 
R  2  CYS E 1462 ? ILE E 1465 ? CYS A 4090 ILE A 4093 
R  3  VAL E 1512 ? VAL E 1515 ? VAL A 4140 VAL A 4143 
R  4  LEU E 1560 ? ASN E 1565 ? LEU A 4188 ASN A 4193 
R  5  ILE E 1433 ? TYR E 1437 ? ILE A 4061 TYR A 4065 
R  6  ALA E 1591 ? GLU E 1605 ? ALA A 4219 GLU A 4233 
R  7  ASN E 1608 ? ASN E 1621 ? ASN A 4236 ASN A 4249 
R  8  GLN E 1629 ? LEU E 1635 ? GLN A 4257 LEU A 4263 
R  9  GLY E 1639 ? ILE E 1640 ? GLY A 4267 ILE A 4268 
S  1  ILE E 1567 ? ARG E 1568 ? ILE A 4195 ARG A 4196 
S  2  THR E 1580 ? THR E 1581 ? THR A 4208 THR A 4209 
T  1  GLU E 1657 ? ALA E 1659 ? GLU A 4285 ALA A 4287 
T  2  TRP E 1662 ? TYR E 1665 ? TRP A 4290 TYR A 4293 
T  3  GLU E 1668 ? GLN E 1672 ? GLU A 4296 GLN A 4300 
U  1  THR F 14   ? ILE F 15   ? THR D 39   ILE D 40   
U  2  LEU F 31   ? PRO F 32   ? LEU D 56   PRO D 57   
V  1  GLY F 242  ? ILE F 243  ? GLY D 267  ILE D 268  
V  2  GLN F 232  ? LEU F 238  ? GLN D 257  LEU D 263  
V  3  ASN F 211  ? ASN F 224  ? ASN D 236  ASN D 249  
V  4  ALA F 194  ? GLU F 208  ? ALA D 219  GLU D 233  
V  5  ILE F 36   ? TYR F 40   ? ILE D 61   TYR D 65   
V  6  LEU F 163  ? ASN F 168  ? LEU D 188  ASN D 193  
V  7  VAL F 115  ? VAL F 118  ? VAL D 140  VAL D 143  
V  8  CYS F 65   ? ILE F 68   ? CYS D 90   ILE D 93   
V  9  LEU F 90   ? SER F 92   ? LEU D 115  SER D 117  
V  10 MET F 351  ? ARG F 352  ? MET D 1027 ARG D 1028 
W  1  ILE F 170  ? MET F 172  ? ILE D 195  MET D 197  
W  2  GLU F 182  ? THR F 184  ? GLU D 207  THR D 209  
X  1  GLU F 260  ? ALA F 262  ? GLU D 285  ALA D 287  
X  2  TRP F 265  ? TYR F 268  ? TRP D 290  TYR D 293  
X  3  GLU F 271  ? GLN F 275  ? GLU D 296  GLN D 300  
Y  1  THR F 363  ? ILE F 364  ? THR D 1039 ILE D 1040 
Y  2  LEU F 380  ? PRO F 381  ? LEU D 1056 PRO D 1057 
Z  1  GLY F 591  ? ILE F 592  ? GLY D 1267 ILE D 1268 
Z  2  GLN F 581  ? LEU F 587  ? GLN D 1257 LEU D 1263 
Z  3  ASN F 560  ? ASN F 573  ? ASN D 1236 ASN D 1249 
Z  4  ALA F 543  ? GLU F 557  ? ALA D 1219 GLU D 1233 
Z  5  ILE F 385  ? TYR F 389  ? ILE D 1061 TYR D 1065 
Z  6  LEU F 512  ? ASN F 517  ? LEU D 1188 ASN D 1193 
Z  7  VAL F 464  ? VAL F 467  ? VAL D 1140 VAL D 1143 
Z  8  CYS F 414  ? ILE F 417  ? CYS D 1090 ILE D 1093 
Z  9  LEU F 439  ? SER F 441  ? LEU D 1115 SER D 1117 
Z  10 ILE F 699  ? ARG F 701  ? ILE D 2026 ARG D 2028 
AA 1  ILE F 519  ? MET F 521  ? ILE D 1195 MET D 1197 
AA 2  GLU F 531  ? THR F 533  ? GLU D 1207 THR D 1209 
AB 1  GLU F 609  ? ALA F 611  ? GLU D 1285 ALA D 1287 
AB 2  TRP F 614  ? TYR F 617  ? TRP D 1290 TYR D 1293 
AB 3  GLU F 620  ? GLN F 624  ? GLU D 1296 GLN D 1300 
AC 1  THR F 712  ? ILE F 713  ? THR D 2039 ILE D 2040 
AC 2  LEU F 729  ? PRO F 730  ? LEU D 2056 PRO D 2057 
AD 1  GLY F 940  ? ILE F 941  ? GLY D 2267 ILE D 2268 
AD 2  GLN F 930  ? LEU F 936  ? GLN D 2257 LEU D 2263 
AD 3  ASN F 909  ? ASN F 922  ? ASN D 2236 ASN D 2249 
AD 4  ALA F 892  ? GLU F 906  ? ALA D 2219 GLU D 2233 
AD 5  ILE F 734  ? TYR F 738  ? ILE D 2061 TYR D 2065 
AD 6  LEU F 861  ? ASN F 866  ? LEU D 2188 ASN D 2193 
AD 7  VAL F 813  ? VAL F 816  ? VAL D 2140 VAL D 2143 
AD 8  CYS F 763  ? ILE F 766  ? CYS D 2090 ILE D 2093 
AD 9  LEU F 788  ? SER F 790  ? LEU D 2115 SER D 2117 
AD 10 ILE F 1049 ? ARG F 1051 ? ILE D 3026 ARG D 3028 
AE 1  ILE F 868  ? MET F 870  ? ILE D 2195 MET D 2197 
AE 2  GLU F 880  ? THR F 882  ? GLU D 2207 THR D 2209 
AF 1  GLU F 958  ? ALA F 960  ? GLU D 2285 ALA D 2287 
AF 2  TRP F 963  ? TYR F 966  ? TRP D 2290 TYR D 2293 
AF 3  GLU F 969  ? GLN F 973  ? GLU D 2296 GLN D 2300 
AG 1  THR F 1062 ? ILE F 1063 ? THR D 3039 ILE D 3040 
AG 2  LEU F 1079 ? PRO F 1080 ? LEU D 3056 PRO D 3057 
AH 1  GLY F 1290 ? ILE F 1291 ? GLY D 3267 ILE D 3268 
AH 2  GLN F 1280 ? LEU F 1286 ? GLN D 3257 LEU D 3263 
AH 3  ASN F 1259 ? ASN F 1272 ? ASN D 3236 ASN D 3249 
AH 4  ALA F 1242 ? GLU F 1256 ? ALA D 3219 GLU D 3233 
AH 5  ILE F 1084 ? TYR F 1088 ? ILE D 3061 TYR D 3065 
AH 6  LEU F 1211 ? ASN F 1216 ? LEU D 3188 ASN D 3193 
AH 7  VAL F 1163 ? VAL F 1166 ? VAL D 3140 VAL D 3143 
AH 8  CYS F 1113 ? ILE F 1116 ? CYS D 3090 ILE D 3093 
AH 9  LEU F 1138 ? SER F 1140 ? LEU D 3115 SER D 3117 
AH 10 MET F 1399 ? ARG F 1400 ? MET D 4027 ARG D 4028 
AI 1  ILE F 1218 ? MET F 1220 ? ILE D 3195 MET D 3197 
AI 2  GLU F 1230 ? THR F 1232 ? GLU D 3207 THR D 3209 
AJ 1  GLU F 1308 ? ALA F 1310 ? GLU D 3285 ALA D 3287 
AJ 2  TRP F 1313 ? TYR F 1316 ? TRP D 3290 TYR D 3293 
AJ 3  GLU F 1319 ? GLN F 1323 ? GLU D 3296 GLN D 3300 
AK 1  THR F 1411 ? ILE F 1412 ? THR D 4039 ILE D 4040 
AK 2  LEU F 1428 ? PRO F 1429 ? LEU D 4056 PRO D 4057 
AL 1  LEU F 1487 ? SER F 1489 ? LEU D 4115 SER D 4117 
AL 2  CYS F 1462 ? ILE F 1465 ? CYS D 4090 ILE D 4093 
AL 3  VAL F 1512 ? VAL F 1515 ? VAL D 4140 VAL D 4143 
AL 4  LEU F 1560 ? ASN F 1565 ? LEU D 4188 ASN D 4193 
AL 5  ILE F 1433 ? TYR F 1437 ? ILE D 4061 TYR D 4065 
AL 6  ALA F 1591 ? GLU F 1605 ? ALA D 4219 GLU D 4233 
AL 7  ASN F 1608 ? ASN F 1621 ? ASN D 4236 ASN D 4249 
AL 8  GLN F 1629 ? LEU F 1635 ? GLN D 4257 LEU D 4263 
AL 9  GLY F 1639 ? ILE F 1640 ? GLY D 4267 ILE D 4268 
AM 1  ILE F 1567 ? MET F 1569 ? ILE D 4195 MET D 4197 
AM 2  GLU F 1579 ? THR F 1581 ? GLU D 4207 THR D 4209 
AN 1  GLU F 1657 ? ALA F 1659 ? GLU D 4285 ALA D 4287 
AN 2  TRP F 1662 ? TYR F 1665 ? TRP D 4290 TYR D 4293 
AN 3  GLU F 1668 ? GLN F 1672 ? GLU D 4296 GLN D 4300 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2  N ILE E 15   ? N ILE A 40   O LEU E 31   ? O LEU A 56   
B  1 2  O GLY E 242  ? O GLY A 267  N LEU E 238  ? N LEU A 263  
B  2 3  O PHE E 235  ? O PHE A 260  N THR E 217  ? N THR A 242  
B  3 4  O GLY E 214  ? O GLY A 239  N VAL E 206  ? N VAL A 231  
B  4 5  O SER E 195  ? O SER A 220  N ILE E 36   ? N ILE A 61   
B  5 6  N VAL E 37   ? N VAL A 62   O PHE E 166  ? O PHE A 191  
B  6 7  O ILE E 165  ? O ILE A 190  N VAL E 118  ? N VAL A 143  
B  7 8  O VAL E 117  ? O VAL A 142  N ILE E 68   ? N ILE A 93   
B  8 9  N PHE E 67   ? N PHE A 92   O LEU E 90   ? O LEU A 115  
B  9 10 N CYS E 91   ? N CYS A 116  O MET E 351  ? O MET A 1027 
C  1 2  N ARG E 171  ? N ARG A 196  O THR E 183  ? O THR A 208  
D  1 2  N GLU E 260  ? N GLU A 285  O SER E 267  ? O SER A 292  
D  2 3  N TYR E 268  ? N TYR A 293  O GLU E 271  ? O GLU A 296  
E  1 2  N ILE E 364  ? N ILE A 1040 O LEU E 380  ? O LEU A 1056 
F  1 2  O GLY E 591  ? O GLY A 1267 N LEU E 587  ? N LEU A 1263 
F  2 3  O PHE E 584  ? O PHE A 1260 N THR E 566  ? N THR A 1242 
F  3 4  O GLY E 563  ? O GLY A 1239 N VAL E 555  ? N VAL A 1231 
F  4 5  O SER E 544  ? O SER A 1220 N ILE E 385  ? N ILE A 1061 
F  5 6  N VAL E 386  ? N VAL A 1062 O PHE E 515  ? O PHE A 1191 
F  6 7  O ILE E 514  ? O ILE A 1190 N ILE E 465  ? N ILE A 1141 
F  7 8  O VAL E 466  ? O VAL A 1142 N ILE E 417  ? N ILE A 1093 
F  8 9  N PHE E 416  ? N PHE A 1092 O LEU E 439  ? O LEU A 1115 
F  9 10 N CYS E 440  ? N CYS A 1116 O MET E 700  ? O MET A 2027 
G  1 2  N ARG E 520  ? N ARG A 1196 O THR E 532  ? O THR A 1208 
H  1 2  N GLU E 609  ? N GLU A 1285 O SER E 616  ? O SER A 1292 
H  2 3  N TYR E 617  ? N TYR A 1293 O GLU E 620  ? O GLU A 1296 
I  1 2  N ILE E 713  ? N ILE A 2040 O LEU E 729  ? O LEU A 2056 
J  1 2  O GLY E 940  ? O GLY A 2267 N LEU E 936  ? N LEU A 2263 
J  2 3  O PHE E 933  ? O PHE A 2260 N THR E 915  ? N THR A 2242 
J  3 4  O GLY E 912  ? O GLY A 2239 N VAL E 904  ? N VAL A 2231 
J  4 5  O SER E 893  ? O SER A 2220 N ILE E 734  ? N ILE A 2061 
J  5 6  N VAL E 735  ? N VAL A 2062 O PHE E 864  ? O PHE A 2191 
J  6 7  O ILE E 863  ? O ILE A 2190 N ILE E 814  ? N ILE A 2141 
J  7 8  O VAL E 815  ? O VAL A 2142 N ILE E 766  ? N ILE A 2093 
J  8 9  N PHE E 765  ? N PHE A 2092 O LEU E 788  ? O LEU A 2115 
J  9 10 N CYS E 789  ? N CYS A 2116 O MET E 1050 ? O MET A 3027 
K  1 2  N ARG E 869  ? N ARG A 2196 O THR E 881  ? O THR A 2208 
L  1 2  N ALA E 960  ? N ALA A 2287 O TRP E 963  ? O TRP A 2290 
L  2 3  N TYR E 966  ? N TYR A 2293 O GLU E 969  ? O GLU A 2296 
M  1 2  N ILE E 1063 ? N ILE A 3040 O LEU E 1079 ? O LEU A 3056 
N  1 2  O GLY E 1290 ? O GLY A 3267 N LEU E 1286 ? N LEU A 3263 
N  2 3  O PHE E 1283 ? O PHE A 3260 N THR E 1265 ? N THR A 3242 
N  3 4  O GLY E 1262 ? O GLY A 3239 N VAL E 1254 ? N VAL A 3231 
N  4 5  O SER E 1243 ? O SER A 3220 N ILE E 1084 ? N ILE A 3061 
N  5 6  N VAL E 1085 ? N VAL A 3062 O PHE E 1214 ? O PHE A 3191 
N  6 7  O ILE E 1213 ? O ILE A 3190 N ILE E 1164 ? N ILE A 3141 
N  7 8  O VAL E 1165 ? O VAL A 3142 N ILE E 1116 ? N ILE A 3093 
N  8 9  N PHE E 1115 ? N PHE A 3092 O LEU E 1138 ? O LEU A 3115 
N  9 10 N CYS E 1139 ? N CYS A 3116 O MET E 1399 ? O MET A 4027 
O  1 2  N ARG E 1219 ? N ARG A 3196 O THR E 1231 ? O THR A 3208 
P  1 2  N ALA E 1310 ? N ALA A 3287 O TRP E 1313 ? O TRP A 3290 
P  2 3  N TYR E 1316 ? N TYR A 3293 O GLU E 1319 ? O GLU A 3296 
Q  1 2  N ILE E 1412 ? N ILE A 4040 O LEU E 1428 ? O LEU A 4056 
R  1 2  O LEU E 1487 ? O LEU A 4115 N PHE E 1464 ? N PHE A 4092 
R  2 3  N ILE E 1465 ? N ILE A 4093 O VAL E 1514 ? O VAL A 4142 
R  3 4  N ILE E 1513 ? N ILE A 4141 O ILE E 1562 ? O ILE A 4190 
R  4 5  O PHE E 1563 ? O PHE A 4191 N VAL E 1434 ? N VAL A 4062 
R  5 6  N ILE E 1433 ? N ILE A 4061 O SER E 1592 ? O SER A 4220 
R  6 7  N VAL E 1603 ? N VAL A 4231 O GLY E 1611 ? O GLY A 4239 
R  7 8  N THR E 1614 ? N THR A 4242 O PHE E 1632 ? O PHE A 4260 
R  8 9  N LEU E 1635 ? N LEU A 4263 O GLY E 1639 ? O GLY A 4267 
S  1 2  N ARG E 1568 ? N ARG A 4196 O THR E 1580 ? O THR A 4208 
T  1 2  N GLU E 1657 ? N GLU A 4285 O SER E 1664 ? O SER A 4292 
T  2 3  N TYR E 1665 ? N TYR A 4293 O GLU E 1668 ? O GLU A 4296 
U  1 2  N ILE F 15   ? N ILE D 40   O LEU F 31   ? O LEU D 56   
V  1 2  O GLY F 242  ? O GLY D 267  N LEU F 238  ? N LEU D 263  
V  2 3  O PHE F 235  ? O PHE D 260  N THR F 217  ? N THR D 242  
V  3 4  O GLY F 214  ? O GLY D 239  N VAL F 206  ? N VAL D 231  
V  4 5  O SER F 195  ? O SER D 220  N ILE F 36   ? N ILE D 61   
V  5 6  N VAL F 37   ? N VAL D 62   O PHE F 166  ? O PHE D 191  
V  6 7  O ILE F 165  ? O ILE D 190  N VAL F 118  ? N VAL D 143  
V  7 8  O VAL F 117  ? O VAL D 142  N ILE F 68   ? N ILE D 93   
V  8 9  N PHE F 67   ? N PHE D 92   O LEU F 90   ? O LEU D 115  
V  9 10 N CYS F 91   ? N CYS D 116  O MET F 351  ? O MET D 1027 
W  1 2  N ARG F 171  ? N ARG D 196  O THR F 183  ? O THR D 208  
X  1 2  N ALA F 262  ? N ALA D 287  O TRP F 265  ? O TRP D 290  
X  2 3  N TYR F 268  ? N TYR D 293  O GLU F 271  ? O GLU D 296  
Y  1 2  N ILE F 364  ? N ILE D 1040 O LEU F 380  ? O LEU D 1056 
Z  1 2  O GLY F 591  ? O GLY D 1267 N LEU F 587  ? N LEU D 1263 
Z  2 3  O PHE F 584  ? O PHE D 1260 N THR F 566  ? N THR D 1242 
Z  3 4  O GLY F 563  ? O GLY D 1239 N VAL F 555  ? N VAL D 1231 
Z  4 5  O SER F 544  ? O SER D 1220 N ILE F 385  ? N ILE D 1061 
Z  5 6  N VAL F 386  ? N VAL D 1062 O PHE F 515  ? O PHE D 1191 
Z  6 7  O ILE F 514  ? O ILE D 1190 N VAL F 467  ? N VAL D 1143 
Z  7 8  O VAL F 466  ? O VAL D 1142 N ILE F 417  ? N ILE D 1093 
Z  8 9  N PHE F 416  ? N PHE D 1092 O LEU F 439  ? O LEU D 1115 
Z  9 10 N CYS F 440  ? N CYS D 1116 O MET F 700  ? O MET D 2027 
AA 1 2  N ARG F 520  ? N ARG D 1196 O THR F 532  ? O THR D 1208 
AB 1 2  N GLU F 609  ? N GLU D 1285 O SER F 616  ? O SER D 1292 
AB 2 3  N TYR F 617  ? N TYR D 1293 O GLU F 620  ? O GLU D 1296 
AC 1 2  N ILE F 713  ? N ILE D 2040 O LEU F 729  ? O LEU D 2056 
AD 1 2  O GLY F 940  ? O GLY D 2267 N LEU F 936  ? N LEU D 2263 
AD 2 3  O PHE F 933  ? O PHE D 2260 N THR F 915  ? N THR D 2242 
AD 3 4  O GLY F 912  ? O GLY D 2239 N VAL F 904  ? N VAL D 2231 
AD 4 5  O SER F 893  ? O SER D 2220 N ILE F 734  ? N ILE D 2061 
AD 5 6  N VAL F 735  ? N VAL D 2062 O PHE F 864  ? O PHE D 2191 
AD 6 7  O ILE F 863  ? O ILE D 2190 N VAL F 816  ? N VAL D 2143 
AD 7 8  O VAL F 815  ? O VAL D 2142 N ILE F 766  ? N ILE D 2093 
AD 8 9  N PHE F 765  ? N PHE D 2092 O LEU F 788  ? O LEU D 2115 
AD 9 10 N CYS F 789  ? N CYS D 2116 O MET F 1050 ? O MET D 3027 
AE 1 2  N ARG F 869  ? N ARG D 2196 O THR F 881  ? O THR D 2208 
AF 1 2  N ALA F 960  ? N ALA D 2287 O TRP F 963  ? O TRP D 2290 
AF 2 3  N TYR F 966  ? N TYR D 2293 O GLU F 969  ? O GLU D 2296 
AG 1 2  N ILE F 1063 ? N ILE D 3040 O LEU F 1079 ? O LEU D 3056 
AH 1 2  O GLY F 1290 ? O GLY D 3267 N LEU F 1286 ? N LEU D 3263 
AH 2 3  O PHE F 1283 ? O PHE D 3260 N THR F 1265 ? N THR D 3242 
AH 3 4  O GLY F 1262 ? O GLY D 3239 N VAL F 1254 ? N VAL D 3231 
AH 4 5  O SER F 1243 ? O SER D 3220 N ILE F 1084 ? N ILE D 3061 
AH 5 6  N VAL F 1085 ? N VAL D 3062 O PHE F 1214 ? O PHE D 3191 
AH 6 7  O ILE F 1213 ? O ILE D 3190 N ILE F 1164 ? N ILE D 3141 
AH 7 8  O VAL F 1165 ? O VAL D 3142 N ILE F 1116 ? N ILE D 3093 
AH 8 9  N PHE F 1115 ? N PHE D 3092 O LEU F 1138 ? O LEU D 3115 
AH 9 10 N CYS F 1139 ? N CYS D 3116 O MET F 1399 ? O MET D 4027 
AI 1 2  N ARG F 1219 ? N ARG D 3196 O THR F 1231 ? O THR D 3208 
AJ 1 2  N ALA F 1310 ? N ALA D 3287 O TRP F 1313 ? O TRP D 3290 
AJ 2 3  N TYR F 1316 ? N TYR D 3293 O GLU F 1319 ? O GLU D 3296 
AK 1 2  N ILE F 1412 ? N ILE D 4040 O LEU F 1428 ? O LEU D 4056 
AL 1 2  O LEU F 1487 ? O LEU D 4115 N PHE F 1464 ? N PHE D 4092 
AL 2 3  N ILE F 1465 ? N ILE D 4093 O VAL F 1514 ? O VAL D 4142 
AL 3 4  N ILE F 1513 ? N ILE D 4141 O LEU F 1560 ? O LEU D 4188 
AL 4 5  O PHE F 1563 ? O PHE D 4191 N VAL F 1434 ? N VAL D 4062 
AL 5 6  N ILE F 1433 ? N ILE D 4061 O SER F 1592 ? O SER D 4220 
AL 6 7  N VAL F 1603 ? N VAL D 4231 O GLY F 1611 ? O GLY D 4239 
AL 7 8  N THR F 1614 ? N THR D 4242 O PHE F 1632 ? O PHE D 4260 
AL 8 9  N LEU F 1635 ? N LEU D 4263 O GLY F 1639 ? O GLY D 4267 
AM 1 2  N ARG F 1568 ? N ARG D 4196 O THR F 1580 ? O THR D 4208 
AN 1 2  N GLU F 1657 ? N GLU D 4285 O SER F 1664 ? O SER D 4292 
AN 2 3  N TYR F 1665 ? N TYR D 4293 O GLU F 1668 ? O GLU D 4296 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG A 500'   
AC2 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE ALF A 501'  
AC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG A 1500'  
AC4 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE ALF A 1501' 
AC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG A 2500'  
AC6 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE ALF A 2501' 
AC7 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG A 3500'  
AC8 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE ALF A 3501' 
AC9 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG A 4500'  
BC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ALF A 4501' 
BC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG D 500'   
BC3 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE ALF D 501'  
BC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG D 1500'  
BC5 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE ALF D 1501' 
BC6 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG D 2500'  
BC7 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE ALF D 2501' 
BC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG D 3500'  
BC9 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE ALF D 3501' 
CC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG D 4500'  
CC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ALF D 4501' 
CC3 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE ADP A 502'  
CC4 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE ADP A 1502' 
CC5 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE ADP A 2502' 
CC6 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE ADP A 3502' 
CC7 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE ADP A 4502' 
CC8 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE ADP D 502'  
CC9 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE ADP D 1502' 
DC1 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE ADP D 2502' 
DC2 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE ADP D 3502' 
DC3 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE ADP D 4502' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 3  THR E 48   ? THR A 73   . ? 1_555 ? 
2   AC1 3  GLU E 71   ? GLU A 96   . ? 1_555 ? 
3   AC1 3  ASP E 119  ? ASP A 144  . ? 1_555 ? 
4   AC2 8  GLU E 43   ? GLU A 68   . ? 1_555 ? 
5   AC2 8  SER E 44   ? SER A 69   . ? 1_555 ? 
6   AC2 8  LYS E 47   ? LYS A 72   . ? 1_555 ? 
7   AC2 8  THR E 48   ? THR A 73   . ? 1_555 ? 
8   AC2 8  GLU E 71   ? GLU A 96   . ? 1_555 ? 
9   AC2 8  PHE E 541  ? PHE A 1217 . ? 1_555 ? 
10  AC2 8  LYS E 572  ? LYS A 1248 . ? 1_555 ? 
11  AC2 8  LYS E 574  ? LYS A 1250 . ? 1_555 ? 
12  AC3 3  THR E 397  ? THR A 1073 . ? 1_555 ? 
13  AC3 3  GLU E 420  ? GLU A 1096 . ? 1_555 ? 
14  AC3 3  ASP E 468  ? ASP A 1144 . ? 1_555 ? 
15  AC4 7  GLU E 392  ? GLU A 1068 . ? 1_555 ? 
16  AC4 7  SER E 393  ? SER A 1069 . ? 1_555 ? 
17  AC4 7  LYS E 396  ? LYS A 1072 . ? 1_555 ? 
18  AC4 7  GLU E 420  ? GLU A 1096 . ? 1_555 ? 
19  AC4 7  PHE E 890  ? PHE A 2217 . ? 1_555 ? 
20  AC4 7  LYS E 921  ? LYS A 2248 . ? 1_555 ? 
21  AC4 7  LYS E 923  ? LYS A 2250 . ? 1_555 ? 
22  AC5 3  THR E 746  ? THR A 2073 . ? 1_555 ? 
23  AC5 3  GLU E 769  ? GLU A 2096 . ? 1_555 ? 
24  AC5 3  ASP E 817  ? ASP A 2144 . ? 1_555 ? 
25  AC6 7  GLU E 741  ? GLU A 2068 . ? 1_555 ? 
26  AC6 7  SER E 742  ? SER A 2069 . ? 1_555 ? 
27  AC6 7  LYS E 745  ? LYS A 2072 . ? 1_555 ? 
28  AC6 7  GLU E 769  ? GLU A 2096 . ? 1_555 ? 
29  AC6 7  PHE E 1240 ? PHE A 3217 . ? 1_555 ? 
30  AC6 7  LYS E 1271 ? LYS A 3248 . ? 1_555 ? 
31  AC6 7  LYS E 1273 ? LYS A 3250 . ? 1_555 ? 
32  AC7 3  THR E 1096 ? THR A 3073 . ? 1_555 ? 
33  AC7 3  GLU E 1119 ? GLU A 3096 . ? 1_555 ? 
34  AC7 3  ASP E 1167 ? ASP A 3144 . ? 1_555 ? 
35  AC8 7  GLU E 1091 ? GLU A 3068 . ? 1_555 ? 
36  AC8 7  SER E 1092 ? SER A 3069 . ? 1_555 ? 
37  AC8 7  LYS E 1095 ? LYS A 3072 . ? 1_555 ? 
38  AC8 7  GLU E 1119 ? GLU A 3096 . ? 1_555 ? 
39  AC8 7  PHE E 1589 ? PHE A 4217 . ? 1_555 ? 
40  AC8 7  LYS E 1620 ? LYS A 4248 . ? 1_555 ? 
41  AC8 7  LYS E 1622 ? LYS A 4250 . ? 1_555 ? 
42  AC9 3  THR E 1445 ? THR A 4073 . ? 1_555 ? 
43  AC9 3  GLU E 1468 ? GLU A 4096 . ? 1_555 ? 
44  AC9 3  ASP E 1516 ? ASP A 4144 . ? 1_555 ? 
45  BC1 4  GLU E 1440 ? GLU A 4068 . ? 1_555 ? 
46  BC1 4  SER E 1441 ? SER A 4069 . ? 1_555 ? 
47  BC1 4  LYS E 1444 ? LYS A 4072 . ? 1_555 ? 
48  BC1 4  GLU E 1468 ? GLU A 4096 . ? 1_555 ? 
49  BC2 3  THR F 48   ? THR D 73   . ? 1_555 ? 
50  BC2 3  GLU F 71   ? GLU D 96   . ? 1_555 ? 
51  BC2 3  ASP F 119  ? ASP D 144  . ? 1_555 ? 
52  BC3 7  GLU F 43   ? GLU D 68   . ? 1_555 ? 
53  BC3 7  SER F 44   ? SER D 69   . ? 1_555 ? 
54  BC3 7  LYS F 47   ? LYS D 72   . ? 1_555 ? 
55  BC3 7  GLU F 71   ? GLU D 96   . ? 1_555 ? 
56  BC3 7  PHE F 541  ? PHE D 1217 . ? 1_555 ? 
57  BC3 7  LYS F 572  ? LYS D 1248 . ? 1_555 ? 
58  BC3 7  LYS F 574  ? LYS D 1250 . ? 1_555 ? 
59  BC4 3  THR F 397  ? THR D 1073 . ? 1_555 ? 
60  BC4 3  GLU F 420  ? GLU D 1096 . ? 1_555 ? 
61  BC4 3  ASP F 468  ? ASP D 1144 . ? 1_555 ? 
62  BC5 7  GLU F 392  ? GLU D 1068 . ? 1_555 ? 
63  BC5 7  SER F 393  ? SER D 1069 . ? 1_555 ? 
64  BC5 7  LYS F 396  ? LYS D 1072 . ? 1_555 ? 
65  BC5 7  GLU F 420  ? GLU D 1096 . ? 1_555 ? 
66  BC5 7  PHE F 890  ? PHE D 2217 . ? 1_555 ? 
67  BC5 7  LYS F 921  ? LYS D 2248 . ? 1_555 ? 
68  BC5 7  LYS F 923  ? LYS D 2250 . ? 1_555 ? 
69  BC6 3  THR F 746  ? THR D 2073 . ? 1_555 ? 
70  BC6 3  GLU F 769  ? GLU D 2096 . ? 1_555 ? 
71  BC6 3  ASP F 817  ? ASP D 2144 . ? 1_555 ? 
72  BC7 7  GLU F 741  ? GLU D 2068 . ? 1_555 ? 
73  BC7 7  SER F 742  ? SER D 2069 . ? 1_555 ? 
74  BC7 7  LYS F 745  ? LYS D 2072 . ? 1_555 ? 
75  BC7 7  GLU F 769  ? GLU D 2096 . ? 1_555 ? 
76  BC7 7  PHE F 1240 ? PHE D 3217 . ? 1_555 ? 
77  BC7 7  LYS F 1271 ? LYS D 3248 . ? 1_555 ? 
78  BC7 7  LYS F 1273 ? LYS D 3250 . ? 1_555 ? 
79  BC8 3  THR F 1096 ? THR D 3073 . ? 1_555 ? 
80  BC8 3  GLU F 1119 ? GLU D 3096 . ? 1_555 ? 
81  BC8 3  ASP F 1167 ? ASP D 3144 . ? 1_555 ? 
82  BC9 7  GLU F 1091 ? GLU D 3068 . ? 1_555 ? 
83  BC9 7  SER F 1092 ? SER D 3069 . ? 1_555 ? 
84  BC9 7  LYS F 1095 ? LYS D 3072 . ? 1_555 ? 
85  BC9 7  GLU F 1119 ? GLU D 3096 . ? 1_555 ? 
86  BC9 7  PHE F 1589 ? PHE D 4217 . ? 1_555 ? 
87  BC9 7  LYS F 1620 ? LYS D 4248 . ? 1_555 ? 
88  BC9 7  LYS F 1622 ? LYS D 4250 . ? 1_555 ? 
89  CC1 3  THR F 1445 ? THR D 4073 . ? 1_555 ? 
90  CC1 3  GLU F 1468 ? GLU D 4096 . ? 1_555 ? 
91  CC1 3  ASP F 1516 ? ASP D 4144 . ? 1_555 ? 
92  CC2 4  GLU F 1440 ? GLU D 4068 . ? 1_555 ? 
93  CC2 4  SER F 1441 ? SER D 4069 . ? 1_555 ? 
94  CC2 4  LYS F 1444 ? LYS D 4072 . ? 1_555 ? 
95  CC2 4  GLU F 1468 ? GLU D 4096 . ? 1_555 ? 
96  CC3 16 SER E 44   ? SER A 69   . ? 1_555 ? 
97  CC3 16 SER E 45   ? SER A 70   . ? 1_555 ? 
98  CC3 16 GLY E 46   ? GLY A 71   . ? 1_555 ? 
99  CC3 16 LYS E 47   ? LYS A 72   . ? 1_555 ? 
100 CC3 16 THR E 48   ? THR A 73   . ? 1_555 ? 
101 CC3 16 THR E 49   ? THR A 74   . ? 1_555 ? 
102 CC3 16 ASP E 75   ? ASP A 100  . ? 1_555 ? 
103 CC3 16 TYR E 78   ? TYR A 103  . ? 1_555 ? 
104 CC3 16 SER E 215  ? SER A 240  . ? 1_555 ? 
105 CC3 16 TYR E 239  ? TYR A 264  . ? 1_555 ? 
106 CC3 16 ASN E 573  ? ASN A 1249 . ? 1_555 ? 
107 CC3 16 LYS E 574  ? LYS A 1250 . ? 1_555 ? 
108 CC3 16 ILE E 575  ? ILE A 1251 . ? 1_555 ? 
109 CC3 16 ALA E 576  ? ALA A 1252 . ? 1_555 ? 
110 CC3 16 ALA E 577  ? ALA A 1253 . ? 1_555 ? 
111 CC3 16 PRO E 578  ? PRO A 1254 . ? 1_555 ? 
112 CC4 15 SER E 393  ? SER A 1069 . ? 1_555 ? 
113 CC4 15 SER E 394  ? SER A 1070 . ? 1_555 ? 
114 CC4 15 GLY E 395  ? GLY A 1071 . ? 1_555 ? 
115 CC4 15 LYS E 396  ? LYS A 1072 . ? 1_555 ? 
116 CC4 15 THR E 397  ? THR A 1073 . ? 1_555 ? 
117 CC4 15 THR E 398  ? THR A 1074 . ? 1_555 ? 
118 CC4 15 TYR E 427  ? TYR A 1103 . ? 1_555 ? 
119 CC4 15 SER E 564  ? SER A 1240 . ? 1_555 ? 
120 CC4 15 TYR E 588  ? TYR A 1264 . ? 1_555 ? 
121 CC4 15 ASN E 922  ? ASN A 2249 . ? 1_555 ? 
122 CC4 15 LYS E 923  ? LYS A 2250 . ? 1_555 ? 
123 CC4 15 ILE E 924  ? ILE A 2251 . ? 1_555 ? 
124 CC4 15 ALA E 925  ? ALA A 2252 . ? 1_555 ? 
125 CC4 15 ALA E 926  ? ALA A 2253 . ? 1_555 ? 
126 CC4 15 PRO E 927  ? PRO A 2254 . ? 1_555 ? 
127 CC5 15 SER E 742  ? SER A 2069 . ? 1_555 ? 
128 CC5 15 SER E 743  ? SER A 2070 . ? 1_555 ? 
129 CC5 15 GLY E 744  ? GLY A 2071 . ? 1_555 ? 
130 CC5 15 LYS E 745  ? LYS A 2072 . ? 1_555 ? 
131 CC5 15 THR E 746  ? THR A 2073 . ? 1_555 ? 
132 CC5 15 THR E 747  ? THR A 2074 . ? 1_555 ? 
133 CC5 15 ASP E 773  ? ASP A 2100 . ? 1_555 ? 
134 CC5 15 TYR E 776  ? TYR A 2103 . ? 1_555 ? 
135 CC5 15 SER E 913  ? SER A 2240 . ? 1_555 ? 
136 CC5 15 TYR E 937  ? TYR A 2264 . ? 1_555 ? 
137 CC5 15 ASN E 1272 ? ASN A 3249 . ? 1_555 ? 
138 CC5 15 LYS E 1273 ? LYS A 3250 . ? 1_555 ? 
139 CC5 15 ALA E 1275 ? ALA A 3252 . ? 1_555 ? 
140 CC5 15 ALA E 1276 ? ALA A 3253 . ? 1_555 ? 
141 CC5 15 PRO E 1277 ? PRO A 3254 . ? 1_555 ? 
142 CC6 15 SER E 1092 ? SER A 3069 . ? 1_555 ? 
143 CC6 15 SER E 1093 ? SER A 3070 . ? 1_555 ? 
144 CC6 15 GLY E 1094 ? GLY A 3071 . ? 1_555 ? 
145 CC6 15 LYS E 1095 ? LYS A 3072 . ? 1_555 ? 
146 CC6 15 THR E 1096 ? THR A 3073 . ? 1_555 ? 
147 CC6 15 THR E 1097 ? THR A 3074 . ? 1_555 ? 
148 CC6 15 TYR E 1126 ? TYR A 3103 . ? 1_555 ? 
149 CC6 15 SER E 1263 ? SER A 3240 . ? 1_555 ? 
150 CC6 15 TYR E 1287 ? TYR A 3264 . ? 1_555 ? 
151 CC6 15 ASN E 1621 ? ASN A 4249 . ? 1_555 ? 
152 CC6 15 LYS E 1622 ? LYS A 4250 . ? 1_555 ? 
153 CC6 15 ILE E 1623 ? ILE A 4251 . ? 1_555 ? 
154 CC6 15 ALA E 1624 ? ALA A 4252 . ? 1_555 ? 
155 CC6 15 ALA E 1625 ? ALA A 4253 . ? 1_555 ? 
156 CC6 15 PRO E 1626 ? PRO A 4254 . ? 1_555 ? 
157 CC7 9  SER E 1441 ? SER A 4069 . ? 1_555 ? 
158 CC7 9  SER E 1442 ? SER A 4070 . ? 1_555 ? 
159 CC7 9  GLY E 1443 ? GLY A 4071 . ? 1_555 ? 
160 CC7 9  LYS E 1444 ? LYS A 4072 . ? 1_555 ? 
161 CC7 9  THR E 1445 ? THR A 4073 . ? 1_555 ? 
162 CC7 9  THR E 1446 ? THR A 4074 . ? 1_555 ? 
163 CC7 9  TYR E 1475 ? TYR A 4103 . ? 1_555 ? 
164 CC7 9  SER E 1612 ? SER A 4240 . ? 1_555 ? 
165 CC7 9  TYR E 1636 ? TYR A 4264 . ? 1_555 ? 
166 CC8 15 SER F 44   ? SER D 69   . ? 1_555 ? 
167 CC8 15 SER F 45   ? SER D 70   . ? 1_555 ? 
168 CC8 15 GLY F 46   ? GLY D 71   . ? 1_555 ? 
169 CC8 15 LYS F 47   ? LYS D 72   . ? 1_555 ? 
170 CC8 15 THR F 48   ? THR D 73   . ? 1_555 ? 
171 CC8 15 THR F 49   ? THR D 74   . ? 1_555 ? 
172 CC8 15 TYR F 78   ? TYR D 103  . ? 1_555 ? 
173 CC8 15 SER F 215  ? SER D 240  . ? 1_555 ? 
174 CC8 15 TYR F 239  ? TYR D 264  . ? 1_555 ? 
175 CC8 15 ASN F 573  ? ASN D 1249 . ? 1_555 ? 
176 CC8 15 LYS F 574  ? LYS D 1250 . ? 1_555 ? 
177 CC8 15 ILE F 575  ? ILE D 1251 . ? 1_555 ? 
178 CC8 15 ALA F 576  ? ALA D 1252 . ? 1_555 ? 
179 CC8 15 ALA F 577  ? ALA D 1253 . ? 1_555 ? 
180 CC8 15 PRO F 578  ? PRO D 1254 . ? 1_555 ? 
181 CC9 15 SER F 393  ? SER D 1069 . ? 1_555 ? 
182 CC9 15 SER F 394  ? SER D 1070 . ? 1_555 ? 
183 CC9 15 GLY F 395  ? GLY D 1071 . ? 1_555 ? 
184 CC9 15 LYS F 396  ? LYS D 1072 . ? 1_555 ? 
185 CC9 15 THR F 397  ? THR D 1073 . ? 1_555 ? 
186 CC9 15 THR F 398  ? THR D 1074 . ? 1_555 ? 
187 CC9 15 ASP F 424  ? ASP D 1100 . ? 1_555 ? 
188 CC9 15 TYR F 427  ? TYR D 1103 . ? 1_555 ? 
189 CC9 15 SER F 564  ? SER D 1240 . ? 1_555 ? 
190 CC9 15 TYR F 588  ? TYR D 1264 . ? 1_555 ? 
191 CC9 15 ASN F 922  ? ASN D 2249 . ? 1_555 ? 
192 CC9 15 LYS F 923  ? LYS D 2250 . ? 1_555 ? 
193 CC9 15 ALA F 925  ? ALA D 2252 . ? 1_555 ? 
194 CC9 15 ALA F 926  ? ALA D 2253 . ? 1_555 ? 
195 CC9 15 PRO F 927  ? PRO D 2254 . ? 1_555 ? 
196 DC1 15 SER F 742  ? SER D 2069 . ? 1_555 ? 
197 DC1 15 SER F 743  ? SER D 2070 . ? 1_555 ? 
198 DC1 15 GLY F 744  ? GLY D 2071 . ? 1_555 ? 
199 DC1 15 LYS F 745  ? LYS D 2072 . ? 1_555 ? 
200 DC1 15 THR F 746  ? THR D 2073 . ? 1_555 ? 
201 DC1 15 THR F 747  ? THR D 2074 . ? 1_555 ? 
202 DC1 15 TYR F 776  ? TYR D 2103 . ? 1_555 ? 
203 DC1 15 SER F 913  ? SER D 2240 . ? 1_555 ? 
204 DC1 15 TYR F 937  ? TYR D 2264 . ? 1_555 ? 
205 DC1 15 ASN F 1272 ? ASN D 3249 . ? 1_555 ? 
206 DC1 15 LYS F 1273 ? LYS D 3250 . ? 1_555 ? 
207 DC1 15 ILE F 1274 ? ILE D 3251 . ? 1_555 ? 
208 DC1 15 ALA F 1275 ? ALA D 3252 . ? 1_555 ? 
209 DC1 15 ALA F 1276 ? ALA D 3253 . ? 1_555 ? 
210 DC1 15 PRO F 1277 ? PRO D 3254 . ? 1_555 ? 
211 DC2 16 SER F 1092 ? SER D 3069 . ? 1_555 ? 
212 DC2 16 SER F 1093 ? SER D 3070 . ? 1_555 ? 
213 DC2 16 GLY F 1094 ? GLY D 3071 . ? 1_555 ? 
214 DC2 16 LYS F 1095 ? LYS D 3072 . ? 1_555 ? 
215 DC2 16 THR F 1096 ? THR D 3073 . ? 1_555 ? 
216 DC2 16 THR F 1097 ? THR D 3074 . ? 1_555 ? 
217 DC2 16 ASP F 1123 ? ASP D 3100 . ? 1_555 ? 
218 DC2 16 TYR F 1126 ? TYR D 3103 . ? 1_555 ? 
219 DC2 16 SER F 1263 ? SER D 3240 . ? 1_555 ? 
220 DC2 16 TYR F 1287 ? TYR D 3264 . ? 1_555 ? 
221 DC2 16 ASN F 1621 ? ASN D 4249 . ? 1_555 ? 
222 DC2 16 LYS F 1622 ? LYS D 4250 . ? 1_555 ? 
223 DC2 16 ILE F 1623 ? ILE D 4251 . ? 1_555 ? 
224 DC2 16 ALA F 1624 ? ALA D 4252 . ? 1_555 ? 
225 DC2 16 ALA F 1625 ? ALA D 4253 . ? 1_555 ? 
226 DC2 16 PRO F 1626 ? PRO D 4254 . ? 1_555 ? 
227 DC3 11 LYS E 967  ? LYS A 2294 . ? 1_556 ? 
228 DC3 11 GLY E 968  ? GLY A 2295 . ? 1_556 ? 
229 DC3 11 SER F 1441 ? SER D 4069 . ? 1_555 ? 
230 DC3 11 SER F 1442 ? SER D 4070 . ? 1_555 ? 
231 DC3 11 GLY F 1443 ? GLY D 4071 . ? 1_555 ? 
232 DC3 11 LYS F 1444 ? LYS D 4072 . ? 1_555 ? 
233 DC3 11 THR F 1445 ? THR D 4073 . ? 1_555 ? 
234 DC3 11 THR F 1446 ? THR D 4074 . ? 1_555 ? 
235 DC3 11 ASP F 1472 ? ASP D 4100 . ? 1_555 ? 
236 DC3 11 TYR F 1475 ? TYR D 4103 . ? 1_555 ? 
237 DC3 11 TYR F 1636 ? TYR D 4264 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3CMT 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3CMT 
_atom_sites.fract_transf_matrix[1][1]   0.006289 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.003328 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012484 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
AL 
C  
F  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     P  P     . DT  A  1 4    ? 87.064  4.860   30.280  1.00 54.53 ? 1002 DT  B P     1 
ATOM   2     O  OP1   . DT  A  1 4    ? 86.447  4.376   31.542  1.00 53.72 ? 1002 DT  B OP1   1 
ATOM   3     O  OP2   . DT  A  1 4    ? 88.534  5.038   30.179  1.00 54.01 ? 1002 DT  B OP2   1 
ATOM   4     O  "O5'" . DT  A  1 4    ? 86.377  6.240   29.822  1.00 52.53 ? 1002 DT  B "O5'" 1 
ATOM   5     C  "C5'" . DT  A  1 4    ? 86.185  6.544   28.438  1.00 48.85 ? 1002 DT  B "C5'" 1 
ATOM   6     C  "C4'" . DT  A  1 4    ? 84.744  6.297   28.027  1.00 46.25 ? 1002 DT  B "C4'" 1 
ATOM   7     O  "O4'" . DT  A  1 4    ? 84.368  4.938   28.369  1.00 45.75 ? 1002 DT  B "O4'" 1 
ATOM   8     C  "C3'" . DT  A  1 4    ? 83.695  7.154   28.727  1.00 44.44 ? 1002 DT  B "C3'" 1 
ATOM   9     O  "O3'" . DT  A  1 4    ? 83.531  8.436   28.100  1.00 41.15 ? 1002 DT  B "O3'" 1 
ATOM   10    C  "C2'" . DT  A  1 4    ? 82.440  6.311   28.528  1.00 45.37 ? 1002 DT  B "C2'" 1 
ATOM   11    C  "C1'" . DT  A  1 4    ? 82.955  4.876   28.436  1.00 46.61 ? 1002 DT  B "C1'" 1 
ATOM   12    N  N1    . DT  A  1 4    ? 82.495  3.985   29.570  1.00 47.32 ? 1002 DT  B N1    1 
ATOM   13    C  C2    . DT  A  1 4    ? 81.144  3.659   29.687  1.00 47.34 ? 1002 DT  B C2    1 
ATOM   14    O  O2    . DT  A  1 4    ? 80.271  4.049   28.926  1.00 46.87 ? 1002 DT  B O2    1 
ATOM   15    N  N3    . DT  A  1 4    ? 80.839  2.841   30.751  1.00 47.33 ? 1002 DT  B N3    1 
ATOM   16    C  C4    . DT  A  1 4    ? 81.722  2.323   31.689  1.00 47.39 ? 1002 DT  B C4    1 
ATOM   17    O  O4    . DT  A  1 4    ? 81.344  1.595   32.604  1.00 47.44 ? 1002 DT  B O4    1 
ATOM   18    C  C5    . DT  A  1 4    ? 83.110  2.697   31.514  1.00 47.36 ? 1002 DT  B C5    1 
ATOM   19    C  C7    . DT  A  1 4    ? 84.161  2.202   32.468  1.00 46.97 ? 1002 DT  B C7    1 
ATOM   20    C  C6    . DT  A  1 4    ? 83.424  3.497   30.480  1.00 47.31 ? 1002 DT  B C6    1 
ATOM   21    P  P     . DT  A  1 5    ? 83.871  9.831   28.823  1.00 38.28 ? 1003 DT  B P     1 
ATOM   22    O  OP1   . DT  A  1 5    ? 84.323  10.765  27.776  1.00 38.86 ? 1003 DT  B OP1   1 
ATOM   23    O  OP2   . DT  A  1 5    ? 84.757  9.551   29.976  1.00 39.18 ? 1003 DT  B OP2   1 
ATOM   24    O  "O5'" . DT  A  1 5    ? 82.481  10.410  29.333  1.00 35.63 ? 1003 DT  B "O5'" 1 
ATOM   25    C  "C5'" . DT  A  1 5    ? 81.697  11.140  28.426  1.00 34.63 ? 1003 DT  B "C5'" 1 
ATOM   26    C  "C4'" . DT  A  1 5    ? 80.430  10.380  28.091  1.00 35.47 ? 1003 DT  B "C4'" 1 
ATOM   27    O  "O4'" . DT  A  1 5    ? 80.567  8.989   28.471  1.00 36.95 ? 1003 DT  B "O4'" 1 
ATOM   28    C  "C3'" . DT  A  1 5    ? 79.198  10.884  28.830  1.00 34.40 ? 1003 DT  B "C3'" 1 
ATOM   29    O  "O3'" . DT  A  1 5    ? 78.573  11.870  28.028  1.00 31.20 ? 1003 DT  B "O3'" 1 
ATOM   30    C  "C2'" . DT  A  1 5    ? 78.324  9.642   28.999  1.00 35.50 ? 1003 DT  B "C2'" 1 
ATOM   31    C  "C1'" . DT  A  1 5    ? 79.313  8.478   28.897  1.00 37.69 ? 1003 DT  B "C1'" 1 
ATOM   32    N  N1    . DT  A  1 5    ? 79.498  7.636   30.145  1.00 38.04 ? 1003 DT  B N1    1 
ATOM   33    C  C2    . DT  A  1 5    ? 78.494  6.766   30.529  1.00 38.33 ? 1003 DT  B C2    1 
ATOM   34    O  O2    . DT  A  1 5    ? 77.444  6.639   29.928  1.00 38.38 ? 1003 DT  B O2    1 
ATOM   35    N  N3    . DT  A  1 5    ? 78.762  6.038   31.664  1.00 38.93 ? 1003 DT  B N3    1 
ATOM   36    C  C4    . DT  A  1 5    ? 79.909  6.079   32.442  1.00 38.99 ? 1003 DT  B C4    1 
ATOM   37    O  O4    . DT  A  1 5    ? 80.040  5.373   33.441  1.00 38.89 ? 1003 DT  B O4    1 
ATOM   38    C  C5    . DT  A  1 5    ? 80.927  7.006   31.991  1.00 38.83 ? 1003 DT  B C5    1 
ATOM   39    C  C7    . DT  A  1 5    ? 82.219  7.150   32.750  1.00 38.30 ? 1003 DT  B C7    1 
ATOM   40    C  C6    . DT  A  1 5    ? 80.670  7.726   30.883  1.00 38.42 ? 1003 DT  B C6    1 
ATOM   41    P  P     . DC  A  1 6    ? 77.856  13.137  28.672  1.00 29.17 ? 1004 DC  B P     1 
ATOM   42    O  OP1   . DC  A  1 6    ? 77.936  14.251  27.727  1.00 30.50 ? 1004 DC  B OP1   1 
ATOM   43    O  OP2   . DC  A  1 6    ? 78.361  13.349  30.031  1.00 30.70 ? 1004 DC  B OP2   1 
ATOM   44    O  "O5'" . DC  A  1 6    ? 76.371  12.615  28.809  1.00 30.70 ? 1004 DC  B "O5'" 1 
ATOM   45    C  "C5'" . DC  A  1 6    ? 75.264  13.379  28.515  1.00 35.45 ? 1004 DC  B "C5'" 1 
ATOM   46    C  "C4'" . DC  A  1 6    ? 74.567  12.700  27.357  1.00 39.68 ? 1004 DC  B "C4'" 1 
ATOM   47    O  "O4'" . DC  A  1 6    ? 73.752  11.564  27.764  1.00 41.85 ? 1004 DC  B "O4'" 1 
ATOM   48    C  "C3'" . DC  A  1 6    ? 73.635  13.630  26.611  1.00 41.12 ? 1004 DC  B "C3'" 1 
ATOM   49    O  "O3'" . DC  A  1 6    ? 73.840  13.338  25.243  1.00 40.52 ? 1004 DC  B "O3'" 1 
ATOM   50    C  "C2'" . DC  A  1 6    ? 72.244  13.240  27.122  1.00 42.39 ? 1004 DC  B "C2'" 1 
ATOM   51    C  "C1'" . DC  A  1 6    ? 72.437  11.736  27.270  1.00 44.60 ? 1004 DC  B "C1'" 1 
ATOM   52    N  N1    . DC  A  1 6    ? 71.490  11.044  28.193  1.00 46.72 ? 1004 DC  B N1    1 
ATOM   53    C  C2    . DC  A  1 6    ? 70.513  10.189  27.644  1.00 48.33 ? 1004 DC  B C2    1 
ATOM   54    O  O2    . DC  A  1 6    ? 70.452  10.029  26.408  1.00 48.07 ? 1004 DC  B O2    1 
ATOM   55    N  N3    . DC  A  1 6    ? 69.662  9.557   28.505  1.00 48.28 ? 1004 DC  B N3    1 
ATOM   56    C  C4    . DC  A  1 6    ? 69.769  9.750   29.831  1.00 47.14 ? 1004 DC  B C4    1 
ATOM   57    N  N4    . DC  A  1 6    ? 68.903  9.105   30.621  1.00 47.14 ? 1004 DC  B N4    1 
ATOM   58    C  C5    . DC  A  1 6    ? 70.755  10.614  30.402  1.00 46.75 ? 1004 DC  B C5    1 
ATOM   59    C  C6    . DC  A  1 6    ? 71.586  11.229  29.553  1.00 46.62 ? 1004 DC  B C6    1 
ATOM   60    P  P     . DC  A  1 7    ? 73.474  14.438  24.162  1.00 38.96 ? 1005 DC  B P     1 
ATOM   61    O  OP1   . DC  A  1 7    ? 74.305  14.167  22.956  1.00 38.66 ? 1005 DC  B OP1   1 
ATOM   62    O  OP2   . DC  A  1 7    ? 73.480  15.751  24.857  1.00 37.58 ? 1005 DC  B OP2   1 
ATOM   63    O  "O5'" . DC  A  1 7    ? 71.967  14.042  23.830  1.00 38.03 ? 1005 DC  B "O5'" 1 
ATOM   64    C  "C5'" . DC  A  1 7    ? 71.710  12.768  23.308  1.00 38.82 ? 1005 DC  B "C5'" 1 
ATOM   65    C  "C4'" . DC  A  1 7    ? 70.252  12.666  22.943  1.00 40.01 ? 1005 DC  B "C4'" 1 
ATOM   66    O  "O4'" . DC  A  1 7    ? 69.557  11.948  23.982  1.00 42.11 ? 1005 DC  B "O4'" 1 
ATOM   67    C  "C3'" . DC  A  1 7    ? 69.514  13.983  22.776  1.00 39.83 ? 1005 DC  B "C3'" 1 
ATOM   68    O  "O3'" . DC  A  1 7    ? 68.711  13.779  21.662  1.00 39.61 ? 1005 DC  B "O3'" 1 
ATOM   69    C  "C2'" . DC  A  1 7    ? 68.646  14.119  24.020  1.00 41.26 ? 1005 DC  B "C2'" 1 
ATOM   70    C  "C1'" . DC  A  1 7    ? 68.383  12.650  24.336  1.00 43.24 ? 1005 DC  B "C1'" 1 
ATOM   71    N  N1    . DC  A  1 7    ? 68.098  12.331  25.772  1.00 44.67 ? 1005 DC  B N1    1 
ATOM   72    C  C2    . DC  A  1 7    ? 67.309  11.206  26.089  1.00 45.08 ? 1005 DC  B C2    1 
ATOM   73    O  O2    . DC  A  1 7    ? 66.850  10.494  25.180  1.00 45.16 ? 1005 DC  B O2    1 
ATOM   74    N  N3    . DC  A  1 7    ? 67.072  10.933  27.401  1.00 44.33 ? 1005 DC  B N3    1 
ATOM   75    C  C4    . DC  A  1 7    ? 67.584  11.719  28.351  1.00 43.65 ? 1005 DC  B C4    1 
ATOM   76    N  N4    . DC  A  1 7    ? 67.323  11.413  29.616  1.00 44.13 ? 1005 DC  B N4    1 
ATOM   77    C  C5    . DC  A  1 7    ? 68.399  12.852  28.055  1.00 44.50 ? 1005 DC  B C5    1 
ATOM   78    C  C6    . DC  A  1 7    ? 68.625  13.118  26.765  1.00 44.79 ? 1005 DC  B C6    1 
ATOM   79    P  P     . DC  A  1 8    ? 68.357  14.957  20.665  1.00 39.44 ? 1006 DC  B P     1 
ATOM   80    O  OP1   . DC  A  1 8    ? 67.905  14.296  19.410  1.00 37.01 ? 1006 DC  B OP1   1 
ATOM   81    O  OP2   . DC  A  1 8    ? 69.487  15.930  20.685  1.00 38.79 ? 1006 DC  B OP2   1 
ATOM   82    O  "O5'" . DC  A  1 8    ? 67.129  15.657  21.418  1.00 41.86 ? 1006 DC  B "O5'" 1 
ATOM   83    C  "C5'" . DC  A  1 8    ? 65.830  15.715  20.844  1.00 44.44 ? 1006 DC  B "C5'" 1 
ATOM   84    C  "C4'" . DC  A  1 8    ? 64.778  15.518  21.924  1.00 46.08 ? 1006 DC  B "C4'" 1 
ATOM   85    O  "O4'" . DC  A  1 8    ? 65.341  14.904  23.103  1.00 47.50 ? 1006 DC  B "O4'" 1 
ATOM   86    C  "C3'" . DC  A  1 8    ? 64.163  16.774  22.520  1.00 44.77 ? 1006 DC  B "C3'" 1 
ATOM   87    O  "O3'" . DC  A  1 8    ? 63.168  17.272  21.650  1.00 42.59 ? 1006 DC  B "O3'" 1 
ATOM   88    C  "C2'" . DC  A  1 8    ? 63.529  16.236  23.794  1.00 45.37 ? 1006 DC  B "C2'" 1 
ATOM   89    C  "C1'" . DC  A  1 8    ? 64.248  14.899  23.988  1.00 46.51 ? 1006 DC  B "C1'" 1 
ATOM   90    N  N1    . DC  A  1 8    ? 64.697  14.688  25.395  1.00 47.81 ? 1006 DC  B N1    1 
ATOM   91    C  C2    . DC  A  1 8    ? 64.241  13.536  26.073  1.00 47.53 ? 1006 DC  B C2    1 
ATOM   92    O  O2    . DC  A  1 8    ? 63.499  12.731  25.477  1.00 46.23 ? 1006 DC  B O2    1 
ATOM   93    N  N3    . DC  A  1 8    ? 64.636  13.351  27.370  1.00 46.28 ? 1006 DC  B N3    1 
ATOM   94    C  C4    . DC  A  1 8    ? 65.424  14.254  27.968  1.00 45.32 ? 1006 DC  B C4    1 
ATOM   95    N  N4    . DC  A  1 8    ? 65.769  14.026  29.233  1.00 44.95 ? 1006 DC  B N4    1 
ATOM   96    C  C5    . DC  A  1 8    ? 65.893  15.427  27.293  1.00 46.12 ? 1006 DC  B C5    1 
ATOM   97    C  C6    . DC  A  1 8    ? 65.513  15.610  26.019  1.00 46.87 ? 1006 DC  B C6    1 
ATOM   98    P  P     . DA  A  1 9    ? 63.131  18.829  21.329  1.00 39.04 ? 1007 DA  B P     1 
ATOM   99    O  OP1   . DA  A  1 9    ? 62.914  18.988  19.873  1.00 35.73 ? 1007 DA  B OP1   1 
ATOM   100   O  OP2   . DA  A  1 9    ? 64.273  19.474  22.021  1.00 40.29 ? 1007 DA  B OP2   1 
ATOM   101   O  "O5'" . DA  A  1 9    ? 61.845  19.260  22.151  1.00 40.47 ? 1007 DA  B "O5'" 1 
ATOM   102   C  "C5'" . DA  A  1 9    ? 60.612  18.995  21.587  1.00 40.53 ? 1007 DA  B "C5'" 1 
ATOM   103   C  "C4'" . DA  A  1 9    ? 59.780  18.002  22.353  1.00 39.08 ? 1007 DA  B "C4'" 1 
ATOM   104   O  "O4'" . DA  A  1 9    ? 59.792  18.173  23.788  1.00 39.17 ? 1007 DA  B "O4'" 1 
ATOM   105   C  "C3'" . DA  A  1 9    ? 58.350  18.266  21.936  1.00 40.54 ? 1007 DA  B "C3'" 1 
ATOM   106   O  "O3'" . DA  A  1 9    ? 57.951  17.163  21.186  1.00 43.01 ? 1007 DA  B "O3'" 1 
ATOM   107   C  "C2'" . DA  A  1 9    ? 57.529  18.446  23.217  1.00 41.34 ? 1007 DA  B "C2'" 1 
ATOM   108   C  "C1'" . DA  A  1 9    ? 58.479  17.832  24.220  1.00 41.05 ? 1007 DA  B "C1'" 1 
ATOM   109   N  N9    . DA  A  1 9    ? 58.274  18.145  25.634  1.00 41.68 ? 1007 DA  B N9    1 
ATOM   110   C  C8    . DA  A  1 9    ? 58.763  19.195  26.368  1.00 41.57 ? 1007 DA  B C8    1 
ATOM   111   N  N7    . DA  A  1 9    ? 58.428  19.159  27.643  1.00 40.75 ? 1007 DA  B N7    1 
ATOM   112   C  C5    . DA  A  1 9    ? 57.671  18.007  27.757  1.00 41.12 ? 1007 DA  B C5    1 
ATOM   113   C  C6    . DA  A  1 9    ? 57.015  17.385  28.850  1.00 40.75 ? 1007 DA  B C6    1 
ATOM   114   N  N6    . DA  A  1 9    ? 57.019  17.873  30.080  1.00 40.22 ? 1007 DA  B N6    1 
ATOM   115   N  N1    . DA  A  1 9    ? 56.337  16.232  28.626  1.00 41.91 ? 1007 DA  B N1    1 
ATOM   116   C  C2    . DA  A  1 9    ? 56.319  15.735  27.368  1.00 42.14 ? 1007 DA  B C2    1 
ATOM   117   N  N3    . DA  A  1 9    ? 56.898  16.223  26.253  1.00 41.12 ? 1007 DA  B N3    1 
ATOM   118   C  C4    . DA  A  1 9    ? 57.563  17.370  26.521  1.00 41.80 ? 1007 DA  B C4    1 
ATOM   119   P  P     . DC  A  1 10   ? 56.803  17.415  20.133  1.00 43.30 ? 1008 DC  B P     1 
ATOM   120   O  OP1   . DC  A  1 10   ? 56.683  16.270  19.178  1.00 42.00 ? 1008 DC  B OP1   1 
ATOM   121   O  OP2   . DC  A  1 10   ? 56.953  18.827  19.676  1.00 39.62 ? 1008 DC  B OP2   1 
ATOM   122   O  "O5'" . DC  A  1 10   ? 55.600  17.294  21.169  1.00 42.15 ? 1008 DC  B "O5'" 1 
ATOM   123   C  "C5'" . DC  A  1 10   ? 55.013  16.043  21.386  1.00 43.37 ? 1008 DC  B "C5'" 1 
ATOM   124   C  "C4'" . DC  A  1 10   ? 53.837  16.230  22.311  1.00 43.98 ? 1008 DC  B "C4'" 1 
ATOM   125   O  "O4'" . DC  A  1 10   ? 54.343  16.681  23.588  1.00 44.67 ? 1008 DC  B "O4'" 1 
ATOM   126   C  "C3'" . DC  A  1 10   ? 52.821  17.289  21.885  1.00 43.74 ? 1008 DC  B "C3'" 1 
ATOM   127   O  "O3'" . DC  A  1 10   ? 51.538  16.694  21.904  1.00 43.37 ? 1008 DC  B "O3'" 1 
ATOM   128   C  "C2'" . DC  A  1 10   ? 52.940  18.369  22.961  1.00 43.45 ? 1008 DC  B "C2'" 1 
ATOM   129   C  "C1'" . DC  A  1 10   ? 53.321  17.469  24.124  1.00 42.25 ? 1008 DC  B "C1'" 1 
ATOM   130   N  N1    . DC  A  1 10   ? 53.834  18.134  25.315  1.00 42.00 ? 1008 DC  B N1    1 
ATOM   131   C  C2    . DC  A  1 10   ? 53.446  17.616  26.554  1.00 42.58 ? 1008 DC  B C2    1 
ATOM   132   O  O2    . DC  A  1 10   ? 52.698  16.616  26.594  1.00 41.80 ? 1008 DC  B O2    1 
ATOM   133   N  N3    . DC  A  1 10   ? 53.915  18.243  27.666  1.00 42.13 ? 1008 DC  B N3    1 
ATOM   134   C  C4    . DC  A  1 10   ? 54.719  19.305  27.552  1.00 40.82 ? 1008 DC  B C4    1 
ATOM   135   N  N4    . DC  A  1 10   ? 55.154  19.875  28.674  1.00 41.54 ? 1008 DC  B N4    1 
ATOM   136   C  C5    . DC  A  1 10   ? 55.127  19.827  26.294  1.00 40.93 ? 1008 DC  B C5    1 
ATOM   137   C  C6    . DC  A  1 10   ? 54.660  19.216  25.206  1.00 41.29 ? 1008 DC  B C6    1 
ATOM   138   P  P     . DC  A  1 11   ? 50.745  16.424  20.554  1.00 42.39 ? 1009 DC  B P     1 
ATOM   139   O  OP1   . DC  A  1 11   ? 50.378  14.980  20.505  1.00 43.12 ? 1009 DC  B OP1   1 
ATOM   140   O  OP2   . DC  A  1 11   ? 51.509  17.111  19.466  1.00 43.04 ? 1009 DC  B OP2   1 
ATOM   141   O  "O5'" . DC  A  1 11   ? 49.359  17.170  20.843  1.00 42.84 ? 1009 DC  B "O5'" 1 
ATOM   142   C  "C5'" . DC  A  1 11   ? 49.293  18.580  21.027  1.00 40.10 ? 1009 DC  B "C5'" 1 
ATOM   143   C  "C4'" . DC  A  1 11   ? 48.548  18.874  22.305  1.00 37.69 ? 1009 DC  B "C4'" 1 
ATOM   144   O  "O4'" . DC  A  1 11   ? 49.504  18.839  23.368  1.00 37.04 ? 1009 DC  B "O4'" 1 
ATOM   145   C  "C3'" . DC  A  1 11   ? 47.919  20.255  22.393  1.00 37.23 ? 1009 DC  B "C3'" 1 
ATOM   146   O  "O3'" . DC  A  1 11   ? 46.580  20.169  21.903  1.00 37.11 ? 1009 DC  B "O3'" 1 
ATOM   147   C  "C2'" . DC  A  1 11   ? 47.953  20.580  23.886  1.00 35.29 ? 1009 DC  B "C2'" 1 
ATOM   148   C  "C1'" . DC  A  1 11   ? 48.999  19.609  24.431  1.00 35.99 ? 1009 DC  B "C1'" 1 
ATOM   149   N  N1    . DC  A  1 11   ? 50.122  20.302  25.099  1.00 36.05 ? 1009 DC  B N1    1 
ATOM   150   C  C2    . DC  A  1 11   ? 50.341  20.066  26.471  1.00 36.75 ? 1009 DC  B C2    1 
ATOM   151   O  O2    . DC  A  1 11   ? 49.609  19.283  27.091  1.00 36.05 ? 1009 DC  B O2    1 
ATOM   152   N  N3    . DC  A  1 11   ? 51.358  20.717  27.097  1.00 37.17 ? 1009 DC  B N3    1 
ATOM   153   C  C4    . DC  A  1 11   ? 52.122  21.558  26.405  1.00 35.57 ? 1009 DC  B C4    1 
ATOM   154   N  N4    . DC  A  1 11   ? 53.099  22.161  27.067  1.00 35.03 ? 1009 DC  B N4    1 
ATOM   155   C  C5    . DC  A  1 11   ? 51.921  21.805  25.009  1.00 36.52 ? 1009 DC  B C5    1 
ATOM   156   C  C6    . DC  A  1 11   ? 50.922  21.162  24.389  1.00 35.47 ? 1009 DC  B C6    1 
ATOM   157   P  P     . DT  A  1 12   ? 46.070  21.175  20.783  1.00 35.13 ? 1010 DT  B P     1 
ATOM   158   O  OP1   . DT  A  1 12   ? 45.035  20.488  19.987  1.00 36.02 ? 1010 DT  B OP1   1 
ATOM   159   O  OP2   . DT  A  1 12   ? 47.238  21.798  20.133  1.00 33.91 ? 1010 DT  B OP2   1 
ATOM   160   O  "O5'" . DT  A  1 12   ? 45.398  22.287  21.709  1.00 38.99 ? 1010 DT  B "O5'" 1 
ATOM   161   C  "C5'" . DT  A  1 12   ? 44.101  22.149  22.255  1.00 39.72 ? 1010 DT  B "C5'" 1 
ATOM   162   C  "C4'" . DT  A  1 12   ? 44.089  22.126  23.767  1.00 41.69 ? 1010 DT  B "C4'" 1 
ATOM   163   O  "O4'" . DT  A  1 12   ? 44.973  23.060  24.439  1.00 42.26 ? 1010 DT  B "O4'" 1 
ATOM   164   C  "C3'" . DT  A  1 12   ? 42.710  22.445  24.273  1.00 44.65 ? 1010 DT  B "C3'" 1 
ATOM   165   O  "O3'" . DT  A  1 12   ? 42.312  21.267  24.897  1.00 50.26 ? 1010 DT  B "O3'" 1 
ATOM   166   C  "C2'" . DT  A  1 12   ? 42.898  23.512  25.330  1.00 44.17 ? 1010 DT  B "C2'" 1 
ATOM   167   C  "C1'" . DT  A  1 12   ? 44.377  23.470  25.653  1.00 44.69 ? 1010 DT  B "C1'" 1 
ATOM   168   N  N1    . DT  A  1 12   ? 44.858  24.836  26.100  1.00 45.69 ? 1010 DT  B N1    1 
ATOM   169   C  C2    . DT  A  1 12   ? 44.734  25.257  27.433  1.00 46.15 ? 1010 DT  B C2    1 
ATOM   170   O  O2    . DT  A  1 12   ? 44.284  24.613  28.371  1.00 46.64 ? 1010 DT  B O2    1 
ATOM   171   N  N3    . DT  A  1 12   ? 45.199  26.517  27.679  1.00 46.07 ? 1010 DT  B N3    1 
ATOM   172   C  C4    . DT  A  1 12   ? 45.750  27.392  26.758  1.00 47.26 ? 1010 DT  B C4    1 
ATOM   173   O  O4    . DT  A  1 12   ? 46.140  28.515  27.086  1.00 48.50 ? 1010 DT  B O4    1 
ATOM   174   C  C5    . DT  A  1 12   ? 45.838  26.915  25.394  1.00 46.45 ? 1010 DT  B C5    1 
ATOM   175   C  C7    . DT  A  1 12   ? 46.416  27.799  24.321  1.00 46.05 ? 1010 DT  B C7    1 
ATOM   176   C  C6    . DT  A  1 12   ? 45.391  25.681  25.138  1.00 45.47 ? 1010 DT  B C6    1 
ATOM   177   P  P     . DT  A  1 13   ? 40.848  20.699  24.674  1.00 51.12 ? 1011 DT  B P     1 
ATOM   178   O  OP1   . DT  A  1 13   ? 40.924  19.274  25.083  1.00 47.79 ? 1011 DT  B OP1   1 
ATOM   179   O  OP2   . DT  A  1 13   ? 40.372  21.159  23.337  1.00 50.74 ? 1011 DT  B OP2   1 
ATOM   180   O  "O5'" . DT  A  1 13   ? 40.017  21.541  25.759  1.00 51.03 ? 1011 DT  B "O5'" 1 
ATOM   181   C  "C5'" . DT  A  1 13   ? 39.989  21.147  27.120  1.00 48.05 ? 1011 DT  B "C5'" 1 
ATOM   182   C  "C4'" . DT  A  1 13   ? 39.632  22.359  27.925  1.00 45.47 ? 1011 DT  B "C4'" 1 
ATOM   183   O  "O4'" . DT  A  1 13   ? 40.624  23.360  27.669  1.00 45.38 ? 1011 DT  B "O4'" 1 
ATOM   184   C  "C3'" . DT  A  1 13   ? 38.327  23.026  27.527  1.00 43.42 ? 1011 DT  B "C3'" 1 
ATOM   185   O  "O3'" . DT  A  1 13   ? 37.355  22.589  28.429  1.00 40.46 ? 1011 DT  B "O3'" 1 
ATOM   186   C  "C2'" . DT  A  1 13   ? 38.580  24.514  27.726  1.00 43.97 ? 1011 DT  B "C2'" 1 
ATOM   187   C  "C1'" . DT  A  1 13   ? 40.047  24.559  28.120  1.00 46.74 ? 1011 DT  B "C1'" 1 
ATOM   188   N  N1    . DT  A  1 13   ? 40.805  25.670  27.519  1.00 47.45 ? 1011 DT  B N1    1 
ATOM   189   C  C2    . DT  A  1 13   ? 41.376  26.580  28.373  1.00 48.04 ? 1011 DT  B C2    1 
ATOM   190   O  O2    . DT  A  1 13   ? 41.259  26.492  29.578  1.00 48.75 ? 1011 DT  B O2    1 
ATOM   191   N  N3    . DT  A  1 13   ? 42.082  27.589  27.761  1.00 48.21 ? 1011 DT  B N3    1 
ATOM   192   C  C4    . DT  A  1 13   ? 42.260  27.763  26.397  1.00 48.94 ? 1011 DT  B C4    1 
ATOM   193   O  O4    . DT  A  1 13   ? 42.901  28.703  25.946  1.00 48.50 ? 1011 DT  B O4    1 
ATOM   194   C  C5    . DT  A  1 13   ? 41.641  26.765  25.544  1.00 50.24 ? 1011 DT  B C5    1 
ATOM   195   C  C7    . DT  A  1 13   ? 41.780  26.857  24.042  1.00 49.68 ? 1011 DT  B C7    1 
ATOM   196   C  C6    . DT  A  1 13   ? 40.944  25.774  26.143  1.00 49.33 ? 1011 DT  B C6    1 
ATOM   197   P  P     . DT  A  1 14   ? 35.908  22.201  27.912  1.00 37.65 ? 1012 DT  B P     1 
ATOM   198   O  OP1   . DT  A  1 14   ? 35.191  21.602  29.055  1.00 37.40 ? 1012 DT  B OP1   1 
ATOM   199   O  OP2   . DT  A  1 14   ? 36.088  21.455  26.646  1.00 36.96 ? 1012 DT  B OP2   1 
ATOM   200   O  "O5'" . DT  A  1 14   ? 35.246  23.625  27.600  1.00 38.23 ? 1012 DT  B "O5'" 1 
ATOM   201   C  "C5'" . DT  A  1 14   ? 34.054  24.066  28.233  1.00 36.37 ? 1012 DT  B "C5'" 1 
ATOM   202   C  "C4'" . DT  A  1 14   ? 34.247  25.464  28.767  1.00 35.57 ? 1012 DT  B "C4'" 1 
ATOM   203   O  "O4'" . DT  A  1 14   ? 35.643  25.794  28.704  1.00 38.70 ? 1012 DT  B "O4'" 1 
ATOM   204   C  "C3'" . DT  A  1 14   ? 33.606  26.550  27.944  1.00 34.14 ? 1012 DT  B "C3'" 1 
ATOM   205   O  "O3'" . DT  A  1 14   ? 32.280  26.627  28.340  1.00 30.72 ? 1012 DT  B "O3'" 1 
ATOM   206   C  "C2'" . DT  A  1 14   ? 34.387  27.770  28.401  1.00 38.08 ? 1012 DT  B "C2'" 1 
ATOM   207   C  "C1'" . DT  A  1 14   ? 35.782  27.195  28.636  1.00 43.47 ? 1012 DT  B "C1'" 1 
ATOM   208   N  N1    . DT  A  1 14   ? 36.771  27.541  27.559  1.00 46.36 ? 1012 DT  B N1    1 
ATOM   209   C  C2    . DT  A  1 14   ? 37.680  28.582  27.777  1.00 47.84 ? 1012 DT  B C2    1 
ATOM   210   O  O2    . DT  A  1 14   ? 37.724  29.240  28.806  1.00 47.67 ? 1012 DT  B O2    1 
ATOM   211   N  N3    . DT  A  1 14   ? 38.548  28.837  26.727  1.00 49.10 ? 1012 DT  B N3    1 
ATOM   212   C  C4    . DT  A  1 14   ? 38.606  28.150  25.504  1.00 49.40 ? 1012 DT  B C4    1 
ATOM   213   O  O4    . DT  A  1 14   ? 39.432  28.471  24.634  1.00 48.28 ? 1012 DT  B O4    1 
ATOM   214   C  C5    . DT  A  1 14   ? 37.632  27.055  25.341  1.00 49.44 ? 1012 DT  B C5    1 
ATOM   215   C  C7    . DT  A  1 14   ? 37.568  26.221  24.080  1.00 47.69 ? 1012 DT  B C7    1 
ATOM   216   C  C6    . DT  A  1 14   ? 36.772  26.819  26.362  1.00 47.86 ? 1012 DT  B C6    1 
ATOM   217   P  P     . DT  A  1 15   ? 31.109  26.667  27.268  1.00 27.72 ? 1013 DT  B P     1 
ATOM   218   O  OP1   . DT  A  1 15   ? 29.923  25.979  27.807  1.00 27.27 ? 1013 DT  B OP1   1 
ATOM   219   O  OP2   . DT  A  1 15   ? 31.655  26.166  26.011  1.00 28.09 ? 1013 DT  B OP2   1 
ATOM   220   O  "O5'" . DT  A  1 15   ? 30.855  28.246  27.153  1.00 31.68 ? 1013 DT  B "O5'" 1 
ATOM   221   C  "C5'" . DT  A  1 15   ? 29.723  28.897  27.739  1.00 35.91 ? 1013 DT  B "C5'" 1 
ATOM   222   C  "C4'" . DT  A  1 15   ? 30.144  29.937  28.757  1.00 39.91 ? 1013 DT  B "C4'" 1 
ATOM   223   O  "O4'" . DT  A  1 15   ? 31.235  30.731  28.234  1.00 42.67 ? 1013 DT  B "O4'" 1 
ATOM   224   C  "C3'" . DT  A  1 15   ? 29.078  30.958  29.117  1.00 40.94 ? 1013 DT  B "C3'" 1 
ATOM   225   O  "O3'" . DT  A  1 15   ? 28.255  30.463  30.161  1.00 40.84 ? 1013 DT  B "O3'" 1 
ATOM   226   C  "C2'" . DT  A  1 15   ? 29.912  32.122  29.630  1.00 42.53 ? 1013 DT  B "C2'" 1 
ATOM   227   C  "C1'" . DT  A  1 15   ? 31.277  31.948  28.957  1.00 45.78 ? 1013 DT  B "C1'" 1 
ATOM   228   N  N1    . DT  A  1 15   ? 31.644  33.100  28.041  1.00 47.71 ? 1013 DT  B N1    1 
ATOM   229   C  C2    . DT  A  1 15   ? 31.872  34.376  28.567  1.00 48.32 ? 1013 DT  B C2    1 
ATOM   230   O  O2    . DT  A  1 15   ? 31.809  34.663  29.751  1.00 48.54 ? 1013 DT  B O2    1 
ATOM   231   N  N3    . DT  A  1 15   ? 32.186  35.348  27.647  1.00 48.32 ? 1013 DT  B N3    1 
ATOM   232   C  C4    . DT  A  1 15   ? 32.302  35.186  26.278  1.00 48.34 ? 1013 DT  B C4    1 
ATOM   233   O  O4    . DT  A  1 15   ? 32.593  36.128  25.547  1.00 48.27 ? 1013 DT  B O4    1 
ATOM   234   C  C5    . DT  A  1 15   ? 32.058  33.843  25.786  1.00 49.00 ? 1013 DT  B C5    1 
ATOM   235   C  C7    . DT  A  1 15   ? 32.149  33.553  24.318  1.00 48.52 ? 1013 DT  B C7    1 
ATOM   236   C  C6    . DT  A  1 15   ? 31.745  32.877  26.673  1.00 48.67 ? 1013 DT  B C6    1 
ATOM   237   P  P     . DG  B  2 1    ? 49.626  22.521  38.852  0.00 81.42 ? 2007 DG  C P     1 
ATOM   238   O  OP1   . DG  B  2 1    ? 49.222  22.812  40.248  0.00 78.69 ? 2007 DG  C OP1   1 
ATOM   239   O  OP2   . DG  B  2 1    ? 50.220  23.628  38.018  0.00 81.26 ? 2007 DG  C OP2   1 
ATOM   240   O  "O5'" . DG  B  2 1    ? 49.039  22.237  37.920  1.00 50.22 ? 2007 DG  C "O5'" 1 
ATOM   241   C  "C5'" . DG  B  2 1    ? 48.464  20.950  37.729  1.00 49.69 ? 2007 DG  C "C5'" 1 
ATOM   242   C  "C4'" . DG  B  2 1    ? 49.238  20.063  36.742  1.00 50.86 ? 2007 DG  C "C4'" 1 
ATOM   243   O  "O4'" . DG  B  2 1    ? 49.705  20.748  35.540  1.00 50.38 ? 2007 DG  C "O4'" 1 
ATOM   244   C  "C3'" . DG  B  2 1    ? 50.486  19.334  37.250  1.00 50.53 ? 2007 DG  C "C3'" 1 
ATOM   245   O  "O3'" . DG  B  2 1    ? 50.256  17.947  37.079  1.00 50.98 ? 2007 DG  C "O3'" 1 
ATOM   246   C  "C2'" . DG  B  2 1    ? 51.609  19.768  36.305  1.00 48.51 ? 2007 DG  C "C2'" 1 
ATOM   247   C  "C1'" . DG  B  2 1    ? 50.780  19.980  35.048  1.00 46.86 ? 2007 DG  C "C1'" 1 
ATOM   248   N  N9    . DG  B  2 1    ? 51.427  20.694  33.955  1.00 46.07 ? 2007 DG  C N9    1 
ATOM   249   C  C8    . DG  B  2 1    ? 52.236  21.786  34.069  1.00 46.03 ? 2007 DG  C C8    1 
ATOM   250   N  N7    . DG  B  2 1    ? 52.686  22.218  32.927  1.00 46.69 ? 2007 DG  C N7    1 
ATOM   251   C  C5    . DG  B  2 1    ? 52.138  21.362  31.987  1.00 46.13 ? 2007 DG  C C5    1 
ATOM   252   C  C6    . DG  B  2 1    ? 52.272  21.346  30.577  1.00 45.20 ? 2007 DG  C C6    1 
ATOM   253   O  O6    . DG  B  2 1    ? 52.914  22.098  29.846  1.00 44.92 ? 2007 DG  C O6    1 
ATOM   254   N  N1    . DG  B  2 1    ? 51.560  20.317  29.999  1.00 45.36 ? 2007 DG  C N1    1 
ATOM   255   C  C2    . DG  B  2 1    ? 50.813  19.415  30.698  1.00 45.17 ? 2007 DG  C C2    1 
ATOM   256   N  N2    . DG  B  2 1    ? 50.196  18.501  29.959  1.00 45.97 ? 2007 DG  C N2    1 
ATOM   257   N  N3    . DG  B  2 1    ? 50.670  19.406  32.010  1.00 45.72 ? 2007 DG  C N3    1 
ATOM   258   C  C4    . DG  B  2 1    ? 51.357  20.414  32.603  1.00 46.33 ? 2007 DG  C C4    1 
ATOM   259   P  P     . DG  B  2 2    ? 50.673  16.900  38.207  1.00 49.80 ? 2008 DG  C P     1 
ATOM   260   O  OP1   . DG  B  2 2    ? 50.130  17.402  39.490  1.00 49.04 ? 2008 DG  C OP1   1 
ATOM   261   O  OP2   . DG  B  2 2    ? 52.123  16.611  38.018  1.00 48.14 ? 2008 DG  C OP2   1 
ATOM   262   O  "O5'" . DG  B  2 2    ? 49.795  15.609  37.841  1.00 48.79 ? 2008 DG  C "O5'" 1 
ATOM   263   C  "C5'" . DG  B  2 2    ? 49.044  15.552  36.634  1.00 46.41 ? 2008 DG  C "C5'" 1 
ATOM   264   C  "C4'" . DG  B  2 2    ? 49.653  14.601  35.614  1.00 44.48 ? 2008 DG  C "C4'" 1 
ATOM   265   O  "O4'" . DG  B  2 2    ? 50.381  15.336  34.606  1.00 44.36 ? 2008 DG  C "O4'" 1 
ATOM   266   C  "C3'" . DG  B  2 2    ? 50.633  13.555  36.114  1.00 43.46 ? 2008 DG  C "C3'" 1 
ATOM   267   O  "O3'" . DG  B  2 2    ? 50.340  12.403  35.373  1.00 42.72 ? 2008 DG  C "O3'" 1 
ATOM   268   C  "C2'" . DG  B  2 2    ? 52.000  14.132  35.750  1.00 43.66 ? 2008 DG  C "C2'" 1 
ATOM   269   C  "C1'" . DG  B  2 2    ? 51.652  14.749  34.407  1.00 45.01 ? 2008 DG  C "C1'" 1 
ATOM   270   N  N9    . DG  B  2 2    ? 52.448  15.878  33.949  1.00 45.96 ? 2008 DG  C N9    1 
ATOM   271   C  C8    . DG  B  2 2    ? 53.056  16.832  34.734  1.00 46.32 ? 2008 DG  C C8    1 
ATOM   272   N  N7    . DG  B  2 2    ? 53.675  17.747  34.035  1.00 47.11 ? 2008 DG  C N7    1 
ATOM   273   C  C5    . DG  B  2 2    ? 53.444  17.391  32.709  1.00 45.79 ? 2008 DG  C C5    1 
ATOM   274   C  C6    . DG  B  2 2    ? 53.867  18.022  31.522  1.00 44.55 ? 2008 DG  C C6    1 
ATOM   275   O  O6    . DG  B  2 2    ? 54.543  19.047  31.413  1.00 45.08 ? 2008 DG  C O6    1 
ATOM   276   N  N1    . DG  B  2 2    ? 53.435  17.351  30.390  1.00 44.65 ? 2008 DG  C N1    1 
ATOM   277   C  C2    . DG  B  2 2    ? 52.681  16.205  30.405  1.00 45.62 ? 2008 DG  C C2    1 
ATOM   278   N  N2    . DG  B  2 2    ? 52.356  15.710  29.205  1.00 45.91 ? 2008 DG  C N2    1 
ATOM   279   N  N3    . DG  B  2 2    ? 52.270  15.591  31.511  1.00 45.69 ? 2008 DG  C N3    1 
ATOM   280   C  C4    . DG  B  2 2    ? 52.686  16.242  32.633  1.00 45.97 ? 2008 DG  C C4    1 
ATOM   281   P  P     . DT  B  2 3    ? 50.900  10.979  35.802  1.00 43.67 ? 2009 DT  C P     1 
ATOM   282   O  OP1   . DT  B  2 3    ? 49.796  10.005  35.673  1.00 44.66 ? 2009 DT  C OP1   1 
ATOM   283   O  OP2   . DT  B  2 3    ? 51.579  11.112  37.109  1.00 44.83 ? 2009 DT  C OP2   1 
ATOM   284   O  "O5'" . DT  B  2 3    ? 51.956  10.668  34.644  1.00 44.26 ? 2009 DT  C "O5'" 1 
ATOM   285   C  "C5'" . DT  B  2 3    ? 51.468  10.283  33.368  1.00 45.73 ? 2009 DT  C "C5'" 1 
ATOM   286   C  "C4'" . DT  B  2 3    ? 52.509  10.475  32.286  1.00 47.94 ? 2009 DT  C "C4'" 1 
ATOM   287   O  "O4'" . DT  B  2 3    ? 52.920  11.852  32.146  1.00 49.11 ? 2009 DT  C "O4'" 1 
ATOM   288   C  "C3'" . DT  B  2 3    ? 53.796  9.733   32.540  1.00 48.48 ? 2009 DT  C "C3'" 1 
ATOM   289   O  "O3'" . DT  B  2 3    ? 53.611  8.503   31.902  1.00 52.61 ? 2009 DT  C "O3'" 1 
ATOM   290   C  "C2'" . DT  B  2 3    ? 54.868  10.580  31.856  1.00 47.96 ? 2009 DT  C "C2'" 1 
ATOM   291   C  "C1'" . DT  B  2 3    ? 54.133  11.842  31.424  1.00 49.05 ? 2009 DT  C "C1'" 1 
ATOM   292   N  N1    . DT  B  2 3    ? 54.869  13.122  31.698  1.00 49.10 ? 2009 DT  C N1    1 
ATOM   293   C  C2    . DT  B  2 3    ? 55.186  14.006  30.661  1.00 49.51 ? 2009 DT  C C2    1 
ATOM   294   O  O2    . DT  B  2 3    ? 54.921  13.835  29.474  1.00 49.19 ? 2009 DT  C O2    1 
ATOM   295   N  N3    . DT  B  2 3    ? 55.853  15.138  31.062  1.00 48.40 ? 2009 DT  C N3    1 
ATOM   296   C  C4    . DT  B  2 3    ? 56.219  15.463  32.359  1.00 49.65 ? 2009 DT  C C4    1 
ATOM   297   O  O4    . DT  B  2 3    ? 56.818  16.505  32.628  1.00 51.05 ? 2009 DT  C O4    1 
ATOM   298   C  C5    . DT  B  2 3    ? 55.858  14.503  33.379  1.00 48.77 ? 2009 DT  C C5    1 
ATOM   299   C  C7    . DT  B  2 3    ? 56.200  14.743  34.822  1.00 49.27 ? 2009 DT  C C7    1 
ATOM   300   C  C6    . DT  B  2 3    ? 55.212  13.399  33.004  1.00 48.10 ? 2009 DT  C C6    1 
ATOM   301   P  P     . DG  B  2 4    ? 54.551  7.266   32.250  1.00 56.26 ? 2010 DG  C P     1 
ATOM   302   O  OP1   . DG  B  2 4    ? 54.676  6.448   31.013  1.00 54.80 ? 2010 DG  C OP1   1 
ATOM   303   O  OP2   . DG  B  2 4    ? 54.053  6.655   33.508  1.00 55.77 ? 2010 DG  C OP2   1 
ATOM   304   O  "O5'" . DG  B  2 4    ? 55.932  8.023   32.575  1.00 57.21 ? 2010 DG  C "O5'" 1 
ATOM   305   C  "C5'" . DG  B  2 4    ? 57.114  7.331   32.877  1.00 59.12 ? 2010 DG  C "C5'" 1 
ATOM   306   C  "C4'" . DG  B  2 4    ? 57.782  6.990   31.563  1.00 60.90 ? 2010 DG  C "C4'" 1 
ATOM   307   O  "O4'" . DG  B  2 4    ? 58.521  8.129   31.042  1.00 61.97 ? 2010 DG  C "O4'" 1 
ATOM   308   C  "C3'" . DG  B  2 4    ? 58.759  5.838   31.668  1.00 61.68 ? 2010 DG  C "C3'" 1 
ATOM   309   O  "O3'" . DG  B  2 4    ? 58.612  5.060   30.511  1.00 62.03 ? 2010 DG  C "O3'" 1 
ATOM   310   C  "C2'" . DG  B  2 4    ? 60.114  6.534   31.716  1.00 62.46 ? 2010 DG  C "C2'" 1 
ATOM   311   C  "C1'" . DG  B  2 4    ? 59.850  7.720   30.789  1.00 62.60 ? 2010 DG  C "C1'" 1 
ATOM   312   N  N9    . DG  B  2 4    ? 60.773  8.834   30.994  1.00 62.86 ? 2010 DG  C N9    1 
ATOM   313   C  C8    . DG  B  2 4    ? 61.152  9.417   32.185  1.00 62.79 ? 2010 DG  C C8    1 
ATOM   314   N  N7    . DG  B  2 4    ? 62.008  10.389  32.034  1.00 62.54 ? 2010 DG  C N7    1 
ATOM   315   C  C5    . DG  B  2 4    ? 62.213  10.449  30.657  1.00 62.72 ? 2010 DG  C C5    1 
ATOM   316   C  C6    . DG  B  2 4    ? 63.040  11.298  29.877  1.00 62.61 ? 2010 DG  C C6    1 
ATOM   317   O  O6    . DG  B  2 4    ? 63.785  12.205  30.256  1.00 63.09 ? 2010 DG  C O6    1 
ATOM   318   N  N1    . DG  B  2 4    ? 62.962  11.027  28.513  1.00 62.53 ? 2010 DG  C N1    1 
ATOM   319   C  C2    . DG  B  2 4    ? 62.180  10.047  27.959  1.00 62.60 ? 2010 DG  C C2    1 
ATOM   320   N  N2    . DG  B  2 4    ? 62.236  9.939   26.627  1.00 62.73 ? 2010 DG  C N2    1 
ATOM   321   N  N3    . DG  B  2 4    ? 61.399  9.238   28.668  1.00 63.20 ? 2010 DG  C N3    1 
ATOM   322   C  C4    . DG  B  2 4    ? 61.462  9.496   30.004  1.00 63.06 ? 2010 DG  C C4    1 
ATOM   323   P  P     . DG  B  2 5    ? 58.875  3.495   30.618  1.00 63.66 ? 2011 DG  C P     1 
ATOM   324   O  OP1   . DG  B  2 5    ? 57.660  2.895   31.215  1.00 64.44 ? 2011 DG  C OP1   1 
ATOM   325   O  OP2   . DG  B  2 5    ? 60.197  3.281   31.262  1.00 63.71 ? 2011 DG  C OP2   1 
ATOM   326   O  "O5'" . DG  B  2 5    ? 58.955  3.009   29.090  1.00 64.34 ? 2011 DG  C "O5'" 1 
ATOM   327   C  "C5'" . DG  B  2 5    ? 58.863  3.907   27.976  1.00 63.08 ? 2011 DG  C "C5'" 1 
ATOM   328   C  "C4'" . DG  B  2 5    ? 60.141  3.916   27.152  1.00 62.33 ? 2011 DG  C "C4'" 1 
ATOM   329   O  "O4'" . DG  B  2 5    ? 60.921  5.076   27.535  1.00 62.63 ? 2011 DG  C "O4'" 1 
ATOM   330   C  "C3'" . DG  B  2 5    ? 61.084  2.715   27.294  1.00 62.63 ? 2011 DG  C "C3'" 1 
ATOM   331   O  "O3'" . DG  B  2 5    ? 61.584  2.363   26.012  1.00 63.30 ? 2011 DG  C "O3'" 1 
ATOM   332   C  "C2'" . DG  B  2 5    ? 62.214  3.259   28.166  1.00 62.81 ? 2011 DG  C "C2'" 1 
ATOM   333   C  "C1'" . DG  B  2 5    ? 62.277  4.681   27.624  1.00 63.32 ? 2011 DG  C "C1'" 1 
ATOM   334   N  N9    . DG  B  2 5    ? 63.016  5.658   28.424  1.00 63.53 ? 2011 DG  C N9    1 
ATOM   335   C  C8    . DG  B  2 5    ? 63.067  5.762   29.796  1.00 63.55 ? 2011 DG  C C8    1 
ATOM   336   N  N7    . DG  B  2 5    ? 63.811  6.751   30.215  1.00 63.82 ? 2011 DG  C N7    1 
ATOM   337   C  C5    . DG  B  2 5    ? 64.285  7.344   29.047  1.00 63.59 ? 2011 DG  C C5    1 
ATOM   338   C  C6    . DG  B  2 5    ? 65.139  8.466   28.862  1.00 63.25 ? 2011 DG  C C6    1 
ATOM   339   O  O6    . DG  B  2 5    ? 65.672  9.182   29.717  1.00 63.27 ? 2011 DG  C O6    1 
ATOM   340   N  N1    . DG  B  2 5    ? 65.376  8.733   27.517  1.00 63.54 ? 2011 DG  C N1    1 
ATOM   341   C  C2    . DG  B  2 5    ? 64.849  8.009   26.472  1.00 63.71 ? 2011 DG  C C2    1 
ATOM   342   N  N2    . DG  B  2 5    ? 65.195  8.423   25.245  1.00 63.75 ? 2011 DG  C N2    1 
ATOM   343   N  N3    . DG  B  2 5    ? 64.044  6.958   26.625  1.00 63.43 ? 2011 DG  C N3    1 
ATOM   344   C  C4    . DG  B  2 5    ? 63.802  6.682   27.935  1.00 63.47 ? 2011 DG  C C4    1 
ATOM   345   P  P     . DG  B  2 6    ? 61.992  0.873   25.596  1.00 64.13 ? 2012 DG  C P     1 
ATOM   346   O  OP1   . DG  B  2 6    ? 60.729  0.162   25.285  1.00 63.77 ? 2012 DG  C OP1   1 
ATOM   347   O  OP2   . DG  B  2 6    ? 62.942  0.318   26.589  1.00 63.84 ? 2012 DG  C OP2   1 
ATOM   348   O  "O5'" . DG  B  2 6    ? 62.761  1.130   24.211  1.00 64.69 ? 2012 DG  C "O5'" 1 
ATOM   349   C  "C5'" . DG  B  2 6    ? 64.098  0.691   23.982  1.00 65.31 ? 2012 DG  C "C5'" 1 
ATOM   350   C  "C4'" . DG  B  2 6    ? 65.012  1.860   23.653  1.00 65.90 ? 2012 DG  C "C4'" 1 
ATOM   351   O  "O4'" . DG  B  2 6    ? 64.798  2.929   24.609  1.00 65.45 ? 2012 DG  C "O4'" 1 
ATOM   352   C  "C3'" . DG  B  2 6    ? 66.498  1.532   23.753  1.00 66.48 ? 2012 DG  C "C3'" 1 
ATOM   353   O  "O3'" . DG  B  2 6    ? 67.013  1.042   22.510  1.00 66.92 ? 2012 DG  C "O3'" 1 
ATOM   354   C  "C2'" . DG  B  2 6    ? 67.130  2.869   24.137  1.00 66.37 ? 2012 DG  C "C2'" 1 
ATOM   355   C  "C1'" . DG  B  2 6    ? 65.969  3.716   24.670  1.00 66.09 ? 2012 DG  C "C1'" 1 
ATOM   356   N  N9    . DG  B  2 6    ? 66.201  4.200   26.036  1.00 66.22 ? 2012 DG  C N9    1 
ATOM   357   C  C8    . DG  B  2 6    ? 65.747  3.661   27.220  1.00 65.88 ? 2012 DG  C C8    1 
ATOM   358   N  N7    . DG  B  2 6    ? 66.136  4.320   28.278  1.00 65.95 ? 2012 DG  C N7    1 
ATOM   359   C  C5    . DG  B  2 6    ? 66.907  5.365   27.771  1.00 66.45 ? 2012 DG  C C5    1 
ATOM   360   C  C6    . DG  B  2 6    ? 67.602  6.417   28.435  1.00 66.34 ? 2012 DG  C C6    1 
ATOM   361   O  O6    . DG  B  2 6    ? 67.672  6.640   29.654  1.00 66.13 ? 2012 DG  C O6    1 
ATOM   362   N  N1    . DG  B  2 6    ? 68.262  7.273   27.542  1.00 66.12 ? 2012 DG  C N1    1 
ATOM   363   C  C2    . DG  B  2 6    ? 68.258  7.127   26.171  1.00 66.11 ? 2012 DG  C C2    1 
ATOM   364   N  N2    . DG  B  2 6    ? 68.945  8.038   25.470  1.00 66.03 ? 2012 DG  C N2    1 
ATOM   365   N  N3    . DG  B  2 6    ? 67.616  6.148   25.536  1.00 66.59 ? 2012 DG  C N3    1 
ATOM   366   C  C4    . DG  B  2 6    ? 66.959  5.303   26.389  1.00 66.80 ? 2012 DG  C C4    1 
ATOM   367   P  P     . DT  C  1 4    ? -23.847 68.957  20.524  1.00 70.51 ? 1002 DT  E P     1 
ATOM   368   O  OP1   . DT  C  1 4    ? -23.389 69.238  21.911  1.00 70.32 ? 1002 DT  E OP1   1 
ATOM   369   O  OP2   . DT  C  1 4    ? -25.240 68.505  20.268  1.00 69.84 ? 1002 DT  E OP2   1 
ATOM   370   O  "O5'" . DT  C  1 4    ? -22.827 67.933  19.820  1.00 68.51 ? 1002 DT  E "O5'" 1 
ATOM   371   C  "C5'" . DT  C  1 4    ? -22.236 68.204  18.546  1.00 63.93 ? 1002 DT  E "C5'" 1 
ATOM   372   C  "C4'" . DT  C  1 4    ? -20.724 68.011  18.559  1.00 60.19 ? 1002 DT  E "C4'" 1 
ATOM   373   O  "O4'" . DT  C  1 4    ? -20.133 69.251  19.023  1.00 60.22 ? 1002 DT  E "O4'" 1 
ATOM   374   C  "C3'" . DT  C  1 4    ? -20.129 66.905  19.441  1.00 57.30 ? 1002 DT  E "C3'" 1 
ATOM   375   O  "O3'" . DT  C  1 4    ? -20.003 65.658  18.726  1.00 55.49 ? 1002 DT  E "O3'" 1 
ATOM   376   C  "C2'" . DT  C  1 4    ? -18.734 67.455  19.674  1.00 57.92 ? 1002 DT  E "C2'" 1 
ATOM   377   C  "C1'" . DT  C  1 4    ? -18.854 68.965  19.556  1.00 60.01 ? 1002 DT  E "C1'" 1 
ATOM   378   N  N1    . DT  C  1 4    ? -18.637 69.605  20.899  1.00 61.33 ? 1002 DT  E N1    1 
ATOM   379   C  C2    . DT  C  1 4    ? -17.340 69.925  21.276  1.00 60.68 ? 1002 DT  E C2    1 
ATOM   380   O  O2    . DT  C  1 4    ? -16.371 69.724  20.563  1.00 60.19 ? 1002 DT  E O2    1 
ATOM   381   N  N3    . DT  C  1 4    ? -17.227 70.499  22.528  1.00 60.88 ? 1002 DT  E N3    1 
ATOM   382   C  C4    . DT  C  1 4    ? -18.260 70.777  23.424  1.00 61.13 ? 1002 DT  E C4    1 
ATOM   383   O  O4    . DT  C  1 4    ? -18.041 71.296  24.518  1.00 60.76 ? 1002 DT  E O4    1 
ATOM   384   C  C5    . DT  C  1 4    ? -19.597 70.413  22.972  1.00 61.17 ? 1002 DT  E C5    1 
ATOM   385   C  C7    . DT  C  1 4    ? -20.807 70.649  23.829  1.00 60.22 ? 1002 DT  E C7    1 
ATOM   386   C  C6    . DT  C  1 4    ? -19.715 69.851  21.752  1.00 61.99 ? 1002 DT  E C6    1 
ATOM   387   P  P     . DT  C  1 5    ? -19.829 64.168  19.351  1.00 53.23 ? 1003 DT  E P     1 
ATOM   388   O  OP1   . DT  C  1 5    ? -20.159 63.237  18.246  1.00 50.78 ? 1003 DT  E OP1   1 
ATOM   389   O  OP2   . DT  C  1 5    ? -20.599 64.150  20.621  1.00 52.30 ? 1003 DT  E OP2   1 
ATOM   390   O  "O5'" . DT  C  1 5    ? -18.284 63.921  19.691  1.00 48.29 ? 1003 DT  E "O5'" 1 
ATOM   391   C  "C5'" . DT  C  1 5    ? -17.379 63.434  18.726  1.00 45.50 ? 1003 DT  E "C5'" 1 
ATOM   392   C  "C4'" . DT  C  1 5    ? -16.044 64.123  18.897  1.00 45.41 ? 1003 DT  E "C4'" 1 
ATOM   393   O  "O4'" . DT  C  1 5    ? -16.283 65.474  19.348  1.00 47.22 ? 1003 DT  E "O4'" 1 
ATOM   394   C  "C3'" . DT  C  1 5    ? -15.141 63.537  19.968  1.00 44.87 ? 1003 DT  E "C3'" 1 
ATOM   395   O  "O3'" . DT  C  1 5    ? -14.246 62.582  19.419  1.00 40.58 ? 1003 DT  E "O3'" 1 
ATOM   396   C  "C2'" . DT  C  1 5    ? -14.355 64.736  20.499  1.00 46.41 ? 1003 DT  E "C2'" 1 
ATOM   397   C  "C1'" . DT  C  1 5    ? -15.336 65.881  20.327  1.00 48.36 ? 1003 DT  E "C1'" 1 
ATOM   398   N  N1    . DT  C  1 5    ? -16.028 66.395  21.588  1.00 49.04 ? 1003 DT  E N1    1 
ATOM   399   C  C2    . DT  C  1 5    ? -15.395 67.343  22.363  1.00 49.29 ? 1003 DT  E C2    1 
ATOM   400   O  O2    . DT  C  1 5    ? -14.299 67.780  22.100  1.00 49.96 ? 1003 DT  E O2    1 
ATOM   401   N  N3    . DT  C  1 5    ? -16.090 67.774  23.469  1.00 49.45 ? 1003 DT  E N3    1 
ATOM   402   C  C4    . DT  C  1 5    ? -17.349 67.365  23.887  1.00 49.86 ? 1003 DT  E C4    1 
ATOM   403   O  O4    . DT  C  1 5    ? -17.893 67.815  24.900  1.00 49.84 ? 1003 DT  E O4    1 
ATOM   404   C  C5    . DT  C  1 5    ? -17.971 66.371  23.038  1.00 50.26 ? 1003 DT  E C5    1 
ATOM   405   C  C7    . DT  C  1 5    ? -19.335 65.827  23.368  1.00 49.58 ? 1003 DT  E C7    1 
ATOM   406   C  C6    . DT  C  1 5    ? -17.288 65.945  21.955  1.00 50.34 ? 1003 DT  E C6    1 
ATOM   407   P  P     . DC  C  1 6    ? -14.084 61.189  20.173  1.00 36.99 ? 1004 DC  E P     1 
ATOM   408   O  OP1   . DC  C  1 6    ? -14.606 60.188  19.229  1.00 41.26 ? 1004 DC  E OP1   1 
ATOM   409   O  OP2   . DC  C  1 6    ? -14.663 61.266  21.523  1.00 35.98 ? 1004 DC  E OP2   1 
ATOM   410   O  "O5'" . DC  C  1 6    ? -12.527 60.900  20.269  1.00 36.77 ? 1004 DC  E "O5'" 1 
ATOM   411   C  "C5'" . DC  C  1 6    ? -11.578 61.855  20.567  1.00 36.40 ? 1004 DC  E "C5'" 1 
ATOM   412   C  "C4'" . DC  C  1 6    ? -10.817 62.215  19.313  1.00 37.80 ? 1004 DC  E "C4'" 1 
ATOM   413   O  "O4'" . DC  C  1 6    ? -9.995  63.351  19.635  1.00 38.88 ? 1004 DC  E "O4'" 1 
ATOM   414   C  "C3'" . DC  C  1 6    ? -9.826  61.223  18.730  1.00 39.76 ? 1004 DC  E "C3'" 1 
ATOM   415   O  "O3'" . DC  C  1 6    ? -9.761  61.479  17.332  1.00 42.71 ? 1004 DC  E "O3'" 1 
ATOM   416   C  "C2'" . DC  C  1 6    ? -8.505  61.574  19.421  1.00 39.54 ? 1004 DC  E "C2'" 1 
ATOM   417   C  "C1'" . DC  C  1 6    ? -8.621  63.085  19.446  1.00 38.41 ? 1004 DC  E "C1'" 1 
ATOM   418   N  N1    . DC  C  1 6    ? -7.947  63.832  20.546  1.00 38.30 ? 1004 DC  E N1    1 
ATOM   419   C  C2    . DC  C  1 6    ? -7.008  64.810  20.204  1.00 37.99 ? 1004 DC  E C2    1 
ATOM   420   O  O2    . DC  C  1 6    ? -6.750  65.000  19.007  1.00 37.92 ? 1004 DC  E O2    1 
ATOM   421   N  N3    . DC  C  1 6    ? -6.413  65.519  21.202  1.00 37.45 ? 1004 DC  E N3    1 
ATOM   422   C  C4    . DC  C  1 6    ? -6.737  65.286  22.480  1.00 37.49 ? 1004 DC  E C4    1 
ATOM   423   N  N4    . DC  C  1 6    ? -6.120  66.007  23.422  1.00 38.63 ? 1004 DC  E N4    1 
ATOM   424   C  C5    . DC  C  1 6    ? -7.695  64.297  22.850  1.00 36.99 ? 1004 DC  E C5    1 
ATOM   425   C  C6    . DC  C  1 6    ? -8.276  63.609  21.859  1.00 37.69 ? 1004 DC  E C6    1 
ATOM   426   P  P     . DC  C  1 7    ? -9.080  60.409  16.365  1.00 45.92 ? 1005 DC  E P     1 
ATOM   427   O  OP1   . DC  C  1 7    ? -9.620  60.594  14.999  1.00 45.91 ? 1005 DC  E OP1   1 
ATOM   428   O  OP2   . DC  C  1 7    ? -9.127  59.052  17.001  1.00 45.54 ? 1005 DC  E OP2   1 
ATOM   429   O  "O5'" . DC  C  1 7    ? -7.585  60.958  16.357  1.00 44.25 ? 1005 DC  E "O5'" 1 
ATOM   430   C  "C5'" . DC  C  1 7    ? -7.305  62.099  15.615  1.00 44.42 ? 1005 DC  E "C5'" 1 
ATOM   431   C  "C4'" . DC  C  1 7    ? -5.818  62.338  15.633  1.00 43.97 ? 1005 DC  E "C4'" 1 
ATOM   432   O  "O4'" . DC  C  1 7    ? -5.511  62.985  16.880  1.00 45.19 ? 1005 DC  E "O4'" 1 
ATOM   433   C  "C3'" . DC  C  1 7    ? -4.922  61.113  15.575  1.00 42.77 ? 1005 DC  E "C3'" 1 
ATOM   434   O  "O3'" . DC  C  1 7    ? -3.930  61.431  14.633  1.00 45.72 ? 1005 DC  E "O3'" 1 
ATOM   435   C  "C2'" . DC  C  1 7    ? -4.305  61.040  16.965  1.00 42.08 ? 1005 DC  E "C2'" 1 
ATOM   436   C  "C1'" . DC  C  1 7    ? -4.271  62.511  17.333  1.00 41.70 ? 1005 DC  E "C1'" 1 
ATOM   437   N  N1    . DC  C  1 7    ? -4.199  62.840  18.783  1.00 41.30 ? 1005 DC  E N1    1 
ATOM   438   C  C2    . DC  C  1 7    ? -3.573  64.038  19.216  1.00 41.60 ? 1005 DC  E C2    1 
ATOM   439   O  O2    . DC  C  1 7    ? -3.067  64.847  18.397  1.00 39.50 ? 1005 DC  E O2    1 
ATOM   440   N  N3    . DC  C  1 7    ? -3.547  64.276  20.558  1.00 40.63 ? 1005 DC  E N3    1 
ATOM   441   C  C4    . DC  C  1 7    ? -4.105  63.414  21.410  1.00 39.14 ? 1005 DC  E C4    1 
ATOM   442   N  N4    . DC  C  1 7    ? -4.054  63.688  22.709  1.00 39.60 ? 1005 DC  E N4    1 
ATOM   443   C  C5    . DC  C  1 7    ? -4.757  62.229  20.978  1.00 38.84 ? 1005 DC  E C5    1 
ATOM   444   C  C6    . DC  C  1 7    ? -4.780  61.983  19.671  1.00 39.21 ? 1005 DC  E C6    1 
ATOM   445   P  P     . DC  C  1 8    ? -3.275  60.364  13.636  1.00 48.49 ? 1006 DC  E P     1 
ATOM   446   O  OP1   . DC  C  1 8    ? -2.648  61.179  12.562  1.00 46.99 ? 1006 DC  E OP1   1 
ATOM   447   O  OP2   . DC  C  1 8    ? -4.280  59.323  13.320  1.00 50.33 ? 1006 DC  E OP2   1 
ATOM   448   O  "O5'" . DC  C  1 8    ? -2.193  59.606  14.554  1.00 47.30 ? 1006 DC  E "O5'" 1 
ATOM   449   C  "C5'" . DC  C  1 8    ? -0.821  59.762  14.330  1.00 45.36 ? 1006 DC  E "C5'" 1 
ATOM   450   C  "C4'" . DC  C  1 8    ? -0.043  59.936  15.619  1.00 45.38 ? 1006 DC  E "C4'" 1 
ATOM   451   O  "O4'" . DC  C  1 8    ? -0.798  60.570  16.666  1.00 47.60 ? 1006 DC  E "O4'" 1 
ATOM   452   C  "C3'" . DC  C  1 8    ? 0.414   58.683  16.325  1.00 44.26 ? 1006 DC  E "C3'" 1 
ATOM   453   O  "O3'" . DC  C  1 8    ? 1.496   58.192  15.594  1.00 46.29 ? 1006 DC  E "O3'" 1 
ATOM   454   C  "C2'" . DC  C  1 8    ? 0.916   59.277  17.629  1.00 44.35 ? 1006 DC  E "C2'" 1 
ATOM   455   C  "C1'" . DC  C  1 8    ? 0.130   60.585  17.726  1.00 46.37 ? 1006 DC  E "C1'" 1 
ATOM   456   N  N1    . DC  C  1 8    ? -0.544  60.733  19.040  1.00 47.23 ? 1006 DC  E N1    1 
ATOM   457   C  C2    . DC  C  1 8    ? -0.280  61.867  19.824  1.00 45.78 ? 1006 DC  E C2    1 
ATOM   458   O  O2    . DC  C  1 8    ? 0.499   62.717  19.400  1.00 46.35 ? 1006 DC  E O2    1 
ATOM   459   N  N3    . DC  C  1 8    ? -0.878  61.995  21.034  1.00 45.27 ? 1006 DC  E N3    1 
ATOM   460   C  C4    . DC  C  1 8    ? -1.697  61.033  21.458  1.00 45.90 ? 1006 DC  E C4    1 
ATOM   461   N  N4    . DC  C  1 8    ? -2.258  61.184  22.651  1.00 46.60 ? 1006 DC  E N4    1 
ATOM   462   C  C5    . DC  C  1 8    ? -1.991  59.866  20.681  1.00 47.39 ? 1006 DC  E C5    1 
ATOM   463   C  C6    . DC  C  1 8    ? -1.396  59.749  19.483  1.00 48.21 ? 1006 DC  E C6    1 
ATOM   464   P  P     . DA  C  1 9    ? 1.689   56.652  15.172  1.00 44.72 ? 1007 DA  E P     1 
ATOM   465   O  OP1   . DA  C  1 9    ? 2.143   56.639  13.755  1.00 41.45 ? 1007 DA  E OP1   1 
ATOM   466   O  OP2   . DA  C  1 9    ? 0.532   55.816  15.557  1.00 44.21 ? 1007 DA  E OP2   1 
ATOM   467   O  "O5'" . DA  C  1 9    ? 2.861   56.337  16.225  1.00 44.51 ? 1007 DA  E "O5'" 1 
ATOM   468   C  "C5'" . DA  C  1 9    ? 4.180   56.678  15.906  1.00 42.80 ? 1007 DA  E "C5'" 1 
ATOM   469   C  "C4'" . DA  C  1 9    ? 4.851   57.593  16.887  1.00 41.91 ? 1007 DA  E "C4'" 1 
ATOM   470   O  "O4'" . DA  C  1 9    ? 4.610   57.273  18.261  1.00 42.79 ? 1007 DA  E "O4'" 1 
ATOM   471   C  "C3'" . DA  C  1 9    ? 6.341   57.392  16.769  1.00 44.16 ? 1007 DA  E "C3'" 1 
ATOM   472   O  "O3'" . DA  C  1 9    ? 6.819   58.549  16.155  1.00 49.06 ? 1007 DA  E "O3'" 1 
ATOM   473   C  "C2'" . DA  C  1 9    ? 6.900   57.203  18.184  1.00 42.49 ? 1007 DA  E "C2'" 1 
ATOM   474   C  "C1'" . DA  C  1 9    ? 5.744   57.772  18.958  1.00 43.18 ? 1007 DA  E "C1'" 1 
ATOM   475   N  N9    . DA  C  1 9    ? 5.662   57.491  20.391  1.00 42.62 ? 1007 DA  E N9    1 
ATOM   476   C  C8    . DA  C  1 9    ? 5.066   56.430  20.996  1.00 43.11 ? 1007 DA  E C8    1 
ATOM   477   N  N7    . DA  C  1 9    ? 5.100   56.461  22.302  1.00 42.53 ? 1007 DA  E N7    1 
ATOM   478   C  C5    . DA  C  1 9    ? 5.761   57.631  22.585  1.00 42.53 ? 1007 DA  E C5    1 
ATOM   479   C  C6    . DA  C  1 9    ? 6.124   58.254  23.802  1.00 43.11 ? 1007 DA  E C6    1 
ATOM   480   N  N6    . DA  C  1 9    ? 5.853   57.745  24.998  1.00 42.93 ? 1007 DA  E N6    1 
ATOM   481   N  N1    . DA  C  1 9    ? 6.783   59.430  23.750  1.00 43.82 ? 1007 DA  E N1    1 
ATOM   482   C  C2    . DA  C  1 9    ? 7.058   59.949  22.541  1.00 44.47 ? 1007 DA  E C2    1 
ATOM   483   N  N3    . DA  C  1 9    ? 6.761   59.455  21.325  1.00 45.71 ? 1007 DA  E N3    1 
ATOM   484   C  C4    . DA  C  1 9    ? 6.108   58.279  21.416  1.00 43.18 ? 1007 DA  E C4    1 
ATOM   485   P  P     . DC  C  1 10   ? 8.145   58.362  15.314  1.00 52.50 ? 1008 DC  E P     1 
ATOM   486   O  OP1   . DC  C  1 10   ? 8.365   59.538  14.408  1.00 49.99 ? 1008 DC  E OP1   1 
ATOM   487   O  OP2   . DC  C  1 10   ? 8.125   56.947  14.819  1.00 49.24 ? 1008 DC  E OP2   1 
ATOM   488   O  "O5'" . DC  C  1 10   ? 9.194   58.472  16.515  1.00 48.90 ? 1008 DC  E "O5'" 1 
ATOM   489   C  "C5'" . DC  C  1 10   ? 9.650   59.732  16.897  1.00 47.50 ? 1008 DC  E "C5'" 1 
ATOM   490   C  "C4'" . DC  C  1 10   ? 10.566  59.594  18.081  1.00 45.93 ? 1008 DC  E "C4'" 1 
ATOM   491   O  "O4'" . DC  C  1 10   ? 9.817   59.114  19.218  1.00 45.05 ? 1008 DC  E "O4'" 1 
ATOM   492   C  "C3'" . DC  C  1 10   ? 11.691  58.599  17.868  1.00 44.81 ? 1008 DC  E "C3'" 1 
ATOM   493   O  "O3'" . DC  C  1 10   ? 12.898  59.249  18.155  1.00 45.67 ? 1008 DC  E "O3'" 1 
ATOM   494   C  "C2'" . DC  C  1 10   ? 11.424  57.507  18.895  1.00 44.80 ? 1008 DC  E "C2'" 1 
ATOM   495   C  "C1'" . DC  C  1 10   ? 10.733  58.335  19.958  1.00 44.39 ? 1008 DC  E "C1'" 1 
ATOM   496   N  N1    . DC  C  1 10   ? 10.002  57.591  21.024  1.00 44.89 ? 1008 DC  E N1    1 
ATOM   497   C  C2    . DC  C  1 10   ? 10.036  58.111  22.332  1.00 45.08 ? 1008 DC  E C2    1 
ATOM   498   O  O2    . DC  C  1 10   ? 10.663  59.149  22.575  1.00 45.80 ? 1008 DC  E O2    1 
ATOM   499   N  N3    . DC  C  1 10   ? 9.363   57.472  23.311  1.00 43.99 ? 1008 DC  E N3    1 
ATOM   500   C  C4    . DC  C  1 10   ? 8.683   56.373  23.015  1.00 43.23 ? 1008 DC  E C4    1 
ATOM   501   N  N4    . DC  C  1 10   ? 8.049   55.788  24.025  1.00 44.08 ? 1008 DC  E N4    1 
ATOM   502   C  C5    . DC  C  1 10   ? 8.617   55.833  21.695  1.00 43.37 ? 1008 DC  E C5    1 
ATOM   503   C  C6    . DC  C  1 10   ? 9.290   56.464  20.733  1.00 43.15 ? 1008 DC  E C6    1 
ATOM   504   P  P     . DC  C  1 11   ? 13.954  59.499  16.988  1.00 46.75 ? 1009 DC  E P     1 
ATOM   505   O  OP1   . DC  C  1 11   ? 14.180  60.968  16.975  1.00 46.84 ? 1009 DC  E OP1   1 
ATOM   506   O  OP2   . DC  C  1 11   ? 13.483  58.737  15.785  1.00 45.12 ? 1009 DC  E OP2   1 
ATOM   507   O  "O5'" . DC  C  1 11   ? 15.321  58.873  17.553  1.00 45.63 ? 1009 DC  E "O5'" 1 
ATOM   508   C  "C5'" . DC  C  1 11   ? 15.493  57.462  17.691  1.00 44.76 ? 1009 DC  E "C5'" 1 
ATOM   509   C  "C4'" . DC  C  1 11   ? 15.870  57.118  19.117  1.00 42.56 ? 1009 DC  E "C4'" 1 
ATOM   510   O  "O4'" . DC  C  1 11   ? 14.666  57.015  19.895  1.00 42.23 ? 1009 DC  E "O4'" 1 
ATOM   511   C  "C3'" . DC  C  1 11   ? 16.533  55.764  19.304  1.00 41.96 ? 1009 DC  E "C3'" 1 
ATOM   512   O  "O3'" . DC  C  1 11   ? 17.939  55.900  19.133  1.00 39.98 ? 1009 DC  E "O3'" 1 
ATOM   513   C  "C2'" . DC  C  1 11   ? 16.147  55.358  20.725  1.00 41.87 ? 1009 DC  E "C2'" 1 
ATOM   514   C  "C1'" . DC  C  1 11   ? 14.972  56.284  21.053  1.00 43.51 ? 1009 DC  E "C1'" 1 
ATOM   515   N  N1    . DC  C  1 11   ? 13.739  55.583  21.519  1.00 44.59 ? 1009 DC  E N1    1 
ATOM   516   C  C2    . DC  C  1 11   ? 13.293  55.748  22.842  1.00 45.40 ? 1009 DC  E C2    1 
ATOM   517   O  O2    . DC  C  1 11   ? 13.914  56.460  23.619  1.00 47.76 ? 1009 DC  E O2    1 
ATOM   518   N  N3    . DC  C  1 11   ? 12.190  55.120  23.279  1.00 44.91 ? 1009 DC  E N3    1 
ATOM   519   C  C4    . DC  C  1 11   ? 11.526  54.340  22.446  1.00 45.07 ? 1009 DC  E C4    1 
ATOM   520   N  N4    . DC  C  1 11   ? 10.445  53.731  22.940  1.00 45.56 ? 1009 DC  E N4    1 
ATOM   521   C  C5    . DC  C  1 11   ? 11.941  54.155  21.090  1.00 46.25 ? 1009 DC  E C5    1 
ATOM   522   C  C6    . DC  C  1 11   ? 13.043  54.786  20.664  1.00 44.80 ? 1009 DC  E C6    1 
ATOM   523   P  P     . DT  C  1 12   ? 18.690  55.054  18.001  1.00 38.43 ? 1010 DT  E P     1 
ATOM   524   O  OP1   . DT  C  1 12   ? 19.849  55.818  17.514  1.00 40.03 ? 1010 DT  E OP1   1 
ATOM   525   O  OP2   . DT  C  1 12   ? 17.720  54.529  17.013  1.00 36.88 ? 1010 DT  E OP2   1 
ATOM   526   O  "O5'" . DT  C  1 12   ? 19.255  53.856  18.886  1.00 43.09 ? 1010 DT  E "O5'" 1 
ATOM   527   C  "C5'" . DT  C  1 12   ? 20.480  53.934  19.605  1.00 46.21 ? 1010 DT  E "C5'" 1 
ATOM   528   C  "C4'" . DT  C  1 12   ? 20.251  54.167  21.081  1.00 49.18 ? 1010 DT  E "C4'" 1 
ATOM   529   O  "O4'" . DT  C  1 12   ? 19.214  53.327  21.656  1.00 50.52 ? 1010 DT  E "O4'" 1 
ATOM   530   C  "C3'" . DT  C  1 12   ? 21.511  53.924  21.873  1.00 50.92 ? 1010 DT  E "C3'" 1 
ATOM   531   O  "O3'" . DT  C  1 12   ? 21.703  55.071  22.631  1.00 55.97 ? 1010 DT  E "O3'" 1 
ATOM   532   C  "C2'" . DT  C  1 12   ? 21.159  52.802  22.812  1.00 51.71 ? 1010 DT  E "C2'" 1 
ATOM   533   C  "C1'" . DT  C  1 12   ? 19.642  52.860  22.917  1.00 53.05 ? 1010 DT  E "C1'" 1 
ATOM   534   N  N1    . DT  C  1 12   ? 19.107  51.483  23.246  1.00 54.50 ? 1010 DT  E N1    1 
ATOM   535   C  C2    . DT  C  1 12   ? 18.975  51.101  24.580  1.00 55.17 ? 1010 DT  E C2    1 
ATOM   536   O  O2    . DT  C  1 12   ? 19.230  51.822  25.536  1.00 55.53 ? 1010 DT  E O2    1 
ATOM   537   N  N3    . DT  C  1 12   ? 18.504  49.819  24.767  1.00 55.79 ? 1010 DT  E N3    1 
ATOM   538   C  C4    . DT  C  1 12   ? 18.172  48.893  23.788  1.00 55.26 ? 1010 DT  E C4    1 
ATOM   539   O  O4    . DT  C  1 12   ? 17.754  47.772  24.068  1.00 55.66 ? 1010 DT  E O4    1 
ATOM   540   C  C5    . DT  C  1 12   ? 18.352  49.331  22.422  1.00 54.82 ? 1010 DT  E C5    1 
ATOM   541   C  C7    . DT  C  1 12   ? 18.028  48.398  21.289  1.00 53.95 ? 1010 DT  E C7    1 
ATOM   542   C  C6    . DT  C  1 12   ? 18.810  50.583  22.222  1.00 54.65 ? 1010 DT  E C6    1 
ATOM   543   P  P     . DT  C  1 13   ? 23.153  55.714  22.698  1.00 59.57 ? 1011 DT  E P     1 
ATOM   544   O  OP1   . DT  C  1 13   ? 22.990  57.147  23.064  1.00 60.09 ? 1011 DT  E OP1   1 
ATOM   545   O  OP2   . DT  C  1 13   ? 23.914  55.291  21.490  1.00 59.19 ? 1011 DT  E OP2   1 
ATOM   546   O  "O5'" . DT  C  1 13   ? 23.771  54.935  23.952  1.00 59.63 ? 1011 DT  E "O5'" 1 
ATOM   547   C  "C5'" . DT  C  1 13   ? 23.540  55.354  25.307  1.00 55.69 ? 1011 DT  E "C5'" 1 
ATOM   548   C  "C4'" . DT  C  1 13   ? 23.733  54.159  26.204  1.00 51.14 ? 1011 DT  E "C4'" 1 
ATOM   549   O  "O4'" . DT  C  1 13   ? 22.858  53.123  25.724  1.00 51.13 ? 1011 DT  E "O4'" 1 
ATOM   550   C  "C3'" . DT  C  1 13   ? 25.107  53.525  26.101  1.00 48.29 ? 1011 DT  E "C3'" 1 
ATOM   551   O  "O3'" . DT  C  1 13   ? 25.878  54.003  27.150  1.00 44.23 ? 1011 DT  E "O3'" 1 
ATOM   552   C  "C2'" . DT  C  1 13   ? 24.873  52.031  26.255  1.00 48.77 ? 1011 DT  E "C2'" 1 
ATOM   553   C  "C1'" . DT  C  1 13   ? 23.353  51.935  26.277  1.00 51.32 ? 1011 DT  E "C1'" 1 
ATOM   554   N  N1    . DT  C  1 13   ? 22.817  50.799  25.502  1.00 52.11 ? 1011 DT  E N1    1 
ATOM   555   C  C2    . DT  C  1 13   ? 22.104  49.843  26.191  1.00 52.55 ? 1011 DT  E C2    1 
ATOM   556   O  O2    . DT  C  1 13   ? 21.912  49.927  27.390  1.00 53.29 ? 1011 DT  E O2    1 
ATOM   557   N  N3    . DT  C  1 13   ? 21.639  48.797  25.428  1.00 51.20 ? 1011 DT  E N3    1 
ATOM   558   C  C4    . DT  C  1 13   ? 21.825  48.639  24.067  1.00 51.55 ? 1011 DT  E C4    1 
ATOM   559   O  O4    . DT  C  1 13   ? 21.368  47.682  23.463  1.00 51.73 ? 1011 DT  E O4    1 
ATOM   560   C  C5    . DT  C  1 13   ? 22.579  49.679  23.397  1.00 52.97 ? 1011 DT  E C5    1 
ATOM   561   C  C7    . DT  C  1 13   ? 22.836  49.611  21.913  1.00 53.01 ? 1011 DT  E C7    1 
ATOM   562   C  C6    . DT  C  1 13   ? 23.043  50.701  24.140  1.00 52.71 ? 1011 DT  E C6    1 
ATOM   563   P  P     . DT  C  1 14   ? 27.361  54.458  26.813  1.00 42.45 ? 1012 DT  E P     1 
ATOM   564   O  OP1   . DT  C  1 14   ? 27.852  55.124  28.038  1.00 41.21 ? 1012 DT  E OP1   1 
ATOM   565   O  OP2   . DT  C  1 14   ? 27.360  55.145  25.492  1.00 41.88 ? 1012 DT  E OP2   1 
ATOM   566   O  "O5'" . DT  C  1 14   ? 28.164  53.091  26.642  1.00 44.21 ? 1012 DT  E "O5'" 1 
ATOM   567   C  "C5'" . DT  C  1 14   ? 29.228  52.741  27.535  1.00 44.28 ? 1012 DT  E "C5'" 1 
ATOM   568   C  "C4'" . DT  C  1 14   ? 29.052  51.330  28.044  1.00 44.04 ? 1012 DT  E "C4'" 1 
ATOM   569   O  "O4'" . DT  C  1 14   ? 27.699  50.906  27.776  1.00 48.34 ? 1012 DT  E "O4'" 1 
ATOM   570   C  "C3'" . DT  C  1 14   ? 29.902  50.299  27.346  1.00 42.11 ? 1012 DT  E "C3'" 1 
ATOM   571   O  "O3'" . DT  C  1 14   ? 31.103  50.256  28.042  1.00 38.98 ? 1012 DT  E "O3'" 1 
ATOM   572   C  "C2'" . DT  C  1 14   ? 29.102  49.033  27.612  1.00 45.96 ? 1012 DT  E "C2'" 1 
ATOM   573   C  "C1'" . DT  C  1 14   ? 27.652  49.511  27.611  1.00 50.95 ? 1012 DT  E "C1'" 1 
ATOM   574   N  N1    . DT  C  1 14   ? 26.900  49.150  26.347  1.00 53.41 ? 1012 DT  E N1    1 
ATOM   575   C  C2    . DT  C  1 14   ? 26.013  48.071  26.388  1.00 54.89 ? 1012 DT  E C2    1 
ATOM   576   O  O2    . DT  C  1 14   ? 25.794  47.400  27.394  1.00 54.89 ? 1012 DT  E O2    1 
ATOM   577   N  N3    . DT  C  1 14   ? 25.379  47.793  25.191  1.00 55.81 ? 1012 DT  E N3    1 
ATOM   578   C  C4    . DT  C  1 14   ? 25.540  48.481  23.986  1.00 55.56 ? 1012 DT  E C4    1 
ATOM   579   O  O4    . DT  C  1 14   ? 24.914  48.146  22.975  1.00 55.32 ? 1012 DT  E O4    1 
ATOM   580   C  C5    . DT  C  1 14   ? 26.473  49.606  24.010  1.00 55.01 ? 1012 DT  E C5    1 
ATOM   581   C  C7    . DT  C  1 14   ? 26.722  50.428  22.772  1.00 53.90 ? 1012 DT  E C7    1 
ATOM   582   C  C6    . DT  C  1 14   ? 27.105  49.876  25.171  1.00 53.59 ? 1012 DT  E C6    1 
ATOM   583   P  P     . DT  C  1 15   ? 32.518  50.246  27.322  1.00 37.10 ? 1013 DT  E P     1 
ATOM   584   O  OP1   . DT  C  1 15   ? 33.454  51.033  28.152  1.00 37.90 ? 1013 DT  E OP1   1 
ATOM   585   O  OP2   . DT  C  1 15   ? 32.300  50.617  25.919  1.00 37.84 ? 1013 DT  E OP2   1 
ATOM   586   O  "O5'" . DT  C  1 15   ? 32.954  48.715  27.389  1.00 39.71 ? 1013 DT  E "O5'" 1 
ATOM   587   C  "C5'" . DT  C  1 15   ? 34.187  48.336  27.971  1.00 43.44 ? 1013 DT  E "C5'" 1 
ATOM   588   C  "C4'" . DT  C  1 15   ? 34.046  47.086  28.806  1.00 46.96 ? 1013 DT  E "C4'" 1 
ATOM   589   O  "O4'" . DT  C  1 15   ? 32.964  46.296  28.275  1.00 50.27 ? 1013 DT  E "O4'" 1 
ATOM   590   C  "C3'" . DT  C  1 15   ? 35.256  46.175  28.750  1.00 47.87 ? 1013 DT  E "C3'" 1 
ATOM   591   O  "O3'" . DT  C  1 15   ? 36.144  46.530  29.795  1.00 46.83 ? 1013 DT  E "O3'" 1 
ATOM   592   C  "C2'" . DT  C  1 15   ? 34.660  44.786  28.964  1.00 50.30 ? 1013 DT  E "C2'" 1 
ATOM   593   C  "C1'" . DT  C  1 15   ? 33.169  44.950  28.646  1.00 54.14 ? 1013 DT  E "C1'" 1 
ATOM   594   N  N1    . DT  C  1 15   ? 32.662  43.990  27.571  1.00 56.60 ? 1013 DT  E N1    1 
ATOM   595   C  C2    . DT  C  1 15   ? 32.289  42.700  27.945  1.00 57.43 ? 1013 DT  E C2    1 
ATOM   596   O  O2    . DT  C  1 15   ? 32.328  42.276  29.089  1.00 57.91 ? 1013 DT  E O2    1 
ATOM   597   N  N3    . DT  C  1 15   ? 31.855  41.891  26.919  1.00 57.78 ? 1013 DT  E N3    1 
ATOM   598   C  C4    . DT  C  1 15   ? 31.753  42.220  25.578  1.00 57.15 ? 1013 DT  E C4    1 
ATOM   599   O  O4    . DT  C  1 15   ? 31.351  41.415  24.738  1.00 57.36 ? 1013 DT  E O4    1 
ATOM   600   C  C5    . DT  C  1 15   ? 32.153  43.568  25.246  1.00 57.22 ? 1013 DT  E C5    1 
ATOM   601   C  C7    . DT  C  1 15   ? 32.082  44.007  23.820  1.00 56.47 ? 1013 DT  E C7    1 
ATOM   602   C  C6    . DT  C  1 15   ? 32.583  44.380  26.234  1.00 57.28 ? 1013 DT  E C6    1 
ATOM   603   P  P     . DG  D  2 1    ? 11.762  52.645  33.978  0.00 83.02 ? 2007 DG  F P     1 
ATOM   604   O  OP1   . DG  D  2 1    ? 11.628  52.551  35.454  0.00 80.09 ? 2007 DG  F OP1   1 
ATOM   605   O  OP2   . DG  D  2 1    ? 11.912  51.402  33.180  0.00 81.77 ? 2007 DG  F OP2   1 
ATOM   606   O  "O5'" . DG  D  2 1    ? 12.188  53.338  33.757  1.00 51.03 ? 2007 DG  F "O5'" 1 
ATOM   607   C  "C5'" . DG  D  2 1    ? 12.971  54.531  33.823  1.00 50.54 ? 2007 DG  F "C5'" 1 
ATOM   608   C  "C4'" . DG  D  2 1    ? 12.423  55.621  32.907  1.00 50.66 ? 2007 DG  F "C4'" 1 
ATOM   609   O  "O4'" . DG  D  2 1    ? 12.196  55.168  31.548  1.00 49.46 ? 2007 DG  F "O4'" 1 
ATOM   610   C  "C3'" . DG  D  2 1    ? 11.098  56.263  33.296  1.00 51.49 ? 2007 DG  F "C3'" 1 
ATOM   611   O  "O3'" . DG  D  2 1    ? 11.339  57.651  33.194  1.00 54.14 ? 2007 DG  F "O3'" 1 
ATOM   612   C  "C2'" . DG  D  2 1    ? 10.124  55.820  32.207  1.00 49.48 ? 2007 DG  F "C2'" 1 
ATOM   613   C  "C1'" . DG  D  2 1    ? 11.073  55.849  31.022  1.00 47.88 ? 2007 DG  F "C1'" 1 
ATOM   614   N  N9    . DG  D  2 1    ? 10.643  55.119  29.834  1.00 47.38 ? 2007 DG  F N9    1 
ATOM   615   C  C8    . DG  D  2 1    ? 9.790   54.048  29.782  1.00 47.75 ? 2007 DG  F C8    1 
ATOM   616   N  N7    . DG  D  2 1    ? 9.592   53.573  28.585  1.00 47.38 ? 2007 DG  F N7    1 
ATOM   617   C  C5    . DG  D  2 1    ? 10.378  54.371  27.785  1.00 46.97 ? 2007 DG  F C5    1 
ATOM   618   C  C6    . DG  D  2 1    ? 10.564  54.327  26.388  1.00 46.80 ? 2007 DG  F C6    1 
ATOM   619   O  O6    . DG  D  2 1    ? 10.059  53.553  25.574  1.00 46.32 ? 2007 DG  F O6    1 
ATOM   620   N  N1    . DG  D  2 1    ? 11.428  55.319  25.946  1.00 47.58 ? 2007 DG  F N1    1 
ATOM   621   C  C2    . DG  D  2 1    ? 12.035  56.235  26.767  1.00 47.79 ? 2007 DG  F C2    1 
ATOM   622   N  N2    . DG  D  2 1    ? 12.837  57.112  26.155  1.00 47.54 ? 2007 DG  F N2    1 
ATOM   623   N  N3    . DG  D  2 1    ? 11.870  56.287  28.088  1.00 48.60 ? 2007 DG  F N3    1 
ATOM   624   C  C4    . DG  D  2 1    ? 11.028  55.326  28.532  1.00 47.51 ? 2007 DG  F C4    1 
ATOM   625   P  P     . DG  D  2 2    ? 10.699  58.682  34.221  1.00 54.00 ? 2008 DG  F P     1 
ATOM   626   O  OP1   . DG  D  2 2    ? 11.042  58.259  35.607  1.00 53.38 ? 2008 DG  F OP1   1 
ATOM   627   O  OP2   . DG  D  2 2    ? 9.289   58.825  33.782  1.00 54.32 ? 2008 DG  F OP2   1 
ATOM   628   O  "O5'" . DG  D  2 2    ? 11.482  60.051  33.923  1.00 52.26 ? 2008 DG  F "O5'" 1 
ATOM   629   C  "C5'" . DG  D  2 2    ? 12.446  60.183  32.895  1.00 48.11 ? 2008 DG  F "C5'" 1 
ATOM   630   C  "C4'" . DG  D  2 2    ? 11.976  61.163  31.839  1.00 46.69 ? 2008 DG  F "C4'" 1 
ATOM   631   O  "O4'" . DG  D  2 2    ? 11.448  60.440  30.702  1.00 47.89 ? 2008 DG  F "O4'" 1 
ATOM   632   C  "C3'" . DG  D  2 2    ? 10.887  62.159  32.205  1.00 46.13 ? 2008 DG  F "C3'" 1 
ATOM   633   O  "O3'" . DG  D  2 2    ? 11.301  63.380  31.621  1.00 47.13 ? 2008 DG  F "O3'" 1 
ATOM   634   C  "C2'" . DG  D  2 2    ? 9.627   61.600  31.541  1.00 46.20 ? 2008 DG  F "C2'" 1 
ATOM   635   C  "C1'" . DG  D  2 2    ? 10.219  61.007  30.268  1.00 46.54 ? 2008 DG  F "C1'" 1 
ATOM   636   N  N9    . DG  D  2 2    ? 9.555   59.859  29.649  1.00 46.96 ? 2008 DG  F N9    1 
ATOM   637   C  C8    . DG  D  2 2    ? 8.817   58.869  30.271  1.00 46.74 ? 2008 DG  F C8    1 
ATOM   638   N  N7    . DG  D  2 2    ? 8.384   57.941  29.461  1.00 46.44 ? 2008 DG  F N7    1 
ATOM   639   C  C5    . DG  D  2 2    ? 8.890   58.324  28.222  1.00 46.18 ? 2008 DG  F C5    1 
ATOM   640   C  C6    . DG  D  2 2    ? 8.758   57.709  26.950  1.00 45.80 ? 2008 DG  F C6    1 
ATOM   641   O  O6    . DG  D  2 2    ? 8.152   56.672  26.655  1.00 46.32 ? 2008 DG  F O6    1 
ATOM   642   N  N1    . DG  D  2 2    ? 9.409   58.417  25.949  1.00 45.25 ? 2008 DG  F N1    1 
ATOM   643   C  C2    . DG  D  2 2    ? 10.105  59.573  26.153  1.00 45.14 ? 2008 DG  F C2    1 
ATOM   644   N  N2    . DG  D  2 2    ? 10.665  60.094  25.064  1.00 45.47 ? 2008 DG  F N2    1 
ATOM   645   N  N3    . DG  D  2 2    ? 10.243  60.173  27.330  1.00 45.68 ? 2008 DG  F N3    1 
ATOM   646   C  C4    . DG  D  2 2    ? 9.612   59.497  28.321  1.00 46.23 ? 2008 DG  F C4    1 
ATOM   647   P  P     . DT  D  2 3    ? 10.589  64.786  31.891  1.00 48.84 ? 2009 DT  F P     1 
ATOM   648   O  OP1   . DT  D  2 3    ? 11.642  65.822  31.996  1.00 48.84 ? 2009 DT  F OP1   1 
ATOM   649   O  OP2   . DT  D  2 3    ? 9.626   64.632  33.004  1.00 50.56 ? 2009 DT  F OP2   1 
ATOM   650   O  "O5'" . DT  D  2 3    ? 9.779   65.002  30.537  1.00 47.90 ? 2009 DT  F "O5'" 1 
ATOM   651   C  "C5'" . DT  D  2 3    ? 10.431  65.586  29.431  1.00 48.72 ? 2009 DT  F "C5'" 1 
ATOM   652   C  "C4'" . DT  D  2 3    ? 9.659   65.316  28.161  1.00 49.70 ? 2009 DT  F "C4'" 1 
ATOM   653   O  "O4'" . DT  D  2 3    ? 9.344   63.913  28.061  1.00 50.79 ? 2009 DT  F "O4'" 1 
ATOM   654   C  "C3'" . DT  D  2 3    ? 8.309   66.002  28.075  1.00 50.21 ? 2009 DT  F "C3'" 1 
ATOM   655   O  "O3'" . DT  D  2 3    ? 8.506   67.249  27.450  1.00 53.43 ? 2009 DT  F "O3'" 1 
ATOM   656   C  "C2'" . DT  D  2 3    ? 7.492   65.074  27.183  1.00 49.68 ? 2009 DT  F "C2'" 1 
ATOM   657   C  "C1'" . DT  D  2 3    ? 8.378   63.838  27.042  1.00 50.37 ? 2009 DT  F "C1'" 1 
ATOM   658   N  N1    . DT  D  2 3    ? 7.633   62.562  27.155  1.00 50.40 ? 2009 DT  F N1    1 
ATOM   659   C  C2    . DT  D  2 3    ? 7.542   61.760  26.032  1.00 50.81 ? 2009 DT  F C2    1 
ATOM   660   O  O2    . DT  D  2 3    ? 8.052   62.053  24.956  1.00 50.66 ? 2009 DT  F O2    1 
ATOM   661   N  N3    . DT  D  2 3    ? 6.823   60.601  26.228  1.00 50.25 ? 2009 DT  F N3    1 
ATOM   662   C  C4    . DT  D  2 3    ? 6.211   60.198  27.404  1.00 50.30 ? 2009 DT  F C4    1 
ATOM   663   O  O4    . DT  D  2 3    ? 5.595   59.148  27.484  1.00 51.44 ? 2009 DT  F O4    1 
ATOM   664   C  C5    . DT  D  2 3    ? 6.349   61.082  28.533  1.00 49.90 ? 2009 DT  F C5    1 
ATOM   665   C  C7    . DT  D  2 3    ? 5.728   60.729  29.852  1.00 50.08 ? 2009 DT  F C7    1 
ATOM   666   C  C6    . DT  D  2 3    ? 7.045   62.209  28.357  1.00 49.83 ? 2009 DT  F C6    1 
ATOM   667   P  P     . DG  D  2 4    ? 7.466   68.465  27.577  1.00 56.43 ? 2010 DG  F P     1 
ATOM   668   O  OP1   . DG  D  2 4    ? 7.532   69.194  26.289  1.00 58.10 ? 2010 DG  F OP1   1 
ATOM   669   O  OP2   . DG  D  2 4    ? 7.691   69.191  28.853  1.00 55.23 ? 2010 DG  F OP2   1 
ATOM   670   O  "O5'" . DG  D  2 4    ? 6.048   67.742  27.639  1.00 56.91 ? 2010 DG  F "O5'" 1 
ATOM   671   C  "C5'" . DG  D  2 4    ? 4.880   68.520  27.712  1.00 56.86 ? 2010 DG  F "C5'" 1 
ATOM   672   C  "C4'" . DG  D  2 4    ? 4.452   68.884  26.304  1.00 56.14 ? 2010 DG  F "C4'" 1 
ATOM   673   O  "O4'" . DG  D  2 4    ? 3.856   67.742  25.644  1.00 56.17 ? 2010 DG  F "O4'" 1 
ATOM   674   C  "C3'" . DG  D  2 4    ? 3.407   69.980  26.255  1.00 56.32 ? 2010 DG  F "C3'" 1 
ATOM   675   O  "O3'" . DG  D  2 4    ? 3.665   70.807  25.141  1.00 54.25 ? 2010 DG  F "O3'" 1 
ATOM   676   C  "C2'" . DG  D  2 4    ? 2.099   69.210  26.089  1.00 56.86 ? 2010 DG  F "C2'" 1 
ATOM   677   C  "C1'" . DG  D  2 4    ? 2.564   68.085  25.179  1.00 55.93 ? 2010 DG  F "C1'" 1 
ATOM   678   N  N9    . DG  D  2 4    ? 1.732   66.889  25.215  1.00 55.84 ? 2010 DG  F N9    1 
ATOM   679   C  C8    . DG  D  2 4    ? 1.188   66.271  26.312  1.00 55.79 ? 2010 DG  F C8    1 
ATOM   680   N  N7    . DG  D  2 4    ? 0.493   65.210  26.015  1.00 56.44 ? 2010 DG  F N7    1 
ATOM   681   C  C5    . DG  D  2 4    ? 0.587   65.109  24.630  1.00 56.42 ? 2010 DG  F C5    1 
ATOM   682   C  C6    . DG  D  2 4    ? 0.043   64.157  23.722  1.00 55.74 ? 2010 DG  F C6    1 
ATOM   683   O  O6    . DG  D  2 4    ? -0.655  63.168  23.956  1.00 55.81 ? 2010 DG  F O6    1 
ATOM   684   N  N1    . DG  D  2 4    ? 0.378   64.430  22.400  1.00 55.98 ? 2010 DG  F N1    1 
ATOM   685   C  C2    . DG  D  2 4    ? 1.152   65.493  21.998  1.00 56.47 ? 2010 DG  F C2    1 
ATOM   686   N  N2    . DG  D  2 4    ? 1.373   65.599  20.682  1.00 56.62 ? 2010 DG  F N2    1 
ATOM   687   N  N3    . DG  D  2 4    ? 1.667   66.394  22.828  1.00 57.11 ? 2010 DG  F N3    1 
ATOM   688   C  C4    . DG  D  2 4    ? 1.348   66.141  24.127  1.00 56.58 ? 2010 DG  F C4    1 
ATOM   689   P  P     . DG  D  2 5    ? 3.237   72.338  25.248  1.00 52.59 ? 2011 DG  F P     1 
ATOM   690   O  OP1   . DG  D  2 5    ? 4.296   72.993  26.048  1.00 51.95 ? 2011 DG  F OP1   1 
ATOM   691   O  OP2   . DG  D  2 5    ? 1.818   72.431  25.673  1.00 51.93 ? 2011 DG  F OP2   1 
ATOM   692   O  "O5'" . DG  D  2 5    ? 3.327   72.851  23.738  1.00 51.93 ? 2011 DG  F "O5'" 1 
ATOM   693   C  "C5'" . DG  D  2 5    ? 3.758   72.032  22.665  1.00 50.55 ? 2011 DG  F "C5'" 1 
ATOM   694   C  "C4'" . DG  D  2 5    ? 2.663   71.868  21.626  1.00 50.05 ? 2011 DG  F "C4'" 1 
ATOM   695   O  "O4'" . DG  D  2 5    ? 1.962   70.635  21.919  1.00 52.30 ? 2011 DG  F "O4'" 1 
ATOM   696   C  "C3'" . DG  D  2 5    ? 1.588   72.950  21.534  1.00 49.34 ? 2011 DG  F "C3'" 1 
ATOM   697   O  "O3'" . DG  D  2 5    ? 1.343   73.246  20.175  1.00 49.88 ? 2011 DG  F "O3'" 1 
ATOM   698   C  "C2'" . DG  D  2 5    ? 0.363   72.285  22.144  1.00 49.33 ? 2011 DG  F "C2'" 1 
ATOM   699   C  "C1'" . DG  D  2 5    ? 0.590   70.855  21.676  1.00 50.75 ? 2011 DG  F "C1'" 1 
ATOM   700   N  N9    . DG  D  2 5    ? -0.243  69.829  22.323  1.00 51.01 ? 2011 DG  F N9    1 
ATOM   701   C  C8    . DG  D  2 5    ? -0.602  69.747  23.654  1.00 50.48 ? 2011 DG  F C8    1 
ATOM   702   N  N7    . DG  D  2 5    ? -1.366  68.729  23.932  1.00 50.54 ? 2011 DG  F N7    1 
ATOM   703   C  C5    . DG  D  2 5    ? -1.532  68.090  22.705  1.00 50.33 ? 2011 DG  F C5    1 
ATOM   704   C  C6    . DG  D  2 5    ? -2.269  66.927  22.379  1.00 49.63 ? 2011 DG  F C6    1 
ATOM   705   O  O6    . DG  D  2 5    ? -2.936  66.210  23.127  1.00 49.65 ? 2011 DG  F O6    1 
ATOM   706   N  N1    . DG  D  2 5    ? -2.188  66.619  21.028  1.00 50.00 ? 2011 DG  F N1    1 
ATOM   707   C  C2    . DG  D  2 5    ? -1.478  67.342  20.098  1.00 50.00 ? 2011 DG  F C2    1 
ATOM   708   N  N2    . DG  D  2 5    ? -1.525  66.872  18.845  1.00 50.33 ? 2011 DG  F N2    1 
ATOM   709   N  N3    . DG  D  2 5    ? -0.777  68.435  20.380  1.00 49.20 ? 2011 DG  F N3    1 
ATOM   710   C  C4    . DG  D  2 5    ? -0.847  68.751  21.702  1.00 50.31 ? 2011 DG  F C4    1 
ATOM   711   P  P     . DG  D  2 6    ? 0.953   74.711  19.645  1.00 52.81 ? 2012 DG  F P     1 
ATOM   712   O  OP1   . DG  D  2 6    ? 2.186   75.500  19.451  1.00 52.89 ? 2012 DG  F OP1   1 
ATOM   713   O  OP2   . DG  D  2 6    ? -0.126  75.300  20.477  1.00 52.57 ? 2012 DG  F OP2   1 
ATOM   714   O  "O5'" . DG  D  2 6    ? 0.424   74.311  18.189  1.00 53.13 ? 2012 DG  F "O5'" 1 
ATOM   715   C  "C5'" . DG  D  2 6    ? -0.824  74.746  17.688  1.00 54.38 ? 2012 DG  F "C5'" 1 
ATOM   716   C  "C4'" . DG  D  2 6    ? -1.690  73.569  17.292  1.00 54.25 ? 2012 DG  F "C4'" 1 
ATOM   717   O  "O4'" . DG  D  2 6    ? -1.680  72.601  18.365  1.00 54.68 ? 2012 DG  F "O4'" 1 
ATOM   718   C  "C3'" . DG  D  2 6    ? -3.162  73.926  17.106  1.00 55.44 ? 2012 DG  F "C3'" 1 
ATOM   719   O  "O3'" . DG  D  2 6    ? -3.465  74.201  15.734  1.00 55.58 ? 2012 DG  F "O3'" 1 
ATOM   720   C  "C2'" . DG  D  2 6    ? -3.915  72.700  17.617  1.00 56.13 ? 2012 DG  F "C2'" 1 
ATOM   721   C  "C1'" . DG  D  2 6    ? -2.838  71.800  18.218  1.00 56.03 ? 2012 DG  F "C1'" 1 
ATOM   722   N  N9    . DG  D  2 6    ? -3.257  71.223  19.497  1.00 55.90 ? 2012 DG  F N9    1 
ATOM   723   C  C8    . DG  D  2 6    ? -3.080  71.764  20.745  1.00 55.69 ? 2012 DG  F C8    1 
ATOM   724   N  N7    . DG  D  2 6    ? -3.565  71.027  21.706  1.00 55.99 ? 2012 DG  F N7    1 
ATOM   725   C  C5    . DG  D  2 6    ? -4.107  69.917  21.062  1.00 56.64 ? 2012 DG  F C5    1 
ATOM   726   C  C6    . DG  D  2 6    ? -4.773  68.765  21.592  1.00 56.50 ? 2012 DG  F C6    1 
ATOM   727   O  O6    . DG  D  2 6    ? -5.029  68.480  22.775  1.00 56.08 ? 2012 DG  F O6    1 
ATOM   728   N  N1    . DG  D  2 6    ? -5.159  67.877  20.588  1.00 55.75 ? 2012 DG  F N1    1 
ATOM   729   C  C2    . DG  D  2 6    ? -4.941  68.080  19.244  1.00 55.85 ? 2012 DG  F C2    1 
ATOM   730   N  N2    . DG  D  2 6    ? -5.391  67.111  18.439  1.00 56.33 ? 2012 DG  F N2    1 
ATOM   731   N  N3    . DG  D  2 6    ? -4.322  69.144  18.729  1.00 55.74 ? 2012 DG  F N3    1 
ATOM   732   C  C4    . DG  D  2 6    ? -3.925  70.026  19.692  1.00 56.36 ? 2012 DG  F C4    1 
ATOM   733   N  N     . VAL E  3 12   ? 98.959  13.727  60.678  1.00 56.06 ? 37   VAL A N     1 
ATOM   734   C  CA    . VAL E  3 12   ? 98.277  14.508  59.610  1.00 56.30 ? 37   VAL A CA    1 
ATOM   735   C  C     . VAL E  3 12   ? 98.515  16.011  59.775  1.00 56.74 ? 37   VAL A C     1 
ATOM   736   O  O     . VAL E  3 12   ? 98.223  16.589  60.823  1.00 56.67 ? 37   VAL A O     1 
ATOM   737   C  CB    . VAL E  3 12   ? 96.762  14.204  59.570  1.00 56.24 ? 37   VAL A CB    1 
ATOM   738   C  CG1   . VAL E  3 12   ? 96.050  15.141  58.604  1.00 55.50 ? 37   VAL A CG1   1 
ATOM   739   C  CG2   . VAL E  3 12   ? 96.523  12.751  59.180  1.00 56.01 ? 37   VAL A CG2   1 
ATOM   740   N  N     . GLU E  3 13   ? 99.043  16.628  58.721  1.00 57.45 ? 38   GLU A N     1 
ATOM   741   C  CA    . GLU E  3 13   ? 99.341  18.057  58.695  1.00 58.25 ? 38   GLU A CA    1 
ATOM   742   C  C     . GLU E  3 13   ? 98.528  18.700  57.563  1.00 57.72 ? 38   GLU A C     1 
ATOM   743   O  O     . GLU E  3 13   ? 98.429  18.126  56.477  1.00 57.32 ? 38   GLU A O     1 
ATOM   744   C  CB    . GLU E  3 13   ? 100.845 18.246  58.472  1.00 59.30 ? 38   GLU A CB    1 
ATOM   745   C  CG    . GLU E  3 13   ? 101.325 19.688  58.345  1.00 62.50 ? 38   GLU A CG    1 
ATOM   746   C  CD    . GLU E  3 13   ? 102.521 19.824  57.407  1.00 64.81 ? 38   GLU A CD    1 
ATOM   747   O  OE1   . GLU E  3 13   ? 103.459 19.001  57.507  1.00 65.51 ? 38   GLU A OE1   1 
ATOM   748   O  OE2   . GLU E  3 13   ? 102.521 20.755  56.567  1.00 66.14 ? 38   GLU A OE2   1 
ATOM   749   N  N     . THR E  3 14   ? 97.944  19.875  57.810  1.00 57.17 ? 39   THR A N     1 
ATOM   750   C  CA    . THR E  3 14   ? 97.035  20.491  56.827  1.00 56.60 ? 39   THR A CA    1 
ATOM   751   C  C     . THR E  3 14   ? 97.465  21.842  56.244  1.00 56.22 ? 39   THR A C     1 
ATOM   752   O  O     . THR E  3 14   ? 98.325  22.529  56.786  1.00 55.57 ? 39   THR A O     1 
ATOM   753   C  CB    . THR E  3 14   ? 95.574  20.613  57.353  1.00 56.56 ? 39   THR A CB    1 
ATOM   754   O  OG1   . THR E  3 14   ? 95.520  21.569  58.417  1.00 57.51 ? 39   THR A OG1   1 
ATOM   755   C  CG2   . THR E  3 14   ? 95.039  19.265  57.832  1.00 56.15 ? 39   THR A CG2   1 
ATOM   756   N  N     . ILE E  3 15   ? 96.835  22.194  55.123  1.00 56.79 ? 40   ILE A N     1 
ATOM   757   C  CA    . ILE E  3 15   ? 97.036  23.455  54.406  1.00 56.79 ? 40   ILE A CA    1 
ATOM   758   C  C     . ILE E  3 15   ? 95.684  24.140  54.287  1.00 56.72 ? 40   ILE A C     1 
ATOM   759   O  O     . ILE E  3 15   ? 94.680  23.475  54.011  1.00 56.40 ? 40   ILE A O     1 
ATOM   760   C  CB    . ILE E  3 15   ? 97.593  23.199  52.972  1.00 56.84 ? 40   ILE A CB    1 
ATOM   761   C  CG1   . ILE E  3 15   ? 99.000  22.607  53.030  1.00 57.49 ? 40   ILE A CG1   1 
ATOM   762   C  CG2   . ILE E  3 15   ? 97.606  24.470  52.111  1.00 56.25 ? 40   ILE A CG2   1 
ATOM   763   C  CD1   . ILE E  3 15   ? 99.981  23.387  53.894  1.00 57.65 ? 40   ILE A CD1   1 
ATOM   764   N  N     . SER E  3 16   ? 95.651  25.457  54.491  1.00 56.74 ? 41   SER A N     1 
ATOM   765   C  CA    . SER E  3 16   ? 94.420  26.223  54.303  1.00 56.68 ? 41   SER A CA    1 
ATOM   766   C  C     . SER E  3 16   ? 93.938  26.129  52.861  1.00 56.68 ? 41   SER A C     1 
ATOM   767   O  O     . SER E  3 16   ? 94.744  26.078  51.931  1.00 56.81 ? 41   SER A O     1 
ATOM   768   C  CB    . SER E  3 16   ? 94.611  27.690  54.689  1.00 56.49 ? 41   SER A CB    1 
ATOM   769   O  OG    . SER E  3 16   ? 93.511  28.467  54.243  1.00 56.30 ? 41   SER A OG    1 
ATOM   770   N  N     . THR E  3 17   ? 92.621  26.105  52.684  1.00 56.71 ? 42   THR A N     1 
ATOM   771   C  CA    . THR E  3 17   ? 92.031  26.042  51.350  1.00 56.39 ? 42   THR A CA    1 
ATOM   772   C  C     . THR E  3 17   ? 91.834  27.434  50.760  1.00 56.74 ? 42   THR A C     1 
ATOM   773   O  O     . THR E  3 17   ? 91.556  27.572  49.568  1.00 57.13 ? 42   THR A O     1 
ATOM   774   C  CB    . THR E  3 17   ? 90.673  25.328  51.361  1.00 55.74 ? 42   THR A CB    1 
ATOM   775   O  OG1   . THR E  3 17   ? 89.801  25.973  52.298  1.00 54.61 ? 42   THR A OG1   1 
ATOM   776   C  CG2   . THR E  3 17   ? 90.840  23.867  51.734  1.00 54.84 ? 42   THR A CG2   1 
ATOM   777   N  N     . GLY E  3 18   ? 91.978  28.458  51.599  1.00 56.68 ? 43   GLY A N     1 
ATOM   778   C  CA    . GLY E  3 18   ? 91.694  29.831  51.191  1.00 56.35 ? 43   GLY A CA    1 
ATOM   779   C  C     . GLY E  3 18   ? 90.283  30.245  51.578  1.00 56.10 ? 43   GLY A C     1 
ATOM   780   O  O     . GLY E  3 18   ? 89.957  31.437  51.592  1.00 56.42 ? 43   GLY A O     1 
ATOM   781   N  N     . SER E  3 19   ? 89.442  29.255  51.873  1.00 55.25 ? 44   SER A N     1 
ATOM   782   C  CA    . SER E  3 19   ? 88.128  29.494  52.456  1.00 54.35 ? 44   SER A CA    1 
ATOM   783   C  C     . SER E  3 19   ? 88.136  29.035  53.902  1.00 54.04 ? 44   SER A C     1 
ATOM   784   O  O     . SER E  3 19   ? 88.517  27.898  54.197  1.00 54.02 ? 44   SER A O     1 
ATOM   785   C  CB    . SER E  3 19   ? 87.037  28.758  51.681  1.00 54.39 ? 44   SER A CB    1 
ATOM   786   O  OG    . SER E  3 19   ? 85.867  28.613  52.469  1.00 53.18 ? 44   SER A OG    1 
ATOM   787   N  N     . LEU E  3 20   ? 87.720  29.930  54.796  1.00 53.61 ? 45   LEU A N     1 
ATOM   788   C  CA    . LEU E  3 20   ? 87.671  29.631  56.222  1.00 52.53 ? 45   LEU A CA    1 
ATOM   789   C  C     . LEU E  3 20   ? 86.596  28.598  56.515  1.00 52.17 ? 45   LEU A C     1 
ATOM   790   O  O     . LEU E  3 20   ? 86.853  27.622  57.220  1.00 52.33 ? 45   LEU A O     1 
ATOM   791   C  CB    . LEU E  3 20   ? 87.418  30.896  57.046  1.00 52.14 ? 45   LEU A CB    1 
ATOM   792   C  CG    . LEU E  3 20   ? 87.298  30.667  58.556  1.00 51.88 ? 45   LEU A CG    1 
ATOM   793   C  CD1   . LEU E  3 20   ? 88.640  30.268  59.160  1.00 51.86 ? 45   LEU A CD1   1 
ATOM   794   C  CD2   . LEU E  3 20   ? 86.726  31.886  59.257  1.00 51.45 ? 45   LEU A CD2   1 
ATOM   795   N  N     . SER E  3 21   ? 85.402  28.813  55.963  1.00 51.50 ? 46   SER A N     1 
ATOM   796   C  CA    . SER E  3 21   ? 84.274  27.922  56.212  1.00 51.17 ? 46   SER A CA    1 
ATOM   797   C  C     . SER E  3 21   ? 84.517  26.525  55.646  1.00 50.92 ? 46   SER A C     1 
ATOM   798   O  O     . SER E  3 21   ? 83.991  25.542  56.173  1.00 51.30 ? 46   SER A O     1 
ATOM   799   C  CB    . SER E  3 21   ? 82.961  28.516  55.691  1.00 51.07 ? 46   SER A CB    1 
ATOM   800   O  OG    . SER E  3 21   ? 82.947  28.581  54.281  1.00 51.36 ? 46   SER A OG    1 
ATOM   801   N  N     . LEU E  3 22   ? 85.316  26.439  54.583  1.00 50.74 ? 47   LEU A N     1 
ATOM   802   C  CA    . LEU E  3 22   ? 85.725  25.142  54.044  1.00 50.57 ? 47   LEU A CA    1 
ATOM   803   C  C     . LEU E  3 22   ? 86.690  24.447  55.001  1.00 50.87 ? 47   LEU A C     1 
ATOM   804   O  O     . LEU E  3 22   ? 86.535  23.258  55.287  1.00 50.95 ? 47   LEU A O     1 
ATOM   805   C  CB    . LEU E  3 22   ? 86.366  25.278  52.660  1.00 49.79 ? 47   LEU A CB    1 
ATOM   806   C  CG    . LEU E  3 22   ? 86.112  24.167  51.632  1.00 49.14 ? 47   LEU A CG    1 
ATOM   807   C  CD1   . LEU E  3 22   ? 87.187  24.190  50.566  1.00 48.82 ? 47   LEU A CD1   1 
ATOM   808   C  CD2   . LEU E  3 22   ? 86.026  22.774  52.238  1.00 48.24 ? 47   LEU A CD2   1 
ATOM   809   N  N     . ASP E  3 23   ? 87.679  25.191  55.495  1.00 51.06 ? 48   ASP A N     1 
ATOM   810   C  CA    . ASP E  3 23   ? 88.631  24.656  56.462  1.00 51.45 ? 48   ASP A CA    1 
ATOM   811   C  C     . ASP E  3 23   ? 87.897  24.118  57.683  1.00 51.29 ? 48   ASP A C     1 
ATOM   812   O  O     . ASP E  3 23   ? 88.314  23.124  58.273  1.00 51.82 ? 48   ASP A O     1 
ATOM   813   C  CB    . ASP E  3 23   ? 89.672  25.713  56.859  1.00 52.33 ? 48   ASP A CB    1 
ATOM   814   C  CG    . ASP E  3 23   ? 90.710  25.971  55.757  1.00 54.28 ? 48   ASP A CG    1 
ATOM   815   O  OD1   . ASP E  3 23   ? 90.841  25.140  54.828  1.00 55.18 ? 48   ASP A OD1   1 
ATOM   816   O  OD2   . ASP E  3 23   ? 91.406  27.010  55.822  1.00 55.36 ? 48   ASP A OD2   1 
ATOM   817   N  N     . ILE E  3 24   ? 86.788  24.764  58.041  1.00 50.85 ? 49   ILE A N     1 
ATOM   818   C  CA    . ILE E  3 24   ? 85.932  24.291  59.135  1.00 49.83 ? 49   ILE A CA    1 
ATOM   819   C  C     . ILE E  3 24   ? 85.165  23.035  58.716  1.00 49.23 ? 49   ILE A C     1 
ATOM   820   O  O     . ILE E  3 24   ? 85.161  22.042  59.443  1.00 49.12 ? 49   ILE A O     1 
ATOM   821   C  CB    . ILE E  3 24   ? 84.969  25.394  59.635  1.00 49.63 ? 49   ILE A CB    1 
ATOM   822   C  CG1   . ILE E  3 24   ? 85.769  26.558  60.225  1.00 48.95 ? 49   ILE A CG1   1 
ATOM   823   C  CG2   . ILE E  3 24   ? 84.012  24.846  60.688  1.00 49.40 ? 49   ILE A CG2   1 
ATOM   824   C  CD1   . ILE E  3 24   ? 85.058  27.892  60.160  1.00 48.59 ? 49   ILE A CD1   1 
ATOM   825   N  N     . ALA E  3 25   ? 84.539  23.080  57.540  1.00 48.43 ? 50   ALA A N     1 
ATOM   826   C  CA    . ALA E  3 25   ? 83.832  21.923  56.992  1.00 47.86 ? 50   ALA A CA    1 
ATOM   827   C  C     . ALA E  3 25   ? 84.735  20.695  56.896  1.00 47.34 ? 50   ALA A C     1 
ATOM   828   O  O     . ALA E  3 25   ? 84.292  19.574  57.147  1.00 47.83 ? 50   ALA A O     1 
ATOM   829   C  CB    . ALA E  3 25   ? 83.240  22.250  55.631  1.00 47.67 ? 50   ALA A CB    1 
ATOM   830   N  N     . LEU E  3 26   ? 86.000  20.921  56.548  1.00 46.30 ? 51   LEU A N     1 
ATOM   831   C  CA    . LEU E  3 26   ? 86.982  19.852  56.419  1.00 46.11 ? 51   LEU A CA    1 
ATOM   832   C  C     . LEU E  3 26   ? 87.353  19.201  57.740  1.00 46.22 ? 51   LEU A C     1 
ATOM   833   O  O     . LEU E  3 26   ? 88.014  18.162  57.755  1.00 46.05 ? 51   LEU A O     1 
ATOM   834   C  CB    . LEU E  3 26   ? 88.246  20.384  55.759  1.00 46.49 ? 51   LEU A CB    1 
ATOM   835   C  CG    . LEU E  3 26   ? 88.212  20.475  54.240  1.00 47.59 ? 51   LEU A CG    1 
ATOM   836   C  CD1   . LEU E  3 26   ? 89.308  21.398  53.762  1.00 48.42 ? 51   LEU A CD1   1 
ATOM   837   C  CD2   . LEU E  3 26   ? 88.359  19.095  53.624  1.00 48.05 ? 51   LEU A CD2   1 
ATOM   838   N  N     . GLY E  3 27   ? 86.949  19.824  58.843  1.00 46.48 ? 52   GLY A N     1 
ATOM   839   C  CA    . GLY E  3 27   ? 87.153  19.261  60.174  1.00 46.58 ? 52   GLY A CA    1 
ATOM   840   C  C     . GLY E  3 27   ? 88.541  19.488  60.746  1.00 46.55 ? 52   GLY A C     1 
ATOM   841   O  O     . GLY E  3 27   ? 88.681  19.942  61.888  1.00 46.48 ? 52   GLY A O     1 
ATOM   842   N  N     . ALA E  3 28   ? 89.566  19.168  59.958  1.00 46.34 ? 53   ALA A N     1 
ATOM   843   C  CA    . ALA E  3 28   ? 90.954  19.286  60.404  1.00 46.23 ? 53   ALA A CA    1 
ATOM   844   C  C     . ALA E  3 28   ? 91.596  20.634  60.060  1.00 46.09 ? 53   ALA A C     1 
ATOM   845   O  O     . ALA E  3 28   ? 92.781  20.847  60.321  1.00 46.32 ? 53   ALA A O     1 
ATOM   846   C  CB    . ALA E  3 28   ? 91.790  18.135  59.858  1.00 45.95 ? 53   ALA A CB    1 
ATOM   847   N  N     . GLY E  3 29   ? 90.814  21.540  59.479  1.00 45.79 ? 54   GLY A N     1 
ATOM   848   C  CA    . GLY E  3 29   ? 91.274  22.903  59.227  1.00 45.52 ? 54   GLY A CA    1 
ATOM   849   C  C     . GLY E  3 29   ? 91.969  23.119  57.898  1.00 45.67 ? 54   GLY A C     1 
ATOM   850   O  O     . GLY E  3 29   ? 92.577  24.166  57.676  1.00 45.35 ? 54   GLY A O     1 
ATOM   851   N  N     . GLY E  3 30   ? 91.880  22.132  57.013  1.00 46.08 ? 55   GLY A N     1 
ATOM   852   C  CA    . GLY E  3 30   ? 92.457  22.245  55.679  1.00 46.56 ? 55   GLY A CA    1 
ATOM   853   C  C     . GLY E  3 30   ? 92.703  20.908  55.010  1.00 46.79 ? 55   GLY A C     1 
ATOM   854   O  O     . GLY E  3 30   ? 92.364  19.859  55.559  1.00 47.28 ? 55   GLY A O     1 
ATOM   855   N  N     . LEU E  3 31   ? 93.294  20.949  53.820  1.00 46.34 ? 56   LEU A N     1 
ATOM   856   C  CA    . LEU E  3 31   ? 93.617  19.735  53.077  1.00 46.02 ? 56   LEU A CA    1 
ATOM   857   C  C     . LEU E  3 31   ? 94.877  19.075  53.638  1.00 45.98 ? 56   LEU A C     1 
ATOM   858   O  O     . LEU E  3 31   ? 95.796  19.775  54.049  1.00 45.60 ? 56   LEU A O     1 
ATOM   859   C  CB    . LEU E  3 31   ? 93.788  20.062  51.594  1.00 45.97 ? 56   LEU A CB    1 
ATOM   860   C  CG    . LEU E  3 31   ? 92.551  20.656  50.914  1.00 45.00 ? 56   LEU A CG    1 
ATOM   861   C  CD1   . LEU E  3 31   ? 92.898  21.214  49.547  1.00 44.35 ? 56   LEU A CD1   1 
ATOM   862   C  CD2   . LEU E  3 31   ? 91.452  19.619  50.804  1.00 44.81 ? 56   LEU A CD2   1 
ATOM   863   N  N     . PRO E  3 32   ? 94.925  17.725  53.654  1.00 46.23 ? 57   PRO A N     1 
ATOM   864   C  CA    . PRO E  3 32   ? 96.050  17.026  54.284  1.00 46.39 ? 57   PRO A CA    1 
ATOM   865   C  C     . PRO E  3 32   ? 97.266  16.833  53.372  1.00 46.58 ? 57   PRO A C     1 
ATOM   866   O  O     . PRO E  3 32   ? 97.122  16.477  52.207  1.00 46.41 ? 57   PRO A O     1 
ATOM   867   C  CB    . PRO E  3 32   ? 95.446  15.676  54.678  1.00 46.06 ? 57   PRO A CB    1 
ATOM   868   C  CG    . PRO E  3 32   ? 94.304  15.463  53.732  1.00 46.35 ? 57   PRO A CG    1 
ATOM   869   C  CD    . PRO E  3 32   ? 93.940  16.782  53.093  1.00 46.36 ? 57   PRO A CD    1 
ATOM   870   N  N     . MET E  3 33   ? 98.454  17.062  53.924  1.00 47.06 ? 58   MET A N     1 
ATOM   871   C  CA    . MET E  3 33   ? 99.710  16.925  53.190  1.00 47.23 ? 58   MET A CA    1 
ATOM   872   C  C     . MET E  3 33   ? 100.068 15.466  52.960  1.00 46.22 ? 58   MET A C     1 
ATOM   873   O  O     . MET E  3 33   ? 99.832  14.622  53.821  1.00 46.45 ? 58   MET A O     1 
ATOM   874   C  CB    . MET E  3 33   ? 100.841 17.608  53.965  1.00 48.52 ? 58   MET A CB    1 
ATOM   875   C  CG    . MET E  3 33   ? 100.672 19.112  54.103  1.00 51.43 ? 58   MET A CG    1 
ATOM   876   S  SD    . MET E  3 33   ? 100.760 19.916  52.486  1.00 56.29 ? 58   MET A SD    1 
ATOM   877   C  CE    . MET E  3 33   ? 102.532 20.115  52.298  1.00 55.44 ? 58   MET A CE    1 
ATOM   878   N  N     . GLY E  3 34   ? 100.645 15.171  51.802  1.00 44.99 ? 59   GLY A N     1 
ATOM   879   C  CA    . GLY E  3 34   ? 101.053 13.806  51.481  1.00 44.41 ? 59   GLY A CA    1 
ATOM   880   C  C     . GLY E  3 34   ? 99.899  12.924  51.039  1.00 44.21 ? 59   GLY A C     1 
ATOM   881   O  O     . GLY E  3 34   ? 100.053 11.707  50.894  1.00 44.32 ? 59   GLY A O     1 
ATOM   882   N  N     . ARG E  3 35   ? 98.744  13.546  50.818  1.00 43.84 ? 60   ARG A N     1 
ATOM   883   C  CA    . ARG E  3 35   ? 97.530  12.836  50.433  1.00 43.48 ? 60   ARG A CA    1 
ATOM   884   C  C     . ARG E  3 35   ? 97.055  13.269  49.046  1.00 43.16 ? 60   ARG A C     1 
ATOM   885   O  O     . ARG E  3 35   ? 97.524  14.271  48.497  1.00 42.88 ? 60   ARG A O     1 
ATOM   886   C  CB    . ARG E  3 35   ? 96.420  13.073  51.469  1.00 43.51 ? 60   ARG A CB    1 
ATOM   887   C  CG    . ARG E  3 35   ? 96.803  12.802  52.928  1.00 43.17 ? 60   ARG A CG    1 
ATOM   888   C  CD    . ARG E  3 35   ? 97.249  11.363  53.156  1.00 43.74 ? 60   ARG A CD    1 
ATOM   889   N  NE    . ARG E  3 35   ? 97.154  10.965  54.562  1.00 44.80 ? 60   ARG A NE    1 
ATOM   890   C  CZ    . ARG E  3 35   ? 96.069  10.431  55.125  1.00 45.24 ? 60   ARG A CZ    1 
ATOM   891   N  NH1   . ARG E  3 35   ? 94.967  10.229  54.410  1.00 45.75 ? 60   ARG A NH1   1 
ATOM   892   N  NH2   . ARG E  3 35   ? 96.082  10.101  56.410  1.00 45.18 ? 60   ARG A NH2   1 
ATOM   893   N  N     . ILE E  3 36   ? 96.130  12.498  48.482  1.00 42.87 ? 61   ILE A N     1 
ATOM   894   C  CA    . ILE E  3 36   ? 95.479  12.856  47.229  1.00 42.69 ? 61   ILE A CA    1 
ATOM   895   C  C     . ILE E  3 36   ? 94.102  13.435  47.535  1.00 43.32 ? 61   ILE A C     1 
ATOM   896   O  O     . ILE E  3 36   ? 93.390  12.932  48.408  1.00 44.04 ? 61   ILE A O     1 
ATOM   897   C  CB    . ILE E  3 36   ? 95.341  11.639  46.301  1.00 42.03 ? 61   ILE A CB    1 
ATOM   898   C  CG1   . ILE E  3 36   ? 96.721  11.082  45.949  1.00 41.08 ? 61   ILE A CG1   1 
ATOM   899   C  CG2   . ILE E  3 36   ? 94.579  12.013  45.041  1.00 42.05 ? 61   ILE A CG2   1 
ATOM   900   C  CD1   . ILE E  3 36   ? 96.708  9.635   45.495  1.00 40.21 ? 61   ILE A CD1   1 
ATOM   901   N  N     . VAL E  3 37   ? 93.742  14.499  46.825  1.00 43.42 ? 62   VAL A N     1 
ATOM   902   C  CA    . VAL E  3 37   ? 92.462  15.170  47.009  1.00 44.43 ? 62   VAL A CA    1 
ATOM   903   C  C     . VAL E  3 37   ? 91.815  15.374  45.644  1.00 45.84 ? 62   VAL A C     1 
ATOM   904   O  O     . VAL E  3 37   ? 92.511  15.667  44.669  1.00 46.10 ? 62   VAL A O     1 
ATOM   905   C  CB    . VAL E  3 37   ? 92.655  16.530  47.724  1.00 43.98 ? 62   VAL A CB    1 
ATOM   906   C  CG1   . VAL E  3 37   ? 91.407  17.393  47.635  1.00 44.04 ? 62   VAL A CG1   1 
ATOM   907   C  CG2   . VAL E  3 37   ? 93.031  16.316  49.175  1.00 44.49 ? 62   VAL A CG2   1 
ATOM   908   N  N     . GLU E  3 38   ? 90.492  15.208  45.570  1.00 46.87 ? 63   GLU A N     1 
ATOM   909   C  CA    . GLU E  3 38   ? 89.749  15.471  44.333  1.00 47.96 ? 63   GLU A CA    1 
ATOM   910   C  C     . GLU E  3 38   ? 88.678  16.546  44.523  1.00 47.14 ? 63   GLU A C     1 
ATOM   911   O  O     . GLU E  3 38   ? 87.903  16.501  45.476  1.00 47.65 ? 63   GLU A O     1 
ATOM   912   C  CB    . GLU E  3 38   ? 89.122  14.182  43.790  1.00 47.79 ? 63   GLU A CB    1 
ATOM   913   C  CG    . GLU E  3 38   ? 88.340  14.346  42.481  1.00 49.71 ? 63   GLU A CG    1 
ATOM   914   C  CD    . GLU E  3 38   ? 87.594  13.076  42.078  1.00 50.82 ? 63   GLU A CD    1 
ATOM   915   O  OE1   . GLU E  3 38   ? 87.371  12.216  42.955  1.00 54.19 ? 63   GLU A OE1   1 
ATOM   916   O  OE2   . GLU E  3 38   ? 87.230  12.925  40.889  1.00 52.44 ? 63   GLU A OE2   1 
ATOM   917   N  N     . ILE E  3 39   ? 88.656  17.519  43.618  1.00 46.08 ? 64   ILE A N     1 
ATOM   918   C  CA    . ILE E  3 39   ? 87.582  18.496  43.565  1.00 45.43 ? 64   ILE A CA    1 
ATOM   919   C  C     . ILE E  3 39   ? 86.866  18.325  42.234  1.00 45.62 ? 64   ILE A C     1 
ATOM   920   O  O     . ILE E  3 39   ? 87.492  18.377  41.171  1.00 46.56 ? 64   ILE A O     1 
ATOM   921   C  CB    . ILE E  3 39   ? 88.103  19.935  43.649  1.00 45.25 ? 64   ILE A CB    1 
ATOM   922   C  CG1   . ILE E  3 39   ? 88.971  20.122  44.882  1.00 45.79 ? 64   ILE A CG1   1 
ATOM   923   C  CG2   . ILE E  3 39   ? 86.945  20.923  43.681  1.00 45.09 ? 64   ILE A CG2   1 
ATOM   924   C  CD1   . ILE E  3 39   ? 89.925  21.291  44.772  1.00 46.72 ? 64   ILE A CD1   1 
ATOM   925   N  N     . TYR E  3 40   ? 85.556  18.116  42.288  1.00 44.75 ? 65   TYR A N     1 
ATOM   926   C  CA    . TYR E  3 40   ? 84.756  18.042  41.077  1.00 43.13 ? 65   TYR A CA    1 
ATOM   927   C  C     . TYR E  3 40   ? 83.552  18.970  41.168  1.00 42.54 ? 65   TYR A C     1 
ATOM   928   O  O     . TYR E  3 40   ? 83.176  19.411  42.254  1.00 42.87 ? 65   TYR A O     1 
ATOM   929   C  CB    . TYR E  3 40   ? 84.338  16.596  40.784  1.00 43.03 ? 65   TYR A CB    1 
ATOM   930   C  CG    . TYR E  3 40   ? 83.398  15.974  41.800  1.00 43.16 ? 65   TYR A CG    1 
ATOM   931   C  CD1   . TYR E  3 40   ? 82.046  16.300  41.812  1.00 42.72 ? 65   TYR A CD1   1 
ATOM   932   C  CD2   . TYR E  3 40   ? 83.856  15.040  42.734  1.00 43.19 ? 65   TYR A CD2   1 
ATOM   933   C  CE1   . TYR E  3 40   ? 81.179  15.732  42.730  1.00 43.29 ? 65   TYR A CE1   1 
ATOM   934   C  CE2   . TYR E  3 40   ? 82.990  14.460  43.659  1.00 42.67 ? 65   TYR A CE2   1 
ATOM   935   C  CZ    . TYR E  3 40   ? 81.652  14.814  43.649  1.00 43.14 ? 65   TYR A CZ    1 
ATOM   936   O  OH    . TYR E  3 40   ? 80.772  14.258  44.550  1.00 43.49 ? 65   TYR A OH    1 
ATOM   937   N  N     . GLY E  3 41   ? 82.956  19.261  40.019  1.00 41.98 ? 66   GLY A N     1 
ATOM   938   C  CA    . GLY E  3 41   ? 81.789  20.131  39.941  1.00 41.30 ? 66   GLY A CA    1 
ATOM   939   C  C     . GLY E  3 41   ? 81.498  20.515  38.503  1.00 40.98 ? 66   GLY A C     1 
ATOM   940   O  O     . GLY E  3 41   ? 82.283  20.190  37.610  1.00 41.01 ? 66   GLY A O     1 
ATOM   941   N  N     . PRO E  3 42   ? 80.371  21.215  38.268  1.00 40.83 ? 67   PRO A N     1 
ATOM   942   C  CA    . PRO E  3 42   ? 79.970  21.674  36.937  1.00 41.37 ? 67   PRO A CA    1 
ATOM   943   C  C     . PRO E  3 42   ? 80.930  22.737  36.390  1.00 41.79 ? 67   PRO A C     1 
ATOM   944   O  O     . PRO E  3 42   ? 81.787  23.216  37.125  1.00 40.78 ? 67   PRO A O     1 
ATOM   945   C  CB    . PRO E  3 42   ? 78.584  22.290  37.179  1.00 40.88 ? 67   PRO A CB    1 
ATOM   946   C  CG    . PRO E  3 42   ? 78.168  21.835  38.517  1.00 39.68 ? 67   PRO A CG    1 
ATOM   947   C  CD    . PRO E  3 42   ? 79.402  21.625  39.295  1.00 40.20 ? 67   PRO A CD    1 
ATOM   948   N  N     . GLU E  3 43   ? 80.792  23.091  35.115  1.00 43.28 ? 68   GLU A N     1 
ATOM   949   C  CA    . GLU E  3 43   ? 81.646  24.122  34.515  1.00 45.47 ? 68   GLU A CA    1 
ATOM   950   C  C     . GLU E  3 43   ? 81.523  25.470  35.209  1.00 45.88 ? 68   GLU A C     1 
ATOM   951   O  O     . GLU E  3 43   ? 80.435  25.852  35.652  1.00 46.00 ? 68   GLU A O     1 
ATOM   952   C  CB    . GLU E  3 43   ? 81.398  24.280  33.012  1.00 46.18 ? 68   GLU A CB    1 
ATOM   953   C  CG    . GLU E  3 43   ? 80.116  23.666  32.511  1.00 50.00 ? 68   GLU A CG    1 
ATOM   954   C  CD    . GLU E  3 43   ? 78.875  24.366  33.014  1.00 53.04 ? 68   GLU A CD    1 
ATOM   955   O  OE1   . GLU E  3 43   ? 78.143  23.744  33.815  1.00 54.88 ? 68   GLU A OE1   1 
ATOM   956   O  OE2   . GLU E  3 43   ? 78.634  25.528  32.613  1.00 54.37 ? 68   GLU A OE2   1 
ATOM   957   N  N     . SER E  3 44   ? 82.658  26.166  35.307  1.00 46.07 ? 69   SER A N     1 
ATOM   958   C  CA    . SER E  3 44   ? 82.751  27.477  35.943  1.00 46.39 ? 69   SER A CA    1 
ATOM   959   C  C     . SER E  3 44   ? 82.214  27.487  37.370  1.00 46.54 ? 69   SER A C     1 
ATOM   960   O  O     . SER E  3 44   ? 81.662  28.491  37.825  1.00 47.00 ? 69   SER A O     1 
ATOM   961   C  CB    . SER E  3 44   ? 82.043  28.542  35.093  1.00 46.95 ? 69   SER A CB    1 
ATOM   962   O  OG    . SER E  3 44   ? 82.911  29.055  34.098  1.00 49.12 ? 69   SER A OG    1 
ATOM   963   N  N     . SER E  3 45   ? 82.374  26.373  38.077  1.00 46.54 ? 70   SER A N     1 
ATOM   964   C  CA    . SER E  3 45   ? 81.871  26.275  39.447  1.00 46.80 ? 70   SER A CA    1 
ATOM   965   C  C     . SER E  3 45   ? 82.875  26.821  40.449  1.00 46.65 ? 70   SER A C     1 
ATOM   966   O  O     . SER E  3 45   ? 82.514  27.201  41.563  1.00 46.33 ? 70   SER A O     1 
ATOM   967   C  CB    . SER E  3 45   ? 81.508  24.836  39.798  1.00 47.20 ? 70   SER A CB    1 
ATOM   968   O  OG    . SER E  3 45   ? 82.603  23.975  39.553  1.00 47.73 ? 70   SER A OG    1 
ATOM   969   N  N     . GLY E  3 46   ? 84.138  26.860  40.043  1.00 46.94 ? 71   GLY A N     1 
ATOM   970   C  CA    . GLY E  3 46   ? 85.184  27.441  40.873  1.00 46.49 ? 71   GLY A CA    1 
ATOM   971   C  C     . GLY E  3 46   ? 86.316  26.488  41.189  1.00 46.20 ? 71   GLY A C     1 
ATOM   972   O  O     . GLY E  3 46   ? 87.104  26.744  42.099  1.00 46.04 ? 71   GLY A O     1 
ATOM   973   N  N     . LYS E  3 47   ? 86.407  25.399  40.427  1.00 45.68 ? 72   LYS A N     1 
ATOM   974   C  CA    . LYS E  3 47   ? 87.409  24.363  40.674  1.00 44.59 ? 72   LYS A CA    1 
ATOM   975   C  C     . LYS E  3 47   ? 88.827  24.913  40.570  1.00 44.04 ? 72   LYS A C     1 
ATOM   976   O  O     . LYS E  3 47   ? 89.597  24.803  41.515  1.00 44.37 ? 72   LYS A O     1 
ATOM   977   C  CB    . LYS E  3 47   ? 87.202  23.158  39.750  1.00 44.46 ? 72   LYS A CB    1 
ATOM   978   C  CG    . LYS E  3 47   ? 85.802  22.540  39.840  1.00 44.32 ? 72   LYS A CG    1 
ATOM   979   C  CD    . LYS E  3 47   ? 85.598  21.398  38.854  1.00 44.20 ? 72   LYS A CD    1 
ATOM   980   C  CE    . LYS E  3 47   ? 85.607  21.874  37.402  1.00 44.39 ? 72   LYS A CE    1 
ATOM   981   N  NZ    . LYS E  3 47   ? 84.469  22.774  37.059  1.00 44.69 ? 72   LYS A NZ    1 
ATOM   982   N  N     . THR E  3 48   ? 89.158  25.534  39.444  1.00 44.08 ? 73   THR A N     1 
ATOM   983   C  CA    . THR E  3 48   ? 90.483  26.136  39.275  1.00 44.23 ? 73   THR A CA    1 
ATOM   984   C  C     . THR E  3 48   ? 90.719  27.244  40.287  1.00 43.81 ? 73   THR A C     1 
ATOM   985   O  O     . THR E  3 48   ? 91.754  27.257  40.947  1.00 43.84 ? 73   THR A O     1 
ATOM   986   C  CB    . THR E  3 48   ? 90.688  26.737  37.874  1.00 44.89 ? 73   THR A CB    1 
ATOM   987   O  OG1   . THR E  3 48   ? 90.258  25.810  36.870  1.00 45.48 ? 73   THR A OG1   1 
ATOM   988   C  CG2   . THR E  3 48   ? 92.158  27.081  37.658  1.00 44.21 ? 73   THR A CG2   1 
ATOM   989   N  N     . THR E  3 49   ? 89.761  28.166  40.396  1.00 43.38 ? 74   THR A N     1 
ATOM   990   C  CA    . THR E  3 49   ? 89.866  29.287  41.323  1.00 43.06 ? 74   THR A CA    1 
ATOM   991   C  C     . THR E  3 49   ? 90.236  28.799  42.720  1.00 44.00 ? 74   THR A C     1 
ATOM   992   O  O     . THR E  3 49   ? 91.220  29.253  43.299  1.00 43.78 ? 74   THR A O     1 
ATOM   993   C  CB    . THR E  3 49   ? 88.580  30.137  41.360  1.00 42.20 ? 74   THR A CB    1 
ATOM   994   O  OG1   . THR E  3 49   ? 88.450  30.858  40.133  1.00 40.22 ? 74   THR A OG1   1 
ATOM   995   C  CG2   . THR E  3 49   ? 88.630  31.141  42.498  1.00 42.96 ? 74   THR A CG2   1 
ATOM   996   N  N     . LEU E  3 50   ? 89.468  27.849  43.240  1.00 45.56 ? 75   LEU A N     1 
ATOM   997   C  CA    . LEU E  3 50   ? 89.721  27.313  44.574  1.00 47.08 ? 75   LEU A CA    1 
ATOM   998   C  C     . LEU E  3 50   ? 91.133  26.749  44.659  1.00 46.89 ? 75   LEU A C     1 
ATOM   999   O  O     . LEU E  3 50   ? 91.902  27.113  45.544  1.00 46.61 ? 75   LEU A O     1 
ATOM   1000  C  CB    . LEU E  3 50   ? 88.681  26.250  44.936  1.00 47.74 ? 75   LEU A CB    1 
ATOM   1001  C  CG    . LEU E  3 50   ? 88.659  25.813  46.399  1.00 48.90 ? 75   LEU A CG    1 
ATOM   1002  C  CD1   . LEU E  3 50   ? 87.237  25.811  46.906  1.00 50.58 ? 75   LEU A CD1   1 
ATOM   1003  C  CD2   . LEU E  3 50   ? 89.293  24.450  46.561  1.00 49.30 ? 75   LEU A CD2   1 
ATOM   1004  N  N     . THR E  3 51   ? 91.453  25.867  43.721  1.00 47.09 ? 76   THR A N     1 
ATOM   1005  C  CA    . THR E  3 51   ? 92.795  25.334  43.547  1.00 47.90 ? 76   THR A CA    1 
ATOM   1006  C  C     . THR E  3 51   ? 93.893  26.400  43.666  1.00 47.93 ? 76   THR A C     1 
ATOM   1007  O  O     . THR E  3 51   ? 94.818  26.252  44.472  1.00 48.18 ? 76   THR A O     1 
ATOM   1008  C  CB    . THR E  3 51   ? 92.883  24.592  42.198  1.00 48.38 ? 76   THR A CB    1 
ATOM   1009  O  OG1   . THR E  3 51   ? 92.708  23.193  42.431  1.00 50.01 ? 76   THR A OG1   1 
ATOM   1010  C  CG2   . THR E  3 51   ? 94.212  24.819  41.514  1.00 48.03 ? 76   THR A CG2   1 
ATOM   1011  N  N     . LEU E  3 52   ? 93.775  27.471  42.880  1.00 47.55 ? 77   LEU A N     1 
ATOM   1012  C  CA    . LEU E  3 52   ? 94.758  28.557  42.877  1.00 46.97 ? 77   LEU A CA    1 
ATOM   1013  C  C     . LEU E  3 52   ? 94.842  29.247  44.235  1.00 47.00 ? 77   LEU A C     1 
ATOM   1014  O  O     . LEU E  3 52   ? 95.928  29.626  44.671  1.00 47.09 ? 77   LEU A O     1 
ATOM   1015  C  CB    . LEU E  3 52   ? 94.441  29.578  41.780  1.00 46.66 ? 77   LEU A CB    1 
ATOM   1016  C  CG    . LEU E  3 52   ? 94.516  29.088  40.325  1.00 46.05 ? 77   LEU A CG    1 
ATOM   1017  C  CD1   . LEU E  3 52   ? 93.865  30.087  39.384  1.00 45.07 ? 77   LEU A CD1   1 
ATOM   1018  C  CD2   . LEU E  3 52   ? 95.947  28.806  39.894  1.00 44.02 ? 77   LEU A CD2   1 
ATOM   1019  N  N     . GLN E  3 53   ? 93.696  29.391  44.901  1.00 46.86 ? 78   GLN A N     1 
ATOM   1020  C  CA    . GLN E  3 53   ? 93.639  29.980  46.237  1.00 46.04 ? 78   GLN A CA    1 
ATOM   1021  C  C     . GLN E  3 53   ? 94.445  29.176  47.244  1.00 45.37 ? 78   GLN A C     1 
ATOM   1022  O  O     . GLN E  3 53   ? 95.134  29.768  48.073  1.00 45.51 ? 78   GLN A O     1 
ATOM   1023  C  CB    . GLN E  3 53   ? 92.196  30.135  46.726  1.00 46.56 ? 78   GLN A CB    1 
ATOM   1024  C  CG    . GLN E  3 53   ? 91.330  31.075  45.900  1.00 48.12 ? 78   GLN A CG    1 
ATOM   1025  C  CD    . GLN E  3 53   ? 91.618  32.538  46.164  1.00 48.64 ? 78   GLN A CD    1 
ATOM   1026  O  OE1   . GLN E  3 53   ? 90.802  33.237  46.763  1.00 48.92 ? 78   GLN A OE1   1 
ATOM   1027  N  NE2   . GLN E  3 53   ? 92.775  33.012  45.710  1.00 48.44 ? 78   GLN A NE2   1 
ATOM   1028  N  N     . VAL E  3 54   ? 94.371  27.843  47.176  1.00 44.72 ? 79   VAL A N     1 
ATOM   1029  C  CA    . VAL E  3 54   ? 95.174  27.012  48.090  1.00 44.23 ? 79   VAL A CA    1 
ATOM   1030  C  C     . VAL E  3 54   ? 96.663  27.155  47.771  1.00 44.02 ? 79   VAL A C     1 
ATOM   1031  O  O     . VAL E  3 54   ? 97.478  27.261  48.690  1.00 44.14 ? 79   VAL A O     1 
ATOM   1032  C  CB    . VAL E  3 54   ? 94.729  25.496  48.207  1.00 43.99 ? 79   VAL A CB    1 
ATOM   1033  C  CG1   . VAL E  3 54   ? 93.393  25.241  47.532  1.00 44.57 ? 79   VAL A CG1   1 
ATOM   1034  C  CG2   . VAL E  3 54   ? 95.798  24.527  47.687  1.00 42.75 ? 79   VAL A CG2   1 
ATOM   1035  N  N     . ILE E  3 55   ? 97.004  27.190  46.481  1.00 43.79 ? 80   ILE A N     1 
ATOM   1036  C  CA    . ILE E  3 55   ? 98.383  27.462  46.058  1.00 43.67 ? 80   ILE A CA    1 
ATOM   1037  C  C     . ILE E  3 55   ? 98.865  28.806  46.614  1.00 44.33 ? 80   ILE A C     1 
ATOM   1038  O  O     . ILE E  3 55   ? 99.927  28.876  47.240  1.00 44.09 ? 80   ILE A O     1 
ATOM   1039  C  CB    . ILE E  3 55   ? 98.545  27.437  44.524  1.00 43.01 ? 80   ILE A CB    1 
ATOM   1040  C  CG1   . ILE E  3 55   ? 98.454  26.003  44.011  1.00 42.34 ? 80   ILE A CG1   1 
ATOM   1041  C  CG2   . ILE E  3 55   ? 99.881  28.063  44.108  1.00 42.20 ? 80   ILE A CG2   1 
ATOM   1042  C  CD1   . ILE E  3 55   ? 98.268  25.907  42.516  1.00 42.12 ? 80   ILE A CD1   1 
ATOM   1043  N  N     . ALA E  3 56   ? 98.071  29.857  46.396  1.00 44.81 ? 81   ALA A N     1 
ATOM   1044  C  CA    . ALA E  3 56   ? 98.386  31.196  46.896  1.00 44.83 ? 81   ALA A CA    1 
ATOM   1045  C  C     . ALA E  3 56   ? 98.692  31.172  48.392  1.00 45.00 ? 81   ALA A C     1 
ATOM   1046  O  O     . ALA E  3 56   ? 99.713  31.707  48.825  1.00 44.99 ? 81   ALA A O     1 
ATOM   1047  C  CB    . ALA E  3 56   ? 97.247  32.163  46.596  1.00 44.75 ? 81   ALA A CB    1 
ATOM   1048  N  N     . ALA E  3 57   ? 97.810  30.532  49.163  1.00 45.02 ? 82   ALA A N     1 
ATOM   1049  C  CA    . ALA E  3 57   ? 97.975  30.394  50.607  1.00 45.05 ? 82   ALA A CA    1 
ATOM   1050  C  C     . ALA E  3 57   ? 99.243  29.624  50.966  1.00 45.35 ? 82   ALA A C     1 
ATOM   1051  O  O     . ALA E  3 57   ? 99.959  30.000  51.900  1.00 45.66 ? 82   ALA A O     1 
ATOM   1052  C  CB    . ALA E  3 57   ? 96.754  29.722  51.215  1.00 44.84 ? 82   ALA A CB    1 
ATOM   1053  N  N     . ALA E  3 58   ? 99.515  28.551  50.222  1.00 45.34 ? 83   ALA A N     1 
ATOM   1054  C  CA    . ALA E  3 58   ? 100.703 27.721  50.443  1.00 45.35 ? 83   ALA A CA    1 
ATOM   1055  C  C     . ALA E  3 58   ? 101.995 28.479  50.145  1.00 45.20 ? 83   ALA A C     1 
ATOM   1056  O  O     . ALA E  3 58   ? 102.984 28.360  50.873  1.00 44.65 ? 83   ALA A O     1 
ATOM   1057  C  CB    . ALA E  3 58   ? 100.627 26.453  49.611  1.00 45.25 ? 83   ALA A CB    1 
ATOM   1058  N  N     . GLN E  3 59   ? 101.972 29.260  49.072  1.00 45.72 ? 84   GLN A N     1 
ATOM   1059  C  CA    . GLN E  3 59   ? 103.112 30.084  48.688  1.00 46.03 ? 84   GLN A CA    1 
ATOM   1060  C  C     . GLN E  3 59   ? 103.356 31.174  49.716  1.00 46.71 ? 84   GLN A C     1 
ATOM   1061  O  O     . GLN E  3 59   ? 104.497 31.510  50.008  1.00 46.71 ? 84   GLN A O     1 
ATOM   1062  C  CB    . GLN E  3 59   ? 102.884 30.705  47.314  1.00 45.43 ? 84   GLN A CB    1 
ATOM   1063  C  CG    . GLN E  3 59   ? 102.987 29.721  46.175  1.00 43.29 ? 84   GLN A CG    1 
ATOM   1064  C  CD    . GLN E  3 59   ? 102.909 30.398  44.834  1.00 42.14 ? 84   GLN A CD    1 
ATOM   1065  O  OE1   . GLN E  3 59   ? 102.128 31.332  44.639  1.00 40.96 ? 84   GLN A OE1   1 
ATOM   1066  N  NE2   . GLN E  3 59   ? 103.722 29.935  43.895  1.00 41.71 ? 84   GLN A NE2   1 
ATOM   1067  N  N     . ARG E  3 60   ? 102.267 31.709  50.261  1.00 47.81 ? 85   ARG A N     1 
ATOM   1068  C  CA    . ARG E  3 60   ? 102.308 32.714  51.314  1.00 48.90 ? 85   ARG A CA    1 
ATOM   1069  C  C     . ARG E  3 60   ? 103.097 32.190  52.518  1.00 49.91 ? 85   ARG A C     1 
ATOM   1070  O  O     . ARG E  3 60   ? 103.527 32.969  53.365  1.00 50.11 ? 85   ARG A O     1 
ATOM   1071  C  CB    . ARG E  3 60   ? 100.880 33.064  51.734  1.00 49.14 ? 85   ARG A CB    1 
ATOM   1072  C  CG    . ARG E  3 60   ? 100.616 34.533  52.041  1.00 49.68 ? 85   ARG A CG    1 
ATOM   1073  C  CD    . ARG E  3 60   ? 99.906  35.290  50.898  1.00 51.13 ? 85   ARG A CD    1 
ATOM   1074  N  NE    . ARG E  3 60   ? 98.835  34.547  50.208  1.00 52.83 ? 85   ARG A NE    1 
ATOM   1075  C  CZ    . ARG E  3 60   ? 97.702  34.100  50.759  1.00 52.77 ? 85   ARG A CZ    1 
ATOM   1076  N  NH1   . ARG E  3 60   ? 97.451  34.272  52.052  1.00 52.97 ? 85   ARG A NH1   1 
ATOM   1077  N  NH2   . ARG E  3 60   ? 96.817  33.451  50.008  1.00 52.86 ? 85   ARG A NH2   1 
ATOM   1078  N  N     . GLU E  3 61   ? 103.291 30.872  52.577  1.00 51.39 ? 86   GLU A N     1 
ATOM   1079  C  CA    . GLU E  3 61   ? 104.027 30.230  53.671  1.00 53.07 ? 86   GLU A CA    1 
ATOM   1080  C  C     . GLU E  3 61   ? 105.287 29.505  53.208  1.00 52.60 ? 86   GLU A C     1 
ATOM   1081  O  O     . GLU E  3 61   ? 105.720 28.535  53.837  1.00 52.53 ? 86   GLU A O     1 
ATOM   1082  C  CB    . GLU E  3 61   ? 103.132 29.237  54.401  1.00 54.46 ? 86   GLU A CB    1 
ATOM   1083  C  CG    . GLU E  3 61   ? 101.901 29.843  55.014  1.00 58.45 ? 86   GLU A CG    1 
ATOM   1084  C  CD    . GLU E  3 61   ? 101.014 28.797  55.640  1.00 61.73 ? 86   GLU A CD    1 
ATOM   1085  O  OE1   . GLU E  3 61   ? 100.397 29.101  56.685  1.00 63.85 ? 86   GLU A OE1   1 
ATOM   1086  O  OE2   . GLU E  3 61   ? 100.943 27.669  55.096  1.00 62.84 ? 86   GLU A OE2   1 
ATOM   1087  N  N     . GLY E  3 62   ? 105.857 29.970  52.100  1.00 52.22 ? 87   GLY A N     1 
ATOM   1088  C  CA    . GLY E  3 62   ? 107.139 29.469  51.608  1.00 51.66 ? 87   GLY A CA    1 
ATOM   1089  C  C     . GLY E  3 62   ? 107.129 28.065  51.039  1.00 51.08 ? 87   GLY A C     1 
ATOM   1090  O  O     . GLY E  3 62   ? 108.169 27.410  50.981  1.00 50.58 ? 87   GLY A O     1 
ATOM   1091  N  N     . LYS E  3 63   ? 105.960 27.598  50.615  1.00 50.92 ? 88   LYS A N     1 
ATOM   1092  C  CA    . LYS E  3 63   ? 105.860 26.277  50.011  1.00 51.08 ? 88   LYS A CA    1 
ATOM   1093  C  C     . LYS E  3 63   ? 105.978 26.367  48.500  1.00 50.95 ? 88   LYS A C     1 
ATOM   1094  O  O     . LYS E  3 63   ? 105.574 27.363  47.901  1.00 51.38 ? 88   LYS A O     1 
ATOM   1095  C  CB    . LYS E  3 63   ? 104.559 25.591  50.417  1.00 51.46 ? 88   LYS A CB    1 
ATOM   1096  C  CG    . LYS E  3 63   ? 104.516 25.208  51.889  1.00 52.60 ? 88   LYS A CG    1 
ATOM   1097  C  CD    . LYS E  3 63   ? 103.444 24.169  52.161  1.00 53.60 ? 88   LYS A CD    1 
ATOM   1098  C  CE    . LYS E  3 63   ? 103.596 23.576  53.550  1.00 53.38 ? 88   LYS A CE    1 
ATOM   1099  N  NZ    . LYS E  3 63   ? 103.141 24.526  54.595  1.00 53.45 ? 88   LYS A NZ    1 
ATOM   1100  N  N     . THR E  3 64   ? 106.548 25.332  47.890  1.00 50.69 ? 89   THR A N     1 
ATOM   1101  C  CA    . THR E  3 64   ? 106.706 25.290  46.438  1.00 50.85 ? 89   THR A CA    1 
ATOM   1102  C  C     . THR E  3 64   ? 105.529 24.544  45.816  1.00 50.74 ? 89   THR A C     1 
ATOM   1103  O  O     . THR E  3 64   ? 105.154 23.466  46.286  1.00 50.97 ? 89   THR A O     1 
ATOM   1104  C  CB    . THR E  3 64   ? 108.032 24.618  46.029  1.00 50.77 ? 89   THR A CB    1 
ATOM   1105  O  OG1   . THR E  3 64   ? 109.096 25.131  46.836  1.00 50.49 ? 89   THR A OG1   1 
ATOM   1106  C  CG2   . THR E  3 64   ? 108.349 24.894  44.569  1.00 51.44 ? 89   THR A CG2   1 
ATOM   1107  N  N     . CYS E  3 65   ? 104.946 25.124  44.769  1.00 50.21 ? 90   CYS A N     1 
ATOM   1108  C  CA    . CYS E  3 65   ? 103.767 24.537  44.134  1.00 49.93 ? 90   CYS A CA    1 
ATOM   1109  C  C     . CYS E  3 65   ? 103.944 24.333  42.638  1.00 49.42 ? 90   CYS A C     1 
ATOM   1110  O  O     . CYS E  3 65   ? 104.632 25.097  41.969  1.00 49.62 ? 90   CYS A O     1 
ATOM   1111  C  CB    . CYS E  3 65   ? 102.527 25.399  44.376  1.00 50.07 ? 90   CYS A CB    1 
ATOM   1112  S  SG    . CYS E  3 65   ? 102.240 25.847  46.084  1.00 49.67 ? 90   CYS A SG    1 
ATOM   1113  N  N     . ALA E  3 66   ? 103.297 23.298  42.121  1.00 48.99 ? 91   ALA A N     1 
ATOM   1114  C  CA    . ALA E  3 66   ? 103.301 23.018  40.697  1.00 48.46 ? 91   ALA A CA    1 
ATOM   1115  C  C     . ALA E  3 66   ? 101.868 22.926  40.195  1.00 48.49 ? 91   ALA A C     1 
ATOM   1116  O  O     . ALA E  3 66   ? 100.984 22.421  40.894  1.00 49.18 ? 91   ALA A O     1 
ATOM   1117  C  CB    . ALA E  3 66   ? 104.046 21.732  40.419  1.00 48.04 ? 91   ALA A CB    1 
ATOM   1118  N  N     . PHE E  3 67   ? 101.642 23.424  38.986  1.00 48.06 ? 92   PHE A N     1 
ATOM   1119  C  CA    . PHE E  3 67   ? 100.329 23.372  38.369  1.00 48.36 ? 92   PHE A CA    1 
ATOM   1120  C  C     . PHE E  3 67   ? 100.427 22.652  37.037  1.00 48.81 ? 92   PHE A C     1 
ATOM   1121  O  O     . PHE E  3 67   ? 101.154 23.090  36.145  1.00 49.44 ? 92   PHE A O     1 
ATOM   1122  C  CB    . PHE E  3 67   ? 99.790  24.786  38.160  1.00 48.12 ? 92   PHE A CB    1 
ATOM   1123  C  CG    . PHE E  3 67   ? 98.329  24.836  37.832  1.00 48.07 ? 92   PHE A CG    1 
ATOM   1124  C  CD1   . PHE E  3 67   ? 97.389  25.034  38.836  1.00 47.25 ? 92   PHE A CD1   1 
ATOM   1125  C  CD2   . PHE E  3 67   ? 97.889  24.692  36.517  1.00 48.31 ? 92   PHE A CD2   1 
ATOM   1126  C  CE1   . PHE E  3 67   ? 96.034  25.089  38.536  1.00 47.86 ? 92   PHE A CE1   1 
ATOM   1127  C  CE2   . PHE E  3 67   ? 96.531  24.741  36.208  1.00 48.18 ? 92   PHE A CE2   1 
ATOM   1128  C  CZ    . PHE E  3 67   ? 95.600  24.939  37.223  1.00 47.87 ? 92   PHE A CZ    1 
ATOM   1129  N  N     . ILE E  3 68   ? 99.705  21.545  36.905  1.00 49.05 ? 93   ILE A N     1 
ATOM   1130  C  CA    . ILE E  3 68   ? 99.678  20.811  35.647  1.00 49.75 ? 93   ILE A CA    1 
ATOM   1131  C  C     . ILE E  3 68   ? 98.395  21.171  34.901  1.00 50.66 ? 93   ILE A C     1 
ATOM   1132  O  O     . ILE E  3 68   ? 97.315  20.669  35.226  1.00 51.33 ? 93   ILE A O     1 
ATOM   1133  C  CB    . ILE E  3 68   ? 99.773  19.275  35.850  1.00 49.47 ? 93   ILE A CB    1 
ATOM   1134  C  CG1   . ILE E  3 68   ? 100.776 18.908  36.950  1.00 48.99 ? 93   ILE A CG1   1 
ATOM   1135  C  CG2   . ILE E  3 68   ? 100.100 18.575  34.530  1.00 49.52 ? 93   ILE A CG2   1 
ATOM   1136  C  CD1   . ILE E  3 68   ? 102.228 19.215  36.628  1.00 49.13 ? 93   ILE A CD1   1 
ATOM   1137  N  N     . ASP E  3 69   ? 98.523  22.049  33.909  1.00 51.09 ? 94   ASP A N     1 
ATOM   1138  C  CA    . ASP E  3 69   ? 97.375  22.568  33.177  1.00 51.63 ? 94   ASP A CA    1 
ATOM   1139  C  C     . ASP E  3 69   ? 97.069  21.707  31.953  1.00 51.81 ? 94   ASP A C     1 
ATOM   1140  O  O     . ASP E  3 69   ? 97.293  22.121  30.812  1.00 52.09 ? 94   ASP A O     1 
ATOM   1141  C  CB    . ASP E  3 69   ? 97.623  24.027  32.781  1.00 52.12 ? 94   ASP A CB    1 
ATOM   1142  C  CG    . ASP E  3 69   ? 96.396  24.697  32.189  1.00 53.83 ? 94   ASP A CG    1 
ATOM   1143  O  OD1   . ASP E  3 69   ? 95.261  24.398  32.629  1.00 55.92 ? 94   ASP A OD1   1 
ATOM   1144  O  OD2   . ASP E  3 69   ? 96.575  25.535  31.281  1.00 54.89 ? 94   ASP A OD2   1 
ATOM   1145  N  N     . ALA E  3 70   ? 96.552  20.505  32.199  1.00 52.05 ? 95   ALA A N     1 
ATOM   1146  C  CA    . ALA E  3 70   ? 96.207  19.573  31.123  1.00 52.09 ? 95   ALA A CA    1 
ATOM   1147  C  C     . ALA E  3 70   ? 95.004  20.073  30.328  1.00 52.20 ? 95   ALA A C     1 
ATOM   1148  O  O     . ALA E  3 70   ? 94.801  19.691  29.175  1.00 51.65 ? 95   ALA A O     1 
ATOM   1149  C  CB    . ALA E  3 70   ? 95.924  18.205  31.691  1.00 52.28 ? 95   ALA A CB    1 
ATOM   1150  N  N     . GLU E  3 71   ? 94.218  20.934  30.968  1.00 52.59 ? 96   GLU A N     1 
ATOM   1151  C  CA    . GLU E  3 71   ? 93.010  21.488  30.385  1.00 52.59 ? 96   GLU A CA    1 
ATOM   1152  C  C     . GLU E  3 71   ? 93.362  22.638  29.454  1.00 51.02 ? 96   GLU A C     1 
ATOM   1153  O  O     . GLU E  3 71   ? 92.525  23.079  28.674  1.00 51.00 ? 96   GLU A O     1 
ATOM   1154  C  CB    . GLU E  3 71   ? 92.075  21.955  31.503  1.00 53.31 ? 96   GLU A CB    1 
ATOM   1155  C  CG    . GLU E  3 71   ? 90.594  21.724  31.232  1.00 54.56 ? 96   GLU A CG    1 
ATOM   1156  C  CD    . GLU E  3 71   ? 89.689  22.237  32.353  1.00 54.80 ? 96   GLU A CD    1 
ATOM   1157  O  OE1   . GLU E  3 71   ? 90.055  23.226  33.033  1.00 57.07 ? 96   GLU A OE1   1 
ATOM   1158  O  OE2   . GLU E  3 71   ? 88.601  21.649  32.552  1.00 56.07 ? 96   GLU A OE2   1 
ATOM   1159  N  N     . HIS E  3 72   ? 94.609  23.104  29.548  1.00 50.25 ? 97   HIS A N     1 
ATOM   1160  C  CA    . HIS E  3 72   ? 95.168  24.160  28.695  1.00 49.75 ? 97   HIS A CA    1 
ATOM   1161  C  C     . HIS E  3 72   ? 94.353  25.452  28.715  1.00 49.30 ? 97   HIS A C     1 
ATOM   1162  O  O     . HIS E  3 72   ? 94.058  26.025  27.662  1.00 49.41 ? 97   HIS A O     1 
ATOM   1163  C  CB    . HIS E  3 72   ? 95.335  23.664  27.259  1.00 49.90 ? 97   HIS A CB    1 
ATOM   1164  C  CG    . HIS E  3 72   ? 96.391  22.620  27.099  1.00 50.85 ? 97   HIS A CG    1 
ATOM   1165  N  ND1   . HIS E  3 72   ? 97.653  22.906  26.625  1.00 52.42 ? 97   HIS A ND1   1 
ATOM   1166  C  CD2   . HIS E  3 72   ? 96.371  21.289  27.337  1.00 51.22 ? 97   HIS A CD2   1 
ATOM   1167  C  CE1   . HIS E  3 72   ? 98.368  21.796  26.584  1.00 52.58 ? 97   HIS A CE1   1 
ATOM   1168  N  NE2   . HIS E  3 72   ? 97.614  20.800  27.013  1.00 52.15 ? 97   HIS A NE2   1 
ATOM   1169  N  N     . ALA E  3 73   ? 93.994  25.912  29.911  1.00 48.07 ? 98   ALA A N     1 
ATOM   1170  C  CA    . ALA E  3 73   ? 93.102  27.056  30.028  1.00 47.39 ? 98   ALA A CA    1 
ATOM   1171  C  C     . ALA E  3 73   ? 93.463  28.025  31.148  1.00 47.35 ? 98   ALA A C     1 
ATOM   1172  O  O     . ALA E  3 73   ? 92.707  28.962  31.423  1.00 47.43 ? 98   ALA A O     1 
ATOM   1173  C  CB    . ALA E  3 73   ? 91.676  26.580  30.177  1.00 47.30 ? 98   ALA A CB    1 
ATOM   1174  N  N     . LEU E  3 74   ? 94.621  27.811  31.775  1.00 47.14 ? 99   LEU A N     1 
ATOM   1175  C  CA    . LEU E  3 74   ? 95.095  28.667  32.864  1.00 46.59 ? 99   LEU A CA    1 
ATOM   1176  C  C     . LEU E  3 74   ? 95.492  30.054  32.377  1.00 46.43 ? 99   LEU A C     1 
ATOM   1177  O  O     . LEU E  3 74   ? 96.259  30.188  31.425  1.00 46.58 ? 99   LEU A O     1 
ATOM   1178  C  CB    . LEU E  3 74   ? 96.277  28.017  33.581  1.00 46.42 ? 99   LEU A CB    1 
ATOM   1179  C  CG    . LEU E  3 74   ? 96.878  28.787  34.759  1.00 47.30 ? 99   LEU A CG    1 
ATOM   1180  C  CD1   . LEU E  3 74   ? 95.850  28.997  35.867  1.00 48.39 ? 99   LEU A CD1   1 
ATOM   1181  C  CD2   . LEU E  3 74   ? 98.115  28.077  35.296  1.00 46.43 ? 99   LEU A CD2   1 
ATOM   1182  N  N     . ASP E  3 75   ? 94.960  31.080  33.033  1.00 46.53 ? 100  ASP A N     1 
ATOM   1183  C  CA    . ASP E  3 75   ? 95.312  32.458  32.719  1.00 46.89 ? 100  ASP A CA    1 
ATOM   1184  C  C     . ASP E  3 75   ? 96.249  32.970  33.798  1.00 46.97 ? 100  ASP A C     1 
ATOM   1185  O  O     . ASP E  3 75   ? 95.815  33.225  34.921  1.00 47.25 ? 100  ASP A O     1 
ATOM   1186  C  CB    . ASP E  3 75   ? 94.062  33.345  32.613  1.00 47.60 ? 100  ASP A CB    1 
ATOM   1187  C  CG    . ASP E  3 75   ? 94.389  34.821  32.369  1.00 48.65 ? 100  ASP A CG    1 
ATOM   1188  O  OD1   . ASP E  3 75   ? 93.466  35.652  32.498  1.00 49.58 ? 100  ASP A OD1   1 
ATOM   1189  O  OD2   . ASP E  3 75   ? 95.551  35.162  32.049  1.00 50.53 ? 100  ASP A OD2   1 
ATOM   1190  N  N     . PRO E  3 76   ? 97.543  33.128  33.458  1.00 46.92 ? 101  PRO A N     1 
ATOM   1191  C  CA    . PRO E  3 76   ? 98.548  33.556  34.426  1.00 46.41 ? 101  PRO A CA    1 
ATOM   1192  C  C     . PRO E  3 76   ? 98.180  34.877  35.084  1.00 46.03 ? 101  PRO A C     1 
ATOM   1193  O  O     . PRO E  3 76   ? 98.304  35.002  36.298  1.00 46.59 ? 101  PRO A O     1 
ATOM   1194  C  CB    . PRO E  3 76   ? 99.819  33.709  33.584  1.00 46.60 ? 101  PRO A CB    1 
ATOM   1195  C  CG    . PRO E  3 76   ? 99.349  33.772  32.164  1.00 47.09 ? 101  PRO A CG    1 
ATOM   1196  C  CD    . PRO E  3 76   ? 98.131  32.918  32.124  1.00 47.20 ? 101  PRO A CD    1 
ATOM   1197  N  N     . ILE E  3 77   ? 97.706  35.839  34.297  1.00 45.44 ? 102  ILE A N     1 
ATOM   1198  C  CA    . ILE E  3 77   ? 97.333  37.148  34.828  1.00 45.63 ? 102  ILE A CA    1 
ATOM   1199  C  C     . ILE E  3 77   ? 96.210  37.045  35.871  1.00 46.21 ? 102  ILE A C     1 
ATOM   1200  O  O     . ILE E  3 77   ? 96.230  37.742  36.889  1.00 45.93 ? 102  ILE A O     1 
ATOM   1201  C  CB    . ILE E  3 77   ? 97.003  38.152  33.691  1.00 45.47 ? 102  ILE A CB    1 
ATOM   1202  C  CG1   . ILE E  3 77   ? 98.283  38.847  33.207  1.00 46.32 ? 102  ILE A CG1   1 
ATOM   1203  C  CG2   . ILE E  3 77   ? 96.003  39.212  34.142  1.00 44.98 ? 102  ILE A CG2   1 
ATOM   1204  C  CD1   . ILE E  3 77   ? 99.132  38.045  32.199  1.00 47.60 ? 102  ILE A CD1   1 
ATOM   1205  N  N     . TYR E  3 78   ? 95.249  36.161  35.632  1.00 47.12 ? 103  TYR A N     1 
ATOM   1206  C  CA    . TYR E  3 78   ? 94.170  35.964  36.592  1.00 47.68 ? 103  TYR A CA    1 
ATOM   1207  C  C     . TYR E  3 78   ? 94.677  35.257  37.844  1.00 47.48 ? 103  TYR A C     1 
ATOM   1208  O  O     . TYR E  3 78   ? 94.276  35.599  38.953  1.00 47.49 ? 103  TYR A O     1 
ATOM   1209  C  CB    . TYR E  3 78   ? 93.001  35.205  35.968  1.00 48.29 ? 103  TYR A CB    1 
ATOM   1210  C  CG    . TYR E  3 78   ? 91.791  35.080  36.870  1.00 48.33 ? 103  TYR A CG    1 
ATOM   1211  C  CD1   . TYR E  3 78   ? 91.009  36.197  37.185  1.00 48.46 ? 103  TYR A CD1   1 
ATOM   1212  C  CD2   . TYR E  3 78   ? 91.422  33.844  37.397  1.00 48.50 ? 103  TYR A CD2   1 
ATOM   1213  C  CE1   . TYR E  3 78   ? 89.886  36.081  38.012  1.00 49.71 ? 103  TYR A CE1   1 
ATOM   1214  C  CE2   . TYR E  3 78   ? 90.303  33.714  38.225  1.00 49.59 ? 103  TYR A CE2   1 
ATOM   1215  C  CZ    . TYR E  3 78   ? 89.536  34.833  38.530  1.00 49.94 ? 103  TYR A CZ    1 
ATOM   1216  O  OH    . TYR E  3 78   ? 88.426  34.697  39.351  1.00 49.69 ? 103  TYR A OH    1 
ATOM   1217  N  N     . ALA E  3 79   ? 95.567  34.283  37.662  1.00 47.41 ? 104  ALA A N     1 
ATOM   1218  C  CA    . ALA E  3 79   ? 96.191  33.599  38.791  1.00 47.53 ? 104  ALA A CA    1 
ATOM   1219  C  C     . ALA E  3 79   ? 96.900  34.603  39.703  1.00 47.31 ? 104  ALA A C     1 
ATOM   1220  O  O     . ALA E  3 79   ? 96.816  34.514  40.927  1.00 46.37 ? 104  ALA A O     1 
ATOM   1221  C  CB    . ALA E  3 79   ? 97.153  32.525  38.308  1.00 47.47 ? 104  ALA A CB    1 
ATOM   1222  N  N     . ARG E  3 80   ? 97.568  35.579  39.096  1.00 48.05 ? 105  ARG A N     1 
ATOM   1223  C  CA    . ARG E  3 80   ? 98.224  36.635  39.855  1.00 48.55 ? 105  ARG A CA    1 
ATOM   1224  C  C     . ARG E  3 80   ? 97.210  37.460  40.634  1.00 48.05 ? 105  ARG A C     1 
ATOM   1225  O  O     . ARG E  3 80   ? 97.437  37.769  41.800  1.00 47.96 ? 105  ARG A O     1 
ATOM   1226  C  CB    . ARG E  3 80   ? 99.031  37.552  38.947  1.00 49.17 ? 105  ARG A CB    1 
ATOM   1227  C  CG    . ARG E  3 80   ? 100.061 38.347  39.707  1.00 51.97 ? 105  ARG A CG    1 
ATOM   1228  C  CD    . ARG E  3 80   ? 99.974  39.819  39.365  1.00 55.98 ? 105  ARG A CD    1 
ATOM   1229  N  NE    . ARG E  3 80   ? 100.092 40.065  37.928  1.00 60.16 ? 105  ARG A NE    1 
ATOM   1230  C  CZ    . ARG E  3 80   ? 101.229 39.991  37.235  1.00 62.11 ? 105  ARG A CZ    1 
ATOM   1231  N  NH1   . ARG E  3 80   ? 102.371 39.663  37.839  1.00 62.55 ? 105  ARG A NH1   1 
ATOM   1232  N  NH2   . ARG E  3 80   ? 101.225 40.239  35.929  1.00 62.69 ? 105  ARG A NH2   1 
ATOM   1233  N  N     . LYS E  3 81   ? 96.101  37.814  39.984  1.00 47.54 ? 106  LYS A N     1 
ATOM   1234  C  CA    . LYS E  3 81   ? 95.025  38.552  40.638  1.00 46.89 ? 106  LYS A CA    1 
ATOM   1235  C  C     . LYS E  3 81   ? 94.513  37.826  41.873  1.00 46.43 ? 106  LYS A C     1 
ATOM   1236  O  O     . LYS E  3 81   ? 94.141  38.462  42.852  1.00 46.44 ? 106  LYS A O     1 
ATOM   1237  C  CB    . LYS E  3 81   ? 93.874  38.807  39.669  1.00 47.10 ? 106  LYS A CB    1 
ATOM   1238  C  CG    . LYS E  3 81   ? 93.891  40.173  39.041  1.00 47.25 ? 106  LYS A CG    1 
ATOM   1239  C  CD    . LYS E  3 81   ? 93.008  40.217  37.814  1.00 48.26 ? 106  LYS A CD    1 
ATOM   1240  C  CE    . LYS E  3 81   ? 93.114  41.571  37.142  1.00 49.21 ? 106  LYS A CE    1 
ATOM   1241  N  NZ    . LYS E  3 81   ? 93.035  41.458  35.663  1.00 50.13 ? 106  LYS A NZ    1 
ATOM   1242  N  N     . LEU E  3 82   ? 94.508  36.497  41.827  1.00 46.26 ? 107  LEU A N     1 
ATOM   1243  C  CA    . LEU E  3 82   ? 94.072  35.697  42.970  1.00 46.34 ? 107  LEU A CA    1 
ATOM   1244  C  C     . LEU E  3 82   ? 95.166  35.567  44.033  1.00 46.34 ? 107  LEU A C     1 
ATOM   1245  O  O     . LEU E  3 82   ? 94.977  34.907  45.054  1.00 46.64 ? 107  LEU A O     1 
ATOM   1246  C  CB    . LEU E  3 82   ? 93.573  34.312  42.528  1.00 46.12 ? 107  LEU A CB    1 
ATOM   1247  C  CG    . LEU E  3 82   ? 92.420  34.227  41.528  1.00 45.46 ? 107  LEU A CG    1 
ATOM   1248  C  CD1   . LEU E  3 82   ? 91.998  32.785  41.374  1.00 45.41 ? 107  LEU A CD1   1 
ATOM   1249  C  CD2   . LEU E  3 82   ? 91.240  35.087  41.948  1.00 44.70 ? 107  LEU A CD2   1 
ATOM   1250  N  N     . GLY E  3 83   ? 96.309  36.199  43.789  1.00 46.31 ? 108  GLY A N     1 
ATOM   1251  C  CA    . GLY E  3 83   ? 97.382  36.249  44.776  1.00 46.70 ? 108  GLY A CA    1 
ATOM   1252  C  C     . GLY E  3 83   ? 98.396  35.131  44.659  1.00 46.84 ? 108  GLY A C     1 
ATOM   1253  O  O     . GLY E  3 83   ? 99.142  34.857  45.601  1.00 46.72 ? 108  GLY A O     1 
ATOM   1254  N  N     . VAL E  3 84   ? 98.426  34.479  43.504  1.00 47.21 ? 109  VAL A N     1 
ATOM   1255  C  CA    . VAL E  3 84   ? 99.432  33.458  43.251  1.00 47.31 ? 109  VAL A CA    1 
ATOM   1256  C  C     . VAL E  3 84   ? 100.729 34.144  42.843  1.00 48.04 ? 109  VAL A C     1 
ATOM   1257  O  O     . VAL E  3 84   ? 100.725 35.072  42.026  1.00 48.70 ? 109  VAL A O     1 
ATOM   1258  C  CB    . VAL E  3 84   ? 98.972  32.447  42.163  1.00 46.70 ? 109  VAL A CB    1 
ATOM   1259  C  CG1   . VAL E  3 84   ? 100.062 31.422  41.866  1.00 45.28 ? 109  VAL A CG1   1 
ATOM   1260  C  CG2   . VAL E  3 84   ? 97.701  31.744  42.606  1.00 45.53 ? 109  VAL A CG2   1 
ATOM   1261  N  N     . ASP E  3 85   ? 101.832 33.701  43.435  1.00 48.30 ? 110  ASP A N     1 
ATOM   1262  C  CA    . ASP E  3 85   ? 103.148 34.131  43.000  1.00 49.27 ? 110  ASP A CA    1 
ATOM   1263  C  C     . ASP E  3 85   ? 103.503 33.405  41.705  1.00 49.64 ? 110  ASP A C     1 
ATOM   1264  O  O     . ASP E  3 85   ? 104.000 32.273  41.716  1.00 49.82 ? 110  ASP A O     1 
ATOM   1265  C  CB    . ASP E  3 85   ? 104.175 33.854  44.093  1.00 49.98 ? 110  ASP A CB    1 
ATOM   1266  C  CG    . ASP E  3 85   ? 105.590 34.206  43.679  1.00 50.73 ? 110  ASP A CG    1 
ATOM   1267  O  OD1   . ASP E  3 85   ? 106.506 33.841  44.440  1.00 50.57 ? 110  ASP A OD1   1 
ATOM   1268  O  OD2   . ASP E  3 85   ? 105.791 34.832  42.611  1.00 51.91 ? 110  ASP A OD2   1 
ATOM   1269  N  N     . ILE E  3 86   ? 103.234 34.083  40.595  1.00 50.04 ? 111  ILE A N     1 
ATOM   1270  C  CA    . ILE E  3 86   ? 103.366 33.531  39.245  1.00 50.31 ? 111  ILE A CA    1 
ATOM   1271  C  C     . ILE E  3 86   ? 104.797 33.090  38.936  1.00 50.46 ? 111  ILE A C     1 
ATOM   1272  O  O     . ILE E  3 86   ? 105.013 32.021  38.354  1.00 50.61 ? 111  ILE A O     1 
ATOM   1273  C  CB    . ILE E  3 86   ? 102.864 34.568  38.195  1.00 50.17 ? 111  ILE A CB    1 
ATOM   1274  C  CG1   . ILE E  3 86   ? 101.405 34.943  38.470  1.00 50.24 ? 111  ILE A CG1   1 
ATOM   1275  C  CG2   . ILE E  3 86   ? 102.966 34.046  36.791  1.00 50.36 ? 111  ILE A CG2   1 
ATOM   1276  C  CD1   . ILE E  3 86   ? 100.472 33.751  38.710  1.00 49.71 ? 111  ILE A CD1   1 
ATOM   1277  N  N     . ASP E  3 87   ? 105.761 33.904  39.361  1.00 50.04 ? 112  ASP A N     1 
ATOM   1278  C  CA    . ASP E  3 87   ? 107.172 33.689  39.055  1.00 49.62 ? 112  ASP A CA    1 
ATOM   1279  C  C     . ASP E  3 87   ? 107.790 32.464  39.715  1.00 49.02 ? 112  ASP A C     1 
ATOM   1280  O  O     . ASP E  3 87   ? 108.862 32.018  39.312  1.00 48.32 ? 112  ASP A O     1 
ATOM   1281  C  CB    . ASP E  3 87   ? 107.969 34.928  39.435  1.00 50.31 ? 112  ASP A CB    1 
ATOM   1282  C  CG    . ASP E  3 87   ? 107.581 36.136  38.616  1.00 51.53 ? 112  ASP A CG    1 
ATOM   1283  O  OD1   . ASP E  3 87   ? 107.242 35.972  37.424  1.00 51.87 ? 112  ASP A OD1   1 
ATOM   1284  O  OD2   . ASP E  3 87   ? 107.620 37.255  39.165  1.00 53.28 ? 112  ASP A OD2   1 
ATOM   1285  N  N     . ASN E  3 88   ? 107.120 31.931  40.729  1.00 49.05 ? 113  ASN A N     1 
ATOM   1286  C  CA    . ASN E  3 88   ? 107.616 30.759  41.444  1.00 48.99 ? 113  ASN A CA    1 
ATOM   1287  C  C     . ASN E  3 88   ? 106.705 29.546  41.342  1.00 48.76 ? 113  ASN A C     1 
ATOM   1288  O  O     . ASN E  3 88   ? 107.062 28.455  41.785  1.00 48.71 ? 113  ASN A O     1 
ATOM   1289  C  CB    . ASN E  3 88   ? 107.889 31.112  42.901  1.00 49.03 ? 113  ASN A CB    1 
ATOM   1290  C  CG    . ASN E  3 88   ? 109.062 32.043  43.045  1.00 49.44 ? 113  ASN A CG    1 
ATOM   1291  O  OD1   . ASN E  3 88   ? 110.087 31.864  42.392  1.00 49.49 ? 113  ASN A OD1   1 
ATOM   1292  N  ND2   . ASN E  3 88   ? 108.919 33.053  43.889  1.00 50.46 ? 113  ASN A ND2   1 
ATOM   1293  N  N     . LEU E  3 89   ? 105.533 29.743  40.748  1.00 48.37 ? 114  LEU A N     1 
ATOM   1294  C  CA    . LEU E  3 89   ? 104.607 28.657  40.506  1.00 48.14 ? 114  LEU A CA    1 
ATOM   1295  C  C     . LEU E  3 89   ? 105.097 27.835  39.321  1.00 48.84 ? 114  LEU A C     1 
ATOM   1296  O  O     . LEU E  3 89   ? 105.090 28.306  38.183  1.00 49.05 ? 114  LEU A O     1 
ATOM   1297  C  CB    . LEU E  3 89   ? 103.199 29.218  40.267  1.00 47.61 ? 114  LEU A CB    1 
ATOM   1298  C  CG    . LEU E  3 89   ? 101.942 28.329  40.202  1.00 46.53 ? 114  LEU A CG    1 
ATOM   1299  C  CD1   . LEU E  3 89   ? 101.559 28.039  38.765  1.00 45.52 ? 114  LEU A CD1   1 
ATOM   1300  C  CD2   . LEU E  3 89   ? 102.060 27.036  41.001  1.00 45.35 ? 114  LEU A CD2   1 
ATOM   1301  N  N     . LEU E  3 90   ? 105.557 26.619  39.601  1.00 49.73 ? 115  LEU A N     1 
ATOM   1302  C  CA    . LEU E  3 90   ? 105.932 25.684  38.549  1.00 51.12 ? 115  LEU A CA    1 
ATOM   1303  C  C     . LEU E  3 90   ? 104.704 25.331  37.742  1.00 52.24 ? 115  LEU A C     1 
ATOM   1304  O  O     . LEU E  3 90   ? 103.623 25.128  38.299  1.00 52.78 ? 115  LEU A O     1 
ATOM   1305  C  CB    . LEU E  3 90   ? 106.542 24.416  39.137  1.00 51.16 ? 115  LEU A CB    1 
ATOM   1306  C  CG    . LEU E  3 90   ? 108.029 24.494  39.477  1.00 51.13 ? 115  LEU A CG    1 
ATOM   1307  C  CD1   . LEU E  3 90   ? 108.398 23.364  40.409  1.00 51.23 ? 115  LEU A CD1   1 
ATOM   1308  C  CD2   . LEU E  3 90   ? 108.873 24.450  38.213  1.00 50.97 ? 115  LEU A CD2   1 
ATOM   1309  N  N     . CYS E  3 91   ? 104.867 25.269  36.427  1.00 53.51 ? 116  CYS A N     1 
ATOM   1310  C  CA    . CYS E  3 91   ? 103.725 25.082  35.550  1.00 53.58 ? 116  CYS A CA    1 
ATOM   1311  C  C     . CYS E  3 91   ? 104.049 24.280  34.299  1.00 53.43 ? 116  CYS A C     1 
ATOM   1312  O  O     . CYS E  3 91   ? 105.020 24.555  33.590  1.00 53.63 ? 116  CYS A O     1 
ATOM   1313  C  CB    . CYS E  3 91   ? 103.128 26.432  35.166  1.00 53.80 ? 116  CYS A CB    1 
ATOM   1314  S  SG    . CYS E  3 91   ? 101.723 26.266  34.071  1.00 55.94 ? 116  CYS A SG    1 
ATOM   1315  N  N     . SER E  3 92   ? 103.203 23.302  34.024  1.00 53.24 ? 117  SER A N     1 
ATOM   1316  C  CA    . SER E  3 92   ? 103.398 22.434  32.887  1.00 53.42 ? 117  SER A CA    1 
ATOM   1317  C  C     . SER E  3 92   ? 102.118 22.311  32.065  1.00 53.36 ? 117  SER A C     1 
ATOM   1318  O  O     . SER E  3 92   ? 101.015 22.242  32.614  1.00 52.61 ? 117  SER A O     1 
ATOM   1319  C  CB    . SER E  3 92   ? 103.856 21.061  33.371  1.00 53.34 ? 117  SER A CB    1 
ATOM   1320  O  OG    . SER E  3 92   ? 104.049 20.183  32.281  1.00 54.35 ? 117  SER A OG    1 
ATOM   1321  N  N     . GLN E  3 93   ? 102.277 22.302  30.744  1.00 53.69 ? 118  GLN A N     1 
ATOM   1322  C  CA    . GLN E  3 93   ? 101.174 22.008  29.840  1.00 53.72 ? 118  GLN A CA    1 
ATOM   1323  C  C     . GLN E  3 93   ? 101.526 20.777  29.020  1.00 53.94 ? 118  GLN A C     1 
ATOM   1324  O  O     . GLN E  3 93   ? 102.053 20.892  27.913  1.00 54.05 ? 118  GLN A O     1 
ATOM   1325  C  CB    . GLN E  3 93   ? 100.841 23.206  28.959  1.00 53.18 ? 118  GLN A CB    1 
ATOM   1326  C  CG    . GLN E  3 93   ? 100.134 24.304  29.720  1.00 53.49 ? 118  GLN A CG    1 
ATOM   1327  C  CD    . GLN E  3 93   ? 99.522  25.338  28.814  1.00 54.54 ? 118  GLN A CD    1 
ATOM   1328  O  OE1   . GLN E  3 93   ? 100.101 25.709  27.790  1.00 55.66 ? 118  GLN A OE1   1 
ATOM   1329  N  NE2   . GLN E  3 93   ? 98.342  25.827  29.190  1.00 54.89 ? 118  GLN A NE2   1 
ATOM   1330  N  N     . PRO E  3 94   ? 101.226 19.589  29.574  1.00 54.06 ? 119  PRO A N     1 
ATOM   1331  C  CA    . PRO E  3 94   ? 101.689 18.311  29.051  1.00 54.17 ? 119  PRO A CA    1 
ATOM   1332  C  C     . PRO E  3 94   ? 100.958 17.921  27.772  1.00 54.38 ? 119  PRO A C     1 
ATOM   1333  O  O     . PRO E  3 94   ? 99.839  18.379  27.537  1.00 54.40 ? 119  PRO A O     1 
ATOM   1334  C  CB    . PRO E  3 94   ? 101.338 17.340  30.176  1.00 54.28 ? 119  PRO A CB    1 
ATOM   1335  C  CG    . PRO E  3 94   ? 100.130 17.943  30.804  1.00 54.70 ? 119  PRO A CG    1 
ATOM   1336  C  CD    . PRO E  3 94   ? 100.364 19.416  30.759  1.00 54.14 ? 119  PRO A CD    1 
ATOM   1337  N  N     . ASP E  3 95   ? 101.594 17.082  26.958  1.00 54.92 ? 120  ASP A N     1 
ATOM   1338  C  CA    . ASP E  3 95   ? 101.001 16.614  25.705  1.00 55.33 ? 120  ASP A CA    1 
ATOM   1339  C  C     . ASP E  3 95   ? 100.038 15.454  25.948  1.00 54.80 ? 120  ASP A C     1 
ATOM   1340  O  O     . ASP E  3 95   ? 98.861  15.533  25.583  1.00 54.99 ? 120  ASP A O     1 
ATOM   1341  C  CB    . ASP E  3 95   ? 102.090 16.224  24.706  1.00 55.89 ? 120  ASP A CB    1 
ATOM   1342  C  CG    . ASP E  3 95   ? 103.058 17.360  24.431  1.00 57.99 ? 120  ASP A CG    1 
ATOM   1343  O  OD1   . ASP E  3 95   ? 102.597 18.510  24.241  1.00 59.92 ? 120  ASP A OD1   1 
ATOM   1344  O  OD2   . ASP E  3 95   ? 104.282 17.102  24.406  1.00 59.03 ? 120  ASP A OD2   1 
ATOM   1345  N  N     . THR E  3 96   ? 100.542 14.394  26.579  1.00 53.67 ? 121  THR A N     1 
ATOM   1346  C  CA    . THR E  3 96   ? 99.736  13.221  26.908  1.00 52.35 ? 121  THR A CA    1 
ATOM   1347  C  C     . THR E  3 96   ? 99.430  13.163  28.402  1.00 51.44 ? 121  THR A C     1 
ATOM   1348  O  O     . THR E  3 96   ? 100.090 13.821  29.201  1.00 51.22 ? 121  THR A O     1 
ATOM   1349  C  CB    . THR E  3 96   ? 100.441 11.915  26.480  1.00 52.26 ? 121  THR A CB    1 
ATOM   1350  O  OG1   . THR E  3 96   ? 101.624 11.725  27.264  1.00 51.91 ? 121  THR A OG1   1 
ATOM   1351  C  CG2   . THR E  3 96   ? 100.817 11.962  25.003  1.00 51.69 ? 121  THR A CG2   1 
ATOM   1352  N  N     . GLY E  3 97   ? 98.423  12.376  28.766  1.00 50.66 ? 122  GLY A N     1 
ATOM   1353  C  CA    . GLY E  3 97   ? 98.077  12.152  30.164  1.00 50.50 ? 122  GLY A CA    1 
ATOM   1354  C  C     . GLY E  3 97   ? 99.176  11.418  30.912  1.00 50.46 ? 122  GLY A C     1 
ATOM   1355  O  O     . GLY E  3 97   ? 99.450  11.716  32.074  1.00 49.72 ? 122  GLY A O     1 
ATOM   1356  N  N     . GLU E  3 98   ? 99.811  10.461  30.240  1.00 51.03 ? 123  GLU A N     1 
ATOM   1357  C  CA    . GLU E  3 98   ? 100.933 9.726   30.825  1.00 51.79 ? 123  GLU A CA    1 
ATOM   1358  C  C     . GLU E  3 98   ? 102.060 10.671  31.209  1.00 51.35 ? 123  GLU A C     1 
ATOM   1359  O  O     . GLU E  3 98   ? 102.623 10.560  32.296  1.00 51.84 ? 123  GLU A O     1 
ATOM   1360  C  CB    . GLU E  3 98   ? 101.461 8.657   29.869  1.00 52.63 ? 123  GLU A CB    1 
ATOM   1361  C  CG    . GLU E  3 98   ? 100.593 7.412   29.773  1.00 55.80 ? 123  GLU A CG    1 
ATOM   1362  C  CD    . GLU E  3 98   ? 99.507  7.520   28.712  1.00 58.09 ? 123  GLU A CD    1 
ATOM   1363  O  OE1   . GLU E  3 98   ? 99.538  8.481   27.909  1.00 58.50 ? 123  GLU A OE1   1 
ATOM   1364  O  OE2   . GLU E  3 98   ? 98.623  6.635   28.684  1.00 59.28 ? 123  GLU A OE2   1 
ATOM   1365  N  N     . GLN E  3 99   ? 102.379 11.596  30.307  1.00 50.71 ? 124  GLN A N     1 
ATOM   1366  C  CA    . GLN E  3 99   ? 103.378 12.629  30.555  1.00 49.93 ? 124  GLN A CA    1 
ATOM   1367  C  C     . GLN E  3 99   ? 103.006 13.457  31.789  1.00 49.31 ? 124  GLN A C     1 
ATOM   1368  O  O     . GLN E  3 99   ? 103.833 13.658  32.676  1.00 49.44 ? 124  GLN A O     1 
ATOM   1369  C  CB    . GLN E  3 99   ? 103.516 13.519  29.318  1.00 50.03 ? 124  GLN A CB    1 
ATOM   1370  C  CG    . GLN E  3 99   ? 104.593 14.593  29.399  1.00 50.34 ? 124  GLN A CG    1 
ATOM   1371  C  CD    . GLN E  3 99   ? 104.578 15.535  28.201  1.00 50.31 ? 124  GLN A CD    1 
ATOM   1372  O  OE1   . GLN E  3 99   ? 104.679 16.755  28.354  1.00 50.25 ? 124  GLN A OE1   1 
ATOM   1373  N  NE2   . GLN E  3 99   ? 104.447 14.973  27.002  1.00 50.66 ? 124  GLN A NE2   1 
ATOM   1374  N  N     . ALA E  3 100  ? 101.755 13.910  31.846  1.00 48.62 ? 125  ALA A N     1 
ATOM   1375  C  CA    . ALA E  3 100  ? 101.248 14.686  32.976  1.00 48.03 ? 125  ALA A CA    1 
ATOM   1376  C  C     . ALA E  3 100  ? 101.487 13.978  34.302  1.00 47.82 ? 125  ALA A C     1 
ATOM   1377  O  O     . ALA E  3 100  ? 101.941 14.593  35.269  1.00 47.50 ? 125  ALA A O     1 
ATOM   1378  C  CB    . ALA E  3 100  ? 99.769  14.971  32.800  1.00 48.06 ? 125  ALA A CB    1 
ATOM   1379  N  N     . LEU E  3 101  ? 101.185 12.683  34.335  1.00 47.61 ? 126  LEU A N     1 
ATOM   1380  C  CA    . LEU E  3 101  ? 101.298 11.897  35.560  1.00 47.40 ? 126  LEU A CA    1 
ATOM   1381  C  C     . LEU E  3 101  ? 102.737 11.506  35.861  1.00 47.71 ? 126  LEU A C     1 
ATOM   1382  O  O     . LEU E  3 101  ? 103.118 11.391  37.027  1.00 47.93 ? 126  LEU A O     1 
ATOM   1383  C  CB    . LEU E  3 101  ? 100.414 10.655  35.491  1.00 46.60 ? 126  LEU A CB    1 
ATOM   1384  C  CG    . LEU E  3 101  ? 98.918  10.908  35.305  1.00 46.01 ? 126  LEU A CG    1 
ATOM   1385  C  CD1   . LEU E  3 101  ? 98.273  9.670   34.714  1.00 45.21 ? 126  LEU A CD1   1 
ATOM   1386  C  CD2   . LEU E  3 101  ? 98.237  11.337  36.606  1.00 44.77 ? 126  LEU A CD2   1 
ATOM   1387  N  N     . GLU E  3 102  ? 103.533 11.300  34.815  1.00 47.90 ? 127  GLU A N     1 
ATOM   1388  C  CA    . GLU E  3 102  ? 104.960 11.055  34.991  1.00 48.52 ? 127  GLU A CA    1 
ATOM   1389  C  C     . GLU E  3 102  ? 105.665 12.268  35.581  1.00 47.99 ? 127  GLU A C     1 
ATOM   1390  O  O     . GLU E  3 102  ? 106.596 12.128  36.367  1.00 47.53 ? 127  GLU A O     1 
ATOM   1391  C  CB    . GLU E  3 102  ? 105.623 10.636  33.678  1.00 49.35 ? 127  GLU A CB    1 
ATOM   1392  C  CG    . GLU E  3 102  ? 105.743 9.130   33.521  1.00 52.06 ? 127  GLU A CG    1 
ATOM   1393  C  CD    . GLU E  3 102  ? 106.580 8.494   34.629  1.00 54.95 ? 127  GLU A CD    1 
ATOM   1394  O  OE1   . GLU E  3 102  ? 106.019 7.709   35.426  1.00 56.02 ? 127  GLU A OE1   1 
ATOM   1395  O  OE2   . GLU E  3 102  ? 107.794 8.791   34.713  1.00 56.26 ? 127  GLU A OE2   1 
ATOM   1396  N  N     . ILE E  3 103  ? 105.207 13.455  35.201  1.00 48.08 ? 128  ILE A N     1 
ATOM   1397  C  CA    . ILE E  3 103  ? 105.720 14.694  35.769  1.00 48.15 ? 128  ILE A CA    1 
ATOM   1398  C  C     . ILE E  3 103  ? 105.369 14.776  37.255  1.00 48.65 ? 128  ILE A C     1 
ATOM   1399  O  O     . ILE E  3 103  ? 106.225 15.111  38.068  1.00 48.98 ? 128  ILE A O     1 
ATOM   1400  C  CB    . ILE E  3 103  ? 105.221 15.936  34.989  1.00 48.03 ? 128  ILE A CB    1 
ATOM   1401  C  CG1   . ILE E  3 103  ? 105.964 16.040  33.653  1.00 47.36 ? 128  ILE A CG1   1 
ATOM   1402  C  CG2   . ILE E  3 103  ? 105.424 17.218  35.802  1.00 47.58 ? 128  ILE A CG2   1 
ATOM   1403  C  CD1   . ILE E  3 103  ? 105.298 16.938  32.628  1.00 46.67 ? 128  ILE A CD1   1 
ATOM   1404  N  N     . CYS E  3 104  ? 104.126 14.448  37.603  1.00 49.29 ? 129  CYS A N     1 
ATOM   1405  C  CA    . CYS E  3 104  ? 103.696 14.410  39.001  1.00 50.07 ? 129  CYS A CA    1 
ATOM   1406  C  C     . CYS E  3 104  ? 104.579 13.496  39.821  1.00 50.19 ? 129  CYS A C     1 
ATOM   1407  O  O     . CYS E  3 104  ? 105.030 13.864  40.910  1.00 50.37 ? 129  CYS A O     1 
ATOM   1408  C  CB    . CYS E  3 104  ? 102.259 13.922  39.116  1.00 50.25 ? 129  CYS A CB    1 
ATOM   1409  S  SG    . CYS E  3 104  ? 101.063 15.145  38.629  1.00 54.11 ? 129  CYS A SG    1 
ATOM   1410  N  N     . ASP E  3 105  ? 104.824 12.303  39.287  1.00 50.19 ? 130  ASP A N     1 
ATOM   1411  C  CA    . ASP E  3 105  ? 105.601 11.298  39.988  1.00 50.11 ? 130  ASP A CA    1 
ATOM   1412  C  C     . ASP E  3 105  ? 107.017 11.791  40.238  1.00 49.36 ? 130  ASP A C     1 
ATOM   1413  O  O     . ASP E  3 105  ? 107.547 11.627  41.334  1.00 49.25 ? 130  ASP A O     1 
ATOM   1414  C  CB    . ASP E  3 105  ? 105.614 9.989   39.202  1.00 50.60 ? 130  ASP A CB    1 
ATOM   1415  C  CG    . ASP E  3 105  ? 105.893 8.785   40.079  1.00 51.43 ? 130  ASP A CG    1 
ATOM   1416  O  OD1   . ASP E  3 105  ? 105.388 8.742   41.224  1.00 52.62 ? 130  ASP A OD1   1 
ATOM   1417  O  OD2   . ASP E  3 105  ? 106.613 7.876   39.616  1.00 51.38 ? 130  ASP A OD2   1 
ATOM   1418  N  N     . ALA E  3 106  ? 107.610 12.409  39.220  1.00 48.88 ? 131  ALA A N     1 
ATOM   1419  C  CA    . ALA E  3 106  ? 108.948 12.986  39.322  1.00 48.24 ? 131  ALA A CA    1 
ATOM   1420  C  C     . ALA E  3 106  ? 109.015 14.058  40.407  1.00 47.82 ? 131  ALA A C     1 
ATOM   1421  O  O     . ALA E  3 106  ? 109.934 14.053  41.225  1.00 48.00 ? 131  ALA A O     1 
ATOM   1422  C  CB    . ALA E  3 106  ? 109.396 13.551  37.978  1.00 48.08 ? 131  ALA A CB    1 
ATOM   1423  N  N     . LEU E  3 107  ? 108.035 14.960  40.417  1.00 47.27 ? 132  LEU A N     1 
ATOM   1424  C  CA    . LEU E  3 107  ? 107.971 16.026  41.414  1.00 46.85 ? 132  LEU A CA    1 
ATOM   1425  C  C     . LEU E  3 107  ? 107.697 15.475  42.805  1.00 47.23 ? 132  LEU A C     1 
ATOM   1426  O  O     . LEU E  3 107  ? 108.282 15.941  43.788  1.00 47.48 ? 132  LEU A O     1 
ATOM   1427  C  CB    . LEU E  3 107  ? 106.917 17.071  41.039  1.00 46.31 ? 132  LEU A CB    1 
ATOM   1428  C  CG    . LEU E  3 107  ? 107.128 17.860  39.740  1.00 44.98 ? 132  LEU A CG    1 
ATOM   1429  C  CD1   . LEU E  3 107  ? 105.919 18.722  39.453  1.00 44.70 ? 132  LEU A CD1   1 
ATOM   1430  C  CD2   . LEU E  3 107  ? 108.383 18.710  39.784  1.00 43.76 ? 132  LEU A CD2   1 
ATOM   1431  N  N     . ALA E  3 108  ? 106.812 14.484  42.885  1.00 47.53 ? 133  ALA A N     1 
ATOM   1432  C  CA    . ALA E  3 108  ? 106.565 13.792  44.145  1.00 48.05 ? 133  ALA A CA    1 
ATOM   1433  C  C     . ALA E  3 108  ? 107.876 13.220  44.685  1.00 48.25 ? 133  ALA A C     1 
ATOM   1434  O  O     . ALA E  3 108  ? 108.290 13.572  45.785  1.00 48.24 ? 133  ALA A O     1 
ATOM   1435  C  CB    . ALA E  3 108  ? 105.513 12.699  43.978  1.00 48.05 ? 133  ALA A CB    1 
ATOM   1436  N  N     . ARG E  3 109  ? 108.541 12.382  43.889  1.00 48.70 ? 134  ARG A N     1 
ATOM   1437  C  CA    . ARG E  3 109  ? 109.809 11.755  44.284  1.00 49.39 ? 134  ARG A CA    1 
ATOM   1438  C  C     . ARG E  3 109  ? 110.902 12.743  44.685  1.00 49.14 ? 134  ARG A C     1 
ATOM   1439  O  O     . ARG E  3 109  ? 111.684 12.457  45.589  1.00 49.30 ? 134  ARG A O     1 
ATOM   1440  C  CB    . ARG E  3 109  ? 110.345 10.844  43.177  1.00 49.54 ? 134  ARG A CB    1 
ATOM   1441  C  CG    . ARG E  3 109  ? 109.813 9.419   43.210  1.00 50.39 ? 134  ARG A CG    1 
ATOM   1442  C  CD    . ARG E  3 109  ? 110.609 8.488   42.288  1.00 51.02 ? 134  ARG A CD    1 
ATOM   1443  N  NE    . ARG E  3 109  ? 110.974 9.125   41.019  1.00 54.18 ? 134  ARG A NE    1 
ATOM   1444  C  CZ    . ARG E  3 109  ? 110.190 9.194   39.943  1.00 55.56 ? 134  ARG A CZ    1 
ATOM   1445  N  NH1   . ARG E  3 109  ? 108.975 8.662   39.954  1.00 55.80 ? 134  ARG A NH1   1 
ATOM   1446  N  NH2   . ARG E  3 109  ? 110.624 9.802   38.847  1.00 56.51 ? 134  ARG A NH2   1 
ATOM   1447  N  N     . SER E  3 110  ? 110.957 13.894  44.015  1.00 48.89 ? 135  SER A N     1 
ATOM   1448  C  CA    . SER E  3 110  ? 111.989 14.902  44.280  1.00 48.55 ? 135  SER A CA    1 
ATOM   1449  C  C     . SER E  3 110  ? 111.971 15.408  45.722  1.00 48.89 ? 135  SER A C     1 
ATOM   1450  O  O     . SER E  3 110  ? 113.010 15.790  46.261  1.00 48.63 ? 135  SER A O     1 
ATOM   1451  C  CB    . SER E  3 110  ? 111.839 16.086  43.328  1.00 48.19 ? 135  SER A CB    1 
ATOM   1452  O  OG    . SER E  3 110  ? 110.770 16.929  43.724  1.00 47.62 ? 135  SER A OG    1 
ATOM   1453  N  N     . GLY E  3 111  ? 110.783 15.415  46.330  1.00 49.40 ? 136  GLY A N     1 
ATOM   1454  C  CA    . GLY E  3 111  ? 110.595 15.917  47.691  1.00 49.79 ? 136  GLY A CA    1 
ATOM   1455  C  C     . GLY E  3 111  ? 110.739 17.426  47.781  1.00 50.31 ? 136  GLY A C     1 
ATOM   1456  O  O     . GLY E  3 111  ? 110.827 17.987  48.876  1.00 50.43 ? 136  GLY A O     1 
ATOM   1457  N  N     . ALA E  3 112  ? 110.756 18.083  46.624  1.00 50.54 ? 137  ALA A N     1 
ATOM   1458  C  CA    . ALA E  3 112  ? 111.011 19.515  46.544  1.00 50.69 ? 137  ALA A CA    1 
ATOM   1459  C  C     . ALA E  3 112  ? 109.739 20.332  46.345  1.00 51.09 ? 137  ALA A C     1 
ATOM   1460  O  O     . ALA E  3 112  ? 109.733 21.540  46.595  1.00 51.60 ? 137  ALA A O     1 
ATOM   1461  C  CB    . ALA E  3 112  ? 111.999 19.803  45.442  1.00 50.67 ? 137  ALA A CB    1 
ATOM   1462  N  N     . VAL E  3 113  ? 108.670 19.675  45.896  1.00 50.89 ? 138  VAL A N     1 
ATOM   1463  C  CA    . VAL E  3 113  ? 107.385 20.342  45.696  1.00 50.30 ? 138  VAL A CA    1 
ATOM   1464  C  C     . VAL E  3 113  ? 106.428 19.969  46.817  1.00 49.63 ? 138  VAL A C     1 
ATOM   1465  O  O     . VAL E  3 113  ? 106.365 18.811  47.222  1.00 49.52 ? 138  VAL A O     1 
ATOM   1466  C  CB    . VAL E  3 113  ? 106.772 19.988  44.333  1.00 50.58 ? 138  VAL A CB    1 
ATOM   1467  C  CG1   . VAL E  3 113  ? 105.501 20.795  44.088  1.00 51.59 ? 138  VAL A CG1   1 
ATOM   1468  C  CG2   . VAL E  3 113  ? 107.780 20.250  43.227  1.00 50.61 ? 138  VAL A CG2   1 
ATOM   1469  N  N     . ASP E  3 114  ? 105.694 20.962  47.312  1.00 49.46 ? 139  ASP A N     1 
ATOM   1470  C  CA    . ASP E  3 114  ? 104.801 20.781  48.455  1.00 49.66 ? 139  ASP A CA    1 
ATOM   1471  C  C     . ASP E  3 114  ? 103.363 20.508  48.046  1.00 49.28 ? 139  ASP A C     1 
ATOM   1472  O  O     . ASP E  3 114  ? 102.704 19.650  48.636  1.00 49.63 ? 139  ASP A O     1 
ATOM   1473  C  CB    . ASP E  3 114  ? 104.863 21.994  49.385  1.00 49.89 ? 139  ASP A CB    1 
ATOM   1474  C  CG    . ASP E  3 114  ? 106.216 22.146  50.050  1.00 50.32 ? 139  ASP A CG    1 
ATOM   1475  O  OD1   . ASP E  3 114  ? 106.579 21.281  50.875  1.00 50.13 ? 139  ASP A OD1   1 
ATOM   1476  O  OD2   . ASP E  3 114  ? 106.918 23.131  49.745  1.00 50.99 ? 139  ASP A OD2   1 
ATOM   1477  N  N     . VAL E  3 115  ? 102.872 21.248  47.054  1.00 48.53 ? 140  VAL A N     1 
ATOM   1478  C  CA    . VAL E  3 115  ? 101.541 20.987  46.504  1.00 47.74 ? 140  VAL A CA    1 
ATOM   1479  C  C     . VAL E  3 115  ? 101.550 20.985  44.984  1.00 46.69 ? 140  VAL A C     1 
ATOM   1480  O  O     . VAL E  3 115  ? 102.084 21.894  44.358  1.00 46.19 ? 140  VAL A O     1 
ATOM   1481  C  CB    . VAL E  3 115  ? 100.409 21.903  47.120  1.00 48.16 ? 140  VAL A CB    1 
ATOM   1482  C  CG1   . VAL E  3 115  ? 100.991 23.082  47.888  1.00 49.19 ? 140  VAL A CG1   1 
ATOM   1483  C  CG2   . VAL E  3 115  ? 99.397  22.372  46.065  1.00 47.60 ? 140  VAL A CG2   1 
ATOM   1484  N  N     . ILE E  3 116  ? 100.980 19.926  44.417  1.00 46.08 ? 141  ILE A N     1 
ATOM   1485  C  CA    . ILE E  3 116  ? 100.788 19.793  42.979  1.00 45.25 ? 141  ILE A CA    1 
ATOM   1486  C  C     . ILE E  3 116  ? 99.291  19.735  42.693  1.00 45.25 ? 141  ILE A C     1 
ATOM   1487  O  O     . ILE E  3 116  ? 98.556  18.987  43.346  1.00 44.95 ? 141  ILE A O     1 
ATOM   1488  C  CB    . ILE E  3 116  ? 101.420 18.486  42.434  1.00 45.05 ? 141  ILE A CB    1 
ATOM   1489  C  CG1   . ILE E  3 116  ? 102.867 18.330  42.904  1.00 44.00 ? 141  ILE A CG1   1 
ATOM   1490  C  CG2   . ILE E  3 116  ? 101.324 18.432  40.905  1.00 44.84 ? 141  ILE A CG2   1 
ATOM   1491  C  CD1   . ILE E  3 116  ? 103.446 16.950  42.661  1.00 44.49 ? 141  ILE A CD1   1 
ATOM   1492  N  N     . VAL E  3 117  ? 98.835  20.529  41.728  1.00 44.92 ? 142  VAL A N     1 
ATOM   1493  C  CA    . VAL E  3 117  ? 97.466  20.377  41.242  1.00 44.67 ? 142  VAL A CA    1 
ATOM   1494  C  C     . VAL E  3 117  ? 97.421  20.040  39.762  1.00 45.56 ? 142  VAL A C     1 
ATOM   1495  O  O     . VAL E  3 117  ? 98.145  20.632  38.950  1.00 46.12 ? 142  VAL A O     1 
ATOM   1496  C  CB    . VAL E  3 117  ? 96.513  21.553  41.638  1.00 43.98 ? 142  VAL A CB    1 
ATOM   1497  C  CG1   . VAL E  3 117  ? 97.255  22.663  42.336  1.00 43.78 ? 142  VAL A CG1   1 
ATOM   1498  C  CG2   . VAL E  3 117  ? 95.739  22.068  40.450  1.00 43.10 ? 142  VAL A CG2   1 
ATOM   1499  N  N     . VAL E  3 118  ? 96.581  19.060  39.438  1.00 46.13 ? 143  VAL A N     1 
ATOM   1500  C  CA    . VAL E  3 118  ? 96.329  18.646  38.064  1.00 46.88 ? 143  VAL A CA    1 
ATOM   1501  C  C     . VAL E  3 118  ? 94.951  19.158  37.654  1.00 47.58 ? 143  VAL A C     1 
ATOM   1502  O  O     . VAL E  3 118  ? 93.940  18.715  38.208  1.00 47.72 ? 143  VAL A O     1 
ATOM   1503  C  CB    . VAL E  3 118  ? 96.375  17.107  37.946  1.00 46.81 ? 143  VAL A CB    1 
ATOM   1504  C  CG1   . VAL E  3 118  ? 96.111  16.663  36.514  1.00 46.66 ? 143  VAL A CG1   1 
ATOM   1505  C  CG2   . VAL E  3 118  ? 97.716  16.580  38.430  1.00 45.54 ? 143  VAL A CG2   1 
ATOM   1506  N  N     . ASP E  3 119  ? 94.912  20.105  36.713  1.00 48.57 ? 144  ASP A N     1 
ATOM   1507  C  CA    . ASP E  3 119  ? 93.637  20.677  36.263  1.00 49.96 ? 144  ASP A CA    1 
ATOM   1508  C  C     . ASP E  3 119  ? 93.012  19.839  35.163  1.00 49.37 ? 144  ASP A C     1 
ATOM   1509  O  O     . ASP E  3 119  ? 93.476  19.837  34.015  1.00 48.05 ? 144  ASP A O     1 
ATOM   1510  C  CB    . ASP E  3 119  ? 93.752  22.148  35.833  1.00 51.65 ? 144  ASP A CB    1 
ATOM   1511  C  CG    . ASP E  3 119  ? 92.400  22.903  35.898  1.00 54.74 ? 144  ASP A CG    1 
ATOM   1512  O  OD1   . ASP E  3 119  ? 91.314  22.269  35.920  1.00 56.22 ? 144  ASP A OD1   1 
ATOM   1513  O  OD2   . ASP E  3 119  ? 92.423  24.154  35.925  1.00 56.71 ? 144  ASP A OD2   1 
ATOM   1514  N  N     . SER E  3 120  ? 91.939  19.157  35.577  1.00 49.66 ? 145  SER A N     1 
ATOM   1515  C  CA    . SER E  3 120  ? 91.120  18.221  34.797  1.00 49.66 ? 145  SER A CA    1 
ATOM   1516  C  C     . SER E  3 120  ? 91.786  16.880  34.526  1.00 48.88 ? 145  SER A C     1 
ATOM   1517  O  O     . SER E  3 120  ? 92.673  16.779  33.674  1.00 48.58 ? 145  SER A O     1 
ATOM   1518  C  CB    . SER E  3 120  ? 90.573  18.844  33.507  1.00 50.21 ? 145  SER A CB    1 
ATOM   1519  O  OG    . SER E  3 120  ? 89.370  19.545  33.769  1.00 51.19 ? 145  SER A OG    1 
ATOM   1520  N  N     . VAL E  3 121  ? 91.358  15.857  35.264  1.00 47.89 ? 146  VAL A N     1 
ATOM   1521  C  CA    . VAL E  3 121  ? 91.706  14.488  34.904  1.00 47.39 ? 146  VAL A CA    1 
ATOM   1522  C  C     . VAL E  3 121  ? 90.984  14.200  33.590  1.00 47.57 ? 146  VAL A C     1 
ATOM   1523  O  O     . VAL E  3 121  ? 91.477  13.449  32.752  1.00 47.86 ? 146  VAL A O     1 
ATOM   1524  C  CB    . VAL E  3 121  ? 91.349  13.433  36.004  1.00 47.18 ? 146  VAL A CB    1 
ATOM   1525  C  CG1   . VAL E  3 121  ? 91.247  14.078  37.378  1.00 46.12 ? 146  VAL A CG1   1 
ATOM   1526  C  CG2   . VAL E  3 121  ? 90.061  12.683  35.673  1.00 47.56 ? 146  VAL A CG2   1 
ATOM   1527  N  N     . ALA E  3 122  ? 89.824  14.839  33.417  1.00 47.25 ? 147  ALA A N     1 
ATOM   1528  C  CA    . ALA E  3 122  ? 89.043  14.769  32.189  1.00 46.53 ? 147  ALA A CA    1 
ATOM   1529  C  C     . ALA E  3 122  ? 89.903  15.026  30.955  1.00 46.08 ? 147  ALA A C     1 
ATOM   1530  O  O     . ALA E  3 122  ? 89.687  14.415  29.903  1.00 46.09 ? 147  ALA A O     1 
ATOM   1531  C  CB    . ALA E  3 122  ? 87.905  15.764  32.246  1.00 46.68 ? 147  ALA A CB    1 
ATOM   1532  N  N     . ALA E  3 123  ? 90.879  15.922  31.101  1.00 45.49 ? 148  ALA A N     1 
ATOM   1533  C  CA    . ALA E  3 123  ? 91.751  16.330  30.003  1.00 44.81 ? 148  ALA A CA    1 
ATOM   1534  C  C     . ALA E  3 123  ? 93.036  15.500  29.901  1.00 44.29 ? 148  ALA A C     1 
ATOM   1535  O  O     . ALA E  3 123  ? 93.834  15.696  28.985  1.00 43.79 ? 148  ALA A O     1 
ATOM   1536  C  CB    . ALA E  3 123  ? 92.073  17.815  30.113  1.00 44.62 ? 148  ALA A CB    1 
ATOM   1537  N  N     . LEU E  3 124  ? 93.229  14.578  30.842  1.00 44.19 ? 149  LEU A N     1 
ATOM   1538  C  CA    . LEU E  3 124  ? 94.371  13.657  30.819  1.00 43.92 ? 149  LEU A CA    1 
ATOM   1539  C  C     . LEU E  3 124  ? 94.230  12.595  29.722  1.00 44.07 ? 149  LEU A C     1 
ATOM   1540  O  O     . LEU E  3 124  ? 93.837  11.455  29.993  1.00 44.01 ? 149  LEU A O     1 
ATOM   1541  C  CB    . LEU E  3 124  ? 94.541  12.990  32.187  1.00 43.31 ? 149  LEU A CB    1 
ATOM   1542  C  CG    . LEU E  3 124  ? 95.601  13.503  33.159  1.00 43.04 ? 149  LEU A CG    1 
ATOM   1543  C  CD1   . LEU E  3 124  ? 95.928  14.964  32.965  1.00 43.54 ? 149  LEU A CD1   1 
ATOM   1544  C  CD2   . LEU E  3 124  ? 95.153  13.264  34.579  1.00 44.63 ? 149  LEU A CD2   1 
ATOM   1545  N  N     . THR E  3 125  ? 94.563  12.979  28.491  1.00 44.13 ? 150  THR A N     1 
ATOM   1546  C  CA    . THR E  3 125  ? 94.377  12.122  27.318  1.00 44.16 ? 150  THR A CA    1 
ATOM   1547  C  C     . THR E  3 125  ? 95.505  11.103  27.153  1.00 44.43 ? 150  THR A C     1 
ATOM   1548  O  O     . THR E  3 125  ? 96.663  11.484  26.962  1.00 43.97 ? 150  THR A O     1 
ATOM   1549  C  CB    . THR E  3 125  ? 94.279  12.949  26.022  1.00 43.90 ? 150  THR A CB    1 
ATOM   1550  O  OG1   . THR E  3 125  ? 93.420  14.073  26.230  1.00 43.34 ? 150  THR A OG1   1 
ATOM   1551  C  CG2   . THR E  3 125  ? 93.734  12.101  24.887  1.00 44.41 ? 150  THR A CG2   1 
ATOM   1552  N  N     . PRO E  3 126  ? 95.168  9.801   27.216  1.00 44.85 ? 151  PRO A N     1 
ATOM   1553  C  CA    . PRO E  3 126  ? 96.136  8.729   26.984  1.00 45.15 ? 151  PRO A CA    1 
ATOM   1554  C  C     . PRO E  3 126  ? 96.890  8.893   25.669  1.00 45.55 ? 151  PRO A C     1 
ATOM   1555  O  O     . PRO E  3 126  ? 96.342  9.425   24.697  1.00 45.71 ? 151  PRO A O     1 
ATOM   1556  C  CB    . PRO E  3 126  ? 95.259  7.478   26.934  1.00 44.95 ? 151  PRO A CB    1 
ATOM   1557  C  CG    . PRO E  3 126  ? 94.109  7.814   27.805  1.00 45.29 ? 151  PRO A CG    1 
ATOM   1558  C  CD    . PRO E  3 126  ? 93.832  9.262   27.538  1.00 45.02 ? 151  PRO A CD    1 
ATOM   1559  N  N     . LYS E  3 127  ? 98.136  8.430   25.653  1.00 46.04 ? 152  LYS A N     1 
ATOM   1560  C  CA    . LYS E  3 127  ? 99.019  8.585   24.501  1.00 46.84 ? 152  LYS A CA    1 
ATOM   1561  C  C     . LYS E  3 127  ? 98.450  7.931   23.249  1.00 46.45 ? 152  LYS A C     1 
ATOM   1562  O  O     . LYS E  3 127  ? 98.516  8.503   22.160  1.00 46.39 ? 152  LYS A O     1 
ATOM   1563  C  CB    . LYS E  3 127  ? 100.406 8.015   24.811  1.00 47.80 ? 152  LYS A CB    1 
ATOM   1564  C  CG    . LYS E  3 127  ? 101.475 8.353   23.779  1.00 49.11 ? 152  LYS A CG    1 
ATOM   1565  C  CD    . LYS E  3 127  ? 102.866 8.117   24.345  1.00 51.15 ? 152  LYS A CD    1 
ATOM   1566  C  CE    . LYS E  3 127  ? 103.944 8.710   23.450  1.00 51.99 ? 152  LYS A CE    1 
ATOM   1567  N  NZ    . LYS E  3 127  ? 104.190 7.863   22.253  1.00 53.10 ? 152  LYS A NZ    1 
ATOM   1568  N  N     . ALA E  3 128  ? 97.892  6.735   23.416  1.00 46.21 ? 153  ALA A N     1 
ATOM   1569  C  CA    . ALA E  3 128  ? 97.307  5.987   22.307  1.00 46.07 ? 153  ALA A CA    1 
ATOM   1570  C  C     . ALA E  3 128  ? 96.112  6.718   21.693  1.00 46.04 ? 153  ALA A C     1 
ATOM   1571  O  O     . ALA E  3 128  ? 95.878  6.623   20.489  1.00 45.97 ? 153  ALA A O     1 
ATOM   1572  C  CB    . ALA E  3 128  ? 96.908  4.591   22.761  1.00 45.95 ? 153  ALA A CB    1 
ATOM   1573  N  N     . GLU E  3 129  ? 95.371  7.449   22.525  1.00 46.08 ? 154  GLU A N     1 
ATOM   1574  C  CA    . GLU E  3 129  ? 94.209  8.208   22.076  1.00 45.93 ? 154  GLU A CA    1 
ATOM   1575  C  C     . GLU E  3 129  ? 94.623  9.402   21.220  1.00 44.88 ? 154  GLU A C     1 
ATOM   1576  O  O     . GLU E  3 129  ? 93.978  9.697   20.219  1.00 45.51 ? 154  GLU A O     1 
ATOM   1577  C  CB    . GLU E  3 129  ? 93.352  8.655   23.265  1.00 46.69 ? 154  GLU A CB    1 
ATOM   1578  C  CG    . GLU E  3 129  ? 91.992  9.238   22.879  1.00 49.11 ? 154  GLU A CG    1 
ATOM   1579  C  CD    . GLU E  3 129  ? 90.966  9.158   24.002  1.00 51.42 ? 154  GLU A CD    1 
ATOM   1580  O  OE1   . GLU E  3 129  ? 89.820  8.737   23.735  1.00 52.74 ? 154  GLU A OE1   1 
ATOM   1581  O  OE2   . GLU E  3 129  ? 91.300  9.510   25.155  1.00 52.56 ? 154  GLU A OE2   1 
ATOM   1582  N  N     . ILE E  3 130  ? 95.710  10.069  21.596  1.00 43.32 ? 155  ILE A N     1 
ATOM   1583  C  CA    . ILE E  3 130  ? 96.195  11.247  20.857  1.00 41.97 ? 155  ILE A CA    1 
ATOM   1584  C  C     . ILE E  3 130  ? 96.790  10.886  19.483  1.00 41.00 ? 155  ILE A C     1 
ATOM   1585  O  O     . ILE E  3 130  ? 96.597  11.614  18.504  1.00 40.19 ? 155  ILE A O     1 
ATOM   1586  C  CB    . ILE E  3 130  ? 97.171  12.101  21.724  1.00 41.63 ? 155  ILE A CB    1 
ATOM   1587  C  CG1   . ILE E  3 130  ? 96.393  12.766  22.857  1.00 41.40 ? 155  ILE A CG1   1 
ATOM   1588  C  CG2   . ILE E  3 130  ? 97.862  13.186  20.905  1.00 40.47 ? 155  ILE A CG2   1 
ATOM   1589  C  CD1   . ILE E  3 130  ? 97.210  13.086  24.064  1.00 42.43 ? 155  ILE A CD1   1 
ATOM   1590  N  N     . GLU E  3 131  ? 97.494  9.757   19.424  1.00 40.40 ? 156  GLU A N     1 
ATOM   1591  C  CA    . GLU E  3 131  ? 98.059  9.240   18.177  1.00 40.04 ? 156  GLU A CA    1 
ATOM   1592  C  C     . GLU E  3 131  ? 96.990  8.752   17.198  1.00 40.10 ? 156  GLU A C     1 
ATOM   1593  O  O     . GLU E  3 131  ? 97.117  8.939   15.987  1.00 40.33 ? 156  GLU A O     1 
ATOM   1594  C  CB    . GLU E  3 131  ? 99.052  8.113   18.465  1.00 39.77 ? 156  GLU A CB    1 
ATOM   1595  C  CG    . GLU E  3 131  ? 100.503 8.560   18.539  1.00 39.86 ? 156  GLU A CG    1 
ATOM   1596  C  CD    . GLU E  3 131  ? 101.427 7.465   19.044  1.00 40.07 ? 156  GLU A CD    1 
ATOM   1597  O  OE1   . GLU E  3 131  ? 102.263 6.969   18.256  1.00 39.56 ? 156  GLU A OE1   1 
ATOM   1598  O  OE2   . GLU E  3 131  ? 101.311 7.094   20.231  1.00 40.69 ? 156  GLU A OE2   1 
ATOM   1599  N  N     . GLY E  3 132  ? 95.943  8.123   17.727  1.00 39.96 ? 157  GLY A N     1 
ATOM   1600  C  CA    . GLY E  3 132  ? 94.859  7.581   16.906  1.00 39.27 ? 157  GLY A CA    1 
ATOM   1601  C  C     . GLY E  3 132  ? 93.805  8.608   16.542  1.00 38.76 ? 157  GLY A C     1 
ATOM   1602  O  O     . GLY E  3 132  ? 93.753  9.688   17.124  1.00 38.74 ? 157  GLY A O     1 
ATOM   1603  N  N     . GLU E  3 133  ? 92.959  8.257   15.580  1.00 38.67 ? 158  GLU A N     1 
ATOM   1604  C  CA    . GLU E  3 133  ? 91.906  9.143   15.085  1.00 38.90 ? 158  GLU A CA    1 
ATOM   1605  C  C     . GLU E  3 133  ? 90.783  9.337   16.095  1.00 39.02 ? 158  GLU A C     1 
ATOM   1606  O  O     . GLU E  3 133  ? 90.593  8.503   16.981  1.00 39.31 ? 158  GLU A O     1 
ATOM   1607  C  CB    . GLU E  3 133  ? 91.316  8.574   13.798  1.00 38.98 ? 158  GLU A CB    1 
ATOM   1608  C  CG    . GLU E  3 133  ? 92.234  8.644   12.602  1.00 39.68 ? 158  GLU A CG    1 
ATOM   1609  C  CD    . GLU E  3 133  ? 91.492  8.424   11.307  1.00 40.99 ? 158  GLU A CD    1 
ATOM   1610  O  OE1   . GLU E  3 133  ? 91.326  9.401   10.544  1.00 41.71 ? 158  GLU A OE1   1 
ATOM   1611  O  OE2   . GLU E  3 133  ? 91.055  7.279   11.059  1.00 41.98 ? 158  GLU A OE2   1 
ATOM   1612  N  N     . ILE E  3 134  ? 90.040  10.438  15.957  1.00 39.05 ? 159  ILE A N     1 
ATOM   1613  C  CA    . ILE E  3 134  ? 88.827  10.654  16.752  1.00 39.05 ? 159  ILE A CA    1 
ATOM   1614  C  C     . ILE E  3 134  ? 87.740  9.744   16.176  1.00 39.62 ? 159  ILE A C     1 
ATOM   1615  O  O     . ILE E  3 134  ? 87.335  9.889   15.017  1.00 39.71 ? 159  ILE A O     1 
ATOM   1616  C  CB    . ILE E  3 134  ? 88.378  12.143  16.783  1.00 38.56 ? 159  ILE A CB    1 
ATOM   1617  C  CG1   . ILE E  3 134  ? 89.543  13.049  17.189  1.00 37.97 ? 159  ILE A CG1   1 
ATOM   1618  C  CG2   . ILE E  3 134  ? 87.227  12.334  17.766  1.00 38.08 ? 159  ILE A CG2   1 
ATOM   1619  C  CD1   . ILE E  3 134  ? 89.477  14.457  16.634  1.00 36.88 ? 159  ILE A CD1   1 
ATOM   1620  N  N     . GLY E  3 135  ? 87.297  8.793   16.992  1.00 40.01 ? 160  GLY A N     1 
ATOM   1621  C  CA    . GLY E  3 135  ? 86.443  7.709   16.530  1.00 40.80 ? 160  GLY A CA    1 
ATOM   1622  C  C     . GLY E  3 135  ? 87.190  6.389   16.574  1.00 41.49 ? 160  GLY A C     1 
ATOM   1623  O  O     . GLY E  3 135  ? 86.947  5.501   15.754  1.00 41.15 ? 160  GLY A O     1 
ATOM   1624  N  N     . ASP E  3 136  ? 88.107  6.271   17.533  1.00 42.56 ? 161  ASP A N     1 
ATOM   1625  C  CA    . ASP E  3 136  ? 88.846  5.034   17.771  1.00 44.02 ? 161  ASP A CA    1 
ATOM   1626  C  C     . ASP E  3 136  ? 88.510  4.446   19.139  1.00 45.20 ? 161  ASP A C     1 
ATOM   1627  O  O     . ASP E  3 136  ? 88.507  5.157   20.150  1.00 44.78 ? 161  ASP A O     1 
ATOM   1628  C  CB    . ASP E  3 136  ? 90.353  5.268   17.642  1.00 44.09 ? 161  ASP A CB    1 
ATOM   1629  C  CG    . ASP E  3 136  ? 90.804  5.450   16.196  1.00 44.07 ? 161  ASP A CG    1 
ATOM   1630  O  OD1   . ASP E  3 136  ? 90.038  5.123   15.261  1.00 43.92 ? 161  ASP A OD1   1 
ATOM   1631  O  OD2   . ASP E  3 136  ? 91.943  5.917   15.997  1.00 43.78 ? 161  ASP A OD2   1 
ATOM   1632  N  N     . SER E  3 137  ? 88.239  3.141   19.154  1.00 47.11 ? 162  SER A N     1 
ATOM   1633  C  CA    . SER E  3 137  ? 87.727  2.443   20.337  1.00 49.07 ? 162  SER A CA    1 
ATOM   1634  C  C     . SER E  3 137  ? 88.779  2.231   21.433  1.00 50.50 ? 162  SER A C     1 
ATOM   1635  O  O     . SER E  3 137  ? 89.331  1.133   21.591  1.00 50.61 ? 162  SER A O     1 
ATOM   1636  C  CB    . SER E  3 137  ? 87.081  1.108   19.936  1.00 49.06 ? 162  SER A CB    1 
ATOM   1637  O  OG    . SER E  3 137  ? 86.599  0.404   21.070  1.00 49.19 ? 162  SER A OG    1 
ATOM   1638  N  N     . HIS E  3 138  ? 89.043  3.294   22.186  1.00 52.03 ? 163  HIS A N     1 
ATOM   1639  C  CA    . HIS E  3 138  ? 89.918  3.215   23.347  1.00 53.64 ? 163  HIS A CA    1 
ATOM   1640  C  C     . HIS E  3 138  ? 89.057  2.961   24.579  1.00 54.05 ? 163  HIS A C     1 
ATOM   1641  O  O     . HIS E  3 138  ? 88.799  3.864   25.374  1.00 54.16 ? 163  HIS A O     1 
ATOM   1642  C  CB    . HIS E  3 138  ? 90.762  4.494   23.493  1.00 54.30 ? 163  HIS A CB    1 
ATOM   1643  C  CG    . HIS E  3 138  ? 91.547  4.847   22.264  1.00 55.83 ? 163  HIS A CG    1 
ATOM   1644  N  ND1   . HIS E  3 138  ? 92.599  4.082   21.805  1.00 56.62 ? 163  HIS A ND1   1 
ATOM   1645  C  CD2   . HIS E  3 138  ? 91.430  5.880   21.396  1.00 56.52 ? 163  HIS A CD2   1 
ATOM   1646  C  CE1   . HIS E  3 138  ? 93.094  4.627   20.707  1.00 56.75 ? 163  HIS A CE1   1 
ATOM   1647  N  NE2   . HIS E  3 138  ? 92.402  5.719   20.438  1.00 56.73 ? 163  HIS A NE2   1 
ATOM   1648  N  N     . MET E  3 139  ? 88.591  1.725   24.717  1.00 54.69 ? 164  MET A N     1 
ATOM   1649  C  CA    . MET E  3 139  ? 87.708  1.378   25.821  1.00 55.81 ? 164  MET A CA    1 
ATOM   1650  C  C     . MET E  3 139  ? 88.472  1.080   27.106  1.00 55.56 ? 164  MET A C     1 
ATOM   1651  O  O     . MET E  3 139  ? 89.293  0.162   27.154  1.00 55.41 ? 164  MET A O     1 
ATOM   1652  C  CB    . MET E  3 139  ? 86.791  0.212   25.451  1.00 55.99 ? 164  MET A CB    1 
ATOM   1653  C  CG    . MET E  3 139  ? 85.402  0.645   24.991  1.00 56.85 ? 164  MET A CG    1 
ATOM   1654  S  SD    . MET E  3 139  ? 84.116  -0.574  25.374  1.00 57.75 ? 164  MET A SD    1 
ATOM   1655  C  CE    . MET E  3 139  ? 84.156  -0.606  27.172  1.00 57.68 ? 164  MET A CE    1 
ATOM   1656  N  N     . GLY E  3 140  ? 88.195  1.881   28.135  1.00 55.59 ? 165  GLY A N     1 
ATOM   1657  C  CA    . GLY E  3 140  ? 88.780  1.712   29.468  1.00 55.53 ? 165  GLY A CA    1 
ATOM   1658  C  C     . GLY E  3 140  ? 90.183  2.270   29.643  1.00 55.44 ? 165  GLY A C     1 
ATOM   1659  O  O     . GLY E  3 140  ? 90.714  2.288   30.758  1.00 55.30 ? 165  GLY A O     1 
ATOM   1660  N  N     . LEU E  3 141  ? 90.770  2.740   28.544  1.00 55.40 ? 166  LEU A N     1 
ATOM   1661  C  CA    . LEU E  3 141  ? 92.182  3.116   28.491  1.00 55.14 ? 166  LEU A CA    1 
ATOM   1662  C  C     . LEU E  3 141  ? 92.589  4.159   29.539  1.00 54.82 ? 166  LEU A C     1 
ATOM   1663  O  O     . LEU E  3 141  ? 93.600  3.981   30.223  1.00 55.10 ? 166  LEU A O     1 
ATOM   1664  C  CB    . LEU E  3 141  ? 92.559  3.584   27.079  1.00 55.33 ? 166  LEU A CB    1 
ATOM   1665  C  CG    . LEU E  3 141  ? 93.887  3.074   26.500  1.00 56.00 ? 166  LEU A CG    1 
ATOM   1666  C  CD1   . LEU E  3 141  ? 93.917  3.241   24.986  1.00 55.95 ? 166  LEU A CD1   1 
ATOM   1667  C  CD2   . LEU E  3 141  ? 95.115  3.739   27.140  1.00 56.31 ? 166  LEU A CD2   1 
ATOM   1668  N  N     . ALA E  3 142  ? 91.804  5.229   29.669  1.00 54.17 ? 167  ALA A N     1 
ATOM   1669  C  CA    . ALA E  3 142  ? 92.104  6.298   30.637  1.00 53.48 ? 167  ALA A CA    1 
ATOM   1670  C  C     . ALA E  3 142  ? 91.887  5.883   32.103  1.00 52.70 ? 167  ALA A C     1 
ATOM   1671  O  O     . ALA E  3 142  ? 92.593  6.348   33.000  1.00 53.04 ? 167  ALA A O     1 
ATOM   1672  C  CB    . ALA E  3 142  ? 91.314  7.568   30.307  1.00 53.51 ? 167  ALA A CB    1 
ATOM   1673  N  N     . ALA E  3 143  ? 90.910  5.008   32.331  1.00 51.16 ? 168  ALA A N     1 
ATOM   1674  C  CA    . ALA E  3 143  ? 90.607  4.474   33.656  1.00 50.16 ? 168  ALA A CA    1 
ATOM   1675  C  C     . ALA E  3 143  ? 91.766  3.638   34.179  1.00 49.54 ? 168  ALA A C     1 
ATOM   1676  O  O     . ALA E  3 143  ? 92.162  3.756   35.345  1.00 49.34 ? 168  ALA A O     1 
ATOM   1677  C  CB    . ALA E  3 143  ? 89.337  3.633   33.598  1.00 50.25 ? 168  ALA A CB    1 
ATOM   1678  N  N     . ARG E  3 144  ? 92.303  2.802   33.292  1.00 48.81 ? 169  ARG A N     1 
ATOM   1679  C  CA    . ARG E  3 144  ? 93.384  1.883   33.614  1.00 48.42 ? 169  ARG A CA    1 
ATOM   1680  C  C     . ARG E  3 144  ? 94.672  2.648   33.896  1.00 47.72 ? 169  ARG A C     1 
ATOM   1681  O  O     . ARG E  3 144  ? 95.466  2.256   34.754  1.00 47.72 ? 169  ARG A O     1 
ATOM   1682  C  CB    . ARG E  3 144  ? 93.572  0.899   32.459  1.00 48.56 ? 169  ARG A CB    1 
ATOM   1683  C  CG    . ARG E  3 144  ? 94.314  -0.383  32.817  1.00 49.76 ? 169  ARG A CG    1 
ATOM   1684  C  CD    . ARG E  3 144  ? 94.059  -1.501  31.803  1.00 50.62 ? 169  ARG A CD    1 
ATOM   1685  N  NE    . ARG E  3 144  ? 94.274  -1.067  30.422  1.00 52.59 ? 169  ARG A NE    1 
ATOM   1686  C  CZ    . ARG E  3 144  ? 93.301  -0.839  29.541  1.00 53.71 ? 169  ARG A CZ    1 
ATOM   1687  N  NH1   . ARG E  3 144  ? 92.030  -1.013  29.889  1.00 54.57 ? 169  ARG A NH1   1 
ATOM   1688  N  NH2   . ARG E  3 144  ? 93.597  -0.440  28.308  1.00 53.61 ? 169  ARG A NH2   1 
ATOM   1689  N  N     . MET E  3 145  ? 94.854  3.746   33.168  1.00 47.27 ? 170  MET A N     1 
ATOM   1690  C  CA    . MET E  3 145  ? 95.995  4.641   33.337  1.00 46.99 ? 170  MET A CA    1 
ATOM   1691  C  C     . MET E  3 145  ? 95.933  5.358   34.686  1.00 46.82 ? 170  MET A C     1 
ATOM   1692  O  O     . MET E  3 145  ? 96.939  5.447   35.390  1.00 46.49 ? 170  MET A O     1 
ATOM   1693  C  CB    . MET E  3 145  ? 96.029  5.655   32.188  1.00 47.05 ? 170  MET A CB    1 
ATOM   1694  C  CG    . MET E  3 145  ? 97.045  6.776   32.343  1.00 47.30 ? 170  MET A CG    1 
ATOM   1695  S  SD    . MET E  3 145  ? 96.672  8.206   31.303  1.00 46.82 ? 170  MET A SD    1 
ATOM   1696  C  CE    . MET E  3 145  ? 95.296  8.954   32.186  1.00 47.61 ? 170  MET A CE    1 
ATOM   1697  N  N     . MET E  3 146  ? 94.750  5.867   35.028  1.00 46.73 ? 171  MET A N     1 
ATOM   1698  C  CA    . MET E  3 146  ? 94.493  6.488   36.326  1.00 46.71 ? 171  MET A CA    1 
ATOM   1699  C  C     . MET E  3 146  ? 94.728  5.511   37.467  1.00 46.09 ? 171  MET A C     1 
ATOM   1700  O  O     . MET E  3 146  ? 95.325  5.857   38.491  1.00 45.64 ? 171  MET A O     1 
ATOM   1701  C  CB    . MET E  3 146  ? 93.047  6.970   36.393  1.00 47.30 ? 171  MET A CB    1 
ATOM   1702  C  CG    . MET E  3 146  ? 92.802  8.318   35.767  1.00 49.36 ? 171  MET A CG    1 
ATOM   1703  S  SD    . MET E  3 146  ? 93.572  9.624   36.730  1.00 53.25 ? 171  MET A SD    1 
ATOM   1704  C  CE    . MET E  3 146  ? 94.952  10.026  35.685  1.00 52.08 ? 171  MET A CE    1 
ATOM   1705  N  N     . SER E  3 147  ? 94.239  4.291   37.276  1.00 45.52 ? 172  SER A N     1 
ATOM   1706  C  CA    . SER E  3 147  ? 94.368  3.240   38.261  1.00 45.16 ? 172  SER A CA    1 
ATOM   1707  C  C     . SER E  3 147  ? 95.836  2.940   38.521  1.00 45.25 ? 172  SER A C     1 
ATOM   1708  O  O     . SER E  3 147  ? 96.245  2.765   39.668  1.00 46.22 ? 172  SER A O     1 
ATOM   1709  C  CB    . SER E  3 147  ? 93.635  1.994   37.785  1.00 44.80 ? 172  SER A CB    1 
ATOM   1710  O  OG    . SER E  3 147  ? 93.290  1.170   38.877  1.00 45.45 ? 172  SER A OG    1 
ATOM   1711  N  N     . GLN E  3 148  ? 96.629  2.907   37.455  1.00 44.90 ? 173  GLN A N     1 
ATOM   1712  C  CA    . GLN E  3 148  ? 98.068  2.708   37.576  1.00 44.88 ? 173  GLN A CA    1 
ATOM   1713  C  C     . GLN E  3 148  ? 98.750  3.882   38.280  1.00 44.83 ? 173  GLN A C     1 
ATOM   1714  O  O     . GLN E  3 148  ? 99.611  3.680   39.137  1.00 44.42 ? 173  GLN A O     1 
ATOM   1715  C  CB    . GLN E  3 148  ? 98.687  2.480   36.203  1.00 45.08 ? 173  GLN A CB    1 
ATOM   1716  C  CG    . GLN E  3 148  ? 100.171 2.164   36.246  1.00 46.18 ? 173  GLN A CG    1 
ATOM   1717  C  CD    . GLN E  3 148  ? 100.755 1.916   34.871  1.00 47.36 ? 173  GLN A CD    1 
ATOM   1718  O  OE1   . GLN E  3 148  ? 101.580 1.020   34.694  1.00 47.87 ? 173  GLN A OE1   1 
ATOM   1719  N  NE2   . GLN E  3 148  ? 100.327 2.705   33.884  1.00 47.91 ? 173  GLN A NE2   1 
ATOM   1720  N  N     . ALA E  3 149  ? 98.356  5.100   37.910  1.00 45.04 ? 174  ALA A N     1 
ATOM   1721  C  CA    . ALA E  3 149  ? 98.920  6.314   38.488  1.00 44.89 ? 174  ALA A CA    1 
ATOM   1722  C  C     . ALA E  3 149  ? 98.777  6.323   40.008  1.00 45.01 ? 174  ALA A C     1 
ATOM   1723  O  O     . ALA E  3 149  ? 99.751  6.564   40.716  1.00 44.96 ? 174  ALA A O     1 
ATOM   1724  C  CB    . ALA E  3 149  ? 98.273  7.548   37.876  1.00 44.76 ? 174  ALA A CB    1 
ATOM   1725  N  N     . MET E  3 150  ? 97.574  6.037   40.504  1.00 45.26 ? 175  MET A N     1 
ATOM   1726  C  CA    . MET E  3 150  ? 97.318  6.048   41.943  1.00 46.11 ? 175  MET A CA    1 
ATOM   1727  C  C     . MET E  3 150  ? 98.261  5.120   42.693  1.00 46.61 ? 175  MET A C     1 
ATOM   1728  O  O     . MET E  3 150  ? 98.857  5.520   43.691  1.00 46.91 ? 175  MET A O     1 
ATOM   1729  C  CB    . MET E  3 150  ? 95.876  5.664   42.251  1.00 46.60 ? 175  MET A CB    1 
ATOM   1730  C  CG    . MET E  3 150  ? 94.812  6.562   41.643  1.00 47.62 ? 175  MET A CG    1 
ATOM   1731  S  SD    . MET E  3 150  ? 95.025  8.322   41.994  1.00 48.40 ? 175  MET A SD    1 
ATOM   1732  C  CE    . MET E  3 150  ? 95.642  8.913   40.429  1.00 47.44 ? 175  MET A CE    1 
ATOM   1733  N  N     . ARG E  3 151  ? 98.392  3.887   42.205  1.00 47.12 ? 176  ARG A N     1 
ATOM   1734  C  CA    . ARG E  3 151  ? 99.309  2.906   42.788  1.00 47.77 ? 176  ARG A CA    1 
ATOM   1735  C  C     . ARG E  3 151  ? 100.711 3.476   42.978  1.00 47.91 ? 176  ARG A C     1 
ATOM   1736  O  O     . ARG E  3 151  ? 101.272 3.402   44.069  1.00 47.63 ? 176  ARG A O     1 
ATOM   1737  C  CB    . ARG E  3 151  ? 99.383  1.661   41.911  1.00 47.98 ? 176  ARG A CB    1 
ATOM   1738  C  CG    . ARG E  3 151  ? 98.310  0.638   42.195  1.00 49.12 ? 176  ARG A CG    1 
ATOM   1739  C  CD    . ARG E  3 151  ? 98.421  -0.525  41.231  1.00 50.59 ? 176  ARG A CD    1 
ATOM   1740  N  NE    . ARG E  3 151  ? 98.008  -0.137  39.883  1.00 52.15 ? 176  ARG A NE    1 
ATOM   1741  C  CZ    . ARG E  3 151  ? 98.076  -0.922  38.810  1.00 52.34 ? 176  ARG A CZ    1 
ATOM   1742  N  NH1   . ARG E  3 151  ? 98.548  -2.159  38.908  1.00 52.45 ? 176  ARG A NH1   1 
ATOM   1743  N  NH2   . ARG E  3 151  ? 97.669  -0.465  37.632  1.00 52.31 ? 176  ARG A NH2   1 
ATOM   1744  N  N     . LYS E  3 152  ? 101.254 4.054   41.910  1.00 48.53 ? 177  LYS A N     1 
ATOM   1745  C  CA    . LYS E  3 152  ? 102.597 4.630   41.917  1.00 49.03 ? 177  LYS A CA    1 
ATOM   1746  C  C     . LYS E  3 152  ? 102.707 5.916   42.742  1.00 49.01 ? 177  LYS A C     1 
ATOM   1747  O  O     . LYS E  3 152  ? 103.701 6.121   43.438  1.00 49.12 ? 177  LYS A O     1 
ATOM   1748  C  CB    . LYS E  3 152  ? 103.071 4.897   40.486  1.00 49.49 ? 177  LYS A CB    1 
ATOM   1749  C  CG    . LYS E  3 152  ? 103.228 3.648   39.622  1.00 50.66 ? 177  LYS A CG    1 
ATOM   1750  C  CD    . LYS E  3 152  ? 104.084 3.939   38.398  1.00 51.76 ? 177  LYS A CD    1 
ATOM   1751  C  CE    . LYS E  3 152  ? 105.499 4.352   38.803  1.00 51.87 ? 177  LYS A CE    1 
ATOM   1752  N  NZ    . LYS E  3 152  ? 106.203 5.090   37.720  1.00 52.75 ? 177  LYS A NZ    1 
ATOM   1753  N  N     . LEU E  3 153  ? 101.693 6.776   42.666  1.00 48.82 ? 178  LEU A N     1 
ATOM   1754  C  CA    . LEU E  3 153  ? 101.751 8.081   43.328  1.00 48.58 ? 178  LEU A CA    1 
ATOM   1755  C  C     . LEU E  3 153  ? 101.579 8.030   44.845  1.00 48.40 ? 178  LEU A C     1 
ATOM   1756  O  O     . LEU E  3 153  ? 102.363 8.638   45.576  1.00 48.44 ? 178  LEU A O     1 
ATOM   1757  C  CB    . LEU E  3 153  ? 100.735 9.052   42.721  1.00 48.49 ? 178  LEU A CB    1 
ATOM   1758  C  CG    . LEU E  3 153  ? 101.023 9.565   41.312  1.00 48.35 ? 178  LEU A CG    1 
ATOM   1759  C  CD1   . LEU E  3 153  ? 99.807  10.299  40.783  1.00 48.32 ? 178  LEU A CD1   1 
ATOM   1760  C  CD2   . LEU E  3 153  ? 102.247 10.461  41.289  1.00 48.27 ? 178  LEU A CD2   1 
ATOM   1761  N  N     . ALA E  3 154  ? 100.556 7.311   45.305  1.00 48.12 ? 179  ALA A N     1 
ATOM   1762  C  CA    . ALA E  3 154  ? 100.197 7.266   46.723  1.00 47.99 ? 179  ALA A CA    1 
ATOM   1763  C  C     . ALA E  3 154  ? 101.417 7.206   47.643  1.00 47.99 ? 179  ALA A C     1 
ATOM   1764  O  O     . ALA E  3 154  ? 101.555 8.025   48.556  1.00 47.35 ? 179  ALA A O     1 
ATOM   1765  C  CB    . ALA E  3 154  ? 99.265  6.095   46.994  1.00 48.00 ? 179  ALA A CB    1 
ATOM   1766  N  N     . GLY E  3 155  ? 102.300 6.245   47.376  1.00 48.34 ? 180  GLY A N     1 
ATOM   1767  C  CA    . GLY E  3 155  ? 103.497 6.028   48.181  1.00 48.90 ? 180  GLY A CA    1 
ATOM   1768  C  C     . GLY E  3 155  ? 104.486 7.172   48.119  1.00 49.52 ? 180  GLY A C     1 
ATOM   1769  O  O     . GLY E  3 155  ? 104.974 7.633   49.153  1.00 49.93 ? 180  GLY A O     1 
ATOM   1770  N  N     . ASN E  3 156  ? 104.782 7.627   46.903  1.00 50.16 ? 181  ASN A N     1 
ATOM   1771  C  CA    . ASN E  3 156  ? 105.722 8.730   46.684  1.00 50.90 ? 181  ASN A CA    1 
ATOM   1772  C  C     . ASN E  3 156  ? 105.254 10.038  47.300  1.00 51.26 ? 181  ASN A C     1 
ATOM   1773  O  O     . ASN E  3 156  ? 106.070 10.834  47.767  1.00 51.54 ? 181  ASN A O     1 
ATOM   1774  C  CB    . ASN E  3 156  ? 105.978 8.945   45.189  1.00 50.98 ? 181  ASN A CB    1 
ATOM   1775  C  CG    . ASN E  3 156  ? 106.870 7.879   44.583  1.00 50.86 ? 181  ASN A CG    1 
ATOM   1776  O  OD1   . ASN E  3 156  ? 107.010 7.803   43.366  1.00 51.00 ? 181  ASN A OD1   1 
ATOM   1777  N  ND2   . ASN E  3 156  ? 107.481 7.053   45.427  1.00 50.42 ? 181  ASN A ND2   1 
ATOM   1778  N  N     . LEU E  3 157  ? 103.941 10.253  47.289  1.00 51.21 ? 182  LEU A N     1 
ATOM   1779  C  CA    . LEU E  3 157  ? 103.363 11.477  47.822  1.00 51.21 ? 182  LEU A CA    1 
ATOM   1780  C  C     . LEU E  3 157  ? 103.444 11.519  49.337  1.00 51.75 ? 182  LEU A C     1 
ATOM   1781  O  O     . LEU E  3 157  ? 103.739 12.565  49.917  1.00 51.56 ? 182  LEU A O     1 
ATOM   1782  C  CB    . LEU E  3 157  ? 101.917 11.630  47.362  1.00 50.76 ? 182  LEU A CB    1 
ATOM   1783  C  CG    . LEU E  3 157  ? 101.752 12.045  45.900  1.00 50.17 ? 182  LEU A CG    1 
ATOM   1784  C  CD1   . LEU E  3 157  ? 100.362 11.699  45.421  1.00 49.97 ? 182  LEU A CD1   1 
ATOM   1785  C  CD2   . LEU E  3 157  ? 102.035 13.526  45.707  1.00 49.73 ? 182  LEU A CD2   1 
ATOM   1786  N  N     . LYS E  3 158  ? 103.191 10.379  49.972  1.00 52.67 ? 183  LYS A N     1 
ATOM   1787  C  CA    . LYS E  3 158  ? 103.263 10.289  51.426  1.00 53.53 ? 183  LYS A CA    1 
ATOM   1788  C  C     . LYS E  3 158  ? 104.696 10.496  51.920  1.00 53.31 ? 183  LYS A C     1 
ATOM   1789  O  O     . LYS E  3 158  ? 104.922 11.289  52.835  1.00 53.33 ? 183  LYS A O     1 
ATOM   1790  C  CB    . LYS E  3 158  ? 102.658 8.963   51.931  1.00 54.01 ? 183  LYS A CB    1 
ATOM   1791  C  CG    . LYS E  3 158  ? 102.791 8.673   53.448  1.00 55.73 ? 183  LYS A CG    1 
ATOM   1792  C  CD    . LYS E  3 158  ? 102.411 9.854   54.372  1.00 57.92 ? 183  LYS A CD    1 
ATOM   1793  C  CE    . LYS E  3 158  ? 100.917 10.167  54.375  1.00 58.79 ? 183  LYS A CE    1 
ATOM   1794  N  NZ    . LYS E  3 158  ? 100.178 9.261   55.288  1.00 60.02 ? 183  LYS A NZ    1 
ATOM   1795  N  N     . GLN E  3 159  ? 105.658 9.815   51.300  1.00 53.25 ? 184  GLN A N     1 
ATOM   1796  C  CA    . GLN E  3 159  ? 107.056 9.916   51.724  1.00 53.62 ? 184  GLN A CA    1 
ATOM   1797  C  C     . GLN E  3 159  ? 107.693 11.284  51.477  1.00 52.68 ? 184  GLN A C     1 
ATOM   1798  O  O     . GLN E  3 159  ? 108.713 11.615  52.080  1.00 52.47 ? 184  GLN A O     1 
ATOM   1799  C  CB    . GLN E  3 159  ? 107.900 8.785   51.129  1.00 54.48 ? 184  GLN A CB    1 
ATOM   1800  C  CG    . GLN E  3 159  ? 108.116 7.638   52.117  1.00 57.44 ? 184  GLN A CG    1 
ATOM   1801  C  CD    . GLN E  3 159  ? 108.171 6.272   51.454  1.00 59.56 ? 184  GLN A CD    1 
ATOM   1802  O  OE1   . GLN E  3 159  ? 109.128 5.945   50.752  1.00 61.27 ? 184  GLN A OE1   1 
ATOM   1803  N  NE2   . GLN E  3 159  ? 107.146 5.460   51.690  1.00 60.07 ? 184  GLN A NE2   1 
ATOM   1804  N  N     . SER E  3 160  ? 107.074 12.079  50.611  1.00 51.85 ? 185  SER A N     1 
ATOM   1805  C  CA    . SER E  3 160  ? 107.556 13.422  50.311  1.00 51.36 ? 185  SER A CA    1 
ATOM   1806  C  C     . SER E  3 160  ? 106.713 14.483  50.993  1.00 50.70 ? 185  SER A C     1 
ATOM   1807  O  O     . SER E  3 160  ? 107.030 15.672  50.931  1.00 50.67 ? 185  SER A O     1 
ATOM   1808  C  CB    . SER E  3 160  ? 107.529 13.662  48.808  1.00 51.66 ? 185  SER A CB    1 
ATOM   1809  O  OG    . SER E  3 160  ? 108.325 12.708  48.136  1.00 52.37 ? 185  SER A OG    1 
ATOM   1810  N  N     . ASN E  3 161  ? 105.633 14.043  51.632  1.00 50.20 ? 186  ASN A N     1 
ATOM   1811  C  CA    . ASN E  3 161  ? 104.661 14.936  52.257  1.00 49.90 ? 186  ASN A CA    1 
ATOM   1812  C  C     . ASN E  3 161  ? 104.091 15.960  51.267  1.00 49.11 ? 186  ASN A C     1 
ATOM   1813  O  O     . ASN E  3 161  ? 103.863 17.124  51.608  1.00 48.90 ? 186  ASN A O     1 
ATOM   1814  C  CB    . ASN E  3 161  ? 105.262 15.617  53.492  1.00 50.41 ? 186  ASN A CB    1 
ATOM   1815  C  CG    . ASN E  3 161  ? 104.212 15.985  54.516  1.00 51.73 ? 186  ASN A CG    1 
ATOM   1816  O  OD1   . ASN E  3 161  ? 103.391 15.153  54.911  1.00 52.51 ? 186  ASN A OD1   1 
ATOM   1817  N  ND2   . ASN E  3 161  ? 104.228 17.238  54.951  1.00 52.74 ? 186  ASN A ND2   1 
ATOM   1818  N  N     . THR E  3 162  ? 103.865 15.497  50.040  1.00 48.24 ? 187  THR A N     1 
ATOM   1819  C  CA    . THR E  3 162  ? 103.357 16.324  48.953  1.00 47.44 ? 187  THR A CA    1 
ATOM   1820  C  C     . THR E  3 162  ? 101.850 16.146  48.803  1.00 46.92 ? 187  THR A C     1 
ATOM   1821  O  O     . THR E  3 162  ? 101.372 15.023  48.659  1.00 47.01 ? 187  THR A O     1 
ATOM   1822  C  CB    . THR E  3 162  ? 104.007 15.918  47.616  1.00 47.46 ? 187  THR A CB    1 
ATOM   1823  O  OG1   . THR E  3 162  ? 105.418 15.760  47.792  1.00 47.16 ? 187  THR A OG1   1 
ATOM   1824  C  CG2   . THR E  3 162  ? 103.723 16.953  46.522  1.00 47.14 ? 187  THR A CG2   1 
ATOM   1825  N  N     . LEU E  3 163  ? 101.109 17.251  48.827  1.00 46.16 ? 188  LEU A N     1 
ATOM   1826  C  CA    . LEU E  3 163  ? 99.678  17.216  48.547  1.00 45.51 ? 188  LEU A CA    1 
ATOM   1827  C  C     . LEU E  3 163  ? 99.445  17.240  47.046  1.00 45.99 ? 188  LEU A C     1 
ATOM   1828  O  O     . LEU E  3 163  ? 100.047 18.052  46.341  1.00 46.35 ? 188  LEU A O     1 
ATOM   1829  C  CB    . LEU E  3 163  ? 98.964  18.401  49.200  1.00 45.08 ? 188  LEU A CB    1 
ATOM   1830  C  CG    . LEU E  3 163  ? 97.526  18.686  48.744  1.00 44.57 ? 188  LEU A CG    1 
ATOM   1831  C  CD1   . LEU E  3 163  ? 96.571  17.575  49.156  1.00 44.74 ? 188  LEU A CD1   1 
ATOM   1832  C  CD2   . LEU E  3 163  ? 97.052  20.020  49.280  1.00 44.94 ? 188  LEU A CD2   1 
ATOM   1833  N  N     . LEU E  3 164  ? 98.573  16.355  46.562  1.00 46.04 ? 189  LEU A N     1 
ATOM   1834  C  CA    . LEU E  3 164  ? 98.208  16.335  45.147  1.00 46.00 ? 189  LEU A CA    1 
ATOM   1835  C  C     . LEU E  3 164  ? 96.708  16.544  44.977  1.00 46.07 ? 189  LEU A C     1 
ATOM   1836  O  O     . LEU E  3 164  ? 95.907  15.717  45.420  1.00 47.07 ? 189  LEU A O     1 
ATOM   1837  C  CB    . LEU E  3 164  ? 98.624  15.012  44.495  1.00 45.93 ? 189  LEU A CB    1 
ATOM   1838  C  CG    . LEU E  3 164  ? 98.877  14.960  42.980  1.00 45.91 ? 189  LEU A CG    1 
ATOM   1839  C  CD1   . LEU E  3 164  ? 98.950  13.515  42.523  1.00 46.15 ? 189  LEU A CD1   1 
ATOM   1840  C  CD2   . LEU E  3 164  ? 97.828  15.701  42.155  1.00 47.11 ? 189  LEU A CD2   1 
ATOM   1841  N  N     . ILE E  3 165  ? 96.330  17.640  44.325  1.00 45.28 ? 190  ILE A N     1 
ATOM   1842  C  CA    . ILE E  3 165  ? 94.920  17.911  44.055  1.00 44.50 ? 190  ILE A CA    1 
ATOM   1843  C  C     . ILE E  3 165  ? 94.554  17.615  42.603  1.00 44.29 ? 190  ILE A C     1 
ATOM   1844  O  O     . ILE E  3 165  ? 95.162  18.154  41.676  1.00 44.54 ? 190  ILE A O     1 
ATOM   1845  C  CB    . ILE E  3 165  ? 94.539  19.361  44.417  1.00 44.25 ? 190  ILE A CB    1 
ATOM   1846  C  CG1   . ILE E  3 165  ? 94.791  19.609  45.904  1.00 44.63 ? 190  ILE A CG1   1 
ATOM   1847  C  CG2   . ILE E  3 165  ? 93.083  19.643  44.070  1.00 43.58 ? 190  ILE A CG2   1 
ATOM   1848  C  CD1   . ILE E  3 165  ? 94.833  21.068  46.285  1.00 46.15 ? 190  ILE A CD1   1 
ATOM   1849  N  N     . PHE E  3 166  ? 93.563  16.750  42.417  1.00 44.09 ? 191  PHE A N     1 
ATOM   1850  C  CA    . PHE E  3 166  ? 93.003  16.493  41.092  1.00 43.68 ? 191  PHE A CA    1 
ATOM   1851  C  C     . PHE E  3 166  ? 91.705  17.258  40.896  1.00 43.47 ? 191  PHE A C     1 
ATOM   1852  O  O     . PHE E  3 166  ? 90.776  17.130  41.695  1.00 44.21 ? 191  PHE A O     1 
ATOM   1853  C  CB    . PHE E  3 166  ? 92.725  15.002  40.907  1.00 43.51 ? 191  PHE A CB    1 
ATOM   1854  C  CG    . PHE E  3 166  ? 93.943  14.188  40.624  1.00 42.81 ? 191  PHE A CG    1 
ATOM   1855  C  CD1   . PHE E  3 166  ? 94.502  14.174  39.350  1.00 42.44 ? 191  PHE A CD1   1 
ATOM   1856  C  CD2   . PHE E  3 166  ? 94.524  13.422  41.624  1.00 42.36 ? 191  PHE A CD2   1 
ATOM   1857  C  CE1   . PHE E  3 166  ? 95.632  13.413  39.078  1.00 42.32 ? 191  PHE A CE1   1 
ATOM   1858  C  CE2   . PHE E  3 166  ? 95.650  12.655  41.367  1.00 42.27 ? 191  PHE A CE2   1 
ATOM   1859  C  CZ    . PHE E  3 166  ? 96.209  12.652  40.091  1.00 42.83 ? 191  PHE A CZ    1 
ATOM   1860  N  N     . ILE E  3 167  ? 91.640  18.058  39.842  1.00 42.75 ? 192  ILE A N     1 
ATOM   1861  C  CA    . ILE E  3 167  ? 90.369  18.640  39.448  1.00 43.17 ? 192  ILE A CA    1 
ATOM   1862  C  C     . ILE E  3 167  ? 89.674  17.699  38.467  1.00 43.55 ? 192  ILE A C     1 
ATOM   1863  O  O     . ILE E  3 167  ? 90.286  17.232  37.507  1.00 43.27 ? 192  ILE A O     1 
ATOM   1864  C  CB    . ILE E  3 167  ? 90.540  20.032  38.831  1.00 43.18 ? 192  ILE A CB    1 
ATOM   1865  C  CG1   . ILE E  3 167  ? 91.122  20.997  39.868  1.00 42.59 ? 192  ILE A CG1   1 
ATOM   1866  C  CG2   . ILE E  3 167  ? 89.203  20.545  38.314  1.00 43.51 ? 192  ILE A CG2   1 
ATOM   1867  C  CD1   . ILE E  3 167  ? 91.511  22.361  39.318  1.00 42.86 ? 192  ILE A CD1   1 
ATOM   1868  N  N     . ASN E  3 168  ? 88.401  17.408  38.718  1.00 44.08 ? 193  ASN A N     1 
ATOM   1869  C  CA    . ASN E  3 168  ? 87.631  16.577  37.798  1.00 44.54 ? 193  ASN A CA    1 
ATOM   1870  C  C     . ASN E  3 168  ? 86.363  17.264  37.307  1.00 44.60 ? 193  ASN A C     1 
ATOM   1871  O  O     . ASN E  3 168  ? 85.821  18.146  37.974  1.00 44.42 ? 193  ASN A O     1 
ATOM   1872  C  CB    . ASN E  3 168  ? 87.293  15.232  38.434  1.00 44.39 ? 193  ASN A CB    1 
ATOM   1873  C  CG    . ASN E  3 168  ? 87.307  14.081  37.429  1.00 44.96 ? 193  ASN A CG    1 
ATOM   1874  O  OD1   . ASN E  3 168  ? 87.555  12.940  37.800  1.00 46.76 ? 193  ASN A OD1   1 
ATOM   1875  N  ND2   . ASN E  3 168  ? 87.051  14.374  36.160  1.00 44.00 ? 193  ASN A ND2   1 
ATOM   1876  N  N     . GLN E  3 169  ? 85.915  16.861  36.121  1.00 45.15 ? 194  GLN A N     1 
ATOM   1877  C  CA    . GLN E  3 169  ? 84.664  17.342  35.552  1.00 45.62 ? 194  GLN A CA    1 
ATOM   1878  C  C     . GLN E  3 169  ? 83.562  16.334  35.824  1.00 45.22 ? 194  GLN A C     1 
ATOM   1879  O  O     . GLN E  3 169  ? 83.830  15.200  36.225  1.00 45.45 ? 194  GLN A O     1 
ATOM   1880  C  CB    . GLN E  3 169  ? 84.802  17.552  34.047  1.00 45.41 ? 194  GLN A CB    1 
ATOM   1881  C  CG    . GLN E  3 169  ? 85.860  18.557  33.657  1.00 47.65 ? 194  GLN A CG    1 
ATOM   1882  C  CD    . GLN E  3 169  ? 86.068  18.621  32.154  1.00 50.00 ? 194  GLN A CD    1 
ATOM   1883  O  OE1   . GLN E  3 169  ? 86.973  19.309  31.666  1.00 51.93 ? 194  GLN A OE1   1 
ATOM   1884  N  NE2   . GLN E  3 169  ? 85.237  17.903  31.410  1.00 48.16 ? 194  GLN A NE2   1 
ATOM   1885  N  N     . ILE E  3 170  ? 82.323  16.755  35.607  1.00 44.87 ? 195  ILE A N     1 
ATOM   1886  C  CA    . ILE E  3 170  ? 81.183  15.865  35.734  1.00 45.00 ? 195  ILE A CA    1 
ATOM   1887  C  C     . ILE E  3 170  ? 80.702  15.387  34.364  1.00 45.77 ? 195  ILE A C     1 
ATOM   1888  O  O     . ILE E  3 170  ? 80.559  16.178  33.427  1.00 45.93 ? 195  ILE A O     1 
ATOM   1889  C  CB    . ILE E  3 170  ? 80.023  16.555  36.451  1.00 44.41 ? 195  ILE A CB    1 
ATOM   1890  C  CG1   . ILE E  3 170  ? 80.415  16.887  37.880  1.00 44.16 ? 195  ILE A CG1   1 
ATOM   1891  C  CG2   . ILE E  3 170  ? 78.782  15.673  36.448  1.00 44.22 ? 195  ILE A CG2   1 
ATOM   1892  C  CD1   . ILE E  3 170  ? 79.363  17.678  38.596  1.00 45.94 ? 195  ILE A CD1   1 
ATOM   1893  N  N     . ARG E  3 171  ? 80.465  14.086  34.253  1.00 46.11 ? 196  ARG A N     1 
ATOM   1894  C  CA    . ARG E  3 171  ? 79.740  13.538  33.120  1.00 46.59 ? 196  ARG A CA    1 
ATOM   1895  C  C     . ARG E  3 171  ? 78.450  12.904  33.639  1.00 47.49 ? 196  ARG A C     1 
ATOM   1896  O  O     . ARG E  3 171  ? 78.296  12.720  34.837  1.00 46.85 ? 196  ARG A O     1 
ATOM   1897  C  CB    . ARG E  3 171  ? 80.592  12.506  32.378  1.00 45.98 ? 196  ARG A CB    1 
ATOM   1898  C  CG    . ARG E  3 171  ? 81.799  13.082  31.660  1.00 45.45 ? 196  ARG A CG    1 
ATOM   1899  C  CD    . ARG E  3 171  ? 81.393  14.065  30.573  1.00 45.97 ? 196  ARG A CD    1 
ATOM   1900  N  NE    . ARG E  3 171  ? 82.545  14.565  29.838  1.00 45.70 ? 196  ARG A NE    1 
ATOM   1901  C  CZ    . ARG E  3 171  ? 83.299  15.583  30.233  1.00 46.48 ? 196  ARG A CZ    1 
ATOM   1902  N  NH1   . ARG E  3 171  ? 83.025  16.217  31.364  1.00 46.75 ? 196  ARG A NH1   1 
ATOM   1903  N  NH2   . ARG E  3 171  ? 84.334  15.967  29.495  1.00 48.23 ? 196  ARG A NH2   1 
ATOM   1904  N  N     . MET E  3 172  ? 77.535  12.554  32.742  1.00 49.15 ? 197  MET A N     1 
ATOM   1905  C  CA    . MET E  3 172  ? 76.276  11.914  33.110  1.00 50.71 ? 197  MET A CA    1 
ATOM   1906  C  C     . MET E  3 172  ? 76.325  10.421  32.786  1.00 51.38 ? 197  MET A C     1 
ATOM   1907  O  O     . MET E  3 172  ? 76.699  10.039  31.678  1.00 51.41 ? 197  MET A O     1 
ATOM   1908  C  CB    . MET E  3 172  ? 75.132  12.566  32.334  1.00 51.53 ? 197  MET A CB    1 
ATOM   1909  C  CG    . MET E  3 172  ? 73.851  12.785  33.123  1.00 54.69 ? 197  MET A CG    1 
ATOM   1910  S  SD    . MET E  3 172  ? 73.978  14.072  34.396  1.00 59.48 ? 197  MET A SD    1 
ATOM   1911  C  CE    . MET E  3 172  ? 74.830  15.409  33.533  1.00 57.98 ? 197  MET A CE    1 
ATOM   1912  N  N     . LYS E  3 173  ? 75.964  9.572   33.743  1.00 52.55 ? 198  LYS A N     1 
ATOM   1913  C  CA    . LYS E  3 173  ? 75.836  8.147   33.444  1.00 53.78 ? 198  LYS A CA    1 
ATOM   1914  C  C     . LYS E  3 173  ? 74.448  7.860   32.887  1.00 54.40 ? 198  LYS A C     1 
ATOM   1915  O  O     . LYS E  3 173  ? 73.442  8.412   33.349  1.00 54.26 ? 198  LYS A O     1 
ATOM   1916  C  CB    . LYS E  3 173  ? 76.222  7.236   34.622  1.00 54.10 ? 198  LYS A CB    1 
ATOM   1917  C  CG    . LYS E  3 173  ? 75.560  7.539   35.961  1.00 55.20 ? 198  LYS A CG    1 
ATOM   1918  C  CD    . LYS E  3 173  ? 76.511  7.283   37.147  1.00 56.02 ? 198  LYS A CD    1 
ATOM   1919  C  CE    . LYS E  3 173  ? 76.814  5.795   37.368  1.00 56.32 ? 198  LYS A CE    1 
ATOM   1920  N  NZ    . LYS E  3 173  ? 77.679  5.556   38.564  1.00 56.27 ? 198  LYS A NZ    1 
ATOM   1921  N  N     . ILE E  3 174  ? 74.426  7.004   31.872  1.00 55.18 ? 199  ILE A N     1 
ATOM   1922  C  CA    . ILE E  3 174  ? 73.289  6.876   30.975  1.00 55.70 ? 199  ILE A CA    1 
ATOM   1923  C  C     . ILE E  3 174  ? 72.470  5.625   31.287  1.00 56.11 ? 199  ILE A C     1 
ATOM   1924  O  O     . ILE E  3 174  ? 73.026  4.557   31.550  1.00 56.49 ? 199  ILE A O     1 
ATOM   1925  C  CB    . ILE E  3 174  ? 73.771  6.908   29.490  1.00 55.69 ? 199  ILE A CB    1 
ATOM   1926  C  CG1   . ILE E  3 174  ? 72.690  7.488   28.572  1.00 55.86 ? 199  ILE A CG1   1 
ATOM   1927  C  CG2   . ILE E  3 174  ? 74.301  5.537   29.026  1.00 55.73 ? 199  ILE A CG2   1 
ATOM   1928  C  CD1   . ILE E  3 174  ? 73.234  8.078   27.281  1.00 55.69 ? 199  ILE A CD1   1 
ATOM   1929  N  N     . GLY E  3 175  ? 71.149  5.775   31.273  1.00 56.19 ? 200  GLY A N     1 
ATOM   1930  C  CA    . GLY E  3 175  ? 70.243  4.671   31.563  1.00 56.35 ? 200  GLY A CA    1 
ATOM   1931  C  C     . GLY E  3 175  ? 70.394  4.124   32.969  1.00 56.56 ? 200  GLY A C     1 
ATOM   1932  O  O     . GLY E  3 175  ? 70.219  2.929   33.193  1.00 56.83 ? 200  GLY A O     1 
ATOM   1933  N  N     . VAL E  3 176  ? 70.748  4.997   33.909  1.00 56.70 ? 201  VAL A N     1 
ATOM   1934  C  CA    . VAL E  3 176  ? 70.746  4.656   35.326  1.00 57.01 ? 201  VAL A CA    1 
ATOM   1935  C  C     . VAL E  3 176  ? 69.332  4.937   35.841  1.00 57.88 ? 201  VAL A C     1 
ATOM   1936  O  O     . VAL E  3 176  ? 68.587  5.698   35.220  1.00 57.93 ? 201  VAL A O     1 
ATOM   1937  C  CB    . VAL E  3 176  ? 71.840  5.447   36.106  1.00 56.56 ? 201  VAL A CB    1 
ATOM   1938  C  CG1   . VAL E  3 176  ? 71.335  6.815   36.564  1.00 55.93 ? 201  VAL A CG1   1 
ATOM   1939  C  CG2   . VAL E  3 176  ? 72.356  4.641   37.284  1.00 55.99 ? 201  VAL A CG2   1 
ATOM   1940  N  N     . MET E  3 177  ? 68.950  4.319   36.954  1.00 58.91 ? 202  MET A N     1 
ATOM   1941  C  CA    . MET E  3 177  ? 67.575  4.445   37.444  1.00 60.16 ? 202  MET A CA    1 
ATOM   1942  C  C     . MET E  3 177  ? 67.462  4.595   38.964  1.00 61.19 ? 202  MET A C     1 
ATOM   1943  O  O     . MET E  3 177  ? 66.428  4.271   39.554  1.00 61.32 ? 202  MET A O     1 
ATOM   1944  C  CB    . MET E  3 177  ? 66.733  3.272   36.936  1.00 60.01 ? 202  MET A CB    1 
ATOM   1945  C  CG    . MET E  3 177  ? 67.462  1.935   36.950  1.00 60.35 ? 202  MET A CG    1 
ATOM   1946  S  SD    . MET E  3 177  ? 66.935  0.828   35.622  1.00 60.48 ? 202  MET A SD    1 
ATOM   1947  C  CE    . MET E  3 177  ? 67.862  1.458   34.227  1.00 60.17 ? 202  MET A CE    1 
ATOM   1948  N  N     . PHE E  3 178  ? 68.528  5.107   39.580  1.00 62.47 ? 203  PHE A N     1 
ATOM   1949  C  CA    . PHE E  3 178  ? 68.604  5.303   41.034  1.00 63.65 ? 203  PHE A CA    1 
ATOM   1950  C  C     . PHE E  3 178  ? 69.588  6.423   41.395  1.00 63.63 ? 203  PHE A C     1 
ATOM   1951  O  O     . PHE E  3 178  ? 70.420  6.821   40.572  1.00 62.98 ? 203  PHE A O     1 
ATOM   1952  C  CB    . PHE E  3 178  ? 69.002  3.996   41.746  1.00 64.57 ? 203  PHE A CB    1 
ATOM   1953  C  CG    . PHE E  3 178  ? 70.162  3.278   41.099  1.00 66.03 ? 203  PHE A CG    1 
ATOM   1954  C  CD1   . PHE E  3 178  ? 71.478  3.704   41.314  1.00 66.93 ? 203  PHE A CD1   1 
ATOM   1955  C  CD2   . PHE E  3 178  ? 69.938  2.181   40.267  1.00 66.47 ? 203  PHE A CD2   1 
ATOM   1956  C  CE1   . PHE E  3 178  ? 72.555  3.048   40.709  1.00 67.08 ? 203  PHE A CE1   1 
ATOM   1957  C  CE2   . PHE E  3 178  ? 71.003  1.515   39.656  1.00 66.86 ? 203  PHE A CE2   1 
ATOM   1958  C  CZ    . PHE E  3 178  ? 72.316  1.948   39.879  1.00 66.86 ? 203  PHE A CZ    1 
ATOM   1959  N  N     . GLY E  3 179  ? 69.481  6.918   42.630  1.00 63.99 ? 204  GLY A N     1 
ATOM   1960  C  CA    . GLY E  3 179  ? 70.389  7.940   43.168  1.00 64.24 ? 204  GLY A CA    1 
ATOM   1961  C  C     . GLY E  3 179  ? 70.475  9.217   42.349  1.00 64.13 ? 204  GLY A C     1 
ATOM   1962  O  O     . GLY E  3 179  ? 69.536  10.015  42.319  1.00 64.36 ? 204  GLY A O     1 
ATOM   1963  N  N     . ASN E  3 180  ? 71.615  9.411   41.693  1.00 63.87 ? 205  ASN A N     1 
ATOM   1964  C  CA    . ASN E  3 180  ? 71.824  10.548  40.803  1.00 63.17 ? 205  ASN A CA    1 
ATOM   1965  C  C     . ASN E  3 180  ? 72.723  10.160  39.625  1.00 61.61 ? 205  ASN A C     1 
ATOM   1966  O  O     . ASN E  3 180  ? 73.611  9.315   39.772  1.00 61.35 ? 205  ASN A O     1 
ATOM   1967  C  CB    . ASN E  3 180  ? 72.327  11.783  41.580  1.00 64.08 ? 205  ASN A CB    1 
ATOM   1968  C  CG    . ASN E  3 180  ? 73.833  12.004  41.466  1.00 65.52 ? 205  ASN A CG    1 
ATOM   1969  O  OD1   . ASN E  3 180  ? 74.641  11.117  41.755  1.00 66.01 ? 205  ASN A OD1   1 
ATOM   1970  N  ND2   . ASN E  3 180  ? 74.214  13.213  41.071  1.00 66.01 ? 205  ASN A ND2   1 
ATOM   1971  N  N     . PRO E  3 181  ? 72.482  10.764  38.449  1.00 60.24 ? 206  PRO A N     1 
ATOM   1972  C  CA    . PRO E  3 181  ? 73.143  10.300  37.233  1.00 59.30 ? 206  PRO A CA    1 
ATOM   1973  C  C     . PRO E  3 181  ? 74.556  10.842  37.007  1.00 58.08 ? 206  PRO A C     1 
ATOM   1974  O  O     . PRO E  3 181  ? 75.173  10.507  36.000  1.00 58.03 ? 206  PRO A O     1 
ATOM   1975  C  CB    . PRO E  3 181  ? 72.204  10.787  36.127  1.00 59.54 ? 206  PRO A CB    1 
ATOM   1976  C  CG    . PRO E  3 181  ? 71.570  12.012  36.686  1.00 60.03 ? 206  PRO A CG    1 
ATOM   1977  C  CD    . PRO E  3 181  ? 71.581  11.902  38.187  1.00 59.99 ? 206  PRO A CD    1 
ATOM   1978  N  N     . GLU E  3 182  ? 75.061  11.661  37.926  1.00 56.64 ? 207  GLU A N     1 
ATOM   1979  C  CA    . GLU E  3 182  ? 76.360  12.301  37.744  1.00 55.48 ? 207  GLU A CA    1 
ATOM   1980  C  C     . GLU E  3 182  ? 77.527  11.354  37.994  1.00 54.76 ? 207  GLU A C     1 
ATOM   1981  O  O     . GLU E  3 182  ? 77.425  10.440  38.805  1.00 54.17 ? 207  GLU A O     1 
ATOM   1982  C  CB    . GLU E  3 182  ? 76.488  13.509  38.659  1.00 55.54 ? 207  GLU A CB    1 
ATOM   1983  C  CG    . GLU E  3 182  ? 75.581  14.670  38.308  1.00 56.51 ? 207  GLU A CG    1 
ATOM   1984  C  CD    . GLU E  3 182  ? 75.856  15.894  39.169  1.00 58.24 ? 207  GLU A CD    1 
ATOM   1985  O  OE1   . GLU E  3 182  ? 76.356  15.733  40.308  1.00 58.54 ? 207  GLU A OE1   1 
ATOM   1986  O  OE2   . GLU E  3 182  ? 75.576  17.022  38.708  1.00 58.84 ? 207  GLU A OE2   1 
ATOM   1987  N  N     . THR E  3 183  ? 78.628  11.574  37.278  1.00 54.63 ? 208  THR A N     1 
ATOM   1988  C  CA    . THR E  3 183  ? 79.881  10.872  37.539  1.00 54.25 ? 208  THR A CA    1 
ATOM   1989  C  C     . THR E  3 183  ? 81.067  11.775  37.279  1.00 53.99 ? 208  THR A C     1 
ATOM   1990  O  O     . THR E  3 183  ? 80.938  12.983  37.074  1.00 53.85 ? 208  THR A O     1 
ATOM   1991  C  CB    . THR E  3 183  ? 80.083  9.608   36.665  1.00 54.43 ? 208  THR A CB    1 
ATOM   1992  O  OG1   . THR E  3 183  ? 78.859  9.241   36.025  1.00 55.54 ? 208  THR A OG1   1 
ATOM   1993  C  CG2   . THR E  3 183  ? 80.613  8.442   37.509  1.00 53.68 ? 208  THR A CG2   1 
ATOM   1994  N  N     . THR E  3 184  ? 82.222  11.133  37.236  1.00 53.69 ? 209  THR A N     1 
ATOM   1995  C  CA    . THR E  3 184  ? 83.505  11.768  37.294  1.00 53.31 ? 209  THR A CA    1 
ATOM   1996  C  C     . THR E  3 184  ? 84.345  11.043  36.251  1.00 53.03 ? 209  THR A C     1 
ATOM   1997  O  O     . THR E  3 184  ? 84.157  9.847   36.028  1.00 52.79 ? 209  THR A O     1 
ATOM   1998  C  CB    . THR E  3 184  ? 84.024  11.627  38.750  1.00 53.57 ? 209  THR A CB    1 
ATOM   1999  O  OG1   . THR E  3 184  ? 83.889  12.883  39.425  1.00 53.16 ? 209  THR A OG1   1 
ATOM   2000  C  CG2   . THR E  3 184  ? 85.465  11.130  38.840  1.00 54.11 ? 209  THR A CG2   1 
ATOM   2001  N  N     . THR E  3 185  ? 85.237  11.758  35.578  1.00 53.01 ? 210  THR A N     1 
ATOM   2002  C  CA    . THR E  3 185  ? 86.006  11.140  34.505  1.00 53.47 ? 210  THR A CA    1 
ATOM   2003  C  C     . THR E  3 185  ? 87.134  10.292  35.067  1.00 53.11 ? 210  THR A C     1 
ATOM   2004  O  O     . THR E  3 185  ? 87.560  10.493  36.204  1.00 52.92 ? 210  THR A O     1 
ATOM   2005  C  CB    . THR E  3 185  ? 86.606  12.184  33.550  1.00 54.17 ? 210  THR A CB    1 
ATOM   2006  O  OG1   . THR E  3 185  ? 85.893  13.420  33.672  1.00 55.51 ? 210  THR A OG1   1 
ATOM   2007  C  CG2   . THR E  3 185  ? 86.541  11.682  32.099  1.00 54.84 ? 210  THR A CG2   1 
ATOM   2008  N  N     . GLY E  3 186  ? 87.600  9.334   34.270  1.00 52.87 ? 211  GLY A N     1 
ATOM   2009  C  CA    . GLY E  3 186  ? 88.828  8.601   34.576  1.00 52.36 ? 211  GLY A CA    1 
ATOM   2010  C  C     . GLY E  3 186  ? 88.696  7.477   35.582  1.00 51.93 ? 211  GLY A C     1 
ATOM   2011  O  O     . GLY E  3 186  ? 89.595  7.254   36.395  1.00 52.26 ? 211  GLY A O     1 
ATOM   2012  N  N     . GLY E  3 187  ? 87.568  6.776   35.536  1.00 51.38 ? 212  GLY A N     1 
ATOM   2013  C  CA    . GLY E  3 187  ? 87.407  5.536   36.283  1.00 50.96 ? 212  GLY A CA    1 
ATOM   2014  C  C     . GLY E  3 187  ? 87.131  5.663   37.766  1.00 50.77 ? 212  GLY A C     1 
ATOM   2015  O  O     . GLY E  3 187  ? 86.652  6.693   38.244  1.00 51.12 ? 212  GLY A O     1 
ATOM   2016  N  N     . ASN E  3 188  ? 87.451  4.596   38.489  1.00 50.40 ? 213  ASN A N     1 
ATOM   2017  C  CA    . ASN E  3 188  ? 87.070  4.448   39.887  1.00 50.51 ? 213  ASN A CA    1 
ATOM   2018  C  C     . ASN E  3 188  ? 88.217  4.560   40.879  1.00 50.24 ? 213  ASN A C     1 
ATOM   2019  O  O     . ASN E  3 188  ? 87.986  4.706   42.083  1.00 50.33 ? 213  ASN A O     1 
ATOM   2020  C  CB    . ASN E  3 188  ? 86.369  3.107   40.083  1.00 51.16 ? 213  ASN A CB    1 
ATOM   2021  C  CG    . ASN E  3 188  ? 84.999  3.069   39.440  1.00 52.49 ? 213  ASN A CG    1 
ATOM   2022  O  OD1   . ASN E  3 188  ? 84.094  3.803   39.834  1.00 53.81 ? 213  ASN A OD1   1 
ATOM   2023  N  ND2   . ASN E  3 188  ? 84.836  2.206   38.447  1.00 52.65 ? 213  ASN A ND2   1 
ATOM   2024  N  N     . ALA E  3 189  ? 89.447  4.486   40.376  1.00 49.94 ? 214  ALA A N     1 
ATOM   2025  C  CA    . ALA E  3 189  ? 90.633  4.502   41.231  1.00 49.40 ? 214  ALA A CA    1 
ATOM   2026  C  C     . ALA E  3 189  ? 90.662  5.717   42.152  1.00 49.05 ? 214  ALA A C     1 
ATOM   2027  O  O     . ALA E  3 189  ? 90.815  5.571   43.364  1.00 49.33 ? 214  ALA A O     1 
ATOM   2028  C  CB    . ALA E  3 189  ? 91.899  4.429   40.396  1.00 49.21 ? 214  ALA A CB    1 
ATOM   2029  N  N     . LEU E  3 190  ? 90.476  6.903   41.579  1.00 48.35 ? 215  LEU A N     1 
ATOM   2030  C  CA    . LEU E  3 190  ? 90.583  8.139   42.336  1.00 47.97 ? 215  LEU A CA    1 
ATOM   2031  C  C     . LEU E  3 190  ? 89.617  8.238   43.528  1.00 48.65 ? 215  LEU A C     1 
ATOM   2032  O  O     . LEU E  3 190  ? 90.010  8.729   44.589  1.00 49.04 ? 215  LEU A O     1 
ATOM   2033  C  CB    . LEU E  3 190  ? 90.447  9.350   41.411  1.00 47.42 ? 215  LEU A CB    1 
ATOM   2034  C  CG    . LEU E  3 190  ? 90.723  10.743  41.990  1.00 47.38 ? 215  LEU A CG    1 
ATOM   2035  C  CD1   . LEU E  3 190  ? 92.109  10.835  42.608  1.00 47.62 ? 215  LEU A CD1   1 
ATOM   2036  C  CD2   . LEU E  3 190  ? 90.570  11.786  40.915  1.00 47.71 ? 215  LEU A CD2   1 
ATOM   2037  N  N     . LYS E  3 191  ? 88.376  7.768   43.367  1.00 48.93 ? 216  LYS A N     1 
ATOM   2038  C  CA    . LYS E  3 191  ? 87.401  7.787   44.467  1.00 49.81 ? 216  LYS A CA    1 
ATOM   2039  C  C     . LYS E  3 191  ? 88.031  7.193   45.718  1.00 48.83 ? 216  LYS A C     1 
ATOM   2040  O  O     . LYS E  3 191  ? 87.864  7.713   46.825  1.00 49.33 ? 216  LYS A O     1 
ATOM   2041  C  CB    . LYS E  3 191  ? 86.164  6.929   44.172  1.00 50.29 ? 216  LYS A CB    1 
ATOM   2042  C  CG    . LYS E  3 191  ? 85.327  7.235   42.952  1.00 52.40 ? 216  LYS A CG    1 
ATOM   2043  C  CD    . LYS E  3 191  ? 84.067  6.337   42.994  1.00 52.86 ? 216  LYS A CD    1 
ATOM   2044  C  CE    . LYS E  3 191  ? 83.456  6.061   41.604  1.00 56.34 ? 216  LYS A CE    1 
ATOM   2045  N  NZ    . LYS E  3 191  ? 83.264  7.255   40.704  1.00 56.68 ? 216  LYS A NZ    1 
ATOM   2046  N  N     . PHE E  3 192  ? 88.739  6.082   45.522  1.00 47.44 ? 217  PHE A N     1 
ATOM   2047  C  CA    . PHE E  3 192  ? 89.288  5.294   46.615  1.00 46.33 ? 217  PHE A CA    1 
ATOM   2048  C  C     . PHE E  3 192  ? 90.511  5.938   47.233  1.00 45.92 ? 217  PHE A C     1 
ATOM   2049  O  O     . PHE E  3 192  ? 90.615  6.032   48.455  1.00 46.08 ? 217  PHE A O     1 
ATOM   2050  C  CB    . PHE E  3 192  ? 89.636  3.887   46.132  1.00 45.71 ? 217  PHE A CB    1 
ATOM   2051  C  CG    . PHE E  3 192  ? 88.444  2.995   45.968  1.00 45.34 ? 217  PHE A CG    1 
ATOM   2052  C  CD1   . PHE E  3 192  ? 87.827  2.854   44.727  1.00 45.06 ? 217  PHE A CD1   1 
ATOM   2053  C  CD2   . PHE E  3 192  ? 87.933  2.292   47.056  1.00 44.65 ? 217  PHE A CD2   1 
ATOM   2054  C  CE1   . PHE E  3 192  ? 86.717  2.025   44.570  1.00 44.58 ? 217  PHE A CE1   1 
ATOM   2055  C  CE2   . PHE E  3 192  ? 86.824  1.460   46.912  1.00 44.38 ? 217  PHE A CE2   1 
ATOM   2056  C  CZ    . PHE E  3 192  ? 86.215  1.325   45.667  1.00 44.79 ? 217  PHE A CZ    1 
ATOM   2057  N  N     . TYR E  3 193  ? 91.431  6.380   46.383  1.00 45.61 ? 218  TYR A N     1 
ATOM   2058  C  CA    . TYR E  3 193  ? 92.710  6.909   46.837  1.00 45.41 ? 218  TYR A CA    1 
ATOM   2059  C  C     . TYR E  3 193  ? 92.608  8.298   47.446  1.00 45.18 ? 218  TYR A C     1 
ATOM   2060  O  O     . TYR E  3 193  ? 93.406  8.643   48.314  1.00 45.06 ? 218  TYR A O     1 
ATOM   2061  C  CB    . TYR E  3 193  ? 93.731  6.903   45.702  1.00 46.00 ? 218  TYR A CB    1 
ATOM   2062  C  CG    . TYR E  3 193  ? 94.300  5.537   45.416  1.00 46.46 ? 218  TYR A CG    1 
ATOM   2063  C  CD1   . TYR E  3 193  ? 95.493  5.128   46.001  1.00 46.99 ? 218  TYR A CD1   1 
ATOM   2064  C  CD2   . TYR E  3 193  ? 93.645  4.650   44.563  1.00 46.73 ? 218  TYR A CD2   1 
ATOM   2065  C  CE1   . TYR E  3 193  ? 96.025  3.868   45.742  1.00 47.44 ? 218  TYR A CE1   1 
ATOM   2066  C  CE2   . TYR E  3 193  ? 94.167  3.390   44.295  1.00 46.87 ? 218  TYR A CE2   1 
ATOM   2067  C  CZ    . TYR E  3 193  ? 95.356  3.005   44.888  1.00 47.05 ? 218  TYR A CZ    1 
ATOM   2068  O  OH    . TYR E  3 193  ? 95.878  1.757   44.628  1.00 46.89 ? 218  TYR A OH    1 
ATOM   2069  N  N     . ALA E  3 194  ? 91.638  9.091   46.995  1.00 45.12 ? 219  ALA A N     1 
ATOM   2070  C  CA    . ALA E  3 194  ? 91.421  10.423  47.560  1.00 45.27 ? 219  ALA A CA    1 
ATOM   2071  C  C     . ALA E  3 194  ? 91.143  10.337  49.057  1.00 45.36 ? 219  ALA A C     1 
ATOM   2072  O  O     . ALA E  3 194  ? 90.371  9.484   49.500  1.00 45.74 ? 219  ALA A O     1 
ATOM   2073  C  CB    . ALA E  3 194  ? 90.288  11.126  46.855  1.00 45.33 ? 219  ALA A CB    1 
ATOM   2074  N  N     . SER E  3 195  ? 91.799  11.197  49.831  1.00 45.32 ? 220  SER A N     1 
ATOM   2075  C  CA    . SER E  3 195  ? 91.568  11.265  51.273  1.00 45.32 ? 220  SER A CA    1 
ATOM   2076  C  C     . SER E  3 195  ? 90.459  12.271  51.545  1.00 45.22 ? 220  SER A C     1 
ATOM   2077  O  O     . SER E  3 195  ? 89.799  12.223  52.591  1.00 45.39 ? 220  SER A O     1 
ATOM   2078  C  CB    . SER E  3 195  ? 92.841  11.661  52.026  1.00 45.32 ? 220  SER A CB    1 
ATOM   2079  O  OG    . SER E  3 195  ? 93.923  10.810  51.693  1.00 45.16 ? 220  SER A OG    1 
ATOM   2080  N  N     . VAL E  3 196  ? 90.266  13.177  50.589  1.00 44.48 ? 221  VAL A N     1 
ATOM   2081  C  CA    . VAL E  3 196  ? 89.207  14.171  50.642  1.00 44.40 ? 221  VAL A CA    1 
ATOM   2082  C  C     . VAL E  3 196  ? 88.624  14.356  49.245  1.00 44.72 ? 221  VAL A C     1 
ATOM   2083  O  O     . VAL E  3 196  ? 89.367  14.481  48.270  1.00 45.22 ? 221  VAL A O     1 
ATOM   2084  C  CB    . VAL E  3 196  ? 89.732  15.530  51.162  1.00 44.17 ? 221  VAL A CB    1 
ATOM   2085  C  CG1   . VAL E  3 196  ? 88.688  16.612  50.995  1.00 44.22 ? 221  VAL A CG1   1 
ATOM   2086  C  CG2   . VAL E  3 196  ? 90.142  15.433  52.618  1.00 44.52 ? 221  VAL A CG2   1 
ATOM   2087  N  N     . ARG E  3 197  ? 87.297  14.363  49.147  1.00 44.89 ? 222  ARG A N     1 
ATOM   2088  C  CA    . ARG E  3 197  ? 86.631  14.697  47.889  1.00 44.90 ? 222  ARG A CA    1 
ATOM   2089  C  C     . ARG E  3 197  ? 85.669  15.863  48.072  1.00 44.97 ? 222  ARG A C     1 
ATOM   2090  O  O     . ARG E  3 197  ? 84.821  15.853  48.961  1.00 44.93 ? 222  ARG A O     1 
ATOM   2091  C  CB    . ARG E  3 197  ? 85.916  13.488  47.287  1.00 44.63 ? 222  ARG A CB    1 
ATOM   2092  C  CG    . ARG E  3 197  ? 86.792  12.243  47.172  1.00 45.26 ? 222  ARG A CG    1 
ATOM   2093  C  CD    . ARG E  3 197  ? 86.584  11.519  45.849  1.00 46.35 ? 222  ARG A CD    1 
ATOM   2094  N  NE    . ARG E  3 197  ? 85.234  10.980  45.699  1.00 47.67 ? 222  ARG A NE    1 
ATOM   2095  C  CZ    . ARG E  3 197  ? 84.561  10.930  44.553  1.00 47.28 ? 222  ARG A CZ    1 
ATOM   2096  N  NH1   . ARG E  3 197  ? 85.091  11.399  43.432  1.00 46.88 ? 222  ARG A NH1   1 
ATOM   2097  N  NH2   . ARG E  3 197  ? 83.339  10.419  44.536  1.00 47.53 ? 222  ARG A NH2   1 
ATOM   2098  N  N     . LEU E  3 198  ? 85.823  16.873  47.226  1.00 45.44 ? 223  LEU A N     1 
ATOM   2099  C  CA    . LEU E  3 198  ? 85.023  18.084  47.305  1.00 45.75 ? 223  LEU A CA    1 
ATOM   2100  C  C     . LEU E  3 198  ? 84.091  18.211  46.108  1.00 46.30 ? 223  LEU A C     1 
ATOM   2101  O  O     . LEU E  3 198  ? 84.518  18.092  44.957  1.00 46.31 ? 223  LEU A O     1 
ATOM   2102  C  CB    . LEU E  3 198  ? 85.939  19.304  47.369  1.00 45.50 ? 223  LEU A CB    1 
ATOM   2103  C  CG    . LEU E  3 198  ? 86.441  19.846  48.710  1.00 45.69 ? 223  LEU A CG    1 
ATOM   2104  C  CD1   . LEU E  3 198  ? 86.238  18.892  49.882  1.00 46.12 ? 223  LEU A CD1   1 
ATOM   2105  C  CD2   . LEU E  3 198  ? 87.898  20.240  48.582  1.00 45.38 ? 223  LEU A CD2   1 
ATOM   2106  N  N     . ASP E  3 199  ? 82.815  18.451  46.396  1.00 46.55 ? 224  ASP A N     1 
ATOM   2107  C  CA    . ASP E  3 199  ? 81.816  18.749  45.378  1.00 46.20 ? 224  ASP A CA    1 
ATOM   2108  C  C     . ASP E  3 199  ? 81.517  20.248  45.443  1.00 45.84 ? 224  ASP A C     1 
ATOM   2109  O  O     . ASP E  3 199  ? 80.831  20.712  46.362  1.00 45.21 ? 224  ASP A O     1 
ATOM   2110  C  CB    . ASP E  3 199  ? 80.551  17.924  45.641  1.00 46.43 ? 224  ASP A CB    1 
ATOM   2111  C  CG    . ASP E  3 199  ? 79.430  18.199  44.640  1.00 47.85 ? 224  ASP A CG    1 
ATOM   2112  O  OD1   . ASP E  3 199  ? 79.371  19.306  44.053  1.00 48.80 ? 224  ASP A OD1   1 
ATOM   2113  O  OD2   . ASP E  3 199  ? 78.584  17.294  44.455  1.00 47.96 ? 224  ASP A OD2   1 
ATOM   2114  N  N     . ILE E  3 200  ? 82.047  20.998  44.478  1.00 45.32 ? 225  ILE A N     1 
ATOM   2115  C  CA    . ILE E  3 200  ? 81.846  22.450  44.422  1.00 44.73 ? 225  ILE A CA    1 
ATOM   2116  C  C     . ILE E  3 200  ? 80.754  22.821  43.413  1.00 44.78 ? 225  ILE A C     1 
ATOM   2117  O  O     . ILE E  3 200  ? 80.676  22.235  42.328  1.00 44.66 ? 225  ILE A O     1 
ATOM   2118  C  CB    . ILE E  3 200  ? 83.171  23.207  44.120  1.00 44.63 ? 225  ILE A CB    1 
ATOM   2119  C  CG1   . ILE E  3 200  ? 82.950  24.724  44.134  1.00 44.55 ? 225  ILE A CG1   1 
ATOM   2120  C  CG2   . ILE E  3 200  ? 83.779  22.755  42.791  1.00 44.80 ? 225  ILE A CG2   1 
ATOM   2121  C  CD1   . ILE E  3 200  ? 84.221  25.544  44.285  1.00 44.60 ? 225  ILE A CD1   1 
ATOM   2122  N  N     . ARG E  3 201  ? 79.914  23.789  43.782  1.00 44.49 ? 226  ARG A N     1 
ATOM   2123  C  CA    . ARG E  3 201  ? 78.807  24.225  42.929  1.00 44.27 ? 226  ARG A CA    1 
ATOM   2124  C  C     . ARG E  3 201  ? 78.492  25.704  43.050  1.00 44.15 ? 226  ARG A C     1 
ATOM   2125  O  O     . ARG E  3 201  ? 78.528  26.263  44.140  1.00 44.00 ? 226  ARG A O     1 
ATOM   2126  C  CB    . ARG E  3 201  ? 77.556  23.405  43.228  1.00 43.90 ? 226  ARG A CB    1 
ATOM   2127  C  CG    . ARG E  3 201  ? 77.498  22.162  42.396  1.00 44.57 ? 226  ARG A CG    1 
ATOM   2128  C  CD    . ARG E  3 201  ? 76.615  21.089  42.975  1.00 45.16 ? 226  ARG A CD    1 
ATOM   2129  N  NE    . ARG E  3 201  ? 77.110  19.767  42.593  1.00 45.27 ? 226  ARG A NE    1 
ATOM   2130  C  CZ    . ARG E  3 201  ? 76.932  19.196  41.401  1.00 44.68 ? 226  ARG A CZ    1 
ATOM   2131  N  NH1   . ARG E  3 201  ? 76.257  19.814  40.439  1.00 43.74 ? 226  ARG A NH1   1 
ATOM   2132  N  NH2   . ARG E  3 201  ? 77.433  17.992  41.173  1.00 44.30 ? 226  ARG A NH2   1 
ATOM   2133  N  N     . ARG E  3 202  ? 78.188  26.334  41.920  1.00 44.67 ? 227  ARG A N     1 
ATOM   2134  C  CA    . ARG E  3 202  ? 77.708  27.709  41.918  1.00 45.32 ? 227  ARG A CA    1 
ATOM   2135  C  C     . ARG E  3 202  ? 76.232  27.673  42.243  1.00 44.99 ? 227  ARG A C     1 
ATOM   2136  O  O     . ARG E  3 202  ? 75.476  26.969  41.586  1.00 45.67 ? 227  ARG A O     1 
ATOM   2137  C  CB    . ARG E  3 202  ? 77.922  28.359  40.552  1.00 46.06 ? 227  ARG A CB    1 
ATOM   2138  C  CG    . ARG E  3 202  ? 77.469  29.804  40.483  1.00 47.56 ? 227  ARG A CG    1 
ATOM   2139  C  CD    . ARG E  3 202  ? 77.327  30.263  39.049  1.00 49.54 ? 227  ARG A CD    1 
ATOM   2140  N  NE    . ARG E  3 202  ? 77.475  31.712  38.946  1.00 50.85 ? 227  ARG A NE    1 
ATOM   2141  C  CZ    . ARG E  3 202  ? 76.464  32.569  38.827  1.00 50.63 ? 227  ARG A CZ    1 
ATOM   2142  N  NH1   . ARG E  3 202  ? 75.212  32.132  38.787  1.00 49.27 ? 227  ARG A NH1   1 
ATOM   2143  N  NH2   . ARG E  3 202  ? 76.713  33.870  38.746  1.00 51.34 ? 227  ARG A NH2   1 
ATOM   2144  N  N     . ILE E  3 203  ? 75.817  28.427  43.252  1.00 44.99 ? 228  ILE A N     1 
ATOM   2145  C  CA    . ILE E  3 203  ? 74.425  28.366  43.707  1.00 45.51 ? 228  ILE A CA    1 
ATOM   2146  C  C     . ILE E  3 203  ? 73.660  29.662  43.476  1.00 45.79 ? 228  ILE A C     1 
ATOM   2147  O  O     . ILE E  3 203  ? 72.436  29.697  43.605  1.00 45.93 ? 228  ILE A O     1 
ATOM   2148  C  CB    . ILE E  3 203  ? 74.314  27.941  45.192  1.00 45.32 ? 228  ILE A CB    1 
ATOM   2149  C  CG1   . ILE E  3 203  ? 75.006  28.967  46.099  1.00 45.44 ? 228  ILE A CG1   1 
ATOM   2150  C  CG2   . ILE E  3 203  ? 74.886  26.536  45.381  1.00 45.19 ? 228  ILE A CG2   1 
ATOM   2151  C  CD1   . ILE E  3 203  ? 74.756  28.774  47.584  1.00 45.71 ? 228  ILE A CD1   1 
ATOM   2152  N  N     . GLY E  3 204  ? 74.385  30.721  43.133  1.00 46.15 ? 229  GLY A N     1 
ATOM   2153  C  CA    . GLY E  3 204  ? 73.775  32.016  42.876  1.00 47.08 ? 229  GLY A CA    1 
ATOM   2154  C  C     . GLY E  3 204  ? 74.782  33.048  42.421  1.00 47.92 ? 229  GLY A C     1 
ATOM   2155  O  O     . GLY E  3 204  ? 75.981  32.769  42.345  1.00 47.82 ? 229  GLY A O     1 
ATOM   2156  N  N     . ALA E  3 205  ? 74.285  34.244  42.120  1.00 48.95 ? 230  ALA A N     1 
ATOM   2157  C  CA    . ALA E  3 205  ? 75.123  35.351  41.669  1.00 49.90 ? 230  ALA A CA    1 
ATOM   2158  C  C     . ALA E  3 205  ? 75.290  36.393  42.768  1.00 50.27 ? 230  ALA A C     1 
ATOM   2159  O  O     . ALA E  3 205  ? 74.333  36.704  43.481  1.00 50.02 ? 230  ALA A O     1 
ATOM   2160  C  CB    . ALA E  3 205  ? 74.521  35.991  40.422  1.00 50.00 ? 230  ALA A CB    1 
ATOM   2161  N  N     . VAL E  3 206  ? 76.506  36.918  42.907  1.00 50.88 ? 231  VAL A N     1 
ATOM   2162  C  CA    . VAL E  3 206  ? 76.758  38.063  43.781  1.00 51.79 ? 231  VAL A CA    1 
ATOM   2163  C  C     . VAL E  3 206  ? 76.564  39.321  42.945  1.00 53.05 ? 231  VAL A C     1 
ATOM   2164  O  O     . VAL E  3 206  ? 77.345  39.593  42.029  1.00 53.38 ? 231  VAL A O     1 
ATOM   2165  C  CB    . VAL E  3 206  ? 78.181  38.038  44.388  1.00 51.30 ? 231  VAL A CB    1 
ATOM   2166  C  CG1   . VAL E  3 206  ? 78.443  39.292  45.193  1.00 50.76 ? 231  VAL A CG1   1 
ATOM   2167  C  CG2   . VAL E  3 206  ? 78.372  36.810  45.257  1.00 51.10 ? 231  VAL A CG2   1 
ATOM   2168  N  N     . LYS E  3 207  ? 75.514  40.074  43.250  1.00 54.50 ? 232  LYS A N     1 
ATOM   2169  C  CA    . LYS E  3 207  ? 75.142  41.215  42.425  1.00 56.64 ? 232  LYS A CA    1 
ATOM   2170  C  C     . LYS E  3 207  ? 75.473  42.572  43.035  1.00 58.03 ? 232  LYS A C     1 
ATOM   2171  O  O     . LYS E  3 207  ? 75.484  42.745  44.253  1.00 58.12 ? 232  LYS A O     1 
ATOM   2172  C  CB    . LYS E  3 207  ? 73.666  41.149  42.029  1.00 56.82 ? 232  LYS A CB    1 
ATOM   2173  C  CG    . LYS E  3 207  ? 73.393  40.325  40.773  1.00 57.48 ? 232  LYS A CG    1 
ATOM   2174  C  CD    . LYS E  3 207  ? 71.969  40.530  40.247  1.00 57.68 ? 232  LYS A CD    1 
ATOM   2175  C  CE    . LYS E  3 207  ? 70.954  39.658  40.987  1.00 58.64 ? 232  LYS A CE    1 
ATOM   2176  N  NZ    . LYS E  3 207  ? 69.559  40.152  40.823  1.00 59.17 ? 232  LYS A NZ    1 
ATOM   2177  N  N     . GLU E  3 208  ? 75.752  43.522  42.148  1.00 59.82 ? 233  GLU A N     1 
ATOM   2178  C  CA    . GLU E  3 208  ? 76.015  44.915  42.483  1.00 60.94 ? 233  GLU A CA    1 
ATOM   2179  C  C     . GLU E  3 208  ? 74.919  45.756  41.853  1.00 61.18 ? 233  GLU A C     1 
ATOM   2180  O  O     . GLU E  3 208  ? 75.186  46.588  40.980  1.00 60.90 ? 233  GLU A O     1 
ATOM   2181  C  CB    . GLU E  3 208  ? 77.364  45.327  41.903  1.00 61.68 ? 233  GLU A CB    1 
ATOM   2182  C  CG    . GLU E  3 208  ? 78.489  45.351  42.902  1.00 63.99 ? 233  GLU A CG    1 
ATOM   2183  C  CD    . GLU E  3 208  ? 78.600  46.685  43.611  1.00 66.29 ? 233  GLU A CD    1 
ATOM   2184  O  OE1   . GLU E  3 208  ? 77.961  47.663  43.160  1.00 67.33 ? 233  GLU A OE1   1 
ATOM   2185  O  OE2   . GLU E  3 208  ? 79.335  46.756  44.621  1.00 67.36 ? 233  GLU A OE2   1 
ATOM   2186  N  N     . GLY E  3 209  ? 73.683  45.521  42.291  1.00 61.74 ? 234  GLY A N     1 
ATOM   2187  C  CA    . GLY E  3 209  ? 72.508  46.088  41.637  1.00 62.50 ? 234  GLY A CA    1 
ATOM   2188  C  C     . GLY E  3 209  ? 72.432  45.576  40.208  1.00 63.29 ? 234  GLY A C     1 
ATOM   2189  O  O     . GLY E  3 209  ? 71.792  44.554  39.932  1.00 63.71 ? 234  GLY A O     1 
ATOM   2190  N  N     . GLU E  3 210  ? 73.113  46.283  39.306  1.00 63.20 ? 235  GLU A N     1 
ATOM   2191  C  CA    . GLU E  3 210  ? 73.191  45.894  37.901  1.00 63.00 ? 235  GLU A CA    1 
ATOM   2192  C  C     . GLU E  3 210  ? 74.139  44.719  37.683  1.00 62.29 ? 235  GLU A C     1 
ATOM   2193  O  O     . GLU E  3 210  ? 73.741  43.685  37.143  1.00 62.82 ? 235  GLU A O     1 
ATOM   2194  C  CB    . GLU E  3 210  ? 73.629  47.083  37.035  1.00 63.31 ? 235  GLU A CB    1 
ATOM   2195  C  CG    . GLU E  3 210  ? 72.580  48.183  36.879  1.00 64.56 ? 235  GLU A CG    1 
ATOM   2196  C  CD    . GLU E  3 210  ? 71.473  47.825  35.888  1.00 65.62 ? 235  GLU A CD    1 
ATOM   2197  O  OE1   . GLU E  3 210  ? 70.866  46.737  36.014  1.00 65.52 ? 235  GLU A OE1   1 
ATOM   2198  O  OE2   . GLU E  3 210  ? 71.201  48.643  34.984  1.00 66.30 ? 235  GLU A OE2   1 
ATOM   2199  N  N     . ASN E  3 211  ? 75.383  44.881  38.129  1.00 60.85 ? 236  ASN A N     1 
ATOM   2200  C  CA    . ASN E  3 211  ? 76.476  43.982  37.762  1.00 59.64 ? 236  ASN A CA    1 
ATOM   2201  C  C     . ASN E  3 211  ? 76.498  42.646  38.479  1.00 58.41 ? 236  ASN A C     1 
ATOM   2202  O  O     . ASN E  3 211  ? 76.100  42.544  39.637  1.00 58.49 ? 236  ASN A O     1 
ATOM   2203  C  CB    . ASN E  3 211  ? 77.812  44.679  37.987  1.00 59.98 ? 236  ASN A CB    1 
ATOM   2204  C  CG    . ASN E  3 211  ? 77.847  46.057  37.380  1.00 60.82 ? 236  ASN A CG    1 
ATOM   2205  O  OD1   . ASN E  3 211  ? 77.620  47.051  38.067  1.00 61.23 ? 236  ASN A OD1   1 
ATOM   2206  N  ND2   . ASN E  3 211  ? 78.108  46.127  36.079  1.00 61.57 ? 236  ASN A ND2   1 
ATOM   2207  N  N     . VAL E  3 212  ? 76.970  41.623  37.773  1.00 56.73 ? 237  VAL A N     1 
ATOM   2208  C  CA    . VAL E  3 212  ? 77.266  40.343  38.391  1.00 55.05 ? 237  VAL A CA    1 
ATOM   2209  C  C     . VAL E  3 212  ? 78.759  40.345  38.681  1.00 54.00 ? 237  VAL A C     1 
ATOM   2210  O  O     . VAL E  3 212  ? 79.584  40.207  37.775  1.00 53.91 ? 237  VAL A O     1 
ATOM   2211  C  CB    . VAL E  3 212  ? 76.854  39.157  37.496  1.00 54.72 ? 237  VAL A CB    1 
ATOM   2212  C  CG1   . VAL E  3 212  ? 77.271  37.832  38.128  1.00 54.19 ? 237  VAL A CG1   1 
ATOM   2213  C  CG2   . VAL E  3 212  ? 75.353  39.177  37.256  1.00 54.39 ? 237  VAL A CG2   1 
ATOM   2214  N  N     . VAL E  3 213  ? 79.095  40.525  39.952  1.00 52.61 ? 238  VAL A N     1 
ATOM   2215  C  CA    . VAL E  3 213  ? 80.475  40.746  40.353  1.00 52.22 ? 238  VAL A CA    1 
ATOM   2216  C  C     . VAL E  3 213  ? 81.117  39.509  41.009  1.00 51.63 ? 238  VAL A C     1 
ATOM   2217  O  O     . VAL E  3 213  ? 82.317  39.502  41.314  1.00 51.47 ? 238  VAL A O     1 
ATOM   2218  C  CB    . VAL E  3 213  ? 80.583  42.016  41.247  1.00 52.48 ? 238  VAL A CB    1 
ATOM   2219  C  CG1   . VAL E  3 213  ? 80.055  41.746  42.661  1.00 52.66 ? 238  VAL A CG1   1 
ATOM   2220  C  CG2   . VAL E  3 213  ? 82.016  42.562  41.267  1.00 52.61 ? 238  VAL A CG2   1 
ATOM   2221  N  N     . GLY E  3 214  ? 80.319  38.462  41.205  1.00 50.94 ? 239  GLY A N     1 
ATOM   2222  C  CA    . GLY E  3 214  ? 80.817  37.216  41.790  1.00 50.70 ? 239  GLY A CA    1 
ATOM   2223  C  C     . GLY E  3 214  ? 79.860  36.033  41.747  1.00 50.58 ? 239  GLY A C     1 
ATOM   2224  O  O     . GLY E  3 214  ? 78.685  36.172  41.387  1.00 50.66 ? 239  GLY A O     1 
ATOM   2225  N  N     . SER E  3 215  ? 80.378  34.862  42.113  1.00 50.04 ? 240  SER A N     1 
ATOM   2226  C  CA    . SER E  3 215  ? 79.587  33.640  42.210  1.00 49.67 ? 240  SER A CA    1 
ATOM   2227  C  C     . SER E  3 215  ? 79.388  33.250  43.663  1.00 49.75 ? 240  SER A C     1 
ATOM   2228  O  O     . SER E  3 215  ? 80.355  33.107  44.410  1.00 49.92 ? 240  SER A O     1 
ATOM   2229  C  CB    . SER E  3 215  ? 80.276  32.483  41.483  1.00 49.66 ? 240  SER A CB    1 
ATOM   2230  O  OG    . SER E  3 215  ? 80.115  32.575  40.081  1.00 49.76 ? 240  SER A OG    1 
ATOM   2231  N  N     . GLU E  3 216  ? 78.132  33.083  44.060  1.00 49.79 ? 241  GLU A N     1 
ATOM   2232  C  CA    . GLU E  3 216  ? 77.808  32.511  45.357  1.00 49.93 ? 241  GLU A CA    1 
ATOM   2233  C  C     . GLU E  3 216  ? 78.075  31.007  45.267  1.00 49.30 ? 241  GLU A C     1 
ATOM   2234  O  O     . GLU E  3 216  ? 77.565  30.336  44.366  1.00 49.28 ? 241  GLU A O     1 
ATOM   2235  C  CB    . GLU E  3 216  ? 76.349  32.795  45.705  1.00 50.75 ? 241  GLU A CB    1 
ATOM   2236  C  CG    . GLU E  3 216  ? 76.051  32.788  47.191  1.00 53.72 ? 241  GLU A CG    1 
ATOM   2237  C  CD    . GLU E  3 216  ? 76.637  33.987  47.918  1.00 56.44 ? 241  GLU A CD    1 
ATOM   2238  O  OE1   . GLU E  3 216  ? 76.416  35.133  47.472  1.00 57.97 ? 241  GLU A OE1   1 
ATOM   2239  O  OE2   . GLU E  3 216  ? 77.310  33.780  48.949  1.00 58.34 ? 241  GLU A OE2   1 
ATOM   2240  N  N     . THR E  3 217  ? 78.879  30.483  46.189  1.00 48.61 ? 242  THR A N     1 
ATOM   2241  C  CA    . THR E  3 217  ? 79.439  29.137  46.035  1.00 48.26 ? 242  THR A CA    1 
ATOM   2242  C  C     . THR E  3 217  ? 79.181  28.214  47.224  1.00 47.82 ? 242  THR A C     1 
ATOM   2243  O  O     . THR E  3 217  ? 79.186  28.656  48.368  1.00 48.33 ? 242  THR A O     1 
ATOM   2244  C  CB    . THR E  3 217  ? 80.955  29.224  45.753  1.00 48.39 ? 242  THR A CB    1 
ATOM   2245  O  OG1   . THR E  3 217  ? 81.163  29.891  44.500  1.00 49.83 ? 242  THR A OG1   1 
ATOM   2246  C  CG2   . THR E  3 217  ? 81.593  27.846  45.690  1.00 48.17 ? 242  THR A CG2   1 
ATOM   2247  N  N     . ARG E  3 218  ? 78.958  26.932  46.937  1.00 47.18 ? 243  ARG A N     1 
ATOM   2248  C  CA    . ARG E  3 218  ? 78.790  25.912  47.970  1.00 46.59 ? 243  ARG A CA    1 
ATOM   2249  C  C     . ARG E  3 218  ? 79.687  24.702  47.700  1.00 46.01 ? 243  ARG A C     1 
ATOM   2250  O  O     . ARG E  3 218  ? 79.679  24.143  46.602  1.00 46.20 ? 243  ARG A O     1 
ATOM   2251  C  CB    . ARG E  3 218  ? 77.331  25.462  48.052  1.00 46.65 ? 243  ARG A CB    1 
ATOM   2252  C  CG    . ARG E  3 218  ? 76.998  24.638  49.293  1.00 47.00 ? 243  ARG A CG    1 
ATOM   2253  C  CD    . ARG E  3 218  ? 75.828  23.687  49.042  1.00 48.27 ? 243  ARG A CD    1 
ATOM   2254  N  NE    . ARG E  3 218  ? 74.726  24.321  48.311  1.00 48.74 ? 243  ARG A NE    1 
ATOM   2255  C  CZ    . ARG E  3 218  ? 73.729  24.996  48.880  1.00 48.06 ? 243  ARG A CZ    1 
ATOM   2256  N  NH1   . ARG E  3 218  ? 73.680  25.127  50.194  1.00 48.18 ? 243  ARG A NH1   1 
ATOM   2257  N  NH2   . ARG E  3 218  ? 72.778  25.541  48.135  1.00 47.60 ? 243  ARG A NH2   1 
ATOM   2258  N  N     . VAL E  3 219  ? 80.453  24.298  48.706  1.00 45.29 ? 244  VAL A N     1 
ATOM   2259  C  CA    . VAL E  3 219  ? 81.291  23.108  48.598  1.00 44.88 ? 244  VAL A CA    1 
ATOM   2260  C  C     . VAL E  3 219  ? 80.822  22.063  49.601  1.00 45.39 ? 244  VAL A C     1 
ATOM   2261  O  O     . VAL E  3 219  ? 80.688  22.362  50.790  1.00 45.43 ? 244  VAL A O     1 
ATOM   2262  C  CB    . VAL E  3 219  ? 82.780  23.427  48.860  1.00 44.52 ? 244  VAL A CB    1 
ATOM   2263  C  CG1   . VAL E  3 219  ? 83.633  22.181  48.690  1.00 43.94 ? 244  VAL A CG1   1 
ATOM   2264  C  CG2   . VAL E  3 219  ? 83.266  24.517  47.933  1.00 44.23 ? 244  VAL A CG2   1 
ATOM   2265  N  N     . LYS E  3 220  ? 80.563  20.848  49.122  1.00 45.76 ? 245  LYS A N     1 
ATOM   2266  C  CA    . LYS E  3 220  ? 80.242  19.722  50.004  1.00 46.16 ? 245  LYS A CA    1 
ATOM   2267  C  C     . LYS E  3 220  ? 81.462  18.833  50.161  1.00 45.66 ? 245  LYS A C     1 
ATOM   2268  O  O     . LYS E  3 220  ? 82.165  18.550  49.178  1.00 45.21 ? 245  LYS A O     1 
ATOM   2269  C  CB    . LYS E  3 220  ? 79.099  18.880  49.443  1.00 46.74 ? 245  LYS A CB    1 
ATOM   2270  C  CG    . LYS E  3 220  ? 77.710  19.374  49.763  1.00 49.25 ? 245  LYS A CG    1 
ATOM   2271  C  CD    . LYS E  3 220  ? 76.690  18.287  49.425  1.00 53.82 ? 245  LYS A CD    1 
ATOM   2272  C  CE    . LYS E  3 220  ? 75.241  18.784  49.506  1.00 56.40 ? 245  LYS A CE    1 
ATOM   2273  N  NZ    . LYS E  3 220  ? 74.898  19.752  48.415  1.00 58.14 ? 245  LYS A NZ    1 
ATOM   2274  N  N     . VAL E  3 221  ? 81.716  18.399  51.393  1.00 44.99 ? 246  VAL A N     1 
ATOM   2275  C  CA    . VAL E  3 221  ? 82.785  17.442  51.638  1.00 44.37 ? 246  VAL A CA    1 
ATOM   2276  C  C     . VAL E  3 221  ? 82.190  16.055  51.487  1.00 44.09 ? 246  VAL A C     1 
ATOM   2277  O  O     . VAL E  3 221  ? 81.556  15.529  52.397  1.00 44.22 ? 246  VAL A O     1 
ATOM   2278  C  CB    . VAL E  3 221  ? 83.449  17.638  53.006  1.00 44.22 ? 246  VAL A CB    1 
ATOM   2279  C  CG1   . VAL E  3 221  ? 84.591  16.638  53.194  1.00 44.15 ? 246  VAL A CG1   1 
ATOM   2280  C  CG2   . VAL E  3 221  ? 83.964  19.063  53.130  1.00 43.93 ? 246  VAL A CG2   1 
ATOM   2281  N  N     . VAL E  3 222  ? 82.391  15.485  50.308  1.00 44.13 ? 247  VAL A N     1 
ATOM   2282  C  CA    . VAL E  3 222  ? 81.735  14.246  49.914  1.00 44.22 ? 247  VAL A CA    1 
ATOM   2283  C  C     . VAL E  3 222  ? 82.451  13.024  50.478  1.00 43.21 ? 247  VAL A C     1 
ATOM   2284  O  O     . VAL E  3 222  ? 81.811  12.031  50.826  1.00 43.16 ? 247  VAL A O     1 
ATOM   2285  C  CB    . VAL E  3 222  ? 81.598  14.167  48.374  1.00 44.80 ? 247  VAL A CB    1 
ATOM   2286  C  CG1   . VAL E  3 222  ? 81.191  12.768  47.921  1.00 45.37 ? 247  VAL A CG1   1 
ATOM   2287  C  CG2   . VAL E  3 222  ? 80.580  15.187  47.900  1.00 45.43 ? 247  VAL A CG2   1 
ATOM   2288  N  N     . LYS E  3 223  ? 83.775  13.102  50.561  1.00 42.28 ? 248  LYS A N     1 
ATOM   2289  C  CA    . LYS E  3 223  ? 84.563  12.064  51.209  1.00 42.10 ? 248  LYS A CA    1 
ATOM   2290  C  C     . LYS E  3 223  ? 85.601  12.688  52.128  1.00 43.00 ? 248  LYS A C     1 
ATOM   2291  O  O     . LYS E  3 223  ? 86.209  13.705  51.790  1.00 43.36 ? 248  LYS A O     1 
ATOM   2292  C  CB    . LYS E  3 223  ? 85.249  11.164  50.185  1.00 41.45 ? 248  LYS A CB    1 
ATOM   2293  C  CG    . LYS E  3 223  ? 85.995  9.992   50.801  1.00 40.14 ? 248  LYS A CG    1 
ATOM   2294  C  CD    . LYS E  3 223  ? 86.948  9.345   49.817  1.00 39.78 ? 248  LYS A CD    1 
ATOM   2295  C  CE    . LYS E  3 223  ? 87.581  8.105   50.423  1.00 39.01 ? 248  LYS A CE    1 
ATOM   2296  N  NZ    . LYS E  3 223  ? 88.353  7.319   49.423  1.00 38.14 ? 248  LYS A NZ    1 
ATOM   2297  N  N     . ASN E  3 224  ? 85.797  12.071  53.290  1.00 43.76 ? 249  ASN A N     1 
ATOM   2298  C  CA    . ASN E  3 224  ? 86.777  12.543  54.257  1.00 43.75 ? 249  ASN A CA    1 
ATOM   2299  C  C     . ASN E  3 224  ? 87.389  11.411  55.082  1.00 43.77 ? 249  ASN A C     1 
ATOM   2300  O  O     . ASN E  3 224  ? 86.692  10.701  55.808  1.00 43.59 ? 249  ASN A O     1 
ATOM   2301  C  CB    . ASN E  3 224  ? 86.152  13.602  55.168  1.00 43.84 ? 249  ASN A CB    1 
ATOM   2302  C  CG    . ASN E  3 224  ? 87.182  14.517  55.784  1.00 44.13 ? 249  ASN A CG    1 
ATOM   2303  O  OD1   . ASN E  3 224  ? 88.387  14.302  55.649  1.00 44.95 ? 249  ASN A OD1   1 
ATOM   2304  N  ND2   . ASN E  3 224  ? 86.712  15.551  56.468  1.00 43.84 ? 249  ASN A ND2   1 
ATOM   2305  N  N     . LYS E  3 225  ? 88.699  11.249  54.947  1.00 44.19 ? 250  LYS A N     1 
ATOM   2306  C  CA    . LYS E  3 225  ? 89.457  10.242  55.682  1.00 44.89 ? 250  LYS A CA    1 
ATOM   2307  C  C     . LYS E  3 225  ? 90.170  10.874  56.866  1.00 45.20 ? 250  LYS A C     1 
ATOM   2308  O  O     . LYS E  3 225  ? 90.889  10.200  57.606  1.00 45.41 ? 250  LYS A O     1 
ATOM   2309  C  CB    . LYS E  3 225  ? 90.508  9.633   54.765  1.00 45.45 ? 250  LYS A CB    1 
ATOM   2310  C  CG    . LYS E  3 225  ? 90.147  8.304   54.175  1.00 46.65 ? 250  LYS A CG    1 
ATOM   2311  C  CD    . LYS E  3 225  ? 91.217  7.888   53.188  1.00 48.90 ? 250  LYS A CD    1 
ATOM   2312  C  CE    . LYS E  3 225  ? 91.390  6.386   53.186  1.00 49.77 ? 250  LYS A CE    1 
ATOM   2313  N  NZ    . LYS E  3 225  ? 92.075  5.927   51.941  1.00 50.20 ? 250  LYS A NZ    1 
ATOM   2314  N  N     . ILE E  3 226  ? 89.958  12.172  57.040  1.00 45.59 ? 251  ILE A N     1 
ATOM   2315  C  CA    . ILE E  3 226  ? 90.794  12.985  57.906  1.00 45.98 ? 251  ILE A CA    1 
ATOM   2316  C  C     . ILE E  3 226  ? 89.984  13.565  59.068  1.00 45.56 ? 251  ILE A C     1 
ATOM   2317  O  O     . ILE E  3 226  ? 90.527  13.884  60.126  1.00 45.33 ? 251  ILE A O     1 
ATOM   2318  C  CB    . ILE E  3 226  ? 91.546  14.055  57.037  1.00 46.54 ? 251  ILE A CB    1 
ATOM   2319  C  CG1   . ILE E  3 226  ? 93.055  13.850  57.145  1.00 47.61 ? 251  ILE A CG1   1 
ATOM   2320  C  CG2   . ILE E  3 226  ? 91.079  15.494  57.293  1.00 46.64 ? 251  ILE A CG2   1 
ATOM   2321  C  CD1   . ILE E  3 226  ? 93.499  12.456  56.709  1.00 48.55 ? 251  ILE A CD1   1 
ATOM   2322  N  N     . ALA E  3 227  ? 88.675  13.660  58.846  1.00 45.43 ? 252  ALA A N     1 
ATOM   2323  C  CA    . ALA E  3 227  ? 87.694  14.120  59.825  1.00 45.05 ? 252  ALA A CA    1 
ATOM   2324  C  C     . ALA E  3 227  ? 86.336  13.604  59.350  1.00 44.99 ? 252  ALA A C     1 
ATOM   2325  O  O     . ALA E  3 227  ? 86.253  12.953  58.304  1.00 45.12 ? 252  ALA A O     1 
ATOM   2326  C  CB    . ALA E  3 227  ? 87.694  15.637  59.905  1.00 44.95 ? 252  ALA A CB    1 
ATOM   2327  N  N     . ALA E  3 228  ? 85.279  13.886  60.106  1.00 44.80 ? 253  ALA A N     1 
ATOM   2328  C  CA    . ALA E  3 228  ? 83.922  13.533  59.685  1.00 45.10 ? 253  ALA A CA    1 
ATOM   2329  C  C     . ALA E  3 228  ? 83.572  14.176  58.332  1.00 45.49 ? 253  ALA A C     1 
ATOM   2330  O  O     . ALA E  3 228  ? 83.879  15.351  58.105  1.00 45.80 ? 253  ALA A O     1 
ATOM   2331  C  CB    . ALA E  3 228  ? 82.918  13.940  60.746  1.00 44.96 ? 253  ALA A CB    1 
ATOM   2332  N  N     . PRO E  3 229  ? 82.952  13.401  57.419  1.00 45.81 ? 254  PRO A N     1 
ATOM   2333  C  CA    . PRO E  3 229  ? 82.533  13.920  56.112  1.00 45.74 ? 254  PRO A CA    1 
ATOM   2334  C  C     . PRO E  3 229  ? 81.148  14.578  56.134  1.00 46.19 ? 254  PRO A C     1 
ATOM   2335  O  O     . PRO E  3 229  ? 80.480  14.600  57.175  1.00 46.94 ? 254  PRO A O     1 
ATOM   2336  C  CB    . PRO E  3 229  ? 82.482  12.656  55.252  1.00 45.22 ? 254  PRO A CB    1 
ATOM   2337  C  CG    . PRO E  3 229  ? 82.048  11.597  56.207  1.00 45.71 ? 254  PRO A CG    1 
ATOM   2338  C  CD    . PRO E  3 229  ? 82.631  11.965  57.560  1.00 45.70 ? 254  PRO A CD    1 
ATOM   2339  N  N     . PHE E  3 230  ? 80.744  15.106  54.979  1.00 46.20 ? 255  PHE A N     1 
ATOM   2340  C  CA    . PHE E  3 230  ? 79.384  15.608  54.724  1.00 46.51 ? 255  PHE A CA    1 
ATOM   2341  C  C     . PHE E  3 230  ? 79.033  16.944  55.374  1.00 47.08 ? 255  PHE A C     1 
ATOM   2342  O  O     . PHE E  3 230  ? 77.858  17.307  55.447  1.00 47.34 ? 255  PHE A O     1 
ATOM   2343  C  CB    . PHE E  3 230  ? 78.318  14.549  55.041  1.00 46.26 ? 255  PHE A CB    1 
ATOM   2344  C  CG    . PHE E  3 230  ? 78.507  13.266  54.293  1.00 46.26 ? 255  PHE A CG    1 
ATOM   2345  C  CD1   . PHE E  3 230  ? 78.443  13.241  52.904  1.00 46.19 ? 255  PHE A CD1   1 
ATOM   2346  C  CD2   . PHE E  3 230  ? 78.747  12.081  54.976  1.00 46.57 ? 255  PHE A CD2   1 
ATOM   2347  C  CE1   . PHE E  3 230  ? 78.620  12.053  52.206  1.00 46.57 ? 255  PHE A CE1   1 
ATOM   2348  C  CE2   . PHE E  3 230  ? 78.926  10.886  54.287  1.00 46.77 ? 255  PHE A CE2   1 
ATOM   2349  C  CZ    . PHE E  3 230  ? 78.861  10.872  52.900  1.00 46.72 ? 255  PHE A CZ    1 
ATOM   2350  N  N     . LYS E  3 231  ? 80.043  17.670  55.846  1.00 47.68 ? 256  LYS A N     1 
ATOM   2351  C  CA    . LYS E  3 231  ? 79.843  19.063  56.229  1.00 48.11 ? 256  LYS A CA    1 
ATOM   2352  C  C     . LYS E  3 231  ? 79.962  19.893  54.958  1.00 48.31 ? 256  LYS A C     1 
ATOM   2353  O  O     . LYS E  3 231  ? 80.547  19.441  53.968  1.00 48.05 ? 256  LYS A O     1 
ATOM   2354  C  CB    . LYS E  3 231  ? 80.876  19.513  57.259  1.00 47.86 ? 256  LYS A CB    1 
ATOM   2355  C  CG    . LYS E  3 231  ? 80.735  18.876  58.622  1.00 48.24 ? 256  LYS A CG    1 
ATOM   2356  C  CD    . LYS E  3 231  ? 81.834  19.387  59.531  1.00 49.82 ? 256  LYS A CD    1 
ATOM   2357  C  CE    . LYS E  3 231  ? 82.008  18.524  60.769  1.00 50.27 ? 256  LYS A CE    1 
ATOM   2358  N  NZ    . LYS E  3 231  ? 83.261  18.879  61.494  1.00 50.66 ? 256  LYS A NZ    1 
ATOM   2359  N  N     . GLN E  3 232  ? 79.403  21.095  54.967  1.00 48.78 ? 257  GLN A N     1 
ATOM   2360  C  CA    . GLN E  3 232  ? 79.488  21.936  53.782  1.00 49.75 ? 257  GLN A CA    1 
ATOM   2361  C  C     . GLN E  3 232  ? 79.840  23.382  54.084  1.00 49.78 ? 257  GLN A C     1 
ATOM   2362  O  O     . GLN E  3 232  ? 79.667  23.856  55.208  1.00 49.66 ? 257  GLN A O     1 
ATOM   2363  C  CB    . GLN E  3 232  ? 78.223  21.830  52.925  1.00 49.75 ? 257  GLN A CB    1 
ATOM   2364  C  CG    . GLN E  3 232  ? 76.928  22.133  53.641  1.00 51.02 ? 257  GLN A CG    1 
ATOM   2365  C  CD    . GLN E  3 232  ? 75.734  22.046  52.715  1.00 51.27 ? 257  GLN A CD    1 
ATOM   2366  O  OE1   . GLN E  3 232  ? 75.134  23.066  52.374  1.00 53.10 ? 257  GLN A OE1   1 
ATOM   2367  N  NE2   . GLN E  3 232  ? 75.390  20.828  52.289  1.00 51.62 ? 257  GLN A NE2   1 
ATOM   2368  N  N     . ALA E  3 233  ? 80.347  24.071  53.065  1.00 49.94 ? 258  ALA A N     1 
ATOM   2369  C  CA    . ALA E  3 233  ? 80.799  25.444  53.204  1.00 49.88 ? 258  ALA A CA    1 
ATOM   2370  C  C     . ALA E  3 233  ? 80.197  26.300  52.109  1.00 49.79 ? 258  ALA A C     1 
ATOM   2371  O  O     . ALA E  3 233  ? 80.221  25.923  50.941  1.00 50.05 ? 258  ALA A O     1 
ATOM   2372  C  CB    . ALA E  3 233  ? 82.304  25.497  53.134  1.00 49.98 ? 258  ALA A CB    1 
ATOM   2373  N  N     . GLU E  3 234  ? 79.649  27.446  52.493  1.00 49.83 ? 259  GLU A N     1 
ATOM   2374  C  CA    . GLU E  3 234  ? 79.161  28.416  51.527  1.00 50.60 ? 259  GLU A CA    1 
ATOM   2375  C  C     . GLU E  3 234  ? 79.992  29.682  51.625  1.00 49.65 ? 259  GLU A C     1 
ATOM   2376  O  O     . GLU E  3 234  ? 80.239  30.185  52.721  1.00 49.85 ? 259  GLU A O     1 
ATOM   2377  C  CB    . GLU E  3 234  ? 77.687  28.743  51.761  1.00 50.85 ? 259  GLU A CB    1 
ATOM   2378  C  CG    . GLU E  3 234  ? 76.747  27.555  51.644  1.00 52.91 ? 259  GLU A CG    1 
ATOM   2379  C  CD    . GLU E  3 234  ? 75.277  27.953  51.683  1.00 53.14 ? 259  GLU A CD    1 
ATOM   2380  O  OE1   . GLU E  3 234  ? 74.949  29.054  52.181  1.00 55.59 ? 259  GLU A OE1   1 
ATOM   2381  O  OE2   . GLU E  3 234  ? 74.445  27.155  51.213  1.00 55.00 ? 259  GLU A OE2   1 
ATOM   2382  N  N     . PHE E  3 235  ? 80.426  30.192  50.478  1.00 48.57 ? 260  PHE A N     1 
ATOM   2383  C  CA    . PHE E  3 235  ? 81.196  31.426  50.431  1.00 47.57 ? 260  PHE A CA    1 
ATOM   2384  C  C     . PHE E  3 235  ? 81.018  32.111  49.088  1.00 47.28 ? 260  PHE A C     1 
ATOM   2385  O  O     . PHE E  3 235  ? 80.301  31.613  48.219  1.00 47.52 ? 260  PHE A O     1 
ATOM   2386  C  CB    . PHE E  3 235  ? 82.676  31.146  50.698  1.00 47.45 ? 260  PHE A CB    1 
ATOM   2387  C  CG    . PHE E  3 235  ? 83.266  30.098  49.804  1.00 47.14 ? 260  PHE A CG    1 
ATOM   2388  C  CD1   . PHE E  3 235  ? 83.706  30.425  48.525  1.00 46.84 ? 260  PHE A CD1   1 
ATOM   2389  C  CD2   . PHE E  3 235  ? 83.388  28.784  50.241  1.00 46.75 ? 260  PHE A CD2   1 
ATOM   2390  C  CE1   . PHE E  3 235  ? 84.253  29.460  47.692  1.00 47.32 ? 260  PHE A CE1   1 
ATOM   2391  C  CE2   . PHE E  3 235  ? 83.939  27.809  49.416  1.00 47.17 ? 260  PHE A CE2   1 
ATOM   2392  C  CZ    . PHE E  3 235  ? 84.372  28.148  48.136  1.00 47.32 ? 260  PHE A CZ    1 
ATOM   2393  N  N     . GLN E  3 236  ? 81.677  33.251  48.922  1.00 46.98 ? 261  GLN A N     1 
ATOM   2394  C  CA    . GLN E  3 236  ? 81.609  33.999  47.673  1.00 46.91 ? 261  GLN A CA    1 
ATOM   2395  C  C     . GLN E  3 236  ? 82.925  33.948  46.914  1.00 46.64 ? 261  GLN A C     1 
ATOM   2396  O  O     . GLN E  3 236  ? 83.995  34.095  47.499  1.00 46.63 ? 261  GLN A O     1 
ATOM   2397  C  CB    . GLN E  3 236  ? 81.258  35.460  47.937  1.00 46.98 ? 261  GLN A CB    1 
ATOM   2398  C  CG    . GLN E  3 236  ? 79.941  35.679  48.635  1.00 46.70 ? 261  GLN A CG    1 
ATOM   2399  C  CD    . GLN E  3 236  ? 79.581  37.145  48.728  1.00 46.73 ? 261  GLN A CD    1 
ATOM   2400  O  OE1   . GLN E  3 236  ? 80.454  38.012  48.814  1.00 46.18 ? 261  GLN A OE1   1 
ATOM   2401  N  NE2   . GLN E  3 236  ? 78.287  37.432  48.710  1.00 47.03 ? 261  GLN A NE2   1 
ATOM   2402  N  N     . ILE E  3 237  ? 82.839  33.732  45.608  1.00 46.43 ? 262  ILE A N     1 
ATOM   2403  C  CA    . ILE E  3 237  ? 83.984  33.935  44.740  1.00 45.64 ? 262  ILE A CA    1 
ATOM   2404  C  C     . ILE E  3 237  ? 83.755  35.246  44.014  1.00 46.35 ? 262  ILE A C     1 
ATOM   2405  O  O     . ILE E  3 237  ? 82.886  35.349  43.147  1.00 46.20 ? 262  ILE A O     1 
ATOM   2406  C  CB    . ILE E  3 237  ? 84.193  32.785  43.736  1.00 45.35 ? 262  ILE A CB    1 
ATOM   2407  C  CG1   . ILE E  3 237  ? 84.454  31.471  44.475  1.00 44.62 ? 262  ILE A CG1   1 
ATOM   2408  C  CG2   . ILE E  3 237  ? 85.361  33.109  42.816  1.00 44.76 ? 262  ILE A CG2   1 
ATOM   2409  C  CD1   . ILE E  3 237  ? 84.702  30.278  43.576  1.00 44.30 ? 262  ILE A CD1   1 
ATOM   2410  N  N     . LEU E  3 238  ? 84.516  36.259  44.402  1.00 47.34 ? 263  LEU A N     1 
ATOM   2411  C  CA    . LEU E  3 238  ? 84.447  37.553  43.747  1.00 48.37 ? 263  LEU A CA    1 
ATOM   2412  C  C     . LEU E  3 238  ? 85.428  37.570  42.587  1.00 49.40 ? 263  LEU A C     1 
ATOM   2413  O  O     . LEU E  3 238  ? 86.630  37.370  42.776  1.00 49.05 ? 263  LEU A O     1 
ATOM   2414  C  CB    . LEU E  3 238  ? 84.751  38.673  44.738  1.00 47.96 ? 263  LEU A CB    1 
ATOM   2415  C  CG    . LEU E  3 238  ? 83.826  38.771  45.951  1.00 47.78 ? 263  LEU A CG    1 
ATOM   2416  C  CD1   . LEU E  3 238  ? 84.347  39.826  46.907  1.00 48.00 ? 263  LEU A CD1   1 
ATOM   2417  C  CD2   . LEU E  3 238  ? 82.389  39.075  45.534  1.00 47.47 ? 263  LEU A CD2   1 
ATOM   2418  N  N     . TYR E  3 239  ? 84.905  37.791  41.384  1.00 51.14 ? 264  TYR A N     1 
ATOM   2419  C  CA    . TYR E  3 239  ? 85.710  37.723  40.161  1.00 52.20 ? 264  TYR A CA    1 
ATOM   2420  C  C     . TYR E  3 239  ? 86.876  38.698  40.229  1.00 53.28 ? 264  TYR A C     1 
ATOM   2421  O  O     . TYR E  3 239  ? 86.709  39.855  40.628  1.00 53.32 ? 264  TYR A O     1 
ATOM   2422  C  CB    . TYR E  3 239  ? 84.857  37.991  38.913  1.00 51.59 ? 264  TYR A CB    1 
ATOM   2423  C  CG    . TYR E  3 239  ? 83.613  37.127  38.799  1.00 51.66 ? 264  TYR A CG    1 
ATOM   2424  C  CD1   . TYR E  3 239  ? 83.655  35.755  39.080  1.00 51.40 ? 264  TYR A CD1   1 
ATOM   2425  C  CD2   . TYR E  3 239  ? 82.396  37.677  38.387  1.00 51.21 ? 264  TYR A CD2   1 
ATOM   2426  C  CE1   . TYR E  3 239  ? 82.519  34.961  38.971  1.00 50.72 ? 264  TYR A CE1   1 
ATOM   2427  C  CE2   . TYR E  3 239  ? 81.254  36.889  38.271  1.00 51.00 ? 264  TYR A CE2   1 
ATOM   2428  C  CZ    . TYR E  3 239  ? 81.325  35.532  38.564  1.00 51.05 ? 264  TYR A CZ    1 
ATOM   2429  O  OH    . TYR E  3 239  ? 80.203  34.748  38.455  1.00 51.52 ? 264  TYR A OH    1 
ATOM   2430  N  N     . GLY E  3 240  ? 88.060  38.210  39.870  1.00 54.42 ? 265  GLY A N     1 
ATOM   2431  C  CA    . GLY E  3 240  ? 89.269  39.032  39.865  1.00 55.47 ? 265  GLY A CA    1 
ATOM   2432  C  C     . GLY E  3 240  ? 89.867  39.262  41.242  1.00 55.94 ? 265  GLY A C     1 
ATOM   2433  O  O     . GLY E  3 240  ? 90.932  39.867  41.371  1.00 55.90 ? 265  GLY A O     1 
ATOM   2434  N  N     . GLU E  3 241  ? 89.180  38.780  42.272  1.00 56.37 ? 266  GLU A N     1 
ATOM   2435  C  CA    . GLU E  3 241  ? 89.641  38.933  43.640  1.00 57.10 ? 266  GLU A CA    1 
ATOM   2436  C  C     . GLU E  3 241  ? 89.900  37.571  44.285  1.00 55.90 ? 266  GLU A C     1 
ATOM   2437  O  O     . GLU E  3 241  ? 90.946  37.357  44.890  1.00 55.86 ? 266  GLU A O     1 
ATOM   2438  C  CB    . GLU E  3 241  ? 88.626  39.744  44.449  1.00 57.44 ? 266  GLU A CB    1 
ATOM   2439  C  CG    . GLU E  3 241  ? 89.090  40.109  45.852  1.00 59.59 ? 266  GLU A CG    1 
ATOM   2440  C  CD    . GLU E  3 241  ? 88.212  41.156  46.514  1.00 59.87 ? 266  GLU A CD    1 
ATOM   2441  O  OE1   . GLU E  3 241  ? 88.111  41.142  47.764  1.00 62.61 ? 266  GLU A OE1   1 
ATOM   2442  O  OE2   . GLU E  3 241  ? 87.627  41.993  45.789  1.00 61.79 ? 266  GLU A OE2   1 
ATOM   2443  N  N     . GLY E  3 242  ? 88.947  36.656  44.143  1.00 54.94 ? 267  GLY A N     1 
ATOM   2444  C  CA    . GLY E  3 242  ? 89.054  35.325  44.732  1.00 53.43 ? 267  GLY A CA    1 
ATOM   2445  C  C     . GLY E  3 242  ? 87.961  35.052  45.743  1.00 52.63 ? 267  GLY A C     1 
ATOM   2446  O  O     . GLY E  3 242  ? 86.914  35.710  45.735  1.00 53.49 ? 267  GLY A O     1 
ATOM   2447  N  N     . ILE E  3 243  ? 88.203  34.074  46.610  1.00 51.09 ? 268  ILE A N     1 
ATOM   2448  C  CA    . ILE E  3 243  ? 87.280  33.737  47.702  1.00 49.38 ? 268  ILE A CA    1 
ATOM   2449  C  C     . ILE E  3 243  ? 87.119  34.950  48.651  1.00 48.45 ? 268  ILE A C     1 
ATOM   2450  O  O     . ILE E  3 243  ? 88.136  35.431  49.152  1.00 48.43 ? 268  ILE A O     1 
ATOM   2451  C  CB    . ILE E  3 243  ? 87.786  32.472  48.454  1.00 49.60 ? 268  ILE A CB    1 
ATOM   2452  C  CG1   . ILE E  3 243  ? 87.655  31.230  47.555  1.00 49.63 ? 268  ILE A CG1   1 
ATOM   2453  C  CG2   . ILE E  3 243  ? 87.049  32.284  49.779  1.00 49.48 ? 268  ILE A CG2   1 
ATOM   2454  C  CD1   . ILE E  3 243  ? 88.409  30.003  48.042  1.00 49.35 ? 268  ILE A CD1   1 
ATOM   2455  N  N     . ASN E  3 244  ? 85.876  35.484  48.827  1.00 47.67 ? 269  ASN A N     1 
ATOM   2456  C  CA    . ASN E  3 244  ? 85.600  36.593  49.775  1.00 47.41 ? 269  ASN A CA    1 
ATOM   2457  C  C     . ASN E  3 244  ? 85.797  36.111  51.203  1.00 47.04 ? 269  ASN A C     1 
ATOM   2458  O  O     . ASN E  3 244  ? 84.849  35.709  51.886  1.00 47.43 ? 269  ASN A O     1 
ATOM   2459  C  CB    . ASN E  3 244  ? 84.203  37.225  49.596  1.00 46.97 ? 269  ASN A CB    1 
ATOM   2460  C  CG    . ASN E  3 244  ? 83.989  38.459  50.484  1.00 46.85 ? 269  ASN A CG    1 
ATOM   2461  O  OD1   . ASN E  3 244  ? 84.887  38.889  51.210  1.00 46.02 ? 269  ASN A OD1   1 
ATOM   2462  N  ND2   . ASN E  3 244  ? 82.793  39.025  50.425  1.00 47.47 ? 269  ASN A ND2   1 
ATOM   2463  N  N     . PHE E  3 245  ? 87.053  36.157  51.635  1.00 46.81 ? 270  PHE A N     1 
ATOM   2464  C  CA    . PHE E  3 245  ? 87.471  35.608  52.918  1.00 46.76 ? 270  PHE A CA    1 
ATOM   2465  C  C     . PHE E  3 245  ? 86.957  36.428  54.096  1.00 46.41 ? 270  PHE A C     1 
ATOM   2466  O  O     . PHE E  3 245  ? 86.451  35.871  55.071  1.00 45.71 ? 270  PHE A O     1 
ATOM   2467  C  CB    . PHE E  3 245  ? 88.998  35.498  52.973  1.00 47.05 ? 270  PHE A CB    1 
ATOM   2468  C  CG    . PHE E  3 245  ? 89.523  34.942  54.267  1.00 47.41 ? 270  PHE A CG    1 
ATOM   2469  C  CD1   . PHE E  3 245  ? 89.630  33.566  54.452  1.00 47.48 ? 270  PHE A CD1   1 
ATOM   2470  C  CD2   . PHE E  3 245  ? 89.917  35.796  55.300  1.00 47.47 ? 270  PHE A CD2   1 
ATOM   2471  C  CE1   . PHE E  3 245  ? 90.117  33.045  55.649  1.00 48.04 ? 270  PHE A CE1   1 
ATOM   2472  C  CE2   . PHE E  3 245  ? 90.404  35.287  56.500  1.00 47.87 ? 270  PHE A CE2   1 
ATOM   2473  C  CZ    . PHE E  3 245  ? 90.504  33.907  56.676  1.00 48.08 ? 270  PHE A CZ    1 
ATOM   2474  N  N     . TYR E  3 246  ? 87.097  37.747  54.003  1.00 46.39 ? 271  TYR A N     1 
ATOM   2475  C  CA    . TYR E  3 246  ? 86.669  38.637  55.076  1.00 46.24 ? 271  TYR A CA    1 
ATOM   2476  C  C     . TYR E  3 246  ? 85.153  38.699  55.186  1.00 45.99 ? 271  TYR A C     1 
ATOM   2477  O  O     . TYR E  3 246  ? 84.616  38.927  56.269  1.00 45.98 ? 271  TYR A O     1 
ATOM   2478  C  CB    . TYR E  3 246  ? 87.277  40.030  54.913  1.00 46.64 ? 271  TYR A CB    1 
ATOM   2479  C  CG    . TYR E  3 246  ? 88.777  40.041  55.088  1.00 47.15 ? 271  TYR A CG    1 
ATOM   2480  C  CD1   . TYR E  3 246  ? 89.353  39.761  56.328  1.00 47.35 ? 271  TYR A CD1   1 
ATOM   2481  C  CD2   . TYR E  3 246  ? 89.623  40.315  54.015  1.00 47.36 ? 271  TYR A CD2   1 
ATOM   2482  C  CE1   . TYR E  3 246  ? 90.729  39.758  56.498  1.00 47.42 ? 271  TYR A CE1   1 
ATOM   2483  C  CE2   . TYR E  3 246  ? 91.005  40.318  54.175  1.00 47.23 ? 271  TYR A CE2   1 
ATOM   2484  C  CZ    . TYR E  3 246  ? 91.549  40.038  55.420  1.00 47.31 ? 271  TYR A CZ    1 
ATOM   2485  O  OH    . TYR E  3 246  ? 92.911  40.039  55.594  1.00 47.36 ? 271  TYR A OH    1 
ATOM   2486  N  N     . GLY E  3 247  ? 84.470  38.481  54.064  1.00 45.70 ? 272  GLY A N     1 
ATOM   2487  C  CA    . GLY E  3 247  ? 83.023  38.296  54.065  1.00 45.07 ? 272  GLY A CA    1 
ATOM   2488  C  C     . GLY E  3 247  ? 82.626  37.150  54.980  1.00 44.73 ? 272  GLY A C     1 
ATOM   2489  O  O     . GLY E  3 247  ? 81.739  37.306  55.823  1.00 44.09 ? 272  GLY A O     1 
ATOM   2490  N  N     . GLU E  3 248  ? 83.294  36.005  54.815  1.00 44.89 ? 273  GLU A N     1 
ATOM   2491  C  CA    . GLU E  3 248  ? 83.085  34.836  55.671  1.00 45.64 ? 273  GLU A CA    1 
ATOM   2492  C  C     . GLU E  3 248  ? 83.333  35.210  57.119  1.00 45.75 ? 273  GLU A C     1 
ATOM   2493  O  O     . GLU E  3 248  ? 82.521  34.913  57.997  1.00 46.04 ? 273  GLU A O     1 
ATOM   2494  C  CB    . GLU E  3 248  ? 84.037  33.698  55.300  1.00 45.40 ? 273  GLU A CB    1 
ATOM   2495  C  CG    . GLU E  3 248  ? 83.751  33.008  53.987  1.00 46.83 ? 273  GLU A CG    1 
ATOM   2496  C  CD    . GLU E  3 248  ? 84.843  32.019  53.610  1.00 47.05 ? 273  GLU A CD    1 
ATOM   2497  O  OE1   . GLU E  3 248  ? 85.997  32.448  53.406  1.00 48.55 ? 273  GLU A OE1   1 
ATOM   2498  O  OE2   . GLU E  3 248  ? 84.550  30.810  53.514  1.00 48.51 ? 273  GLU A OE2   1 
ATOM   2499  N  N     . LEU E  3 249  ? 84.463  35.873  57.355  1.00 45.84 ? 274  LEU A N     1 
ATOM   2500  C  CA    . LEU E  3 249  ? 84.877  36.237  58.703  1.00 45.21 ? 274  LEU A CA    1 
ATOM   2501  C  C     . LEU E  3 249  ? 83.799  37.046  59.414  1.00 45.43 ? 274  LEU A C     1 
ATOM   2502  O  O     . LEU E  3 249  ? 83.510  36.790  60.579  1.00 45.36 ? 274  LEU A O     1 
ATOM   2503  C  CB    . LEU E  3 249  ? 86.209  36.991  58.678  1.00 44.80 ? 274  LEU A CB    1 
ATOM   2504  C  CG    . LEU E  3 249  ? 86.971  37.095  60.001  1.00 44.31 ? 274  LEU A CG    1 
ATOM   2505  C  CD1   . LEU E  3 249  ? 87.201  35.723  60.608  1.00 44.04 ? 274  LEU A CD1   1 
ATOM   2506  C  CD2   . LEU E  3 249  ? 88.294  37.813  59.801  1.00 44.66 ? 274  LEU A CD2   1 
ATOM   2507  N  N     . VAL E  3 250  ? 83.197  38.001  58.705  1.00 45.89 ? 275  VAL A N     1 
ATOM   2508  C  CA    . VAL E  3 250  ? 82.081  38.771  59.251  1.00 46.57 ? 275  VAL A CA    1 
ATOM   2509  C  C     . VAL E  3 250  ? 80.938  37.839  59.660  1.00 46.90 ? 275  VAL A C     1 
ATOM   2510  O  O     . VAL E  3 250  ? 80.526  37.842  60.817  1.00 46.90 ? 275  VAL A O     1 
ATOM   2511  C  CB    . VAL E  3 250  ? 81.574  39.868  58.268  1.00 46.86 ? 275  VAL A CB    1 
ATOM   2512  C  CG1   . VAL E  3 250  ? 80.279  40.501  58.777  1.00 47.05 ? 275  VAL A CG1   1 
ATOM   2513  C  CG2   . VAL E  3 250  ? 82.635  40.945  58.068  1.00 46.81 ? 275  VAL A CG2   1 
ATOM   2514  N  N     . ASP E  3 251  ? 80.450  37.031  58.719  1.00 47.48 ? 276  ASP A N     1 
ATOM   2515  C  CA    . ASP E  3 251  ? 79.315  36.143  58.980  1.00 47.96 ? 276  ASP A CA    1 
ATOM   2516  C  C     . ASP E  3 251  ? 79.580  35.152  60.106  1.00 47.78 ? 276  ASP A C     1 
ATOM   2517  O  O     . ASP E  3 251  ? 78.717  34.941  60.957  1.00 47.96 ? 276  ASP A O     1 
ATOM   2518  C  CB    . ASP E  3 251  ? 78.894  35.405  57.708  1.00 48.76 ? 276  ASP A CB    1 
ATOM   2519  C  CG    . ASP E  3 251  ? 78.200  36.314  56.706  1.00 50.22 ? 276  ASP A CG    1 
ATOM   2520  O  OD1   . ASP E  3 251  ? 77.933  37.492  57.040  1.00 51.02 ? 276  ASP A OD1   1 
ATOM   2521  O  OD2   . ASP E  3 251  ? 77.921  35.845  55.580  1.00 50.91 ? 276  ASP A OD2   1 
ATOM   2522  N  N     . LEU E  3 252  ? 80.771  34.557  60.106  1.00 47.61 ? 277  LEU A N     1 
ATOM   2523  C  CA    . LEU E  3 252  ? 81.178  33.626  61.157  1.00 47.77 ? 277  LEU A CA    1 
ATOM   2524  C  C     . LEU E  3 252  ? 81.343  34.323  62.509  1.00 47.89 ? 277  LEU A C     1 
ATOM   2525  O  O     . LEU E  3 252  ? 80.987  33.769  63.556  1.00 47.84 ? 277  LEU A O     1 
ATOM   2526  C  CB    . LEU E  3 252  ? 82.477  32.908  60.774  1.00 47.84 ? 277  LEU A CB    1 
ATOM   2527  C  CG    . LEU E  3 252  ? 82.432  31.593  59.979  1.00 48.63 ? 277  LEU A CG    1 
ATOM   2528  C  CD1   . LEU E  3 252  ? 81.472  30.588  60.608  1.00 48.13 ? 277  LEU A CD1   1 
ATOM   2529  C  CD2   . LEU E  3 252  ? 82.083  31.805  58.506  1.00 49.51 ? 277  LEU A CD2   1 
ATOM   2530  N  N     . GLY E  3 253  ? 81.882  35.539  62.476  1.00 47.78 ? 278  GLY A N     1 
ATOM   2531  C  CA    . GLY E  3 253  ? 82.061  36.349  63.678  1.00 47.60 ? 278  GLY A CA    1 
ATOM   2532  C  C     . GLY E  3 253  ? 80.737  36.718  64.313  1.00 47.53 ? 278  GLY A C     1 
ATOM   2533  O  O     . GLY E  3 253  ? 80.569  36.580  65.523  1.00 47.64 ? 278  GLY A O     1 
ATOM   2534  N  N     . VAL E  3 254  ? 79.797  37.179  63.489  1.00 47.69 ? 279  VAL A N     1 
ATOM   2535  C  CA    . VAL E  3 254  ? 78.452  37.540  63.940  1.00 48.05 ? 279  VAL A CA    1 
ATOM   2536  C  C     . VAL E  3 254  ? 77.730  36.322  64.500  1.00 48.85 ? 279  VAL A C     1 
ATOM   2537  O  O     . VAL E  3 254  ? 77.103  36.398  65.560  1.00 49.00 ? 279  VAL A O     1 
ATOM   2538  C  CB    . VAL E  3 254  ? 77.626  38.198  62.801  1.00 47.87 ? 279  VAL A CB    1 
ATOM   2539  C  CG1   . VAL E  3 254  ? 76.134  38.192  63.110  1.00 47.38 ? 279  VAL A CG1   1 
ATOM   2540  C  CG2   . VAL E  3 254  ? 78.104  39.617  62.560  1.00 47.60 ? 279  VAL A CG2   1 
ATOM   2541  N  N     . LYS E  3 255  ? 77.848  35.201  63.792  1.00 50.01 ? 280  LYS A N     1 
ATOM   2542  C  CA    . LYS E  3 255  ? 77.225  33.942  64.192  1.00 51.44 ? 280  LYS A CA    1 
ATOM   2543  C  C     . LYS E  3 255  ? 77.737  33.468  65.550  1.00 51.76 ? 280  LYS A C     1 
ATOM   2544  O  O     . LYS E  3 255  ? 76.968  32.943  66.363  1.00 51.92 ? 280  LYS A O     1 
ATOM   2545  C  CB    . LYS E  3 255  ? 77.478  32.868  63.133  1.00 52.15 ? 280  LYS A CB    1 
ATOM   2546  C  CG    . LYS E  3 255  ? 76.661  31.605  63.311  1.00 53.90 ? 280  LYS A CG    1 
ATOM   2547  C  CD    . LYS E  3 255  ? 77.309  30.442  62.590  1.00 56.12 ? 280  LYS A CD    1 
ATOM   2548  C  CE    . LYS E  3 255  ? 76.554  29.156  62.864  1.00 58.10 ? 280  LYS A CE    1 
ATOM   2549  N  NZ    . LYS E  3 255  ? 77.261  27.984  62.284  1.00 59.39 ? 280  LYS A NZ    1 
ATOM   2550  N  N     . GLU E  3 256  ? 79.031  33.671  65.792  1.00 52.01 ? 281  GLU A N     1 
ATOM   2551  C  CA    . GLU E  3 256  ? 79.662  33.234  67.037  1.00 52.40 ? 281  GLU A CA    1 
ATOM   2552  C  C     . GLU E  3 256  ? 79.645  34.281  68.155  1.00 51.91 ? 281  GLU A C     1 
ATOM   2553  O  O     . GLU E  3 256  ? 80.299  34.105  69.189  1.00 51.70 ? 281  GLU A O     1 
ATOM   2554  C  CB    . GLU E  3 256  ? 81.088  32.736  66.769  1.00 52.83 ? 281  GLU A CB    1 
ATOM   2555  C  CG    . GLU E  3 256  ? 81.152  31.437  65.965  1.00 54.47 ? 281  GLU A CG    1 
ATOM   2556  C  CD    . GLU E  3 256  ? 80.307  30.317  66.565  1.00 56.44 ? 281  GLU A CD    1 
ATOM   2557  O  OE1   . GLU E  3 256  ? 80.483  30.007  67.766  1.00 57.80 ? 281  GLU A OE1   1 
ATOM   2558  O  OE2   . GLU E  3 256  ? 79.471  29.745  65.830  1.00 56.79 ? 281  GLU A OE2   1 
ATOM   2559  N  N     . LYS E  3 257  ? 78.884  35.358  67.941  1.00 51.53 ? 282  LYS A N     1 
ATOM   2560  C  CA    . LYS E  3 257  ? 78.731  36.461  68.905  1.00 51.26 ? 282  LYS A CA    1 
ATOM   2561  C  C     . LYS E  3 257  ? 80.052  37.161  69.247  1.00 50.68 ? 282  LYS A C     1 
ATOM   2562  O  O     . LYS E  3 257  ? 80.215  37.699  70.347  1.00 50.63 ? 282  LYS A O     1 
ATOM   2563  C  CB    . LYS E  3 257  ? 78.015  35.996  70.189  1.00 51.68 ? 282  LYS A CB    1 
ATOM   2564  C  CG    . LYS E  3 257  ? 76.736  35.192  69.965  1.00 52.71 ? 282  LYS A CG    1 
ATOM   2565  C  CD    . LYS E  3 257  ? 75.545  36.069  69.603  1.00 53.36 ? 282  LYS A CD    1 
ATOM   2566  C  CE    . LYS E  3 257  ? 74.343  35.213  69.235  1.00 53.62 ? 282  LYS A CE    1 
ATOM   2567  N  NZ    . LYS E  3 257  ? 73.121  36.031  69.013  1.00 53.80 ? 282  LYS A NZ    1 
ATOM   2568  N  N     . LEU E  3 258  ? 80.991  37.142  68.304  1.00 49.96 ? 283  LEU A N     1 
ATOM   2569  C  CA    . LEU E  3 258  ? 82.240  37.883  68.442  1.00 49.32 ? 283  LEU A CA    1 
ATOM   2570  C  C     . LEU E  3 258  ? 82.077  39.277  67.852  1.00 49.35 ? 283  LEU A C     1 
ATOM   2571  O  O     . LEU E  3 258  ? 82.712  40.229  68.302  1.00 49.22 ? 283  LEU A O     1 
ATOM   2572  C  CB    . LEU E  3 258  ? 83.399  37.150  67.760  1.00 48.98 ? 283  LEU A CB    1 
ATOM   2573  C  CG    . LEU E  3 258  ? 83.758  35.734  68.224  1.00 48.25 ? 283  LEU A CG    1 
ATOM   2574  C  CD1   . LEU E  3 258  ? 84.987  35.256  67.489  1.00 47.84 ? 283  LEU A CD1   1 
ATOM   2575  C  CD2   . LEU E  3 258  ? 83.991  35.666  69.722  1.00 47.62 ? 283  LEU A CD2   1 
ATOM   2576  N  N     . ILE E  3 259  ? 81.225  39.382  66.838  1.00 49.74 ? 284  ILE A N     1 
ATOM   2577  C  CA    . ILE E  3 259  ? 80.875  40.664  66.241  1.00 49.99 ? 284  ILE A CA    1 
ATOM   2578  C  C     . ILE E  3 259  ? 79.400  40.953  66.513  1.00 50.72 ? 284  ILE A C     1 
ATOM   2579  O  O     . ILE E  3 259  ? 78.537  40.087  66.339  1.00 50.92 ? 284  ILE A O     1 
ATOM   2580  C  CB    . ILE E  3 259  ? 81.180  40.702  64.719  1.00 49.64 ? 284  ILE A CB    1 
ATOM   2581  C  CG1   . ILE E  3 259  ? 82.669  40.442  64.471  1.00 49.32 ? 284  ILE A CG1   1 
ATOM   2582  C  CG2   . ILE E  3 259  ? 80.772  42.048  64.110  1.00 49.07 ? 284  ILE A CG2   1 
ATOM   2583  C  CD1   . ILE E  3 259  ? 83.035  40.241  63.015  1.00 49.52 ? 284  ILE A CD1   1 
ATOM   2584  N  N     . GLU E  3 260  ? 79.132  42.174  66.959  1.00 51.46 ? 285  GLU A N     1 
ATOM   2585  C  CA    . GLU E  3 260  ? 77.786  42.626  67.262  1.00 52.49 ? 285  GLU A CA    1 
ATOM   2586  C  C     . GLU E  3 260  ? 77.094  43.084  65.988  1.00 52.45 ? 285  GLU A C     1 
ATOM   2587  O  O     . GLU E  3 260  ? 77.721  43.710  65.132  1.00 52.23 ? 285  GLU A O     1 
ATOM   2588  C  CB    . GLU E  3 260  ? 77.860  43.792  68.245  1.00 53.34 ? 285  GLU A CB    1 
ATOM   2589  C  CG    . GLU E  3 260  ? 76.774  43.805  69.303  1.00 55.50 ? 285  GLU A CG    1 
ATOM   2590  C  CD    . GLU E  3 260  ? 77.087  42.889  70.477  1.00 57.00 ? 285  GLU A CD    1 
ATOM   2591  O  OE1   . GLU E  3 260  ? 77.134  41.652  70.287  1.00 57.80 ? 285  GLU A OE1   1 
ATOM   2592  O  OE2   . GLU E  3 260  ? 77.279  43.409  71.596  1.00 57.72 ? 285  GLU A OE2   1 
ATOM   2593  N  N     . LYS E  3 261  ? 75.807  42.771  65.860  1.00 52.76 ? 286  LYS A N     1 
ATOM   2594  C  CA    . LYS E  3 261  ? 75.016  43.255  64.729  1.00 53.29 ? 286  LYS A CA    1 
ATOM   2595  C  C     . LYS E  3 261  ? 73.711  43.892  65.210  1.00 53.59 ? 286  LYS A C     1 
ATOM   2596  O  O     . LYS E  3 261  ? 72.753  43.191  65.549  1.00 53.67 ? 286  LYS A O     1 
ATOM   2597  C  CB    . LYS E  3 261  ? 74.741  42.135  63.715  1.00 53.25 ? 286  LYS A CB    1 
ATOM   2598  C  CG    . LYS E  3 261  ? 74.476  42.641  62.295  1.00 53.35 ? 286  LYS A CG    1 
ATOM   2599  C  CD    . LYS E  3 261  ? 73.540  41.723  61.514  1.00 53.72 ? 286  LYS A CD    1 
ATOM   2600  C  CE    . LYS E  3 261  ? 72.107  41.846  62.022  1.00 53.93 ? 286  LYS A CE    1 
ATOM   2601  N  NZ    . LYS E  3 261  ? 71.117  41.151  61.160  1.00 54.18 ? 286  LYS A NZ    1 
ATOM   2602  N  N     . ALA E  3 262  ? 73.692  45.225  65.246  1.00 53.76 ? 287  ALA A N     1 
ATOM   2603  C  CA    . ALA E  3 262  ? 72.506  45.991  65.632  1.00 53.61 ? 287  ALA A CA    1 
ATOM   2604  C  C     . ALA E  3 262  ? 71.785  46.530  64.394  1.00 53.68 ? 287  ALA A C     1 
ATOM   2605  O  O     . ALA E  3 262  ? 71.992  47.678  63.985  1.00 53.63 ? 287  ALA A O     1 
ATOM   2606  C  CB    . ALA E  3 262  ? 72.888  47.123  66.582  1.00 53.32 ? 287  ALA A CB    1 
ATOM   2607  N  N     . GLY E  3 263  ? 70.943  45.686  63.802  1.00 53.81 ? 288  GLY A N     1 
ATOM   2608  C  CA    . GLY E  3 263  ? 70.253  46.008  62.553  1.00 53.96 ? 288  GLY A CA    1 
ATOM   2609  C  C     . GLY E  3 263  ? 71.198  45.931  61.368  1.00 54.09 ? 288  GLY A C     1 
ATOM   2610  O  O     . GLY E  3 263  ? 71.482  44.844  60.856  1.00 54.21 ? 288  GLY A O     1 
ATOM   2611  N  N     . ALA E  3 264  ? 71.685  47.092  60.936  1.00 53.96 ? 289  ALA A N     1 
ATOM   2612  C  CA    . ALA E  3 264  ? 72.668  47.179  59.858  1.00 53.69 ? 289  ALA A CA    1 
ATOM   2613  C  C     . ALA E  3 264  ? 74.057  47.540  60.391  1.00 53.48 ? 289  ALA A C     1 
ATOM   2614  O  O     . ALA E  3 264  ? 75.046  47.479  59.657  1.00 53.36 ? 289  ALA A O     1 
ATOM   2615  C  CB    . ALA E  3 264  ? 72.214  48.185  58.802  1.00 53.56 ? 289  ALA A CB    1 
ATOM   2616  N  N     . TRP E  3 265  ? 74.123  47.903  61.672  1.00 53.33 ? 290  TRP A N     1 
ATOM   2617  C  CA    . TRP E  3 265  ? 75.376  48.324  62.304  1.00 53.19 ? 290  TRP A CA    1 
ATOM   2618  C  C     . TRP E  3 265  ? 76.185  47.174  62.901  1.00 53.12 ? 290  TRP A C     1 
ATOM   2619  O  O     . TRP E  3 265  ? 75.718  46.468  63.797  1.00 53.14 ? 290  TRP A O     1 
ATOM   2620  C  CB    . TRP E  3 265  ? 75.120  49.403  63.362  1.00 52.91 ? 290  TRP A CB    1 
ATOM   2621  C  CG    . TRP E  3 265  ? 75.116  50.785  62.794  1.00 52.87 ? 290  TRP A CG    1 
ATOM   2622  C  CD1   . TRP E  3 265  ? 74.027  51.575  62.569  1.00 52.77 ? 290  TRP A CD1   1 
ATOM   2623  C  CD2   . TRP E  3 265  ? 76.257  51.538  62.359  1.00 53.08 ? 290  TRP A CD2   1 
ATOM   2624  N  NE1   . TRP E  3 265  ? 74.417  52.777  62.029  1.00 52.85 ? 290  TRP A NE1   1 
ATOM   2625  C  CE2   . TRP E  3 265  ? 75.780  52.782  61.888  1.00 52.98 ? 290  TRP A CE2   1 
ATOM   2626  C  CE3   . TRP E  3 265  ? 77.637  51.284  62.323  1.00 53.21 ? 290  TRP A CE3   1 
ATOM   2627  C  CZ2   . TRP E  3 265  ? 76.635  53.773  61.387  1.00 52.83 ? 290  TRP A CZ2   1 
ATOM   2628  C  CZ3   . TRP E  3 265  ? 78.487  52.271  61.825  1.00 52.90 ? 290  TRP A CZ3   1 
ATOM   2629  C  CH2   . TRP E  3 265  ? 77.980  53.500  61.364  1.00 52.83 ? 290  TRP A CH2   1 
ATOM   2630  N  N     . TYR E  3 266  ? 77.402  47.002  62.392  1.00 52.87 ? 291  TYR A N     1 
ATOM   2631  C  CA    . TYR E  3 266  ? 78.322  45.987  62.892  1.00 52.52 ? 291  TYR A CA    1 
ATOM   2632  C  C     . TYR E  3 266  ? 79.306  46.596  63.885  1.00 52.37 ? 291  TYR A C     1 
ATOM   2633  O  O     . TYR E  3 266  ? 80.024  47.547  63.559  1.00 52.60 ? 291  TYR A O     1 
ATOM   2634  C  CB    . TYR E  3 266  ? 79.083  45.338  61.736  1.00 52.48 ? 291  TYR A CB    1 
ATOM   2635  C  CG    . TYR E  3 266  ? 78.231  44.468  60.839  1.00 52.67 ? 291  TYR A CG    1 
ATOM   2636  C  CD1   . TYR E  3 266  ? 77.513  45.019  59.778  1.00 52.72 ? 291  TYR A CD1   1 
ATOM   2637  C  CD2   . TYR E  3 266  ? 78.154  43.090  61.042  1.00 52.62 ? 291  TYR A CD2   1 
ATOM   2638  C  CE1   . TYR E  3 266  ? 76.731  44.220  58.948  1.00 52.76 ? 291  TYR A CE1   1 
ATOM   2639  C  CE2   . TYR E  3 266  ? 77.379  42.283  60.215  1.00 52.50 ? 291  TYR A CE2   1 
ATOM   2640  C  CZ    . TYR E  3 266  ? 76.670  42.855  59.171  1.00 52.68 ? 291  TYR A CZ    1 
ATOM   2641  O  OH    . TYR E  3 266  ? 75.900  42.065  58.350  1.00 52.58 ? 291  TYR A OH    1 
ATOM   2642  N  N     . SER E  3 267  ? 79.332  46.049  65.097  1.00 51.91 ? 292  SER A N     1 
ATOM   2643  C  CA    . SER E  3 267  ? 80.252  46.512  66.137  1.00 51.40 ? 292  SER A CA    1 
ATOM   2644  C  C     . SER E  3 267  ? 81.217  45.401  66.539  1.00 51.03 ? 292  SER A C     1 
ATOM   2645  O  O     . SER E  3 267  ? 80.856  44.222  66.528  1.00 51.11 ? 292  SER A O     1 
ATOM   2646  C  CB    . SER E  3 267  ? 79.482  46.994  67.372  1.00 51.22 ? 292  SER A CB    1 
ATOM   2647  O  OG    . SER E  3 267  ? 78.441  47.889  67.022  1.00 51.27 ? 292  SER A OG    1 
ATOM   2648  N  N     . TYR E  3 268  ? 82.446  45.777  66.878  1.00 50.39 ? 293  TYR A N     1 
ATOM   2649  C  CA    . TYR E  3 268  ? 83.385  44.838  67.479  1.00 49.87 ? 293  TYR A CA    1 
ATOM   2650  C  C     . TYR E  3 268  ? 83.941  45.410  68.765  1.00 50.16 ? 293  TYR A C     1 
ATOM   2651  O  O     . TYR E  3 268  ? 84.613  46.446  68.753  1.00 50.18 ? 293  TYR A O     1 
ATOM   2652  C  CB    . TYR E  3 268  ? 84.522  44.471  66.524  1.00 49.19 ? 293  TYR A CB    1 
ATOM   2653  C  CG    . TYR E  3 268  ? 85.526  43.502  67.123  1.00 48.41 ? 293  TYR A CG    1 
ATOM   2654  C  CD1   . TYR E  3 268  ? 85.142  42.217  67.510  1.00 48.23 ? 293  TYR A CD1   1 
ATOM   2655  C  CD2   . TYR E  3 268  ? 86.857  43.869  67.301  1.00 47.90 ? 293  TYR A CD2   1 
ATOM   2656  C  CE1   . TYR E  3 268  ? 86.058  41.324  68.059  1.00 47.79 ? 293  TYR A CE1   1 
ATOM   2657  C  CE2   . TYR E  3 268  ? 87.780  42.982  67.849  1.00 47.75 ? 293  TYR A CE2   1 
ATOM   2658  C  CZ    . TYR E  3 268  ? 87.374  41.713  68.223  1.00 47.87 ? 293  TYR A CZ    1 
ATOM   2659  O  OH    . TYR E  3 268  ? 88.281  40.831  68.762  1.00 48.10 ? 293  TYR A OH    1 
ATOM   2660  N  N     . LYS E  3 269  ? 83.652  44.723  69.869  1.00 50.61 ? 294  LYS A N     1 
ATOM   2661  C  CA    . LYS E  3 269  ? 84.061  45.144  71.212  1.00 50.90 ? 294  LYS A CA    1 
ATOM   2662  C  C     . LYS E  3 269  ? 83.709  46.607  71.483  1.00 51.48 ? 294  LYS A C     1 
ATOM   2663  O  O     . LYS E  3 269  ? 84.570  47.406  71.859  1.00 51.53 ? 294  LYS A O     1 
ATOM   2664  C  CB    . LYS E  3 269  ? 85.557  44.880  71.445  1.00 50.69 ? 294  LYS A CB    1 
ATOM   2665  C  CG    . LYS E  3 269  ? 85.977  43.428  71.239  1.00 50.55 ? 294  LYS A CG    1 
ATOM   2666  C  CD    . LYS E  3 269  ? 87.303  43.103  71.916  1.00 50.27 ? 294  LYS A CD    1 
ATOM   2667  C  CE    . LYS E  3 269  ? 88.481  43.791  71.244  1.00 50.23 ? 294  LYS A CE    1 
ATOM   2668  N  NZ    . LYS E  3 269  ? 89.772  43.346  71.826  1.00 50.79 ? 294  LYS A NZ    1 
ATOM   2669  N  N     . GLY E  3 270  ? 82.440  46.951  71.267  1.00 52.20 ? 295  GLY A N     1 
ATOM   2670  C  CA    . GLY E  3 270  ? 81.931  48.295  71.550  1.00 53.24 ? 295  GLY A CA    1 
ATOM   2671  C  C     . GLY E  3 270  ? 82.140  49.287  70.422  1.00 54.12 ? 295  GLY A C     1 
ATOM   2672  O  O     . GLY E  3 270  ? 81.275  50.122  70.149  1.00 54.05 ? 295  GLY A O     1 
ATOM   2673  N  N     . GLU E  3 271  ? 83.301  49.194  69.777  1.00 55.07 ? 296  GLU A N     1 
ATOM   2674  C  CA    . GLU E  3 271  ? 83.657  50.040  68.644  1.00 55.93 ? 296  GLU A CA    1 
ATOM   2675  C  C     . GLU E  3 271  ? 82.893  49.595  67.394  1.00 55.81 ? 296  GLU A C     1 
ATOM   2676  O  O     . GLU E  3 271  ? 82.873  48.409  67.057  1.00 55.56 ? 296  GLU A O     1 
ATOM   2677  C  CB    . GLU E  3 271  ? 85.170  49.971  68.402  1.00 56.54 ? 296  GLU A CB    1 
ATOM   2678  C  CG    . GLU E  3 271  ? 85.700  50.918  67.325  1.00 58.39 ? 296  GLU A CG    1 
ATOM   2679  C  CD    . GLU E  3 271  ? 86.972  50.410  66.646  1.00 59.66 ? 296  GLU A CD    1 
ATOM   2680  O  OE1   . GLU E  3 271  ? 87.392  49.260  66.909  1.00 60.09 ? 296  GLU A OE1   1 
ATOM   2681  O  OE2   . GLU E  3 271  ? 87.550  51.166  65.834  1.00 60.23 ? 296  GLU A OE2   1 
ATOM   2682  N  N     . LYS E  3 272  ? 82.259  50.556  66.724  1.00 55.74 ? 297  LYS A N     1 
ATOM   2683  C  CA    . LYS E  3 272  ? 81.527  50.292  65.487  1.00 55.53 ? 297  LYS A CA    1 
ATOM   2684  C  C     . LYS E  3 272  ? 82.513  50.187  64.334  1.00 55.07 ? 297  LYS A C     1 
ATOM   2685  O  O     . LYS E  3 272  ? 83.396  51.033  64.187  1.00 54.87 ? 297  LYS A O     1 
ATOM   2686  C  CB    . LYS E  3 272  ? 80.486  51.385  65.218  1.00 55.83 ? 297  LYS A CB    1 
ATOM   2687  C  CG    . LYS E  3 272  ? 79.487  51.567  66.354  1.00 56.67 ? 297  LYS A CG    1 
ATOM   2688  C  CD    . LYS E  3 272  ? 78.143  52.072  65.869  1.00 57.59 ? 297  LYS A CD    1 
ATOM   2689  C  CE    . LYS E  3 272  ? 77.052  51.714  66.868  1.00 58.00 ? 297  LYS A CE    1 
ATOM   2690  N  NZ    . LYS E  3 272  ? 75.687  51.986  66.346  1.00 58.55 ? 297  LYS A NZ    1 
ATOM   2691  N  N     . ILE E  3 273  ? 82.366  49.140  63.526  1.00 54.68 ? 298  ILE A N     1 
ATOM   2692  C  CA    . ILE E  3 273  ? 83.326  48.853  62.454  1.00 54.27 ? 298  ILE A CA    1 
ATOM   2693  C  C     . ILE E  3 273  ? 82.772  49.064  61.041  1.00 54.14 ? 298  ILE A C     1 
ATOM   2694  O  O     . ILE E  3 273  ? 83.534  49.107  60.074  1.00 53.92 ? 298  ILE A O     1 
ATOM   2695  C  CB    . ILE E  3 273  ? 83.945  47.435  62.581  1.00 54.09 ? 298  ILE A CB    1 
ATOM   2696  C  CG1   . ILE E  3 273  ? 82.884  46.350  62.373  1.00 54.15 ? 298  ILE A CG1   1 
ATOM   2697  C  CG2   . ILE E  3 273  ? 84.650  47.278  63.926  1.00 53.87 ? 298  ILE A CG2   1 
ATOM   2698  C  CD1   . ILE E  3 273  ? 83.453  44.990  62.022  1.00 54.43 ? 298  ILE A CD1   1 
ATOM   2699  N  N     . GLY E  3 274  ? 81.454  49.186  60.921  1.00 54.11 ? 299  GLY A N     1 
ATOM   2700  C  CA    . GLY E  3 274  ? 80.844  49.446  59.622  1.00 53.87 ? 299  GLY A CA    1 
ATOM   2701  C  C     . GLY E  3 274  ? 79.344  49.252  59.570  1.00 53.74 ? 299  GLY A C     1 
ATOM   2702  O  O     . GLY E  3 274  ? 78.759  48.557  60.408  1.00 53.51 ? 299  GLY A O     1 
ATOM   2703  N  N     . GLN E  3 275  ? 78.727  49.877  58.573  1.00 53.64 ? 300  GLN A N     1 
ATOM   2704  C  CA    . GLN E  3 275  ? 77.302  49.726  58.328  1.00 53.56 ? 300  GLN A CA    1 
ATOM   2705  C  C     . GLN E  3 275  ? 77.077  48.887  57.070  1.00 53.74 ? 300  GLN A C     1 
ATOM   2706  O  O     . GLN E  3 275  ? 77.547  49.238  55.983  1.00 53.57 ? 300  GLN A O     1 
ATOM   2707  C  CB    . GLN E  3 275  ? 76.637  51.093  58.195  1.00 53.29 ? 300  GLN A CB    1 
ATOM   2708  C  CG    . GLN E  3 275  ? 75.120  51.039  58.235  1.00 53.08 ? 300  GLN A CG    1 
ATOM   2709  C  CD    . GLN E  3 275  ? 74.478  52.410  58.243  1.00 52.90 ? 300  GLN A CD    1 
ATOM   2710  O  OE1   . GLN E  3 275  ? 73.285  52.540  58.517  1.00 52.85 ? 300  GLN A OE1   1 
ATOM   2711  N  NE2   . GLN E  3 275  ? 75.262  53.442  57.944  1.00 52.66 ? 300  GLN A NE2   1 
ATOM   2712  N  N     . GLY E  3 276  ? 76.361  47.775  57.230  1.00 53.87 ? 301  GLY A N     1 
ATOM   2713  C  CA    . GLY E  3 276  ? 76.161  46.817  56.145  1.00 53.60 ? 301  GLY A CA    1 
ATOM   2714  C  C     . GLY E  3 276  ? 77.372  45.916  55.987  1.00 53.53 ? 301  GLY A C     1 
ATOM   2715  O  O     . GLY E  3 276  ? 78.516  46.362  56.144  1.00 53.56 ? 301  GLY A O     1 
ATOM   2716  N  N     . LYS E  3 277  ? 77.118  44.647  55.671  1.00 53.20 ? 302  LYS A N     1 
ATOM   2717  C  CA    . LYS E  3 277  ? 78.168  43.631  55.539  1.00 52.97 ? 302  LYS A CA    1 
ATOM   2718  C  C     . LYS E  3 277  ? 79.332  44.106  54.657  1.00 52.45 ? 302  LYS A C     1 
ATOM   2719  O  O     . LYS E  3 277  ? 80.495  43.809  54.946  1.00 52.45 ? 302  LYS A O     1 
ATOM   2720  C  CB    . LYS E  3 277  ? 77.564  42.323  55.015  1.00 52.76 ? 302  LYS A CB    1 
ATOM   2721  C  CG    . LYS E  3 277  ? 78.491  41.112  55.009  1.00 53.32 ? 302  LYS A CG    1 
ATOM   2722  C  CD    . LYS E  3 277  ? 77.695  39.851  54.672  1.00 54.11 ? 302  LYS A CD    1 
ATOM   2723  C  CE    . LYS E  3 277  ? 78.393  38.962  53.638  1.00 55.66 ? 302  LYS A CE    1 
ATOM   2724  N  NZ    . LYS E  3 277  ? 79.579  38.248  54.191  1.00 56.97 ? 302  LYS A NZ    1 
ATOM   2725  N  N     . ALA E  3 278  ? 79.005  44.859  53.605  1.00 51.76 ? 303  ALA A N     1 
ATOM   2726  C  CA    . ALA E  3 278  ? 79.998  45.425  52.688  1.00 51.22 ? 303  ALA A CA    1 
ATOM   2727  C  C     . ALA E  3 278  ? 81.090  46.221  53.411  1.00 50.89 ? 303  ALA A C     1 
ATOM   2728  O  O     . ALA E  3 278  ? 82.283  45.991  53.188  1.00 50.64 ? 303  ALA A O     1 
ATOM   2729  C  CB    . ALA E  3 278  ? 79.311  46.289  51.635  1.00 51.12 ? 303  ALA A CB    1 
ATOM   2730  N  N     . ASN E  3 279  ? 80.676  47.143  54.279  1.00 50.55 ? 304  ASN A N     1 
ATOM   2731  C  CA    . ASN E  3 279  ? 81.612  47.995  55.015  1.00 50.28 ? 304  ASN A CA    1 
ATOM   2732  C  C     . ASN E  3 279  ? 82.383  47.272  56.109  1.00 50.28 ? 304  ASN A C     1 
ATOM   2733  O  O     . ASN E  3 279  ? 83.573  47.532  56.308  1.00 50.24 ? 304  ASN A O     1 
ATOM   2734  C  CB    . ASN E  3 279  ? 80.894  49.206  55.604  1.00 49.95 ? 304  ASN A CB    1 
ATOM   2735  C  CG    . ASN E  3 279  ? 80.636  50.282  54.577  1.00 49.52 ? 304  ASN A CG    1 
ATOM   2736  O  OD1   . ASN E  3 279  ? 79.507  50.734  54.414  1.00 49.28 ? 304  ASN A OD1   1 
ATOM   2737  N  ND2   . ASN E  3 279  ? 81.685  50.698  53.872  1.00 49.20 ? 304  ASN A ND2   1 
ATOM   2738  N  N     . ALA E  3 280  ? 81.698  46.375  56.816  1.00 50.21 ? 305  ALA A N     1 
ATOM   2739  C  CA    . ALA E  3 280  ? 82.323  45.565  57.857  1.00 50.17 ? 305  ALA A CA    1 
ATOM   2740  C  C     . ALA E  3 280  ? 83.458  44.720  57.281  1.00 50.23 ? 305  ALA A C     1 
ATOM   2741  O  O     . ALA E  3 280  ? 84.514  44.576  57.906  1.00 50.18 ? 305  ALA A O     1 
ATOM   2742  C  CB    . ALA E  3 280  ? 81.290  44.687  58.536  1.00 50.02 ? 305  ALA A CB    1 
ATOM   2743  N  N     . THR E  3 281  ? 83.232  44.181  56.082  1.00 50.24 ? 306  THR A N     1 
ATOM   2744  C  CA    . THR E  3 281  ? 84.244  43.425  55.347  1.00 50.11 ? 306  THR A CA    1 
ATOM   2745  C  C     . THR E  3 281  ? 85.461  44.305  55.046  1.00 50.15 ? 306  THR A C     1 
ATOM   2746  O  O     . THR E  3 281  ? 86.606  43.886  55.252  1.00 49.97 ? 306  THR A O     1 
ATOM   2747  C  CB    . THR E  3 281  ? 83.660  42.847  54.038  1.00 49.93 ? 306  THR A CB    1 
ATOM   2748  O  OG1   . THR E  3 281  ? 82.508  42.054  54.342  1.00 50.05 ? 306  THR A OG1   1 
ATOM   2749  C  CG2   . THR E  3 281  ? 84.679  41.980  53.313  1.00 50.22 ? 306  THR A CG2   1 
ATOM   2750  N  N     . ALA E  3 282  ? 85.198  45.526  54.580  1.00 50.29 ? 307  ALA A N     1 
ATOM   2751  C  CA    . ALA E  3 282  ? 86.253  46.484  54.236  1.00 50.31 ? 307  ALA A CA    1 
ATOM   2752  C  C     . ALA E  3 282  ? 87.087  46.882  55.452  1.00 50.19 ? 307  ALA A C     1 
ATOM   2753  O  O     . ALA E  3 282  ? 88.293  47.113  55.338  1.00 49.76 ? 307  ALA A O     1 
ATOM   2754  C  CB    . ALA E  3 282  ? 85.657  47.720  53.568  1.00 50.24 ? 307  ALA A CB    1 
ATOM   2755  N  N     . TRP E  3 283  ? 86.434  46.951  56.610  1.00 50.33 ? 308  TRP A N     1 
ATOM   2756  C  CA    . TRP E  3 283  ? 87.107  47.279  57.859  1.00 50.47 ? 308  TRP A CA    1 
ATOM   2757  C  C     . TRP E  3 283  ? 88.106  46.204  58.270  1.00 50.76 ? 308  TRP A C     1 
ATOM   2758  O  O     . TRP E  3 283  ? 89.183  46.519  58.774  1.00 50.90 ? 308  TRP A O     1 
ATOM   2759  C  CB    . TRP E  3 283  ? 86.094  47.501  58.980  1.00 50.34 ? 308  TRP A CB    1 
ATOM   2760  C  CG    . TRP E  3 283  ? 86.719  48.070  60.219  1.00 50.47 ? 308  TRP A CG    1 
ATOM   2761  C  CD1   . TRP E  3 283  ? 86.952  49.388  60.483  1.00 50.07 ? 308  TRP A CD1   1 
ATOM   2762  C  CD2   . TRP E  3 283  ? 87.207  47.339  61.354  1.00 50.49 ? 308  TRP A CD2   1 
ATOM   2763  N  NE1   . TRP E  3 283  ? 87.546  49.527  61.713  1.00 49.95 ? 308  TRP A NE1   1 
ATOM   2764  C  CE2   . TRP E  3 283  ? 87.713  48.286  62.270  1.00 50.25 ? 308  TRP A CE2   1 
ATOM   2765  C  CE3   . TRP E  3 283  ? 87.257  45.977  61.689  1.00 50.50 ? 308  TRP A CE3   1 
ATOM   2766  C  CZ2   . TRP E  3 283  ? 88.267  47.916  63.502  1.00 50.33 ? 308  TRP A CZ2   1 
ATOM   2767  C  CZ3   . TRP E  3 283  ? 87.809  45.609  62.915  1.00 50.04 ? 308  TRP A CZ3   1 
ATOM   2768  C  CH2   . TRP E  3 283  ? 88.306  46.577  63.804  1.00 50.20 ? 308  TRP A CH2   1 
ATOM   2769  N  N     . LEU E  3 284  ? 87.747  44.939  58.061  1.00 51.08 ? 309  LEU A N     1 
ATOM   2770  C  CA    . LEU E  3 284  ? 88.636  43.830  58.400  1.00 51.53 ? 309  LEU A CA    1 
ATOM   2771  C  C     . LEU E  3 284  ? 89.843  43.732  57.470  1.00 52.17 ? 309  LEU A C     1 
ATOM   2772  O  O     . LEU E  3 284  ? 90.930  43.344  57.907  1.00 52.26 ? 309  LEU A O     1 
ATOM   2773  C  CB    . LEU E  3 284  ? 87.875  42.509  58.446  1.00 51.15 ? 309  LEU A CB    1 
ATOM   2774  C  CG    . LEU E  3 284  ? 86.977  42.325  59.671  1.00 50.65 ? 309  LEU A CG    1 
ATOM   2775  C  CD1   . LEU E  3 284  ? 86.077  41.125  59.478  1.00 50.47 ? 309  LEU A CD1   1 
ATOM   2776  C  CD2   . LEU E  3 284  ? 87.795  42.185  60.952  1.00 50.61 ? 309  LEU A CD2   1 
ATOM   2777  N  N     . LYS E  3 285  ? 89.653  44.082  56.198  1.00 52.79 ? 310  LYS A N     1 
ATOM   2778  C  CA    . LYS E  3 285  ? 90.778  44.259  55.280  1.00 53.86 ? 310  LYS A CA    1 
ATOM   2779  C  C     . LYS E  3 285  ? 91.737  45.303  55.847  1.00 54.05 ? 310  LYS A C     1 
ATOM   2780  O  O     . LYS E  3 285  ? 92.956  45.111  55.833  1.00 54.15 ? 310  LYS A O     1 
ATOM   2781  C  CB    . LYS E  3 285  ? 90.303  44.726  53.902  1.00 54.17 ? 310  LYS A CB    1 
ATOM   2782  C  CG    . LYS E  3 285  ? 89.761  43.644  52.986  1.00 54.85 ? 310  LYS A CG    1 
ATOM   2783  C  CD    . LYS E  3 285  ? 89.316  44.253  51.657  1.00 54.53 ? 310  LYS A CD    1 
ATOM   2784  C  CE    . LYS E  3 285  ? 88.496  43.276  50.826  1.00 55.17 ? 310  LYS A CE    1 
ATOM   2785  N  NZ    . LYS E  3 285  ? 89.345  42.266  50.142  1.00 55.85 ? 310  LYS A NZ    1 
ATOM   2786  N  N     . ASP E  3 286  ? 91.166  46.399  56.352  1.00 54.28 ? 311  ASP A N     1 
ATOM   2787  C  CA    . ASP E  3 286  ? 91.929  47.528  56.892  1.00 54.29 ? 311  ASP A CA    1 
ATOM   2788  C  C     . ASP E  3 286  ? 92.658  47.227  58.197  1.00 54.12 ? 311  ASP A C     1 
ATOM   2789  O  O     . ASP E  3 286  ? 93.723  47.786  58.454  1.00 54.20 ? 311  ASP A O     1 
ATOM   2790  C  CB    . ASP E  3 286  ? 91.024  48.750  57.080  1.00 54.42 ? 311  ASP A CB    1 
ATOM   2791  C  CG    . ASP E  3 286  ? 90.916  49.595  55.824  1.00 55.14 ? 311  ASP A CG    1 
ATOM   2792  O  OD1   . ASP E  3 286  ? 90.702  49.030  54.729  1.00 55.43 ? 311  ASP A OD1   1 
ATOM   2793  O  OD2   . ASP E  3 286  ? 91.044  50.833  55.937  1.00 55.53 ? 311  ASP A OD2   1 
ATOM   2794  N  N     . ASN E  3 287  ? 92.081  46.354  59.018  1.00 54.05 ? 312  ASN A N     1 
ATOM   2795  C  CA    . ASN E  3 287  ? 92.688  45.963  60.287  1.00 53.96 ? 312  ASN A CA    1 
ATOM   2796  C  C     . ASN E  3 287  ? 93.043  44.481  60.291  1.00 54.30 ? 312  ASN A C     1 
ATOM   2797  O  O     . ASN E  3 287  ? 92.335  43.678  60.904  1.00 54.14 ? 312  ASN A O     1 
ATOM   2798  C  CB    . ASN E  3 287  ? 91.744  46.274  61.449  1.00 53.72 ? 312  ASN A CB    1 
ATOM   2799  C  CG    . ASN E  3 287  ? 91.278  47.714  61.454  1.00 53.38 ? 312  ASN A CG    1 
ATOM   2800  O  OD1   . ASN E  3 287  ? 90.631  48.180  60.513  1.00 52.81 ? 312  ASN A OD1   1 
ATOM   2801  N  ND2   . ASN E  3 287  ? 91.597  48.429  62.524  1.00 53.16 ? 312  ASN A ND2   1 
ATOM   2802  N  N     . PRO E  3 288  ? 94.147  44.109  59.611  1.00 54.86 ? 313  PRO A N     1 
ATOM   2803  C  CA    . PRO E  3 288  ? 94.481  42.694  59.450  1.00 55.21 ? 313  PRO A CA    1 
ATOM   2804  C  C     . PRO E  3 288  ? 94.860  42.034  60.772  1.00 55.56 ? 313  PRO A C     1 
ATOM   2805  O  O     . PRO E  3 288  ? 94.710  40.822  60.915  1.00 55.68 ? 313  PRO A O     1 
ATOM   2806  C  CB    . PRO E  3 288  ? 95.692  42.719  58.504  1.00 55.24 ? 313  PRO A CB    1 
ATOM   2807  C  CG    . PRO E  3 288  ? 95.705  44.090  57.903  1.00 55.09 ? 313  PRO A CG    1 
ATOM   2808  C  CD    . PRO E  3 288  ? 95.156  44.971  58.971  1.00 54.97 ? 313  PRO A CD    1 
ATOM   2809  N  N     . GLU E  3 289  ? 95.335  42.836  61.723  1.00 55.86 ? 314  GLU A N     1 
ATOM   2810  C  CA    . GLU E  3 289  ? 95.754  42.351  63.037  1.00 56.28 ? 314  GLU A CA    1 
ATOM   2811  C  C     . GLU E  3 289  ? 94.542  41.901  63.835  1.00 55.99 ? 314  GLU A C     1 
ATOM   2812  O  O     . GLU E  3 289  ? 94.576  40.866  64.504  1.00 55.84 ? 314  GLU A O     1 
ATOM   2813  C  CB    . GLU E  3 289  ? 96.487  43.449  63.812  1.00 56.82 ? 314  GLU A CB    1 
ATOM   2814  C  CG    . GLU E  3 289  ? 96.920  44.654  62.978  1.00 58.96 ? 314  GLU A CG    1 
ATOM   2815  C  CD    . GLU E  3 289  ? 97.932  44.312  61.895  1.00 60.88 ? 314  GLU A CD    1 
ATOM   2816  O  OE1   . GLU E  3 289  ? 98.711  43.350  62.072  1.00 62.07 ? 314  GLU A OE1   1 
ATOM   2817  O  OE2   . GLU E  3 289  ? 97.947  45.013  60.861  1.00 61.89 ? 314  GLU A OE2   1 
ATOM   2818  N  N     . THR E  3 290  ? 93.477  42.699  63.757  1.00 55.78 ? 315  THR A N     1 
ATOM   2819  C  CA    . THR E  3 290  ? 92.206  42.403  64.412  1.00 55.47 ? 315  THR A CA    1 
ATOM   2820  C  C     . THR E  3 290  ? 91.518  41.227  63.724  1.00 55.38 ? 315  THR A C     1 
ATOM   2821  O  O     . THR E  3 290  ? 90.890  40.396  64.382  1.00 55.36 ? 315  THR A O     1 
ATOM   2822  C  CB    . THR E  3 290  ? 91.265  43.625  64.388  1.00 55.29 ? 315  THR A CB    1 
ATOM   2823  O  OG1   . THR E  3 290  ? 92.009  44.811  64.687  1.00 55.20 ? 315  THR A OG1   1 
ATOM   2824  C  CG2   . THR E  3 290  ? 90.153  43.469  65.406  1.00 54.89 ? 315  THR A CG2   1 
ATOM   2825  N  N     . ALA E  3 291  ? 91.643  41.169  62.399  1.00 55.19 ? 316  ALA A N     1 
ATOM   2826  C  CA    . ALA E  3 291  ? 91.104  40.067  61.614  1.00 55.21 ? 316  ALA A CA    1 
ATOM   2827  C  C     . ALA E  3 291  ? 91.714  38.736  62.049  1.00 55.47 ? 316  ALA A C     1 
ATOM   2828  O  O     . ALA E  3 291  ? 90.983  37.773  62.275  1.00 55.87 ? 316  ALA A O     1 
ATOM   2829  C  CB    . ALA E  3 291  ? 91.326  40.307  60.132  1.00 55.05 ? 316  ALA A CB    1 
ATOM   2830  N  N     . LYS E  3 292  ? 93.043  38.694  62.184  1.00 55.54 ? 317  LYS A N     1 
ATOM   2831  C  CA    . LYS E  3 292  ? 93.750  37.492  62.654  1.00 55.61 ? 317  LYS A CA    1 
ATOM   2832  C  C     . LYS E  3 292  ? 93.214  37.038  64.010  1.00 55.05 ? 317  LYS A C     1 
ATOM   2833  O  O     . LYS E  3 292  ? 93.023  35.843  64.244  1.00 54.52 ? 317  LYS A O     1 
ATOM   2834  C  CB    . LYS E  3 292  ? 95.267  37.730  62.755  1.00 56.27 ? 317  LYS A CB    1 
ATOM   2835  C  CG    . LYS E  3 292  ? 96.027  37.989  61.437  1.00 57.88 ? 317  LYS A CG    1 
ATOM   2836  C  CD    . LYS E  3 292  ? 96.000  36.807  60.458  1.00 59.93 ? 317  LYS A CD    1 
ATOM   2837  C  CE    . LYS E  3 292  ? 94.943  36.998  59.363  1.00 61.09 ? 317  LYS A CE    1 
ATOM   2838  N  NZ    . LYS E  3 292  ? 94.784  35.803  58.483  1.00 61.18 ? 317  LYS A NZ    1 
ATOM   2839  N  N     . GLU E  3 293  ? 92.971  38.011  64.886  1.00 54.91 ? 318  GLU A N     1 
ATOM   2840  C  CA    . GLU E  3 293  ? 92.466  37.767  66.234  1.00 54.95 ? 318  GLU A CA    1 
ATOM   2841  C  C     . GLU E  3 293  ? 91.082  37.121  66.204  1.00 54.17 ? 318  GLU A C     1 
ATOM   2842  O  O     . GLU E  3 293  ? 90.852  36.114  66.876  1.00 54.30 ? 318  GLU A O     1 
ATOM   2843  C  CB    . GLU E  3 293  ? 92.436  39.076  67.033  1.00 54.94 ? 318  GLU A CB    1 
ATOM   2844  C  CG    . GLU E  3 293  ? 92.085  38.922  68.507  1.00 55.59 ? 318  GLU A CG    1 
ATOM   2845  C  CD    . GLU E  3 293  ? 91.871  40.259  69.200  1.00 56.11 ? 318  GLU A CD    1 
ATOM   2846  O  OE1   . GLU E  3 293  ? 92.790  41.107  69.174  1.00 57.33 ? 318  GLU A OE1   1 
ATOM   2847  O  OE2   . GLU E  3 293  ? 90.782  40.461  69.779  1.00 57.48 ? 318  GLU A OE2   1 
ATOM   2848  N  N     . ILE E  3 294  ? 90.170  37.699  65.423  1.00 53.22 ? 319  ILE A N     1 
ATOM   2849  C  CA    . ILE E  3 294  ? 88.817  37.161  65.298  1.00 52.32 ? 319  ILE A CA    1 
ATOM   2850  C  C     . ILE E  3 294  ? 88.856  35.779  64.651  1.00 52.01 ? 319  ILE A C     1 
ATOM   2851  O  O     . ILE E  3 294  ? 88.188  34.856  65.113  1.00 51.86 ? 319  ILE A O     1 
ATOM   2852  C  CB    . ILE E  3 294  ? 87.872  38.104  64.511  1.00 52.18 ? 319  ILE A CB    1 
ATOM   2853  C  CG1   . ILE E  3 294  ? 87.813  39.482  65.176  1.00 52.17 ? 319  ILE A CG1   1 
ATOM   2854  C  CG2   . ILE E  3 294  ? 86.465  37.510  64.421  1.00 51.99 ? 319  ILE A CG2   1 
ATOM   2855  C  CD1   . ILE E  3 294  ? 87.067  40.535  64.369  1.00 52.14 ? 319  ILE A CD1   1 
ATOM   2856  N  N     . GLU E  3 295  ? 89.658  35.640  63.599  1.00 51.97 ? 320  GLU A N     1 
ATOM   2857  C  CA    . GLU E  3 295  ? 89.801  34.361  62.906  1.00 52.02 ? 320  GLU A CA    1 
ATOM   2858  C  C     . GLU E  3 295  ? 90.266  33.257  63.856  1.00 51.70 ? 320  GLU A C     1 
ATOM   2859  O  O     . GLU E  3 295  ? 89.680  32.173  63.885  1.00 51.71 ? 320  GLU A O     1 
ATOM   2860  C  CB    . GLU E  3 295  ? 90.761  34.485  61.720  1.00 52.42 ? 320  GLU A CB    1 
ATOM   2861  C  CG    . GLU E  3 295  ? 90.738  33.286  60.780  1.00 52.99 ? 320  GLU A CG    1 
ATOM   2862  C  CD    . GLU E  3 295  ? 92.010  33.145  59.958  1.00 53.74 ? 320  GLU A CD    1 
ATOM   2863  O  OE1   . GLU E  3 295  ? 92.702  34.163  59.712  1.00 54.09 ? 320  GLU A OE1   1 
ATOM   2864  O  OE2   . GLU E  3 295  ? 92.312  32.002  59.554  1.00 53.77 ? 320  GLU A OE2   1 
ATOM   2865  N  N     . LYS E  3 296  ? 91.307  33.545  64.637  1.00 51.34 ? 321  LYS A N     1 
ATOM   2866  C  CA    . LYS E  3 296  ? 91.853  32.581  65.587  1.00 51.23 ? 321  LYS A CA    1 
ATOM   2867  C  C     . LYS E  3 296  ? 90.783  32.073  66.554  1.00 51.11 ? 321  LYS A C     1 
ATOM   2868  O  O     . LYS E  3 296  ? 90.722  30.876  66.846  1.00 50.84 ? 321  LYS A O     1 
ATOM   2869  C  CB    . LYS E  3 296  ? 93.021  33.191  66.363  1.00 51.27 ? 321  LYS A CB    1 
ATOM   2870  C  CG    . LYS E  3 296  ? 93.760  32.190  67.250  1.00 51.56 ? 321  LYS A CG    1 
ATOM   2871  C  CD    . LYS E  3 296  ? 94.836  32.854  68.100  1.00 51.54 ? 321  LYS A CD    1 
ATOM   2872  C  CE    . LYS E  3 296  ? 96.103  33.123  67.300  1.00 51.73 ? 321  LYS A CE    1 
ATOM   2873  N  NZ    . LYS E  3 296  ? 97.069  33.945  68.076  1.00 51.51 ? 321  LYS A NZ    1 
ATOM   2874  N  N     . LYS E  3 297  ? 89.944  32.990  67.036  1.00 51.14 ? 322  LYS A N     1 
ATOM   2875  C  CA    . LYS E  3 297  ? 88.859  32.654  67.958  1.00 51.01 ? 322  LYS A CA    1 
ATOM   2876  C  C     . LYS E  3 297  ? 87.766  31.843  67.286  1.00 50.61 ? 322  LYS A C     1 
ATOM   2877  O  O     . LYS E  3 297  ? 87.248  30.895  67.879  1.00 50.73 ? 322  LYS A O     1 
ATOM   2878  C  CB    . LYS E  3 297  ? 88.270  33.912  68.601  1.00 51.19 ? 322  LYS A CB    1 
ATOM   2879  C  CG    . LYS E  3 297  ? 88.931  34.271  69.911  1.00 52.38 ? 322  LYS A CG    1 
ATOM   2880  C  CD    . LYS E  3 297  ? 88.841  35.758  70.198  1.00 53.41 ? 322  LYS A CD    1 
ATOM   2881  C  CE    . LYS E  3 297  ? 89.649  36.120  71.439  1.00 53.34 ? 322  LYS A CE    1 
ATOM   2882  N  NZ    . LYS E  3 297  ? 89.765  37.589  71.607  1.00 53.24 ? 322  LYS A NZ    1 
ATOM   2883  N  N     . VAL E  3 298  ? 87.422  32.212  66.053  1.00 50.02 ? 323  VAL A N     1 
ATOM   2884  C  CA    . VAL E  3 298  ? 86.429  31.467  65.279  1.00 49.29 ? 323  VAL A CA    1 
ATOM   2885  C  C     . VAL E  3 298  ? 86.899  30.021  65.088  1.00 49.21 ? 323  VAL A C     1 
ATOM   2886  O  O     . VAL E  3 298  ? 86.130  29.079  65.300  1.00 49.50 ? 323  VAL A O     1 
ATOM   2887  C  CB    . VAL E  3 298  ? 86.112  32.150  63.921  1.00 48.81 ? 323  VAL A CB    1 
ATOM   2888  C  CG1   . VAL E  3 298  ? 85.284  31.238  63.024  1.00 48.19 ? 323  VAL A CG1   1 
ATOM   2889  C  CG2   . VAL E  3 298  ? 85.375  33.462  64.143  1.00 48.16 ? 323  VAL A CG2   1 
ATOM   2890  N  N     . ARG E  3 299  ? 88.170  29.857  64.724  1.00 48.73 ? 324  ARG A N     1 
ATOM   2891  C  CA    . ARG E  3 299  ? 88.764  28.534  64.551  1.00 48.58 ? 324  ARG A CA    1 
ATOM   2892  C  C     . ARG E  3 299  ? 88.755  27.720  65.841  1.00 48.74 ? 324  ARG A C     1 
ATOM   2893  O  O     . ARG E  3 299  ? 88.360  26.553  65.833  1.00 48.84 ? 324  ARG A O     1 
ATOM   2894  C  CB    . ARG E  3 299  ? 90.184  28.649  64.002  1.00 48.57 ? 324  ARG A CB    1 
ATOM   2895  C  CG    . ARG E  3 299  ? 90.220  29.037  62.546  1.00 49.27 ? 324  ARG A CG    1 
ATOM   2896  C  CD    . ARG E  3 299  ? 91.629  29.310  62.059  1.00 49.61 ? 324  ARG A CD    1 
ATOM   2897  N  NE    . ARG E  3 299  ? 91.653  29.434  60.602  1.00 49.61 ? 324  ARG A NE    1 
ATOM   2898  C  CZ    . ARG E  3 299  ? 91.827  28.416  59.762  1.00 49.75 ? 324  ARG A CZ    1 
ATOM   2899  N  NH1   . ARG E  3 299  ? 92.015  27.184  60.224  1.00 49.66 ? 324  ARG A NH1   1 
ATOM   2900  N  NH2   . ARG E  3 299  ? 91.819  28.630  58.454  1.00 49.84 ? 324  ARG A NH2   1 
ATOM   2901  N  N     . GLU E  3 300  ? 89.178  28.340  66.944  1.00 48.51 ? 325  GLU A N     1 
ATOM   2902  C  CA    . GLU E  3 300  ? 89.141  27.695  68.258  1.00 48.24 ? 325  GLU A CA    1 
ATOM   2903  C  C     . GLU E  3 300  ? 87.736  27.217  68.609  1.00 46.98 ? 325  GLU A C     1 
ATOM   2904  O  O     . GLU E  3 300  ? 87.559  26.095  69.076  1.00 46.55 ? 325  GLU A O     1 
ATOM   2905  C  CB    . GLU E  3 300  ? 89.667  28.638  69.339  1.00 48.54 ? 325  GLU A CB    1 
ATOM   2906  C  CG    . GLU E  3 300  ? 91.188  28.709  69.401  1.00 49.73 ? 325  GLU A CG    1 
ATOM   2907  C  CD    . GLU E  3 300  ? 91.705  29.875  70.235  1.00 49.99 ? 325  GLU A CD    1 
ATOM   2908  O  OE1   . GLU E  3 300  ? 90.972  30.372  71.120  1.00 51.25 ? 325  GLU A OE1   1 
ATOM   2909  O  OE2   . GLU E  3 300  ? 92.859  30.295  70.005  1.00 51.30 ? 325  GLU A OE2   1 
ATOM   2910  N  N     . LEU E  3 301  ? 86.748  28.069  68.353  1.00 46.21 ? 326  LEU A N     1 
ATOM   2911  C  CA    . LEU E  3 301  ? 85.345  27.753  68.613  1.00 45.51 ? 326  LEU A CA    1 
ATOM   2912  C  C     . LEU E  3 301  ? 84.762  26.665  67.713  1.00 45.21 ? 326  LEU A C     1 
ATOM   2913  O  O     . LEU E  3 301  ? 83.931  25.877  68.163  1.00 45.07 ? 326  LEU A O     1 
ATOM   2914  C  CB    . LEU E  3 301  ? 84.480  29.011  68.487  1.00 45.33 ? 326  LEU A CB    1 
ATOM   2915  C  CG    . LEU E  3 301  ? 84.487  30.023  69.632  1.00 44.69 ? 326  LEU A CG    1 
ATOM   2916  C  CD1   . LEU E  3 301  ? 83.823  31.315  69.198  1.00 44.27 ? 326  LEU A CD1   1 
ATOM   2917  C  CD2   . LEU E  3 301  ? 83.799  29.469  70.831  1.00 44.60 ? 326  LEU A CD2   1 
ATOM   2918  N  N     . LEU E  3 302  ? 85.189  26.618  66.451  1.00 44.83 ? 327  LEU A N     1 
ATOM   2919  C  CA    . LEU E  3 302  ? 84.476  25.814  65.451  1.00 44.39 ? 327  LEU A CA    1 
ATOM   2920  C  C     . LEU E  3 302  ? 85.229  24.645  64.790  1.00 44.29 ? 327  LEU A C     1 
ATOM   2921  O  O     . LEU E  3 302  ? 84.603  23.789  64.158  1.00 43.99 ? 327  LEU A O     1 
ATOM   2922  C  CB    . LEU E  3 302  ? 83.836  26.724  64.392  1.00 44.27 ? 327  LEU A CB    1 
ATOM   2923  C  CG    . LEU E  3 302  ? 82.687  27.635  64.855  1.00 43.50 ? 327  LEU A CG    1 
ATOM   2924  C  CD1   . LEU E  3 302  ? 82.218  28.520  63.712  1.00 43.39 ? 327  LEU A CD1   1 
ATOM   2925  C  CD2   . LEU E  3 302  ? 81.516  26.837  65.421  1.00 42.85 ? 327  LEU A CD2   1 
ATOM   2926  N  N     . LEU E  3 303  ? 86.553  24.609  64.923  1.00 44.50 ? 328  LEU A N     1 
ATOM   2927  C  CA    . LEU E  3 303  ? 87.327  23.475  64.408  1.00 44.79 ? 328  LEU A CA    1 
ATOM   2928  C  C     . LEU E  3 303  ? 87.166  22.273  65.331  1.00 45.05 ? 328  LEU A C     1 
ATOM   2929  O  O     . LEU E  3 303  ? 87.521  22.330  66.510  1.00 45.17 ? 328  LEU A O     1 
ATOM   2930  C  CB    . LEU E  3 303  ? 88.806  23.832  64.213  1.00 44.57 ? 328  LEU A CB    1 
ATOM   2931  C  CG    . LEU E  3 303  ? 89.180  24.842  63.122  1.00 44.42 ? 328  LEU A CG    1 
ATOM   2932  C  CD1   . LEU E  3 303  ? 90.692  24.974  63.023  1.00 44.08 ? 328  LEU A CD1   1 
ATOM   2933  C  CD2   . LEU E  3 303  ? 88.588  24.453  61.773  1.00 44.35 ? 328  LEU A CD2   1 
ATOM   2934  N  N     . SER E  3 304  ? 86.573  21.212  64.788  1.00 45.50 ? 329  SER A N     1 
ATOM   2935  C  CA    . SER E  3 304  ? 86.241  20.003  65.543  1.00 45.96 ? 329  SER A CA    1 
ATOM   2936  C  C     . SER E  3 304  ? 87.484  19.191  65.893  1.00 46.44 ? 329  SER A C     1 
ATOM   2937  O  O     . SER E  3 304  ? 87.598  18.664  67.005  1.00 46.27 ? 329  SER A O     1 
ATOM   2938  C  CB    . SER E  3 304  ? 85.259  19.138  64.750  1.00 45.91 ? 329  SER A CB    1 
ATOM   2939  O  OG    . SER E  3 304  ? 85.786  18.802  63.476  1.00 45.01 ? 329  SER A OG    1 
ATOM   2940  N  N     . ASN E  3 305  ? 88.399  19.087  64.929  1.00 46.93 ? 330  ASN A N     1 
ATOM   2941  C  CA    . ASN E  3 305  ? 89.683  18.424  65.130  1.00 47.35 ? 330  ASN A CA    1 
ATOM   2942  C  C     . ASN E  3 305  ? 90.789  19.449  65.374  1.00 47.71 ? 330  ASN A C     1 
ATOM   2943  O  O     . ASN E  3 305  ? 91.050  20.291  64.504  1.00 47.93 ? 330  ASN A O     1 
ATOM   2944  C  CB    . ASN E  3 305  ? 90.037  17.543  63.925  1.00 47.21 ? 330  ASN A CB    1 
ATOM   2945  C  CG    . ASN E  3 305  ? 89.063  16.393  63.728  1.00 47.16 ? 330  ASN A CG    1 
ATOM   2946  O  OD1   . ASN E  3 305  ? 87.853  16.545  63.913  1.00 46.95 ? 330  ASN A OD1   1 
ATOM   2947  N  ND2   . ASN E  3 305  ? 89.588  15.234  63.341  1.00 46.91 ? 330  ASN A ND2   1 
ATOM   2948  N  N     . PRO E  3 306  ? 91.426  19.402  66.566  1.00 47.82 ? 331  PRO A N     1 
ATOM   2949  C  CA    . PRO E  3 306  ? 92.558  20.292  66.859  1.00 47.82 ? 331  PRO A CA    1 
ATOM   2950  C  C     . PRO E  3 306  ? 93.792  19.974  66.005  1.00 47.67 ? 331  PRO A C     1 
ATOM   2951  O  O     . PRO E  3 306  ? 94.072  18.803  65.732  1.00 47.45 ? 331  PRO A O     1 
ATOM   2952  C  CB    . PRO E  3 306  ? 92.842  20.032  68.351  1.00 47.93 ? 331  PRO A CB    1 
ATOM   2953  C  CG    . PRO E  3 306  ? 91.613  19.328  68.878  1.00 47.77 ? 331  PRO A CG    1 
ATOM   2954  C  CD    . PRO E  3 306  ? 91.104  18.535  67.716  1.00 47.70 ? 331  PRO A CD    1 
ATOM   2955  N  N     . ASN E  3 307  ? 94.507  21.015  65.583  1.00 47.65 ? 332  ASN A N     1 
ATOM   2956  C  CA    . ASN E  3 307  ? 95.727  20.858  64.788  1.00 47.68 ? 332  ASN A CA    1 
ATOM   2957  C  C     . ASN E  3 307  ? 96.901  20.304  65.607  1.00 47.91 ? 332  ASN A C     1 
ATOM   2958  O  O     . ASN E  3 307  ? 97.796  19.649  65.062  1.00 47.95 ? 332  ASN A O     1 
ATOM   2959  C  CB    . ASN E  3 307  ? 96.112  22.185  64.123  1.00 47.37 ? 332  ASN A CB    1 
ATOM   2960  C  CG    . ASN E  3 307  ? 97.040  21.998  62.932  1.00 46.91 ? 332  ASN A CG    1 
ATOM   2961  O  OD1   . ASN E  3 307  ? 98.245  22.233  63.025  1.00 46.38 ? 332  ASN A OD1   1 
ATOM   2962  N  ND2   . ASN E  3 307  ? 96.480  21.569  61.806  1.00 46.43 ? 332  ASN A ND2   1 
ATOM   2963  N  N     . SER E  3 308  ? 96.887  20.577  66.913  1.00 47.93 ? 333  SER A N     1 
ATOM   2964  C  CA    . SER E  3 308  ? 97.896  20.073  67.845  1.00 47.78 ? 333  SER A CA    1 
ATOM   2965  C  C     . SER E  3 308  ? 97.340  20.050  69.267  1.00 47.68 ? 333  SER A C     1 
ATOM   2966  O  O     . SER E  3 308  ? 98.061  19.773  70.226  1.00 47.62 ? 333  SER A O     1 
ATOM   2967  C  CB    . SER E  3 308  ? 99.170  20.923  67.782  1.00 47.74 ? 333  SER A CB    1 
ATOM   2968  O  OG    . SER E  3 308  ? 98.879  22.289  68.018  1.00 47.86 ? 333  SER A OG    1 
ATOM   2969  N  N     . ALA E  3 325  ? 119.671 26.367  55.774  1.00 95.12 ? 1001 ALA A N     1 
ATOM   2970  C  CA    . ALA E  3 325  ? 120.272 25.002  55.781  1.00 95.11 ? 1001 ALA A CA    1 
ATOM   2971  C  C     . ALA E  3 325  ? 119.255 23.938  55.364  1.00 95.13 ? 1001 ALA A C     1 
ATOM   2972  O  O     . ALA E  3 325  ? 119.614 22.934  54.743  1.00 95.23 ? 1001 ALA A O     1 
ATOM   2973  C  CB    . ALA E  3 325  ? 120.851 24.685  57.158  1.00 94.91 ? 1001 ALA A CB    1 
ATOM   2974  N  N     . ILE E  3 326  ? 117.988 24.177  55.694  1.00 94.99 ? 1002 ILE A N     1 
ATOM   2975  C  CA    . ILE E  3 326  ? 116.914 23.201  55.482  1.00 94.83 ? 1002 ILE A CA    1 
ATOM   2976  C  C     . ILE E  3 326  ? 116.292 23.308  54.082  1.00 94.54 ? 1002 ILE A C     1 
ATOM   2977  O  O     . ILE E  3 326  ? 116.026 22.291  53.432  1.00 94.51 ? 1002 ILE A O     1 
ATOM   2978  C  CB    . ILE E  3 326  ? 115.803 23.335  56.570  1.00 94.93 ? 1002 ILE A CB    1 
ATOM   2979  C  CG1   . ILE E  3 326  ? 116.418 23.650  57.945  1.00 95.03 ? 1002 ILE A CG1   1 
ATOM   2980  C  CG2   . ILE E  3 326  ? 114.930 22.072  56.615  1.00 94.78 ? 1002 ILE A CG2   1 
ATOM   2981  C  CD1   . ILE E  3 326  ? 115.508 24.433  58.885  1.00 95.00 ? 1002 ILE A CD1   1 
ATOM   2982  N  N     . ASP E  3 327  ? 116.069 24.543  53.630  1.00 94.10 ? 1003 ASP A N     1 
ATOM   2983  C  CA    . ASP E  3 327  ? 115.417 24.816  52.342  1.00 93.42 ? 1003 ASP A CA    1 
ATOM   2984  C  C     . ASP E  3 327  ? 116.394 24.872  51.160  1.00 92.50 ? 1003 ASP A C     1 
ATOM   2985  O  O     . ASP E  3 327  ? 115.979 24.855  49.996  1.00 92.45 ? 1003 ASP A O     1 
ATOM   2986  C  CB    . ASP E  3 327  ? 114.575 26.103  52.417  1.00 93.72 ? 1003 ASP A CB    1 
ATOM   2987  C  CG    . ASP E  3 327  ? 115.381 27.328  52.871  1.00 93.99 ? 1003 ASP A CG    1 
ATOM   2988  O  OD1   . ASP E  3 327  ? 116.610 27.224  53.089  1.00 93.58 ? 1003 ASP A OD1   1 
ATOM   2989  O  OD2   . ASP E  3 327  ? 114.771 28.410  53.011  1.00 94.28 ? 1003 ASP A OD2   1 
ATOM   2990  N  N     . GLU E  3 328  ? 117.686 24.945  51.471  1.00 91.15 ? 1004 GLU A N     1 
ATOM   2991  C  CA    . GLU E  3 328  ? 118.730 24.967  50.450  1.00 89.84 ? 1004 GLU A CA    1 
ATOM   2992  C  C     . GLU E  3 328  ? 118.972 23.580  49.872  1.00 88.44 ? 1004 GLU A C     1 
ATOM   2993  O  O     . GLU E  3 328  ? 119.346 23.444  48.706  1.00 88.42 ? 1004 GLU A O     1 
ATOM   2994  C  CB    . GLU E  3 328  ? 120.012 25.549  51.028  1.00 90.23 ? 1004 GLU A CB    1 
ATOM   2995  C  CG    . GLU E  3 328  ? 119.897 27.034  51.287  1.00 91.43 ? 1004 GLU A CG    1 
ATOM   2996  C  CD    . GLU E  3 328  ? 120.447 27.467  52.635  1.00 92.46 ? 1004 GLU A CD    1 
ATOM   2997  O  OE1   . GLU E  3 328  ? 121.435 26.870  53.113  1.00 93.06 ? 1004 GLU A OE1   1 
ATOM   2998  O  OE2   . GLU E  3 328  ? 119.889 28.425  53.210  1.00 92.85 ? 1004 GLU A OE2   1 
ATOM   2999  N  N     . ASN E  3 329  ? 118.755 22.557  50.696  1.00 86.66 ? 1005 ASN A N     1 
ATOM   3000  C  CA    . ASN E  3 329  ? 118.748 21.172  50.234  1.00 84.85 ? 1005 ASN A CA    1 
ATOM   3001  C  C     . ASN E  3 329  ? 117.590 20.896  49.284  1.00 83.62 ? 1005 ASN A C     1 
ATOM   3002  O  O     . ASN E  3 329  ? 117.723 20.108  48.347  1.00 83.40 ? 1005 ASN A O     1 
ATOM   3003  C  CB    . ASN E  3 329  ? 118.672 20.212  51.418  1.00 84.76 ? 1005 ASN A CB    1 
ATOM   3004  C  CG    . ASN E  3 329  ? 120.030 19.897  51.998  1.00 84.42 ? 1005 ASN A CG    1 
ATOM   3005  O  OD1   . ASN E  3 329  ? 120.958 19.529  51.277  1.00 84.15 ? 1005 ASN A OD1   1 
ATOM   3006  N  ND2   . ASN E  3 329  ? 120.153 20.029  53.311  1.00 84.27 ? 1005 ASN A ND2   1 
ATOM   3007  N  N     . LYS E  3 330  ? 116.459 21.553  49.542  1.00 82.17 ? 1006 LYS A N     1 
ATOM   3008  C  CA    . LYS E  3 330  ? 115.248 21.404  48.737  1.00 80.64 ? 1006 LYS A CA    1 
ATOM   3009  C  C     . LYS E  3 330  ? 115.451 21.892  47.310  1.00 79.44 ? 1006 LYS A C     1 
ATOM   3010  O  O     . LYS E  3 330  ? 115.054 21.218  46.361  1.00 79.45 ? 1006 LYS A O     1 
ATOM   3011  C  CB    . LYS E  3 330  ? 114.071 22.144  49.381  1.00 80.60 ? 1006 LYS A CB    1 
ATOM   3012  C  CG    . LYS E  3 330  ? 113.481 21.450  50.605  1.00 80.65 ? 1006 LYS A CG    1 
ATOM   3013  C  CD    . LYS E  3 330  ? 112.263 22.189  51.146  1.00 80.77 ? 1006 LYS A CD    1 
ATOM   3014  C  CE    . LYS E  3 330  ? 111.031 21.971  50.268  1.00 81.17 ? 1006 LYS A CE    1 
ATOM   3015  N  NZ    . LYS E  3 330  ? 109.824 22.656  50.806  1.00 81.58 ? 1006 LYS A NZ    1 
ATOM   3016  N  N     . GLN E  3 331  ? 116.077 23.058  47.169  1.00 77.94 ? 1007 GLN A N     1 
ATOM   3017  C  CA    . GLN E  3 331  ? 116.330 23.655  45.858  1.00 76.50 ? 1007 GLN A CA    1 
ATOM   3018  C  C     . GLN E  3 331  ? 117.324 22.837  45.046  1.00 75.03 ? 1007 GLN A C     1 
ATOM   3019  O  O     . GLN E  3 331  ? 117.187 22.707  43.829  1.00 74.89 ? 1007 GLN A O     1 
ATOM   3020  C  CB    . GLN E  3 331  ? 116.818 25.091  46.011  1.00 76.72 ? 1007 GLN A CB    1 
ATOM   3021  C  CG    . GLN E  3 331  ? 115.751 26.026  46.542  1.00 76.93 ? 1007 GLN A CG    1 
ATOM   3022  C  CD    . GLN E  3 331  ? 116.163 27.474  46.483  1.00 76.91 ? 1007 GLN A CD    1 
ATOM   3023  O  OE1   . GLN E  3 331  ? 117.259 27.841  46.913  1.00 76.74 ? 1007 GLN A OE1   1 
ATOM   3024  N  NE2   . GLN E  3 331  ? 115.282 28.313  45.952  1.00 76.76 ? 1007 GLN A NE2   1 
ATOM   3025  N  N     . LYS E  3 332  ? 118.321 22.292  45.738  1.00 73.32 ? 1008 LYS A N     1 
ATOM   3026  C  CA    . LYS E  3 332  ? 119.276 21.354  45.161  1.00 71.74 ? 1008 LYS A CA    1 
ATOM   3027  C  C     . LYS E  3 332  ? 118.540 20.182  44.498  1.00 70.30 ? 1008 LYS A C     1 
ATOM   3028  O  O     . LYS E  3 332  ? 118.858 19.809  43.369  1.00 70.04 ? 1008 LYS A O     1 
ATOM   3029  C  CB    . LYS E  3 332  ? 120.239 20.880  46.260  1.00 71.96 ? 1008 LYS A CB    1 
ATOM   3030  C  CG    . LYS E  3 332  ? 121.250 19.798  45.890  1.00 72.07 ? 1008 LYS A CG    1 
ATOM   3031  C  CD    . LYS E  3 332  ? 122.159 19.524  47.093  1.00 71.96 ? 1008 LYS A CD    1 
ATOM   3032  C  CE    . LYS E  3 332  ? 122.548 18.057  47.220  1.00 71.92 ? 1008 LYS A CE    1 
ATOM   3033  N  NZ    . LYS E  3 332  ? 123.707 17.694  46.363  1.00 71.64 ? 1008 LYS A NZ    1 
ATOM   3034  N  N     . ALA E  3 333  ? 117.542 19.634  45.193  1.00 68.69 ? 1009 ALA A N     1 
ATOM   3035  C  CA    . ALA E  3 333  ? 116.746 18.515  44.681  1.00 67.04 ? 1009 ALA A CA    1 
ATOM   3036  C  C     . ALA E  3 333  ? 115.677 18.952  43.677  1.00 65.93 ? 1009 ALA A C     1 
ATOM   3037  O  O     . ALA E  3 333  ? 115.283 18.170  42.806  1.00 65.91 ? 1009 ALA A O     1 
ATOM   3038  C  CB    . ALA E  3 333  ? 116.114 17.737  45.831  1.00 66.92 ? 1009 ALA A CB    1 
ATOM   3039  N  N     . LEU E  3 334  ? 115.209 20.194  43.808  1.00 64.49 ? 1010 LEU A N     1 
ATOM   3040  C  CA    . LEU E  3 334  ? 114.217 20.767  42.893  1.00 63.03 ? 1010 LEU A CA    1 
ATOM   3041  C  C     . LEU E  3 334  ? 114.794 20.921  41.492  1.00 62.31 ? 1010 LEU A C     1 
ATOM   3042  O  O     . LEU E  3 334  ? 114.262 20.359  40.535  1.00 62.23 ? 1010 LEU A O     1 
ATOM   3043  C  CB    . LEU E  3 334  ? 113.717 22.123  43.410  1.00 62.88 ? 1010 LEU A CB    1 
ATOM   3044  C  CG    . LEU E  3 334  ? 112.766 22.938  42.524  1.00 62.24 ? 1010 LEU A CG    1 
ATOM   3045  C  CD1   . LEU E  3 334  ? 111.326 22.536  42.745  1.00 61.09 ? 1010 LEU A CD1   1 
ATOM   3046  C  CD2   . LEU E  3 334  ? 112.938 24.423  42.790  1.00 62.69 ? 1010 LEU A CD2   1 
ATOM   3047  N  N     . ALA E  3 335  ? 115.883 21.682  41.388  1.00 61.50 ? 1011 ALA A N     1 
ATOM   3048  C  CA    . ALA E  3 335  ? 116.578 21.894  40.123  1.00 60.64 ? 1011 ALA A CA    1 
ATOM   3049  C  C     . ALA E  3 335  ? 116.977 20.568  39.474  1.00 60.11 ? 1011 ALA A C     1 
ATOM   3050  O  O     . ALA E  3 335  ? 116.898 20.424  38.255  1.00 60.18 ? 1011 ALA A O     1 
ATOM   3051  C  CB    . ALA E  3 335  ? 117.794 22.781  40.329  1.00 60.72 ? 1011 ALA A CB    1 
ATOM   3052  N  N     . ALA E  3 336  ? 117.387 19.605  40.298  1.00 59.55 ? 1012 ALA A N     1 
ATOM   3053  C  CA    . ALA E  3 336  ? 117.710 18.255  39.837  1.00 58.99 ? 1012 ALA A CA    1 
ATOM   3054  C  C     . ALA E  3 336  ? 116.520 17.589  39.145  1.00 58.82 ? 1012 ALA A C     1 
ATOM   3055  O  O     . ALA E  3 336  ? 116.685 16.939  38.113  1.00 59.14 ? 1012 ALA A O     1 
ATOM   3056  C  CB    . ALA E  3 336  ? 118.199 17.400  40.996  1.00 58.79 ? 1012 ALA A CB    1 
ATOM   3057  N  N     . ALA E  3 337  ? 115.327 17.763  39.712  1.00 58.36 ? 1013 ALA A N     1 
ATOM   3058  C  CA    . ALA E  3 337  ? 114.110 17.183  39.147  1.00 57.90 ? 1013 ALA A CA    1 
ATOM   3059  C  C     . ALA E  3 337  ? 113.661 17.912  37.886  1.00 57.52 ? 1013 ALA A C     1 
ATOM   3060  O  O     . ALA E  3 337  ? 113.297 17.273  36.902  1.00 57.36 ? 1013 ALA A O     1 
ATOM   3061  C  CB    . ALA E  3 337  ? 113.000 17.172  40.176  1.00 58.11 ? 1013 ALA A CB    1 
ATOM   3062  N  N     . LEU E  3 338  ? 113.694 19.243  37.924  1.00 57.28 ? 1014 LEU A N     1 
ATOM   3063  C  CA    . LEU E  3 338  ? 113.336 20.073  36.773  1.00 57.23 ? 1014 LEU A CA    1 
ATOM   3064  C  C     . LEU E  3 338  ? 114.234 19.795  35.574  1.00 57.29 ? 1014 LEU A C     1 
ATOM   3065  O  O     . LEU E  3 338  ? 113.762 19.734  34.442  1.00 57.21 ? 1014 LEU A O     1 
ATOM   3066  C  CB    . LEU E  3 338  ? 113.390 21.558  37.136  1.00 57.17 ? 1014 LEU A CB    1 
ATOM   3067  C  CG    . LEU E  3 338  ? 112.116 22.255  37.623  1.00 57.01 ? 1014 LEU A CG    1 
ATOM   3068  C  CD1   . LEU E  3 338  ? 111.730 21.823  39.023  1.00 56.75 ? 1014 LEU A CD1   1 
ATOM   3069  C  CD2   . LEU E  3 338  ? 112.314 23.759  37.578  1.00 57.43 ? 1014 LEU A CD2   1 
ATOM   3070  N  N     . GLY E  3 339  ? 115.527 19.629  35.835  1.00 57.77 ? 1015 GLY A N     1 
ATOM   3071  C  CA    . GLY E  3 339  ? 116.485 19.251  34.800  1.00 58.61 ? 1015 GLY A CA    1 
ATOM   3072  C  C     . GLY E  3 339  ? 116.163 17.884  34.228  1.00 59.15 ? 1015 GLY A C     1 
ATOM   3073  O  O     . GLY E  3 339  ? 116.156 17.697  33.011  1.00 59.22 ? 1015 GLY A O     1 
ATOM   3074  N  N     . GLN E  3 340  ? 115.885 16.936  35.120  1.00 59.75 ? 1016 GLN A N     1 
ATOM   3075  C  CA    . GLN E  3 340  ? 115.490 15.577  34.749  1.00 60.37 ? 1016 GLN A CA    1 
ATOM   3076  C  C     . GLN E  3 340  ? 114.233 15.563  33.873  1.00 60.33 ? 1016 GLN A C     1 
ATOM   3077  O  O     . GLN E  3 340  ? 114.183 14.854  32.864  1.00 60.03 ? 1016 GLN A O     1 
ATOM   3078  C  CB    . GLN E  3 340  ? 115.315 14.719  36.016  1.00 60.81 ? 1016 GLN A CB    1 
ATOM   3079  C  CG    . GLN E  3 340  ? 114.227 13.636  35.972  1.00 62.43 ? 1016 GLN A CG    1 
ATOM   3080  C  CD    . GLN E  3 340  ? 114.592 12.424  35.123  1.00 63.98 ? 1016 GLN A CD    1 
ATOM   3081  O  OE1   . GLN E  3 340  ? 115.661 12.367  34.510  1.00 65.10 ? 1016 GLN A OE1   1 
ATOM   3082  N  NE2   . GLN E  3 340  ? 113.695 11.442  35.089  1.00 64.18 ? 1016 GLN A NE2   1 
ATOM   3083  N  N     . ILE E  3 341  ? 113.239 16.360  34.260  1.00 60.59 ? 1017 ILE A N     1 
ATOM   3084  C  CA    . ILE E  3 341  ? 111.966 16.449  33.544  1.00 60.77 ? 1017 ILE A CA    1 
ATOM   3085  C  C     . ILE E  3 341  ? 112.163 17.007  32.143  1.00 61.18 ? 1017 ILE A C     1 
ATOM   3086  O  O     . ILE E  3 341  ? 111.657 16.447  31.170  1.00 61.29 ? 1017 ILE A O     1 
ATOM   3087  C  CB    . ILE E  3 341  ? 110.935 17.313  34.313  1.00 60.56 ? 1017 ILE A CB    1 
ATOM   3088  C  CG1   . ILE E  3 341  ? 110.483 16.596  35.586  1.00 60.93 ? 1017 ILE A CG1   1 
ATOM   3089  C  CG2   . ILE E  3 341  ? 109.721 17.619  33.445  1.00 60.35 ? 1017 ILE A CG2   1 
ATOM   3090  C  CD1   . ILE E  3 341  ? 109.779 17.491  36.587  1.00 61.44 ? 1017 ILE A CD1   1 
ATOM   3091  N  N     . GLU E  3 342  ? 112.911 18.102  32.050  1.00 61.84 ? 1018 GLU A N     1 
ATOM   3092  C  CA    . GLU E  3 342  ? 113.127 18.778  30.778  1.00 62.73 ? 1018 GLU A CA    1 
ATOM   3093  C  C     . GLU E  3 342  ? 113.957 17.939  29.827  1.00 62.79 ? 1018 GLU A C     1 
ATOM   3094  O  O     . GLU E  3 342  ? 113.721 17.956  28.620  1.00 62.93 ? 1018 GLU A O     1 
ATOM   3095  C  CB    . GLU E  3 342  ? 113.764 20.146  30.990  1.00 63.31 ? 1018 GLU A CB    1 
ATOM   3096  C  CG    . GLU E  3 342  ? 112.819 21.136  31.654  1.00 65.59 ? 1018 GLU A CG    1 
ATOM   3097  C  CD    . GLU E  3 342  ? 113.009 22.559  31.166  1.00 66.92 ? 1018 GLU A CD    1 
ATOM   3098  O  OE1   . GLU E  3 342  ? 111.982 23.217  30.877  1.00 67.28 ? 1018 GLU A OE1   1 
ATOM   3099  O  OE2   . GLU E  3 342  ? 114.174 23.013  31.064  1.00 67.07 ? 1018 GLU A OE2   1 
ATOM   3100  N  N     . LYS E  3 343  ? 114.912 17.194  30.378  1.00 63.15 ? 1019 LYS A N     1 
ATOM   3101  C  CA    . LYS E  3 343  ? 115.736 16.294  29.580  1.00 63.83 ? 1019 LYS A CA    1 
ATOM   3102  C  C     . LYS E  3 343  ? 114.927 15.099  29.088  1.00 64.10 ? 1019 LYS A C     1 
ATOM   3103  O  O     . LYS E  3 343  ? 115.258 14.498  28.064  1.00 64.07 ? 1019 LYS A O     1 
ATOM   3104  C  CB    . LYS E  3 343  ? 116.952 15.816  30.373  1.00 64.11 ? 1019 LYS A CB    1 
ATOM   3105  C  CG    . LYS E  3 343  ? 118.184 15.570  29.503  1.00 64.55 ? 1019 LYS A CG    1 
ATOM   3106  C  CD    . LYS E  3 343  ? 119.279 14.810  30.237  1.00 64.75 ? 1019 LYS A CD    1 
ATOM   3107  C  CE    . LYS E  3 343  ? 118.960 13.323  30.331  1.00 64.96 ? 1019 LYS A CE    1 
ATOM   3108  N  NZ    . LYS E  3 343  ? 120.148 12.533  30.747  1.00 65.64 ? 1019 LYS A NZ    1 
ATOM   3109  N  N     . GLN E  3 344  ? 113.868 14.764  29.822  1.00 64.42 ? 1020 GLN A N     1 
ATOM   3110  C  CA    . GLN E  3 344  ? 112.982 13.668  29.449  1.00 64.90 ? 1020 GLN A CA    1 
ATOM   3111  C  C     . GLN E  3 344  ? 111.871 14.076  28.498  1.00 64.84 ? 1020 GLN A C     1 
ATOM   3112  O  O     . GLN E  3 344  ? 111.559 13.342  27.566  1.00 64.65 ? 1020 GLN A O     1 
ATOM   3113  C  CB    . GLN E  3 344  ? 112.349 13.046  30.684  1.00 65.54 ? 1020 GLN A CB    1 
ATOM   3114  C  CG    . GLN E  3 344  ? 113.076 11.833  31.208  1.00 67.17 ? 1020 GLN A CG    1 
ATOM   3115  C  CD    . GLN E  3 344  ? 112.138 10.855  31.889  1.00 68.29 ? 1020 GLN A CD    1 
ATOM   3116  O  OE1   . GLN E  3 344  ? 111.316 11.234  32.726  1.00 68.88 ? 1020 GLN A OE1   1 
ATOM   3117  N  NE2   . GLN E  3 344  ? 112.254 9.584   31.527  1.00 68.58 ? 1020 GLN A NE2   1 
ATOM   3118  N  N     . PHE E  3 345  ? 111.267 15.235  28.742  1.00 65.18 ? 1021 PHE A N     1 
ATOM   3119  C  CA    . PHE E  3 345  ? 110.070 15.636  28.003  1.00 65.53 ? 1021 PHE A CA    1 
ATOM   3120  C  C     . PHE E  3 345  ? 110.236 16.902  27.165  1.00 65.17 ? 1021 PHE A C     1 
ATOM   3121  O  O     . PHE E  3 345  ? 109.252 17.551  26.798  1.00 65.76 ? 1021 PHE A O     1 
ATOM   3122  C  CB    . PHE E  3 345  ? 108.869 15.739  28.948  1.00 66.27 ? 1021 PHE A CB    1 
ATOM   3123  C  CG    . PHE E  3 345  ? 108.579 14.464  29.693  1.00 67.46 ? 1021 PHE A CG    1 
ATOM   3124  C  CD1   . PHE E  3 345  ? 108.066 13.353  29.025  1.00 68.39 ? 1021 PHE A CD1   1 
ATOM   3125  C  CD2   . PHE E  3 345  ? 108.825 14.371  31.060  1.00 67.65 ? 1021 PHE A CD2   1 
ATOM   3126  C  CE1   . PHE E  3 345  ? 107.800 12.168  29.709  1.00 68.49 ? 1021 PHE A CE1   1 
ATOM   3127  C  CE2   . PHE E  3 345  ? 108.561 13.191  31.755  1.00 67.73 ? 1021 PHE A CE2   1 
ATOM   3128  C  CZ    . PHE E  3 345  ? 108.048 12.087  31.079  1.00 67.72 ? 1021 PHE A CZ    1 
ATOM   3129  N  N     . GLY E  3 346  ? 111.482 17.244  26.858  1.00 64.13 ? 1022 GLY A N     1 
ATOM   3130  C  CA    . GLY E  3 346  ? 111.759 18.292  25.894  1.00 63.32 ? 1022 GLY A CA    1 
ATOM   3131  C  C     . GLY E  3 346  ? 111.921 19.688  26.455  1.00 63.05 ? 1022 GLY A C     1 
ATOM   3132  O  O     . GLY E  3 346  ? 111.782 19.915  27.662  1.00 62.57 ? 1022 GLY A O     1 
ATOM   3133  N  N     . LYS E  3 347  ? 112.198 20.613  25.534  1.00 63.18 ? 1023 LYS A N     1 
ATOM   3134  C  CA    . LYS E  3 347  ? 112.548 22.017  25.799  1.00 62.64 ? 1023 LYS A CA    1 
ATOM   3135  C  C     . LYS E  3 347  ? 111.853 22.615  27.025  1.00 61.46 ? 1023 LYS A C     1 
ATOM   3136  O  O     . LYS E  3 347  ? 112.408 22.589  28.118  1.00 61.45 ? 1023 LYS A O     1 
ATOM   3137  C  CB    . LYS E  3 347  ? 112.291 22.886  24.548  1.00 63.22 ? 1023 LYS A CB    1 
ATOM   3138  C  CG    . LYS E  3 347  ? 112.760 22.278  23.213  1.00 63.65 ? 1023 LYS A CG    1 
ATOM   3139  C  CD    . LYS E  3 347  ? 114.172 22.710  22.829  1.00 63.96 ? 1023 LYS A CD    1 
ATOM   3140  C  CE    . LYS E  3 347  ? 114.159 24.000  22.017  1.00 64.02 ? 1023 LYS A CE    1 
ATOM   3141  N  NZ    . LYS E  3 347  ? 115.532 24.408  21.611  1.00 63.81 ? 1023 LYS A NZ    1 
ATOM   3142  N  N     . GLY E  3 348  ? 110.645 23.140  26.847  1.00 60.04 ? 1024 GLY A N     1 
ATOM   3143  C  CA    . GLY E  3 348  ? 109.960 23.834  27.931  1.00 58.29 ? 1024 GLY A CA    1 
ATOM   3144  C  C     . GLY E  3 348  ? 108.769 23.077  28.469  1.00 57.06 ? 1024 GLY A C     1 
ATOM   3145  O  O     . GLY E  3 348  ? 107.679 23.640  28.578  1.00 57.08 ? 1024 GLY A O     1 
ATOM   3146  N  N     . SER E  3 349  ? 108.978 21.806  28.812  1.00 55.85 ? 1025 SER A N     1 
ATOM   3147  C  CA    . SER E  3 349  ? 107.901 20.950  29.321  1.00 54.92 ? 1025 SER A CA    1 
ATOM   3148  C  C     . SER E  3 349  ? 107.411 21.370  30.707  1.00 54.70 ? 1025 SER A C     1 
ATOM   3149  O  O     . SER E  3 349  ? 106.245 21.165  31.044  1.00 54.51 ? 1025 SER A O     1 
ATOM   3150  C  CB    . SER E  3 349  ? 108.322 19.483  29.323  1.00 54.33 ? 1025 SER A CB    1 
ATOM   3151  O  OG    . SER E  3 349  ? 109.634 19.343  29.823  1.00 54.26 ? 1025 SER A OG    1 
ATOM   3152  N  N     . ILE E  3 350  ? 108.306 21.956  31.501  1.00 54.36 ? 1026 ILE A N     1 
ATOM   3153  C  CA    . ILE E  3 350  ? 107.934 22.577  32.772  1.00 53.57 ? 1026 ILE A CA    1 
ATOM   3154  C  C     . ILE E  3 350  ? 108.707 23.880  32.977  1.00 53.40 ? 1026 ILE A C     1 
ATOM   3155  O  O     . ILE E  3 350  ? 109.912 23.934  32.735  1.00 52.89 ? 1026 ILE A O     1 
ATOM   3156  C  CB    . ILE E  3 350  ? 108.137 21.621  33.978  1.00 53.29 ? 1026 ILE A CB    1 
ATOM   3157  C  CG1   . ILE E  3 350  ? 107.603 22.265  35.260  1.00 53.63 ? 1026 ILE A CG1   1 
ATOM   3158  C  CG2   . ILE E  3 350  ? 109.610 21.224  34.136  1.00 53.34 ? 1026 ILE A CG2   1 
ATOM   3159  C  CD1   . ILE E  3 350  ? 107.308 21.286  36.372  1.00 54.90 ? 1026 ILE A CD1   1 
ATOM   3160  N  N     . MET E  3 351  ? 108.003 24.927  33.402  1.00 53.77 ? 1027 MET A N     1 
ATOM   3161  C  CA    . MET E  3 351  ? 108.636 26.207  33.736  1.00 54.51 ? 1027 MET A CA    1 
ATOM   3162  C  C     . MET E  3 351  ? 107.796 27.040  34.690  1.00 54.63 ? 1027 MET A C     1 
ATOM   3163  O  O     . MET E  3 351  ? 106.664 26.681  35.010  1.00 54.72 ? 1027 MET A O     1 
ATOM   3164  C  CB    . MET E  3 351  ? 108.961 27.017  32.479  1.00 54.62 ? 1027 MET A CB    1 
ATOM   3165  C  CG    . MET E  3 351  ? 107.870 27.048  31.428  1.00 54.97 ? 1027 MET A CG    1 
ATOM   3166  S  SD    . MET E  3 351  ? 108.394 28.080  30.053  1.00 55.53 ? 1027 MET A SD    1 
ATOM   3167  C  CE    . MET E  3 351  ? 107.762 27.141  28.661  1.00 55.57 ? 1027 MET A CE    1 
ATOM   3168  N  N     . ARG E  3 352  ? 108.363 28.151  35.150  1.00 54.64 ? 1028 ARG A N     1 
ATOM   3169  C  CA    . ARG E  3 352  ? 107.631 29.073  36.003  1.00 54.84 ? 1028 ARG A CA    1 
ATOM   3170  C  C     . ARG E  3 352  ? 106.580 29.808  35.184  1.00 53.80 ? 1028 ARG A C     1 
ATOM   3171  O  O     . ARG E  3 352  ? 106.868 30.306  34.092  1.00 53.10 ? 1028 ARG A O     1 
ATOM   3172  C  CB    . ARG E  3 352  ? 108.584 30.063  36.672  1.00 55.75 ? 1028 ARG A CB    1 
ATOM   3173  C  CG    . ARG E  3 352  ? 109.227 29.543  37.950  1.00 57.97 ? 1028 ARG A CG    1 
ATOM   3174  C  CD    . ARG E  3 352  ? 110.523 28.800  37.687  1.00 59.57 ? 1028 ARG A CD    1 
ATOM   3175  N  NE    . ARG E  3 352  ? 111.477 29.028  38.768  1.00 62.74 ? 1028 ARG A NE    1 
ATOM   3176  C  CZ    . ARG E  3 352  ? 112.237 30.118  38.876  1.00 65.14 ? 1028 ARG A CZ    1 
ATOM   3177  N  NH1   . ARG E  3 352  ? 112.154 31.085  37.965  1.00 66.09 ? 1028 ARG A NH1   1 
ATOM   3178  N  NH2   . ARG E  3 352  ? 113.085 30.245  39.892  1.00 65.86 ? 1028 ARG A NH2   1 
ATOM   3179  N  N     . LEU E  3 353  ? 105.363 29.867  35.720  1.00 52.93 ? 1029 LEU A N     1 
ATOM   3180  C  CA    . LEU E  3 353  ? 104.222 30.436  35.010  1.00 52.28 ? 1029 LEU A CA    1 
ATOM   3181  C  C     . LEU E  3 353  ? 104.517 31.840  34.479  1.00 52.36 ? 1029 LEU A C     1 
ATOM   3182  O  O     . LEU E  3 353  ? 104.207 32.159  33.330  1.00 52.55 ? 1029 LEU A O     1 
ATOM   3183  C  CB    . LEU E  3 353  ? 103.000 30.484  35.931  1.00 51.52 ? 1029 LEU A CB    1 
ATOM   3184  C  CG    . LEU E  3 353  ? 101.597 30.169  35.405  1.00 50.23 ? 1029 LEU A CG    1 
ATOM   3185  C  CD1   . LEU E  3 353  ? 100.587 30.952  36.210  1.00 50.55 ? 1029 LEU A CD1   1 
ATOM   3186  C  CD2   . LEU E  3 353  ? 101.415 30.469  33.937  1.00 49.64 ? 1029 LEU A CD2   1 
ATOM   3187  N  N     . GLY E  3 354  ? 105.133 32.664  35.322  1.00 52.27 ? 1030 GLY A N     1 
ATOM   3188  C  CA    . GLY E  3 354  ? 105.336 34.075  35.027  1.00 52.33 ? 1030 GLY A CA    1 
ATOM   3189  C  C     . GLY E  3 354  ? 106.163 34.340  33.799  1.00 52.45 ? 1030 GLY A C     1 
ATOM   3190  O  O     . GLY E  3 354  ? 106.052 35.405  33.192  1.00 52.24 ? 1030 GLY A O     1 
ATOM   3191  N  N     . GLU E  3 355  ? 106.989 33.368  33.432  1.00 52.86 ? 1031 GLU A N     1 
ATOM   3192  C  CA    . GLU E  3 355  ? 107.898 33.541  32.307  1.00 54.27 ? 1031 GLU A CA    1 
ATOM   3193  C  C     . GLU E  3 355  ? 107.497 32.735  31.074  1.00 53.23 ? 1031 GLU A C     1 
ATOM   3194  O  O     . GLU E  3 355  ? 108.160 32.800  30.039  1.00 52.61 ? 1031 GLU A O     1 
ATOM   3195  C  CB    . GLU E  3 355  ? 109.348 33.255  32.724  1.00 54.83 ? 1031 GLU A CB    1 
ATOM   3196  C  CG    . GLU E  3 355  ? 109.561 31.905  33.400  1.00 56.82 ? 1031 GLU A CG    1 
ATOM   3197  C  CD    . GLU E  3 355  ? 110.879 31.815  34.162  1.00 56.49 ? 1031 GLU A CD    1 
ATOM   3198  O  OE1   . GLU E  3 355  ? 111.446 32.867  34.534  1.00 57.20 ? 1031 GLU A OE1   1 
ATOM   3199  O  OE2   . GLU E  3 355  ? 111.341 30.678  34.399  1.00 58.87 ? 1031 GLU A OE2   1 
ATOM   3200  N  N     . ASP E  3 356  ? 106.408 31.983  31.181  1.00 52.96 ? 1032 ASP A N     1 
ATOM   3201  C  CA    . ASP E  3 356  ? 105.888 31.273  30.022  1.00 52.66 ? 1032 ASP A CA    1 
ATOM   3202  C  C     . ASP E  3 356  ? 105.110 32.225  29.116  1.00 51.95 ? 1032 ASP A C     1 
ATOM   3203  O  O     . ASP E  3 356  ? 104.009 32.667  29.457  1.00 51.66 ? 1032 ASP A O     1 
ATOM   3204  C  CB    . ASP E  3 356  ? 105.018 30.085  30.435  1.00 53.00 ? 1032 ASP A CB    1 
ATOM   3205  C  CG    . ASP E  3 356  ? 104.753 29.127  29.283  1.00 53.94 ? 1032 ASP A CG    1 
ATOM   3206  O  OD1   . ASP E  3 356  ? 104.686 29.578  28.116  1.00 55.15 ? 1032 ASP A OD1   1 
ATOM   3207  O  OD2   . ASP E  3 356  ? 104.611 27.915  29.545  1.00 54.36 ? 1032 ASP A OD2   1 
ATOM   3208  N  N     . ARG E  3 357  ? 105.696 32.525  27.960  1.00 51.27 ? 1033 ARG A N     1 
ATOM   3209  C  CA    . ARG E  3 357  ? 105.095 33.448  27.003  1.00 50.85 ? 1033 ARG A CA    1 
ATOM   3210  C  C     . ARG E  3 357  ? 103.879 32.867  26.302  1.00 51.00 ? 1033 ARG A C     1 
ATOM   3211  O  O     . ARG E  3 357  ? 102.900 33.575  26.065  1.00 50.71 ? 1033 ARG A O     1 
ATOM   3212  C  CB    . ARG E  3 357  ? 106.123 33.895  25.959  1.00 50.38 ? 1033 ARG A CB    1 
ATOM   3213  C  CG    . ARG E  3 357  ? 107.208 34.848  26.465  1.00 48.87 ? 1033 ARG A CG    1 
ATOM   3214  C  CD    . ARG E  3 357  ? 106.634 36.055  27.194  1.00 46.55 ? 1033 ARG A CD    1 
ATOM   3215  N  NE    . ARG E  3 357  ? 106.322 35.726  28.583  1.00 44.88 ? 1033 ARG A NE    1 
ATOM   3216  C  CZ    . ARG E  3 357  ? 105.488 36.411  29.356  1.00 43.87 ? 1033 ARG A CZ    1 
ATOM   3217  N  NH1   . ARG E  3 357  ? 104.864 37.483  28.889  1.00 44.17 ? 1033 ARG A NH1   1 
ATOM   3218  N  NH2   . ARG E  3 357  ? 105.275 36.021  30.602  1.00 42.93 ? 1033 ARG A NH2   1 
ATOM   3219  N  N     . SER E  3 358  ? 103.947 31.578  25.979  1.00 51.43 ? 1034 SER A N     1 
ATOM   3220  C  CA    . SER E  3 358  ? 102.886 30.910  25.233  1.00 52.06 ? 1034 SER A CA    1 
ATOM   3221  C  C     . SER E  3 358  ? 101.611 30.778  26.054  1.00 52.79 ? 1034 SER A C     1 
ATOM   3222  O  O     . SER E  3 358  ? 100.615 30.215  25.589  1.00 53.89 ? 1034 SER A O     1 
ATOM   3223  C  CB    . SER E  3 358  ? 103.355 29.534  24.761  1.00 51.95 ? 1034 SER A CB    1 
ATOM   3224  O  OG    . SER E  3 358  ? 103.634 28.696  25.866  1.00 51.68 ? 1034 SER A OG    1 
ATOM   3225  N  N     . MET E  3 359  ? 101.648 31.308  27.273  1.00 52.92 ? 1035 MET A N     1 
ATOM   3226  C  CA    . MET E  3 359  ? 100.521 31.243  28.188  1.00 52.86 ? 1035 MET A CA    1 
ATOM   3227  C  C     . MET E  3 359  ? 99.690  32.526  28.152  1.00 52.39 ? 1035 MET A C     1 
ATOM   3228  O  O     . MET E  3 359  ? 98.564  32.555  28.647  1.00 52.37 ? 1035 MET A O     1 
ATOM   3229  C  CB    . MET E  3 359  ? 101.034 30.996  29.599  1.00 53.26 ? 1035 MET A CB    1 
ATOM   3230  C  CG    . MET E  3 359  ? 100.133 30.122  30.428  1.00 55.91 ? 1035 MET A CG    1 
ATOM   3231  S  SD    . MET E  3 359  ? 100.438 28.381  30.095  1.00 60.10 ? 1035 MET A SD    1 
ATOM   3232  C  CE    . MET E  3 359  ? 101.895 28.050  31.072  1.00 58.90 ? 1035 MET A CE    1 
ATOM   3233  N  N     . ASP E  3 360  ? 100.252 33.577  27.560  1.00 52.38 ? 1036 ASP A N     1 
ATOM   3234  C  CA    . ASP E  3 360  ? 99.603  34.880  27.493  1.00 52.70 ? 1036 ASP A CA    1 
ATOM   3235  C  C     . ASP E  3 360  ? 98.374  34.842  26.636  1.00 52.86 ? 1036 ASP A C     1 
ATOM   3236  O  O     . ASP E  3 360  ? 98.383  34.267  25.530  1.00 53.11 ? 1036 ASP A O     1 
ATOM   3237  C  CB    . ASP E  3 360  ? 100.558 35.941  26.949  1.00 53.10 ? 1036 ASP A CB    1 
ATOM   3238  C  CG    . ASP E  3 360  ? 101.744 36.178  27.858  1.00 53.94 ? 1036 ASP A CG    1 
ATOM   3239  O  OD1   . ASP E  3 360  ? 101.574 36.100  29.101  1.00 55.65 ? 1036 ASP A OD1   1 
ATOM   3240  O  OD2   . ASP E  3 360  ? 102.842 36.449  27.325  1.00 52.50 ? 1036 ASP A OD2   1 
ATOM   3241  N  N     . VAL E  3 361  ? 97.329  35.475  27.177  1.00 53.36 ? 1037 VAL A N     1 
ATOM   3242  C  CA    . VAL E  3 361  ? 96.050  35.520  26.490  1.00 54.28 ? 1037 VAL A CA    1 
ATOM   3243  C  C     . VAL E  3 361  ? 96.017  36.628  25.434  1.00 55.36 ? 1037 VAL A C     1 
ATOM   3244  O  O     . VAL E  3 361  ? 96.199  37.805  25.745  1.00 55.63 ? 1037 VAL A O     1 
ATOM   3245  C  CB    . VAL E  3 361  ? 94.857  35.653  27.461  1.00 53.87 ? 1037 VAL A CB    1 
ATOM   3246  C  CG1   . VAL E  3 361  ? 93.565  35.838  26.683  1.00 54.09 ? 1037 VAL A CG1   1 
ATOM   3247  C  CG2   . VAL E  3 361  ? 94.763  34.425  28.355  1.00 53.19 ? 1037 VAL A CG2   1 
ATOM   3248  N  N     . GLU E  3 362  ? 95.780  36.228  24.188  1.00 56.33 ? 1038 GLU A N     1 
ATOM   3249  C  CA    . GLU E  3 362  ? 95.718  37.143  23.058  1.00 57.65 ? 1038 GLU A CA    1 
ATOM   3250  C  C     . GLU E  3 362  ? 94.325  37.033  22.437  1.00 57.39 ? 1038 GLU A C     1 
ATOM   3251  O  O     . GLU E  3 362  ? 93.797  35.925  22.310  1.00 58.09 ? 1038 GLU A O     1 
ATOM   3252  C  CB    . GLU E  3 362  ? 96.803  36.754  22.053  1.00 59.12 ? 1038 GLU A CB    1 
ATOM   3253  C  CG    . GLU E  3 362  ? 96.828  37.562  20.759  1.00 64.04 ? 1038 GLU A CG    1 
ATOM   3254  C  CD    . GLU E  3 362  ? 97.296  36.734  19.559  1.00 68.23 ? 1038 GLU A CD    1 
ATOM   3255  O  OE1   . GLU E  3 362  ? 98.300  35.998  19.701  1.00 70.75 ? 1038 GLU A OE1   1 
ATOM   3256  O  OE2   . GLU E  3 362  ? 96.662  36.818  18.477  1.00 69.47 ? 1038 GLU A OE2   1 
ATOM   3257  N  N     . THR E  3 363  ? 93.721  38.164  22.060  1.00 56.74 ? 1039 THR A N     1 
ATOM   3258  C  CA    . THR E  3 363  ? 92.322  38.151  21.577  1.00 56.47 ? 1039 THR A CA    1 
ATOM   3259  C  C     . THR E  3 363  ? 92.084  38.604  20.130  1.00 56.26 ? 1039 THR A C     1 
ATOM   3260  O  O     . THR E  3 363  ? 92.929  39.243  19.518  1.00 56.20 ? 1039 THR A O     1 
ATOM   3261  C  CB    . THR E  3 363  ? 91.355  38.941  22.499  1.00 56.34 ? 1039 THR A CB    1 
ATOM   3262  O  OG1   . THR E  3 363  ? 91.663  40.336  22.435  1.00 56.15 ? 1039 THR A OG1   1 
ATOM   3263  C  CG2   . THR E  3 363  ? 91.439  38.451  23.939  1.00 57.22 ? 1039 THR A CG2   1 
ATOM   3264  N  N     . ILE E  3 364  ? 90.909  38.252  19.613  1.00 56.58 ? 1040 ILE A N     1 
ATOM   3265  C  CA    . ILE E  3 364  ? 90.446  38.601  18.271  1.00 56.39 ? 1040 ILE A CA    1 
ATOM   3266  C  C     . ILE E  3 364  ? 89.122  39.331  18.428  1.00 56.56 ? 1040 ILE A C     1 
ATOM   3267  O  O     . ILE E  3 364  ? 88.292  38.930  19.250  1.00 57.03 ? 1040 ILE A O     1 
ATOM   3268  C  CB    . ILE E  3 364  ? 90.211  37.315  17.417  1.00 56.36 ? 1040 ILE A CB    1 
ATOM   3269  C  CG1   . ILE E  3 364  ? 91.528  36.595  17.145  1.00 56.40 ? 1040 ILE A CG1   1 
ATOM   3270  C  CG2   . ILE E  3 364  ? 89.497  37.615  16.092  1.00 56.75 ? 1040 ILE A CG2   1 
ATOM   3271  C  CD1   . ILE E  3 364  ? 92.617  37.484  16.564  1.00 57.64 ? 1040 ILE A CD1   1 
ATOM   3272  N  N     . SER E  3 365  ? 88.919  40.397  17.653  1.00 55.89 ? 1041 SER A N     1 
ATOM   3273  C  CA    . SER E  3 365  ? 87.637  41.097  17.653  1.00 55.29 ? 1041 SER A CA    1 
ATOM   3274  C  C     . SER E  3 365  ? 86.507  40.178  17.199  1.00 55.36 ? 1041 SER A C     1 
ATOM   3275  O  O     . SER E  3 365  ? 86.706  39.319  16.347  1.00 55.38 ? 1041 SER A O     1 
ATOM   3276  C  CB    . SER E  3 365  ? 87.687  42.329  16.760  1.00 54.99 ? 1041 SER A CB    1 
ATOM   3277  O  OG    . SER E  3 365  ? 86.381  42.833  16.550  1.00 55.39 ? 1041 SER A OG    1 
ATOM   3278  N  N     . THR E  3 366  ? 85.325  40.364  17.779  1.00 55.75 ? 1042 THR A N     1 
ATOM   3279  C  CA    . THR E  3 366  ? 84.163  39.560  17.421  1.00 55.73 ? 1042 THR A CA    1 
ATOM   3280  C  C     . THR E  3 366  ? 83.395  40.189  16.267  1.00 56.34 ? 1042 THR A C     1 
ATOM   3281  O  O     . THR E  3 366  ? 82.519  39.553  15.678  1.00 56.74 ? 1042 THR A O     1 
ATOM   3282  C  CB    . THR E  3 366  ? 83.204  39.406  18.599  1.00 55.67 ? 1042 THR A CB    1 
ATOM   3283  O  OG1   . THR E  3 366  ? 82.835  40.703  19.088  1.00 55.30 ? 1042 THR A OG1   1 
ATOM   3284  C  CG2   . THR E  3 366  ? 83.851  38.594  19.711  1.00 55.07 ? 1042 THR A CG2   1 
ATOM   3285  N  N     . GLY E  3 367  ? 83.725  41.438  15.946  1.00 56.47 ? 1043 GLY A N     1 
ATOM   3286  C  CA    . GLY E  3 367  ? 82.994  42.186  14.926  1.00 56.04 ? 1043 GLY A CA    1 
ATOM   3287  C  C     . GLY E  3 367  ? 81.943  43.075  15.560  1.00 55.55 ? 1043 GLY A C     1 
ATOM   3288  O  O     . GLY E  3 367  ? 81.430  43.991  14.917  1.00 56.15 ? 1043 GLY A O     1 
ATOM   3289  N  N     . SER E  3 368  ? 81.615  42.789  16.821  1.00 54.40 ? 1044 SER A N     1 
ATOM   3290  C  CA    . SER E  3 368  ? 80.782  43.669  17.636  1.00 53.40 ? 1044 SER A CA    1 
ATOM   3291  C  C     . SER E  3 368  ? 81.633  44.324  18.706  1.00 52.35 ? 1044 SER A C     1 
ATOM   3292  O  O     . SER E  3 368  ? 82.341  43.641  19.447  1.00 52.13 ? 1044 SER A O     1 
ATOM   3293  C  CB    . SER E  3 368  ? 79.630  42.900  18.286  1.00 53.89 ? 1044 SER A CB    1 
ATOM   3294  O  OG    . SER E  3 368  ? 79.097  43.611  19.394  1.00 52.89 ? 1044 SER A OG    1 
ATOM   3295  N  N     . LEU E  3 369  ? 81.559  45.649  18.778  1.00 51.39 ? 1045 LEU A N     1 
ATOM   3296  C  CA    . LEU E  3 369  ? 82.323  46.406  19.758  1.00 50.74 ? 1045 LEU A CA    1 
ATOM   3297  C  C     . LEU E  3 369  ? 81.812  46.147  21.161  1.00 50.35 ? 1045 LEU A C     1 
ATOM   3298  O  O     . LEU E  3 369  ? 82.602  45.892  22.068  1.00 49.81 ? 1045 LEU A O     1 
ATOM   3299  C  CB    . LEU E  3 369  ? 82.269  47.905  19.461  1.00 50.87 ? 1045 LEU A CB    1 
ATOM   3300  C  CG    . LEU E  3 369  ? 83.012  48.790  20.473  1.00 51.40 ? 1045 LEU A CG    1 
ATOM   3301  C  CD1   . LEU E  3 369  ? 84.525  48.593  20.390  1.00 50.51 ? 1045 LEU A CD1   1 
ATOM   3302  C  CD2   . LEU E  3 369  ? 82.645  50.257  20.307  1.00 50.99 ? 1045 LEU A CD2   1 
ATOM   3303  N  N     . SER E  3 370  ? 80.490  46.209  21.328  1.00 50.51 ? 1046 SER A N     1 
ATOM   3304  C  CA    . SER E  3 370  ? 79.865  46.025  22.641  1.00 50.04 ? 1046 SER A CA    1 
ATOM   3305  C  C     . SER E  3 370  ? 80.068  44.610  23.171  1.00 49.80 ? 1046 SER A C     1 
ATOM   3306  O  O     . SER E  3 370  ? 80.129  44.410  24.386  1.00 49.76 ? 1046 SER A O     1 
ATOM   3307  C  CB    . SER E  3 370  ? 78.378  46.414  22.628  1.00 49.46 ? 1046 SER A CB    1 
ATOM   3308  O  OG    . SER E  3 370  ? 77.620  45.528  21.834  1.00 48.91 ? 1046 SER A OG    1 
ATOM   3309  N  N     . LEU E  3 371  ? 80.191  43.641  22.263  1.00 49.51 ? 1047 LEU A N     1 
ATOM   3310  C  CA    . LEU E  3 371  ? 80.529  42.275  22.653  1.00 49.89 ? 1047 LEU A CA    1 
ATOM   3311  C  C     . LEU E  3 371  ? 81.969  42.193  23.142  1.00 50.64 ? 1047 LEU A C     1 
ATOM   3312  O  O     . LEU E  3 371  ? 82.238  41.598  24.185  1.00 50.87 ? 1047 LEU A O     1 
ATOM   3313  C  CB    . LEU E  3 371  ? 80.314  41.286  21.506  1.00 49.63 ? 1047 LEU A CB    1 
ATOM   3314  C  CG    . LEU E  3 371  ? 79.803  39.875  21.848  1.00 49.00 ? 1047 LEU A CG    1 
ATOM   3315  C  CD1   . LEU E  3 371  ? 80.136  38.909  20.727  1.00 47.77 ? 1047 LEU A CD1   1 
ATOM   3316  C  CD2   . LEU E  3 371  ? 80.334  39.325  23.166  1.00 48.20 ? 1047 LEU A CD2   1 
ATOM   3317  N  N     . ASP E  3 372  ? 82.889  42.793  22.389  1.00 51.40 ? 1048 ASP A N     1 
ATOM   3318  C  CA    . ASP E  3 372  ? 84.292  42.848  22.790  1.00 52.04 ? 1048 ASP A CA    1 
ATOM   3319  C  C     . ASP E  3 372  ? 84.431  43.479  24.173  1.00 51.92 ? 1048 ASP A C     1 
ATOM   3320  O  O     . ASP E  3 372  ? 85.299  43.086  24.949  1.00 52.65 ? 1048 ASP A O     1 
ATOM   3321  C  CB    . ASP E  3 372  ? 85.137  43.604  21.754  1.00 53.08 ? 1048 ASP A CB    1 
ATOM   3322  C  CG    . ASP E  3 372  ? 85.374  42.794  20.474  1.00 54.95 ? 1048 ASP A CG    1 
ATOM   3323  O  OD1   . ASP E  3 372  ? 85.166  41.560  20.488  1.00 56.87 ? 1048 ASP A OD1   1 
ATOM   3324  O  OD2   . ASP E  3 372  ? 85.776  43.394  19.452  1.00 55.14 ? 1048 ASP A OD2   1 
ATOM   3325  N  N     . ILE E  3 373  ? 83.560  44.439  24.482  1.00 51.33 ? 1049 ILE A N     1 
ATOM   3326  C  CA    . ILE E  3 373  ? 83.518  45.046  25.813  1.00 50.77 ? 1049 ILE A CA    1 
ATOM   3327  C  C     . ILE E  3 373  ? 82.933  44.074  26.837  1.00 50.47 ? 1049 ILE A C     1 
ATOM   3328  O  O     . ILE E  3 373  ? 83.515  43.867  27.904  1.00 50.97 ? 1049 ILE A O     1 
ATOM   3329  C  CB    . ILE E  3 373  ? 82.745  46.380  25.815  1.00 50.61 ? 1049 ILE A CB    1 
ATOM   3330  C  CG1   . ILE E  3 373  ? 83.470  47.396  24.932  1.00 51.35 ? 1049 ILE A CG1   1 
ATOM   3331  C  CG2   . ILE E  3 373  ? 82.627  46.940  27.228  1.00 49.50 ? 1049 ILE A CG2   1 
ATOM   3332  C  CD1   . ILE E  3 373  ? 82.566  48.466  24.346  1.00 51.93 ? 1049 ILE A CD1   1 
ATOM   3333  N  N     . ALA E  3 374  ? 81.799  43.466  26.500  1.00 49.66 ? 1050 ALA A N     1 
ATOM   3334  C  CA    . ALA E  3 374  ? 81.175  42.464  27.366  1.00 49.02 ? 1050 ALA A CA    1 
ATOM   3335  C  C     . ALA E  3 374  ? 82.139  41.326  27.701  1.00 48.27 ? 1050 ALA A C     1 
ATOM   3336  O  O     . ALA E  3 374  ? 82.150  40.830  28.828  1.00 48.58 ? 1050 ALA A O     1 
ATOM   3337  C  CB    . ALA E  3 374  ? 79.905  41.918  26.726  1.00 48.64 ? 1050 ALA A CB    1 
ATOM   3338  N  N     . LEU E  3 375  ? 82.952  40.938  26.721  1.00 47.32 ? 1051 LEU A N     1 
ATOM   3339  C  CA    . LEU E  3 375  ? 83.921  39.859  26.880  1.00 47.18 ? 1051 LEU A CA    1 
ATOM   3340  C  C     . LEU E  3 375  ? 85.051  40.201  27.836  1.00 47.78 ? 1051 LEU A C     1 
ATOM   3341  O  O     . LEU E  3 375  ? 85.827  39.326  28.222  1.00 48.50 ? 1051 LEU A O     1 
ATOM   3342  C  CB    . LEU E  3 375  ? 84.510  39.477  25.528  1.00 46.88 ? 1051 LEU A CB    1 
ATOM   3343  C  CG    . LEU E  3 375  ? 83.669  38.529  24.682  1.00 46.70 ? 1051 LEU A CG    1 
ATOM   3344  C  CD1   . LEU E  3 375  ? 84.123  38.587  23.244  1.00 47.71 ? 1051 LEU A CD1   1 
ATOM   3345  C  CD2   . LEU E  3 375  ? 83.764  37.118  25.221  1.00 46.07 ? 1051 LEU A CD2   1 
ATOM   3346  N  N     . GLY E  3 376  ? 85.158  41.475  28.199  1.00 48.01 ? 1052 GLY A N     1 
ATOM   3347  C  CA    . GLY E  3 376  ? 86.143  41.920  29.179  1.00 47.92 ? 1052 GLY A CA    1 
ATOM   3348  C  C     . GLY E  3 376  ? 87.539  42.127  28.618  1.00 47.45 ? 1052 GLY A C     1 
ATOM   3349  O  O     . GLY E  3 376  ? 88.152  43.175  28.833  1.00 47.81 ? 1052 GLY A O     1 
ATOM   3350  N  N     . ALA E  3 377  ? 88.045  41.128  27.906  1.00 46.87 ? 1053 ALA A N     1 
ATOM   3351  C  CA    . ALA E  3 377  ? 89.401  41.183  27.369  1.00 47.21 ? 1053 ALA A CA    1 
ATOM   3352  C  C     . ALA E  3 377  ? 89.473  41.746  25.944  1.00 47.62 ? 1053 ALA A C     1 
ATOM   3353  O  O     . ALA E  3 377  ? 90.551  41.786  25.337  1.00 47.85 ? 1053 ALA A O     1 
ATOM   3354  C  CB    . ALA E  3 377  ? 90.059  39.813  27.446  1.00 47.43 ? 1053 ALA A CB    1 
ATOM   3355  N  N     . GLY E  3 378  ? 88.331  42.178  25.413  1.00 47.52 ? 1054 GLY A N     1 
ATOM   3356  C  CA    . GLY E  3 378  ? 88.290  42.840  24.109  1.00 47.07 ? 1054 GLY A CA    1 
ATOM   3357  C  C     . GLY E  3 378  ? 88.125  41.925  22.906  1.00 47.14 ? 1054 GLY A C     1 
ATOM   3358  O  O     . GLY E  3 378  ? 88.288  42.360  21.761  1.00 47.18 ? 1054 GLY A O     1 
ATOM   3359  N  N     . GLY E  3 379  ? 87.801  40.660  23.158  1.00 46.82 ? 1055 GLY A N     1 
ATOM   3360  C  CA    . GLY E  3 379  ? 87.571  39.704  22.083  1.00 46.54 ? 1055 GLY A CA    1 
ATOM   3361  C  C     . GLY E  3 379  ? 87.705  38.261  22.523  1.00 46.61 ? 1055 GLY A C     1 
ATOM   3362  O  O     . GLY E  3 379  ? 87.937  37.979  23.699  1.00 47.02 ? 1055 GLY A O     1 
ATOM   3363  N  N     . LEU E  3 380  ? 87.549  37.344  21.573  1.00 46.18 ? 1056 LEU A N     1 
ATOM   3364  C  CA    . LEU E  3 380  ? 87.696  35.918  21.841  1.00 45.97 ? 1056 LEU A CA    1 
ATOM   3365  C  C     . LEU E  3 380  ? 89.173  35.532  21.961  1.00 46.47 ? 1056 LEU A C     1 
ATOM   3366  O  O     . LEU E  3 380  ? 90.011  36.083  21.252  1.00 47.51 ? 1056 LEU A O     1 
ATOM   3367  C  CB    . LEU E  3 380  ? 87.016  35.113  20.739  1.00 45.40 ? 1056 LEU A CB    1 
ATOM   3368  C  CG    . LEU E  3 380  ? 85.517  35.379  20.603  1.00 45.72 ? 1056 LEU A CG    1 
ATOM   3369  C  CD1   . LEU E  3 380  ? 84.970  34.775  19.328  1.00 46.50 ? 1056 LEU A CD1   1 
ATOM   3370  C  CD2   . LEU E  3 380  ? 84.766  34.834  21.807  1.00 46.42 ? 1056 LEU A CD2   1 
ATOM   3371  N  N     . PRO E  3 381  ? 89.505  34.587  22.858  1.00 46.25 ? 1057 PRO A N     1 
ATOM   3372  C  CA    . PRO E  3 381  ? 90.916  34.255  23.098  1.00 46.40 ? 1057 PRO A CA    1 
ATOM   3373  C  C     . PRO E  3 381  ? 91.496  33.211  22.136  1.00 46.39 ? 1057 PRO A C     1 
ATOM   3374  O  O     . PRO E  3 381  ? 90.846  32.210  21.840  1.00 48.12 ? 1057 PRO A O     1 
ATOM   3375  C  CB    . PRO E  3 381  ? 90.906  33.723  24.534  1.00 46.46 ? 1057 PRO A CB    1 
ATOM   3376  C  CG    . PRO E  3 381  ? 89.509  33.208  24.752  1.00 46.46 ? 1057 PRO A CG    1 
ATOM   3377  C  CD    . PRO E  3 381  ? 88.599  33.783  23.696  1.00 45.83 ? 1057 PRO A CD    1 
ATOM   3378  N  N     . MET E  3 382  ? 92.714  33.450  21.667  1.00 45.59 ? 1058 MET A N     1 
ATOM   3379  C  CA    . MET E  3 382  ? 93.395  32.555  20.736  1.00 46.08 ? 1058 MET A CA    1 
ATOM   3380  C  C     . MET E  3 382  ? 93.880  31.292  21.425  1.00 45.25 ? 1058 MET A C     1 
ATOM   3381  O  O     . MET E  3 382  ? 94.307  31.332  22.572  1.00 45.18 ? 1058 MET A O     1 
ATOM   3382  C  CB    . MET E  3 382  ? 94.586  33.272  20.095  1.00 47.86 ? 1058 MET A CB    1 
ATOM   3383  C  CG    . MET E  3 382  ? 94.201  34.462  19.229  1.00 50.61 ? 1058 MET A CG    1 
ATOM   3384  S  SD    . MET E  3 382  ? 93.260  33.921  17.788  1.00 55.34 ? 1058 MET A SD    1 
ATOM   3385  C  CE    . MET E  3 382  ? 94.594  33.505  16.656  1.00 55.04 ? 1058 MET A CE    1 
ATOM   3386  N  N     . GLY E  3 383  ? 93.823  30.169  20.718  1.00 45.23 ? 1059 GLY A N     1 
ATOM   3387  C  CA    . GLY E  3 383  ? 94.278  28.893  21.274  1.00 45.49 ? 1059 GLY A CA    1 
ATOM   3388  C  C     . GLY E  3 383  ? 93.285  28.260  22.234  1.00 45.52 ? 1059 GLY A C     1 
ATOM   3389  O  O     . GLY E  3 383  ? 93.607  27.282  22.918  1.00 45.63 ? 1059 GLY A O     1 
ATOM   3390  N  N     . ARG E  3 384  ? 92.076  28.818  22.273  1.00 44.92 ? 1060 ARG A N     1 
ATOM   3391  C  CA    . ARG E  3 384  ? 91.027  28.363  23.174  1.00 43.75 ? 1060 ARG A CA    1 
ATOM   3392  C  C     . ARG E  3 384  ? 89.829  27.855  22.382  1.00 43.73 ? 1060 ARG A C     1 
ATOM   3393  O  O     . ARG E  3 384  ? 89.729  28.083  21.177  1.00 44.25 ? 1060 ARG A O     1 
ATOM   3394  C  CB    . ARG E  3 384  ? 90.598  29.499  24.113  1.00 43.25 ? 1060 ARG A CB    1 
ATOM   3395  C  CG    . ARG E  3 384  ? 91.730  30.197  24.876  1.00 42.07 ? 1060 ARG A CG    1 
ATOM   3396  C  CD    . ARG E  3 384  ? 92.524  29.238  25.747  1.00 42.75 ? 1060 ARG A CD    1 
ATOM   3397  N  NE    . ARG E  3 384  ? 93.258  29.922  26.810  1.00 44.17 ? 1060 ARG A NE    1 
ATOM   3398  C  CZ    . ARG E  3 384  ? 92.768  30.180  28.024  1.00 46.04 ? 1060 ARG A CZ    1 
ATOM   3399  N  NH1   . ARG E  3 384  ? 91.531  29.819  28.342  1.00 47.26 ? 1060 ARG A NH1   1 
ATOM   3400  N  NH2   . ARG E  3 384  ? 93.513  30.807  28.928  1.00 46.49 ? 1060 ARG A NH2   1 
ATOM   3401  N  N     . ILE E  3 385  ? 88.927  27.159  23.068  1.00 43.73 ? 1061 ILE A N     1 
ATOM   3402  C  CA    . ILE E  3 385  ? 87.656  26.731  22.492  1.00 42.65 ? 1061 ILE A CA    1 
ATOM   3403  C  C     . ILE E  3 385  ? 86.551  27.672  22.967  1.00 42.83 ? 1061 ILE A C     1 
ATOM   3404  O  O     . ILE E  3 385  ? 86.514  28.068  24.139  1.00 42.66 ? 1061 ILE A O     1 
ATOM   3405  C  CB    . ILE E  3 385  ? 87.320  25.292  22.898  1.00 42.41 ? 1061 ILE A CB    1 
ATOM   3406  C  CG1   . ILE E  3 385  ? 88.395  24.330  22.384  1.00 41.21 ? 1061 ILE A CG1   1 
ATOM   3407  C  CG2   . ILE E  3 385  ? 85.952  24.890  22.369  1.00 43.82 ? 1061 ILE A CG2   1 
ATOM   3408  C  CD1   . ILE E  3 385  ? 88.461  23.012  23.149  1.00 40.97 ? 1061 ILE A CD1   1 
ATOM   3409  N  N     . VAL E  3 386  ? 85.666  28.037  22.048  1.00 43.10 ? 1062 VAL A N     1 
ATOM   3410  C  CA    . VAL E  3 386  ? 84.559  28.940  22.337  1.00 44.20 ? 1062 VAL A CA    1 
ATOM   3411  C  C     . VAL E  3 386  ? 83.271  28.318  21.799  1.00 45.95 ? 1062 VAL A C     1 
ATOM   3412  O  O     . VAL E  3 386  ? 83.289  27.697  20.733  1.00 46.60 ? 1062 VAL A O     1 
ATOM   3413  C  CB    . VAL E  3 386  ? 84.801  30.330  21.692  1.00 43.39 ? 1062 VAL A CB    1 
ATOM   3414  C  CG1   . VAL E  3 386  ? 83.537  31.176  21.682  1.00 43.36 ? 1062 VAL A CG1   1 
ATOM   3415  C  CG2   . VAL E  3 386  ? 85.899  31.057  22.417  1.00 41.86 ? 1062 VAL A CG2   1 
ATOM   3416  N  N     . GLU E  3 387  ? 82.167  28.473  22.537  1.00 46.98 ? 1063 GLU A N     1 
ATOM   3417  C  CA    . GLU E  3 387  ? 80.853  28.002  22.078  1.00 48.05 ? 1063 GLU A CA    1 
ATOM   3418  C  C     . GLU E  3 387  ? 79.839  29.139  21.992  1.00 47.26 ? 1063 GLU A C     1 
ATOM   3419  O  O     . GLU E  3 387  ? 79.702  29.934  22.922  1.00 48.28 ? 1063 GLU A O     1 
ATOM   3420  C  CB    . GLU E  3 387  ? 80.330  26.886  22.982  1.00 47.88 ? 1063 GLU A CB    1 
ATOM   3421  C  CG    . GLU E  3 387  ? 78.972  26.310  22.578  1.00 50.91 ? 1063 GLU A CG    1 
ATOM   3422  C  CD    . GLU E  3 387  ? 78.402  25.331  23.625  1.00 51.93 ? 1063 GLU A CD    1 
ATOM   3423  O  OE1   . GLU E  3 387  ? 78.856  25.375  24.788  1.00 54.35 ? 1063 GLU A OE1   1 
ATOM   3424  O  OE2   . GLU E  3 387  ? 77.510  24.509  23.295  1.00 53.27 ? 1063 GLU A OE2   1 
ATOM   3425  N  N     . ILE E  3 388  ? 79.148  29.221  20.860  1.00 46.63 ? 1064 ILE A N     1 
ATOM   3426  C  CA    . ILE E  3 388  ? 78.023  30.134  20.704  1.00 45.86 ? 1064 ILE A CA    1 
ATOM   3427  C  C     . ILE E  3 388  ? 76.775  29.295  20.487  1.00 46.00 ? 1064 ILE A C     1 
ATOM   3428  O  O     . ILE E  3 388  ? 76.726  28.465  19.573  1.00 46.21 ? 1064 ILE A O     1 
ATOM   3429  C  CB    . ILE E  3 388  ? 78.192  31.065  19.501  1.00 45.15 ? 1064 ILE A CB    1 
ATOM   3430  C  CG1   . ILE E  3 388  ? 79.504  31.816  19.590  1.00 46.08 ? 1064 ILE A CG1   1 
ATOM   3431  C  CG2   . ILE E  3 388  ? 77.051  32.062  19.436  1.00 45.31 ? 1064 ILE A CG2   1 
ATOM   3432  C  CD1   . ILE E  3 388  ? 79.980  32.327  18.260  1.00 49.27 ? 1064 ILE A CD1   1 
ATOM   3433  N  N     . TYR E  3 389  ? 75.771  29.502  21.330  1.00 45.35 ? 1065 TYR A N     1 
ATOM   3434  C  CA    . TYR E  3 389  ? 74.499  28.836  21.141  1.00 45.00 ? 1065 TYR A CA    1 
ATOM   3435  C  C     . TYR E  3 389  ? 73.346  29.839  21.155  1.00 44.59 ? 1065 TYR A C     1 
ATOM   3436  O  O     . TYR E  3 389  ? 73.504  30.967  21.626  1.00 44.90 ? 1065 TYR A O     1 
ATOM   3437  C  CB    . TYR E  3 389  ? 74.310  27.725  22.181  1.00 45.22 ? 1065 TYR A CB    1 
ATOM   3438  C  CG    . TYR E  3 389  ? 74.187  28.199  23.611  1.00 45.20 ? 1065 TYR A CG    1 
ATOM   3439  C  CD1   . TYR E  3 389  ? 72.994  28.755  24.080  1.00 44.79 ? 1065 TYR A CD1   1 
ATOM   3440  C  CD2   . TYR E  3 389  ? 75.249  28.060  24.506  1.00 44.40 ? 1065 TYR A CD2   1 
ATOM   3441  C  CE1   . TYR E  3 389  ? 72.866  29.182  25.389  1.00 45.97 ? 1065 TYR A CE1   1 
ATOM   3442  C  CE2   . TYR E  3 389  ? 75.132  28.483  25.834  1.00 45.02 ? 1065 TYR A CE2   1 
ATOM   3443  C  CZ    . TYR E  3 389  ? 73.934  29.047  26.265  1.00 46.25 ? 1065 TYR A CZ    1 
ATOM   3444  O  OH    . TYR E  3 389  ? 73.783  29.479  27.567  1.00 46.62 ? 1065 TYR A OH    1 
ATOM   3445  N  N     . GLY E  3 390  ? 72.194  29.417  20.640  1.00 43.80 ? 1066 GLY A N     1 
ATOM   3446  C  CA    . GLY E  3 390  ? 70.998  30.249  20.602  1.00 42.36 ? 1066 GLY A CA    1 
ATOM   3447  C  C     . GLY E  3 390  ? 69.930  29.620  19.733  1.00 41.29 ? 1066 GLY A C     1 
ATOM   3448  O  O     . GLY E  3 390  ? 70.178  28.596  19.094  1.00 40.08 ? 1066 GLY A O     1 
ATOM   3449  N  N     . PRO E  3 391  ? 68.731  30.232  19.699  1.00 41.35 ? 1067 PRO A N     1 
ATOM   3450  C  CA    . PRO E  3 391  ? 67.607  29.754  18.884  1.00 42.15 ? 1067 PRO A CA    1 
ATOM   3451  C  C     . PRO E  3 391  ? 67.890  29.893  17.387  1.00 42.13 ? 1067 PRO A C     1 
ATOM   3452  O  O     . PRO E  3 391  ? 68.876  30.524  17.016  1.00 41.72 ? 1067 PRO A O     1 
ATOM   3453  C  CB    . PRO E  3 391  ? 66.458  30.688  19.287  1.00 42.63 ? 1067 PRO A CB    1 
ATOM   3454  C  CG    . PRO E  3 391  ? 66.912  31.375  20.524  1.00 41.64 ? 1067 PRO A CG    1 
ATOM   3455  C  CD    . PRO E  3 391  ? 68.381  31.443  20.456  1.00 40.59 ? 1067 PRO A CD    1 
ATOM   3456  N  N     . GLU E  3 392  ? 67.039  29.315  16.541  1.00 41.81 ? 1068 GLU A N     1 
ATOM   3457  C  CA    . GLU E  3 392  ? 67.223  29.427  15.098  1.00 43.06 ? 1068 GLU A CA    1 
ATOM   3458  C  C     . GLU E  3 392  ? 67.193  30.860  14.613  1.00 43.71 ? 1068 GLU A C     1 
ATOM   3459  O  O     . GLU E  3 392  ? 66.445  31.688  15.141  1.00 44.28 ? 1068 GLU A O     1 
ATOM   3460  C  CB    . GLU E  3 392  ? 66.209  28.598  14.318  1.00 43.65 ? 1068 GLU A CB    1 
ATOM   3461  C  CG    . GLU E  3 392  ? 65.007  28.150  15.114  1.00 49.83 ? 1068 GLU A CG    1 
ATOM   3462  C  CD    . GLU E  3 392  ? 64.094  29.272  15.534  1.00 51.73 ? 1068 GLU A CD    1 
ATOM   3463  O  OE1   . GLU E  3 392  ? 64.049  29.546  16.749  1.00 55.64 ? 1068 GLU A OE1   1 
ATOM   3464  O  OE2   . GLU E  3 392  ? 63.430  29.869  14.661  1.00 51.84 ? 1068 GLU A OE2   1 
ATOM   3465  N  N     . SER E  3 393  ? 68.026  31.137  13.610  1.00 44.25 ? 1069 SER A N     1 
ATOM   3466  C  CA    . SER E  3 393  ? 68.145  32.471  13.009  1.00 45.26 ? 1069 SER A CA    1 
ATOM   3467  C  C     . SER E  3 393  ? 68.447  33.580  14.030  1.00 45.10 ? 1069 SER A C     1 
ATOM   3468  O  O     . SER E  3 393  ? 68.005  34.723  13.868  1.00 44.38 ? 1069 SER A O     1 
ATOM   3469  C  CB    . SER E  3 393  ? 66.894  32.815  12.177  1.00 45.42 ? 1069 SER A CB    1 
ATOM   3470  O  OG    . SER E  3 393  ? 66.985  32.280  10.869  1.00 44.86 ? 1069 SER A OG    1 
ATOM   3471  N  N     . SER E  3 394  ? 69.195  33.239  15.076  1.00 45.22 ? 1070 SER A N     1 
ATOM   3472  C  CA    . SER E  3 394  ? 69.516  34.207  16.123  1.00 45.08 ? 1070 SER A CA    1 
ATOM   3473  C  C     . SER E  3 394  ? 70.751  35.009  15.766  1.00 44.63 ? 1070 SER A C     1 
ATOM   3474  O  O     . SER E  3 394  ? 70.950  36.114  16.271  1.00 43.94 ? 1070 SER A O     1 
ATOM   3475  C  CB    . SER E  3 394  ? 69.698  33.521  17.476  1.00 45.36 ? 1070 SER A CB    1 
ATOM   3476  O  OG    . SER E  3 394  ? 70.641  32.470  17.391  1.00 45.23 ? 1070 SER A OG    1 
ATOM   3477  N  N     . GLY E  3 395  ? 71.568  34.449  14.882  1.00 44.91 ? 1071 GLY A N     1 
ATOM   3478  C  CA    . GLY E  3 395  ? 72.741  35.152  14.382  1.00 45.70 ? 1071 GLY A CA    1 
ATOM   3479  C  C     . GLY E  3 395  ? 74.050  34.429  14.632  1.00 45.67 ? 1071 GLY A C     1 
ATOM   3480  O  O     . GLY E  3 395  ? 75.129  35.029  14.524  1.00 45.56 ? 1071 GLY A O     1 
ATOM   3481  N  N     . LYS E  3 396  ? 73.958  33.139  14.951  1.00 44.93 ? 1072 LYS A N     1 
ATOM   3482  C  CA    . LYS E  3 396  ? 75.136  32.341  15.281  1.00 44.18 ? 1072 LYS A CA    1 
ATOM   3483  C  C     . LYS E  3 396  ? 76.146  32.315  14.122  1.00 44.71 ? 1072 LYS A C     1 
ATOM   3484  O  O     . LYS E  3 396  ? 77.297  32.702  14.305  1.00 45.46 ? 1072 LYS A O     1 
ATOM   3485  C  CB    . LYS E  3 396  ? 74.738  30.930  15.715  1.00 43.64 ? 1072 LYS A CB    1 
ATOM   3486  C  CG    . LYS E  3 396  ? 73.758  30.891  16.878  1.00 43.87 ? 1072 LYS A CG    1 
ATOM   3487  C  CD    . LYS E  3 396  ? 73.326  29.484  17.236  1.00 43.57 ? 1072 LYS A CD    1 
ATOM   3488  C  CE    . LYS E  3 396  ? 72.482  28.838  16.131  1.00 45.37 ? 1072 LYS A CE    1 
ATOM   3489  N  NZ    . LYS E  3 396  ? 71.157  29.499  15.915  1.00 46.40 ? 1072 LYS A NZ    1 
ATOM   3490  N  N     . THR E  3 397  ? 75.714  31.897  12.934  1.00 44.42 ? 1073 THR A N     1 
ATOM   3491  C  CA    . THR E  3 397  ? 76.587  31.894  11.766  1.00 44.11 ? 1073 THR A CA    1 
ATOM   3492  C  C     . THR E  3 397  ? 77.072  33.296  11.427  1.00 44.43 ? 1073 THR A C     1 
ATOM   3493  O  O     . THR E  3 397  ? 78.275  33.506  11.257  1.00 44.14 ? 1073 THR A O     1 
ATOM   3494  C  CB    . THR E  3 397  ? 75.898  31.331  10.529  1.00 44.48 ? 1073 THR A CB    1 
ATOM   3495  O  OG1   . THR E  3 397  ? 75.233  30.111  10.865  1.00 44.68 ? 1073 THR A OG1   1 
ATOM   3496  C  CG2   . THR E  3 397  ? 76.927  31.064  9.434   1.00 45.24 ? 1073 THR A CG2   1 
ATOM   3497  N  N     . THR E  3 398  ? 76.137  34.244  11.325  1.00 44.41 ? 1074 THR A N     1 
ATOM   3498  C  CA    . THR E  3 398  ? 76.472  35.633  11.006  1.00 44.55 ? 1074 THR A CA    1 
ATOM   3499  C  C     . THR E  3 398  ? 77.609  36.138  11.897  1.00 45.17 ? 1074 THR A C     1 
ATOM   3500  O  O     . THR E  3 398  ? 78.632  36.604  11.397  1.00 44.47 ? 1074 THR A O     1 
ATOM   3501  C  CB    . THR E  3 398  ? 75.243  36.571  11.109  1.00 44.39 ? 1074 THR A CB    1 
ATOM   3502  O  OG1   . THR E  3 398  ? 74.337  36.298  10.036  1.00 44.31 ? 1074 THR A OG1   1 
ATOM   3503  C  CG2   . THR E  3 398  ? 75.662  38.026  11.013  1.00 44.27 ? 1074 THR A CG2   1 
ATOM   3504  N  N     . LEU E  3 399  ? 77.439  36.015  13.212  1.00 46.30 ? 1075 LEU A N     1 
ATOM   3505  C  CA    . LEU E  3 399  ? 78.457  36.467  14.153  1.00 47.26 ? 1075 LEU A CA    1 
ATOM   3506  C  C     . LEU E  3 399  ? 79.782  35.782  13.871  1.00 47.34 ? 1075 LEU A C     1 
ATOM   3507  O  O     . LEU E  3 399  ? 80.792  36.438  13.699  1.00 48.00 ? 1075 LEU A O     1 
ATOM   3508  C  CB    . LEU E  3 399  ? 78.018  36.214  15.588  1.00 47.72 ? 1075 LEU A CB    1 
ATOM   3509  C  CG    . LEU E  3 399  ? 78.848  36.903  16.665  1.00 48.45 ? 1075 LEU A CG    1 
ATOM   3510  C  CD1   . LEU E  3 399  ? 77.925  37.578  17.653  1.00 49.58 ? 1075 LEU A CD1   1 
ATOM   3511  C  CD2   . LEU E  3 399  ? 79.732  35.905  17.360  1.00 49.66 ? 1075 LEU A CD2   1 
ATOM   3512  N  N     . THR E  3 400  ? 79.754  34.460  13.811  1.00 47.61 ? 1076 THR A N     1 
ATOM   3513  C  CA    . THR E  3 400  ? 80.891  33.649  13.400  1.00 47.95 ? 1076 THR A CA    1 
ATOM   3514  C  C     . THR E  3 400  ? 81.628  34.210  12.179  1.00 48.13 ? 1076 THR A C     1 
ATOM   3515  O  O     . THR E  3 400  ? 82.846  34.425  12.225  1.00 48.77 ? 1076 THR A O     1 
ATOM   3516  C  CB    . THR E  3 400  ? 80.424  32.202  13.146  1.00 48.63 ? 1076 THR A CB    1 
ATOM   3517  O  OG1   . THR E  3 400  ? 80.702  31.417  14.311  1.00 50.76 ? 1076 THR A OG1   1 
ATOM   3518  C  CG2   . THR E  3 400  ? 81.106  31.576  11.947  1.00 47.25 ? 1076 THR A CG2   1 
ATOM   3519  N  N     . LEU E  3 401  ? 80.891  34.460  11.098  1.00 47.76 ? 1077 LEU A N     1 
ATOM   3520  C  CA    . LEU E  3 401  ? 81.481  34.970  9.856   1.00 46.57 ? 1077 LEU A CA    1 
ATOM   3521  C  C     . LEU E  3 401  ? 82.114  36.341  10.074  1.00 47.07 ? 1077 LEU A C     1 
ATOM   3522  O  O     . LEU E  3 401  ? 83.177  36.632  9.511   1.00 47.71 ? 1077 LEU A O     1 
ATOM   3523  C  CB    . LEU E  3 401  ? 80.438  35.029  8.736   1.00 45.36 ? 1077 LEU A CB    1 
ATOM   3524  C  CG    . LEU E  3 401  ? 79.842  33.696  8.276   1.00 44.18 ? 1077 LEU A CG    1 
ATOM   3525  C  CD1   . LEU E  3 401  ? 78.600  33.914  7.444   1.00 43.82 ? 1077 LEU A CD1   1 
ATOM   3526  C  CD2   . LEU E  3 401  ? 80.860  32.876  7.509   1.00 43.51 ? 1077 LEU A CD2   1 
ATOM   3527  N  N     . GLN E  3 402  ? 81.470  37.169  10.901  1.00 46.31 ? 1078 GLN A N     1 
ATOM   3528  C  CA    . GLN E  3 402  ? 81.995  38.491  11.232  1.00 45.75 ? 1078 GLN A CA    1 
ATOM   3529  C  C     . GLN E  3 402  ? 83.363  38.414  11.902  1.00 45.22 ? 1078 GLN A C     1 
ATOM   3530  O  O     . GLN E  3 402  ? 84.239  39.218  11.580  1.00 45.72 ? 1078 GLN A O     1 
ATOM   3531  C  CB    . GLN E  3 402  ? 81.022  39.279  12.107  1.00 46.04 ? 1078 GLN A CB    1 
ATOM   3532  C  CG    . GLN E  3 402  ? 79.684  39.589  11.458  1.00 48.34 ? 1078 GLN A CG    1 
ATOM   3533  C  CD    . GLN E  3 402  ? 79.747  40.732  10.458  1.00 50.03 ? 1078 GLN A CD    1 
ATOM   3534  O  OE1   . GLN E  3 402  ? 79.238  41.826  10.719  1.00 50.01 ? 1078 GLN A OE1   1 
ATOM   3535  N  NE2   . GLN E  3 402  ? 80.366  40.483  9.305   1.00 50.64 ? 1078 GLN A NE2   1 
ATOM   3536  N  N     . VAL E  3 403  ? 83.554  37.457  12.818  1.00 43.93 ? 1079 VAL A N     1 
ATOM   3537  C  CA    . VAL E  3 403  ? 84.861  37.296  13.460  1.00 42.95 ? 1079 VAL A CA    1 
ATOM   3538  C  C     . VAL E  3 403  ? 85.886  36.810  12.435  1.00 43.92 ? 1079 VAL A C     1 
ATOM   3539  O  O     . VAL E  3 403  ? 87.023  37.303  12.427  1.00 44.53 ? 1079 VAL A O     1 
ATOM   3540  C  CB    . VAL E  3 403  ? 84.881  36.431  14.780  1.00 41.98 ? 1079 VAL A CB    1 
ATOM   3541  C  CG1   . VAL E  3 403  ? 83.487  36.124  15.278  1.00 44.01 ? 1079 VAL A CG1   1 
ATOM   3542  C  CG2   . VAL E  3 403  ? 85.701  35.148  14.627  1.00 40.50 ? 1079 VAL A CG2   1 
ATOM   3543  N  N     . ILE E  3 404  ? 85.485  35.882  11.561  1.00 43.54 ? 1080 ILE A N     1 
ATOM   3544  C  CA    . ILE E  3 404  ? 86.357  35.462  10.456  1.00 43.74 ? 1080 ILE A CA    1 
ATOM   3545  C  C     . ILE E  3 404  ? 86.765  36.666  9.596   1.00 43.94 ? 1080 ILE A C     1 
ATOM   3546  O  O     . ILE E  3 404  ? 87.955  36.880  9.344   1.00 43.23 ? 1080 ILE A O     1 
ATOM   3547  C  CB    . ILE E  3 404  ? 85.708  34.378  9.579   1.00 43.54 ? 1080 ILE A CB    1 
ATOM   3548  C  CG1   . ILE E  3 404  ? 85.674  33.053  10.331  1.00 43.51 ? 1080 ILE A CG1   1 
ATOM   3549  C  CG2   . ILE E  3 404  ? 86.474  34.208  8.260   1.00 42.47 ? 1080 ILE A CG2   1 
ATOM   3550  C  CD1   . ILE E  3 404  ? 84.759  32.022  9.700   1.00 43.78 ? 1080 ILE A CD1   1 
ATOM   3551  N  N     . ALA E  3 405  ? 85.772  37.453  9.174   1.00 44.23 ? 1081 ALA A N     1 
ATOM   3552  C  CA    . ALA E  3 405  ? 86.007  38.644  8.359   1.00 44.60 ? 1081 ALA A CA    1 
ATOM   3553  C  C     . ALA E  3 405  ? 87.044  39.558  8.995   1.00 44.26 ? 1081 ALA A C     1 
ATOM   3554  O  O     . ALA E  3 405  ? 87.994  39.972  8.338   1.00 44.03 ? 1081 ALA A O     1 
ATOM   3555  C  CB    . ALA E  3 405  ? 84.704  39.394  8.126   1.00 44.90 ? 1081 ALA A CB    1 
ATOM   3556  N  N     . ALA E  3 406  ? 86.853  39.846  10.280  1.00 44.52 ? 1082 ALA A N     1 
ATOM   3557  C  CA    . ALA E  3 406  ? 87.778  40.674  11.057  1.00 44.73 ? 1082 ALA A CA    1 
ATOM   3558  C  C     . ALA E  3 406  ? 89.180  40.067  11.135  1.00 44.47 ? 1082 ALA A C     1 
ATOM   3559  O  O     . ALA E  3 406  ? 90.168  40.781  11.016  1.00 44.08 ? 1082 ALA A O     1 
ATOM   3560  C  CB    . ALA E  3 406  ? 87.224  40.920  12.458  1.00 44.50 ? 1082 ALA A CB    1 
ATOM   3561  N  N     . ALA E  3 407  ? 89.251  38.752  11.331  1.00 44.93 ? 1083 ALA A N     1 
ATOM   3562  C  CA    . ALA E  3 407  ? 90.523  38.033  11.417  1.00 44.72 ? 1083 ALA A CA    1 
ATOM   3563  C  C     . ALA E  3 407  ? 91.266  38.045  10.090  1.00 44.75 ? 1083 ALA A C     1 
ATOM   3564  O  O     . ALA E  3 407  ? 92.485  38.202  10.052  1.00 44.91 ? 1083 ALA A O     1 
ATOM   3565  C  CB    . ALA E  3 407  ? 90.297  36.605  11.878  1.00 45.04 ? 1083 ALA A CB    1 
ATOM   3566  N  N     . GLN E  3 408  ? 90.521  37.877  9.002   1.00 45.22 ? 1084 GLN A N     1 
ATOM   3567  C  CA    . GLN E  3 408  ? 91.092  37.913  7.661   1.00 45.60 ? 1084 GLN A CA    1 
ATOM   3568  C  C     . GLN E  3 408  ? 91.603  39.305  7.345   1.00 46.34 ? 1084 GLN A C     1 
ATOM   3569  O  O     . GLN E  3 408  ? 92.631  39.457  6.700   1.00 46.29 ? 1084 GLN A O     1 
ATOM   3570  C  CB    . GLN E  3 408  ? 90.055  37.485  6.627   1.00 44.86 ? 1084 GLN A CB    1 
ATOM   3571  C  CG    . GLN E  3 408  ? 89.755  36.005  6.650   1.00 43.40 ? 1084 GLN A CG    1 
ATOM   3572  C  CD    . GLN E  3 408  ? 88.845  35.590  5.526   1.00 43.46 ? 1084 GLN A CD    1 
ATOM   3573  O  OE1   . GLN E  3 408  ? 87.901  36.301  5.179   1.00 43.58 ? 1084 GLN A OE1   1 
ATOM   3574  N  NE2   . GLN E  3 408  ? 89.124  34.431  4.942   1.00 43.21 ? 1084 GLN A NE2   1 
ATOM   3575  N  N     . ARG E  3 409  ? 90.875  40.313  7.822   1.00 47.66 ? 1085 ARG A N     1 
ATOM   3576  C  CA    . ARG E  3 409  ? 91.241  41.718  7.675   1.00 48.54 ? 1085 ARG A CA    1 
ATOM   3577  C  C     . ARG E  3 409  ? 92.629  41.973  8.263   1.00 49.13 ? 1085 ARG A C     1 
ATOM   3578  O  O     . ARG E  3 409  ? 93.259  42.981  7.963   1.00 49.19 ? 1085 ARG A O     1 
ATOM   3579  C  CB    . ARG E  3 409  ? 90.202  42.596  8.382   1.00 48.68 ? 1085 ARG A CB    1 
ATOM   3580  C  CG    . ARG E  3 409  ? 89.822  43.894  7.673   1.00 49.74 ? 1085 ARG A CG    1 
ATOM   3581  C  CD    . ARG E  3 409  ? 88.483  43.821  6.898   1.00 51.80 ? 1085 ARG A CD    1 
ATOM   3582  N  NE    . ARG E  3 409  ? 87.392  43.095  7.574   1.00 53.67 ? 1085 ARG A NE    1 
ATOM   3583  C  CZ    . ARG E  3 409  ? 86.838  43.422  8.745   1.00 53.99 ? 1085 ARG A CZ    1 
ATOM   3584  N  NH1   . ARG E  3 409  ? 87.270  44.468  9.445   1.00 55.02 ? 1085 ARG A NH1   1 
ATOM   3585  N  NH2   . ARG E  3 409  ? 85.858  42.678  9.233   1.00 53.04 ? 1085 ARG A NH2   1 
ATOM   3586  N  N     . GLU E  3 410  ? 93.101  41.042  9.089   1.00 50.59 ? 1086 GLU A N     1 
ATOM   3587  C  CA    . GLU E  3 410  ? 94.412  41.149  9.729   1.00 52.35 ? 1086 GLU A CA    1 
ATOM   3588  C  C     . GLU E  3 410  ? 95.357  40.019  9.346   1.00 52.49 ? 1086 GLU A C     1 
ATOM   3589  O  O     . GLU E  3 410  ? 96.241  39.654  10.124  1.00 52.98 ? 1086 GLU A O     1 
ATOM   3590  C  CB    . GLU E  3 410  ? 94.265  41.162  11.241  1.00 53.27 ? 1086 GLU A CB    1 
ATOM   3591  C  CG    . GLU E  3 410  ? 93.435  42.294  11.770  1.00 57.96 ? 1086 GLU A CG    1 
ATOM   3592  C  CD    . GLU E  3 410  ? 93.243  42.195  13.266  1.00 62.45 ? 1086 GLU A CD    1 
ATOM   3593  O  OE1   . GLU E  3 410  ? 93.215  43.263  13.917  1.00 65.24 ? 1086 GLU A OE1   1 
ATOM   3594  O  OE2   . GLU E  3 410  ? 93.135  41.057  13.791  1.00 64.00 ? 1086 GLU A OE2   1 
ATOM   3595  N  N     . GLY E  3 411  ? 95.158  39.460  8.156   1.00 52.50 ? 1087 GLY A N     1 
ATOM   3596  C  CA    . GLY E  3 411  ? 96.073  38.468  7.587   1.00 51.73 ? 1087 GLY A CA    1 
ATOM   3597  C  C     . GLY E  3 411  ? 96.062  37.102  8.246   1.00 51.00 ? 1087 GLY A C     1 
ATOM   3598  O  O     . GLY E  3 411  ? 97.030  36.353  8.136   1.00 50.52 ? 1087 GLY A O     1 
ATOM   3599  N  N     . LYS E  3 412  ? 94.972  36.775  8.928   1.00 50.73 ? 1088 LYS A N     1 
ATOM   3600  C  CA    . LYS E  3 412  ? 94.858  35.473  9.563   1.00 51.05 ? 1088 LYS A CA    1 
ATOM   3601  C  C     . LYS E  3 412  ? 94.153  34.495  8.639   1.00 51.26 ? 1088 LYS A C     1 
ATOM   3602  O  O     . LYS E  3 412  ? 93.302  34.892  7.841   1.00 51.69 ? 1088 LYS A O     1 
ATOM   3603  C  CB    . LYS E  3 412  ? 94.133  35.582  10.904  1.00 51.48 ? 1088 LYS A CB    1 
ATOM   3604  C  CG    . LYS E  3 412  ? 94.935  36.315  11.962  1.00 52.24 ? 1088 LYS A CG    1 
ATOM   3605  C  CD    . LYS E  3 412  ? 94.410  36.027  13.356  1.00 52.97 ? 1088 LYS A CD    1 
ATOM   3606  C  CE    . LYS E  3 412  ? 95.393  36.502  14.421  1.00 53.80 ? 1088 LYS A CE    1 
ATOM   3607  N  NZ    . LYS E  3 412  ? 95.367  37.980  14.569  1.00 54.07 ? 1088 LYS A NZ    1 
ATOM   3608  N  N     . THR E  3 413  ? 94.520  33.220  8.740   1.00 51.28 ? 1089 THR A N     1 
ATOM   3609  C  CA    . THR E  3 413  ? 93.906  32.176  7.922   1.00 51.42 ? 1089 THR A CA    1 
ATOM   3610  C  C     . THR E  3 413  ? 92.769  31.524  8.696   1.00 51.24 ? 1089 THR A C     1 
ATOM   3611  O  O     . THR E  3 413  ? 92.930  31.175  9.866   1.00 51.58 ? 1089 THR A O     1 
ATOM   3612  C  CB    . THR E  3 413  ? 94.933  31.110  7.494   1.00 51.53 ? 1089 THR A CB    1 
ATOM   3613  O  OG1   . THR E  3 413  ? 96.123  31.756  7.021   1.00 51.74 ? 1089 THR A OG1   1 
ATOM   3614  C  CG2   . THR E  3 413  ? 94.374  30.235  6.382   1.00 51.94 ? 1089 THR A CG2   1 
ATOM   3615  N  N     . CYS E  3 414  ? 91.619  31.374  8.045   1.00 50.66 ? 1090 CYS A N     1 
ATOM   3616  C  CA    . CYS E  3 414  ? 90.443  30.817  8.711   1.00 50.20 ? 1090 CYS A CA    1 
ATOM   3617  C  C     . CYS E  3 414  ? 89.847  29.632  7.974   1.00 49.42 ? 1090 CYS A C     1 
ATOM   3618  O  O     . CYS E  3 414  ? 89.905  29.557  6.747   1.00 50.48 ? 1090 CYS A O     1 
ATOM   3619  C  CB    . CYS E  3 414  ? 89.364  31.882  8.876   1.00 50.70 ? 1090 CYS A CB    1 
ATOM   3620  S  SG    . CYS E  3 414  ? 89.958  33.401  9.606   1.00 52.11 ? 1090 CYS A SG    1 
ATOM   3621  N  N     . ALA E  3 415  ? 89.265  28.715  8.735   1.00 47.89 ? 1091 ALA A N     1 
ATOM   3622  C  CA    . ALA E  3 415  ? 88.591  27.561  8.174   1.00 46.97 ? 1091 ALA A CA    1 
ATOM   3623  C  C     . ALA E  3 415  ? 87.166  27.507  8.696   1.00 47.27 ? 1091 ALA A C     1 
ATOM   3624  O  O     . ALA E  3 415  ? 86.908  27.840  9.857   1.00 47.03 ? 1091 ALA A O     1 
ATOM   3625  C  CB    . ALA E  3 415  ? 89.332  26.298  8.529   1.00 46.15 ? 1091 ALA A CB    1 
ATOM   3626  N  N     . PHE E  3 416  ? 86.243  27.095  7.830   1.00 47.17 ? 1092 PHE A N     1 
ATOM   3627  C  CA    . PHE E  3 416  ? 84.842  26.963  8.198   1.00 47.04 ? 1092 PHE A CA    1 
ATOM   3628  C  C     . PHE E  3 416  ? 84.390  25.538  7.923   1.00 47.47 ? 1092 PHE A C     1 
ATOM   3629  O  O     . PHE E  3 416  ? 84.447  25.072  6.781   1.00 47.96 ? 1092 PHE A O     1 
ATOM   3630  C  CB    . PHE E  3 416  ? 83.989  27.952  7.401   1.00 46.83 ? 1092 PHE A CB    1 
ATOM   3631  C  CG    . PHE E  3 416  ? 82.599  28.117  7.930   1.00 46.59 ? 1092 PHE A CG    1 
ATOM   3632  C  CD1   . PHE E  3 416  ? 82.300  29.150  8.806   1.00 46.56 ? 1092 PHE A CD1   1 
ATOM   3633  C  CD2   . PHE E  3 416  ? 81.583  27.243  7.552   1.00 46.93 ? 1092 PHE A CD2   1 
ATOM   3634  C  CE1   . PHE E  3 416  ? 81.010  29.310  9.309   1.00 45.83 ? 1092 PHE A CE1   1 
ATOM   3635  C  CE2   . PHE E  3 416  ? 80.290  27.397  8.048   1.00 46.50 ? 1092 PHE A CE2   1 
ATOM   3636  C  CZ    . PHE E  3 416  ? 80.007  28.435  8.929   1.00 46.17 ? 1092 PHE A CZ    1 
ATOM   3637  N  N     . ILE E  3 417  ? 83.952  24.849  8.971   1.00 47.59 ? 1093 ILE A N     1 
ATOM   3638  C  CA    . ILE E  3 417  ? 83.431  23.498  8.826   1.00 48.37 ? 1093 ILE A CA    1 
ATOM   3639  C  C     . ILE E  3 417  ? 81.906  23.553  8.837   1.00 49.83 ? 1093 ILE A C     1 
ATOM   3640  O  O     . ILE E  3 417  ? 81.283  23.672  9.892   1.00 50.75 ? 1093 ILE A O     1 
ATOM   3641  C  CB    . ILE E  3 417  ? 83.937  22.542  9.931   1.00 47.94 ? 1093 ILE A CB    1 
ATOM   3642  C  CG1   . ILE E  3 417  ? 85.421  22.776  10.265  1.00 46.77 ? 1093 ILE A CG1   1 
ATOM   3643  C  CG2   . ILE E  3 417  ? 83.655  21.094  9.541   1.00 48.11 ? 1093 ILE A CG2   1 
ATOM   3644  C  CD1   . ILE E  3 417  ? 86.399  22.437  9.161   1.00 46.18 ? 1093 ILE A CD1   1 
ATOM   3645  N  N     . ASP E  3 418  ? 81.314  23.475  7.650   1.00 50.94 ? 1094 ASP A N     1 
ATOM   3646  C  CA    . ASP E  3 418  ? 79.869  23.627  7.491   1.00 52.17 ? 1094 ASP A CA    1 
ATOM   3647  C  C     . ASP E  3 418  ? 79.147  22.282  7.590   1.00 52.35 ? 1094 ASP A C     1 
ATOM   3648  O  O     . ASP E  3 418  ? 78.642  21.748  6.590   1.00 51.29 ? 1094 ASP A O     1 
ATOM   3649  C  CB    . ASP E  3 418  ? 79.557  24.318  6.157   1.00 52.56 ? 1094 ASP A CB    1 
ATOM   3650  C  CG    . ASP E  3 418  ? 78.089  24.689  6.012   1.00 53.74 ? 1094 ASP A CG    1 
ATOM   3651  O  OD1   . ASP E  3 418  ? 77.437  25.053  7.026   1.00 56.02 ? 1094 ASP A OD1   1 
ATOM   3652  O  OD2   . ASP E  3 418  ? 77.594  24.624  4.870   1.00 53.43 ? 1094 ASP A OD2   1 
ATOM   3653  N  N     . ALA E  3 419  ? 79.103  21.741  8.805   1.00 52.98 ? 1095 ALA A N     1 
ATOM   3654  C  CA    . ALA E  3 419  ? 78.463  20.445  9.047   1.00 53.93 ? 1095 ALA A CA    1 
ATOM   3655  C  C     . ALA E  3 419  ? 76.951  20.547  8.897   1.00 54.69 ? 1095 ALA A C     1 
ATOM   3656  O  O     . ALA E  3 419  ? 76.263  19.551  8.670   1.00 54.71 ? 1095 ALA A O     1 
ATOM   3657  C  CB    . ALA E  3 419  ? 78.811  19.939  10.428  1.00 53.59 ? 1095 ALA A CB    1 
ATOM   3658  N  N     . GLU E  3 420  ? 76.450  21.771  9.038   1.00 55.62 ? 1096 GLU A N     1 
ATOM   3659  C  CA    . GLU E  3 420  ? 75.028  22.060  8.969   1.00 55.19 ? 1096 GLU A CA    1 
ATOM   3660  C  C     . GLU E  3 420  ? 74.590  22.153  7.507   1.00 53.92 ? 1096 GLU A C     1 
ATOM   3661  O  O     . GLU E  3 420  ? 73.392  22.138  7.212   1.00 53.95 ? 1096 GLU A O     1 
ATOM   3662  C  CB    . GLU E  3 420  ? 74.744  23.366  9.714   1.00 55.50 ? 1096 GLU A CB    1 
ATOM   3663  C  CG    . GLU E  3 420  ? 73.432  23.377  10.476  1.00 56.58 ? 1096 GLU A CG    1 
ATOM   3664  C  CD    . GLU E  3 420  ? 73.154  24.709  11.171  1.00 57.53 ? 1096 GLU A CD    1 
ATOM   3665  O  OE1   . GLU E  3 420  ? 73.593  25.771  10.659  1.00 60.64 ? 1096 GLU A OE1   1 
ATOM   3666  O  OE2   . GLU E  3 420  ? 72.485  24.693  12.231  1.00 58.22 ? 1096 GLU A OE2   1 
ATOM   3667  N  N     . HIS E  3 421  ? 75.575  22.242  6.608   1.00 52.47 ? 1097 HIS A N     1 
ATOM   3668  C  CA    . HIS E  3 421  ? 75.365  22.272  5.152   1.00 50.65 ? 1097 HIS A CA    1 
ATOM   3669  C  C     . HIS E  3 421  ? 74.426  23.387  4.699   1.00 48.99 ? 1097 HIS A C     1 
ATOM   3670  O  O     . HIS E  3 421  ? 73.520  23.157  3.921   1.00 48.53 ? 1097 HIS A O     1 
ATOM   3671  C  CB    . HIS E  3 421  ? 74.862  20.918  4.649   1.00 50.57 ? 1097 HIS A CB    1 
ATOM   3672  C  CG    . HIS E  3 421  ? 75.874  19.820  4.742   1.00 52.10 ? 1097 HIS A CG    1 
ATOM   3673  N  ND1   . HIS E  3 421  ? 76.612  19.394  3.657   1.00 54.85 ? 1097 HIS A ND1   1 
ATOM   3674  C  CD2   . HIS E  3 421  ? 76.264  19.053  5.787   1.00 52.22 ? 1097 HIS A CD2   1 
ATOM   3675  C  CE1   . HIS E  3 421  ? 77.417  18.415  4.032   1.00 54.71 ? 1097 HIS A CE1   1 
ATOM   3676  N  NE2   . HIS E  3 421  ? 77.226  18.191  5.321   1.00 53.08 ? 1097 HIS A NE2   1 
ATOM   3677  N  N     . ALA E  3 422  ? 74.654  24.600  5.185   1.00 48.46 ? 1098 ALA A N     1 
ATOM   3678  C  CA    . ALA E  3 422  ? 73.738  25.694  4.922   1.00 47.92 ? 1098 ALA A CA    1 
ATOM   3679  C  C     . ALA E  3 422  ? 74.421  27.037  4.673   1.00 48.99 ? 1098 ALA A C     1 
ATOM   3680  O  O     . ALA E  3 422  ? 73.738  28.060  4.557   1.00 50.15 ? 1098 ALA A O     1 
ATOM   3681  C  CB    . ALA E  3 422  ? 72.748  25.810  6.044   1.00 46.90 ? 1098 ALA A CB    1 
ATOM   3682  N  N     . LEU E  3 423  ? 75.753  27.032  4.570   1.00 49.23 ? 1099 LEU A N     1 
ATOM   3683  C  CA    . LEU E  3 423  ? 76.530  28.253  4.327   1.00 48.76 ? 1099 LEU A CA    1 
ATOM   3684  C  C     . LEU E  3 423  ? 76.310  28.795  2.921   1.00 48.97 ? 1099 LEU A C     1 
ATOM   3685  O  O     . LEU E  3 423  ? 76.418  28.056  1.935   1.00 49.79 ? 1099 LEU A O     1 
ATOM   3686  C  CB    . LEU E  3 423  ? 78.015  27.990  4.545   1.00 48.26 ? 1099 LEU A CB    1 
ATOM   3687  C  CG    . LEU E  3 423  ? 78.959  29.171  4.337   1.00 49.38 ? 1099 LEU A CG    1 
ATOM   3688  C  CD1   . LEU E  3 423  ? 78.638  30.305  5.305   1.00 51.02 ? 1099 LEU A CD1   1 
ATOM   3689  C  CD2   . LEU E  3 423  ? 80.412  28.728  4.485   1.00 49.32 ? 1099 LEU A CD2   1 
ATOM   3690  N  N     . ASP E  3 424  ? 75.988  30.082  2.838   1.00 48.63 ? 1100 ASP A N     1 
ATOM   3691  C  CA    . ASP E  3 424  ? 75.830  30.751  1.551   1.00 48.51 ? 1100 ASP A CA    1 
ATOM   3692  C  C     . ASP E  3 424  ? 77.068  31.608  1.293   1.00 47.68 ? 1100 ASP A C     1 
ATOM   3693  O  O     . ASP E  3 424  ? 77.243  32.650  1.926   1.00 48.07 ? 1100 ASP A O     1 
ATOM   3694  C  CB    . ASP E  3 424  ? 74.549  31.599  1.519   1.00 49.18 ? 1100 ASP A CB    1 
ATOM   3695  C  CG    . ASP E  3 424  ? 74.384  32.393  0.215   1.00 50.52 ? 1100 ASP A CG    1 
ATOM   3696  O  OD1   . ASP E  3 424  ? 73.515  33.291  0.181   1.00 51.45 ? 1100 ASP A OD1   1 
ATOM   3697  O  OD2   . ASP E  3 424  ? 75.106  32.130  -0.773  1.00 51.82 ? 1100 ASP A OD2   1 
ATOM   3698  N  N     . PRO E  3 425  ? 77.930  31.168  0.358   1.00 46.39 ? 1101 PRO A N     1 
ATOM   3699  C  CA    . PRO E  3 425  ? 79.170  31.874  0.073   1.00 45.16 ? 1101 PRO A CA    1 
ATOM   3700  C  C     . PRO E  3 425  ? 78.924  33.331  -0.298  1.00 44.64 ? 1101 PRO A C     1 
ATOM   3701  O  O     . PRO E  3 425  ? 79.628  34.202  0.193   1.00 44.87 ? 1101 PRO A O     1 
ATOM   3702  C  CB    . PRO E  3 425  ? 79.756  31.100  -1.107  1.00 45.39 ? 1101 PRO A CB    1 
ATOM   3703  C  CG    . PRO E  3 425  ? 78.622  30.304  -1.664  1.00 46.61 ? 1101 PRO A CG    1 
ATOM   3704  C  CD    . PRO E  3 425  ? 77.774  29.979  -0.494  1.00 46.32 ? 1101 PRO A CD    1 
ATOM   3705  N  N     . ILE E  3 426  ? 77.919  33.594  -1.127  1.00 44.25 ? 1102 ILE A N     1 
ATOM   3706  C  CA    . ILE E  3 426  ? 77.617  34.956  -1.554  1.00 44.58 ? 1102 ILE A CA    1 
ATOM   3707  C  C     . ILE E  3 426  ? 77.246  35.850  -0.365  1.00 44.80 ? 1102 ILE A C     1 
ATOM   3708  O  O     . ILE E  3 426  ? 77.638  37.016  -0.311  1.00 44.55 ? 1102 ILE A O     1 
ATOM   3709  C  CB    . ILE E  3 426  ? 76.545  34.981  -2.681  1.00 44.94 ? 1102 ILE A CB    1 
ATOM   3710  C  CG1   . ILE E  3 426  ? 77.210  34.828  -4.056  1.00 45.45 ? 1102 ILE A CG1   1 
ATOM   3711  C  CG2   . ILE E  3 426  ? 75.721  36.271  -2.657  1.00 44.70 ? 1102 ILE A CG2   1 
ATOM   3712  C  CD1   . ILE E  3 426  ? 77.560  33.387  -4.460  1.00 45.85 ? 1102 ILE A CD1   1 
ATOM   3713  N  N     . TYR E  3 427  ? 76.515  35.302  0.597   1.00 45.39 ? 1103 TYR A N     1 
ATOM   3714  C  CA    . TYR E  3 427  ? 76.165  36.075  1.780   1.00 46.47 ? 1103 TYR A CA    1 
ATOM   3715  C  C     . TYR E  3 427  ? 77.386  36.298  2.670   1.00 46.89 ? 1103 TYR A C     1 
ATOM   3716  O  O     . TYR E  3 427  ? 77.562  37.388  3.223   1.00 47.99 ? 1103 TYR A O     1 
ATOM   3717  C  CB    . TYR E  3 427  ? 75.031  35.417  2.560   1.00 47.02 ? 1103 TYR A CB    1 
ATOM   3718  C  CG    . TYR E  3 427  ? 74.526  36.234  3.735   1.00 47.22 ? 1103 TYR A CG    1 
ATOM   3719  C  CD1   . TYR E  3 427  ? 73.802  37.415  3.535   1.00 46.99 ? 1103 TYR A CD1   1 
ATOM   3720  C  CD2   . TYR E  3 427  ? 74.759  35.817  5.046   1.00 47.55 ? 1103 TYR A CD2   1 
ATOM   3721  C  CE1   . TYR E  3 427  ? 73.330  38.159  4.620   1.00 48.20 ? 1103 TYR A CE1   1 
ATOM   3722  C  CE2   . TYR E  3 427  ? 74.289  36.551  6.137   1.00 47.85 ? 1103 TYR A CE2   1 
ATOM   3723  C  CZ    . TYR E  3 427  ? 73.577  37.718  5.921   1.00 48.20 ? 1103 TYR A CZ    1 
ATOM   3724  O  OH    . TYR E  3 427  ? 73.113  38.433  7.006   1.00 48.26 ? 1103 TYR A OH    1 
ATOM   3725  N  N     . ALA E  3 428  ? 78.235  35.276  2.796   1.00 46.16 ? 1104 ALA A N     1 
ATOM   3726  C  CA    . ALA E  3 428  ? 79.488  35.410  3.545   1.00 44.85 ? 1104 ALA A CA    1 
ATOM   3727  C  C     . ALA E  3 428  ? 80.322  36.555  2.982   1.00 45.29 ? 1104 ALA A C     1 
ATOM   3728  O  O     . ALA E  3 428  ? 80.894  37.338  3.735   1.00 44.61 ? 1104 ALA A O     1 
ATOM   3729  C  CB    . ALA E  3 428  ? 80.268  34.115  3.538   1.00 43.38 ? 1104 ALA A CB    1 
ATOM   3730  N  N     . ARG E  3 429  ? 80.357  36.670  1.656   1.00 46.68 ? 1105 ARG A N     1 
ATOM   3731  C  CA    . ARG E  3 429  ? 81.071  37.760  0.996   1.00 47.43 ? 1105 ARG A CA    1 
ATOM   3732  C  C     . ARG E  3 429  ? 80.463  39.110  1.356   1.00 47.45 ? 1105 ARG A C     1 
ATOM   3733  O  O     . ARG E  3 429  ? 81.191  40.058  1.635   1.00 47.60 ? 1105 ARG A O     1 
ATOM   3734  C  CB    . ARG E  3 429  ? 81.076  37.590  -0.521  1.00 47.79 ? 1105 ARG A CB    1 
ATOM   3735  C  CG    . ARG E  3 429  ? 82.153  38.397  -1.187  1.00 50.26 ? 1105 ARG A CG    1 
ATOM   3736  C  CD    . ARG E  3 429  ? 81.581  39.219  -2.313  1.00 54.36 ? 1105 ARG A CD    1 
ATOM   3737  N  NE    . ARG E  3 429  ? 80.882  38.401  -3.304  1.00 57.60 ? 1105 ARG A NE    1 
ATOM   3738  C  CZ    . ARG E  3 429  ? 81.480  37.614  -4.197  1.00 59.08 ? 1105 ARG A CZ    1 
ATOM   3739  N  NH1   . ARG E  3 429  ? 82.805  37.508  -4.229  1.00 60.19 ? 1105 ARG A NH1   1 
ATOM   3740  N  NH2   . ARG E  3 429  ? 80.748  36.919  -5.058  1.00 58.88 ? 1105 ARG A NH2   1 
ATOM   3741  N  N     . LYS E  3 430  ? 79.133  39.190  1.343   1.00 47.48 ? 1106 LYS A N     1 
ATOM   3742  C  CA    . LYS E  3 430  ? 78.425  40.410  1.725   1.00 47.46 ? 1106 LYS A CA    1 
ATOM   3743  C  C     . LYS E  3 430  ? 78.794  40.854  3.130   1.00 47.25 ? 1106 LYS A C     1 
ATOM   3744  O  O     . LYS E  3 430  ? 78.864  42.051  3.405   1.00 47.37 ? 1106 LYS A O     1 
ATOM   3745  C  CB    . LYS E  3 430  ? 76.913  40.220  1.626   1.00 47.96 ? 1106 LYS A CB    1 
ATOM   3746  C  CG    . LYS E  3 430  ? 76.308  40.760  0.354   1.00 49.01 ? 1106 LYS A CG    1 
ATOM   3747  C  CD    . LYS E  3 430  ? 74.935  40.173  0.112   1.00 50.11 ? 1106 LYS A CD    1 
ATOM   3748  C  CE    . LYS E  3 430  ? 74.389  40.641  -1.224  1.00 51.15 ? 1106 LYS A CE    1 
ATOM   3749  N  NZ    . LYS E  3 430  ? 73.575  39.588  -1.891  1.00 52.55 ? 1106 LYS A NZ    1 
ATOM   3750  N  N     . LEU E  3 431  ? 79.043  39.890  4.015   1.00 46.85 ? 1107 LEU A N     1 
ATOM   3751  C  CA    . LEU E  3 431  ? 79.451  40.204  5.387   1.00 46.63 ? 1107 LEU A CA    1 
ATOM   3752  C  C     . LEU E  3 431  ? 80.939  40.569  5.487   1.00 46.24 ? 1107 LEU A C     1 
ATOM   3753  O  O     . LEU E  3 431  ? 81.452  40.832  6.573   1.00 45.93 ? 1107 LEU A O     1 
ATOM   3754  C  CB    . LEU E  3 431  ? 79.102  39.055  6.349   1.00 46.29 ? 1107 LEU A CB    1 
ATOM   3755  C  CG    . LEU E  3 431  ? 77.643  38.604  6.456   1.00 45.25 ? 1107 LEU A CG    1 
ATOM   3756  C  CD1   . LEU E  3 431  ? 77.507  37.589  7.552   1.00 45.37 ? 1107 LEU A CD1   1 
ATOM   3757  C  CD2   . LEU E  3 431  ? 76.714  39.775  6.710   1.00 45.70 ? 1107 LEU A CD2   1 
ATOM   3758  N  N     . GLY E  3 432  ? 81.624  40.577  4.348   1.00 46.13 ? 1108 GLY A N     1 
ATOM   3759  C  CA    . GLY E  3 432  ? 83.017  41.000  4.284   1.00 45.68 ? 1108 GLY A CA    1 
ATOM   3760  C  C     . GLY E  3 432  ? 84.029  39.888  4.466   1.00 45.47 ? 1108 GLY A C     1 
ATOM   3761  O  O     . GLY E  3 432  ? 85.191  40.143  4.761   1.00 45.34 ? 1108 GLY A O     1 
ATOM   3762  N  N     . VAL E  3 433  ? 83.593  38.647  4.298   1.00 45.73 ? 1109 VAL A N     1 
ATOM   3763  C  CA    . VAL E  3 433  ? 84.513  37.522  4.350   1.00 45.55 ? 1109 VAL A CA    1 
ATOM   3764  C  C     . VAL E  3 433  ? 85.229  37.413  3.014   1.00 46.54 ? 1109 VAL A C     1 
ATOM   3765  O  O     . VAL E  3 433  ? 84.605  37.519  1.955   1.00 47.82 ? 1109 VAL A O     1 
ATOM   3766  C  CB    . VAL E  3 433  ? 83.786  36.205  4.692   1.00 44.63 ? 1109 VAL A CB    1 
ATOM   3767  C  CG1   . VAL E  3 433  ? 84.746  35.027  4.682   1.00 43.56 ? 1109 VAL A CG1   1 
ATOM   3768  C  CG2   . VAL E  3 433  ? 83.121  36.322  6.042   1.00 44.42 ? 1109 VAL A CG2   1 
ATOM   3769  N  N     . ASP E  3 434  ? 86.541  37.227  3.071   1.00 46.84 ? 1110 ASP A N     1 
ATOM   3770  C  CA    . ASP E  3 434  ? 87.315  36.919  1.884   1.00 48.02 ? 1110 ASP A CA    1 
ATOM   3771  C  C     . ASP E  3 434  ? 87.091  35.459  1.515   1.00 48.66 ? 1110 ASP A C     1 
ATOM   3772  O  O     . ASP E  3 434  ? 87.758  34.565  2.038   1.00 48.49 ? 1110 ASP A O     1 
ATOM   3773  C  CB    . ASP E  3 434  ? 88.789  37.201  2.133   1.00 48.62 ? 1110 ASP A CB    1 
ATOM   3774  C  CG    . ASP E  3 434  ? 89.670  36.838  0.956   1.00 50.57 ? 1110 ASP A CG    1 
ATOM   3775  O  OD1   . ASP E  3 434  ? 90.903  36.873  1.146   1.00 51.63 ? 1110 ASP A OD1   1 
ATOM   3776  O  OD2   . ASP E  3 434  ? 89.153  36.521  -0.143  1.00 52.15 ? 1110 ASP A OD2   1 
ATOM   3777  N  N     . ILE E  3 435  ? 86.145  35.249  0.601   1.00 49.41 ? 1111 ILE A N     1 
ATOM   3778  C  CA    . ILE E  3 435  ? 85.669  33.926  0.197   1.00 50.01 ? 1111 ILE A CA    1 
ATOM   3779  C  C     . ILE E  3 435  ? 86.788  33.066  -0.390  1.00 50.10 ? 1111 ILE A C     1 
ATOM   3780  O  O     . ILE E  3 435  ? 86.892  31.875  -0.078  1.00 50.43 ? 1111 ILE A O     1 
ATOM   3781  C  CB    . ILE E  3 435  ? 84.485  34.066  -0.814  1.00 50.57 ? 1111 ILE A CB    1 
ATOM   3782  C  CG1   . ILE E  3 435  ? 83.345  34.872  -0.194  1.00 51.20 ? 1111 ILE A CG1   1 
ATOM   3783  C  CG2   . ILE E  3 435  ? 83.945  32.727  -1.261  1.00 50.32 ? 1111 ILE A CG2   1 
ATOM   3784  C  CD1   . ILE E  3 435  ? 82.955  34.419  1.216   1.00 52.15 ? 1111 ILE A CD1   1 
ATOM   3785  N  N     . ASP E  3 436  ? 87.633  33.689  -1.210  1.00 49.52 ? 1112 ASP A N     1 
ATOM   3786  C  CA    . ASP E  3 436  ? 88.689  32.990  -1.934  1.00 49.33 ? 1112 ASP A CA    1 
ATOM   3787  C  C     . ASP E  3 436  ? 89.803  32.422  -1.064  1.00 48.08 ? 1112 ASP A C     1 
ATOM   3788  O  O     . ASP E  3 436  ? 90.576  31.578  -1.515  1.00 46.99 ? 1112 ASP A O     1 
ATOM   3789  C  CB    . ASP E  3 436  ? 89.283  33.919  -2.980  1.00 50.72 ? 1112 ASP A CB    1 
ATOM   3790  C  CG    . ASP E  3 436  ? 88.281  34.305  -4.043  1.00 54.07 ? 1112 ASP A CG    1 
ATOM   3791  O  OD1   . ASP E  3 436  ? 87.409  33.468  -4.376  1.00 55.94 ? 1112 ASP A OD1   1 
ATOM   3792  O  OD2   . ASP E  3 436  ? 88.371  35.445  -4.552  1.00 57.08 ? 1112 ASP A OD2   1 
ATOM   3793  N  N     . ASN E  3 437  ? 89.884  32.887  0.176   1.00 47.58 ? 1113 ASN A N     1 
ATOM   3794  C  CA    . ASN E  3 437  ? 90.915  32.427  1.092   1.00 47.14 ? 1113 ASN A CA    1 
ATOM   3795  C  C     . ASN E  3 437  ? 90.365  31.737  2.319   1.00 46.83 ? 1113 ASN A C     1 
ATOM   3796  O  O     . ASN E  3 437  ? 91.117  31.188  3.112   1.00 47.21 ? 1113 ASN A O     1 
ATOM   3797  C  CB    . ASN E  3 437  ? 91.819  33.585  1.487   1.00 47.56 ? 1113 ASN A CB    1 
ATOM   3798  C  CG    . ASN E  3 437  ? 92.672  34.052  0.338   1.00 49.55 ? 1113 ASN A CG    1 
ATOM   3799  O  OD1   . ASN E  3 437  ? 93.224  33.243  -0.411  1.00 50.26 ? 1113 ASN A OD1   1 
ATOM   3800  N  ND2   . ASN E  3 437  ? 92.780  35.363  0.179   1.00 51.52 ? 1113 ASN A ND2   1 
ATOM   3801  N  N     . LEU E  3 438  ? 89.047  31.758  2.469   1.00 46.78 ? 1114 LEU A N     1 
ATOM   3802  C  CA    . LEU E  3 438  ? 88.384  31.058  3.558   1.00 46.28 ? 1114 LEU A CA    1 
ATOM   3803  C  C     . LEU E  3 438  ? 88.340  29.569  3.243   1.00 46.80 ? 1114 LEU A C     1 
ATOM   3804  O  O     . LEU E  3 438  ? 87.640  29.142  2.328   1.00 47.20 ? 1114 LEU A O     1 
ATOM   3805  C  CB    . LEU E  3 438  ? 86.974  31.628  3.763   1.00 45.54 ? 1114 LEU A CB    1 
ATOM   3806  C  CG    . LEU E  3 438  ? 86.091  31.280  4.966   1.00 43.07 ? 1114 LEU A CG    1 
ATOM   3807  C  CD1   . LEU E  3 438  ? 85.102  30.212  4.595   1.00 43.26 ? 1114 LEU A CD1   1 
ATOM   3808  C  CD2   . LEU E  3 438  ? 86.884  30.881  6.194   1.00 42.39 ? 1114 LEU A CD2   1 
ATOM   3809  N  N     . LEU E  3 439  ? 89.125  28.791  3.979   1.00 47.74 ? 1115 LEU A N     1 
ATOM   3810  C  CA    . LEU E  3 439  ? 89.084  27.340  3.868   1.00 48.97 ? 1115 LEU A CA    1 
ATOM   3811  C  C     . LEU E  3 439  ? 87.721  26.849  4.308   1.00 50.38 ? 1115 LEU A C     1 
ATOM   3812  O  O     . LEU E  3 439  ? 87.154  27.341  5.285   1.00 50.34 ? 1115 LEU A O     1 
ATOM   3813  C  CB    . LEU E  3 439  ? 90.161  26.695  4.732   1.00 48.90 ? 1115 LEU A CB    1 
ATOM   3814  C  CG    . LEU E  3 439  ? 91.549  26.623  4.119   1.00 48.83 ? 1115 LEU A CG    1 
ATOM   3815  C  CD1   . LEU E  3 439  ? 92.575  26.371  5.200   1.00 48.93 ? 1115 LEU A CD1   1 
ATOM   3816  C  CD2   . LEU E  3 439  ? 91.596  25.537  3.061   1.00 50.10 ? 1115 LEU A CD2   1 
ATOM   3817  N  N     . CYS E  3 440  ? 87.188  25.878  3.581   1.00 52.17 ? 1116 CYS A N     1 
ATOM   3818  C  CA    . CYS E  3 440  ? 85.830  25.443  3.830   1.00 52.46 ? 1116 CYS A CA    1 
ATOM   3819  C  C     . CYS E  3 440  ? 85.618  23.971  3.546   1.00 52.45 ? 1116 CYS A C     1 
ATOM   3820  O  O     . CYS E  3 440  ? 86.001  23.454  2.499   1.00 52.47 ? 1116 CYS A O     1 
ATOM   3821  C  CB    . CYS E  3 440  ? 84.855  26.276  3.009   1.00 53.17 ? 1116 CYS A CB    1 
ATOM   3822  S  SG    . CYS E  3 440  ? 83.162  25.815  3.288   1.00 55.21 ? 1116 CYS A SG    1 
ATOM   3823  N  N     . SER E  3 441  ? 84.974  23.304  4.490   1.00 52.53 ? 1117 SER A N     1 
ATOM   3824  C  CA    . SER E  3 441  ? 84.731  21.882  4.376   1.00 52.46 ? 1117 SER A CA    1 
ATOM   3825  C  C     . SER E  3 441  ? 83.275  21.552  4.676   1.00 52.54 ? 1117 SER A C     1 
ATOM   3826  O  O     . SER E  3 441  ? 82.666  22.142  5.572   1.00 52.29 ? 1117 SER A O     1 
ATOM   3827  C  CB    . SER E  3 441  ? 85.652  21.130  5.334   1.00 52.19 ? 1117 SER A CB    1 
ATOM   3828  O  OG    . SER E  3 441  ? 85.430  19.738  5.257   1.00 51.69 ? 1117 SER A OG    1 
ATOM   3829  N  N     . GLN E  3 442  ? 82.722  20.618  3.911   1.00 53.05 ? 1118 GLN A N     1 
ATOM   3830  C  CA    . GLN E  3 442  ? 81.397  20.075  4.199   1.00 53.52 ? 1118 GLN A CA    1 
ATOM   3831  C  C     . GLN E  3 442  ? 81.512  18.580  4.430   1.00 52.98 ? 1118 GLN A C     1 
ATOM   3832  O  O     . GLN E  3 442  ? 81.338  17.788  3.507   1.00 53.95 ? 1118 GLN A O     1 
ATOM   3833  C  CB    . GLN E  3 442  ? 80.407  20.400  3.085   1.00 54.12 ? 1118 GLN A CB    1 
ATOM   3834  C  CG    . GLN E  3 442  ? 79.979  21.850  3.094   1.00 56.45 ? 1118 GLN A CG    1 
ATOM   3835  C  CD    . GLN E  3 442  ? 78.777  22.112  2.219   1.00 58.41 ? 1118 GLN A CD    1 
ATOM   3836  O  OE1   . GLN E  3 442  ? 78.642  21.543  1.131   1.00 60.59 ? 1118 GLN A OE1   1 
ATOM   3837  N  NE2   . GLN E  3 442  ? 77.893  22.990  2.684   1.00 58.35 ? 1118 GLN A NE2   1 
ATOM   3838  N  N     . PRO E  3 443  ? 81.803  18.192  5.678   1.00 52.49 ? 1119 PRO A N     1 
ATOM   3839  C  CA    . PRO E  3 443  ? 82.186  16.834  6.037   1.00 52.62 ? 1119 PRO A CA    1 
ATOM   3840  C  C     . PRO E  3 443  ? 81.004  15.879  5.994   1.00 52.39 ? 1119 PRO A C     1 
ATOM   3841  O  O     . PRO E  3 443  ? 79.863  16.310  6.125   1.00 52.21 ? 1119 PRO A O     1 
ATOM   3842  C  CB    . PRO E  3 443  ? 82.681  16.992  7.474   1.00 52.78 ? 1119 PRO A CB    1 
ATOM   3843  C  CG    . PRO E  3 443  ? 81.884  18.125  8.003   1.00 52.37 ? 1119 PRO A CG    1 
ATOM   3844  C  CD    . PRO E  3 443  ? 81.742  19.072  6.858   1.00 52.54 ? 1119 PRO A CD    1 
ATOM   3845  N  N     . ASP E  3 444  ? 81.287  14.593  5.820   1.00 52.87 ? 1120 ASP A N     1 
ATOM   3846  C  CA    . ASP E  3 444  ? 80.245  13.570  5.775   1.00 53.66 ? 1120 ASP A CA    1 
ATOM   3847  C  C     . ASP E  3 444  ? 79.817  13.149  7.178   1.00 53.27 ? 1120 ASP A C     1 
ATOM   3848  O  O     . ASP E  3 444  ? 78.640  13.242  7.526   1.00 53.18 ? 1120 ASP A O     1 
ATOM   3849  C  CB    . ASP E  3 444  ? 80.714  12.364  4.961   1.00 54.42 ? 1120 ASP A CB    1 
ATOM   3850  C  CG    . ASP E  3 444  ? 81.132  12.743  3.543   1.00 56.37 ? 1120 ASP A CG    1 
ATOM   3851  O  OD1   . ASP E  3 444  ? 80.412  13.541  2.892   1.00 56.63 ? 1120 ASP A OD1   1 
ATOM   3852  O  OD2   . ASP E  3 444  ? 82.184  12.244  3.083   1.00 56.75 ? 1120 ASP A OD2   1 
ATOM   3853  N  N     . THR E  3 445  ? 80.782  12.705  7.979   1.00 52.51 ? 1121 THR A N     1 
ATOM   3854  C  CA    . THR E  3 445  ? 80.531  12.307  9.358   1.00 51.71 ? 1121 THR A CA    1 
ATOM   3855  C  C     . THR E  3 445  ? 81.077  13.342  10.339  1.00 50.89 ? 1121 THR A C     1 
ATOM   3856  O  O     . THR E  3 445  ? 81.905  14.173  9.980   1.00 50.62 ? 1121 THR A O     1 
ATOM   3857  C  CB    . THR E  3 445  ? 81.164  10.936  9.666   1.00 52.19 ? 1121 THR A CB    1 
ATOM   3858  O  OG1   . THR E  3 445  ? 82.593  11.040  9.616   1.00 53.57 ? 1121 THR A OG1   1 
ATOM   3859  C  CG2   . THR E  3 445  ? 80.704  9.890   8.661   1.00 52.12 ? 1121 THR A CG2   1 
ATOM   3860  N  N     . GLY E  3 446  ? 80.600  13.281  11.577  1.00 50.52 ? 1122 GLY A N     1 
ATOM   3861  C  CA    . GLY E  3 446  ? 81.085  14.145  12.645  1.00 50.32 ? 1122 GLY A CA    1 
ATOM   3862  C  C     . GLY E  3 446  ? 82.530  13.857  12.993  1.00 50.21 ? 1122 GLY A C     1 
ATOM   3863  O  O     . GLY E  3 446  ? 83.289  14.774  13.279  1.00 51.08 ? 1122 GLY A O     1 
ATOM   3864  N  N     . GLU E  3 447  ? 82.912  12.583  12.964  1.00 49.96 ? 1123 GLU A N     1 
ATOM   3865  C  CA    . GLU E  3 447  ? 84.300  12.195  13.205  1.00 50.47 ? 1123 GLU A CA    1 
ATOM   3866  C  C     . GLU E  3 447  ? 85.237  12.841  12.191  1.00 49.58 ? 1123 GLU A C     1 
ATOM   3867  O  O     . GLU E  3 447  ? 86.295  13.348  12.551  1.00 49.55 ? 1123 GLU A O     1 
ATOM   3868  C  CB    . GLU E  3 447  ? 84.464  10.677  13.163  1.00 51.38 ? 1123 GLU A CB    1 
ATOM   3869  C  CG    . GLU E  3 447  ? 83.969  9.959   14.399  1.00 55.28 ? 1123 GLU A CG    1 
ATOM   3870  C  CD    . GLU E  3 447  ? 82.504  9.585   14.320  1.00 59.11 ? 1123 GLU A CD    1 
ATOM   3871  O  OE1   . GLU E  3 447  ? 81.911  9.714   13.225  1.00 61.19 ? 1123 GLU A OE1   1 
ATOM   3872  O  OE2   . GLU E  3 447  ? 81.947  9.156   15.358  1.00 61.39 ? 1123 GLU A OE2   1 
ATOM   3873  N  N     . GLN E  3 448  ? 84.832  12.818  10.927  1.00 48.65 ? 1124 GLN A N     1 
ATOM   3874  C  CA    . GLN E  3 448  ? 85.575  13.457  9.853   1.00 48.34 ? 1124 GLN A CA    1 
ATOM   3875  C  C     . GLN E  3 448  ? 85.734  14.953  10.131  1.00 47.57 ? 1124 GLN A C     1 
ATOM   3876  O  O     . GLN E  3 448  ? 86.836  15.490  10.046  1.00 48.14 ? 1124 GLN A O     1 
ATOM   3877  C  CB    . GLN E  3 448  ? 84.860  13.220  8.522   1.00 48.49 ? 1124 GLN A CB    1 
ATOM   3878  C  CG    . GLN E  3 448  ? 85.564  13.765  7.290   1.00 49.35 ? 1124 GLN A CG    1 
ATOM   3879  C  CD    . GLN E  3 448  ? 84.724  13.629  6.025   1.00 49.72 ? 1124 GLN A CD    1 
ATOM   3880  O  OE1   . GLN E  3 448  ? 84.627  14.566  5.230   1.00 49.97 ? 1124 GLN A OE1   1 
ATOM   3881  N  NE2   . GLN E  3 448  ? 84.110  12.460  5.835   1.00 51.07 ? 1124 GLN A NE2   1 
ATOM   3882  N  N     . ALA E  3 449  ? 84.635  15.614  10.482  1.00 46.51 ? 1125 ALA A N     1 
ATOM   3883  C  CA    . ALA E  3 449  ? 84.641  17.038  10.801  1.00 45.33 ? 1125 ALA A CA    1 
ATOM   3884  C  C     . ALA E  3 449  ? 85.679  17.381  11.861  1.00 44.73 ? 1125 ALA A C     1 
ATOM   3885  O  O     . ALA E  3 449  ? 86.420  18.352  11.725  1.00 44.00 ? 1125 ALA A O     1 
ATOM   3886  C  CB    . ALA E  3 449  ? 83.261  17.476  11.262  1.00 45.76 ? 1125 ALA A CB    1 
ATOM   3887  N  N     . LEU E  3 450  ? 85.727  16.571  12.912  1.00 44.60 ? 1126 LEU A N     1 
ATOM   3888  C  CA    . LEU E  3 450  ? 86.612  16.822  14.034  1.00 44.59 ? 1126 LEU A CA    1 
ATOM   3889  C  C     . LEU E  3 450  ? 88.040  16.397  13.731  1.00 45.85 ? 1126 LEU A C     1 
ATOM   3890  O  O     . LEU E  3 450  ? 88.986  17.006  14.224  1.00 46.96 ? 1126 LEU A O     1 
ATOM   3891  C  CB    . LEU E  3 450  ? 86.097  16.124  15.290  1.00 44.04 ? 1126 LEU A CB    1 
ATOM   3892  C  CG    . LEU E  3 450  ? 84.709  16.532  15.782  1.00 41.63 ? 1126 LEU A CG    1 
ATOM   3893  C  CD1   . LEU E  3 450  ? 84.140  15.418  16.631  1.00 41.07 ? 1126 LEU A CD1   1 
ATOM   3894  C  CD2   . LEU E  3 450  ? 84.735  17.863  16.524  1.00 39.18 ? 1126 LEU A CD2   1 
ATOM   3895  N  N     . GLU E  3 451  ? 88.200  15.355  12.922  1.00 46.87 ? 1127 GLU A N     1 
ATOM   3896  C  CA    . GLU E  3 451  ? 89.529  14.956  12.462  1.00 47.23 ? 1127 GLU A CA    1 
ATOM   3897  C  C     . GLU E  3 451  ? 90.156  16.028  11.596  1.00 46.12 ? 1127 GLU A C     1 
ATOM   3898  O  O     . GLU E  3 451  ? 91.359  16.233  11.646  1.00 46.53 ? 1127 GLU A O     1 
ATOM   3899  C  CB    . GLU E  3 451  ? 89.490  13.622  11.716  1.00 48.59 ? 1127 GLU A CB    1 
ATOM   3900  C  CG    . GLU E  3 451  ? 89.821  12.427  12.601  1.00 53.00 ? 1127 GLU A CG    1 
ATOM   3901  C  CD    . GLU E  3 451  ? 91.224  12.518  13.201  1.00 56.16 ? 1127 GLU A CD    1 
ATOM   3902  O  OE1   . GLU E  3 451  ? 91.340  12.637  14.447  1.00 56.89 ? 1127 GLU A OE1   1 
ATOM   3903  O  OE2   . GLU E  3 451  ? 92.206  12.490  12.421  1.00 57.02 ? 1127 GLU A OE2   1 
ATOM   3904  N  N     . ILE E  3 452  ? 89.330  16.712  10.810  1.00 45.79 ? 1128 ILE A N     1 
ATOM   3905  C  CA    . ILE E  3 452  ? 89.786  17.840  10.005  1.00 45.59 ? 1128 ILE A CA    1 
ATOM   3906  C  C     . ILE E  3 452  ? 90.252  18.982  10.908  1.00 46.79 ? 1128 ILE A C     1 
ATOM   3907  O  O     . ILE E  3 452  ? 91.311  19.558  10.672  1.00 46.87 ? 1128 ILE A O     1 
ATOM   3908  C  CB    . ILE E  3 452  ? 88.713  18.306  9.006   1.00 44.68 ? 1128 ILE A CB    1 
ATOM   3909  C  CG1   . ILE E  3 452  ? 88.620  17.306  7.854   1.00 44.65 ? 1128 ILE A CG1   1 
ATOM   3910  C  CG2   . ILE E  3 452  ? 89.038  19.690  8.462   1.00 43.48 ? 1128 ILE A CG2   1 
ATOM   3911  C  CD1   . ILE E  3 452  ? 87.349  17.404  7.038   1.00 46.12 ? 1128 ILE A CD1   1 
ATOM   3912  N  N     . CYS E  3 453  ? 89.476  19.287  11.949  1.00 48.04 ? 1129 CYS A N     1 
ATOM   3913  C  CA    . CYS E  3 453  ? 89.857  20.301  12.935  1.00 48.88 ? 1129 CYS A CA    1 
ATOM   3914  C  C     . CYS E  3 453  ? 91.204  19.997  13.552  1.00 48.84 ? 1129 CYS A C     1 
ATOM   3915  O  O     . CYS E  3 453  ? 92.055  20.877  13.665  1.00 48.59 ? 1129 CYS A O     1 
ATOM   3916  C  CB    . CYS E  3 453  ? 88.828  20.388  14.054  1.00 49.27 ? 1129 CYS A CB    1 
ATOM   3917  S  SG    . CYS E  3 453  ? 87.318  21.197  13.574  1.00 54.04 ? 1129 CYS A SG    1 
ATOM   3918  N  N     . ASP E  3 454  ? 91.386  18.742  13.951  1.00 49.12 ? 1130 ASP A N     1 
ATOM   3919  C  CA    . ASP E  3 454  ? 92.600  18.322  14.615  1.00 49.55 ? 1130 ASP A CA    1 
ATOM   3920  C  C     . ASP E  3 454  ? 93.795  18.481  13.693  1.00 48.93 ? 1130 ASP A C     1 
ATOM   3921  O  O     . ASP E  3 454  ? 94.842  18.970  14.112  1.00 49.32 ? 1130 ASP A O     1 
ATOM   3922  C  CB    . ASP E  3 454  ? 92.476  16.877  15.086  1.00 50.99 ? 1130 ASP A CB    1 
ATOM   3923  C  CG    . ASP E  3 454  ? 93.421  16.553  16.229  1.00 53.76 ? 1130 ASP A CG    1 
ATOM   3924  O  OD1   . ASP E  3 454  ? 93.605  17.411  17.127  1.00 55.96 ? 1130 ASP A OD1   1 
ATOM   3925  O  OD2   . ASP E  3 454  ? 93.975  15.429  16.235  1.00 55.04 ? 1130 ASP A OD2   1 
ATOM   3926  N  N     . ALA E  3 455  ? 93.624  18.084  12.435  1.00 48.17 ? 1131 ALA A N     1 
ATOM   3927  C  CA    . ALA E  3 455  ? 94.657  18.238  11.419  1.00 47.11 ? 1131 ALA A CA    1 
ATOM   3928  C  C     . ALA E  3 455  ? 95.055  19.706  11.227  1.00 46.66 ? 1131 ALA A C     1 
ATOM   3929  O  O     . ALA E  3 455  ? 96.240  20.031  11.211  1.00 46.90 ? 1131 ALA A O     1 
ATOM   3930  C  CB    . ALA E  3 455  ? 94.198  17.626  10.109  1.00 46.90 ? 1131 ALA A CB    1 
ATOM   3931  N  N     . LEU E  3 456  ? 94.062  20.583  11.098  1.00 46.14 ? 1132 LEU A N     1 
ATOM   3932  C  CA    . LEU E  3 456  ? 94.308  22.014  10.940  1.00 45.79 ? 1132 LEU A CA    1 
ATOM   3933  C  C     . LEU E  3 456  ? 94.932  22.618  12.192  1.00 46.72 ? 1132 LEU A C     1 
ATOM   3934  O  O     . LEU E  3 456  ? 95.843  23.448  12.101  1.00 47.01 ? 1132 LEU A O     1 
ATOM   3935  C  CB    . LEU E  3 456  ? 93.019  22.754  10.578  1.00 44.79 ? 1132 LEU A CB    1 
ATOM   3936  C  CG    . LEU E  3 456  ? 92.354  22.381  9.252   1.00 44.72 ? 1132 LEU A CG    1 
ATOM   3937  C  CD1   . LEU E  3 456  ? 91.017  23.083  9.119   1.00 44.95 ? 1132 LEU A CD1   1 
ATOM   3938  C  CD2   . LEU E  3 456  ? 93.241  22.693  8.053   1.00 44.14 ? 1132 LEU A CD2   1 
ATOM   3939  N  N     . ALA E  3 457  ? 94.440  22.205  13.358  1.00 47.56 ? 1133 ALA A N     1 
ATOM   3940  C  CA    . ALA E  3 457  ? 95.034  22.628  14.620  1.00 48.10 ? 1133 ALA A CA    1 
ATOM   3941  C  C     . ALA E  3 457  ? 96.516  22.266  14.625  1.00 48.29 ? 1133 ALA A C     1 
ATOM   3942  O  O     . ALA E  3 457  ? 97.354  23.148  14.757  1.00 48.70 ? 1133 ALA A O     1 
ATOM   3943  C  CB    . ALA E  3 457  ? 94.302  22.009  15.817  1.00 48.20 ? 1133 ALA A CB    1 
ATOM   3944  N  N     . ARG E  3 458  ? 96.829  20.984  14.428  1.00 48.38 ? 1134 ARG A N     1 
ATOM   3945  C  CA    . ARG E  3 458  ? 98.214  20.498  14.431  1.00 49.29 ? 1134 ARG A CA    1 
ATOM   3946  C  C     . ARG E  3 458  ? 99.123  21.194  13.421  1.00 49.07 ? 1134 ARG A C     1 
ATOM   3947  O  O     . ARG E  3 458  ? 100.303 21.409  13.697  1.00 49.45 ? 1134 ARG A O     1 
ATOM   3948  C  CB    . ARG E  3 458  ? 98.274  18.986  14.197  1.00 49.20 ? 1134 ARG A CB    1 
ATOM   3949  C  CG    . ARG E  3 458  ? 98.155  18.140  15.460  1.00 50.84 ? 1134 ARG A CG    1 
ATOM   3950  C  CD    . ARG E  3 458  ? 98.532  16.676  15.214  1.00 51.30 ? 1134 ARG A CD    1 
ATOM   3951  N  NE    . ARG E  3 458  ? 98.046  16.185  13.922  1.00 54.46 ? 1134 ARG A NE    1 
ATOM   3952  C  CZ    . ARG E  3 458  ? 96.825  15.702  13.703  1.00 56.72 ? 1134 ARG A CZ    1 
ATOM   3953  N  NH1   . ARG E  3 458  ? 95.937  15.630  14.689  1.00 57.43 ? 1134 ARG A NH1   1 
ATOM   3954  N  NH2   . ARG E  3 458  ? 96.489  15.289  12.488  1.00 57.85 ? 1134 ARG A NH2   1 
ATOM   3955  N  N     . SER E  3 459  ? 98.578  21.543  12.258  1.00 48.91 ? 1135 SER A N     1 
ATOM   3956  C  CA    . SER E  3 459  ? 99.359  22.175  11.192  1.00 48.50 ? 1135 SER A CA    1 
ATOM   3957  C  C     . SER E  3 459  ? 99.988  23.502  11.619  1.00 48.76 ? 1135 SER A C     1 
ATOM   3958  O  O     . SER E  3 459  ? 101.048 23.883  11.119  1.00 48.73 ? 1135 SER A O     1 
ATOM   3959  C  CB    . SER E  3 459  ? 98.490  22.405  9.956   1.00 48.45 ? 1135 SER A CB    1 
ATOM   3960  O  OG    . SER E  3 459  ? 97.637  23.524  10.133  1.00 48.50 ? 1135 SER A OG    1 
ATOM   3961  N  N     . GLY E  3 460  ? 99.319  24.201  12.534  1.00 49.18 ? 1136 GLY A N     1 
ATOM   3962  C  CA    . GLY E  3 460  ? 99.764  25.509  13.003  1.00 49.35 ? 1136 GLY A CA    1 
ATOM   3963  C  C     . GLY E  3 460  ? 99.610  26.588  11.948  1.00 49.72 ? 1136 GLY A C     1 
ATOM   3964  O  O     . GLY E  3 460  ? 100.126 27.694  12.103  1.00 50.01 ? 1136 GLY A O     1 
ATOM   3965  N  N     . ALA E  3 461  ? 98.887  26.266  10.878  1.00 49.84 ? 1137 ALA A N     1 
ATOM   3966  C  CA    . ALA E  3 461  ? 98.752  27.155  9.733   1.00 49.49 ? 1137 ALA A CA    1 
ATOM   3967  C  C     . ALA E  3 461  ? 97.422  27.905  9.720   1.00 49.74 ? 1137 ALA A C     1 
ATOM   3968  O  O     . ALA E  3 461  ? 97.291  28.925  9.040   1.00 49.87 ? 1137 ALA A O     1 
ATOM   3969  C  CB    . ALA E  3 461  ? 98.934  26.378  8.456   1.00 49.43 ? 1137 ALA A CB    1 
ATOM   3970  N  N     . VAL E  3 462  ? 96.444  27.400  10.472  1.00 49.57 ? 1138 VAL A N     1 
ATOM   3971  C  CA    . VAL E  3 462  ? 95.136  28.047  10.564  1.00 49.23 ? 1138 VAL A CA    1 
ATOM   3972  C  C     . VAL E  3 462  ? 95.015  28.780  11.894  1.00 48.79 ? 1138 VAL A C     1 
ATOM   3973  O  O     . VAL E  3 462  ? 95.424  28.260  12.931  1.00 48.23 ? 1138 VAL A O     1 
ATOM   3974  C  CB    . VAL E  3 462  ? 93.984  27.034  10.388  1.00 48.98 ? 1138 VAL A CB    1 
ATOM   3975  C  CG1   . VAL E  3 462  ? 92.636  27.744  10.349  1.00 48.32 ? 1138 VAL A CG1   1 
ATOM   3976  C  CG2   . VAL E  3 462  ? 94.190  26.232  9.118   1.00 49.18 ? 1138 VAL A CG2   1 
ATOM   3977  N  N     . ASP E  3 463  ? 94.458  29.988  11.848  1.00 48.91 ? 1139 ASP A N     1 
ATOM   3978  C  CA    . ASP E  3 463  ? 94.338  30.840  13.027  1.00 49.29 ? 1139 ASP A CA    1 
ATOM   3979  C  C     . ASP E  3 463  ? 92.985  30.719  13.727  1.00 49.06 ? 1139 ASP A C     1 
ATOM   3980  O  O     . ASP E  3 463  ? 92.922  30.672  14.964  1.00 49.47 ? 1139 ASP A O     1 
ATOM   3981  C  CB    . ASP E  3 463  ? 94.610  32.293  12.656  1.00 49.97 ? 1139 ASP A CB    1 
ATOM   3982  C  CG    . ASP E  3 463  ? 96.035  32.513  12.216  1.00 53.32 ? 1139 ASP A CG    1 
ATOM   3983  O  OD1   . ASP E  3 463  ? 96.943  32.378  13.069  1.00 55.90 ? 1139 ASP A OD1   1 
ATOM   3984  O  OD2   . ASP E  3 463  ? 96.253  32.817  11.019  1.00 54.57 ? 1139 ASP A OD2   1 
ATOM   3985  N  N     . VAL E  3 464  ? 91.905  30.693  12.946  1.00 47.36 ? 1140 VAL A N     1 
ATOM   3986  C  CA    . VAL E  3 464  ? 90.578  30.467  13.509  1.00 46.17 ? 1140 VAL A CA    1 
ATOM   3987  C  C     . VAL E  3 464  ? 89.793  29.438  12.706  1.00 46.66 ? 1140 VAL A C     1 
ATOM   3988  O  O     . VAL E  3 464  ? 89.732  29.506  11.480  1.00 48.36 ? 1140 VAL A O     1 
ATOM   3989  C  CB    . VAL E  3 464  ? 89.772  31.797  13.780  1.00 45.36 ? 1140 VAL A CB    1 
ATOM   3990  C  CG1   . VAL E  3 464  ? 90.389  32.988  13.090  1.00 45.05 ? 1140 VAL A CG1   1 
ATOM   3991  C  CG2   . VAL E  3 464  ? 88.293  31.661  13.415  1.00 44.81 ? 1140 VAL A CG2   1 
ATOM   3992  N  N     . ILE E  3 465  ? 89.238  28.461  13.417  1.00 45.71 ? 1141 ILE A N     1 
ATOM   3993  C  CA    . ILE E  3 465  ? 88.375  27.447  12.839  1.00 45.37 ? 1141 ILE A CA    1 
ATOM   3994  C  C     . ILE E  3 465  ? 86.999  27.573  13.481  1.00 45.10 ? 1141 ILE A C     1 
ATOM   3995  O  O     . ILE E  3 465  ? 86.884  27.649  14.705  1.00 44.02 ? 1141 ILE A O     1 
ATOM   3996  C  CB    . ILE E  3 465  ? 88.891  26.017  13.132  1.00 45.28 ? 1141 ILE A CB    1 
ATOM   3997  C  CG1   . ILE E  3 465  ? 90.364  25.871  12.754  1.00 45.87 ? 1141 ILE A CG1   1 
ATOM   3998  C  CG2   . ILE E  3 465  ? 88.037  24.977  12.410  1.00 46.20 ? 1141 ILE A CG2   1 
ATOM   3999  C  CD1   . ILE E  3 465  ? 91.018  24.599  13.279  1.00 46.06 ? 1141 ILE A CD1   1 
ATOM   4000  N  N     . VAL E  3 466  ? 85.952  27.594  12.662  1.00 44.96 ? 1142 VAL A N     1 
ATOM   4001  C  CA    . VAL E  3 466  ? 84.602  27.493  13.201  1.00 44.02 ? 1142 VAL A CA    1 
ATOM   4002  C  C     . VAL E  3 466  ? 83.867  26.276  12.672  1.00 45.27 ? 1142 VAL A C     1 
ATOM   4003  O  O     . VAL E  3 466  ? 83.926  25.970  11.482  1.00 46.62 ? 1142 VAL A O     1 
ATOM   4004  C  CB    . VAL E  3 466  ? 83.768  28.817  13.092  1.00 42.83 ? 1142 VAL A CB    1 
ATOM   4005  C  CG1   . VAL E  3 466  ? 84.503  29.884  12.345  1.00 42.50 ? 1142 VAL A CG1   1 
ATOM   4006  C  CG2   . VAL E  3 466  ? 82.405  28.567  12.489  1.00 41.90 ? 1142 VAL A CG2   1 
ATOM   4007  N  N     . VAL E  3 467  ? 83.206  25.573  13.590  1.00 46.31 ? 1143 VAL A N     1 
ATOM   4008  C  CA    . VAL E  3 467  ? 82.371  24.421  13.278  1.00 46.63 ? 1143 VAL A CA    1 
ATOM   4009  C  C     . VAL E  3 467  ? 80.913  24.849  13.411  1.00 47.68 ? 1143 VAL A C     1 
ATOM   4010  O  O     . VAL E  3 467  ? 80.460  25.156  14.513  1.00 48.10 ? 1143 VAL A O     1 
ATOM   4011  C  CB    . VAL E  3 467  ? 82.672  23.256  14.244  1.00 45.94 ? 1143 VAL A CB    1 
ATOM   4012  C  CG1   . VAL E  3 467  ? 81.805  22.049  13.926  1.00 45.24 ? 1143 VAL A CG1   1 
ATOM   4013  C  CG2   . VAL E  3 467  ? 84.140  22.886  14.177  1.00 44.94 ? 1143 VAL A CG2   1 
ATOM   4014  N  N     . ASP E  3 468  ? 80.192  24.896  12.293  1.00 49.40 ? 1144 ASP A N     1 
ATOM   4015  C  CA    . ASP E  3 468  ? 78.777  25.293  12.312  1.00 51.44 ? 1144 ASP A CA    1 
ATOM   4016  C  C     . ASP E  3 468  ? 77.854  24.113  12.607  1.00 50.41 ? 1144 ASP A C     1 
ATOM   4017  O  O     . ASP E  3 468  ? 77.623  23.239  11.754  1.00 48.71 ? 1144 ASP A O     1 
ATOM   4018  C  CB    . ASP E  3 468  ? 78.341  26.009  11.024  1.00 54.45 ? 1144 ASP A CB    1 
ATOM   4019  C  CG    . ASP E  3 468  ? 77.099  26.916  11.227  1.00 58.68 ? 1144 ASP A CG    1 
ATOM   4020  O  OD1   . ASP E  3 468  ? 76.350  26.756  12.221  1.00 60.57 ? 1144 ASP A OD1   1 
ATOM   4021  O  OD2   . ASP E  3 468  ? 76.865  27.804  10.372  1.00 62.10 ? 1144 ASP A OD2   1 
ATOM   4022  N  N     . SER E  3 469  ? 77.338  24.160  13.841  1.00 49.86 ? 1145 SER A N     1 
ATOM   4023  C  CA    . SER E  3 469  ? 76.446  23.191  14.484  1.00 48.20 ? 1145 SER A CA    1 
ATOM   4024  C  C     . SER E  3 469  ? 77.138  21.918  14.910  1.00 47.30 ? 1145 SER A C     1 
ATOM   4025  O  O     . SER E  3 469  ? 77.468  21.078  14.084  1.00 47.31 ? 1145 SER A O     1 
ATOM   4026  C  CB    . SER E  3 469  ? 75.200  22.901  13.654  1.00 48.90 ? 1145 SER A CB    1 
ATOM   4027  O  OG    . SER E  3 469  ? 74.194  23.864  13.912  1.00 49.29 ? 1145 SER A OG    1 
ATOM   4028  N  N     . VAL E  3 470  ? 77.371  21.789  16.213  1.00 47.12 ? 1146 VAL A N     1 
ATOM   4029  C  CA    . VAL E  3 470  ? 77.774  20.501  16.781  1.00 46.07 ? 1146 VAL A CA    1 
ATOM   4030  C  C     . VAL E  3 470  ? 76.553  19.593  16.644  1.00 46.11 ? 1146 VAL A C     1 
ATOM   4031  O  O     . VAL E  3 470  ? 76.673  18.387  16.453  1.00 45.94 ? 1146 VAL A O     1 
ATOM   4032  C  CB    . VAL E  3 470  ? 78.274  20.582  18.268  1.00 45.02 ? 1146 VAL A CB    1 
ATOM   4033  C  CG1   . VAL E  3 470  ? 78.777  21.980  18.609  1.00 44.57 ? 1146 VAL A CG1   1 
ATOM   4034  C  CG2   . VAL E  3 470  ? 77.195  20.151  19.241  1.00 44.55 ? 1146 VAL A CG2   1 
ATOM   4035  N  N     . ALA E  3 471  ? 75.375  20.209  16.709  1.00 46.01 ? 1147 ALA A N     1 
ATOM   4036  C  CA    . ALA E  3 471  ? 74.108  19.528  16.502  1.00 44.98 ? 1147 ALA A CA    1 
ATOM   4037  C  C     . ALA E  3 471  ? 74.128  18.681  15.243  1.00 44.05 ? 1147 ALA A C     1 
ATOM   4038  O  O     . ALA E  3 471  ? 73.536  17.612  15.219  1.00 45.34 ? 1147 ALA A O     1 
ATOM   4039  C  CB    . ALA E  3 471  ? 72.980  20.538  16.433  1.00 45.02 ? 1147 ALA A CB    1 
ATOM   4040  N  N     . ALA E  3 472  ? 74.815  19.165  14.213  1.00 42.73 ? 1148 ALA A N     1 
ATOM   4041  C  CA    . ALA E  3 472  ? 74.874  18.498  12.917  1.00 42.49 ? 1148 ALA A CA    1 
ATOM   4042  C  C     . ALA E  3 472  ? 76.065  17.537  12.778  1.00 42.87 ? 1148 ALA A C     1 
ATOM   4043  O  O     . ALA E  3 472  ? 76.220  16.873  11.744  1.00 42.84 ? 1148 ALA A O     1 
ATOM   4044  C  CB    . ALA E  3 472  ? 74.884  19.530  11.796  1.00 42.60 ? 1148 ALA A CB    1 
ATOM   4045  N  N     . LEU E  3 473  ? 76.903  17.466  13.814  1.00 42.89 ? 1149 LEU A N     1 
ATOM   4046  C  CA    . LEU E  3 473  ? 78.043  16.533  13.850  1.00 41.88 ? 1149 LEU A CA    1 
ATOM   4047  C  C     . LEU E  3 473  ? 77.585  15.088  14.065  1.00 42.03 ? 1149 LEU A C     1 
ATOM   4048  O  O     . LEU E  3 473  ? 77.637  14.568  15.180  1.00 41.16 ? 1149 LEU A O     1 
ATOM   4049  C  CB    . LEU E  3 473  ? 79.036  16.948  14.941  1.00 40.92 ? 1149 LEU A CB    1 
ATOM   4050  C  CG    . LEU E  3 473  ? 80.307  17.713  14.577  1.00 40.35 ? 1149 LEU A CG    1 
ATOM   4051  C  CD1   . LEU E  3 473  ? 80.178  18.530  13.303  1.00 42.01 ? 1149 LEU A CD1   1 
ATOM   4052  C  CD2   . LEU E  3 473  ? 80.722  18.600  15.711  1.00 38.52 ? 1149 LEU A CD2   1 
ATOM   4053  N  N     . THR E  3 474  ? 77.139  14.448  12.986  1.00 42.61 ? 1150 THR A N     1 
ATOM   4054  C  CA    . THR E  3 474  ? 76.550  13.110  13.051  1.00 42.81 ? 1150 THR A CA    1 
ATOM   4055  C  C     . THR E  3 474  ? 77.615  12.018  13.083  1.00 43.35 ? 1150 THR A C     1 
ATOM   4056  O  O     . THR E  3 474  ? 78.392  11.877  12.135  1.00 43.27 ? 1150 THR A O     1 
ATOM   4057  C  CB    . THR E  3 474  ? 75.615  12.845  11.851  1.00 42.91 ? 1150 THR A CB    1 
ATOM   4058  O  OG1   . THR E  3 474  ? 74.759  13.971  11.642  1.00 42.91 ? 1150 THR A OG1   1 
ATOM   4059  C  CG2   . THR E  3 474  ? 74.764  11.615  12.092  1.00 43.23 ? 1150 THR A CG2   1 
ATOM   4060  N  N     . PRO E  3 475  ? 77.650  11.229  14.170  1.00 44.12 ? 1151 PRO A N     1 
ATOM   4061  C  CA    . PRO E  3 475  ? 78.556  10.084  14.290  1.00 44.47 ? 1151 PRO A CA    1 
ATOM   4062  C  C     . PRO E  3 475  ? 78.457  9.132   13.108  1.00 44.84 ? 1151 PRO A C     1 
ATOM   4063  O  O     . PRO E  3 475  ? 77.383  8.981   12.520  1.00 45.08 ? 1151 PRO A O     1 
ATOM   4064  C  CB    . PRO E  3 475  ? 78.063  9.387   15.556  1.00 44.17 ? 1151 PRO A CB    1 
ATOM   4065  C  CG    . PRO E  3 475  ? 77.505  10.484  16.367  1.00 44.72 ? 1151 PRO A CG    1 
ATOM   4066  C  CD    . PRO E  3 475  ? 76.830  11.393  15.381  1.00 44.63 ? 1151 PRO A CD    1 
ATOM   4067  N  N     . LYS E  3 476  ? 79.576  8.498   12.778  1.00 45.42 ? 1152 LYS A N     1 
ATOM   4068  C  CA    . LYS E  3 476  ? 79.675  7.621   11.615  1.00 46.71 ? 1152 LYS A CA    1 
ATOM   4069  C  C     . LYS E  3 476  ? 78.688  6.455   11.688  1.00 47.03 ? 1152 LYS A C     1 
ATOM   4070  O  O     . LYS E  3 476  ? 78.056  6.099   10.684  1.00 47.02 ? 1152 LYS A O     1 
ATOM   4071  C  CB    . LYS E  3 476  ? 81.104  7.095   11.465  1.00 47.44 ? 1152 LYS A CB    1 
ATOM   4072  C  CG    . LYS E  3 476  ? 81.377  6.370   10.151  1.00 49.02 ? 1152 LYS A CG    1 
ATOM   4073  C  CD    . LYS E  3 476  ? 82.875  6.246   9.905   1.00 51.81 ? 1152 LYS A CD    1 
ATOM   4074  C  CE    . LYS E  3 476  ? 83.182  5.801   8.481   1.00 52.10 ? 1152 LYS A CE    1 
ATOM   4075  N  NZ    . LYS E  3 476  ? 82.951  4.350   8.302   1.00 52.68 ? 1152 LYS A NZ    1 
ATOM   4076  N  N     . ALA E  3 477  ? 78.557  5.872   12.879  1.00 46.75 ? 1153 ALA A N     1 
ATOM   4077  C  CA    . ALA E  3 477  ? 77.662  4.741   13.096  1.00 45.89 ? 1153 ALA A CA    1 
ATOM   4078  C  C     . ALA E  3 477  ? 76.206  5.131   12.892  1.00 46.22 ? 1153 ALA A C     1 
ATOM   4079  O  O     . ALA E  3 477  ? 75.409  4.314   12.437  1.00 46.78 ? 1153 ALA A O     1 
ATOM   4080  C  CB    . ALA E  3 477  ? 77.867  4.164   14.479  1.00 45.56 ? 1153 ALA A CB    1 
ATOM   4081  N  N     . GLU E  3 478  ? 75.867  6.376   13.222  1.00 46.44 ? 1154 GLU A N     1 
ATOM   4082  C  CA    . GLU E  3 478  ? 74.501  6.875   13.062  1.00 47.25 ? 1154 GLU A CA    1 
ATOM   4083  C  C     . GLU E  3 478  ? 74.141  7.029   11.596  1.00 47.27 ? 1154 GLU A C     1 
ATOM   4084  O  O     . GLU E  3 478  ? 73.030  6.721   11.168  1.00 47.33 ? 1154 GLU A O     1 
ATOM   4085  C  CB    . GLU E  3 478  ? 74.323  8.204   13.791  1.00 48.10 ? 1154 GLU A CB    1 
ATOM   4086  C  CG    . GLU E  3 478  ? 72.871  8.683   13.868  1.00 50.29 ? 1154 GLU A CG    1 
ATOM   4087  C  CD    . GLU E  3 478  ? 72.617  9.625   15.037  1.00 53.07 ? 1154 GLU A CD    1 
ATOM   4088  O  OE1   . GLU E  3 478  ? 71.619  9.407   15.765  1.00 52.16 ? 1154 GLU A OE1   1 
ATOM   4089  O  OE2   . GLU E  3 478  ? 73.416  10.576  15.236  1.00 55.49 ? 1154 GLU A OE2   1 
ATOM   4090  N  N     . ILE E  3 479  ? 75.104  7.481   10.830  1.00 46.80 ? 1155 ILE A N     1 
ATOM   4091  C  CA    . ILE E  3 479  ? 74.907  7.647   9.413   1.00 46.29 ? 1155 ILE A CA    1 
ATOM   4092  C  C     . ILE E  3 479  ? 74.721  6.309   8.715   1.00 47.13 ? 1155 ILE A C     1 
ATOM   4093  O  O     . ILE E  3 479  ? 73.847  6.167   7.863   1.00 47.03 ? 1155 ILE A O     1 
ATOM   4094  C  CB    . ILE E  3 479  ? 76.053  8.452   8.812   1.00 45.24 ? 1155 ILE A CB    1 
ATOM   4095  C  CG1   . ILE E  3 479  ? 75.720  9.931   8.932   1.00 45.06 ? 1155 ILE A CG1   1 
ATOM   4096  C  CG2   . ILE E  3 479  ? 76.270  8.103   7.360   1.00 44.03 ? 1155 ILE A CG2   1 
ATOM   4097  C  CD1   . ILE E  3 479  ? 76.912  10.817  8.902   1.00 46.65 ? 1155 ILE A CD1   1 
ATOM   4098  N  N     . GLU E  3 480  ? 75.530  5.327   9.094   1.00 48.35 ? 1156 GLU A N     1 
ATOM   4099  C  CA    . GLU E  3 480  ? 75.435  3.998   8.500   1.00 50.21 ? 1156 GLU A CA    1 
ATOM   4100  C  C     . GLU E  3 480  ? 74.235  3.211   9.021   1.00 50.21 ? 1156 GLU A C     1 
ATOM   4101  O  O     . GLU E  3 480  ? 73.698  2.348   8.319   1.00 50.44 ? 1156 GLU A O     1 
ATOM   4102  C  CB    . GLU E  3 480  ? 76.732  3.224   8.718   1.00 51.24 ? 1156 GLU A CB    1 
ATOM   4103  C  CG    . GLU E  3 480  ? 77.837  3.640   7.755   1.00 54.01 ? 1156 GLU A CG    1 
ATOM   4104  C  CD    . GLU E  3 480  ? 79.214  3.225   8.225   1.00 56.18 ? 1156 GLU A CD    1 
ATOM   4105  O  OE1   . GLU E  3 480  ? 79.934  2.574   7.434   1.00 56.87 ? 1156 GLU A OE1   1 
ATOM   4106  O  OE2   . GLU E  3 480  ? 79.572  3.545   9.385   1.00 57.62 ? 1156 GLU A OE2   1 
ATOM   4107  N  N     . GLY E  3 481  ? 73.821  3.517   10.249  1.00 50.14 ? 1157 GLY A N     1 
ATOM   4108  C  CA    . GLY E  3 481  ? 72.623  2.919   10.840  1.00 49.89 ? 1157 GLY A CA    1 
ATOM   4109  C  C     . GLY E  3 481  ? 71.346  3.462   10.225  1.00 49.29 ? 1157 GLY A C     1 
ATOM   4110  O  O     . GLY E  3 481  ? 71.393  4.367   9.390   1.00 49.80 ? 1157 GLY A O     1 
ATOM   4111  N  N     . GLU E  3 482  ? 70.207  2.909   10.635  1.00 48.36 ? 1158 GLU A N     1 
ATOM   4112  C  CA    . GLU E  3 482  ? 68.905  3.361   10.147  1.00 47.48 ? 1158 GLU A CA    1 
ATOM   4113  C  C     . GLU E  3 482  ? 68.309  4.458   11.021  1.00 46.71 ? 1158 GLU A C     1 
ATOM   4114  O  O     . GLU E  3 482  ? 68.785  4.705   12.129  1.00 46.77 ? 1158 GLU A O     1 
ATOM   4115  C  CB    . GLU E  3 482  ? 67.940  2.190   10.052  1.00 47.46 ? 1158 GLU A CB    1 
ATOM   4116  C  CG    . GLU E  3 482  ? 68.119  1.381   8.802   1.00 50.16 ? 1158 GLU A CG    1 
ATOM   4117  C  CD    . GLU E  3 482  ? 66.935  0.477   8.535   1.00 52.93 ? 1158 GLU A CD    1 
ATOM   4118  O  OE1   . GLU E  3 482  ? 66.182  0.760   7.573   1.00 54.52 ? 1158 GLU A OE1   1 
ATOM   4119  O  OE2   . GLU E  3 482  ? 66.747  -0.508  9.290   1.00 52.95 ? 1158 GLU A OE2   1 
ATOM   4120  N  N     . ILE E  3 483  ? 67.279  5.129   10.508  1.00 45.99 ? 1159 ILE A N     1 
ATOM   4121  C  CA    . ILE E  3 483  ? 66.540  6.111   11.292  1.00 45.19 ? 1159 ILE A CA    1 
ATOM   4122  C  C     . ILE E  3 483  ? 65.650  5.354   12.259  1.00 45.00 ? 1159 ILE A C     1 
ATOM   4123  O  O     . ILE E  3 483  ? 64.814  4.539   11.850  1.00 45.53 ? 1159 ILE A O     1 
ATOM   4124  C  CB    . ILE E  3 483  ? 65.721  7.088   10.412  1.00 45.20 ? 1159 ILE A CB    1 
ATOM   4125  C  CG1   . ILE E  3 483  ? 66.660  8.114   9.778   1.00 46.56 ? 1159 ILE A CG1   1 
ATOM   4126  C  CG2   . ILE E  3 483  ? 64.681  7.830   11.242  1.00 44.11 ? 1159 ILE A CG2   1 
ATOM   4127  C  CD1   . ILE E  3 483  ? 66.075  8.879   8.601   1.00 47.63 ? 1159 ILE A CD1   1 
ATOM   4128  N  N     . GLY E  3 484  ? 65.855  5.613   13.543  1.00 44.35 ? 1160 GLY A N     1 
ATOM   4129  C  CA    . GLY E  3 484  ? 65.142  4.911   14.599  1.00 44.18 ? 1160 GLY A CA    1 
ATOM   4130  C  C     . GLY E  3 484  ? 66.084  4.054   15.419  1.00 44.26 ? 1160 GLY A C     1 
ATOM   4131  O  O     . GLY E  3 484  ? 65.732  3.615   16.513  1.00 43.88 ? 1160 GLY A O     1 
ATOM   4132  N  N     . ASP E  3 485  ? 67.281  3.812   14.883  1.00 44.50 ? 1161 ASP A N     1 
ATOM   4133  C  CA    . ASP E  3 485  ? 68.330  3.099   15.607  1.00 44.40 ? 1161 ASP A CA    1 
ATOM   4134  C  C     . ASP E  3 485  ? 68.763  3.910   16.813  1.00 44.00 ? 1161 ASP A C     1 
ATOM   4135  O  O     . ASP E  3 485  ? 68.849  5.135   16.753  1.00 44.06 ? 1161 ASP A O     1 
ATOM   4136  C  CB    . ASP E  3 485  ? 69.534  2.821   14.703  1.00 44.83 ? 1161 ASP A CB    1 
ATOM   4137  C  CG    . ASP E  3 485  ? 69.309  1.643   13.766  1.00 46.57 ? 1161 ASP A CG    1 
ATOM   4138  O  OD1   . ASP E  3 485  ? 68.259  0.964   13.873  1.00 47.59 ? 1161 ASP A OD1   1 
ATOM   4139  O  OD2   . ASP E  3 485  ? 70.194  1.390   12.921  1.00 47.37 ? 1161 ASP A OD2   1 
ATOM   4140  N  N     . SER E  3 486  ? 69.024  3.217   17.909  1.00 43.65 ? 1162 SER A N     1 
ATOM   4141  C  CA    . SER E  3 486  ? 69.386  3.872   19.146  1.00 44.09 ? 1162 SER A CA    1 
ATOM   4142  C  C     . SER E  3 486  ? 70.905  3.898   19.297  1.00 44.24 ? 1162 SER A C     1 
ATOM   4143  O  O     . SER E  3 486  ? 71.561  2.852   19.238  1.00 45.04 ? 1162 SER A O     1 
ATOM   4144  C  CB    . SER E  3 486  ? 68.737  3.140   20.319  1.00 44.85 ? 1162 SER A CB    1 
ATOM   4145  O  OG    . SER E  3 486  ? 68.936  3.838   21.533  1.00 46.30 ? 1162 SER A OG    1 
ATOM   4146  N  N     . HIS E  3 487  ? 71.461  5.095   19.478  1.00 43.67 ? 1163 HIS A N     1 
ATOM   4147  C  CA    . HIS E  3 487  ? 72.898  5.260   19.680  1.00 42.96 ? 1163 HIS A CA    1 
ATOM   4148  C  C     . HIS E  3 487  ? 73.156  6.016   20.967  1.00 43.19 ? 1163 HIS A C     1 
ATOM   4149  O  O     . HIS E  3 487  ? 73.652  7.139   20.936  1.00 42.73 ? 1163 HIS A O     1 
ATOM   4150  C  CB    . HIS E  3 487  ? 73.535  6.004   18.503  1.00 42.47 ? 1163 HIS A CB    1 
ATOM   4151  C  CG    . HIS E  3 487  ? 73.245  5.388   17.173  1.00 42.49 ? 1163 HIS A CG    1 
ATOM   4152  N  ND1   . HIS E  3 487  ? 73.704  4.138   16.817  1.00 43.37 ? 1163 HIS A ND1   1 
ATOM   4153  C  CD2   . HIS E  3 487  ? 72.542  5.847   16.113  1.00 42.42 ? 1163 HIS A CD2   1 
ATOM   4154  C  CE1   . HIS E  3 487  ? 73.293  3.850   15.596  1.00 43.35 ? 1163 HIS A CE1   1 
ATOM   4155  N  NE2   . HIS E  3 487  ? 72.587  4.872   15.146  1.00 44.12 ? 1163 HIS A NE2   1 
ATOM   4156  N  N     . MET E  3 488  ? 72.818  5.394   22.095  1.00 43.98 ? 1164 MET A N     1 
ATOM   4157  C  CA    . MET E  3 488  ? 72.921  6.042   23.402  1.00 45.23 ? 1164 MET A CA    1 
ATOM   4158  C  C     . MET E  3 488  ? 74.276  6.689   23.662  1.00 44.38 ? 1164 MET A C     1 
ATOM   4159  O  O     . MET E  3 488  ? 75.323  6.035   23.595  1.00 43.64 ? 1164 MET A O     1 
ATOM   4160  C  CB    . MET E  3 488  ? 72.608  5.056   24.511  1.00 44.82 ? 1164 MET A CB    1 
ATOM   4161  C  CG    . MET E  3 488  ? 71.141  4.861   24.742  1.00 46.25 ? 1164 MET A CG    1 
ATOM   4162  S  SD    . MET E  3 488  ? 70.879  3.395   25.744  1.00 50.51 ? 1164 MET A SD    1 
ATOM   4163  C  CE    . MET E  3 488  ? 70.897  4.060   27.409  1.00 49.29 ? 1164 MET A CE    1 
ATOM   4164  N  N     . GLY E  3 489  ? 74.233  7.987   23.942  1.00 44.45 ? 1165 GLY A N     1 
ATOM   4165  C  CA    . GLY E  3 489  ? 75.421  8.773   24.265  1.00 44.70 ? 1165 GLY A CA    1 
ATOM   4166  C  C     . GLY E  3 489  ? 76.587  8.764   23.286  1.00 44.92 ? 1165 GLY A C     1 
ATOM   4167  O  O     . GLY E  3 489  ? 77.695  9.144   23.661  1.00 45.51 ? 1165 GLY A O     1 
ATOM   4168  N  N     . LEU E  3 490  ? 76.357  8.354   22.039  1.00 44.47 ? 1166 LEU A N     1 
ATOM   4169  C  CA    . LEU E  3 490  ? 77.444  8.232   21.067  1.00 43.50 ? 1166 LEU A CA    1 
ATOM   4170  C  C     . LEU E  3 490  ? 78.022  9.588   20.714  1.00 44.06 ? 1166 LEU A C     1 
ATOM   4171  O  O     . LEU E  3 490  ? 79.236  9.773   20.777  1.00 44.55 ? 1166 LEU A O     1 
ATOM   4172  C  CB    . LEU E  3 490  ? 76.985  7.531   19.794  1.00 43.07 ? 1166 LEU A CB    1 
ATOM   4173  C  CG    . LEU E  3 490  ? 77.949  6.559   19.108  1.00 42.15 ? 1166 LEU A CG    1 
ATOM   4174  C  CD1   . LEU E  3 490  ? 77.353  6.172   17.777  1.00 43.72 ? 1166 LEU A CD1   1 
ATOM   4175  C  CD2   . LEU E  3 490  ? 79.338  7.113   18.898  1.00 41.99 ? 1166 LEU A CD2   1 
ATOM   4176  N  N     . ALA E  3 491  ? 77.158  10.533  20.347  1.00 44.74 ? 1167 ALA A N     1 
ATOM   4177  C  CA    . ALA E  3 491  ? 77.612  11.873  19.963  1.00 45.23 ? 1167 ALA A CA    1 
ATOM   4178  C  C     . ALA E  3 491  ? 78.304  12.551  21.130  1.00 45.89 ? 1167 ALA A C     1 
ATOM   4179  O  O     . ALA E  3 491  ? 79.302  13.237  20.953  1.00 46.75 ? 1167 ALA A O     1 
ATOM   4180  C  CB    . ALA E  3 491  ? 76.457  12.724  19.468  1.00 45.12 ? 1167 ALA A CB    1 
ATOM   4181  N  N     . ALA E  3 492  ? 77.779  12.345  22.323  1.00 45.78 ? 1168 ALA A N     1 
ATOM   4182  C  CA    . ALA E  3 492  ? 78.340  12.931  23.524  1.00 45.09 ? 1168 ALA A CA    1 
ATOM   4183  C  C     . ALA E  3 492  ? 79.743  12.410  23.775  1.00 44.67 ? 1168 ALA A C     1 
ATOM   4184  O  O     . ALA E  3 492  ? 80.646  13.169  24.114  1.00 44.47 ? 1168 ALA A O     1 
ATOM   4185  C  CB    . ALA E  3 492  ? 77.447  12.612  24.697  1.00 45.84 ? 1168 ALA A CB    1 
ATOM   4186  N  N     . ARG E  3 493  ? 79.908  11.104  23.595  1.00 45.08 ? 1169 ARG A N     1 
ATOM   4187  C  CA    . ARG E  3 493  ? 81.166  10.417  23.851  1.00 45.74 ? 1169 ARG A CA    1 
ATOM   4188  C  C     . ARG E  3 493  ? 82.216  10.829  22.828  1.00 45.55 ? 1169 ARG A C     1 
ATOM   4189  O  O     . ARG E  3 493  ? 83.400  10.942  23.146  1.00 44.48 ? 1169 ARG A O     1 
ATOM   4190  C  CB    . ARG E  3 493  ? 80.932  8.908   23.812  1.00 46.07 ? 1169 ARG A CB    1 
ATOM   4191  C  CG    . ARG E  3 493  ? 81.999  8.075   24.496  1.00 48.65 ? 1169 ARG A CG    1 
ATOM   4192  C  CD    . ARG E  3 493  ? 81.496  6.671   24.850  1.00 51.16 ? 1169 ARG A CD    1 
ATOM   4193  N  NE    . ARG E  3 493  ? 80.864  5.997   23.716  1.00 53.21 ? 1169 ARG A NE    1 
ATOM   4194  C  CZ    . ARG E  3 493  ? 79.552  5.800   23.592  1.00 54.38 ? 1169 ARG A CZ    1 
ATOM   4195  N  NH1   . ARG E  3 493  ? 78.716  6.215   24.539  1.00 54.38 ? 1169 ARG A NH1   1 
ATOM   4196  N  NH2   . ARG E  3 493  ? 79.073  5.184   22.516  1.00 55.38 ? 1169 ARG A NH2   1 
ATOM   4197  N  N     . MET E  3 494  ? 81.756  11.058  21.601  1.00 46.34 ? 1170 MET A N     1 
ATOM   4198  C  CA    . MET E  3 494  ? 82.596  11.523  20.503  1.00 47.21 ? 1170 MET A CA    1 
ATOM   4199  C  C     . MET E  3 494  ? 83.097  12.941  20.765  1.00 47.37 ? 1170 MET A C     1 
ATOM   4200  O  O     . MET E  3 494  ? 84.281  13.225  20.590  1.00 48.04 ? 1170 MET A O     1 
ATOM   4201  C  CB    . MET E  3 494  ? 81.814  11.463  19.190  1.00 46.96 ? 1170 MET A CB    1 
ATOM   4202  C  CG    . MET E  3 494  ? 82.509  12.103  18.002  1.00 47.58 ? 1170 MET A CG    1 
ATOM   4203  S  SD    . MET E  3 494  ? 81.381  12.516  16.658  1.00 49.03 ? 1170 MET A SD    1 
ATOM   4204  C  CE    . MET E  3 494  ? 80.528  13.950  17.327  1.00 49.36 ? 1170 MET A CE    1 
ATOM   4205  N  N     . MET E  3 495  ? 82.187  13.822  21.179  1.00 47.21 ? 1171 MET A N     1 
ATOM   4206  C  CA    . MET E  3 495  ? 82.523  15.189  21.575  1.00 46.69 ? 1171 MET A CA    1 
ATOM   4207  C  C     . MET E  3 495  ? 83.518  15.216  22.724  1.00 46.10 ? 1171 MET A C     1 
ATOM   4208  O  O     . MET E  3 495  ? 84.467  16.001  22.725  1.00 46.05 ? 1171 MET A O     1 
ATOM   4209  C  CB    . MET E  3 495  ? 81.262  15.928  22.011  1.00 47.14 ? 1171 MET A CB    1 
ATOM   4210  C  CG    . MET E  3 495  ? 80.456  16.517  20.886  1.00 48.94 ? 1171 MET A CG    1 
ATOM   4211  S  SD    . MET E  3 495  ? 81.334  17.899  20.136  1.00 49.75 ? 1171 MET A SD    1 
ATOM   4212  C  CE    . MET E  3 495  ? 81.805  17.136  18.607  1.00 52.07 ? 1171 MET A CE    1 
ATOM   4213  N  N     . SER E  3 496  ? 83.275  14.355  23.705  1.00 45.97 ? 1172 SER A N     1 
ATOM   4214  C  CA    . SER E  3 496  ? 84.113  14.256  24.885  1.00 45.27 ? 1172 SER A CA    1 
ATOM   4215  C  C     . SER E  3 496  ? 85.529  13.863  24.484  1.00 44.67 ? 1172 SER A C     1 
ATOM   4216  O  O     . SER E  3 496  ? 86.503  14.405  25.009  1.00 44.31 ? 1172 SER A O     1 
ATOM   4217  C  CB    . SER E  3 496  ? 83.516  13.245  25.853  1.00 45.19 ? 1172 SER A CB    1 
ATOM   4218  O  OG    . SER E  3 496  ? 83.981  13.470  27.162  1.00 46.00 ? 1172 SER A OG    1 
ATOM   4219  N  N     . GLN E  3 497  ? 85.632  12.940  23.528  1.00 44.48 ? 1173 GLN A N     1 
ATOM   4220  C  CA    . GLN E  3 497  ? 86.925  12.524  22.989  1.00 44.16 ? 1173 GLN A CA    1 
ATOM   4221  C  C     . GLN E  3 497  ? 87.609  13.647  22.216  1.00 43.71 ? 1173 GLN A C     1 
ATOM   4222  O  O     . GLN E  3 497  ? 88.814  13.867  22.370  1.00 43.70 ? 1173 GLN A O     1 
ATOM   4223  C  CB    . GLN E  3 497  ? 86.772  11.294  22.102  1.00 43.78 ? 1173 GLN A CB    1 
ATOM   4224  C  CG    . GLN E  3 497  ? 88.090  10.735  21.603  1.00 44.26 ? 1173 GLN A CG    1 
ATOM   4225  C  CD    . GLN E  3 497  ? 87.913  9.493   20.751  1.00 45.80 ? 1173 GLN A CD    1 
ATOM   4226  O  OE1   . GLN E  3 497  ? 88.692  8.543   20.851  1.00 46.18 ? 1173 GLN A OE1   1 
ATOM   4227  N  NE2   . GLN E  3 497  ? 86.882  9.490   19.907  1.00 47.09 ? 1173 GLN A NE2   1 
ATOM   4228  N  N     . ALA E  3 498  ? 86.834  14.349  21.391  1.00 43.13 ? 1174 ALA A N     1 
ATOM   4229  C  CA    . ALA E  3 498  ? 87.345  15.454  20.590  1.00 42.33 ? 1174 ALA A CA    1 
ATOM   4230  C  C     . ALA E  3 498  ? 88.013  16.513  21.456  1.00 43.12 ? 1174 ALA A C     1 
ATOM   4231  O  O     . ALA E  3 498  ? 89.147  16.911  21.178  1.00 42.89 ? 1174 ALA A O     1 
ATOM   4232  C  CB    . ALA E  3 498  ? 86.242  16.062  19.766  1.00 41.47 ? 1174 ALA A CB    1 
ATOM   4233  N  N     . MET E  3 499  ? 87.329  16.946  22.515  1.00 44.43 ? 1175 MET A N     1 
ATOM   4234  C  CA    . MET E  3 499  ? 87.870  17.972  23.415  1.00 45.59 ? 1175 MET A CA    1 
ATOM   4235  C  C     . MET E  3 499  ? 89.239  17.594  23.958  1.00 45.37 ? 1175 MET A C     1 
ATOM   4236  O  O     . MET E  3 499  ? 90.170  18.392  23.893  1.00 44.26 ? 1175 MET A O     1 
ATOM   4237  C  CB    . MET E  3 499  ? 86.923  18.251  24.578  1.00 46.35 ? 1175 MET A CB    1 
ATOM   4238  C  CG    . MET E  3 499  ? 85.542  18.739  24.189  1.00 49.12 ? 1175 MET A CG    1 
ATOM   4239  S  SD    . MET E  3 499  ? 85.555  20.154  23.071  1.00 52.28 ? 1175 MET A SD    1 
ATOM   4240  C  CE    . MET E  3 499  ? 85.124  19.363  21.515  1.00 51.68 ? 1175 MET A CE    1 
ATOM   4241  N  N     . ARG E  3 500  ? 89.351  16.374  24.483  1.00 46.19 ? 1176 ARG A N     1 
ATOM   4242  C  CA    . ARG E  3 500  ? 90.617  15.850  24.994  1.00 47.15 ? 1176 ARG A CA    1 
ATOM   4243  C  C     . ARG E  3 500  ? 91.755  16.041  23.996  1.00 47.38 ? 1176 ARG A C     1 
ATOM   4244  O  O     . ARG E  3 500  ? 92.806  16.588  24.342  1.00 47.45 ? 1176 ARG A O     1 
ATOM   4245  C  CB    . ARG E  3 500  ? 90.477  14.371  25.342  1.00 47.41 ? 1176 ARG A CB    1 
ATOM   4246  C  CG    . ARG E  3 500  ? 89.947  14.108  26.732  1.00 48.61 ? 1176 ARG A CG    1 
ATOM   4247  C  CD    . ARG E  3 500  ? 89.795  12.623  26.965  1.00 49.71 ? 1176 ARG A CD    1 
ATOM   4248  N  NE    . ARG E  3 500  ? 88.679  12.087  26.195  1.00 51.20 ? 1176 ARG A NE    1 
ATOM   4249  C  CZ    . ARG E  3 500  ? 88.350  10.800  26.132  1.00 52.24 ? 1176 ARG A CZ    1 
ATOM   4250  N  NH1   . ARG E  3 500  ? 89.054  9.888   26.791  1.00 53.43 ? 1176 ARG A NH1   1 
ATOM   4251  N  NH2   . ARG E  3 500  ? 87.307  10.420  25.409  1.00 52.43 ? 1176 ARG A NH2   1 
ATOM   4252  N  N     . LYS E  3 501  ? 91.524  15.602  22.760  1.00 47.43 ? 1177 LYS A N     1 
ATOM   4253  C  CA    . LYS E  3 501  ? 92.518  15.678  21.695  1.00 47.43 ? 1177 LYS A CA    1 
ATOM   4254  C  C     . LYS E  3 501  ? 92.761  17.097  21.192  1.00 47.19 ? 1177 LYS A C     1 
ATOM   4255  O  O     . LYS E  3 501  ? 93.900  17.466  20.906  1.00 47.28 ? 1177 LYS A O     1 
ATOM   4256  C  CB    . LYS E  3 501  ? 92.116  14.788  20.522  1.00 48.09 ? 1177 LYS A CB    1 
ATOM   4257  C  CG    . LYS E  3 501  ? 92.065  13.295  20.840  1.00 49.76 ? 1177 LYS A CG    1 
ATOM   4258  C  CD    . LYS E  3 501  ? 92.078  12.463  19.564  1.00 50.88 ? 1177 LYS A CD    1 
ATOM   4259  C  CE    . LYS E  3 501  ? 93.369  12.688  18.778  1.00 51.26 ? 1177 LYS A CE    1 
ATOM   4260  N  NZ    . LYS E  3 501  ? 93.226  12.303  17.348  1.00 52.26 ? 1177 LYS A NZ    1 
ATOM   4261  N  N     . LEU E  3 502  ? 91.699  17.890  21.081  1.00 46.96 ? 1178 LEU A N     1 
ATOM   4262  C  CA    . LEU E  3 502  ? 91.822  19.241  20.520  1.00 47.21 ? 1178 LEU A CA    1 
ATOM   4263  C  C     . LEU E  3 502  ? 92.480  20.269  21.443  1.00 47.13 ? 1178 LEU A C     1 
ATOM   4264  O  O     . LEU E  3 502  ? 93.376  20.996  21.018  1.00 46.25 ? 1178 LEU A O     1 
ATOM   4265  C  CB    . LEU E  3 502  ? 90.467  19.764  20.047  1.00 46.97 ? 1178 LEU A CB    1 
ATOM   4266  C  CG    . LEU E  3 502  ? 89.868  19.101  18.810  1.00 46.92 ? 1178 LEU A CG    1 
ATOM   4267  C  CD1   . LEU E  3 502  ? 88.441  19.571  18.643  1.00 47.64 ? 1178 LEU A CD1   1 
ATOM   4268  C  CD2   . LEU E  3 502  ? 90.675  19.401  17.569  1.00 46.70 ? 1178 LEU A CD2   1 
ATOM   4269  N  N     . ALA E  3 503  ? 92.028  20.324  22.695  1.00 47.88 ? 1179 ALA A N     1 
ATOM   4270  C  CA    . ALA E  3 503  ? 92.478  21.328  23.662  1.00 48.08 ? 1179 ALA A CA    1 
ATOM   4271  C  C     . ALA E  3 503  ? 93.974  21.599  23.575  1.00 48.68 ? 1179 ALA A C     1 
ATOM   4272  O  O     . ALA E  3 503  ? 94.388  22.753  23.434  1.00 49.37 ? 1179 ALA A O     1 
ATOM   4273  C  CB    . ALA E  3 503  ? 92.098  20.917  25.071  1.00 47.85 ? 1179 ALA A CB    1 
ATOM   4274  N  N     . GLY E  3 504  ? 94.772  20.534  23.644  1.00 48.91 ? 1180 GLY A N     1 
ATOM   4275  C  CA    . GLY E  3 504  ? 96.234  20.639  23.601  1.00 49.06 ? 1180 GLY A CA    1 
ATOM   4276  C  C     . GLY E  3 504  ? 96.786  21.161  22.286  1.00 48.93 ? 1180 GLY A C     1 
ATOM   4277  O  O     . GLY E  3 504  ? 97.633  22.058  22.275  1.00 48.57 ? 1180 GLY A O     1 
ATOM   4278  N  N     . ASN E  3 505  ? 96.301  20.595  21.180  1.00 49.01 ? 1181 ASN A N     1 
ATOM   4279  C  CA    . ASN E  3 505  ? 96.728  20.992  19.836  1.00 48.97 ? 1181 ASN A CA    1 
ATOM   4280  C  C     . ASN E  3 505  ? 96.384  22.430  19.506  1.00 48.82 ? 1181 ASN A C     1 
ATOM   4281  O  O     . ASN E  3 505  ? 97.125  23.097  18.791  1.00 48.82 ? 1181 ASN A O     1 
ATOM   4282  C  CB    . ASN E  3 505  ? 96.112  20.079  18.772  1.00 49.07 ? 1181 ASN A CB    1 
ATOM   4283  C  CG    . ASN E  3 505  ? 96.750  18.707  18.733  1.00 50.22 ? 1181 ASN A CG    1 
ATOM   4284  O  OD1   . ASN E  3 505  ? 96.242  17.806  18.069  1.00 49.96 ? 1181 ASN A OD1   1 
ATOM   4285  N  ND2   . ASN E  3 505  ? 97.872  18.539  19.437  1.00 51.56 ? 1181 ASN A ND2   1 
ATOM   4286  N  N     . LEU E  3 506  ? 95.251  22.896  20.021  1.00 48.63 ? 1182 LEU A N     1 
ATOM   4287  C  CA    . LEU E  3 506  ? 94.791  24.248  19.761  1.00 48.80 ? 1182 LEU A CA    1 
ATOM   4288  C  C     . LEU E  3 506  ? 95.632  25.274  20.495  1.00 49.23 ? 1182 LEU A C     1 
ATOM   4289  O  O     . LEU E  3 506  ? 95.948  26.326  19.948  1.00 48.74 ? 1182 LEU A O     1 
ATOM   4290  C  CB    . LEU E  3 506  ? 93.323  24.397  20.140  1.00 48.97 ? 1182 LEU A CB    1 
ATOM   4291  C  CG    . LEU E  3 506  ? 92.334  23.746  19.174  1.00 49.55 ? 1182 LEU A CG    1 
ATOM   4292  C  CD1   . LEU E  3 506  ? 90.998  23.514  19.870  1.00 50.10 ? 1182 LEU A CD1   1 
ATOM   4293  C  CD2   . LEU E  3 506  ? 92.157  24.582  17.915  1.00 48.51 ? 1182 LEU A CD2   1 
ATOM   4294  N  N     . LYS E  3 507  ? 95.994  24.963  21.734  1.00 50.53 ? 1183 LYS A N     1 
ATOM   4295  C  CA    . LYS E  3 507  ? 96.823  25.859  22.526  1.00 51.83 ? 1183 LYS A CA    1 
ATOM   4296  C  C     . LYS E  3 507  ? 98.224  25.987  21.917  1.00 51.47 ? 1183 LYS A C     1 
ATOM   4297  O  O     . LYS E  3 507  ? 98.716  27.100  21.739  1.00 51.34 ? 1183 LYS A O     1 
ATOM   4298  C  CB    . LYS E  3 507  ? 96.866  25.417  24.002  1.00 52.59 ? 1183 LYS A CB    1 
ATOM   4299  C  CG    . LYS E  3 507  ? 97.837  26.199  24.931  1.00 55.71 ? 1183 LYS A CG    1 
ATOM   4300  C  CD    . LYS E  3 507  ? 97.755  27.741  24.813  1.00 59.28 ? 1183 LYS A CD    1 
ATOM   4301  C  CE    . LYS E  3 507  ? 96.449  28.332  25.354  1.00 61.80 ? 1183 LYS A CE    1 
ATOM   4302  N  NZ    . LYS E  3 507  ? 96.509  28.495  26.837  1.00 63.31 ? 1183 LYS A NZ    1 
ATOM   4303  N  N     . GLN E  3 508  ? 98.843  24.859  21.568  1.00 51.24 ? 1184 GLN A N     1 
ATOM   4304  C  CA    . GLN E  3 508  ? 100.199 24.875  21.018  1.00 51.43 ? 1184 GLN A CA    1 
ATOM   4305  C  C     . GLN E  3 508  ? 100.311 25.520  19.641  1.00 50.42 ? 1184 GLN A C     1 
ATOM   4306  O  O     . GLN E  3 508  ? 101.395 25.914  19.231  1.00 50.23 ? 1184 GLN A O     1 
ATOM   4307  C  CB    . GLN E  3 508  ? 100.829 23.480  21.038  1.00 52.47 ? 1184 GLN A CB    1 
ATOM   4308  C  CG    . GLN E  3 508  ? 101.769 23.287  22.237  1.00 57.19 ? 1184 GLN A CG    1 
ATOM   4309  C  CD    . GLN E  3 508  ? 101.760 21.869  22.799  1.00 59.90 ? 1184 GLN A CD    1 
ATOM   4310  O  OE1   . GLN E  3 508  ? 102.266 20.936  22.171  1.00 60.75 ? 1184 GLN A OE1   1 
ATOM   4311  N  NE2   . GLN E  3 508  ? 101.193 21.705  23.999  1.00 60.39 ? 1184 GLN A NE2   1 
ATOM   4312  N  N     . SER E  3 509  ? 99.185  25.643  18.946  1.00 49.80 ? 1185 SER A N     1 
ATOM   4313  C  CA    . SER E  3 509  ? 99.142  26.267  17.628  1.00 48.31 ? 1185 SER A CA    1 
ATOM   4314  C  C     . SER E  3 509  ? 98.578  27.673  17.693  1.00 47.75 ? 1185 SER A C     1 
ATOM   4315  O  O     . SER E  3 509  ? 98.562  28.387  16.694  1.00 47.35 ? 1185 SER A O     1 
ATOM   4316  C  CB    . SER E  3 509  ? 98.284  25.434  16.692  1.00 48.20 ? 1185 SER A CB    1 
ATOM   4317  O  OG    . SER E  3 509  ? 98.788  24.120  16.597  1.00 48.38 ? 1185 SER A OG    1 
ATOM   4318  N  N     . ASN E  3 510  ? 98.114  28.059  18.877  1.00 47.70 ? 1186 ASN A N     1 
ATOM   4319  C  CA    . ASN E  3 510  ? 97.441  29.332  19.091  1.00 47.58 ? 1186 ASN A CA    1 
ATOM   4320  C  C     . ASN E  3 510  ? 96.235  29.525  18.161  1.00 47.75 ? 1186 ASN A C     1 
ATOM   4321  O  O     . ASN E  3 510  ? 95.982  30.625  17.664  1.00 48.23 ? 1186 ASN A O     1 
ATOM   4322  C  CB    . ASN E  3 510  ? 98.427  30.490  18.974  1.00 47.58 ? 1186 ASN A CB    1 
ATOM   4323  C  CG    . ASN E  3 510  ? 98.007  31.688  19.795  1.00 49.06 ? 1186 ASN A CG    1 
ATOM   4324  O  OD1   . ASN E  3 510  ? 97.711  31.570  20.985  1.00 49.67 ? 1186 ASN A OD1   1 
ATOM   4325  N  ND2   . ASN E  3 510  ? 97.976  32.852  19.163  1.00 50.48 ? 1186 ASN A ND2   1 
ATOM   4326  N  N     . THR E  3 511  ? 95.496  28.436  17.946  1.00 47.21 ? 1187 THR A N     1 
ATOM   4327  C  CA    . THR E  3 511  ? 94.338  28.410  17.057  1.00 46.05 ? 1187 THR A CA    1 
ATOM   4328  C  C     . THR E  3 511  ? 93.062  28.552  17.867  1.00 45.77 ? 1187 THR A C     1 
ATOM   4329  O  O     . THR E  3 511  ? 92.834  27.789  18.806  1.00 45.86 ? 1187 THR A O     1 
ATOM   4330  C  CB    . THR E  3 511  ? 94.261  27.067  16.295  1.00 45.86 ? 1187 THR A CB    1 
ATOM   4331  O  OG1   . THR E  3 511  ? 95.548  26.730  15.769  1.00 46.30 ? 1187 THR A OG1   1 
ATOM   4332  C  CG2   . THR E  3 511  ? 93.237  27.120  15.165  1.00 44.82 ? 1187 THR A CG2   1 
ATOM   4333  N  N     . LEU E  3 512  ? 92.228  29.522  17.505  1.00 45.18 ? 1188 LEU A N     1 
ATOM   4334  C  CA    . LEU E  3 512  ? 90.901  29.644  18.110  1.00 44.48 ? 1188 LEU A CA    1 
ATOM   4335  C  C     . LEU E  3 512  ? 89.923  28.705  17.419  1.00 44.29 ? 1188 LEU A C     1 
ATOM   4336  O  O     . LEU E  3 512  ? 89.888  28.652  16.190  1.00 45.31 ? 1188 LEU A O     1 
ATOM   4337  C  CB    . LEU E  3 512  ? 90.393  31.085  18.018  1.00 44.47 ? 1188 LEU A CB    1 
ATOM   4338  C  CG    . LEU E  3 512  ? 88.906  31.329  18.298  1.00 43.27 ? 1188 LEU A CG    1 
ATOM   4339  C  CD1   . LEU E  3 512  ? 88.588  31.067  19.750  1.00 43.51 ? 1188 LEU A CD1   1 
ATOM   4340  C  CD2   . LEU E  3 512  ? 88.514  32.739  17.914  1.00 44.00 ? 1188 LEU A CD2   1 
ATOM   4341  N  N     . LEU E  3 513  ? 89.133  27.973  18.206  1.00 43.77 ? 1189 LEU A N     1 
ATOM   4342  C  CA    . LEU E  3 513  ? 88.097  27.097  17.661  1.00 43.88 ? 1189 LEU A CA    1 
ATOM   4343  C  C     . LEU E  3 513  ? 86.726  27.497  18.173  1.00 43.81 ? 1189 LEU A C     1 
ATOM   4344  O  O     . LEU E  3 513  ? 86.477  27.417  19.372  1.00 44.92 ? 1189 LEU A O     1 
ATOM   4345  C  CB    . LEU E  3 513  ? 88.367  25.637  18.027  1.00 43.68 ? 1189 LEU A CB    1 
ATOM   4346  C  CG    . LEU E  3 513  ? 87.806  24.524  17.128  1.00 44.79 ? 1189 LEU A CG    1 
ATOM   4347  C  CD1   . LEU E  3 513  ? 87.932  23.191  17.830  1.00 44.47 ? 1189 LEU A CD1   1 
ATOM   4348  C  CD2   . LEU E  3 513  ? 86.366  24.745  16.710  1.00 46.21 ? 1189 LEU A CD2   1 
ATOM   4349  N  N     . ILE E  3 514  ? 85.839  27.912  17.269  1.00 43.25 ? 1190 ILE A N     1 
ATOM   4350  C  CA    . ILE E  3 514  ? 84.478  28.274  17.655  1.00 43.40 ? 1190 ILE A CA    1 
ATOM   4351  C  C     . ILE E  3 514  ? 83.475  27.189  17.283  1.00 43.98 ? 1190 ILE A C     1 
ATOM   4352  O  O     . ILE E  3 514  ? 83.377  26.797  16.124  1.00 45.62 ? 1190 ILE A O     1 
ATOM   4353  C  CB    . ILE E  3 514  ? 84.047  29.615  17.044  1.00 43.07 ? 1190 ILE A CB    1 
ATOM   4354  C  CG1   . ILE E  3 514  ? 84.975  30.731  17.531  1.00 44.14 ? 1190 ILE A CG1   1 
ATOM   4355  C  CG2   . ILE E  3 514  ? 82.605  29.926  17.422  1.00 43.33 ? 1190 ILE A CG2   1 
ATOM   4356  C  CD1   . ILE E  3 514  ? 84.898  32.005  16.716  1.00 43.87 ? 1190 ILE A CD1   1 
ATOM   4357  N  N     . PHE E  3 515  ? 82.737  26.698  18.273  1.00 43.67 ? 1191 PHE A N     1 
ATOM   4358  C  CA    . PHE E  3 515  ? 81.646  25.757  18.026  1.00 42.92 ? 1191 PHE A CA    1 
ATOM   4359  C  C     . PHE E  3 515  ? 80.317  26.475  18.057  1.00 42.90 ? 1191 PHE A C     1 
ATOM   4360  O  O     . PHE E  3 515  ? 79.995  27.145  19.038  1.00 43.79 ? 1191 PHE A O     1 
ATOM   4361  C  CB    . PHE E  3 515  ? 81.629  24.655  19.083  1.00 42.25 ? 1191 PHE A CB    1 
ATOM   4362  C  CG    . PHE E  3 515  ? 82.667  23.598  18.875  1.00 42.37 ? 1191 PHE A CG    1 
ATOM   4363  C  CD1   . PHE E  3 515  ? 82.472  22.595  17.930  1.00 41.17 ? 1191 PHE A CD1   1 
ATOM   4364  C  CD2   . PHE E  3 515  ? 83.840  23.595  19.631  1.00 41.69 ? 1191 PHE A CD2   1 
ATOM   4365  C  CE1   . PHE E  3 515  ? 83.430  21.606  17.739  1.00 39.81 ? 1191 PHE A CE1   1 
ATOM   4366  C  CE2   . PHE E  3 515  ? 84.802  22.608  19.453  1.00 40.00 ? 1191 PHE A CE2   1 
ATOM   4367  C  CZ    . PHE E  3 515  ? 84.598  21.612  18.506  1.00 40.39 ? 1191 PHE A CZ    1 
ATOM   4368  N  N     . ILE E  3 516  ? 79.541  26.341  16.990  1.00 42.75 ? 1192 ILE A N     1 
ATOM   4369  C  CA    . ILE E  3 516  ? 78.156  26.794  17.026  1.00 43.19 ? 1192 ILE A CA    1 
ATOM   4370  C  C     . ILE E  3 516  ? 77.261  25.647  17.496  1.00 43.64 ? 1192 ILE A C     1 
ATOM   4371  O  O     . ILE E  3 516  ? 77.358  24.530  16.995  1.00 43.69 ? 1192 ILE A O     1 
ATOM   4372  C  CB    . ILE E  3 516  ? 77.682  27.308  15.675  1.00 43.03 ? 1192 ILE A CB    1 
ATOM   4373  C  CG1   . ILE E  3 516  ? 78.495  28.538  15.264  1.00 44.61 ? 1192 ILE A CG1   1 
ATOM   4374  C  CG2   . ILE E  3 516  ? 76.203  27.649  15.739  1.00 44.16 ? 1192 ILE A CG2   1 
ATOM   4375  C  CD1   . ILE E  3 516  ? 78.231  29.023  13.831  1.00 45.57 ? 1192 ILE A CD1   1 
ATOM   4376  N  N     . ASN E  3 517  ? 76.403  25.914  18.473  1.00 43.78 ? 1193 ASN A N     1 
ATOM   4377  C  CA    . ASN E  3 517  ? 75.477  24.896  18.932  1.00 43.77 ? 1193 ASN A CA    1 
ATOM   4378  C  C     . ASN E  3 517  ? 74.022  25.352  18.843  1.00 43.76 ? 1193 ASN A C     1 
ATOM   4379  O  O     . ASN E  3 517  ? 73.737  26.549  18.857  1.00 44.27 ? 1193 ASN A O     1 
ATOM   4380  C  CB    . ASN E  3 517  ? 75.824  24.468  20.351  1.00 43.50 ? 1193 ASN A CB    1 
ATOM   4381  C  CG    . ASN E  3 517  ? 75.553  22.998  20.603  1.00 44.00 ? 1193 ASN A CG    1 
ATOM   4382  O  OD1   . ASN E  3 517  ? 76.187  22.404  21.457  1.00 47.47 ? 1193 ASN A OD1   1 
ATOM   4383  N  ND2   . ASN E  3 517  ? 74.618  22.406  19.869  1.00 43.04 ? 1193 ASN A ND2   1 
ATOM   4384  N  N     . GLN E  3 518  ? 73.116  24.388  18.729  1.00 43.22 ? 1194 GLN A N     1 
ATOM   4385  C  CA    . GLN E  3 518  ? 71.696  24.660  18.737  1.00 44.24 ? 1194 GLN A CA    1 
ATOM   4386  C  C     . GLN E  3 518  ? 71.135  24.392  20.122  1.00 44.84 ? 1194 GLN A C     1 
ATOM   4387  O  O     . GLN E  3 518  ? 71.801  23.792  20.967  1.00 45.41 ? 1194 GLN A O     1 
ATOM   4388  C  CB    . GLN E  3 518  ? 70.988  23.772  17.730  1.00 44.97 ? 1194 GLN A CB    1 
ATOM   4389  C  CG    . GLN E  3 518  ? 71.442  23.951  16.303  1.00 46.61 ? 1194 GLN A CG    1 
ATOM   4390  C  CD    . GLN E  3 518  ? 70.807  22.933  15.363  1.00 48.79 ? 1194 GLN A CD    1 
ATOM   4391  O  OE1   . GLN E  3 518  ? 71.154  22.870  14.182  1.00 52.70 ? 1194 GLN A OE1   1 
ATOM   4392  N  NE2   . GLN E  3 518  ? 69.881  22.130  15.880  1.00 44.71 ? 1194 GLN A NE2   1 
ATOM   4393  N  N     . ILE E  3 519  ? 69.904  24.835  20.349  1.00 45.04 ? 1195 ILE A N     1 
ATOM   4394  C  CA    . ILE E  3 519  ? 69.216  24.581  21.604  1.00 45.03 ? 1195 ILE A CA    1 
ATOM   4395  C  C     . ILE E  3 519  ? 68.217  23.444  21.439  1.00 45.91 ? 1195 ILE A C     1 
ATOM   4396  O  O     . ILE E  3 519  ? 67.452  23.401  20.475  1.00 46.46 ? 1195 ILE A O     1 
ATOM   4397  C  CB    . ILE E  3 519  ? 68.475  25.831  22.095  1.00 44.48 ? 1195 ILE A CB    1 
ATOM   4398  C  CG1   . ILE E  3 519  ? 69.474  26.930  22.430  1.00 45.70 ? 1195 ILE A CG1   1 
ATOM   4399  C  CG2   . ILE E  3 519  ? 67.635  25.521  23.319  1.00 45.03 ? 1195 ILE A CG2   1 
ATOM   4400  C  CD1   . ILE E  3 519  ? 68.809  28.223  22.805  1.00 47.96 ? 1195 ILE A CD1   1 
ATOM   4401  N  N     . ARG E  3 520  ? 68.232  22.517  22.385  1.00 46.72 ? 1196 ARG A N     1 
ATOM   4402  C  CA    . ARG E  3 520  ? 67.149  21.549  22.523  1.00 47.15 ? 1196 ARG A CA    1 
ATOM   4403  C  C     . ARG E  3 520  ? 66.464  21.768  23.858  1.00 48.21 ? 1196 ARG A C     1 
ATOM   4404  O  O     . ARG E  3 520  ? 67.002  22.459  24.733  1.00 49.18 ? 1196 ARG A O     1 
ATOM   4405  C  CB    . ARG E  3 520  ? 67.672  20.119  22.418  1.00 46.46 ? 1196 ARG A CB    1 
ATOM   4406  C  CG    . ARG E  3 520  ? 68.186  19.757  21.034  1.00 46.00 ? 1196 ARG A CG    1 
ATOM   4407  C  CD    . ARG E  3 520  ? 67.067  19.821  19.986  1.00 45.38 ? 1196 ARG A CD    1 
ATOM   4408  N  NE    . ARG E  3 520  ? 67.522  19.392  18.670  1.00 43.81 ? 1196 ARG A NE    1 
ATOM   4409  C  CZ    . ARG E  3 520  ? 68.146  20.180  17.803  1.00 44.80 ? 1196 ARG A CZ    1 
ATOM   4410  N  NH1   . ARG E  3 520  ? 68.385  21.446  18.108  1.00 46.97 ? 1196 ARG A NH1   1 
ATOM   4411  N  NH2   . ARG E  3 520  ? 68.535  19.701  16.631  1.00 44.51 ? 1196 ARG A NH2   1 
ATOM   4412  N  N     . MET E  3 521  ? 65.270  21.205  23.997  1.00 48.78 ? 1197 MET A N     1 
ATOM   4413  C  CA    . MET E  3 521  ? 64.537  21.297  25.235  1.00 50.94 ? 1197 MET A CA    1 
ATOM   4414  C  C     . MET E  3 521  ? 64.796  20.010  26.003  1.00 52.18 ? 1197 MET A C     1 
ATOM   4415  O  O     . MET E  3 521  ? 64.700  18.924  25.435  1.00 53.01 ? 1197 MET A O     1 
ATOM   4416  C  CB    . MET E  3 521  ? 63.048  21.448  24.934  1.00 51.89 ? 1197 MET A CB    1 
ATOM   4417  C  CG    . MET E  3 521  ? 62.365  22.592  25.666  1.00 54.08 ? 1197 MET A CG    1 
ATOM   4418  S  SD    . MET E  3 521  ? 63.170  24.188  25.395  1.00 58.29 ? 1197 MET A SD    1 
ATOM   4419  C  CE    . MET E  3 521  ? 62.814  24.539  23.662  1.00 58.19 ? 1197 MET A CE    1 
ATOM   4420  N  N     . LYS E  3 522  ? 65.157  20.117  27.276  1.00 53.35 ? 1198 LYS A N     1 
ATOM   4421  C  CA    . LYS E  3 522  ? 65.226  18.930  28.120  1.00 55.13 ? 1198 LYS A CA    1 
ATOM   4422  C  C     . LYS E  3 522  ? 63.861  18.751  28.742  1.00 56.22 ? 1198 LYS A C     1 
ATOM   4423  O  O     . LYS E  3 522  ? 63.148  19.723  28.948  1.00 55.98 ? 1198 LYS A O     1 
ATOM   4424  C  CB    . LYS E  3 522  ? 66.341  19.018  29.169  1.00 55.32 ? 1198 LYS A CB    1 
ATOM   4425  C  CG    . LYS E  3 522  ? 66.192  20.135  30.179  1.00 57.40 ? 1198 LYS A CG    1 
ATOM   4426  C  CD    . LYS E  3 522  ? 67.529  20.799  30.507  1.00 58.68 ? 1198 LYS A CD    1 
ATOM   4427  C  CE    . LYS E  3 522  ? 68.326  20.008  31.531  1.00 59.29 ? 1198 LYS A CE    1 
ATOM   4428  N  NZ    . LYS E  3 522  ? 69.504  20.792  31.982  1.00 59.98 ? 1198 LYS A NZ    1 
ATOM   4429  N  N     . ILE E  3 523  ? 63.484  17.512  29.018  1.00 58.56 ? 1199 ILE A N     1 
ATOM   4430  C  CA    . ILE E  3 523  ? 62.103  17.235  29.381  1.00 61.12 ? 1199 ILE A CA    1 
ATOM   4431  C  C     . ILE E  3 523  ? 61.993  16.534  30.736  1.00 63.84 ? 1199 ILE A C     1 
ATOM   4432  O  O     . ILE E  3 523  ? 62.733  15.600  31.019  1.00 63.84 ? 1199 ILE A O     1 
ATOM   4433  C  CB    . ILE E  3 523  ? 61.354  16.522  28.212  1.00 60.66 ? 1199 ILE A CB    1 
ATOM   4434  C  CG1   . ILE E  3 523  ? 60.180  15.697  28.701  1.00 62.34 ? 1199 ILE A CG1   1 
ATOM   4435  C  CG2   . ILE E  3 523  ? 62.267  15.621  27.447  1.00 60.15 ? 1199 ILE A CG2   1 
ATOM   4436  C  CD1   . ILE E  3 523  ? 59.622  14.809  27.624  1.00 64.19 ? 1199 ILE A CD1   1 
ATOM   4437  N  N     . GLY E  3 524  ? 61.078  17.024  31.573  1.00 67.52 ? 1200 GLY A N     1 
ATOM   4438  C  CA    . GLY E  3 524  ? 60.910  16.546  32.951  1.00 71.70 ? 1200 GLY A CA    1 
ATOM   4439  C  C     . GLY E  3 524  ? 61.612  17.454  33.949  1.00 74.99 ? 1200 GLY A C     1 
ATOM   4440  O  O     . GLY E  3 524  ? 62.237  16.979  34.901  1.00 75.25 ? 1200 GLY A O     1 
ATOM   4441  N  N     . VAL E  3 525  ? 61.495  18.764  33.729  1.00 78.00 ? 1201 VAL A N     1 
ATOM   4442  C  CA    . VAL E  3 525  ? 62.227  19.785  34.490  1.00 80.50 ? 1201 VAL A CA    1 
ATOM   4443  C  C     . VAL E  3 525  ? 61.305  20.970  34.843  1.00 82.74 ? 1201 VAL A C     1 
ATOM   4444  O  O     . VAL E  3 525  ? 60.809  21.671  33.952  1.00 83.68 ? 1201 VAL A O     1 
ATOM   4445  C  CB    . VAL E  3 525  ? 63.506  20.253  33.708  1.00 79.83 ? 1201 VAL A CB    1 
ATOM   4446  C  CG1   . VAL E  3 525  ? 63.146  20.756  32.322  1.00 79.02 ? 1201 VAL A CG1   1 
ATOM   4447  C  CG2   . VAL E  3 525  ? 64.289  21.308  34.478  1.00 79.52 ? 1201 VAL A CG2   1 
ATOM   4448  N  N     . MET E  3 526  ? 61.070  21.178  36.138  1.00 84.35 ? 1202 MET A N     1 
ATOM   4449  C  CA    . MET E  3 526  ? 60.172  22.246  36.613  1.00 86.20 ? 1202 MET A CA    1 
ATOM   4450  C  C     . MET E  3 526  ? 60.921  23.467  37.160  1.00 86.48 ? 1202 MET A C     1 
ATOM   4451  O  O     . MET E  3 526  ? 60.462  24.608  37.031  1.00 86.90 ? 1202 MET A O     1 
ATOM   4452  C  CB    . MET E  3 526  ? 59.193  21.704  37.657  1.00 87.29 ? 1202 MET A CB    1 
ATOM   4453  C  CG    . MET E  3 526  ? 59.479  20.271  38.096  1.00 90.33 ? 1202 MET A CG    1 
ATOM   4454  S  SD    . MET E  3 526  ? 58.367  19.014  37.390  1.00 94.42 ? 1202 MET A SD    1 
ATOM   4455  C  CE    . MET E  3 526  ? 58.456  19.286  35.608  1.00 93.17 ? 1202 MET A CE    1 
ATOM   4456  N  N     . PHE E  3 527  ? 62.068  23.198  37.779  1.00 86.13 ? 1203 PHE A N     1 
ATOM   4457  C  CA    . PHE E  3 527  ? 63.021  24.210  38.231  1.00 85.04 ? 1203 PHE A CA    1 
ATOM   4458  C  C     . PHE E  3 527  ? 63.804  24.792  37.046  1.00 82.79 ? 1203 PHE A C     1 
ATOM   4459  O  O     . PHE E  3 527  ? 63.734  24.276  35.921  1.00 82.06 ? 1203 PHE A O     1 
ATOM   4460  C  CB    . PHE E  3 527  ? 64.004  23.560  39.215  1.00 86.59 ? 1203 PHE A CB    1 
ATOM   4461  C  CG    . PHE E  3 527  ? 64.695  22.336  38.652  1.00 88.81 ? 1203 PHE A CG    1 
ATOM   4462  C  CD1   . PHE E  3 527  ? 65.885  22.461  37.917  1.00 89.67 ? 1203 PHE A CD1   1 
ATOM   4463  C  CD2   . PHE E  3 527  ? 64.140  21.062  38.824  1.00 89.50 ? 1203 PHE A CD2   1 
ATOM   4464  C  CE1   . PHE E  3 527  ? 66.522  21.338  37.375  1.00 89.78 ? 1203 PHE A CE1   1 
ATOM   4465  C  CE2   . PHE E  3 527  ? 64.763  19.930  38.286  1.00 90.14 ? 1203 PHE A CE2   1 
ATOM   4466  C  CZ    . PHE E  3 527  ? 65.960  20.068  37.561  1.00 89.57 ? 1203 PHE A CZ    1 
ATOM   4467  N  N     . GLY E  3 528  ? 64.559  25.855  37.319  1.00 80.52 ? 1204 GLY A N     1 
ATOM   4468  C  CA    . GLY E  3 528  ? 65.485  26.447  36.353  1.00 77.37 ? 1204 GLY A CA    1 
ATOM   4469  C  C     . GLY E  3 528  ? 64.892  26.670  34.983  1.00 74.50 ? 1204 GLY A C     1 
ATOM   4470  O  O     . GLY E  3 528  ? 63.719  27.055  34.840  1.00 74.74 ? 1204 GLY A O     1 
ATOM   4471  N  N     . ASN E  3 529  ? 65.711  26.412  33.975  1.00 70.90 ? 1205 ASN A N     1 
ATOM   4472  C  CA    . ASN E  3 529  ? 65.226  26.542  32.621  1.00 67.03 ? 1205 ASN A CA    1 
ATOM   4473  C  C     . ASN E  3 529  ? 65.441  25.256  31.824  1.00 63.68 ? 1205 ASN A C     1 
ATOM   4474  O  O     . ASN E  3 529  ? 66.428  24.545  32.038  1.00 62.76 ? 1205 ASN A O     1 
ATOM   4475  C  CB    . ASN E  3 529  ? 65.786  27.806  31.947  1.00 67.23 ? 1205 ASN A CB    1 
ATOM   4476  C  CG    . ASN E  3 529  ? 66.917  27.518  30.983  1.00 68.19 ? 1205 ASN A CG    1 
ATOM   4477  O  OD1   . ASN E  3 529  ? 67.917  26.890  31.335  1.00 68.74 ? 1205 ASN A OD1   1 
ATOM   4478  N  ND2   . ASN E  3 529  ? 66.770  28.000  29.754  1.00 69.16 ? 1205 ASN A ND2   1 
ATOM   4479  N  N     . PRO E  3 530  ? 64.502  24.949  30.914  1.00 60.87 ? 1206 PRO A N     1 
ATOM   4480  C  CA    . PRO E  3 530  ? 64.514  23.654  30.255  1.00 58.96 ? 1206 PRO A CA    1 
ATOM   4481  C  C     . PRO E  3 530  ? 65.452  23.541  29.051  1.00 57.42 ? 1206 PRO A C     1 
ATOM   4482  O  O     . PRO E  3 530  ? 65.507  22.483  28.433  1.00 57.64 ? 1206 PRO A O     1 
ATOM   4483  C  CB    . PRO E  3 530  ? 63.061  23.488  29.814  1.00 59.08 ? 1206 PRO A CB    1 
ATOM   4484  C  CG    . PRO E  3 530  ? 62.573  24.868  29.595  1.00 59.49 ? 1206 PRO A CG    1 
ATOM   4485  C  CD    . PRO E  3 530  ? 63.380  25.790  30.455  1.00 60.12 ? 1206 PRO A CD    1 
ATOM   4486  N  N     . GLU E  3 531  ? 66.183  24.604  28.726  1.00 55.45 ? 1207 GLU A N     1 
ATOM   4487  C  CA    . GLU E  3 531  ? 67.019  24.611  27.531  1.00 54.20 ? 1207 GLU A CA    1 
ATOM   4488  C  C     . GLU E  3 531  ? 68.308  23.835  27.715  1.00 53.39 ? 1207 GLU A C     1 
ATOM   4489  O  O     . GLU E  3 531  ? 68.832  23.760  28.816  1.00 53.39 ? 1207 GLU A O     1 
ATOM   4490  C  CB    . GLU E  3 531  ? 67.347  26.037  27.128  1.00 54.67 ? 1207 GLU A CB    1 
ATOM   4491  C  CG    . GLU E  3 531  ? 66.168  26.838  26.621  1.00 56.00 ? 1207 GLU A CG    1 
ATOM   4492  C  CD    . GLU E  3 531  ? 66.584  28.202  26.105  1.00 57.87 ? 1207 GLU A CD    1 
ATOM   4493  O  OE1   . GLU E  3 531  ? 67.626  28.730  26.554  1.00 58.42 ? 1207 GLU A OE1   1 
ATOM   4494  O  OE2   . GLU E  3 531  ? 65.872  28.750  25.243  1.00 59.48 ? 1207 GLU A OE2   1 
ATOM   4495  N  N     . THR E  3 532  ? 68.805  23.249  26.629  1.00 52.94 ? 1208 THR A N     1 
ATOM   4496  C  CA    . THR E  3 532  ? 70.121  22.622  26.622  1.00 53.69 ? 1208 THR A CA    1 
ATOM   4497  C  C     . THR E  3 532  ? 70.773  22.781  25.271  1.00 53.97 ? 1208 THR A C     1 
ATOM   4498  O  O     . THR E  3 532  ? 70.292  23.508  24.403  1.00 54.58 ? 1208 THR A O     1 
ATOM   4499  C  CB    . THR E  3 532  ? 70.102  21.103  26.921  1.00 54.21 ? 1208 THR A CB    1 
ATOM   4500  O  OG1   . THR E  3 532  ? 68.838  20.715  27.460  1.00 56.89 ? 1208 THR A OG1   1 
ATOM   4501  C  CG2   . THR E  3 532  ? 71.219  20.722  27.903  1.00 54.90 ? 1208 THR A CG2   1 
ATOM   4502  N  N     . THR E  3 533  ? 71.850  22.032  25.103  1.00 53.97 ? 1209 THR A N     1 
ATOM   4503  C  CA    . THR E  3 533  ? 72.809  22.209  24.051  1.00 53.70 ? 1209 THR A CA    1 
ATOM   4504  C  C     . THR E  3 533  ? 73.113  20.800  23.563  1.00 53.99 ? 1209 THR A C     1 
ATOM   4505  O  O     . THR E  3 533  ? 73.099  19.861  24.357  1.00 54.98 ? 1209 THR A O     1 
ATOM   4506  C  CB    . THR E  3 533  ? 74.019  22.948  24.663  1.00 53.51 ? 1209 THR A CB    1 
ATOM   4507  O  OG1   . THR E  3 533  ? 73.988  24.313  24.239  1.00 53.79 ? 1209 THR A OG1   1 
ATOM   4508  C  CG2   . THR E  3 533  ? 75.371  22.316  24.312  1.00 54.89 ? 1209 THR A CG2   1 
ATOM   4509  N  N     . THR E  3 534  ? 73.343  20.630  22.267  1.00 53.81 ? 1210 THR A N     1 
ATOM   4510  C  CA    . THR E  3 534  ? 73.566  19.286  21.733  1.00 54.55 ? 1210 THR A CA    1 
ATOM   4511  C  C     . THR E  3 534  ? 74.972  18.785  22.035  1.00 53.87 ? 1210 THR A C     1 
ATOM   4512  O  O     . THR E  3 534  ? 75.875  19.574  22.301  1.00 54.28 ? 1210 THR A O     1 
ATOM   4513  C  CB    . THR E  3 534  ? 73.339  19.230  20.216  1.00 55.83 ? 1210 THR A CB    1 
ATOM   4514  O  OG1   . THR E  3 534  ? 72.543  20.348  19.805  1.00 58.02 ? 1210 THR A OG1   1 
ATOM   4515  C  CG2   . THR E  3 534  ? 72.631  17.920  19.822  1.00 56.85 ? 1210 THR A CG2   1 
ATOM   4516  N  N     . GLY E  3 535  ? 75.144  17.467  22.016  1.00 53.19 ? 1211 GLY A N     1 
ATOM   4517  C  CA    . GLY E  3 535  ? 76.473  16.861  22.072  1.00 52.75 ? 1211 GLY A CA    1 
ATOM   4518  C  C     . GLY E  3 535  ? 77.123  16.786  23.439  1.00 52.42 ? 1211 GLY A C     1 
ATOM   4519  O  O     . GLY E  3 535  ? 78.338  16.965  23.564  1.00 52.76 ? 1211 GLY A O     1 
ATOM   4520  N  N     . GLY E  3 536  ? 76.313  16.536  24.463  1.00 51.72 ? 1212 GLY A N     1 
ATOM   4521  C  CA    . GLY E  3 536  ? 76.822  16.219  25.786  1.00 51.14 ? 1212 GLY A CA    1 
ATOM   4522  C  C     . GLY E  3 536  ? 77.341  17.374  26.616  1.00 51.19 ? 1212 GLY A C     1 
ATOM   4523  O  O     . GLY E  3 536  ? 76.968  18.533  26.404  1.00 51.28 ? 1212 GLY A O     1 
ATOM   4524  N  N     . ASN E  3 537  ? 78.217  17.037  27.561  1.00 50.99 ? 1213 ASN A N     1 
ATOM   4525  C  CA    . ASN E  3 537  ? 78.661  17.960  28.603  1.00 50.38 ? 1213 ASN A CA    1 
ATOM   4526  C  C     . ASN E  3 537  ? 80.105  18.422  28.475  1.00 49.51 ? 1213 ASN A C     1 
ATOM   4527  O  O     . ASN E  3 537  ? 80.515  19.377  29.146  1.00 48.71 ? 1213 ASN A O     1 
ATOM   4528  C  CB    . ASN E  3 537  ? 78.460  17.319  29.978  1.00 50.54 ? 1213 ASN A CB    1 
ATOM   4529  C  CG    . ASN E  3 537  ? 77.004  17.197  30.352  1.00 50.58 ? 1213 ASN A CG    1 
ATOM   4530  O  OD1   . ASN E  3 537  ? 76.310  18.197  30.523  1.00 50.34 ? 1213 ASN A OD1   1 
ATOM   4531  N  ND2   . ASN E  3 537  ? 76.532  15.966  30.491  1.00 51.67 ? 1213 ASN A ND2   1 
ATOM   4532  N  N     . ALA E  3 538  ? 80.869  17.739  27.626  1.00 48.81 ? 1214 ALA A N     1 
ATOM   4533  C  CA    . ALA E  3 538  ? 82.290  18.025  27.471  1.00 48.43 ? 1214 ALA A CA    1 
ATOM   4534  C  C     . ALA E  3 538  ? 82.542  19.487  27.115  1.00 48.20 ? 1214 ALA A C     1 
ATOM   4535  O  O     . ALA E  3 538  ? 83.334  20.160  27.773  1.00 48.80 ? 1214 ALA A O     1 
ATOM   4536  C  CB    . ALA E  3 538  ? 82.915  17.099  26.443  1.00 47.95 ? 1214 ALA A CB    1 
ATOM   4537  N  N     . LEU E  3 539  ? 81.842  19.983  26.100  1.00 47.66 ? 1215 LEU A N     1 
ATOM   4538  C  CA    . LEU E  3 539  ? 82.074  21.332  25.604  1.00 47.19 ? 1215 LEU A CA    1 
ATOM   4539  C  C     . LEU E  3 539  ? 81.872  22.436  26.654  1.00 47.66 ? 1215 LEU A C     1 
ATOM   4540  O  O     . LEU E  3 539  ? 82.640  23.390  26.677  1.00 47.68 ? 1215 LEU A O     1 
ATOM   4541  C  CB    . LEU E  3 539  ? 81.229  21.590  24.360  1.00 47.05 ? 1215 LEU A CB    1 
ATOM   4542  C  CG    . LEU E  3 539  ? 81.451  22.889  23.583  1.00 47.32 ? 1215 LEU A CG    1 
ATOM   4543  C  CD1   . LEU E  3 539  ? 82.902  23.027  23.163  1.00 47.94 ? 1215 LEU A CD1   1 
ATOM   4544  C  CD2   . LEU E  3 539  ? 80.543  22.932  22.366  1.00 47.43 ? 1215 LEU A CD2   1 
ATOM   4545  N  N     . LYS E  3 540  ? 80.861  22.308  27.520  1.00 48.72 ? 1216 LYS A N     1 
ATOM   4546  C  CA    . LYS E  3 540  ? 80.609  23.299  28.582  1.00 48.78 ? 1216 LYS A CA    1 
ATOM   4547  C  C     . LYS E  3 540  ? 81.902  23.567  29.334  1.00 46.76 ? 1216 LYS A C     1 
ATOM   4548  O  O     . LYS E  3 540  ? 82.221  24.709  29.659  1.00 46.07 ? 1216 LYS A O     1 
ATOM   4549  C  CB    . LYS E  3 540  ? 79.611  22.788  29.629  1.00 49.54 ? 1216 LYS A CB    1 
ATOM   4550  C  CG    . LYS E  3 540  ? 78.218  22.390  29.207  1.00 51.68 ? 1216 LYS A CG    1 
ATOM   4551  C  CD    . LYS E  3 540  ? 77.394  22.089  30.491  1.00 52.59 ? 1216 LYS A CD    1 
ATOM   4552  C  CE    . LYS E  3 540  ? 76.218  21.114  30.262  1.00 57.82 ? 1216 LYS A CE    1 
ATOM   4553  N  NZ    . LYS E  3 540  ? 75.322  21.398  29.068  1.00 60.22 ? 1216 LYS A NZ    1 
ATOM   4554  N  N     . PHE E  3 541  ? 82.623  22.485  29.621  1.00 45.50 ? 1217 PHE A N     1 
ATOM   4555  C  CA    . PHE E  3 541  ? 83.808  22.524  30.456  1.00 44.89 ? 1217 PHE A CA    1 
ATOM   4556  C  C     . PHE E  3 541  ? 85.006  23.091  29.727  1.00 45.43 ? 1217 PHE A C     1 
ATOM   4557  O  O     . PHE E  3 541  ? 85.715  23.951  30.259  1.00 46.11 ? 1217 PHE A O     1 
ATOM   4558  C  CB    . PHE E  3 541  ? 84.140  21.127  30.978  1.00 43.73 ? 1217 PHE A CB    1 
ATOM   4559  C  CG    . PHE E  3 541  ? 83.265  20.680  32.107  1.00 43.44 ? 1217 PHE A CG    1 
ATOM   4560  C  CD1   . PHE E  3 541  ? 82.145  19.900  31.858  1.00 45.22 ? 1217 PHE A CD1   1 
ATOM   4561  C  CD2   . PHE E  3 541  ? 83.551  21.045  33.421  1.00 41.86 ? 1217 PHE A CD2   1 
ATOM   4562  C  CE1   . PHE E  3 541  ? 81.322  19.483  32.909  1.00 46.44 ? 1217 PHE A CE1   1 
ATOM   4563  C  CE2   . PHE E  3 541  ? 82.745  20.637  34.470  1.00 41.97 ? 1217 PHE A CE2   1 
ATOM   4564  C  CZ    . PHE E  3 541  ? 81.628  19.856  34.221  1.00 44.19 ? 1217 PHE A CZ    1 
ATOM   4565  N  N     . TYR E  3 542  ? 85.226  22.607  28.509  1.00 45.74 ? 1218 TYR A N     1 
ATOM   4566  C  CA    . TYR E  3 542  ? 86.410  22.968  27.737  1.00 45.87 ? 1218 TYR A CA    1 
ATOM   4567  C  C     . TYR E  3 542  ? 86.351  24.376  27.167  1.00 45.90 ? 1218 TYR A C     1 
ATOM   4568  O  O     . TYR E  3 542  ? 87.392  25.007  26.989  1.00 46.92 ? 1218 TYR A O     1 
ATOM   4569  C  CB    . TYR E  3 542  ? 86.662  21.954  26.621  1.00 45.71 ? 1218 TYR A CB    1 
ATOM   4570  C  CG    . TYR E  3 542  ? 87.279  20.665  27.107  1.00 46.37 ? 1218 TYR A CG    1 
ATOM   4571  C  CD1   . TYR E  3 542  ? 88.661  20.489  27.107  1.00 46.60 ? 1218 TYR A CD1   1 
ATOM   4572  C  CD2   . TYR E  3 542  ? 86.482  19.623  27.580  1.00 47.14 ? 1218 TYR A CD2   1 
ATOM   4573  C  CE1   . TYR E  3 542  ? 89.235  19.303  27.563  1.00 46.03 ? 1218 TYR A CE1   1 
ATOM   4574  C  CE2   . TYR E  3 542  ? 87.045  18.433  28.032  1.00 46.78 ? 1218 TYR A CE2   1 
ATOM   4575  C  CZ    . TYR E  3 542  ? 88.422  18.283  28.018  1.00 46.01 ? 1218 TYR A CZ    1 
ATOM   4576  O  OH    . TYR E  3 542  ? 88.989  17.115  28.458  1.00 45.91 ? 1218 TYR A OH    1 
ATOM   4577  N  N     . ALA E  3 543  ? 85.149  24.866  26.877  1.00 45.23 ? 1219 ALA A N     1 
ATOM   4578  C  CA    . ALA E  3 543  ? 84.988  26.231  26.380  1.00 44.88 ? 1219 ALA A CA    1 
ATOM   4579  C  C     . ALA E  3 543  ? 85.559  27.244  27.371  1.00 44.46 ? 1219 ALA A C     1 
ATOM   4580  O  O     . ALA E  3 543  ? 85.334  27.127  28.581  1.00 44.29 ? 1219 ALA A O     1 
ATOM   4581  C  CB    . ALA E  3 543  ? 83.531  26.531  26.096  1.00 44.62 ? 1219 ALA A CB    1 
ATOM   4582  N  N     . SER E  3 544  ? 86.320  28.210  26.856  1.00 43.50 ? 1220 SER A N     1 
ATOM   4583  C  CA    . SER E  3 544  ? 86.858  29.280  27.685  1.00 43.75 ? 1220 SER A CA    1 
ATOM   4584  C  C     . SER E  3 544  ? 85.880  30.440  27.705  1.00 43.84 ? 1220 SER A C     1 
ATOM   4585  O  O     . SER E  3 544  ? 85.900  31.277  28.617  1.00 44.66 ? 1220 SER A O     1 
ATOM   4586  C  CB    . SER E  3 544  ? 88.213  29.749  27.166  1.00 43.86 ? 1220 SER A CB    1 
ATOM   4587  O  OG    . SER E  3 544  ? 89.103  28.659  27.012  1.00 44.65 ? 1220 SER A OG    1 
ATOM   4588  N  N     . VAL E  3 545  ? 85.027  30.479  26.686  1.00 43.26 ? 1221 VAL A N     1 
ATOM   4589  C  CA    . VAL E  3 545  ? 83.964  31.467  26.579  1.00 43.48 ? 1221 VAL A CA    1 
ATOM   4590  C  C     . VAL E  3 545  ? 82.716  30.799  26.011  1.00 44.79 ? 1221 VAL A C     1 
ATOM   4591  O  O     . VAL E  3 545  ? 82.800  30.049  25.032  1.00 45.75 ? 1221 VAL A O     1 
ATOM   4592  C  CB    . VAL E  3 545  ? 84.377  32.642  25.665  1.00 42.91 ? 1221 VAL A CB    1 
ATOM   4593  C  CG1   . VAL E  3 545  ? 83.203  33.544  25.378  1.00 42.36 ? 1221 VAL A CG1   1 
ATOM   4594  C  CG2   . VAL E  3 545  ? 85.494  33.441  26.288  1.00 42.61 ? 1221 VAL A CG2   1 
ATOM   4595  N  N     . ARG E  3 546  ? 81.563  31.055  26.628  1.00 45.63 ? 1222 ARG A N     1 
ATOM   4596  C  CA    . ARG E  3 546  ? 80.287  30.602  26.063  1.00 45.66 ? 1222 ARG A CA    1 
ATOM   4597  C  C     . ARG E  3 546  ? 79.338  31.772  25.847  1.00 45.46 ? 1222 ARG A C     1 
ATOM   4598  O  O     . ARG E  3 546  ? 79.104  32.574  26.753  1.00 46.19 ? 1222 ARG A O     1 
ATOM   4599  C  CB    . ARG E  3 546  ? 79.639  29.527  26.927  1.00 45.85 ? 1222 ARG A CB    1 
ATOM   4600  C  CG    . ARG E  3 546  ? 80.566  28.374  27.274  1.00 48.01 ? 1222 ARG A CG    1 
ATOM   4601  C  CD    . ARG E  3 546  ? 79.860  27.024  27.189  1.00 50.53 ? 1222 ARG A CD    1 
ATOM   4602  N  NE    . ARG E  3 546  ? 78.781  26.871  28.165  1.00 51.49 ? 1222 ARG A NE    1 
ATOM   4603  C  CZ    . ARG E  3 546  ? 77.638  26.231  27.927  1.00 52.61 ? 1222 ARG A CZ    1 
ATOM   4604  N  NH1   . ARG E  3 546  ? 77.397  25.679  26.744  1.00 53.53 ? 1222 ARG A NH1   1 
ATOM   4605  N  NH2   . ARG E  3 546  ? 76.719  26.157  28.873  1.00 53.74 ? 1222 ARG A NH2   1 
ATOM   4606  N  N     . LEU E  3 547  ? 78.808  31.868  24.636  1.00 44.86 ? 1223 LEU A N     1 
ATOM   4607  C  CA    . LEU E  3 547  ? 77.940  32.970  24.262  1.00 45.48 ? 1223 LEU A CA    1 
ATOM   4608  C  C     . LEU E  3 547  ? 76.521  32.490  24.007  1.00 46.54 ? 1223 LEU A C     1 
ATOM   4609  O  O     . LEU E  3 547  ? 76.309  31.528  23.256  1.00 47.31 ? 1223 LEU A O     1 
ATOM   4610  C  CB    . LEU E  3 547  ? 78.477  33.650  23.005  1.00 45.33 ? 1223 LEU A CB    1 
ATOM   4611  C  CG    . LEU E  3 547  ? 79.474  34.812  23.088  1.00 44.13 ? 1223 LEU A CG    1 
ATOM   4612  C  CD1   . LEU E  3 547  ? 80.117  34.981  24.458  1.00 43.15 ? 1223 LEU A CD1   1 
ATOM   4613  C  CD2   . LEU E  3 547  ? 80.522  34.651  22.002  1.00 43.62 ? 1223 LEU A CD2   1 
ATOM   4614  N  N     . ASP E  3 548  ? 75.560  33.165  24.639  1.00 46.42 ? 1224 ASP A N     1 
ATOM   4615  C  CA    . ASP E  3 548  ? 74.138  32.929  24.409  1.00 45.54 ? 1224 ASP A CA    1 
ATOM   4616  C  C     . ASP E  3 548  ? 73.606  34.089  23.572  1.00 44.70 ? 1224 ASP A C     1 
ATOM   4617  O  O     . ASP E  3 548  ? 73.416  35.192  24.083  1.00 45.22 ? 1224 ASP A O     1 
ATOM   4618  C  CB    . ASP E  3 548  ? 73.409  32.837  25.753  1.00 46.04 ? 1224 ASP A CB    1 
ATOM   4619  C  CG    . ASP E  3 548  ? 71.906  32.630  25.612  1.00 49.06 ? 1224 ASP A CG    1 
ATOM   4620  O  OD1   . ASP E  3 548  ? 71.322  33.033  24.578  1.00 52.18 ? 1224 ASP A OD1   1 
ATOM   4621  O  OD2   . ASP E  3 548  ? 71.300  32.071  26.557  1.00 49.33 ? 1224 ASP A OD2   1 
ATOM   4622  N  N     . ILE E  3 549  ? 73.382  33.842  22.284  1.00 43.63 ? 1225 ILE A N     1 
ATOM   4623  C  CA    . ILE E  3 549  ? 72.885  34.873  21.368  1.00 42.77 ? 1225 ILE A CA    1 
ATOM   4624  C  C     . ILE E  3 549  ? 71.382  34.721  21.134  1.00 43.03 ? 1225 ILE A C     1 
ATOM   4625  O  O     . ILE E  3 549  ? 70.881  33.605  20.998  1.00 43.63 ? 1225 ILE A O     1 
ATOM   4626  C  CB    . ILE E  3 549  ? 73.666  34.877  20.021  1.00 42.38 ? 1225 ILE A CB    1 
ATOM   4627  C  CG1   . ILE E  3 549  ? 73.174  35.998  19.104  1.00 42.08 ? 1225 ILE A CG1   1 
ATOM   4628  C  CG2   . ILE E  3 549  ? 73.570  33.529  19.318  1.00 43.06 ? 1225 ILE A CG2   1 
ATOM   4629  C  CD1   . ILE E  3 549  ? 74.130  36.361  17.987  1.00 41.31 ? 1225 ILE A CD1   1 
ATOM   4630  N  N     . ARG E  3 550  ? 70.668  35.843  21.097  1.00 42.97 ? 1226 ARG A N     1 
ATOM   4631  C  CA    . ARG E  3 550  ? 69.216  35.833  20.904  1.00 42.87 ? 1226 ARG A CA    1 
ATOM   4632  C  C     . ARG E  3 550  ? 68.708  37.021  20.107  1.00 43.90 ? 1226 ARG A C     1 
ATOM   4633  O  O     . ARG E  3 550  ? 69.192  38.138  20.275  1.00 45.89 ? 1226 ARG A O     1 
ATOM   4634  C  CB    . ARG E  3 550  ? 68.509  35.771  22.253  1.00 41.83 ? 1226 ARG A CB    1 
ATOM   4635  C  CG    . ARG E  3 550  ? 68.300  34.359  22.688  1.00 41.37 ? 1226 ARG A CG    1 
ATOM   4636  C  CD    . ARG E  3 550  ? 68.085  34.210  24.162  1.00 42.65 ? 1226 ARG A CD    1 
ATOM   4637  N  NE    . ARG E  3 550  ? 68.582  32.911  24.612  1.00 42.28 ? 1226 ARG A NE    1 
ATOM   4638  C  CZ    . ARG E  3 550  ? 67.937  31.756  24.472  1.00 40.85 ? 1226 ARG A CZ    1 
ATOM   4639  N  NH1   . ARG E  3 550  ? 66.744  31.713  23.893  1.00 39.70 ? 1226 ARG A NH1   1 
ATOM   4640  N  NH2   . ARG E  3 550  ? 68.494  30.639  24.918  1.00 39.31 ? 1226 ARG A NH2   1 
ATOM   4641  N  N     . ARG E  3 551  ? 67.743  36.778  19.226  1.00 44.12 ? 1227 ARG A N     1 
ATOM   4642  C  CA    . ARG E  3 551  ? 67.050  37.867  18.542  1.00 45.03 ? 1227 ARG A CA    1 
ATOM   4643  C  C     . ARG E  3 551  ? 66.001  38.432  19.496  1.00 45.48 ? 1227 ARG A C     1 
ATOM   4644  O  O     . ARG E  3 551  ? 65.176  37.683  20.028  1.00 46.87 ? 1227 ARG A O     1 
ATOM   4645  C  CB    . ARG E  3 551  ? 66.383  37.361  17.266  1.00 44.99 ? 1227 ARG A CB    1 
ATOM   4646  C  CG    . ARG E  3 551  ? 65.666  38.440  16.476  1.00 45.58 ? 1227 ARG A CG    1 
ATOM   4647  C  CD    . ARG E  3 551  ? 64.711  37.830  15.470  1.00 47.19 ? 1227 ARG A CD    1 
ATOM   4648  N  NE    . ARG E  3 551  ? 64.468  38.738  14.353  1.00 47.69 ? 1227 ARG A NE    1 
ATOM   4649  C  CZ    . ARG E  3 551  ? 63.392  39.507  14.221  1.00 47.98 ? 1227 ARG A CZ    1 
ATOM   4650  N  NH1   . ARG E  3 551  ? 62.429  39.481  15.137  1.00 47.90 ? 1227 ARG A NH1   1 
ATOM   4651  N  NH2   . ARG E  3 551  ? 63.278  40.302  13.165  1.00 47.99 ? 1227 ARG A NH2   1 
ATOM   4652  N  N     . ILE E  3 552  ? 66.026  39.739  19.722  1.00 44.84 ? 1228 ILE A N     1 
ATOM   4653  C  CA    . ILE E  3 552  ? 65.126  40.336  20.705  1.00 44.62 ? 1228 ILE A CA    1 
ATOM   4654  C  C     . ILE E  3 552  ? 64.094  41.274  20.084  1.00 45.40 ? 1228 ILE A C     1 
ATOM   4655  O  O     . ILE E  3 552  ? 63.134  41.681  20.746  1.00 46.25 ? 1228 ILE A O     1 
ATOM   4656  C  CB    . ILE E  3 552  ? 65.901  41.056  21.831  1.00 43.96 ? 1228 ILE A CB    1 
ATOM   4657  C  CG1   . ILE E  3 552  ? 66.725  42.214  21.263  1.00 43.97 ? 1228 ILE A CG1   1 
ATOM   4658  C  CG2   . ILE E  3 552  ? 66.771  40.064  22.587  1.00 42.39 ? 1228 ILE A CG2   1 
ATOM   4659  C  CD1   . ILE E  3 552  ? 67.327  43.132  22.312  1.00 44.78 ? 1228 ILE A CD1   1 
ATOM   4660  N  N     . GLY E  3 553  ? 64.295  41.611  18.815  1.00 45.52 ? 1229 GLY A N     1 
ATOM   4661  C  CA    . GLY E  3 553  ? 63.377  42.487  18.104  1.00 46.38 ? 1229 GLY A CA    1 
ATOM   4662  C  C     . GLY E  3 553  ? 63.755  42.659  16.648  1.00 47.27 ? 1229 GLY A C     1 
ATOM   4663  O  O     . GLY E  3 553  ? 64.768  42.121  16.193  1.00 47.39 ? 1229 GLY A O     1 
ATOM   4664  N  N     . ALA E  3 554  ? 62.932  43.414  15.921  1.00 47.84 ? 1230 ALA A N     1 
ATOM   4665  C  CA    . ALA E  3 554  ? 63.159  43.684  14.505  1.00 48.20 ? 1230 ALA A CA    1 
ATOM   4666  C  C     . ALA E  3 554  ? 63.655  45.108  14.295  1.00 49.31 ? 1230 ALA A C     1 
ATOM   4667  O  O     . ALA E  3 554  ? 63.176  46.035  14.946  1.00 49.82 ? 1230 ALA A O     1 
ATOM   4668  C  CB    . ALA E  3 554  ? 61.885  43.452  13.721  1.00 47.30 ? 1230 ALA A CB    1 
ATOM   4669  N  N     . VAL E  3 555  ? 64.621  45.275  13.395  1.00 50.54 ? 1231 VAL A N     1 
ATOM   4670  C  CA    . VAL E  3 555  ? 65.040  46.602  12.950  1.00 51.93 ? 1231 VAL A CA    1 
ATOM   4671  C  C     . VAL E  3 555  ? 64.182  46.967  11.749  1.00 53.32 ? 1231 VAL A C     1 
ATOM   4672  O  O     . VAL E  3 555  ? 64.297  46.350  10.686  1.00 52.99 ? 1231 VAL A O     1 
ATOM   4673  C  CB    . VAL E  3 555  ? 66.535  46.649  12.569  1.00 51.79 ? 1231 VAL A CB    1 
ATOM   4674  C  CG1   . VAL E  3 555  ? 66.904  48.014  12.008  1.00 50.68 ? 1231 VAL A CG1   1 
ATOM   4675  C  CG2   . VAL E  3 555  ? 67.404  46.320  13.770  1.00 51.79 ? 1231 VAL A CG2   1 
ATOM   4676  N  N     . LYS E  3 556  ? 63.315  47.960  11.928  1.00 55.23 ? 1232 LYS A N     1 
ATOM   4677  C  CA    . LYS E  3 556  ? 62.329  48.300  10.908  1.00 57.51 ? 1232 LYS A CA    1 
ATOM   4678  C  C     . LYS E  3 556  ? 62.637  49.573  10.131  1.00 58.42 ? 1232 LYS A C     1 
ATOM   4679  O  O     . LYS E  3 556  ? 63.244  50.505  10.648  1.00 58.69 ? 1232 LYS A O     1 
ATOM   4680  C  CB    . LYS E  3 556  ? 60.916  48.352  11.500  1.00 57.16 ? 1232 LYS A CB    1 
ATOM   4681  C  CG    . LYS E  3 556  ? 60.214  46.996  11.534  1.00 58.74 ? 1232 LYS A CG    1 
ATOM   4682  C  CD    . LYS E  3 556  ? 58.717  47.125  11.824  1.00 59.57 ? 1232 LYS A CD    1 
ATOM   4683  C  CE    . LYS E  3 556  ? 58.440  47.258  13.323  1.00 61.98 ? 1232 LYS A CE    1 
ATOM   4684  N  NZ    . LYS E  3 556  ? 57.093  47.836  13.609  1.00 62.12 ? 1232 LYS A NZ    1 
ATOM   4685  N  N     . GLU E  3 557  ? 62.207  49.575  8.872   1.00 59.82 ? 1233 GLU A N     1 
ATOM   4686  C  CA    . GLU E  3 557  ? 62.302  50.710  7.969   1.00 60.62 ? 1233 GLU A CA    1 
ATOM   4687  C  C     . GLU E  3 557  ? 60.892  51.134  7.616   1.00 60.42 ? 1233 GLU A C     1 
ATOM   4688  O  O     . GLU E  3 557  ? 60.487  51.065  6.454   1.00 59.71 ? 1233 GLU A O     1 
ATOM   4689  C  CB    . GLU E  3 557  ? 63.030  50.284  6.699   1.00 61.76 ? 1233 GLU A CB    1 
ATOM   4690  C  CG    . GLU E  3 557  ? 64.477  50.697  6.636   1.00 64.18 ? 1233 GLU A CG    1 
ATOM   4691  C  CD    . GLU E  3 557  ? 64.649  52.076  6.043   1.00 67.12 ? 1233 GLU A CD    1 
ATOM   4692  O  OE1   . GLU E  3 557  ? 63.678  52.612  5.452   1.00 67.52 ? 1233 GLU A OE1   1 
ATOM   4693  O  OE2   . GLU E  3 557  ? 65.762  52.627  6.166   1.00 70.08 ? 1233 GLU A OE2   1 
ATOM   4694  N  N     . GLY E  3 558  ? 60.145  51.564  8.630   1.00 61.12 ? 1234 GLY A N     1 
ATOM   4695  C  CA    . GLY E  3 558  ? 58.710  51.814  8.491   1.00 61.96 ? 1234 GLY A CA    1 
ATOM   4696  C  C     . GLY E  3 558  ? 58.011  50.519  8.127   1.00 62.38 ? 1234 GLY A C     1 
ATOM   4697  O  O     . GLY E  3 558  ? 57.559  49.775  9.002   1.00 62.97 ? 1234 GLY A O     1 
ATOM   4698  N  N     . GLU E  3 559  ? 57.952  50.242  6.827   1.00 62.20 ? 1235 GLU A N     1 
ATOM   4699  C  CA    . GLU E  3 559  ? 57.373  49.003  6.314   1.00 61.75 ? 1235 GLU A CA    1 
ATOM   4700  C  C     . GLU E  3 559  ? 58.294  47.804  6.520   1.00 60.28 ? 1235 GLU A C     1 
ATOM   4701  O  O     . GLU E  3 559  ? 57.908  46.818  7.141   1.00 59.65 ? 1235 GLU A O     1 
ATOM   4702  C  CB    . GLU E  3 559  ? 57.033  49.148  4.825   1.00 62.61 ? 1235 GLU A CB    1 
ATOM   4703  C  CG    . GLU E  3 559  ? 55.855  50.077  4.522   1.00 64.50 ? 1235 GLU A CG    1 
ATOM   4704  C  CD    . GLU E  3 559  ? 54.503  49.432  4.797   1.00 65.94 ? 1235 GLU A CD    1 
ATOM   4705  O  OE1   . GLU E  3 559  ? 54.302  48.895  5.912   1.00 66.57 ? 1235 GLU A OE1   1 
ATOM   4706  O  OE2   . GLU E  3 559  ? 53.636  49.468  3.896   1.00 66.51 ? 1235 GLU A OE2   1 
ATOM   4707  N  N     . ASN E  3 560  ? 59.518  47.915  6.015   1.00 59.09 ? 1236 ASN A N     1 
ATOM   4708  C  CA    . ASN E  3 560  ? 60.421  46.774  5.878   1.00 57.97 ? 1236 ASN A CA    1 
ATOM   4709  C  C     . ASN E  3 560  ? 61.096  46.317  7.157   1.00 56.93 ? 1236 ASN A C     1 
ATOM   4710  O  O     . ASN E  3 560  ? 61.393  47.121  8.037   1.00 56.77 ? 1236 ASN A O     1 
ATOM   4711  C  CB    . ASN E  3 560  ? 61.499  47.087  4.843   1.00 58.30 ? 1236 ASN A CB    1 
ATOM   4712  C  CG    . ASN E  3 560  ? 60.926  47.637  3.565   1.00 58.40 ? 1236 ASN A CG    1 
ATOM   4713  O  OD1   . ASN E  3 560  ? 60.886  48.844  3.371   1.00 59.66 ? 1236 ASN A OD1   1 
ATOM   4714  N  ND2   . ASN E  3 560  ? 60.453  46.758  2.697   1.00 58.82 ? 1236 ASN A ND2   1 
ATOM   4715  N  N     . VAL E  3 561  ? 61.339  45.014  7.243   1.00 55.70 ? 1237 VAL A N     1 
ATOM   4716  C  CA    . VAL E  3 561  ? 62.176  44.459  8.294   1.00 54.59 ? 1237 VAL A CA    1 
ATOM   4717  C  C     . VAL E  3 561  ? 63.565  44.290  7.693   1.00 54.30 ? 1237 VAL A C     1 
ATOM   4718  O  O     . VAL E  3 561  ? 63.807  43.380  6.894   1.00 54.21 ? 1237 VAL A O     1 
ATOM   4719  C  CB    . VAL E  3 561  ? 61.619  43.129  8.837   1.00 54.08 ? 1237 VAL A CB    1 
ATOM   4720  C  CG1   . VAL E  3 561  ? 62.577  42.516  9.859   1.00 53.98 ? 1237 VAL A CG1   1 
ATOM   4721  C  CG2   . VAL E  3 561  ? 60.254  43.353  9.460   1.00 53.42 ? 1237 VAL A CG2   1 
ATOM   4722  N  N     . VAL E  3 562  ? 64.468  45.189  8.070   1.00 53.49 ? 1238 VAL A N     1 
ATOM   4723  C  CA    . VAL E  3 562  ? 65.775  45.281  7.429   1.00 52.44 ? 1238 VAL A CA    1 
ATOM   4724  C  C     . VAL E  3 562  ? 66.907  44.699  8.294   1.00 51.71 ? 1238 VAL A C     1 
ATOM   4725  O  O     . VAL E  3 562  ? 68.056  44.607  7.849   1.00 51.51 ? 1238 VAL A O     1 
ATOM   4726  C  CB    . VAL E  3 562  ? 66.063  46.743  6.985   1.00 52.36 ? 1238 VAL A CB    1 
ATOM   4727  C  CG1   . VAL E  3 562  ? 66.417  47.626  8.183   1.00 52.05 ? 1238 VAL A CG1   1 
ATOM   4728  C  CG2   . VAL E  3 562  ? 67.148  46.791  5.904   1.00 52.52 ? 1238 VAL A CG2   1 
ATOM   4729  N  N     . GLY E  3 563  ? 66.572  44.296  9.519   1.00 50.86 ? 1239 GLY A N     1 
ATOM   4730  C  CA    . GLY E  3 563  ? 67.553  43.701  10.424  1.00 50.19 ? 1239 GLY A CA    1 
ATOM   4731  C  C     . GLY E  3 563  ? 66.991  43.082  11.689  1.00 50.15 ? 1239 GLY A C     1 
ATOM   4732  O  O     . GLY E  3 563  ? 65.806  43.232  11.996  1.00 51.15 ? 1239 GLY A O     1 
ATOM   4733  N  N     . SER E  3 564  ? 67.853  42.374  12.415  1.00 49.52 ? 1240 SER A N     1 
ATOM   4734  C  CA    . SER E  3 564  ? 67.509  41.774  13.704  1.00 49.17 ? 1240 SER A CA    1 
ATOM   4735  C  C     . SER E  3 564  ? 68.179  42.533  14.843  1.00 48.77 ? 1240 SER A C     1 
ATOM   4736  O  O     . SER E  3 564  ? 69.396  42.704  14.852  1.00 48.55 ? 1240 SER A O     1 
ATOM   4737  C  CB    . SER E  3 564  ? 67.946  40.304  13.758  1.00 48.92 ? 1240 SER A CB    1 
ATOM   4738  O  OG    . SER E  3 564  ? 67.072  39.469  13.032  1.00 48.36 ? 1240 SER A OG    1 
ATOM   4739  N  N     . GLU E  3 565  ? 67.380  42.984  15.801  1.00 48.57 ? 1241 GLU A N     1 
ATOM   4740  C  CA    . GLU E  3 565  ? 67.906  43.521  17.041  1.00 49.12 ? 1241 GLU A CA    1 
ATOM   4741  C  C     . GLU E  3 565  ? 68.395  42.341  17.885  1.00 48.18 ? 1241 GLU A C     1 
ATOM   4742  O  O     . GLU E  3 565  ? 67.647  41.392  18.129  1.00 47.96 ? 1241 GLU A O     1 
ATOM   4743  C  CB    . GLU E  3 565  ? 66.818  44.306  17.769  1.00 50.70 ? 1241 GLU A CB    1 
ATOM   4744  C  CG    . GLU E  3 565  ? 67.342  45.377  18.713  1.00 55.07 ? 1241 GLU A CG    1 
ATOM   4745  C  CD    . GLU E  3 565  ? 67.951  46.571  17.983  1.00 59.24 ? 1241 GLU A CD    1 
ATOM   4746  O  OE1   . GLU E  3 565  ? 67.289  47.124  17.072  1.00 60.39 ? 1241 GLU A OE1   1 
ATOM   4747  O  OE2   . GLU E  3 565  ? 69.092  46.964  18.332  1.00 61.80 ? 1241 GLU A OE2   1 
ATOM   4748  N  N     . THR E  3 566  ? 69.647  42.398  18.326  1.00 47.33 ? 1242 THR A N     1 
ATOM   4749  C  CA    . THR E  3 566  ? 70.314  41.218  18.882  1.00 47.00 ? 1242 THR A CA    1 
ATOM   4750  C  C     . THR E  3 566  ? 70.913  41.438  20.269  1.00 46.07 ? 1242 THR A C     1 
ATOM   4751  O  O     . THR E  3 566  ? 71.415  42.517  20.564  1.00 46.56 ? 1242 THR A O     1 
ATOM   4752  C  CB    . THR E  3 566  ? 71.407  40.719  17.910  1.00 47.38 ? 1242 THR A CB    1 
ATOM   4753  O  OG1   . THR E  3 566  ? 70.785  40.290  16.693  1.00 50.22 ? 1242 THR A OG1   1 
ATOM   4754  C  CG2   . THR E  3 566  ? 72.185  39.556  18.492  1.00 46.56 ? 1242 THR A CG2   1 
ATOM   4755  N  N     . ARG E  3 567  ? 70.855  40.405  21.107  1.00 44.83 ? 1243 ARG A N     1 
ATOM   4756  C  CA    . ARG E  3 567  ? 71.469  40.426  22.434  1.00 43.93 ? 1243 ARG A CA    1 
ATOM   4757  C  C     . ARG E  3 567  ? 72.329  39.185  22.670  1.00 43.83 ? 1243 ARG A C     1 
ATOM   4758  O  O     . ARG E  3 567  ? 71.868  38.057  22.480  1.00 45.13 ? 1243 ARG A O     1 
ATOM   4759  C  CB    . ARG E  3 567  ? 70.399  40.511  23.517  1.00 43.55 ? 1243 ARG A CB    1 
ATOM   4760  C  CG    . ARG E  3 567  ? 70.943  40.843  24.899  1.00 43.96 ? 1243 ARG A CG    1 
ATOM   4761  C  CD    . ARG E  3 567  ? 70.049  40.306  26.007  1.00 45.17 ? 1243 ARG A CD    1 
ATOM   4762  N  NE    . ARG E  3 567  ? 68.623  40.528  25.745  1.00 46.51 ? 1243 ARG A NE    1 
ATOM   4763  C  CZ    . ARG E  3 567  ? 67.946  41.623  26.086  1.00 45.29 ? 1243 ARG A CZ    1 
ATOM   4764  N  NH1   . ARG E  3 567  ? 68.562  42.609  26.711  1.00 45.81 ? 1243 ARG A NH1   1 
ATOM   4765  N  NH2   . ARG E  3 567  ? 66.651  41.732  25.809  1.00 44.29 ? 1243 ARG A NH2   1 
ATOM   4766  N  N     . VAL E  3 568  ? 73.573  39.391  23.087  1.00 42.42 ? 1244 VAL A N     1 
ATOM   4767  C  CA    . VAL E  3 568  ? 74.455  38.278  23.406  1.00 42.13 ? 1244 VAL A CA    1 
ATOM   4768  C  C     . VAL E  3 568  ? 74.822  38.332  24.874  1.00 42.80 ? 1244 VAL A C     1 
ATOM   4769  O  O     . VAL E  3 568  ? 75.276  39.364  25.354  1.00 42.64 ? 1244 VAL A O     1 
ATOM   4770  C  CB    . VAL E  3 568  ? 75.746  38.309  22.569  1.00 42.34 ? 1244 VAL A CB    1 
ATOM   4771  C  CG1   . VAL E  3 568  ? 76.628  37.114  22.898  1.00 42.82 ? 1244 VAL A CG1   1 
ATOM   4772  C  CG2   . VAL E  3 568  ? 75.432  38.336  21.091  1.00 40.46 ? 1244 VAL A CG2   1 
ATOM   4773  N  N     . LYS E  3 569  ? 74.615  37.226  25.585  1.00 44.52 ? 1245 LYS A N     1 
ATOM   4774  C  CA    . LYS E  3 569  ? 75.041  37.098  26.988  1.00 45.82 ? 1245 LYS A CA    1 
ATOM   4775  C  C     . LYS E  3 569  ? 76.321  36.286  27.065  1.00 45.77 ? 1245 LYS A C     1 
ATOM   4776  O  O     . LYS E  3 569  ? 76.458  35.256  26.389  1.00 45.97 ? 1245 LYS A O     1 
ATOM   4777  C  CB    . LYS E  3 569  ? 73.979  36.411  27.849  1.00 46.04 ? 1245 LYS A CB    1 
ATOM   4778  C  CG    . LYS E  3 569  ? 72.895  37.311  28.380  1.00 49.67 ? 1245 LYS A CG    1 
ATOM   4779  C  CD    . LYS E  3 569  ? 72.100  36.569  29.455  1.00 55.61 ? 1245 LYS A CD    1 
ATOM   4780  C  CE    . LYS E  3 569  ? 70.836  37.324  29.889  1.00 58.54 ? 1245 LYS A CE    1 
ATOM   4781  N  NZ    . LYS E  3 569  ? 69.785  37.358  28.820  1.00 60.50 ? 1245 LYS A NZ    1 
ATOM   4782  N  N     . VAL E  3 570  ? 77.260  36.749  27.882  1.00 45.34 ? 1246 VAL A N     1 
ATOM   4783  C  CA    . VAL E  3 570  ? 78.470  35.983  28.126  1.00 45.06 ? 1246 VAL A CA    1 
ATOM   4784  C  C     . VAL E  3 570  ? 78.182  35.056  29.294  1.00 45.00 ? 1246 VAL A C     1 
ATOM   4785  O  O     . VAL E  3 570  ? 78.249  35.448  30.458  1.00 44.45 ? 1246 VAL A O     1 
ATOM   4786  C  CB    . VAL E  3 570  ? 79.698  36.879  28.381  1.00 44.81 ? 1246 VAL A CB    1 
ATOM   4787  C  CG1   . VAL E  3 570  ? 80.950  36.028  28.580  1.00 43.68 ? 1246 VAL A CG1   1 
ATOM   4788  C  CG2   . VAL E  3 570  ? 79.891  37.830  27.215  1.00 45.19 ? 1246 VAL A CG2   1 
ATOM   4789  N  N     . VAL E  3 571  ? 77.840  33.821  28.954  1.00 45.37 ? 1247 VAL A N     1 
ATOM   4790  C  CA    . VAL E  3 571  ? 77.366  32.845  29.921  1.00 45.85 ? 1247 VAL A CA    1 
ATOM   4791  C  C     . VAL E  3 571  ? 78.515  32.188  30.691  1.00 46.00 ? 1247 VAL A C     1 
ATOM   4792  O  O     . VAL E  3 571  ? 78.369  31.878  31.887  1.00 46.19 ? 1247 VAL A O     1 
ATOM   4793  C  CB    . VAL E  3 571  ? 76.485  31.796  29.230  1.00 45.84 ? 1247 VAL A CB    1 
ATOM   4794  C  CG1   . VAL E  3 571  ? 76.209  30.607  30.147  1.00 47.36 ? 1247 VAL A CG1   1 
ATOM   4795  C  CG2   . VAL E  3 571  ? 75.191  32.442  28.803  1.00 46.66 ? 1247 VAL A CG2   1 
ATOM   4796  N  N     . LYS E  3 572  ? 79.642  31.972  30.006  1.00 44.96 ? 1248 LYS A N     1 
ATOM   4797  C  CA    . LYS E  3 572  ? 80.862  31.491  30.656  1.00 43.91 ? 1248 LYS A CA    1 
ATOM   4798  C  C     . LYS E  3 572  ? 82.062  32.300  30.198  1.00 44.06 ? 1248 LYS A C     1 
ATOM   4799  O  O     . LYS E  3 572  ? 82.172  32.640  29.014  1.00 44.17 ? 1248 LYS A O     1 
ATOM   4800  C  CB    . LYS E  3 572  ? 81.101  30.013  30.361  1.00 42.86 ? 1248 LYS A CB    1 
ATOM   4801  C  CG    . LYS E  3 572  ? 82.286  29.429  31.110  1.00 40.54 ? 1248 LYS A CG    1 
ATOM   4802  C  CD    . LYS E  3 572  ? 82.699  28.085  30.551  1.00 38.53 ? 1248 LYS A CD    1 
ATOM   4803  C  CE    . LYS E  3 572  ? 83.793  27.470  31.405  1.00 37.75 ? 1248 LYS A CE    1 
ATOM   4804  N  NZ    . LYS E  3 572  ? 84.075  26.062  31.035  1.00 37.36 ? 1248 LYS A NZ    1 
ATOM   4805  N  N     . ASN E  3 573  ? 82.959  32.600  31.136  1.00 43.64 ? 1249 ASN A N     1 
ATOM   4806  C  CA    . ASN E  3 573  ? 84.174  33.336  30.818  1.00 43.24 ? 1249 ASN A CA    1 
ATOM   4807  C  C     . ASN E  3 573  ? 85.352  32.953  31.709  1.00 43.73 ? 1249 ASN A C     1 
ATOM   4808  O  O     . ASN E  3 573  ? 85.304  33.109  32.930  1.00 44.51 ? 1249 ASN A O     1 
ATOM   4809  C  CB    . ASN E  3 573  ? 83.911  34.839  30.892  1.00 43.15 ? 1249 ASN A CB    1 
ATOM   4810  C  CG    . ASN E  3 573  ? 84.889  35.636  30.074  1.00 41.76 ? 1249 ASN A CG    1 
ATOM   4811  O  OD1   . ASN E  3 573  ? 85.851  35.092  29.539  1.00 40.16 ? 1249 ASN A OD1   1 
ATOM   4812  N  ND2   . ASN E  3 573  ? 84.647  36.939  29.966  1.00 41.61 ? 1249 ASN A ND2   1 
ATOM   4813  N  N     . LYS E  3 574  ? 86.405  32.443  31.084  1.00 43.60 ? 1250 LYS A N     1 
ATOM   4814  C  CA    . LYS E  3 574  ? 87.622  32.036  31.781  1.00 43.90 ? 1250 LYS A CA    1 
ATOM   4815  C  C     . LYS E  3 574  ? 88.700  33.102  31.623  1.00 44.45 ? 1250 LYS A C     1 
ATOM   4816  O  O     . LYS E  3 574  ? 89.828  32.957  32.109  1.00 44.54 ? 1250 LYS A O     1 
ATOM   4817  C  CB    . LYS E  3 574  ? 88.139  30.736  31.177  1.00 43.79 ? 1250 LYS A CB    1 
ATOM   4818  C  CG    . LYS E  3 574  ? 87.822  29.497  31.954  1.00 44.43 ? 1250 LYS A CG    1 
ATOM   4819  C  CD    . LYS E  3 574  ? 88.282  28.290  31.178  1.00 44.53 ? 1250 LYS A CD    1 
ATOM   4820  C  CE    . LYS E  3 574  ? 88.742  27.206  32.118  1.00 46.50 ? 1250 LYS A CE    1 
ATOM   4821  N  NZ    . LYS E  3 574  ? 88.751  25.879  31.439  1.00 47.70 ? 1250 LYS A NZ    1 
ATOM   4822  N  N     . ILE E  3 575  ? 88.339  34.178  30.937  1.00 44.86 ? 1251 ILE A N     1 
ATOM   4823  C  CA    . ILE E  3 575  ? 89.310  35.126  30.418  1.00 44.53 ? 1251 ILE A CA    1 
ATOM   4824  C  C     . ILE E  3 575  ? 89.118  36.507  31.050  1.00 44.76 ? 1251 ILE A C     1 
ATOM   4825  O  O     . ILE E  3 575  ? 90.047  37.308  31.120  1.00 44.76 ? 1251 ILE A O     1 
ATOM   4826  C  CB    . ILE E  3 575  ? 89.251  35.112  28.849  1.00 44.27 ? 1251 ILE A CB    1 
ATOM   4827  C  CG1   . ILE E  3 575  ? 90.590  34.668  28.275  1.00 45.45 ? 1251 ILE A CG1   1 
ATOM   4828  C  CG2   . ILE E  3 575  ? 88.689  36.391  28.229  1.00 43.01 ? 1251 ILE A CG2   1 
ATOM   4829  C  CD1   . ILE E  3 575  ? 91.034  33.304  28.788  1.00 47.00 ? 1251 ILE A CD1   1 
ATOM   4830  N  N     . ALA E  3 576  ? 87.898  36.745  31.529  1.00 44.91 ? 1252 ALA A N     1 
ATOM   4831  C  CA    . ALA E  3 576  ? 87.493  37.966  32.220  1.00 44.63 ? 1252 ALA A CA    1 
ATOM   4832  C  C     . ALA E  3 576  ? 86.231  37.613  33.008  1.00 44.82 ? 1252 ALA A C     1 
ATOM   4833  O  O     . ALA E  3 576  ? 85.764  36.471  32.942  1.00 45.20 ? 1252 ALA A O     1 
ATOM   4834  C  CB    . ALA E  3 576  ? 87.211  39.074  31.219  1.00 43.91 ? 1252 ALA A CB    1 
ATOM   4835  N  N     . ALA E  3 577  ? 85.690  38.569  33.760  1.00 44.55 ? 1253 ALA A N     1 
ATOM   4836  C  CA    . ALA E  3 577  ? 84.422  38.368  34.465  1.00 44.46 ? 1253 ALA A CA    1 
ATOM   4837  C  C     . ALA E  3 577  ? 83.294  37.999  33.489  1.00 44.82 ? 1253 ALA A C     1 
ATOM   4838  O  O     . ALA E  3 577  ? 83.187  38.600  32.410  1.00 45.51 ? 1253 ALA A O     1 
ATOM   4839  C  CB    . ALA E  3 577  ? 84.054  39.612  35.250  1.00 44.67 ? 1253 ALA A CB    1 
ATOM   4840  N  N     . PRO E  3 578  ? 82.470  36.992  33.850  1.00 44.34 ? 1254 PRO A N     1 
ATOM   4841  C  CA    . PRO E  3 578  ? 81.334  36.584  33.022  1.00 43.99 ? 1254 PRO A CA    1 
ATOM   4842  C  C     . PRO E  3 578  ? 80.058  37.394  33.282  1.00 44.13 ? 1254 PRO A C     1 
ATOM   4843  O  O     . PRO E  3 578  ? 80.035  38.268  34.148  1.00 44.36 ? 1254 PRO A O     1 
ATOM   4844  C  CB    . PRO E  3 578  ? 81.118  35.136  33.454  1.00 43.86 ? 1254 PRO A CB    1 
ATOM   4845  C  CG    . PRO E  3 578  ? 81.473  35.147  34.899  1.00 43.82 ? 1254 PRO A CG    1 
ATOM   4846  C  CD    . PRO E  3 578  ? 82.589  36.153  35.058  1.00 43.84 ? 1254 PRO A CD    1 
ATOM   4847  N  N     . PHE E  3 579  ? 79.016  37.089  32.515  1.00 44.53 ? 1255 PHE A N     1 
ATOM   4848  C  CA    . PHE E  3 579  ? 77.656  37.600  32.726  1.00 45.13 ? 1255 PHE A CA    1 
ATOM   4849  C  C     . PHE E  3 579  ? 77.426  39.055  32.334  1.00 45.81 ? 1255 PHE A C     1 
ATOM   4850  O  O     . PHE E  3 579  ? 76.415  39.643  32.711  1.00 46.32 ? 1255 PHE A O     1 
ATOM   4851  C  CB    . PHE E  3 579  ? 77.159  37.327  34.154  1.00 44.93 ? 1255 PHE A CB    1 
ATOM   4852  C  CG    . PHE E  3 579  ? 77.191  35.878  34.537  1.00 44.97 ? 1255 PHE A CG    1 
ATOM   4853  C  CD1   . PHE E  3 579  ? 76.420  34.941  33.849  1.00 44.56 ? 1255 PHE A CD1   1 
ATOM   4854  C  CD2   . PHE E  3 579  ? 77.996  35.445  35.585  1.00 44.89 ? 1255 PHE A CD2   1 
ATOM   4855  C  CE1   . PHE E  3 579  ? 76.456  33.597  34.197  1.00 44.52 ? 1255 PHE A CE1   1 
ATOM   4856  C  CE2   . PHE E  3 579  ? 78.038  34.103  35.944  1.00 44.60 ? 1255 PHE A CE2   1 
ATOM   4857  C  CZ    . PHE E  3 579  ? 77.266  33.177  35.252  1.00 44.71 ? 1255 PHE A CZ    1 
ATOM   4858  N  N     . LYS E  3 580  ? 78.353  39.634  31.578  1.00 46.43 ? 1256 LYS A N     1 
ATOM   4859  C  CA    . LYS E  3 580  ? 78.085  40.910  30.930  1.00 47.17 ? 1256 LYS A CA    1 
ATOM   4860  C  C     . LYS E  3 580  ? 77.350  40.609  29.630  1.00 47.44 ? 1256 LYS A C     1 
ATOM   4861  O  O     . LYS E  3 580  ? 77.430  39.496  29.113  1.00 46.95 ? 1256 LYS A O     1 
ATOM   4862  C  CB    . LYS E  3 580  ? 79.378  41.659  30.640  1.00 47.56 ? 1256 LYS A CB    1 
ATOM   4863  C  CG    . LYS E  3 580  ? 80.102  42.173  31.858  1.00 49.43 ? 1256 LYS A CG    1 
ATOM   4864  C  CD    . LYS E  3 580  ? 81.377  42.874  31.429  1.00 51.37 ? 1256 LYS A CD    1 
ATOM   4865  C  CE    . LYS E  3 580  ? 82.345  43.060  32.588  1.00 53.12 ? 1256 LYS A CE    1 
ATOM   4866  N  NZ    . LYS E  3 580  ? 83.690  43.488  32.092  1.00 54.81 ? 1256 LYS A NZ    1 
ATOM   4867  N  N     . GLN E  3 581  ? 76.629  41.587  29.100  1.00 48.31 ? 1257 GLN A N     1 
ATOM   4868  C  CA    . GLN E  3 581  ? 75.910  41.366  27.855  1.00 49.40 ? 1257 GLN A CA    1 
ATOM   4869  C  C     . GLN E  3 581  ? 76.051  42.492  26.844  1.00 49.49 ? 1257 GLN A C     1 
ATOM   4870  O  O     . GLN E  3 581  ? 76.385  43.618  27.194  1.00 50.14 ? 1257 GLN A O     1 
ATOM   4871  C  CB    . GLN E  3 581  ? 74.440  41.030  28.119  1.00 49.74 ? 1257 GLN A CB    1 
ATOM   4872  C  CG    . GLN E  3 581  ? 73.676  42.038  28.947  1.00 50.95 ? 1257 GLN A CG    1 
ATOM   4873  C  CD    . GLN E  3 581  ? 72.224  41.639  29.117  1.00 51.40 ? 1257 GLN A CD    1 
ATOM   4874  O  OE1   . GLN E  3 581  ? 71.330  42.273  28.556  1.00 53.89 ? 1257 GLN A OE1   1 
ATOM   4875  N  NE2   . GLN E  3 581  ? 71.982  40.570  29.876  1.00 52.10 ? 1257 GLN A NE2   1 
ATOM   4876  N  N     . ALA E  3 582  ? 75.800  42.168  25.582  1.00 49.68 ? 1258 ALA A N     1 
ATOM   4877  C  CA    . ALA E  3 582  ? 75.958  43.116  24.495  1.00 49.69 ? 1258 ALA A CA    1 
ATOM   4878  C  C     . ALA E  3 582  ? 74.710  43.126  23.638  1.00 50.28 ? 1258 ALA A C     1 
ATOM   4879  O  O     . ALA E  3 582  ? 74.206  42.068  23.262  1.00 51.25 ? 1258 ALA A O     1 
ATOM   4880  C  CB    . ALA E  3 582  ? 77.150  42.738  23.662  1.00 49.15 ? 1258 ALA A CB    1 
ATOM   4881  N  N     . GLU E  3 583  ? 74.205  44.319  23.341  1.00 50.53 ? 1259 GLU A N     1 
ATOM   4882  C  CA    . GLU E  3 583  ? 73.089  44.465  22.412  1.00 51.27 ? 1259 GLU A CA    1 
ATOM   4883  C  C     . GLU E  3 583  ? 73.562  45.207  21.174  1.00 50.89 ? 1259 GLU A C     1 
ATOM   4884  O  O     . GLU E  3 583  ? 74.242  46.228  21.282  1.00 52.34 ? 1259 GLU A O     1 
ATOM   4885  C  CB    . GLU E  3 583  ? 71.923  45.215  23.054  1.00 50.89 ? 1259 GLU A CB    1 
ATOM   4886  C  CG    . GLU E  3 583  ? 71.346  44.543  24.290  1.00 52.56 ? 1259 GLU A CG    1 
ATOM   4887  C  CD    . GLU E  3 583  ? 70.059  45.201  24.784  1.00 53.30 ? 1259 GLU A CD    1 
ATOM   4888  O  OE1   . GLU E  3 583  ? 69.805  46.382  24.461  1.00 55.10 ? 1259 GLU A OE1   1 
ATOM   4889  O  OE2   . GLU E  3 583  ? 69.292  44.531  25.503  1.00 55.28 ? 1259 GLU A OE2   1 
ATOM   4890  N  N     . PHE E  3 584  ? 73.215  44.689  20.003  1.00 49.48 ? 1260 PHE A N     1 
ATOM   4891  C  CA    . PHE E  3 584  ? 73.570  45.342  18.752  1.00 48.80 ? 1260 PHE A CA    1 
ATOM   4892  C  C     . PHE E  3 584  ? 72.579  44.966  17.662  1.00 48.24 ? 1260 PHE A C     1 
ATOM   4893  O  O     . PHE E  3 584  ? 71.640  44.207  17.907  1.00 48.72 ? 1260 PHE A O     1 
ATOM   4894  C  CB    . PHE E  3 584  ? 74.997  44.971  18.341  1.00 49.37 ? 1260 PHE A CB    1 
ATOM   4895  C  CG    . PHE E  3 584  ? 75.244  43.494  18.281  1.00 50.07 ? 1260 PHE A CG    1 
ATOM   4896  C  CD1   . PHE E  3 584  ? 74.875  42.757  17.155  1.00 50.29 ? 1260 PHE A CD1   1 
ATOM   4897  C  CD2   . PHE E  3 584  ? 75.850  42.838  19.346  1.00 49.83 ? 1260 PHE A CD2   1 
ATOM   4898  C  CE1   . PHE E  3 584  ? 75.096  41.385  17.094  1.00 50.64 ? 1260 PHE A CE1   1 
ATOM   4899  C  CE2   . PHE E  3 584  ? 76.083  41.467  19.293  1.00 50.61 ? 1260 PHE A CE2   1 
ATOM   4900  C  CZ    . PHE E  3 584  ? 75.704  40.736  18.163  1.00 50.70 ? 1260 PHE A CZ    1 
ATOM   4901  N  N     . GLN E  3 585  ? 72.793  45.493  16.460  1.00 47.20 ? 1261 GLN A N     1 
ATOM   4902  C  CA    . GLN E  3 585  ? 71.930  45.196  15.324  1.00 46.09 ? 1261 GLN A CA    1 
ATOM   4903  C  C     . GLN E  3 585  ? 72.635  44.333  14.294  1.00 45.72 ? 1261 GLN A C     1 
ATOM   4904  O  O     . GLN E  3 585  ? 73.798  44.568  13.968  1.00 45.59 ? 1261 GLN A O     1 
ATOM   4905  C  CB    . GLN E  3 585  ? 71.469  46.479  14.647  1.00 46.08 ? 1261 GLN A CB    1 
ATOM   4906  C  CG    . GLN E  3 585  ? 70.705  47.427  15.539  1.00 45.68 ? 1261 GLN A CG    1 
ATOM   4907  C  CD    . GLN E  3 585  ? 70.148  48.608  14.775  1.00 46.28 ? 1261 GLN A CD    1 
ATOM   4908  O  OE1   . GLN E  3 585  ? 70.733  49.069  13.789  1.00 45.73 ? 1261 GLN A OE1   1 
ATOM   4909  N  NE2   . GLN E  3 585  ? 69.008  49.109  15.227  1.00 46.75 ? 1261 GLN A NE2   1 
ATOM   4910  N  N     . ILE E  3 586  ? 71.928  43.326  13.792  1.00 45.42 ? 1262 ILE A N     1 
ATOM   4911  C  CA    . ILE E  3 586  ? 72.386  42.605  12.623  1.00 44.84 ? 1262 ILE A CA    1 
ATOM   4912  C  C     . ILE E  3 586  ? 71.549  43.090  11.464  1.00 45.24 ? 1262 ILE A C     1 
ATOM   4913  O  O     . ILE E  3 586  ? 70.362  42.791  11.382  1.00 45.23 ? 1262 ILE A O     1 
ATOM   4914  C  CB    . ILE E  3 586  ? 72.274  41.082  12.774  1.00 44.21 ? 1262 ILE A CB    1 
ATOM   4915  C  CG1   . ILE E  3 586  ? 73.162  40.600  13.924  1.00 43.37 ? 1262 ILE A CG1   1 
ATOM   4916  C  CG2   . ILE E  3 586  ? 72.685  40.394  11.468  1.00 44.72 ? 1262 ILE A CG2   1 
ATOM   4917  C  CD1   . ILE E  3 586  ? 73.161  39.101  14.142  1.00 43.00 ? 1262 ILE A CD1   1 
ATOM   4918  N  N     . LEU E  3 587  ? 72.171  43.869  10.589  1.00 46.15 ? 1263 LEU A N     1 
ATOM   4919  C  CA    . LEU E  3 587  ? 71.500  44.353  9.397   1.00 47.69 ? 1263 LEU A CA    1 
ATOM   4920  C  C     . LEU E  3 587  ? 71.700  43.350  8.276   1.00 48.61 ? 1263 LEU A C     1 
ATOM   4921  O  O     . LEU E  3 587  ? 72.833  43.048  7.904   1.00 48.91 ? 1263 LEU A O     1 
ATOM   4922  C  CB    . LEU E  3 587  ? 72.026  45.732  8.999   1.00 47.47 ? 1263 LEU A CB    1 
ATOM   4923  C  CG    . LEU E  3 587  ? 71.866  46.841  10.039  1.00 46.88 ? 1263 LEU A CG    1 
ATOM   4924  C  CD1   . LEU E  3 587  ? 72.574  48.093  9.553   1.00 47.41 ? 1263 LEU A CD1   1 
ATOM   4925  C  CD2   . LEU E  3 587  ? 70.399  47.124  10.338  1.00 45.95 ? 1263 LEU A CD2   1 
ATOM   4926  N  N     . TYR E  3 588  ? 70.595  42.828  7.752   1.00 49.86 ? 1264 TYR A N     1 
ATOM   4927  C  CA    . TYR E  3 588  ? 70.642  41.766  6.752   1.00 51.17 ? 1264 TYR A CA    1 
ATOM   4928  C  C     . TYR E  3 588  ? 71.439  42.210  5.537   1.00 52.20 ? 1264 TYR A C     1 
ATOM   4929  O  O     . TYR E  3 588  ? 71.260  43.324  5.045   1.00 52.70 ? 1264 TYR A O     1 
ATOM   4930  C  CB    . TYR E  3 588  ? 69.231  41.325  6.339   1.00 51.15 ? 1264 TYR A CB    1 
ATOM   4931  C  CG    . TYR E  3 588  ? 68.323  40.943  7.492   1.00 50.82 ? 1264 TYR A CG    1 
ATOM   4932  C  CD1   . TYR E  3 588  ? 68.793  40.160  8.550   1.00 50.57 ? 1264 TYR A CD1   1 
ATOM   4933  C  CD2   . TYR E  3 588  ? 66.986  41.347  7.513   1.00 49.95 ? 1264 TYR A CD2   1 
ATOM   4934  C  CE1   . TYR E  3 588  ? 67.963  39.807  9.606   1.00 50.76 ? 1264 TYR A CE1   1 
ATOM   4935  C  CE2   . TYR E  3 588  ? 66.146  40.994  8.561   1.00 50.62 ? 1264 TYR A CE2   1 
ATOM   4936  C  CZ    . TYR E  3 588  ? 66.643  40.224  9.606   1.00 51.06 ? 1264 TYR A CZ    1 
ATOM   4937  O  OH    . TYR E  3 588  ? 65.817  39.878  10.651  1.00 51.88 ? 1264 TYR A OH    1 
ATOM   4938  N  N     . GLY E  3 589  ? 72.341  41.344  5.085   1.00 53.15 ? 1265 GLY A N     1 
ATOM   4939  C  CA    . GLY E  3 589  ? 73.158  41.619  3.905   1.00 54.54 ? 1265 GLY A CA    1 
ATOM   4940  C  C     . GLY E  3 589  ? 74.317  42.560  4.167   1.00 55.19 ? 1265 GLY A C     1 
ATOM   4941  O  O     . GLY E  3 589  ? 75.135  42.815  3.279   1.00 55.35 ? 1265 GLY A O     1 
ATOM   4942  N  N     . GLU E  3 590  ? 74.387  43.077  5.388   1.00 55.71 ? 1266 GLU A N     1 
ATOM   4943  C  CA    . GLU E  3 590  ? 75.447  43.991  5.772   1.00 56.93 ? 1266 GLU A CA    1 
ATOM   4944  C  C     . GLU E  3 590  ? 76.283  43.408  6.910   1.00 55.70 ? 1266 GLU A C     1 
ATOM   4945  O  O     . GLU E  3 590  ? 77.510  43.414  6.850   1.00 55.82 ? 1266 GLU A O     1 
ATOM   4946  C  CB    . GLU E  3 590  ? 74.857  45.349  6.157   1.00 57.23 ? 1266 GLU A CB    1 
ATOM   4947  C  CG    . GLU E  3 590  ? 75.893  46.434  6.413   1.00 59.76 ? 1266 GLU A CG    1 
ATOM   4948  C  CD    . GLU E  3 590  ? 75.291  47.829  6.494   1.00 60.44 ? 1266 GLU A CD    1 
ATOM   4949  O  OE1   . GLU E  3 590  ? 75.859  48.686  7.217   1.00 63.47 ? 1266 GLU A OE1   1 
ATOM   4950  O  OE2   . GLU E  3 590  ? 74.255  48.073  5.830   1.00 63.33 ? 1266 GLU A OE2   1 
ATOM   4951  N  N     . GLY E  3 591  ? 75.611  42.900  7.938   1.00 54.85 ? 1267 GLY A N     1 
ATOM   4952  C  CA    . GLY E  3 591  ? 76.279  42.336  9.106   1.00 53.18 ? 1267 GLY A CA    1 
ATOM   4953  C  C     . GLY E  3 591  ? 75.956  43.087  10.382  1.00 52.09 ? 1267 GLY A C     1 
ATOM   4954  O  O     . GLY E  3 591  ? 74.943  43.786  10.464  1.00 51.94 ? 1267 GLY A O     1 
ATOM   4955  N  N     . ILE E  3 592  ? 76.820  42.929  11.381  1.00 50.99 ? 1268 ILE A N     1 
ATOM   4956  C  CA    . ILE E  3 592  ? 76.709  43.646  12.650  1.00 50.41 ? 1268 ILE A CA    1 
ATOM   4957  C  C     . ILE E  3 592  ? 76.855  45.170  12.440  1.00 50.03 ? 1268 ILE A C     1 
ATOM   4958  O  O     . ILE E  3 592  ? 77.827  45.597  11.809  1.00 50.83 ? 1268 ILE A O     1 
ATOM   4959  C  CB    . ILE E  3 592  ? 77.791  43.142  13.645  1.00 50.37 ? 1268 ILE A CB    1 
ATOM   4960  C  CG1   . ILE E  3 592  ? 77.476  41.707  14.085  1.00 50.50 ? 1268 ILE A CG1   1 
ATOM   4961  C  CG2   . ILE E  3 592  ? 77.909  44.082  14.854  1.00 50.43 ? 1268 ILE A CG2   1 
ATOM   4962  C  CD1   . ILE E  3 592  ? 78.614  40.997  14.794  1.00 50.12 ? 1268 ILE A CD1   1 
ATOM   4963  N  N     . ASN E  3 593  ? 75.909  45.982  12.960  1.00 48.66 ? 1269 ASN A N     1 
ATOM   4964  C  CA    . ASN E  3 593  ? 76.003  47.450  12.866  1.00 47.63 ? 1269 ASN A CA    1 
ATOM   4965  C  C     . ASN E  3 593  ? 77.020  47.986  13.862  1.00 47.60 ? 1269 ASN A C     1 
ATOM   4966  O  O     . ASN E  3 593  ? 76.677  48.387  14.980  1.00 47.73 ? 1269 ASN A O     1 
ATOM   4967  C  CB    . ASN E  3 593  ? 74.640  48.138  13.040  1.00 47.15 ? 1269 ASN A CB    1 
ATOM   4968  C  CG    . ASN E  3 593  ? 74.703  49.644  12.791  1.00 46.82 ? 1269 ASN A CG    1 
ATOM   4969  O  OD1   . ASN E  3 593  ? 75.750  50.196  12.442  1.00 45.90 ? 1269 ASN A OD1   1 
ATOM   4970  N  ND2   . ASN E  3 593  ? 73.575  50.313  12.974  1.00 47.28 ? 1269 ASN A ND2   1 
ATOM   4971  N  N     . PHE E  3 594  ? 78.278  47.985  13.431  1.00 47.60 ? 1270 PHE A N     1 
ATOM   4972  C  CA    . PHE E  3 594  ? 79.409  48.329  14.287  1.00 47.44 ? 1270 PHE A CA    1 
ATOM   4973  C  C     . PHE E  3 594  ? 79.447  49.814  14.623  1.00 46.86 ? 1270 PHE A C     1 
ATOM   4974  O  O     . PHE E  3 594  ? 79.650  50.191  15.778  1.00 46.62 ? 1270 PHE A O     1 
ATOM   4975  C  CB    . PHE E  3 594  ? 80.727  47.899  13.628  1.00 47.71 ? 1270 PHE A CB    1 
ATOM   4976  C  CG    . PHE E  3 594  ? 81.950  48.218  14.445  1.00 48.28 ? 1270 PHE A CG    1 
ATOM   4977  C  CD1   . PHE E  3 594  ? 82.398  47.334  15.426  1.00 48.46 ? 1270 PHE A CD1   1 
ATOM   4978  C  CD2   . PHE E  3 594  ? 82.657  49.405  14.235  1.00 47.80 ? 1270 PHE A CD2   1 
ATOM   4979  C  CE1   . PHE E  3 594  ? 83.531  47.628  16.187  1.00 48.61 ? 1270 PHE A CE1   1 
ATOM   4980  C  CE2   . PHE E  3 594  ? 83.785  49.709  14.991  1.00 47.24 ? 1270 PHE A CE2   1 
ATOM   4981  C  CZ    . PHE E  3 594  ? 84.224  48.819  15.969  1.00 47.76 ? 1270 PHE A CZ    1 
ATOM   4982  N  N     . TYR E  3 595  ? 79.261  50.652  13.609  1.00 46.36 ? 1271 TYR A N     1 
ATOM   4983  C  CA    . TYR E  3 595  ? 79.307  52.091  13.805  1.00 45.84 ? 1271 TYR A CA    1 
ATOM   4984  C  C     . TYR E  3 595  ? 78.101  52.593  14.584  1.00 45.13 ? 1271 TYR A C     1 
ATOM   4985  O  O     . TYR E  3 595  ? 78.188  53.598  15.288  1.00 44.72 ? 1271 TYR A O     1 
ATOM   4986  C  CB    . TYR E  3 595  ? 79.458  52.815  12.471  1.00 46.79 ? 1271 TYR A CB    1 
ATOM   4987  C  CG    . TYR E  3 595  ? 80.792  52.556  11.811  1.00 47.49 ? 1271 TYR A CG    1 
ATOM   4988  C  CD1   . TYR E  3 595  ? 81.974  53.029  12.381  1.00 47.45 ? 1271 TYR A CD1   1 
ATOM   4989  C  CD2   . TYR E  3 595  ? 80.874  51.830  10.624  1.00 48.06 ? 1271 TYR A CD2   1 
ATOM   4990  C  CE1   . TYR E  3 595  ? 83.205  52.789  11.786  1.00 48.24 ? 1271 TYR A CE1   1 
ATOM   4991  C  CE2   . TYR E  3 595  ? 82.102  51.587  10.014  1.00 48.54 ? 1271 TYR A CE2   1 
ATOM   4992  C  CZ    . TYR E  3 595  ? 83.264  52.069  10.602  1.00 48.49 ? 1271 TYR A CZ    1 
ATOM   4993  O  OH    . TYR E  3 595  ? 84.485  51.835  10.008  1.00 48.21 ? 1271 TYR A OH    1 
ATOM   4994  N  N     . GLY E  3 596  ? 76.986  51.876  14.465  1.00 44.62 ? 1272 GLY A N     1 
ATOM   4995  C  CA    . GLY E  3 596  ? 75.824  52.115  15.309  1.00 43.94 ? 1272 GLY A CA    1 
ATOM   4996  C  C     . GLY E  3 596  ? 76.191  52.003  16.777  1.00 43.72 ? 1272 GLY A C     1 
ATOM   4997  O  O     . GLY E  3 596  ? 75.868  52.892  17.568  1.00 42.82 ? 1272 GLY A O     1 
ATOM   4998  N  N     . GLU E  3 597  ? 76.872  50.912  17.133  1.00 44.48 ? 1273 GLU A N     1 
ATOM   4999  C  CA    . GLU E  3 597  ? 77.376  50.699  18.494  1.00 45.77 ? 1273 GLU A CA    1 
ATOM   5000  C  C     . GLU E  3 597  ? 78.284  51.848  18.898  1.00 45.65 ? 1273 GLU A C     1 
ATOM   5001  O  O     . GLU E  3 597  ? 78.139  52.415  19.984  1.00 46.13 ? 1273 GLU A O     1 
ATOM   5002  C  CB    . GLU E  3 597  ? 78.181  49.404  18.596  1.00 45.64 ? 1273 GLU A CB    1 
ATOM   5003  C  CG    . GLU E  3 597  ? 77.379  48.125  18.497  1.00 47.65 ? 1273 GLU A CG    1 
ATOM   5004  C  CD    . GLU E  3 597  ? 78.274  46.892  18.417  1.00 48.03 ? 1273 GLU A CD    1 
ATOM   5005  O  OE1   . GLU E  3 597  ? 79.050  46.772  17.442  1.00 50.14 ? 1273 GLU A OE1   1 
ATOM   5006  O  OE2   . GLU E  3 597  ? 78.204  46.039  19.328  1.00 49.28 ? 1273 GLU A OE2   1 
ATOM   5007  N  N     . LEU E  3 598  ? 79.216  52.187  18.009  1.00 44.91 ? 1274 LEU A N     1 
ATOM   5008  C  CA    . LEU E  3 598  ? 80.192  53.225  18.281  1.00 44.13 ? 1274 LEU A CA    1 
ATOM   5009  C  C     . LEU E  3 598  ? 79.523  54.543  18.647  1.00 43.96 ? 1274 LEU A C     1 
ATOM   5010  O  O     . LEU E  3 598  ? 79.948  55.204  19.590  1.00 44.27 ? 1274 LEU A O     1 
ATOM   5011  C  CB    . LEU E  3 598  ? 81.137  53.400  17.096  1.00 44.29 ? 1274 LEU A CB    1 
ATOM   5012  C  CG    . LEU E  3 598  ? 82.446  54.152  17.361  1.00 44.31 ? 1274 LEU A CG    1 
ATOM   5013  C  CD1   . LEU E  3 598  ? 83.219  53.526  18.507  1.00 44.69 ? 1274 LEU A CD1   1 
ATOM   5014  C  CD2   . LEU E  3 598  ? 83.303  54.190  16.108  1.00 44.31 ? 1274 LEU A CD2   1 
ATOM   5015  N  N     . VAL E  3 599  ? 78.474  54.914  17.916  1.00 43.73 ? 1275 VAL A N     1 
ATOM   5016  C  CA    . VAL E  3 599  ? 77.687  56.098  18.257  1.00 44.04 ? 1275 VAL A CA    1 
ATOM   5017  C  C     . VAL E  3 599  ? 77.132  55.993  19.680  1.00 44.62 ? 1275 VAL A C     1 
ATOM   5018  O  O     . VAL E  3 599  ? 77.401  56.853  20.508  1.00 44.89 ? 1275 VAL A O     1 
ATOM   5019  C  CB    . VAL E  3 599  ? 76.545  56.361  17.244  1.00 44.05 ? 1275 VAL A CB    1 
ATOM   5020  C  CG1   . VAL E  3 599  ? 75.622  57.473  17.737  1.00 43.94 ? 1275 VAL A CG1   1 
ATOM   5021  C  CG2   . VAL E  3 599  ? 77.114  56.724  15.882  1.00 44.33 ? 1275 VAL A CG2   1 
ATOM   5022  N  N     . ASP E  3 600  ? 76.384  54.930  19.965  1.00 45.70 ? 1276 ASP A N     1 
ATOM   5023  C  CA    . ASP E  3 600  ? 75.752  54.763  21.276  1.00 46.50 ? 1276 ASP A CA    1 
ATOM   5024  C  C     . ASP E  3 600  ? 76.750  54.732  22.425  1.00 46.02 ? 1276 ASP A C     1 
ATOM   5025  O  O     . ASP E  3 600  ? 76.521  55.358  23.457  1.00 45.56 ? 1276 ASP A O     1 
ATOM   5026  C  CB    . ASP E  3 600  ? 74.873  53.510  21.304  1.00 47.76 ? 1276 ASP A CB    1 
ATOM   5027  C  CG    . ASP E  3 600  ? 73.596  53.672  20.498  1.00 50.19 ? 1276 ASP A CG    1 
ATOM   5028  O  OD1   . ASP E  3 600  ? 73.333  54.793  20.006  1.00 51.92 ? 1276 ASP A OD1   1 
ATOM   5029  O  OD2   . ASP E  3 600  ? 72.850  52.676  20.357  1.00 52.12 ? 1276 ASP A OD2   1 
ATOM   5030  N  N     . LEU E  3 601  ? 77.848  54.005  22.233  1.00 46.03 ? 1277 LEU A N     1 
ATOM   5031  C  CA    . LEU E  3 601  ? 78.913  53.922  23.230  1.00 46.44 ? 1277 LEU A CA    1 
ATOM   5032  C  C     . LEU E  3 601  ? 79.631  55.259  23.405  1.00 46.66 ? 1277 LEU A C     1 
ATOM   5033  O  O     . LEU E  3 601  ? 79.989  55.634  24.521  1.00 46.47 ? 1277 LEU A O     1 
ATOM   5034  C  CB    . LEU E  3 601  ? 79.922  52.824  22.861  1.00 46.69 ? 1277 LEU A CB    1 
ATOM   5035  C  CG    . LEU E  3 601  ? 79.733  51.378  23.338  1.00 46.80 ? 1277 LEU A CG    1 
ATOM   5036  C  CD1   . LEU E  3 601  ? 79.461  51.318  24.834  1.00 47.27 ? 1277 LEU A CD1   1 
ATOM   5037  C  CD2   . LEU E  3 601  ? 78.628  50.659  22.577  1.00 49.08 ? 1277 LEU A CD2   1 
ATOM   5038  N  N     . GLY E  3 602  ? 79.833  55.966  22.294  1.00 47.04 ? 1278 GLY A N     1 
ATOM   5039  C  CA    . GLY E  3 602  ? 80.463  57.285  22.305  1.00 47.31 ? 1278 GLY A CA    1 
ATOM   5040  C  C     . GLY E  3 602  ? 79.631  58.308  23.055  1.00 47.42 ? 1278 GLY A C     1 
ATOM   5041  O  O     . GLY E  3 602  ? 80.155  59.051  23.882  1.00 47.55 ? 1278 GLY A O     1 
ATOM   5042  N  N     . VAL E  3 603  ? 78.333  58.336  22.766  1.00 47.75 ? 1279 VAL A N     1 
ATOM   5043  C  CA    . VAL E  3 603  ? 77.391  59.227  23.442  1.00 48.28 ? 1279 VAL A CA    1 
ATOM   5044  C  C     . VAL E  3 603  ? 77.316  58.910  24.935  1.00 48.85 ? 1279 VAL A C     1 
ATOM   5045  O  O     . VAL E  3 603  ? 77.337  59.815  25.771  1.00 48.86 ? 1279 VAL A O     1 
ATOM   5046  C  CB    . VAL E  3 603  ? 75.985  59.156  22.791  1.00 48.50 ? 1279 VAL A CB    1 
ATOM   5047  C  CG1   . VAL E  3 603  ? 74.908  59.731  23.709  1.00 48.45 ? 1279 VAL A CG1   1 
ATOM   5048  C  CG2   . VAL E  3 603  ? 75.989  59.887  21.461  1.00 48.36 ? 1279 VAL A CG2   1 
ATOM   5049  N  N     . LYS E  3 604  ? 77.251  57.621  25.253  1.00 49.80 ? 1280 LYS A N     1 
ATOM   5050  C  CA    . LYS E  3 604  ? 77.184  57.150  26.632  1.00 50.81 ? 1280 LYS A CA    1 
ATOM   5051  C  C     . LYS E  3 604  ? 78.413  57.574  27.430  1.00 50.83 ? 1280 LYS A C     1 
ATOM   5052  O  O     . LYS E  3 604  ? 78.303  57.923  28.605  1.00 50.55 ? 1280 LYS A O     1 
ATOM   5053  C  CB    . LYS E  3 604  ? 77.042  55.627  26.657  1.00 51.70 ? 1280 LYS A CB    1 
ATOM   5054  C  CG    . LYS E  3 604  ? 76.696  55.051  28.015  1.00 53.69 ? 1280 LYS A CG    1 
ATOM   5055  C  CD    . LYS E  3 604  ? 77.073  53.587  28.093  1.00 55.35 ? 1280 LYS A CD    1 
ATOM   5056  C  CE    . LYS E  3 604  ? 76.843  53.049  29.489  1.00 56.74 ? 1280 LYS A CE    1 
ATOM   5057  N  NZ    . LYS E  3 604  ? 77.350  51.661  29.615  1.00 58.07 ? 1280 LYS A NZ    1 
ATOM   5058  N  N     . GLU E  3 605  ? 79.575  57.550  26.782  1.00 51.35 ? 1281 GLU A N     1 
ATOM   5059  C  CA    . GLU E  3 605  ? 80.837  57.891  27.440  1.00 51.88 ? 1281 GLU A CA    1 
ATOM   5060  C  C     . GLU E  3 605  ? 81.213  59.368  27.328  1.00 51.81 ? 1281 GLU A C     1 
ATOM   5061  O  O     . GLU E  3 605  ? 82.335  59.753  27.669  1.00 52.15 ? 1281 GLU A O     1 
ATOM   5062  C  CB    . GLU E  3 605  ? 81.974  57.003  26.921  1.00 52.53 ? 1281 GLU A CB    1 
ATOM   5063  C  CG    . GLU E  3 605  ? 81.856  55.535  27.332  1.00 55.10 ? 1281 GLU A CG    1 
ATOM   5064  C  CD    . GLU E  3 605  ? 81.690  55.346  28.833  1.00 56.92 ? 1281 GLU A CD    1 
ATOM   5065  O  OE1   . GLU E  3 605  ? 82.526  55.869  29.602  1.00 57.43 ? 1281 GLU A OE1   1 
ATOM   5066  O  OE2   . GLU E  3 605  ? 80.721  54.669  29.242  1.00 58.71 ? 1281 GLU A OE2   1 
ATOM   5067  N  N     . LYS E  3 606  ? 80.266  60.187  26.864  1.00 51.45 ? 1282 LYS A N     1 
ATOM   5068  C  CA    . LYS E  3 606  ? 80.442  61.642  26.715  1.00 50.94 ? 1282 LYS A CA    1 
ATOM   5069  C  C     . LYS E  3 606  ? 81.586  62.023  25.766  1.00 50.53 ? 1282 LYS A C     1 
ATOM   5070  O  O     . LYS E  3 606  ? 82.204  63.082  25.918  1.00 50.66 ? 1282 LYS A O     1 
ATOM   5071  C  CB    . LYS E  3 606  ? 80.615  62.335  28.080  1.00 50.83 ? 1282 LYS A CB    1 
ATOM   5072  C  CG    . LYS E  3 606  ? 79.592  61.946  29.140  1.00 51.34 ? 1282 LYS A CG    1 
ATOM   5073  C  CD    . LYS E  3 606  ? 78.249  62.634  28.943  1.00 52.16 ? 1282 LYS A CD    1 
ATOM   5074  C  CE    . LYS E  3 606  ? 77.221  62.091  29.925  1.00 52.62 ? 1282 LYS A CE    1 
ATOM   5075  N  NZ    . LYS E  3 606  ? 75.934  62.832  29.863  1.00 53.18 ? 1282 LYS A NZ    1 
ATOM   5076  N  N     . LEU E  3 607  ? 81.865  61.153  24.798  1.00 49.84 ? 1283 LEU A N     1 
ATOM   5077  C  CA    . LEU E  3 607  ? 82.830  61.452  23.746  1.00 49.31 ? 1283 LEU A CA    1 
ATOM   5078  C  C     . LEU E  3 607  ? 82.120  62.098  22.563  1.00 49.18 ? 1283 LEU A C     1 
ATOM   5079  O  O     . LEU E  3 607  ? 82.704  62.904  21.839  1.00 49.05 ? 1283 LEU A O     1 
ATOM   5080  C  CB    . LEU E  3 607  ? 83.567  60.187  23.298  1.00 49.07 ? 1283 LEU A CB    1 
ATOM   5081  C  CG    . LEU E  3 607  ? 84.374  59.394  24.332  1.00 48.46 ? 1283 LEU A CG    1 
ATOM   5082  C  CD1   . LEU E  3 607  ? 85.087  58.251  23.644  1.00 48.27 ? 1283 LEU A CD1   1 
ATOM   5083  C  CD2   . LEU E  3 607  ? 85.377  60.274  25.065  1.00 48.28 ? 1283 LEU A CD2   1 
ATOM   5084  N  N     . ILE E  3 608  ? 80.857  61.730  22.374  1.00 49.26 ? 1284 ILE A N     1 
ATOM   5085  C  CA    . ILE E  3 608  ? 80.016  62.337  21.356  1.00 49.59 ? 1284 ILE A CA    1 
ATOM   5086  C  C     . ILE E  3 608  ? 78.888  63.095  22.047  1.00 50.12 ? 1284 ILE A C     1 
ATOM   5087  O  O     . ILE E  3 608  ? 78.253  62.586  22.972  1.00 50.09 ? 1284 ILE A O     1 
ATOM   5088  C  CB    . ILE E  3 608  ? 79.457  61.283  20.359  1.00 49.48 ? 1284 ILE A CB    1 
ATOM   5089  C  CG1   . ILE E  3 608  ? 80.606  60.558  19.653  1.00 48.98 ? 1284 ILE A CG1   1 
ATOM   5090  C  CG2   . ILE E  3 608  ? 78.546  61.941  19.320  1.00 49.43 ? 1284 ILE A CG2   1 
ATOM   5091  C  CD1   . ILE E  3 608  ? 80.174  59.373  18.827  1.00 48.49 ? 1284 ILE A CD1   1 
ATOM   5092  N  N     . GLU E  3 609  ? 78.669  64.323  21.594  1.00 51.08 ? 1285 GLU A N     1 
ATOM   5093  C  CA    . GLU E  3 609  ? 77.628  65.187  22.122  1.00 52.34 ? 1285 GLU A CA    1 
ATOM   5094  C  C     . GLU E  3 609  ? 76.294  64.848  21.467  1.00 52.57 ? 1285 GLU A C     1 
ATOM   5095  O  O     . GLU E  3 609  ? 76.243  64.567  20.265  1.00 52.34 ? 1285 GLU A O     1 
ATOM   5096  C  CB    . GLU E  3 609  ? 77.985  66.643  21.824  1.00 52.99 ? 1285 GLU A CB    1 
ATOM   5097  C  CG    . GLU E  3 609  ? 77.639  67.622  22.924  1.00 55.20 ? 1285 GLU A CG    1 
ATOM   5098  C  CD    . GLU E  3 609  ? 78.690  67.659  24.021  1.00 57.27 ? 1285 GLU A CD    1 
ATOM   5099  O  OE1   . GLU E  3 609  ? 78.863  66.641  24.727  1.00 58.33 ? 1285 GLU A OE1   1 
ATOM   5100  O  OE2   . GLU E  3 609  ? 79.340  68.714  24.182  1.00 58.12 ? 1285 GLU A OE2   1 
ATOM   5101  N  N     . LYS E  3 610  ? 75.220  64.871  22.252  1.00 53.04 ? 1286 LYS A N     1 
ATOM   5102  C  CA    . LYS E  3 610  ? 73.876  64.678  21.708  1.00 53.63 ? 1286 LYS A CA    1 
ATOM   5103  C  C     . LYS E  3 610  ? 72.924  65.778  22.185  1.00 53.65 ? 1286 LYS A C     1 
ATOM   5104  O  O     . LYS E  3 610  ? 72.442  65.749  23.321  1.00 53.62 ? 1286 LYS A O     1 
ATOM   5105  C  CB    . LYS E  3 610  ? 73.328  63.287  22.056  1.00 53.94 ? 1286 LYS A CB    1 
ATOM   5106  C  CG    . LYS E  3 610  ? 72.262  62.779  21.079  1.00 54.72 ? 1286 LYS A CG    1 
ATOM   5107  C  CD    . LYS E  3 610  ? 71.244  61.855  21.748  1.00 55.11 ? 1286 LYS A CD    1 
ATOM   5108  C  CE    . LYS E  3 610  ? 70.299  62.644  22.657  1.00 55.26 ? 1286 LYS A CE    1 
ATOM   5109  N  NZ    . LYS E  3 610  ? 69.158  61.838  23.159  1.00 55.32 ? 1286 LYS A NZ    1 
ATOM   5110  N  N     . ALA E  3 611  ? 72.673  66.750  21.310  1.00 53.78 ? 1287 ALA A N     1 
ATOM   5111  C  CA    . ALA E  3 611  ? 71.752  67.849  21.594  1.00 53.84 ? 1287 ALA A CA    1 
ATOM   5112  C  C     . ALA E  3 611  ? 70.399  67.602  20.919  1.00 53.94 ? 1287 ALA A C     1 
ATOM   5113  O  O     . ALA E  3 611  ? 70.136  68.096  19.816  1.00 54.09 ? 1287 ALA A O     1 
ATOM   5114  C  CB    . ALA E  3 611  ? 72.355  69.183  21.150  1.00 53.71 ? 1287 ALA A CB    1 
ATOM   5115  N  N     . GLY E  3 612  ? 69.550  66.828  21.593  1.00 53.89 ? 1288 GLY A N     1 
ATOM   5116  C  CA    . GLY E  3 612  ? 68.257  66.419  21.047  1.00 53.75 ? 1288 GLY A CA    1 
ATOM   5117  C  C     . GLY E  3 612  ? 68.431  65.349  19.988  1.00 53.77 ? 1288 GLY A C     1 
ATOM   5118  O  O     . GLY E  3 612  ? 68.604  64.171  20.307  1.00 53.73 ? 1288 GLY A O     1 
ATOM   5119  N  N     . ALA E  3 613  ? 68.387  65.767  18.726  1.00 53.84 ? 1289 ALA A N     1 
ATOM   5120  C  CA    . ALA E  3 613  ? 68.617  64.871  17.594  1.00 53.90 ? 1289 ALA A CA    1 
ATOM   5121  C  C     . ALA E  3 613  ? 69.980  65.124  16.941  1.00 53.76 ? 1289 ALA A C     1 
ATOM   5122  O  O     . ALA E  3 613  ? 70.423  64.347  16.088  1.00 53.84 ? 1289 ALA A O     1 
ATOM   5123  C  CB    . ALA E  3 613  ? 67.492  65.006  16.568  1.00 53.94 ? 1289 ALA A CB    1 
ATOM   5124  N  N     . TRP E  3 614  ? 70.641  66.206  17.353  1.00 53.30 ? 1290 TRP A N     1 
ATOM   5125  C  CA    . TRP E  3 614  ? 71.931  66.596  16.781  1.00 52.84 ? 1290 TRP A CA    1 
ATOM   5126  C  C     . TRP E  3 614  ? 73.132  65.960  17.481  1.00 52.41 ? 1290 TRP A C     1 
ATOM   5127  O  O     . TRP E  3 614  ? 73.349  66.160  18.676  1.00 52.38 ? 1290 TRP A O     1 
ATOM   5128  C  CB    . TRP E  3 614  ? 72.072  68.121  16.748  1.00 52.74 ? 1290 TRP A CB    1 
ATOM   5129  C  CG    . TRP E  3 614  ? 71.506  68.731  15.508  1.00 52.64 ? 1290 TRP A CG    1 
ATOM   5130  C  CD1   . TRP E  3 614  ? 70.338  69.424  15.397  1.00 52.58 ? 1290 TRP A CD1   1 
ATOM   5131  C  CD2   . TRP E  3 614  ? 72.079  68.691  14.194  1.00 52.67 ? 1290 TRP A CD2   1 
ATOM   5132  N  NE1   . TRP E  3 614  ? 70.150  69.826  14.096  1.00 52.78 ? 1290 TRP A NE1   1 
ATOM   5133  C  CE2   . TRP E  3 614  ? 71.202  69.389  13.336  1.00 52.76 ? 1290 TRP A CE2   1 
ATOM   5134  C  CE3   . TRP E  3 614  ? 73.249  68.135  13.658  1.00 52.56 ? 1290 TRP A CE3   1 
ATOM   5135  C  CZ2   . TRP E  3 614  ? 71.457  69.547  11.968  1.00 52.74 ? 1290 TRP A CZ2   1 
ATOM   5136  C  CZ3   . TRP E  3 614  ? 73.503  68.292  12.297  1.00 52.53 ? 1290 TRP A CZ3   1 
ATOM   5137  C  CH2   . TRP E  3 614  ? 72.609  68.993  11.469  1.00 52.58 ? 1290 TRP A CH2   1 
ATOM   5138  N  N     . TYR E  3 615  ? 73.907  65.198  16.716  1.00 51.91 ? 1291 TYR A N     1 
ATOM   5139  C  CA    . TYR E  3 615  ? 75.123  64.574  17.216  1.00 51.73 ? 1291 TYR A CA    1 
ATOM   5140  C  C     . TYR E  3 615  ? 76.348  65.400  16.844  1.00 51.55 ? 1291 TYR A C     1 
ATOM   5141  O  O     . TYR E  3 615  ? 76.592  65.675  15.666  1.00 51.35 ? 1291 TYR A O     1 
ATOM   5142  C  CB    . TYR E  3 615  ? 75.268  63.161  16.657  1.00 52.20 ? 1291 TYR A CB    1 
ATOM   5143  C  CG    . TYR E  3 615  ? 74.256  62.170  17.184  1.00 52.59 ? 1291 TYR A CG    1 
ATOM   5144  C  CD1   . TYR E  3 615  ? 72.998  62.044  16.592  1.00 53.36 ? 1291 TYR A CD1   1 
ATOM   5145  C  CD2   . TYR E  3 615  ? 74.561  61.341  18.264  1.00 52.52 ? 1291 TYR A CD2   1 
ATOM   5146  C  CE1   . TYR E  3 615  ? 72.065  61.125  17.073  1.00 53.30 ? 1291 TYR A CE1   1 
ATOM   5147  C  CE2   . TYR E  3 615  ? 73.637  60.417  18.749  1.00 52.39 ? 1291 TYR A CE2   1 
ATOM   5148  C  CZ    . TYR E  3 615  ? 72.393  60.316  18.150  1.00 52.69 ? 1291 TYR A CZ    1 
ATOM   5149  O  OH    . TYR E  3 615  ? 71.478  59.408  18.626  1.00 52.31 ? 1291 TYR A OH    1 
ATOM   5150  N  N     . SER E  3 616  ? 77.114  65.796  17.856  1.00 51.44 ? 1292 SER A N     1 
ATOM   5151  C  CA    . SER E  3 616  ? 78.334  66.575  17.647  1.00 51.39 ? 1292 SER A CA    1 
ATOM   5152  C  C     . SER E  3 616  ? 79.557  65.801  18.132  1.00 51.05 ? 1292 SER A C     1 
ATOM   5153  O  O     . SER E  3 616  ? 79.477  65.047  19.104  1.00 51.19 ? 1292 SER A O     1 
ATOM   5154  C  CB    . SER E  3 616  ? 78.253  67.926  18.375  1.00 51.36 ? 1292 SER A CB    1 
ATOM   5155  O  OG    . SER E  3 616  ? 77.037  68.603  18.098  1.00 51.09 ? 1292 SER A OG    1 
ATOM   5156  N  N     . TYR E  3 617  ? 80.683  65.978  17.447  1.00 50.32 ? 1293 TYR A N     1 
ATOM   5157  C  CA    . TYR E  3 617  ? 81.954  65.469  17.939  1.00 49.77 ? 1293 TYR A CA    1 
ATOM   5158  C  C     . TYR E  3 617  ? 82.986  66.583  17.971  1.00 50.19 ? 1293 TYR A C     1 
ATOM   5159  O  O     . TYR E  3 617  ? 83.342  67.143  16.932  1.00 50.11 ? 1293 TYR A O     1 
ATOM   5160  C  CB    . TYR E  3 617  ? 82.459  64.290  17.105  1.00 48.96 ? 1293 TYR A CB    1 
ATOM   5161  C  CG    . TYR E  3 617  ? 83.788  63.740  17.583  1.00 48.56 ? 1293 TYR A CG    1 
ATOM   5162  C  CD1   . TYR E  3 617  ? 83.919  63.180  18.856  1.00 48.55 ? 1293 TYR A CD1   1 
ATOM   5163  C  CD2   . TYR E  3 617  ? 84.916  63.779  16.766  1.00 48.54 ? 1293 TYR A CD2   1 
ATOM   5164  C  CE1   . TYR E  3 617  ? 85.140  62.675  19.303  1.00 48.40 ? 1293 TYR A CE1   1 
ATOM   5165  C  CE2   . TYR E  3 617  ? 86.142  63.275  17.204  1.00 48.52 ? 1293 TYR A CE2   1 
ATOM   5166  C  CZ    . TYR E  3 617  ? 86.246  62.725  18.471  1.00 48.47 ? 1293 TYR A CZ    1 
ATOM   5167  O  OH    . TYR E  3 617  ? 87.454  62.225  18.904  1.00 48.28 ? 1293 TYR A OH    1 
ATOM   5168  N  N     . LYS E  3 618  ? 83.456  66.892  19.178  1.00 50.58 ? 1294 LYS A N     1 
ATOM   5169  C  CA    . LYS E  3 618  ? 84.423  67.961  19.409  1.00 51.23 ? 1294 LYS A CA    1 
ATOM   5170  C  C     . LYS E  3 618  ? 83.996  69.271  18.740  1.00 52.26 ? 1294 LYS A C     1 
ATOM   5171  O  O     . LYS E  3 618  ? 84.755  69.871  17.975  1.00 52.55 ? 1294 LYS A O     1 
ATOM   5172  C  CB    . LYS E  3 618  ? 85.832  67.542  18.963  1.00 50.98 ? 1294 LYS A CB    1 
ATOM   5173  C  CG    . LYS E  3 618  ? 86.349  66.272  19.630  1.00 50.70 ? 1294 LYS A CG    1 
ATOM   5174  C  CD    . LYS E  3 618  ? 87.867  66.149  19.556  1.00 50.43 ? 1294 LYS A CD    1 
ATOM   5175  C  CE    . LYS E  3 618  ? 88.358  65.901  18.138  1.00 50.52 ? 1294 LYS A CE    1 
ATOM   5176  N  NZ    . LYS E  3 618  ? 89.819  65.641  18.107  1.00 51.18 ? 1294 LYS A NZ    1 
ATOM   5177  N  N     . GLY E  3 619  ? 82.767  69.698  19.025  1.00 53.34 ? 1295 GLY A N     1 
ATOM   5178  C  CA    . GLY E  3 619  ? 82.244  70.972  18.522  1.00 54.64 ? 1295 GLY A CA    1 
ATOM   5179  C  C     . GLY E  3 619  ? 81.633  70.886  17.134  1.00 55.71 ? 1295 GLY A C     1 
ATOM   5180  O  O     . GLY E  3 619  ? 80.612  71.522  16.851  1.00 55.70 ? 1295 GLY A O     1 
ATOM   5181  N  N     . GLU E  3 620  ? 82.272  70.101  16.269  1.00 56.66 ? 1296 GLU A N     1 
ATOM   5182  C  CA    . GLU E  3 620  ? 81.808  69.868  14.906  1.00 57.36 ? 1296 GLU A CA    1 
ATOM   5183  C  C     . GLU E  3 620  ? 80.601  68.922  14.915  1.00 56.99 ? 1296 GLU A C     1 
ATOM   5184  O  O     . GLU E  3 620  ? 80.634  67.862  15.546  1.00 56.63 ? 1296 GLU A O     1 
ATOM   5185  C  CB    . GLU E  3 620  ? 82.949  69.279  14.064  1.00 58.07 ? 1296 GLU A CB    1 
ATOM   5186  C  CG    . GLU E  3 620  ? 82.642  69.107  12.576  1.00 59.55 ? 1296 GLU A CG    1 
ATOM   5187  C  CD    . GLU E  3 620  ? 83.431  67.971  11.921  1.00 60.68 ? 1296 GLU A CD    1 
ATOM   5188  O  OE1   . GLU E  3 620  ? 84.134  67.217  12.633  1.00 60.96 ? 1296 GLU A OE1   1 
ATOM   5189  O  OE2   . GLU E  3 620  ? 83.340  67.825  10.684  1.00 61.21 ? 1296 GLU A OE2   1 
ATOM   5190  N  N     . LYS E  3 621  ? 79.539  69.326  14.222  1.00 56.70 ? 1297 LYS A N     1 
ATOM   5191  C  CA    . LYS E  3 621  ? 78.331  68.512  14.099  1.00 56.24 ? 1297 LYS A CA    1 
ATOM   5192  C  C     . LYS E  3 621  ? 78.557  67.429  13.054  1.00 55.73 ? 1297 LYS A C     1 
ATOM   5193  O  O     . LYS E  3 621  ? 79.048  67.709  11.958  1.00 55.58 ? 1297 LYS A O     1 
ATOM   5194  C  CB    . LYS E  3 621  ? 77.118  69.376  13.736  1.00 56.58 ? 1297 LYS A CB    1 
ATOM   5195  C  CG    . LYS E  3 621  ? 76.854  70.504  14.725  1.00 57.71 ? 1297 LYS A CG    1 
ATOM   5196  C  CD    . LYS E  3 621  ? 75.386  70.883  14.791  1.00 58.42 ? 1297 LYS A CD    1 
ATOM   5197  C  CE    . LYS E  3 621  ? 75.078  71.565  16.117  1.00 59.07 ? 1297 LYS A CE    1 
ATOM   5198  N  NZ    . LYS E  3 621  ? 73.619  71.763  16.331  1.00 59.19 ? 1297 LYS A NZ    1 
ATOM   5199  N  N     . ILE E  3 622  ? 78.206  66.193  13.401  1.00 55.17 ? 1298 ILE A N     1 
ATOM   5200  C  CA    . ILE E  3 622  ? 78.489  65.043  12.535  1.00 54.61 ? 1298 ILE A CA    1 
ATOM   5201  C  C     . ILE E  3 622  ? 77.247  64.404  11.910  1.00 54.20 ? 1298 ILE A C     1 
ATOM   5202  O  O     . ILE E  3 622  ? 77.358  63.605  10.978  1.00 54.12 ? 1298 ILE A O     1 
ATOM   5203  C  CB    . ILE E  3 622  ? 79.339  63.962  13.255  1.00 54.61 ? 1298 ILE A CB    1 
ATOM   5204  C  CG1   . ILE E  3 622  ? 78.555  63.324  14.408  1.00 54.86 ? 1298 ILE A CG1   1 
ATOM   5205  C  CG2   . ILE E  3 622  ? 80.665  64.553  13.737  1.00 54.53 ? 1298 ILE A CG2   1 
ATOM   5206  C  CD1   . ILE E  3 622  ? 79.100  61.979  14.857  1.00 54.75 ? 1298 ILE A CD1   1 
ATOM   5207  N  N     . GLY E  3 623  ? 76.069  64.746  12.422  1.00 53.70 ? 1299 GLY A N     1 
ATOM   5208  C  CA    . GLY E  3 623  ? 74.830  64.235  11.846  1.00 53.01 ? 1299 GLY A CA    1 
ATOM   5209  C  C     . GLY E  3 623  ? 73.596  64.447  12.696  1.00 52.68 ? 1299 GLY A C     1 
ATOM   5210  O  O     . GLY E  3 623  ? 73.685  64.654  13.909  1.00 52.68 ? 1299 GLY A O     1 
ATOM   5211  N  N     . GLN E  3 624  ? 72.440  64.395  12.044  1.00 52.25 ? 1300 GLN A N     1 
ATOM   5212  C  CA    . GLN E  3 624  ? 71.163  64.495  12.729  1.00 52.22 ? 1300 GLN A CA    1 
ATOM   5213  C  C     . GLN E  3 624  ? 70.473  63.135  12.732  1.00 52.51 ? 1300 GLN A C     1 
ATOM   5214  O  O     . GLN E  3 624  ? 70.222  62.553  11.675  1.00 52.69 ? 1300 GLN A O     1 
ATOM   5215  C  CB    . GLN E  3 624  ? 70.283  65.547  12.062  1.00 52.15 ? 1300 GLN A CB    1 
ATOM   5216  C  CG    . GLN E  3 624  ? 69.058  65.922  12.875  1.00 52.11 ? 1300 GLN A CG    1 
ATOM   5217  C  CD    . GLN E  3 624  ? 68.270  67.066  12.270  1.00 52.00 ? 1300 GLN A CD    1 
ATOM   5218  O  OE1   . GLN E  3 624  ? 67.404  67.641  12.925  1.00 52.10 ? 1300 GLN A OE1   1 
ATOM   5219  N  NE2   . GLN E  3 624  ? 68.565  67.403  11.017  1.00 51.84 ? 1300 GLN A NE2   1 
ATOM   5220  N  N     . GLY E  3 625  ? 70.174  62.631  13.927  1.00 52.58 ? 1301 GLY A N     1 
ATOM   5221  C  CA    . GLY E  3 625  ? 69.619  61.290  14.087  1.00 52.56 ? 1301 GLY A CA    1 
ATOM   5222  C  C     . GLY E  3 625  ? 70.710  60.237  14.009  1.00 52.67 ? 1301 GLY A C     1 
ATOM   5223  O  O     . GLY E  3 625  ? 71.656  60.369  13.225  1.00 52.73 ? 1301 GLY A O     1 
ATOM   5224  N  N     . LYS E  3 626  ? 70.571  59.189  14.822  1.00 52.53 ? 1302 LYS A N     1 
ATOM   5225  C  CA    . LYS E  3 626  ? 71.564  58.109  14.913  1.00 52.41 ? 1302 LYS A CA    1 
ATOM   5226  C  C     . LYS E  3 626  ? 71.971  57.566  13.536  1.00 52.05 ? 1302 LYS A C     1 
ATOM   5227  O  O     . LYS E  3 626  ? 73.140  57.239  13.314  1.00 52.34 ? 1302 LYS A O     1 
ATOM   5228  C  CB    . LYS E  3 626  ? 71.039  56.990  15.820  1.00 52.21 ? 1302 LYS A CB    1 
ATOM   5229  C  CG    . LYS E  3 626  ? 72.031  55.882  16.166  1.00 52.26 ? 1302 LYS A CG    1 
ATOM   5230  C  CD    . LYS E  3 626  ? 71.435  54.974  17.240  1.00 53.18 ? 1302 LYS A CD    1 
ATOM   5231  C  CE    . LYS E  3 626  ? 71.630  53.489  16.939  1.00 54.62 ? 1302 LYS A CE    1 
ATOM   5232  N  NZ    . LYS E  3 626  ? 73.036  53.042  17.120  1.00 57.09 ? 1302 LYS A NZ    1 
ATOM   5233  N  N     . ALA E  3 627  ? 71.005  57.501  12.620  1.00 51.35 ? 1303 ALA A N     1 
ATOM   5234  C  CA    . ALA E  3 627  ? 71.237  57.052  11.245  1.00 50.78 ? 1303 ALA A CA    1 
ATOM   5235  C  C     . ALA E  3 627  ? 72.372  57.808  10.547  1.00 50.17 ? 1303 ALA A C     1 
ATOM   5236  O  O     . ALA E  3 627  ? 73.283  57.192  9.986   1.00 49.79 ? 1303 ALA A O     1 
ATOM   5237  C  CB    . ALA E  3 627  ? 69.948  57.152  10.435  1.00 51.02 ? 1303 ALA A CB    1 
ATOM   5238  N  N     . ASN E  3 628  ? 72.312  59.138  10.595  1.00 49.76 ? 1304 ASN A N     1 
ATOM   5239  C  CA    . ASN E  3 628  ? 73.315  59.987  9.951   1.00 49.31 ? 1304 ASN A CA    1 
ATOM   5240  C  C     . ASN E  3 628  ? 74.666  59.992  10.652  1.00 49.15 ? 1304 ASN A C     1 
ATOM   5241  O  O     . ASN E  3 628  ? 75.710  60.008  9.995   1.00 49.06 ? 1304 ASN A O     1 
ATOM   5242  C  CB    . ASN E  3 628  ? 72.799  61.416  9.803   1.00 49.17 ? 1304 ASN A CB    1 
ATOM   5243  C  CG    . ASN E  3 628  ? 71.838  61.568  8.647   1.00 48.55 ? 1304 ASN A CG    1 
ATOM   5244  O  OD1   . ASN E  3 628  ? 70.733  62.074  8.812   1.00 48.73 ? 1304 ASN A OD1   1 
ATOM   5245  N  ND2   . ASN E  3 628  ? 72.253  61.125  7.468   1.00 47.70 ? 1304 ASN A ND2   1 
ATOM   5246  N  N     . ALA E  3 629  ? 74.638  59.988  11.983  1.00 48.96 ? 1305 ALA A N     1 
ATOM   5247  C  CA    . ALA E  3 629  ? 75.856  59.938  12.782  1.00 49.31 ? 1305 ALA A CA    1 
ATOM   5248  C  C     . ALA E  3 629  ? 76.651  58.673  12.475  1.00 49.41 ? 1305 ALA A C     1 
ATOM   5249  O  O     . ALA E  3 629  ? 77.879  58.705  12.381  1.00 50.05 ? 1305 ALA A O     1 
ATOM   5250  C  CB    . ALA E  3 629  ? 75.524  60.022  14.260  1.00 49.04 ? 1305 ALA A CB    1 
ATOM   5251  N  N     . THR E  3 630  ? 75.936  57.567  12.306  1.00 49.59 ? 1306 THR A N     1 
ATOM   5252  C  CA    . THR E  3 630  ? 76.533  56.294  11.914  1.00 50.07 ? 1306 THR A CA    1 
ATOM   5253  C  C     . THR E  3 630  ? 77.214  56.410  10.546  1.00 49.95 ? 1306 THR A C     1 
ATOM   5254  O  O     . THR E  3 630  ? 78.350  55.959  10.365  1.00 49.70 ? 1306 THR A O     1 
ATOM   5255  C  CB    . THR E  3 630  ? 75.467  55.166  11.891  1.00 50.33 ? 1306 THR A CB    1 
ATOM   5256  O  OG1   . THR E  3 630  ? 74.813  55.093  13.167  1.00 50.85 ? 1306 THR A OG1   1 
ATOM   5257  C  CG2   . THR E  3 630  ? 76.098  53.815  11.577  1.00 50.54 ? 1306 THR A CG2   1 
ATOM   5258  N  N     . ALA E  3 631  ? 76.516  57.032  9.598   1.00 50.03 ? 1307 ALA A N     1 
ATOM   5259  C  CA    . ALA E  3 631  ? 77.029  57.216  8.241   1.00 50.25 ? 1307 ALA A CA    1 
ATOM   5260  C  C     . ALA E  3 631  ? 78.286  58.086  8.216   1.00 50.43 ? 1307 ALA A C     1 
ATOM   5261  O  O     . ALA E  3 631  ? 79.183  57.865  7.398   1.00 50.56 ? 1307 ALA A O     1 
ATOM   5262  C  CB    . ALA E  3 631  ? 75.950  57.801  7.338   1.00 50.23 ? 1307 ALA A CB    1 
ATOM   5263  N  N     . TRP E  3 632  ? 78.342  59.067  9.116   1.00 50.31 ? 1308 TRP A N     1 
ATOM   5264  C  CA    . TRP E  3 632  ? 79.497  59.946  9.233   1.00 50.31 ? 1308 TRP A CA    1 
ATOM   5265  C  C     . TRP E  3 632  ? 80.747  59.192  9.683   1.00 50.41 ? 1308 TRP A C     1 
ATOM   5266  O  O     . TRP E  3 632  ? 81.843  59.466  9.198   1.00 50.80 ? 1308 TRP A O     1 
ATOM   5267  C  CB    . TRP E  3 632  ? 79.208  61.098  10.195  1.00 50.37 ? 1308 TRP A CB    1 
ATOM   5268  C  CG    . TRP E  3 632  ? 80.273  62.158  10.166  1.00 50.65 ? 1308 TRP A CG    1 
ATOM   5269  C  CD1   . TRP E  3 632  ? 80.356  63.208  9.298   1.00 50.40 ? 1308 TRP A CD1   1 
ATOM   5270  C  CD2   . TRP E  3 632  ? 81.416  62.258  11.028  1.00 50.46 ? 1308 TRP A CD2   1 
ATOM   5271  N  NE1   . TRP E  3 632  ? 81.473  63.959  9.569   1.00 50.33 ? 1308 TRP A NE1   1 
ATOM   5272  C  CE2   . TRP E  3 632  ? 82.141  63.400  10.626  1.00 50.34 ? 1308 TRP A CE2   1 
ATOM   5273  C  CE3   . TRP E  3 632  ? 81.894  61.497  12.105  1.00 50.62 ? 1308 TRP A CE3   1 
ATOM   5274  C  CZ2   . TRP E  3 632  ? 83.319  63.802  11.264  1.00 50.88 ? 1308 TRP A CZ2   1 
ATOM   5275  C  CZ3   . TRP E  3 632  ? 83.068  61.898  12.739  1.00 50.31 ? 1308 TRP A CZ3   1 
ATOM   5276  C  CH2   . TRP E  3 632  ? 83.765  63.039  12.316  1.00 50.74 ? 1308 TRP A CH2   1 
ATOM   5277  N  N     . LEU E  3 633  ? 80.582  58.252  10.609  1.00 50.38 ? 1309 LEU A N     1 
ATOM   5278  C  CA    . LEU E  3 633  ? 81.708  57.463  11.097  1.00 50.60 ? 1309 LEU A CA    1 
ATOM   5279  C  C     . LEU E  3 633  ? 82.235  56.480  10.059  1.00 51.27 ? 1309 LEU A C     1 
ATOM   5280  O  O     . LEU E  3 633  ? 83.437  56.215  10.016  1.00 51.08 ? 1309 LEU A O     1 
ATOM   5281  C  CB    . LEU E  3 633  ? 81.353  56.746  12.395  1.00 50.35 ? 1309 LEU A CB    1 
ATOM   5282  C  CG    . LEU E  3 633  ? 81.288  57.647  13.629  1.00 50.31 ? 1309 LEU A CG    1 
ATOM   5283  C  CD1   . LEU E  3 633  ? 80.665  56.896  14.792  1.00 50.04 ? 1309 LEU A CD1   1 
ATOM   5284  C  CD2   . LEU E  3 633  ? 82.670  58.180  14.005  1.00 50.53 ? 1309 LEU A CD2   1 
ATOM   5285  N  N     . LYS E  3 634  ? 81.339  55.942  9.229   1.00 52.26 ? 1310 LYS A N     1 
ATOM   5286  C  CA    . LYS E  3 634  ? 81.752  55.174  8.052   1.00 53.27 ? 1310 LYS A CA    1 
ATOM   5287  C  C     . LYS E  3 634  ? 82.644  56.043  7.174   1.00 53.48 ? 1310 LYS A C     1 
ATOM   5288  O  O     . LYS E  3 634  ? 83.678  55.585  6.686   1.00 53.73 ? 1310 LYS A O     1 
ATOM   5289  C  CB    . LYS E  3 634  ? 80.544  54.723  7.231   1.00 53.39 ? 1310 LYS A CB    1 
ATOM   5290  C  CG    . LYS E  3 634  ? 79.822  53.492  7.743   1.00 54.04 ? 1310 LYS A CG    1 
ATOM   5291  C  CD    . LYS E  3 634  ? 78.636  53.165  6.837   1.00 54.19 ? 1310 LYS A CD    1 
ATOM   5292  C  CE    . LYS E  3 634  ? 77.703  52.130  7.454   1.00 55.03 ? 1310 LYS A CE    1 
ATOM   5293  N  NZ    . LYS E  3 634  ? 78.236  50.746  7.339   1.00 54.83 ? 1310 LYS A NZ    1 
ATOM   5294  N  N     . ASP E  3 635  ? 82.235  57.299  6.993   1.00 53.73 ? 1311 ASP A N     1 
ATOM   5295  C  CA    . ASP E  3 635  ? 82.939  58.261  6.135   1.00 53.75 ? 1311 ASP A CA    1 
ATOM   5296  C  C     . ASP E  3 635  ? 84.290  58.716  6.679   1.00 53.20 ? 1311 ASP A C     1 
ATOM   5297  O  O     . ASP E  3 635  ? 85.198  59.012  5.908   1.00 52.78 ? 1311 ASP A O     1 
ATOM   5298  C  CB    . ASP E  3 635  ? 82.057  59.484  5.858   1.00 54.20 ? 1311 ASP A CB    1 
ATOM   5299  C  CG    . ASP E  3 635  ? 81.144  59.289  4.660   1.00 55.08 ? 1311 ASP A CG    1 
ATOM   5300  O  OD1   . ASP E  3 635  ? 80.494  58.224  4.559   1.00 56.64 ? 1311 ASP A OD1   1 
ATOM   5301  O  OD2   . ASP E  3 635  ? 81.072  60.208  3.818   1.00 54.88 ? 1311 ASP A OD2   1 
ATOM   5302  N  N     . ASN E  3 636  ? 84.412  58.784  8.002   1.00 52.97 ? 1312 ASN A N     1 
ATOM   5303  C  CA    . ASN E  3 636  ? 85.657  59.186  8.648   1.00 52.56 ? 1312 ASN A CA    1 
ATOM   5304  C  C     . ASN E  3 636  ? 86.238  58.047  9.477   1.00 52.90 ? 1312 ASN A C     1 
ATOM   5305  O  O     . ASN E  3 636  ? 86.137  58.067  10.703  1.00 52.98 ? 1312 ASN A O     1 
ATOM   5306  C  CB    . ASN E  3 636  ? 85.425  60.405  9.538   1.00 52.19 ? 1312 ASN A CB    1 
ATOM   5307  C  CG    . ASN E  3 636  ? 84.768  61.548  8.801   1.00 51.71 ? 1312 ASN A CG    1 
ATOM   5308  O  OD1   . ASN E  3 636  ? 83.652  61.428  8.301   1.00 50.47 ? 1312 ASN A OD1   1 
ATOM   5309  N  ND2   . ASN E  3 636  ? 85.459  62.677  8.739   1.00 52.53 ? 1312 ASN A ND2   1 
ATOM   5310  N  N     . PRO E  3 637  ? 86.860  57.054  8.813   1.00 53.32 ? 1313 PRO A N     1 
ATOM   5311  C  CA    . PRO E  3 637  ? 87.320  55.858  9.517   1.00 53.72 ? 1313 PRO A CA    1 
ATOM   5312  C  C     . PRO E  3 637  ? 88.453  56.159  10.492  1.00 54.18 ? 1313 PRO A C     1 
ATOM   5313  O  O     . PRO E  3 637  ? 88.635  55.433  11.467  1.00 54.10 ? 1313 PRO A O     1 
ATOM   5314  C  CB    . PRO E  3 637  ? 87.824  54.951  8.385   1.00 53.60 ? 1313 PRO A CB    1 
ATOM   5315  C  CG    . PRO E  3 637  ? 87.256  55.523  7.131   1.00 53.31 ? 1313 PRO A CG    1 
ATOM   5316  C  CD    . PRO E  3 637  ? 87.191  56.987  7.380   1.00 53.36 ? 1313 PRO A CD    1 
ATOM   5317  N  N     . GLU E  3 638  ? 89.192  57.231  10.226  1.00 54.81 ? 1314 GLU A N     1 
ATOM   5318  C  CA    . GLU E  3 638  ? 90.322  57.636  11.055  1.00 55.69 ? 1314 GLU A CA    1 
ATOM   5319  C  C     . GLU E  3 638  ? 89.823  58.150  12.391  1.00 55.16 ? 1314 GLU A C     1 
ATOM   5320  O  O     . GLU E  3 638  ? 90.397  57.844  13.434  1.00 55.16 ? 1314 GLU A O     1 
ATOM   5321  C  CB    . GLU E  3 638  ? 91.130  58.738  10.365  1.00 56.95 ? 1314 GLU A CB    1 
ATOM   5322  C  CG    . GLU E  3 638  ? 90.822  58.939  8.879   1.00 60.27 ? 1314 GLU A CG    1 
ATOM   5323  C  CD    . GLU E  3 638  ? 91.153  57.724  8.019   1.00 62.82 ? 1314 GLU A CD    1 
ATOM   5324  O  OE1   . GLU E  3 638  ? 92.075  56.958  8.379   1.00 64.26 ? 1314 GLU A OE1   1 
ATOM   5325  O  OE2   . GLU E  3 638  ? 90.486  57.540  6.978   1.00 63.93 ? 1314 GLU A OE2   1 
ATOM   5326  N  N     . THR E  3 639  ? 88.751  58.939  12.338  1.00 54.77 ? 1315 THR A N     1 
ATOM   5327  C  CA    . THR E  3 639  ? 88.107  59.485  13.528  1.00 54.57 ? 1315 THR A CA    1 
ATOM   5328  C  C     . THR E  3 639  ? 87.400  58.376  14.300  1.00 54.95 ? 1315 THR A C     1 
ATOM   5329  O  O     . THR E  3 639  ? 87.389  58.381  15.532  1.00 55.00 ? 1315 THR A O     1 
ATOM   5330  C  CB    . THR E  3 639  ? 87.083  60.572  13.158  1.00 54.32 ? 1315 THR A CB    1 
ATOM   5331  O  OG1   . THR E  3 639  ? 87.630  61.420  12.141  1.00 53.88 ? 1315 THR A OG1   1 
ATOM   5332  C  CG2   . THR E  3 639  ? 86.727  61.411  14.369  1.00 53.66 ? 1315 THR A CG2   1 
ATOM   5333  N  N     . ALA E  3 640  ? 86.814  57.434  13.564  1.00 55.15 ? 1316 ALA A N     1 
ATOM   5334  C  CA    . ALA E  3 640  ? 86.162  56.274  14.158  1.00 55.25 ? 1316 ALA A CA    1 
ATOM   5335  C  C     . ALA E  3 640  ? 87.151  55.457  14.992  1.00 55.55 ? 1316 ALA A C     1 
ATOM   5336  O  O     . ALA E  3 640  ? 86.848  55.106  16.133  1.00 55.72 ? 1316 ALA A O     1 
ATOM   5337  C  CB    . ALA E  3 640  ? 85.515  55.412  13.081  1.00 55.25 ? 1316 ALA A CB    1 
ATOM   5338  N  N     . LYS E  3 641  ? 88.331  55.177  14.427  1.00 55.64 ? 1317 LYS A N     1 
ATOM   5339  C  CA    . LYS E  3 641  ? 89.389  54.448  15.137  1.00 55.66 ? 1317 LYS A CA    1 
ATOM   5340  C  C     . LYS E  3 641  ? 89.744  55.150  16.442  1.00 55.30 ? 1317 LYS A C     1 
ATOM   5341  O  O     . LYS E  3 641  ? 89.926  54.500  17.471  1.00 55.13 ? 1317 LYS A O     1 
ATOM   5342  C  CB    . LYS E  3 641  ? 90.654  54.299  14.273  1.00 56.22 ? 1317 LYS A CB    1 
ATOM   5343  C  CG    . LYS E  3 641  ? 90.537  53.425  13.008  1.00 58.08 ? 1317 LYS A CG    1 
ATOM   5344  C  CD    . LYS E  3 641  ? 90.223  51.948  13.292  1.00 60.17 ? 1317 LYS A CD    1 
ATOM   5345  C  CE    . LYS E  3 641  ? 88.732  51.637  13.097  1.00 61.06 ? 1317 LYS A CE    1 
ATOM   5346  N  NZ    . LYS E  3 641  ? 88.363  50.254  13.515  1.00 61.24 ? 1317 LYS A NZ    1 
ATOM   5347  N  N     . GLU E  3 642  ? 89.827  56.479  16.380  1.00 55.12 ? 1318 GLU A N     1 
ATOM   5348  C  CA    . GLU E  3 642  ? 90.167  57.317  17.525  1.00 54.93 ? 1318 GLU A CA    1 
ATOM   5349  C  C     . GLU E  3 642  ? 89.127  57.196  18.636  1.00 54.38 ? 1318 GLU A C     1 
ATOM   5350  O  O     . GLU E  3 642  ? 89.485  56.981  19.795  1.00 54.70 ? 1318 GLU A O     1 
ATOM   5351  C  CB    . GLU E  3 642  ? 90.306  58.775  17.084  1.00 54.97 ? 1318 GLU A CB    1 
ATOM   5352  C  CG    . GLU E  3 642  ? 90.819  59.725  18.160  1.00 55.94 ? 1318 GLU A CG    1 
ATOM   5353  C  CD    . GLU E  3 642  ? 90.756  61.187  17.734  1.00 56.02 ? 1318 GLU A CD    1 
ATOM   5354  O  OE1   . GLU E  3 642  ? 91.345  61.542  16.686  1.00 56.47 ? 1318 GLU A OE1   1 
ATOM   5355  O  OE2   . GLU E  3 642  ? 90.120  61.986  18.455  1.00 56.89 ? 1318 GLU A OE2   1 
ATOM   5356  N  N     . ILE E  3 643  ? 87.848  57.327  18.280  1.00 53.49 ? 1319 ILE A N     1 
ATOM   5357  C  CA    . ILE E  3 643  ? 86.761  57.203  19.254  1.00 52.21 ? 1319 ILE A CA    1 
ATOM   5358  C  C     . ILE E  3 643  ? 86.715  55.786  19.819  1.00 52.00 ? 1319 ILE A C     1 
ATOM   5359  O  O     . ILE E  3 643  ? 86.588  55.606  21.027  1.00 51.98 ? 1319 ILE A O     1 
ATOM   5360  C  CB    . ILE E  3 643  ? 85.384  57.603  18.665  1.00 51.90 ? 1319 ILE A CB    1 
ATOM   5361  C  CG1   . ILE E  3 643  ? 85.425  59.033  18.123  1.00 51.43 ? 1319 ILE A CG1   1 
ATOM   5362  C  CG2   . ILE E  3 643  ? 84.289  57.485  19.723  1.00 51.48 ? 1319 ILE A CG2   1 
ATOM   5363  C  CD1   . ILE E  3 643  ? 84.186  59.443  17.351  1.00 51.62 ? 1319 ILE A CD1   1 
ATOM   5364  N  N     . GLU E  3 644  ? 86.842  54.791  18.944  1.00 52.00 ? 1320 GLU A N     1 
ATOM   5365  C  CA    . GLU E  3 644  ? 86.839  53.392  19.365  1.00 52.23 ? 1320 GLU A CA    1 
ATOM   5366  C  C     . GLU E  3 644  ? 87.932  53.108  20.397  1.00 52.30 ? 1320 GLU A C     1 
ATOM   5367  O  O     . GLU E  3 644  ? 87.663  52.505  21.440  1.00 52.61 ? 1320 GLU A O     1 
ATOM   5368  C  CB    . GLU E  3 644  ? 86.991  52.460  18.165  1.00 52.39 ? 1320 GLU A CB    1 
ATOM   5369  C  CG    . GLU E  3 644  ? 86.716  51.001  18.491  1.00 53.46 ? 1320 GLU A CG    1 
ATOM   5370  C  CD    . GLU E  3 644  ? 87.347  50.031  17.504  1.00 55.10 ? 1320 GLU A CD    1 
ATOM   5371  O  OE1   . GLU E  3 644  ? 87.590  50.415  16.332  1.00 56.57 ? 1320 GLU A OE1   1 
ATOM   5372  O  OE2   . GLU E  3 644  ? 87.597  48.873  17.906  1.00 54.81 ? 1320 GLU A OE2   1 
ATOM   5373  N  N     . LYS E  3 645  ? 89.154  53.557  20.104  1.00 51.77 ? 1321 LYS A N     1 
ATOM   5374  C  CA    . LYS E  3 645  ? 90.292  53.362  20.999  1.00 51.34 ? 1321 LYS A CA    1 
ATOM   5375  C  C     . LYS E  3 645  ? 90.007  53.906  22.398  1.00 51.07 ? 1321 LYS A C     1 
ATOM   5376  O  O     . LYS E  3 645  ? 90.335  53.263  23.398  1.00 50.64 ? 1321 LYS A O     1 
ATOM   5377  C  CB    . LYS E  3 645  ? 91.557  54.012  20.425  1.00 51.75 ? 1321 LYS A CB    1 
ATOM   5378  C  CG    . LYS E  3 645  ? 92.831  53.695  21.213  1.00 51.52 ? 1321 LYS A CG    1 
ATOM   5379  C  CD    . LYS E  3 645  ? 94.038  54.445  20.682  1.00 51.24 ? 1321 LYS A CD    1 
ATOM   5380  C  CE    . LYS E  3 645  ? 94.611  53.785  19.436  1.00 51.23 ? 1321 LYS A CE    1 
ATOM   5381  N  NZ    . LYS E  3 645  ? 95.664  54.628  18.818  1.00 51.87 ? 1321 LYS A NZ    1 
ATOM   5382  N  N     . LYS E  3 646  ? 89.393  55.088  22.455  1.00 51.14 ? 1322 LYS A N     1 
ATOM   5383  C  CA    . LYS E  3 646  ? 89.051  55.730  23.723  1.00 51.03 ? 1322 LYS A CA    1 
ATOM   5384  C  C     . LYS E  3 646  ? 87.944  54.989  24.457  1.00 50.52 ? 1322 LYS A C     1 
ATOM   5385  O  O     . LYS E  3 646  ? 88.007  54.829  25.675  1.00 50.75 ? 1322 LYS A O     1 
ATOM   5386  C  CB    . LYS E  3 646  ? 88.670  57.199  23.513  1.00 51.16 ? 1322 LYS A CB    1 
ATOM   5387  C  CG    . LYS E  3 646  ? 89.841  58.147  23.652  1.00 51.53 ? 1322 LYS A CG    1 
ATOM   5388  C  CD    . LYS E  3 646  ? 89.628  59.416  22.849  1.00 52.38 ? 1322 LYS A CD    1 
ATOM   5389  C  CE    . LYS E  3 646  ? 90.877  60.277  22.860  1.00 52.46 ? 1322 LYS A CE    1 
ATOM   5390  N  NZ    . LYS E  3 646  ? 90.778  61.392  21.889  1.00 52.94 ? 1322 LYS A NZ    1 
ATOM   5391  N  N     . VAL E  3 647  ? 86.939  54.531  23.714  1.00 49.69 ? 1323 VAL A N     1 
ATOM   5392  C  CA    . VAL E  3 647  ? 85.852  53.757  24.297  1.00 48.82 ? 1323 VAL A CA    1 
ATOM   5393  C  C     . VAL E  3 647  ? 86.417  52.489  24.940  1.00 48.86 ? 1323 VAL A C     1 
ATOM   5394  O  O     . VAL E  3 647  ? 86.074  52.158  26.079  1.00 48.72 ? 1323 VAL A O     1 
ATOM   5395  C  CB    . VAL E  3 647  ? 84.751  53.431  23.255  1.00 48.43 ? 1323 VAL A CB    1 
ATOM   5396  C  CG1   . VAL E  3 647  ? 83.768  52.408  23.803  1.00 48.95 ? 1323 VAL A CG1   1 
ATOM   5397  C  CG2   . VAL E  3 647  ? 84.005  54.694  22.855  1.00 47.53 ? 1323 VAL A CG2   1 
ATOM   5398  N  N     . ARG E  3 648  ? 87.303  51.806  24.218  1.00 49.03 ? 1324 ARG A N     1 
ATOM   5399  C  CA    . ARG E  3 648  ? 87.952  50.596  24.724  1.00 49.33 ? 1324 ARG A CA    1 
ATOM   5400  C  C     . ARG E  3 648  ? 88.786  50.865  25.979  1.00 49.74 ? 1324 ARG A C     1 
ATOM   5401  O  O     . ARG E  3 648  ? 88.673  50.131  26.965  1.00 49.95 ? 1324 ARG A O     1 
ATOM   5402  C  CB    . ARG E  3 648  ? 88.809  49.948  23.640  1.00 49.29 ? 1324 ARG A CB    1 
ATOM   5403  C  CG    . ARG E  3 648  ? 87.998  49.264  22.574  1.00 49.47 ? 1324 ARG A CG    1 
ATOM   5404  C  CD    . ARG E  3 648  ? 88.862  48.791  21.422  1.00 50.25 ? 1324 ARG A CD    1 
ATOM   5405  N  NE    . ARG E  3 648  ? 88.094  47.916  20.541  1.00 51.46 ? 1324 ARG A NE    1 
ATOM   5406  C  CZ    . ARG E  3 648  ? 87.994  46.595  20.688  1.00 51.80 ? 1324 ARG A CZ    1 
ATOM   5407  N  NH1   . ARG E  3 648  ? 88.631  45.975  21.677  1.00 51.86 ? 1324 ARG A NH1   1 
ATOM   5408  N  NH2   . ARG E  3 648  ? 87.256  45.889  19.839  1.00 51.58 ? 1324 ARG A NH2   1 
ATOM   5409  N  N     . GLU E  3 649  ? 89.607  51.918  25.941  1.00 49.41 ? 1325 GLU A N     1 
ATOM   5410  C  CA    . GLU E  3 649  ? 90.389  52.333  27.105  1.00 49.07 ? 1325 GLU A CA    1 
ATOM   5411  C  C     . GLU E  3 649  ? 89.494  52.580  28.317  1.00 48.09 ? 1325 GLU A C     1 
ATOM   5412  O  O     . GLU E  3 649  ? 89.800  52.131  29.419  1.00 48.18 ? 1325 GLU A O     1 
ATOM   5413  C  CB    . GLU E  3 649  ? 91.213  53.579  26.790  1.00 49.21 ? 1325 GLU A CB    1 
ATOM   5414  C  CG    . GLU E  3 649  ? 92.488  53.283  26.016  1.00 50.67 ? 1325 GLU A CG    1 
ATOM   5415  C  CD    . GLU E  3 649  ? 93.140  54.530  25.418  1.00 50.87 ? 1325 GLU A CD    1 
ATOM   5416  O  OE1   . GLU E  3 649  ? 92.906  55.650  25.928  1.00 51.93 ? 1325 GLU A OE1   1 
ATOM   5417  O  OE2   . GLU E  3 649  ? 93.896  54.382  24.432  1.00 51.81 ? 1325 GLU A OE2   1 
ATOM   5418  N  N     . LEU E  3 650  ? 88.376  53.267  28.093  1.00 47.11 ? 1326 LEU A N     1 
ATOM   5419  C  CA    . LEU E  3 650  ? 87.414  53.570  29.150  1.00 46.03 ? 1326 LEU A CA    1 
ATOM   5420  C  C     . LEU E  3 650  ? 86.669  52.359  29.693  1.00 45.21 ? 1326 LEU A C     1 
ATOM   5421  O  O     . LEU E  3 650  ? 86.374  52.306  30.884  1.00 45.18 ? 1326 LEU A O     1 
ATOM   5422  C  CB    . LEU E  3 650  ? 86.391  54.605  28.666  1.00 46.01 ? 1326 LEU A CB    1 
ATOM   5423  C  CG    . LEU E  3 650  ? 86.808  56.080  28.618  1.00 46.34 ? 1326 LEU A CG    1 
ATOM   5424  C  CD1   . LEU E  3 650  ? 85.790  56.878  27.821  1.00 46.40 ? 1326 LEU A CD1   1 
ATOM   5425  C  CD2   . LEU E  3 650  ? 86.963  56.660  30.015  1.00 45.67 ? 1326 LEU A CD2   1 
ATOM   5426  N  N     . LEU E  3 651  ? 86.367  51.389  28.833  1.00 44.70 ? 1327 LEU A N     1 
ATOM   5427  C  CA    . LEU E  3 651  ? 85.402  50.348  29.197  1.00 44.41 ? 1327 LEU A CA    1 
ATOM   5428  C  C     . LEU E  3 651  ? 85.897  48.895  29.247  1.00 44.87 ? 1327 LEU A C     1 
ATOM   5429  O  O     . LEU E  3 651  ? 85.204  48.029  29.794  1.00 45.36 ? 1327 LEU A O     1 
ATOM   5430  C  CB    . LEU E  3 651  ? 84.140  50.464  28.328  1.00 43.81 ? 1327 LEU A CB    1 
ATOM   5431  C  CG    . LEU E  3 651  ? 83.263  51.706  28.533  1.00 42.48 ? 1327 LEU A CG    1 
ATOM   5432  C  CD1   . LEU E  3 651  ? 82.110  51.709  27.549  1.00 42.06 ? 1327 LEU A CD1   1 
ATOM   5433  C  CD2   . LEU E  3 651  ? 82.744  51.803  29.964  1.00 41.82 ? 1327 LEU A CD2   1 
ATOM   5434  N  N     . LEU E  3 652  ? 87.072  48.617  28.684  1.00 44.83 ? 1328 LEU A N     1 
ATOM   5435  C  CA    . LEU E  3 652  ? 87.651  47.275  28.788  1.00 45.07 ? 1328 LEU A CA    1 
ATOM   5436  C  C     . LEU E  3 652  ? 88.256  47.041  30.170  1.00 45.96 ? 1328 LEU A C     1 
ATOM   5437  O  O     . LEU E  3 652  ? 89.138  47.792  30.614  1.00 46.39 ? 1328 LEU A O     1 
ATOM   5438  C  CB    . LEU E  3 652  ? 88.697  47.022  27.700  1.00 44.79 ? 1328 LEU A CB    1 
ATOM   5439  C  CG    . LEU E  3 652  ? 88.243  46.936  26.240  1.00 44.37 ? 1328 LEU A CG    1 
ATOM   5440  C  CD1   . LEU E  3 652  ? 89.419  46.576  25.347  1.00 43.69 ? 1328 LEU A CD1   1 
ATOM   5441  C  CD2   . LEU E  3 652  ? 87.118  45.924  26.073  1.00 44.70 ? 1328 LEU A CD2   1 
ATOM   5442  N  N     . SER E  3 653  ? 87.769  45.990  30.832  1.00 46.88 ? 1329 SER A N     1 
ATOM   5443  C  CA    . SER E  3 653  ? 88.196  45.620  32.188  1.00 47.50 ? 1329 SER A CA    1 
ATOM   5444  C  C     . SER E  3 653  ? 89.488  44.794  32.194  1.00 48.31 ? 1329 SER A C     1 
ATOM   5445  O  O     . SER E  3 653  ? 90.219  44.789  33.190  1.00 48.56 ? 1329 SER A O     1 
ATOM   5446  C  CB    . SER E  3 653  ? 87.068  44.891  32.940  1.00 47.28 ? 1329 SER A CB    1 
ATOM   5447  O  OG    . SER E  3 653  ? 86.515  43.828  32.177  1.00 45.44 ? 1329 SER A OG    1 
ATOM   5448  N  N     . ASN E  3 654  ? 89.758  44.096  31.089  1.00 48.97 ? 1330 ASN A N     1 
ATOM   5449  C  CA    . ASN E  3 654  ? 91.047  43.426  30.874  1.00 49.71 ? 1330 ASN A CA    1 
ATOM   5450  C  C     . ASN E  3 654  ? 91.739  43.884  29.576  1.00 50.65 ? 1330 ASN A C     1 
ATOM   5451  O  O     . ASN E  3 654  ? 91.673  43.180  28.560  1.00 50.67 ? 1330 ASN A O     1 
ATOM   5452  C  CB    . ASN E  3 654  ? 90.884  41.900  30.862  1.00 49.38 ? 1330 ASN A CB    1 
ATOM   5453  C  CG    . ASN E  3 654  ? 90.279  41.358  32.143  1.00 48.71 ? 1330 ASN A CG    1 
ATOM   5454  O  OD1   . ASN E  3 654  ? 89.175  41.739  32.534  1.00 48.13 ? 1330 ASN A OD1   1 
ATOM   5455  N  ND2   . ASN E  3 654  ? 90.991  40.442  32.789  1.00 47.90 ? 1330 ASN A ND2   1 
ATOM   5456  N  N     . PRO E  3 655  ? 92.392  45.070  29.597  1.00 51.31 ? 1331 PRO A N     1 
ATOM   5457  C  CA    . PRO E  3 655  ? 93.150  45.526  28.427  1.00 51.82 ? 1331 PRO A CA    1 
ATOM   5458  C  C     . PRO E  3 655  ? 94.372  44.641  28.153  1.00 52.56 ? 1331 PRO A C     1 
ATOM   5459  O  O     . PRO E  3 655  ? 94.834  43.921  29.046  1.00 52.41 ? 1331 PRO A O     1 
ATOM   5460  C  CB    . PRO E  3 655  ? 93.573  46.952  28.809  1.00 51.77 ? 1331 PRO A CB    1 
ATOM   5461  C  CG    . PRO E  3 655  ? 92.669  47.338  29.940  1.00 51.59 ? 1331 PRO A CG    1 
ATOM   5462  C  CD    . PRO E  3 655  ? 92.444  46.064  30.683  1.00 51.39 ? 1331 PRO A CD    1 
ATOM   5463  N  N     . ASN E  3 656  ? 94.891  44.713  26.928  1.00 53.29 ? 1332 ASN A N     1 
ATOM   5464  C  CA    . ASN E  3 656  ? 95.840  43.721  26.428  1.00 53.62 ? 1332 ASN A CA    1 
ATOM   5465  C  C     . ASN E  3 656  ? 97.021  44.308  25.641  1.00 53.36 ? 1332 ASN A C     1 
ATOM   5466  O  O     . ASN E  3 656  ? 96.840  45.186  24.792  1.00 53.23 ? 1332 ASN A O     1 
ATOM   5467  C  CB    . ASN E  3 656  ? 95.075  42.694  25.574  1.00 54.07 ? 1332 ASN A CB    1 
ATOM   5468  C  CG    . ASN E  3 656  ? 95.936  41.526  25.130  1.00 54.94 ? 1332 ASN A CG    1 
ATOM   5469  O  OD1   . ASN E  3 656  ? 95.871  41.104  23.973  1.00 55.68 ? 1332 ASN A OD1   1 
ATOM   5470  N  ND2   . ASN E  3 656  ? 96.740  40.991  26.046  1.00 55.13 ? 1332 ASN A ND2   1 
ATOM   5471  N  N     . SER E  3 657  ? 98.224  43.818  25.947  1.00 53.18 ? 1333 SER A N     1 
ATOM   5472  C  CA    . SER E  3 657  ? 99.437  44.120  25.176  1.00 53.06 ? 1333 SER A CA    1 
ATOM   5473  C  C     . SER E  3 657  ? 100.541 43.104  25.478  1.00 52.78 ? 1333 SER A C     1 
ATOM   5474  O  O     . SER E  3 657  ? 100.924 42.308  24.620  1.00 52.46 ? 1333 SER A O     1 
ATOM   5475  C  CB    . SER E  3 657  ? 99.939  45.550  25.437  1.00 53.16 ? 1333 SER A CB    1 
ATOM   5476  O  OG    . SER E  3 657  ? 100.699 45.636  26.632  1.00 52.98 ? 1333 SER A OG    1 
ATOM   5477  N  N     . ALA E  3 674  ? 109.582 35.359  5.346   1.00 95.21 ? 2001 ALA A N     1 
ATOM   5478  C  CA    . ALA E  3 674  ? 110.349 34.253  5.988   1.00 95.15 ? 2001 ALA A CA    1 
ATOM   5479  C  C     . ALA E  3 674  ? 109.508 33.511  7.024   1.00 95.13 ? 2001 ALA A C     1 
ATOM   5480  O  O     . ALA E  3 674  ? 109.673 32.306  7.219   1.00 95.13 ? 2001 ALA A O     1 
ATOM   5481  C  CB    . ALA E  3 674  ? 111.625 34.794  6.623   1.00 95.14 ? 2001 ALA A CB    1 
ATOM   5482  N  N     . ILE E  3 675  ? 108.597 34.239  7.668   1.00 95.16 ? 2002 ILE A N     1 
ATOM   5483  C  CA    . ILE E  3 675  ? 107.791 33.709  8.775   1.00 95.19 ? 2002 ILE A CA    1 
ATOM   5484  C  C     . ILE E  3 675  ? 106.504 33.017  8.292   1.00 94.82 ? 2002 ILE A C     1 
ATOM   5485  O  O     . ILE E  3 675  ? 106.134 31.948  8.796   1.00 94.81 ? 2002 ILE A O     1 
ATOM   5486  C  CB    . ILE E  3 675  ? 107.438 34.828  9.805   1.00 95.46 ? 2002 ILE A CB    1 
ATOM   5487  C  CG1   . ILE E  3 675  ? 108.617 35.800  9.984   1.00 95.76 ? 2002 ILE A CG1   1 
ATOM   5488  C  CG2   . ILE E  3 675  ? 106.995 34.215  11.145  1.00 95.17 ? 2002 ILE A CG2   1 
ATOM   5489  C  CD1   . ILE E  3 675  ? 108.217 37.217  10.387  1.00 95.77 ? 2002 ILE A CD1   1 
ATOM   5490  N  N     . ASP E  3 676  ? 105.835 33.636  7.319   1.00 94.14 ? 2003 ASP A N     1 
ATOM   5491  C  CA    . ASP E  3 676  ? 104.557 33.143  6.794   1.00 93.14 ? 2003 ASP A CA    1 
ATOM   5492  C  C     . ASP E  3 676  ? 104.715 32.132  5.650   1.00 92.49 ? 2003 ASP A C     1 
ATOM   5493  O  O     . ASP E  3 676  ? 103.754 31.453  5.273   1.00 92.97 ? 2003 ASP A O     1 
ATOM   5494  C  CB    . ASP E  3 676  ? 103.653 34.316  6.369   1.00 92.79 ? 2003 ASP A CB    1 
ATOM   5495  C  CG    . ASP E  3 676  ? 104.309 35.245  5.345   1.00 91.94 ? 2003 ASP A CG    1 
ATOM   5496  O  OD1   . ASP E  3 676  ? 105.449 34.983  4.904   1.00 91.65 ? 2003 ASP A OD1   1 
ATOM   5497  O  OD2   . ASP E  3 676  ? 103.670 36.253  4.980   1.00 91.09 ? 2003 ASP A OD2   1 
ATOM   5498  N  N     . GLU E  3 677  ? 105.925 32.041  5.108   1.00 91.12 ? 2004 GLU A N     1 
ATOM   5499  C  CA    . GLU E  3 677  ? 106.227 31.093  4.038   1.00 89.98 ? 2004 GLU A CA    1 
ATOM   5500  C  C     . GLU E  3 677  ? 106.385 29.677  4.581   1.00 88.61 ? 2004 GLU A C     1 
ATOM   5501  O  O     . GLU E  3 677  ? 106.088 28.703  3.886   1.00 88.64 ? 2004 GLU A O     1 
ATOM   5502  C  CB    . GLU E  3 677  ? 107.473 31.535  3.276   1.00 90.42 ? 2004 GLU A CB    1 
ATOM   5503  C  CG    . GLU E  3 677  ? 107.227 32.761  2.408   1.00 91.50 ? 2004 GLU A CG    1 
ATOM   5504  C  CD    . GLU E  3 677  ? 108.309 33.816  2.544   1.00 92.61 ? 2004 GLU A CD    1 
ATOM   5505  O  OE1   . GLU E  3 677  ? 109.492 33.452  2.724   1.00 93.28 ? 2004 GLU A OE1   1 
ATOM   5506  O  OE2   . GLU E  3 677  ? 107.970 35.016  2.467   1.00 93.22 ? 2004 GLU A OE2   1 
ATOM   5507  N  N     . ASN E  3 678  ? 106.849 29.576  5.826   1.00 86.81 ? 2005 ASN A N     1 
ATOM   5508  C  CA    . ASN E  3 678  ? 106.873 28.306  6.548   1.00 85.13 ? 2005 ASN A CA    1 
ATOM   5509  C  C     . ASN E  3 678  ? 105.471 27.790  6.835   1.00 83.87 ? 2005 ASN A C     1 
ATOM   5510  O  O     . ASN E  3 678  ? 105.234 26.580  6.830   1.00 83.44 ? 2005 ASN A O     1 
ATOM   5511  C  CB    . ASN E  3 678  ? 107.638 28.451  7.862   1.00 85.14 ? 2005 ASN A CB    1 
ATOM   5512  C  CG    . ASN E  3 678  ? 109.124 28.251  7.693   1.00 85.04 ? 2005 ASN A CG    1 
ATOM   5513  O  OD1   . ASN E  3 678  ? 109.568 27.262  7.110   1.00 85.00 ? 2005 ASN A OD1   1 
ATOM   5514  N  ND2   . ASN E  3 678  ? 109.907 29.187  8.213   1.00 85.33 ? 2005 ASN A ND2   1 
ATOM   5515  N  N     . LYS E  3 679  ? 104.554 28.723  7.087   1.00 82.63 ? 2006 LYS A N     1 
ATOM   5516  C  CA    . LYS E  3 679  ? 103.158 28.409  7.381   1.00 81.53 ? 2006 LYS A CA    1 
ATOM   5517  C  C     . LYS E  3 679  ? 102.458 27.743  6.201   1.00 80.36 ? 2006 LYS A C     1 
ATOM   5518  O  O     . LYS E  3 679  ? 101.753 26.748  6.375   1.00 80.30 ? 2006 LYS A O     1 
ATOM   5519  C  CB    . LYS E  3 679  ? 102.396 29.672  7.794   1.00 81.63 ? 2006 LYS A CB    1 
ATOM   5520  C  CG    . LYS E  3 679  ? 102.708 30.165  9.205   1.00 81.83 ? 2006 LYS A CG    1 
ATOM   5521  C  CD    . LYS E  3 679  ? 101.849 31.372  9.586   1.00 81.98 ? 2006 LYS A CD    1 
ATOM   5522  C  CE    . LYS E  3 679  ? 100.406 30.975  9.899   1.00 82.21 ? 2006 LYS A CE    1 
ATOM   5523  N  NZ    . LYS E  3 679  ? 99.570  32.138  10.308  1.00 81.64 ? 2006 LYS A NZ    1 
ATOM   5524  N  N     . GLN E  3 680  ? 102.661 28.292  5.006   1.00 79.02 ? 2007 GLN A N     1 
ATOM   5525  C  CA    . GLN E  3 680  ? 102.050 27.761  3.787   1.00 77.62 ? 2007 GLN A CA    1 
ATOM   5526  C  C     . GLN E  3 680  ? 102.596 26.385  3.432   1.00 76.08 ? 2007 GLN A C     1 
ATOM   5527  O  O     . GLN E  3 680  ? 101.855 25.518  2.964   1.00 76.29 ? 2007 GLN A O     1 
ATOM   5528  C  CB    . GLN E  3 680  ? 102.249 28.727  2.624   1.00 77.76 ? 2007 GLN A CB    1 
ATOM   5529  C  CG    . GLN E  3 680  ? 101.474 30.019  2.791   1.00 78.17 ? 2007 GLN A CG    1 
ATOM   5530  C  CD    . GLN E  3 680  ? 101.498 30.874  1.549   1.00 77.98 ? 2007 GLN A CD    1 
ATOM   5531  O  OE1   . GLN E  3 680  ? 102.553 31.119  0.966   1.00 76.94 ? 2007 GLN A OE1   1 
ATOM   5532  N  NE2   . GLN E  3 680  ? 100.328 31.341  1.138   1.00 78.97 ? 2007 GLN A NE2   1 
ATOM   5533  N  N     . LYS E  3 681  ? 103.893 26.201  3.661   1.00 74.07 ? 2008 LYS A N     1 
ATOM   5534  C  CA    . LYS E  3 681  ? 104.552 24.905  3.536   1.00 72.30 ? 2008 LYS A CA    1 
ATOM   5535  C  C     . LYS E  3 681  ? 103.824 23.848  4.380   1.00 70.98 ? 2008 LYS A C     1 
ATOM   5536  O  O     . LYS E  3 681  ? 103.546 22.750  3.895   1.00 71.09 ? 2008 LYS A O     1 
ATOM   5537  C  CB    . LYS E  3 681  ? 106.025 25.047  3.944   1.00 72.42 ? 2008 LYS A CB    1 
ATOM   5538  C  CG    . LYS E  3 681  ? 106.868 23.774  3.991   1.00 72.08 ? 2008 LYS A CG    1 
ATOM   5539  C  CD    . LYS E  3 681  ? 108.311 24.139  4.343   1.00 72.18 ? 2008 LYS A CD    1 
ATOM   5540  C  CE    . LYS E  3 681  ? 108.983 23.102  5.231   1.00 71.92 ? 2008 LYS A CE    1 
ATOM   5541  N  NZ    . LYS E  3 681  ? 109.550 21.970  4.457   1.00 72.14 ? 2008 LYS A NZ    1 
ATOM   5542  N  N     . ALA E  3 682  ? 103.494 24.199  5.624   1.00 69.07 ? 2009 ALA A N     1 
ATOM   5543  C  CA    . ALA E  3 682  ? 102.780 23.296  6.534   1.00 67.34 ? 2009 ALA A CA    1 
ATOM   5544  C  C     . ALA E  3 682  ? 101.274 23.217  6.254   1.00 66.16 ? 2009 ALA A C     1 
ATOM   5545  O  O     . ALA E  3 682  ? 100.639 22.198  6.549   1.00 65.72 ? 2009 ALA A O     1 
ATOM   5546  C  CB    . ALA E  3 682  ? 103.032 23.690  7.983   1.00 67.14 ? 2009 ALA A CB    1 
ATOM   5547  N  N     . LEU E  3 683  ? 100.716 24.294  5.697   1.00 64.82 ? 2010 LEU A N     1 
ATOM   5548  C  CA    . LEU E  3 683  ? 99.299  24.352  5.324   1.00 63.52 ? 2010 LEU A CA    1 
ATOM   5549  C  C     . LEU E  3 683  ? 98.991  23.370  4.199   1.00 62.98 ? 2010 LEU A C     1 
ATOM   5550  O  O     . LEU E  3 683  ? 98.152  22.482  4.362   1.00 63.17 ? 2010 LEU A O     1 
ATOM   5551  C  CB    . LEU E  3 683  ? 98.900  25.774  4.905   1.00 63.06 ? 2010 LEU A CB    1 
ATOM   5552  C  CG    . LEU E  3 683  ? 97.484  26.002  4.361   1.00 62.09 ? 2010 LEU A CG    1 
ATOM   5553  C  CD1   . LEU E  3 683  ? 96.496  26.255  5.483   1.00 60.97 ? 2010 LEU A CD1   1 
ATOM   5554  C  CD2   . LEU E  3 683  ? 97.474  27.160  3.379   1.00 62.18 ? 2010 LEU A CD2   1 
ATOM   5555  N  N     . ALA E  3 684  ? 99.679  23.536  3.069   1.00 62.01 ? 2011 ALA A N     1 
ATOM   5556  C  CA    . ALA E  3 684  ? 99.531  22.650  1.919   1.00 61.69 ? 2011 ALA A CA    1 
ATOM   5557  C  C     . ALA E  3 684  ? 99.772  21.188  2.301   1.00 61.68 ? 2011 ALA A C     1 
ATOM   5558  O  O     . ALA E  3 684  ? 99.072  20.296  1.815   1.00 62.41 ? 2011 ALA A O     1 
ATOM   5559  C  CB    . ALA E  3 684  ? 100.462 23.071  0.797   1.00 61.43 ? 2011 ALA A CB    1 
ATOM   5560  N  N     . ALA E  3 685  ? 100.749 20.955  3.180   1.00 60.87 ? 2012 ALA A N     1 
ATOM   5561  C  CA    . ALA E  3 685  ? 101.024 19.622  3.722   1.00 60.03 ? 2012 ALA A CA    1 
ATOM   5562  C  C     . ALA E  3 685  ? 99.805  19.016  4.430   1.00 59.87 ? 2012 ALA A C     1 
ATOM   5563  O  O     . ALA E  3 685  ? 99.514  17.829  4.264   1.00 59.87 ? 2012 ALA A O     1 
ATOM   5564  C  CB    . ALA E  3 685  ? 102.211 19.672  4.664   1.00 59.65 ? 2012 ALA A CB    1 
ATOM   5565  N  N     . ALA E  3 686  ? 99.098  19.836  5.207   1.00 59.47 ? 2013 ALA A N     1 
ATOM   5566  C  CA    . ALA E  3 686  ? 97.903  19.389  5.929   1.00 58.92 ? 2013 ALA A CA    1 
ATOM   5567  C  C     . ALA E  3 686  ? 96.713  19.175  4.996   1.00 58.45 ? 2013 ALA A C     1 
ATOM   5568  O  O     . ALA E  3 686  ? 96.010  18.172  5.108   1.00 58.48 ? 2013 ALA A O     1 
ATOM   5569  C  CB    . ALA E  3 686  ? 97.548  20.366  7.039   1.00 58.39 ? 2013 ALA A CB    1 
ATOM   5570  N  N     . LEU E  3 687  ? 96.497  20.118  4.079   1.00 57.98 ? 2014 LEU A N     1 
ATOM   5571  C  CA    . LEU E  3 687  ? 95.420  20.023  3.095   1.00 57.56 ? 2014 LEU A CA    1 
ATOM   5572  C  C     . LEU E  3 687  ? 95.575  18.787  2.212   1.00 58.61 ? 2014 LEU A C     1 
ATOM   5573  O  O     . LEU E  3 687  ? 94.591  18.114  1.906   1.00 59.20 ? 2014 LEU A O     1 
ATOM   5574  C  CB    . LEU E  3 687  ? 95.362  21.281  2.226   1.00 57.03 ? 2014 LEU A CB    1 
ATOM   5575  C  CG    . LEU E  3 687  ? 94.441  22.429  2.632   1.00 55.48 ? 2014 LEU A CG    1 
ATOM   5576  C  CD1   . LEU E  3 687  ? 94.960  23.161  3.845   1.00 56.17 ? 2014 LEU A CD1   1 
ATOM   5577  C  CD2   . LEU E  3 687  ? 94.291  23.392  1.473   1.00 56.15 ? 2014 LEU A CD2   1 
ATOM   5578  N  N     . GLY E  3 688  ? 96.810  18.500  1.804   1.00 58.75 ? 2015 GLY A N     1 
ATOM   5579  C  CA    . GLY E  3 688  ? 97.111  17.291  1.048   1.00 59.45 ? 2015 GLY A CA    1 
ATOM   5580  C  C     . GLY E  3 688  ? 96.808  16.049  1.866   1.00 60.09 ? 2015 GLY A C     1 
ATOM   5581  O  O     . GLY E  3 688  ? 96.181  15.110  1.371   1.00 60.34 ? 2015 GLY A O     1 
ATOM   5582  N  N     . GLN E  3 689  ? 97.249  16.061  3.124   1.00 60.45 ? 2016 GLN A N     1 
ATOM   5583  C  CA    . GLN E  3 689  ? 96.997  14.974  4.070   1.00 61.02 ? 2016 GLN A CA    1 
ATOM   5584  C  C     . GLN E  3 689  ? 95.497  14.717  4.262   1.00 60.78 ? 2016 GLN A C     1 
ATOM   5585  O  O     . GLN E  3 689  ? 95.052  13.564  4.254   1.00 60.71 ? 2016 GLN A O     1 
ATOM   5586  C  CB    . GLN E  3 689  ? 97.709  15.267  5.404   1.00 61.52 ? 2016 GLN A CB    1 
ATOM   5587  C  CG    . GLN E  3 689  ? 97.011  14.776  6.684   1.00 63.90 ? 2016 GLN A CG    1 
ATOM   5588  C  CD    . GLN E  3 689  ? 97.096  13.266  6.901   1.00 65.28 ? 2016 GLN A CD    1 
ATOM   5589  O  OE1   . GLN E  3 689  ? 97.657  12.527  6.085   1.00 64.76 ? 2016 GLN A OE1   1 
ATOM   5590  N  NE2   . GLN E  3 689  ? 96.531  12.805  8.014   1.00 66.09 ? 2016 GLN A NE2   1 
ATOM   5591  N  N     . ILE E  3 690  ? 94.732  15.797  4.414   1.00 60.51 ? 2017 ILE A N     1 
ATOM   5592  C  CA    . ILE E  3 690  ? 93.288  15.720  4.624   1.00 60.47 ? 2017 ILE A CA    1 
ATOM   5593  C  C     . ILE E  3 690  ? 92.579  15.118  3.413   1.00 60.73 ? 2017 ILE A C     1 
ATOM   5594  O  O     . ILE E  3 690  ? 91.745  14.223  3.553   1.00 60.44 ? 2017 ILE A O     1 
ATOM   5595  C  CB    . ILE E  3 690  ? 92.689  17.111  4.943   1.00 60.35 ? 2017 ILE A CB    1 
ATOM   5596  C  CG1   . ILE E  3 690  ? 93.149  17.588  6.323   1.00 59.98 ? 2017 ILE A CG1   1 
ATOM   5597  C  CG2   . ILE E  3 690  ? 91.162  17.074  4.890   1.00 61.09 ? 2017 ILE A CG2   1 
ATOM   5598  C  CD1   . ILE E  3 690  ? 92.924  19.066  6.572   1.00 59.40 ? 2017 ILE A CD1   1 
ATOM   5599  N  N     . GLU E  3 691  ? 92.925  15.612  2.228   1.00 61.37 ? 2018 GLU A N     1 
ATOM   5600  C  CA    . GLU E  3 691  ? 92.283  15.179  0.998   1.00 61.93 ? 2018 GLU A CA    1 
ATOM   5601  C  C     . GLU E  3 691  ? 92.620  13.739  0.671   1.00 62.57 ? 2018 GLU A C     1 
ATOM   5602  O  O     . GLU E  3 691  ? 91.776  13.007  0.158   1.00 62.66 ? 2018 GLU A O     1 
ATOM   5603  C  CB    . GLU E  3 691  ? 92.656  16.099  -0.157  1.00 62.10 ? 2018 GLU A CB    1 
ATOM   5604  C  CG    . GLU E  3 691  ? 92.055  17.484  -0.024  1.00 63.88 ? 2018 GLU A CG    1 
ATOM   5605  C  CD    . GLU E  3 691  ? 91.666  18.096  -1.356  1.00 65.78 ? 2018 GLU A CD    1 
ATOM   5606  O  OE1   . GLU E  3 691  ? 90.536  18.635  -1.441  1.00 66.28 ? 2018 GLU A OE1   1 
ATOM   5607  O  OE2   . GLU E  3 691  ? 92.474  18.032  -2.315  1.00 66.09 ? 2018 GLU A OE2   1 
ATOM   5608  N  N     . LYS E  3 692  ? 93.846  13.333  0.989   1.00 63.63 ? 2019 LYS A N     1 
ATOM   5609  C  CA    . LYS E  3 692  ? 94.275  11.953  0.782   1.00 65.00 ? 2019 LYS A CA    1 
ATOM   5610  C  C     . LYS E  3 692  ? 93.579  11.015  1.765   1.00 65.39 ? 2019 LYS A C     1 
ATOM   5611  O  O     . LYS E  3 692  ? 93.406  9.830   1.483   1.00 65.82 ? 2019 LYS A O     1 
ATOM   5612  C  CB    . LYS E  3 692  ? 95.796  11.822  0.906   1.00 65.23 ? 2019 LYS A CB    1 
ATOM   5613  C  CG    . LYS E  3 692  ? 96.392  10.740  0.001   1.00 65.77 ? 2019 LYS A CG    1 
ATOM   5614  C  CD    . LYS E  3 692  ? 97.837  10.404  0.354   1.00 65.78 ? 2019 LYS A CD    1 
ATOM   5615  C  CE    . LYS E  3 692  ? 97.923  9.524   1.596   1.00 66.83 ? 2019 LYS A CE    1 
ATOM   5616  N  NZ    . LYS E  3 692  ? 99.278  8.928   1.751   1.00 67.26 ? 2019 LYS A NZ    1 
ATOM   5617  N  N     . GLN E  3 693  ? 93.178  11.555  2.912   1.00 65.65 ? 2020 GLN A N     1 
ATOM   5618  C  CA    . GLN E  3 693  ? 92.469  10.782  3.922   1.00 65.90 ? 2020 GLN A CA    1 
ATOM   5619  C  C     . GLN E  3 693  ? 90.966  10.729  3.702   1.00 66.06 ? 2020 GLN A C     1 
ATOM   5620  O  O     . GLN E  3 693  ? 90.356  9.677   3.877   1.00 66.19 ? 2020 GLN A O     1 
ATOM   5621  C  CB    . GLN E  3 693  ? 92.734  11.344  5.310   1.00 66.11 ? 2020 GLN A CB    1 
ATOM   5622  C  CG    . GLN E  3 693  ? 93.847  10.658  6.050   1.00 67.58 ? 2020 GLN A CG    1 
ATOM   5623  C  CD    . GLN E  3 693  ? 93.633  10.688  7.552   1.00 68.57 ? 2020 GLN A CD    1 
ATOM   5624  O  OE1   . GLN E  3 693  ? 93.334  11.734  8.133   1.00 68.66 ? 2020 GLN A OE1   1 
ATOM   5625  N  NE2   . GLN E  3 693  ? 93.782  9.534   8.189   1.00 69.27 ? 2020 GLN A NE2   1 
ATOM   5626  N  N     . PHE E  3 694  ? 90.370  11.861  3.333   1.00 66.24 ? 2021 PHE A N     1 
ATOM   5627  C  CA    . PHE E  3 694  ? 88.911  11.966  3.282   1.00 66.35 ? 2021 PHE A CA    1 
ATOM   5628  C  C     . PHE E  3 694  ? 88.350  12.244  1.890   1.00 65.85 ? 2021 PHE A C     1 
ATOM   5629  O  O     . PHE E  3 694  ? 87.222  12.717  1.743   1.00 66.30 ? 2021 PHE A O     1 
ATOM   5630  C  CB    . PHE E  3 694  ? 88.410  12.992  4.305   1.00 67.16 ? 2021 PHE A CB    1 
ATOM   5631  C  CG    . PHE E  3 694  ? 88.821  12.683  5.717   1.00 68.42 ? 2021 PHE A CG    1 
ATOM   5632  C  CD1   . PHE E  3 694  ? 88.255  11.606  6.402   1.00 68.88 ? 2021 PHE A CD1   1 
ATOM   5633  C  CD2   . PHE E  3 694  ? 89.781  13.465  6.362   1.00 69.05 ? 2021 PHE A CD2   1 
ATOM   5634  C  CE1   . PHE E  3 694  ? 88.635  11.310  7.709   1.00 69.57 ? 2021 PHE A CE1   1 
ATOM   5635  C  CE2   . PHE E  3 694  ? 90.173  13.183  7.669   1.00 69.69 ? 2021 PHE A CE2   1 
ATOM   5636  C  CZ    . PHE E  3 694  ? 89.600  12.101  8.345   1.00 69.95 ? 2021 PHE A CZ    1 
ATOM   5637  N  N     . GLY E  3 695  ? 89.142  11.939  0.870   1.00 64.93 ? 2022 GLY A N     1 
ATOM   5638  C  CA    . GLY E  3 695  ? 88.646  11.950  -0.493  1.00 64.39 ? 2022 GLY A CA    1 
ATOM   5639  C  C     . GLY E  3 695  ? 88.804  13.249  -1.253  1.00 64.01 ? 2022 GLY A C     1 
ATOM   5640  O  O     . GLY E  3 695  ? 89.287  14.250  -0.716  1.00 63.69 ? 2022 GLY A O     1 
ATOM   5641  N  N     . LYS E  3 696  ? 88.362  13.198  -2.512  1.00 63.79 ? 2023 LYS A N     1 
ATOM   5642  C  CA    . LYS E  3 696  ? 88.504  14.259  -3.520  1.00 62.86 ? 2023 LYS A CA    1 
ATOM   5643  C  C     . LYS E  3 696  ? 88.469  15.681  -2.950  1.00 61.19 ? 2023 LYS A C     1 
ATOM   5644  O  O     . LYS E  3 696  ? 89.513  16.243  -2.650  1.00 61.64 ? 2023 LYS A O     1 
ATOM   5645  C  CB    . LYS E  3 696  ? 87.447  14.093  -4.633  1.00 63.53 ? 2023 LYS A CB    1 
ATOM   5646  C  CG    . LYS E  3 696  ? 87.240  12.654  -5.140  1.00 63.84 ? 2023 LYS A CG    1 
ATOM   5647  C  CD    . LYS E  3 696  ? 88.102  12.322  -6.355  1.00 63.42 ? 2023 LYS A CD    1 
ATOM   5648  C  CE    . LYS E  3 696  ? 87.395  12.680  -7.661  1.00 62.50 ? 2023 LYS A CE    1 
ATOM   5649  N  NZ    . LYS E  3 696  ? 88.222  12.332  -8.846  1.00 62.31 ? 2023 LYS A NZ    1 
ATOM   5650  N  N     . GLY E  3 697  ? 87.279  16.254  -2.798  1.00 58.91 ? 2024 GLY A N     1 
ATOM   5651  C  CA    . GLY E  3 697  ? 87.162  17.640  -2.374  1.00 57.08 ? 2024 GLY A CA    1 
ATOM   5652  C  C     . GLY E  3 697  ? 86.621  17.796  -0.967  1.00 56.18 ? 2024 GLY A C     1 
ATOM   5653  O  O     . GLY E  3 697  ? 85.677  18.561  -0.744  1.00 55.86 ? 2024 GLY A O     1 
ATOM   5654  N  N     . SER E  3 698  ? 87.223  17.079  -0.018  1.00 54.97 ? 2025 SER A N     1 
ATOM   5655  C  CA    . SER E  3 698  ? 86.793  17.120  1.381   1.00 53.60 ? 2025 SER A CA    1 
ATOM   5656  C  C     . SER E  3 698  ? 87.057  18.470  2.048   1.00 53.50 ? 2025 SER A C     1 
ATOM   5657  O  O     . SER E  3 698  ? 86.323  18.874  2.950   1.00 54.04 ? 2025 SER A O     1 
ATOM   5658  C  CB    . SER E  3 698  ? 87.429  15.986  2.180   1.00 52.81 ? 2025 SER A CB    1 
ATOM   5659  O  OG    . SER E  3 698  ? 88.803  15.869  1.880   1.00 53.02 ? 2025 SER A OG    1 
ATOM   5660  N  N     . ILE E  3 699  ? 88.103  19.164  1.603   1.00 53.07 ? 2026 ILE A N     1 
ATOM   5661  C  CA    . ILE E  3 699  ? 88.359  20.547  2.016   1.00 52.60 ? 2026 ILE A CA    1 
ATOM   5662  C  C     . ILE E  3 699  ? 88.843  21.382  0.834   1.00 52.34 ? 2026 ILE A C     1 
ATOM   5663  O  O     . ILE E  3 699  ? 89.682  20.934  0.061   1.00 51.88 ? 2026 ILE A O     1 
ATOM   5664  C  CB    . ILE E  3 699  ? 89.367  20.640  3.198   1.00 52.75 ? 2026 ILE A CB    1 
ATOM   5665  C  CG1   . ILE E  3 699  ? 89.493  22.090  3.686   1.00 52.63 ? 2026 ILE A CG1   1 
ATOM   5666  C  CG2   . ILE E  3 699  ? 90.735  20.073  2.814   1.00 52.23 ? 2026 ILE A CG2   1 
ATOM   5667  C  CD1   . ILE E  3 699  ? 90.035  22.233  5.087   1.00 52.08 ? 2026 ILE A CD1   1 
ATOM   5668  N  N     . MET E  3 700  ? 88.291  22.584  0.690   1.00 52.85 ? 2027 MET A N     1 
ATOM   5669  C  CA    . MET E  3 700  ? 88.723  23.524  -0.346  1.00 53.69 ? 2027 MET A CA    1 
ATOM   5670  C  C     . MET E  3 700  ? 88.377  24.967  -0.008  1.00 53.03 ? 2027 MET A C     1 
ATOM   5671  O  O     . MET E  3 700  ? 87.690  25.236  0.971   1.00 52.67 ? 2027 MET A O     1 
ATOM   5672  C  CB    . MET E  3 700  ? 88.154  23.150  -1.718  1.00 54.03 ? 2027 MET A CB    1 
ATOM   5673  C  CG    . MET E  3 700  ? 86.692  22.771  -1.725  1.00 54.03 ? 2027 MET A CG    1 
ATOM   5674  S  SD    . MET E  3 700  ? 86.193  22.437  -3.410  1.00 56.00 ? 2027 MET A SD    1 
ATOM   5675  C  CE    . MET E  3 700  ? 85.106  21.026  -3.168  1.00 56.58 ? 2027 MET A CE    1 
ATOM   5676  N  N     . ARG E  3 701  ? 88.872  25.894  -0.820  1.00 53.08 ? 2028 ARG A N     1 
ATOM   5677  C  CA    . ARG E  3 701  ? 88.555  27.299  -0.642  1.00 53.14 ? 2028 ARG A CA    1 
ATOM   5678  C  C     . ARG E  3 701  ? 87.111  27.548  -1.038  1.00 52.04 ? 2028 ARG A C     1 
ATOM   5679  O  O     . ARG E  3 701  ? 86.663  27.086  -2.086  1.00 52.63 ? 2028 ARG A O     1 
ATOM   5680  C  CB    . ARG E  3 701  ? 89.497  28.172  -1.467  1.00 54.23 ? 2028 ARG A CB    1 
ATOM   5681  C  CG    . ARG E  3 701  ? 90.814  28.498  -0.779  1.00 57.29 ? 2028 ARG A CG    1 
ATOM   5682  C  CD    . ARG E  3 701  ? 91.885  27.457  -1.055  1.00 60.65 ? 2028 ARG A CD    1 
ATOM   5683  N  NE    . ARG E  3 701  ? 93.206  28.076  -1.141  1.00 63.78 ? 2028 ARG A NE    1 
ATOM   5684  C  CZ    . ARG E  3 701  ? 93.673  28.694  -2.228  1.00 66.30 ? 2028 ARG A CZ    1 
ATOM   5685  N  NH1   . ARG E  3 701  ? 92.928  28.781  -3.328  1.00 66.30 ? 2028 ARG A NH1   1 
ATOM   5686  N  NH2   . ARG E  3 701  ? 94.889  29.232  -2.221  1.00 67.38 ? 2028 ARG A NH2   1 
ATOM   5687  N  N     . LEU E  3 702  ? 86.390  28.277  -0.195  1.00 50.69 ? 2029 LEU A N     1 
ATOM   5688  C  CA    . LEU E  3 702  ? 84.961  28.502  -0.387  1.00 50.42 ? 2029 LEU A CA    1 
ATOM   5689  C  C     . LEU E  3 702  ? 84.634  29.038  -1.785  1.00 50.88 ? 2029 LEU A C     1 
ATOM   5690  O  O     . LEU E  3 702  ? 83.698  28.574  -2.447  1.00 50.48 ? 2029 LEU A O     1 
ATOM   5691  C  CB    . LEU E  3 702  ? 84.442  29.483  0.663   1.00 49.79 ? 2029 LEU A CB    1 
ATOM   5692  C  CG    . LEU E  3 702  ? 83.072  29.279  1.322   1.00 49.18 ? 2029 LEU A CG    1 
ATOM   5693  C  CD1   . LEU E  3 702  ? 82.520  30.630  1.710   1.00 49.50 ? 2029 LEU A CD1   1 
ATOM   5694  C  CD2   . LEU E  3 702  ? 82.071  28.555  0.449   1.00 48.32 ? 2029 LEU A CD2   1 
ATOM   5695  N  N     . GLY E  3 703  ? 85.426  30.009  -2.229  1.00 51.52 ? 2030 GLY A N     1 
ATOM   5696  C  CA    . GLY E  3 703  ? 85.160  30.736  -3.464  1.00 51.59 ? 2030 GLY A CA    1 
ATOM   5697  C  C     . GLY E  3 703  ? 85.131  29.876  -4.698  1.00 51.70 ? 2030 GLY A C     1 
ATOM   5698  O  O     . GLY E  3 703  ? 84.505  30.238  -5.691  1.00 51.67 ? 2030 GLY A O     1 
ATOM   5699  N  N     . GLU E  3 704  ? 85.803  28.734  -4.632  1.00 52.09 ? 2031 GLU A N     1 
ATOM   5700  C  CA    . GLU E  3 704  ? 85.909  27.857  -5.787  1.00 53.62 ? 2031 GLU A CA    1 
ATOM   5701  C  C     . GLU E  3 704  ? 85.082  26.583  -5.660  1.00 53.33 ? 2031 GLU A C     1 
ATOM   5702  O  O     . GLU E  3 704  ? 85.060  25.760  -6.579  1.00 53.27 ? 2031 GLU A O     1 
ATOM   5703  C  CB    . GLU E  3 704  ? 87.374  27.547  -6.103  1.00 54.24 ? 2031 GLU A CB    1 
ATOM   5704  C  CG    . GLU E  3 704  ? 88.177  27.004  -4.930  1.00 55.70 ? 2031 GLU A CG    1 
ATOM   5705  C  CD    . GLU E  3 704  ? 89.687  27.094  -5.143  1.00 55.89 ? 2031 GLU A CD    1 
ATOM   5706  O  OE1   . GLU E  3 704  ? 90.146  27.916  -5.975  1.00 55.42 ? 2031 GLU A OE1   1 
ATOM   5707  O  OE2   . GLU E  3 704  ? 90.413  26.339  -4.458  1.00 58.37 ? 2031 GLU A OE2   1 
ATOM   5708  N  N     . ASP E  3 705  ? 84.387  26.425  -4.535  1.00 53.29 ? 2032 ASP A N     1 
ATOM   5709  C  CA    . ASP E  3 705  ? 83.476  25.297  -4.382  1.00 52.66 ? 2032 ASP A CA    1 
ATOM   5710  C  C     . ASP E  3 705  ? 82.164  25.563  -5.107  1.00 51.79 ? 2032 ASP A C     1 
ATOM   5711  O  O     . ASP E  3 705  ? 81.360  26.396  -4.672  1.00 51.04 ? 2032 ASP A O     1 
ATOM   5712  C  CB    . ASP E  3 705  ? 83.218  24.985  -2.915  1.00 53.42 ? 2032 ASP A CB    1 
ATOM   5713  C  CG    . ASP E  3 705  ? 82.573  23.625  -2.716  1.00 55.63 ? 2032 ASP A CG    1 
ATOM   5714  O  OD1   . ASP E  3 705  ? 81.810  23.174  -3.602  1.00 56.71 ? 2032 ASP A OD1   1 
ATOM   5715  O  OD2   . ASP E  3 705  ? 82.833  22.999  -1.667  1.00 57.72 ? 2032 ASP A OD2   1 
ATOM   5716  N  N     . ARG E  3 706  ? 81.966  24.843  -6.209  1.00 51.29 ? 2033 ARG A N     1 
ATOM   5717  C  CA    . ARG E  3 706  ? 80.779  25.008  -7.044  1.00 51.44 ? 2033 ARG A CA    1 
ATOM   5718  C  C     . ARG E  3 706  ? 79.519  24.464  -6.385  1.00 51.79 ? 2033 ARG A C     1 
ATOM   5719  O  O     . ARG E  3 706  ? 78.445  25.062  -6.493  1.00 51.70 ? 2033 ARG A O     1 
ATOM   5720  C  CB    . ARG E  3 706  ? 80.971  24.344  -8.413  1.00 51.09 ? 2033 ARG A CB    1 
ATOM   5721  C  CG    . ARG E  3 706  ? 81.942  25.048  -9.358  1.00 50.54 ? 2033 ARG A CG    1 
ATOM   5722  C  CD    . ARG E  3 706  ? 81.618  26.525  -9.523  1.00 49.79 ? 2033 ARG A CD    1 
ATOM   5723  N  NE    . ARG E  3 706  ? 82.163  27.306  -8.408  1.00 48.79 ? 2033 ARG A NE    1 
ATOM   5724  C  CZ    . ARG E  3 706  ? 81.750  28.523  -8.056  1.00 47.42 ? 2033 ARG A CZ    1 
ATOM   5725  N  NH1   . ARG E  3 706  ? 80.777  29.128  -8.730  1.00 48.30 ? 2033 ARG A NH1   1 
ATOM   5726  N  NH2   . ARG E  3 706  ? 82.318  29.146  -7.031  1.00 44.43 ? 2033 ARG A NH2   1 
ATOM   5727  N  N     . SER E  3 707  ? 79.656  23.333  -5.697  1.00 52.07 ? 2034 SER A N     1 
ATOM   5728  C  CA    . SER E  3 707  ? 78.515  22.659  -5.085  1.00 52.40 ? 2034 SER A CA    1 
ATOM   5729  C  C     . SER E  3 707  ? 77.936  23.461  -3.927  1.00 52.75 ? 2034 SER A C     1 
ATOM   5730  O  O     . SER E  3 707  ? 76.985  23.028  -3.271  1.00 53.55 ? 2034 SER A O     1 
ATOM   5731  C  CB    . SER E  3 707  ? 78.915  21.263  -4.608  1.00 52.39 ? 2034 SER A CB    1 
ATOM   5732  O  OG    . SER E  3 707  ? 79.901  21.338  -3.594  1.00 51.87 ? 2034 SER A OG    1 
ATOM   5733  N  N     . MET E  3 708  ? 78.514  24.632  -3.686  1.00 52.94 ? 2035 MET A N     1 
ATOM   5734  C  CA    . MET E  3 708  ? 78.095  25.500  -2.600  1.00 53.04 ? 2035 MET A CA    1 
ATOM   5735  C  C     . MET E  3 708  ? 77.145  26.597  -3.089  1.00 52.58 ? 2035 MET A C     1 
ATOM   5736  O  O     . MET E  3 708  ? 76.490  27.258  -2.287  1.00 52.59 ? 2035 MET A O     1 
ATOM   5737  C  CB    . MET E  3 708  ? 79.323  26.128  -1.956  1.00 53.55 ? 2035 MET A CB    1 
ATOM   5738  C  CG    . MET E  3 708  ? 79.193  26.322  -0.469  1.00 55.90 ? 2035 MET A CG    1 
ATOM   5739  S  SD    . MET E  3 708  ? 79.607  24.817  0.425   1.00 58.65 ? 2035 MET A SD    1 
ATOM   5740  C  CE    . MET E  3 708  ? 81.396  24.840  0.421   1.00 58.90 ? 2035 MET A CE    1 
ATOM   5741  N  N     . ASP E  3 709  ? 77.078  26.783  -4.405  1.00 52.30 ? 2036 ASP A N     1 
ATOM   5742  C  CA    . ASP E  3 709  ? 76.238  27.809  -5.009  1.00 52.20 ? 2036 ASP A CA    1 
ATOM   5743  C  C     . ASP E  3 709  ? 74.779  27.473  -4.830  1.00 51.85 ? 2036 ASP A C     1 
ATOM   5744  O  O     . ASP E  3 709  ? 74.363  26.340  -5.041  1.00 51.56 ? 2036 ASP A O     1 
ATOM   5745  C  CB    . ASP E  3 709  ? 76.532  27.932  -6.505  1.00 53.14 ? 2036 ASP A CB    1 
ATOM   5746  C  CG    . ASP E  3 709  ? 77.956  28.389  -6.795  1.00 53.24 ? 2036 ASP A CG    1 
ATOM   5747  O  OD1   . ASP E  3 709  ? 78.506  29.197  -6.006  1.00 53.28 ? 2036 ASP A OD1   1 
ATOM   5748  O  OD2   . ASP E  3 709  ? 78.514  27.938  -7.824  1.00 52.10 ? 2036 ASP A OD2   1 
ATOM   5749  N  N     . VAL E  3 710  ? 74.002  28.462  -4.443  1.00 52.48 ? 2037 VAL A N     1 
ATOM   5750  C  CA    . VAL E  3 710  ? 72.574  28.249  -4.200  1.00 53.74 ? 2037 VAL A CA    1 
ATOM   5751  C  C     . VAL E  3 710  ? 71.771  28.302  -5.500  1.00 54.80 ? 2037 VAL A C     1 
ATOM   5752  O  O     . VAL E  3 710  ? 71.840  29.287  -6.237  1.00 54.87 ? 2037 VAL A O     1 
ATOM   5753  C  CB    . VAL E  3 710  ? 72.016  29.267  -3.176  1.00 53.38 ? 2037 VAL A CB    1 
ATOM   5754  C  CG1   . VAL E  3 710  ? 70.513  29.172  -3.086  1.00 51.31 ? 2037 VAL A CG1   1 
ATOM   5755  C  CG2   . VAL E  3 710  ? 72.656  29.055  -1.809  1.00 52.61 ? 2037 VAL A CG2   1 
ATOM   5756  N  N     . GLU E  3 711  ? 71.015  27.236  -5.763  1.00 55.85 ? 2038 GLU A N     1 
ATOM   5757  C  CA    . GLU E  3 711  ? 70.193  27.117  -6.960  1.00 56.59 ? 2038 GLU A CA    1 
ATOM   5758  C  C     . GLU E  3 711  ? 68.737  26.965  -6.519  1.00 55.67 ? 2038 GLU A C     1 
ATOM   5759  O  O     . GLU E  3 711  ? 68.461  26.239  -5.569  1.00 56.40 ? 2038 GLU A O     1 
ATOM   5760  C  CB    . GLU E  3 711  ? 70.664  25.902  -7.759  1.00 58.17 ? 2038 GLU A CB    1 
ATOM   5761  C  CG    . GLU E  3 711  ? 69.865  25.584  -9.020  1.00 64.82 ? 2038 GLU A CG    1 
ATOM   5762  C  CD    . GLU E  3 711  ? 69.803  24.080  -9.310  1.00 69.46 ? 2038 GLU A CD    1 
ATOM   5763  O  OE1   . GLU E  3 711  ? 70.866  23.422  -9.223  1.00 72.14 ? 2038 GLU A OE1   1 
ATOM   5764  O  OE2   . GLU E  3 711  ? 68.699  23.557  -9.620  1.00 70.19 ? 2038 GLU A OE2   1 
ATOM   5765  N  N     . THR E  3 712  ? 67.809  27.652  -7.187  1.00 54.72 ? 2039 THR A N     1 
ATOM   5766  C  CA    . THR E  3 712  ? 66.401  27.647  -6.748  1.00 54.54 ? 2039 THR A CA    1 
ATOM   5767  C  C     . THR E  3 712  ? 65.362  27.036  -7.710  1.00 54.42 ? 2039 THR A C     1 
ATOM   5768  O  O     . THR E  3 712  ? 65.616  26.855  -8.897  1.00 54.19 ? 2039 THR A O     1 
ATOM   5769  C  CB    . THR E  3 712  ? 65.915  29.056  -6.333  1.00 54.38 ? 2039 THR A CB    1 
ATOM   5770  O  OG1   . THR E  3 712  ? 65.867  29.906  -7.483  1.00 55.60 ? 2039 THR A OG1   1 
ATOM   5771  C  CG2   . THR E  3 712  ? 66.822  29.664  -5.287  1.00 52.91 ? 2039 THR A CG2   1 
ATOM   5772  N  N     . ILE E  3 713  ? 64.190  26.728  -7.154  1.00 54.43 ? 2040 ILE A N     1 
ATOM   5773  C  CA    . ILE E  3 713  ? 63.048  26.176  -7.878  1.00 54.42 ? 2040 ILE A CA    1 
ATOM   5774  C  C     . ILE E  3 713  ? 61.872  27.116  -7.650  1.00 54.28 ? 2040 ILE A C     1 
ATOM   5775  O  O     . ILE E  3 713  ? 61.673  27.597  -6.537  1.00 54.22 ? 2040 ILE A O     1 
ATOM   5776  C  CB    . ILE E  3 713  ? 62.682  24.761  -7.331  1.00 54.62 ? 2040 ILE A CB    1 
ATOM   5777  C  CG1   . ILE E  3 713  ? 63.783  23.757  -7.638  1.00 54.62 ? 2040 ILE A CG1   1 
ATOM   5778  C  CG2   . ILE E  3 713  ? 61.351  24.245  -7.889  1.00 57.40 ? 2040 ILE A CG2   1 
ATOM   5779  C  CD1   . ILE E  3 713  ? 64.208  23.718  -9.102  1.00 55.33 ? 2040 ILE A CD1   1 
ATOM   5780  N  N     . SER E  3 714  ? 61.092  27.385  -8.692  1.00 54.42 ? 2041 SER A N     1 
ATOM   5781  C  CA    . SER E  3 714  ? 59.873  28.178  -8.534  1.00 54.68 ? 2041 SER A CA    1 
ATOM   5782  C  C     . SER E  3 714  ? 58.889  27.505  -7.577  1.00 54.81 ? 2041 SER A C     1 
ATOM   5783  O  O     . SER E  3 714  ? 58.779  26.277  -7.535  1.00 54.75 ? 2041 SER A O     1 
ATOM   5784  C  CB    . SER E  3 714  ? 59.198  28.423  -9.885  1.00 54.82 ? 2041 SER A CB    1 
ATOM   5785  O  OG    . SER E  3 714  ? 57.895  28.944  -9.692  1.00 54.36 ? 2041 SER A OG    1 
ATOM   5786  N  N     . THR E  3 715  ? 58.169  28.314  -6.815  1.00 55.02 ? 2042 THR A N     1 
ATOM   5787  C  CA    . THR E  3 715  ? 57.175  27.788  -5.886  1.00 55.59 ? 2042 THR A CA    1 
ATOM   5788  C  C     . THR E  3 715  ? 55.819  27.635  -6.548  1.00 56.43 ? 2042 THR A C     1 
ATOM   5789  O  O     . THR E  3 715  ? 54.923  27.011  -5.981  1.00 57.82 ? 2042 THR A O     1 
ATOM   5790  C  CB    . THR E  3 715  ? 56.993  28.697  -4.669  1.00 55.57 ? 2042 THR A CB    1 
ATOM   5791  O  OG1   . THR E  3 715  ? 56.652  30.017  -5.106  1.00 56.84 ? 2042 THR A OG1   1 
ATOM   5792  C  CG2   . THR E  3 715  ? 58.267  28.745  -3.843  1.00 56.30 ? 2042 THR A CG2   1 
ATOM   5793  N  N     . GLY E  3 716  ? 55.667  28.207  -7.742  1.00 56.33 ? 2043 GLY A N     1 
ATOM   5794  C  CA    . GLY E  3 716  ? 54.382  28.211  -8.430  1.00 56.13 ? 2043 GLY A CA    1 
ATOM   5795  C  C     . GLY E  3 716  ? 53.640  29.508  -8.180  1.00 56.50 ? 2043 GLY A C     1 
ATOM   5796  O  O     . GLY E  3 716  ? 52.695  29.836  -8.892  1.00 58.73 ? 2043 GLY A O     1 
ATOM   5797  N  N     . SER E  3 717  ? 54.058  30.239  -7.153  1.00 55.30 ? 2044 SER A N     1 
ATOM   5798  C  CA    . SER E  3 717  ? 53.598  31.601  -6.933  1.00 54.52 ? 2044 SER A CA    1 
ATOM   5799  C  C     . SER E  3 717  ? 54.731  32.582  -7.241  1.00 53.82 ? 2044 SER A C     1 
ATOM   5800  O  O     . SER E  3 717  ? 55.850  32.444  -6.730  1.00 53.23 ? 2044 SER A O     1 
ATOM   5801  C  CB    . SER E  3 717  ? 53.117  31.778  -5.497  1.00 54.93 ? 2044 SER A CB    1 
ATOM   5802  O  OG    . SER E  3 717  ? 53.131  33.147  -5.119  1.00 57.33 ? 2044 SER A OG    1 
ATOM   5803  N  N     . LEU E  3 718  ? 54.433  33.567  -8.083  1.00 52.95 ? 2045 LEU A N     1 
ATOM   5804  C  CA    . LEU E  3 718  ? 55.416  34.573  -8.461  1.00 52.15 ? 2045 LEU A CA    1 
ATOM   5805  C  C     . LEU E  3 718  ? 55.757  35.463  -7.281  1.00 52.18 ? 2045 LEU A C     1 
ATOM   5806  O  O     . LEU E  3 718  ? 56.936  35.708  -7.012  1.00 52.25 ? 2045 LEU A O     1 
ATOM   5807  C  CB    . LEU E  3 718  ? 54.911  35.431  -9.619  1.00 51.97 ? 2045 LEU A CB    1 
ATOM   5808  C  CG    . LEU E  3 718  ? 55.868  36.548  -10.052 1.00 51.86 ? 2045 LEU A CG    1 
ATOM   5809  C  CD1   . LEU E  3 718  ? 57.120  35.982  -10.709 1.00 51.69 ? 2045 LEU A CD1   1 
ATOM   5810  C  CD2   . LEU E  3 718  ? 55.184  37.544  -10.969 1.00 51.65 ? 2045 LEU A CD2   1 
ATOM   5811  N  N     . SER E  3 719  ? 54.725  35.938  -6.580  1.00 51.66 ? 2046 SER A N     1 
ATOM   5812  C  CA    . SER E  3 719  ? 54.919  36.856  -5.459  1.00 50.82 ? 2046 SER A CA    1 
ATOM   5813  C  C     . SER E  3 719  ? 55.652  36.180  -4.307  1.00 50.13 ? 2046 SER A C     1 
ATOM   5814  O  O     . SER E  3 719  ? 56.359  36.848  -3.555  1.00 50.26 ? 2046 SER A O     1 
ATOM   5815  C  CB    . SER E  3 719  ? 53.596  37.478  -4.999  1.00 50.63 ? 2046 SER A CB    1 
ATOM   5816  O  OG    . SER E  3 719  ? 52.760  36.503  -4.411  1.00 50.73 ? 2046 SER A OG    1 
ATOM   5817  N  N     . LEU E  3 720  ? 55.496  34.862  -4.183  1.00 49.49 ? 2047 LEU A N     1 
ATOM   5818  C  CA    . LEU E  3 720  ? 56.256  34.102  -3.198  1.00 49.83 ? 2047 LEU A CA    1 
ATOM   5819  C  C     . LEU E  3 720  ? 57.721  34.020  -3.602  1.00 50.78 ? 2047 LEU A C     1 
ATOM   5820  O  O     . LEU E  3 720  ? 58.608  34.229  -2.773  1.00 52.24 ? 2047 LEU A O     1 
ATOM   5821  C  CB    . LEU E  3 720  ? 55.699  32.693  -3.009  1.00 49.46 ? 2047 LEU A CB    1 
ATOM   5822  C  CG    . LEU E  3 720  ? 55.736  32.071  -1.599  1.00 49.43 ? 2047 LEU A CG    1 
ATOM   5823  C  CD1   . LEU E  3 720  ? 55.642  30.556  -1.678  1.00 49.36 ? 2047 LEU A CD1   1 
ATOM   5824  C  CD2   . LEU E  3 720  ? 56.956  32.448  -0.790  1.00 49.91 ? 2047 LEU A CD2   1 
ATOM   5825  N  N     . ASP E  3 721  ? 57.978  33.719  -4.870  1.00 50.85 ? 2048 ASP A N     1 
ATOM   5826  C  CA    . ASP E  3 721  ? 59.346  33.681  -5.377  1.00 51.44 ? 2048 ASP A CA    1 
ATOM   5827  C  C     . ASP E  3 721  ? 60.040  35.022  -5.143  1.00 50.74 ? 2048 ASP A C     1 
ATOM   5828  O  O     . ASP E  3 721  ? 61.234  35.069  -4.873  1.00 50.97 ? 2048 ASP A O     1 
ATOM   5829  C  CB    . ASP E  3 721  ? 59.374  33.294  -6.862  1.00 53.29 ? 2048 ASP A CB    1 
ATOM   5830  C  CG    . ASP E  3 721  ? 59.067  31.800  -7.096  1.00 56.80 ? 2048 ASP A CG    1 
ATOM   5831  O  OD1   . ASP E  3 721  ? 59.184  31.002  -6.137  1.00 59.27 ? 2048 ASP A OD1   1 
ATOM   5832  O  OD2   . ASP E  3 721  ? 58.721  31.414  -8.243  1.00 57.11 ? 2048 ASP A OD2   1 
ATOM   5833  N  N     . ILE E  3 722  ? 59.276  36.107  -5.218  1.00 49.92 ? 2049 ILE A N     1 
ATOM   5834  C  CA    . ILE E  3 722  ? 59.798  37.441  -4.912  1.00 48.71 ? 2049 ILE A CA    1 
ATOM   5835  C  C     . ILE E  3 722  ? 60.039  37.595  -3.410  1.00 48.51 ? 2049 ILE A C     1 
ATOM   5836  O  O     . ILE E  3 722  ? 61.112  38.025  -2.994  1.00 49.18 ? 2049 ILE A O     1 
ATOM   5837  C  CB    . ILE E  3 722  ? 58.878  38.558  -5.451  1.00 47.85 ? 2049 ILE A CB    1 
ATOM   5838  C  CG1   . ILE E  3 722  ? 58.827  38.493  -6.974  1.00 47.71 ? 2049 ILE A CG1   1 
ATOM   5839  C  CG2   . ILE E  3 722  ? 59.371  39.924  -5.026  1.00 46.18 ? 2049 ILE A CG2   1 
ATOM   5840  C  CD1   . ILE E  3 722  ? 57.548  39.051  -7.565  1.00 49.76 ? 2049 ILE A CD1   1 
ATOM   5841  N  N     . ALA E  3 723  ? 59.048  37.231  -2.605  1.00 48.09 ? 2050 ALA A N     1 
ATOM   5842  C  CA    . ALA E  3 723  ? 59.177  37.274  -1.150  1.00 47.07 ? 2050 ALA A CA    1 
ATOM   5843  C  C     . ALA E  3 723  ? 60.378  36.472  -0.670  1.00 46.02 ? 2050 ALA A C     1 
ATOM   5844  O  O     . ALA E  3 723  ? 61.052  36.871  0.272   1.00 45.73 ? 2050 ALA A O     1 
ATOM   5845  C  CB    . ALA E  3 723  ? 57.901  36.769  -0.485  1.00 47.49 ? 2050 ALA A CB    1 
ATOM   5846  N  N     . LEU E  3 724  ? 60.643  35.350  -1.334  1.00 46.04 ? 2051 LEU A N     1 
ATOM   5847  C  CA    . LEU E  3 724  ? 61.750  34.465  -0.977  1.00 46.75 ? 2051 LEU A CA    1 
ATOM   5848  C  C     . LEU E  3 724  ? 63.113  35.071  -1.271  1.00 47.46 ? 2051 LEU A C     1 
ATOM   5849  O  O     . LEU E  3 724  ? 64.138  34.532  -0.859  1.00 48.53 ? 2051 LEU A O     1 
ATOM   5850  C  CB    . LEU E  3 724  ? 61.627  33.141  -1.715  1.00 46.46 ? 2051 LEU A CB    1 
ATOM   5851  C  CG    . LEU E  3 724  ? 60.685  32.127  -1.096  1.00 46.72 ? 2051 LEU A CG    1 
ATOM   5852  C  CD1   . LEU E  3 724  ? 60.324  31.085  -2.123  1.00 49.56 ? 2051 LEU A CD1   1 
ATOM   5853  C  CD2   . LEU E  3 724  ? 61.341  31.487  0.104   1.00 48.80 ? 2051 LEU A CD2   1 
ATOM   5854  N  N     . GLY E  3 725  ? 63.123  36.178  -2.003  1.00 47.64 ? 2052 GLY A N     1 
ATOM   5855  C  CA    . GLY E  3 725  ? 64.354  36.912  -2.274  1.00 46.82 ? 2052 GLY A CA    1 
ATOM   5856  C  C     . GLY E  3 725  ? 65.182  36.345  -3.412  1.00 46.00 ? 2052 GLY A C     1 
ATOM   5857  O  O     . GLY E  3 725  ? 65.581  37.084  -4.325  1.00 45.33 ? 2052 GLY A O     1 
ATOM   5858  N  N     . ALA E  3 726  ? 65.444  35.038  -3.356  1.00 44.80 ? 2053 ALA A N     1 
ATOM   5859  C  CA    . ALA E  3 726  ? 66.291  34.375  -4.346  1.00 44.03 ? 2053 ALA A CA    1 
ATOM   5860  C  C     . ALA E  3 726  ? 65.505  33.781  -5.514  1.00 43.50 ? 2053 ALA A C     1 
ATOM   5861  O  O     . ALA E  3 726  ? 66.073  33.133  -6.387  1.00 43.50 ? 2053 ALA A O     1 
ATOM   5862  C  CB    . ALA E  3 726  ? 67.161  33.324  -3.683  1.00 44.16 ? 2053 ALA A CB    1 
ATOM   5863  N  N     . GLY E  3 727  ? 64.200  34.008  -5.531  1.00 43.57 ? 2054 GLY A N     1 
ATOM   5864  C  CA    . GLY E  3 727  ? 63.367  33.595  -6.660  1.00 43.83 ? 2054 GLY A CA    1 
ATOM   5865  C  C     . GLY E  3 727  ? 62.793  32.192  -6.581  1.00 43.69 ? 2054 GLY A C     1 
ATOM   5866  O  O     . GLY E  3 727  ? 62.261  31.692  -7.566  1.00 43.74 ? 2054 GLY A O     1 
ATOM   5867  N  N     . GLY E  3 728  ? 62.899  31.562  -5.414  1.00 43.47 ? 2055 GLY A N     1 
ATOM   5868  C  CA    . GLY E  3 728  ? 62.356  30.229  -5.204  1.00 43.45 ? 2055 GLY A CA    1 
ATOM   5869  C  C     . GLY E  3 728  ? 63.005  29.488  -4.049  1.00 43.80 ? 2055 GLY A C     1 
ATOM   5870  O  O     . GLY E  3 728  ? 63.844  30.033  -3.342  1.00 44.15 ? 2055 GLY A O     1 
ATOM   5871  N  N     . LEU E  3 729  ? 62.601  28.239  -3.853  1.00 44.11 ? 2056 LEU A N     1 
ATOM   5872  C  CA    . LEU E  3 729  ? 63.140  27.399  -2.790  1.00 43.48 ? 2056 LEU A CA    1 
ATOM   5873  C  C     . LEU E  3 729  ? 64.503  26.852  -3.199  1.00 43.61 ? 2056 LEU A C     1 
ATOM   5874  O  O     . LEU E  3 729  ? 64.716  26.566  -4.378  1.00 43.08 ? 2056 LEU A O     1 
ATOM   5875  C  CB    . LEU E  3 729  ? 62.164  26.261  -2.484  1.00 42.99 ? 2056 LEU A CB    1 
ATOM   5876  C  CG    . LEU E  3 729  ? 60.790  26.719  -2.004  1.00 41.77 ? 2056 LEU A CG    1 
ATOM   5877  C  CD1   . LEU E  3 729  ? 59.817  25.567  -1.980  1.00 43.50 ? 2056 LEU A CD1   1 
ATOM   5878  C  CD2   . LEU E  3 729  ? 60.894  27.347  -0.629  1.00 44.44 ? 2056 LEU A CD2   1 
ATOM   5879  N  N     . PRO E  3 730  ? 65.436  26.717  -2.233  1.00 44.10 ? 2057 PRO A N     1 
ATOM   5880  C  CA    . PRO E  3 730  ? 66.812  26.301  -2.573  1.00 44.64 ? 2057 PRO A CA    1 
ATOM   5881  C  C     . PRO E  3 730  ? 67.014  24.786  -2.657  1.00 45.20 ? 2057 PRO A C     1 
ATOM   5882  O  O     . PRO E  3 730  ? 66.518  24.042  -1.815  1.00 46.54 ? 2057 PRO A O     1 
ATOM   5883  C  CB    . PRO E  3 730  ? 67.651  26.899  -1.441  1.00 44.06 ? 2057 PRO A CB    1 
ATOM   5884  C  CG    . PRO E  3 730  ? 66.699  27.046  -0.284  1.00 44.89 ? 2057 PRO A CG    1 
ATOM   5885  C  CD    . PRO E  3 730  ? 65.274  26.961  -0.789  1.00 43.48 ? 2057 PRO A CD    1 
ATOM   5886  N  N     . MET E  3 731  ? 67.741  24.344  -3.676  1.00 45.38 ? 2058 MET A N     1 
ATOM   5887  C  CA    . MET E  3 731  ? 68.026  22.926  -3.887  1.00 46.08 ? 2058 MET A CA    1 
ATOM   5888  C  C     . MET E  3 731  ? 69.046  22.397  -2.887  1.00 46.01 ? 2058 MET A C     1 
ATOM   5889  O  O     . MET E  3 731  ? 69.987  23.094  -2.517  1.00 45.91 ? 2058 MET A O     1 
ATOM   5890  C  CB    . MET E  3 731  ? 68.541  22.703  -5.305  1.00 46.85 ? 2058 MET A CB    1 
ATOM   5891  C  CG    . MET E  3 731  ? 67.535  23.045  -6.376  1.00 50.48 ? 2058 MET A CG    1 
ATOM   5892  S  SD    . MET E  3 731  ? 66.131  21.917  -6.284  1.00 58.11 ? 2058 MET A SD    1 
ATOM   5893  C  CE    . MET E  3 731  ? 66.726  20.531  -7.282  1.00 57.63 ? 2058 MET A CE    1 
ATOM   5894  N  N     . GLY E  3 732  ? 68.866  21.155  -2.455  1.00 46.27 ? 2059 GLY A N     1 
ATOM   5895  C  CA    . GLY E  3 732  ? 69.796  20.540  -1.507  1.00 45.65 ? 2059 GLY A CA    1 
ATOM   5896  C  C     . GLY E  3 732  ? 69.578  20.989  -0.074  1.00 45.34 ? 2059 GLY A C     1 
ATOM   5897  O  O     . GLY E  3 732  ? 70.388  20.691  0.806   1.00 46.20 ? 2059 GLY A O     1 
ATOM   5898  N  N     . ARG E  3 733  ? 68.478  21.702  0.158   1.00 44.13 ? 2060 ARG A N     1 
ATOM   5899  C  CA    . ARG E  3 733  ? 68.165  22.244  1.467   1.00 43.25 ? 2060 ARG A CA    1 
ATOM   5900  C  C     . ARG E  3 733  ? 66.864  21.649  1.992   1.00 43.83 ? 2060 ARG A C     1 
ATOM   5901  O  O     . ARG E  3 733  ? 66.115  21.019  1.241   1.00 44.78 ? 2060 ARG A O     1 
ATOM   5902  C  CB    . ARG E  3 733  ? 68.046  23.766  1.391   1.00 43.42 ? 2060 ARG A CB    1 
ATOM   5903  C  CG    . ARG E  3 733  ? 69.235  24.496  0.747   1.00 43.79 ? 2060 ARG A CG    1 
ATOM   5904  C  CD    . ARG E  3 733  ? 70.546  24.237  1.485   1.00 44.10 ? 2060 ARG A CD    1 
ATOM   5905  N  NE    . ARG E  3 733  ? 71.557  25.258  1.206   1.00 44.78 ? 2060 ARG A NE    1 
ATOM   5906  C  CZ    . ARG E  3 733  ? 71.711  26.382  1.910   1.00 45.87 ? 2060 ARG A CZ    1 
ATOM   5907  N  NH1   . ARG E  3 733  ? 70.914  26.635  2.940   1.00 47.86 ? 2060 ARG A NH1   1 
ATOM   5908  N  NH2   . ARG E  3 733  ? 72.662  27.258  1.594   1.00 44.64 ? 2060 ARG A NH2   1 
ATOM   5909  N  N     . ILE E  3 734  ? 66.609  21.847  3.286   1.00 43.74 ? 2061 ILE A N     1 
ATOM   5910  C  CA    . ILE E  3 734  ? 65.345  21.466  3.910   1.00 42.54 ? 2061 ILE A CA    1 
ATOM   5911  C  C     . ILE E  3 734  ? 64.473  22.708  4.065   1.00 43.34 ? 2061 ILE A C     1 
ATOM   5912  O  O     . ILE E  3 734  ? 64.961  23.780  4.437   1.00 43.77 ? 2061 ILE A O     1 
ATOM   5913  C  CB    . ILE E  3 734  ? 65.576  20.834  5.279   1.00 41.70 ? 2061 ILE A CB    1 
ATOM   5914  C  CG1   . ILE E  3 734  ? 66.419  19.568  5.133   1.00 40.42 ? 2061 ILE A CG1   1 
ATOM   5915  C  CG2   . ILE E  3 734  ? 64.247  20.536  5.965   1.00 42.09 ? 2061 ILE A CG2   1 
ATOM   5916  C  CD1   . ILE E  3 734  ? 67.141  19.148  6.420   1.00 37.97 ? 2061 ILE A CD1   1 
ATOM   5917  N  N     . VAL E  3 735  ? 63.187  22.554  3.769   1.00 43.82 ? 2062 VAL A N     1 
ATOM   5918  C  CA    . VAL E  3 735  ? 62.223  23.644  3.844   1.00 45.11 ? 2062 VAL A CA    1 
ATOM   5919  C  C     . VAL E  3 735  ? 61.000  23.164  4.631   1.00 46.11 ? 2062 VAL A C     1 
ATOM   5920  O  O     . VAL E  3 735  ? 60.593  22.006  4.492   1.00 45.88 ? 2062 VAL A O     1 
ATOM   5921  C  CB    . VAL E  3 735  ? 61.812  24.113  2.415   1.00 44.88 ? 2062 VAL A CB    1 
ATOM   5922  C  CG1   . VAL E  3 735  ? 60.582  25.002  2.447   1.00 46.32 ? 2062 VAL A CG1   1 
ATOM   5923  C  CG2   . VAL E  3 735  ? 62.943  24.838  1.752   1.00 44.02 ? 2062 VAL A CG2   1 
ATOM   5924  N  N     . GLU E  3 736  ? 60.426  24.042  5.455   1.00 46.89 ? 2063 GLU A N     1 
ATOM   5925  C  CA    . GLU E  3 736  ? 59.196  23.716  6.179   1.00 48.65 ? 2063 GLU A CA    1 
ATOM   5926  C  C     . GLU E  3 736  ? 58.069  24.691  5.844   1.00 48.34 ? 2063 GLU A C     1 
ATOM   5927  O  O     . GLU E  3 736  ? 58.278  25.911  5.855   1.00 50.71 ? 2063 GLU A O     1 
ATOM   5928  C  CB    . GLU E  3 736  ? 59.452  23.692  7.688   1.00 48.28 ? 2063 GLU A CB    1 
ATOM   5929  C  CG    . GLU E  3 736  ? 58.233  23.350  8.542   1.00 50.75 ? 2063 GLU A CG    1 
ATOM   5930  C  CD    . GLU E  3 736  ? 58.505  23.503  10.041  1.00 52.74 ? 2063 GLU A CD    1 
ATOM   5931  O  OE1   . GLU E  3 736  ? 59.474  24.210  10.402  1.00 55.11 ? 2063 GLU A OE1   1 
ATOM   5932  O  OE2   . GLU E  3 736  ? 57.762  22.912  10.865  1.00 56.14 ? 2063 GLU A OE2   1 
ATOM   5933  N  N     . ILE E  3 737  ? 56.892  24.154  5.528   1.00 45.99 ? 2064 ILE A N     1 
ATOM   5934  C  CA    . ILE E  3 737  ? 55.690  24.962  5.380   1.00 44.88 ? 2064 ILE A CA    1 
ATOM   5935  C  C     . ILE E  3 737  ? 54.708  24.540  6.456   1.00 46.65 ? 2064 ILE A C     1 
ATOM   5936  O  O     . ILE E  3 737  ? 54.362  23.352  6.558   1.00 49.25 ? 2064 ILE A O     1 
ATOM   5937  C  CB    . ILE E  3 737  ? 55.025  24.750  4.037   1.00 43.30 ? 2064 ILE A CB    1 
ATOM   5938  C  CG1   . ILE E  3 737  ? 56.014  25.017  2.921   1.00 46.03 ? 2064 ILE A CG1   1 
ATOM   5939  C  CG2   . ILE E  3 737  ? 53.835  25.670  3.884   1.00 42.27 ? 2064 ILE A CG2   1 
ATOM   5940  C  CD1   . ILE E  3 737  ? 55.642  24.356  1.602   1.00 51.18 ? 2064 ILE A CD1   1 
ATOM   5941  N  N     . TYR E  3 738  ? 54.255  25.493  7.264   1.00 45.32 ? 2065 TYR A N     1 
ATOM   5942  C  CA    . TYR E  3 738  ? 53.234  25.199  8.260   1.00 43.60 ? 2065 TYR A CA    1 
ATOM   5943  C  C     . TYR E  3 738  ? 52.078  26.185  8.142   1.00 42.88 ? 2065 TYR A C     1 
ATOM   5944  O  O     . TYR E  3 738  ? 52.221  27.241  7.525   1.00 43.08 ? 2065 TYR A O     1 
ATOM   5945  C  CB    . TYR E  3 738  ? 53.838  25.182  9.669   1.00 43.54 ? 2065 TYR A CB    1 
ATOM   5946  C  CG    . TYR E  3 738  ? 54.374  26.518  10.160  1.00 44.82 ? 2065 TYR A CG    1 
ATOM   5947  C  CD1   . TYR E  3 738  ? 53.508  27.511  10.615  1.00 44.38 ? 2065 TYR A CD1   1 
ATOM   5948  C  CD2   . TYR E  3 738  ? 55.754  26.778  10.201  1.00 44.04 ? 2065 TYR A CD2   1 
ATOM   5949  C  CE1   . TYR E  3 738  ? 53.989  28.727  11.067  1.00 45.04 ? 2065 TYR A CE1   1 
ATOM   5950  C  CE2   . TYR E  3 738  ? 56.247  27.995  10.666  1.00 42.40 ? 2065 TYR A CE2   1 
ATOM   5951  C  CZ    . TYR E  3 738  ? 55.354  28.969  11.096  1.00 44.50 ? 2065 TYR A CZ    1 
ATOM   5952  O  OH    . TYR E  3 738  ? 55.797  30.198  11.567  1.00 45.41 ? 2065 TYR A OH    1 
ATOM   5953  N  N     . GLY E  3 739  ? 50.942  25.833  8.733   1.00 42.10 ? 2066 GLY A N     1 
ATOM   5954  C  CA    . GLY E  3 739  ? 49.760  26.685  8.742   1.00 41.27 ? 2066 GLY A CA    1 
ATOM   5955  C  C     . GLY E  3 739  ? 48.549  25.918  9.233   1.00 41.33 ? 2066 GLY A C     1 
ATOM   5956  O  O     . GLY E  3 739  ? 48.640  24.719  9.465   1.00 41.51 ? 2066 GLY A O     1 
ATOM   5957  N  N     . PRO E  3 740  ? 47.406  26.605  9.390   1.00 41.41 ? 2067 PRO A N     1 
ATOM   5958  C  CA    . PRO E  3 740  ? 46.155  25.998  9.842   1.00 42.81 ? 2067 PRO A CA    1 
ATOM   5959  C  C     . PRO E  3 740  ? 45.597  25.023  8.819   1.00 43.15 ? 2067 PRO A C     1 
ATOM   5960  O  O     . PRO E  3 740  ? 46.114  24.977  7.705   1.00 42.63 ? 2067 PRO A O     1 
ATOM   5961  C  CB    . PRO E  3 740  ? 45.209  27.196  9.971   1.00 44.20 ? 2067 PRO A CB    1 
ATOM   5962  C  CG    . PRO E  3 740  ? 46.084  28.409  9.938   1.00 42.66 ? 2067 PRO A CG    1 
ATOM   5963  C  CD    . PRO E  3 740  ? 47.255  28.046  9.136   1.00 41.27 ? 2067 PRO A CD    1 
ATOM   5964  N  N     . GLU E  3 741  ? 44.565  24.254  9.190   1.00 43.60 ? 2068 GLU A N     1 
ATOM   5965  C  CA    . GLU E  3 741  ? 43.947  23.304  8.259   1.00 44.99 ? 2068 GLU A CA    1 
ATOM   5966  C  C     . GLU E  3 741  ? 43.370  23.980  7.027   1.00 45.08 ? 2068 GLU A C     1 
ATOM   5967  O  O     . GLU E  3 741  ? 42.845  25.096  7.100   1.00 43.98 ? 2068 GLU A O     1 
ATOM   5968  C  CB    . GLU E  3 741  ? 42.879  22.445  8.923   1.00 45.57 ? 2068 GLU A CB    1 
ATOM   5969  C  CG    . GLU E  3 741  ? 42.397  22.963  10.245  1.00 51.37 ? 2068 GLU A CG    1 
ATOM   5970  C  CD    . GLU E  3 741  ? 41.611  24.255  10.149  1.00 55.43 ? 2068 GLU A CD    1 
ATOM   5971  O  OE1   . GLU E  3 741  ? 42.141  25.286  10.620  1.00 57.82 ? 2068 GLU A OE1   1 
ATOM   5972  O  OE2   . GLU E  3 741  ? 40.474  24.242  9.616   1.00 57.16 ? 2068 GLU A OE2   1 
ATOM   5973  N  N     . SER E  3 742  ? 43.504  23.290  5.894   1.00 45.86 ? 2069 SER A N     1 
ATOM   5974  C  CA    . SER E  3 742  ? 43.038  23.771  4.595   1.00 46.49 ? 2069 SER A CA    1 
ATOM   5975  C  C     . SER E  3 742  ? 43.586  25.144  4.225   1.00 46.42 ? 2069 SER A C     1 
ATOM   5976  O  O     . SER E  3 742  ? 42.904  25.930  3.564   1.00 47.71 ? 2069 SER A O     1 
ATOM   5977  C  CB    . SER E  3 742  ? 41.504  23.757  4.527   1.00 46.99 ? 2069 SER A CB    1 
ATOM   5978  O  OG    . SER E  3 742  ? 41.023  22.476  4.143   1.00 48.99 ? 2069 SER A OG    1 
ATOM   5979  N  N     . SER E  3 743  ? 44.813  25.435  4.644   1.00 45.67 ? 2070 SER A N     1 
ATOM   5980  C  CA    . SER E  3 743  ? 45.404  26.748  4.374   1.00 45.37 ? 2070 SER A CA    1 
ATOM   5981  C  C     . SER E  3 743  ? 46.087  26.762  3.020   1.00 44.92 ? 2070 SER A C     1 
ATOM   5982  O  O     . SER E  3 743  ? 46.288  27.825  2.430   1.00 45.78 ? 2070 SER A O     1 
ATOM   5983  C  CB    . SER E  3 743  ? 46.388  27.159  5.465   1.00 45.64 ? 2070 SER A CB    1 
ATOM   5984  O  OG    . SER E  3 743  ? 47.338  26.131  5.683   1.00 48.23 ? 2070 SER A OG    1 
ATOM   5985  N  N     . GLY E  3 744  ? 46.437  25.580  2.526   1.00 43.68 ? 2071 GLY A N     1 
ATOM   5986  C  CA    . GLY E  3 744  ? 47.017  25.458  1.201   1.00 41.78 ? 2071 GLY A CA    1 
ATOM   5987  C  C     . GLY E  3 744  ? 48.373  24.802  1.184   1.00 40.76 ? 2071 GLY A C     1 
ATOM   5988  O  O     . GLY E  3 744  ? 49.075  24.874  0.186   1.00 41.02 ? 2071 GLY A O     1 
ATOM   5989  N  N     . LYS E  3 745  ? 48.735  24.152  2.284   1.00 40.57 ? 2072 LYS A N     1 
ATOM   5990  C  CA    . LYS E  3 745  ? 50.044  23.529  2.424   1.00 40.49 ? 2072 LYS A CA    1 
ATOM   5991  C  C     . LYS E  3 745  ? 50.295  22.481  1.337   1.00 41.69 ? 2072 LYS A C     1 
ATOM   5992  O  O     . LYS E  3 745  ? 51.281  22.578  0.610   1.00 43.37 ? 2072 LYS A O     1 
ATOM   5993  C  CB    . LYS E  3 745  ? 50.225  22.943  3.825   1.00 39.96 ? 2072 LYS A CB    1 
ATOM   5994  C  CG    . LYS E  3 745  ? 49.996  23.943  4.950   1.00 39.85 ? 2072 LYS A CG    1 
ATOM   5995  C  CD    . LYS E  3 745  ? 50.112  23.323  6.334   1.00 40.67 ? 2072 LYS A CD    1 
ATOM   5996  C  CE    . LYS E  3 745  ? 48.988  22.332  6.605   1.00 42.99 ? 2072 LYS A CE    1 
ATOM   5997  N  NZ    . LYS E  3 745  ? 47.637  22.962  6.673   1.00 42.65 ? 2072 LYS A NZ    1 
ATOM   5998  N  N     . THR E  3 746  ? 49.405  21.502  1.203   1.00 42.13 ? 2073 THR A N     1 
ATOM   5999  C  CA    . THR E  3 746  ? 49.550  20.484  0.160   1.00 42.62 ? 2073 THR A CA    1 
ATOM   6000  C  C     . THR E  3 746  ? 49.492  21.103  -1.227  1.00 43.32 ? 2073 THR A C     1 
ATOM   6001  O  O     . THR E  3 746  ? 50.362  20.830  -2.058  1.00 43.26 ? 2073 THR A O     1 
ATOM   6002  C  CB    . THR E  3 746  ? 48.461  19.409  0.237   1.00 43.16 ? 2073 THR A CB    1 
ATOM   6003  O  OG1   . THR E  3 746  ? 48.344  18.950  1.583   1.00 40.77 ? 2073 THR A OG1   1 
ATOM   6004  C  CG2   . THR E  3 746  ? 48.798  18.234  -0.673  1.00 41.72 ? 2073 THR A CG2   1 
ATOM   6005  N  N     . THR E  3 747  ? 48.469  21.927  -1.470  1.00 43.51 ? 2074 THR A N     1 
ATOM   6006  C  CA    . THR E  3 747  ? 48.297  22.582  -2.764  1.00 44.64 ? 2074 THR A CA    1 
ATOM   6007  C  C     . THR E  3 747  ? 49.599  23.259  -3.201  1.00 45.56 ? 2074 THR A C     1 
ATOM   6008  O  O     . THR E  3 747  ? 50.099  22.998  -4.288  1.00 45.47 ? 2074 THR A O     1 
ATOM   6009  C  CB    . THR E  3 747  ? 47.130  23.591  -2.755  1.00 44.79 ? 2074 THR A CB    1 
ATOM   6010  O  OG1   . THR E  3 747  ? 45.891  22.881  -2.694  1.00 46.54 ? 2074 THR A OG1   1 
ATOM   6011  C  CG2   . THR E  3 747  ? 47.121  24.430  -4.020  1.00 45.69 ? 2074 THR A CG2   1 
ATOM   6012  N  N     . LEU E  3 748  ? 50.158  24.102  -2.339  1.00 46.57 ? 2075 LEU A N     1 
ATOM   6013  C  CA    . LEU E  3 748  ? 51.388  24.808  -2.658  1.00 47.94 ? 2075 LEU A CA    1 
ATOM   6014  C  C     . LEU E  3 748  ? 52.488  23.822  -2.990  1.00 48.08 ? 2075 LEU A C     1 
ATOM   6015  O  O     . LEU E  3 748  ? 53.115  23.914  -4.038  1.00 49.27 ? 2075 LEU A O     1 
ATOM   6016  C  CB    . LEU E  3 748  ? 51.812  25.715  -1.506  1.00 49.02 ? 2075 LEU A CB    1 
ATOM   6017  C  CG    . LEU E  3 748  ? 52.919  26.717  -1.832  1.00 49.80 ? 2075 LEU A CG    1 
ATOM   6018  C  CD1   . LEU E  3 748  ? 52.515  28.086  -1.333  1.00 53.25 ? 2075 LEU A CD1   1 
ATOM   6019  C  CD2   . LEU E  3 748  ? 54.214  26.280  -1.203  1.00 49.06 ? 2075 LEU A CD2   1 
ATOM   6020  N  N     . THR E  3 749  ? 52.705  22.880  -2.087  1.00 47.73 ? 2076 THR A N     1 
ATOM   6021  C  CA    . THR E  3 749  ? 53.604  21.753  -2.311  1.00 48.08 ? 2076 THR A CA    1 
ATOM   6022  C  C     . THR E  3 749  ? 53.495  21.131  -3.716  1.00 46.87 ? 2076 THR A C     1 
ATOM   6023  O  O     . THR E  3 749  ? 54.499  21.009  -4.427  1.00 45.61 ? 2076 THR A O     1 
ATOM   6024  C  CB    . THR E  3 749  ? 53.366  20.689  -1.212  1.00 48.58 ? 2076 THR A CB    1 
ATOM   6025  O  OG1   . THR E  3 749  ? 54.344  20.861  -0.188  1.00 51.15 ? 2076 THR A OG1   1 
ATOM   6026  C  CG2   . THR E  3 749  ? 53.457  19.281  -1.752  1.00 48.26 ? 2076 THR A CG2   1 
ATOM   6027  N  N     . LEU E  3 750  ? 52.276  20.751  -4.101  1.00 46.05 ? 2077 LEU A N     1 
ATOM   6028  C  CA    . LEU E  3 750  ? 52.022  20.124  -5.395  1.00 44.72 ? 2077 LEU A CA    1 
ATOM   6029  C  C     . LEU E  3 750  ? 52.366  21.065  -6.543  1.00 44.73 ? 2077 LEU A C     1 
ATOM   6030  O  O     . LEU E  3 750  ? 52.885  20.621  -7.566  1.00 44.26 ? 2077 LEU A O     1 
ATOM   6031  C  CB    . LEU E  3 750  ? 50.562  19.667  -5.497  1.00 44.17 ? 2077 LEU A CB    1 
ATOM   6032  C  CG    . LEU E  3 750  ? 50.102  18.574  -4.534  1.00 42.81 ? 2077 LEU A CG    1 
ATOM   6033  C  CD1   . LEU E  3 750  ? 48.599  18.464  -4.530  1.00 41.74 ? 2077 LEU A CD1   1 
ATOM   6034  C  CD2   . LEU E  3 750  ? 50.732  17.238  -4.880  1.00 42.62 ? 2077 LEU A CD2   1 
ATOM   6035  N  N     . GLN E  3 751  ? 52.089  22.360  -6.358  1.00 44.77 ? 2078 GLN A N     1 
ATOM   6036  C  CA    . GLN E  3 751  ? 52.421  23.383  -7.351  1.00 44.94 ? 2078 GLN A CA    1 
ATOM   6037  C  C     . GLN E  3 751  ? 53.923  23.455  -7.618  1.00 44.02 ? 2078 GLN A C     1 
ATOM   6038  O  O     . GLN E  3 751  ? 54.325  23.587  -8.773  1.00 43.71 ? 2078 GLN A O     1 
ATOM   6039  C  CB    . GLN E  3 751  ? 51.889  24.761  -6.949  1.00 45.71 ? 2078 GLN A CB    1 
ATOM   6040  C  CG    . GLN E  3 751  ? 50.375  24.863  -6.832  1.00 48.08 ? 2078 GLN A CG    1 
ATOM   6041  C  CD    . GLN E  3 751  ? 49.674  24.943  -8.176  1.00 51.70 ? 2078 GLN A CD    1 
ATOM   6042  O  OE1   . GLN E  3 751  ? 49.144  25.996  -8.549  1.00 54.60 ? 2078 GLN A OE1   1 
ATOM   6043  N  NE2   . GLN E  3 751  ? 49.655  23.829  -8.911  1.00 51.46 ? 2078 GLN A NE2   1 
ATOM   6044  N  N     . VAL E  3 752  ? 54.743  23.361  -6.567  1.00 42.76 ? 2079 VAL A N     1 
ATOM   6045  C  CA    . VAL E  3 752  ? 56.193  23.352  -6.764  1.00 42.75 ? 2079 VAL A CA    1 
ATOM   6046  C  C     . VAL E  3 752  ? 56.625  22.079  -7.479  1.00 43.23 ? 2079 VAL A C     1 
ATOM   6047  O  O     . VAL E  3 752  ? 57.471  22.140  -8.376  1.00 46.35 ? 2079 VAL A O     1 
ATOM   6048  C  CB    . VAL E  3 752  ? 57.072  23.649  -5.479  1.00 42.47 ? 2079 VAL A CB    1 
ATOM   6049  C  CG1   . VAL E  3 752  ? 56.228  24.116  -4.311  1.00 43.63 ? 2079 VAL A CG1   1 
ATOM   6050  C  CG2   . VAL E  3 752  ? 57.960  22.466  -5.086  1.00 39.71 ? 2079 VAL A CG2   1 
ATOM   6051  N  N     . ILE E  3 753  ? 56.037  20.945  -7.113  1.00 42.17 ? 2080 ILE A N     1 
ATOM   6052  C  CA    . ILE E  3 753  ? 56.285  19.696  -7.838  1.00 42.39 ? 2080 ILE A CA    1 
ATOM   6053  C  C     . ILE E  3 753  ? 55.936  19.845  -9.328  1.00 42.40 ? 2080 ILE A C     1 
ATOM   6054  O  O     . ILE E  3 753  ? 56.752  19.534  -10.200 1.00 41.10 ? 2080 ILE A O     1 
ATOM   6055  C  CB    . ILE E  3 753  ? 55.518  18.502  -7.226  1.00 41.88 ? 2080 ILE A CB    1 
ATOM   6056  C  CG1   . ILE E  3 753  ? 56.158  18.096  -5.902  1.00 41.58 ? 2080 ILE A CG1   1 
ATOM   6057  C  CG2   . ILE E  3 753  ? 55.509  17.310  -8.188  1.00 40.98 ? 2080 ILE A CG2   1 
ATOM   6058  C  CD1   . ILE E  3 753  ? 55.310  17.179  -5.072  1.00 42.27 ? 2080 ILE A CD1   1 
ATOM   6059  N  N     . ALA E  3 754  ? 54.730  20.341  -9.600  1.00 42.78 ? 2081 ALA A N     1 
ATOM   6060  C  CA    . ALA E  3 754  ? 54.267  20.557  -10.965 1.00 43.71 ? 2081 ALA A CA    1 
ATOM   6061  C  C     . ALA E  3 754  ? 55.284  21.377  -11.761 1.00 45.08 ? 2081 ALA A C     1 
ATOM   6062  O  O     . ALA E  3 754  ? 55.661  21.005  -12.875 1.00 46.29 ? 2081 ALA A O     1 
ATOM   6063  C  CB    . ALA E  3 754  ? 52.905  21.244  -10.969 1.00 42.94 ? 2081 ALA A CB    1 
ATOM   6064  N  N     . ALA E  3 755  ? 55.734  22.483  -11.174 1.00 45.06 ? 2082 ALA A N     1 
ATOM   6065  C  CA    . ALA E  3 755  ? 56.696  23.366  -11.804 1.00 44.57 ? 2082 ALA A CA    1 
ATOM   6066  C  C     . ALA E  3 755  ? 58.019  22.651  -12.044 1.00 45.30 ? 2082 ALA A C     1 
ATOM   6067  O  O     . ALA E  3 755  ? 58.635  22.823  -13.102 1.00 46.32 ? 2082 ALA A O     1 
ATOM   6068  C  CB    . ALA E  3 755  ? 56.899  24.608  -10.948 1.00 44.45 ? 2082 ALA A CB    1 
ATOM   6069  N  N     . ALA E  3 756  ? 58.454  21.860  -11.061 1.00 45.18 ? 2083 ALA A N     1 
ATOM   6070  C  CA    . ALA E  3 756  ? 59.716  21.119  -11.151 1.00 45.12 ? 2083 ALA A CA    1 
ATOM   6071  C  C     . ALA E  3 756  ? 59.656  20.048  -12.236 1.00 45.10 ? 2083 ALA A C     1 
ATOM   6072  O  O     . ALA E  3 756  ? 60.617  19.850  -12.979 1.00 45.48 ? 2083 ALA A O     1 
ATOM   6073  C  CB    . ALA E  3 756  ? 60.066  20.502  -9.819  1.00 44.83 ? 2083 ALA A CB    1 
ATOM   6074  N  N     . GLN E  3 757  ? 58.519  19.371  -12.327 1.00 45.24 ? 2084 GLN A N     1 
ATOM   6075  C  CA    . GLN E  3 757  ? 58.307  18.352  -13.350 1.00 45.72 ? 2084 GLN A CA    1 
ATOM   6076  C  C     . GLN E  3 757  ? 58.273  18.977  -14.729 1.00 45.76 ? 2084 GLN A C     1 
ATOM   6077  O  O     . GLN E  3 757  ? 58.757  18.392  -15.689 1.00 44.86 ? 2084 GLN A O     1 
ATOM   6078  C  CB    . GLN E  3 757  ? 57.007  17.590  -13.097 1.00 46.10 ? 2084 GLN A CB    1 
ATOM   6079  C  CG    . GLN E  3 757  ? 57.069  16.659  -11.909 1.00 46.15 ? 2084 GLN A CG    1 
ATOM   6080  C  CD    . GLN E  3 757  ? 55.825  15.833  -11.772 1.00 46.38 ? 2084 GLN A CD    1 
ATOM   6081  O  OE1   . GLN E  3 757  ? 54.714  16.327  -11.968 1.00 47.61 ? 2084 GLN A OE1   1 
ATOM   6082  N  NE2   . GLN E  3 757  ? 55.998  14.563  -11.430 1.00 46.17 ? 2084 GLN A NE2   1 
ATOM   6083  N  N     . ARG E  3 758  ? 57.700  20.174  -14.807 1.00 47.36 ? 2085 ARG A N     1 
ATOM   6084  C  CA    . ARG E  3 758  ? 57.635  20.952  -16.036 1.00 49.57 ? 2085 ARG A CA    1 
ATOM   6085  C  C     . ARG E  3 758  ? 59.043  21.201  -16.587 1.00 51.05 ? 2085 ARG A C     1 
ATOM   6086  O  O     . ARG E  3 758  ? 59.202  21.553  -17.757 1.00 51.10 ? 2085 ARG A O     1 
ATOM   6087  C  CB    . ARG E  3 758  ? 56.945  22.290  -15.752 1.00 50.23 ? 2085 ARG A CB    1 
ATOM   6088  C  CG    . ARG E  3 758  ? 56.005  22.811  -16.839 1.00 51.28 ? 2085 ARG A CG    1 
ATOM   6089  C  CD    . ARG E  3 758  ? 54.501  22.571  -16.532 1.00 52.28 ? 2085 ARG A CD    1 
ATOM   6090  N  NE    . ARG E  3 758  ? 54.091  22.798  -15.134 1.00 53.36 ? 2085 ARG A NE    1 
ATOM   6091  C  CZ    . ARG E  3 758  ? 54.169  23.955  -14.467 1.00 53.48 ? 2085 ARG A CZ    1 
ATOM   6092  N  NH1   . ARG E  3 758  ? 54.676  25.048  -15.025 1.00 54.48 ? 2085 ARG A NH1   1 
ATOM   6093  N  NH2   . ARG E  3 758  ? 53.756  24.015  -13.213 1.00 54.37 ? 2085 ARG A NH2   1 
ATOM   6094  N  N     . GLU E  3 759  ? 60.056  21.010  -15.737 1.00 52.70 ? 2086 GLU A N     1 
ATOM   6095  C  CA    . GLU E  3 759  ? 61.457  21.192  -16.115 1.00 54.13 ? 2086 GLU A CA    1 
ATOM   6096  C  C     . GLU E  3 759  ? 62.282  19.918  -16.009 1.00 53.99 ? 2086 GLU A C     1 
ATOM   6097  O  O     . GLU E  3 759  ? 63.487  19.973  -15.779 1.00 54.44 ? 2086 GLU A O     1 
ATOM   6098  C  CB    . GLU E  3 759  ? 62.099  22.255  -15.246 1.00 55.25 ? 2086 GLU A CB    1 
ATOM   6099  C  CG    . GLU E  3 759  ? 61.444  23.600  -15.347 1.00 61.62 ? 2086 GLU A CG    1 
ATOM   6100  C  CD    . GLU E  3 759  ? 62.068  24.597  -14.400 1.00 67.62 ? 2086 GLU A CD    1 
ATOM   6101  O  OE1   . GLU E  3 759  ? 62.157  25.790  -14.789 1.00 70.27 ? 2086 GLU A OE1   1 
ATOM   6102  O  OE2   . GLU E  3 759  ? 62.479  24.184  -13.280 1.00 69.73 ? 2086 GLU A OE2   1 
ATOM   6103  N  N     . GLY E  3 760  ? 61.626  18.773  -16.163 1.00 54.20 ? 2087 GLY A N     1 
ATOM   6104  C  CA    . GLY E  3 760  ? 62.306  17.477  -16.233 1.00 53.00 ? 2087 GLY A CA    1 
ATOM   6105  C  C     . GLY E  3 760  ? 62.921  16.981  -14.938 1.00 51.39 ? 2087 GLY A C     1 
ATOM   6106  O  O     . GLY E  3 760  ? 63.827  16.146  -14.959 1.00 51.02 ? 2087 GLY A O     1 
ATOM   6107  N  N     . LYS E  3 761  ? 62.437  17.487  -13.813 1.00 50.27 ? 2088 LYS A N     1 
ATOM   6108  C  CA    . LYS E  3 761  ? 62.927  17.029  -12.519 1.00 50.50 ? 2088 LYS A CA    1 
ATOM   6109  C  C     . LYS E  3 761  ? 62.067  15.899  -11.974 1.00 50.17 ? 2088 LYS A C     1 
ATOM   6110  O  O     . LYS E  3 761  ? 60.867  15.840  -12.240 1.00 50.63 ? 2088 LYS A O     1 
ATOM   6111  C  CB    . LYS E  3 761  ? 62.998  18.182  -11.522 1.00 51.11 ? 2088 LYS A CB    1 
ATOM   6112  C  CG    . LYS E  3 761  ? 64.054  19.213  -11.871 1.00 51.77 ? 2088 LYS A CG    1 
ATOM   6113  C  CD    . LYS E  3 761  ? 64.385  20.083  -10.678 1.00 52.93 ? 2088 LYS A CD    1 
ATOM   6114  C  CE    . LYS E  3 761  ? 65.640  20.904  -10.919 1.00 54.45 ? 2088 LYS A CE    1 
ATOM   6115  N  NZ    . LYS E  3 761  ? 65.386  22.037  -11.851 1.00 56.99 ? 2088 LYS A NZ    1 
ATOM   6116  N  N     . THR E  3 762  ? 62.685  14.994  -11.223 1.00 49.71 ? 2089 THR A N     1 
ATOM   6117  C  CA    . THR E  3 762  ? 61.969  13.858  -10.648 1.00 50.34 ? 2089 THR A CA    1 
ATOM   6118  C  C     . THR E  3 762  ? 61.555  14.197  -9.224  1.00 50.51 ? 2089 THR A C     1 
ATOM   6119  O  O     . THR E  3 762  ? 62.360  14.702  -8.451  1.00 51.43 ? 2089 THR A O     1 
ATOM   6120  C  CB    . THR E  3 762  ? 62.824  12.580  -10.647 1.00 50.57 ? 2089 THR A CB    1 
ATOM   6121  O  OG1   . THR E  3 762  ? 63.447  12.414  -11.927 1.00 52.25 ? 2089 THR A OG1   1 
ATOM   6122  C  CG2   . THR E  3 762  ? 61.968  11.359  -10.369 1.00 51.21 ? 2089 THR A CG2   1 
ATOM   6123  N  N     . CYS E  3 763  ? 60.297  13.933  -8.883  1.00 50.12 ? 2090 CYS A N     1 
ATOM   6124  C  CA    . CYS E  3 763  ? 59.779  14.295  -7.570  1.00 49.88 ? 2090 CYS A CA    1 
ATOM   6125  C  C     . CYS E  3 763  ? 59.141  13.122  -6.851  1.00 49.91 ? 2090 CYS A C     1 
ATOM   6126  O  O     . CYS E  3 763  ? 58.581  12.217  -7.479  1.00 51.10 ? 2090 CYS A O     1 
ATOM   6127  C  CB    . CYS E  3 763  ? 58.746  15.407  -7.684  1.00 50.93 ? 2090 CYS A CB    1 
ATOM   6128  S  SG    . CYS E  3 763  ? 59.261  16.814  -8.648  1.00 52.87 ? 2090 CYS A SG    1 
ATOM   6129  N  N     . ALA E  3 764  ? 59.219  13.154  -5.526  1.00 48.64 ? 2091 ALA A N     1 
ATOM   6130  C  CA    . ALA E  3 764  ? 58.615  12.126  -4.698  1.00 48.23 ? 2091 ALA A CA    1 
ATOM   6131  C  C     . ALA E  3 764  ? 57.706  12.778  -3.684  1.00 48.02 ? 2091 ALA A C     1 
ATOM   6132  O  O     . ALA E  3 764  ? 58.015  13.847  -3.170  1.00 48.47 ? 2091 ALA A O     1 
ATOM   6133  C  CB    . ALA E  3 764  ? 59.680  11.310  -4.001  1.00 47.72 ? 2091 ALA A CB    1 
ATOM   6134  N  N     . PHE E  3 765  ? 56.585  12.128  -3.402  1.00 47.86 ? 2092 PHE A N     1 
ATOM   6135  C  CA    . PHE E  3 765  ? 55.631  12.629  -2.426  1.00 48.36 ? 2092 PHE A CA    1 
ATOM   6136  C  C     . PHE E  3 765  ? 55.411  11.569  -1.357  1.00 49.32 ? 2092 PHE A C     1 
ATOM   6137  O  O     . PHE E  3 765  ? 54.980  10.455  -1.665  1.00 50.05 ? 2092 PHE A O     1 
ATOM   6138  C  CB    . PHE E  3 765  ? 54.306  12.975  -3.109  1.00 47.68 ? 2092 PHE A CB    1 
ATOM   6139  C  CG    . PHE E  3 765  ? 53.381  13.787  -2.258  1.00 47.88 ? 2092 PHE A CG    1 
ATOM   6140  C  CD1   . PHE E  3 765  ? 53.366  15.174  -2.358  1.00 47.78 ? 2092 PHE A CD1   1 
ATOM   6141  C  CD2   . PHE E  3 765  ? 52.513  13.170  -1.360  1.00 49.10 ? 2092 PHE A CD2   1 
ATOM   6142  C  CE1   . PHE E  3 765  ? 52.510  15.942  -1.576  1.00 47.21 ? 2092 PHE A CE1   1 
ATOM   6143  C  CE2   . PHE E  3 765  ? 51.649  13.926  -0.571  1.00 50.01 ? 2092 PHE A CE2   1 
ATOM   6144  C  CZ    . PHE E  3 765  ? 51.656  15.321  -0.677  1.00 49.09 ? 2092 PHE A CZ    1 
ATOM   6145  N  N     . ILE E  3 766  ? 55.717  11.910  -0.109  1.00 49.54 ? 2093 ILE A N     1 
ATOM   6146  C  CA    . ILE E  3 766  ? 55.496  10.994  1.000   1.00 50.13 ? 2093 ILE A CA    1 
ATOM   6147  C  C     . ILE E  3 766  ? 54.219  11.406  1.723   1.00 51.18 ? 2093 ILE A C     1 
ATOM   6148  O  O     . ILE E  3 766  ? 54.217  12.353  2.505   1.00 53.02 ? 2093 ILE A O     1 
ATOM   6149  C  CB    . ILE E  3 766  ? 56.689  10.962  1.995   1.00 50.09 ? 2093 ILE A CB    1 
ATOM   6150  C  CG1   . ILE E  3 766  ? 58.047  10.988  1.271   1.00 49.04 ? 2093 ILE A CG1   1 
ATOM   6151  C  CG2   . ILE E  3 766  ? 56.571  9.761   2.932   1.00 51.02 ? 2093 ILE A CG2   1 
ATOM   6152  C  CD1   . ILE E  3 766  ? 58.366  9.762   0.433   1.00 48.32 ? 2093 ILE A CD1   1 
ATOM   6153  N  N     . ASP E  3 767  ? 53.132  10.692  1.451   1.00 51.57 ? 2094 ASP A N     1 
ATOM   6154  C  CA    . ASP E  3 767  ? 51.820  11.048  1.973   1.00 52.24 ? 2094 ASP A CA    1 
ATOM   6155  C  C     . ASP E  3 767  ? 51.554  10.358  3.306   1.00 52.72 ? 2094 ASP A C     1 
ATOM   6156  O  O     . ASP E  3 767  ? 50.726  9.436   3.392   1.00 53.19 ? 2094 ASP A O     1 
ATOM   6157  C  CB    . ASP E  3 767  ? 50.733  10.697  0.949   1.00 52.70 ? 2094 ASP A CB    1 
ATOM   6158  C  CG    . ASP E  3 767  ? 49.350  11.194  1.355   1.00 54.87 ? 2094 ASP A CG    1 
ATOM   6159  O  OD1   . ASP E  3 767  ? 49.240  12.297  1.953   1.00 58.68 ? 2094 ASP A OD1   1 
ATOM   6160  O  OD2   . ASP E  3 767  ? 48.370  10.481  1.060   1.00 52.84 ? 2094 ASP A OD2   1 
ATOM   6161  N  N     . ALA E  3 768  ? 52.251  10.810  4.347   1.00 52.12 ? 2095 ALA A N     1 
ATOM   6162  C  CA    . ALA E  3 768  ? 52.102  10.227  5.679   1.00 52.02 ? 2095 ALA A CA    1 
ATOM   6163  C  C     . ALA E  3 768  ? 50.743  10.560  6.272   1.00 52.65 ? 2095 ALA A C     1 
ATOM   6164  O  O     . ALA E  3 768  ? 50.258  9.874   7.171   1.00 53.25 ? 2095 ALA A O     1 
ATOM   6165  C  CB    . ALA E  3 768  ? 53.192  10.720  6.584   1.00 51.89 ? 2095 ALA A CB    1 
ATOM   6166  N  N     . GLU E  3 769  ? 50.142  11.628  5.758   1.00 53.49 ? 2096 GLU A N     1 
ATOM   6167  C  CA    . GLU E  3 769  ? 48.861  12.127  6.228   1.00 53.40 ? 2096 GLU A CA    1 
ATOM   6168  C  C     . GLU E  3 769  ? 47.739  11.319  5.608   1.00 52.04 ? 2096 GLU A C     1 
ATOM   6169  O  O     . GLU E  3 769  ? 46.598  11.410  6.058   1.00 52.52 ? 2096 GLU A O     1 
ATOM   6170  C  CB    . GLU E  3 769  ? 48.721  13.603  5.866   1.00 54.25 ? 2096 GLU A CB    1 
ATOM   6171  C  CG    . GLU E  3 769  ? 48.019  14.452  6.907   1.00 55.93 ? 2096 GLU A CG    1 
ATOM   6172  C  CD    . GLU E  3 769  ? 47.877  15.923  6.490   1.00 57.03 ? 2096 GLU A CD    1 
ATOM   6173  O  OE1   . GLU E  3 769  ? 47.759  16.211  5.268   1.00 59.42 ? 2096 GLU A OE1   1 
ATOM   6174  O  OE2   . GLU E  3 769  ? 47.874  16.797  7.396   1.00 58.98 ? 2096 GLU A OE2   1 
ATOM   6175  N  N     . HIS E  3 770  ? 48.078  10.530  4.583   1.00 51.21 ? 2097 HIS A N     1 
ATOM   6176  C  CA    . HIS E  3 770  ? 47.147  9.608   3.901   1.00 50.37 ? 2097 HIS A CA    1 
ATOM   6177  C  C     . HIS E  3 770  ? 45.897  10.300  3.350   1.00 49.77 ? 2097 HIS A C     1 
ATOM   6178  O  O     . HIS E  3 770  ? 44.778  9.827   3.551   1.00 48.83 ? 2097 HIS A O     1 
ATOM   6179  C  CB    . HIS E  3 770  ? 46.742  8.450   4.817   1.00 49.31 ? 2097 HIS A CB    1 
ATOM   6180  C  CG    . HIS E  3 770  ? 47.857  7.505   5.126   1.00 51.32 ? 2097 HIS A CG    1 
ATOM   6181  N  ND1   . HIS E  3 770  ? 48.011  6.299   4.474   1.00 53.56 ? 2097 HIS A ND1   1 
ATOM   6182  C  CD2   . HIS E  3 770  ? 48.872  7.584   6.017   1.00 51.15 ? 2097 HIS A CD2   1 
ATOM   6183  C  CE1   . HIS E  3 770  ? 49.076  5.677   4.950   1.00 53.79 ? 2097 HIS A CE1   1 
ATOM   6184  N  NE2   . HIS E  3 770  ? 49.616  6.437   5.887   1.00 52.94 ? 2097 HIS A NE2   1 
ATOM   6185  N  N     . ALA E  3 771  ? 46.090  11.415  2.650   1.00 48.93 ? 2098 ALA A N     1 
ATOM   6186  C  CA    . ALA E  3 771  ? 44.957  12.217  2.212   1.00 48.09 ? 2098 ALA A CA    1 
ATOM   6187  C  C     . ALA E  3 771  ? 45.123  12.814  0.819   1.00 48.68 ? 2098 ALA A C     1 
ATOM   6188  O  O     . ALA E  3 771  ? 44.287  13.616  0.389   1.00 49.68 ? 2098 ALA A O     1 
ATOM   6189  C  CB    . ALA E  3 771  ? 44.668  13.304  3.226   1.00 47.71 ? 2098 ALA A CB    1 
ATOM   6190  N  N     . LEU E  3 772  ? 46.180  12.411  0.115   1.00 48.28 ? 2099 LEU A N     1 
ATOM   6191  C  CA    . LEU E  3 772  ? 46.451  12.909  -1.231  1.00 48.40 ? 2099 LEU A CA    1 
ATOM   6192  C  C     . LEU E  3 772  ? 45.434  12.390  -2.233  1.00 48.82 ? 2099 LEU A C     1 
ATOM   6193  O  O     . LEU E  3 772  ? 45.167  11.189  -2.280  1.00 48.44 ? 2099 LEU A O     1 
ATOM   6194  C  CB    . LEU E  3 772  ? 47.855  12.517  -1.679  1.00 48.34 ? 2099 LEU A CB    1 
ATOM   6195  C  CG    . LEU E  3 772  ? 48.297  12.978  -3.072  1.00 48.89 ? 2099 LEU A CG    1 
ATOM   6196  C  CD1   . LEU E  3 772  ? 48.290  14.501  -3.189  1.00 49.27 ? 2099 LEU A CD1   1 
ATOM   6197  C  CD2   . LEU E  3 772  ? 49.671  12.416  -3.408  1.00 48.75 ? 2099 LEU A CD2   1 
ATOM   6198  N  N     . ASP E  3 773  ? 44.864  13.303  -3.021  1.00 49.23 ? 2100 ASP A N     1 
ATOM   6199  C  CA    . ASP E  3 773  ? 43.929  12.939  -4.082  1.00 48.42 ? 2100 ASP A CA    1 
ATOM   6200  C  C     . ASP E  3 773  ? 44.645  13.067  -5.421  1.00 47.54 ? 2100 ASP A C     1 
ATOM   6201  O  O     . ASP E  3 773  ? 44.892  14.180  -5.896  1.00 47.48 ? 2100 ASP A O     1 
ATOM   6202  C  CB    . ASP E  3 773  ? 42.672  13.816  -4.038  1.00 49.90 ? 2100 ASP A CB    1 
ATOM   6203  C  CG    . ASP E  3 773  ? 41.688  13.521  -5.184  1.00 53.82 ? 2100 ASP A CG    1 
ATOM   6204  O  OD1   . ASP E  3 773  ? 40.746  14.331  -5.378  1.00 56.65 ? 2100 ASP A OD1   1 
ATOM   6205  O  OD2   . ASP E  3 773  ? 41.840  12.494  -5.893  1.00 55.26 ? 2100 ASP A OD2   1 
ATOM   6206  N  N     . PRO E  3 774  ? 44.975  11.920  -6.042  1.00 46.70 ? 2101 PRO A N     1 
ATOM   6207  C  CA    . PRO E  3 774  ? 45.717  11.910  -7.291  1.00 46.12 ? 2101 PRO A CA    1 
ATOM   6208  C  C     . PRO E  3 774  ? 45.029  12.736  -8.366  1.00 45.97 ? 2101 PRO A C     1 
ATOM   6209  O  O     . PRO E  3 774  ? 45.696  13.509  -9.058  1.00 46.91 ? 2101 PRO A O     1 
ATOM   6210  C  CB    . PRO E  3 774  ? 45.739  10.430  -7.682  1.00 46.13 ? 2101 PRO A CB    1 
ATOM   6211  C  CG    . PRO E  3 774  ? 44.684  9.786   -6.874  1.00 45.87 ? 2101 PRO A CG    1 
ATOM   6212  C  CD    . PRO E  3 774  ? 44.650  10.555  -5.602  1.00 46.62 ? 2101 PRO A CD    1 
ATOM   6213  N  N     . ILE E  3 775  ? 43.713  12.594  -8.490  1.00 44.99 ? 2102 ILE A N     1 
ATOM   6214  C  CA    . ILE E  3 775  ? 42.959  13.329  -9.503  1.00 45.11 ? 2102 ILE A CA    1 
ATOM   6215  C  C     . ILE E  3 775  ? 43.074  14.848  -9.311  1.00 45.20 ? 2102 ILE A C     1 
ATOM   6216  O  O     . ILE E  3 775  ? 43.183  15.593  -10.294 1.00 44.81 ? 2102 ILE A O     1 
ATOM   6217  C  CB    . ILE E  3 775  ? 41.487  12.846  -9.587  1.00 45.29 ? 2102 ILE A CB    1 
ATOM   6218  C  CG1   . ILE E  3 775  ? 41.367  11.649  -10.542 1.00 44.78 ? 2102 ILE A CG1   1 
ATOM   6219  C  CG2   . ILE E  3 775  ? 40.553  13.957  -10.052 1.00 45.87 ? 2102 ILE A CG2   1 
ATOM   6220  C  CD1   . ILE E  3 775  ? 41.733  10.284  -9.933  1.00 45.52 ? 2102 ILE A CD1   1 
ATOM   6221  N  N     . TYR E  3 776  ? 43.083  15.300  -8.058  1.00 45.01 ? 2103 TYR A N     1 
ATOM   6222  C  CA    . TYR E  3 776  ? 43.224  16.724  -7.786  1.00 45.26 ? 2103 TYR A CA    1 
ATOM   6223  C  C     . TYR E  3 776  ? 44.648  17.181  -8.071  1.00 46.26 ? 2103 TYR A C     1 
ATOM   6224  O  O     . TYR E  3 776  ? 44.857  18.270  -8.620  1.00 46.86 ? 2103 TYR A O     1 
ATOM   6225  C  CB    . TYR E  3 776  ? 42.815  17.064  -6.362  1.00 45.29 ? 2103 TYR A CB    1 
ATOM   6226  C  CG    . TYR E  3 776  ? 42.825  18.545  -6.058  1.00 46.24 ? 2103 TYR A CG    1 
ATOM   6227  C  CD1   . TYR E  3 776  ? 41.878  19.411  -6.629  1.00 46.77 ? 2103 TYR A CD1   1 
ATOM   6228  C  CD2   . TYR E  3 776  ? 43.780  19.089  -5.190  1.00 46.84 ? 2103 TYR A CD2   1 
ATOM   6229  C  CE1   . TYR E  3 776  ? 41.882  20.792  -6.340  1.00 47.07 ? 2103 TYR A CE1   1 
ATOM   6230  C  CE2   . TYR E  3 776  ? 43.798  20.458  -4.892  1.00 47.43 ? 2103 TYR A CE2   1 
ATOM   6231  C  CZ    . TYR E  3 776  ? 42.844  21.305  -5.469  1.00 48.47 ? 2103 TYR A CZ    1 
ATOM   6232  O  OH    . TYR E  3 776  ? 42.866  22.658  -5.169  1.00 48.32 ? 2103 TYR A OH    1 
ATOM   6233  N  N     . ALA E  3 777  ? 45.626  16.347  -7.716  1.00 46.32 ? 2104 ALA A N     1 
ATOM   6234  C  CA    . ALA E  3 777  ? 47.023  16.639  -8.037  1.00 46.52 ? 2104 ALA A CA    1 
ATOM   6235  C  C     . ALA E  3 777  ? 47.200  16.843  -9.551  1.00 47.45 ? 2104 ALA A C     1 
ATOM   6236  O  O     . ALA E  3 777  ? 47.907  17.757  -9.986  1.00 48.47 ? 2104 ALA A O     1 
ATOM   6237  C  CB    . ALA E  3 777  ? 47.935  15.549  -7.520  1.00 45.24 ? 2104 ALA A CB    1 
ATOM   6238  N  N     . ARG E  3 778  ? 46.528  16.015  -10.347 1.00 47.43 ? 2105 ARG A N     1 
ATOM   6239  C  CA    . ARG E  3 778  ? 46.563  16.165  -11.794 1.00 47.69 ? 2105 ARG A CA    1 
ATOM   6240  C  C     . ARG E  3 778  ? 45.968  17.496  -12.221 1.00 47.22 ? 2105 ARG A C     1 
ATOM   6241  O  O     . ARG E  3 778  ? 46.531  18.174  -13.064 1.00 47.31 ? 2105 ARG A O     1 
ATOM   6242  C  CB    . ARG E  3 778  ? 45.817  15.033  -12.482 1.00 48.40 ? 2105 ARG A CB    1 
ATOM   6243  C  CG    . ARG E  3 778  ? 46.215  14.877  -13.926 1.00 51.67 ? 2105 ARG A CG    1 
ATOM   6244  C  CD    . ARG E  3 778  ? 44.995  14.818  -14.820 1.00 56.30 ? 2105 ARG A CD    1 
ATOM   6245  N  NE    . ARG E  3 778  ? 44.076  13.749  -14.434 1.00 59.65 ? 2105 ARG A NE    1 
ATOM   6246  C  CZ    . ARG E  3 778  ? 44.286  12.451  -14.649 1.00 61.56 ? 2105 ARG A CZ    1 
ATOM   6247  N  NH1   . ARG E  3 778  ? 45.401  12.037  -15.245 1.00 62.13 ? 2105 ARG A NH1   1 
ATOM   6248  N  NH2   . ARG E  3 778  ? 43.376  11.561  -14.258 1.00 62.67 ? 2105 ARG A NH2   1 
ATOM   6249  N  N     . LYS E  3 779  ? 44.830  17.860  -11.635 1.00 47.26 ? 2106 LYS A N     1 
ATOM   6250  C  CA    . LYS E  3 779  ? 44.187  19.140  -11.917 1.00 47.13 ? 2106 LYS A CA    1 
ATOM   6251  C  C     . LYS E  3 779  ? 45.123  20.303  -11.662 1.00 46.79 ? 2106 LYS A C     1 
ATOM   6252  O  O     . LYS E  3 779  ? 45.072  21.302  -12.367 1.00 47.80 ? 2106 LYS A O     1 
ATOM   6253  C  CB    . LYS E  3 779  ? 42.916  19.309  -11.089 1.00 47.55 ? 2106 LYS A CB    1 
ATOM   6254  C  CG    . LYS E  3 779  ? 41.645  18.963  -11.831 1.00 49.24 ? 2106 LYS A CG    1 
ATOM   6255  C  CD    . LYS E  3 779  ? 40.495  18.731  -10.876 1.00 50.51 ? 2106 LYS A CD    1 
ATOM   6256  C  CE    . LYS E  3 779  ? 39.262  18.288  -11.642 1.00 52.61 ? 2106 LYS A CE    1 
ATOM   6257  N  NZ    . LYS E  3 779  ? 38.474  17.288  -10.863 1.00 54.29 ? 2106 LYS A NZ    1 
ATOM   6258  N  N     . LEU E  3 780  ? 45.988  20.169  -10.662 1.00 46.68 ? 2107 LEU A N     1 
ATOM   6259  C  CA    . LEU E  3 780  ? 46.960  21.222  -10.355 1.00 47.04 ? 2107 LEU A CA    1 
ATOM   6260  C  C     . LEU E  3 780  ? 48.172  21.181  -11.280 1.00 47.05 ? 2107 LEU A C     1 
ATOM   6261  O  O     . LEU E  3 780  ? 49.099  21.976  -11.134 1.00 47.58 ? 2107 LEU A O     1 
ATOM   6262  C  CB    . LEU E  3 780  ? 47.401  21.170  -8.886  1.00 46.72 ? 2107 LEU A CB    1 
ATOM   6263  C  CG    . LEU E  3 780  ? 46.328  21.285  -7.796  1.00 46.26 ? 2107 LEU A CG    1 
ATOM   6264  C  CD1   . LEU E  3 780  ? 46.983  21.370  -6.438  1.00 46.94 ? 2107 LEU A CD1   1 
ATOM   6265  C  CD2   . LEU E  3 780  ? 45.434  22.490  -8.007  1.00 46.40 ? 2107 LEU A CD2   1 
ATOM   6266  N  N     . GLY E  3 781  ? 48.159  20.248  -12.225 1.00 46.90 ? 2108 GLY A N     1 
ATOM   6267  C  CA    . GLY E  3 781  ? 49.197  20.173  -13.245 1.00 46.81 ? 2108 GLY A CA    1 
ATOM   6268  C  C     . GLY E  3 781  ? 50.365  19.283  -12.881 1.00 46.54 ? 2108 GLY A C     1 
ATOM   6269  O  O     . GLY E  3 781  ? 51.438  19.388  -13.474 1.00 47.58 ? 2108 GLY A O     1 
ATOM   6270  N  N     . VAL E  3 782  ? 50.168  18.406  -11.907 1.00 45.94 ? 2109 VAL A N     1 
ATOM   6271  C  CA    . VAL E  3 782  ? 51.192  17.435  -11.561 1.00 45.40 ? 2109 VAL A CA    1 
ATOM   6272  C  C     . VAL E  3 782  ? 51.124  16.273  -12.542 1.00 45.92 ? 2109 VAL A C     1 
ATOM   6273  O  O     . VAL E  3 782  ? 50.041  15.782  -12.861 1.00 45.78 ? 2109 VAL A O     1 
ATOM   6274  C  CB    . VAL E  3 782  ? 51.030  16.929  -10.115 1.00 44.72 ? 2109 VAL A CB    1 
ATOM   6275  C  CG1   . VAL E  3 782  ? 52.078  15.879  -9.789  1.00 44.52 ? 2109 VAL A CG1   1 
ATOM   6276  C  CG2   . VAL E  3 782  ? 51.123  18.087  -9.142  1.00 43.88 ? 2109 VAL A CG2   1 
ATOM   6277  N  N     . ASP E  3 783  ? 52.286  15.865  -13.038 1.00 46.77 ? 2110 ASP A N     1 
ATOM   6278  C  CA    . ASP E  3 783  ? 52.396  14.662  -13.837 1.00 47.94 ? 2110 ASP A CA    1 
ATOM   6279  C  C     . ASP E  3 783  ? 52.333  13.456  -12.909 1.00 47.75 ? 2110 ASP A C     1 
ATOM   6280  O  O     . ASP E  3 783  ? 53.339  13.023  -12.351 1.00 46.31 ? 2110 ASP A O     1 
ATOM   6281  C  CB    . ASP E  3 783  ? 53.690  14.679  -14.640 1.00 49.29 ? 2110 ASP A CB    1 
ATOM   6282  C  CG    . ASP E  3 783  ? 53.896  13.414  -15.452 1.00 52.22 ? 2110 ASP A CG    1 
ATOM   6283  O  OD1   . ASP E  3 783  ? 55.015  13.265  -15.993 1.00 53.73 ? 2110 ASP A OD1   1 
ATOM   6284  O  OD2   . ASP E  3 783  ? 52.960  12.577  -15.547 1.00 53.90 ? 2110 ASP A OD2   1 
ATOM   6285  N  N     . ILE E  3 784  ? 51.122  12.932  -12.765 1.00 49.13 ? 2111 ILE A N     1 
ATOM   6286  C  CA    . ILE E  3 784  ? 50.791  11.840  -11.842 1.00 49.51 ? 2111 ILE A CA    1 
ATOM   6287  C  C     . ILE E  3 784  ? 51.598  10.569  -12.125 1.00 48.97 ? 2111 ILE A C     1 
ATOM   6288  O  O     . ILE E  3 784  ? 52.086  9.922   -11.198 1.00 48.32 ? 2111 ILE A O     1 
ATOM   6289  C  CB    . ILE E  3 784  ? 49.253  11.537  -11.896 1.00 50.07 ? 2111 ILE A CB    1 
ATOM   6290  C  CG1   . ILE E  3 784  ? 48.449  12.787  -11.540 1.00 51.87 ? 2111 ILE A CG1   1 
ATOM   6291  C  CG2   . ILE E  3 784  ? 48.853  10.437  -10.964 1.00 49.71 ? 2111 ILE A CG2   1 
ATOM   6292  C  CD1   . ILE E  3 784  ? 48.948  13.536  -10.301 1.00 50.70 ? 2111 ILE A CD1   1 
ATOM   6293  N  N     . ASP E  3 785  ? 51.751  10.242  -13.409 1.00 48.16 ? 2112 ASP A N     1 
ATOM   6294  C  CA    . ASP E  3 785  ? 52.399  9.014   -13.833 1.00 47.44 ? 2112 ASP A CA    1 
ATOM   6295  C  C     . ASP E  3 785  ? 53.889  8.941   -13.537 1.00 47.17 ? 2112 ASP A C     1 
ATOM   6296  O  O     . ASP E  3 785  ? 54.474  7.862   -13.577 1.00 46.86 ? 2112 ASP A O     1 
ATOM   6297  C  CB    . ASP E  3 785  ? 52.168  8.813   -15.317 1.00 48.43 ? 2112 ASP A CB    1 
ATOM   6298  C  CG    . ASP E  3 785  ? 50.710  8.605   -15.650 1.00 50.60 ? 2112 ASP A CG    1 
ATOM   6299  O  OD1   . ASP E  3 785  ? 49.988  8.000   -14.830 1.00 51.36 ? 2112 ASP A OD1   1 
ATOM   6300  O  OD2   . ASP E  3 785  ? 50.284  9.035   -16.742 1.00 52.72 ? 2112 ASP A OD2   1 
ATOM   6301  N  N     . ASN E  3 786  ? 54.499  10.083  -13.237 1.00 47.17 ? 2113 ASN A N     1 
ATOM   6302  C  CA    . ASN E  3 786  ? 55.927  10.137  -12.949 1.00 46.54 ? 2113 ASN A CA    1 
ATOM   6303  C  C     . ASN E  3 786  ? 56.239  10.626  -11.554 1.00 46.26 ? 2113 ASN A C     1 
ATOM   6304  O  O     . ASN E  3 786  ? 57.393  10.621  -11.134 1.00 46.93 ? 2113 ASN A O     1 
ATOM   6305  C  CB    . ASN E  3 786  ? 56.646  10.987  -13.991 1.00 46.66 ? 2113 ASN A CB    1 
ATOM   6306  C  CG    . ASN E  3 786  ? 56.662  10.327  -15.345 1.00 47.36 ? 2113 ASN A CG    1 
ATOM   6307  O  OD1   . ASN E  3 786  ? 56.900  9.125   -15.456 1.00 47.72 ? 2113 ASN A OD1   1 
ATOM   6308  N  ND2   . ASN E  3 786  ? 56.398  11.098  -16.385 1.00 48.75 ? 2113 ASN A ND2   1 
ATOM   6309  N  N     . LEU E  3 787  ? 55.206  11.049  -10.838 1.00 45.59 ? 2114 LEU A N     1 
ATOM   6310  C  CA    . LEU E  3 787  ? 55.358  11.464  -9.450  1.00 46.13 ? 2114 LEU A CA    1 
ATOM   6311  C  C     . LEU E  3 787  ? 55.479  10.227  -8.565  1.00 46.80 ? 2114 LEU A C     1 
ATOM   6312  O  O     . LEU E  3 787  ? 54.521  9.476   -8.398  1.00 47.68 ? 2114 LEU A O     1 
ATOM   6313  C  CB    . LEU E  3 787  ? 54.175  12.346  -9.031  1.00 45.15 ? 2114 LEU A CB    1 
ATOM   6314  C  CG    . LEU E  3 787  ? 54.120  13.138  -7.723  1.00 43.58 ? 2114 LEU A CG    1 
ATOM   6315  C  CD1   . LEU E  3 787  ? 53.311  12.391  -6.707  1.00 43.91 ? 2114 LEU A CD1   1 
ATOM   6316  C  CD2   . LEU E  3 787  ? 55.488  13.503  -7.174  1.00 43.23 ? 2114 LEU A CD2   1 
ATOM   6317  N  N     . LEU E  3 788  ? 56.674  10.002  -8.029  1.00 47.39 ? 2115 LEU A N     1 
ATOM   6318  C  CA    . LEU E  3 788  ? 56.887  8.935   -7.069  1.00 48.41 ? 2115 LEU A CA    1 
ATOM   6319  C  C     . LEU E  3 788  ? 56.072  9.216   -5.822  1.00 49.76 ? 2115 LEU A C     1 
ATOM   6320  O  O     . LEU E  3 788  ? 56.011  10.350  -5.350  1.00 50.23 ? 2115 LEU A O     1 
ATOM   6321  C  CB    . LEU E  3 788  ? 58.363  8.826   -6.705  1.00 47.99 ? 2115 LEU A CB    1 
ATOM   6322  C  CG    . LEU E  3 788  ? 59.222  8.018   -7.666  1.00 48.11 ? 2115 LEU A CG    1 
ATOM   6323  C  CD1   . LEU E  3 788  ? 60.674  8.321   -7.431  1.00 47.11 ? 2115 LEU A CD1   1 
ATOM   6324  C  CD2   . LEU E  3 788  ? 58.950  6.531   -7.509  1.00 50.44 ? 2115 LEU A CD2   1 
ATOM   6325  N  N     . CYS E  3 789  ? 55.444  8.181   -5.286  1.00 51.26 ? 2116 CYS A N     1 
ATOM   6326  C  CA    . CYS E  3 789  ? 54.535  8.370   -4.177  1.00 51.59 ? 2116 CYS A CA    1 
ATOM   6327  C  C     . CYS E  3 789  ? 54.517  7.211   -3.202  1.00 51.55 ? 2116 CYS A C     1 
ATOM   6328  O  O     . CYS E  3 789  ? 54.395  6.051   -3.583  1.00 51.04 ? 2116 CYS A O     1 
ATOM   6329  C  CB    . CYS E  3 789  ? 53.126  8.626   -4.696  1.00 52.49 ? 2116 CYS A CB    1 
ATOM   6330  S  SG    . CYS E  3 789  ? 51.921  8.852   -3.376  1.00 54.41 ? 2116 CYS A SG    1 
ATOM   6331  N  N     . SER E  3 790  ? 54.607  7.547   -1.926  1.00 52.34 ? 2117 SER A N     1 
ATOM   6332  C  CA    . SER E  3 790  ? 54.637  6.548   -0.879  1.00 53.30 ? 2117 SER A CA    1 
ATOM   6333  C  C     . SER E  3 790  ? 53.644  6.874   0.234   1.00 52.54 ? 2117 SER A C     1 
ATOM   6334  O  O     . SER E  3 790  ? 53.471  8.032   0.606   1.00 51.48 ? 2117 SER A O     1 
ATOM   6335  C  CB    . SER E  3 790  ? 56.053  6.446   -0.313  1.00 54.34 ? 2117 SER A CB    1 
ATOM   6336  O  OG    . SER E  3 790  ? 56.119  5.480   0.721   1.00 57.08 ? 2117 SER A OG    1 
ATOM   6337  N  N     . GLN E  3 791  ? 52.984  5.841   0.746   1.00 52.98 ? 2118 GLN A N     1 
ATOM   6338  C  CA    . GLN E  3 791  ? 52.132  5.976   1.922   1.00 53.17 ? 2118 GLN A CA    1 
ATOM   6339  C  C     . GLN E  3 791  ? 52.662  5.069   3.016   1.00 53.83 ? 2118 GLN A C     1 
ATOM   6340  O  O     . GLN E  3 791  ? 52.219  3.933   3.152   1.00 54.98 ? 2118 GLN A O     1 
ATOM   6341  C  CB    . GLN E  3 791  ? 50.671  5.678   1.596   1.00 52.05 ? 2118 GLN A CB    1 
ATOM   6342  C  CG    . GLN E  3 791  ? 50.026  6.794   0.817   1.00 52.99 ? 2118 GLN A CG    1 
ATOM   6343  C  CD    . GLN E  3 791  ? 48.532  6.687   0.766   1.00 52.34 ? 2118 GLN A CD    1 
ATOM   6344  O  OE1   . GLN E  3 791  ? 47.983  5.598   0.659   1.00 53.85 ? 2118 GLN A OE1   1 
ATOM   6345  N  NE2   . GLN E  3 791  ? 47.857  7.826   0.829   1.00 52.07 ? 2118 GLN A NE2   1 
ATOM   6346  N  N     . PRO E  3 792  ? 53.619  5.578   3.805   1.00 54.03 ? 2119 PRO A N     1 
ATOM   6347  C  CA    . PRO E  3 792  ? 54.409  4.784   4.733   1.00 54.36 ? 2119 PRO A CA    1 
ATOM   6348  C  C     . PRO E  3 792  ? 53.600  4.383   5.955   1.00 54.40 ? 2119 PRO A C     1 
ATOM   6349  O  O     . PRO E  3 792  ? 52.623  5.052   6.288   1.00 53.74 ? 2119 PRO A O     1 
ATOM   6350  C  CB    . PRO E  3 792  ? 55.524  5.748   5.137   1.00 54.59 ? 2119 PRO A CB    1 
ATOM   6351  C  CG    . PRO E  3 792  ? 54.885  7.083   5.047   1.00 53.47 ? 2119 PRO A CG    1 
ATOM   6352  C  CD    . PRO E  3 792  ? 53.981  7.005   3.864   1.00 54.13 ? 2119 PRO A CD    1 
ATOM   6353  N  N     . ASP E  3 793  ? 54.016  3.302   6.612   1.00 54.80 ? 2120 ASP A N     1 
ATOM   6354  C  CA    . ASP E  3 793  ? 53.335  2.816   7.808   1.00 55.03 ? 2120 ASP A CA    1 
ATOM   6355  C  C     . ASP E  3 793  ? 53.785  3.579   9.041   1.00 53.20 ? 2120 ASP A C     1 
ATOM   6356  O  O     . ASP E  3 793  ? 52.963  4.168   9.730   1.00 53.39 ? 2120 ASP A O     1 
ATOM   6357  C  CB    . ASP E  3 793  ? 53.556  1.310   7.982   1.00 57.29 ? 2120 ASP A CB    1 
ATOM   6358  C  CG    . ASP E  3 793  ? 53.104  0.505   6.763   1.00 61.01 ? 2120 ASP A CG    1 
ATOM   6359  O  OD1   . ASP E  3 793  ? 52.001  0.790   6.231   1.00 63.22 ? 2120 ASP A OD1   1 
ATOM   6360  O  OD2   . ASP E  3 793  ? 53.855  -0.410  6.342   1.00 63.12 ? 2120 ASP A OD2   1 
ATOM   6361  N  N     . THR E  3 794  ? 55.092  3.581   9.293   1.00 51.57 ? 2121 THR A N     1 
ATOM   6362  C  CA    . THR E  3 794  ? 55.676  4.291   10.424  1.00 50.41 ? 2121 THR A CA    1 
ATOM   6363  C  C     . THR E  3 794  ? 56.412  5.544   9.962   1.00 49.82 ? 2121 THR A C     1 
ATOM   6364  O  O     . THR E  3 794  ? 56.742  5.683   8.791   1.00 50.24 ? 2121 THR A O     1 
ATOM   6365  C  CB    . THR E  3 794  ? 56.645  3.394   11.223  1.00 50.45 ? 2121 THR A CB    1 
ATOM   6366  O  OG1   . THR E  3 794  ? 57.782  3.069   10.416  1.00 52.17 ? 2121 THR A OG1   1 
ATOM   6367  C  CG2   . THR E  3 794  ? 55.967  2.105   11.655  1.00 51.35 ? 2121 THR A CG2   1 
ATOM   6368  N  N     . GLY E  3 795  ? 56.663  6.458   10.892  1.00 49.82 ? 2122 GLY A N     1 
ATOM   6369  C  CA    . GLY E  3 795  ? 57.435  7.664   10.622  1.00 49.28 ? 2122 GLY A CA    1 
ATOM   6370  C  C     . GLY E  3 795  ? 58.874  7.338   10.279  1.00 49.61 ? 2122 GLY A C     1 
ATOM   6371  O  O     . GLY E  3 795  ? 59.454  7.959   9.398   1.00 49.78 ? 2122 GLY A O     1 
ATOM   6372  N  N     . GLU E  3 796  ? 59.450  6.359   10.971  1.00 49.78 ? 2123 GLU A N     1 
ATOM   6373  C  CA    . GLU E  3 796  ? 60.802  5.910   10.674  1.00 51.14 ? 2123 GLU A CA    1 
ATOM   6374  C  C     . GLU E  3 796  ? 60.923  5.443   9.225   1.00 50.92 ? 2123 GLU A C     1 
ATOM   6375  O  O     . GLU E  3 796  ? 61.886  5.780   8.532   1.00 52.15 ? 2123 GLU A O     1 
ATOM   6376  C  CB    . GLU E  3 796  ? 61.231  4.787   11.614  1.00 52.75 ? 2123 GLU A CB    1 
ATOM   6377  C  CG    . GLU E  3 796  ? 61.598  5.246   13.009  1.00 57.91 ? 2123 GLU A CG    1 
ATOM   6378  C  CD    . GLU E  3 796  ? 60.411  5.279   13.957  1.00 62.45 ? 2123 GLU A CD    1 
ATOM   6379  O  OE1   . GLU E  3 796  ? 59.329  4.767   13.590  1.00 63.33 ? 2123 GLU A OE1   1 
ATOM   6380  O  OE2   . GLU E  3 796  ? 60.570  5.819   15.080  1.00 65.75 ? 2123 GLU A OE2   1 
ATOM   6381  N  N     . GLN E  3 797  ? 59.944  4.665   8.779   1.00 49.88 ? 2124 GLN A N     1 
ATOM   6382  C  CA    . GLN E  3 797  ? 59.880  4.196   7.400   1.00 49.62 ? 2124 GLN A CA    1 
ATOM   6383  C  C     . GLN E  3 797  ? 59.853  5.380   6.433   1.00 49.26 ? 2124 GLN A C     1 
ATOM   6384  O  O     . GLN E  3 797  ? 60.623  5.424   5.467   1.00 48.94 ? 2124 GLN A O     1 
ATOM   6385  C  CB    . GLN E  3 797  ? 58.647  3.306   7.216   1.00 49.08 ? 2124 GLN A CB    1 
ATOM   6386  C  CG    . GLN E  3 797  ? 58.493  2.686   5.850   1.00 49.73 ? 2124 GLN A CG    1 
ATOM   6387  C  CD    . GLN E  3 797  ? 57.186  1.930   5.700   1.00 50.48 ? 2124 GLN A CD    1 
ATOM   6388  O  OE1   . GLN E  3 797  ? 56.491  2.060   4.689   1.00 53.64 ? 2124 GLN A OE1   1 
ATOM   6389  N  NE2   . GLN E  3 797  ? 56.840  1.138   6.705   1.00 49.69 ? 2124 GLN A NE2   1 
ATOM   6390  N  N     . ALA E  3 798  ? 58.980  6.346   6.719   1.00 48.95 ? 2125 ALA A N     1 
ATOM   6391  C  CA    . ALA E  3 798  ? 58.852  7.557   5.906   1.00 48.52 ? 2125 ALA A CA    1 
ATOM   6392  C  C     . ALA E  3 798  ? 60.195  8.262   5.714   1.00 48.20 ? 2125 ALA A C     1 
ATOM   6393  O  O     . ALA E  3 798  ? 60.548  8.663   4.602   1.00 48.18 ? 2125 ALA A O     1 
ATOM   6394  C  CB    . ALA E  3 798  ? 57.849  8.506   6.531   1.00 48.39 ? 2125 ALA A CB    1 
ATOM   6395  N  N     . LEU E  3 799  ? 60.939  8.400   6.805   1.00 47.37 ? 2126 LEU A N     1 
ATOM   6396  C  CA    . LEU E  3 799  ? 62.198  9.117   6.783   1.00 46.00 ? 2126 LEU A CA    1 
ATOM   6397  C  C     . LEU E  3 799  ? 63.312  8.265   6.210   1.00 46.95 ? 2126 LEU A C     1 
ATOM   6398  O  O     . LEU E  3 799  ? 64.230  8.796   5.590   1.00 48.12 ? 2126 LEU A O     1 
ATOM   6399  C  CB    . LEU E  3 799  ? 62.555  9.607   8.182   1.00 45.05 ? 2126 LEU A CB    1 
ATOM   6400  C  CG    . LEU E  3 799  ? 61.558  10.558  8.849   1.00 42.78 ? 2126 LEU A CG    1 
ATOM   6401  C  CD1   . LEU E  3 799  ? 61.734  10.510  10.351  1.00 40.95 ? 2126 LEU A CD1   1 
ATOM   6402  C  CD2   . LEU E  3 799  ? 61.676  11.986  8.310   1.00 40.90 ? 2126 LEU A CD2   1 
ATOM   6403  N  N     . GLU E  3 800  ? 63.240  6.952   6.416   1.00 47.81 ? 2127 GLU A N     1 
ATOM   6404  C  CA    . GLU E  3 800  ? 64.203  6.041   5.798   1.00 49.26 ? 2127 GLU A CA    1 
ATOM   6405  C  C     . GLU E  3 800  ? 64.070  6.049   4.279   1.00 48.79 ? 2127 GLU A C     1 
ATOM   6406  O  O     . GLU E  3 800  ? 65.065  5.929   3.558   1.00 48.32 ? 2127 GLU A O     1 
ATOM   6407  C  CB    . GLU E  3 800  ? 64.063  4.621   6.343   1.00 50.05 ? 2127 GLU A CB    1 
ATOM   6408  C  CG    . GLU E  3 800  ? 65.049  4.313   7.461   1.00 53.97 ? 2127 GLU A CG    1 
ATOM   6409  C  CD    . GLU E  3 800  ? 66.504  4.446   7.014   1.00 56.94 ? 2127 GLU A CD    1 
ATOM   6410  O  OE1   . GLU E  3 800  ? 67.197  5.353   7.521   1.00 58.92 ? 2127 GLU A OE1   1 
ATOM   6411  O  OE2   . GLU E  3 800  ? 66.949  3.659   6.144   1.00 58.02 ? 2127 GLU A OE2   1 
ATOM   6412  N  N     . ILE E  3 801  ? 62.836  6.205   3.806   1.00 48.38 ? 2128 ILE A N     1 
ATOM   6413  C  CA    . ILE E  3 801  ? 62.574  6.322   2.379   1.00 47.37 ? 2128 ILE A CA    1 
ATOM   6414  C  C     . ILE E  3 801  ? 63.202  7.608   1.842   1.00 47.60 ? 2128 ILE A C     1 
ATOM   6415  O  O     . ILE E  3 801  ? 63.859  7.593   0.810   1.00 47.62 ? 2128 ILE A O     1 
ATOM   6416  C  CB    . ILE E  3 801  ? 61.059  6.222   2.063   1.00 46.51 ? 2128 ILE A CB    1 
ATOM   6417  C  CG1   . ILE E  3 801  ? 60.591  4.774   2.199   1.00 44.59 ? 2128 ILE A CG1   1 
ATOM   6418  C  CG2   . ILE E  3 801  ? 60.756  6.725   0.652   1.00 46.81 ? 2128 ILE A CG2   1 
ATOM   6419  C  CD1   . ILE E  3 801  ? 59.107  4.616   2.314   1.00 43.04 ? 2128 ILE A CD1   1 
ATOM   6420  N  N     . CYS E  3 802  ? 63.021  8.711   2.562   1.00 48.57 ? 2129 CYS A N     1 
ATOM   6421  C  CA    . CYS E  3 802  ? 63.627  9.988   2.186   1.00 48.91 ? 2129 CYS A CA    1 
ATOM   6422  C  C     . CYS E  3 802  ? 65.123  9.861   2.058   1.00 48.17 ? 2129 CYS A C     1 
ATOM   6423  O  O     . CYS E  3 802  ? 65.704  10.325  1.086   1.00 48.28 ? 2129 CYS A O     1 
ATOM   6424  C  CB    . CYS E  3 802  ? 63.311  11.066  3.218   1.00 49.71 ? 2129 CYS A CB    1 
ATOM   6425  S  SG    . CYS E  3 802  ? 61.622  11.637  3.123   1.00 51.82 ? 2129 CYS A SG    1 
ATOM   6426  N  N     . ASP E  3 803  ? 65.736  9.224   3.046   1.00 47.93 ? 2130 ASP A N     1 
ATOM   6427  C  CA    . ASP E  3 803  ? 67.170  9.096   3.082   1.00 49.04 ? 2130 ASP A CA    1 
ATOM   6428  C  C     . ASP E  3 803  ? 67.660  8.292   1.890   1.00 48.97 ? 2130 ASP A C     1 
ATOM   6429  O  O     . ASP E  3 803  ? 68.651  8.657   1.257   1.00 49.63 ? 2130 ASP A O     1 
ATOM   6430  C  CB    . ASP E  3 803  ? 67.612  8.439   4.384   1.00 50.75 ? 2130 ASP A CB    1 
ATOM   6431  C  CG    . ASP E  3 803  ? 69.058  8.760   4.738   1.00 53.43 ? 2130 ASP A CG    1 
ATOM   6432  O  OD1   . ASP E  3 803  ? 69.496  9.918   4.516   1.00 54.20 ? 2130 ASP A OD1   1 
ATOM   6433  O  OD2   . ASP E  3 803  ? 69.752  7.850   5.251   1.00 54.61 ? 2130 ASP A OD2   1 
ATOM   6434  N  N     . ALA E  3 804  ? 66.953  7.207   1.583   1.00 48.35 ? 2131 ALA A N     1 
ATOM   6435  C  CA    . ALA E  3 804  ? 67.269  6.370   0.427   1.00 47.43 ? 2131 ALA A CA    1 
ATOM   6436  C  C     . ALA E  3 804  ? 67.197  7.151   -0.886  1.00 46.65 ? 2131 ALA A C     1 
ATOM   6437  O  O     . ALA E  3 804  ? 68.108  7.076   -1.700  1.00 47.24 ? 2131 ALA A O     1 
ATOM   6438  C  CB    . ALA E  3 804  ? 66.349  5.169   0.382   1.00 47.95 ? 2131 ALA A CB    1 
ATOM   6439  N  N     . LEU E  3 805  ? 66.121  7.904   -1.074  1.00 45.86 ? 2132 LEU A N     1 
ATOM   6440  C  CA    . LEU E  3 805  ? 65.955  8.743   -2.255  1.00 45.32 ? 2132 LEU A CA    1 
ATOM   6441  C  C     . LEU E  3 805  ? 66.983  9.875   -2.313  1.00 46.23 ? 2132 LEU A C     1 
ATOM   6442  O  O     . LEU E  3 805  ? 67.518  10.180  -3.389  1.00 47.10 ? 2132 LEU A O     1 
ATOM   6443  C  CB    . LEU E  3 805  ? 64.539  9.320   -2.315  1.00 44.58 ? 2132 LEU A CB    1 
ATOM   6444  C  CG    . LEU E  3 805  ? 63.377  8.330   -2.430  1.00 42.68 ? 2132 LEU A CG    1 
ATOM   6445  C  CD1   . LEU E  3 805  ? 62.056  9.051   -2.318  1.00 41.37 ? 2132 LEU A CD1   1 
ATOM   6446  C  CD2   . LEU E  3 805  ? 63.441  7.533   -3.716  1.00 40.91 ? 2132 LEU A CD2   1 
ATOM   6447  N  N     . ALA E  3 806  ? 67.253  10.499  -1.166  1.00 45.99 ? 2133 ALA A N     1 
ATOM   6448  C  CA    . ALA E  3 806  ? 68.312  11.494  -1.085  1.00 46.34 ? 2133 ALA A CA    1 
ATOM   6449  C  C     . ALA E  3 806  ? 69.629  10.895  -1.566  1.00 46.58 ? 2133 ALA A C     1 
ATOM   6450  O  O     . ALA E  3 806  ? 70.207  11.406  -2.511  1.00 46.56 ? 2133 ALA A O     1 
ATOM   6451  C  CB    . ALA E  3 806  ? 68.443  12.045  0.325   1.00 47.08 ? 2133 ALA A CB    1 
ATOM   6452  N  N     . ARG E  3 807  ? 70.061  9.791   -0.945  1.00 46.93 ? 2134 ARG A N     1 
ATOM   6453  C  CA    . ARG E  3 807  ? 71.315  9.119   -1.293  1.00 48.02 ? 2134 ARG A CA    1 
ATOM   6454  C  C     . ARG E  3 807  ? 71.414  8.699   -2.754  1.00 47.14 ? 2134 ARG A C     1 
ATOM   6455  O  O     . ARG E  3 807  ? 72.494  8.761   -3.336  1.00 46.75 ? 2134 ARG A O     1 
ATOM   6456  C  CB    . ARG E  3 807  ? 71.551  7.902   -0.407  1.00 47.74 ? 2134 ARG A CB    1 
ATOM   6457  C  CG    . ARG E  3 807  ? 72.269  8.202   0.900   1.00 50.79 ? 2134 ARG A CG    1 
ATOM   6458  C  CD    . ARG E  3 807  ? 72.764  6.926   1.594   1.00 52.39 ? 2134 ARG A CD    1 
ATOM   6459  N  NE    . ARG E  3 807  ? 71.797  5.822   1.490   1.00 57.52 ? 2134 ARG A NE    1 
ATOM   6460  C  CZ    . ARG E  3 807  ? 70.765  5.632   2.312   1.00 58.59 ? 2134 ARG A CZ    1 
ATOM   6461  N  NH1   . ARG E  3 807  ? 70.549  6.470   3.321   1.00 59.82 ? 2134 ARG A NH1   1 
ATOM   6462  N  NH2   . ARG E  3 807  ? 69.946  4.601   2.124   1.00 58.02 ? 2134 ARG A NH2   1 
ATOM   6463  N  N     . SER E  3 808  ? 70.294  8.281   -3.340  1.00 46.97 ? 2135 SER A N     1 
ATOM   6464  C  CA    . SER E  3 808  ? 70.266  7.805   -4.731  1.00 46.76 ? 2135 SER A CA    1 
ATOM   6465  C  C     . SER E  3 808  ? 70.732  8.858   -5.732  1.00 47.41 ? 2135 SER A C     1 
ATOM   6466  O  O     . SER E  3 808  ? 71.280  8.524   -6.783  1.00 47.03 ? 2135 SER A O     1 
ATOM   6467  C  CB    . SER E  3 808  ? 68.862  7.346   -5.115  1.00 46.35 ? 2135 SER A CB    1 
ATOM   6468  O  OG    . SER E  3 808  ? 68.013  8.456   -5.367  1.00 44.24 ? 2135 SER A OG    1 
ATOM   6469  N  N     . GLY E  3 809  ? 70.492  10.125  -5.406  1.00 48.50 ? 2136 GLY A N     1 
ATOM   6470  C  CA    . GLY E  3 809  ? 70.836  11.243  -6.286  1.00 48.89 ? 2136 GLY A CA    1 
ATOM   6471  C  C     . GLY E  3 809  ? 69.944  11.320  -7.513  1.00 48.55 ? 2136 GLY A C     1 
ATOM   6472  O  O     . GLY E  3 809  ? 70.220  12.064  -8.451  1.00 48.01 ? 2136 GLY A O     1 
ATOM   6473  N  N     . ALA E  3 810  ? 68.863  10.552  -7.495  1.00 49.04 ? 2137 ALA A N     1 
ATOM   6474  C  CA    . ALA E  3 810  ? 67.978  10.432  -8.643  1.00 49.16 ? 2137 ALA A CA    1 
ATOM   6475  C  C     . ALA E  3 810  ? 66.699  11.266  -8.498  1.00 49.41 ? 2137 ALA A C     1 
ATOM   6476  O  O     . ALA E  3 810  ? 66.024  11.543  -9.490  1.00 49.28 ? 2137 ALA A O     1 
ATOM   6477  C  CB    . ALA E  3 810  ? 67.641  8.975   -8.882  1.00 49.27 ? 2137 ALA A CB    1 
ATOM   6478  N  N     . VAL E  3 811  ? 66.371  11.659  -7.269  1.00 49.20 ? 2138 VAL A N     1 
ATOM   6479  C  CA    . VAL E  3 811  ? 65.198  12.484  -7.021  1.00 48.80 ? 2138 VAL A CA    1 
ATOM   6480  C  C     . VAL E  3 811  ? 65.628  13.918  -6.759  1.00 48.69 ? 2138 VAL A C     1 
ATOM   6481  O  O     . VAL E  3 811  ? 66.609  14.153  -6.058  1.00 48.61 ? 2138 VAL A O     1 
ATOM   6482  C  CB    . VAL E  3 811  ? 64.383  11.945  -5.841  1.00 48.65 ? 2138 VAL A CB    1 
ATOM   6483  C  CG1   . VAL E  3 811  ? 63.100  12.739  -5.668  1.00 50.25 ? 2138 VAL A CG1   1 
ATOM   6484  C  CG2   . VAL E  3 811  ? 64.066  10.481  -6.066  1.00 48.98 ? 2138 VAL A CG2   1 
ATOM   6485  N  N     . ASP E  3 812  ? 64.893  14.866  -7.337  1.00 48.99 ? 2139 ASP A N     1 
ATOM   6486  C  CA    . ASP E  3 812  ? 65.222  16.290  -7.246  1.00 49.40 ? 2139 ASP A CA    1 
ATOM   6487  C  C     . ASP E  3 812  ? 64.474  17.006  -6.131  1.00 49.46 ? 2139 ASP A C     1 
ATOM   6488  O  O     . ASP E  3 812  ? 65.066  17.824  -5.418  1.00 50.80 ? 2139 ASP A O     1 
ATOM   6489  C  CB    . ASP E  3 812  ? 64.961  16.986  -8.575  1.00 50.00 ? 2139 ASP A CB    1 
ATOM   6490  C  CG    . ASP E  3 812  ? 65.874  16.493  -9.666  1.00 52.80 ? 2139 ASP A CG    1 
ATOM   6491  O  OD1   . ASP E  3 812  ? 67.099  16.730  -9.572  1.00 54.93 ? 2139 ASP A OD1   1 
ATOM   6492  O  OD2   . ASP E  3 812  ? 65.370  15.859  -10.616 1.00 54.41 ? 2139 ASP A OD2   1 
ATOM   6493  N  N     . VAL E  3 813  ? 63.179  16.722  -5.990  1.00 47.84 ? 2140 VAL A N     1 
ATOM   6494  C  CA    . VAL E  3 813  ? 62.403  17.262  -4.873  1.00 46.70 ? 2140 VAL A CA    1 
ATOM   6495  C  C     . VAL E  3 813  ? 61.545  16.201  -4.202  1.00 46.56 ? 2140 VAL A C     1 
ATOM   6496  O  O     . VAL E  3 813  ? 60.836  15.442  -4.867  1.00 46.89 ? 2140 VAL A O     1 
ATOM   6497  C  CB    . VAL E  3 813  ? 61.600  18.568  -5.239  1.00 46.60 ? 2140 VAL A CB    1 
ATOM   6498  C  CG1   . VAL E  3 813  ? 61.531  18.787  -6.736  1.00 46.47 ? 2140 VAL A CG1   1 
ATOM   6499  C  CG2   . VAL E  3 813  ? 60.206  18.586  -4.610  1.00 45.94 ? 2140 VAL A CG2   1 
ATOM   6500  N  N     . ILE E  3 814  ? 61.664  16.131  -2.878  1.00 46.10 ? 2141 ILE A N     1 
ATOM   6501  C  CA    . ILE E  3 814  ? 60.857  15.248  -2.043  1.00 45.57 ? 2141 ILE A CA    1 
ATOM   6502  C  C     . ILE E  3 814  ? 60.004  16.107  -1.112  1.00 45.80 ? 2141 ILE A C     1 
ATOM   6503  O  O     . ILE E  3 814  ? 60.514  17.026  -0.461  1.00 45.91 ? 2141 ILE A O     1 
ATOM   6504  C  CB    . ILE E  3 814  ? 61.732  14.326  -1.158  1.00 44.80 ? 2141 ILE A CB    1 
ATOM   6505  C  CG1   . ILE E  3 814  ? 62.792  13.609  -1.989  1.00 43.86 ? 2141 ILE A CG1   1 
ATOM   6506  C  CG2   . ILE E  3 814  ? 60.858  13.326  -0.403  1.00 45.11 ? 2141 ILE A CG2   1 
ATOM   6507  C  CD1   . ILE E  3 814  ? 63.859  12.927  -1.168  1.00 43.74 ? 2141 ILE A CD1   1 
ATOM   6508  N  N     . VAL E  3 815  ? 58.708  15.813  -1.043  1.00 45.27 ? 2142 VAL A N     1 
ATOM   6509  C  CA    . VAL E  3 815  ? 57.876  16.430  -0.020  1.00 44.44 ? 2142 VAL A CA    1 
ATOM   6510  C  C     . VAL E  3 815  ? 57.247  15.411  0.904   1.00 45.34 ? 2142 VAL A C     1 
ATOM   6511  O  O     . VAL E  3 815  ? 56.752  14.378  0.459   1.00 46.04 ? 2142 VAL A O     1 
ATOM   6512  C  CB    . VAL E  3 815  ? 56.861  17.475  -0.571  1.00 43.50 ? 2142 VAL A CB    1 
ATOM   6513  C  CG1   . VAL E  3 815  ? 56.879  17.520  -2.079  1.00 45.00 ? 2142 VAL A CG1   1 
ATOM   6514  C  CG2   . VAL E  3 815  ? 55.476  17.249  -0.032  1.00 40.69 ? 2142 VAL A CG2   1 
ATOM   6515  N  N     . VAL E  3 816  ? 57.320  15.705  2.201   1.00 46.25 ? 2143 VAL A N     1 
ATOM   6516  C  CA    . VAL E  3 816  ? 56.707  14.903  3.245   1.00 46.34 ? 2143 VAL A CA    1 
ATOM   6517  C  C     . VAL E  3 816  ? 55.466  15.641  3.749   1.00 47.55 ? 2143 VAL A C     1 
ATOM   6518  O  O     . VAL E  3 816  ? 55.583  16.706  4.349   1.00 47.46 ? 2143 VAL A O     1 
ATOM   6519  C  CB    . VAL E  3 816  ? 57.694  14.690  4.400   1.00 45.44 ? 2143 VAL A CB    1 
ATOM   6520  C  CG1   . VAL E  3 816  ? 57.059  13.853  5.491   1.00 47.79 ? 2143 VAL A CG1   1 
ATOM   6521  C  CG2   . VAL E  3 816  ? 58.944  14.021  3.897   1.00 43.23 ? 2143 VAL A CG2   1 
ATOM   6522  N  N     . ASP E  3 817  ? 54.284  15.090  3.475   1.00 49.89 ? 2144 ASP A N     1 
ATOM   6523  C  CA    . ASP E  3 817  ? 53.026  15.717  3.908   1.00 52.25 ? 2144 ASP A CA    1 
ATOM   6524  C  C     . ASP E  3 817  ? 52.664  15.322  5.338   1.00 51.42 ? 2144 ASP A C     1 
ATOM   6525  O  O     . ASP E  3 817  ? 52.229  14.192  5.598   1.00 49.63 ? 2144 ASP A O     1 
ATOM   6526  C  CB    . ASP E  3 817  ? 51.848  15.446  2.950   1.00 53.48 ? 2144 ASP A CB    1 
ATOM   6527  C  CG    . ASP E  3 817  ? 50.734  16.521  3.046   1.00 56.58 ? 2144 ASP A CG    1 
ATOM   6528  O  OD1   . ASP E  3 817  ? 50.640  17.258  4.061   1.00 57.65 ? 2144 ASP A OD1   1 
ATOM   6529  O  OD2   . ASP E  3 817  ? 49.937  16.630  2.089   1.00 58.48 ? 2144 ASP A OD2   1 
ATOM   6530  N  N     . SER E  3 818  ? 52.854  16.316  6.215   1.00 51.07 ? 2145 SER A N     1 
ATOM   6531  C  CA    . SER E  3 818  ? 52.637  16.297  7.661   1.00 49.66 ? 2145 SER A CA    1 
ATOM   6532  C  C     . SER E  3 818  ? 53.704  15.541  8.417   1.00 48.79 ? 2145 SER A C     1 
ATOM   6533  O  O     . SER E  3 818  ? 53.726  14.313  8.415   1.00 49.43 ? 2145 SER A O     1 
ATOM   6534  C  CB    . SER E  3 818  ? 51.228  15.834  8.042   1.00 49.82 ? 2145 SER A CB    1 
ATOM   6535  O  OG    . SER E  3 818  ? 50.322  16.924  7.995   1.00 51.62 ? 2145 SER A OG    1 
ATOM   6536  N  N     . VAL E  3 819  ? 54.600  16.282  9.062   1.00 47.78 ? 2146 VAL A N     1 
ATOM   6537  C  CA    . VAL E  3 819  ? 55.476  15.683  10.066  1.00 46.59 ? 2146 VAL A CA    1 
ATOM   6538  C  C     . VAL E  3 819  ? 54.578  15.260  11.228  1.00 47.33 ? 2146 VAL A C     1 
ATOM   6539  O  O     . VAL E  3 819  ? 54.843  14.261  11.889  1.00 48.20 ? 2146 VAL A O     1 
ATOM   6540  C  CB    . VAL E  3 819  ? 56.637  16.619  10.545  1.00 45.05 ? 2146 VAL A CB    1 
ATOM   6541  C  CG1   . VAL E  3 819  ? 56.936  17.687  9.513   1.00 43.55 ? 2146 VAL A CG1   1 
ATOM   6542  C  CG2   . VAL E  3 819  ? 56.329  17.243  11.897  1.00 45.20 ? 2146 VAL A CG2   1 
ATOM   6543  N  N     . ALA E  3 820  ? 53.501  16.023  11.438  1.00 47.36 ? 2147 ALA A N     1 
ATOM   6544  C  CA    . ALA E  3 820  ? 52.465  15.707  12.415  1.00 46.49 ? 2147 ALA A CA    1 
ATOM   6545  C  C     . ALA E  3 820  ? 52.009  14.256  12.328  1.00 46.10 ? 2147 ALA A C     1 
ATOM   6546  O  O     . ALA E  3 820  ? 51.727  13.631  13.349  1.00 46.18 ? 2147 ALA A O     1 
ATOM   6547  C  CB    . ALA E  3 820  ? 51.287  16.619  12.222  1.00 46.37 ? 2147 ALA A CB    1 
ATOM   6548  N  N     . ALA E  3 821  ? 51.960  13.730  11.107  1.00 45.54 ? 2148 ALA A N     1 
ATOM   6549  C  CA    . ALA E  3 821  ? 51.491  12.376  10.856  1.00 45.51 ? 2148 ALA A CA    1 
ATOM   6550  C  C     . ALA E  3 821  ? 52.613  11.327  10.862  1.00 45.79 ? 2148 ALA A C     1 
ATOM   6551  O  O     . ALA E  3 821  ? 52.352  10.130  10.723  1.00 46.74 ? 2148 ALA A O     1 
ATOM   6552  C  CB    . ALA E  3 821  ? 50.719  12.334  9.539   1.00 45.90 ? 2148 ALA A CB    1 
ATOM   6553  N  N     . LEU E  3 822  ? 53.857  11.774  11.014  1.00 45.32 ? 2149 LEU A N     1 
ATOM   6554  C  CA    . LEU E  3 822  ? 55.008  10.869  11.116  1.00 44.25 ? 2149 LEU A CA    1 
ATOM   6555  C  C     . LEU E  3 822  ? 55.032  10.119  12.451  1.00 44.13 ? 2149 LEU A C     1 
ATOM   6556  O  O     . LEU E  3 822  ? 55.757  10.503  13.378  1.00 45.22 ? 2149 LEU A O     1 
ATOM   6557  C  CB    . LEU E  3 822  ? 56.305  11.660  10.919  1.00 43.53 ? 2149 LEU A CB    1 
ATOM   6558  C  CG    . LEU E  3 822  ? 57.025  11.624  9.571   1.00 42.58 ? 2149 LEU A CG    1 
ATOM   6559  C  CD1   . LEU E  3 822  ? 56.099  11.362  8.403   1.00 42.31 ? 2149 LEU A CD1   1 
ATOM   6560  C  CD2   . LEU E  3 822  ? 57.784  12.902  9.358   1.00 41.97 ? 2149 LEU A CD2   1 
ATOM   6561  N  N     . THR E  3 823  ? 54.246  9.051   12.540  1.00 43.32 ? 2150 THR A N     1 
ATOM   6562  C  CA    . THR E  3 823  ? 54.068  8.308   13.790  1.00 44.12 ? 2150 THR A CA    1 
ATOM   6563  C  C     . THR E  3 823  ? 55.199  7.320   14.049  1.00 44.17 ? 2150 THR A C     1 
ATOM   6564  O  O     . THR E  3 823  ? 55.384  6.384   13.279  1.00 45.25 ? 2150 THR A O     1 
ATOM   6565  C  CB    . THR E  3 823  ? 52.737  7.516   13.797  1.00 44.66 ? 2150 THR A CB    1 
ATOM   6566  O  OG1   . THR E  3 823  ? 51.667  8.339   13.317  1.00 47.14 ? 2150 THR A OG1   1 
ATOM   6567  C  CG2   . THR E  3 823  ? 52.407  7.046   15.202  1.00 45.94 ? 2150 THR A CG2   1 
ATOM   6568  N  N     . PRO E  3 824  ? 55.949  7.508   15.146  1.00 44.35 ? 2151 PRO A N     1 
ATOM   6569  C  CA    . PRO E  3 824  ? 56.998  6.568   15.549  1.00 45.04 ? 2151 PRO A CA    1 
ATOM   6570  C  C     . PRO E  3 824  ? 56.508  5.125   15.624  1.00 46.37 ? 2151 PRO A C     1 
ATOM   6571  O  O     . PRO E  3 824  ? 55.339  4.871   15.946  1.00 47.01 ? 2151 PRO A O     1 
ATOM   6572  C  CB    . PRO E  3 824  ? 57.379  7.056   16.943  1.00 44.50 ? 2151 PRO A CB    1 
ATOM   6573  C  CG    . PRO E  3 824  ? 57.103  8.507   16.888  1.00 45.29 ? 2151 PRO A CG    1 
ATOM   6574  C  CD    . PRO E  3 824  ? 55.854  8.642   16.076  1.00 44.41 ? 2151 PRO A CD    1 
ATOM   6575  N  N     . LYS E  3 825  ? 57.410  4.192   15.332  1.00 47.41 ? 2152 LYS A N     1 
ATOM   6576  C  CA    . LYS E  3 825  ? 57.077  2.770   15.275  1.00 47.86 ? 2152 LYS A CA    1 
ATOM   6577  C  C     . LYS E  3 825  ? 56.536  2.259   16.603  1.00 46.88 ? 2152 LYS A C     1 
ATOM   6578  O  O     . LYS E  3 825  ? 55.573  1.500   16.624  1.00 46.89 ? 2152 LYS A O     1 
ATOM   6579  C  CB    . LYS E  3 825  ? 58.300  1.955   14.853  1.00 49.22 ? 2152 LYS A CB    1 
ATOM   6580  C  CG    . LYS E  3 825  ? 58.001  0.495   14.522  1.00 50.52 ? 2152 LYS A CG    1 
ATOM   6581  C  CD    . LYS E  3 825  ? 59.152  -0.125  13.744  1.00 54.20 ? 2152 LYS A CD    1 
ATOM   6582  C  CE    . LYS E  3 825  ? 58.769  -1.473  13.149  1.00 54.25 ? 2152 LYS A CE    1 
ATOM   6583  N  NZ    . LYS E  3 825  ? 58.798  -2.548  14.169  1.00 53.69 ? 2152 LYS A NZ    1 
ATOM   6584  N  N     . ALA E  3 826  ? 57.156  2.690   17.699  1.00 46.21 ? 2153 ALA A N     1 
ATOM   6585  C  CA    . ALA E  3 826  ? 56.757  2.269   19.036  1.00 46.09 ? 2153 ALA A CA    1 
ATOM   6586  C  C     . ALA E  3 826  ? 55.352  2.742   19.380  1.00 46.46 ? 2153 ALA A C     1 
ATOM   6587  O  O     . ALA E  3 826  ? 54.627  2.056   20.107  1.00 46.37 ? 2153 ALA A O     1 
ATOM   6588  C  CB    . ALA E  3 826  ? 57.752  2.762   20.066  1.00 45.96 ? 2153 ALA A CB    1 
ATOM   6589  N  N     . GLU E  3 827  ? 54.973  3.903   18.843  1.00 46.88 ? 2154 GLU A N     1 
ATOM   6590  C  CA    . GLU E  3 827  ? 53.648  4.476   19.070  1.00 47.62 ? 2154 GLU A CA    1 
ATOM   6591  C  C     . GLU E  3 827  ? 52.555  3.689   18.357  1.00 47.36 ? 2154 GLU A C     1 
ATOM   6592  O  O     . GLU E  3 827  ? 51.489  3.440   18.928  1.00 47.35 ? 2154 GLU A O     1 
ATOM   6593  C  CB    . GLU E  3 827  ? 53.603  5.947   18.646  1.00 48.17 ? 2154 GLU A CB    1 
ATOM   6594  C  CG    . GLU E  3 827  ? 52.329  6.689   19.071  1.00 50.65 ? 2154 GLU A CG    1 
ATOM   6595  C  CD    . GLU E  3 827  ? 52.520  8.199   19.181  1.00 54.65 ? 2154 GLU A CD    1 
ATOM   6596  O  OE1   . GLU E  3 827  ? 52.096  8.783   20.213  1.00 55.33 ? 2154 GLU A OE1   1 
ATOM   6597  O  OE2   . GLU E  3 827  ? 53.102  8.804   18.245  1.00 56.40 ? 2154 GLU A OE2   1 
ATOM   6598  N  N     . ILE E  3 828  ? 52.812  3.321   17.104  1.00 47.11 ? 2155 ILE A N     1 
ATOM   6599  C  CA    . ILE E  3 828  ? 51.872  2.523   16.306  1.00 46.75 ? 2155 ILE A CA    1 
ATOM   6600  C  C     . ILE E  3 828  ? 51.632  1.152   16.915  1.00 46.82 ? 2155 ILE A C     1 
ATOM   6601  O  O     . ILE E  3 828  ? 50.497  0.692   16.966  1.00 47.15 ? 2155 ILE A O     1 
ATOM   6602  C  CB    . ILE E  3 828  ? 52.338  2.399   14.839  1.00 46.43 ? 2155 ILE A CB    1 
ATOM   6603  C  CG1   . ILE E  3 828  ? 51.829  3.594   14.050  1.00 45.58 ? 2155 ILE A CG1   1 
ATOM   6604  C  CG2   . ILE E  3 828  ? 51.828  1.117   14.192  1.00 44.82 ? 2155 ILE A CG2   1 
ATOM   6605  C  CD1   . ILE E  3 828  ? 52.642  3.905   12.854  1.00 45.77 ? 2155 ILE A CD1   1 
ATOM   6606  N  N     . GLU E  3 829  ? 52.697  0.514   17.384  1.00 47.01 ? 2156 GLU A N     1 
ATOM   6607  C  CA    . GLU E  3 829  ? 52.581  -0.787  18.019  1.00 48.22 ? 2156 GLU A CA    1 
ATOM   6608  C  C     . GLU E  3 829  ? 52.019  -0.688  19.432  1.00 47.83 ? 2156 GLU A C     1 
ATOM   6609  O  O     . GLU E  3 829  ? 51.386  -1.621  19.913  1.00 48.03 ? 2156 GLU A O     1 
ATOM   6610  C  CB    . GLU E  3 829  ? 53.928  -1.501  18.019  1.00 49.76 ? 2156 GLU A CB    1 
ATOM   6611  C  CG    . GLU E  3 829  ? 54.271  -2.125  16.671  1.00 53.04 ? 2156 GLU A CG    1 
ATOM   6612  C  CD    . GLU E  3 829  ? 55.747  -2.450  16.530  1.00 55.47 ? 2156 GLU A CD    1 
ATOM   6613  O  OE1   . GLU E  3 829  ? 56.067  -3.612  16.197  1.00 55.62 ? 2156 GLU A OE1   1 
ATOM   6614  O  OE2   . GLU E  3 829  ? 56.585  -1.544  16.753  1.00 57.97 ? 2156 GLU A OE2   1 
ATOM   6615  N  N     . GLY E  3 830  ? 52.249  0.449   20.085  1.00 47.64 ? 2157 GLY A N     1 
ATOM   6616  C  CA    . GLY E  3 830  ? 51.680  0.725   21.405  1.00 47.21 ? 2157 GLY A CA    1 
ATOM   6617  C  C     . GLY E  3 830  ? 50.186  0.995   21.345  1.00 46.77 ? 2157 GLY A C     1 
ATOM   6618  O  O     . GLY E  3 830  ? 49.605  1.039   20.263  1.00 46.83 ? 2157 GLY A O     1 
ATOM   6619  N  N     . GLU E  3 831  ? 49.564  1.165   22.510  1.00 46.42 ? 2158 GLU A N     1 
ATOM   6620  C  CA    . GLU E  3 831  ? 48.136  1.466   22.588  1.00 46.18 ? 2158 GLU A CA    1 
ATOM   6621  C  C     . GLU E  3 831  ? 47.861  2.965   22.595  1.00 46.07 ? 2158 GLU A C     1 
ATOM   6622  O  O     . GLU E  3 831  ? 48.780  3.770   22.766  1.00 46.74 ? 2158 GLU A O     1 
ATOM   6623  C  CB    . GLU E  3 831  ? 47.531  0.819   23.817  1.00 46.08 ? 2158 GLU A CB    1 
ATOM   6624  C  CG    . GLU E  3 831  ? 47.195  -0.626  23.610  1.00 48.66 ? 2158 GLU A CG    1 
ATOM   6625  C  CD    . GLU E  3 831  ? 46.261  -1.147  24.673  1.00 53.08 ? 2158 GLU A CD    1 
ATOM   6626  O  OE1   . GLU E  3 831  ? 45.086  -1.419  24.336  1.00 55.43 ? 2158 GLU A OE1   1 
ATOM   6627  O  OE2   . GLU E  3 831  ? 46.690  -1.274  25.847  1.00 54.66 ? 2158 GLU A OE2   1 
ATOM   6628  N  N     . ILE E  3 832  ? 46.599  3.337   22.381  1.00 45.18 ? 2159 ILE A N     1 
ATOM   6629  C  CA    . ILE E  3 832  ? 46.189  4.732   22.498  1.00 44.33 ? 2159 ILE A CA    1 
ATOM   6630  C  C     . ILE E  3 832  ? 46.108  5.072   23.975  1.00 43.63 ? 2159 ILE A C     1 
ATOM   6631  O  O     . ILE E  3 832  ? 45.366  4.439   24.727  1.00 42.74 ? 2159 ILE A O     1 
ATOM   6632  C  CB    . ILE E  3 832  ? 44.856  5.026   21.770  1.00 44.25 ? 2159 ILE A CB    1 
ATOM   6633  C  CG1   . ILE E  3 832  ? 45.104  5.096   20.268  1.00 46.65 ? 2159 ILE A CG1   1 
ATOM   6634  C  CG2   . ILE E  3 832  ? 44.271  6.361   22.211  1.00 43.48 ? 2159 ILE A CG2   1 
ATOM   6635  C  CD1   . ILE E  3 832  ? 43.859  4.998   19.411  1.00 49.73 ? 2159 ILE A CD1   1 
ATOM   6636  N  N     . GLY E  3 833  ? 46.897  6.066   24.376  1.00 43.29 ? 2160 GLY A N     1 
ATOM   6637  C  CA    . GLY E  3 833  ? 47.000  6.471   25.768  1.00 42.89 ? 2160 GLY A CA    1 
ATOM   6638  C  C     . GLY E  3 833  ? 48.381  6.197   26.316  1.00 42.96 ? 2160 GLY A C     1 
ATOM   6639  O  O     . GLY E  3 833  ? 48.745  6.719   27.364  1.00 43.19 ? 2160 GLY A O     1 
ATOM   6640  N  N     . ASP E  3 834  ? 49.145  5.367   25.610  1.00 43.44 ? 2161 ASP A N     1 
ATOM   6641  C  CA    . ASP E  3 834  ? 50.535  5.097   25.966  1.00 43.73 ? 2161 ASP A CA    1 
ATOM   6642  C  C     . ASP E  3 834  ? 51.349  6.367   25.824  1.00 43.33 ? 2161 ASP A C     1 
ATOM   6643  O  O     . ASP E  3 834  ? 51.137  7.154   24.908  1.00 42.04 ? 2161 ASP A O     1 
ATOM   6644  C  CB    . ASP E  3 834  ? 51.136  4.001   25.083  1.00 44.78 ? 2161 ASP A CB    1 
ATOM   6645  C  CG    . ASP E  3 834  ? 50.689  2.606   25.490  1.00 46.02 ? 2161 ASP A CG    1 
ATOM   6646  O  OD1   . ASP E  3 834  ? 50.006  2.469   26.526  1.00 47.11 ? 2161 ASP A OD1   1 
ATOM   6647  O  OD2   . ASP E  3 834  ? 51.027  1.642   24.769  1.00 47.48 ? 2161 ASP A OD2   1 
ATOM   6648  N  N     . SER E  3 835  ? 52.276  6.557   26.751  1.00 43.91 ? 2162 SER A N     1 
ATOM   6649  C  CA    . SER E  3 835  ? 53.089  7.755   26.790  1.00 43.72 ? 2162 SER A CA    1 
ATOM   6650  C  C     . SER E  3 835  ? 54.426  7.505   26.101  1.00 43.38 ? 2162 SER A C     1 
ATOM   6651  O  O     . SER E  3 835  ? 55.148  6.574   26.461  1.00 43.37 ? 2162 SER A O     1 
ATOM   6652  C  CB    . SER E  3 835  ? 53.305  8.175   28.240  1.00 44.15 ? 2162 SER A CB    1 
ATOM   6653  O  OG    . SER E  3 835  ? 53.952  9.427   28.305  1.00 46.63 ? 2162 SER A OG    1 
ATOM   6654  N  N     . HIS E  3 836  ? 54.742  8.330   25.103  1.00 42.93 ? 2163 HIS A N     1 
ATOM   6655  C  CA    . HIS E  3 836  ? 56.001  8.214   24.374  1.00 42.38 ? 2163 HIS A CA    1 
ATOM   6656  C  C     . HIS E  3 836  ? 56.729  9.541   24.414  1.00 42.90 ? 2163 HIS A C     1 
ATOM   6657  O  O     . HIS E  3 836  ? 56.906  10.186  23.374  1.00 44.33 ? 2163 HIS A O     1 
ATOM   6658  C  CB    . HIS E  3 836  ? 55.768  7.794   22.915  1.00 41.89 ? 2163 HIS A CB    1 
ATOM   6659  C  CG    . HIS E  3 836  ? 54.972  6.546   22.768  1.00 41.19 ? 2163 HIS A CG    1 
ATOM   6660  N  ND1   . HIS E  3 836  ? 55.431  5.322   23.195  1.00 42.05 ? 2163 HIS A ND1   1 
ATOM   6661  C  CD2   . HIS E  3 836  ? 53.739  6.331   22.256  1.00 43.03 ? 2163 HIS A CD2   1 
ATOM   6662  C  CE1   . HIS E  3 836  ? 54.510  4.404   22.957  1.00 44.38 ? 2163 HIS A CE1   1 
ATOM   6663  N  NE2   . HIS E  3 836  ? 53.473  4.990   22.387  1.00 44.37 ? 2163 HIS A NE2   1 
ATOM   6664  N  N     . MET E  3 837  ? 57.161  9.941   25.608  1.00 42.30 ? 2164 MET A N     1 
ATOM   6665  C  CA    . MET E  3 837  ? 57.788  11.249  25.810  1.00 42.02 ? 2164 MET A CA    1 
ATOM   6666  C  C     . MET E  3 837  ? 58.912  11.561  24.825  1.00 41.59 ? 2164 MET A C     1 
ATOM   6667  O  O     . MET E  3 837  ? 59.878  10.807  24.702  1.00 40.66 ? 2164 MET A O     1 
ATOM   6668  C  CB    . MET E  3 837  ? 58.303  11.379  27.233  1.00 41.04 ? 2164 MET A CB    1 
ATOM   6669  C  CG    . MET E  3 837  ? 57.257  11.754  28.229  1.00 41.46 ? 2164 MET A CG    1 
ATOM   6670  S  SD    . MET E  3 837  ? 57.899  11.414  29.870  1.00 43.50 ? 2164 MET A SD    1 
ATOM   6671  C  CE    . MET E  3 837  ? 58.578  13.015  30.310  1.00 46.15 ? 2164 MET A CE    1 
ATOM   6672  N  N     . GLY E  3 838  ? 58.755  12.674  24.117  1.00 41.89 ? 2165 GLY A N     1 
ATOM   6673  C  CA    . GLY E  3 838  ? 59.741  13.142  23.155  1.00 43.53 ? 2165 GLY A CA    1 
ATOM   6674  C  C     . GLY E  3 838  ? 60.200  12.197  22.053  1.00 44.76 ? 2165 GLY A C     1 
ATOM   6675  O  O     . GLY E  3 838  ? 61.233  12.444  21.440  1.00 45.57 ? 2165 GLY A O     1 
ATOM   6676  N  N     . LEU E  3 839  ? 59.442  11.133  21.780  1.00 45.34 ? 2166 LEU A N     1 
ATOM   6677  C  CA    . LEU E  3 839  ? 59.864  10.125  20.801  1.00 44.55 ? 2166 LEU A CA    1 
ATOM   6678  C  C     . LEU E  3 839  ? 59.890  10.687  19.392  1.00 44.22 ? 2166 LEU A C     1 
ATOM   6679  O  O     . LEU E  3 839  ? 60.887  10.547  18.687  1.00 44.49 ? 2166 LEU A O     1 
ATOM   6680  C  CB    . LEU E  3 839  ? 58.967  8.889   20.841  1.00 44.20 ? 2166 LEU A CB    1 
ATOM   6681  C  CG    . LEU E  3 839  ? 59.618  7.507   20.657  1.00 44.18 ? 2166 LEU A CG    1 
ATOM   6682  C  CD1   . LEU E  3 839  ? 58.529  6.484   20.506  1.00 44.77 ? 2166 LEU A CD1   1 
ATOM   6683  C  CD2   . LEU E  3 839  ? 60.573  7.408   19.473  1.00 45.78 ? 2166 LEU A CD2   1 
ATOM   6684  N  N     . ALA E  3 840  ? 58.795  11.318  18.984  1.00 44.47 ? 2167 ALA A N     1 
ATOM   6685  C  CA    . ALA E  3 840  ? 58.712  11.890  17.645  1.00 44.66 ? 2167 ALA A CA    1 
ATOM   6686  C  C     . ALA E  3 840  ? 59.752  12.984  17.492  1.00 45.15 ? 2167 ALA A C     1 
ATOM   6687  O  O     . ALA E  3 840  ? 60.331  13.123  16.416  1.00 45.70 ? 2167 ALA A O     1 
ATOM   6688  C  CB    . ALA E  3 840  ? 57.317  12.428  17.353  1.00 44.49 ? 2167 ALA A CB    1 
ATOM   6689  N  N     . ALA E  3 841  ? 60.003  13.730  18.577  1.00 45.28 ? 2168 ALA A N     1 
ATOM   6690  C  CA    . ALA E  3 841  ? 60.960  14.839  18.563  1.00 45.57 ? 2168 ALA A CA    1 
ATOM   6691  C  C     . ALA E  3 841  ? 62.376  14.320  18.360  1.00 45.69 ? 2168 ALA A C     1 
ATOM   6692  O  O     . ALA E  3 841  ? 63.148  14.863  17.566  1.00 44.80 ? 2168 ALA A O     1 
ATOM   6693  C  CB    . ALA E  3 841  ? 60.872  15.630  19.856  1.00 45.73 ? 2168 ALA A CB    1 
ATOM   6694  N  N     . ARG E  3 842  ? 62.695  13.256  19.089  1.00 46.20 ? 2169 ARG A N     1 
ATOM   6695  C  CA    . ARG E  3 842  ? 64.017  12.648  19.083  1.00 45.79 ? 2169 ARG A CA    1 
ATOM   6696  C  C     . ARG E  3 842  ? 64.269  11.981  17.736  1.00 45.47 ? 2169 ARG A C     1 
ATOM   6697  O  O     . ARG E  3 842  ? 65.394  11.978  17.242  1.00 45.66 ? 2169 ARG A O     1 
ATOM   6698  C  CB    . ARG E  3 842  ? 64.116  11.644  20.234  1.00 45.83 ? 2169 ARG A CB    1 
ATOM   6699  C  CG    . ARG E  3 842  ? 65.515  11.261  20.641  1.00 47.04 ? 2169 ARG A CG    1 
ATOM   6700  C  CD    . ARG E  3 842  ? 65.568  10.635  22.034  1.00 47.51 ? 2169 ARG A CD    1 
ATOM   6701  N  NE    . ARG E  3 842  ? 64.606  9.549   22.210  1.00 49.12 ? 2169 ARG A NE    1 
ATOM   6702  C  CZ    . ARG E  3 842  ? 63.483  9.647   22.921  1.00 50.57 ? 2169 ARG A CZ    1 
ATOM   6703  N  NH1   . ARG E  3 842  ? 63.176  10.784  23.540  1.00 51.66 ? 2169 ARG A NH1   1 
ATOM   6704  N  NH2   . ARG E  3 842  ? 62.666  8.605   23.020  1.00 49.97 ? 2169 ARG A NH2   1 
ATOM   6705  N  N     . MET E  3 843  ? 63.207  11.432  17.153  1.00 45.55 ? 2170 MET A N     1 
ATOM   6706  C  CA    . MET E  3 843  ? 63.252  10.802  15.839  1.00 46.95 ? 2170 MET A CA    1 
ATOM   6707  C  C     . MET E  3 843  ? 63.504  11.837  14.746  1.00 46.22 ? 2170 MET A C     1 
ATOM   6708  O  O     . MET E  3 843  ? 64.314  11.624  13.857  1.00 46.36 ? 2170 MET A O     1 
ATOM   6709  C  CB    . MET E  3 843  ? 61.942  10.056  15.575  1.00 46.97 ? 2170 MET A CB    1 
ATOM   6710  C  CG    . MET E  3 843  ? 61.777  9.531   14.157  1.00 48.09 ? 2170 MET A CG    1 
ATOM   6711  S  SD    . MET E  3 843  ? 60.055  9.178   13.723  1.00 50.26 ? 2170 MET A SD    1 
ATOM   6712  C  CE    . MET E  3 843  ? 59.394  10.836  13.514  1.00 49.83 ? 2170 MET A CE    1 
ATOM   6713  N  N     . MET E  3 844  ? 62.797  12.954  14.820  1.00 46.40 ? 2171 MET A N     1 
ATOM   6714  C  CA    . MET E  3 844  ? 62.992  14.078  13.907  1.00 45.61 ? 2171 MET A CA    1 
ATOM   6715  C  C     . MET E  3 844  ? 64.398  14.634  14.014  1.00 44.68 ? 2171 MET A C     1 
ATOM   6716  O  O     . MET E  3 844  ? 65.030  14.950  13.011  1.00 44.18 ? 2171 MET A O     1 
ATOM   6717  C  CB    . MET E  3 844  ? 62.007  15.196  14.245  1.00 46.79 ? 2171 MET A CB    1 
ATOM   6718  C  CG    . MET E  3 844  ? 60.635  15.042  13.663  1.00 48.77 ? 2171 MET A CG    1 
ATOM   6719  S  SD    . MET E  3 844  ? 60.765  15.283  11.890  1.00 52.33 ? 2171 MET A SD    1 
ATOM   6720  C  CE    . MET E  3 844  ? 60.466  13.604  11.354  1.00 54.22 ? 2171 MET A CE    1 
ATOM   6721  N  N     . SER E  3 845  ? 64.873  14.759  15.248  1.00 43.96 ? 2172 SER A N     1 
ATOM   6722  C  CA    . SER E  3 845  ? 66.191  15.287  15.517  1.00 43.07 ? 2172 SER A CA    1 
ATOM   6723  C  C     . SER E  3 845  ? 67.247  14.392  14.882  1.00 42.66 ? 2172 SER A C     1 
ATOM   6724  O  O     . SER E  3 845  ? 68.210  14.886  14.299  1.00 44.10 ? 2172 SER A O     1 
ATOM   6725  C  CB    . SER E  3 845  ? 66.401  15.399  17.018  1.00 43.53 ? 2172 SER A CB    1 
ATOM   6726  O  OG    . SER E  3 845  ? 67.412  16.333  17.322  1.00 43.51 ? 2172 SER A OG    1 
ATOM   6727  N  N     . GLN E  3 846  ? 67.046  13.079  14.969  1.00 41.18 ? 2173 GLN A N     1 
ATOM   6728  C  CA    . GLN E  3 846  ? 67.931  12.118  14.320  1.00 40.05 ? 2173 GLN A CA    1 
ATOM   6729  C  C     . GLN E  3 846  ? 67.869  12.222  12.801  1.00 40.35 ? 2173 GLN A C     1 
ATOM   6730  O  O     . GLN E  3 846  ? 68.895  12.196  12.126  1.00 41.30 ? 2173 GLN A O     1 
ATOM   6731  C  CB    . GLN E  3 846  ? 67.602  10.702  14.763  1.00 38.98 ? 2173 GLN A CB    1 
ATOM   6732  C  CG    . GLN E  3 846  ? 68.555  9.655   14.232  1.00 39.63 ? 2173 GLN A CG    1 
ATOM   6733  C  CD    . GLN E  3 846  ? 68.236  8.259   14.733  1.00 42.24 ? 2173 GLN A CD    1 
ATOM   6734  O  OE1   . GLN E  3 846  ? 69.136  7.483   15.054  1.00 42.62 ? 2173 GLN A OE1   1 
ATOM   6735  N  NE2   . GLN E  3 846  ? 66.947  7.934   14.813  1.00 43.92 ? 2173 GLN A NE2   1 
ATOM   6736  N  N     . ALA E  3 847  ? 66.661  12.352  12.268  1.00 40.73 ? 2174 ALA A N     1 
ATOM   6737  C  CA    . ALA E  3 847  ? 66.449  12.438  10.833  1.00 40.18 ? 2174 ALA A CA    1 
ATOM   6738  C  C     . ALA E  3 847  ? 67.231  13.590  10.235  1.00 41.05 ? 2174 ALA A C     1 
ATOM   6739  O  O     . ALA E  3 847  ? 67.949  13.403  9.255   1.00 41.72 ? 2174 ALA A O     1 
ATOM   6740  C  CB    . ALA E  3 847  ? 64.980  12.565  10.519  1.00 39.40 ? 2174 ALA A CB    1 
ATOM   6741  N  N     . MET E  3 848  ? 67.125  14.771  10.839  1.00 42.45 ? 2175 MET A N     1 
ATOM   6742  C  CA    . MET E  3 848  ? 67.817  15.965  10.324  1.00 43.38 ? 2175 MET A CA    1 
ATOM   6743  C  C     . MET E  3 848  ? 69.311  15.743  10.203  1.00 43.73 ? 2175 MET A C     1 
ATOM   6744  O  O     . MET E  3 848  ? 69.888  16.040  9.170   1.00 43.68 ? 2175 MET A O     1 
ATOM   6745  C  CB    . MET E  3 848  ? 67.565  17.185  11.195  1.00 43.53 ? 2175 MET A CB    1 
ATOM   6746  C  CG    . MET E  3 848  ? 66.111  17.599  11.338  1.00 46.90 ? 2175 MET A CG    1 
ATOM   6747  S  SD    . MET E  3 848  ? 65.207  17.840  9.777   1.00 48.08 ? 2175 MET A SD    1 
ATOM   6748  C  CE    . MET E  3 848  ? 64.233  16.329  9.715   1.00 48.75 ? 2175 MET A CE    1 
ATOM   6749  N  N     . ARG E  3 849  ? 69.927  15.208  11.257  1.00 44.80 ? 2176 ARG A N     1 
ATOM   6750  C  CA    . ARG E  3 849  ? 71.354  14.886  11.259  1.00 45.16 ? 2176 ARG A CA    1 
ATOM   6751  C  C     . ARG E  3 849  ? 71.751  14.061  10.048  1.00 45.69 ? 2176 ARG A C     1 
ATOM   6752  O  O     . ARG E  3 849  ? 72.691  14.408  9.336   1.00 45.99 ? 2176 ARG A O     1 
ATOM   6753  C  CB    . ARG E  3 849  ? 71.724  14.128  12.522  1.00 45.09 ? 2176 ARG A CB    1 
ATOM   6754  C  CG    . ARG E  3 849  ? 72.045  15.010  13.696  1.00 46.77 ? 2176 ARG A CG    1 
ATOM   6755  C  CD    . ARG E  3 849  ? 72.332  14.170  14.922  1.00 48.45 ? 2176 ARG A CD    1 
ATOM   6756  N  NE    . ARG E  3 849  ? 71.112  13.564  15.450  1.00 47.92 ? 2176 ARG A NE    1 
ATOM   6757  C  CZ    . ARG E  3 849  ? 71.071  12.715  16.469  1.00 48.77 ? 2176 ARG A CZ    1 
ATOM   6758  N  NH1   . ARG E  3 849  ? 72.189  12.347  17.094  1.00 51.42 ? 2176 ARG A NH1   1 
ATOM   6759  N  NH2   . ARG E  3 849  ? 69.907  12.233  16.869  1.00 49.04 ? 2176 ARG A NH2   1 
ATOM   6760  N  N     . LYS E  3 850  ? 71.013  12.979  9.813   1.00 46.83 ? 2177 LYS A N     1 
ATOM   6761  C  CA    . LYS E  3 850  ? 71.271  12.068  8.694   1.00 48.02 ? 2177 LYS A CA    1 
ATOM   6762  C  C     . LYS E  3 850  ? 70.930  12.659  7.322   1.00 48.14 ? 2177 LYS A C     1 
ATOM   6763  O  O     . LYS E  3 850  ? 71.670  12.452  6.355   1.00 48.53 ? 2177 LYS A O     1 
ATOM   6764  C  CB    . LYS E  3 850  ? 70.512  10.754  8.882   1.00 48.18 ? 2177 LYS A CB    1 
ATOM   6765  C  CG    . LYS E  3 850  ? 70.924  9.950   10.111  1.00 49.98 ? 2177 LYS A CG    1 
ATOM   6766  C  CD    . LYS E  3 850  ? 70.455  8.507   9.996   1.00 50.86 ? 2177 LYS A CD    1 
ATOM   6767  C  CE    . LYS E  3 850  ? 71.099  7.821   8.787   1.00 52.33 ? 2177 LYS A CE    1 
ATOM   6768  N  NZ    . LYS E  3 850  ? 70.343  6.614   8.368   1.00 52.73 ? 2177 LYS A NZ    1 
ATOM   6769  N  N     . LEU E  3 851  ? 69.821  13.389  7.236   1.00 47.34 ? 2178 LEU A N     1 
ATOM   6770  C  CA    . LEU E  3 851  ? 69.360  13.919  5.949   1.00 47.22 ? 2178 LEU A CA    1 
ATOM   6771  C  C     . LEU E  3 851  ? 70.168  15.097  5.409   1.00 47.01 ? 2178 LEU A C     1 
ATOM   6772  O  O     . LEU E  3 851  ? 70.540  15.101  4.242   1.00 47.71 ? 2178 LEU A O     1 
ATOM   6773  C  CB    . LEU E  3 851  ? 67.879  14.292  6.008   1.00 47.22 ? 2178 LEU A CB    1 
ATOM   6774  C  CG    . LEU E  3 851  ? 66.883  13.142  6.112   1.00 47.32 ? 2178 LEU A CG    1 
ATOM   6775  C  CD1   . LEU E  3 851  ? 65.512  13.686  6.426   1.00 47.50 ? 2178 LEU A CD1   1 
ATOM   6776  C  CD2   . LEU E  3 851  ? 66.853  12.329  4.840   1.00 47.88 ? 2178 LEU A CD2   1 
ATOM   6777  N  N     . ALA E  3 852  ? 70.423  16.091  6.254   1.00 46.40 ? 2179 ALA A N     1 
ATOM   6778  C  CA    . ALA E  3 852  ? 71.077  17.330  5.842   1.00 46.02 ? 2179 ALA A CA    1 
ATOM   6779  C  C     . ALA E  3 852  ? 72.218  17.100  4.871   1.00 45.89 ? 2179 ALA A C     1 
ATOM   6780  O  O     . ALA E  3 852  ? 72.256  17.713  3.806   1.00 44.95 ? 2179 ALA A O     1 
ATOM   6781  C  CB    . ALA E  3 852  ? 71.568  18.098  7.057   1.00 46.61 ? 2179 ALA A CB    1 
ATOM   6782  N  N     . GLY E  3 853  ? 73.136  16.211  5.247   1.00 46.75 ? 2180 GLY A N     1 
ATOM   6783  C  CA    . GLY E  3 853  ? 74.312  15.915  4.433   1.00 48.11 ? 2180 GLY A CA    1 
ATOM   6784  C  C     . GLY E  3 853  ? 73.993  15.252  3.105   1.00 48.92 ? 2180 GLY A C     1 
ATOM   6785  O  O     . GLY E  3 853  ? 74.506  15.660  2.063   1.00 49.00 ? 2180 GLY A O     1 
ATOM   6786  N  N     . ASN E  3 854  ? 73.142  14.225  3.149   1.00 49.83 ? 2181 ASN A N     1 
ATOM   6787  C  CA    . ASN E  3 854  ? 72.733  13.482  1.953   1.00 49.60 ? 2181 ASN A CA    1 
ATOM   6788  C  C     . ASN E  3 854  ? 71.985  14.339  0.965   1.00 49.09 ? 2181 ASN A C     1 
ATOM   6789  O  O     . ASN E  3 854  ? 72.106  14.145  -0.230  1.00 49.64 ? 2181 ASN A O     1 
ATOM   6790  C  CB    . ASN E  3 854  ? 71.866  12.279  2.324   1.00 50.08 ? 2181 ASN A CB    1 
ATOM   6791  C  CG    . ASN E  3 854  ? 72.669  11.134  2.925   1.00 52.43 ? 2181 ASN A CG    1 
ATOM   6792  O  OD1   . ASN E  3 854  ? 72.092  10.172  3.444   1.00 54.37 ? 2181 ASN A OD1   1 
ATOM   6793  N  ND2   . ASN E  3 854  ? 74.003  11.220  2.850   1.00 52.57 ? 2181 ASN A ND2   1 
ATOM   6794  N  N     . LEU E  3 855  ? 71.200  15.277  1.476   1.00 49.10 ? 2182 LEU A N     1 
ATOM   6795  C  CA    . LEU E  3 855  ? 70.408  16.159  0.637   1.00 49.08 ? 2182 LEU A CA    1 
ATOM   6796  C  C     . LEU E  3 855  ? 71.284  17.154  -0.104  1.00 49.31 ? 2182 LEU A C     1 
ATOM   6797  O  O     . LEU E  3 855  ? 71.048  17.436  -1.274  1.00 49.45 ? 2182 LEU A O     1 
ATOM   6798  C  CB    . LEU E  3 855  ? 69.348  16.884  1.465   1.00 48.26 ? 2182 LEU A CB    1 
ATOM   6799  C  CG    . LEU E  3 855  ? 68.170  16.013  1.884   1.00 49.18 ? 2182 LEU A CG    1 
ATOM   6800  C  CD1   . LEU E  3 855  ? 67.466  16.644  3.069   1.00 51.42 ? 2182 LEU A CD1   1 
ATOM   6801  C  CD2   . LEU E  3 855  ? 67.200  15.788  0.728   1.00 47.88 ? 2182 LEU A CD2   1 
ATOM   6802  N  N     . LYS E  3 856  ? 72.293  17.681  0.579   1.00 49.86 ? 2183 LYS A N     1 
ATOM   6803  C  CA    . LYS E  3 856  ? 73.183  18.652  -0.020  1.00 51.05 ? 2183 LYS A CA    1 
ATOM   6804  C  C     . LYS E  3 856  ? 74.013  17.993  -1.129  1.00 51.43 ? 2183 LYS A C     1 
ATOM   6805  O  O     . LYS E  3 856  ? 74.106  18.524  -2.239  1.00 51.21 ? 2183 LYS A O     1 
ATOM   6806  C  CB    . LYS E  3 856  ? 74.052  19.343  1.052   1.00 51.46 ? 2183 LYS A CB    1 
ATOM   6807  C  CG    . LYS E  3 856  ? 75.176  20.284  0.532   1.00 55.63 ? 2183 LYS A CG    1 
ATOM   6808  C  CD    . LYS E  3 856  ? 74.734  21.297  -0.560  1.00 59.64 ? 2183 LYS A CD    1 
ATOM   6809  C  CE    . LYS E  3 856  ? 73.792  22.383  -0.040  1.00 60.69 ? 2183 LYS A CE    1 
ATOM   6810  N  NZ    . LYS E  3 856  ? 74.552  23.483  0.597   1.00 63.99 ? 2183 LYS A NZ    1 
ATOM   6811  N  N     . GLN E  3 857  ? 74.583  16.825  -0.844  1.00 52.06 ? 2184 GLN A N     1 
ATOM   6812  C  CA    . GLN E  3 857  ? 75.434  16.139  -1.818  1.00 52.63 ? 2184 GLN A CA    1 
ATOM   6813  C  C     . GLN E  3 857  ? 74.688  15.627  -3.042  1.00 51.89 ? 2184 GLN A C     1 
ATOM   6814  O  O     . GLN E  3 857  ? 75.300  15.351  -4.065  1.00 52.09 ? 2184 GLN A O     1 
ATOM   6815  C  CB    . GLN E  3 857  ? 76.258  15.032  -1.158  1.00 53.93 ? 2184 GLN A CB    1 
ATOM   6816  C  CG    . GLN E  3 857  ? 77.691  15.487  -0.856  1.00 61.07 ? 2184 GLN A CG    1 
ATOM   6817  C  CD    . GLN E  3 857  ? 78.264  14.890  0.429   1.00 67.03 ? 2184 GLN A CD    1 
ATOM   6818  O  OE1   . GLN E  3 857  ? 78.549  13.690  0.497   1.00 71.14 ? 2184 GLN A OE1   1 
ATOM   6819  N  NE2   . GLN E  3 857  ? 78.447  15.734  1.453   1.00 67.75 ? 2184 GLN A NE2   1 
ATOM   6820  N  N     . SER E  3 858  ? 73.367  15.517  -2.936  1.00 51.63 ? 2185 SER A N     1 
ATOM   6821  C  CA    . SER E  3 858  ? 72.523  15.060  -4.034  1.00 50.59 ? 2185 SER A CA    1 
ATOM   6822  C  C     . SER E  3 858  ? 71.791  16.214  -4.683  1.00 50.14 ? 2185 SER A C     1 
ATOM   6823  O  O     . SER E  3 858  ? 71.109  16.030  -5.694  1.00 50.46 ? 2185 SER A O     1 
ATOM   6824  C  CB    . SER E  3 858  ? 71.502  14.057  -3.524  1.00 50.68 ? 2185 SER A CB    1 
ATOM   6825  O  OG    . SER E  3 858  ? 72.159  12.953  -2.933  1.00 51.95 ? 2185 SER A OG    1 
ATOM   6826  N  N     . ASN E  3 859  ? 71.938  17.398  -4.095  1.00 49.47 ? 2186 ASN A N     1 
ATOM   6827  C  CA    . ASN E  3 859  ? 71.226  18.593  -4.528  1.00 49.16 ? 2186 ASN A CA    1 
ATOM   6828  C  C     . ASN E  3 859  ? 69.697  18.398  -4.549  1.00 48.23 ? 2186 ASN A C     1 
ATOM   6829  O  O     . ASN E  3 859  ? 68.998  18.901  -5.430  1.00 48.02 ? 2186 ASN A O     1 
ATOM   6830  C  CB    . ASN E  3 859  ? 71.761  19.080  -5.878  1.00 49.50 ? 2186 ASN A CB    1 
ATOM   6831  C  CG    . ASN E  3 859  ? 71.583  20.563  -6.060  1.00 51.33 ? 2186 ASN A CG    1 
ATOM   6832  O  OD1   . ASN E  3 859  ? 71.964  21.356  -5.191  1.00 50.93 ? 2186 ASN A OD1   1 
ATOM   6833  N  ND2   . ASN E  3 859  ? 70.985  20.956  -7.186  1.00 53.42 ? 2186 ASN A ND2   1 
ATOM   6834  N  N     . THR E  3 860  ? 69.202  17.666  -3.555  1.00 47.42 ? 2187 THR A N     1 
ATOM   6835  C  CA    . THR E  3 860  ? 67.789  17.332  -3.434  1.00 47.09 ? 2187 THR A CA    1 
ATOM   6836  C  C     . THR E  3 860  ? 67.103  18.289  -2.477  1.00 46.97 ? 2187 THR A C     1 
ATOM   6837  O  O     . THR E  3 860  ? 67.547  18.453  -1.342  1.00 47.95 ? 2187 THR A O     1 
ATOM   6838  C  CB    . THR E  3 860  ? 67.621  15.913  -2.869  1.00 47.22 ? 2187 THR A CB    1 
ATOM   6839  O  OG1   . THR E  3 860  ? 68.515  15.013  -3.546  1.00 49.23 ? 2187 THR A OG1   1 
ATOM   6840  C  CG2   . THR E  3 860  ? 66.166  15.435  -2.995  1.00 45.94 ? 2187 THR A CG2   1 
ATOM   6841  N  N     . LEU E  3 861  ? 66.021  18.917  -2.925  1.00 46.24 ? 2188 LEU A N     1 
ATOM   6842  C  CA    . LEU E  3 861  ? 65.196  19.732  -2.033  1.00 45.93 ? 2188 LEU A CA    1 
ATOM   6843  C  C     . LEU E  3 861  ? 64.213  18.848  -1.264  1.00 45.89 ? 2188 LEU A C     1 
ATOM   6844  O  O     . LEU E  3 861  ? 63.548  17.996  -1.857  1.00 46.36 ? 2188 LEU A O     1 
ATOM   6845  C  CB    . LEU E  3 861  ? 64.432  20.795  -2.824  1.00 45.74 ? 2188 LEU A CB    1 
ATOM   6846  C  CG    . LEU E  3 861  ? 63.288  21.516  -2.105  1.00 45.17 ? 2188 LEU A CG    1 
ATOM   6847  C  CD1   . LEU E  3 861  ? 63.816  22.397  -0.991  1.00 45.05 ? 2188 LEU A CD1   1 
ATOM   6848  C  CD2   . LEU E  3 861  ? 62.471  22.328  -3.083  1.00 45.94 ? 2188 LEU A CD2   1 
ATOM   6849  N  N     . LEU E  3 862  ? 64.124  19.053  0.048   1.00 45.21 ? 2189 LEU A N     1 
ATOM   6850  C  CA    . LEU E  3 862  ? 63.160  18.329  0.872   1.00 45.65 ? 2189 LEU A CA    1 
ATOM   6851  C  C     . LEU E  3 862  ? 62.187  19.292  1.558   1.00 46.06 ? 2189 LEU A C     1 
ATOM   6852  O  O     . LEU E  3 862  ? 62.603  20.105  2.387   1.00 47.34 ? 2189 LEU A O     1 
ATOM   6853  C  CB    . LEU E  3 862  ? 63.875  17.498  1.935   1.00 45.42 ? 2189 LEU A CB    1 
ATOM   6854  C  CG    . LEU E  3 862  ? 63.167  16.256  2.510   1.00 46.54 ? 2189 LEU A CG    1 
ATOM   6855  C  CD1   . LEU E  3 862  ? 63.900  15.775  3.750   1.00 45.48 ? 2189 LEU A CD1   1 
ATOM   6856  C  CD2   . LEU E  3 862  ? 61.700  16.468  2.836   1.00 46.33 ? 2189 LEU A CD2   1 
ATOM   6857  N  N     . ILE E  3 863  ? 60.900  19.190  1.229   1.00 44.71 ? 2190 ILE A N     1 
ATOM   6858  C  CA    . ILE E  3 863  ? 59.900  20.034  1.862   1.00 44.43 ? 2190 ILE A CA    1 
ATOM   6859  C  C     . ILE E  3 863  ? 59.103  19.258  2.913   1.00 45.10 ? 2190 ILE A C     1 
ATOM   6860  O  O     . ILE E  3 863  ? 58.512  18.218  2.625   1.00 45.48 ? 2190 ILE A O     1 
ATOM   6861  C  CB    . ILE E  3 863  ? 58.955  20.673  0.832   1.00 44.23 ? 2190 ILE A CB    1 
ATOM   6862  C  CG1   . ILE E  3 863  ? 59.743  21.555  -0.127  1.00 45.06 ? 2190 ILE A CG1   1 
ATOM   6863  C  CG2   . ILE E  3 863  ? 57.884  21.502  1.526   1.00 43.16 ? 2190 ILE A CG2   1 
ATOM   6864  C  CD1   . ILE E  3 863  ? 58.988  21.902  -1.392  1.00 47.95 ? 2190 ILE A CD1   1 
ATOM   6865  N  N     . PHE E  3 864  ? 59.101  19.768  4.140   1.00 45.13 ? 2191 PHE A N     1 
ATOM   6866  C  CA    . PHE E  3 864  ? 58.255  19.230  5.201   1.00 43.58 ? 2191 PHE A CA    1 
ATOM   6867  C  C     . PHE E  3 864  ? 57.009  20.079  5.393   1.00 43.26 ? 2191 PHE A C     1 
ATOM   6868  O  O     . PHE E  3 864  ? 57.101  21.285  5.610   1.00 43.64 ? 2191 PHE A O     1 
ATOM   6869  C  CB    . PHE E  3 864  ? 59.021  19.190  6.512   1.00 42.24 ? 2191 PHE A CB    1 
ATOM   6870  C  CG    . PHE E  3 864  ? 59.992  18.061  6.611   1.00 40.89 ? 2191 PHE A CG    1 
ATOM   6871  C  CD1   . PHE E  3 864  ? 59.552  16.772  6.918   1.00 42.07 ? 2191 PHE A CD1   1 
ATOM   6872  C  CD2   . PHE E  3 864  ? 61.344  18.278  6.426   1.00 37.87 ? 2191 PHE A CD2   1 
ATOM   6873  C  CE1   . PHE E  3 864  ? 60.457  15.717  7.030   1.00 40.11 ? 2191 PHE A CE1   1 
ATOM   6874  C  CE2   . PHE E  3 864  ? 62.254  17.237  6.539   1.00 36.10 ? 2191 PHE A CE2   1 
ATOM   6875  C  CZ    . PHE E  3 864  ? 61.814  15.959  6.836   1.00 38.41 ? 2191 PHE A CZ    1 
ATOM   6876  N  N     . ILE E  3 865  ? 55.845  19.455  5.300   1.00 43.36 ? 2192 ILE A N     1 
ATOM   6877  C  CA    . ILE E  3 865  ? 54.616  20.128  5.681   1.00 43.43 ? 2192 ILE A CA    1 
ATOM   6878  C  C     . ILE E  3 865  ? 54.363  19.870  7.168   1.00 43.88 ? 2192 ILE A C     1 
ATOM   6879  O  O     . ILE E  3 865  ? 54.432  18.730  7.632   1.00 44.80 ? 2192 ILE A O     1 
ATOM   6880  C  CB    . ILE E  3 865  ? 53.416  19.667  4.836   1.00 42.85 ? 2192 ILE A CB    1 
ATOM   6881  C  CG1   . ILE E  3 865  ? 53.630  20.041  3.375   1.00 42.79 ? 2192 ILE A CG1   1 
ATOM   6882  C  CG2   . ILE E  3 865  ? 52.134  20.305  5.356   1.00 43.84 ? 2192 ILE A CG2   1 
ATOM   6883  C  CD1   . ILE E  3 865  ? 52.579  19.495  2.434   1.00 44.72 ? 2192 ILE A CD1   1 
ATOM   6884  N  N     . ASN E  3 866  ? 54.081  20.924  7.919   1.00 43.32 ? 2193 ASN A N     1 
ATOM   6885  C  CA    . ASN E  3 866  ? 53.750  20.750  9.322   1.00 43.17 ? 2193 ASN A CA    1 
ATOM   6886  C  C     . ASN E  3 866  ? 52.398  21.361  9.681   1.00 43.06 ? 2193 ASN A C     1 
ATOM   6887  O  O     . ASN E  3 866  ? 51.919  22.281  9.004   1.00 42.95 ? 2193 ASN A O     1 
ATOM   6888  C  CB    . ASN E  3 866  ? 54.856  21.326  10.197  1.00 43.14 ? 2193 ASN A CB    1 
ATOM   6889  C  CG    . ASN E  3 866  ? 55.062  20.541  11.482  1.00 43.74 ? 2193 ASN A CG    1 
ATOM   6890  O  OD1   . ASN E  3 866  ? 56.156  20.548  12.036  1.00 44.45 ? 2193 ASN A OD1   1 
ATOM   6891  N  ND2   . ASN E  3 866  ? 54.021  19.857  11.957  1.00 44.44 ? 2193 ASN A ND2   1 
ATOM   6892  N  N     . GLN E  3 867  ? 51.785  20.825  10.735  1.00 42.30 ? 2194 GLN A N     1 
ATOM   6893  C  CA    . GLN E  3 867  ? 50.543  21.359  11.259  1.00 42.30 ? 2194 GLN A CA    1 
ATOM   6894  C  C     . GLN E  3 867  ? 50.847  22.261  12.443  1.00 42.14 ? 2194 GLN A C     1 
ATOM   6895  O  O     . GLN E  3 867  ? 51.956  22.255  12.961  1.00 41.83 ? 2194 GLN A O     1 
ATOM   6896  C  CB    . GLN E  3 867  ? 49.616  20.232  11.689  1.00 41.72 ? 2194 GLN A CB    1 
ATOM   6897  C  CG    . GLN E  3 867  ? 49.232  19.284  10.586  1.00 43.17 ? 2194 GLN A CG    1 
ATOM   6898  C  CD    . GLN E  3 867  ? 48.433  18.096  11.101  1.00 47.11 ? 2194 GLN A CD    1 
ATOM   6899  O  OE1   . GLN E  3 867  ? 48.123  17.174  10.349  1.00 50.53 ? 2194 GLN A OE1   1 
ATOM   6900  N  NE2   . GLN E  3 867  ? 48.098  18.110  12.387  1.00 45.78 ? 2194 GLN A NE2   1 
ATOM   6901  N  N     . ILE E  3 868  ? 49.854  23.036  12.862  1.00 42.75 ? 2195 ILE A N     1 
ATOM   6902  C  CA    . ILE E  3 868  ? 49.962  23.860  14.052  1.00 43.08 ? 2195 ILE A CA    1 
ATOM   6903  C  C     . ILE E  3 868  ? 49.271  23.199  15.253  1.00 43.91 ? 2195 ILE A C     1 
ATOM   6904  O  O     . ILE E  3 868  ? 48.149  22.702  15.150  1.00 44.56 ? 2195 ILE A O     1 
ATOM   6905  C  CB    . ILE E  3 868  ? 49.342  25.237  13.819  1.00 42.90 ? 2195 ILE A CB    1 
ATOM   6906  C  CG1   . ILE E  3 868  ? 50.093  25.981  12.735  1.00 44.18 ? 2195 ILE A CG1   1 
ATOM   6907  C  CG2   . ILE E  3 868  ? 49.363  26.063  15.095  1.00 44.09 ? 2195 ILE A CG2   1 
ATOM   6908  C  CD1   . ILE E  3 868  ? 49.453  27.294  12.385  1.00 45.22 ? 2195 ILE A CD1   1 
ATOM   6909  N  N     . ARG E  3 869  ? 49.954  23.195  16.388  1.00 44.18 ? 2196 ARG A N     1 
ATOM   6910  C  CA    . ARG E  3 869  ? 49.329  22.878  17.653  1.00 45.11 ? 2196 ARG A CA    1 
ATOM   6911  C  C     . ARG E  3 869  ? 49.406  24.094  18.536  1.00 46.15 ? 2196 ARG A C     1 
ATOM   6912  O  O     . ARG E  3 869  ? 50.153  25.014  18.250  1.00 47.71 ? 2196 ARG A O     1 
ATOM   6913  C  CB    . ARG E  3 869  ? 50.016  21.695  18.319  1.00 45.44 ? 2196 ARG A CB    1 
ATOM   6914  C  CG    . ARG E  3 869  ? 49.804  20.378  17.582  1.00 47.25 ? 2196 ARG A CG    1 
ATOM   6915  C  CD    . ARG E  3 869  ? 48.323  19.967  17.550  1.00 45.56 ? 2196 ARG A CD    1 
ATOM   6916  N  NE    . ARG E  3 869  ? 48.129  18.669  16.913  1.00 42.71 ? 2196 ARG A NE    1 
ATOM   6917  C  CZ    . ARG E  3 869  ? 48.038  18.489  15.602  1.00 41.68 ? 2196 ARG A CZ    1 
ATOM   6918  N  NH1   . ARG E  3 869  ? 48.121  19.520  14.774  1.00 41.16 ? 2196 ARG A NH1   1 
ATOM   6919  N  NH2   . ARG E  3 869  ? 47.862  17.273  15.122  1.00 42.06 ? 2196 ARG A NH2   1 
ATOM   6920  N  N     . MET E  3 870  ? 48.605  24.116  19.588  1.00 47.21 ? 2197 MET A N     1 
ATOM   6921  C  CA    . MET E  3 870  ? 48.622  25.215  20.520  1.00 48.52 ? 2197 MET A CA    1 
ATOM   6922  C  C     . MET E  3 870  ? 49.503  24.764  21.660  1.00 49.41 ? 2197 MET A C     1 
ATOM   6923  O  O     . MET E  3 870  ? 49.374  23.639  22.113  1.00 50.31 ? 2197 MET A O     1 
ATOM   6924  C  CB    . MET E  3 870  ? 47.203  25.485  21.003  1.00 48.96 ? 2197 MET A CB    1 
ATOM   6925  C  CG    . MET E  3 870  ? 46.779  26.941  20.946  1.00 51.87 ? 2197 MET A CG    1 
ATOM   6926  S  SD    . MET E  3 870  ? 46.974  27.704  19.330  1.00 58.50 ? 2197 MET A SD    1 
ATOM   6927  C  CE    . MET E  3 870  ? 45.729  26.851  18.333  1.00 59.48 ? 2197 MET A CE    1 
ATOM   6928  N  N     . LYS E  3 871  ? 50.434  25.606  22.092  1.00 50.77 ? 2198 LYS A N     1 
ATOM   6929  C  CA    . LYS E  3 871  ? 51.172  25.333  23.325  1.00 52.76 ? 2198 LYS A CA    1 
ATOM   6930  C  C     . LYS E  3 871  ? 50.395  25.957  24.466  1.00 54.24 ? 2198 LYS A C     1 
ATOM   6931  O  O     . LYS E  3 871  ? 49.703  26.947  24.284  1.00 54.17 ? 2198 LYS A O     1 
ATOM   6932  C  CB    . LYS E  3 871  ? 52.630  25.822  23.270  1.00 52.37 ? 2198 LYS A CB    1 
ATOM   6933  C  CG    . LYS E  3 871  ? 52.804  27.317  23.113  1.00 53.34 ? 2198 LYS A CG    1 
ATOM   6934  C  CD    . LYS E  3 871  ? 53.942  27.677  22.166  1.00 53.19 ? 2198 LYS A CD    1 
ATOM   6935  C  CE    . LYS E  3 871  ? 55.291  27.617  22.848  1.00 52.77 ? 2198 LYS A CE    1 
ATOM   6936  N  NZ    . LYS E  3 871  ? 56.335  28.184  21.966  1.00 53.09 ? 2198 LYS A NZ    1 
ATOM   6937  N  N     . ILE E  3 872  ? 50.487  25.368  25.642  1.00 57.45 ? 2199 ILE A N     1 
ATOM   6938  C  CA    . ILE E  3 872  ? 49.584  25.754  26.709  1.00 61.78 ? 2199 ILE A CA    1 
ATOM   6939  C  C     . ILE E  3 872  ? 50.337  26.206  27.966  1.00 64.36 ? 2199 ILE A C     1 
ATOM   6940  O  O     . ILE E  3 872  ? 51.287  25.562  28.393  1.00 64.17 ? 2199 ILE A O     1 
ATOM   6941  C  CB    . ILE E  3 872  ? 48.505  24.645  26.956  1.00 61.65 ? 2199 ILE A CB    1 
ATOM   6942  C  CG1   . ILE E  3 872  ? 47.943  24.693  28.366  1.00 62.68 ? 2199 ILE A CG1   1 
ATOM   6943  C  CG2   . ILE E  3 872  ? 49.062  23.267  26.716  1.00 61.13 ? 2199 ILE A CG2   1 
ATOM   6944  C  CD1   . ILE E  3 872  ? 47.098  23.492  28.688  1.00 63.61 ? 2199 ILE A CD1   1 
ATOM   6945  N  N     . GLY E  3 873  ? 49.906  27.336  28.527  1.00 68.04 ? 2200 GLY A N     1 
ATOM   6946  C  CA    . GLY E  3 873  ? 50.569  27.963  29.673  1.00 72.24 ? 2200 GLY A CA    1 
ATOM   6947  C  C     . GLY E  3 873  ? 51.480  29.098  29.235  1.00 75.52 ? 2200 GLY A C     1 
ATOM   6948  O  O     . GLY E  3 873  ? 52.586  29.258  29.760  1.00 75.85 ? 2200 GLY A O     1 
ATOM   6949  N  N     . VAL E  3 874  ? 51.000  29.891  28.276  1.00 78.54 ? 2201 VAL A N     1 
ATOM   6950  C  CA    . VAL E  3 874  ? 51.794  30.936  27.613  1.00 80.73 ? 2201 VAL A CA    1 
ATOM   6951  C  C     . VAL E  3 874  ? 50.966  32.228  27.443  1.00 82.99 ? 2201 VAL A C     1 
ATOM   6952  O  O     . VAL E  3 874  ? 49.949  32.239  26.740  1.00 83.73 ? 2201 VAL A O     1 
ATOM   6953  C  CB    . VAL E  3 874  ? 52.358  30.424  26.246  1.00 79.79 ? 2201 VAL A CB    1 
ATOM   6954  C  CG1   . VAL E  3 874  ? 51.238  29.934  25.340  1.00 78.71 ? 2201 VAL A CG1   1 
ATOM   6955  C  CG2   . VAL E  3 874  ? 53.190  31.484  25.551  1.00 79.89 ? 2201 VAL A CG2   1 
ATOM   6956  N  N     . MET E  3 875  ? 51.401  33.304  28.102  1.00 84.93 ? 2202 MET A N     1 
ATOM   6957  C  CA    . MET E  3 875  ? 50.680  34.594  28.082  1.00 86.51 ? 2202 MET A CA    1 
ATOM   6958  C  C     . MET E  3 875  ? 51.337  35.634  27.169  1.00 86.35 ? 2202 MET A C     1 
ATOM   6959  O  O     . MET E  3 875  ? 50.659  36.461  26.551  1.00 86.45 ? 2202 MET A O     1 
ATOM   6960  C  CB    . MET E  3 875  ? 50.515  35.152  29.503  1.00 87.59 ? 2202 MET A CB    1 
ATOM   6961  C  CG    . MET E  3 875  ? 51.272  34.378  30.581  1.00 90.26 ? 2202 MET A CG    1 
ATOM   6962  S  SD    . MET E  3 875  ? 50.243  33.288  31.611  1.00 94.34 ? 2202 MET A SD    1 
ATOM   6963  C  CE    . MET E  3 875  ? 49.338  32.261  30.436  1.00 92.60 ? 2202 MET A CE    1 
ATOM   6964  N  N     . PHE E  3 876  ? 52.664  35.580  27.112  1.00 86.10 ? 2203 PHE A N     1 
ATOM   6965  C  CA    . PHE E  3 876  ? 53.481  36.358  26.184  1.00 85.58 ? 2203 PHE A CA    1 
ATOM   6966  C  C     . PHE E  3 876  ? 53.397  35.777  24.762  1.00 83.52 ? 2203 PHE A C     1 
ATOM   6967  O  O     . PHE E  3 876  ? 52.866  34.679  24.554  1.00 83.49 ? 2203 PHE A O     1 
ATOM   6968  C  CB    . PHE E  3 876  ? 54.940  36.320  26.664  1.00 87.15 ? 2203 PHE A CB    1 
ATOM   6969  C  CG    . PHE E  3 876  ? 55.473  34.914  26.857  1.00 89.59 ? 2203 PHE A CG    1 
ATOM   6970  C  CD1   . PHE E  3 876  ? 56.061  34.217  25.786  1.00 90.64 ? 2203 PHE A CD1   1 
ATOM   6971  C  CD2   . PHE E  3 876  ? 55.357  34.272  28.098  1.00 90.14 ? 2203 PHE A CD2   1 
ATOM   6972  C  CE1   . PHE E  3 876  ? 56.538  32.908  25.949  1.00 90.69 ? 2203 PHE A CE1   1 
ATOM   6973  C  CE2   . PHE E  3 876  ? 55.829  32.964  28.275  1.00 90.57 ? 2203 PHE A CE2   1 
ATOM   6974  C  CZ    . PHE E  3 876  ? 56.423  32.280  27.198  1.00 90.32 ? 2203 PHE A CZ    1 
ATOM   6975  N  N     . GLY E  3 877  ? 53.939  36.517  23.795  1.00 81.17 ? 2204 GLY A N     1 
ATOM   6976  C  CA    . GLY E  3 877  ? 54.091  36.041  22.414  1.00 78.23 ? 2204 GLY A CA    1 
ATOM   6977  C  C     . GLY E  3 877  ? 52.835  35.429  21.835  1.00 75.30 ? 2204 GLY A C     1 
ATOM   6978  O  O     . GLY E  3 877  ? 51.724  35.911  22.090  1.00 75.65 ? 2204 GLY A O     1 
ATOM   6979  N  N     . ASN E  3 878  ? 53.010  34.356  21.072  1.00 71.78 ? 2205 ASN A N     1 
ATOM   6980  C  CA    . ASN E  3 878  ? 51.863  33.652  20.513  1.00 68.44 ? 2205 ASN A CA    1 
ATOM   6981  C  C     . ASN E  3 878  ? 51.891  32.162  20.856  1.00 65.61 ? 2205 ASN A C     1 
ATOM   6982  O  O     . ASN E  3 878  ? 52.967  31.563  20.956  1.00 65.99 ? 2205 ASN A O     1 
ATOM   6983  C  CB    . ASN E  3 878  ? 51.713  33.935  19.006  1.00 68.31 ? 2205 ASN A CB    1 
ATOM   6984  C  CG    . ASN E  3 878  ? 52.221  32.811  18.132  1.00 68.23 ? 2205 ASN A CG    1 
ATOM   6985  O  OD1   . ASN E  3 878  ? 53.366  32.363  18.249  1.00 68.58 ? 2205 ASN A OD1   1 
ATOM   6986  N  ND2   . ASN E  3 878  ? 51.370  32.364  17.223  1.00 68.96 ? 2205 ASN A ND2   1 
ATOM   6987  N  N     . PRO E  3 879  ? 50.709  31.563  21.052  1.00 62.54 ? 2206 PRO A N     1 
ATOM   6988  C  CA    . PRO E  3 879  ? 50.654  30.213  21.593  1.00 60.31 ? 2206 PRO A CA    1 
ATOM   6989  C  C     . PRO E  3 879  ? 50.843  29.093  20.571  1.00 57.96 ? 2206 PRO A C     1 
ATOM   6990  O  O     . PRO E  3 879  ? 50.795  27.926  20.941  1.00 57.91 ? 2206 PRO A O     1 
ATOM   6991  C  CB    . PRO E  3 879  ? 49.251  30.148  22.198  1.00 60.84 ? 2206 PRO A CB    1 
ATOM   6992  C  CG    . PRO E  3 879  ? 48.440  31.080  21.369  1.00 61.34 ? 2206 PRO A CG    1 
ATOM   6993  C  CD    . PRO E  3 879  ? 49.366  32.112  20.791  1.00 61.95 ? 2206 PRO A CD    1 
ATOM   6994  N  N     . GLU E  3 880  ? 51.059  29.433  19.308  1.00 55.69 ? 2207 GLU A N     1 
ATOM   6995  C  CA    . GLU E  3 880  ? 51.148  28.419  18.261  1.00 54.38 ? 2207 GLU A CA    1 
ATOM   6996  C  C     . GLU E  3 880  ? 52.488  27.694  18.251  1.00 53.04 ? 2207 GLU A C     1 
ATOM   6997  O  O     . GLU E  3 880  ? 53.506  28.262  18.624  1.00 53.54 ? 2207 GLU A O     1 
ATOM   6998  C  CB    . GLU E  3 880  ? 50.911  29.043  16.893  1.00 54.90 ? 2207 GLU A CB    1 
ATOM   6999  C  CG    . GLU E  3 880  ? 49.502  29.545  16.659  1.00 55.51 ? 2207 GLU A CG    1 
ATOM   7000  C  CD    . GLU E  3 880  ? 49.307  30.045  15.236  1.00 56.45 ? 2207 GLU A CD    1 
ATOM   7001  O  OE1   . GLU E  3 880  ? 50.301  30.462  14.605  1.00 57.42 ? 2207 GLU A OE1   1 
ATOM   7002  O  OE2   . GLU E  3 880  ? 48.164  30.015  14.742  1.00 56.33 ? 2207 GLU A OE2   1 
ATOM   7003  N  N     . THR E  3 881  ? 52.473  26.433  17.833  1.00 51.70 ? 2208 THR A N     1 
ATOM   7004  C  CA    . THR E  3 881  ? 53.692  25.670  17.602  1.00 51.29 ? 2208 THR A CA    1 
ATOM   7005  C  C     . THR E  3 881  ? 53.505  24.708  16.447  1.00 51.55 ? 2208 THR A C     1 
ATOM   7006  O  O     . THR E  3 881  ? 52.525  24.755  15.711  1.00 51.28 ? 2208 THR A O     1 
ATOM   7007  C  CB    . THR E  3 881  ? 54.142  24.822  18.806  1.00 50.77 ? 2208 THR A CB    1 
ATOM   7008  O  OG1   . THR E  3 881  ? 53.434  25.222  19.977  1.00 54.11 ? 2208 THR A OG1   1 
ATOM   7009  C  CG2   . THR E  3 881  ? 55.656  24.946  19.027  1.00 49.52 ? 2208 THR A CG2   1 
ATOM   7010  N  N     . THR E  3 882  ? 54.456  23.800  16.350  1.00 52.15 ? 2209 THR A N     1 
ATOM   7011  C  CA    . THR E  3 882  ? 54.684  22.982  15.199  1.00 52.30 ? 2209 THR A CA    1 
ATOM   7012  C  C     . THR E  3 882  ? 54.980  21.598  15.766  1.00 52.92 ? 2209 THR A C     1 
ATOM   7013  O  O     . THR E  3 882  ? 55.552  21.478  16.846  1.00 54.49 ? 2209 THR A O     1 
ATOM   7014  C  CB    . THR E  3 882  ? 55.857  23.618  14.418  1.00 52.60 ? 2209 THR A CB    1 
ATOM   7015  O  OG1   . THR E  3 882  ? 55.336  24.293  13.271  1.00 53.31 ? 2209 THR A OG1   1 
ATOM   7016  C  CG2   . THR E  3 882  ? 56.943  22.621  14.002  1.00 54.19 ? 2209 THR A CG2   1 
ATOM   7017  N  N     . THR E  3 883  ? 54.565  20.550  15.078  1.00 52.60 ? 2210 THR A N     1 
ATOM   7018  C  CA    . THR E  3 883  ? 54.753  19.213  15.613  1.00 53.12 ? 2210 THR A CA    1 
ATOM   7019  C  C     . THR E  3 883  ? 56.176  18.733  15.423  1.00 51.05 ? 2210 THR A C     1 
ATOM   7020  O  O     . THR E  3 883  ? 56.881  19.227  14.563  1.00 51.07 ? 2210 THR A O     1 
ATOM   7021  C  CB    . THR E  3 883  ? 53.794  18.201  14.957  1.00 55.24 ? 2210 THR A CB    1 
ATOM   7022  O  OG1   . THR E  3 883  ? 52.684  18.897  14.375  1.00 56.98 ? 2210 THR A OG1   1 
ATOM   7023  C  CG2   . THR E  3 883  ? 53.267  17.187  16.011  1.00 58.03 ? 2210 THR A CG2   1 
ATOM   7024  N  N     . GLY E  3 884  ? 56.596  17.782  16.247  1.00 50.71 ? 2211 GLY A N     1 
ATOM   7025  C  CA    . GLY E  3 884  ? 57.849  17.063  16.022  1.00 50.82 ? 2211 GLY A CA    1 
ATOM   7026  C  C     . GLY E  3 884  ? 59.104  17.769  16.475  1.00 50.01 ? 2211 GLY A C     1 
ATOM   7027  O  O     . GLY E  3 884  ? 60.137  17.688  15.824  1.00 50.32 ? 2211 GLY A O     1 
ATOM   7028  N  N     . GLY E  3 885  ? 59.008  18.479  17.586  1.00 49.62 ? 2212 GLY A N     1 
ATOM   7029  C  CA    . GLY E  3 885  ? 60.184  19.015  18.239  1.00 49.85 ? 2212 GLY A CA    1 
ATOM   7030  C  C     . GLY E  3 885  ? 60.789  20.265  17.641  1.00 49.66 ? 2212 GLY A C     1 
ATOM   7031  O  O     . GLY E  3 885  ? 60.122  21.014  16.928  1.00 49.48 ? 2212 GLY A O     1 
ATOM   7032  N  N     . ASN E  3 886  ? 62.069  20.471  17.946  1.00 49.85 ? 2213 ASN A N     1 
ATOM   7033  C  CA    . ASN E  3 886  ? 62.783  21.709  17.635  1.00 49.69 ? 2213 ASN A CA    1 
ATOM   7034  C  C     . ASN E  3 886  ? 63.831  21.587  16.534  1.00 49.14 ? 2213 ASN A C     1 
ATOM   7035  O  O     . ASN E  3 886  ? 64.317  22.596  16.021  1.00 49.30 ? 2213 ASN A O     1 
ATOM   7036  C  CB    . ASN E  3 886  ? 63.453  22.244  18.899  1.00 50.15 ? 2213 ASN A CB    1 
ATOM   7037  C  CG    . ASN E  3 886  ? 62.455  22.766  19.902  1.00 51.01 ? 2213 ASN A CG    1 
ATOM   7038  O  OD1   . ASN E  3 886  ? 61.759  23.741  19.636  1.00 51.37 ? 2213 ASN A OD1   1 
ATOM   7039  N  ND2   . ASN E  3 886  ? 62.379  22.123  21.069  1.00 52.14 ? 2213 ASN A ND2   1 
ATOM   7040  N  N     . ALA E  3 887  ? 64.181  20.356  16.178  1.00 48.28 ? 2214 ALA A N     1 
ATOM   7041  C  CA    . ALA E  3 887  ? 65.224  20.110  15.189  1.00 47.19 ? 2214 ALA A CA    1 
ATOM   7042  C  C     . ALA E  3 887  ? 64.939  20.825  13.871  1.00 46.65 ? 2214 ALA A C     1 
ATOM   7043  O  O     . ALA E  3 887  ? 65.775  21.540  13.363  1.00 46.46 ? 2214 ALA A O     1 
ATOM   7044  C  CB    . ALA E  3 887  ? 65.415  18.614  14.971  1.00 46.77 ? 2214 ALA A CB    1 
ATOM   7045  N  N     . LEU E  3 888  ? 63.739  20.656  13.341  1.00 47.13 ? 2215 LEU A N     1 
ATOM   7046  C  CA    . LEU E  3 888  ? 63.409  21.189  12.034  1.00 46.91 ? 2215 LEU A CA    1 
ATOM   7047  C  C     . LEU E  3 888  ? 63.537  22.707  11.939  1.00 47.65 ? 2215 LEU A C     1 
ATOM   7048  O  O     . LEU E  3 888  ? 63.972  23.206  10.915  1.00 48.03 ? 2215 LEU A O     1 
ATOM   7049  C  CB    . LEU E  3 888  ? 62.014  20.728  11.612  1.00 48.04 ? 2215 LEU A CB    1 
ATOM   7050  C  CG    . LEU E  3 888  ? 61.521  21.047  10.193  1.00 48.44 ? 2215 LEU A CG    1 
ATOM   7051  C  CD1   . LEU E  3 888  ? 62.489  20.512  9.159   1.00 47.96 ? 2215 LEU A CD1   1 
ATOM   7052  C  CD2   . LEU E  3 888  ? 60.124  20.471  9.969   1.00 46.63 ? 2215 LEU A CD2   1 
ATOM   7053  N  N     . LYS E  3 889  ? 63.170  23.441  12.991  1.00 49.27 ? 2216 LYS A N     1 
ATOM   7054  C  CA    . LYS E  3 889  ? 63.295  24.915  12.985  1.00 50.69 ? 2216 LYS A CA    1 
ATOM   7055  C  C     . LYS E  3 889  ? 64.697  25.307  12.551  1.00 48.80 ? 2216 LYS A C     1 
ATOM   7056  O  O     . LYS E  3 889  ? 64.884  26.248  11.777  1.00 48.52 ? 2216 LYS A O     1 
ATOM   7057  C  CB    . LYS E  3 889  ? 63.106  25.530  14.381  1.00 51.29 ? 2216 LYS A CB    1 
ATOM   7058  C  CG    . LYS E  3 889  ? 61.815  25.302  15.130  1.00 55.16 ? 2216 LYS A CG    1 
ATOM   7059  C  CD    . LYS E  3 889  ? 61.848  26.166  16.429  1.00 55.03 ? 2216 LYS A CD    1 
ATOM   7060  C  CE    . LYS E  3 889  ? 60.949  25.608  17.567  1.00 58.91 ? 2216 LYS A CE    1 
ATOM   7061  N  NZ    . LYS E  3 889  ? 59.534  25.214  17.193  1.00 61.88 ? 2216 LYS A NZ    1 
ATOM   7062  N  N     . PHE E  3 890  ? 65.676  24.584  13.093  1.00 47.30 ? 2217 PHE A N     1 
ATOM   7063  C  CA    . PHE E  3 890  ? 67.088  24.898  12.920  1.00 45.57 ? 2217 PHE A CA    1 
ATOM   7064  C  C     . PHE E  3 890  ? 67.591  24.495  11.551  1.00 45.92 ? 2217 PHE A C     1 
ATOM   7065  O  O     . PHE E  3 890  ? 68.269  25.280  10.892  1.00 47.27 ? 2217 PHE A O     1 
ATOM   7066  C  CB    . PHE E  3 890  ? 67.929  24.205  13.991  1.00 44.30 ? 2217 PHE A CB    1 
ATOM   7067  C  CG    . PHE E  3 890  ? 67.855  24.857  15.330  1.00 43.30 ? 2217 PHE A CG    1 
ATOM   7068  C  CD1   . PHE E  3 890  ? 66.952  24.413  16.292  1.00 44.15 ? 2217 PHE A CD1   1 
ATOM   7069  C  CD2   . PHE E  3 890  ? 68.684  25.925  15.634  1.00 43.86 ? 2217 PHE A CD2   1 
ATOM   7070  C  CE1   . PHE E  3 890  ? 66.886  25.029  17.542  1.00 44.55 ? 2217 PHE A CE1   1 
ATOM   7071  C  CE2   . PHE E  3 890  ? 68.631  26.549  16.876  1.00 43.78 ? 2217 PHE A CE2   1 
ATOM   7072  C  CZ    . PHE E  3 890  ? 67.731  26.103  17.831  1.00 44.22 ? 2217 PHE A CZ    1 
ATOM   7073  N  N     . TYR E  3 891  ? 67.253  23.279  11.127  1.00 45.49 ? 2218 TYR A N     1 
ATOM   7074  C  CA    . TYR E  3 891  ? 67.773  22.717  9.888   1.00 45.30 ? 2218 TYR A CA    1 
ATOM   7075  C  C     . TYR E  3 891  ? 67.142  23.327  8.651   1.00 45.67 ? 2218 TYR A C     1 
ATOM   7076  O  O     . TYR E  3 891  ? 67.797  23.403  7.609   1.00 47.45 ? 2218 TYR A O     1 
ATOM   7077  C  CB    . TYR E  3 891  ? 67.629  21.199  9.869   1.00 45.45 ? 2218 TYR A CB    1 
ATOM   7078  C  CG    . TYR E  3 891  ? 68.660  20.486  10.712  1.00 45.58 ? 2218 TYR A CG    1 
ATOM   7079  C  CD1   . TYR E  3 891  ? 69.840  20.016  10.150  1.00 45.56 ? 2218 TYR A CD1   1 
ATOM   7080  C  CD2   . TYR E  3 891  ? 68.458  20.288  12.072  1.00 46.47 ? 2218 TYR A CD2   1 
ATOM   7081  C  CE1   . TYR E  3 891  ? 70.795  19.360  10.916  1.00 45.64 ? 2218 TYR A CE1   1 
ATOM   7082  C  CE2   . TYR E  3 891  ? 69.401  19.633  12.854  1.00 47.16 ? 2218 TYR A CE2   1 
ATOM   7083  C  CZ    . TYR E  3 891  ? 70.569  19.174  12.267  1.00 47.16 ? 2218 TYR A CZ    1 
ATOM   7084  O  OH    . TYR E  3 891  ? 71.511  18.525  13.032  1.00 47.51 ? 2218 TYR A OH    1 
ATOM   7085  N  N     . ALA E  3 892  ? 65.888  23.763  8.756   1.00 44.89 ? 2219 ALA A N     1 
ATOM   7086  C  CA    . ALA E  3 892  ? 65.209  24.411  7.631   1.00 44.68 ? 2219 ALA A CA    1 
ATOM   7087  C  C     . ALA E  3 892  ? 65.977  25.642  7.174   1.00 45.07 ? 2219 ALA A C     1 
ATOM   7088  O  O     . ALA E  3 892  ? 66.448  26.435  8.007   1.00 44.79 ? 2219 ALA A O     1 
ATOM   7089  C  CB    . ALA E  3 892  ? 63.806  24.786  8.004   1.00 44.91 ? 2219 ALA A CB    1 
ATOM   7090  N  N     . SER E  3 893  ? 66.138  25.779  5.857   1.00 45.26 ? 2220 SER A N     1 
ATOM   7091  C  CA    . SER E  3 893  ? 66.805  26.957  5.285   1.00 45.41 ? 2220 SER A CA    1 
ATOM   7092  C  C     . SER E  3 893  ? 65.755  28.009  4.982   1.00 45.46 ? 2220 SER A C     1 
ATOM   7093  O  O     . SER E  3 893  ? 66.063  29.196  4.880   1.00 46.80 ? 2220 SER A O     1 
ATOM   7094  C  CB    . SER E  3 893  ? 67.592  26.610  4.020   1.00 44.37 ? 2220 SER A CB    1 
ATOM   7095  O  OG    . SER E  3 893  ? 68.485  25.535  4.254   1.00 43.36 ? 2220 SER A OG    1 
ATOM   7096  N  N     . VAL E  3 894  ? 64.514  27.553  4.838   1.00 44.37 ? 2221 VAL A N     1 
ATOM   7097  C  CA    . VAL E  3 894  ? 63.373  28.426  4.630   1.00 44.25 ? 2221 VAL A CA    1 
ATOM   7098  C  C     . VAL E  3 894  ? 62.177  27.879  5.416   1.00 45.97 ? 2221 VAL A C     1 
ATOM   7099  O  O     . VAL E  3 894  ? 61.883  26.672  5.371   1.00 47.01 ? 2221 VAL A O     1 
ATOM   7100  C  CB    . VAL E  3 894  ? 63.009  28.520  3.135   1.00 43.20 ? 2221 VAL A CB    1 
ATOM   7101  C  CG1   . VAL E  3 894  ? 61.699  29.245  2.940   1.00 41.96 ? 2221 VAL A CG1   1 
ATOM   7102  C  CG2   . VAL E  3 894  ? 64.093  29.211  2.366   1.00 42.35 ? 2221 VAL A CG2   1 
ATOM   7103  N  N     . ARG E  3 895  ? 61.488  28.756  6.141   1.00 46.01 ? 2222 ARG A N     1 
ATOM   7104  C  CA    . ARG E  3 895  ? 60.228  28.366  6.774   1.00 46.20 ? 2222 ARG A CA    1 
ATOM   7105  C  C     . ARG E  3 895  ? 59.077  29.267  6.321   1.00 45.62 ? 2222 ARG A C     1 
ATOM   7106  O  O     . ARG E  3 895  ? 59.189  30.499  6.346   1.00 45.47 ? 2222 ARG A O     1 
ATOM   7107  C  CB    . ARG E  3 895  ? 60.355  28.358  8.295   1.00 46.92 ? 2222 ARG A CB    1 
ATOM   7108  C  CG    . ARG E  3 895  ? 61.556  27.578  8.817   1.00 47.38 ? 2222 ARG A CG    1 
ATOM   7109  C  CD    . ARG E  3 895  ? 61.198  26.749  10.052  1.00 50.39 ? 2222 ARG A CD    1 
ATOM   7110  N  NE    . ARG E  3 895  ? 60.821  27.557  11.210  1.00 50.35 ? 2222 ARG A NE    1 
ATOM   7111  C  CZ    . ARG E  3 895  ? 59.878  27.225  12.087  1.00 50.75 ? 2222 ARG A CZ    1 
ATOM   7112  N  NH1   . ARG E  3 895  ? 59.180  26.107  11.949  1.00 50.34 ? 2222 ARG A NH1   1 
ATOM   7113  N  NH2   . ARG E  3 895  ? 59.616  28.031  13.103  1.00 53.15 ? 2222 ARG A NH2   1 
ATOM   7114  N  N     . LEU E  3 896  ? 57.986  28.642  5.891   1.00 44.15 ? 2223 LEU A N     1 
ATOM   7115  C  CA    . LEU E  3 896  ? 56.841  29.364  5.358   1.00 43.56 ? 2223 LEU A CA    1 
ATOM   7116  C  C     . LEU E  3 896  ? 55.635  29.203  6.256   1.00 44.11 ? 2223 LEU A C     1 
ATOM   7117  O  O     . LEU E  3 896  ? 55.270  28.087  6.623   1.00 45.45 ? 2223 LEU A O     1 
ATOM   7118  C  CB    . LEU E  3 896  ? 56.505  28.858  3.959   1.00 42.93 ? 2223 LEU A CB    1 
ATOM   7119  C  CG    . LEU E  3 896  ? 57.142  29.471  2.708   1.00 42.65 ? 2223 LEU A CG    1 
ATOM   7120  C  CD1   . LEU E  3 896  ? 58.345  30.352  2.996   1.00 42.89 ? 2223 LEU A CD1   1 
ATOM   7121  C  CD2   . LEU E  3 896  ? 57.501  28.368  1.725   1.00 43.35 ? 2223 LEU A CD2   1 
ATOM   7122  N  N     . ASP E  3 897  ? 55.023  30.327  6.609   1.00 44.05 ? 2224 ASP A N     1 
ATOM   7123  C  CA    . ASP E  3 897  ? 53.767  30.348  7.349   1.00 44.10 ? 2224 ASP A CA    1 
ATOM   7124  C  C     . ASP E  3 897  ? 52.654  30.715  6.367   1.00 43.80 ? 2224 ASP A C     1 
ATOM   7125  O  O     . ASP E  3 897  ? 52.518  31.878  5.985   1.00 44.27 ? 2224 ASP A O     1 
ATOM   7126  C  CB    . ASP E  3 897  ? 53.861  31.378  8.480   1.00 45.12 ? 2224 ASP A CB    1 
ATOM   7127  C  CG    . ASP E  3 897  ? 52.574  31.516  9.291   1.00 47.98 ? 2224 ASP A CG    1 
ATOM   7128  O  OD1   . ASP E  3 897  ? 51.474  31.255  8.758   1.00 50.69 ? 2224 ASP A OD1   1 
ATOM   7129  O  OD2   . ASP E  3 897  ? 52.668  31.908  10.480  1.00 48.96 ? 2224 ASP A OD2   1 
ATOM   7130  N  N     . ILE E  3 898  ? 51.870  29.723  5.954   1.00 42.87 ? 2225 ILE A N     1 
ATOM   7131  C  CA    . ILE E  3 898  ? 50.766  29.940  5.016   1.00 42.76 ? 2225 ILE A CA    1 
ATOM   7132  C  C     . ILE E  3 898  ? 49.410  30.041  5.736   1.00 42.97 ? 2225 ILE A C     1 
ATOM   7133  O  O     . ILE E  3 898  ? 49.147  29.299  6.678   1.00 43.07 ? 2225 ILE A O     1 
ATOM   7134  C  CB    . ILE E  3 898  ? 50.733  28.851  3.913   1.00 42.52 ? 2225 ILE A CB    1 
ATOM   7135  C  CG1   . ILE E  3 898  ? 49.625  29.140  2.895   1.00 43.53 ? 2225 ILE A CG1   1 
ATOM   7136  C  CG2   . ILE E  3 898  ? 50.564  27.468  4.514   1.00 42.77 ? 2225 ILE A CG2   1 
ATOM   7137  C  CD1   . ILE E  3 898  ? 49.794  28.411  1.566   1.00 43.00 ? 2225 ILE A CD1   1 
ATOM   7138  N  N     . ARG E  3 899  ? 48.561  30.967  5.292   1.00 42.80 ? 2226 ARG A N     1 
ATOM   7139  C  CA    . ARG E  3 899  ? 47.263  31.196  5.925   1.00 42.99 ? 2226 ARG A CA    1 
ATOM   7140  C  C     . ARG E  3 899  ? 46.184  31.614  4.943   1.00 44.02 ? 2226 ARG A C     1 
ATOM   7141  O  O     . ARG E  3 899  ? 46.444  32.387  4.030   1.00 45.33 ? 2226 ARG A O     1 
ATOM   7142  C  CB    . ARG E  3 899  ? 47.389  32.240  7.033   1.00 41.66 ? 2226 ARG A CB    1 
ATOM   7143  C  CG    . ARG E  3 899  ? 47.726  31.605  8.340   1.00 40.80 ? 2226 ARG A CG    1 
ATOM   7144  C  CD    . ARG E  3 899  ? 48.326  32.548  9.324   1.00 42.94 ? 2226 ARG A CD    1 
ATOM   7145  N  NE    . ARG E  3 899  ? 49.246  31.829  10.208  1.00 45.25 ? 2226 ARG A NE    1 
ATOM   7146  C  CZ    . ARG E  3 899  ? 48.881  31.085  11.249  1.00 46.37 ? 2226 ARG A CZ    1 
ATOM   7147  N  NH1   . ARG E  3 899  ? 47.590  30.943  11.571  1.00 47.27 ? 2226 ARG A NH1   1 
ATOM   7148  N  NH2   . ARG E  3 899  ? 49.816  30.481  11.969  1.00 44.13 ? 2226 ARG A NH2   1 
ATOM   7149  N  N     . ARG E  3 900  ? 44.977  31.087  5.124   1.00 44.53 ? 2227 ARG A N     1 
ATOM   7150  C  CA    . ARG E  3 900  ? 43.828  31.539  4.345   1.00 44.89 ? 2227 ARG A CA    1 
ATOM   7151  C  C     . ARG E  3 900  ? 43.323  32.820  4.980   1.00 45.37 ? 2227 ARG A C     1 
ATOM   7152  O  O     . ARG E  3 900  ? 43.060  32.853  6.178   1.00 47.26 ? 2227 ARG A O     1 
ATOM   7153  C  CB    . ARG E  3 900  ? 42.726  30.485  4.353   1.00 45.18 ? 2227 ARG A CB    1 
ATOM   7154  C  CG    . ARG E  3 900  ? 41.503  30.867  3.552   1.00 46.17 ? 2227 ARG A CG    1 
ATOM   7155  C  CD    . ARG E  3 900  ? 40.320  30.004  3.910   1.00 48.33 ? 2227 ARG A CD    1 
ATOM   7156  N  NE    . ARG E  3 900  ? 39.367  29.946  2.806   1.00 50.06 ? 2227 ARG A NE    1 
ATOM   7157  C  CZ    . ARG E  3 900  ? 38.240  30.644  2.740   1.00 50.72 ? 2227 ARG A CZ    1 
ATOM   7158  N  NH1   . ARG E  3 900  ? 37.901  31.463  3.728   1.00 52.18 ? 2227 ARG A NH1   1 
ATOM   7159  N  NH2   . ARG E  3 900  ? 37.443  30.512  1.685   1.00 51.15 ? 2227 ARG A NH2   1 
ATOM   7160  N  N     . ILE E  3 901  ? 43.189  33.879  4.193   1.00 45.21 ? 2228 ILE A N     1 
ATOM   7161  C  CA    . ILE E  3 901  ? 42.819  35.178  4.758   1.00 44.90 ? 2228 ILE A CA    1 
ATOM   7162  C  C     . ILE E  3 901  ? 41.449  35.648  4.296   1.00 45.12 ? 2228 ILE A C     1 
ATOM   7163  O  O     . ILE E  3 901  ? 40.907  36.606  4.846   1.00 45.95 ? 2228 ILE A O     1 
ATOM   7164  C  CB    . ILE E  3 901  ? 43.878  36.260  4.474   1.00 43.97 ? 2228 ILE A CB    1 
ATOM   7165  C  CG1   . ILE E  3 901  ? 44.035  36.472  2.966   1.00 44.73 ? 2228 ILE A CG1   1 
ATOM   7166  C  CG2   . ILE E  3 901  ? 45.202  35.880  5.127   1.00 44.30 ? 2228 ILE A CG2   1 
ATOM   7167  C  CD1   . ILE E  3 901  ? 44.889  37.676  2.578   1.00 46.15 ? 2228 ILE A CD1   1 
ATOM   7168  N  N     . GLY E  3 902  ? 40.895  34.966  3.296   1.00 44.58 ? 2229 GLY A N     1 
ATOM   7169  C  CA    . GLY E  3 902  ? 39.590  35.318  2.757   1.00 44.75 ? 2229 GLY A CA    1 
ATOM   7170  C  C     . GLY E  3 902  ? 39.121  34.368  1.679   1.00 44.69 ? 2229 GLY A C     1 
ATOM   7171  O  O     . GLY E  3 902  ? 39.838  33.444  1.301   1.00 43.60 ? 2229 GLY A O     1 
ATOM   7172  N  N     . ALA E  3 903  ? 37.909  34.606  1.186   1.00 45.77 ? 2230 ALA A N     1 
ATOM   7173  C  CA    . ALA E  3 903  ? 37.319  33.783  0.138   1.00 47.27 ? 2230 ALA A CA    1 
ATOM   7174  C  C     . ALA E  3 903  ? 37.323  34.507  -1.201  1.00 48.43 ? 2230 ALA A C     1 
ATOM   7175  O  O     . ALA E  3 903  ? 37.057  35.706  -1.262  1.00 49.05 ? 2230 ALA A O     1 
ATOM   7176  C  CB    . ALA E  3 903  ? 35.904  33.397  0.517   1.00 47.17 ? 2230 ALA A CB    1 
ATOM   7177  N  N     . VAL E  3 904  ? 37.636  33.781  -2.270  1.00 49.63 ? 2231 VAL A N     1 
ATOM   7178  C  CA    . VAL E  3 904  ? 37.481  34.302  -3.628  1.00 50.60 ? 2231 VAL A CA    1 
ATOM   7179  C  C     . VAL E  3 904  ? 36.071  33.947  -4.087  1.00 52.26 ? 2231 VAL A C     1 
ATOM   7180  O  O     . VAL E  3 904  ? 35.749  32.774  -4.289  1.00 51.75 ? 2231 VAL A O     1 
ATOM   7181  C  CB    . VAL E  3 904  ? 38.530  33.713  -4.602  1.00 49.94 ? 2231 VAL A CB    1 
ATOM   7182  C  CG1   . VAL E  3 904  ? 38.276  34.171  -6.019  1.00 48.78 ? 2231 VAL A CG1   1 
ATOM   7183  C  CG2   . VAL E  3 904  ? 39.929  34.093  -4.174  1.00 50.02 ? 2231 VAL A CG2   1 
ATOM   7184  N  N     . LYS E  3 905  ? 35.232  34.967  -4.237  1.00 54.46 ? 2232 LYS A N     1 
ATOM   7185  C  CA    . LYS E  3 905  ? 33.822  34.750  -4.530  1.00 57.04 ? 2232 LYS A CA    1 
ATOM   7186  C  C     . LYS E  3 905  ? 33.416  35.043  -5.975  1.00 58.63 ? 2232 LYS A C     1 
ATOM   7187  O  O     . LYS E  3 905  ? 33.991  35.892  -6.648  1.00 59.14 ? 2232 LYS A O     1 
ATOM   7188  C  CB    . LYS E  3 905  ? 32.932  35.521  -3.550  1.00 56.82 ? 2232 LYS A CB    1 
ATOM   7189  C  CG    . LYS E  3 905  ? 32.656  34.776  -2.243  1.00 57.73 ? 2232 LYS A CG    1 
ATOM   7190  C  CD    . LYS E  3 905  ? 31.531  35.420  -1.441  1.00 58.81 ? 2232 LYS A CD    1 
ATOM   7191  C  CE    . LYS E  3 905  ? 32.038  36.596  -0.610  1.00 62.15 ? 2232 LYS A CE    1 
ATOM   7192  N  NZ    . LYS E  3 905  ? 30.938  37.531  -0.210  1.00 63.72 ? 2232 LYS A NZ    1 
ATOM   7193  N  N     . GLU E  3 906  ? 32.417  34.300  -6.428  1.00 60.89 ? 2233 GLU A N     1 
ATOM   7194  C  CA    . GLU E  3 906  ? 31.804  34.453  -7.738  1.00 62.56 ? 2233 GLU A CA    1 
ATOM   7195  C  C     . GLU E  3 906  ? 30.354  34.844  -7.515  1.00 62.67 ? 2233 GLU A C     1 
ATOM   7196  O  O     . GLU E  3 906  ? 29.435  34.098  -7.878  1.00 62.30 ? 2233 GLU A O     1 
ATOM   7197  C  CB    . GLU E  3 906  ? 31.850  33.115  -8.477  1.00 64.12 ? 2233 GLU A CB    1 
ATOM   7198  C  CG    . GLU E  3 906  ? 32.941  33.006  -9.512  1.00 66.73 ? 2233 GLU A CG    1 
ATOM   7199  C  CD    . GLU E  3 906  ? 32.495  33.518  -10.868 1.00 69.69 ? 2233 GLU A CD    1 
ATOM   7200  O  OE1   . GLU E  3 906  ? 31.275  33.732  -11.071 1.00 71.32 ? 2233 GLU A OE1   1 
ATOM   7201  O  OE2   . GLU E  3 906  ? 33.370  33.704  -11.738 1.00 71.29 ? 2233 GLU A OE2   1 
ATOM   7202  N  N     . GLY E  3 907  ? 30.159  36.012  -6.902  1.00 62.97 ? 2234 GLY A N     1 
ATOM   7203  C  CA    . GLY E  3 907  ? 28.839  36.437  -6.435  1.00 63.06 ? 2234 GLY A CA    1 
ATOM   7204  C  C     . GLY E  3 907  ? 28.339  35.464  -5.385  1.00 62.93 ? 2234 GLY A C     1 
ATOM   7205  O  O     . GLY E  3 907  ? 28.563  35.654  -4.188  1.00 62.69 ? 2234 GLY A O     1 
ATOM   7206  N  N     . GLU E  3 908  ? 27.680  34.405  -5.851  1.00 63.20 ? 2235 GLU A N     1 
ATOM   7207  C  CA    . GLU E  3 908  ? 27.190  33.335  -4.987  1.00 63.10 ? 2235 GLU A CA    1 
ATOM   7208  C  C     . GLU E  3 908  ? 28.313  32.418  -4.513  1.00 61.97 ? 2235 GLU A C     1 
ATOM   7209  O  O     . GLU E  3 908  ? 28.503  32.245  -3.314  1.00 62.09 ? 2235 GLU A O     1 
ATOM   7210  C  CB    . GLU E  3 908  ? 26.117  32.509  -5.709  1.00 63.73 ? 2235 GLU A CB    1 
ATOM   7211  C  CG    . GLU E  3 908  ? 24.787  33.233  -5.932  1.00 65.90 ? 2235 GLU A CG    1 
ATOM   7212  C  CD    . GLU E  3 908  ? 23.930  33.303  -4.673  1.00 68.09 ? 2235 GLU A CD    1 
ATOM   7213  O  OE1   . GLU E  3 908  ? 24.446  33.739  -3.618  1.00 69.83 ? 2235 GLU A OE1   1 
ATOM   7214  O  OE2   . GLU E  3 908  ? 22.736  32.928  -4.739  1.00 68.18 ? 2235 GLU A OE2   1 
ATOM   7215  N  N     . ASN E  3 909  ? 29.062  31.860  -5.463  1.00 60.43 ? 2236 ASN A N     1 
ATOM   7216  C  CA    . ASN E  3 909  ? 29.981  30.750  -5.199  1.00 59.07 ? 2236 ASN A CA    1 
ATOM   7217  C  C     . ASN E  3 909  ? 31.294  31.133  -4.539  1.00 57.42 ? 2236 ASN A C     1 
ATOM   7218  O  O     . ASN E  3 909  ? 31.815  32.217  -4.763  1.00 57.53 ? 2236 ASN A O     1 
ATOM   7219  C  CB    . ASN E  3 909  ? 30.285  29.996  -6.493  1.00 59.26 ? 2236 ASN A CB    1 
ATOM   7220  C  CG    . ASN E  3 909  ? 29.041  29.656  -7.264  1.00 59.77 ? 2236 ASN A CG    1 
ATOM   7221  O  OD1   . ASN E  3 909  ? 28.655  30.375  -8.181  1.00 61.38 ? 2236 ASN A OD1   1 
ATOM   7222  N  ND2   . ASN E  3 909  ? 28.385  28.573  -6.881  1.00 60.10 ? 2236 ASN A ND2   1 
ATOM   7223  N  N     . VAL E  3 910  ? 31.818  30.226  -3.722  1.00 55.44 ? 2237 VAL A N     1 
ATOM   7224  C  CA    . VAL E  3 910  ? 33.159  30.352  -3.193  1.00 53.44 ? 2237 VAL A CA    1 
ATOM   7225  C  C     . VAL E  3 910  ? 34.038  29.488  -4.080  1.00 52.83 ? 2237 VAL A C     1 
ATOM   7226  O  O     . VAL E  3 910  ? 34.029  28.265  -3.989  1.00 52.20 ? 2237 VAL A O     1 
ATOM   7227  C  CB    . VAL E  3 910  ? 33.243  29.930  -1.716  1.00 53.12 ? 2237 VAL A CB    1 
ATOM   7228  C  CG1   . VAL E  3 910  ? 34.687  29.955  -1.230  1.00 54.22 ? 2237 VAL A CG1   1 
ATOM   7229  C  CG2   . VAL E  3 910  ? 32.378  30.841  -0.855  1.00 51.81 ? 2237 VAL A CG2   1 
ATOM   7230  N  N     . VAL E  3 911  ? 34.789  30.146  -4.953  1.00 53.02 ? 2238 VAL A N     1 
ATOM   7231  C  CA    . VAL E  3 911  ? 35.540  29.464  -6.000  1.00 52.45 ? 2238 VAL A CA    1 
ATOM   7232  C  C     . VAL E  3 911  ? 37.056  29.370  -5.708  1.00 51.22 ? 2238 VAL A C     1 
ATOM   7233  O  O     . VAL E  3 911  ? 37.810  28.719  -6.450  1.00 50.15 ? 2238 VAL A O     1 
ATOM   7234  C  CB    . VAL E  3 911  ? 35.239  30.111  -7.385  1.00 52.66 ? 2238 VAL A CB    1 
ATOM   7235  C  CG1   . VAL E  3 911  ? 35.956  31.452  -7.531  1.00 51.97 ? 2238 VAL A CG1   1 
ATOM   7236  C  CG2   . VAL E  3 911  ? 35.581  29.146  -8.531  1.00 53.46 ? 2238 VAL A CG2   1 
ATOM   7237  N  N     . GLY E  3 912  ? 37.485  30.003  -4.617  1.00 50.33 ? 2239 GLY A N     1 
ATOM   7238  C  CA    . GLY E  3 912  ? 38.883  29.962  -4.201  1.00 49.95 ? 2239 GLY A CA    1 
ATOM   7239  C  C     . GLY E  3 912  ? 39.188  30.526  -2.823  1.00 49.85 ? 2239 GLY A C     1 
ATOM   7240  O  O     . GLY E  3 912  ? 38.332  31.118  -2.165  1.00 49.54 ? 2239 GLY A O     1 
ATOM   7241  N  N     . SER E  3 913  ? 40.427  30.325  -2.390  1.00 50.55 ? 2240 SER A N     1 
ATOM   7242  C  CA    . SER E  3 913  ? 40.923  30.855  -1.124  1.00 51.46 ? 2240 SER A CA    1 
ATOM   7243  C  C     . SER E  3 913  ? 41.910  31.995  -1.381  1.00 51.92 ? 2240 SER A C     1 
ATOM   7244  O  O     . SER E  3 913  ? 42.898  31.830  -2.109  1.00 52.24 ? 2240 SER A O     1 
ATOM   7245  C  CB    . SER E  3 913  ? 41.625  29.758  -0.299  1.00 51.15 ? 2240 SER A CB    1 
ATOM   7246  O  OG    . SER E  3 913  ? 40.703  28.900  0.342   1.00 49.88 ? 2240 SER A OG    1 
ATOM   7247  N  N     . GLU E  3 914  ? 41.639  33.149  -0.784  1.00 51.49 ? 2241 GLU A N     1 
ATOM   7248  C  CA    . GLU E  3 914  ? 42.601  34.233  -0.766  1.00 50.98 ? 2241 GLU A CA    1 
ATOM   7249  C  C     . GLU E  3 914  ? 43.685  33.862  0.256   1.00 49.61 ? 2241 GLU A C     1 
ATOM   7250  O  O     . GLU E  3 914  ? 43.381  33.548  1.409   1.00 48.73 ? 2241 GLU A O     1 
ATOM   7251  C  CB    . GLU E  3 914  ? 41.896  35.534  -0.388  1.00 52.47 ? 2241 GLU A CB    1 
ATOM   7252  C  CG    . GLU E  3 914  ? 42.582  36.783  -0.882  1.00 56.36 ? 2241 GLU A CG    1 
ATOM   7253  C  CD    . GLU E  3 914  ? 42.482  36.951  -2.389  1.00 59.66 ? 2241 GLU A CD    1 
ATOM   7254  O  OE1   . GLU E  3 914  ? 41.348  36.870  -2.919  1.00 58.29 ? 2241 GLU A OE1   1 
ATOM   7255  O  OE2   . GLU E  3 914  ? 43.542  37.180  -3.034  1.00 62.80 ? 2241 GLU A OE2   1 
ATOM   7256  N  N     . THR E  3 915  ? 44.945  33.894  -0.170  1.00 48.53 ? 2242 THR A N     1 
ATOM   7257  C  CA    . THR E  3 915  ? 46.030  33.293  0.602   1.00 47.59 ? 2242 THR A CA    1 
ATOM   7258  C  C     . THR E  3 915  ? 47.193  34.234  0.888   1.00 46.21 ? 2242 THR A C     1 
ATOM   7259  O  O     . THR E  3 915  ? 47.540  35.060  0.056   1.00 47.64 ? 2242 THR A O     1 
ATOM   7260  C  CB    . THR E  3 915  ? 46.539  32.034  -0.118  1.00 48.42 ? 2242 THR A CB    1 
ATOM   7261  O  OG1   . THR E  3 915  ? 45.482  31.062  -0.156  1.00 51.30 ? 2242 THR A OG1   1 
ATOM   7262  C  CG2   . THR E  3 915  ? 47.739  31.432  0.599   1.00 49.51 ? 2242 THR A CG2   1 
ATOM   7263  N  N     . ARG E  3 916  ? 47.785  34.099  2.073   1.00 44.90 ? 2243 ARG A N     1 
ATOM   7264  C  CA    . ARG E  3 916  ? 48.969  34.863  2.459   1.00 44.19 ? 2243 ARG A CA    1 
ATOM   7265  C  C     . ARG E  3 916  ? 50.056  33.954  3.011   1.00 43.52 ? 2243 ARG A C     1 
ATOM   7266  O  O     . ARG E  3 916  ? 49.803  33.167  3.917   1.00 43.74 ? 2243 ARG A O     1 
ATOM   7267  C  CB    . ARG E  3 916  ? 48.614  35.907  3.513   1.00 44.50 ? 2243 ARG A CB    1 
ATOM   7268  C  CG    . ARG E  3 916  ? 49.698  36.968  3.732   1.00 46.53 ? 2243 ARG A CG    1 
ATOM   7269  C  CD    . ARG E  3 916  ? 49.640  37.564  5.133   1.00 48.04 ? 2243 ARG A CD    1 
ATOM   7270  N  NE    . ARG E  3 916  ? 48.270  37.868  5.551   1.00 49.23 ? 2243 ARG A NE    1 
ATOM   7271  C  CZ    . ARG E  3 916  ? 47.660  39.024  5.313   1.00 49.09 ? 2243 ARG A CZ    1 
ATOM   7272  N  NH1   . ARG E  3 916  ? 48.304  39.989  4.672   1.00 49.00 ? 2243 ARG A NH1   1 
ATOM   7273  N  NH2   . ARG E  3 916  ? 46.412  39.218  5.721   1.00 48.05 ? 2243 ARG A NH2   1 
ATOM   7274  N  N     . VAL E  3 917  ? 51.266  34.070  2.468   1.00 43.03 ? 2244 VAL A N     1 
ATOM   7275  C  CA    . VAL E  3 917  ? 52.412  33.309  2.969   1.00 42.70 ? 2244 VAL A CA    1 
ATOM   7276  C  C     . VAL E  3 917  ? 53.448  34.273  3.537   1.00 43.57 ? 2244 VAL A C     1 
ATOM   7277  O  O     . VAL E  3 917  ? 53.833  35.225  2.870   1.00 43.46 ? 2244 VAL A O     1 
ATOM   7278  C  CB    . VAL E  3 917  ? 53.062  32.456  1.865   1.00 41.95 ? 2244 VAL A CB    1 
ATOM   7279  C  CG1   . VAL E  3 917  ? 54.215  31.648  2.425   1.00 41.51 ? 2244 VAL A CG1   1 
ATOM   7280  C  CG2   . VAL E  3 917  ? 52.042  31.544  1.225   1.00 41.05 ? 2244 VAL A CG2   1 
ATOM   7281  N  N     . LYS E  3 918  ? 53.872  34.038  4.777   1.00 45.02 ? 2245 LYS A N     1 
ATOM   7282  C  CA    . LYS E  3 918  ? 54.971  34.791  5.390   1.00 46.41 ? 2245 LYS A CA    1 
ATOM   7283  C  C     . LYS E  3 918  ? 56.248  33.968  5.361   1.00 46.32 ? 2245 LYS A C     1 
ATOM   7284  O  O     . LYS E  3 918  ? 56.225  32.758  5.649   1.00 46.96 ? 2245 LYS A O     1 
ATOM   7285  C  CB    . LYS E  3 918  ? 54.668  35.130  6.843   1.00 47.50 ? 2245 LYS A CB    1 
ATOM   7286  C  CG    . LYS E  3 918  ? 53.844  36.372  7.048   1.00 53.58 ? 2245 LYS A CG    1 
ATOM   7287  C  CD    . LYS E  3 918  ? 53.897  36.795  8.526   1.00 58.86 ? 2245 LYS A CD    1 
ATOM   7288  C  CE    . LYS E  3 918  ? 52.901  37.925  8.851   1.00 61.17 ? 2245 LYS A CE    1 
ATOM   7289  N  NZ    . LYS E  3 918  ? 51.465  37.468  8.797   1.00 61.54 ? 2245 LYS A NZ    1 
ATOM   7290  N  N     . VAL E  3 919  ? 57.359  34.612  5.015   1.00 44.88 ? 2246 VAL A N     1 
ATOM   7291  C  CA    . VAL E  3 919  ? 58.644  33.937  5.059   1.00 43.69 ? 2246 VAL A CA    1 
ATOM   7292  C  C     . VAL E  3 919  ? 59.196  34.150  6.454   1.00 43.96 ? 2246 VAL A C     1 
ATOM   7293  O  O     . VAL E  3 919  ? 59.753  35.190  6.775   1.00 44.75 ? 2246 VAL A O     1 
ATOM   7294  C  CB    . VAL E  3 919  ? 59.600  34.432  3.964   1.00 43.42 ? 2246 VAL A CB    1 
ATOM   7295  C  CG1   . VAL E  3 919  ? 60.930  33.690  4.039   1.00 44.53 ? 2246 VAL A CG1   1 
ATOM   7296  C  CG2   . VAL E  3 919  ? 58.967  34.237  2.597   1.00 41.50 ? 2246 VAL A CG2   1 
ATOM   7297  N  N     . VAL E  3 920  ? 59.002  33.150  7.295   1.00 44.69 ? 2247 VAL A N     1 
ATOM   7298  C  CA    . VAL E  3 920  ? 59.297  33.254  8.721   1.00 44.40 ? 2247 VAL A CA    1 
ATOM   7299  C  C     . VAL E  3 920  ? 60.787  33.044  9.006   1.00 44.09 ? 2247 VAL A C     1 
ATOM   7300  O  O     . VAL E  3 920  ? 61.329  33.655  9.923   1.00 44.53 ? 2247 VAL A O     1 
ATOM   7301  C  CB    . VAL E  3 920  ? 58.428  32.264  9.519   1.00 43.80 ? 2247 VAL A CB    1 
ATOM   7302  C  CG1   . VAL E  3 920  ? 58.922  32.132  10.943  1.00 46.90 ? 2247 VAL A CG1   1 
ATOM   7303  C  CG2   . VAL E  3 920  ? 57.003  32.729  9.502   1.00 43.95 ? 2247 VAL A CG2   1 
ATOM   7304  N  N     . LYS E  3 921  ? 61.432  32.175  8.229   1.00 43.00 ? 2248 LYS A N     1 
ATOM   7305  C  CA    . LYS E  3 921  ? 62.874  31.984  8.311   1.00 41.98 ? 2248 LYS A CA    1 
ATOM   7306  C  C     . LYS E  3 921  ? 63.465  31.931  6.919   1.00 42.71 ? 2248 LYS A C     1 
ATOM   7307  O  O     . LYS E  3 921  ? 62.887  31.325  6.007   1.00 43.68 ? 2248 LYS A O     1 
ATOM   7308  C  CB    . LYS E  3 921  ? 63.228  30.700  9.063   1.00 41.73 ? 2248 LYS A CB    1 
ATOM   7309  C  CG    . LYS E  3 921  ? 64.724  30.501  9.268   1.00 38.07 ? 2248 LYS A CG    1 
ATOM   7310  C  CD    . LYS E  3 921  ? 65.057  29.095  9.702   1.00 36.95 ? 2248 LYS A CD    1 
ATOM   7311  C  CE    . LYS E  3 921  ? 66.529  28.968  10.011  1.00 36.31 ? 2248 LYS A CE    1 
ATOM   7312  N  NZ    . LYS E  3 921  ? 66.854  27.661  10.652  1.00 37.54 ? 2248 LYS A NZ    1 
ATOM   7313  N  N     . ASN E  3 922  ? 64.629  32.555  6.765   1.00 42.54 ? 2249 ASN A N     1 
ATOM   7314  C  CA    . ASN E  3 922  ? 65.335  32.558  5.487   1.00 42.04 ? 2249 ASN A CA    1 
ATOM   7315  C  C     . ASN E  3 922  ? 66.852  32.611  5.639   1.00 41.01 ? 2249 ASN A C     1 
ATOM   7316  O  O     . ASN E  3 922  ? 67.396  33.553  6.201   1.00 39.93 ? 2249 ASN A O     1 
ATOM   7317  C  CB    . ASN E  3 922  ? 64.845  33.715  4.618   1.00 42.73 ? 2249 ASN A CB    1 
ATOM   7318  C  CG    . ASN E  3 922  ? 65.087  33.483  3.149   1.00 43.00 ? 2249 ASN A CG    1 
ATOM   7319  O  OD1   . ASN E  3 922  ? 65.746  32.528  2.755   1.00 44.05 ? 2249 ASN A OD1   1 
ATOM   7320  N  ND2   . ASN E  3 922  ? 64.548  34.360  2.327   1.00 44.35 ? 2249 ASN A ND2   1 
ATOM   7321  N  N     . LYS E  3 923  ? 67.516  31.579  5.138   1.00 41.28 ? 2250 LYS A N     1 
ATOM   7322  C  CA    . LYS E  3 923  ? 68.966  31.464  5.182   1.00 42.65 ? 2250 LYS A CA    1 
ATOM   7323  C  C     . LYS E  3 923  ? 69.566  31.826  3.827   1.00 43.56 ? 2250 LYS A C     1 
ATOM   7324  O  O     . LYS E  3 923  ? 70.789  31.782  3.627   1.00 43.52 ? 2250 LYS A O     1 
ATOM   7325  C  CB    . LYS E  3 923  ? 69.346  30.024  5.501   1.00 43.48 ? 2250 LYS A CB    1 
ATOM   7326  C  CG    . LYS E  3 923  ? 69.746  29.763  6.918   1.00 45.29 ? 2250 LYS A CG    1 
ATOM   7327  C  CD    . LYS E  3 923  ? 69.990  28.284  7.107   1.00 46.68 ? 2250 LYS A CD    1 
ATOM   7328  C  CE    . LYS E  3 923  ? 71.081  28.058  8.127   1.00 48.01 ? 2250 LYS A CE    1 
ATOM   7329  N  NZ    . LYS E  3 923  ? 71.014  26.679  8.699   1.00 49.92 ? 2250 LYS A NZ    1 
ATOM   7330  N  N     . ILE E  3 924  ? 68.689  32.188  2.899   1.00 44.12 ? 2251 ILE A N     1 
ATOM   7331  C  CA    . ILE E  3 924  ? 69.036  32.264  1.492   1.00 44.33 ? 2251 ILE A CA    1 
ATOM   7332  C  C     . ILE E  3 924  ? 68.915  33.700  0.967   1.00 44.42 ? 2251 ILE A C     1 
ATOM   7333  O  O     . ILE E  3 924  ? 69.558  34.074  -0.011  1.00 43.54 ? 2251 ILE A O     1 
ATOM   7334  C  CB    . ILE E  3 924  ? 68.185  31.207  0.711   1.00 44.74 ? 2251 ILE A CB    1 
ATOM   7335  C  CG1   . ILE E  3 924  ? 69.108  30.202  0.047   1.00 47.46 ? 2251 ILE A CG1   1 
ATOM   7336  C  CG2   . ILE E  3 924  ? 67.120  31.804  -0.233  1.00 44.16 ? 2251 ILE A CG2   1 
ATOM   7337  C  CD1   . ILE E  3 924  ? 70.026  29.490  1.042   1.00 49.87 ? 2251 ILE A CD1   1 
ATOM   7338  N  N     . ALA E  3 925  ? 68.086  34.484  1.656   1.00 44.41 ? 2252 ALA A N     1 
ATOM   7339  C  CA    . ALA E  3 925  ? 67.847  35.897  1.385   1.00 43.72 ? 2252 ALA A CA    1 
ATOM   7340  C  C     . ALA E  3 925  ? 67.258  36.491  2.669   1.00 44.04 ? 2252 ALA A C     1 
ATOM   7341  O  O     . ALA E  3 925  ? 67.038  35.761  3.643   1.00 44.94 ? 2252 ALA A O     1 
ATOM   7342  C  CB    . ALA E  3 925  ? 66.875  36.054  0.234   1.00 43.06 ? 2252 ALA A CB    1 
ATOM   7343  N  N     . ALA E  3 926  ? 67.011  37.799  2.687   1.00 43.26 ? 2253 ALA A N     1 
ATOM   7344  C  CA    . ALA E  3 926  ? 66.365  38.445  3.828   1.00 42.76 ? 2253 ALA A CA    1 
ATOM   7345  C  C     . ALA E  3 926  ? 65.008  37.801  4.121   1.00 43.49 ? 2253 ALA A C     1 
ATOM   7346  O  O     . ALA E  3 926  ? 64.256  37.508  3.188   1.00 45.23 ? 2253 ALA A O     1 
ATOM   7347  C  CB    . ALA E  3 926  ? 66.197  39.917  3.560   1.00 43.00 ? 2253 ALA A CB    1 
ATOM   7348  N  N     . PRO E  3 927  ? 64.701  37.554  5.409   1.00 43.16 ? 2254 PRO A N     1 
ATOM   7349  C  CA    . PRO E  3 927  ? 63.415  36.990  5.819   1.00 43.19 ? 2254 PRO A CA    1 
ATOM   7350  C  C     . PRO E  3 927  ? 62.321  38.036  6.033   1.00 42.86 ? 2254 PRO A C     1 
ATOM   7351  O  O     . PRO E  3 927  ? 62.577  39.229  5.915   1.00 42.60 ? 2254 PRO A O     1 
ATOM   7352  C  CB    . PRO E  3 927  ? 63.753  36.334  7.156   1.00 43.19 ? 2254 PRO A CB    1 
ATOM   7353  C  CG    . PRO E  3 927  ? 64.776  37.225  7.730   1.00 43.17 ? 2254 PRO A CG    1 
ATOM   7354  C  CD    . PRO E  3 927  ? 65.582  37.766  6.570   1.00 43.29 ? 2254 PRO A CD    1 
ATOM   7355  N  N     . PHE E  3 928  ? 61.118  37.558  6.340   1.00 43.37 ? 2255 PHE A N     1 
ATOM   7356  C  CA    . PHE E  3 928  ? 59.982  38.374  6.779   1.00 44.22 ? 2255 PHE A CA    1 
ATOM   7357  C  C     . PHE E  3 928  ? 59.286  39.173  5.686   1.00 44.76 ? 2255 PHE A C     1 
ATOM   7358  O  O     . PHE E  3 928  ? 58.519  40.089  5.983   1.00 45.07 ? 2255 PHE A O     1 
ATOM   7359  C  CB    . PHE E  3 928  ? 60.356  39.273  7.968   1.00 44.80 ? 2255 PHE A CB    1 
ATOM   7360  C  CG    . PHE E  3 928  ? 60.882  38.520  9.154   1.00 45.44 ? 2255 PHE A CG    1 
ATOM   7361  C  CD1   . PHE E  3 928  ? 60.084  37.596  9.821   1.00 44.56 ? 2255 PHE A CD1   1 
ATOM   7362  C  CD2   . PHE E  3 928  ? 62.179  38.736  9.607   1.00 46.11 ? 2255 PHE A CD2   1 
ATOM   7363  C  CE1   . PHE E  3 928  ? 60.572  36.895  10.913  1.00 44.70 ? 2255 PHE A CE1   1 
ATOM   7364  C  CE2   . PHE E  3 928  ? 62.678  38.037  10.708  1.00 45.29 ? 2255 PHE A CE2   1 
ATOM   7365  C  CZ    . PHE E  3 928  ? 61.874  37.118  11.360  1.00 44.39 ? 2255 PHE A CZ    1 
ATOM   7366  N  N     . LYS E  3 929  ? 59.552  38.837  4.428   1.00 45.46 ? 2256 LYS A N     1 
ATOM   7367  C  CA    . LYS E  3 929  ? 58.733  39.355  3.338   1.00 46.78 ? 2256 LYS A CA    1 
ATOM   7368  C  C     . LYS E  3 929  ? 57.508  38.450  3.233   1.00 47.71 ? 2256 LYS A C     1 
ATOM   7369  O  O     . LYS E  3 929  ? 57.521  37.309  3.712   1.00 47.75 ? 2256 LYS A O     1 
ATOM   7370  C  CB    . LYS E  3 929  ? 59.502  39.369  2.021   1.00 46.66 ? 2256 LYS A CB    1 
ATOM   7371  C  CG    . LYS E  3 929  ? 60.633  40.366  1.955   1.00 48.43 ? 2256 LYS A CG    1 
ATOM   7372  C  CD    . LYS E  3 929  ? 61.332  40.259  0.614   1.00 49.95 ? 2256 LYS A CD    1 
ATOM   7373  C  CE    . LYS E  3 929  ? 62.691  40.930  0.624   1.00 51.53 ? 2256 LYS A CE    1 
ATOM   7374  N  NZ    . LYS E  3 929  ? 63.455  40.572  -0.604  1.00 53.77 ? 2256 LYS A NZ    1 
ATOM   7375  N  N     . GLN E  3 930  ? 56.442  38.944  2.623   1.00 48.66 ? 2257 GLN A N     1 
ATOM   7376  C  CA    . GLN E  3 930  ? 55.251  38.114  2.477   1.00 50.03 ? 2257 GLN A CA    1 
ATOM   7377  C  C     . GLN E  3 930  ? 54.614  38.175  1.097   1.00 49.97 ? 2257 GLN A C     1 
ATOM   7378  O  O     . GLN E  3 930  ? 54.838  39.119  0.339   1.00 51.83 ? 2257 GLN A O     1 
ATOM   7379  C  CB    . GLN E  3 930  ? 54.231  38.415  3.574   1.00 50.14 ? 2257 GLN A CB    1 
ATOM   7380  C  CG    . GLN E  3 930  ? 53.811  39.860  3.697   1.00 51.38 ? 2257 GLN A CG    1 
ATOM   7381  C  CD    . GLN E  3 930  ? 52.768  40.056  4.782   1.00 52.67 ? 2257 GLN A CD    1 
ATOM   7382  O  OE1   . GLN E  3 930  ? 51.597  40.335  4.487   1.00 55.42 ? 2257 GLN A OE1   1 
ATOM   7383  N  NE2   . GLN E  3 930  ? 53.179  39.890  6.050   1.00 52.08 ? 2257 GLN A NE2   1 
ATOM   7384  N  N     . ALA E  3 931  ? 53.832  37.154  0.774   1.00 49.13 ? 2258 ALA A N     1 
ATOM   7385  C  CA    . ALA E  3 931  ? 53.217  37.046  -0.533  1.00 49.37 ? 2258 ALA A CA    1 
ATOM   7386  C  C     . ALA E  3 931  ? 51.732  36.770  -0.370  1.00 51.24 ? 2258 ALA A C     1 
ATOM   7387  O  O     . ALA E  3 931  ? 51.336  35.913  0.426   1.00 52.03 ? 2258 ALA A O     1 
ATOM   7388  C  CB    . ALA E  3 931  ? 53.865  35.942  -1.305  1.00 48.65 ? 2258 ALA A CB    1 
ATOM   7389  N  N     . GLU E  3 932  ? 50.909  37.508  -1.109  1.00 52.05 ? 2259 GLU A N     1 
ATOM   7390  C  CA    . GLU E  3 932  ? 49.471  37.253  -1.142  1.00 52.25 ? 2259 GLU A CA    1 
ATOM   7391  C  C     . GLU E  3 932  ? 49.080  36.828  -2.539  1.00 50.72 ? 2259 GLU A C     1 
ATOM   7392  O  O     . GLU E  3 932  ? 49.467  37.461  -3.520  1.00 51.08 ? 2259 GLU A O     1 
ATOM   7393  C  CB    . GLU E  3 932  ? 48.676  38.492  -0.742  1.00 52.67 ? 2259 GLU A CB    1 
ATOM   7394  C  CG    . GLU E  3 932  ? 48.963  39.000  0.665   1.00 55.44 ? 2259 GLU A CG    1 
ATOM   7395  C  CD    . GLU E  3 932  ? 48.010  40.112  1.104   1.00 56.36 ? 2259 GLU A CD    1 
ATOM   7396  O  OE1   . GLU E  3 932  ? 47.397  40.786  0.236   1.00 59.32 ? 2259 GLU A OE1   1 
ATOM   7397  O  OE2   . GLU E  3 932  ? 47.875  40.313  2.329   1.00 59.69 ? 2259 GLU A OE2   1 
ATOM   7398  N  N     . PHE E  3 933  ? 48.317  35.750  -2.630  1.00 49.59 ? 2260 PHE A N     1 
ATOM   7399  C  CA    . PHE E  3 933  ? 47.831  35.266  -3.919  1.00 48.97 ? 2260 PHE A CA    1 
ATOM   7400  C  C     . PHE E  3 933  ? 46.519  34.518  -3.751  1.00 48.68 ? 2260 PHE A C     1 
ATOM   7401  O  O     . PHE E  3 933  ? 46.013  34.392  -2.636  1.00 50.12 ? 2260 PHE A O     1 
ATOM   7402  C  CB    . PHE E  3 933  ? 48.881  34.377  -4.591  1.00 47.78 ? 2260 PHE A CB    1 
ATOM   7403  C  CG    . PHE E  3 933  ? 49.366  33.264  -3.729  1.00 46.10 ? 2260 PHE A CG    1 
ATOM   7404  C  CD1   . PHE E  3 933  ? 48.644  32.086  -3.633  1.00 47.92 ? 2260 PHE A CD1   1 
ATOM   7405  C  CD2   . PHE E  3 933  ? 50.542  33.385  -3.012  1.00 45.02 ? 2260 PHE A CD2   1 
ATOM   7406  C  CE1   . PHE E  3 933  ? 49.085  31.038  -2.829  1.00 47.84 ? 2260 PHE A CE1   1 
ATOM   7407  C  CE2   . PHE E  3 933  ? 50.997  32.342  -2.214  1.00 45.25 ? 2260 PHE A CE2   1 
ATOM   7408  C  CZ    . PHE E  3 933  ? 50.266  31.168  -2.121  1.00 46.42 ? 2260 PHE A CZ    1 
ATOM   7409  N  N     . GLN E  3 934  ? 45.976  34.020  -4.856  1.00 47.72 ? 2261 GLN A N     1 
ATOM   7410  C  CA    . GLN E  3 934  ? 44.733  33.254  -4.817  1.00 46.73 ? 2261 GLN A CA    1 
ATOM   7411  C  C     . GLN E  3 934  ? 44.979  31.787  -5.108  1.00 46.42 ? 2261 GLN A C     1 
ATOM   7412  O  O     . GLN E  3 934  ? 45.731  31.439  -6.017  1.00 46.57 ? 2261 GLN A O     1 
ATOM   7413  C  CB    . GLN E  3 934  ? 43.735  33.795  -5.836  1.00 46.22 ? 2261 GLN A CB    1 
ATOM   7414  C  CG    . GLN E  3 934  ? 43.363  35.247  -5.644  1.00 45.31 ? 2261 GLN A CG    1 
ATOM   7415  C  CD    . GLN E  3 934  ? 42.260  35.685  -6.580  1.00 44.14 ? 2261 GLN A CD    1 
ATOM   7416  O  OE1   . GLN E  3 934  ? 42.150  35.187  -7.700  1.00 43.28 ? 2261 GLN A OE1   1 
ATOM   7417  N  NE2   . GLN E  3 934  ? 41.432  36.621  -6.126  1.00 43.54 ? 2261 GLN A NE2   1 
ATOM   7418  N  N     . ILE E  3 935  ? 44.348  30.924  -4.327  1.00 46.51 ? 2262 ILE A N     1 
ATOM   7419  C  CA    . ILE E  3 935  ? 44.273  29.516  -4.684  1.00 45.92 ? 2262 ILE A CA    1 
ATOM   7420  C  C     . ILE E  3 935  ? 42.870  29.279  -5.224  1.00 46.74 ? 2262 ILE A C     1 
ATOM   7421  O  O     . ILE E  3 935  ? 41.894  29.322  -4.476  1.00 47.69 ? 2262 ILE A O     1 
ATOM   7422  C  CB    . ILE E  3 935  ? 44.574  28.583  -3.499  1.00 45.30 ? 2262 ILE A CB    1 
ATOM   7423  C  CG1   . ILE E  3 935  ? 46.001  28.820  -2.992  1.00 44.93 ? 2262 ILE A CG1   1 
ATOM   7424  C  CG2   . ILE E  3 935  ? 44.389  27.127  -3.916  1.00 44.42 ? 2262 ILE A CG2   1 
ATOM   7425  C  CD1   . ILE E  3 935  ? 46.424  27.925  -1.843  1.00 44.26 ? 2262 ILE A CD1   1 
ATOM   7426  N  N     . LEU E  3 936  ? 42.775  29.071  -6.532  1.00 46.36 ? 2263 LEU A N     1 
ATOM   7427  C  CA    . LEU E  3 936  ? 41.508  28.772  -7.161  1.00 46.60 ? 2263 LEU A CA    1 
ATOM   7428  C  C     . LEU E  3 936  ? 41.316  27.263  -7.161  1.00 48.59 ? 2263 LEU A C     1 
ATOM   7429  O  O     . LEU E  3 936  ? 42.149  26.526  -7.709  1.00 48.69 ? 2263 LEU A O     1 
ATOM   7430  C  CB    . LEU E  3 936  ? 41.469  29.322  -8.580  1.00 45.22 ? 2263 LEU A CB    1 
ATOM   7431  C  CG    . LEU E  3 936  ? 41.625  30.829  -8.712  1.00 44.31 ? 2263 LEU A CG    1 
ATOM   7432  C  CD1   . LEU E  3 936  ? 41.705  31.196  -10.177 1.00 45.33 ? 2263 LEU A CD1   1 
ATOM   7433  C  CD2   . LEU E  3 936  ? 40.501  31.585  -8.019  1.00 42.94 ? 2263 LEU A CD2   1 
ATOM   7434  N  N     . TYR E  3 937  ? 40.228  26.809  -6.533  1.00 50.08 ? 2264 TYR A N     1 
ATOM   7435  C  CA    . TYR E  3 937  ? 39.980  25.381  -6.346  1.00 51.02 ? 2264 TYR A CA    1 
ATOM   7436  C  C     . TYR E  3 937  ? 39.941  24.672  -7.690  1.00 51.87 ? 2264 TYR A C     1 
ATOM   7437  O  O     . TYR E  3 937  ? 39.316  25.163  -8.636  1.00 51.41 ? 2264 TYR A O     1 
ATOM   7438  C  CB    . TYR E  3 937  ? 38.681  25.141  -5.564  1.00 50.91 ? 2264 TYR A CB    1 
ATOM   7439  C  CG    . TYR E  3 937  ? 38.595  25.879  -4.246  1.00 50.48 ? 2264 TYR A CG    1 
ATOM   7440  C  CD1   . TYR E  3 937  ? 39.698  25.956  -3.391  1.00 50.96 ? 2264 TYR A CD1   1 
ATOM   7441  C  CD2   . TYR E  3 937  ? 37.404  26.486  -3.843  1.00 49.48 ? 2264 TYR A CD2   1 
ATOM   7442  C  CE1   . TYR E  3 937  ? 39.618  26.629  -2.175  1.00 51.83 ? 2264 TYR A CE1   1 
ATOM   7443  C  CE2   . TYR E  3 937  ? 37.312  27.163  -2.630  1.00 49.74 ? 2264 TYR A CE2   1 
ATOM   7444  C  CZ    . TYR E  3 937  ? 38.422  27.230  -1.800  1.00 50.93 ? 2264 TYR A CZ    1 
ATOM   7445  O  OH    . TYR E  3 937  ? 38.340  27.902  -0.600  1.00 50.82 ? 2264 TYR A OH    1 
ATOM   7446  N  N     . GLY E  3 938  ? 40.639  23.540  -7.772  1.00 52.71 ? 2265 GLY A N     1 
ATOM   7447  C  CA    . GLY E  3 938  ? 40.660  22.736  -8.990  1.00 54.93 ? 2265 GLY A CA    1 
ATOM   7448  C  C     . GLY E  3 938  ? 41.562  23.288  -10.077 1.00 56.00 ? 2265 GLY A C     1 
ATOM   7449  O  O     . GLY E  3 938  ? 41.742  22.667  -11.127 1.00 56.30 ? 2265 GLY A O     1 
ATOM   7450  N  N     . GLU E  3 939  ? 42.137  24.456  -9.823  1.00 57.01 ? 2266 GLU A N     1 
ATOM   7451  C  CA    . GLU E  3 939  ? 43.029  25.088  -10.779 1.00 58.99 ? 2266 GLU A CA    1 
ATOM   7452  C  C     . GLU E  3 939  ? 44.426  25.249  -10.189 1.00 57.35 ? 2266 GLU A C     1 
ATOM   7453  O  O     . GLU E  3 939  ? 45.420  24.927  -10.844 1.00 57.74 ? 2266 GLU A O     1 
ATOM   7454  C  CB    . GLU E  3 939  ? 42.458  26.437  -11.224 1.00 59.83 ? 2266 GLU A CB    1 
ATOM   7455  C  CG    . GLU E  3 939  ? 43.240  27.124  -12.335 1.00 62.75 ? 2266 GLU A CG    1 
ATOM   7456  C  CD    . GLU E  3 939  ? 42.479  28.291  -12.963 1.00 63.83 ? 2266 GLU A CD    1 
ATOM   7457  O  OE1   . GLU E  3 939  ? 43.149  29.235  -13.461 1.00 66.83 ? 2266 GLU A OE1   1 
ATOM   7458  O  OE2   . GLU E  3 939  ? 41.218  28.261  -12.966 1.00 66.47 ? 2266 GLU A OE2   1 
ATOM   7459  N  N     . GLY E  3 940  ? 44.492  25.737  -8.953  1.00 56.06 ? 2267 GLY A N     1 
ATOM   7460  C  CA    . GLY E  3 940  ? 45.767  25.985  -8.279  1.00 55.12 ? 2267 GLY A CA    1 
ATOM   7461  C  C     . GLY E  3 940  ? 46.006  27.449  -7.956  1.00 54.44 ? 2267 GLY A C     1 
ATOM   7462  O  O     . GLY E  3 940  ? 45.062  28.247  -7.888  1.00 55.35 ? 2267 GLY A O     1 
ATOM   7463  N  N     . ILE E  3 941  ? 47.274  27.790  -7.746  1.00 52.74 ? 2268 ILE A N     1 
ATOM   7464  C  CA    . ILE E  3 941  ? 47.692  29.165  -7.512  1.00 51.36 ? 2268 ILE A CA    1 
ATOM   7465  C  C     . ILE E  3 941  ? 47.423  29.977  -8.740  1.00 50.09 ? 2268 ILE A C     1 
ATOM   7466  O  O     . ILE E  3 941  ? 47.776  29.623  -9.858  1.00 50.00 ? 2268 ILE A O     1 
ATOM   7467  C  CB    . ILE E  3 941  ? 49.195  29.262  -7.170  1.00 51.42 ? 2268 ILE A CB    1 
ATOM   7468  C  CG1   . ILE E  3 941  ? 49.449  28.652  -5.787  1.00 51.10 ? 2268 ILE A CG1   1 
ATOM   7469  C  CG2   . ILE E  3 941  ? 49.706  30.715  -7.249  1.00 50.06 ? 2268 ILE A CG2   1 
ATOM   7470  C  CD1   . ILE E  3 941  ? 50.904  28.355  -5.491  1.00 50.25 ? 2268 ILE A CD1   1 
ATOM   7471  N  N     . ASN E  3 942  ? 46.814  31.093  -8.521  1.00 48.59 ? 2269 ASN A N     1 
ATOM   7472  C  CA    . ASN E  3 942  ? 46.588  31.918  -9.646  1.00 47.68 ? 2269 ASN A CA    1 
ATOM   7473  C  C     . ASN E  3 942  ? 47.851  32.713  -9.976  1.00 47.20 ? 2269 ASN A C     1 
ATOM   7474  O  O     . ASN E  3 942  ? 48.024  33.844  -9.515  1.00 46.70 ? 2269 ASN A O     1 
ATOM   7475  C  CB    . ASN E  3 942  ? 45.386  32.801  -9.398  1.00 47.32 ? 2269 ASN A CB    1 
ATOM   7476  C  CG    . ASN E  3 942  ? 45.001  33.588  -10.613 1.00 47.63 ? 2269 ASN A CG    1 
ATOM   7477  O  OD1   . ASN E  3 942  ? 45.604  33.456  -11.681 1.00 48.75 ? 2269 ASN A OD1   1 
ATOM   7478  N  ND2   . ASN E  3 942  ? 43.993  34.423  -10.464 1.00 47.38 ? 2269 ASN A ND2   1 
ATOM   7479  N  N     . PHE E  3 943  ? 48.717  32.102  -10.785 1.00 47.04 ? 2270 PHE A N     1 
ATOM   7480  C  CA    . PHE E  3 943  ? 50.026  32.656  -11.114 1.00 47.25 ? 2270 PHE A CA    1 
ATOM   7481  C  C     . PHE E  3 943  ? 49.913  33.882  -12.010 1.00 47.76 ? 2270 PHE A C     1 
ATOM   7482  O  O     . PHE E  3 943  ? 50.568  34.905  -11.768 1.00 47.62 ? 2270 PHE A O     1 
ATOM   7483  C  CB    . PHE E  3 943  ? 50.914  31.593  -11.777 1.00 47.14 ? 2270 PHE A CB    1 
ATOM   7484  C  CG    . PHE E  3 943  ? 52.282  32.091  -12.153 1.00 48.04 ? 2270 PHE A CG    1 
ATOM   7485  C  CD1   . PHE E  3 943  ? 53.324  32.083  -11.224 1.00 48.32 ? 2270 PHE A CD1   1 
ATOM   7486  C  CD2   . PHE E  3 943  ? 52.534  32.573  -13.438 1.00 48.62 ? 2270 PHE A CD2   1 
ATOM   7487  C  CE1   . PHE E  3 943  ? 54.598  32.549  -11.570 1.00 48.23 ? 2270 PHE A CE1   1 
ATOM   7488  C  CE2   . PHE E  3 943  ? 53.805  33.046  -13.791 1.00 48.71 ? 2270 PHE A CE2   1 
ATOM   7489  C  CZ    . PHE E  3 943  ? 54.837  33.034  -12.855 1.00 47.67 ? 2270 PHE A CZ    1 
ATOM   7490  N  N     . TYR E  3 944  ? 49.092  33.772  -13.052 1.00 47.84 ? 2271 TYR A N     1 
ATOM   7491  C  CA    . TYR E  3 944  ? 48.923  34.870  -13.996 1.00 47.22 ? 2271 TYR A CA    1 
ATOM   7492  C  C     . TYR E  3 944  ? 48.166  36.037  -13.379 1.00 46.59 ? 2271 TYR A C     1 
ATOM   7493  O  O     . TYR E  3 944  ? 48.376  37.184  -13.762 1.00 46.88 ? 2271 TYR A O     1 
ATOM   7494  C  CB    . TYR E  3 944  ? 48.258  34.383  -15.277 1.00 47.93 ? 2271 TYR A CB    1 
ATOM   7495  C  CG    . TYR E  3 944  ? 49.128  33.428  -16.060 1.00 48.30 ? 2271 TYR A CG    1 
ATOM   7496  C  CD1   . TYR E  3 944  ? 50.312  33.864  -16.648 1.00 48.27 ? 2271 TYR A CD1   1 
ATOM   7497  C  CD2   . TYR E  3 944  ? 48.770  32.091  -16.211 1.00 48.94 ? 2271 TYR A CD2   1 
ATOM   7498  C  CE1   . TYR E  3 944  ? 51.122  32.998  -17.364 1.00 48.80 ? 2271 TYR A CE1   1 
ATOM   7499  C  CE2   . TYR E  3 944  ? 49.569  31.217  -16.935 1.00 49.33 ? 2271 TYR A CE2   1 
ATOM   7500  C  CZ    . TYR E  3 944  ? 50.746  31.679  -17.505 1.00 48.84 ? 2271 TYR A CZ    1 
ATOM   7501  O  OH    . TYR E  3 944  ? 51.550  30.827  -18.224 1.00 49.36 ? 2271 TYR A OH    1 
ATOM   7502  N  N     . GLY E  3 945  ? 47.303  35.737  -12.411 1.00 45.64 ? 2272 GLY A N     1 
ATOM   7503  C  CA    . GLY E  3 945  ? 46.681  36.763  -11.590 1.00 44.64 ? 2272 GLY A CA    1 
ATOM   7504  C  C     . GLY E  3 945  ? 47.732  37.631  -10.920 1.00 44.10 ? 2272 GLY A C     1 
ATOM   7505  O  O     . GLY E  3 945  ? 47.651  38.859  -10.984 1.00 43.07 ? 2272 GLY A O     1 
ATOM   7506  N  N     . GLU E  3 946  ? 48.717  36.987  -10.285 1.00 43.95 ? 2273 GLU A N     1 
ATOM   7507  C  CA    . GLU E  3 946  ? 49.832  37.682  -9.645  1.00 44.58 ? 2273 GLU A CA    1 
ATOM   7508  C  C     . GLU E  3 946  ? 50.551  38.521  -10.674 1.00 45.04 ? 2273 GLU A C     1 
ATOM   7509  O  O     . GLU E  3 946  ? 50.828  39.698  -10.439 1.00 45.89 ? 2273 GLU A O     1 
ATOM   7510  C  CB    . GLU E  3 946  ? 50.835  36.700  -9.053  1.00 44.68 ? 2273 GLU A CB    1 
ATOM   7511  C  CG    . GLU E  3 946  ? 50.373  35.951  -7.823  1.00 46.42 ? 2273 GLU A CG    1 
ATOM   7512  C  CD    . GLU E  3 946  ? 51.351  34.857  -7.419  1.00 46.34 ? 2273 GLU A CD    1 
ATOM   7513  O  OE1   . GLU E  3 946  ? 51.561  33.904  -8.202  1.00 46.94 ? 2273 GLU A OE1   1 
ATOM   7514  O  OE2   . GLU E  3 946  ? 51.915  34.953  -6.315  1.00 48.90 ? 2273 GLU A OE2   1 
ATOM   7515  N  N     . LEU E  3 947  ? 50.842  37.908  -11.824 1.00 44.99 ? 2274 LEU A N     1 
ATOM   7516  C  CA    . LEU E  3 947  ? 51.598  38.568  -12.886 1.00 43.80 ? 2274 LEU A CA    1 
ATOM   7517  C  C     . LEU E  3 947  ? 50.942  39.872  -13.316 1.00 44.32 ? 2274 LEU A C     1 
ATOM   7518  O  O     . LEU E  3 947  ? 51.626  40.876  -13.487 1.00 44.07 ? 2274 LEU A O     1 
ATOM   7519  C  CB    . LEU E  3 947  ? 51.789  37.633  -14.082 1.00 43.45 ? 2274 LEU A CB    1 
ATOM   7520  C  CG    . LEU E  3 947  ? 52.870  38.022  -15.095 1.00 41.67 ? 2274 LEU A CG    1 
ATOM   7521  C  CD1   . LEU E  3 947  ? 54.211  38.231  -14.420 1.00 40.87 ? 2274 LEU A CD1   1 
ATOM   7522  C  CD2   . LEU E  3 947  ? 52.981  36.964  -16.168 1.00 41.94 ? 2274 LEU A CD2   1 
ATOM   7523  N  N     . VAL E  3 948  ? 49.618  39.855  -13.472 1.00 44.86 ? 2275 VAL A N     1 
ATOM   7524  C  CA    . VAL E  3 948  ? 48.863  41.075  -13.763 1.00 45.02 ? 2275 VAL A CA    1 
ATOM   7525  C  C     . VAL E  3 948  ? 49.101  42.131  -12.680 1.00 45.02 ? 2275 VAL A C     1 
ATOM   7526  O  O     . VAL E  3 948  ? 49.561  43.221  -12.993 1.00 44.30 ? 2275 VAL A O     1 
ATOM   7527  C  CB    . VAL E  3 948  ? 47.344  40.805  -13.945 1.00 45.42 ? 2275 VAL A CB    1 
ATOM   7528  C  CG1   . VAL E  3 948  ? 46.569  42.117  -14.035 1.00 45.92 ? 2275 VAL A CG1   1 
ATOM   7529  C  CG2   . VAL E  3 948  ? 47.090  39.962  -15.185 1.00 44.31 ? 2275 VAL A CG2   1 
ATOM   7530  N  N     . ASP E  3 949  ? 48.820  41.794  -11.420 1.00 45.81 ? 2276 ASP A N     1 
ATOM   7531  C  CA    . ASP E  3 949  ? 48.957  42.741  -10.311 1.00 47.07 ? 2276 ASP A CA    1 
ATOM   7532  C  C     . ASP E  3 949  ? 50.367  43.290  -10.159 1.00 46.88 ? 2276 ASP A C     1 
ATOM   7533  O  O     . ASP E  3 949  ? 50.545  44.491  -9.967  1.00 47.03 ? 2276 ASP A O     1 
ATOM   7534  C  CB    . ASP E  3 949  ? 48.489  42.122  -8.996  1.00 48.59 ? 2276 ASP A CB    1 
ATOM   7535  C  CG    . ASP E  3 949  ? 46.975  41.969  -8.931  1.00 53.08 ? 2276 ASP A CG    1 
ATOM   7536  O  OD1   . ASP E  3 949  ? 46.282  42.456  -9.860  1.00 56.08 ? 2276 ASP A OD1   1 
ATOM   7537  O  OD2   . ASP E  3 949  ? 46.475  41.359  -7.955  1.00 54.42 ? 2276 ASP A OD2   1 
ATOM   7538  N  N     . LEU E  3 950  ? 51.360  42.410  -10.252 1.00 46.83 ? 2277 LEU A N     1 
ATOM   7539  C  CA    . LEU E  3 950  ? 52.765  42.809  -10.186 1.00 46.52 ? 2277 LEU A CA    1 
ATOM   7540  C  C     . LEU E  3 950  ? 53.175  43.664  -11.383 1.00 46.92 ? 2277 LEU A C     1 
ATOM   7541  O  O     . LEU E  3 950  ? 53.930  44.623  -11.235 1.00 47.63 ? 2277 LEU A O     1 
ATOM   7542  C  CB    . LEU E  3 950  ? 53.676  41.581  -10.084 1.00 46.35 ? 2277 LEU A CB    1 
ATOM   7543  C  CG    . LEU E  3 950  ? 54.039  40.992  -8.715  1.00 46.89 ? 2277 LEU A CG    1 
ATOM   7544  C  CD1   . LEU E  3 950  ? 54.521  42.061  -7.756  1.00 48.44 ? 2277 LEU A CD1   1 
ATOM   7545  C  CD2   . LEU E  3 950  ? 52.880  40.240  -8.083  1.00 51.15 ? 2277 LEU A CD2   1 
ATOM   7546  N  N     . GLY E  3 951  ? 52.668  43.310  -12.564 1.00 47.32 ? 2278 GLY A N     1 
ATOM   7547  C  CA    . GLY E  3 951  ? 52.931  44.058  -13.796 1.00 46.17 ? 2278 GLY A CA    1 
ATOM   7548  C  C     . GLY E  3 951  ? 52.372  45.463  -13.732 1.00 45.48 ? 2278 GLY A C     1 
ATOM   7549  O  O     . GLY E  3 951  ? 53.064  46.414  -14.070 1.00 44.88 ? 2278 GLY A O     1 
ATOM   7550  N  N     . VAL E  3 952  ? 51.122  45.582  -13.283 1.00 45.70 ? 2279 VAL A N     1 
ATOM   7551  C  CA    . VAL E  3 952  ? 50.455  46.874  -13.122 1.00 46.13 ? 2279 VAL A CA    1 
ATOM   7552  C  C     . VAL E  3 952  ? 51.185  47.724  -12.091 1.00 47.61 ? 2279 VAL A C     1 
ATOM   7553  O  O     . VAL E  3 952  ? 51.415  48.920  -12.314 1.00 48.25 ? 2279 VAL A O     1 
ATOM   7554  C  CB    . VAL E  3 952  ? 48.963  46.706  -12.747 1.00 45.07 ? 2279 VAL A CB    1 
ATOM   7555  C  CG1   . VAL E  3 952  ? 48.371  47.980  -12.182 1.00 43.85 ? 2279 VAL A CG1   1 
ATOM   7556  C  CG2   . VAL E  3 952  ? 48.179  46.275  -13.958 1.00 46.35 ? 2279 VAL A CG2   1 
ATOM   7557  N  N     . LYS E  3 953  ? 51.565  47.093  -10.982 1.00 48.95 ? 2280 LYS A N     1 
ATOM   7558  C  CA    . LYS E  3 953  ? 52.264  47.764  -9.894  1.00 50.79 ? 2280 LYS A CA    1 
ATOM   7559  C  C     . LYS E  3 953  ? 53.609  48.320  -10.354 1.00 51.39 ? 2280 LYS A C     1 
ATOM   7560  O  O     . LYS E  3 953  ? 54.011  49.415  -9.940  1.00 52.24 ? 2280 LYS A O     1 
ATOM   7561  C  CB    . LYS E  3 953  ? 52.469  46.801  -8.731  1.00 51.93 ? 2280 LYS A CB    1 
ATOM   7562  C  CG    . LYS E  3 953  ? 52.948  47.454  -7.449  1.00 55.17 ? 2280 LYS A CG    1 
ATOM   7563  C  CD    . LYS E  3 953  ? 53.614  46.428  -6.546  1.00 57.76 ? 2280 LYS A CD    1 
ATOM   7564  C  CE    . LYS E  3 953  ? 54.202  47.094  -5.323  1.00 60.35 ? 2280 LYS A CE    1 
ATOM   7565  N  NZ    . LYS E  3 953  ? 54.984  46.132  -4.506  1.00 61.90 ? 2280 LYS A NZ    1 
ATOM   7566  N  N     . GLU E  3 954  ? 54.289  47.573  -11.220 1.00 51.02 ? 2281 GLU A N     1 
ATOM   7567  C  CA    . GLU E  3 954  ? 55.597  47.975  -11.717 1.00 51.18 ? 2281 GLU A CA    1 
ATOM   7568  C  C     . GLU E  3 954  ? 55.552  48.812  -13.005 1.00 50.97 ? 2281 GLU A C     1 
ATOM   7569  O  O     . GLU E  3 954  ? 56.588  49.056  -13.623 1.00 51.72 ? 2281 GLU A O     1 
ATOM   7570  C  CB    . GLU E  3 954  ? 56.490  46.748  -11.892 1.00 51.83 ? 2281 GLU A CB    1 
ATOM   7571  C  CG    . GLU E  3 954  ? 56.892  46.086  -10.580 1.00 54.92 ? 2281 GLU A CG    1 
ATOM   7572  C  CD    . GLU E  3 954  ? 57.519  47.060  -9.585  1.00 58.26 ? 2281 GLU A CD    1 
ATOM   7573  O  OE1   . GLU E  3 954  ? 58.501  47.751  -9.946  1.00 59.27 ? 2281 GLU A OE1   1 
ATOM   7574  O  OE2   . GLU E  3 954  ? 57.031  47.125  -8.434  1.00 60.46 ? 2281 GLU A OE2   1 
ATOM   7575  N  N     . LYS E  3 955  ? 54.355  49.258  -13.386 1.00 50.10 ? 2282 LYS A N     1 
ATOM   7576  C  CA    . LYS E  3 955  ? 54.127  50.084  -14.578 1.00 49.20 ? 2282 LYS A CA    1 
ATOM   7577  C  C     . LYS E  3 955  ? 54.564  49.406  -15.879 1.00 48.39 ? 2282 LYS A C     1 
ATOM   7578  O  O     . LYS E  3 955  ? 54.929  50.071  -16.848 1.00 48.74 ? 2282 LYS A O     1 
ATOM   7579  C  CB    . LYS E  3 955  ? 54.786  51.464  -14.439 1.00 49.76 ? 2282 LYS A CB    1 
ATOM   7580  C  CG    . LYS E  3 955  ? 54.506  52.182  -13.130 1.00 52.05 ? 2282 LYS A CG    1 
ATOM   7581  C  CD    . LYS E  3 955  ? 53.133  52.829  -13.090 1.00 54.18 ? 2282 LYS A CD    1 
ATOM   7582  C  CE    . LYS E  3 955  ? 52.852  53.400  -11.707 1.00 56.04 ? 2282 LYS A CE    1 
ATOM   7583  N  NZ    . LYS E  3 955  ? 51.573  54.158  -11.662 1.00 56.89 ? 2282 LYS A NZ    1 
ATOM   7584  N  N     . LEU E  3 956  ? 54.530  48.081  -15.894 1.00 47.88 ? 2283 LEU A N     1 
ATOM   7585  C  CA    . LEU E  3 956  ? 54.768  47.320  -17.119 1.00 48.22 ? 2283 LEU A CA    1 
ATOM   7586  C  C     . LEU E  3 956  ? 53.453  47.079  -17.858 1.00 48.60 ? 2283 LEU A C     1 
ATOM   7587  O  O     . LEU E  3 956  ? 53.429  46.974  -19.084 1.00 49.22 ? 2283 LEU A O     1 
ATOM   7588  C  CB    . LEU E  3 956  ? 55.452  45.984  -16.818 1.00 47.72 ? 2283 LEU A CB    1 
ATOM   7589  C  CG    . LEU E  3 956  ? 56.798  45.988  -16.092 1.00 46.14 ? 2283 LEU A CG    1 
ATOM   7590  C  CD1   . LEU E  3 956  ? 57.312  44.577  -15.976 1.00 46.71 ? 2283 LEU A CD1   1 
ATOM   7591  C  CD2   . LEU E  3 956  ? 57.805  46.845  -16.804 1.00 45.81 ? 2283 LEU A CD2   1 
ATOM   7592  N  N     . ILE E  3 957  ? 52.367  46.984  -17.099 1.00 48.57 ? 2284 ILE A N     1 
ATOM   7593  C  CA    . ILE E  3 957  ? 51.029  46.885  -17.661 1.00 48.88 ? 2284 ILE A CA    1 
ATOM   7594  C  C     . ILE E  3 957  ? 50.239  48.147  -17.307 1.00 49.76 ? 2284 ILE A C     1 
ATOM   7595  O  O     . ILE E  3 957  ? 50.246  48.605  -16.162 1.00 49.51 ? 2284 ILE A O     1 
ATOM   7596  C  CB    . ILE E  3 957  ? 50.297  45.614  -17.176 1.00 48.20 ? 2284 ILE A CB    1 
ATOM   7597  C  CG1   . ILE E  3 957  ? 51.088  44.365  -17.574 1.00 47.80 ? 2284 ILE A CG1   1 
ATOM   7598  C  CG2   . ILE E  3 957  ? 48.889  45.542  -17.758 1.00 48.45 ? 2284 ILE A CG2   1 
ATOM   7599  C  CD1   . ILE E  3 957  ? 50.580  43.087  -16.966 1.00 47.49 ? 2284 ILE A CD1   1 
ATOM   7600  N  N     . GLU E  3 958  ? 49.581  48.712  -18.312 1.00 50.79 ? 2285 GLU A N     1 
ATOM   7601  C  CA    . GLU E  3 958  ? 48.781  49.908  -18.155 1.00 51.82 ? 2285 GLU A CA    1 
ATOM   7602  C  C     . GLU E  3 958  ? 47.403  49.536  -17.631 1.00 51.57 ? 2285 GLU A C     1 
ATOM   7603  O  O     . GLU E  3 958  ? 46.835  48.522  -18.042 1.00 51.37 ? 2285 GLU A O     1 
ATOM   7604  C  CB    . GLU E  3 958  ? 48.638  50.586  -19.514 1.00 53.59 ? 2285 GLU A CB    1 
ATOM   7605  C  CG    . GLU E  3 958  ? 48.670  52.100  -19.481 1.00 57.34 ? 2285 GLU A CG    1 
ATOM   7606  C  CD    . GLU E  3 958  ? 50.092  52.650  -19.430 1.00 59.94 ? 2285 GLU A CD    1 
ATOM   7607  O  OE1   . GLU E  3 958  ? 50.794  52.412  -18.421 1.00 60.89 ? 2285 GLU A OE1   1 
ATOM   7608  O  OE2   . GLU E  3 958  ? 50.507  53.327  -20.398 1.00 60.30 ? 2285 GLU A OE2   1 
ATOM   7609  N  N     . LYS E  3 959  ? 46.865  50.353  -16.729 1.00 51.59 ? 2286 LYS A N     1 
ATOM   7610  C  CA    . LYS E  3 959  ? 45.498  50.156  -16.249 1.00 52.11 ? 2286 LYS A CA    1 
ATOM   7611  C  C     . LYS E  3 959  ? 44.691  51.451  -16.334 1.00 52.25 ? 2286 LYS A C     1 
ATOM   7612  O  O     . LYS E  3 959  ? 44.836  52.335  -15.495 1.00 52.21 ? 2286 LYS A O     1 
ATOM   7613  C  CB    . LYS E  3 959  ? 45.484  49.600  -14.821 1.00 52.33 ? 2286 LYS A CB    1 
ATOM   7614  C  CG    . LYS E  3 959  ? 44.216  48.811  -14.469 1.00 53.45 ? 2286 LYS A CG    1 
ATOM   7615  C  CD    . LYS E  3 959  ? 43.869  48.892  -12.986 1.00 54.34 ? 2286 LYS A CD    1 
ATOM   7616  C  CE    . LYS E  3 959  ? 43.341  50.284  -12.626 1.00 55.99 ? 2286 LYS A CE    1 
ATOM   7617  N  NZ    . LYS E  3 959  ? 42.769  50.364  -11.251 1.00 56.95 ? 2286 LYS A NZ    1 
ATOM   7618  N  N     . ALA E  3 960  ? 43.851  51.550  -17.363 1.00 52.72 ? 2287 ALA A N     1 
ATOM   7619  C  CA    . ALA E  3 960  ? 42.972  52.700  -17.561 1.00 52.99 ? 2287 ALA A CA    1 
ATOM   7620  C  C     . ALA E  3 960  ? 41.547  52.374  -17.103 1.00 53.32 ? 2287 ALA A C     1 
ATOM   7621  O  O     . ALA E  3 960  ? 40.687  51.993  -17.907 1.00 53.50 ? 2287 ALA A O     1 
ATOM   7622  C  CB    . ALA E  3 960  ? 42.990  53.139  -19.026 1.00 53.36 ? 2287 ALA A CB    1 
ATOM   7623  N  N     . GLY E  3 961  ? 41.311  52.525  -15.800 1.00 53.38 ? 2288 GLY A N     1 
ATOM   7624  C  CA    . GLY E  3 961  ? 40.033  52.169  -15.186 1.00 53.32 ? 2288 GLY A CA    1 
ATOM   7625  C  C     . GLY E  3 961  ? 39.893  50.665  -15.061 1.00 53.26 ? 2288 GLY A C     1 
ATOM   7626  O  O     . GLY E  3 961  ? 40.440  50.055  -14.139 1.00 53.02 ? 2288 GLY A O     1 
ATOM   7627  N  N     . ALA E  3 962  ? 39.158  50.070  -15.997 1.00 53.34 ? 2289 ALA A N     1 
ATOM   7628  C  CA    . ALA E  3 962  ? 38.993  48.618  -16.059 1.00 53.31 ? 2289 ALA A CA    1 
ATOM   7629  C  C     . ALA E  3 962  ? 39.783  48.010  -17.222 1.00 53.29 ? 2289 ALA A C     1 
ATOM   7630  O  O     . ALA E  3 962  ? 39.911  46.789  -17.325 1.00 53.22 ? 2289 ALA A O     1 
ATOM   7631  C  CB    . ALA E  3 962  ? 37.514  48.256  -16.165 1.00 53.26 ? 2289 ALA A CB    1 
ATOM   7632  N  N     . TRP E  3 963  ? 40.316  48.868  -18.088 1.00 53.31 ? 2290 TRP A N     1 
ATOM   7633  C  CA    . TRP E  3 963  ? 41.050  48.425  -19.271 1.00 53.12 ? 2290 TRP A CA    1 
ATOM   7634  C  C     . TRP E  3 963  ? 42.539  48.209  -19.018 1.00 52.91 ? 2290 TRP A C     1 
ATOM   7635  O  O     . TRP E  3 963  ? 43.260  49.137  -18.638 1.00 53.27 ? 2290 TRP A O     1 
ATOM   7636  C  CB    . TRP E  3 963  ? 40.841  49.399  -20.433 1.00 53.44 ? 2290 TRP A CB    1 
ATOM   7637  C  CG    . TRP E  3 963  ? 39.635  49.072  -21.247 1.00 53.83 ? 2290 TRP A CG    1 
ATOM   7638  C  CD1   . TRP E  3 963  ? 38.442  49.738  -21.251 1.00 53.78 ? 2290 TRP A CD1   1 
ATOM   7639  C  CD2   . TRP E  3 963  ? 39.494  47.984  -22.172 1.00 54.14 ? 2290 TRP A CD2   1 
ATOM   7640  N  NE1   . TRP E  3 963  ? 37.569  49.137  -22.128 1.00 53.89 ? 2290 TRP A NE1   1 
ATOM   7641  C  CE2   . TRP E  3 963  ? 38.187  48.059  -22.706 1.00 54.04 ? 2290 TRP A CE2   1 
ATOM   7642  C  CE3   . TRP E  3 963  ? 40.347  46.956  -22.603 1.00 53.77 ? 2290 TRP A CE3   1 
ATOM   7643  C  CZ2   . TRP E  3 963  ? 37.708  47.142  -23.654 1.00 53.65 ? 2290 TRP A CZ2   1 
ATOM   7644  C  CZ3   . TRP E  3 963  ? 39.870  46.042  -23.545 1.00 53.92 ? 2290 TRP A CZ3   1 
ATOM   7645  C  CH2   . TRP E  3 963  ? 38.559  46.144  -24.059 1.00 53.76 ? 2290 TRP A CH2   1 
ATOM   7646  N  N     . TYR E  3 964  ? 42.988  46.975  -19.239 1.00 52.23 ? 2291 TYR A N     1 
ATOM   7647  C  CA    . TYR E  3 964  ? 44.402  46.618  -19.115 1.00 51.36 ? 2291 TYR A CA    1 
ATOM   7648  C  C     . TYR E  3 964  ? 45.097  46.633  -20.477 1.00 50.96 ? 2291 TYR A C     1 
ATOM   7649  O  O     . TYR E  3 964  ? 44.682  45.937  -21.407 1.00 50.56 ? 2291 TYR A O     1 
ATOM   7650  C  CB    . TYR E  3 964  ? 44.551  45.240  -18.471 1.00 51.11 ? 2291 TYR A CB    1 
ATOM   7651  C  CG    . TYR E  3 964  ? 44.152  45.185  -17.015 1.00 51.24 ? 2291 TYR A CG    1 
ATOM   7652  C  CD1   . TYR E  3 964  ? 42.824  44.984  -16.641 1.00 52.02 ? 2291 TYR A CD1   1 
ATOM   7653  C  CD2   . TYR E  3 964  ? 45.105  45.319  -16.007 1.00 50.86 ? 2291 TYR A CD2   1 
ATOM   7654  C  CE1   . TYR E  3 964  ? 42.454  44.932  -15.298 1.00 51.90 ? 2291 TYR A CE1   1 
ATOM   7655  C  CE2   . TYR E  3 964  ? 44.744  45.264  -14.661 1.00 50.94 ? 2291 TYR A CE2   1 
ATOM   7656  C  CZ    . TYR E  3 964  ? 43.418  45.073  -14.314 1.00 51.31 ? 2291 TYR A CZ    1 
ATOM   7657  O  OH    . TYR E  3 964  ? 43.052  45.018  -12.989 1.00 50.74 ? 2291 TYR A OH    1 
ATOM   7658  N  N     . SER E  3 965  ? 46.152  47.433  -20.590 1.00 50.48 ? 2292 SER A N     1 
ATOM   7659  C  CA    . SER E  3 965  ? 46.918  47.519  -21.825 1.00 50.03 ? 2292 SER A CA    1 
ATOM   7660  C  C     . SER E  3 965  ? 48.350  47.047  -21.591 1.00 49.64 ? 2292 SER A C     1 
ATOM   7661  O  O     . SER E  3 965  ? 48.903  47.231  -20.505 1.00 48.98 ? 2292 SER A O     1 
ATOM   7662  C  CB    . SER E  3 965  ? 46.919  48.958  -22.357 1.00 50.32 ? 2292 SER A CB    1 
ATOM   7663  O  OG    . SER E  3 965  ? 45.609  49.506  -22.390 1.00 50.77 ? 2292 SER A OG    1 
ATOM   7664  N  N     . TYR E  3 966  ? 48.940  46.422  -22.606 1.00 49.49 ? 2293 TYR A N     1 
ATOM   7665  C  CA    . TYR E  3 966  ? 50.373  46.138  -22.592 1.00 49.22 ? 2293 TYR A CA    1 
ATOM   7666  C  C     . TYR E  3 966  ? 51.044  46.660  -23.850 1.00 49.04 ? 2293 TYR A C     1 
ATOM   7667  O  O     . TYR E  3 966  ? 50.734  46.216  -24.957 1.00 48.79 ? 2293 TYR A O     1 
ATOM   7668  C  CB    . TYR E  3 966  ? 50.650  44.649  -22.428 1.00 48.94 ? 2293 TYR A CB    1 
ATOM   7669  C  CG    . TYR E  3 966  ? 52.131  44.308  -22.419 1.00 49.47 ? 2293 TYR A CG    1 
ATOM   7670  C  CD1   . TYR E  3 966  ? 52.974  44.789  -21.413 1.00 49.37 ? 2293 TYR A CD1   1 
ATOM   7671  C  CD2   . TYR E  3 966  ? 52.689  43.501  -23.413 1.00 49.36 ? 2293 TYR A CD2   1 
ATOM   7672  C  CE1   . TYR E  3 966  ? 54.332  44.477  -21.399 1.00 47.88 ? 2293 TYR A CE1   1 
ATOM   7673  C  CE2   . TYR E  3 966  ? 54.046  43.180  -23.404 1.00 47.83 ? 2293 TYR A CE2   1 
ATOM   7674  C  CZ    . TYR E  3 966  ? 54.856  43.671  -22.396 1.00 47.91 ? 2293 TYR A CZ    1 
ATOM   7675  O  OH    . TYR E  3 966  ? 56.191  43.360  -22.383 1.00 48.07 ? 2293 TYR A OH    1 
ATOM   7676  N  N     . LYS E  3 967  ? 51.962  47.603  -23.659 1.00 48.97 ? 2294 LYS A N     1 
ATOM   7677  C  CA    . LYS E  3 967  ? 52.661  48.261  -24.761 1.00 49.99 ? 2294 LYS A CA    1 
ATOM   7678  C  C     . LYS E  3 967  ? 51.697  48.765  -25.840 1.00 50.22 ? 2294 LYS A C     1 
ATOM   7679  O  O     . LYS E  3 967  ? 51.847  48.445  -27.022 1.00 49.21 ? 2294 LYS A O     1 
ATOM   7680  C  CB    . LYS E  3 967  ? 53.730  47.343  -25.363 1.00 50.21 ? 2294 LYS A CB    1 
ATOM   7681  C  CG    . LYS E  3 967  ? 54.753  46.840  -24.355 1.00 51.52 ? 2294 LYS A CG    1 
ATOM   7682  C  CD    . LYS E  3 967  ? 56.040  46.355  -25.021 1.00 52.95 ? 2294 LYS A CD    1 
ATOM   7683  C  CE    . LYS E  3 967  ? 55.829  45.071  -25.816 1.00 54.54 ? 2294 LYS A CE    1 
ATOM   7684  N  NZ    . LYS E  3 967  ? 57.117  44.532  -26.334 1.00 55.27 ? 2294 LYS A NZ    1 
ATOM   7685  N  N     . GLY E  3 968  ? 50.697  49.532  -25.410 1.00 51.41 ? 2295 GLY A N     1 
ATOM   7686  C  CA    . GLY E  3 968  ? 49.744  50.169  -26.320 1.00 53.45 ? 2295 GLY A CA    1 
ATOM   7687  C  C     . GLY E  3 968  ? 48.575  49.290  -26.709 1.00 54.37 ? 2295 GLY A C     1 
ATOM   7688  O  O     . GLY E  3 968  ? 47.443  49.773  -26.849 1.00 54.31 ? 2295 GLY A O     1 
ATOM   7689  N  N     . GLU E  3 969  ? 48.864  48.003  -26.892 1.00 55.22 ? 2296 GLU A N     1 
ATOM   7690  C  CA    . GLU E  3 969  ? 47.863  46.998  -27.227 1.00 55.93 ? 2296 GLU A CA    1 
ATOM   7691  C  C     . GLU E  3 969  ? 47.037  46.650  -25.987 1.00 55.37 ? 2296 GLU A C     1 
ATOM   7692  O  O     . GLU E  3 969  ? 47.584  46.384  -24.918 1.00 54.97 ? 2296 GLU A O     1 
ATOM   7693  C  CB    . GLU E  3 969  ? 48.548  45.749  -27.788 1.00 56.71 ? 2296 GLU A CB    1 
ATOM   7694  C  CG    . GLU E  3 969  ? 47.604  44.665  -28.300 1.00 59.91 ? 2296 GLU A CG    1 
ATOM   7695  C  CD    . GLU E  3 969  ? 48.197  43.249  -28.209 1.00 62.35 ? 2296 GLU A CD    1 
ATOM   7696  O  OE1   . GLU E  3 969  ? 49.300  43.075  -27.638 1.00 63.04 ? 2296 GLU A OE1   1 
ATOM   7697  O  OE2   . GLU E  3 969  ? 47.549  42.300  -28.707 1.00 63.19 ? 2296 GLU A OE2   1 
ATOM   7698  N  N     . LYS E  3 970  ? 45.716  46.673  -26.139 1.00 55.56 ? 2297 LYS A N     1 
ATOM   7699  C  CA    . LYS E  3 970  ? 44.800  46.331  -25.053 1.00 55.59 ? 2297 LYS A CA    1 
ATOM   7700  C  C     . LYS E  3 970  ? 44.722  44.820  -24.938 1.00 54.93 ? 2297 LYS A C     1 
ATOM   7701  O  O     . LYS E  3 970  ? 44.559  44.123  -25.940 1.00 54.30 ? 2297 LYS A O     1 
ATOM   7702  C  CB    . LYS E  3 970  ? 43.409  46.937  -25.286 1.00 56.17 ? 2297 LYS A CB    1 
ATOM   7703  C  CG    . LYS E  3 970  ? 43.426  48.454  -25.451 1.00 58.68 ? 2297 LYS A CG    1 
ATOM   7704  C  CD    . LYS E  3 970  ? 42.136  49.102  -24.988 1.00 60.54 ? 2297 LYS A CD    1 
ATOM   7705  C  CE    . LYS E  3 970  ? 42.385  50.563  -24.609 1.00 61.64 ? 2297 LYS A CE    1 
ATOM   7706  N  NZ    . LYS E  3 970  ? 41.197  51.204  -23.972 1.00 62.41 ? 2297 LYS A NZ    1 
ATOM   7707  N  N     . ILE E  3 971  ? 44.855  44.319  -23.713 1.00 54.76 ? 2298 ILE A N     1 
ATOM   7708  C  CA    . ILE E  3 971  ? 44.907  42.870  -23.476 1.00 54.59 ? 2298 ILE A CA    1 
ATOM   7709  C  C     . ILE E  3 971  ? 43.680  42.294  -22.752 1.00 54.59 ? 2298 ILE A C     1 
ATOM   7710  O  O     . ILE E  3 971  ? 43.484  41.081  -22.726 1.00 54.79 ? 2298 ILE A O     1 
ATOM   7711  C  CB    . ILE E  3 971  ? 46.197  42.446  -22.735 1.00 54.21 ? 2298 ILE A CB    1 
ATOM   7712  C  CG1   . ILE E  3 971  ? 46.218  43.004  -21.309 1.00 54.12 ? 2298 ILE A CG1   1 
ATOM   7713  C  CG2   . ILE E  3 971  ? 47.428  42.873  -23.528 1.00 54.94 ? 2298 ILE A CG2   1 
ATOM   7714  C  CD1   . ILE E  3 971  ? 47.176  42.291  -20.379 1.00 53.23 ? 2298 ILE A CD1   1 
ATOM   7715  N  N     . GLY E  3 972  ? 42.858  43.157  -22.166 1.00 54.32 ? 2299 GLY A N     1 
ATOM   7716  C  CA    . GLY E  3 972  ? 41.633  42.702  -21.529 1.00 53.80 ? 2299 GLY A CA    1 
ATOM   7717  C  C     . GLY E  3 972  ? 40.947  43.731  -20.659 1.00 53.53 ? 2299 GLY A C     1 
ATOM   7718  O  O     . GLY E  3 972  ? 41.563  44.702  -20.210 1.00 53.24 ? 2299 GLY A O     1 
ATOM   7719  N  N     . GLN E  3 973  ? 39.659  43.506  -20.425 1.00 53.18 ? 2300 GLN A N     1 
ATOM   7720  C  CA    . GLN E  3 973  ? 38.883  44.347  -19.534 1.00 53.18 ? 2300 GLN A CA    1 
ATOM   7721  C  C     . GLN E  3 973  ? 38.585  43.595  -18.240 1.00 52.99 ? 2300 GLN A C     1 
ATOM   7722  O  O     . GLN E  3 973  ? 37.981  42.521  -18.258 1.00 52.62 ? 2300 GLN A O     1 
ATOM   7723  C  CB    . GLN E  3 973  ? 37.590  44.792  -20.214 1.00 53.38 ? 2300 GLN A CB    1 
ATOM   7724  C  CG    . GLN E  3 973  ? 36.864  45.903  -19.474 1.00 53.58 ? 2300 GLN A CG    1 
ATOM   7725  C  CD    . GLN E  3 973  ? 35.665  46.429  -20.228 1.00 53.88 ? 2300 GLN A CD    1 
ATOM   7726  O  OE1   . GLN E  3 973  ? 35.123  47.481  -19.888 1.00 54.80 ? 2300 GLN A OE1   1 
ATOM   7727  N  NE2   . GLN E  3 973  ? 35.239  45.702  -21.256 1.00 54.12 ? 2300 GLN A NE2   1 
ATOM   7728  N  N     . GLY E  3 974  ? 39.020  44.167  -17.120 1.00 53.05 ? 2301 GLY A N     1 
ATOM   7729  C  CA    . GLY E  3 974  ? 38.900  43.515  -15.818 1.00 52.90 ? 2301 GLY A CA    1 
ATOM   7730  C  C     . GLY E  3 974  ? 40.003  42.498  -15.623 1.00 52.97 ? 2301 GLY A C     1 
ATOM   7731  O  O     . GLY E  3 974  ? 40.396  41.809  -16.569 1.00 53.43 ? 2301 GLY A O     1 
ATOM   7732  N  N     . LYS E  3 975  ? 40.499  42.400  -14.390 1.00 52.82 ? 2302 LYS A N     1 
ATOM   7733  C  CA    . LYS E  3 975  ? 41.615  41.505  -14.046 1.00 52.76 ? 2302 LYS A CA    1 
ATOM   7734  C  C     . LYS E  3 975  ? 41.412  40.080  -14.574 1.00 51.46 ? 2302 LYS A C     1 
ATOM   7735  O  O     . LYS E  3 975  ? 42.362  39.435  -15.013 1.00 50.51 ? 2302 LYS A O     1 
ATOM   7736  C  CB    . LYS E  3 975  ? 41.835  41.514  -12.527 1.00 53.17 ? 2302 LYS A CB    1 
ATOM   7737  C  CG    . LYS E  3 975  ? 43.083  40.791  -12.025 1.00 54.18 ? 2302 LYS A CG    1 
ATOM   7738  C  CD    . LYS E  3 975  ? 43.288  41.066  -10.530 1.00 54.09 ? 2302 LYS A CD    1 
ATOM   7739  C  CE    . LYS E  3 975  ? 43.625  39.800  -9.728  1.00 54.75 ? 2302 LYS A CE    1 
ATOM   7740  N  NZ    . LYS E  3 975  ? 45.012  39.305  -9.966  1.00 53.70 ? 2302 LYS A NZ    1 
ATOM   7741  N  N     . ALA E  3 976  ? 40.165  39.616  -14.548 1.00 51.33 ? 2303 ALA A N     1 
ATOM   7742  C  CA    . ALA E  3 976  ? 39.786  38.294  -15.058 1.00 51.00 ? 2303 ALA A CA    1 
ATOM   7743  C  C     . ALA E  3 976  ? 40.252  38.050  -16.495 1.00 50.60 ? 2303 ALA A C     1 
ATOM   7744  O  O     . ALA E  3 976  ? 40.879  37.027  -16.782 1.00 50.46 ? 2303 ALA A O     1 
ATOM   7745  C  CB    . ALA E  3 976  ? 38.274  38.099  -14.947 1.00 50.99 ? 2303 ALA A CB    1 
ATOM   7746  N  N     . ASN E  3 977  ? 39.950  38.995  -17.384 1.00 50.04 ? 2304 ASN A N     1 
ATOM   7747  C  CA    . ASN E  3 977  ? 40.314  38.881  -18.795 1.00 49.46 ? 2304 ASN A CA    1 
ATOM   7748  C  C     . ASN E  3 977  ? 41.797  39.053  -19.072 1.00 48.99 ? 2304 ASN A C     1 
ATOM   7749  O  O     . ASN E  3 977  ? 42.360  38.355  -19.913 1.00 48.92 ? 2304 ASN A O     1 
ATOM   7750  C  CB    . ASN E  3 977  ? 39.513  39.864  -19.640 1.00 49.49 ? 2304 ASN A CB    1 
ATOM   7751  C  CG    . ASN E  3 977  ? 38.116  39.385  -19.905 1.00 49.57 ? 2304 ASN A CG    1 
ATOM   7752  O  OD1   . ASN E  3 977  ? 37.151  40.097  -19.650 1.00 50.36 ? 2304 ASN A OD1   1 
ATOM   7753  N  ND2   . ASN E  3 977  ? 37.995  38.164  -20.415 1.00 49.61 ? 2304 ASN A ND2   1 
ATOM   7754  N  N     . ALA E  3 978  ? 42.419  39.993  -18.369 1.00 48.84 ? 2305 ALA A N     1 
ATOM   7755  C  CA    . ALA E  3 978  ? 43.853  40.232  -18.496 1.00 48.90 ? 2305 ALA A CA    1 
ATOM   7756  C  C     . ALA E  3 978  ? 44.643  38.983  -18.126 1.00 48.71 ? 2305 ALA A C     1 
ATOM   7757  O  O     . ALA E  3 978  ? 45.636  38.661  -18.771 1.00 48.79 ? 2305 ALA A O     1 
ATOM   7758  C  CB    . ALA E  3 978  ? 44.272  41.409  -17.634 1.00 49.13 ? 2305 ALA A CB    1 
ATOM   7759  N  N     . THR E  3 979  ? 44.182  38.281  -17.093 1.00 49.00 ? 2306 THR A N     1 
ATOM   7760  C  CA    . THR E  3 979  ? 44.774  37.013  -16.666 1.00 49.04 ? 2306 THR A CA    1 
ATOM   7761  C  C     . THR E  3 979  ? 44.663  35.970  -17.776 1.00 48.25 ? 2306 THR A C     1 
ATOM   7762  O  O     . THR E  3 979  ? 45.629  35.266  -18.073 1.00 47.86 ? 2306 THR A O     1 
ATOM   7763  C  CB    . THR E  3 979  ? 44.095  36.491  -15.379 1.00 49.61 ? 2306 THR A CB    1 
ATOM   7764  O  OG1   . THR E  3 979  ? 44.174  37.489  -14.354 1.00 51.11 ? 2306 THR A OG1   1 
ATOM   7765  C  CG2   . THR E  3 979  ? 44.764  35.220  -14.877 1.00 50.43 ? 2306 THR A CG2   1 
ATOM   7766  N  N     . ALA E  3 980  ? 43.484  35.894  -18.392 1.00 47.84 ? 2307 ALA A N     1 
ATOM   7767  C  CA    . ALA E  3 980  ? 43.224  34.946  -19.472 1.00 47.78 ? 2307 ALA A CA    1 
ATOM   7768  C  C     . ALA E  3 980  ? 44.097  35.214  -20.695 1.00 47.92 ? 2307 ALA A C     1 
ATOM   7769  O  O     . ALA E  3 980  ? 44.512  34.286  -21.385 1.00 47.64 ? 2307 ALA A O     1 
ATOM   7770  C  CB    . ALA E  3 980  ? 41.752  34.970  -19.851 1.00 47.84 ? 2307 ALA A CB    1 
ATOM   7771  N  N     . TRP E  3 981  ? 44.373  36.489  -20.952 1.00 48.53 ? 2308 TRP A N     1 
ATOM   7772  C  CA    . TRP E  3 981  ? 45.230  36.887  -22.060 1.00 48.99 ? 2308 TRP A CA    1 
ATOM   7773  C  C     . TRP E  3 981  ? 46.670  36.406  -21.881 1.00 49.59 ? 2308 TRP A C     1 
ATOM   7774  O  O     . TRP E  3 981  ? 47.309  35.996  -22.849 1.00 50.15 ? 2308 TRP A O     1 
ATOM   7775  C  CB    . TRP E  3 981  ? 45.214  38.403  -22.240 1.00 48.96 ? 2308 TRP A CB    1 
ATOM   7776  C  CG    . TRP E  3 981  ? 45.884  38.843  -23.507 1.00 48.64 ? 2308 TRP A CG    1 
ATOM   7777  C  CD1   . TRP E  3 981  ? 45.317  38.918  -24.742 1.00 48.64 ? 2308 TRP A CD1   1 
ATOM   7778  C  CD2   . TRP E  3 981  ? 47.249  39.251  -23.665 1.00 48.31 ? 2308 TRP A CD2   1 
ATOM   7779  N  NE1   . TRP E  3 981  ? 46.237  39.353  -25.659 1.00 48.83 ? 2308 TRP A NE1   1 
ATOM   7780  C  CE2   . TRP E  3 981  ? 47.432  39.567  -25.025 1.00 48.72 ? 2308 TRP A CE2   1 
ATOM   7781  C  CE3   . TRP E  3 981  ? 48.332  39.389  -22.789 1.00 48.50 ? 2308 TRP A CE3   1 
ATOM   7782  C  CZ2   . TRP E  3 981  ? 48.658  40.013  -25.534 1.00 49.02 ? 2308 TRP A CZ2   1 
ATOM   7783  C  CZ3   . TRP E  3 981  ? 49.553  39.829  -23.298 1.00 48.18 ? 2308 TRP A CZ3   1 
ATOM   7784  C  CH2   . TRP E  3 981  ? 49.703  40.135  -24.656 1.00 48.09 ? 2308 TRP A CH2   1 
ATOM   7785  N  N     . LEU E  3 982  ? 47.178  36.467  -20.651 1.00 49.65 ? 2309 LEU A N     1 
ATOM   7786  C  CA    . LEU E  3 982  ? 48.535  36.013  -20.363 1.00 49.80 ? 2309 LEU A CA    1 
ATOM   7787  C  C     . LEU E  3 982  ? 48.685  34.499  -20.455 1.00 50.77 ? 2309 LEU A C     1 
ATOM   7788  O  O     . LEU E  3 982  ? 49.735  34.011  -20.868 1.00 50.68 ? 2309 LEU A O     1 
ATOM   7789  C  CB    . LEU E  3 982  ? 49.010  36.525  -19.009 1.00 49.69 ? 2309 LEU A CB    1 
ATOM   7790  C  CG    . LEU E  3 982  ? 49.362  38.015  -18.972 1.00 50.40 ? 2309 LEU A CG    1 
ATOM   7791  C  CD1   . LEU E  3 982  ? 49.553  38.473  -17.538 1.00 50.77 ? 2309 LEU A CD1   1 
ATOM   7792  C  CD2   . LEU E  3 982  ? 50.604  38.318  -19.801 1.00 49.97 ? 2309 LEU A CD2   1 
ATOM   7793  N  N     . LYS E  3 983  ? 47.641  33.761  -20.074 1.00 51.95 ? 2310 LYS A N     1 
ATOM   7794  C  CA    . LYS E  3 983  ? 47.586  32.327  -20.339 1.00 53.27 ? 2310 LYS A CA    1 
ATOM   7795  C  C     . LYS E  3 983  ? 47.733  32.087  -21.841 1.00 53.58 ? 2310 LYS A C     1 
ATOM   7796  O  O     . LYS E  3 983  ? 48.468  31.194  -22.265 1.00 53.81 ? 2310 LYS A O     1 
ATOM   7797  C  CB    . LYS E  3 983  ? 46.257  31.733  -19.874 1.00 53.86 ? 2310 LYS A CB    1 
ATOM   7798  C  CG    . LYS E  3 983  ? 46.142  31.437  -18.390 1.00 54.46 ? 2310 LYS A CG    1 
ATOM   7799  C  CD    . LYS E  3 983  ? 44.755  30.856  -18.079 1.00 55.07 ? 2310 LYS A CD    1 
ATOM   7800  C  CE    . LYS E  3 983  ? 44.473  30.814  -16.583 1.00 56.16 ? 2310 LYS A CE    1 
ATOM   7801  N  NZ    . LYS E  3 983  ? 45.161  29.679  -15.912 1.00 57.02 ? 2310 LYS A NZ    1 
ATOM   7802  N  N     . ASP E  3 984  ? 47.032  32.899  -22.633 1.00 53.79 ? 2311 ASP A N     1 
ATOM   7803  C  CA    . ASP E  3 984  ? 47.012  32.772  -24.091 1.00 54.48 ? 2311 ASP A CA    1 
ATOM   7804  C  C     . ASP E  3 984  ? 48.331  33.142  -24.768 1.00 54.20 ? 2311 ASP A C     1 
ATOM   7805  O  O     . ASP E  3 984  ? 48.670  32.582  -25.813 1.00 54.29 ? 2311 ASP A O     1 
ATOM   7806  C  CB    . ASP E  3 984  ? 45.869  33.603  -24.690 1.00 55.38 ? 2311 ASP A CB    1 
ATOM   7807  C  CG    . ASP E  3 984  ? 44.555  32.837  -24.752 1.00 55.89 ? 2311 ASP A CG    1 
ATOM   7808  O  OD1   . ASP E  3 984  ? 44.176  32.197  -23.747 1.00 55.72 ? 2311 ASP A OD1   1 
ATOM   7809  O  OD2   . ASP E  3 984  ? 43.898  32.883  -25.814 1.00 56.40 ? 2311 ASP A OD2   1 
ATOM   7810  N  N     . ASN E  3 985  ? 49.058  34.091  -24.183 1.00 53.39 ? 2312 ASN A N     1 
ATOM   7811  C  CA    . ASN E  3 985  ? 50.340  34.520  -24.726 1.00 52.78 ? 2312 ASN A CA    1 
ATOM   7812  C  C     . ASN E  3 985  ? 51.467  34.204  -23.758 1.00 53.16 ? 2312 ASN A C     1 
ATOM   7813  O  O     . ASN E  3 985  ? 51.962  35.098  -23.077 1.00 53.16 ? 2312 ASN A O     1 
ATOM   7814  C  CB    . ASN E  3 985  ? 50.316  36.017  -25.021 1.00 52.51 ? 2312 ASN A CB    1 
ATOM   7815  C  CG    . ASN E  3 985  ? 49.160  36.421  -25.912 1.00 51.65 ? 2312 ASN A CG    1 
ATOM   7816  O  OD1   . ASN E  3 985  ? 47.996  36.260  -25.555 1.00 49.57 ? 2312 ASN A OD1   1 
ATOM   7817  N  ND2   . ASN E  3 985  ? 49.481  36.968  -27.077 1.00 52.00 ? 2312 ASN A ND2   1 
ATOM   7818  N  N     . PRO E  3 986  ? 51.886  32.928  -23.695 1.00 53.95 ? 2313 PRO A N     1 
ATOM   7819  C  CA    . PRO E  3 986  ? 52.868  32.513  -22.694 1.00 54.72 ? 2313 PRO A CA    1 
ATOM   7820  C  C     . PRO E  3 986  ? 54.242  33.139  -22.936 1.00 55.36 ? 2313 PRO A C     1 
ATOM   7821  O  O     . PRO E  3 986  ? 55.019  33.306  -21.994 1.00 55.69 ? 2313 PRO A O     1 
ATOM   7822  C  CB    . PRO E  3 986  ? 52.937  30.986  -22.872 1.00 54.66 ? 2313 PRO A CB    1 
ATOM   7823  C  CG    . PRO E  3 986  ? 51.728  30.621  -23.668 1.00 54.59 ? 2313 PRO A CG    1 
ATOM   7824  C  CD    . PRO E  3 986  ? 51.492  31.800  -24.553 1.00 54.18 ? 2313 PRO A CD    1 
ATOM   7825  N  N     . GLU E  3 987  ? 54.522  33.491  -24.188 1.00 55.64 ? 2314 GLU A N     1 
ATOM   7826  C  CA    . GLU E  3 987  ? 55.799  34.084  -24.574 1.00 56.24 ? 2314 GLU A CA    1 
ATOM   7827  C  C     . GLU E  3 987  ? 55.915  35.486  -24.002 1.00 55.87 ? 2314 GLU A C     1 
ATOM   7828  O  O     . GLU E  3 987  ? 56.969  35.877  -23.505 1.00 55.76 ? 2314 GLU A O     1 
ATOM   7829  C  CB    . GLU E  3 987  ? 55.924  34.150  -26.095 1.00 56.86 ? 2314 GLU A CB    1 
ATOM   7830  C  CG    . GLU E  3 987  ? 54.894  33.318  -26.859 1.00 60.73 ? 2314 GLU A CG    1 
ATOM   7831  C  CD    . GLU E  3 987  ? 55.012  31.821  -26.607 1.00 63.72 ? 2314 GLU A CD    1 
ATOM   7832  O  OE1   . GLU E  3 987  ? 56.130  31.345  -26.301 1.00 65.69 ? 2314 GLU A OE1   1 
ATOM   7833  O  OE2   . GLU E  3 987  ? 53.980  31.121  -26.719 1.00 64.96 ? 2314 GLU A OE2   1 
ATOM   7834  N  N     . THR E  3 988  ? 54.817  36.232  -24.083 1.00 55.75 ? 2315 THR A N     1 
ATOM   7835  C  CA    . THR E  3 988  ? 54.728  37.585  -23.540 1.00 55.52 ? 2315 THR A CA    1 
ATOM   7836  C  C     . THR E  3 988  ? 54.726  37.542  -22.017 1.00 55.92 ? 2315 THR A C     1 
ATOM   7837  O  O     . THR E  3 988  ? 55.311  38.408  -21.364 1.00 56.52 ? 2315 THR A O     1 
ATOM   7838  C  CB    . THR E  3 988  ? 53.452  38.298  -24.021 1.00 55.34 ? 2315 THR A CB    1 
ATOM   7839  O  OG1   . THR E  3 988  ? 53.251  38.028  -25.414 1.00 57.31 ? 2315 THR A OG1   1 
ATOM   7840  C  CG2   . THR E  3 988  ? 53.560  39.793  -23.821 1.00 54.11 ? 2315 THR A CG2   1 
ATOM   7841  N  N     . ALA E  3 989  ? 54.068  36.529  -21.460 1.00 55.80 ? 2316 ALA A N     1 
ATOM   7842  C  CA    . ALA E  3 989  ? 54.044  36.326  -20.022 1.00 55.93 ? 2316 ALA A CA    1 
ATOM   7843  C  C     . ALA E  3 989  ? 55.462  36.136  -19.481 1.00 56.33 ? 2316 ALA A C     1 
ATOM   7844  O  O     . ALA E  3 989  ? 55.839  36.789  -18.502 1.00 56.33 ? 2316 ALA A O     1 
ATOM   7845  C  CB    . ALA E  3 989  ? 53.159  35.139  -19.666 1.00 56.34 ? 2316 ALA A CB    1 
ATOM   7846  N  N     . LYS E  3 990  ? 56.247  35.269  -20.132 1.00 56.37 ? 2317 LYS A N     1 
ATOM   7847  C  CA    . LYS E  3 990  ? 57.644  35.028  -19.740 1.00 56.59 ? 2317 LYS A CA    1 
ATOM   7848  C  C     . LYS E  3 990  ? 58.430  36.333  -19.720 1.00 55.90 ? 2317 LYS A C     1 
ATOM   7849  O  O     . LYS E  3 990  ? 59.222  36.578  -18.809 1.00 55.68 ? 2317 LYS A O     1 
ATOM   7850  C  CB    . LYS E  3 990  ? 58.337  34.025  -20.679 1.00 57.27 ? 2317 LYS A CB    1 
ATOM   7851  C  CG    . LYS E  3 990  ? 57.818  32.572  -20.665 1.00 60.18 ? 2317 LYS A CG    1 
ATOM   7852  C  CD    . LYS E  3 990  ? 57.990  31.855  -19.311 1.00 63.40 ? 2317 LYS A CD    1 
ATOM   7853  C  CE    . LYS E  3 990  ? 56.682  31.853  -18.487 1.00 64.87 ? 2317 LYS A CE    1 
ATOM   7854  N  NZ    . LYS E  3 990  ? 56.858  31.290  -17.114 1.00 64.97 ? 2317 LYS A NZ    1 
ATOM   7855  N  N     . GLU E  3 991  ? 58.185  37.163  -20.731 1.00 55.49 ? 2318 GLU A N     1 
ATOM   7856  C  CA    . GLU E  3 991  ? 58.852  38.450  -20.885 1.00 55.29 ? 2318 GLU A CA    1 
ATOM   7857  C  C     . GLU E  3 991  ? 58.525  39.387  -19.726 1.00 54.09 ? 2318 GLU A C     1 
ATOM   7858  O  O     . GLU E  3 991  ? 59.429  39.970  -19.128 1.00 54.60 ? 2318 GLU A O     1 
ATOM   7859  C  CB    . GLU E  3 991  ? 58.461  39.087  -22.220 1.00 55.31 ? 2318 GLU A CB    1 
ATOM   7860  C  CG    . GLU E  3 991  ? 59.226  40.360  -22.580 1.00 56.67 ? 2318 GLU A CG    1 
ATOM   7861  C  CD    . GLU E  3 991  ? 58.659  41.063  -23.818 1.00 57.27 ? 2318 GLU A CD    1 
ATOM   7862  O  OE1   . GLU E  3 991  ? 58.584  40.432  -24.898 1.00 58.71 ? 2318 GLU A OE1   1 
ATOM   7863  O  OE2   . GLU E  3 991  ? 58.292  42.256  -23.717 1.00 58.64 ? 2318 GLU A OE2   1 
ATOM   7864  N  N     . ILE E  3 992  ? 57.241  39.522  -19.406 1.00 52.30 ? 2319 ILE A N     1 
ATOM   7865  C  CA    . ILE E  3 992  ? 56.825  40.383  -18.304 1.00 51.16 ? 2319 ILE A CA    1 
ATOM   7866  C  C     . ILE E  3 992  ? 57.354  39.834  -16.977 1.00 51.27 ? 2319 ILE A C     1 
ATOM   7867  O  O     . ILE E  3 992  ? 57.854  40.588  -16.139 1.00 51.45 ? 2319 ILE A O     1 
ATOM   7868  C  CB    . ILE E  3 992  ? 55.286  40.563  -18.246 1.00 51.12 ? 2319 ILE A CB    1 
ATOM   7869  C  CG1   . ILE E  3 992  ? 54.760  41.128  -19.565 1.00 50.34 ? 2319 ILE A CG1   1 
ATOM   7870  C  CG2   . ILE E  3 992  ? 54.883  41.483  -17.084 1.00 50.41 ? 2319 ILE A CG2   1 
ATOM   7871  C  CD1   . ILE E  3 992  ? 53.246  41.161  -19.670 1.00 50.44 ? 2319 ILE A CD1   1 
ATOM   7872  N  N     . GLU E  3 993  ? 57.255  38.519  -16.798 1.00 50.57 ? 2320 GLU A N     1 
ATOM   7873  C  CA    . GLU E  3 993  ? 57.744  37.882  -15.582 1.00 50.28 ? 2320 GLU A CA    1 
ATOM   7874  C  C     . GLU E  3 993  ? 59.232  38.171  -15.358 1.00 49.81 ? 2320 GLU A C     1 
ATOM   7875  O  O     . GLU E  3 993  ? 59.633  38.572  -14.262 1.00 49.10 ? 2320 GLU A O     1 
ATOM   7876  C  CB    . GLU E  3 993  ? 57.489  36.372  -15.620 1.00 50.35 ? 2320 GLU A CB    1 
ATOM   7877  C  CG    . GLU E  3 993  ? 57.705  35.684  -14.281 1.00 51.52 ? 2320 GLU A CG    1 
ATOM   7878  C  CD    . GLU E  3 993  ? 57.971  34.198  -14.401 1.00 52.33 ? 2320 GLU A CD    1 
ATOM   7879  O  OE1   . GLU E  3 993  ? 57.534  33.586  -15.398 1.00 54.10 ? 2320 GLU A OE1   1 
ATOM   7880  O  OE2   . GLU E  3 993  ? 58.617  33.641  -13.486 1.00 52.69 ? 2320 GLU A OE2   1 
ATOM   7881  N  N     . LYS E  3 994  ? 60.033  37.982  -16.406 1.00 49.40 ? 2321 LYS A N     1 
ATOM   7882  C  CA    . LYS E  3 994  ? 61.469  38.206  -16.335 1.00 49.69 ? 2321 LYS A CA    1 
ATOM   7883  C  C     . LYS E  3 994  ? 61.799  39.618  -15.860 1.00 49.90 ? 2321 LYS A C     1 
ATOM   7884  O  O     . LYS E  3 994  ? 62.698  39.806  -15.033 1.00 49.98 ? 2321 LYS A O     1 
ATOM   7885  C  CB    . LYS E  3 994  ? 62.124  37.939  -17.689 1.00 49.78 ? 2321 LYS A CB    1 
ATOM   7886  C  CG    . LYS E  3 994  ? 63.655  37.976  -17.649 1.00 51.10 ? 2321 LYS A CG    1 
ATOM   7887  C  CD    . LYS E  3 994  ? 64.277  37.832  -19.030 1.00 50.76 ? 2321 LYS A CD    1 
ATOM   7888  C  CE    . LYS E  3 994  ? 64.303  36.378  -19.478 1.00 52.12 ? 2321 LYS A CE    1 
ATOM   7889  N  NZ    . LYS E  3 994  ? 64.722  36.264  -20.899 1.00 52.84 ? 2321 LYS A NZ    1 
ATOM   7890  N  N     . LYS E  3 995  ? 61.068  40.600  -16.387 1.00 50.16 ? 2322 LYS A N     1 
ATOM   7891  C  CA    . LYS E  3 995  ? 61.248  42.006  -16.007 1.00 50.08 ? 2322 LYS A CA    1 
ATOM   7892  C  C     . LYS E  3 995  ? 60.808  42.275  -14.570 1.00 50.25 ? 2322 LYS A C     1 
ATOM   7893  O  O     . LYS E  3 995  ? 61.486  43.006  -13.843 1.00 50.76 ? 2322 LYS A O     1 
ATOM   7894  C  CB    . LYS E  3 995  ? 60.515  42.938  -16.968 1.00 49.83 ? 2322 LYS A CB    1 
ATOM   7895  C  CG    . LYS E  3 995  ? 61.369  43.392  -18.116 1.00 51.62 ? 2322 LYS A CG    1 
ATOM   7896  C  CD    . LYS E  3 995  ? 60.529  43.719  -19.344 1.00 53.37 ? 2322 LYS A CD    1 
ATOM   7897  C  CE    . LYS E  3 995  ? 61.422  44.010  -20.542 1.00 54.34 ? 2322 LYS A CE    1 
ATOM   7898  N  NZ    . LYS E  3 995  ? 60.643  44.114  -21.797 1.00 55.75 ? 2322 LYS A NZ    1 
ATOM   7899  N  N     . VAL E  3 996  ? 59.686  41.678  -14.161 1.00 49.30 ? 2323 VAL A N     1 
ATOM   7900  C  CA    . VAL E  3 996  ? 59.209  41.818  -12.791 1.00 47.97 ? 2323 VAL A CA    1 
ATOM   7901  C  C     . VAL E  3 996  ? 60.271  41.287  -11.822 1.00 48.12 ? 2323 VAL A C     1 
ATOM   7902  O  O     . VAL E  3 996  ? 60.603  41.943  -10.833 1.00 48.68 ? 2323 VAL A O     1 
ATOM   7903  C  CB    . VAL E  3 996  ? 57.838  41.137  -12.580 1.00 46.91 ? 2323 VAL A CB    1 
ATOM   7904  C  CG1   . VAL E  3 996  ? 57.479  41.085  -11.099 1.00 45.25 ? 2323 VAL A CG1   1 
ATOM   7905  C  CG2   . VAL E  3 996  ? 56.755  41.877  -13.350 1.00 45.67 ? 2323 VAL A CG2   1 
ATOM   7906  N  N     . ARG E  3 997  ? 60.822  40.118  -12.136 1.00 47.93 ? 2324 ARG A N     1 
ATOM   7907  C  CA    . ARG E  3 997  ? 61.865  39.510  -11.315 1.00 47.87 ? 2324 ARG A CA    1 
ATOM   7908  C  C     . ARG E  3 997  ? 63.119  40.377  -11.243 1.00 48.01 ? 2324 ARG A C     1 
ATOM   7909  O  O     . ARG E  3 997  ? 63.654  40.603  -10.154 1.00 47.53 ? 2324 ARG A O     1 
ATOM   7910  C  CB    . ARG E  3 997  ? 62.206  38.108  -11.819 1.00 47.66 ? 2324 ARG A CB    1 
ATOM   7911  C  CG    . ARG E  3 997  ? 61.149  37.089  -11.506 1.00 46.58 ? 2324 ARG A CG    1 
ATOM   7912  C  CD    . ARG E  3 997  ? 61.429  35.759  -12.171 1.00 47.57 ? 2324 ARG A CD    1 
ATOM   7913  N  NE    . ARG E  3 997  ? 60.525  34.731  -11.660 1.00 49.04 ? 2324 ARG A NE    1 
ATOM   7914  C  CZ    . ARG E  3 997  ? 60.780  33.965  -10.602 1.00 49.84 ? 2324 ARG A CZ    1 
ATOM   7915  N  NH1   . ARG E  3 997  ? 61.928  34.091  -9.941  1.00 51.61 ? 2324 ARG A NH1   1 
ATOM   7916  N  NH2   . ARG E  3 997  ? 59.891  33.066  -10.207 1.00 48.25 ? 2324 ARG A NH2   1 
ATOM   7917  N  N     . GLU E  3 998  ? 63.573  40.867  -12.397 1.00 48.01 ? 2325 GLU A N     1 
ATOM   7918  C  CA    . GLU E  3 998  ? 64.716  41.779  -12.452 1.00 48.42 ? 2325 GLU A CA    1 
ATOM   7919  C  C     . GLU E  3 998  ? 64.490  43.008  -11.581 1.00 46.98 ? 2325 GLU A C     1 
ATOM   7920  O  O     . GLU E  3 998  ? 65.377  43.415  -10.840 1.00 47.62 ? 2325 GLU A O     1 
ATOM   7921  C  CB    . GLU E  3 998  ? 65.009  42.201  -13.887 1.00 48.81 ? 2325 GLU A CB    1 
ATOM   7922  C  CG    . GLU E  3 998  ? 65.789  41.161  -14.682 1.00 51.10 ? 2325 GLU A CG    1 
ATOM   7923  C  CD    . GLU E  3 998  ? 65.791  41.424  -16.187 1.00 51.45 ? 2325 GLU A CD    1 
ATOM   7924  O  OE1   . GLU E  3 998  ? 65.605  42.592  -16.607 1.00 53.75 ? 2325 GLU A OE1   1 
ATOM   7925  O  OE2   . GLU E  3 998  ? 65.983  40.453  -16.955 1.00 53.47 ? 2325 GLU A OE2   1 
ATOM   7926  N  N     . LEU E  3 999  ? 63.288  43.570  -11.656 1.00 45.33 ? 2326 LEU A N     1 
ATOM   7927  C  CA    . LEU E  3 999  ? 62.922  44.738  -10.861 1.00 43.30 ? 2326 LEU A CA    1 
ATOM   7928  C  C     . LEU E  3 999  ? 62.807  44.481  -9.365  1.00 41.01 ? 2326 LEU A C     1 
ATOM   7929  O  O     . LEU E  3 999  ? 63.138  45.356  -8.572  1.00 39.76 ? 2326 LEU A O     1 
ATOM   7930  C  CB    . LEU E  3 999  ? 61.603  45.338  -11.365 1.00 43.78 ? 2326 LEU A CB    1 
ATOM   7931  C  CG    . LEU E  3 999  ? 61.627  46.202  -12.628 1.00 44.23 ? 2326 LEU A CG    1 
ATOM   7932  C  CD1   . LEU E  3 999  ? 60.211  46.421  -13.125 1.00 44.99 ? 2326 LEU A CD1   1 
ATOM   7933  C  CD2   . LEU E  3 999  ? 62.310  47.530  -12.379 1.00 43.52 ? 2326 LEU A CD2   1 
ATOM   7934  N  N     . LEU E  3 1000 ? 62.335  43.294  -8.983  1.00 40.16 ? 2327 LEU A N     1 
ATOM   7935  C  CA    . LEU E  3 1000 ? 61.897  43.066  -7.595  1.00 39.98 ? 2327 LEU A CA    1 
ATOM   7936  C  C     . LEU E  3 1000 ? 62.649  42.023  -6.761  1.00 40.34 ? 2327 LEU A C     1 
ATOM   7937  O  O     . LEU E  3 1000 ? 62.512  42.003  -5.534  1.00 39.39 ? 2327 LEU A O     1 
ATOM   7938  C  CB    . LEU E  3 1000 ? 60.385  42.827  -7.526  1.00 39.08 ? 2327 LEU A CB    1 
ATOM   7939  C  CG    . LEU E  3 1000 ? 59.478  44.010  -7.879  1.00 39.45 ? 2327 LEU A CG    1 
ATOM   7940  C  CD1   . LEU E  3 1000 ? 58.026  43.593  -7.854  1.00 38.60 ? 2327 LEU A CD1   1 
ATOM   7941  C  CD2   . LEU E  3 1000 ? 59.709  45.210  -6.960  1.00 40.24 ? 2327 LEU A CD2   1 
ATOM   7942  N  N     . LEU E  3 1001 ? 63.434  41.164  -7.409  1.00 41.20 ? 2328 LEU A N     1 
ATOM   7943  C  CA    . LEU E  3 1001 ? 64.266  40.206  -6.679  1.00 41.76 ? 2328 LEU A CA    1 
ATOM   7944  C  C     . LEU E  3 1001 ? 65.519  40.854  -6.110  1.00 42.07 ? 2328 LEU A C     1 
ATOM   7945  O  O     . LEU E  3 1001 ? 66.283  41.485  -6.826  1.00 42.24 ? 2328 LEU A O     1 
ATOM   7946  C  CB    . LEU E  3 1001 ? 64.679  39.029  -7.569  1.00 41.90 ? 2328 LEU A CB    1 
ATOM   7947  C  CG    . LEU E  3 1001 ? 63.609  38.052  -8.053  1.00 42.43 ? 2328 LEU A CG    1 
ATOM   7948  C  CD1   . LEU E  3 1001 ? 64.259  36.909  -8.826  1.00 43.04 ? 2328 LEU A CD1   1 
ATOM   7949  C  CD2   . LEU E  3 1001 ? 62.777  37.517  -6.894  1.00 41.77 ? 2328 LEU A CD2   1 
ATOM   7950  N  N     . SER E  3 1002 ? 65.753  40.654  -4.824  1.00 43.25 ? 2329 SER A N     1 
ATOM   7951  C  CA    . SER E  3 1002 ? 67.026  41.023  -4.213  1.00 43.53 ? 2329 SER A CA    1 
ATOM   7952  C  C     . SER E  3 1002 ? 67.752  39.714  -3.965  1.00 43.96 ? 2329 SER A C     1 
ATOM   7953  O  O     . SER E  3 1002 ? 67.467  39.028  -2.978  1.00 44.12 ? 2329 SER A O     1 
ATOM   7954  C  CB    . SER E  3 1002 ? 66.792  41.765  -2.894  1.00 43.76 ? 2329 SER A CB    1 
ATOM   7955  O  OG    . SER E  3 1002 ? 65.980  40.992  -2.011  1.00 42.79 ? 2329 SER A OG    1 
ATOM   7956  N  N     . ASN E  3 1003 ? 68.663  39.367  -4.877  1.00 43.70 ? 2330 ASN A N     1 
ATOM   7957  C  CA    . ASN E  3 1003 ? 69.343  38.053  -4.923  1.00 43.96 ? 2330 ASN A CA    1 
ATOM   7958  C  C     . ASN E  3 1003 ? 69.028  37.241  -6.190  1.00 44.62 ? 2330 ASN A C     1 
ATOM   7959  O  O     . ASN E  3 1003 ? 68.450  36.156  -6.092  1.00 44.67 ? 2330 ASN A O     1 
ATOM   7960  C  CB    . ASN E  3 1003 ? 69.039  37.180  -3.689  1.00 43.04 ? 2330 ASN A CB    1 
ATOM   7961  C  CG    . ASN E  3 1003 ? 69.863  37.560  -2.478  1.00 41.49 ? 2330 ASN A CG    1 
ATOM   7962  O  OD1   . ASN E  3 1003 ? 71.093  37.503  -2.505  1.00 41.38 ? 2330 ASN A OD1   1 
ATOM   7963  N  ND2   . ASN E  3 1003 ? 69.185  37.934  -1.397  1.00 39.48 ? 2330 ASN A ND2   1 
ATOM   7964  N  N     . PRO E  3 1004 ? 69.400  37.760  -7.379  1.00 45.15 ? 2331 PRO A N     1 
ATOM   7965  C  CA    . PRO E  3 1004 ? 69.252  36.998  -8.631  1.00 45.36 ? 2331 PRO A CA    1 
ATOM   7966  C  C     . PRO E  3 1004 ? 70.196  35.781  -8.726  1.00 45.34 ? 2331 PRO A C     1 
ATOM   7967  O  O     . PRO E  3 1004 ? 71.254  35.755  -8.085  1.00 44.66 ? 2331 PRO A O     1 
ATOM   7968  C  CB    . PRO E  3 1004 ? 69.567  38.039  -9.715  1.00 46.09 ? 2331 PRO A CB    1 
ATOM   7969  C  CG    . PRO E  3 1004 ? 69.463  39.390  -9.013  1.00 45.78 ? 2331 PRO A CG    1 
ATOM   7970  C  CD    . PRO E  3 1004 ? 69.947  39.104  -7.631  1.00 45.22 ? 2331 PRO A CD    1 
ATOM   7971  N  N     . ASN E  3 1005 ? 69.817  34.802  -9.546  1.00 45.65 ? 2332 ASN A N     1 
ATOM   7972  C  CA    . ASN E  3 1005 ? 70.294  33.428  -9.373  1.00 46.19 ? 2332 ASN A CA    1 
ATOM   7973  C  C     . ASN E  3 1005 ? 70.731  32.677  -10.640 1.00 46.64 ? 2332 ASN A C     1 
ATOM   7974  O  O     . ASN E  3 1005 ? 71.924  32.383  -10.809 1.00 46.73 ? 2332 ASN A O     1 
ATOM   7975  C  CB    . ASN E  3 1005 ? 69.198  32.622  -8.662  1.00 46.22 ? 2332 ASN A CB    1 
ATOM   7976  C  CG    . ASN E  3 1005 ? 69.751  31.518  -7.793  1.00 45.82 ? 2332 ASN A CG    1 
ATOM   7977  O  OD1   . ASN E  3 1005 ? 70.431  31.778  -6.796  1.00 44.73 ? 2332 ASN A OD1   1 
ATOM   7978  N  ND2   . ASN E  3 1005 ? 69.441  30.272  -8.150  1.00 45.81 ? 2332 ASN A ND2   1 
ATOM   7979  N  N     . SER E  3 1006 ? 69.755  32.364  -11.503 1.00 46.73 ? 2333 SER A N     1 
ATOM   7980  C  CA    . SER E  3 1006 ? 69.921  31.469  -12.668 1.00 46.84 ? 2333 SER A CA    1 
ATOM   7981  C  C     . SER E  3 1006 ? 70.817  30.249  -12.382 1.00 46.64 ? 2333 SER A C     1 
ATOM   7982  O  O     . SER E  3 1006 ? 70.611  29.166  -12.937 1.00 46.05 ? 2333 SER A O     1 
ATOM   7983  C  CB    . SER E  3 1006 ? 70.413  32.237  -13.908 1.00 46.89 ? 2333 SER A CB    1 
ATOM   7984  O  OG    . SER E  3 1006 ? 71.827  32.381  -13.918 1.00 46.92 ? 2333 SER A OG    1 
ATOM   7985  N  N     . ALA E  3 1024 ? 73.158  10.281  -21.730 1.00 95.18 ? 3001 ALA A N     1 
ATOM   7986  C  CA    . ALA E  3 1024 ? 74.349  9.767   -20.997 1.00 95.12 ? 3001 ALA A CA    1 
ATOM   7987  C  C     . ALA E  3 1024 ? 74.314  10.172  -19.527 1.00 95.09 ? 3001 ALA A C     1 
ATOM   7988  O  O     . ALA E  3 1024 ? 74.791  9.436   -18.663 1.00 95.13 ? 3001 ALA A O     1 
ATOM   7989  C  CB    . ALA E  3 1024 ? 75.634  10.259  -21.659 1.00 95.20 ? 3001 ALA A CB    1 
ATOM   7990  N  N     . ILE E  3 1025 ? 73.733  11.338  -19.255 1.00 95.17 ? 3002 ILE A N     1 
ATOM   7991  C  CA    . ILE E  3 1025 ? 73.725  11.927  -17.910 1.00 95.30 ? 3002 ILE A CA    1 
ATOM   7992  C  C     . ILE E  3 1025 ? 72.538  11.445  -17.059 1.00 94.60 ? 3002 ILE A C     1 
ATOM   7993  O  O     . ILE E  3 1025 ? 72.698  11.142  -15.872 1.00 94.15 ? 3002 ILE A O     1 
ATOM   7994  C  CB    . ILE E  3 1025 ? 73.734  13.489  -17.972 1.00 95.77 ? 3002 ILE A CB    1 
ATOM   7995  C  CG1   . ILE E  3 1025 ? 74.622  13.987  -19.128 1.00 95.68 ? 3002 ILE A CG1   1 
ATOM   7996  C  CG2   . ILE E  3 1025 ? 74.161  14.086  -16.620 1.00 95.38 ? 3002 ILE A CG2   1 
ATOM   7997  C  CD1   . ILE E  3 1025 ? 74.211  15.336  -19.714 1.00 95.26 ? 3002 ILE A CD1   1 
ATOM   7998  N  N     . ASP E  3 1026 ? 71.360  11.378  -17.680 1.00 94.01 ? 3003 ASP A N     1 
ATOM   7999  C  CA    . ASP E  3 1026 ? 70.119  10.994  -16.997 1.00 93.50 ? 3003 ASP A CA    1 
ATOM   8000  C  C     . ASP E  3 1026 ? 69.870  9.479   -16.971 1.00 92.56 ? 3003 ASP A C     1 
ATOM   8001  O  O     . ASP E  3 1026 ? 69.009  8.991   -16.233 1.00 92.54 ? 3003 ASP A O     1 
ATOM   8002  C  CB    . ASP E  3 1026 ? 68.914  11.738  -17.602 1.00 93.95 ? 3003 ASP A CB    1 
ATOM   8003  C  CG    . ASP E  3 1026 ? 68.765  11.521  -19.112 1.00 94.71 ? 3003 ASP A CG    1 
ATOM   8004  O  OD1   . ASP E  3 1026 ? 69.557  10.763  -19.716 1.00 95.16 ? 3003 ASP A OD1   1 
ATOM   8005  O  OD2   . ASP E  3 1026 ? 67.839  12.121  -19.701 1.00 95.42 ? 3003 ASP A OD2   1 
ATOM   8006  N  N     . GLU E  3 1027 ? 70.628  8.744   -17.779 1.00 91.32 ? 3004 GLU A N     1 
ATOM   8007  C  CA    . GLU E  3 1027 ? 70.525  7.287   -17.832 1.00 89.81 ? 3004 GLU A CA    1 
ATOM   8008  C  C     . GLU E  3 1027 ? 71.214  6.643   -16.635 1.00 88.26 ? 3004 GLU A C     1 
ATOM   8009  O  O     . GLU E  3 1027 ? 70.805  5.575   -16.179 1.00 88.04 ? 3004 GLU A O     1 
ATOM   8010  C  CB    . GLU E  3 1027 ? 71.099  6.765   -19.147 1.00 90.21 ? 3004 GLU A CB    1 
ATOM   8011  C  CG    . GLU E  3 1027 ? 70.214  7.082   -20.348 1.00 90.94 ? 3004 GLU A CG    1 
ATOM   8012  C  CD    . GLU E  3 1027 ? 70.988  7.633   -21.537 1.00 91.42 ? 3004 GLU A CD    1 
ATOM   8013  O  OE1   . GLU E  3 1027 ? 72.145  7.212   -21.760 1.00 91.56 ? 3004 GLU A OE1   1 
ATOM   8014  O  OE2   . GLU E  3 1027 ? 70.431  8.492   -22.256 1.00 91.13 ? 3004 GLU A OE2   1 
ATOM   8015  N  N     . ASN E  3 1028 ? 72.256  7.304   -16.133 1.00 86.51 ? 3005 ASN A N     1 
ATOM   8016  C  CA    . ASN E  3 1028 ? 72.893  6.919   -14.876 1.00 84.76 ? 3005 ASN A CA    1 
ATOM   8017  C  C     . ASN E  3 1028 ? 71.962  7.109   -13.688 1.00 83.58 ? 3005 ASN A C     1 
ATOM   8018  O  O     . ASN E  3 1028 ? 72.000  6.332   -12.732 1.00 83.36 ? 3005 ASN A O     1 
ATOM   8019  C  CB    . ASN E  3 1028 ? 74.172  7.723   -14.651 1.00 84.57 ? 3005 ASN A CB    1 
ATOM   8020  C  CG    . ASN E  3 1028 ? 75.375  7.102   -15.320 1.00 83.94 ? 3005 ASN A CG    1 
ATOM   8021  O  OD1   . ASN E  3 1028 ? 75.648  5.912   -15.156 1.00 83.20 ? 3005 ASN A OD1   1 
ATOM   8022  N  ND2   . ASN E  3 1028 ? 76.112  7.908   -16.071 1.00 84.03 ? 3005 ASN A ND2   1 
ATOM   8023  N  N     . LYS E  3 1029 ? 71.133  8.150   -13.764 1.00 82.13 ? 3006 LYS A N     1 
ATOM   8024  C  CA    . LYS E  3 1029 ? 70.175  8.482   -12.715 1.00 80.66 ? 3006 LYS A CA    1 
ATOM   8025  C  C     . LYS E  3 1029 ? 69.124  7.390   -12.538 1.00 79.71 ? 3006 LYS A C     1 
ATOM   8026  O  O     . LYS E  3 1029 ? 68.817  7.000   -11.413 1.00 80.32 ? 3006 LYS A O     1 
ATOM   8027  C  CB    . LYS E  3 1029 ? 69.495  9.822   -13.007 1.00 80.52 ? 3006 LYS A CB    1 
ATOM   8028  C  CG    . LYS E  3 1029 ? 70.370  11.042  -12.751 1.00 80.32 ? 3006 LYS A CG    1 
ATOM   8029  C  CD    . LYS E  3 1029 ? 69.606  12.346  -12.978 1.00 80.67 ? 3006 LYS A CD    1 
ATOM   8030  C  CE    . LYS E  3 1029 ? 68.639  12.654  -11.834 1.00 81.63 ? 3006 LYS A CE    1 
ATOM   8031  N  NZ    . LYS E  3 1029 ? 67.916  13.947  -12.020 1.00 80.86 ? 3006 LYS A NZ    1 
ATOM   8032  N  N     . GLN E  3 1030 ? 68.587  6.899   -13.651 1.00 78.00 ? 3007 GLN A N     1 
ATOM   8033  C  CA    . GLN E  3 1030 ? 67.558  5.864   -13.624 1.00 76.60 ? 3007 GLN A CA    1 
ATOM   8034  C  C     . GLN E  3 1030 ? 68.107  4.545   -13.108 1.00 74.82 ? 3007 GLN A C     1 
ATOM   8035  O  O     . GLN E  3 1030 ? 67.424  3.819   -12.388 1.00 74.58 ? 3007 GLN A O     1 
ATOM   8036  C  CB    . GLN E  3 1030 ? 66.950  5.685   -15.010 1.00 77.25 ? 3007 GLN A CB    1 
ATOM   8037  C  CG    . GLN E  3 1030 ? 66.121  6.878   -15.451 1.00 78.71 ? 3007 GLN A CG    1 
ATOM   8038  C  CD    . GLN E  3 1030 ? 65.340  6.612   -16.721 1.00 78.80 ? 3007 GLN A CD    1 
ATOM   8039  O  OE1   . GLN E  3 1030 ? 65.884  6.120   -17.712 1.00 77.84 ? 3007 GLN A OE1   1 
ATOM   8040  N  NE2   . GLN E  3 1030 ? 64.053  6.946   -16.699 1.00 79.16 ? 3007 GLN A NE2   1 
ATOM   8041  N  N     . LYS E  3 1031 ? 69.346  4.253   -13.485 1.00 73.18 ? 3008 LYS A N     1 
ATOM   8042  C  CA    . LYS E  3 1031 ? 70.086  3.108   -12.970 1.00 71.91 ? 3008 LYS A CA    1 
ATOM   8043  C  C     . LYS E  3 1031 ? 70.106  3.137   -11.437 1.00 70.35 ? 3008 LYS A C     1 
ATOM   8044  O  O     . LYS E  3 1031 ? 69.846  2.123   -10.794 1.00 70.34 ? 3008 LYS A O     1 
ATOM   8045  C  CB    . LYS E  3 1031 ? 71.503  3.114   -13.568 1.00 72.05 ? 3008 LYS A CB    1 
ATOM   8046  C  CG    . LYS E  3 1031 ? 72.486  2.060   -13.064 1.00 72.26 ? 3008 LYS A CG    1 
ATOM   8047  C  CD    . LYS E  3 1031 ? 73.806  2.187   -13.838 1.00 72.57 ? 3008 LYS A CD    1 
ATOM   8048  C  CE    . LYS E  3 1031 ? 75.030  1.908   -12.972 1.00 72.86 ? 3008 LYS A CE    1 
ATOM   8049  N  NZ    . LYS E  3 1031 ? 75.340  0.459   -12.865 1.00 72.56 ? 3008 LYS A NZ    1 
ATOM   8050  N  N     . ALA E  3 1032 ? 70.382  4.306   -10.864 1.00 68.75 ? 3009 ALA A N     1 
ATOM   8051  C  CA    . ALA E  3 1032 ? 70.435  4.472   -9.407  1.00 67.06 ? 3009 ALA A CA    1 
ATOM   8052  C  C     . ALA E  3 1032 ? 69.048  4.604   -8.774  1.00 66.08 ? 3009 ALA A C     1 
ATOM   8053  O  O     . ALA E  3 1032 ? 68.865  4.266   -7.600  1.00 66.17 ? 3009 ALA A O     1 
ATOM   8054  C  CB    . ALA E  3 1032 ? 71.309  5.665   -9.035  1.00 66.73 ? 3009 ALA A CB    1 
ATOM   8055  N  N     . LEU E  3 1033 ? 68.083  5.104   -9.550  1.00 64.65 ? 3010 LEU A N     1 
ATOM   8056  C  CA    . LEU E  3 1033 ? 66.696  5.253   -9.097  1.00 62.80 ? 3010 LEU A CA    1 
ATOM   8057  C  C     . LEU E  3 1033 ? 66.065  3.890   -8.859  1.00 62.46 ? 3010 LEU A C     1 
ATOM   8058  O  O     . LEU E  3 1033 ? 65.623  3.603   -7.745  1.00 62.56 ? 3010 LEU A O     1 
ATOM   8059  C  CB    . LEU E  3 1033 ? 65.870  6.043   -10.117 1.00 62.30 ? 3010 LEU A CB    1 
ATOM   8060  C  CG    . LEU E  3 1033 ? 64.363  6.183   -9.881  1.00 61.57 ? 3010 LEU A CG    1 
ATOM   8061  C  CD1   . LEU E  3 1033 ? 64.048  7.366   -8.990  1.00 59.28 ? 3010 LEU A CD1   1 
ATOM   8062  C  CD2   . LEU E  3 1033 ? 63.634  6.312   -11.211 1.00 62.19 ? 3010 LEU A CD2   1 
ATOM   8063  N  N     . ALA E  3 1034 ? 66.038  3.058   -9.907  1.00 61.47 ? 3011 ALA A N     1 
ATOM   8064  C  CA    . ALA E  3 1034 ? 65.502  1.698   -9.827  1.00 60.22 ? 3011 ALA A CA    1 
ATOM   8065  C  C     . ALA E  3 1034 ? 66.185  0.894   -8.720  1.00 59.75 ? 3011 ALA A C     1 
ATOM   8066  O  O     . ALA E  3 1034 ? 65.533  0.126   -8.015  1.00 60.20 ? 3011 ALA A O     1 
ATOM   8067  C  CB    . ALA E  3 1034 ? 65.625  0.992   -11.163 1.00 59.81 ? 3011 ALA A CB    1 
ATOM   8068  N  N     . ALA E  3 1035 ? 67.491  1.096   -8.559  1.00 59.18 ? 3012 ALA A N     1 
ATOM   8069  C  CA    . ALA E  3 1035 ? 68.258  0.472   -7.483  1.00 58.83 ? 3012 ALA A CA    1 
ATOM   8070  C  C     . ALA E  3 1035 ? 67.708  0.841   -6.104  1.00 58.73 ? 3012 ALA A C     1 
ATOM   8071  O  O     . ALA E  3 1035 ? 67.607  -0.012  -5.225  1.00 59.36 ? 3012 ALA A O     1 
ATOM   8072  C  CB    . ALA E  3 1035 ? 69.731  0.852   -7.590  1.00 58.77 ? 3012 ALA A CB    1 
ATOM   8073  N  N     . ALA E  3 1036 ? 67.349  2.109   -5.925  1.00 58.10 ? 3013 ALA A N     1 
ATOM   8074  C  CA    . ALA E  3 1036 ? 66.816  2.584   -4.658  1.00 57.72 ? 3013 ALA A CA    1 
ATOM   8075  C  C     . ALA E  3 1036 ? 65.380  2.097   -4.425  1.00 57.74 ? 3013 ALA A C     1 
ATOM   8076  O  O     . ALA E  3 1036 ? 65.039  1.666   -3.322  1.00 58.25 ? 3013 ALA A O     1 
ATOM   8077  C  CB    . ALA E  3 1036 ? 66.891  4.096   -4.592  1.00 57.61 ? 3013 ALA A CB    1 
ATOM   8078  N  N     . LEU E  3 1037 ? 64.551  2.166   -5.466  1.00 56.88 ? 3014 LEU A N     1 
ATOM   8079  C  CA    . LEU E  3 1037 ? 63.169  1.705   -5.397  1.00 56.07 ? 3014 LEU A CA    1 
ATOM   8080  C  C     . LEU E  3 1037 ? 63.094  0.222   -5.069  1.00 56.69 ? 3014 LEU A C     1 
ATOM   8081  O  O     . LEU E  3 1037 ? 62.248  -0.200  -4.282  1.00 56.95 ? 3014 LEU A O     1 
ATOM   8082  C  CB    . LEU E  3 1037 ? 62.438  1.994   -6.709  1.00 55.49 ? 3014 LEU A CB    1 
ATOM   8083  C  CG    . LEU E  3 1037 ? 61.646  3.298   -6.853  1.00 54.92 ? 3014 LEU A CG    1 
ATOM   8084  C  CD1   . LEU E  3 1037 ? 62.543  4.502   -6.979  1.00 54.38 ? 3014 LEU A CD1   1 
ATOM   8085  C  CD2   . LEU E  3 1037 ? 60.733  3.208   -8.058  1.00 55.72 ? 3014 LEU A CD2   1 
ATOM   8086  N  N     . GLY E  3 1038 ? 63.983  -0.561  -5.675  1.00 57.37 ? 3015 GLY A N     1 
ATOM   8087  C  CA    . GLY E  3 1038 ? 64.089  -1.988  -5.386  1.00 58.31 ? 3015 GLY A CA    1 
ATOM   8088  C  C     . GLY E  3 1038 ? 64.491  -2.213  -3.943  1.00 59.31 ? 3015 GLY A C     1 
ATOM   8089  O  O     . GLY E  3 1038 ? 63.902  -3.044  -3.252  1.00 59.88 ? 3015 GLY A O     1 
ATOM   8090  N  N     . GLN E  3 1039 ? 65.490  -1.454  -3.494  1.00 59.92 ? 3016 GLN A N     1 
ATOM   8091  C  CA    . GLN E  3 1039 ? 65.972  -1.497  -2.112  1.00 60.84 ? 3016 GLN A CA    1 
ATOM   8092  C  C     . GLN E  3 1039 ? 64.860  -1.166  -1.105  1.00 60.36 ? 3016 GLN A C     1 
ATOM   8093  O  O     . GLN E  3 1039 ? 64.716  -1.846  -0.085  1.00 59.99 ? 3016 GLN A O     1 
ATOM   8094  C  CB    . GLN E  3 1039 ? 67.195  -0.570  -1.953  1.00 61.93 ? 3016 GLN A CB    1 
ATOM   8095  C  CG    . GLN E  3 1039 ? 67.356  0.144   -0.596  1.00 64.98 ? 3016 GLN A CG    1 
ATOM   8096  C  CD    . GLN E  3 1039 ? 67.827  -0.770  0.533   1.00 66.32 ? 3016 GLN A CD    1 
ATOM   8097  O  OE1   . GLN E  3 1039 ? 68.027  -1.974  0.344   1.00 65.58 ? 3016 GLN A OE1   1 
ATOM   8098  N  NE2   . GLN E  3 1039 ? 68.007  -0.190  1.718   1.00 67.77 ? 3016 GLN A NE2   1 
ATOM   8099  N  N     . ILE E  3 1040 ? 64.079  -0.131  -1.413  1.00 60.17 ? 3017 ILE A N     1 
ATOM   8100  C  CA    . ILE E  3 1040 ? 62.995  0.325   -0.552  1.00 60.21 ? 3017 ILE A CA    1 
ATOM   8101  C  C     . ILE E  3 1040 ? 61.910  -0.732  -0.435  1.00 61.00 ? 3017 ILE A C     1 
ATOM   8102  O  O     . ILE E  3 1040 ? 61.456  -1.042  0.669   1.00 61.69 ? 3017 ILE A O     1 
ATOM   8103  C  CB    . ILE E  3 1040 ? 62.380  1.641   -1.067  1.00 59.92 ? 3017 ILE A CB    1 
ATOM   8104  C  CG1   . ILE E  3 1040 ? 63.371  2.794   -0.889  1.00 60.16 ? 3017 ILE A CG1   1 
ATOM   8105  C  CG2   . ILE E  3 1040 ? 61.081  1.960   -0.331  1.00 60.19 ? 3017 ILE A CG2   1 
ATOM   8106  C  CD1   . ILE E  3 1040 ? 63.017  4.040   -1.673  1.00 59.63 ? 3017 ILE A CD1   1 
ATOM   8107  N  N     . GLU E  3 1041 ? 61.506  -1.287  -1.574  1.00 61.65 ? 3018 GLU A N     1 
ATOM   8108  C  CA    . GLU E  3 1041 ? 60.432  -2.274  -1.612  1.00 62.34 ? 3018 GLU A CA    1 
ATOM   8109  C  C     . GLU E  3 1041 ? 60.830  -3.575  -0.941  1.00 62.81 ? 3018 GLU A C     1 
ATOM   8110  O  O     . GLU E  3 1041 ? 60.005  -4.218  -0.295  1.00 63.07 ? 3018 GLU A O     1 
ATOM   8111  C  CB    . GLU E  3 1041 ? 59.972  -2.523  -3.043  1.00 62.31 ? 3018 GLU A CB    1 
ATOM   8112  C  CG    . GLU E  3 1041 ? 59.253  -1.323  -3.638  1.00 63.86 ? 3018 GLU A CG    1 
ATOM   8113  C  CD    . GLU E  3 1041 ? 58.137  -1.708  -4.584  1.00 64.83 ? 3018 GLU A CD    1 
ATOM   8114  O  OE1   . GLU E  3 1041 ? 57.043  -1.111  -4.466  1.00 64.91 ? 3018 GLU A OE1   1 
ATOM   8115  O  OE2   . GLU E  3 1041 ? 58.345  -2.606  -5.434  1.00 65.40 ? 3018 GLU A OE2   1 
ATOM   8116  N  N     . LYS E  3 1042 ? 62.101  -3.942  -1.077  1.00 63.50 ? 3019 LYS A N     1 
ATOM   8117  C  CA    . LYS E  3 1042 ? 62.629  -5.137  -0.428  1.00 64.45 ? 3019 LYS A CA    1 
ATOM   8118  C  C     . LYS E  3 1042 ? 62.724  -4.941  1.081   1.00 64.20 ? 3019 LYS A C     1 
ATOM   8119  O  O     . LYS E  3 1042 ? 62.675  -5.904  1.840   1.00 64.31 ? 3019 LYS A O     1 
ATOM   8120  C  CB    . LYS E  3 1042 ? 63.998  -5.513  -1.001  1.00 64.58 ? 3019 LYS A CB    1 
ATOM   8121  C  CG    . LYS E  3 1042 ? 64.252  -7.018  -1.017  1.00 65.95 ? 3019 LYS A CG    1 
ATOM   8122  C  CD    . LYS E  3 1042 ? 65.709  -7.368  -1.294  1.00 65.91 ? 3019 LYS A CD    1 
ATOM   8123  C  CE    . LYS E  3 1042 ? 66.584  -7.149  -0.062  1.00 66.81 ? 3019 LYS A CE    1 
ATOM   8124  N  NZ    . LYS E  3 1042 ? 67.912  -7.805  -0.213  1.00 66.71 ? 3019 LYS A NZ    1 
ATOM   8125  N  N     . GLN E  3 1043 ? 62.853  -3.690  1.504   1.00 64.48 ? 3020 GLN A N     1 
ATOM   8126  C  CA    . GLN E  3 1043 ? 62.927  -3.358  2.919   1.00 65.11 ? 3020 GLN A CA    1 
ATOM   8127  C  C     . GLN E  3 1043 ? 61.568  -3.167  3.563   1.00 65.19 ? 3020 GLN A C     1 
ATOM   8128  O  O     . GLN E  3 1043 ? 61.355  -3.611  4.685   1.00 65.69 ? 3020 GLN A O     1 
ATOM   8129  C  CB    . GLN E  3 1043 ? 63.744  -2.090  3.132   1.00 65.76 ? 3020 GLN A CB    1 
ATOM   8130  C  CG    . GLN E  3 1043 ? 65.195  -2.329  3.459   1.00 67.51 ? 3020 GLN A CG    1 
ATOM   8131  C  CD    . GLN E  3 1043 ? 65.768  -1.231  4.336   1.00 69.21 ? 3020 GLN A CD    1 
ATOM   8132  O  OE1   . GLN E  3 1043 ? 65.604  -0.038  4.060   1.00 68.18 ? 3020 GLN A OE1   1 
ATOM   8133  N  NE2   . GLN E  3 1043 ? 66.446  -1.633  5.407   1.00 71.06 ? 3020 GLN A NE2   1 
ATOM   8134  N  N     . PHE E  3 1044 ? 60.658  -2.494  2.867   1.00 65.45 ? 3021 PHE A N     1 
ATOM   8135  C  CA    . PHE E  3 1044 ? 59.390  -2.088  3.475   1.00 65.80 ? 3021 PHE A CA    1 
ATOM   8136  C  C     . PHE E  3 1044 ? 58.157  -2.705  2.821   1.00 65.26 ? 3021 PHE A C     1 
ATOM   8137  O  O     . PHE E  3 1044 ? 57.040  -2.202  2.971   1.00 65.48 ? 3021 PHE A O     1 
ATOM   8138  C  CB    . PHE E  3 1044 ? 59.284  -0.558  3.544   1.00 66.36 ? 3021 PHE A CB    1 
ATOM   8139  C  CG    . PHE E  3 1044 ? 60.401  0.087   4.303   1.00 66.69 ? 3021 PHE A CG    1 
ATOM   8140  C  CD1   . PHE E  3 1044 ? 60.490  -0.057  5.686   1.00 67.86 ? 3021 PHE A CD1   1 
ATOM   8141  C  CD2   . PHE E  3 1044 ? 61.373  0.830   3.635   1.00 67.65 ? 3021 PHE A CD2   1 
ATOM   8142  C  CE1   . PHE E  3 1044 ? 61.533  0.534   6.403   1.00 69.81 ? 3021 PHE A CE1   1 
ATOM   8143  C  CE2   . PHE E  3 1044 ? 62.425  1.432   4.333   1.00 69.24 ? 3021 PHE A CE2   1 
ATOM   8144  C  CZ    . PHE E  3 1044 ? 62.509  1.283   5.723   1.00 69.68 ? 3021 PHE A CZ    1 
ATOM   8145  N  N     . GLY E  3 1045 ? 58.366  -3.802  2.106   1.00 64.70 ? 3022 GLY A N     1 
ATOM   8146  C  CA    . GLY E  3 1045 ? 57.260  -4.604  1.611   1.00 64.91 ? 3022 GLY A CA    1 
ATOM   8147  C  C     . GLY E  3 1045 ? 56.744  -4.266  0.225   1.00 64.62 ? 3022 GLY A C     1 
ATOM   8148  O  O     . GLY E  3 1045 ? 57.217  -3.326  -0.427  1.00 64.17 ? 3022 GLY A O     1 
ATOM   8149  N  N     . LYS E  3 1046 ? 55.747  -5.051  -0.188  1.00 64.26 ? 3023 LYS A N     1 
ATOM   8150  C  CA    . LYS E  3 1046 ? 55.145  -5.038  -1.525  1.00 63.06 ? 3023 LYS A CA    1 
ATOM   8151  C  C     . LYS E  3 1046 ? 55.127  -3.658  -2.189  1.00 61.09 ? 3023 LYS A C     1 
ATOM   8152  O  O     . LYS E  3 1046 ? 56.046  -3.322  -2.919  1.00 61.64 ? 3023 LYS A O     1 
ATOM   8153  C  CB    . LYS E  3 1046 ? 53.728  -5.647  -1.485  1.00 63.87 ? 3023 LYS A CB    1 
ATOM   8154  C  CG    . LYS E  3 1046 ? 53.586  -6.933  -0.644  1.00 64.11 ? 3023 LYS A CG    1 
ATOM   8155  C  CD    . LYS E  3 1046 ? 53.759  -8.208  -1.472  1.00 64.70 ? 3023 LYS A CD    1 
ATOM   8156  C  CE    . LYS E  3 1046 ? 52.437  -8.677  -2.079  1.00 64.12 ? 3023 LYS A CE    1 
ATOM   8157  N  NZ    . LYS E  3 1046 ? 52.603  -9.935  -2.854  1.00 63.77 ? 3023 LYS A NZ    1 
ATOM   8158  N  N     . GLY E  3 1047 ? 54.095  -2.865  -1.933  1.00 58.53 ? 3024 GLY A N     1 
ATOM   8159  C  CA    . GLY E  3 1047 ? 53.942  -1.600  -2.631  1.00 57.34 ? 3024 GLY A CA    1 
ATOM   8160  C  C     . GLY E  3 1047 ? 54.175  -0.397  -1.741  1.00 57.19 ? 3024 GLY A C     1 
ATOM   8161  O  O     . GLY E  3 1047 ? 53.347  0.523   -1.696  1.00 57.00 ? 3024 GLY A O     1 
ATOM   8162  N  N     . SER E  3 1048 ? 55.306  -0.393  -1.037  1.00 56.40 ? 3025 SER A N     1 
ATOM   8163  C  CA    . SER E  3 1048 ? 55.627  0.693   -0.106  1.00 55.64 ? 3025 SER A CA    1 
ATOM   8164  C  C     . SER E  3 1048 ? 55.915  2.009   -0.820  1.00 55.22 ? 3025 SER A C     1 
ATOM   8165  O  O     . SER E  3 1048 ? 55.682  3.079   -0.261  1.00 55.82 ? 3025 SER A O     1 
ATOM   8166  C  CB    . SER E  3 1048 ? 56.789  0.307   0.801   1.00 55.17 ? 3025 SER A CB    1 
ATOM   8167  O  OG    . SER E  3 1048 ? 57.804  -0.332  0.051   1.00 56.28 ? 3025 SER A OG    1 
ATOM   8168  N  N     . ILE E  3 1049 ? 56.424  1.923   -2.049  1.00 54.43 ? 3026 ILE A N     1 
ATOM   8169  C  CA    . ILE E  3 1049 ? 56.584  3.096   -2.921  1.00 53.57 ? 3026 ILE A CA    1 
ATOM   8170  C  C     . ILE E  3 1049 ? 56.236  2.749   -4.365  1.00 53.22 ? 3026 ILE A C     1 
ATOM   8171  O  O     . ILE E  3 1049 ? 56.648  1.713   -4.868  1.00 53.45 ? 3026 ILE A O     1 
ATOM   8172  C  CB    . ILE E  3 1049 ? 58.012  3.713   -2.849  1.00 53.49 ? 3026 ILE A CB    1 
ATOM   8173  C  CG1   . ILE E  3 1049 ? 58.084  5.007   -3.664  1.00 52.34 ? 3026 ILE A CG1   1 
ATOM   8174  C  CG2   . ILE E  3 1049 ? 59.075  2.724   -3.327  1.00 52.57 ? 3026 ILE A CG2   1 
ATOM   8175  C  CD1   . ILE E  3 1049 ? 59.213  5.919   -3.277  1.00 51.97 ? 3026 ILE A CD1   1 
ATOM   8176  N  N     . MET E  3 1050 ? 55.457  3.609   -5.014  1.00 53.28 ? 3027 MET A N     1 
ATOM   8177  C  CA    . MET E  3 1050 ? 55.115  3.440   -6.425  1.00 53.94 ? 3027 MET A CA    1 
ATOM   8178  C  C     . MET E  3 1050 ? 54.704  4.745   -7.083  1.00 53.47 ? 3027 MET A C     1 
ATOM   8179  O  O     . MET E  3 1050 ? 54.563  5.764   -6.419  1.00 54.59 ? 3027 MET A O     1 
ATOM   8180  C  CB    . MET E  3 1050 ? 54.015  2.399   -6.612  1.00 54.46 ? 3027 MET A CB    1 
ATOM   8181  C  CG    . MET E  3 1050 ? 52.856  2.498   -5.649  1.00 55.06 ? 3027 MET A CG    1 
ATOM   8182  S  SD    . MET E  3 1050 ? 51.650  1.233   -6.068  1.00 57.00 ? 3027 MET A SD    1 
ATOM   8183  C  CE    . MET E  3 1050 ? 51.130  0.694   -4.423  1.00 57.29 ? 3027 MET A CE    1 
ATOM   8184  N  N     . ARG E  3 1051 ? 54.522  4.711   -8.397  1.00 52.99 ? 3028 ARG A N     1 
ATOM   8185  C  CA    . ARG E  3 1051 ? 54.071  5.885   -9.129  1.00 52.76 ? 3028 ARG A CA    1 
ATOM   8186  C  C     . ARG E  3 1051 ? 52.613  6.148   -8.821  1.00 51.37 ? 3028 ARG A C     1 
ATOM   8187  O  O     . ARG E  3 1051 ? 51.800  5.226   -8.829  1.00 52.16 ? 3028 ARG A O     1 
ATOM   8188  C  CB    . ARG E  3 1051 ? 54.271  5.695   -10.629 1.00 54.02 ? 3028 ARG A CB    1 
ATOM   8189  C  CG    . ARG E  3 1051 ? 55.662  6.060   -11.127 1.00 57.66 ? 3028 ARG A CG    1 
ATOM   8190  C  CD    . ARG E  3 1051 ? 56.631  4.891   -11.061 1.00 61.16 ? 3028 ARG A CD    1 
ATOM   8191  N  NE    . ARG E  3 1051 ? 57.573  4.933   -12.176 1.00 64.26 ? 3028 ARG A NE    1 
ATOM   8192  C  CZ    . ARG E  3 1051 ? 57.290  4.500   -13.407 1.00 67.12 ? 3028 ARG A CZ    1 
ATOM   8193  N  NH1   . ARG E  3 1051 ? 56.087  3.992   -13.683 1.00 67.65 ? 3028 ARG A NH1   1 
ATOM   8194  N  NH2   . ARG E  3 1051 ? 58.207  4.574   -14.370 1.00 67.88 ? 3028 ARG A NH2   1 
ATOM   8195  N  N     . LEU E  3 1052 ? 52.290  7.405   -8.544  1.00 49.96 ? 3029 LEU A N     1 
ATOM   8196  C  CA    . LEU E  3 1052 ? 50.952  7.783   -8.095  1.00 49.71 ? 3029 LEU A CA    1 
ATOM   8197  C  C     . LEU E  3 1052 ? 49.863  7.291   -9.043  1.00 50.09 ? 3029 LEU A C     1 
ATOM   8198  O  O     . LEU E  3 1052 ? 48.838  6.766   -8.609  1.00 49.92 ? 3029 LEU A O     1 
ATOM   8199  C  CB    . LEU E  3 1052 ? 50.855  9.299   -7.965  1.00 49.21 ? 3029 LEU A CB    1 
ATOM   8200  C  CG    . LEU E  3 1052 ? 50.068  9.949   -6.825  1.00 49.24 ? 3029 LEU A CG    1 
ATOM   8201  C  CD1   . LEU E  3 1052 ? 49.533  11.284  -7.290  1.00 49.79 ? 3029 LEU A CD1   1 
ATOM   8202  C  CD2   . LEU E  3 1052 ? 48.930  9.104   -6.309  1.00 48.81 ? 3029 LEU A CD2   1 
ATOM   8203  N  N     . GLY E  3 1053 ? 50.107  7.454   -10.339 1.00 50.80 ? 3030 GLY A N     1 
ATOM   8204  C  CA    . GLY E  3 1053 ? 49.109  7.180   -11.365 1.00 51.19 ? 3030 GLY A CA    1 
ATOM   8205  C  C     . GLY E  3 1053 ? 48.634  5.749   -11.408 1.00 51.77 ? 3030 GLY A C     1 
ATOM   8206  O  O     . GLY E  3 1053 ? 47.534  5.475   -11.891 1.00 52.44 ? 3030 GLY A O     1 
ATOM   8207  N  N     . GLU E  3 1054 ? 49.456  4.839   -10.897 1.00 51.69 ? 3031 GLU A N     1 
ATOM   8208  C  CA    . GLU E  3 1054 ? 49.136  3.428   -10.959 1.00 52.84 ? 3031 GLU A CA    1 
ATOM   8209  C  C     . GLU E  3 1054 ? 48.760  2.848   -9.606  1.00 52.38 ? 3031 GLU A C     1 
ATOM   8210  O  O     . GLU E  3 1054 ? 48.433  1.664   -9.504  1.00 53.61 ? 3031 GLU A O     1 
ATOM   8211  C  CB    . GLU E  3 1054 ? 50.270  2.637   -11.620 1.00 53.27 ? 3031 GLU A CB    1 
ATOM   8212  C  CG    . GLU E  3 1054 ? 51.641  2.852   -11.004 1.00 55.08 ? 3031 GLU A CG    1 
ATOM   8213  C  CD    . GLU E  3 1054 ? 52.785  2.403   -11.907 1.00 55.38 ? 3031 GLU A CD    1 
ATOM   8214  O  OE1   . GLU E  3 1054 ? 52.590  2.295   -13.139 1.00 56.32 ? 3031 GLU A OE1   1 
ATOM   8215  O  OE2   . GLU E  3 1054 ? 53.892  2.172   -11.371 1.00 58.43 ? 3031 GLU A OE2   1 
ATOM   8216  N  N     . ASP E  3 1055 ? 48.785  3.678   -8.569  1.00 52.01 ? 3032 ASP A N     1 
ATOM   8217  C  CA    . ASP E  3 1055 ? 48.315  3.233   -7.258  1.00 51.55 ? 3032 ASP A CA    1 
ATOM   8218  C  C     . ASP E  3 1055 ? 46.789  3.239   -7.189  1.00 50.92 ? 3032 ASP A C     1 
ATOM   8219  O  O     . ASP E  3 1055 ? 46.163  4.304   -7.151  1.00 50.41 ? 3032 ASP A O     1 
ATOM   8220  C  CB    . ASP E  3 1055 ? 48.905  4.078   -6.135  1.00 51.34 ? 3032 ASP A CB    1 
ATOM   8221  C  CG    . ASP E  3 1055 ? 48.734  3.431   -4.771  1.00 52.50 ? 3032 ASP A CG    1 
ATOM   8222  O  OD1   . ASP E  3 1055 ? 47.730  2.712   -4.555  1.00 53.40 ? 3032 ASP A OD1   1 
ATOM   8223  O  OD2   . ASP E  3 1055 ? 49.613  3.641   -3.910  1.00 53.31 ? 3032 ASP A OD2   1 
ATOM   8224  N  N     . ARG E  3 1056 ? 46.208  2.041   -7.174  1.00 50.16 ? 3033 ARG A N     1 
ATOM   8225  C  CA    . ARG E  3 1056 ? 44.761  1.888   -7.160  1.00 49.63 ? 3033 ARG A CA    1 
ATOM   8226  C  C     . ARG E  3 1056 ? 44.148  2.276   -5.823  1.00 49.61 ? 3033 ARG A C     1 
ATOM   8227  O  O     . ARG E  3 1056 ? 43.084  2.888   -5.780  1.00 48.85 ? 3033 ARG A O     1 
ATOM   8228  C  CB    . ARG E  3 1056 ? 44.367  0.453   -7.518  1.00 49.47 ? 3033 ARG A CB    1 
ATOM   8229  C  CG    . ARG E  3 1056 ? 44.567  0.059   -8.980  1.00 48.09 ? 3033 ARG A CG    1 
ATOM   8230  C  CD    . ARG E  3 1056 ? 43.903  1.031   -9.942  1.00 45.17 ? 3033 ARG A CD    1 
ATOM   8231  N  NE    . ARG E  3 1056 ? 44.767  2.180   -10.169 1.00 44.93 ? 3033 ARG A NE    1 
ATOM   8232  C  CZ    . ARG E  3 1056 ? 44.364  3.351   -10.646 1.00 44.11 ? 3033 ARG A CZ    1 
ATOM   8233  N  NH1   . ARG E  3 1056 ? 43.087  3.544   -10.953 1.00 43.68 ? 3033 ARG A NH1   1 
ATOM   8234  N  NH2   . ARG E  3 1056 ? 45.245  4.331   -10.816 1.00 41.65 ? 3033 ARG A NH2   1 
ATOM   8235  N  N     . SER E  3 1057 ? 44.828  1.923   -4.738  1.00 50.30 ? 3034 SER A N     1 
ATOM   8236  C  CA    . SER E  3 1057 ? 44.312  2.157   -3.397  1.00 51.36 ? 3034 SER A CA    1 
ATOM   8237  C  C     . SER E  3 1057 ? 44.256  3.644   -3.062  1.00 51.87 ? 3034 SER A C     1 
ATOM   8238  O  O     . SER E  3 1057 ? 43.883  4.030   -1.953  1.00 53.40 ? 3034 SER A O     1 
ATOM   8239  C  CB    . SER E  3 1057 ? 45.164  1.415   -2.373  1.00 51.65 ? 3034 SER A CB    1 
ATOM   8240  O  OG    . SER E  3 1057 ? 46.485  1.930   -2.365  1.00 52.90 ? 3034 SER A OG    1 
ATOM   8241  N  N     . MET E  3 1058 ? 44.624  4.472   -4.030  1.00 51.68 ? 3035 MET A N     1 
ATOM   8242  C  CA    . MET E  3 1058 ? 44.651  5.911   -3.850  1.00 51.47 ? 3035 MET A CA    1 
ATOM   8243  C  C     . MET E  3 1058 ? 43.379  6.567   -4.414  1.00 50.96 ? 3035 MET A C     1 
ATOM   8244  O  O     . MET E  3 1058 ? 43.088  7.730   -4.138  1.00 50.90 ? 3035 MET A O     1 
ATOM   8245  C  CB    . MET E  3 1058 ? 45.892  6.475   -4.534  1.00 51.99 ? 3035 MET A CB    1 
ATOM   8246  C  CG    . MET E  3 1058 ? 46.505  7.661   -3.840  1.00 53.30 ? 3035 MET A CG    1 
ATOM   8247  S  SD    . MET E  3 1058 ? 47.604  7.159   -2.522  1.00 57.48 ? 3035 MET A SD    1 
ATOM   8248  C  CE    . MET E  3 1058 ? 49.100  6.721   -3.399  1.00 57.13 ? 3035 MET A CE    1 
ATOM   8249  N  N     . ASP E  3 1059 ? 42.624  5.815   -5.205  1.00 50.57 ? 3036 ASP A N     1 
ATOM   8250  C  CA    . ASP E  3 1059 ? 41.410  6.328   -5.832  1.00 51.22 ? 3036 ASP A CA    1 
ATOM   8251  C  C     . ASP E  3 1059 ? 40.328  6.582   -4.787  1.00 51.76 ? 3036 ASP A C     1 
ATOM   8252  O  O     . ASP E  3 1059 ? 40.120  5.771   -3.895  1.00 51.84 ? 3036 ASP A O     1 
ATOM   8253  C  CB    . ASP E  3 1059 ? 40.875  5.325   -6.862  1.00 51.09 ? 3036 ASP A CB    1 
ATOM   8254  C  CG    . ASP E  3 1059 ? 41.830  5.089   -8.016  1.00 50.22 ? 3036 ASP A CG    1 
ATOM   8255  O  OD1   . ASP E  3 1059 ? 42.509  6.053   -8.434  1.00 50.85 ? 3036 ASP A OD1   1 
ATOM   8256  O  OD2   . ASP E  3 1059 ? 41.883  3.940   -8.512  1.00 49.01 ? 3036 ASP A OD2   1 
ATOM   8257  N  N     . VAL E  3 1060 ? 39.613  7.689   -4.907  1.00 52.56 ? 3037 VAL A N     1 
ATOM   8258  C  CA    . VAL E  3 1060 ? 38.589  8.062   -3.930  1.00 53.47 ? 3037 VAL A CA    1 
ATOM   8259  C  C     . VAL E  3 1060 ? 37.234  7.429   -4.244  1.00 54.76 ? 3037 VAL A C     1 
ATOM   8260  O  O     . VAL E  3 1060 ? 36.707  7.590   -5.347  1.00 55.50 ? 3037 VAL A O     1 
ATOM   8261  C  CB    . VAL E  3 1060 ? 38.454  9.598   -3.838  1.00 53.18 ? 3037 VAL A CB    1 
ATOM   8262  C  CG1   . VAL E  3 1060 ? 37.265  9.991   -2.987  1.00 53.39 ? 3037 VAL A CG1   1 
ATOM   8263  C  CG2   . VAL E  3 1060 ? 39.729  10.208  -3.285  1.00 53.07 ? 3037 VAL A CG2   1 
ATOM   8264  N  N     . GLU E  3 1061 ? 36.679  6.717   -3.265  1.00 55.65 ? 3038 GLU A N     1 
ATOM   8265  C  CA    . GLU E  3 1061 ? 35.396  6.042   -3.412  1.00 56.99 ? 3038 GLU A CA    1 
ATOM   8266  C  C     . GLU E  3 1061 ? 34.444  6.604   -2.358  1.00 55.84 ? 3038 GLU A C     1 
ATOM   8267  O  O     . GLU E  3 1061 ? 34.855  6.814   -1.228  1.00 56.26 ? 3038 GLU A O     1 
ATOM   8268  C  CB    . GLU E  3 1061 ? 35.611  4.537   -3.234  1.00 59.15 ? 3038 GLU A CB    1 
ATOM   8269  C  CG    . GLU E  3 1061 ? 34.351  3.670   -3.275  1.00 66.55 ? 3038 GLU A CG    1 
ATOM   8270  C  CD    . GLU E  3 1061 ? 34.452  2.439   -2.354  1.00 72.25 ? 3038 GLU A CD    1 
ATOM   8271  O  OE1   . GLU E  3 1061 ? 35.513  1.765   -2.384  1.00 72.51 ? 3038 GLU A OE1   1 
ATOM   8272  O  OE2   . GLU E  3 1061 ? 33.473  2.152   -1.602  1.00 75.04 ? 3038 GLU A OE2   1 
ATOM   8273  N  N     . THR E  3 1062 ? 33.186  6.859   -2.718  1.00 55.17 ? 3039 THR A N     1 
ATOM   8274  C  CA    . THR E  3 1062 ? 32.247  7.518   -1.789  1.00 54.79 ? 3039 THR A CA    1 
ATOM   8275  C  C     . THR E  3 1062 ? 31.007  6.714   -1.358  1.00 54.56 ? 3039 THR A C     1 
ATOM   8276  O  O     . THR E  3 1062 ? 30.652  5.716   -1.970  1.00 55.02 ? 3039 THR A O     1 
ATOM   8277  C  CB    . THR E  3 1062 ? 31.784  8.911   -2.306  1.00 54.90 ? 3039 THR A CB    1 
ATOM   8278  O  OG1   . THR E  3 1062 ? 30.966  8.756   -3.469  1.00 55.72 ? 3039 THR A OG1   1 
ATOM   8279  C  CG2   . THR E  3 1062 ? 32.968  9.796   -2.639  1.00 54.95 ? 3039 THR A CG2   1 
ATOM   8280  N  N     . ILE E  3 1063 ? 30.369  7.178   -0.287  1.00 54.43 ? 3040 ILE A N     1 
ATOM   8281  C  CA    . ILE E  3 1063 ? 29.160  6.597   0.285   1.00 54.55 ? 3040 ILE A CA    1 
ATOM   8282  C  C     . ILE E  3 1063 ? 28.123  7.709   0.335   1.00 55.06 ? 3040 ILE A C     1 
ATOM   8283  O  O     . ILE E  3 1063 ? 28.457  8.845   0.679   1.00 55.68 ? 3040 ILE A O     1 
ATOM   8284  C  CB    . ILE E  3 1063 ? 29.423  6.087   1.741   1.00 54.73 ? 3040 ILE A CB    1 
ATOM   8285  C  CG1   . ILE E  3 1063 ? 30.376  4.908   1.738   1.00 55.47 ? 3040 ILE A CG1   1 
ATOM   8286  C  CG2   . ILE E  3 1063 ? 28.130  5.691   2.475   1.00 56.63 ? 3040 ILE A CG2   1 
ATOM   8287  C  CD1   . ILE E  3 1063 ? 29.970  3.787   0.782   1.00 58.86 ? 3040 ILE A CD1   1 
ATOM   8288  N  N     . SER E  3 1064 ? 26.870  7.393   0.006   1.00 55.05 ? 3041 SER A N     1 
ATOM   8289  C  CA    . SER E  3 1064 ? 25.787  8.367   0.126   1.00 55.24 ? 3041 SER A CA    1 
ATOM   8290  C  C     . SER E  3 1064 ? 25.601  8.797   1.572   1.00 55.71 ? 3041 SER A C     1 
ATOM   8291  O  O     . SER E  3 1064 ? 25.790  7.996   2.488   1.00 56.89 ? 3041 SER A O     1 
ATOM   8292  C  CB    . SER E  3 1064 ? 24.481  7.798   -0.409  1.00 55.74 ? 3041 SER A CB    1 
ATOM   8293  O  OG    . SER E  3 1064 ? 23.390  8.626   -0.038  1.00 57.20 ? 3041 SER A OG    1 
ATOM   8294  N  N     . THR E  3 1065 ? 25.235  10.058  1.774   1.00 55.57 ? 3042 THR A N     1 
ATOM   8295  C  CA    . THR E  3 1065 ? 25.010  10.577  3.118   1.00 55.47 ? 3042 THR A CA    1 
ATOM   8296  C  C     . THR E  3 1065 ? 23.571  10.373  3.544   1.00 56.13 ? 3042 THR A C     1 
ATOM   8297  O  O     . THR E  3 1065 ? 23.243  10.560  4.720   1.00 57.52 ? 3042 THR A O     1 
ATOM   8298  C  CB    . THR E  3 1065 ? 25.305  12.060  3.206   1.00 55.80 ? 3042 THR A CB    1 
ATOM   8299  O  OG1   . THR E  3 1065 ? 24.532  12.758  2.213   1.00 57.76 ? 3042 THR A OG1   1 
ATOM   8300  C  CG2   . THR E  3 1065 ? 26.792  12.318  2.991   1.00 57.17 ? 3042 THR A CG2   1 
ATOM   8301  N  N     . GLY E  3 1066 ? 22.716  9.993   2.594   1.00 55.58 ? 3043 GLY A N     1 
ATOM   8302  C  CA    . GLY E  3 1066 ? 21.283  9.873   2.846   1.00 55.73 ? 3043 GLY A CA    1 
ATOM   8303  C  C     . GLY E  3 1066 ? 20.530  11.133  2.456   1.00 55.53 ? 3043 GLY A C     1 
ATOM   8304  O  O     . GLY E  3 1066 ? 19.299  11.120  2.349   1.00 57.04 ? 3043 GLY A O     1 
ATOM   8305  N  N     . SER E  3 1067 ? 21.272  12.223  2.269   1.00 53.90 ? 3044 SER A N     1 
ATOM   8306  C  CA    . SER E  3 1067 ? 20.735  13.442  1.686   1.00 53.28 ? 3044 SER A CA    1 
ATOM   8307  C  C     . SER E  3 1067 ? 21.322  13.623  0.293   1.00 52.60 ? 3044 SER A C     1 
ATOM   8308  O  O     . SER E  3 1067 ? 22.550  13.579  0.116   1.00 52.42 ? 3044 SER A O     1 
ATOM   8309  C  CB    . SER E  3 1067 ? 21.051  14.660  2.557   1.00 54.01 ? 3044 SER A CB    1 
ATOM   8310  O  OG    . SER E  3 1067 ? 20.973  15.865  1.809   1.00 54.57 ? 3044 SER A OG    1 
ATOM   8311  N  N     . LEU E  3 1068 ? 20.440  13.823  -0.686  1.00 50.79 ? 3045 LEU A N     1 
ATOM   8312  C  CA    . LEU E  3 1068 ? 20.860  14.005  -2.066  1.00 49.76 ? 3045 LEU A CA    1 
ATOM   8313  C  C     . LEU E  3 1068 ? 21.590  15.327  -2.235  1.00 50.13 ? 3045 LEU A C     1 
ATOM   8314  O  O     . LEU E  3 1068 ? 22.661  15.373  -2.850  1.00 50.29 ? 3045 LEU A O     1 
ATOM   8315  C  CB    . LEU E  3 1068 ? 19.672  13.934  -3.025  1.00 48.45 ? 3045 LEU A CB    1 
ATOM   8316  C  CG    . LEU E  3 1068 ? 20.021  14.175  -4.496  1.00 46.85 ? 3045 LEU A CG    1 
ATOM   8317  C  CD1   . LEU E  3 1068 ? 20.835  13.027  -5.074  1.00 45.76 ? 3045 LEU A CD1   1 
ATOM   8318  C  CD2   . LEU E  3 1068 ? 18.778  14.436  -5.318  1.00 48.11 ? 3045 LEU A CD2   1 
ATOM   8319  N  N     . SER E  3 1069 ? 21.011  16.394  -1.681  1.00 50.14 ? 3046 SER A N     1 
ATOM   8320  C  CA    . SER E  3 1069 ? 21.569  17.736  -1.827  1.00 49.64 ? 3046 SER A CA    1 
ATOM   8321  C  C     . SER E  3 1069 ? 22.911  17.858  -1.107  1.00 49.45 ? 3046 SER A C     1 
ATOM   8322  O  O     . SER E  3 1069 ? 23.772  18.644  -1.526  1.00 50.39 ? 3046 SER A O     1 
ATOM   8323  C  CB    . SER E  3 1069 ? 20.583  18.817  -1.370  1.00 49.17 ? 3046 SER A CB    1 
ATOM   8324  O  OG    . SER E  3 1069 ? 20.377  18.756  0.024   1.00 50.16 ? 3046 SER A OG    1 
ATOM   8325  N  N     . LEU E  3 1070 ? 23.096  17.077  -0.044  1.00 48.07 ? 3047 LEU A N     1 
ATOM   8326  C  CA    . LEU E  3 1070 ? 24.396  17.008  0.614   1.00 48.21 ? 3047 LEU A CA    1 
ATOM   8327  C  C     . LEU E  3 1070 ? 25.423  16.311  -0.280  1.00 49.18 ? 3047 LEU A C     1 
ATOM   8328  O  O     . LEU E  3 1070 ? 26.538  16.795  -0.441  1.00 49.02 ? 3047 LEU A O     1 
ATOM   8329  C  CB    . LEU E  3 1070 ? 24.310  16.289  1.959   1.00 47.09 ? 3047 LEU A CB    1 
ATOM   8330  C  CG    . LEU E  3 1070 ? 25.198  16.789  3.106   1.00 45.51 ? 3047 LEU A CG    1 
ATOM   8331  C  CD1   . LEU E  3 1070 ? 25.377  15.712  4.139   1.00 43.83 ? 3047 LEU A CD1   1 
ATOM   8332  C  CD2   . LEU E  3 1070 ? 26.557  17.259  2.659   1.00 48.11 ? 3047 LEU A CD2   1 
ATOM   8333  N  N     . ASP E  3 1071 ? 25.041  15.175  -0.857  1.00 50.39 ? 3048 ASP A N     1 
ATOM   8334  C  CA    . ASP E  3 1071 ? 25.912  14.452  -1.774  1.00 50.51 ? 3048 ASP A CA    1 
ATOM   8335  C  C     . ASP E  3 1071 ? 26.344  15.363  -2.915  1.00 49.39 ? 3048 ASP A C     1 
ATOM   8336  O  O     . ASP E  3 1071 ? 27.473  15.263  -3.388  1.00 49.72 ? 3048 ASP A O     1 
ATOM   8337  C  CB    . ASP E  3 1071 ? 25.230  13.177  -2.296  1.00 52.21 ? 3048 ASP A CB    1 
ATOM   8338  C  CG    . ASP E  3 1071 ? 25.163  12.060  -1.238  1.00 55.10 ? 3048 ASP A CG    1 
ATOM   8339  O  OD1   . ASP E  3 1071 ? 25.904  12.125  -0.229  1.00 55.58 ? 3048 ASP A OD1   1 
ATOM   8340  O  OD2   . ASP E  3 1071 ? 24.375  11.105  -1.419  1.00 56.61 ? 3048 ASP A OD2   1 
ATOM   8341  N  N     . ILE E  3 1072 ? 25.455  16.264  -3.332  1.00 48.10 ? 3049 ILE A N     1 
ATOM   8342  C  CA    . ILE E  3 1072 ? 25.780  17.247  -4.358  1.00 47.31 ? 3049 ILE A CA    1 
ATOM   8343  C  C     . ILE E  3 1072 ? 26.736  18.299  -3.797  1.00 47.87 ? 3049 ILE A C     1 
ATOM   8344  O  O     . ILE E  3 1072 ? 27.766  18.596  -4.408  1.00 48.15 ? 3049 ILE A O     1 
ATOM   8345  C  CB    . ILE E  3 1072 ? 24.525  17.887  -4.951  1.00 46.36 ? 3049 ILE A CB    1 
ATOM   8346  C  CG1   . ILE E  3 1072 ? 23.707  16.829  -5.677  1.00 46.12 ? 3049 ILE A CG1   1 
ATOM   8347  C  CG2   . ILE E  3 1072 ? 24.890  18.986  -5.930  1.00 46.86 ? 3049 ILE A CG2   1 
ATOM   8348  C  CD1   . ILE E  3 1072 ? 22.234  17.153  -5.758  1.00 50.04 ? 3049 ILE A CD1   1 
ATOM   8349  N  N     . ALA E  3 1073 ? 26.405  18.843  -2.628  1.00 48.21 ? 3050 ALA A N     1 
ATOM   8350  C  CA    . ALA E  3 1073 ? 27.270  19.822  -1.953  1.00 47.59 ? 3050 ALA A CA    1 
ATOM   8351  C  C     . ALA E  3 1073 ? 28.677  19.288  -1.739  1.00 46.93 ? 3050 ALA A C     1 
ATOM   8352  O  O     . ALA E  3 1073 ? 29.645  20.030  -1.862  1.00 48.19 ? 3050 ALA A O     1 
ATOM   8353  C  CB    . ALA E  3 1073 ? 26.668  20.254  -0.620  1.00 47.45 ? 3050 ALA A CB    1 
ATOM   8354  N  N     . LEU E  3 1074 ? 28.780  18.000  -1.429  1.00 46.59 ? 3051 LEU A N     1 
ATOM   8355  C  CA    . LEU E  3 1074 ? 30.061  17.338  -1.186  1.00 45.85 ? 3051 LEU A CA    1 
ATOM   8356  C  C     . LEU E  3 1074 ? 30.909  17.200  -2.435  1.00 46.30 ? 3051 LEU A C     1 
ATOM   8357  O  O     . LEU E  3 1074 ? 32.085  16.834  -2.341  1.00 45.92 ? 3051 LEU A O     1 
ATOM   8358  C  CB    . LEU E  3 1074 ? 29.840  15.953  -0.605  1.00 45.91 ? 3051 LEU A CB    1 
ATOM   8359  C  CG    . LEU E  3 1074 ? 29.580  15.899  0.887   1.00 47.29 ? 3051 LEU A CG    1 
ATOM   8360  C  CD1   . LEU E  3 1074 ? 28.938  14.568  1.245   1.00 48.92 ? 3051 LEU A CD1   1 
ATOM   8361  C  CD2   . LEU E  3 1074 ? 30.882  16.109  1.642   1.00 47.24 ? 3051 LEU A CD2   1 
ATOM   8362  N  N     . GLY E  3 1075 ? 30.309  17.467  -3.597  1.00 46.51 ? 3052 GLY A N     1 
ATOM   8363  C  CA    . GLY E  3 1075 ? 31.038  17.486  -4.865  1.00 46.33 ? 3052 GLY A CA    1 
ATOM   8364  C  C     . GLY E  3 1075 ? 31.267  16.118  -5.475  1.00 46.16 ? 3052 GLY A C     1 
ATOM   8365  O  O     . GLY E  3 1075 ? 30.998  15.913  -6.655  1.00 46.39 ? 3052 GLY A O     1 
ATOM   8366  N  N     . ALA E  3 1076 ? 31.766  15.181  -4.672  1.00 46.25 ? 3053 ALA A N     1 
ATOM   8367  C  CA    . ALA E  3 1076 ? 32.077  13.833  -5.148  1.00 45.64 ? 3053 ALA A CA    1 
ATOM   8368  C  C     . ALA E  3 1076 ? 30.931  12.836  -4.966  1.00 45.08 ? 3053 ALA A C     1 
ATOM   8369  O  O     . ALA E  3 1076 ? 31.076  11.652  -5.276  1.00 44.92 ? 3053 ALA A O     1 
ATOM   8370  C  CB    . ALA E  3 1076 ? 33.350  13.319  -4.493  1.00 46.33 ? 3053 ALA A CB    1 
ATOM   8371  N  N     . GLY E  3 1077 ? 29.799  13.316  -4.463  1.00 44.79 ? 3054 GLY A N     1 
ATOM   8372  C  CA    . GLY E  3 1077 ? 28.594  12.495  -4.364  1.00 44.87 ? 3054 GLY A CA    1 
ATOM   8373  C  C     . GLY E  3 1077 ? 28.438  11.725  -3.069  1.00 44.74 ? 3054 GLY A C     1 
ATOM   8374  O  O     . GLY E  3 1077 ? 27.572  10.855  -2.966  1.00 44.35 ? 3054 GLY A O     1 
ATOM   8375  N  N     . GLY E  3 1078 ? 29.275  12.034  -2.085  1.00 44.57 ? 3055 GLY A N     1 
ATOM   8376  C  CA    . GLY E  3 1078 ? 29.183  11.391  -0.782  1.00 44.91 ? 3055 GLY A CA    1 
ATOM   8377  C  C     . GLY E  3 1078 ? 30.458  11.490  0.025   1.00 44.74 ? 3055 GLY A C     1 
ATOM   8378  O  O     . GLY E  3 1078 ? 31.415  12.107  -0.408  1.00 45.35 ? 3055 GLY A O     1 
ATOM   8379  N  N     . LEU E  3 1079 ? 30.463  10.879  1.203   1.00 44.33 ? 3056 LEU A N     1 
ATOM   8380  C  CA    . LEU E  3 1079 ? 31.644  10.855  2.060   1.00 44.23 ? 3056 LEU A CA    1 
ATOM   8381  C  C     . LEU E  3 1079 ? 32.687  9.852   1.548   1.00 44.24 ? 3056 LEU A C     1 
ATOM   8382  O  O     . LEU E  3 1079 ? 32.329  8.801   1.031   1.00 44.31 ? 3056 LEU A O     1 
ATOM   8383  C  CB    . LEU E  3 1079 ? 31.230  10.527  3.501   1.00 44.17 ? 3056 LEU A CB    1 
ATOM   8384  C  CG    . LEU E  3 1079 ? 30.263  11.533  4.136   1.00 42.68 ? 3056 LEU A CG    1 
ATOM   8385  C  CD1   . LEU E  3 1079 ? 29.694  11.016  5.433   1.00 40.25 ? 3056 LEU A CD1   1 
ATOM   8386  C  CD2   . LEU E  3 1079 ? 30.946  12.856  4.359   1.00 41.63 ? 3056 LEU A CD2   1 
ATOM   8387  N  N     . PRO E  3 1080 ? 33.984  10.169  1.691   1.00 44.67 ? 3057 PRO A N     1 
ATOM   8388  C  CA    . PRO E  3 1080 ? 35.026  9.296   1.128   1.00 45.08 ? 3057 PRO A CA    1 
ATOM   8389  C  C     . PRO E  3 1080 ? 35.451  8.143   2.037   1.00 45.12 ? 3057 PRO A C     1 
ATOM   8390  O  O     . PRO E  3 1080 ? 35.617  8.325   3.235   1.00 45.87 ? 3057 PRO A O     1 
ATOM   8391  C  CB    . PRO E  3 1080 ? 36.197  10.255  0.892   1.00 44.93 ? 3057 PRO A CB    1 
ATOM   8392  C  CG    . PRO E  3 1080 ? 35.989  11.384  1.871   1.00 45.66 ? 3057 PRO A CG    1 
ATOM   8393  C  CD    . PRO E  3 1080 ? 34.555  11.350  2.363   1.00 44.78 ? 3057 PRO A CD    1 
ATOM   8394  N  N     . MET E  3 1081 ? 35.621  6.964   1.452   1.00 45.75 ? 3058 MET A N     1 
ATOM   8395  C  CA    . MET E  3 1081 ? 36.018  5.759   2.182   1.00 46.31 ? 3058 MET A CA    1 
ATOM   8396  C  C     . MET E  3 1081 ? 37.485  5.806   2.572   1.00 45.77 ? 3058 MET A C     1 
ATOM   8397  O  O     . MET E  3 1081 ? 38.318  6.310   1.823   1.00 45.96 ? 3058 MET A O     1 
ATOM   8398  C  CB    . MET E  3 1081 ? 35.751  4.514   1.327   1.00 47.39 ? 3058 MET A CB    1 
ATOM   8399  C  CG    . MET E  3 1081 ? 34.277  4.281   1.030   1.00 50.15 ? 3058 MET A CG    1 
ATOM   8400  S  SD    . MET E  3 1081 ? 33.378  3.939   2.567   1.00 55.01 ? 3058 MET A SD    1 
ATOM   8401  C  CE    . MET E  3 1081 ? 33.651  2.160   2.687   1.00 57.14 ? 3058 MET A CE    1 
ATOM   8402  N  N     . GLY E  3 1082 ? 37.802  5.281   3.747   1.00 45.37 ? 3059 GLY A N     1 
ATOM   8403  C  CA    . GLY E  3 1082 ? 39.190  5.264   4.207   1.00 45.62 ? 3059 GLY A CA    1 
ATOM   8404  C  C     . GLY E  3 1082 ? 39.676  6.598   4.755   1.00 44.90 ? 3059 GLY A C     1 
ATOM   8405  O  O     . GLY E  3 1082 ? 40.866  6.787   5.037   1.00 45.43 ? 3059 GLY A O     1 
ATOM   8406  N  N     . ARG E  3 1083 ? 38.745  7.524   4.922   1.00 43.72 ? 3060 ARG A N     1 
ATOM   8407  C  CA    . ARG E  3 1083 ? 39.059  8.858   5.392   1.00 43.19 ? 3060 ARG A CA    1 
ATOM   8408  C  C     . ARG E  3 1083 ? 38.369  9.133   6.731   1.00 43.86 ? 3060 ARG A C     1 
ATOM   8409  O  O     . ARG E  3 1083 ? 37.487  8.386   7.158   1.00 44.08 ? 3060 ARG A O     1 
ATOM   8410  C  CB    . ARG E  3 1083 ? 38.630  9.905   4.356   1.00 42.63 ? 3060 ARG A CB    1 
ATOM   8411  C  CG    . ARG E  3 1083 ? 39.141  9.681   2.932   1.00 42.96 ? 3060 ARG A CG    1 
ATOM   8412  C  CD    . ARG E  3 1083 ? 40.656  9.657   2.848   1.00 42.40 ? 3060 ARG A CD    1 
ATOM   8413  N  NE    . ARG E  3 1083 ? 41.146  9.900   1.495   1.00 42.44 ? 3060 ARG A NE    1 
ATOM   8414  C  CZ    . ARG E  3 1083 ? 41.407  11.106  1.002   1.00 45.35 ? 3060 ARG A CZ    1 
ATOM   8415  N  NH1   . ARG E  3 1083 ? 41.214  12.177  1.763   1.00 47.48 ? 3060 ARG A NH1   1 
ATOM   8416  N  NH2   . ARG E  3 1083 ? 41.861  11.255  -0.246  1.00 44.80 ? 3060 ARG A NH2   1 
ATOM   8417  N  N     . ILE E  3 1084 ? 38.792  10.208  7.395   1.00 44.26 ? 3061 ILE A N     1 
ATOM   8418  C  CA    . ILE E  3 1084 ? 38.141  10.689  8.607   1.00 42.77 ? 3061 ILE A CA    1 
ATOM   8419  C  C     . ILE E  3 1084 ? 37.246  11.886  8.256   1.00 43.87 ? 3061 ILE A C     1 
ATOM   8420  O  O     . ILE E  3 1084 ? 37.627  12.747  7.461   1.00 45.49 ? 3061 ILE A O     1 
ATOM   8421  C  CB    . ILE E  3 1084 ? 39.167  11.106  9.652   1.00 41.25 ? 3061 ILE A CB    1 
ATOM   8422  C  CG1   . ILE E  3 1084 ? 40.043  9.920   10.031  1.00 38.49 ? 3061 ILE A CG1   1 
ATOM   8423  C  CG2   . ILE E  3 1084 ? 38.468  11.672  10.880  1.00 41.69 ? 3061 ILE A CG2   1 
ATOM   8424  C  CD1   . ILE E  3 1084 ? 41.370  10.309  10.643  1.00 39.30 ? 3061 ILE A CD1   1 
ATOM   8425  N  N     . VAL E  3 1085 ? 36.057  11.928  8.841   1.00 43.41 ? 3062 VAL A N     1 
ATOM   8426  C  CA    . VAL E  3 1085 ? 35.094  12.980  8.591   1.00 43.64 ? 3062 VAL A CA    1 
ATOM   8427  C  C     . VAL E  3 1085 ? 34.578  13.469  9.942   1.00 45.60 ? 3062 VAL A C     1 
ATOM   8428  O  O     . VAL E  3 1085 ? 34.389  12.674  10.873  1.00 45.52 ? 3062 VAL A O     1 
ATOM   8429  C  CB    . VAL E  3 1085 ? 33.920  12.445  7.742   1.00 44.00 ? 3062 VAL A CB    1 
ATOM   8430  C  CG1   . VAL E  3 1085 ? 32.731  13.391  7.752   1.00 44.12 ? 3062 VAL A CG1   1 
ATOM   8431  C  CG2   . VAL E  3 1085 ? 34.366  12.190  6.335   1.00 45.36 ? 3062 VAL A CG2   1 
ATOM   8432  N  N     . GLU E  3 1086 ? 34.354  14.778  10.057  1.00 46.96 ? 3063 GLU A N     1 
ATOM   8433  C  CA    . GLU E  3 1086 ? 33.775  15.358  11.272  1.00 47.47 ? 3063 GLU A CA    1 
ATOM   8434  C  C     . GLU E  3 1086 ? 32.478  16.104  10.980  1.00 47.13 ? 3063 GLU A C     1 
ATOM   8435  O  O     . GLU E  3 1086 ? 32.410  16.908  10.044  1.00 48.15 ? 3063 GLU A O     1 
ATOM   8436  C  CB    . GLU E  3 1086 ? 34.781  16.289  11.953  1.00 47.25 ? 3063 GLU A CB    1 
ATOM   8437  C  CG    . GLU E  3 1086 ? 34.277  16.951  13.247  1.00 49.84 ? 3063 GLU A CG    1 
ATOM   8438  C  CD    . GLU E  3 1086 ? 35.248  18.011  13.795  1.00 50.47 ? 3063 GLU A CD    1 
ATOM   8439  O  OE1   . GLU E  3 1086 ? 36.091  18.505  13.015  1.00 52.63 ? 3063 GLU A OE1   1 
ATOM   8440  O  OE2   . GLU E  3 1086 ? 35.183  18.349  15.004  1.00 51.11 ? 3063 GLU A OE2   1 
ATOM   8441  N  N     . ILE E  3 1087 ? 31.450  15.827  11.779  1.00 46.19 ? 3064 ILE A N     1 
ATOM   8442  C  CA    . ILE E  3 1087 ? 30.209  16.592  11.729  1.00 45.45 ? 3064 ILE A CA    1 
ATOM   8443  C  C     . ILE E  3 1087 ? 30.047  17.278  13.063  1.00 45.06 ? 3064 ILE A C     1 
ATOM   8444  O  O     . ILE E  3 1087 ? 30.077  16.621  14.103  1.00 46.73 ? 3064 ILE A O     1 
ATOM   8445  C  CB    . ILE E  3 1087 ? 28.983  15.693  11.489  1.00 44.86 ? 3064 ILE A CB    1 
ATOM   8446  C  CG1   . ILE E  3 1087 ? 29.168  14.871  10.222  1.00 46.14 ? 3064 ILE A CG1   1 
ATOM   8447  C  CG2   . ILE E  3 1087 ? 27.717  16.531  11.366  1.00 44.73 ? 3064 ILE A CG2   1 
ATOM   8448  C  CD1   . ILE E  3 1087 ? 28.305  13.642  10.170  1.00 49.26 ? 3064 ILE A CD1   1 
ATOM   8449  N  N     . TYR E  3 1088 ? 29.889  18.594  13.042  1.00 43.84 ? 3065 TYR A N     1 
ATOM   8450  C  CA    . TYR E  3 1088 ? 29.616  19.332  14.270  1.00 43.35 ? 3065 TYR A CA    1 
ATOM   8451  C  C     . TYR E  3 1088 ? 28.405  20.252  14.103  1.00 42.67 ? 3065 TYR A C     1 
ATOM   8452  O  O     . TYR E  3 1088 ? 27.989  20.549  12.971  1.00 43.19 ? 3065 TYR A O     1 
ATOM   8453  C  CB    . TYR E  3 1088 ? 30.857  20.107  14.732  1.00 43.72 ? 3065 TYR A CB    1 
ATOM   8454  C  CG    . TYR E  3 1088 ? 31.295  21.222  13.802  1.00 44.76 ? 3065 TYR A CG    1 
ATOM   8455  C  CD1   . TYR E  3 1088 ? 30.612  22.440  13.774  1.00 44.88 ? 3065 TYR A CD1   1 
ATOM   8456  C  CD2   . TYR E  3 1088 ? 32.405  21.069  12.967  1.00 45.13 ? 3065 TYR A CD2   1 
ATOM   8457  C  CE1   . TYR E  3 1088 ? 31.010  23.476  12.935  1.00 45.94 ? 3065 TYR A CE1   1 
ATOM   8458  C  CE2   . TYR E  3 1088 ? 32.822  22.109  12.118  1.00 46.08 ? 3065 TYR A CE2   1 
ATOM   8459  C  CZ    . TYR E  3 1088 ? 32.117  23.312  12.111  1.00 46.28 ? 3065 TYR A CZ    1 
ATOM   8460  O  OH    . TYR E  3 1088 ? 32.505  24.349  11.284  1.00 44.95 ? 3065 TYR A OH    1 
ATOM   8461  N  N     . GLY E  3 1089 ? 27.851  20.701  15.226  1.00 40.59 ? 3066 GLY A N     1 
ATOM   8462  C  CA    . GLY E  3 1089 ? 26.689  21.574  15.219  1.00 39.30 ? 3066 GLY A CA    1 
ATOM   8463  C  C     . GLY E  3 1089 ? 26.109  21.691  16.612  1.00 39.95 ? 3066 GLY A C     1 
ATOM   8464  O  O     . GLY E  3 1089 ? 26.558  20.996  17.524  1.00 40.02 ? 3066 GLY A O     1 
ATOM   8465  N  N     . PRO E  3 1090 ? 25.102  22.568  16.790  1.00 40.34 ? 3067 PRO A N     1 
ATOM   8466  C  CA    . PRO E  3 1090 ? 24.414  22.774  18.063  1.00 41.41 ? 3067 PRO A CA    1 
ATOM   8467  C  C     . PRO E  3 1090 ? 23.588  21.558  18.475  1.00 42.08 ? 3067 PRO A C     1 
ATOM   8468  O  O     . PRO E  3 1090 ? 23.420  20.646  17.677  1.00 42.66 ? 3067 PRO A O     1 
ATOM   8469  C  CB    . PRO E  3 1090 ? 23.474  23.941  17.765  1.00 42.17 ? 3067 PRO A CB    1 
ATOM   8470  C  CG    . PRO E  3 1090 ? 23.949  24.529  16.502  1.00 41.01 ? 3067 PRO A CG    1 
ATOM   8471  C  CD    . PRO E  3 1090 ? 24.552  23.429  15.737  1.00 40.50 ? 3067 PRO A CD    1 
ATOM   8472  N  N     . GLU E  3 1091 ? 23.073  21.546  19.702  1.00 42.58 ? 3068 GLU A N     1 
ATOM   8473  C  CA    . GLU E  3 1091 ? 22.273  20.412  20.175  1.00 45.02 ? 3068 GLU A CA    1 
ATOM   8474  C  C     . GLU E  3 1091 ? 21.029  20.188  19.345  1.00 45.15 ? 3068 GLU A C     1 
ATOM   8475  O  O     . GLU E  3 1091 ? 20.415  21.133  18.868  1.00 45.63 ? 3068 GLU A O     1 
ATOM   8476  C  CB    . GLU E  3 1091 ? 21.893  20.532  21.654  1.00 46.00 ? 3068 GLU A CB    1 
ATOM   8477  C  CG    . GLU E  3 1091 ? 22.080  21.903  22.243  1.00 52.03 ? 3068 GLU A CG    1 
ATOM   8478  C  CD    . GLU E  3 1091 ? 21.135  22.938  21.671  1.00 56.13 ? 3068 GLU A CD    1 
ATOM   8479  O  OE1   . GLU E  3 1091 ? 21.622  23.829  20.933  1.00 57.08 ? 3068 GLU A OE1   1 
ATOM   8480  O  OE2   . GLU E  3 1091 ? 19.916  22.859  21.965  1.00 57.44 ? 3068 GLU A OE2   1 
ATOM   8481  N  N     . SER E  3 1092 ? 20.685  18.920  19.165  1.00 45.56 ? 3069 SER A N     1 
ATOM   8482  C  CA    . SER E  3 1092 ? 19.524  18.518  18.391  1.00 46.15 ? 3069 SER A CA    1 
ATOM   8483  C  C     . SER E  3 1092 ? 19.514  19.083  16.970  1.00 45.63 ? 3069 SER A C     1 
ATOM   8484  O  O     . SER E  3 1092 ? 18.452  19.355  16.404  1.00 46.27 ? 3069 SER A O     1 
ATOM   8485  C  CB    . SER E  3 1092 ? 18.233  18.865  19.142  1.00 46.69 ? 3069 SER A CB    1 
ATOM   8486  O  OG    . SER E  3 1092 ? 17.887  17.830  20.055  1.00 50.76 ? 3069 SER A OG    1 
ATOM   8487  N  N     . SER E  3 1093 ? 20.693  19.253  16.388  1.00 44.85 ? 3070 SER A N     1 
ATOM   8488  C  CA    . SER E  3 1093 ? 20.782  19.809  15.044  1.00 45.06 ? 3070 SER A CA    1 
ATOM   8489  C  C     . SER E  3 1093 ? 20.627  18.730  13.984  1.00 45.03 ? 3070 SER A C     1 
ATOM   8490  O  O     . SER E  3 1093 ? 20.256  19.024  12.839  1.00 45.22 ? 3070 SER A O     1 
ATOM   8491  C  CB    . SER E  3 1093 ? 22.090  20.572  14.848  1.00 45.22 ? 3070 SER A CB    1 
ATOM   8492  O  OG    . SER E  3 1093 ? 23.200  19.753  15.164  1.00 48.49 ? 3070 SER A OG    1 
ATOM   8493  N  N     . GLY E  3 1094 ? 20.902  17.485  14.371  1.00 44.80 ? 3071 GLY A N     1 
ATOM   8494  C  CA    . GLY E  3 1094 ? 20.723  16.348  13.477  1.00 43.69 ? 3071 GLY A CA    1 
ATOM   8495  C  C     . GLY E  3 1094 ? 21.978  15.547  13.237  1.00 42.54 ? 3071 GLY A C     1 
ATOM   8496  O  O     . GLY E  3 1094 ? 22.042  14.769  12.289  1.00 41.53 ? 3071 GLY A O     1 
ATOM   8497  N  N     . LYS E  3 1095 ? 22.970  15.728  14.107  1.00 42.54 ? 3072 LYS A N     1 
ATOM   8498  C  CA    . LYS E  3 1095 ? 24.258  15.056  13.956  1.00 42.46 ? 3072 LYS A CA    1 
ATOM   8499  C  C     . LYS E  3 1095 ? 24.105  13.531  13.982  1.00 43.99 ? 3072 LYS A C     1 
ATOM   8500  O  O     . LYS E  3 1095 ? 24.507  12.844  13.030  1.00 44.81 ? 3072 LYS A O     1 
ATOM   8501  C  CB    . LYS E  3 1095 ? 25.263  15.542  14.996  1.00 41.90 ? 3072 LYS A CB    1 
ATOM   8502  C  CG    . LYS E  3 1095 ? 25.465  17.063  15.007  1.00 41.87 ? 3072 LYS A CG    1 
ATOM   8503  C  CD    . LYS E  3 1095 ? 26.414  17.536  16.119  1.00 40.88 ? 3072 LYS A CD    1 
ATOM   8504  C  CE    . LYS E  3 1095 ? 25.826  17.347  17.522  1.00 40.93 ? 3072 LYS A CE    1 
ATOM   8505  N  NZ    . LYS E  3 1095 ? 24.596  18.149  17.786  1.00 37.91 ? 3072 LYS A NZ    1 
ATOM   8506  N  N     . THR E  3 1096 ? 23.503  12.996  15.040  1.00 44.48 ? 3073 THR A N     1 
ATOM   8507  C  CA    . THR E  3 1096 ? 23.270  11.549  15.119  1.00 44.75 ? 3073 THR A CA    1 
ATOM   8508  C  C     . THR E  3 1096 ? 22.382  11.076  13.979  1.00 44.81 ? 3073 THR A C     1 
ATOM   8509  O  O     . THR E  3 1096 ? 22.726  10.116  13.288  1.00 44.37 ? 3073 THR A O     1 
ATOM   8510  C  CB    . THR E  3 1096 ? 22.600  11.142  16.432  1.00 45.40 ? 3073 THR A CB    1 
ATOM   8511  O  OG1   . THR E  3 1096 ? 23.277  11.778  17.519  1.00 44.59 ? 3073 THR A OG1   1 
ATOM   8512  C  CG2   . THR E  3 1096 ? 22.639  9.627   16.600  1.00 43.86 ? 3073 THR A CG2   1 
ATOM   8513  N  N     . THR E  3 1097 ? 21.246  11.755  13.794  1.00 44.33 ? 3074 THR A N     1 
ATOM   8514  C  CA    . THR E  3 1097 ? 20.299  11.388  12.753  1.00 44.42 ? 3074 THR A CA    1 
ATOM   8515  C  C     . THR E  3 1097 ? 21.006  11.211  11.418  1.00 45.10 ? 3074 THR A C     1 
ATOM   8516  O  O     . THR E  3 1097 ? 20.912  10.159  10.802  1.00 44.99 ? 3074 THR A O     1 
ATOM   8517  C  CB    . THR E  3 1097 ? 19.140  12.392  12.642  1.00 43.91 ? 3074 THR A CB    1 
ATOM   8518  O  OG1   . THR E  3 1097 ? 18.283  12.266  13.790  1.00 43.10 ? 3074 THR A OG1   1 
ATOM   8519  C  CG2   . THR E  3 1097 ? 18.326  12.127  11.379  1.00 44.56 ? 3074 THR A CG2   1 
ATOM   8520  N  N     . LEU E  3 1098 ? 21.747  12.229  11.002  1.00 47.11 ? 3075 LEU A N     1 
ATOM   8521  C  CA    . LEU E  3 1098 ? 22.462  12.185  9.731   1.00 48.73 ? 3075 LEU A CA    1 
ATOM   8522  C  C     . LEU E  3 1098 ? 23.403  10.988  9.696   1.00 49.34 ? 3075 LEU A C     1 
ATOM   8523  O  O     . LEU E  3 1098 ? 23.374  10.197  8.755   1.00 49.74 ? 3075 LEU A O     1 
ATOM   8524  C  CB    . LEU E  3 1098 ? 23.229  13.484  9.501   1.00 49.73 ? 3075 LEU A CB    1 
ATOM   8525  C  CG    . LEU E  3 1098 ? 23.798  13.682  8.098   1.00 51.70 ? 3075 LEU A CG    1 
ATOM   8526  C  CD1   . LEU E  3 1098 ? 23.457  15.064  7.611   1.00 54.61 ? 3075 LEU A CD1   1 
ATOM   8527  C  CD2   . LEU E  3 1098 ? 25.294  13.490  8.096   1.00 51.46 ? 3075 LEU A CD2   1 
ATOM   8528  N  N     . THR E  3 1099 ? 24.225  10.871  10.735  1.00 49.44 ? 3076 THR A N     1 
ATOM   8529  C  CA    . THR E  3 1099 ? 25.095  9.724   10.946  1.00 49.13 ? 3076 THR A CA    1 
ATOM   8530  C  C     . THR E  3 1099 ? 24.385  8.391   10.696  1.00 48.69 ? 3076 THR A C     1 
ATOM   8531  O  O     . THR E  3 1099 ? 24.861  7.572   9.906   1.00 50.35 ? 3076 THR A O     1 
ATOM   8532  C  CB    . THR E  3 1099 ? 25.679  9.790   12.368  1.00 49.32 ? 3076 THR A CB    1 
ATOM   8533  O  OG1   . THR E  3 1099 ? 26.990  10.338  12.299  1.00 52.11 ? 3076 THR A OG1   1 
ATOM   8534  C  CG2   . THR E  3 1099 ? 25.770  8.434   13.008  1.00 50.41 ? 3076 THR A CG2   1 
ATOM   8535  N  N     . LEU E  3 1100 ? 23.244  8.187   11.354  1.00 47.34 ? 3077 LEU A N     1 
ATOM   8536  C  CA    . LEU E  3 1100 ? 22.484  6.942   11.229  1.00 46.16 ? 3077 LEU A CA    1 
ATOM   8537  C  C     . LEU E  3 1100 ? 21.979  6.731   9.805   1.00 46.28 ? 3077 LEU A C     1 
ATOM   8538  O  O     . LEU E  3 1100 ? 21.948  5.603   9.319   1.00 47.66 ? 3077 LEU A O     1 
ATOM   8539  C  CB    . LEU E  3 1100 ? 21.310  6.919   12.211  1.00 44.99 ? 3077 LEU A CB    1 
ATOM   8540  C  CG    . LEU E  3 1100 ? 21.658  6.922   13.699  1.00 43.88 ? 3077 LEU A CG    1 
ATOM   8541  C  CD1   . LEU E  3 1100 ? 20.435  7.249   14.526  1.00 44.24 ? 3077 LEU A CD1   1 
ATOM   8542  C  CD2   . LEU E  3 1100 ? 22.268  5.608   14.134  1.00 41.61 ? 3077 LEU A CD2   1 
ATOM   8543  N  N     . GLN E  3 1101 ? 21.596  7.818   9.140   1.00 45.07 ? 3078 GLN A N     1 
ATOM   8544  C  CA    . GLN E  3 1101 ? 21.157  7.759   7.756   1.00 44.47 ? 3078 GLN A CA    1 
ATOM   8545  C  C     . GLN E  3 1101 ? 22.251  7.241   6.837   1.00 44.55 ? 3078 GLN A C     1 
ATOM   8546  O  O     . GLN E  3 1101 ? 21.954  6.441   5.939   1.00 45.94 ? 3078 GLN A O     1 
ATOM   8547  C  CB    . GLN E  3 1101 ? 20.662  9.113   7.264   1.00 45.39 ? 3078 GLN A CB    1 
ATOM   8548  C  CG    . GLN E  3 1101 ? 19.442  9.656   7.992   1.00 49.08 ? 3078 GLN A CG    1 
ATOM   8549  C  CD    . GLN E  3 1101 ? 18.146  9.002   7.566   1.00 52.10 ? 3078 GLN A CD    1 
ATOM   8550  O  OE1   . GLN E  3 1101 ? 17.320  9.625   6.901   1.00 53.67 ? 3078 GLN A OE1   1 
ATOM   8551  N  NE2   . GLN E  3 1101 ? 17.950  7.746   7.962   1.00 53.90 ? 3078 GLN A NE2   1 
ATOM   8552  N  N     . VAL E  3 1102 ? 23.502  7.677   7.049   1.00 43.06 ? 3079 VAL A N     1 
ATOM   8553  C  CA    . VAL E  3 1102 ? 24.615  7.171   6.233   1.00 41.78 ? 3079 VAL A CA    1 
ATOM   8554  C  C     . VAL E  3 1102 ? 24.842  5.691   6.512   1.00 42.71 ? 3079 VAL A C     1 
ATOM   8555  O  O     . VAL E  3 1102 ? 25.028  4.904   5.569   1.00 45.48 ? 3079 VAL A O     1 
ATOM   8556  C  CB    . VAL E  3 1102 ? 25.952  8.019   6.284   1.00 40.50 ? 3079 VAL A CB    1 
ATOM   8557  C  CG1   . VAL E  3 1102 ? 25.756  9.341   7.000   1.00 37.77 ? 3079 VAL A CG1   1 
ATOM   8558  C  CG2   . VAL E  3 1102 ? 27.124  7.234   6.859   1.00 37.16 ? 3079 VAL A CG2   1 
ATOM   8559  N  N     . ILE E  3 1103 ? 24.789  5.309   7.784   1.00 41.53 ? 3080 ILE A N     1 
ATOM   8560  C  CA    . ILE E  3 1103 ? 24.849  3.895   8.148   1.00 42.34 ? 3080 ILE A CA    1 
ATOM   8561  C  C     . ILE E  3 1103 ? 23.758  3.092   7.424   1.00 42.91 ? 3080 ILE A C     1 
ATOM   8562  O  O     . ILE E  3 1103 ? 24.051  2.092   6.765   1.00 43.17 ? 3080 ILE A O     1 
ATOM   8563  C  CB    . ILE E  3 1103 ? 24.760  3.680   9.681   1.00 41.23 ? 3080 ILE A CB    1 
ATOM   8564  C  CG1   . ILE E  3 1103 ? 26.058  4.148   10.339  1.00 39.15 ? 3080 ILE A CG1   1 
ATOM   8565  C  CG2   . ILE E  3 1103 ? 24.477  2.205   10.007  1.00 39.28 ? 3080 ILE A CG2   1 
ATOM   8566  C  CD1   . ILE E  3 1103 ? 25.971  4.284   11.811  1.00 36.95 ? 3080 ILE A CD1   1 
ATOM   8567  N  N     . ALA E  3 1104 ? 22.516  3.553   7.537   1.00 43.71 ? 3081 ALA A N     1 
ATOM   8568  C  CA    . ALA E  3 1104 ? 21.378  2.892   6.909   1.00 44.87 ? 3081 ALA A CA    1 
ATOM   8569  C  C     . ALA E  3 1104 ? 21.634  2.677   5.418   1.00 45.34 ? 3081 ALA A C     1 
ATOM   8570  O  O     . ALA E  3 1104 ? 21.438  1.576   4.911   1.00 46.37 ? 3081 ALA A O     1 
ATOM   8571  C  CB    . ALA E  3 1104 ? 20.100  3.692   7.134   1.00 45.26 ? 3081 ALA A CB    1 
ATOM   8572  N  N     . ALA E  3 1105 ? 22.090  3.723   4.735   1.00 44.76 ? 3082 ALA A N     1 
ATOM   8573  C  CA    . ALA E  3 1105 ? 22.382  3.651   3.317   1.00 45.06 ? 3082 ALA A CA    1 
ATOM   8574  C  C     . ALA E  3 1105 ? 23.501  2.652   3.035   1.00 45.53 ? 3082 ALA A C     1 
ATOM   8575  O  O     . ALA E  3 1105 ? 23.429  1.892   2.069   1.00 44.78 ? 3082 ALA A O     1 
ATOM   8576  C  CB    . ALA E  3 1105 ? 22.751  5.025   2.801   1.00 46.17 ? 3082 ALA A CB    1 
ATOM   8577  N  N     . ALA E  3 1106 ? 24.529  2.662   3.887   1.00 46.42 ? 3083 ALA A N     1 
ATOM   8578  C  CA    . ALA E  3 1106 ? 25.679  1.762   3.739   1.00 46.95 ? 3083 ALA A CA    1 
ATOM   8579  C  C     . ALA E  3 1106 ? 25.286  0.304   3.935   1.00 46.48 ? 3083 ALA A C     1 
ATOM   8580  O  O     . ALA E  3 1106 ? 25.748  -0.575  3.204   1.00 46.90 ? 3083 ALA A O     1 
ATOM   8581  C  CB    . ALA E  3 1106 ? 26.786  2.143   4.701   1.00 46.50 ? 3083 ALA A CB    1 
ATOM   8582  N  N     . GLN E  3 1107 ? 24.431  0.065   4.922   1.00 46.00 ? 3084 GLN A N     1 
ATOM   8583  C  CA    . GLN E  3 1107 ? 23.913  -1.272  5.194   1.00 46.45 ? 3084 GLN A CA    1 
ATOM   8584  C  C     . GLN E  3 1107 ? 23.040  -1.759  4.045   1.00 46.98 ? 3084 GLN A C     1 
ATOM   8585  O  O     . GLN E  3 1107 ? 23.059  -2.936  3.706   1.00 46.68 ? 3084 GLN A O     1 
ATOM   8586  C  CB    . GLN E  3 1107 ? 23.114  -1.284  6.491   1.00 45.83 ? 3084 GLN A CB    1 
ATOM   8587  C  CG    . GLN E  3 1107 ? 23.972  -1.143  7.720   1.00 45.71 ? 3084 GLN A CG    1 
ATOM   8588  C  CD    . GLN E  3 1107 ? 23.176  -1.294  8.987   1.00 45.57 ? 3084 GLN A CD    1 
ATOM   8589  O  OE1   . GLN E  3 1107 ? 22.057  -0.798  9.082   1.00 45.45 ? 3084 GLN A OE1   1 
ATOM   8590  N  NE2   . GLN E  3 1107 ? 23.747  -1.985  9.974   1.00 45.77 ? 3084 GLN A NE2   1 
ATOM   8591  N  N     . ARG E  3 1108 ? 22.292  -0.833  3.450   1.00 47.60 ? 3085 ARG A N     1 
ATOM   8592  C  CA    . ARG E  3 1108 ? 21.445  -1.107  2.305   1.00 48.61 ? 3085 ARG A CA    1 
ATOM   8593  C  C     . ARG E  3 1108 ? 22.282  -1.675  1.159   1.00 50.19 ? 3085 ARG A C     1 
ATOM   8594  O  O     . ARG E  3 1108 ? 21.741  -2.279  0.236   1.00 50.95 ? 3085 ARG A O     1 
ATOM   8595  C  CB    . ARG E  3 1108 ? 20.762  0.189   1.862   1.00 48.99 ? 3085 ARG A CB    1 
ATOM   8596  C  CG    . ARG E  3 1108 ? 19.309  0.060   1.403   1.00 50.81 ? 3085 ARG A CG    1 
ATOM   8597  C  CD    . ARG E  3 1108 ? 18.264  0.485   2.470   1.00 53.26 ? 3085 ARG A CD    1 
ATOM   8598  N  NE    . ARG E  3 1108 ? 18.603  1.693   3.251   1.00 55.97 ? 3085 ARG A NE    1 
ATOM   8599  C  CZ    . ARG E  3 1108 ? 18.792  2.924   2.758   1.00 56.81 ? 3085 ARG A CZ    1 
ATOM   8600  N  NH1   . ARG E  3 1108 ? 18.708  3.171   1.456   1.00 57.45 ? 3085 ARG A NH1   1 
ATOM   8601  N  NH2   . ARG E  3 1108 ? 19.094  3.921   3.577   1.00 58.07 ? 3085 ARG A NH2   1 
ATOM   8602  N  N     . GLU E  3 1109 ? 23.603  -1.492  1.232   1.00 51.87 ? 3086 GLU A N     1 
ATOM   8603  C  CA    . GLU E  3 1109 ? 24.530  -1.983  0.208   1.00 53.46 ? 3086 GLU A CA    1 
ATOM   8604  C  C     . GLU E  3 1109 ? 25.524  -3.019  0.733   1.00 52.93 ? 3086 GLU A C     1 
ATOM   8605  O  O     . GLU E  3 1109 ? 26.629  -3.154  0.203   1.00 53.13 ? 3086 GLU A O     1 
ATOM   8606  C  CB    . GLU E  3 1109 ? 25.304  -0.825  -0.396  1.00 54.92 ? 3086 GLU A CB    1 
ATOM   8607  C  CG    . GLU E  3 1109 ? 24.446  0.203   -1.065  1.00 61.36 ? 3086 GLU A CG    1 
ATOM   8608  C  CD    . GLU E  3 1109 ? 25.268  1.368   -1.565  1.00 68.62 ? 3086 GLU A CD    1 
ATOM   8609  O  OE1   . GLU E  3 1109 ? 24.906  1.914   -2.637  1.00 72.09 ? 3086 GLU A OE1   1 
ATOM   8610  O  OE2   . GLU E  3 1109 ? 26.278  1.732   -0.895  1.00 71.29 ? 3086 GLU A OE2   1 
ATOM   8611  N  N     . GLY E  3 1110 ? 25.132  -3.732  1.785   1.00 52.39 ? 3087 GLY A N     1 
ATOM   8612  C  CA    . GLY E  3 1110 ? 25.908  -4.853  2.311   1.00 50.82 ? 3087 GLY A CA    1 
ATOM   8613  C  C     . GLY E  3 1110 ? 27.182  -4.484  3.031   1.00 49.10 ? 3087 GLY A C     1 
ATOM   8614  O  O     . GLY E  3 1110 ? 28.083  -5.298  3.149   1.00 48.81 ? 3087 GLY A O     1 
ATOM   8615  N  N     . LYS E  3 1111 ? 27.263  -3.257  3.515   1.00 48.87 ? 3088 LYS A N     1 
ATOM   8616  C  CA    . LYS E  3 1111 ? 28.436  -2.826  4.253   1.00 49.74 ? 3088 LYS A CA    1 
ATOM   8617  C  C     . LYS E  3 1111 ? 28.234  -3.032  5.746   1.00 50.25 ? 3088 LYS A C     1 
ATOM   8618  O  O     . LYS E  3 1111 ? 27.107  -2.941  6.242   1.00 51.47 ? 3088 LYS A O     1 
ATOM   8619  C  CB    . LYS E  3 1111 ? 28.767  -1.367  3.941   1.00 49.95 ? 3088 LYS A CB    1 
ATOM   8620  C  CG    . LYS E  3 1111 ? 29.275  -1.154  2.528   1.00 52.32 ? 3088 LYS A CG    1 
ATOM   8621  C  CD    . LYS E  3 1111 ? 30.007  0.173   2.389   1.00 54.47 ? 3088 LYS A CD    1 
ATOM   8622  C  CE    . LYS E  3 1111 ? 30.769  0.244   1.065   1.00 57.02 ? 3088 LYS A CE    1 
ATOM   8623  N  NZ    . LYS E  3 1111 ? 29.854  0.456   -0.095  1.00 58.75 ? 3088 LYS A NZ    1 
ATOM   8624  N  N     . THR E  3 1112 ? 29.319  -3.320  6.460   1.00 49.72 ? 3089 THR A N     1 
ATOM   8625  C  CA    . THR E  3 1112 ? 29.250  -3.519  7.903   1.00 49.99 ? 3089 THR A CA    1 
ATOM   8626  C  C     . THR E  3 1112 ? 29.565  -2.218  8.613   1.00 49.87 ? 3089 THR A C     1 
ATOM   8627  O  O     . THR E  3 1112 ? 30.529  -1.541  8.264   1.00 51.05 ? 3089 THR A O     1 
ATOM   8628  C  CB    . THR E  3 1112 ? 30.218  -4.617  8.360   1.00 50.38 ? 3089 THR A CB    1 
ATOM   8629  O  OG1   . THR E  3 1112 ? 30.097  -5.756  7.493   1.00 50.14 ? 3089 THR A OG1   1 
ATOM   8630  C  CG2   . THR E  3 1112 ? 29.898  -5.041  9.789   1.00 52.22 ? 3089 THR A CG2   1 
ATOM   8631  N  N     . CYS E  3 1113 ? 28.745  -1.856  9.595   1.00 49.51 ? 3090 CYS A N     1 
ATOM   8632  C  CA    . CYS E  3 1113 ? 28.929  -0.581  10.304  1.00 49.64 ? 3090 CYS A CA    1 
ATOM   8633  C  C     . CYS E  3 1113 ? 29.015  -0.740  11.814  1.00 49.06 ? 3090 CYS A C     1 
ATOM   8634  O  O     . CYS E  3 1113 ? 28.400  -1.643  12.393  1.00 50.41 ? 3090 CYS A O     1 
ATOM   8635  C  CB    . CYS E  3 1113 ? 27.797  0.384   9.992   1.00 49.91 ? 3090 CYS A CB    1 
ATOM   8636  S  SG    . CYS E  3 1113 ? 27.478  0.611   8.264   1.00 52.27 ? 3090 CYS A SG    1 
ATOM   8637  N  N     . ALA E  3 1114 ? 29.771  0.150   12.445  1.00 46.79 ? 3091 ALA A N     1 
ATOM   8638  C  CA    . ALA E  3 1114 ? 29.905  0.152   13.886  1.00 45.48 ? 3091 ALA A CA    1 
ATOM   8639  C  C     . ALA E  3 1114 ? 29.552  1.527   14.409  1.00 45.32 ? 3091 ALA A C     1 
ATOM   8640  O  O     . ALA E  3 1114 ? 29.856  2.539   13.774  1.00 44.79 ? 3091 ALA A O     1 
ATOM   8641  C  CB    . ALA E  3 1114 ? 31.311  -0.230  14.292  1.00 45.14 ? 3091 ALA A CB    1 
ATOM   8642  N  N     . PHE E  3 1115 ? 28.901  1.555   15.565  1.00 45.69 ? 3092 PHE A N     1 
ATOM   8643  C  CA    . PHE E  3 1115 ? 28.518  2.798   16.212  1.00 46.02 ? 3092 PHE A CA    1 
ATOM   8644  C  C     . PHE E  3 1115 ? 29.103  2.845   17.608  1.00 45.99 ? 3092 PHE A C     1 
ATOM   8645  O  O     . PHE E  3 1115 ? 28.793  1.999   18.436  1.00 46.41 ? 3092 PHE A O     1 
ATOM   8646  C  CB    . PHE E  3 1115 ? 26.994  2.918   16.277  1.00 45.70 ? 3092 PHE A CB    1 
ATOM   8647  C  CG    . PHE E  3 1115 ? 26.511  4.297   16.612  1.00 46.42 ? 3092 PHE A CG    1 
ATOM   8648  C  CD1   . PHE E  3 1115 ? 26.189  5.198   15.603  1.00 46.56 ? 3092 PHE A CD1   1 
ATOM   8649  C  CD2   . PHE E  3 1115 ? 26.381  4.699   17.934  1.00 47.61 ? 3092 PHE A CD2   1 
ATOM   8650  C  CE1   . PHE E  3 1115 ? 25.751  6.477   15.903  1.00 46.45 ? 3092 PHE A CE1   1 
ATOM   8651  C  CE2   . PHE E  3 1115 ? 25.940  5.977   18.249  1.00 48.34 ? 3092 PHE A CE2   1 
ATOM   8652  C  CZ    . PHE E  3 1115 ? 25.629  6.871   17.228  1.00 47.80 ? 3092 PHE A CZ    1 
ATOM   8653  N  N     . ILE E  3 1116 ? 29.946  3.836   17.867  1.00 46.54 ? 3093 ILE A N     1 
ATOM   8654  C  CA    . ILE E  3 1116 ? 30.518  4.018   19.198  1.00 48.55 ? 3093 ILE A CA    1 
ATOM   8655  C  C     . ILE E  3 1116 ? 29.751  5.120   19.926  1.00 49.60 ? 3093 ILE A C     1 
ATOM   8656  O  O     . ILE E  3 1116 ? 29.976  6.307   19.682  1.00 51.34 ? 3093 ILE A O     1 
ATOM   8657  C  CB    . ILE E  3 1116 ? 32.042  4.363   19.163  1.00 48.57 ? 3093 ILE A CB    1 
ATOM   8658  C  CG1   . ILE E  3 1116 ? 32.800  3.543   18.103  1.00 49.71 ? 3093 ILE A CG1   1 
ATOM   8659  C  CG2   . ILE E  3 1116 ? 32.662  4.179   20.544  1.00 47.56 ? 3093 ILE A CG2   1 
ATOM   8660  C  CD1   . ILE E  3 1116 ? 32.856  2.036   18.362  1.00 50.90 ? 3093 ILE A CD1   1 
ATOM   8661  N  N     . ASP E  3 1117 ? 28.848  4.720   20.815  1.00 49.65 ? 3094 ASP A N     1 
ATOM   8662  C  CA    . ASP E  3 1117 ? 27.965  5.649   21.488  1.00 50.73 ? 3094 ASP A CA    1 
ATOM   8663  C  C     . ASP E  3 1117 ? 28.579  6.118   22.804  1.00 51.35 ? 3094 ASP A C     1 
ATOM   8664  O  O     . ASP E  3 1117 ? 28.123  5.751   23.893  1.00 51.78 ? 3094 ASP A O     1 
ATOM   8665  C  CB    . ASP E  3 1117 ? 26.595  5.000   21.719  1.00 52.26 ? 3094 ASP A CB    1 
ATOM   8666  C  CG    . ASP E  3 1117 ? 25.554  5.981   22.260  1.00 55.47 ? 3094 ASP A CG    1 
ATOM   8667  O  OD1   . ASP E  3 1117 ? 25.563  7.178   21.866  1.00 57.93 ? 3094 ASP A OD1   1 
ATOM   8668  O  OD2   . ASP E  3 1117 ? 24.714  5.546   23.080  1.00 56.73 ? 3094 ASP A OD2   1 
ATOM   8669  N  N     . ALA E  3 1118 ? 29.615  6.943   22.698  1.00 51.54 ? 3095 ALA A N     1 
ATOM   8670  C  CA    . ALA E  3 1118 ? 30.294  7.493   23.872  1.00 51.63 ? 3095 ALA A CA    1 
ATOM   8671  C  C     . ALA E  3 1118 ? 29.396  8.480   24.627  1.00 52.27 ? 3095 ALA A C     1 
ATOM   8672  O  O     . ALA E  3 1118 ? 29.591  8.742   25.818  1.00 52.19 ? 3095 ALA A O     1 
ATOM   8673  C  CB    . ALA E  3 1118 ? 31.586  8.171   23.457  1.00 50.54 ? 3095 ALA A CB    1 
ATOM   8674  N  N     . GLU E  3 1119 ? 28.418  9.022   23.908  1.00 52.75 ? 3096 GLU A N     1 
ATOM   8675  C  CA    . GLU E  3 1119 ? 27.505  10.016  24.430  1.00 52.83 ? 3096 GLU A CA    1 
ATOM   8676  C  C     . GLU E  3 1119 ? 26.402  9.328   25.220  1.00 52.31 ? 3096 GLU A C     1 
ATOM   8677  O  O     . GLU E  3 1119 ? 25.668  9.986   25.969  1.00 52.83 ? 3096 GLU A O     1 
ATOM   8678  C  CB    . GLU E  3 1119 ? 26.924  10.836  23.274  1.00 53.71 ? 3096 GLU A CB    1 
ATOM   8679  C  CG    . GLU E  3 1119 ? 26.725  12.321  23.579  1.00 53.77 ? 3096 GLU A CG    1 
ATOM   8680  C  CD    . GLU E  3 1119 ? 26.076  13.099  22.434  1.00 53.71 ? 3096 GLU A CD    1 
ATOM   8681  O  OE1   . GLU E  3 1119 ? 25.291  12.516  21.641  1.00 56.47 ? 3096 GLU A OE1   1 
ATOM   8682  O  OE2   . GLU E  3 1119 ? 26.342  14.312  22.333  1.00 52.76 ? 3096 GLU A OE2   1 
ATOM   8683  N  N     . HIS E  3 1120 ? 26.307  8.006   25.052  1.00 51.36 ? 3097 HIS A N     1 
ATOM   8684  C  CA    . HIS E  3 1120 ? 25.372  7.145   25.792  1.00 50.26 ? 3097 HIS A CA    1 
ATOM   8685  C  C     . HIS E  3 1120 ? 23.916  7.579   25.647  1.00 49.79 ? 3097 HIS A C     1 
ATOM   8686  O  O     . HIS E  3 1120 ? 23.185  7.670   26.637  1.00 49.97 ? 3097 HIS A O     1 
ATOM   8687  C  CB    . HIS E  3 1120 ? 25.752  7.071   27.273  1.00 49.68 ? 3097 HIS A CB    1 
ATOM   8688  C  CG    . HIS E  3 1120 ? 27.025  6.331   27.534  1.00 50.77 ? 3097 HIS A CG    1 
ATOM   8689  N  ND1   . HIS E  3 1120 ? 27.051  5.014   27.943  1.00 53.35 ? 3097 HIS A ND1   1 
ATOM   8690  C  CD2   . HIS E  3 1120 ? 28.316  6.725   27.451  1.00 50.49 ? 3097 HIS A CD2   1 
ATOM   8691  C  CE1   . HIS E  3 1120 ? 28.304  4.628   28.101  1.00 53.22 ? 3097 HIS A CE1   1 
ATOM   8692  N  NE2   . HIS E  3 1120 ? 29.091  5.648   27.806  1.00 51.86 ? 3097 HIS A NE2   1 
ATOM   8693  N  N     . ALA E  3 1121 ? 23.493  7.839   24.413  1.00 48.39 ? 3098 ALA A N     1 
ATOM   8694  C  CA    . ALA E  3 1121 ? 22.167  8.397   24.187  1.00 47.86 ? 3098 ALA A CA    1 
ATOM   8695  C  C     . ALA E  3 1121 ? 21.453  7.835   22.960  1.00 48.59 ? 3098 ALA A C     1 
ATOM   8696  O  O     . ALA E  3 1121 ? 20.384  8.328   22.579  1.00 49.01 ? 3098 ALA A O     1 
ATOM   8697  C  CB    . ALA E  3 1121 ? 22.246  9.914   24.114  1.00 47.28 ? 3098 ALA A CB    1 
ATOM   8698  N  N     . LEU E  3 1122 ? 22.030  6.798   22.358  1.00 48.93 ? 3099 LEU A N     1 
ATOM   8699  C  CA    . LEU E  3 1122 ? 21.454  6.173   21.167  1.00 49.57 ? 3099 LEU A CA    1 
ATOM   8700  C  C     . LEU E  3 1122 ? 20.191  5.409   21.498  1.00 49.47 ? 3099 LEU A C     1 
ATOM   8701  O  O     . LEU E  3 1122 ? 20.174  4.606   22.435  1.00 51.58 ? 3099 LEU A O     1 
ATOM   8702  C  CB    . LEU E  3 1122 ? 22.463  5.229   20.514  1.00 50.15 ? 3099 LEU A CB    1 
ATOM   8703  C  CG    . LEU E  3 1122 ? 22.018  4.506   19.239  1.00 50.69 ? 3099 LEU A CG    1 
ATOM   8704  C  CD1   . LEU E  3 1122 ? 21.672  5.491   18.125  1.00 48.66 ? 3099 LEU A CD1   1 
ATOM   8705  C  CD2   . LEU E  3 1122 ? 23.097  3.534   18.782  1.00 51.37 ? 3099 LEU A CD2   1 
ATOM   8706  N  N     . ASP E  3 1123 ? 19.129  5.669   20.740  1.00 48.45 ? 3100 ASP A N     1 
ATOM   8707  C  CA    . ASP E  3 1123 ? 17.879  4.932   20.902  1.00 47.30 ? 3100 ASP A CA    1 
ATOM   8708  C  C     . ASP E  3 1123 ? 17.751  3.929   19.765  1.00 46.28 ? 3100 ASP A C     1 
ATOM   8709  O  O     . ASP E  3 1123 ? 17.480  4.324   18.623  1.00 47.07 ? 3100 ASP A O     1 
ATOM   8710  C  CB    . ASP E  3 1123 ? 16.679  5.888   20.928  1.00 48.12 ? 3100 ASP A CB    1 
ATOM   8711  C  CG    . ASP E  3 1123 ? 15.318  5.157   21.009  1.00 50.40 ? 3100 ASP A CG    1 
ATOM   8712  O  OD1   . ASP E  3 1123 ? 14.274  5.822   20.811  1.00 50.60 ? 3100 ASP A OD1   1 
ATOM   8713  O  OD2   . ASP E  3 1123 ? 15.270  3.931   21.271  1.00 52.11 ? 3100 ASP A OD2   1 
ATOM   8714  N  N     . PRO E  3 1124 ? 17.935  2.627   20.072  1.00 44.46 ? 3101 PRO A N     1 
ATOM   8715  C  CA    . PRO E  3 1124 ? 17.898  1.588   19.052  1.00 43.59 ? 3101 PRO A CA    1 
ATOM   8716  C  C     . PRO E  3 1124 ? 16.597  1.612   18.253  1.00 43.63 ? 3101 PRO A C     1 
ATOM   8717  O  O     . PRO E  3 1124 ? 16.637  1.517   17.028  1.00 44.56 ? 3101 PRO A O     1 
ATOM   8718  C  CB    . PRO E  3 1124 ? 18.025  0.299   19.857  1.00 43.90 ? 3101 PRO A CB    1 
ATOM   8719  C  CG    . PRO E  3 1124 ? 17.709  0.670   21.259  1.00 44.58 ? 3101 PRO A CG    1 
ATOM   8720  C  CD    . PRO E  3 1124 ? 18.171  2.066   21.410  1.00 43.37 ? 3101 PRO A CD    1 
ATOM   8721  N  N     . ILE E  3 1125 ? 15.467  1.776   18.931  1.00 43.34 ? 3102 ILE A N     1 
ATOM   8722  C  CA    . ILE E  3 1125 ? 14.173  1.798   18.264  1.00 45.07 ? 3102 ILE A CA    1 
ATOM   8723  C  C     . ILE E  3 1125 ? 14.072  2.945   17.255  1.00 45.56 ? 3102 ILE A C     1 
ATOM   8724  O  O     . ILE E  3 1125 ? 13.521  2.784   16.162  1.00 45.45 ? 3102 ILE A O     1 
ATOM   8725  C  CB    . ILE E  3 1125 ? 13.004  1.789   19.289  1.00 46.62 ? 3102 ILE A CB    1 
ATOM   8726  C  CG1   . ILE E  3 1125 ? 12.637  0.342   19.676  1.00 48.48 ? 3102 ILE A CG1   1 
ATOM   8727  C  CG2   . ILE E  3 1125 ? 11.761  2.493   18.746  1.00 47.07 ? 3102 ILE A CG2   1 
ATOM   8728  C  CD1   . ILE E  3 1125 ? 13.533  -0.303  20.765  1.00 50.56 ? 3102 ILE A CD1   1 
ATOM   8729  N  N     . TYR E  3 1126 ? 14.637  4.095   17.601  1.00 46.55 ? 3103 TYR A N     1 
ATOM   8730  C  CA    . TYR E  3 1126 ? 14.623  5.227   16.682  1.00 47.00 ? 3103 TYR A CA    1 
ATOM   8731  C  C     . TYR E  3 1126 ? 15.563  4.986   15.508  1.00 47.11 ? 3103 TYR A C     1 
ATOM   8732  O  O     . TYR E  3 1126 ? 15.236  5.315   14.365  1.00 47.82 ? 3103 TYR A O     1 
ATOM   8733  C  CB    . TYR E  3 1126 ? 14.956  6.536   17.402  1.00 47.35 ? 3103 TYR A CB    1 
ATOM   8734  C  CG    . TYR E  3 1126 ? 14.828  7.775   16.533  1.00 47.72 ? 3103 TYR A CG    1 
ATOM   8735  C  CD1   . TYR E  3 1126 ? 13.575  8.245   16.116  1.00 47.08 ? 3103 TYR A CD1   1 
ATOM   8736  C  CD2   . TYR E  3 1126 ? 15.965  8.482   16.132  1.00 48.88 ? 3103 TYR A CD2   1 
ATOM   8737  C  CE1   . TYR E  3 1126 ? 13.460  9.382   15.315  1.00 47.26 ? 3103 TYR A CE1   1 
ATOM   8738  C  CE2   . TYR E  3 1126 ? 15.866  9.621   15.334  1.00 49.48 ? 3103 TYR A CE2   1 
ATOM   8739  C  CZ    . TYR E  3 1126 ? 14.610  10.068  14.930  1.00 49.61 ? 3103 TYR A CZ    1 
ATOM   8740  O  OH    . TYR E  3 1126 ? 14.526  11.206  14.142  1.00 50.82 ? 3103 TYR A OH    1 
ATOM   8741  N  N     . ALA E  3 1127 ? 16.724  4.402   15.788  1.00 46.92 ? 3104 ALA A N     1 
ATOM   8742  C  CA    . ALA E  3 1127 ? 17.660  4.024   14.731  1.00 46.17 ? 3104 ALA A CA    1 
ATOM   8743  C  C     . ALA E  3 1127 ? 16.975  3.100   13.711  1.00 46.04 ? 3104 ALA A C     1 
ATOM   8744  O  O     . ALA E  3 1127 ? 17.156  3.262   12.503  1.00 45.08 ? 3104 ALA A O     1 
ATOM   8745  C  CB    . ALA E  3 1127 ? 18.897  3.374   15.318  1.00 45.02 ? 3104 ALA A CB    1 
ATOM   8746  N  N     . ARG E  3 1128 ? 16.158  2.170   14.205  1.00 45.61 ? 3105 ARG A N     1 
ATOM   8747  C  CA    . ARG E  3 1128 ? 15.402  1.289   13.333  1.00 46.49 ? 3105 ARG A CA    1 
ATOM   8748  C  C     . ARG E  3 1128 ? 14.416  2.068   12.480  1.00 46.41 ? 3105 ARG A C     1 
ATOM   8749  O  O     . ARG E  3 1128 ? 14.297  1.811   11.285  1.00 47.28 ? 3105 ARG A O     1 
ATOM   8750  C  CB    . ARG E  3 1128 ? 14.656  0.227   14.127  1.00 47.20 ? 3105 ARG A CB    1 
ATOM   8751  C  CG    . ARG E  3 1128 ? 14.273  -0.960  13.277  1.00 51.22 ? 3105 ARG A CG    1 
ATOM   8752  C  CD    . ARG E  3 1128 ? 12.813  -1.284  13.446  1.00 57.59 ? 3105 ARG A CD    1 
ATOM   8753  N  NE    . ARG E  3 1128 ? 12.460  -1.521  14.845  1.00 63.40 ? 3105 ARG A NE    1 
ATOM   8754  C  CZ    . ARG E  3 1128 ? 12.761  -2.628  15.526  1.00 66.80 ? 3105 ARG A CZ    1 
ATOM   8755  N  NH1   . ARG E  3 1128 ? 13.450  -3.614  14.945  1.00 67.85 ? 3105 ARG A NH1   1 
ATOM   8756  N  NH2   . ARG E  3 1128 ? 12.384  -2.748  16.801  1.00 66.63 ? 3105 ARG A NH2   1 
ATOM   8757  N  N     . LYS E  3 1129 ? 13.710  3.011   13.095  1.00 46.11 ? 3106 LYS A N     1 
ATOM   8758  C  CA    . LYS E  3 1129 ? 12.776  3.867   12.370  1.00 46.15 ? 3106 LYS A CA    1 
ATOM   8759  C  C     . LYS E  3 1129 ? 13.458  4.610   11.238  1.00 46.28 ? 3106 LYS A C     1 
ATOM   8760  O  O     . LYS E  3 1129 ? 12.845  4.838   10.203  1.00 47.75 ? 3106 LYS A O     1 
ATOM   8761  C  CB    . LYS E  3 1129 ? 12.119  4.868   13.310  1.00 46.73 ? 3106 LYS A CB    1 
ATOM   8762  C  CG    . LYS E  3 1129 ? 10.759  4.466   13.786  1.00 47.58 ? 3106 LYS A CG    1 
ATOM   8763  C  CD    . LYS E  3 1129 ? 10.356  5.252   15.011  1.00 49.41 ? 3106 LYS A CD    1 
ATOM   8764  C  CE    . LYS E  3 1129 ? 9.010   4.747   15.525  1.00 53.64 ? 3106 LYS A CE    1 
ATOM   8765  N  NZ    . LYS E  3 1129 ? 8.929   4.762   17.018  1.00 56.60 ? 3106 LYS A NZ    1 
ATOM   8766  N  N     . LEU E  3 1130 ? 14.724  4.979   11.429  1.00 45.76 ? 3107 LEU A N     1 
ATOM   8767  C  CA    . LEU E  3 1130 ? 15.479  5.655   10.378  1.00 45.84 ? 3107 LEU A CA    1 
ATOM   8768  C  C     . LEU E  3 1130 ? 16.007  4.686   9.320   1.00 46.15 ? 3107 LEU A C     1 
ATOM   8769  O  O     . LEU E  3 1130 ? 16.688  5.099   8.382   1.00 48.17 ? 3107 LEU A O     1 
ATOM   8770  C  CB    . LEU E  3 1130 ? 16.617  6.498   10.965  1.00 45.64 ? 3107 LEU A CB    1 
ATOM   8771  C  CG    . LEU E  3 1130 ? 16.285  7.591   11.986  1.00 45.41 ? 3107 LEU A CG    1 
ATOM   8772  C  CD1   . LEU E  3 1130 ? 17.519  8.397   12.314  1.00 44.64 ? 3107 LEU A CD1   1 
ATOM   8773  C  CD2   . LEU E  3 1130 ? 15.200  8.511   11.487  1.00 45.91 ? 3107 LEU A CD2   1 
ATOM   8774  N  N     . GLY E  3 1131 ? 15.697  3.402   9.476   1.00 44.95 ? 3108 GLY A N     1 
ATOM   8775  C  CA    . GLY E  3 1131 ? 16.044  2.398   8.484   1.00 44.67 ? 3108 GLY A CA    1 
ATOM   8776  C  C     . GLY E  3 1131 ? 17.382  1.731   8.713   1.00 45.13 ? 3108 GLY A C     1 
ATOM   8777  O  O     . GLY E  3 1131 ? 17.947  1.127   7.805   1.00 47.16 ? 3108 GLY A O     1 
ATOM   8778  N  N     . VAL E  3 1132 ? 17.899  1.834   9.925   1.00 45.17 ? 3109 VAL A N     1 
ATOM   8779  C  CA    . VAL E  3 1132 ? 19.120  1.124   10.274  1.00 45.28 ? 3109 VAL A CA    1 
ATOM   8780  C  C     . VAL E  3 1132 ? 18.775  -0.321  10.607  1.00 45.52 ? 3109 VAL A C     1 
ATOM   8781  O  O     . VAL E  3 1132 ? 17.814  -0.589  11.325  1.00 43.57 ? 3109 VAL A O     1 
ATOM   8782  C  CB    . VAL E  3 1132 ? 19.853  1.792   11.461  1.00 45.05 ? 3109 VAL A CB    1 
ATOM   8783  C  CG1   . VAL E  3 1132 ? 21.099  1.015   11.850  1.00 43.80 ? 3109 VAL A CG1   1 
ATOM   8784  C  CG2   . VAL E  3 1132 ? 20.225  3.217   11.104  1.00 45.09 ? 3109 VAL A CG2   1 
ATOM   8785  N  N     . ASP E  3 1133 ? 19.554  -1.245  10.049  1.00 47.24 ? 3110 ASP A N     1 
ATOM   8786  C  CA    . ASP E  3 1133 ? 19.468  -2.647  10.410  1.00 48.21 ? 3110 ASP A CA    1 
ATOM   8787  C  C     . ASP E  3 1133 ? 20.138  -2.836  11.766  1.00 48.66 ? 3110 ASP A C     1 
ATOM   8788  O  O     . ASP E  3 1133 ? 21.356  -3.004  11.866  1.00 49.11 ? 3110 ASP A O     1 
ATOM   8789  C  CB    . ASP E  3 1133 ? 20.123  -3.505  9.343   1.00 49.10 ? 3110 ASP A CB    1 
ATOM   8790  C  CG    . ASP E  3 1133 ? 20.140  -4.968  9.700   1.00 52.69 ? 3110 ASP A CG    1 
ATOM   8791  O  OD1   . ASP E  3 1133 ? 20.837  -5.714  8.978   1.00 57.29 ? 3110 ASP A OD1   1 
ATOM   8792  O  OD2   . ASP E  3 1133 ? 19.476  -5.380  10.684  1.00 53.53 ? 3110 ASP A OD2   1 
ATOM   8793  N  N     . ILE E  3 1134 ? 19.310  -2.794  12.804  1.00 49.23 ? 3111 ILE A N     1 
ATOM   8794  C  CA    . ILE E  3 1134 ? 19.730  -2.840  14.202  1.00 49.75 ? 3111 ILE A CA    1 
ATOM   8795  C  C     . ILE E  3 1134 ? 20.510  -4.116  14.529  1.00 50.31 ? 3111 ILE A C     1 
ATOM   8796  O  O     . ILE E  3 1134 ? 21.546  -4.064  15.201  1.00 51.18 ? 3111 ILE A O     1 
ATOM   8797  C  CB    . ILE E  3 1134 ? 18.488  -2.697  15.135  1.00 49.53 ? 3111 ILE A CB    1 
ATOM   8798  C  CG1   . ILE E  3 1134 ? 17.768  -1.386  14.866  1.00 51.25 ? 3111 ILE A CG1   1 
ATOM   8799  C  CG2   . ILE E  3 1134 ? 18.857  -2.705  16.578  1.00 50.86 ? 3111 ILE A CG2   1 
ATOM   8800  C  CD1   . ILE E  3 1134 ? 18.693  -0.155  14.742  1.00 50.24 ? 3111 ILE A CD1   1 
ATOM   8801  N  N     . ASP E  3 1135 ? 20.026  -5.247  14.024  1.00 49.49 ? 3112 ASP A N     1 
ATOM   8802  C  CA    . ASP E  3 1135 ? 20.602  -6.546  14.329  1.00 49.54 ? 3112 ASP A CA    1 
ATOM   8803  C  C     . ASP E  3 1135 ? 22.008  -6.777  13.799  1.00 48.88 ? 3112 ASP A C     1 
ATOM   8804  O  O     . ASP E  3 1135 ? 22.684  -7.698  14.236  1.00 48.98 ? 3112 ASP A O     1 
ATOM   8805  C  CB    . ASP E  3 1135 ? 19.682  -7.634  13.807  1.00 51.80 ? 3112 ASP A CB    1 
ATOM   8806  C  CG    . ASP E  3 1135 ? 18.324  -7.628  14.494  1.00 55.56 ? 3112 ASP A CG    1 
ATOM   8807  O  OD1   . ASP E  3 1135 ? 18.262  -7.300  15.702  1.00 57.74 ? 3112 ASP A OD1   1 
ATOM   8808  O  OD2   . ASP E  3 1135 ? 17.316  -7.966  13.832  1.00 57.61 ? 3112 ASP A OD2   1 
ATOM   8809  N  N     . ASN E  3 1136 ? 22.441  -5.946  12.860  1.00 48.69 ? 3113 ASN A N     1 
ATOM   8810  C  CA    . ASN E  3 1136 ? 23.766  -6.077  12.269  1.00 48.36 ? 3113 ASN A CA    1 
ATOM   8811  C  C     . ASN E  3 1136 ? 24.660  -4.879  12.509  1.00 47.28 ? 3113 ASN A C     1 
ATOM   8812  O  O     . ASN E  3 1136 ? 25.841  -4.902  12.176  1.00 47.72 ? 3113 ASN A O     1 
ATOM   8813  C  CB    . ASN E  3 1136 ? 23.644  -6.373  10.779  1.00 49.11 ? 3113 ASN A CB    1 
ATOM   8814  C  CG    . ASN E  3 1136 ? 23.099  -7.747  10.526  1.00 50.05 ? 3113 ASN A CG    1 
ATOM   8815  O  OD1   . ASN E  3 1136 ? 23.490  -8.707  11.188  1.00 50.38 ? 3113 ASN A OD1   1 
ATOM   8816  N  ND2   . ASN E  3 1136 ? 22.181  -7.855  9.582   1.00 52.29 ? 3113 ASN A ND2   1 
ATOM   8817  N  N     . LEU E  3 1137 ? 24.092  -3.837  13.097  1.00 46.10 ? 3114 LEU A N     1 
ATOM   8818  C  CA    . LEU E  3 1137 ? 24.860  -2.661  13.463  1.00 46.54 ? 3114 LEU A CA    1 
ATOM   8819  C  C     . LEU E  3 1137 ? 25.670  -2.948  14.725  1.00 46.66 ? 3114 LEU A C     1 
ATOM   8820  O  O     . LEU E  3 1137 ? 25.112  -3.113  15.808  1.00 46.78 ? 3114 LEU A O     1 
ATOM   8821  C  CB    . LEU E  3 1137 ? 23.918  -1.466  13.656  1.00 46.02 ? 3114 LEU A CB    1 
ATOM   8822  C  CG    . LEU E  3 1137 ? 24.409  -0.017  13.832  1.00 44.63 ? 3114 LEU A CG    1 
ATOM   8823  C  CD1   . LEU E  3 1137 ? 24.423  0.361   15.279  1.00 42.90 ? 3114 LEU A CD1   1 
ATOM   8824  C  CD2   . LEU E  3 1137 ? 25.760  0.254   13.183  1.00 43.68 ? 3114 LEU A CD2   1 
ATOM   8825  N  N     . LEU E  3 1138 ? 26.985  -3.042  14.571  1.00 47.08 ? 3115 LEU A N     1 
ATOM   8826  C  CA    . LEU E  3 1138 ? 27.874  -3.200  15.712  1.00 48.68 ? 3115 LEU A CA    1 
ATOM   8827  C  C     . LEU E  3 1138 ? 27.788  -1.965  16.570  1.00 49.81 ? 3115 LEU A C     1 
ATOM   8828  O  O     . LEU E  3 1138 ? 27.738  -0.855  16.056  1.00 51.23 ? 3115 LEU A O     1 
ATOM   8829  C  CB    . LEU E  3 1138 ? 29.316  -3.408  15.267  1.00 48.25 ? 3115 LEU A CB    1 
ATOM   8830  C  CG    . LEU E  3 1138 ? 29.683  -4.842  14.901  1.00 50.39 ? 3115 LEU A CG    1 
ATOM   8831  C  CD1   . LEU E  3 1138 ? 30.949  -4.856  14.080  1.00 50.96 ? 3115 LEU A CD1   1 
ATOM   8832  C  CD2   . LEU E  3 1138 ? 29.833  -5.706  16.146  1.00 50.64 ? 3115 LEU A CD2   1 
ATOM   8833  N  N     . CYS E  3 1139 ? 27.763  -2.154  17.881  1.00 51.02 ? 3116 CYS A N     1 
ATOM   8834  C  CA    . CYS E  3 1139 ? 27.541  -1.043  18.779  1.00 50.60 ? 3116 CYS A CA    1 
ATOM   8835  C  C     . CYS E  3 1139 ? 28.264  -1.186  20.099  1.00 50.17 ? 3116 CYS A C     1 
ATOM   8836  O  O     . CYS E  3 1139 ? 28.195  -2.220  20.750  1.00 51.04 ? 3116 CYS A O     1 
ATOM   8837  C  CB    . CYS E  3 1139 ? 26.051  -0.858  19.025  1.00 51.77 ? 3116 CYS A CB    1 
ATOM   8838  S  SG    . CYS E  3 1139 ? 25.713  0.486   20.150  1.00 54.97 ? 3116 CYS A SG    1 
ATOM   8839  N  N     . SER E  3 1140 ? 28.939  -0.121  20.498  1.00 50.12 ? 3117 SER A N     1 
ATOM   8840  C  CA    . SER E  3 1140 ? 29.706  -0.116  21.718  1.00 50.24 ? 3117 SER A CA    1 
ATOM   8841  C  C     . SER E  3 1140 ? 29.399  1.112   22.568  1.00 50.89 ? 3117 SER A C     1 
ATOM   8842  O  O     . SER E  3 1140 ? 29.217  2.209   22.049  1.00 51.21 ? 3117 SER A O     1 
ATOM   8843  C  CB    . SER E  3 1140 ? 31.182  -0.164  21.378  1.00 49.96 ? 3117 SER A CB    1 
ATOM   8844  O  OG    . SER E  3 1140 ? 31.950  -0.157  22.558  1.00 52.79 ? 3117 SER A OG    1 
ATOM   8845  N  N     . GLN E  3 1141 ? 29.319  0.916   23.877  1.00 51.85 ? 3118 GLN A N     1 
ATOM   8846  C  CA    . GLN E  3 1141 ? 29.203  2.024   24.813  1.00 52.39 ? 3118 GLN A CA    1 
ATOM   8847  C  C     . GLN E  3 1141 ? 30.389  1.982   25.756  1.00 53.11 ? 3118 GLN A C     1 
ATOM   8848  O  O     . GLN E  3 1141 ? 30.307  1.408   26.846  1.00 54.76 ? 3118 GLN A O     1 
ATOM   8849  C  CB    . GLN E  3 1141 ? 27.879  1.982   25.573  1.00 52.39 ? 3118 GLN A CB    1 
ATOM   8850  C  CG    . GLN E  3 1141 ? 26.710  2.394   24.710  1.00 54.34 ? 3118 GLN A CG    1 
ATOM   8851  C  CD    . GLN E  3 1141 ? 25.455  2.655   25.503  1.00 55.44 ? 3118 GLN A CD    1 
ATOM   8852  O  OE1   . GLN E  3 1141 ? 25.160  1.955   26.471  1.00 57.75 ? 3118 GLN A OE1   1 
ATOM   8853  N  NE2   . GLN E  3 1141 ? 24.695  3.663   25.090  1.00 56.06 ? 3118 GLN A NE2   1 
ATOM   8854  N  N     . PRO E  3 1142 ? 31.499  2.606   25.342  1.00 52.84 ? 3119 PRO A N     1 
ATOM   8855  C  CA    . PRO E  3 1142 ? 32.799  2.484   25.995  1.00 53.27 ? 3119 PRO A CA    1 
ATOM   8856  C  C     . PRO E  3 1142 ? 32.861  3.245   27.309  1.00 53.37 ? 3119 PRO A C     1 
ATOM   8857  O  O     . PRO E  3 1142 ? 32.104  4.195   27.497  1.00 53.79 ? 3119 PRO A O     1 
ATOM   8858  C  CB    . PRO E  3 1142 ? 33.735  3.133   24.991  1.00 53.97 ? 3119 PRO A CB    1 
ATOM   8859  C  CG    . PRO E  3 1142 ? 32.883  4.162   24.327  1.00 53.63 ? 3119 PRO A CG    1 
ATOM   8860  C  CD    . PRO E  3 1142 ? 31.541  3.537   24.204  1.00 52.76 ? 3119 PRO A CD    1 
ATOM   8861  N  N     . ASP E  3 1143 ? 33.760  2.830   28.198  1.00 53.29 ? 3120 ASP A N     1 
ATOM   8862  C  CA    . ASP E  3 1143 ? 33.899  3.473   29.504  1.00 54.47 ? 3120 ASP A CA    1 
ATOM   8863  C  C     . ASP E  3 1143 ? 34.764  4.723   29.411  1.00 53.14 ? 3120 ASP A C     1 
ATOM   8864  O  O     . ASP E  3 1143 ? 34.333  5.817   29.785  1.00 52.38 ? 3120 ASP A O     1 
ATOM   8865  C  CB    . ASP E  3 1143 ? 34.460  2.489   30.534  1.00 56.33 ? 3120 ASP A CB    1 
ATOM   8866  C  CG    . ASP E  3 1143 ? 33.602  1.227   30.669  1.00 60.15 ? 3120 ASP A CG    1 
ATOM   8867  O  OD1   . ASP E  3 1143 ? 32.351  1.344   30.736  1.00 62.59 ? 3120 ASP A OD1   1 
ATOM   8868  O  OD2   . ASP E  3 1143 ? 34.180  0.115   30.710  1.00 61.73 ? 3120 ASP A OD2   1 
ATOM   8869  N  N     . THR E  3 1144 ? 35.975  4.551   28.890  1.00 51.82 ? 3121 THR A N     1 
ATOM   8870  C  CA    . THR E  3 1144 ? 36.903  5.655   28.704  1.00 50.57 ? 3121 THR A CA    1 
ATOM   8871  C  C     . THR E  3 1144 ? 37.031  6.024   27.229  1.00 49.92 ? 3121 THR A C     1 
ATOM   8872  O  O     . THR E  3 1144 ? 36.681  5.246   26.359  1.00 49.62 ? 3121 THR A O     1 
ATOM   8873  C  CB    . THR E  3 1144 ? 38.293  5.309   29.258  1.00 50.74 ? 3121 THR A CB    1 
ATOM   8874  O  OG1   . THR E  3 1144 ? 38.880  4.262   28.475  1.00 50.07 ? 3121 THR A OG1   1 
ATOM   8875  C  CG2   . THR E  3 1144 ? 38.201  4.872   30.718  1.00 50.31 ? 3121 THR A CG2   1 
ATOM   8876  N  N     . GLY E  3 1145 ? 37.530  7.222   26.960  1.00 49.70 ? 3122 GLY A N     1 
ATOM   8877  C  CA    . GLY E  3 1145 ? 37.792  7.662   25.599  1.00 49.74 ? 3122 GLY A CA    1 
ATOM   8878  C  C     . GLY E  3 1145 ? 38.889  6.855   24.923  1.00 49.84 ? 3122 GLY A C     1 
ATOM   8879  O  O     . GLY E  3 1145 ? 38.811  6.562   23.732  1.00 48.72 ? 3122 GLY A O     1 
ATOM   8880  N  N     . GLU E  3 1146 ? 39.918  6.493   25.680  1.00 50.93 ? 3123 GLU A N     1 
ATOM   8881  C  CA    . GLU E  3 1146 ? 40.978  5.636   25.159  1.00 52.18 ? 3123 GLU A CA    1 
ATOM   8882  C  C     . GLU E  3 1146 ? 40.417  4.301   24.676  1.00 51.66 ? 3123 GLU A C     1 
ATOM   8883  O  O     . GLU E  3 1146 ? 40.781  3.833   23.609  1.00 52.25 ? 3123 GLU A O     1 
ATOM   8884  C  CB    . GLU E  3 1146 ? 42.045  5.381   26.217  1.00 53.98 ? 3123 GLU A CB    1 
ATOM   8885  C  CG    . GLU E  3 1146 ? 42.974  6.550   26.456  1.00 57.79 ? 3123 GLU A CG    1 
ATOM   8886  C  CD    . GLU E  3 1146 ? 42.473  7.509   27.528  1.00 61.57 ? 3123 GLU A CD    1 
ATOM   8887  O  OE1   . GLU E  3 1146 ? 41.481  7.187   28.225  1.00 62.28 ? 3123 GLU A OE1   1 
ATOM   8888  O  OE2   . GLU E  3 1146 ? 43.086  8.591   27.674  1.00 63.97 ? 3123 GLU A OE2   1 
ATOM   8889  N  N     . GLN E  3 1147 ? 39.535  3.699   25.471  1.00 50.30 ? 3124 GLN A N     1 
ATOM   8890  C  CA    . GLN E  3 1147 ? 38.845  2.472   25.096  1.00 49.00 ? 3124 GLN A CA    1 
ATOM   8891  C  C     . GLN E  3 1147 ? 38.077  2.657   23.784  1.00 46.48 ? 3124 GLN A C     1 
ATOM   8892  O  O     . GLN E  3 1147 ? 38.197  1.852   22.872  1.00 45.40 ? 3124 GLN A O     1 
ATOM   8893  C  CB    . GLN E  3 1147 ? 37.898  2.048   26.230  1.00 49.90 ? 3124 GLN A CB    1 
ATOM   8894  C  CG    . GLN E  3 1147 ? 37.174  0.730   26.021  1.00 50.48 ? 3124 GLN A CG    1 
ATOM   8895  C  CD    . GLN E  3 1147 ? 36.159  0.450   27.097  1.00 51.28 ? 3124 GLN A CD    1 
ATOM   8896  O  OE1   . GLN E  3 1147 ? 35.038  0.026   26.809  1.00 54.62 ? 3124 GLN A OE1   1 
ATOM   8897  N  NE2   . GLN E  3 1147 ? 36.540  0.685   28.351  1.00 53.82 ? 3124 GLN A NE2   1 
ATOM   8898  N  N     . ALA E  3 1148 ? 37.304  3.733   23.698  1.00 45.39 ? 3125 ALA A N     1 
ATOM   8899  C  CA    . ALA E  3 1148 ? 36.539  4.059   22.501  1.00 45.41 ? 3125 ALA A CA    1 
ATOM   8900  C  C     . ALA E  3 1148 ? 37.420  4.074   21.248  1.00 45.89 ? 3125 ALA A C     1 
ATOM   8901  O  O     . ALA E  3 1148 ? 37.053  3.523   20.202  1.00 45.67 ? 3125 ALA A O     1 
ATOM   8902  C  CB    . ALA E  3 1148 ? 35.838  5.404   22.668  1.00 44.11 ? 3125 ALA A CB    1 
ATOM   8903  N  N     . LEU E  3 1149 ? 38.584  4.706   21.359  1.00 45.77 ? 3126 LEU A N     1 
ATOM   8904  C  CA    . LEU E  3 1149 ? 39.471  4.869   20.216  1.00 44.84 ? 3126 LEU A CA    1 
ATOM   8905  C  C     . LEU E  3 1149 ? 40.276  3.615   19.954  1.00 45.67 ? 3126 LEU A C     1 
ATOM   8906  O  O     . LEU E  3 1149 ? 40.618  3.337   18.816  1.00 46.91 ? 3126 LEU A O     1 
ATOM   8907  C  CB    . LEU E  3 1149 ? 40.397  6.061   20.422  1.00 44.35 ? 3126 LEU A CB    1 
ATOM   8908  C  CG    . LEU E  3 1149 ? 39.722  7.429   20.608  1.00 42.86 ? 3126 LEU A CG    1 
ATOM   8909  C  CD1   . LEU E  3 1149 ? 40.658  8.361   21.350  1.00 43.82 ? 3126 LEU A CD1   1 
ATOM   8910  C  CD2   . LEU E  3 1149 ? 39.252  8.034   19.293  1.00 37.37 ? 3126 LEU A CD2   1 
ATOM   8911  N  N     . GLU E  3 1150 ? 40.587  2.858   20.999  1.00 46.46 ? 3127 GLU A N     1 
ATOM   8912  C  CA    . GLU E  3 1150 ? 41.235  1.562   20.826  1.00 47.43 ? 3127 GLU A CA    1 
ATOM   8913  C  C     . GLU E  3 1150 ? 40.313  0.586   20.101  1.00 47.16 ? 3127 GLU A C     1 
ATOM   8914  O  O     . GLU E  3 1150 ? 40.771  -0.238  19.319  1.00 47.95 ? 3127 GLU A O     1 
ATOM   8915  C  CB    . GLU E  3 1150 ? 41.687  0.976   22.167  1.00 48.74 ? 3127 GLU A CB    1 
ATOM   8916  C  CG    . GLU E  3 1150 ? 43.140  1.267   22.492  1.00 52.35 ? 3127 GLU A CG    1 
ATOM   8917  C  CD    . GLU E  3 1150 ? 44.090  0.689   21.456  1.00 56.50 ? 3127 GLU A CD    1 
ATOM   8918  O  OE1   . GLU E  3 1150 ? 44.767  1.478   20.752  1.00 56.70 ? 3127 GLU A OE1   1 
ATOM   8919  O  OE2   . GLU E  3 1150 ? 44.146  -0.559  21.335  1.00 59.83 ? 3127 GLU A OE2   1 
ATOM   8920  N  N     . ILE E  3 1151 ? 39.015  0.693   20.358  1.00 46.32 ? 3128 ILE A N     1 
ATOM   8921  C  CA    . ILE E  3 1151 ? 38.037  -0.123  19.668  1.00 45.89 ? 3128 ILE A CA    1 
ATOM   8922  C  C     . ILE E  3 1151 ? 38.019  0.243   18.196  1.00 47.13 ? 3128 ILE A C     1 
ATOM   8923  O  O     . ILE E  3 1151 ? 38.027  -0.637  17.352  1.00 48.52 ? 3128 ILE A O     1 
ATOM   8924  C  CB    . ILE E  3 1151 ? 36.631  -0.014  20.316  1.00 45.46 ? 3128 ILE A CB    1 
ATOM   8925  C  CG1   . ILE E  3 1151 ? 36.599  -0.809  21.622  1.00 44.41 ? 3128 ILE A CG1   1 
ATOM   8926  C  CG2   . ILE E  3 1151 ? 35.543  -0.537  19.377  1.00 44.59 ? 3128 ILE A CG2   1 
ATOM   8927  C  CD1   . ILE E  3 1151 ? 35.468  -0.463  22.537  1.00 43.53 ? 3128 ILE A CD1   1 
ATOM   8928  N  N     . CYS E  3 1152 ? 38.012  1.537   17.890  1.00 48.74 ? 3129 CYS A N     1 
ATOM   8929  C  CA    . CYS E  3 1152 ? 38.077  2.016   16.502  1.00 50.23 ? 3129 CYS A CA    1 
ATOM   8930  C  C     . CYS E  3 1152 ? 39.284  1.455   15.774  1.00 49.52 ? 3129 CYS A C     1 
ATOM   8931  O  O     . CYS E  3 1152 ? 39.171  0.982   14.646  1.00 49.01 ? 3129 CYS A O     1 
ATOM   8932  C  CB    . CYS E  3 1152 ? 38.162  3.540   16.451  1.00 51.19 ? 3129 CYS A CB    1 
ATOM   8933  S  SG    . CYS E  3 1152 ? 36.637  4.336   16.829  1.00 59.13 ? 3129 CYS A SG    1 
ATOM   8934  N  N     . ASP E  3 1153 ? 40.436  1.515   16.431  1.00 49.30 ? 3130 ASP A N     1 
ATOM   8935  C  CA    . ASP E  3 1153 ? 41.671  1.082   15.833  1.00 49.96 ? 3130 ASP A CA    1 
ATOM   8936  C  C     . ASP E  3 1153 ? 41.615  -0.400  15.528  1.00 49.07 ? 3130 ASP A C     1 
ATOM   8937  O  O     . ASP E  3 1153 ? 42.037  -0.823  14.459  1.00 49.20 ? 3130 ASP A O     1 
ATOM   8938  C  CB    . ASP E  3 1153 ? 42.842  1.388   16.758  1.00 52.71 ? 3130 ASP A CB    1 
ATOM   8939  C  CG    . ASP E  3 1153 ? 44.166  1.486   16.012  1.00 56.95 ? 3130 ASP A CG    1 
ATOM   8940  O  OD1   . ASP E  3 1153 ? 44.182  2.032   14.876  1.00 58.66 ? 3130 ASP A OD1   1 
ATOM   8941  O  OD2   . ASP E  3 1153 ? 45.191  1.026   16.575  1.00 58.43 ? 3130 ASP A OD2   1 
ATOM   8942  N  N     . ALA E  3 1154 ? 41.087  -1.180  16.468  1.00 48.19 ? 3131 ALA A N     1 
ATOM   8943  C  CA    . ALA E  3 1154 ? 40.907  -2.615  16.287  1.00 47.40 ? 3131 ALA A CA    1 
ATOM   8944  C  C     . ALA E  3 1154 ? 40.003  -2.941  15.096  1.00 46.98 ? 3131 ALA A C     1 
ATOM   8945  O  O     . ALA E  3 1154 ? 40.336  -3.790  14.276  1.00 48.17 ? 3131 ALA A O     1 
ATOM   8946  C  CB    . ALA E  3 1154 ? 40.357  -3.237  17.547  1.00 47.75 ? 3131 ALA A CB    1 
ATOM   8947  N  N     . LEU E  3 1155 ? 38.866  -2.266  15.003  1.00 45.98 ? 3132 LEU A N     1 
ATOM   8948  C  CA    . LEU E  3 1155 ? 37.948  -2.445  13.883  1.00 45.05 ? 3132 LEU A CA    1 
ATOM   8949  C  C     . LEU E  3 1155 ? 38.555  -1.968  12.563  1.00 45.71 ? 3132 LEU A C     1 
ATOM   8950  O  O     . LEU E  3 1155 ? 38.384  -2.615  11.527  1.00 45.76 ? 3132 LEU A O     1 
ATOM   8951  C  CB    . LEU E  3 1155 ? 36.625  -1.723  14.146  1.00 44.22 ? 3132 LEU A CB    1 
ATOM   8952  C  CG    . LEU E  3 1155 ? 35.796  -2.186  15.349  1.00 43.27 ? 3132 LEU A CG    1 
ATOM   8953  C  CD1   . LEU E  3 1155 ? 34.611  -1.276  15.552  1.00 42.51 ? 3132 LEU A CD1   1 
ATOM   8954  C  CD2   . LEU E  3 1155 ? 35.330  -3.613  15.204  1.00 41.15 ? 3132 LEU A CD2   1 
ATOM   8955  N  N     . ALA E  3 1156 ? 39.255  -0.834  12.599  1.00 45.91 ? 3133 ALA A N     1 
ATOM   8956  C  CA    . ALA E  3 1156 ? 39.966  -0.355  11.426  1.00 46.49 ? 3133 ALA A CA    1 
ATOM   8957  C  C     . ALA E  3 1156 ? 40.928  -1.441  10.941  1.00 47.11 ? 3133 ALA A C     1 
ATOM   8958  O  O     . ALA E  3 1156 ? 40.814  -1.879  9.812   1.00 47.06 ? 3133 ALA A O     1 
ATOM   8959  C  CB    . ALA E  3 1156 ? 40.700  0.959   11.715  1.00 46.38 ? 3133 ALA A CB    1 
ATOM   8960  N  N     . ARG E  3 1157 ? 41.832  -1.898  11.812  1.00 47.71 ? 3134 ARG A N     1 
ATOM   8961  C  CA    . ARG E  3 1157 ? 42.826  -2.917  11.470  1.00 48.18 ? 3134 ARG A CA    1 
ATOM   8962  C  C     . ARG E  3 1157 ? 42.226  -4.213  10.966  1.00 46.92 ? 3134 ARG A C     1 
ATOM   8963  O  O     . ARG E  3 1157 ? 42.802  -4.851  10.106  1.00 47.82 ? 3134 ARG A O     1 
ATOM   8964  C  CB    . ARG E  3 1157 ? 43.740  -3.230  12.655  1.00 48.57 ? 3134 ARG A CB    1 
ATOM   8965  C  CG    . ARG E  3 1157 ? 44.958  -2.320  12.789  1.00 50.46 ? 3134 ARG A CG    1 
ATOM   8966  C  CD    . ARG E  3 1157 ? 45.975  -2.873  13.795  1.00 52.16 ? 3134 ARG A CD    1 
ATOM   8967  N  NE    . ARG E  3 1157 ? 45.340  -3.453  14.991  1.00 58.34 ? 3134 ARG A NE    1 
ATOM   8968  C  CZ    . ARG E  3 1157 ? 44.941  -2.762  16.064  1.00 60.09 ? 3134 ARG A CZ    1 
ATOM   8969  N  NH1   . ARG E  3 1157 ? 45.107  -1.443  16.120  1.00 60.87 ? 3134 ARG A NH1   1 
ATOM   8970  N  NH2   . ARG E  3 1157 ? 44.365  -3.392  17.088  1.00 59.87 ? 3134 ARG A NH2   1 
ATOM   8971  N  N     . SER E  3 1158 ? 41.074  -4.605  11.495  1.00 46.79 ? 3135 SER A N     1 
ATOM   8972  C  CA    . SER E  3 1158 ? 40.424  -5.867  11.104  1.00 46.19 ? 3135 SER A CA    1 
ATOM   8973  C  C     . SER E  3 1158 ? 40.077  -5.933  9.623   1.00 45.13 ? 3135 SER A C     1 
ATOM   8974  O  O     . SER E  3 1158 ? 40.052  -7.000  9.038   1.00 43.78 ? 3135 SER A O     1 
ATOM   8975  C  CB    . SER E  3 1158 ? 39.153  -6.088  11.916  1.00 46.72 ? 3135 SER A CB    1 
ATOM   8976  O  OG    . SER E  3 1158 ? 38.100  -5.266  11.438  1.00 48.29 ? 3135 SER A OG    1 
ATOM   8977  N  N     . GLY E  3 1159 ? 39.794  -4.780  9.033   1.00 46.37 ? 3136 GLY A N     1 
ATOM   8978  C  CA    . GLY E  3 1159 ? 39.418  -4.687  7.628   1.00 46.91 ? 3136 GLY A CA    1 
ATOM   8979  C  C     . GLY E  3 1159 ? 38.023  -5.211  7.374   1.00 47.54 ? 3136 GLY A C     1 
ATOM   8980  O  O     . GLY E  3 1159 ? 37.620  -5.388  6.226   1.00 46.90 ? 3136 GLY A O     1 
ATOM   8981  N  N     . ALA E  3 1160 ? 37.282  -5.446  8.451   1.00 48.88 ? 3137 ALA A N     1 
ATOM   8982  C  CA    . ALA E  3 1160 ? 35.970  -6.082  8.370   1.00 49.30 ? 3137 ALA A CA    1 
ATOM   8983  C  C     . ALA E  3 1160 ? 34.824  -5.078  8.501   1.00 50.09 ? 3137 ALA A C     1 
ATOM   8984  O  O     . ALA E  3 1160 ? 33.694  -5.370  8.113   1.00 51.11 ? 3137 ALA A O     1 
ATOM   8985  C  CB    . ALA E  3 1160 ? 35.854  -7.167  9.418   1.00 49.23 ? 3137 ALA A CB    1 
ATOM   8986  N  N     . VAL E  3 1161 ? 35.115  -3.899  9.040   1.00 49.82 ? 3138 VAL A N     1 
ATOM   8987  C  CA    . VAL E  3 1161 ? 34.102  -2.857  9.174   1.00 49.74 ? 3138 VAL A CA    1 
ATOM   8988  C  C     . VAL E  3 1161 ? 34.308  -1.791  8.104   1.00 50.18 ? 3138 VAL A C     1 
ATOM   8989  O  O     . VAL E  3 1161 ? 35.443  -1.408  7.821   1.00 51.20 ? 3138 VAL A O     1 
ATOM   8990  C  CB    . VAL E  3 1161 ? 34.133  -2.223  10.572  1.00 49.36 ? 3138 VAL A CB    1 
ATOM   8991  C  CG1   . VAL E  3 1161 ? 32.996  -1.219  10.748  1.00 47.78 ? 3138 VAL A CG1   1 
ATOM   8992  C  CG2   . VAL E  3 1161 ? 34.046  -3.311  11.620  1.00 50.06 ? 3138 VAL A CG2   1 
ATOM   8993  N  N     . ASP E  3 1162 ? 33.206  -1.328  7.511   1.00 49.80 ? 3139 ASP A N     1 
ATOM   8994  C  CA    . ASP E  3 1162 ? 33.242  -0.368  6.407   1.00 48.67 ? 3139 ASP A CA    1 
ATOM   8995  C  C     . ASP E  3 1162 ? 33.062  1.064   6.862   1.00 47.65 ? 3139 ASP A C     1 
ATOM   8996  O  O     . ASP E  3 1162 ? 33.765  1.954   6.389   1.00 48.48 ? 3139 ASP A O     1 
ATOM   8997  C  CB    . ASP E  3 1162 ? 32.196  -0.718  5.351   1.00 49.26 ? 3139 ASP A CB    1 
ATOM   8998  C  CG    . ASP E  3 1162 ? 32.493  -2.035  4.659   1.00 51.86 ? 3139 ASP A CG    1 
ATOM   8999  O  OD1   . ASP E  3 1162 ? 33.498  -2.112  3.915   1.00 53.58 ? 3139 ASP A OD1   1 
ATOM   9000  O  OD2   . ASP E  3 1162 ? 31.727  -2.998  4.864   1.00 54.64 ? 3139 ASP A OD2   1 
ATOM   9001  N  N     . VAL E  3 1163 ? 32.110  1.297   7.761   1.00 46.33 ? 3140 VAL A N     1 
ATOM   9002  C  CA    . VAL E  3 1163 ? 31.948  2.627   8.360   1.00 44.70 ? 3140 VAL A CA    1 
ATOM   9003  C  C     . VAL E  3 1163 ? 31.802  2.555   9.872   1.00 44.78 ? 3140 VAL A C     1 
ATOM   9004  O  O     . VAL E  3 1163 ? 31.032  1.752   10.390  1.00 45.83 ? 3140 VAL A O     1 
ATOM   9005  C  CB    . VAL E  3 1163 ? 30.832  3.486   7.675   1.00 43.65 ? 3140 VAL A CB    1 
ATOM   9006  C  CG1   . VAL E  3 1163 ? 29.938  2.646   6.796   1.00 44.86 ? 3140 VAL A CG1   1 
ATOM   9007  C  CG2   . VAL E  3 1163 ? 30.020  4.277   8.676   1.00 42.67 ? 3140 VAL A CG2   1 
ATOM   9008  N  N     . ILE E  3 1164 ? 32.600  3.363   10.563  1.00 44.51 ? 3141 ILE A N     1 
ATOM   9009  C  CA    . ILE E  3 1164 ? 32.532  3.519   12.012  1.00 44.36 ? 3141 ILE A CA    1 
ATOM   9010  C  C     . ILE E  3 1164 ? 32.140  4.963   12.329  1.00 44.36 ? 3141 ILE A C     1 
ATOM   9011  O  O     . ILE E  3 1164 ? 32.724  5.913   11.792  1.00 44.07 ? 3141 ILE A O     1 
ATOM   9012  C  CB    . ILE E  3 1164 ? 33.898  3.258   12.684  1.00 44.01 ? 3141 ILE A CB    1 
ATOM   9013  C  CG1   . ILE E  3 1164 ? 34.495  1.935   12.218  1.00 44.84 ? 3141 ILE A CG1   1 
ATOM   9014  C  CG2   . ILE E  3 1164 ? 33.760  3.295   14.208  1.00 43.77 ? 3141 ILE A CG2   1 
ATOM   9015  C  CD1   . ILE E  3 1164 ? 35.957  1.744   12.610  1.00 45.35 ? 3141 ILE A CD1   1 
ATOM   9016  N  N     . VAL E  3 1165 ? 31.158  5.138   13.204  1.00 43.64 ? 3142 VAL A N     1 
ATOM   9017  C  CA    . VAL E  3 1165 ? 30.881  6.479   13.717  1.00 42.83 ? 3142 VAL A CA    1 
ATOM   9018  C  C     . VAL E  3 1165 ? 31.050  6.559   15.225  1.00 44.52 ? 3142 VAL A C     1 
ATOM   9019  O  O     . VAL E  3 1165 ? 30.614  5.666   15.960  1.00 45.59 ? 3142 VAL A O     1 
ATOM   9020  C  CB    . VAL E  3 1165 ? 29.535  7.099   13.207  1.00 41.13 ? 3142 VAL A CB    1 
ATOM   9021  C  CG1   . VAL E  3 1165 ? 28.748  6.108   12.384  1.00 42.47 ? 3142 VAL A CG1   1 
ATOM   9022  C  CG2   . VAL E  3 1165 ? 28.717  7.666   14.324  1.00 35.67 ? 3142 VAL A CG2   1 
ATOM   9023  N  N     . VAL E  3 1166 ? 31.731  7.618   15.662  1.00 45.35 ? 3143 VAL A N     1 
ATOM   9024  C  CA    . VAL E  3 1166 ? 31.923  7.916   17.072  1.00 45.75 ? 3143 VAL A CA    1 
ATOM   9025  C  C     . VAL E  3 1166 ? 30.998  9.082   17.433  1.00 47.21 ? 3143 VAL A C     1 
ATOM   9026  O  O     . VAL E  3 1166 ? 31.204  10.205  16.937  1.00 47.37 ? 3143 VAL A O     1 
ATOM   9027  C  CB    . VAL E  3 1166 ? 33.394  8.300   17.341  1.00 44.65 ? 3143 VAL A CB    1 
ATOM   9028  C  CG1   . VAL E  3 1166 ? 33.617  8.607   18.813  1.00 43.94 ? 3143 VAL A CG1   1 
ATOM   9029  C  CG2   . VAL E  3 1166 ? 34.302  7.191   16.906  1.00 43.62 ? 3143 VAL A CG2   1 
ATOM   9030  N  N     . ASP E  3 1167 ? 29.982  8.818   18.267  1.00 47.92 ? 3144 ASP A N     1 
ATOM   9031  C  CA    . ASP E  3 1167 ? 29.046  9.868   18.675  1.00 50.05 ? 3144 ASP A CA    1 
ATOM   9032  C  C     . ASP E  3 1167 ? 29.558  10.654  19.876  1.00 50.22 ? 3144 ASP A C     1 
ATOM   9033  O  O     . ASP E  3 1167 ? 29.543  10.164  21.008  1.00 47.95 ? 3144 ASP A O     1 
ATOM   9034  C  CB    . ASP E  3 1167 ? 27.636  9.350   18.933  1.00 52.01 ? 3144 ASP A CB    1 
ATOM   9035  C  CG    . ASP E  3 1167 ? 26.548  10.452  18.786  1.00 56.54 ? 3144 ASP A CG    1 
ATOM   9036  O  OD1   . ASP E  3 1167 ? 26.843  11.668  18.853  1.00 56.36 ? 3144 ASP A OD1   1 
ATOM   9037  O  OD2   . ASP E  3 1167 ? 25.363  10.092  18.608  1.00 61.29 ? 3144 ASP A OD2   1 
ATOM   9038  N  N     . SER E  3 1168 ? 29.991  11.882  19.552  1.00 51.21 ? 3145 SER A N     1 
ATOM   9039  C  CA    . SER E  3 1168 ? 30.568  12.903  20.427  1.00 51.21 ? 3145 SER A CA    1 
ATOM   9040  C  C     . SER E  3 1168 ? 31.997  12.619  20.824  1.00 50.85 ? 3145 SER A C     1 
ATOM   9041  O  O     . SER E  3 1168 ? 32.255  11.762  21.659  1.00 51.38 ? 3145 SER A O     1 
ATOM   9042  C  CB    . SER E  3 1168 ? 29.695  13.210  21.648  1.00 52.27 ? 3145 SER A CB    1 
ATOM   9043  O  OG    . SER E  3 1168 ? 28.724  14.187  21.327  1.00 54.94 ? 3145 SER A OG    1 
ATOM   9044  N  N     . VAL E  3 1169 ? 32.928  13.345  20.213  1.00 50.51 ? 3146 VAL A N     1 
ATOM   9045  C  CA    . VAL E  3 1169 ? 34.293  13.370  20.716  1.00 49.17 ? 3146 VAL A CA    1 
ATOM   9046  C  C     . VAL E  3 1169 ? 34.222  14.087  22.063  1.00 48.90 ? 3146 VAL A C     1 
ATOM   9047  O  O     . VAL E  3 1169 ? 34.969  13.780  22.979  1.00 50.81 ? 3146 VAL A O     1 
ATOM   9048  C  CB    . VAL E  3 1169 ? 35.322  14.047  19.735  1.00 48.24 ? 3146 VAL A CB    1 
ATOM   9049  C  CG1   . VAL E  3 1169 ? 34.819  14.033  18.307  1.00 46.31 ? 3146 VAL A CG1   1 
ATOM   9050  C  CG2   . VAL E  3 1169 ? 35.653  15.463  20.158  1.00 49.13 ? 3146 VAL A CG2   1 
ATOM   9051  N  N     . ALA E  3 1170 ? 33.289  15.026  22.173  1.00 47.48 ? 3147 ALA A N     1 
ATOM   9052  C  CA    . ALA E  3 1170 ? 33.030  15.739  23.406  1.00 46.70 ? 3147 ALA A CA    1 
ATOM   9053  C  C     . ALA E  3 1170 ? 32.897  14.790  24.593  1.00 46.09 ? 3147 ALA A C     1 
ATOM   9054  O  O     . ALA E  3 1170 ? 33.317  15.123  25.702  1.00 45.76 ? 3147 ALA A O     1 
ATOM   9055  C  CB    . ALA E  3 1170 ? 31.769  16.559  23.257  1.00 47.50 ? 3147 ALA A CB    1 
ATOM   9056  N  N     . ALA E  3 1171 ? 32.321  13.615  24.345  1.00 45.15 ? 3148 ALA A N     1 
ATOM   9057  C  CA    . ALA E  3 1171 ? 32.062  12.627  25.391  1.00 44.80 ? 3148 ALA A CA    1 
ATOM   9058  C  C     . ALA E  3 1171 ? 33.198  11.611  25.562  1.00 44.69 ? 3148 ALA A C     1 
ATOM   9059  O  O     . ALA E  3 1171 ? 33.139  10.749  26.433  1.00 45.92 ? 3148 ALA A O     1 
ATOM   9060  C  CB    . ALA E  3 1171 ? 30.729  11.915  25.130  1.00 44.46 ? 3148 ALA A CB    1 
ATOM   9061  N  N     . LEU E  3 1172 ? 34.225  11.708  24.728  1.00 44.16 ? 3149 LEU A N     1 
ATOM   9062  C  CA    . LEU E  3 1172 ? 35.405  10.850  24.839  1.00 43.60 ? 3149 LEU A CA    1 
ATOM   9063  C  C     . LEU E  3 1172 ? 36.266  11.233  26.045  1.00 43.71 ? 3149 LEU A C     1 
ATOM   9064  O  O     . LEU E  3 1172 ? 37.273  11.939  25.901  1.00 44.44 ? 3149 LEU A O     1 
ATOM   9065  C  CB    . LEU E  3 1172 ? 36.228  10.934  23.549  1.00 43.15 ? 3149 LEU A CB    1 
ATOM   9066  C  CG    . LEU E  3 1172 ? 36.128  9.830   22.506  1.00 43.21 ? 3149 LEU A CG    1 
ATOM   9067  C  CD1   . LEU E  3 1172 ? 34.805  9.098   22.542  1.00 44.66 ? 3149 LEU A CD1   1 
ATOM   9068  C  CD2   . LEU E  3 1172 ? 36.377  10.393  21.135  1.00 43.51 ? 3149 LEU A CD2   1 
ATOM   9069  N  N     . THR E  3 1173 ? 35.870  10.759  27.225  1.00 42.94 ? 3150 THR A N     1 
ATOM   9070  C  CA    . THR E  3 1173 ? 36.525  11.122  28.478  1.00 43.02 ? 3150 THR A CA    1 
ATOM   9071  C  C     . THR E  3 1173 ? 37.795  10.311  28.741  1.00 43.07 ? 3150 THR A C     1 
ATOM   9072  O  O     . THR E  3 1173 ? 37.732  9.096   28.877  1.00 42.29 ? 3150 THR A O     1 
ATOM   9073  C  CB    . THR E  3 1173 ? 35.579  10.929  29.670  1.00 43.74 ? 3150 THR A CB    1 
ATOM   9074  O  OG1   . THR E  3 1173 ? 34.278  11.443  29.355  1.00 42.86 ? 3150 THR A OG1   1 
ATOM   9075  C  CG2   . THR E  3 1173 ? 36.137  11.638  30.908  1.00 46.46 ? 3150 THR A CG2   1 
ATOM   9076  N  N     . PRO E  3 1174 ? 38.953  10.983  28.817  1.00 44.18 ? 3151 PRO A N     1 
ATOM   9077  C  CA    . PRO E  3 1174 ? 40.217  10.333  29.153  1.00 44.98 ? 3151 PRO A CA    1 
ATOM   9078  C  C     . PRO E  3 1174 ? 40.133  9.521   30.437  1.00 45.65 ? 3151 PRO A C     1 
ATOM   9079  O  O     . PRO E  3 1174 ? 39.377  9.875   31.354  1.00 45.93 ? 3151 PRO A O     1 
ATOM   9080  C  CB    . PRO E  3 1174 ? 41.174  11.512  29.348  1.00 45.34 ? 3151 PRO A CB    1 
ATOM   9081  C  CG    . PRO E  3 1174 ? 40.626  12.559  28.443  1.00 45.75 ? 3151 PRO A CG    1 
ATOM   9082  C  CD    . PRO E  3 1174 ? 39.136  12.423  28.563  1.00 45.36 ? 3151 PRO A CD    1 
ATOM   9083  N  N     . LYS E  3 1175 ? 40.919  8.446   30.493  1.00 46.22 ? 3152 LYS A N     1 
ATOM   9084  C  CA    . LYS E  3 1175 ? 40.905  7.507   31.614  1.00 46.08 ? 3152 LYS A CA    1 
ATOM   9085  C  C     . LYS E  3 1175 ? 41.247  8.184   32.934  1.00 45.54 ? 3152 LYS A C     1 
ATOM   9086  O  O     . LYS E  3 1175 ? 40.603  7.929   33.949  1.00 46.20 ? 3152 LYS A O     1 
ATOM   9087  C  CB    . LYS E  3 1175 ? 41.864  6.347   31.350  1.00 46.39 ? 3152 LYS A CB    1 
ATOM   9088  C  CG    . LYS E  3 1175 ? 41.729  5.196   32.321  1.00 48.90 ? 3152 LYS A CG    1 
ATOM   9089  C  CD    . LYS E  3 1175 ? 42.396  3.948   31.777  1.00 53.26 ? 3152 LYS A CD    1 
ATOM   9090  C  CE    . LYS E  3 1175 ? 42.034  2.706   32.598  1.00 56.20 ? 3152 LYS A CE    1 
ATOM   9091  N  NZ    . LYS E  3 1175 ? 42.798  2.635   33.882  1.00 55.55 ? 3152 LYS A NZ    1 
ATOM   9092  N  N     . ALA E  3 1176 ? 42.252  9.054   32.905  1.00 44.65 ? 3153 ALA A N     1 
ATOM   9093  C  CA    . ALA E  3 1176 ? 42.691  9.767   34.091  1.00 44.47 ? 3153 ALA A CA    1 
ATOM   9094  C  C     . ALA E  3 1176 ? 41.606  10.688  34.632  1.00 45.16 ? 3153 ALA A C     1 
ATOM   9095  O  O     . ALA E  3 1176 ? 41.499  10.871  35.842  1.00 45.99 ? 3153 ALA A O     1 
ATOM   9096  C  CB    . ALA E  3 1176 ? 43.954  10.540  33.802  1.00 44.26 ? 3153 ALA A CB    1 
ATOM   9097  N  N     . GLU E  3 1177 ? 40.801  11.249  33.735  1.00 46.00 ? 3154 GLU A N     1 
ATOM   9098  C  CA    . GLU E  3 1177 ? 39.704  12.135  34.116  1.00 47.52 ? 3154 GLU A CA    1 
ATOM   9099  C  C     . GLU E  3 1177 ? 38.591  11.353  34.804  1.00 47.56 ? 3154 GLU A C     1 
ATOM   9100  O  O     . GLU E  3 1177 ? 38.022  11.830  35.808  1.00 48.49 ? 3154 GLU A O     1 
ATOM   9101  C  CB    . GLU E  3 1177 ? 39.158  12.889  32.897  1.00 48.41 ? 3154 GLU A CB    1 
ATOM   9102  C  CG    . GLU E  3 1177 ? 38.188  14.021  33.233  1.00 50.38 ? 3154 GLU A CG    1 
ATOM   9103  C  CD    . GLU E  3 1177 ? 38.109  15.074  32.134  1.00 52.24 ? 3154 GLU A CD    1 
ATOM   9104  O  OE1   . GLU E  3 1177 ? 38.178  16.276  32.460  1.00 53.50 ? 3154 GLU A OE1   1 
ATOM   9105  O  OE2   . GLU E  3 1177 ? 37.979  14.708  30.946  1.00 52.59 ? 3154 GLU A OE2   1 
ATOM   9106  N  N     . ILE E  3 1178 ? 38.298  10.163  34.254  1.00 46.28 ? 3155 ILE A N     1 
ATOM   9107  C  CA    . ILE E  3 1178 ? 37.279  9.280   34.806  1.00 45.60 ? 3155 ILE A CA    1 
ATOM   9108  C  C     . ILE E  3 1178 ? 37.663  8.804   36.186  1.00 46.02 ? 3155 ILE A C     1 
ATOM   9109  O  O     . ILE E  3 1178 ? 36.840  8.820   37.079  1.00 46.32 ? 3155 ILE A O     1 
ATOM   9110  C  CB    . ILE E  3 1178 ? 36.966  8.101   33.873  1.00 44.66 ? 3155 ILE A CB    1 
ATOM   9111  C  CG1   . ILE E  3 1178 ? 35.895  8.539   32.888  1.00 44.29 ? 3155 ILE A CG1   1 
ATOM   9112  C  CG2   . ILE E  3 1178 ? 36.460  6.891   34.655  1.00 45.10 ? 3155 ILE A CG2   1 
ATOM   9113  C  CD1   . ILE E  3 1178 ? 35.844  7.741   31.648  1.00 47.16 ? 3155 ILE A CD1   1 
ATOM   9114  N  N     . GLU E  3 1179 ? 38.919  8.405   36.356  1.00 47.57 ? 3156 GLU A N     1 
ATOM   9115  C  CA    . GLU E  3 1179 ? 39.412  7.947   37.652  1.00 49.09 ? 3156 GLU A CA    1 
ATOM   9116  C  C     . GLU E  3 1179 ? 39.656  9.099   38.619  1.00 49.32 ? 3156 GLU A C     1 
ATOM   9117  O  O     . GLU E  3 1179 ? 39.556  8.926   39.834  1.00 48.81 ? 3156 GLU A O     1 
ATOM   9118  C  CB    . GLU E  3 1179 ? 40.673  7.115   37.470  1.00 50.13 ? 3156 GLU A CB    1 
ATOM   9119  C  CG    . GLU E  3 1179 ? 40.382  5.688   37.019  1.00 53.81 ? 3156 GLU A CG    1 
ATOM   9120  C  CD    . GLU E  3 1179 ? 41.596  4.990   36.424  1.00 55.64 ? 3156 GLU A CD    1 
ATOM   9121  O  OE1   . GLU E  3 1179 ? 41.913  3.868   36.880  1.00 57.22 ? 3156 GLU A OE1   1 
ATOM   9122  O  OE2   . GLU E  3 1179 ? 42.231  5.559   35.509  1.00 55.52 ? 3156 GLU A OE2   1 
ATOM   9123  N  N     . GLY E  3 1180 ? 39.968  10.273  38.069  1.00 50.21 ? 3157 GLY A N     1 
ATOM   9124  C  CA    . GLY E  3 1180 ? 40.118  11.504  38.853  1.00 50.04 ? 3157 GLY A CA    1 
ATOM   9125  C  C     . GLY E  3 1180 ? 38.787  12.028  39.363  1.00 49.87 ? 3157 GLY A C     1 
ATOM   9126  O  O     . GLY E  3 1180 ? 37.730  11.485  39.034  1.00 50.52 ? 3157 GLY A O     1 
ATOM   9127  N  N     . GLU E  3 1181 ? 38.837  13.077  40.179  1.00 49.06 ? 3158 GLU A N     1 
ATOM   9128  C  CA    . GLU E  3 1181 ? 37.627  13.700  40.712  1.00 47.87 ? 3158 GLU A CA    1 
ATOM   9129  C  C     . GLU E  3 1181 ? 37.103  14.818  39.813  1.00 46.83 ? 3158 GLU A C     1 
ATOM   9130  O  O     . GLU E  3 1181 ? 37.799  15.265  38.895  1.00 46.89 ? 3158 GLU A O     1 
ATOM   9131  C  CB    . GLU E  3 1181 ? 37.889  14.233  42.111  1.00 48.06 ? 3158 GLU A CB    1 
ATOM   9132  C  CG    . GLU E  3 1181 ? 37.798  13.178  43.166  1.00 50.00 ? 3158 GLU A CG    1 
ATOM   9133  C  CD    . GLU E  3 1181 ? 37.668  13.772  44.548  1.00 52.29 ? 3158 GLU A CD    1 
ATOM   9134  O  OE1   . GLU E  3 1181 ? 36.573  13.654  45.143  1.00 54.32 ? 3158 GLU A OE1   1 
ATOM   9135  O  OE2   . GLU E  3 1181 ? 38.655  14.366  45.035  1.00 52.69 ? 3158 GLU A OE2   1 
ATOM   9136  N  N     . ILE E  3 1182 ? 35.872  15.255  40.071  1.00 45.52 ? 3159 ILE A N     1 
ATOM   9137  C  CA    . ILE E  3 1182 ? 35.318  16.406  39.368  1.00 45.38 ? 3159 ILE A CA    1 
ATOM   9138  C  C     . ILE E  3 1182 ? 35.941  17.656  39.951  1.00 45.09 ? 3159 ILE A C     1 
ATOM   9139  O  O     . ILE E  3 1182 ? 35.835  17.908  41.157  1.00 45.24 ? 3159 ILE A O     1 
ATOM   9140  C  CB    . ILE E  3 1182 ? 33.775  16.461  39.434  1.00 45.62 ? 3159 ILE A CB    1 
ATOM   9141  C  CG1   . ILE E  3 1182 ? 33.181  15.435  38.468  1.00 47.10 ? 3159 ILE A CG1   1 
ATOM   9142  C  CG2   . ILE E  3 1182 ? 33.258  17.837  39.037  1.00 45.55 ? 3159 ILE A CG2   1 
ATOM   9143  C  CD1   . ILE E  3 1182 ? 31.720  15.100  38.710  1.00 48.36 ? 3159 ILE A CD1   1 
ATOM   9144  N  N     . GLY E  3 1183 ? 36.606  18.419  39.087  1.00 44.45 ? 3160 GLY A N     1 
ATOM   9145  C  CA    . GLY E  3 1183 ? 37.336  19.609  39.504  1.00 44.25 ? 3160 GLY A CA    1 
ATOM   9146  C  C     . GLY E  3 1183 ? 38.828  19.437  39.319  1.00 43.82 ? 3160 GLY A C     1 
ATOM   9147  O  O     . GLY E  3 1183 ? 39.571  20.415  39.345  1.00 43.75 ? 3160 GLY A O     1 
ATOM   9148  N  N     . ASP E  3 1184 ? 39.263  18.189  39.141  1.00 43.50 ? 3161 ASP A N     1 
ATOM   9149  C  CA    . ASP E  3 1184 ? 40.654  17.891  38.817  1.00 43.23 ? 3161 ASP A CA    1 
ATOM   9150  C  C     . ASP E  3 1184 ? 41.014  18.476  37.463  1.00 42.75 ? 3161 ASP A C     1 
ATOM   9151  O  O     . ASP E  3 1184 ? 40.220  18.461  36.529  1.00 41.85 ? 3161 ASP A O     1 
ATOM   9152  C  CB    . ASP E  3 1184 ? 40.913  16.386  38.812  1.00 43.85 ? 3161 ASP A CB    1 
ATOM   9153  C  CG    . ASP E  3 1184 ? 41.024  15.804  40.209  1.00 45.39 ? 3161 ASP A CG    1 
ATOM   9154  O  OD1   . ASP E  3 1184 ? 41.005  16.574  41.196  1.00 45.42 ? 3161 ASP A OD1   1 
ATOM   9155  O  OD2   . ASP E  3 1184 ? 41.134  14.562  40.318  1.00 47.72 ? 3161 ASP A OD2   1 
ATOM   9156  N  N     . SER E  3 1185 ? 42.226  18.997  37.373  1.00 43.11 ? 3162 SER A N     1 
ATOM   9157  C  CA    . SER E  3 1185 ? 42.681  19.649  36.168  1.00 43.47 ? 3162 SER A CA    1 
ATOM   9158  C  C     . SER E  3 1185 ? 43.483  18.674  35.311  1.00 42.77 ? 3162 SER A C     1 
ATOM   9159  O  O     . SER E  3 1185 ? 44.453  18.082  35.779  1.00 42.35 ? 3162 SER A O     1 
ATOM   9160  C  CB    . SER E  3 1185 ? 43.520  20.872  36.539  1.00 44.20 ? 3162 SER A CB    1 
ATOM   9161  O  OG    . SER E  3 1185 ? 43.849  21.621  35.383  1.00 47.38 ? 3162 SER A OG    1 
ATOM   9162  N  N     . HIS E  3 1186 ? 43.064  18.503  34.062  1.00 42.72 ? 3163 HIS A N     1 
ATOM   9163  C  CA    . HIS E  3 1186 ? 43.764  17.625  33.126  1.00 42.96 ? 3163 HIS A CA    1 
ATOM   9164  C  C     . HIS E  3 1186 ? 44.133  18.392  31.868  1.00 43.35 ? 3163 HIS A C     1 
ATOM   9165  O  O     . HIS E  3 1186 ? 43.628  18.105  30.788  1.00 44.38 ? 3163 HIS A O     1 
ATOM   9166  C  CB    . HIS E  3 1186 ? 42.906  16.408  32.760  1.00 42.71 ? 3163 HIS A CB    1 
ATOM   9167  C  CG    . HIS E  3 1186 ? 42.415  15.644  33.941  1.00 42.58 ? 3163 HIS A CG    1 
ATOM   9168  N  ND1   . HIS E  3 1186 ? 43.263  14.974  34.794  1.00 42.97 ? 3163 HIS A ND1   1 
ATOM   9169  C  CD2   . HIS E  3 1186 ? 41.166  15.452  34.420  1.00 43.96 ? 3163 HIS A CD2   1 
ATOM   9170  C  CE1   . HIS E  3 1186 ? 42.556  14.404  35.753  1.00 45.23 ? 3163 HIS A CE1   1 
ATOM   9171  N  NE2   . HIS E  3 1186 ? 41.280  14.679  35.548  1.00 46.47 ? 3163 HIS A NE2   1 
ATOM   9172  N  N     . MET E  3 1187 ? 45.018  19.367  32.011  1.00 43.59 ? 3164 MET A N     1 
ATOM   9173  C  CA    . MET E  3 1187 ? 45.382  20.245  30.905  1.00 44.23 ? 3164 MET A CA    1 
ATOM   9174  C  C     . MET E  3 1187 ? 45.746  19.506  29.626  1.00 42.26 ? 3164 MET A C     1 
ATOM   9175  O  O     . MET E  3 1187 ? 46.624  18.645  29.605  1.00 40.84 ? 3164 MET A O     1 
ATOM   9176  C  CB    . MET E  3 1187 ? 46.525  21.167  31.317  1.00 44.32 ? 3164 MET A CB    1 
ATOM   9177  C  CG    . MET E  3 1187 ? 46.093  22.365  32.092  1.00 44.81 ? 3164 MET A CG    1 
ATOM   9178  S  SD    . MET E  3 1187 ? 47.570  23.049  32.845  1.00 49.15 ? 3164 MET A SD    1 
ATOM   9179  C  CE    . MET E  3 1187 ? 48.035  24.332  31.696  1.00 50.49 ? 3164 MET A CE    1 
ATOM   9180  N  N     . GLY E  3 1188 ? 45.042  19.854  28.561  1.00 42.84 ? 3165 GLY A N     1 
ATOM   9181  C  CA    . GLY E  3 1188 ? 45.279  19.284  27.237  1.00 44.18 ? 3165 GLY A CA    1 
ATOM   9182  C  C     . GLY E  3 1188 ? 45.280  17.769  27.079  1.00 44.25 ? 3165 GLY A C     1 
ATOM   9183  O  O     . GLY E  3 1188 ? 45.768  17.277  26.069  1.00 45.44 ? 3165 GLY A O     1 
ATOM   9184  N  N     . LEU E  3 1189 ? 44.724  17.030  28.042  1.00 43.29 ? 3166 LEU A N     1 
ATOM   9185  C  CA    . LEU E  3 1189 ? 44.765  15.573  28.003  1.00 42.13 ? 3166 LEU A CA    1 
ATOM   9186  C  C     . LEU E  3 1189 ? 43.942  15.017  26.863  1.00 42.19 ? 3166 LEU A C     1 
ATOM   9187  O  O     . LEU E  3 1189 ? 44.433  14.190  26.099  1.00 41.84 ? 3166 LEU A O     1 
ATOM   9188  C  CB    . LEU E  3 1189 ? 44.273  14.963  29.308  1.00 42.70 ? 3166 LEU A CB    1 
ATOM   9189  C  CG    . LEU E  3 1189 ? 44.984  13.714  29.851  1.00 42.82 ? 3166 LEU A CG    1 
ATOM   9190  C  CD1   . LEU E  3 1189 ? 44.204  13.172  31.014  1.00 42.62 ? 3166 LEU A CD1   1 
ATOM   9191  C  CD2   . LEU E  3 1189 ? 45.175  12.627  28.821  1.00 44.76 ? 3166 LEU A CD2   1 
ATOM   9192  N  N     . ALA E  3 1190 ? 42.694  15.465  26.751  1.00 43.01 ? 3167 ALA A N     1 
ATOM   9193  C  CA    . ALA E  3 1190 ? 41.801  14.982  25.692  1.00 43.48 ? 3167 ALA A CA    1 
ATOM   9194  C  C     . ALA E  3 1190 ? 42.345  15.380  24.349  1.00 44.78 ? 3167 ALA A C     1 
ATOM   9195  O  O     . ALA E  3 1190 ? 42.271  14.612  23.397  1.00 46.95 ? 3167 ALA A O     1 
ATOM   9196  C  CB    . ALA E  3 1190 ? 40.395  15.528  25.858  1.00 42.97 ? 3167 ALA A CB    1 
ATOM   9197  N  N     . ALA E  3 1191 ? 42.891  16.590  24.281  1.00 45.96 ? 3168 ALA A N     1 
ATOM   9198  C  CA    . ALA E  3 1191 ? 43.458  17.100  23.043  1.00 45.87 ? 3168 ALA A CA    1 
ATOM   9199  C  C     . ALA E  3 1191 ? 44.626  16.232  22.611  1.00 45.71 ? 3168 ALA A C     1 
ATOM   9200  O  O     . ALA E  3 1191 ? 44.736  15.858  21.450  1.00 45.74 ? 3168 ALA A O     1 
ATOM   9201  C  CB    . ALA E  3 1191 ? 43.905  18.534  23.229  1.00 46.31 ? 3168 ALA A CB    1 
ATOM   9202  N  N     . ARG E  3 1192 ? 45.481  15.907  23.572  1.00 45.88 ? 3169 ARG A N     1 
ATOM   9203  C  CA    . ARG E  3 1192 ? 46.687  15.137  23.333  1.00 46.37 ? 3169 ARG A CA    1 
ATOM   9204  C  C     . ARG E  3 1192 ? 46.331  13.708  22.961  1.00 46.71 ? 3169 ARG A C     1 
ATOM   9205  O  O     . ARG E  3 1192 ? 47.010  13.096  22.143  1.00 47.69 ? 3169 ARG A O     1 
ATOM   9206  C  CB    . ARG E  3 1192 ? 47.571  15.179  24.576  1.00 45.93 ? 3169 ARG A CB    1 
ATOM   9207  C  CG    . ARG E  3 1192 ? 49.022  14.840  24.350  1.00 46.53 ? 3169 ARG A CG    1 
ATOM   9208  C  CD    . ARG E  3 1192 ? 49.912  15.331  25.507  1.00 48.50 ? 3169 ARG A CD    1 
ATOM   9209  N  NE    . ARG E  3 1192 ? 49.423  14.936  26.835  1.00 49.88 ? 3169 ARG A NE    1 
ATOM   9210  C  CZ    . ARG E  3 1192 ? 48.849  15.766  27.702  1.00 50.37 ? 3169 ARG A CZ    1 
ATOM   9211  N  NH1   . ARG E  3 1192 ? 48.690  17.047  27.392  1.00 51.79 ? 3169 ARG A NH1   1 
ATOM   9212  N  NH2   . ARG E  3 1192 ? 48.431  15.317  28.875  1.00 49.47 ? 3169 ARG A NH2   1 
ATOM   9213  N  N     . MET E  3 1193 ? 45.262  13.198  23.563  1.00 47.17 ? 3170 MET A N     1 
ATOM   9214  C  CA    . MET E  3 1193 ? 44.741  11.862  23.281  1.00 49.09 ? 3170 MET A CA    1 
ATOM   9215  C  C     . MET E  3 1193 ? 44.178  11.784  21.863  1.00 48.90 ? 3170 MET A C     1 
ATOM   9216  O  O     . MET E  3 1193 ? 44.440  10.831  21.138  1.00 49.52 ? 3170 MET A O     1 
ATOM   9217  C  CB    . MET E  3 1193 ? 43.657  11.493  24.299  1.00 49.52 ? 3170 MET A CB    1 
ATOM   9218  C  CG    . MET E  3 1193 ? 42.877  10.230  23.976  1.00 48.47 ? 3170 MET A CG    1 
ATOM   9219  S  SD    . MET E  3 1193 ? 41.320  10.173  24.856  1.00 52.57 ? 3170 MET A SD    1 
ATOM   9220  C  CE    . MET E  3 1193 ? 40.320  11.331  23.930  1.00 48.35 ? 3170 MET A CE    1 
ATOM   9221  N  N     . MET E  3 1194 ? 43.402  12.793  21.480  1.00 48.54 ? 3171 MET A N     1 
ATOM   9222  C  CA    . MET E  3 1194 ? 42.860  12.909  20.131  1.00 47.61 ? 3171 MET A CA    1 
ATOM   9223  C  C     . MET E  3 1194 ? 43.974  13.002  19.099  1.00 46.87 ? 3171 MET A C     1 
ATOM   9224  O  O     . MET E  3 1194 ? 43.919  12.397  18.029  1.00 46.81 ? 3171 MET A O     1 
ATOM   9225  C  CB    . MET E  3 1194 ? 42.008  14.171  20.035  1.00 48.01 ? 3171 MET A CB    1 
ATOM   9226  C  CG    . MET E  3 1194 ? 40.593  14.018  20.504  1.00 49.93 ? 3171 MET A CG    1 
ATOM   9227  S  SD    . MET E  3 1194 ? 39.711  12.967  19.356  1.00 53.71 ? 3171 MET A SD    1 
ATOM   9228  C  CE    . MET E  3 1194 ? 39.543  11.503  20.363  1.00 57.16 ? 3171 MET A CE    1 
ATOM   9229  N  N     . SER E  3 1195 ? 44.989  13.783  19.433  1.00 46.40 ? 3172 SER A N     1 
ATOM   9230  C  CA    . SER E  3 1195 ? 46.125  13.998  18.561  1.00 45.29 ? 3172 SER A CA    1 
ATOM   9231  C  C     . SER E  3 1195 ? 46.832  12.666  18.309  1.00 44.66 ? 3172 SER A C     1 
ATOM   9232  O  O     . SER E  3 1195 ? 47.218  12.364  17.175  1.00 44.66 ? 3172 SER A O     1 
ATOM   9233  C  CB    . SER E  3 1195 ? 47.069  15.028  19.191  1.00 44.75 ? 3172 SER A CB    1 
ATOM   9234  O  OG    . SER E  3 1195 ? 47.869  15.645  18.210  1.00 45.69 ? 3172 SER A OG    1 
ATOM   9235  N  N     . GLN E  3 1196 ? 46.971  11.865  19.366  1.00 43.37 ? 3173 GLN A N     1 
ATOM   9236  C  CA    . GLN E  3 1196 ? 47.574  10.546  19.259  1.00 41.94 ? 3173 GLN A CA    1 
ATOM   9237  C  C     . GLN E  3 1196 ? 46.713  9.603   18.434  1.00 42.34 ? 3173 GLN A C     1 
ATOM   9238  O  O     . GLN E  3 1196 ? 47.232  8.860   17.597  1.00 43.03 ? 3173 GLN A O     1 
ATOM   9239  C  CB    . GLN E  3 1196 ? 47.813  9.954   20.635  1.00 41.45 ? 3173 GLN A CB    1 
ATOM   9240  C  CG    . GLN E  3 1196 ? 48.525  8.620   20.614  1.00 41.62 ? 3173 GLN A CG    1 
ATOM   9241  C  CD    . GLN E  3 1196 ? 48.781  8.068   21.999  1.00 42.09 ? 3173 GLN A CD    1 
ATOM   9242  O  OE1   . GLN E  3 1196 ? 49.853  7.522   22.266  1.00 44.83 ? 3173 GLN A OE1   1 
ATOM   9243  N  NE2   . GLN E  3 1196 ? 47.809  8.217   22.895  1.00 41.09 ? 3173 GLN A NE2   1 
ATOM   9244  N  N     . ALA E  3 1197 ? 45.402  9.638   18.673  1.00 42.10 ? 3174 ALA A N     1 
ATOM   9245  C  CA    . ALA E  3 1197 ? 44.450  8.796   17.953  1.00 40.95 ? 3174 ALA A CA    1 
ATOM   9246  C  C     . ALA E  3 1197 ? 44.556  9.004   16.438  1.00 42.04 ? 3174 ALA A C     1 
ATOM   9247  O  O     . ALA E  3 1197 ? 44.668  8.033   15.682  1.00 42.42 ? 3174 ALA A O     1 
ATOM   9248  C  CB    . ALA E  3 1197 ? 43.050  9.065   18.431  1.00 39.24 ? 3174 ALA A CB    1 
ATOM   9249  N  N     . MET E  3 1198 ? 44.557  10.263  15.998  1.00 42.26 ? 3175 MET A N     1 
ATOM   9250  C  CA    . MET E  3 1198 ? 44.624  10.559  14.573  1.00 43.70 ? 3175 MET A CA    1 
ATOM   9251  C  C     . MET E  3 1198 ? 45.847  9.927   13.927  1.00 44.60 ? 3175 MET A C     1 
ATOM   9252  O  O     . MET E  3 1198 ? 45.734  9.288   12.887  1.00 44.92 ? 3175 MET A O     1 
ATOM   9253  C  CB    . MET E  3 1198 ? 44.628  12.058  14.314  1.00 44.05 ? 3175 MET A CB    1 
ATOM   9254  C  CG    . MET E  3 1198 ? 43.445  12.813  14.847  1.00 45.15 ? 3175 MET A CG    1 
ATOM   9255  S  SD    . MET E  3 1198 ? 41.898  12.158  14.273  1.00 50.30 ? 3175 MET A SD    1 
ATOM   9256  C  CE    . MET E  3 1198 ? 41.279  11.334  15.762  1.00 50.45 ? 3175 MET A CE    1 
ATOM   9257  N  N     . ARG E  3 1199 ? 47.009  10.108  14.551  1.00 45.89 ? 3176 ARG A N     1 
ATOM   9258  C  CA    . ARG E  3 1199 ? 48.262  9.526   14.062  1.00 46.95 ? 3176 ARG A CA    1 
ATOM   9259  C  C     . ARG E  3 1199 ? 48.135  8.041   13.802  1.00 47.52 ? 3176 ARG A C     1 
ATOM   9260  O  O     . ARG E  3 1199 ? 48.488  7.575   12.720  1.00 48.71 ? 3176 ARG A O     1 
ATOM   9261  C  CB    . ARG E  3 1199 ? 49.383  9.755   15.062  1.00 47.09 ? 3176 ARG A CB    1 
ATOM   9262  C  CG    . ARG E  3 1199 ? 50.089  11.076  14.903  1.00 48.68 ? 3176 ARG A CG    1 
ATOM   9263  C  CD    . ARG E  3 1199 ? 51.134  11.250  15.982  1.00 49.57 ? 3176 ARG A CD    1 
ATOM   9264  N  NE    . ARG E  3 1199 ? 50.512  11.496  17.278  1.00 50.57 ? 3176 ARG A NE    1 
ATOM   9265  C  CZ    . ARG E  3 1199 ? 51.171  11.592  18.425  1.00 51.32 ? 3176 ARG A CZ    1 
ATOM   9266  N  NH1   . ARG E  3 1199 ? 52.499  11.464  18.457  1.00 53.09 ? 3176 ARG A NH1   1 
ATOM   9267  N  NH2   . ARG E  3 1199 ? 50.498  11.819  19.545  1.00 50.60 ? 3176 ARG A NH2   1 
ATOM   9268  N  N     . LYS E  3 1200 ? 47.619  7.316   14.793  1.00 47.57 ? 3177 LYS A N     1 
ATOM   9269  C  CA    . LYS E  3 1200 ? 47.420  5.868   14.697  1.00 48.64 ? 3177 LYS A CA    1 
ATOM   9270  C  C     . LYS E  3 1200 ? 46.294  5.448   13.733  1.00 48.20 ? 3177 LYS A C     1 
ATOM   9271  O  O     . LYS E  3 1200 ? 46.430  4.468   13.001  1.00 48.62 ? 3177 LYS A O     1 
ATOM   9272  C  CB    . LYS E  3 1200 ? 47.155  5.268   16.079  1.00 49.57 ? 3177 LYS A CB    1 
ATOM   9273  C  CG    . LYS E  3 1200 ? 48.294  5.433   17.077  1.00 51.03 ? 3177 LYS A CG    1 
ATOM   9274  C  CD    . LYS E  3 1200 ? 48.138  4.481   18.253  1.00 51.00 ? 3177 LYS A CD    1 
ATOM   9275  C  CE    . LYS E  3 1200 ? 48.164  3.033   17.782  1.00 53.08 ? 3177 LYS A CE    1 
ATOM   9276  N  NZ    . LYS E  3 1200 ? 47.538  2.109   18.775  1.00 54.94 ? 3177 LYS A NZ    1 
ATOM   9277  N  N     . LEU E  3 1201 ? 45.192  6.185   13.732  1.00 46.76 ? 3178 LEU A N     1 
ATOM   9278  C  CA    . LEU E  3 1201 ? 44.045  5.797   12.929  1.00 47.27 ? 3178 LEU A CA    1 
ATOM   9279  C  C     . LEU E  3 1201 ? 44.204  6.038   11.424  1.00 47.48 ? 3178 LEU A C     1 
ATOM   9280  O  O     . LEU E  3 1201 ? 43.899  5.163   10.621  1.00 47.64 ? 3178 LEU A O     1 
ATOM   9281  C  CB    . LEU E  3 1201 ? 42.772  6.480   13.435  1.00 47.25 ? 3178 LEU A CB    1 
ATOM   9282  C  CG    . LEU E  3 1201 ? 42.221  6.005   14.771  1.00 46.52 ? 3178 LEU A CG    1 
ATOM   9283  C  CD1   . LEU E  3 1201 ? 41.137  6.952   15.219  1.00 47.29 ? 3178 LEU A CD1   1 
ATOM   9284  C  CD2   . LEU E  3 1201 ? 41.696  4.593   14.680  1.00 46.86 ? 3178 LEU A CD2   1 
ATOM   9285  N  N     . ALA E  3 1202 ? 44.665  7.230   11.054  1.00 47.86 ? 3179 ALA A N     1 
ATOM   9286  C  CA    . ALA E  3 1202 ? 44.740  7.656   9.655   1.00 48.01 ? 3179 ALA A CA    1 
ATOM   9287  C  C     . ALA E  3 1202 ? 45.228  6.544   8.731   1.00 48.67 ? 3179 ALA A C     1 
ATOM   9288  O  O     . ALA E  3 1202 ? 44.576  6.241   7.729   1.00 49.14 ? 3179 ALA A O     1 
ATOM   9289  C  CB    . ALA E  3 1202 ? 45.628  8.884   9.519   1.00 47.38 ? 3179 ALA A CB    1 
ATOM   9290  N  N     . GLY E  3 1203 ? 46.360  5.937   9.089   1.00 48.80 ? 3180 GLY A N     1 
ATOM   9291  C  CA    . GLY E  3 1203 ? 46.966  4.881   8.290   1.00 48.50 ? 3180 GLY A CA    1 
ATOM   9292  C  C     . GLY E  3 1203 ? 46.131  3.615   8.220   1.00 48.79 ? 3180 GLY A C     1 
ATOM   9293  O  O     . GLY E  3 1203 ? 45.924  3.063   7.138   1.00 48.51 ? 3180 GLY A O     1 
ATOM   9294  N  N     . ASN E  3 1204 ? 45.654  3.154   9.376   1.00 49.57 ? 3181 ASN A N     1 
ATOM   9295  C  CA    . ASN E  3 1204 ? 44.831  1.941   9.465   1.00 50.02 ? 3181 ASN A CA    1 
ATOM   9296  C  C     . ASN E  3 1204 ? 43.521  2.063   8.722   1.00 49.14 ? 3181 ASN A C     1 
ATOM   9297  O  O     . ASN E  3 1204 ? 43.027  1.090   8.174   1.00 50.33 ? 3181 ASN A O     1 
ATOM   9298  C  CB    . ASN E  3 1204 ? 44.543  1.562   10.920  1.00 50.66 ? 3181 ASN A CB    1 
ATOM   9299  C  CG    . ASN E  3 1204 ? 45.757  0.976   11.630  1.00 54.09 ? 3181 ASN A CG    1 
ATOM   9300  O  OD1   . ASN E  3 1204 ? 45.740  0.802   12.853  1.00 57.34 ? 3181 ASN A OD1   1 
ATOM   9301  N  ND2   . ASN E  3 1204 ? 46.813  0.661   10.871  1.00 52.79 ? 3181 ASN A ND2   1 
ATOM   9302  N  N     . LEU E  3 1205 ? 42.962  3.263   8.712   1.00 47.88 ? 3182 LEU A N     1 
ATOM   9303  C  CA    . LEU E  3 1205 ? 41.692  3.503   8.065   1.00 47.33 ? 3182 LEU A CA    1 
ATOM   9304  C  C     . LEU E  3 1205 ? 41.829  3.473   6.565   1.00 47.88 ? 3182 LEU A C     1 
ATOM   9305  O  O     . LEU E  3 1205 ? 40.962  2.947   5.885   1.00 48.51 ? 3182 LEU A O     1 
ATOM   9306  C  CB    . LEU E  3 1205 ? 41.101  4.829   8.522   1.00 47.30 ? 3182 LEU A CB    1 
ATOM   9307  C  CG    . LEU E  3 1205 ? 40.520  4.822   9.935   1.00 47.01 ? 3182 LEU A CG    1 
ATOM   9308  C  CD1   . LEU E  3 1205 ? 40.434  6.223   10.460  1.00 47.39 ? 3182 LEU A CD1   1 
ATOM   9309  C  CD2   . LEU E  3 1205 ? 39.151  4.158   9.958   1.00 48.12 ? 3182 LEU A CD2   1 
ATOM   9310  N  N     . LYS E  3 1206 ? 42.919  4.034   6.053   1.00 49.05 ? 3183 LYS A N     1 
ATOM   9311  C  CA    . LYS E  3 1206 ? 43.153  4.073   4.620   1.00 50.15 ? 3183 LYS A CA    1 
ATOM   9312  C  C     . LYS E  3 1206 ? 43.399  2.664   4.094   1.00 50.30 ? 3183 LYS A C     1 
ATOM   9313  O  O     . LYS E  3 1206 ? 42.796  2.270   3.094   1.00 50.79 ? 3183 LYS A O     1 
ATOM   9314  C  CB    . LYS E  3 1206 ? 44.294  5.047   4.270   1.00 51.34 ? 3183 LYS A CB    1 
ATOM   9315  C  CG    . LYS E  3 1206 ? 44.777  5.056   2.791   1.00 57.24 ? 3183 LYS A CG    1 
ATOM   9316  C  CD    . LYS E  3 1206 ? 43.641  5.141   1.734   1.00 61.27 ? 3183 LYS A CD    1 
ATOM   9317  C  CE    . LYS E  3 1206 ? 42.928  6.493   1.724   1.00 61.24 ? 3183 LYS A CE    1 
ATOM   9318  N  NZ    . LYS E  3 1206 ? 43.687  7.478   0.912   1.00 62.23 ? 3183 LYS A NZ    1 
ATOM   9319  N  N     . GLN E  3 1207 ? 44.246  1.896   4.777   1.00 50.75 ? 3184 GLN A N     1 
ATOM   9320  C  CA    . GLN E  3 1207 ? 44.579  0.545   4.320   1.00 51.66 ? 3184 GLN A CA    1 
ATOM   9321  C  C     . GLN E  3 1207 ? 43.425  -0.441  4.402   1.00 49.88 ? 3184 GLN A C     1 
ATOM   9322  O  O     . GLN E  3 1207 ? 43.453  -1.472  3.747   1.00 50.35 ? 3184 GLN A O     1 
ATOM   9323  C  CB    . GLN E  3 1207 ? 45.829  0.006   5.017   1.00 53.74 ? 3184 GLN A CB    1 
ATOM   9324  C  CG    . GLN E  3 1207 ? 47.093  0.142   4.143   1.00 61.70 ? 3184 GLN A CG    1 
ATOM   9325  C  CD    . GLN E  3 1207 ? 48.363  0.438   4.950   1.00 67.52 ? 3184 GLN A CD    1 
ATOM   9326  O  OE1   . GLN E  3 1207 ? 48.870  -0.428  5.680   1.00 68.57 ? 3184 GLN A OE1   1 
ATOM   9327  N  NE2   . GLN E  3 1207 ? 48.887  1.671   4.814   1.00 68.33 ? 3184 GLN A NE2   1 
ATOM   9328  N  N     . SER E  3 1208 ? 42.408  -0.107  5.184   1.00 48.68 ? 3185 SER A N     1 
ATOM   9329  C  CA    . SER E  3 1208 ? 41.226  -0.943  5.332   1.00 48.41 ? 3185 SER A CA    1 
ATOM   9330  C  C     . SER E  3 1208 ? 40.050  -0.395  4.558   1.00 48.13 ? 3185 SER A C     1 
ATOM   9331  O  O     . SER E  3 1208 ? 38.995  -1.017  4.494   1.00 49.06 ? 3185 SER A O     1 
ATOM   9332  C  CB    . SER E  3 1208 ? 40.833  -1.023  6.793   1.00 48.78 ? 3185 SER A CB    1 
ATOM   9333  O  OG    . SER E  3 1208 ? 41.899  -1.546  7.553   1.00 53.26 ? 3185 SER A OG    1 
ATOM   9334  N  N     . ASN E  3 1209 ? 40.236  0.780   3.977   1.00 47.88 ? 3186 ASN A N     1 
ATOM   9335  C  CA    . ASN E  3 1209 ? 39.181  1.491   3.267   1.00 47.44 ? 3186 ASN A CA    1 
ATOM   9336  C  C     . ASN E  3 1209 ? 37.954  1.730   4.144   1.00 46.76 ? 3186 ASN A C     1 
ATOM   9337  O  O     . ASN E  3 1209 ? 36.817  1.663   3.678   1.00 46.77 ? 3186 ASN A O     1 
ATOM   9338  C  CB    . ASN E  3 1209 ? 38.822  0.785   1.960   1.00 47.67 ? 3186 ASN A CB    1 
ATOM   9339  C  CG    . ASN E  3 1209 ? 38.290  1.740   0.924   1.00 50.93 ? 3186 ASN A CG    1 
ATOM   9340  O  OD1   . ASN E  3 1209 ? 38.909  2.769   0.640   1.00 52.92 ? 3186 ASN A OD1   1 
ATOM   9341  N  ND2   . ASN E  3 1209 ? 37.130  1.418   0.356   1.00 53.33 ? 3186 ASN A ND2   1 
ATOM   9342  N  N     . THR E  3 1210 ? 38.214  2.023   5.419   1.00 46.39 ? 3187 THR A N     1 
ATOM   9343  C  CA    . THR E  3 1210 ? 37.179  2.253   6.424   1.00 45.83 ? 3187 THR A CA    1 
ATOM   9344  C  C     . THR E  3 1210 ? 36.922  3.738   6.597   1.00 45.94 ? 3187 THR A C     1 
ATOM   9345  O  O     . THR E  3 1210 ? 37.856  4.493   6.847   1.00 45.98 ? 3187 THR A O     1 
ATOM   9346  C  CB    . THR E  3 1210 ? 37.611  1.696   7.783   1.00 44.55 ? 3187 THR A CB    1 
ATOM   9347  O  OG1   . THR E  3 1210 ? 38.175  0.388   7.600   1.00 47.02 ? 3187 THR A OG1   1 
ATOM   9348  C  CG2   . THR E  3 1210 ? 36.431  1.651   8.758   1.00 41.84 ? 3187 THR A CG2   1 
ATOM   9349  N  N     . LEU E  3 1211 ? 35.660  4.153   6.466   1.00 46.09 ? 3188 LEU A N     1 
ATOM   9350  C  CA    . LEU E  3 1211 ? 35.266  5.531   6.763   1.00 45.03 ? 3188 LEU A CA    1 
ATOM   9351  C  C     . LEU E  3 1211 ? 35.021  5.683   8.253   1.00 44.73 ? 3188 LEU A C     1 
ATOM   9352  O  O     . LEU E  3 1211 ? 34.335  4.859   8.846   1.00 45.15 ? 3188 LEU A O     1 
ATOM   9353  C  CB    . LEU E  3 1211 ? 34.006  5.921   5.991   1.00 44.49 ? 3188 LEU A CB    1 
ATOM   9354  C  CG    . LEU E  3 1211 ? 33.290  7.198   6.431   1.00 43.99 ? 3188 LEU A CG    1 
ATOM   9355  C  CD1   . LEU E  3 1211 ? 34.138  8.431   6.133   1.00 45.48 ? 3188 LEU A CD1   1 
ATOM   9356  C  CD2   . LEU E  3 1211 ? 31.936  7.316   5.755   1.00 44.52 ? 3188 LEU A CD2   1 
ATOM   9357  N  N     . LEU E  3 1212 ? 35.594  6.726   8.850   1.00 44.80 ? 3189 LEU A N     1 
ATOM   9358  C  CA    . LEU E  3 1212 ? 35.370  7.036   10.261  1.00 45.52 ? 3189 LEU A CA    1 
ATOM   9359  C  C     . LEU E  3 1212 ? 34.731  8.415   10.435  1.00 45.57 ? 3189 LEU A C     1 
ATOM   9360  O  O     . LEU E  3 1212 ? 35.348  9.419   10.114  1.00 46.71 ? 3189 LEU A O     1 
ATOM   9361  C  CB    . LEU E  3 1212 ? 36.686  6.988   11.038  1.00 44.72 ? 3189 LEU A CB    1 
ATOM   9362  C  CG    . LEU E  3 1212 ? 36.646  6.707   12.550  1.00 45.47 ? 3189 LEU A CG    1 
ATOM   9363  C  CD1   . LEU E  3 1212 ? 37.990  7.012   13.171  1.00 42.61 ? 3189 LEU A CD1   1 
ATOM   9364  C  CD2   . LEU E  3 1212 ? 35.559  7.461   13.292  1.00 46.84 ? 3189 LEU A CD2   1 
ATOM   9365  N  N     . ILE E  3 1213 ? 33.511  8.463   10.957  1.00 45.01 ? 3190 ILE A N     1 
ATOM   9366  C  CA    . ILE E  3 1213 ? 32.844  9.738   11.195  1.00 44.75 ? 3190 ILE A CA    1 
ATOM   9367  C  C     . ILE E  3 1213 ? 32.871  10.114  12.674  1.00 45.91 ? 3190 ILE A C     1 
ATOM   9368  O  O     . ILE E  3 1213 ? 32.432  9.346   13.536  1.00 47.85 ? 3190 ILE A O     1 
ATOM   9369  C  CB    . ILE E  3 1213 ? 31.395  9.720   10.691  1.00 44.34 ? 3190 ILE A CB    1 
ATOM   9370  C  CG1   . ILE E  3 1213 ? 31.375  9.461   9.191   1.00 43.36 ? 3190 ILE A CG1   1 
ATOM   9371  C  CG2   . ILE E  3 1213 ? 30.692  11.018  11.031  1.00 43.10 ? 3190 ILE A CG2   1 
ATOM   9372  C  CD1   . ILE E  3 1213 ? 30.020  9.023   8.668   1.00 44.92 ? 3190 ILE A CD1   1 
ATOM   9373  N  N     . PHE E  3 1214 ? 33.402  11.297  12.963  1.00 45.81 ? 3191 PHE A N     1 
ATOM   9374  C  CA    . PHE E  3 1214 ? 33.368  11.846  14.318  1.00 45.23 ? 3191 PHE A CA    1 
ATOM   9375  C  C     . PHE E  3 1214 ? 32.263  12.879  14.455  1.00 44.84 ? 3191 PHE A C     1 
ATOM   9376  O  O     . PHE E  3 1214 ? 32.230  13.856  13.703  1.00 44.91 ? 3191 PHE A O     1 
ATOM   9377  C  CB    . PHE E  3 1214 ? 34.698  12.504  14.674  1.00 43.93 ? 3191 PHE A CB    1 
ATOM   9378  C  CG    . PHE E  3 1214 ? 35.777  11.540  15.029  1.00 43.02 ? 3191 PHE A CG    1 
ATOM   9379  C  CD1   . PHE E  3 1214 ? 35.821  10.960  16.289  1.00 43.38 ? 3191 PHE A CD1   1 
ATOM   9380  C  CD2   . PHE E  3 1214 ? 36.771  11.234  14.114  1.00 43.79 ? 3191 PHE A CD2   1 
ATOM   9381  C  CE1   . PHE E  3 1214 ? 36.837  10.063  16.633  1.00 44.65 ? 3191 PHE A CE1   1 
ATOM   9382  C  CE2   . PHE E  3 1214 ? 37.798  10.343  14.443  1.00 44.78 ? 3191 PHE A CE2   1 
ATOM   9383  C  CZ    . PHE E  3 1214 ? 37.833  9.752   15.706  1.00 43.51 ? 3191 PHE A CZ    1 
ATOM   9384  N  N     . ILE E  3 1215 ? 31.363  12.669  15.411  1.00 44.11 ? 3192 ILE A N     1 
ATOM   9385  C  CA    . ILE E  3 1215 ? 30.417  13.715  15.758  1.00 44.16 ? 3192 ILE A CA    1 
ATOM   9386  C  C     . ILE E  3 1215 ? 31.029  14.605  16.844  1.00 45.58 ? 3192 ILE A C     1 
ATOM   9387  O  O     . ILE E  3 1215 ? 31.546  14.112  17.847  1.00 48.29 ? 3192 ILE A O     1 
ATOM   9388  C  CB    . ILE E  3 1215 ? 29.082  13.148  16.222  1.00 42.87 ? 3192 ILE A CB    1 
ATOM   9389  C  CG1   . ILE E  3 1215 ? 28.420  12.373  15.089  1.00 42.90 ? 3192 ILE A CG1   1 
ATOM   9390  C  CG2   . ILE E  3 1215 ? 28.175  14.275  16.675  1.00 44.15 ? 3192 ILE A CG2   1 
ATOM   9391  C  CD1   . ILE E  3 1215 ? 27.173  11.603  15.500  1.00 45.37 ? 3192 ILE A CD1   1 
ATOM   9392  N  N     . ASN E  3 1216 ? 30.991  15.915  16.646  1.00 44.74 ? 3193 ASN A N     1 
ATOM   9393  C  CA    . ASN E  3 1216 ? 31.479  16.824  17.671  1.00 44.53 ? 3193 ASN A CA    1 
ATOM   9394  C  C     . ASN E  3 1216 ? 30.420  17.843  18.107  1.00 45.04 ? 3193 ASN A C     1 
ATOM   9395  O  O     . ASN E  3 1216 ? 29.476  18.143  17.361  1.00 46.30 ? 3193 ASN A O     1 
ATOM   9396  C  CB    . ASN E  3 1216 ? 32.732  17.537  17.185  1.00 44.59 ? 3193 ASN A CB    1 
ATOM   9397  C  CG    . ASN E  3 1216 ? 33.736  17.806  18.303  1.00 44.75 ? 3193 ASN A CG    1 
ATOM   9398  O  OD1   . ASN E  3 1216 ? 34.941  17.903  18.046  1.00 45.63 ? 3193 ASN A OD1   1 
ATOM   9399  N  ND2   . ASN E  3 1216 ? 33.256  17.926  19.534  1.00 42.77 ? 3193 ASN A ND2   1 
ATOM   9400  N  N     . GLN E  3 1217 ? 30.573  18.355  19.325  1.00 43.61 ? 3194 GLN A N     1 
ATOM   9401  C  CA    . GLN E  3 1217 ? 29.701  19.385  19.843  1.00 43.08 ? 3194 GLN A CA    1 
ATOM   9402  C  C     . GLN E  3 1217 ? 30.394  20.719  19.704  1.00 42.72 ? 3194 GLN A C     1 
ATOM   9403  O  O     . GLN E  3 1217 ? 31.585  20.777  19.440  1.00 43.29 ? 3194 GLN A O     1 
ATOM   9404  C  CB    . GLN E  3 1217 ? 29.393  19.132  21.312  1.00 43.32 ? 3194 GLN A CB    1 
ATOM   9405  C  CG    . GLN E  3 1217 ? 28.689  17.823  21.593  1.00 44.74 ? 3194 GLN A CG    1 
ATOM   9406  C  CD    . GLN E  3 1217 ? 28.536  17.547  23.082  1.00 44.56 ? 3194 GLN A CD    1 
ATOM   9407  O  OE1   . GLN E  3 1217 ? 28.068  16.488  23.479  1.00 48.52 ? 3194 GLN A OE1   1 
ATOM   9408  N  NE2   . GLN E  3 1217 ? 28.929  18.496  23.906  1.00 43.06 ? 3194 GLN A NE2   1 
ATOM   9409  N  N     . ILE E  3 1218 ? 29.641  21.795  19.882  1.00 42.86 ? 3195 ILE A N     1 
ATOM   9410  C  CA    . ILE E  3 1218 ? 30.188  23.140  19.862  1.00 42.14 ? 3195 ILE A CA    1 
ATOM   9411  C  C     . ILE E  3 1218 ? 30.370  23.669  21.282  1.00 43.50 ? 3195 ILE A C     1 
ATOM   9412  O  O     . ILE E  3 1218 ? 29.479  23.551  22.127  1.00 44.03 ? 3195 ILE A O     1 
ATOM   9413  C  CB    . ILE E  3 1218 ? 29.278  24.100  19.088  1.00 40.79 ? 3195 ILE A CB    1 
ATOM   9414  C  CG1   . ILE E  3 1218 ? 29.226  23.707  17.628  1.00 40.34 ? 3195 ILE A CG1   1 
ATOM   9415  C  CG2   . ILE E  3 1218 ? 29.769  25.519  19.198  1.00 40.93 ? 3195 ILE A CG2   1 
ATOM   9416  C  CD1   . ILE E  3 1218 ? 28.257  24.530  16.855  1.00 43.06 ? 3195 ILE A CD1   1 
ATOM   9417  N  N     . ARG E  3 1219 ? 31.536  24.245  21.538  1.00 43.98 ? 3196 ARG A N     1 
ATOM   9418  C  CA    . ARG E  3 1219 ? 31.737  25.034  22.733  1.00 44.65 ? 3196 ARG A CA    1 
ATOM   9419  C  C     . ARG E  3 1219 ? 32.034  26.450  22.301  1.00 45.81 ? 3196 ARG A C     1 
ATOM   9420  O  O     . ARG E  3 1219 ? 32.299  26.701  21.134  1.00 45.52 ? 3196 ARG A O     1 
ATOM   9421  C  CB    . ARG E  3 1219 ? 32.877  24.479  23.583  1.00 44.21 ? 3196 ARG A CB    1 
ATOM   9422  C  CG    . ARG E  3 1219 ? 32.585  23.131  24.217  1.00 42.52 ? 3196 ARG A CG    1 
ATOM   9423  C  CD    . ARG E  3 1219 ? 31.440  23.216  25.203  1.00 43.47 ? 3196 ARG A CD    1 
ATOM   9424  N  NE    . ARG E  3 1219 ? 31.198  21.940  25.868  1.00 43.63 ? 3196 ARG A NE    1 
ATOM   9425  C  CZ    . ARG E  3 1219 ? 30.476  20.953  25.357  1.00 44.29 ? 3196 ARG A CZ    1 
ATOM   9426  N  NH1   . ARG E  3 1219 ? 29.911  21.083  24.157  1.00 46.54 ? 3196 ARG A NH1   1 
ATOM   9427  N  NH2   . ARG E  3 1219 ? 30.329  19.829  26.042  1.00 43.79 ? 3196 ARG A NH2   1 
ATOM   9428  N  N     . MET E  3 1220 ? 31.980  27.367  23.248  1.00 47.46 ? 3197 MET A N     1 
ATOM   9429  C  CA    . MET E  3 1220 ? 32.272  28.744  22.989  1.00 49.43 ? 3197 MET A CA    1 
ATOM   9430  C  C     . MET E  3 1220 ? 33.685  28.973  23.478  1.00 50.63 ? 3197 MET A C     1 
ATOM   9431  O  O     . MET E  3 1220 ? 34.032  28.545  24.575  1.00 50.51 ? 3197 MET A O     1 
ATOM   9432  C  CB    . MET E  3 1220 ? 31.289  29.613  23.767  1.00 50.52 ? 3197 MET A CB    1 
ATOM   9433  C  CG    . MET E  3 1220 ? 30.600  30.683  22.941  1.00 54.54 ? 3197 MET A CG    1 
ATOM   9434  S  SD    . MET E  3 1220 ? 29.789  30.020  21.457  1.00 61.63 ? 3197 MET A SD    1 
ATOM   9435  C  CE    . MET E  3 1220 ? 28.387  29.115  22.138  1.00 60.55 ? 3197 MET A CE    1 
ATOM   9436  N  N     . LYS E  3 1221 ? 34.519  29.606  22.660  1.00 52.79 ? 3198 LYS A N     1 
ATOM   9437  C  CA    . LYS E  3 1221 ? 35.827  30.058  23.140  1.00 55.37 ? 3198 LYS A CA    1 
ATOM   9438  C  C     . LYS E  3 1221 ? 35.652  31.451  23.698  1.00 57.71 ? 3198 LYS A C     1 
ATOM   9439  O  O     . LYS E  3 1221 ? 34.795  32.200  23.244  1.00 58.90 ? 3198 LYS A O     1 
ATOM   9440  C  CB    . LYS E  3 1221 ? 36.901  30.005  22.047  1.00 55.11 ? 3198 LYS A CB    1 
ATOM   9441  C  CG    . LYS E  3 1221 ? 36.654  30.898  20.850  1.00 55.30 ? 3198 LYS A CG    1 
ATOM   9442  C  CD    . LYS E  3 1221 ? 37.045  30.230  19.546  1.00 56.84 ? 3198 LYS A CD    1 
ATOM   9443  C  CE    . LYS E  3 1221 ? 38.540  30.299  19.294  1.00 59.55 ? 3198 LYS A CE    1 
ATOM   9444  N  NZ    . LYS E  3 1221 ? 38.853  29.830  17.918  1.00 61.57 ? 3198 LYS A NZ    1 
ATOM   9445  N  N     . ILE E  3 1222 ? 36.445  31.804  24.694  1.00 60.47 ? 3199 ILE A N     1 
ATOM   9446  C  CA    . ILE E  3 1222 ? 36.163  33.026  25.435  1.00 63.91 ? 3199 ILE A CA    1 
ATOM   9447  C  C     . ILE E  3 1222 ? 37.350  33.996  25.420  1.00 66.73 ? 3199 ILE A C     1 
ATOM   9448  O  O     . ILE E  3 1222 ? 38.494  33.593  25.618  1.00 67.19 ? 3199 ILE A O     1 
ATOM   9449  C  CB    . ILE E  3 1222 ? 35.608  32.694  26.859  1.00 63.34 ? 3199 ILE A CB    1 
ATOM   9450  C  CG1   . ILE E  3 1222 ? 35.864  33.816  27.854  1.00 64.09 ? 3199 ILE A CG1   1 
ATOM   9451  C  CG2   . ILE E  3 1222 ? 36.216  31.430  27.397  1.00 62.94 ? 3199 ILE A CG2   1 
ATOM   9452  C  CD1   . ILE E  3 1222 ? 35.563  33.411  29.273  1.00 64.43 ? 3199 ILE A CD1   1 
ATOM   9453  N  N     . GLY E  3 1223 ? 37.059  35.269  25.157  1.00 69.99 ? 3200 GLY A N     1 
ATOM   9454  C  CA    . GLY E  3 1223 ? 38.083  36.305  24.996  1.00 74.03 ? 3200 GLY A CA    1 
ATOM   9455  C  C     . GLY E  3 1223 ? 38.393  36.566  23.528  1.00 77.23 ? 3200 GLY A C     1 
ATOM   9456  O  O     . GLY E  3 1223 ? 39.554  36.744  23.149  1.00 77.95 ? 3200 GLY A O     1 
ATOM   9457  N  N     . VAL E  3 1224 ? 37.342  36.600  22.708  1.00 79.77 ? 3201 VAL A N     1 
ATOM   9458  C  CA    . VAL E  3 1224 ? 37.455  36.687  21.247  1.00 81.54 ? 3201 VAL A CA    1 
ATOM   9459  C  C     . VAL E  3 1224 ? 36.428  37.687  20.677  1.00 83.44 ? 3201 VAL A C     1 
ATOM   9460  O  O     . VAL E  3 1224 ? 35.216  37.483  20.798  1.00 84.58 ? 3201 VAL A O     1 
ATOM   9461  C  CB    . VAL E  3 1224 ? 37.311  35.265  20.597  1.00 80.75 ? 3201 VAL A CB    1 
ATOM   9462  C  CG1   . VAL E  3 1224 ? 36.005  34.602  21.009  1.00 79.77 ? 3201 VAL A CG1   1 
ATOM   9463  C  CG2   . VAL E  3 1224 ? 37.431  35.320  19.081  1.00 80.56 ? 3201 VAL A CG2   1 
ATOM   9464  N  N     . MET E  3 1225 ? 36.918  38.766  20.070  1.00 84.50 ? 3202 MET A N     1 
ATOM   9465  C  CA    . MET E  3 1225 ? 36.045  39.820  19.527  1.00 86.23 ? 3202 MET A CA    1 
ATOM   9466  C  C     . MET E  3 1225 ? 35.912  39.762  18.002  1.00 86.11 ? 3202 MET A C     1 
ATOM   9467  O  O     . MET E  3 1225 ? 34.863  40.087  17.440  1.00 86.30 ? 3202 MET A O     1 
ATOM   9468  C  CB    . MET E  3 1225 ? 36.530  41.204  19.974  1.00 87.67 ? 3202 MET A CB    1 
ATOM   9469  C  CG    . MET E  3 1225 ? 37.871  41.197  20.704  1.00 90.67 ? 3202 MET A CG    1 
ATOM   9470  S  SD    . MET E  3 1225 ? 37.768  41.380  22.510  1.00 94.32 ? 3202 MET A SD    1 
ATOM   9471  C  CE    . MET E  3 1225 ? 36.608  40.110  23.032  1.00 91.97 ? 3202 MET A CE    1 
ATOM   9472  N  N     . PHE E  3 1226 ? 36.997  39.356  17.354  1.00 86.01 ? 3203 PHE A N     1 
ATOM   9473  C  CA    . PHE E  3 1226 ? 37.041  39.073  15.921  1.00 85.89 ? 3203 PHE A CA    1 
ATOM   9474  C  C     . PHE E  3 1226 ? 36.354  37.727  15.608  1.00 84.02 ? 3203 PHE A C     1 
ATOM   9475  O  O     . PHE E  3 1226 ? 36.021  36.955  16.518  1.00 83.98 ? 3203 PHE A O     1 
ATOM   9476  C  CB    . PHE E  3 1226 ? 38.512  39.005  15.477  1.00 87.83 ? 3203 PHE A CB    1 
ATOM   9477  C  CG    . PHE E  3 1226 ? 39.339  38.018  16.281  1.00 90.34 ? 3203 PHE A CG    1 
ATOM   9478  C  CD1   . PHE E  3 1226 ? 39.413  36.666  15.902  1.00 90.97 ? 3203 PHE A CD1   1 
ATOM   9479  C  CD2   . PHE E  3 1226 ? 40.015  38.433  17.437  1.00 91.32 ? 3203 PHE A CD2   1 
ATOM   9480  C  CE1   . PHE E  3 1226 ? 40.156  35.747  16.652  1.00 91.17 ? 3203 PHE A CE1   1 
ATOM   9481  C  CE2   . PHE E  3 1226 ? 40.762  37.523  18.197  1.00 91.80 ? 3203 PHE A CE2   1 
ATOM   9482  C  CZ    . PHE E  3 1226 ? 40.834  36.176  17.802  1.00 91.09 ? 3203 PHE A CZ    1 
ATOM   9483  N  N     . GLY E  3 1227 ? 36.165  37.448  14.318  1.00 81.59 ? 3204 GLY A N     1 
ATOM   9484  C  CA    . GLY E  3 1227 ? 35.663  36.148  13.849  1.00 77.55 ? 3204 GLY A CA    1 
ATOM   9485  C  C     . GLY E  3 1227 ? 34.416  35.663  14.569  1.00 74.02 ? 3204 GLY A C     1 
ATOM   9486  O  O     . GLY E  3 1227 ? 33.547  36.463  14.932  1.00 73.87 ? 3204 GLY A O     1 
ATOM   9487  N  N     . ASN E  3 1228 ? 34.316  34.351  14.765  1.00 70.27 ? 3205 ASN A N     1 
ATOM   9488  C  CA    . ASN E  3 1228 ? 33.202  33.783  15.523  1.00 66.43 ? 3205 ASN A CA    1 
ATOM   9489  C  C     . ASN E  3 1228 ? 33.696  32.967  16.723  1.00 62.68 ? 3205 ASN A C     1 
ATOM   9490  O  O     . ASN E  3 1228 ? 34.754  32.339  16.659  1.00 61.88 ? 3205 ASN A O     1 
ATOM   9491  C  CB    . ASN E  3 1228 ? 32.236  33.007  14.608  1.00 66.80 ? 3205 ASN A CB    1 
ATOM   9492  C  CG    . ASN E  3 1228 ? 32.422  31.508  14.676  1.00 68.11 ? 3205 ASN A CG    1 
ATOM   9493  O  OD1   . ASN E  3 1228 ? 33.523  30.985  14.477  1.00 69.55 ? 3205 ASN A OD1   1 
ATOM   9494  N  ND2   . ASN E  3 1228 ? 31.327  30.801  14.933  1.00 68.95 ? 3205 ASN A ND2   1 
ATOM   9495  N  N     . PRO E  3 1229 ? 32.940  32.990  17.827  1.00 59.58 ? 3206 PRO A N     1 
ATOM   9496  C  CA    . PRO E  3 1229 ? 33.443  32.440  19.076  1.00 57.84 ? 3206 PRO A CA    1 
ATOM   9497  C  C     . PRO E  3 1229 ? 33.283  30.929  19.232  1.00 56.38 ? 3206 PRO A C     1 
ATOM   9498  O  O     . PRO E  3 1229 ? 33.672  30.383  20.262  1.00 55.46 ? 3206 PRO A O     1 
ATOM   9499  C  CB    . PRO E  3 1229 ? 32.613  33.174  20.124  1.00 57.55 ? 3206 PRO A CB    1 
ATOM   9500  C  CG    . PRO E  3 1229 ? 31.335  33.452  19.450  1.00 58.51 ? 3206 PRO A CG    1 
ATOM   9501  C  CD    . PRO E  3 1229 ? 31.582  33.533  17.975  1.00 59.06 ? 3206 PRO A CD    1 
ATOM   9502  N  N     . GLU E  3 1230 ? 32.727  30.259  18.228  1.00 55.25 ? 3207 GLU A N     1 
ATOM   9503  C  CA    . GLU E  3 1230 ? 32.459  28.824  18.320  1.00 54.42 ? 3207 GLU A CA    1 
ATOM   9504  C  C     . GLU E  3 1230 ? 33.707  27.963  18.154  1.00 53.98 ? 3207 GLU A C     1 
ATOM   9505  O  O     . GLU E  3 1230 ? 34.624  28.332  17.432  1.00 54.46 ? 3207 GLU A O     1 
ATOM   9506  C  CB    . GLU E  3 1230 ? 31.435  28.409  17.275  1.00 54.23 ? 3207 GLU A CB    1 
ATOM   9507  C  CG    . GLU E  3 1230 ? 30.044  28.955  17.508  1.00 55.36 ? 3207 GLU A CG    1 
ATOM   9508  C  CD    . GLU E  3 1230 ? 29.032  28.394  16.518  1.00 56.28 ? 3207 GLU A CD    1 
ATOM   9509  O  OE1   . GLU E  3 1230 ? 29.436  27.997  15.405  1.00 57.05 ? 3207 GLU A OE1   1 
ATOM   9510  O  OE2   . GLU E  3 1230 ? 27.828  28.356  16.847  1.00 55.78 ? 3207 GLU A OE2   1 
ATOM   9511  N  N     . THR E  3 1231 ? 33.735  26.818  18.833  1.00 53.41 ? 3208 THR A N     1 
ATOM   9512  C  CA    . THR E  3 1231 ? 34.785  25.823  18.637  1.00 53.72 ? 3208 THR A CA    1 
ATOM   9513  C  C     . THR E  3 1231 ? 34.226  24.437  18.795  1.00 55.01 ? 3208 THR A C     1 
ATOM   9514  O  O     . THR E  3 1231 ? 33.017  24.232  18.891  1.00 57.26 ? 3208 THR A O     1 
ATOM   9515  C  CB    . THR E  3 1231 ? 35.950  25.915  19.644  1.00 53.16 ? 3208 THR A CB    1 
ATOM   9516  O  OG1   . THR E  3 1231 ? 35.913  27.164  20.329  1.00 57.22 ? 3208 THR A OG1   1 
ATOM   9517  C  CG2   . THR E  3 1231 ? 37.293  25.756  18.935  1.00 52.67 ? 3208 THR A CG2   1 
ATOM   9518  N  N     . THR E  3 1232 ? 35.149  23.494  18.880  1.00 54.74 ? 3209 THR A N     1 
ATOM   9519  C  CA    . THR E  3 1232 ? 34.889  22.091  18.734  1.00 53.85 ? 3209 THR A CA    1 
ATOM   9520  C  C     . THR E  3 1232 ? 35.698  21.430  19.844  1.00 54.07 ? 3209 THR A C     1 
ATOM   9521  O  O     . THR E  3 1232 ? 36.768  21.920  20.195  1.00 55.17 ? 3209 THR A O     1 
ATOM   9522  C  CB    . THR E  3 1232 ? 35.319  21.702  17.303  1.00 53.80 ? 3209 THR A CB    1 
ATOM   9523  O  OG1   . THR E  3 1232 ? 34.148  21.546  16.498  1.00 54.28 ? 3209 THR A OG1   1 
ATOM   9524  C  CG2   . THR E  3 1232 ? 36.192  20.436  17.241  1.00 55.64 ? 3209 THR A CG2   1 
ATOM   9525  N  N     . THR E  3 1233 ? 35.191  20.354  20.429  1.00 53.72 ? 3210 THR A N     1 
ATOM   9526  C  CA    . THR E  3 1233 ? 35.891  19.732  21.543  1.00 54.23 ? 3210 THR A CA    1 
ATOM   9527  C  C     . THR E  3 1233 ? 37.069  18.900  21.065  1.00 53.32 ? 3210 THR A C     1 
ATOM   9528  O  O     . THR E  3 1233 ? 37.116  18.492  19.909  1.00 53.68 ? 3210 THR A O     1 
ATOM   9529  C  CB    . THR E  3 1233 ? 34.964  18.836  22.369  1.00 55.63 ? 3210 THR A CB    1 
ATOM   9530  O  OG1   . THR E  3 1233 ? 33.603  19.203  22.126  1.00 58.04 ? 3210 THR A OG1   1 
ATOM   9531  C  CG2   . THR E  3 1233 ? 35.274  18.988  23.873  1.00 58.05 ? 3210 THR A CG2   1 
ATOM   9532  N  N     . GLY E  3 1234 ? 38.032  18.676  21.955  1.00 52.91 ? 3211 GLY A N     1 
ATOM   9533  C  CA    . GLY E  3 1234 ? 39.107  17.717  21.711  1.00 52.14 ? 3211 GLY A CA    1 
ATOM   9534  C  C     . GLY E  3 1234 ? 40.249  18.190  20.839  1.00 51.52 ? 3211 GLY A C     1 
ATOM   9535  O  O     . GLY E  3 1234 ? 40.793  17.429  20.046  1.00 52.19 ? 3211 GLY A O     1 
ATOM   9536  N  N     . GLY E  3 1235 ? 40.609  19.454  20.978  1.00 51.40 ? 3212 GLY A N     1 
ATOM   9537  C  CA    . GLY E  3 1235 ? 41.823  19.968  20.364  1.00 50.92 ? 3212 GLY A CA    1 
ATOM   9538  C  C     . GLY E  3 1235 ? 41.772  20.269  18.881  1.00 50.43 ? 3212 GLY A C     1 
ATOM   9539  O  O     . GLY E  3 1235 ? 40.703  20.468  18.297  1.00 51.53 ? 3212 GLY A O     1 
ATOM   9540  N  N     . ASN E  3 1236 ? 42.952  20.290  18.279  1.00 49.42 ? 3213 ASN A N     1 
ATOM   9541  C  CA    . ASN E  3 1236 ? 43.125  20.753  16.916  1.00 49.19 ? 3213 ASN A CA    1 
ATOM   9542  C  C     . ASN E  3 1236 ? 43.422  19.655  15.903  1.00 48.86 ? 3213 ASN A C     1 
ATOM   9543  O  O     . ASN E  3 1236 ? 43.332  19.881  14.698  1.00 49.60 ? 3213 ASN A O     1 
ATOM   9544  C  CB    . ASN E  3 1236 ? 44.242  21.790  16.882  1.00 49.26 ? 3213 ASN A CB    1 
ATOM   9545  C  CG    . ASN E  3 1236 ? 43.839  23.091  17.528  1.00 50.68 ? 3213 ASN A CG    1 
ATOM   9546  O  OD1   . ASN E  3 1236 ? 42.937  23.783  17.053  1.00 52.34 ? 3213 ASN A OD1   1 
ATOM   9547  N  ND2   . ASN E  3 1236 ? 44.517  23.444  18.611  1.00 51.31 ? 3213 ASN A ND2   1 
ATOM   9548  N  N     . ALA E  3 1237 ? 43.784  18.473  16.391  1.00 47.96 ? 3214 ALA A N     1 
ATOM   9549  C  CA    . ALA E  3 1237 ? 44.198  17.380  15.526  1.00 46.49 ? 3214 ALA A CA    1 
ATOM   9550  C  C     . ALA E  3 1237 ? 43.136  17.068  14.479  1.00 46.26 ? 3214 ALA A C     1 
ATOM   9551  O  O     . ALA E  3 1237 ? 43.432  17.020  13.294  1.00 46.20 ? 3214 ALA A O     1 
ATOM   9552  C  CB    . ALA E  3 1237 ? 44.542  16.154  16.350  1.00 46.42 ? 3214 ALA A CB    1 
ATOM   9553  N  N     . LEU E  3 1238 ? 41.895  16.893  14.917  1.00 46.85 ? 3215 LEU A N     1 
ATOM   9554  C  CA    . LEU E  3 1238 ? 40.827  16.468  14.021  1.00 46.67 ? 3215 LEU A CA    1 
ATOM   9555  C  C     . LEU E  3 1238 ? 40.582  17.421  12.843  1.00 47.01 ? 3215 LEU A C     1 
ATOM   9556  O  O     . LEU E  3 1238 ? 40.325  16.949  11.745  1.00 47.64 ? 3215 LEU A O     1 
ATOM   9557  C  CB    . LEU E  3 1238 ? 39.537  16.214  14.809  1.00 47.06 ? 3215 LEU A CB    1 
ATOM   9558  C  CG    . LEU E  3 1238 ? 38.328  15.614  14.083  1.00 46.49 ? 3215 LEU A CG    1 
ATOM   9559  C  CD1   . LEU E  3 1238 ? 38.672  14.290  13.440  1.00 47.09 ? 3215 LEU A CD1   1 
ATOM   9560  C  CD2   . LEU E  3 1238 ? 37.180  15.443  15.056  1.00 46.32 ? 3215 LEU A CD2   1 
ATOM   9561  N  N     . LYS E  3 1239 ? 40.659  18.738  13.062  1.00 47.32 ? 3216 LYS A N     1 
ATOM   9562  C  CA    . LYS E  3 1239 ? 40.475  19.716  11.977  1.00 48.16 ? 3216 LYS A CA    1 
ATOM   9563  C  C     . LYS E  3 1239 ? 41.358  19.338  10.795  1.00 46.68 ? 3216 LYS A C     1 
ATOM   9564  O  O     . LYS E  3 1239 ? 40.943  19.423  9.639   1.00 46.79 ? 3216 LYS A O     1 
ATOM   9565  C  CB    . LYS E  3 1239 ? 40.914  21.127  12.372  1.00 48.78 ? 3216 LYS A CB    1 
ATOM   9566  C  CG    . LYS E  3 1239 ? 40.294  21.803  13.560  1.00 53.32 ? 3216 LYS A CG    1 
ATOM   9567  C  CD    . LYS E  3 1239 ? 40.843  23.266  13.636  1.00 53.58 ? 3216 LYS A CD    1 
ATOM   9568  C  CE    . LYS E  3 1239 ? 40.786  23.888  15.060  1.00 60.44 ? 3216 LYS A CE    1 
ATOM   9569  N  NZ    . LYS E  3 1239 ? 39.482  23.705  15.845  1.00 61.89 ? 3216 LYS A NZ    1 
ATOM   9570  N  N     . PHE E  3 1240 ? 42.593  18.944  11.103  1.00 45.30 ? 3217 PHE A N     1 
ATOM   9571  C  CA    . PHE E  3 1240 ? 43.606  18.681  10.101  1.00 44.16 ? 3217 PHE A CA    1 
ATOM   9572  C  C     . PHE E  3 1240 ? 43.388  17.354  9.413   1.00 45.61 ? 3217 PHE A C     1 
ATOM   9573  O  O     . PHE E  3 1240 ? 43.445  17.283  8.185   1.00 48.41 ? 3217 PHE A O     1 
ATOM   9574  C  CB    . PHE E  3 1240 ? 44.989  18.705  10.728  1.00 42.37 ? 3217 PHE A CB    1 
ATOM   9575  C  CG    . PHE E  3 1240 ? 45.501  20.084  11.009  1.00 42.20 ? 3217 PHE A CG    1 
ATOM   9576  C  CD1   . PHE E  3 1240 ? 45.359  20.655  12.269  1.00 41.51 ? 3217 PHE A CD1   1 
ATOM   9577  C  CD2   . PHE E  3 1240 ? 46.133  20.820  10.012  1.00 42.10 ? 3217 PHE A CD2   1 
ATOM   9578  C  CE1   . PHE E  3 1240 ? 45.844  21.932  12.528  1.00 40.29 ? 3217 PHE A CE1   1 
ATOM   9579  C  CE2   . PHE E  3 1240 ? 46.614  22.091  10.260  1.00 39.49 ? 3217 PHE A CE2   1 
ATOM   9580  C  CZ    . PHE E  3 1240 ? 46.468  22.649  11.519  1.00 40.52 ? 3217 PHE A CZ    1 
ATOM   9581  N  N     . TYR E  3 1241 ? 43.138  16.308  10.199  1.00 44.87 ? 3218 TYR A N     1 
ATOM   9582  C  CA    . TYR E  3 1241 ? 43.028  14.956  9.673   1.00 45.00 ? 3218 TYR A CA    1 
ATOM   9583  C  C     . TYR E  3 1241 ? 41.735  14.705  8.917   1.00 45.82 ? 3218 TYR A C     1 
ATOM   9584  O  O     . TYR E  3 1241 ? 41.718  13.882  7.995   1.00 48.15 ? 3218 TYR A O     1 
ATOM   9585  C  CB    . TYR E  3 1241 ? 43.200  13.923  10.785  1.00 45.54 ? 3218 TYR A CB    1 
ATOM   9586  C  CG    . TYR E  3 1241 ? 44.637  13.731  11.214  1.00 45.57 ? 3218 TYR A CG    1 
ATOM   9587  C  CD1   . TYR E  3 1241 ? 45.417  12.726  10.658  1.00 46.19 ? 3218 TYR A CD1   1 
ATOM   9588  C  CD2   . TYR E  3 1241 ? 45.218  14.559  12.166  1.00 45.47 ? 3218 TYR A CD2   1 
ATOM   9589  C  CE1   . TYR E  3 1241 ? 46.740  12.551  11.041  1.00 45.97 ? 3218 TYR A CE1   1 
ATOM   9590  C  CE2   . TYR E  3 1241 ? 46.536  14.388  12.560  1.00 46.02 ? 3218 TYR A CE2   1 
ATOM   9591  C  CZ    . TYR E  3 1241 ? 47.292  13.386  11.991  1.00 45.65 ? 3218 TYR A CZ    1 
ATOM   9592  O  OH    . TYR E  3 1241 ? 48.599  13.209  12.374  1.00 45.03 ? 3218 TYR A OH    1 
ATOM   9593  N  N     . ALA E  3 1242 ? 40.659  15.395  9.295   1.00 44.92 ? 3219 ALA A N     1 
ATOM   9594  C  CA    . ALA E  3 1242 ? 39.382  15.268  8.589   1.00 44.41 ? 3219 ALA A CA    1 
ATOM   9595  C  C     . ALA E  3 1242 ? 39.539  15.618  7.115   1.00 44.83 ? 3219 ALA A C     1 
ATOM   9596  O  O     . ALA E  3 1242 ? 40.197  16.610  6.788   1.00 45.43 ? 3219 ALA A O     1 
ATOM   9597  C  CB    . ALA E  3 1242 ? 38.342  16.136  9.217   1.00 43.44 ? 3219 ALA A CB    1 
ATOM   9598  N  N     . SER E  3 1243 ? 38.977  14.784  6.235   1.00 44.49 ? 3220 SER A N     1 
ATOM   9599  C  CA    . SER E  3 1243 ? 38.999  15.052  4.796   1.00 44.76 ? 3220 SER A CA    1 
ATOM   9600  C  C     . SER E  3 1243 ? 37.761  15.847  4.425   1.00 44.66 ? 3220 SER A C     1 
ATOM   9601  O  O     . SER E  3 1243 ? 37.729  16.528  3.394   1.00 45.45 ? 3220 SER A O     1 
ATOM   9602  C  CB    . SER E  3 1243 ? 39.056  13.763  3.986   1.00 45.29 ? 3220 SER A CB    1 
ATOM   9603  O  OG    . SER E  3 1243 ? 40.116  12.931  4.415   1.00 47.93 ? 3220 SER A OG    1 
ATOM   9604  N  N     . VAL E  3 1244 ? 36.744  15.752  5.275   1.00 44.11 ? 3221 VAL A N     1 
ATOM   9605  C  CA    . VAL E  3 1244 ? 35.509  16.506  5.126   1.00 43.74 ? 3221 VAL A CA    1 
ATOM   9606  C  C     . VAL E  3 1244 ? 35.036  16.962  6.507   1.00 45.31 ? 3221 VAL A C     1 
ATOM   9607  O  O     . VAL E  3 1244 ? 35.038  16.172  7.470   1.00 46.99 ? 3221 VAL A O     1 
ATOM   9608  C  CB    . VAL E  3 1244 ? 34.410  15.651  4.466   1.00 42.55 ? 3221 VAL A CB    1 
ATOM   9609  C  CG1   . VAL E  3 1244 ? 33.084  16.361  4.510   1.00 43.13