data_3COA
# 
_entry.id   3COA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3COA         
NDB   PD1104       
RCSB  RCSB047016   
WWPDB D_1000047016 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3CO6 . unspecified 
PDB 3CO7 . unspecified 
# 
_pdbx_database_status.entry_id                        3COA 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2008-03-27 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Brent, M.M.'     1 
'Anand, R.'       2 
'Marmorstein, R.' 3 
# 
_citation.id                        primary 
_citation.title                     
'Structural Basis for DNA Recognition by FoxO1 and Its Regulation by Posttranslational Modification.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            16 
_citation.page_first                1407 
_citation.page_last                 1416 
_citation.year                      2008 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18786403 
_citation.pdbx_database_id_DOI      10.1016/j.str.2008.06.013 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Brent, M.M.'     1 
primary 'Anand, R.'       2 
primary 'Marmorstein, R.' 3 
# 
_cell.length_a           76.062 
_cell.length_b           102.432 
_cell.length_c           65.446 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           3COA 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.entry_id                         3COA 
_symmetry.Int_Tables_number                18 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 
;DNA (5'-D(*DTP*DGP*DGP*DTP*DTP*DTP*DGP*DTP*DTP*DTP*DTP*DGP*DCP*DTP*DTP*DG)-3')
;
4932.182  2   ? ? ? ? 
2 polymer     syn 
;DNA (5'-D(*DCP*DAP*DAP*DGP*DCP*DAP*DAP*DAP*DAP*DCP*DAP*DAP*DAP*DCP*DCP*DA)-3')
;
4862.225  2   ? ? ? ? 
3 polymer     man 'Forkhead box protein O1'                                                        13153.746 2   ? ? ? ? 
4 non-polymer syn 'CALCIUM ION'                                                                    40.078    2   ? ? ? ? 
5 water       nat water                                                                            18.015    207 ? ? ? ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        'Forkhead box protein O1A, Forkhead in rhabdomyosarcoma' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DT)(DG)(DG)(DT)(DT)(DT)(DG)(DT)(DT)(DT)(DT)(DG)(DC)(DT)(DT)(DG)' TGGTTTGTTTTGCTTG A,D ? 
2 polydeoxyribonucleotide no no '(DC)(DA)(DA)(DG)(DC)(DA)(DA)(DA)(DA)(DC)(DA)(DA)(DA)(DC)(DC)(DA)' CAAGCAAAACAAACCA B,E ? 
3 'polypeptide(L)'        no no 
;SKSSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNE
GTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKS
;
;SKSSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNE
GTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKS
;
C,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DT  n 
1 2   DG  n 
1 3   DG  n 
1 4   DT  n 
1 5   DT  n 
1 6   DT  n 
1 7   DG  n 
1 8   DT  n 
1 9   DT  n 
1 10  DT  n 
1 11  DT  n 
1 12  DG  n 
1 13  DC  n 
1 14  DT  n 
1 15  DT  n 
1 16  DG  n 
2 1   DC  n 
2 2   DA  n 
2 3   DA  n 
2 4   DG  n 
2 5   DC  n 
2 6   DA  n 
2 7   DA  n 
2 8   DA  n 
2 9   DA  n 
2 10  DC  n 
2 11  DA  n 
2 12  DA  n 
2 13  DA  n 
2 14  DC  n 
2 15  DC  n 
2 16  DA  n 
3 1   SER n 
3 2   LYS n 
3 3   SER n 
3 4   SER n 
3 5   SER n 
3 6   SER n 
3 7   ARG n 
3 8   ARG n 
3 9   ASN n 
3 10  ALA n 
3 11  TRP n 
3 12  GLY n 
3 13  ASN n 
3 14  LEU n 
3 15  SER n 
3 16  TYR n 
3 17  ALA n 
3 18  ASP n 
3 19  LEU n 
3 20  ILE n 
3 21  THR n 
3 22  LYS n 
3 23  ALA n 
3 24  ILE n 
3 25  GLU n 
3 26  SER n 
3 27  SER n 
3 28  ALA n 
3 29  GLU n 
3 30  LYS n 
3 31  ARG n 
3 32  LEU n 
3 33  THR n 
3 34  LEU n 
3 35  SER n 
3 36  GLN n 
3 37  ILE n 
3 38  TYR n 
3 39  GLU n 
3 40  TRP n 
3 41  MET n 
3 42  VAL n 
3 43  LYS n 
3 44  SER n 
3 45  VAL n 
3 46  PRO n 
3 47  TYR n 
3 48  PHE n 
3 49  LYS n 
3 50  ASP n 
3 51  LYS n 
3 52  GLY n 
3 53  ASP n 
3 54  SER n 
3 55  ASN n 
3 56  SER n 
3 57  SER n 
3 58  ALA n 
3 59  GLY n 
3 60  TRP n 
3 61  LYS n 
3 62  ASN n 
3 63  SER n 
3 64  ILE n 
3 65  ARG n 
3 66  HIS n 
3 67  ASN n 
3 68  LEU n 
3 69  SER n 
3 70  LEU n 
3 71  HIS n 
3 72  SER n 
3 73  LYS n 
3 74  PHE n 
3 75  ILE n 
3 76  ARG n 
3 77  VAL n 
3 78  GLN n 
3 79  ASN n 
3 80  GLU n 
3 81  GLY n 
3 82  THR n 
3 83  GLY n 
3 84  LYS n 
3 85  SER n 
3 86  SER n 
3 87  TRP n 
3 88  TRP n 
3 89  MET n 
3 90  LEU n 
3 91  ASN n 
3 92  PRO n 
3 93  GLU n 
3 94  GLY n 
3 95  GLY n 
3 96  LYS n 
3 97  SER n 
3 98  GLY n 
3 99  LYS n 
3 100 SER n 
3 101 PRO n 
3 102 ARG n 
3 103 ARG n 
3 104 ARG n 
3 105 ALA n 
3 106 ALA n 
3 107 SER n 
3 108 MET n 
3 109 ASP n 
3 110 ASN n 
3 111 ASN n 
3 112 SER n 
3 113 LYS n 
3 114 PHE n 
3 115 ALA n 
3 116 LYS n 
3 117 SER n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'FOXO1, FKHR, FOXO1A' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP FOXO1_HUMAN Q12778 3 
;KSSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEG
TGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKS
;
151 ? 
2 PDB 3COA        3COA   1 ? ?   ? 
3 PDB 3COA        3COA   2 ? ?   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3COA C 2 ? 117 ? Q12778 151 ? 266 ? 151 266 
2 1 3COA F 2 ? 117 ? Q12778 151 ? 266 ? 151 266 
3 2 3COA A 1 ? 16  ? 3COA   -4  ? 12  ? -4  12  
4 2 3COA D 1 ? 16  ? 3COA   -4  ? 12  ? -4  12  
5 3 3COA B 1 ? 16  ? 3COA   13  ? 28  ? 13  28  
6 3 3COA E 1 ? 16  ? 3COA   13  ? 28  ? 13  28  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3COA SER C 1 ? UNP Q12778 ? ? 'EXPRESSION TAG' 150 1 
2 3COA SER F 1 ? UNP Q12778 ? ? 'EXPRESSION TAG' 150 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CA  non-polymer         . 'CALCIUM ION'                        ? 'Ca 2'            40.078  
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3COA 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.78 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   55.71 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              6.8 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.pdbx_details    '30% PEG 4000, pH 6.8, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1 1 'PEG 4000' ? ? ? 
1 2 2 'PEG 4000' ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2006-11-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Si (111) channel cut' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.88560 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X6A' 
_diffrn_source.pdbx_wavelength_list        0.88560 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X6A 
# 
_reflns.entry_id                     3COA 
_reflns.d_resolution_high            2.200 
_reflns.d_resolution_low             30.000 
_reflns.number_obs                   49316 
_reflns.pdbx_Rmerge_I_obs            0.064 
_reflns.pdbx_netI_over_sigmaI        10.600 
_reflns.pdbx_chi_squared             1.035 
_reflns.pdbx_redundancy              11.000 
_reflns.percent_possible_obs         99.400 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   0 
_reflns.number_all                   50178 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
2.20 2.28  ? ? ? 0.327 ? ? 1.064 9.90  ? 4883 98.10 ? 1  
2.28 2.37  ? ? ? 0.272 ? ? 0.997 11.20 ? 4899 99.30 ? 2  
2.37 2.48  ? ? ? 0.218 ? ? 1.013 11.30 ? 4923 99.30 ? 3  
2.48 2.61  ? ? ? 0.178 ? ? 1.016 11.30 ? 4960 99.30 ? 4  
2.61 2.77  ? ? ? 0.142 ? ? 1.062 11.20 ? 4911 99.30 ? 5  
2.77 2.99  ? ? ? 0.099 ? ? 1.029 11.20 ? 4957 99.70 ? 6  
2.99 3.29  ? ? ? 0.058 ? ? 1.030 11.10 ? 4949 99.50 ? 7  
3.29 3.76  ? ? ? 0.043 ? ? 1.032 11.10 ? 4922 99.70 ? 8  
3.76 4.73  ? ? ? 0.037 ? ? 1.060 10.90 ? 4970 99.80 ? 9  
4.73 30.00 ? ? ? 0.037 ? ? 1.045 10.30 ? 4942 99.50 ? 10 
# 
_refine.entry_id                                 3COA 
_refine.ls_d_res_high                            2.200 
_refine.ls_d_res_low                             30.000 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    95.400 
_refine.ls_number_reflns_obs                     47874 
_refine.ls_R_factor_R_work                       0.216 
_refine.ls_R_factor_R_free                       0.250 
_refine.ls_percent_reflns_R_free                 9.300 
_refine.ls_number_reflns_R_free                  4650 
_refine.B_iso_mean                               30.097 
_refine.solvent_model_param_bsol                 36.334 
_refine.aniso_B[1][1]                            10.293 
_refine.aniso_B[2][2]                            -6.935 
_refine.aniso_B[3][3]                            -3.358 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.pdbx_method_to_determine_struct          ? 
_refine.overall_FOM_work_R_set                   0.827 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     50178 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.details                                  ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1378 
_refine_hist.pdbx_number_atoms_nucleic_acid   1300 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             207 
_refine_hist.number_atoms_total               2887 
_refine_hist.d_res_high                       2.200 
_refine_hist.d_res_low                        30.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_mcbond_it  ? 1.525 1.500 ? 'X-RAY DIFFRACTION' ? 
c_scbond_it  ? 1.866 2.000 ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it ? 2.451 2.000 ? 'X-RAY DIFFRACTION' ? 
c_scangle_it ? 2.734 2.500 ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param ? 'X-RAY DIFFRACTION' 
2 dna-rna_rep.param ? 'X-RAY DIFFRACTION' 
3 water_rep.param   ? 'X-RAY DIFFRACTION' 
4 ion.param         ? 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3COA 
_struct.title                     'Crystal Structure of FoxO1 DBD Bound to IRE DNA' 
_struct.pdbx_descriptor           'Forkhead box protein O1/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3COA 
_struct_keywords.text            
;winged helix, forkhead domain, Chromosomal rearrangement, Cytoplasm, DNA-binding, Nucleus, Phosphoprotein, Proto-oncogene, Transcription, Transcription regulation, Transcription-DNA COMPLEX
;
_struct_keywords.pdbx_keywords   Transcription/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
K N N 5 ? 
L N N 5 ? 
M N N 5 ? 
N N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER E 15 ? SER E 26 ? SER C 164 SER C 175 1 ? 12 
HELX_P HELX_P2 2 THR E 33 ? VAL E 45 ? THR C 182 VAL C 194 1 ? 13 
HELX_P HELX_P3 3 PRO E 46 ? LYS E 49 ? PRO C 195 LYS C 198 5 ? 4  
HELX_P HELX_P4 4 ASP E 53 ? HIS E 71 ? ASP C 202 HIS C 220 1 ? 19 
HELX_P HELX_P5 5 SER F 15 ? SER F 27 ? SER F 164 SER F 176 1 ? 13 
HELX_P HELX_P6 6 THR F 33 ? VAL F 45 ? THR F 182 VAL F 194 1 ? 13 
HELX_P HELX_P7 7 PRO F 46 ? LYS F 49 ? PRO F 195 LYS F 198 5 ? 4  
HELX_P HELX_P8 8 ASP F 53 ? HIS F 71 ? ASP F 202 HIS F 220 1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? E LEU 68 O  ? ? ? 1_555 G CA .  CA ? ? C LEU 217 C CA 1  1_555 ? ? ? ? ? ? ?            2.788 ? 
metalc2  metalc ? ? E HIS 71 O  ? ? ? 1_555 G CA .  CA ? ? C HIS 220 C CA 1  1_555 ? ? ? ? ? ? ?            2.921 ? 
metalc3  metalc ? ? E PHE 74 O  ? ? ? 1_555 G CA .  CA ? ? C PHE 223 C CA 1  1_555 ? ? ? ? ? ? ?            2.876 ? 
metalc4  metalc ? ? F LEU 68 O  ? ? ? 1_555 H CA .  CA ? ? F LEU 217 F CA 2  1_555 ? ? ? ? ? ? ?            2.879 ? 
metalc5  metalc ? ? F PHE 74 O  ? ? ? 1_555 H CA .  CA ? ? F PHE 223 F CA 2  1_555 ? ? ? ? ? ? ?            2.820 ? 
hydrog1  hydrog ? ? A DT  1  N3 ? ? ? 1_555 B DA 16 N1 ? ? A DT  -4  B DA 28 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A DT  1  O4 ? ? ? 1_555 B DA 16 N6 ? ? A DT  -4  B DA 28 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DG  2  N1 ? ? ? 1_555 B DC 15 N3 ? ? A DG  -3  B DC 27 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DG  2  N2 ? ? ? 1_555 B DC 15 O2 ? ? A DG  -3  B DC 27 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DG  2  O6 ? ? ? 1_555 B DC 15 N4 ? ? A DG  -3  B DC 27 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DG  3  N1 ? ? ? 1_555 B DC 14 N3 ? ? A DG  -2  B DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DG  3  N2 ? ? ? 1_555 B DC 14 O2 ? ? A DG  -2  B DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DG  3  O6 ? ? ? 1_555 B DC 14 N4 ? ? A DG  -2  B DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DT  4  N3 ? ? ? 1_555 B DA 13 N1 ? ? A DT  -1  B DA 25 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DT  4  O4 ? ? ? 1_555 B DA 13 N6 ? ? A DT  -1  B DA 25 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DT  5  N3 ? ? ? 1_555 B DA 12 N1 ? ? A DT  1   B DA 24 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DT  5  O4 ? ? ? 1_555 B DA 12 N6 ? ? A DT  1   B DA 24 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DT  6  N3 ? ? ? 1_555 B DA 11 N1 ? ? A DT  2   B DA 23 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DT  6  O4 ? ? ? 1_555 B DA 11 N6 ? ? A DT  2   B DA 23 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DG  7  N1 ? ? ? 1_555 B DC 10 N3 ? ? A DG  3   B DC 22 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DG  7  N2 ? ? ? 1_555 B DC 10 O2 ? ? A DG  3   B DC 22 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DG  7  O6 ? ? ? 1_555 B DC 10 N4 ? ? A DG  3   B DC 22 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DT  8  N3 ? ? ? 1_555 B DA 9  N1 ? ? A DT  4   B DA 21 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DT  8  O4 ? ? ? 1_555 B DA 9  N6 ? ? A DT  4   B DA 21 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A DT  9  N3 ? ? ? 1_555 B DA 8  N1 ? ? A DT  5   B DA 20 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A DT  9  O4 ? ? ? 1_555 B DA 8  N6 ? ? A DT  5   B DA 20 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? A DT  10 N3 ? ? ? 1_555 B DA 7  N1 ? ? A DT  6   B DA 19 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? A DT  10 O4 ? ? ? 1_555 B DA 7  N6 ? ? A DT  6   B DA 19 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? A DT  11 N3 ? ? ? 1_555 B DA 6  N1 ? ? A DT  7   B DA 18 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? A DT  11 O4 ? ? ? 1_555 B DA 6  N6 ? ? A DT  7   B DA 18 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? A DG  12 N1 ? ? ? 1_555 B DC 5  N3 ? ? A DG  8   B DC 17 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? A DG  12 N2 ? ? ? 1_555 B DC 5  O2 ? ? A DG  8   B DC 17 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? A DG  12 O6 ? ? ? 1_555 B DC 5  N4 ? ? A DG  8   B DC 17 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? A DC  13 N3 ? ? ? 1_555 B DG 4  N1 ? ? A DC  9   B DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? A DC  13 N4 ? ? ? 1_555 B DG 4  O6 ? ? A DC  9   B DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? A DC  13 O2 ? ? ? 1_555 B DG 4  N2 ? ? A DC  9   B DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? A DT  14 N3 ? ? ? 1_555 B DA 3  N1 ? ? A DT  10  B DA 15 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? A DT  14 O4 ? ? ? 1_555 B DA 3  N6 ? ? A DT  10  B DA 15 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? A DT  15 N3 ? ? ? 1_555 B DA 2  N1 ? ? A DT  11  B DA 14 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? A DT  15 O4 ? ? ? 1_555 B DA 2  N6 ? ? A DT  11  B DA 14 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? A DG  16 N1 ? ? ? 1_555 B DC 1  N3 ? ? A DG  12  B DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? A DG  16 N2 ? ? ? 1_555 B DC 1  O2 ? ? A DG  12  B DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? A DG  16 O6 ? ? ? 1_555 B DC 1  N4 ? ? A DG  12  B DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? C DT  1  N3 ? ? ? 1_555 D DA 16 N1 ? ? D DT  -4  E DA 28 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? C DT  1  O4 ? ? ? 1_555 D DA 16 N6 ? ? D DT  -4  E DA 28 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? C DG  2  N1 ? ? ? 1_555 D DC 15 N3 ? ? D DG  -3  E DC 27 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? C DG  2  N2 ? ? ? 1_555 D DC 15 O2 ? ? D DG  -3  E DC 27 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? C DG  2  O6 ? ? ? 1_555 D DC 15 N4 ? ? D DG  -3  E DC 27 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? C DG  3  N1 ? ? ? 1_555 D DC 14 N3 ? ? D DG  -2  E DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ? ? C DG  3  N2 ? ? ? 1_555 D DC 14 O2 ? ? D DG  -2  E DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ? ? C DG  3  O6 ? ? ? 1_555 D DC 14 N4 ? ? D DG  -2  E DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ? ? C DT  4  N3 ? ? ? 1_555 D DA 13 N1 ? ? D DT  -1  E DA 25 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ? ? C DT  4  O4 ? ? ? 1_555 D DA 13 N6 ? ? D DT  -1  E DA 25 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ? ? C DT  5  N3 ? ? ? 1_555 D DA 12 N1 ? ? D DT  1   E DA 24 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ? ? C DT  5  O4 ? ? ? 1_555 D DA 12 N6 ? ? D DT  1   E DA 24 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51 hydrog ? ? C DT  6  N3 ? ? ? 1_555 D DA 11 N1 ? ? D DT  2   E DA 23 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52 hydrog ? ? C DT  6  O4 ? ? ? 1_555 D DA 11 N6 ? ? D DT  2   E DA 23 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53 hydrog ? ? C DG  7  N1 ? ? ? 1_555 D DC 10 N3 ? ? D DG  3   E DC 22 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54 hydrog ? ? C DG  7  N2 ? ? ? 1_555 D DC 10 O2 ? ? D DG  3   E DC 22 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55 hydrog ? ? C DG  7  O6 ? ? ? 1_555 D DC 10 N4 ? ? D DG  3   E DC 22 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56 hydrog ? ? C DT  8  N3 ? ? ? 1_555 D DA 9  N1 ? ? D DT  4   E DA 21 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57 hydrog ? ? C DT  8  O4 ? ? ? 1_555 D DA 9  N6 ? ? D DT  4   E DA 21 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58 hydrog ? ? C DT  9  N3 ? ? ? 1_555 D DA 8  N1 ? ? D DT  5   E DA 20 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59 hydrog ? ? C DT  9  O4 ? ? ? 1_555 D DA 8  N6 ? ? D DT  5   E DA 20 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog60 hydrog ? ? C DT  10 N3 ? ? ? 1_555 D DA 7  N1 ? ? D DT  6   E DA 19 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61 hydrog ? ? C DT  10 O4 ? ? ? 1_555 D DA 7  N6 ? ? D DT  6   E DA 19 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62 hydrog ? ? C DT  11 N3 ? ? ? 1_555 D DA 6  N1 ? ? D DT  7   E DA 18 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog63 hydrog ? ? C DT  11 O4 ? ? ? 1_555 D DA 6  N6 ? ? D DT  7   E DA 18 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog64 hydrog ? ? C DG  12 N1 ? ? ? 1_555 D DC 5  N3 ? ? D DG  8   E DC 17 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog65 hydrog ? ? C DG  12 N2 ? ? ? 1_555 D DC 5  O2 ? ? D DG  8   E DC 17 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog66 hydrog ? ? C DG  12 O6 ? ? ? 1_555 D DC 5  N4 ? ? D DG  8   E DC 17 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog67 hydrog ? ? C DC  13 N3 ? ? ? 1_555 D DG 4  N1 ? ? D DC  9   E DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog68 hydrog ? ? C DC  13 N4 ? ? ? 1_555 D DG 4  O6 ? ? D DC  9   E DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog69 hydrog ? ? C DC  13 O2 ? ? ? 1_555 D DG 4  N2 ? ? D DC  9   E DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog70 hydrog ? ? C DT  14 N3 ? ? ? 1_555 D DA 3  N1 ? ? D DT  10  E DA 15 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog71 hydrog ? ? C DT  14 O4 ? ? ? 1_555 D DA 3  N6 ? ? D DT  10  E DA 15 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog72 hydrog ? ? C DT  15 N3 ? ? ? 1_555 D DA 2  N1 ? ? D DT  11  E DA 14 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog73 hydrog ? ? C DT  15 O4 ? ? ? 1_555 D DA 2  N6 ? ? D DT  11  E DA 14 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog74 hydrog ? ? C DG  16 N1 ? ? ? 1_555 D DC 1  N3 ? ? D DG  12  E DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog75 hydrog ? ? C DG  16 N2 ? ? ? 1_555 D DC 1  O2 ? ? D DG  12  E DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog76 hydrog ? ? C DG  16 O6 ? ? ? 1_555 D DC 1  N4 ? ? D DG  12  E DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE E 74 ? VAL E 77 ? PHE C 223 VAL C 226 
A 2 TRP E 87 ? LEU E 90 ? TRP C 236 LEU C 239 
B 1 PHE F 74 ? VAL F 77 ? PHE F 223 VAL F 226 
B 2 TRP F 87 ? LEU F 90 ? TRP F 236 LEU F 239 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL E 77 ? N VAL C 226 O TRP E 87 ? O TRP C 236 
B 1 2 N VAL F 77 ? N VAL F 226 O TRP F 87 ? O TRP F 236 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CA C 1' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CA F 2' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 LEU E 68 ? LEU C 217 . ? 1_555 ? 
2 AC1 4 SER E 69 ? SER C 218 . ? 1_555 ? 
3 AC1 4 HIS E 71 ? HIS C 220 . ? 1_555 ? 
4 AC1 4 PHE E 74 ? PHE C 223 . ? 1_555 ? 
5 AC2 5 HOH K .  ? HOH D 13  . ? 1_555 ? 
6 AC2 5 LEU F 68 ? LEU F 217 . ? 1_555 ? 
7 AC2 5 SER F 69 ? SER F 218 . ? 1_555 ? 
8 AC2 5 HIS F 71 ? HIS F 220 . ? 1_555 ? 
9 AC2 5 PHE F 74 ? PHE F 223 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3COA 
_atom_sites.fract_transf_matrix[1][1]   0.013147 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009763 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015280 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'" . DT  A 1 1  ? 17.550 -9.952  45.271  1.00 64.42 ? -4  DT  A "O5'" 1 
ATOM   2    C  "C5'" . DT  A 1 1  ? 17.531 -10.587 43.981  1.00 63.93 ? -4  DT  A "C5'" 1 
ATOM   3    C  "C4'" . DT  A 1 1  ? 18.908 -10.748 43.377  1.00 62.59 ? -4  DT  A "C4'" 1 
ATOM   4    O  "O4'" . DT  A 1 1  ? 18.769 -11.129 41.989  1.00 61.48 ? -4  DT  A "O4'" 1 
ATOM   5    C  "C3'" . DT  A 1 1  ? 19.721 -9.458  43.370  1.00 62.97 ? -4  DT  A "C3'" 1 
ATOM   6    O  "O3'" . DT  A 1 1  ? 21.114 -9.736  43.534  1.00 63.50 ? -4  DT  A "O3'" 1 
ATOM   7    C  "C2'" . DT  A 1 1  ? 19.412 -8.851  42.014  1.00 60.92 ? -4  DT  A "C2'" 1 
ATOM   8    C  "C1'" . DT  A 1 1  ? 19.132 -10.055 41.127  1.00 59.22 ? -4  DT  A "C1'" 1 
ATOM   9    N  N1    . DT  A 1 1  ? 18.005 -9.848  40.202  1.00 56.25 ? -4  DT  A N1    1 
ATOM   10   C  C2    . DT  A 1 1  ? 18.248 -9.798  38.846  1.00 54.58 ? -4  DT  A C2    1 
ATOM   11   O  O2    . DT  A 1 1  ? 19.365 -9.876  38.363  1.00 54.50 ? -4  DT  A O2    1 
ATOM   12   N  N3    . DT  A 1 1  ? 17.126 -9.653  38.069  1.00 53.31 ? -4  DT  A N3    1 
ATOM   13   C  C4    . DT  A 1 1  ? 15.818 -9.545  38.504  1.00 52.75 ? -4  DT  A C4    1 
ATOM   14   O  O4    . DT  A 1 1  ? 14.911 -9.427  37.686  1.00 51.91 ? -4  DT  A O4    1 
ATOM   15   C  C5    . DT  A 1 1  ? 15.640 -9.584  39.939  1.00 53.33 ? -4  DT  A C5    1 
ATOM   16   C  C7    . DT  A 1 1  ? 14.262 -9.464  40.506  1.00 52.14 ? -4  DT  A C7    1 
ATOM   17   C  C6    . DT  A 1 1  ? 16.728 -9.728  40.704  1.00 54.06 ? -4  DT  A C6    1 
ATOM   18   P  P     . DG  A 1 2  ? 22.069 -8.610  44.162  1.00 65.18 ? -3  DG  A P     1 
ATOM   19   O  OP1   . DG  A 1 2  ? 23.297 -9.262  44.692  1.00 65.47 ? -3  DG  A OP1   1 
ATOM   20   O  OP2   . DG  A 1 2  ? 21.258 -7.724  45.044  1.00 65.50 ? -3  DG  A OP2   1 
ATOM   21   O  "O5'" . DG  A 1 2  ? 22.512 -7.762  42.899  1.00 63.59 ? -3  DG  A "O5'" 1 
ATOM   22   C  "C5'" . DG  A 1 2  ? 23.284 -8.359  41.867  1.00 60.64 ? -3  DG  A "C5'" 1 
ATOM   23   C  "C4'" . DG  A 1 2  ? 23.274 -7.461  40.657  1.00 58.25 ? -3  DG  A "C4'" 1 
ATOM   24   O  "O4'" . DG  A 1 2  ? 21.946 -7.444  40.076  1.00 56.29 ? -3  DG  A "O4'" 1 
ATOM   25   C  "C3'" . DG  A 1 2  ? 23.594 -6.003  40.993  1.00 56.73 ? -3  DG  A "C3'" 1 
ATOM   26   O  "O3'" . DG  A 1 2  ? 24.256 -5.431  39.870  1.00 55.95 ? -3  DG  A "O3'" 1 
ATOM   27   C  "C2'" . DG  A 1 2  ? 22.213 -5.384  41.126  1.00 55.60 ? -3  DG  A "C2'" 1 
ATOM   28   C  "C1'" . DG  A 1 2  ? 21.511 -6.099  39.993  1.00 54.37 ? -3  DG  A "C1'" 1 
ATOM   29   N  N9    . DG  A 1 2  ? 20.052 -6.078  39.981  1.00 51.17 ? -3  DG  A N9    1 
ATOM   30   C  C8    . DG  A 1 2  ? 19.193 -5.907  41.040  1.00 50.89 ? -3  DG  A C8    1 
ATOM   31   N  N7    . DG  A 1 2  ? 17.935 -5.917  40.683  1.00 50.95 ? -3  DG  A N7    1 
ATOM   32   C  C5    . DG  A 1 2  ? 17.971 -6.106  39.306  1.00 48.64 ? -3  DG  A C5    1 
ATOM   33   C  C6    . DG  A 1 2  ? 16.914 -6.196  38.353  1.00 46.94 ? -3  DG  A C6    1 
ATOM   34   O  O6    . DG  A 1 2  ? 15.690 -6.122  38.542  1.00 45.28 ? -3  DG  A O6    1 
ATOM   35   N  N1    . DG  A 1 2  ? 17.406 -6.392  37.066  1.00 45.35 ? -3  DG  A N1    1 
ATOM   36   C  C2    . DG  A 1 2  ? 18.742 -6.485  36.735  1.00 46.44 ? -3  DG  A C2    1 
ATOM   37   N  N2    . DG  A 1 2  ? 19.030 -6.671  35.442  1.00 45.28 ? -3  DG  A N2    1 
ATOM   38   N  N3    . DG  A 1 2  ? 19.725 -6.400  37.608  1.00 47.13 ? -3  DG  A N3    1 
ATOM   39   C  C4    . DG  A 1 2  ? 19.271 -6.212  38.863  1.00 48.93 ? -3  DG  A C4    1 
ATOM   40   P  P     . DG  A 1 3  ? 25.277 -4.216  40.070  1.00 55.17 ? -2  DG  A P     1 
ATOM   41   O  OP1   . DG  A 1 3  ? 26.535 -4.792  40.610  1.00 54.92 ? -2  DG  A OP1   1 
ATOM   42   O  OP2   . DG  A 1 3  ? 24.576 -3.133  40.810  1.00 53.85 ? -2  DG  A OP2   1 
ATOM   43   O  "O5'" . DG  A 1 3  ? 25.543 -3.743  38.574  1.00 52.10 ? -2  DG  A "O5'" 1 
ATOM   44   C  "C5'" . DG  A 1 3  ? 25.792 -4.710  37.554  1.00 49.23 ? -2  DG  A "C5'" 1 
ATOM   45   C  "C4'" . DG  A 1 3  ? 25.072 -4.336  36.278  1.00 47.04 ? -2  DG  A "C4'" 1 
ATOM   46   O  "O4'" . DG  A 1 3  ? 23.637 -4.483  36.432  1.00 46.36 ? -2  DG  A "O4'" 1 
ATOM   47   C  "C3'" . DG  A 1 3  ? 25.300 -2.904  35.794  1.00 45.16 ? -2  DG  A "C3'" 1 
ATOM   48   O  "O3'" . DG  A 1 3  ? 25.444 -2.899  34.377  1.00 44.50 ? -2  DG  A "O3'" 1 
ATOM   49   C  "C2'" . DG  A 1 3  ? 24.017 -2.190  36.177  1.00 44.15 ? -2  DG  A "C2'" 1 
ATOM   50   C  "C1'" . DG  A 1 3  ? 22.993 -3.292  35.996  1.00 42.57 ? -2  DG  A "C1'" 1 
ATOM   51   N  N9    . DG  A 1 3  ? 21.771 -3.128  36.776  1.00 39.00 ? -2  DG  A N9    1 
ATOM   52   C  C8    . DG  A 1 3  ? 21.666 -2.956  38.134  1.00 37.82 ? -2  DG  A C8    1 
ATOM   53   N  N7    . DG  A 1 3  ? 20.430 -2.869  38.544  1.00 36.40 ? -2  DG  A N7    1 
ATOM   54   C  C5    . DG  A 1 3  ? 19.674 -2.982  37.385  1.00 35.19 ? -2  DG  A C5    1 
ATOM   55   C  C6    . DG  A 1 3  ? 18.264 -2.966  37.198  1.00 34.34 ? -2  DG  A C6    1 
ATOM   56   O  O6    . DG  A 1 3  ? 17.368 -2.850  38.055  1.00 32.75 ? -2  DG  A O6    1 
ATOM   57   N  N1    . DG  A 1 3  ? 17.929 -3.108  35.855  1.00 32.43 ? -2  DG  A N1    1 
ATOM   58   C  C2    . DG  A 1 3  ? 18.829 -3.256  34.827  1.00 33.56 ? -2  DG  A C2    1 
ATOM   59   N  N2    . DG  A 1 3  ? 18.315 -3.397  33.599  1.00 33.08 ? -2  DG  A N2    1 
ATOM   60   N  N3    . DG  A 1 3  ? 20.139 -3.272  34.990  1.00 34.50 ? -2  DG  A N3    1 
ATOM   61   C  C4    . DG  A 1 3  ? 20.488 -3.133  36.285  1.00 36.16 ? -2  DG  A C4    1 
ATOM   62   P  P     . DT  A 1 4  ? 25.672 -1.507  33.608  1.00 44.76 ? -1  DT  A P     1 
ATOM   63   O  OP1   . DT  A 1 4  ? 26.690 -1.767  32.554  1.00 44.39 ? -1  DT  A OP1   1 
ATOM   64   O  OP2   . DT  A 1 4  ? 25.889 -0.425  34.606  1.00 42.33 ? -1  DT  A OP2   1 
ATOM   65   O  "O5'" . DT  A 1 4  ? 24.281 -1.262  32.875  1.00 41.03 ? -1  DT  A "O5'" 1 
ATOM   66   C  "C5'" . DT  A 1 4  ? 23.760 -2.252  31.997  1.00 36.89 ? -1  DT  A "C5'" 1 
ATOM   67   C  "C4'" . DT  A 1 4  ? 22.503 -1.751  31.325  1.00 35.70 ? -1  DT  A "C4'" 1 
ATOM   68   O  "O4'" . DT  A 1 4  ? 21.405 -1.670  32.270  1.00 33.00 ? -1  DT  A "O4'" 1 
ATOM   69   C  "C3'" . DT  A 1 4  ? 22.604 -0.375  30.667  1.00 33.17 ? -1  DT  A "C3'" 1 
ATOM   70   O  "O3'" . DT  A 1 4  ? 21.867 -0.450  29.447  1.00 34.38 ? -1  DT  A "O3'" 1 
ATOM   71   C  "C2'" . DT  A 1 4  ? 21.922 0.537   31.678  1.00 33.46 ? -1  DT  A "C2'" 1 
ATOM   72   C  "C1'" . DT  A 1 4  ? 20.835 -0.371  32.235  1.00 32.65 ? -1  DT  A "C1'" 1 
ATOM   73   N  N1    . DT  A 1 4  ? 20.343 -0.064  33.593  1.00 31.22 ? -1  DT  A N1    1 
ATOM   74   C  C2    . DT  A 1 4  ? 18.978 0.032   33.773  1.00 29.92 ? -1  DT  A C2    1 
ATOM   75   O  O2    . DT  A 1 4  ? 18.183 -0.074  32.861  1.00 27.83 ? -1  DT  A O2    1 
ATOM   76   N  N3    . DT  A 1 4  ? 18.582 0.252   35.071  1.00 29.42 ? -1  DT  A N3    1 
ATOM   77   C  C4    . DT  A 1 4  ? 19.399 0.392   36.179  1.00 29.95 ? -1  DT  A C4    1 
ATOM   78   O  O4    . DT  A 1 4  ? 18.904 0.581   37.294  1.00 30.67 ? -1  DT  A O4    1 
ATOM   79   C  C5    . DT  A 1 4  ? 20.817 0.301   35.913  1.00 30.08 ? -1  DT  A C5    1 
ATOM   80   C  C7    . DT  A 1 4  ? 21.773 0.446   37.053  1.00 29.59 ? -1  DT  A C7    1 
ATOM   81   C  C6    . DT  A 1 4  ? 21.214 0.088   34.650  1.00 29.94 ? -1  DT  A C6    1 
ATOM   82   P  P     . DT  A 1 5  ? 22.032 0.678   28.312  1.00 33.21 ? 1   DT  A P     1 
ATOM   83   O  OP1   . DT  A 1 5  ? 22.446 -0.038  27.080  1.00 33.01 ? 1   DT  A OP1   1 
ATOM   84   O  OP2   . DT  A 1 5  ? 22.819 1.845   28.796  1.00 29.31 ? 1   DT  A OP2   1 
ATOM   85   O  "O5'" . DT  A 1 5  ? 20.525 1.120   28.095  1.00 32.92 ? 1   DT  A "O5'" 1 
ATOM   86   C  "C5'" . DT  A 1 5  ? 19.632 1.046   29.182  1.00 30.38 ? 1   DT  A "C5'" 1 
ATOM   87   C  "C4'" . DT  A 1 5  ? 18.205 1.237   28.735  1.00 28.01 ? 1   DT  A "C4'" 1 
ATOM   88   O  "O4'" . DT  A 1 5  ? 17.491 1.367   29.977  1.00 26.48 ? 1   DT  A "O4'" 1 
ATOM   89   C  "C3'" . DT  A 1 5  ? 17.923 2.536   27.979  1.00 25.29 ? 1   DT  A "C3'" 1 
ATOM   90   O  "O3'" . DT  A 1 5  ? 16.709 2.388   27.218  1.00 22.93 ? 1   DT  A "O3'" 1 
ATOM   91   C  "C2'" . DT  A 1 5  ? 17.787 3.545   29.101  1.00 24.78 ? 1   DT  A "C2'" 1 
ATOM   92   C  "C1'" . DT  A 1 5  ? 17.180 2.726   30.228  1.00 25.32 ? 1   DT  A "C1'" 1 
ATOM   93   N  N1    . DT  A 1 5  ? 17.664 3.043   31.584  1.00 26.17 ? 1   DT  A N1    1 
ATOM   94   C  C2    . DT  A 1 5  ? 16.704 3.270   32.535  1.00 24.56 ? 1   DT  A C2    1 
ATOM   95   O  O2    . DT  A 1 5  ? 15.516 3.242   32.283  1.00 24.49 ? 1   DT  A O2    1 
ATOM   96   N  N3    . DT  A 1 5  ? 17.190 3.527   33.794  1.00 24.51 ? 1   DT  A N3    1 
ATOM   97   C  C4    . DT  A 1 5  ? 18.515 3.582   34.177  1.00 24.61 ? 1   DT  A C4    1 
ATOM   98   O  O4    . DT  A 1 5  ? 18.804 3.815   35.338  1.00 26.77 ? 1   DT  A O4    1 
ATOM   99   C  C5    . DT  A 1 5  ? 19.473 3.351   33.128  1.00 26.20 ? 1   DT  A C5    1 
ATOM   100  C  C7    . DT  A 1 5  ? 20.930 3.409   33.464  1.00 25.88 ? 1   DT  A C7    1 
ATOM   101  C  C6    . DT  A 1 5  ? 19.010 3.096   31.894  1.00 24.83 ? 1   DT  A C6    1 
ATOM   102  P  P     . DT  A 1 6  ? 16.183 3.589   26.268  1.00 21.51 ? 2   DT  A P     1 
ATOM   103  O  OP1   . DT  A 1 6  ? 15.391 2.944   25.204  1.00 21.28 ? 2   DT  A OP1   1 
ATOM   104  O  OP2   . DT  A 1 6  ? 17.301 4.489   25.893  1.00 22.20 ? 2   DT  A OP2   1 
ATOM   105  O  "O5'" . DT  A 1 6  ? 15.195 4.394   27.222  1.00 20.53 ? 2   DT  A "O5'" 1 
ATOM   106  C  "C5'" . DT  A 1 6  ? 14.077 3.735   27.800  1.00 18.54 ? 2   DT  A "C5'" 1 
ATOM   107  C  "C4'" . DT  A 1 6  ? 13.350 4.639   28.770  1.00 18.58 ? 2   DT  A "C4'" 1 
ATOM   108  O  "O4'" . DT  A 1 6  ? 14.105 4.798   29.995  1.00 18.25 ? 2   DT  A "O4'" 1 
ATOM   109  C  "C3'" . DT  A 1 6  ? 12.978 6.050   28.301  1.00 15.74 ? 2   DT  A "C3'" 1 
ATOM   110  O  "O3'" . DT  A 1 6  ? 11.606 6.259   28.637  1.00 16.22 ? 2   DT  A "O3'" 1 
ATOM   111  C  "C2'" . DT  A 1 6  ? 13.880 6.949   29.138  1.00 17.00 ? 2   DT  A "C2'" 1 
ATOM   112  C  "C1'" . DT  A 1 6  ? 14.040 6.141   30.423  1.00 17.91 ? 2   DT  A "C1'" 1 
ATOM   113  N  N1    . DT  A 1 6  ? 15.246 6.390   31.258  1.00 21.65 ? 2   DT  A N1    1 
ATOM   114  C  C2    . DT  A 1 6  ? 15.083 6.564   32.622  1.00 21.57 ? 2   DT  A C2    1 
ATOM   115  O  O2    . DT  A 1 6  ? 13.993 6.593   33.169  1.00 21.18 ? 2   DT  A O2    1 
ATOM   116  N  N3    . DT  A 1 6  ? 16.258 6.699   33.325  1.00 23.31 ? 2   DT  A N3    1 
ATOM   117  C  C4    . DT  A 1 6  ? 17.541 6.683   32.816  1.00 22.69 ? 2   DT  A C4    1 
ATOM   118  O  O4    . DT  A 1 6  ? 18.500 6.786   33.571  1.00 25.21 ? 2   DT  A O4    1 
ATOM   119  C  C5    . DT  A 1 6  ? 17.634 6.535   31.386  1.00 22.78 ? 2   DT  A C5    1 
ATOM   120  C  C7    . DT  A 1 6  ? 18.985 6.534   30.748  1.00 22.63 ? 2   DT  A C7    1 
ATOM   121  C  C6    . DT  A 1 6  ? 16.499 6.404   30.688  1.00 21.90 ? 2   DT  A C6    1 
ATOM   122  P  P     . DG  A 1 7  ? 10.766 7.446   27.953  1.00 15.89 ? 3   DG  A P     1 
ATOM   123  O  OP1   . DG  A 1 7  ? 9.395  6.905   27.801  1.00 15.97 ? 3   DG  A OP1   1 
ATOM   124  O  OP2   . DG  A 1 7  ? 11.461 7.989   26.754  1.00 20.06 ? 3   DG  A OP2   1 
ATOM   125  O  "O5'" . DG  A 1 7  ? 10.762 8.555   29.077  1.00 16.85 ? 3   DG  A "O5'" 1 
ATOM   126  C  "C5'" . DG  A 1 7  ? 10.238 8.226   30.346  1.00 18.78 ? 3   DG  A "C5'" 1 
ATOM   127  C  "C4'" . DG  A 1 7  ? 10.565 9.288   31.364  1.00 18.55 ? 3   DG  A "C4'" 1 
ATOM   128  O  "O4'" . DG  A 1 7  ? 11.901 9.120   31.887  1.00 16.95 ? 3   DG  A "O4'" 1 
ATOM   129  C  "C3'" . DG  A 1 7  ? 10.425 10.755  30.954  1.00 18.86 ? 3   DG  A "C3'" 1 
ATOM   130  O  "O3'" . DG  A 1 7  ? 9.378  11.289  31.767  1.00 17.89 ? 3   DG  A "O3'" 1 
ATOM   131  C  "C2'" . DG  A 1 7  ? 11.806 11.352  31.250  1.00 16.71 ? 3   DG  A "C2'" 1 
ATOM   132  C  "C1'" . DG  A 1 7  ? 12.376 10.381  32.283  1.00 18.09 ? 3   DG  A "C1'" 1 
ATOM   133  N  N9    . DG  A 1 7  ? 13.828 10.275  32.453  1.00 17.73 ? 3   DG  A N9    1 
ATOM   134  C  C8    . DG  A 1 7  ? 14.778 10.064  31.483  1.00 16.50 ? 3   DG  A C8    1 
ATOM   135  N  N7    . DG  A 1 7  ? 15.995 9.979   31.962  1.00 16.54 ? 3   DG  A N7    1 
ATOM   136  C  C5    . DG  A 1 7  ? 15.846 10.158  33.332  1.00 15.41 ? 3   DG  A C5    1 
ATOM   137  C  C6    . DG  A 1 7  ? 16.827 10.172  34.388  1.00 17.05 ? 3   DG  A C6    1 
ATOM   138  O  O6    . DG  A 1 7  ? 18.054 10.035  34.311  1.00 17.75 ? 3   DG  A O6    1 
ATOM   139  N  N1    . DG  A 1 7  ? 16.239 10.370  35.633  1.00 16.53 ? 3   DG  A N1    1 
ATOM   140  C  C2    . DG  A 1 7  ? 14.894 10.543  35.844  1.00 17.81 ? 3   DG  A C2    1 
ATOM   141  N  N2    . DG  A 1 7  ? 14.535 10.726  37.119  1.00 19.23 ? 3   DG  A N2    1 
ATOM   142  N  N3    . DG  A 1 7  ? 13.970 10.542  34.874  1.00 15.97 ? 3   DG  A N3    1 
ATOM   143  C  C4    . DG  A 1 7  ? 14.515 10.342  33.656  1.00 17.43 ? 3   DG  A C4    1 
ATOM   144  P  P     . DT  A 1 8  ? 8.957  12.821  31.651  1.00 20.74 ? 4   DT  A P     1 
ATOM   145  O  OP1   . DT  A 1 8  ? 7.482  12.888  31.861  1.00 24.72 ? 4   DT  A OP1   1 
ATOM   146  O  OP2   . DT  A 1 8  ? 9.540  13.455  30.456  1.00 21.71 ? 4   DT  A OP2   1 
ATOM   147  O  "O5'" . DT  A 1 8  ? 9.652  13.426  32.949  1.00 22.11 ? 4   DT  A "O5'" 1 
ATOM   148  C  "C5'" . DT  A 1 8  ? 9.442  12.807  34.215  1.00 21.29 ? 4   DT  A "C5'" 1 
ATOM   149  C  "C4'" . DT  A 1 8  ? 10.140 13.583  35.308  1.00 21.77 ? 4   DT  A "C4'" 1 
ATOM   150  O  "O4'" . DT  A 1 8  ? 11.562 13.299  35.324  1.00 18.27 ? 4   DT  A "O4'" 1 
ATOM   151  C  "C3'" . DT  A 1 8  ? 10.008 15.099  35.206  1.00 21.84 ? 4   DT  A "C3'" 1 
ATOM   152  O  "O3'" . DT  A 1 8  ? 9.539  15.608  36.462  1.00 24.86 ? 4   DT  A "O3'" 1 
ATOM   153  C  "C2'" . DT  A 1 8  ? 11.423 15.562  34.858  1.00 19.15 ? 4   DT  A "C2'" 1 
ATOM   154  C  "C1'" . DT  A 1 8  ? 12.278 14.500  35.523  1.00 18.27 ? 4   DT  A "C1'" 1 
ATOM   155  N  N1    . DT  A 1 8  ? 13.656 14.282  35.011  1.00 20.76 ? 4   DT  A N1    1 
ATOM   156  C  C2    . DT  A 1 8  ? 14.687 14.171  35.936  1.00 19.84 ? 4   DT  A C2    1 
ATOM   157  O  O2    . DT  A 1 8  ? 14.529 14.277  37.139  1.00 20.84 ? 4   DT  A O2    1 
ATOM   158  N  N3    . DT  A 1 8  ? 15.921 13.920  35.393  1.00 17.07 ? 4   DT  A N3    1 
ATOM   159  C  C4    . DT  A 1 8  ? 16.230 13.773  34.065  1.00 16.46 ? 4   DT  A C4    1 
ATOM   160  O  O4    . DT  A 1 8  ? 17.390 13.565  33.731  1.00 13.49 ? 4   DT  A O4    1 
ATOM   161  C  C5    . DT  A 1 8  ? 15.114 13.893  33.149  1.00 17.54 ? 4   DT  A C5    1 
ATOM   162  C  C7    . DT  A 1 8  ? 15.363 13.708  31.683  1.00 15.57 ? 4   DT  A C7    1 
ATOM   163  C  C6    . DT  A 1 8  ? 13.901 14.155  33.658  1.00 16.60 ? 4   DT  A C6    1 
ATOM   164  P  P     . DT  A 1 9  ? 9.042  17.133  36.575  1.00 26.34 ? 5   DT  A P     1 
ATOM   165  O  OP1   . DT  A 1 9  ? 7.818  17.182  37.403  1.00 34.00 ? 5   DT  A OP1   1 
ATOM   166  O  OP2   . DT  A 1 9  ? 9.051  17.777  35.239  1.00 29.17 ? 5   DT  A OP2   1 
ATOM   167  O  "O5'" . DT  A 1 9  ? 10.195 17.795  37.423  1.00 28.31 ? 5   DT  A "O5'" 1 
ATOM   168  C  "C5'" . DT  A 1 9  ? 11.503 17.379  37.188  1.00 28.05 ? 5   DT  A "C5'" 1 
ATOM   169  C  "C4'" . DT  A 1 9  ? 12.403 17.837  38.293  1.00 25.38 ? 5   DT  A "C4'" 1 
ATOM   170  O  "O4'" . DT  A 1 9  ? 13.669 17.246  37.945  1.00 24.51 ? 5   DT  A "O4'" 1 
ATOM   171  C  "C3'" . DT  A 1 9  ? 12.591 19.351  38.305  1.00 26.10 ? 5   DT  A "C3'" 1 
ATOM   172  O  "O3'" . DT  A 1 9  ? 12.671 19.848  39.652  1.00 29.60 ? 5   DT  A "O3'" 1 
ATOM   173  C  "C2'" . DT  A 1 9  ? 13.854 19.561  37.492  1.00 24.35 ? 5   DT  A "C2'" 1 
ATOM   174  C  "C1'" . DT  A 1 9  ? 14.606 18.234  37.599  1.00 24.77 ? 5   DT  A "C1'" 1 
ATOM   175  N  N1    . DT  A 1 9  ? 15.257 17.812  36.343  1.00 23.54 ? 5   DT  A N1    1 
ATOM   176  C  C2    . DT  A 1 9  ? 16.537 17.320  36.414  1.00 22.48 ? 5   DT  A C2    1 
ATOM   177  O  O2    . DT  A 1 9  ? 17.117 17.138  37.464  1.00 23.99 ? 5   DT  A O2    1 
ATOM   178  N  N3    . DT  A 1 9  ? 17.121 17.052  35.198  1.00 21.77 ? 5   DT  A N3    1 
ATOM   179  C  C4    . DT  A 1 9  ? 16.564 17.227  33.954  1.00 22.02 ? 5   DT  A C4    1 
ATOM   180  O  O4    . DT  A 1 9  ? 17.231 16.992  32.961  1.00 22.42 ? 5   DT  A O4    1 
ATOM   181  C  C5    . DT  A 1 9  ? 15.189 17.708  33.954  1.00 23.40 ? 5   DT  A C5    1 
ATOM   182  C  C7    . DT  A 1 9  ? 14.483 17.913  32.649  1.00 21.82 ? 5   DT  A C7    1 
ATOM   183  C  C6    . DT  A 1 9  ? 14.612 17.959  35.134  1.00 21.60 ? 5   DT  A C6    1 
ATOM   184  P  P     . DT  A 1 10 ? 12.777 21.435  39.924  1.00 29.72 ? 6   DT  A P     1 
ATOM   185  O  OP1   . DT  A 1 10 ? 12.142 21.709  41.233  1.00 33.09 ? 6   DT  A OP1   1 
ATOM   186  O  OP2   . DT  A 1 10 ? 12.336 22.192  38.730  1.00 29.94 ? 6   DT  A OP2   1 
ATOM   187  O  "O5'" . DT  A 1 10 ? 14.339 21.627  40.119  1.00 29.33 ? 6   DT  A "O5'" 1 
ATOM   188  C  "C5'" . DT  A 1 10 ? 15.042 20.747  40.981  1.00 28.49 ? 6   DT  A "C5'" 1 
ATOM   189  C  "C4'" . DT  A 1 10 ? 16.516 21.062  40.975  1.00 27.73 ? 6   DT  A "C4'" 1 
ATOM   190  O  "O4'" . DT  A 1 10 ? 17.194 20.430  39.862  1.00 26.94 ? 6   DT  A "O4'" 1 
ATOM   191  C  "C3'" . DT  A 1 10 ? 16.872 22.550  40.934  1.00 27.71 ? 6   DT  A "C3'" 1 
ATOM   192  O  "O3'" . DT  A 1 10 ? 17.806 22.795  41.983  1.00 27.33 ? 6   DT  A "O3'" 1 
ATOM   193  C  "C2'" . DT  A 1 10 ? 17.488 22.743  39.553  1.00 24.64 ? 6   DT  A "C2'" 1 
ATOM   194  C  "C1'" . DT  A 1 10 ? 18.063 21.363  39.233  1.00 27.38 ? 6   DT  A "C1'" 1 
ATOM   195  N  N1    . DT  A 1 10 ? 18.138 21.006  37.785  1.00 26.44 ? 6   DT  A N1    1 
ATOM   196  C  C2    . DT  A 1 10 ? 19.301 20.428  37.315  1.00 25.01 ? 6   DT  A C2    1 
ATOM   197  O  O2    . DT  A 1 10 ? 20.274 20.224  38.011  1.00 26.12 ? 6   DT  A O2    1 
ATOM   198  N  N3    . DT  A 1 10 ? 19.278 20.090  35.985  1.00 23.33 ? 6   DT  A N3    1 
ATOM   199  C  C4    . DT  A 1 10 ? 18.238 20.269  35.096  1.00 23.87 ? 6   DT  A C4    1 
ATOM   200  O  O4    . DT  A 1 10 ? 18.366 19.907  33.933  1.00 22.49 ? 6   DT  A O4    1 
ATOM   201  C  C5    . DT  A 1 10 ? 17.050 20.894  35.647  1.00 23.90 ? 6   DT  A C5    1 
ATOM   202  C  C7    . DT  A 1 10 ? 15.874 21.133  34.753  1.00 22.16 ? 6   DT  A C7    1 
ATOM   203  C  C6    . DT  A 1 10 ? 17.062 21.232  36.944  1.00 24.07 ? 6   DT  A C6    1 
ATOM   204  P  P     . DT  A 1 11 ? 18.355 24.273  42.255  1.00 27.17 ? 7   DT  A P     1 
ATOM   205  O  OP1   . DT  A 1 11 ? 18.613 24.291  43.715  1.00 28.29 ? 7   DT  A OP1   1 
ATOM   206  O  OP2   . DT  A 1 11 ? 17.486 25.311  41.640  1.00 25.48 ? 7   DT  A OP2   1 
ATOM   207  O  "O5'" . DT  A 1 11 ? 19.763 24.236  41.537  1.00 26.21 ? 7   DT  A "O5'" 1 
ATOM   208  C  "C5'" . DT  A 1 11 ? 20.669 23.203  41.865  1.00 27.14 ? 7   DT  A "C5'" 1 
ATOM   209  C  "C4'" . DT  A 1 11 ? 21.920 23.337  41.038  1.00 29.37 ? 7   DT  A "C4'" 1 
ATOM   210  O  "O4'" . DT  A 1 11 ? 21.681 22.866  39.691  1.00 29.27 ? 7   DT  A "O4'" 1 
ATOM   211  C  "C3'" . DT  A 1 11 ? 22.437 24.771  40.915  1.00 30.12 ? 7   DT  A "C3'" 1 
ATOM   212  O  "O3'" . DT  A 1 11 ? 23.804 24.789  41.304  1.00 33.14 ? 7   DT  A "O3'" 1 
ATOM   213  C  "C2'" . DT  A 1 11 ? 22.269 25.109  39.436  1.00 29.07 ? 7   DT  A "C2'" 1 
ATOM   214  C  "C1'" . DT  A 1 11 ? 22.307 23.738  38.770  1.00 28.64 ? 7   DT  A "C1'" 1 
ATOM   215  N  N1    . DT  A 1 11 ? 21.596 23.614  37.472  1.00 26.23 ? 7   DT  A N1    1 
ATOM   216  C  C2    . DT  A 1 11 ? 22.260 23.020  36.415  1.00 26.67 ? 7   DT  A C2    1 
ATOM   217  O  O2    . DT  A 1 11 ? 23.398 22.589  36.494  1.00 24.36 ? 7   DT  A O2    1 
ATOM   218  N  N3    . DT  A 1 11 ? 21.532 22.946  35.247  1.00 27.82 ? 7   DT  A N3    1 
ATOM   219  C  C4    . DT  A 1 11 ? 20.238 23.388  35.044  1.00 27.45 ? 7   DT  A C4    1 
ATOM   220  O  O4    . DT  A 1 11 ? 19.713 23.241  33.951  1.00 30.32 ? 7   DT  A O4    1 
ATOM   221  C  C5    . DT  A 1 11 ? 19.603 23.999  36.197  1.00 27.04 ? 7   DT  A C5    1 
ATOM   222  C  C7    . DT  A 1 11 ? 18.203 24.511  36.071  1.00 21.94 ? 7   DT  A C7    1 
ATOM   223  C  C6    . DT  A 1 11 ? 20.308 24.079  37.333  1.00 25.84 ? 7   DT  A C6    1 
ATOM   224  P  P     . DG  A 1 12 ? 24.598 26.179  41.363  1.00 32.48 ? 8   DG  A P     1 
ATOM   225  O  OP1   . DG  A 1 12 ? 25.513 26.067  42.519  1.00 35.64 ? 8   DG  A OP1   1 
ATOM   226  O  OP2   . DG  A 1 12 ? 23.641 27.318  41.271  1.00 31.06 ? 8   DG  A OP2   1 
ATOM   227  O  "O5'" . DG  A 1 12 ? 25.494 26.112  40.051  1.00 34.27 ? 8   DG  A "O5'" 1 
ATOM   228  C  "C5'" . DG  A 1 12 ? 26.359 25.003  39.837  1.00 34.81 ? 8   DG  A "C5'" 1 
ATOM   229  C  "C4'" . DG  A 1 12 ? 27.193 25.220  38.598  1.00 37.84 ? 8   DG  A "C4'" 1 
ATOM   230  O  "O4'" . DG  A 1 12 ? 26.420 24.941  37.403  1.00 36.20 ? 8   DG  A "O4'" 1 
ATOM   231  C  "C3'" . DG  A 1 12 ? 27.735 26.640  38.442  1.00 38.70 ? 8   DG  A "C3'" 1 
ATOM   232  O  "O3'" . DG  A 1 12 ? 29.090 26.564  37.977  1.00 41.52 ? 8   DG  A "O3'" 1 
ATOM   233  C  "C2'" . DG  A 1 12 ? 26.791 27.263  37.423  1.00 36.63 ? 8   DG  A "C2'" 1 
ATOM   234  C  "C1'" . DG  A 1 12 ? 26.433 26.070  36.545  1.00 35.91 ? 8   DG  A "C1'" 1 
ATOM   235  N  N9    . DG  A 1 12 ? 25.151 26.104  35.837  1.00 34.45 ? 8   DG  A N9    1 
ATOM   236  C  C8    . DG  A 1 12 ? 23.918 26.460  36.329  1.00 33.34 ? 8   DG  A C8    1 
ATOM   237  N  N7    . DG  A 1 12 ? 22.959 26.331  35.447  1.00 32.42 ? 8   DG  A N7    1 
ATOM   238  C  C5    . DG  A 1 12 ? 23.600 25.875  34.302  1.00 31.45 ? 8   DG  A C5    1 
ATOM   239  C  C6    . DG  A 1 12 ? 23.077 25.540  33.001  1.00 30.92 ? 8   DG  A C6    1 
ATOM   240  O  O6    . DG  A 1 12 ? 21.900 25.568  32.605  1.00 27.21 ? 8   DG  A O6    1 
ATOM   241  N  N1    . DG  A 1 12 ? 24.086 25.126  32.140  1.00 26.73 ? 8   DG  A N1    1 
ATOM   242  C  C2    . DG  A 1 12 ? 25.418 25.020  32.477  1.00 30.68 ? 8   DG  A C2    1 
ATOM   243  N  N2    . DG  A 1 12 ? 26.252 24.579  31.517  1.00 28.97 ? 8   DG  A N2    1 
ATOM   244  N  N3    . DG  A 1 12 ? 25.908 25.320  33.671  1.00 30.99 ? 8   DG  A N3    1 
ATOM   245  C  C4    . DG  A 1 12 ? 24.953 25.739  34.524  1.00 32.04 ? 8   DG  A C4    1 
ATOM   246  P  P     . DC  A 1 13 ? 29.981 27.898  37.861  1.00 45.38 ? 9   DC  A P     1 
ATOM   247  O  OP1   . DC  A 1 13 ? 31.201 27.686  38.677  1.00 45.24 ? 9   DC  A OP1   1 
ATOM   248  O  OP2   . DC  A 1 13 ? 29.116 29.086  38.113  1.00 43.32 ? 9   DC  A OP2   1 
ATOM   249  O  "O5'" . DC  A 1 13 ? 30.383 27.897  36.323  1.00 44.81 ? 9   DC  A "O5'" 1 
ATOM   250  C  "C5'" . DC  A 1 13 ? 29.492 27.308  35.390  1.00 45.57 ? 9   DC  A "C5'" 1 
ATOM   251  C  "C4'" . DC  A 1 13 ? 29.799 27.748  33.982  1.00 44.49 ? 9   DC  A "C4'" 1 
ATOM   252  O  "O4'" . DC  A 1 13 ? 28.540 27.605  33.288  1.00 42.67 ? 9   DC  A "O4'" 1 
ATOM   253  C  "C3'" . DC  A 1 13 ? 30.206 29.211  33.796  1.00 44.76 ? 9   DC  A "C3'" 1 
ATOM   254  O  "O3'" . DC  A 1 13 ? 31.017 29.312  32.612  1.00 47.47 ? 9   DC  A "O3'" 1 
ATOM   255  C  "C2'" . DC  A 1 13 ? 28.879 29.913  33.595  1.00 43.14 ? 9   DC  A "C2'" 1 
ATOM   256  C  "C1'" . DC  A 1 13 ? 28.091 28.865  32.830  1.00 41.28 ? 9   DC  A "C1'" 1 
ATOM   257  N  N1    . DC  A 1 13 ? 26.632 28.921  33.008  1.00 37.64 ? 9   DC  A N1    1 
ATOM   258  C  C2    . DC  A 1 13 ? 25.818 28.549  31.928  1.00 35.61 ? 9   DC  A C2    1 
ATOM   259  O  O2    . DC  A 1 13 ? 26.357 28.132  30.881  1.00 32.89 ? 9   DC  A O2    1 
ATOM   260  N  N3    . DC  A 1 13 ? 24.476 28.656  32.049  1.00 33.82 ? 9   DC  A N3    1 
ATOM   261  C  C4    . DC  A 1 13 ? 23.940 29.102  33.188  1.00 34.88 ? 9   DC  A C4    1 
ATOM   262  N  N4    . DC  A 1 13 ? 22.608 29.200  33.254  1.00 31.92 ? 9   DC  A N4    1 
ATOM   263  C  C5    . DC  A 1 13 ? 24.746 29.467  34.309  1.00 34.27 ? 9   DC  A C5    1 
ATOM   264  C  C6    . DC  A 1 13 ? 26.074 29.355  34.177  1.00 35.48 ? 9   DC  A C6    1 
ATOM   265  P  P     . DT  A 1 14 ? 31.650 30.730  32.177  1.00 49.18 ? 10  DT  A P     1 
ATOM   266  O  OP1   . DT  A 1 14 ? 33.123 30.542  32.118  1.00 49.99 ? 10  DT  A OP1   1 
ATOM   267  O  OP2   . DT  A 1 14 ? 31.076 31.834  32.993  1.00 49.85 ? 10  DT  A OP2   1 
ATOM   268  O  "O5'" . DT  A 1 14 ? 31.121 30.944  30.695  1.00 48.95 ? 10  DT  A "O5'" 1 
ATOM   269  C  "C5'" . DT  A 1 14 ? 31.036 29.859  29.782  1.00 48.01 ? 10  DT  A "C5'" 1 
ATOM   270  C  "C4'" . DT  A 1 14 ? 30.196 30.260  28.594  1.00 47.32 ? 10  DT  A "C4'" 1 
ATOM   271  O  "O4'" . DT  A 1 14 ? 28.783 30.223  28.916  1.00 45.47 ? 10  DT  A "O4'" 1 
ATOM   272  C  "C3'" . DT  A 1 14 ? 30.476 31.675  28.084  1.00 48.66 ? 10  DT  A "C3'" 1 
ATOM   273  O  "O3'" . DT  A 1 14 ? 30.525 31.660  26.658  1.00 50.67 ? 10  DT  A "O3'" 1 
ATOM   274  C  "C2'" . DT  A 1 14 ? 29.274 32.473  28.568  1.00 46.11 ? 10  DT  A "C2'" 1 
ATOM   275  C  "C1'" . DT  A 1 14 ? 28.171 31.435  28.507  1.00 44.29 ? 10  DT  A "C1'" 1 
ATOM   276  N  N1    . DT  A 1 14 ? 27.002 31.676  29.377  1.00 41.96 ? 10  DT  A N1    1 
ATOM   277  C  C2    . DT  A 1 14 ? 25.748 31.631  28.803  1.00 41.19 ? 10  DT  A C2    1 
ATOM   278  O  O2    . DT  A 1 14 ? 25.562 31.422  27.619  1.00 41.54 ? 10  DT  A O2    1 
ATOM   279  N  N3    . DT  A 1 14 ? 24.709 31.834  29.673  1.00 40.64 ? 10  DT  A N3    1 
ATOM   280  C  C4    . DT  A 1 14 ? 24.788 32.063  31.032  1.00 40.93 ? 10  DT  A C4    1 
ATOM   281  O  O4    . DT  A 1 14 ? 23.751 32.198  31.685  1.00 41.16 ? 10  DT  A O4    1 
ATOM   282  C  C5    . DT  A 1 14 ? 26.137 32.115  31.571  1.00 41.06 ? 10  DT  A C5    1 
ATOM   283  C  C7    . DT  A 1 14 ? 26.334 32.377  33.032  1.00 40.92 ? 10  DT  A C7    1 
ATOM   284  C  C6    . DT  A 1 14 ? 27.161 31.925  30.724  1.00 41.54 ? 10  DT  A C6    1 
ATOM   285  P  P     . DT  A 1 15 ? 31.076 32.942  25.865  1.00 52.66 ? 11  DT  A P     1 
ATOM   286  O  OP1   . DT  A 1 15 ? 32.268 32.499  25.084  1.00 53.04 ? 11  DT  A OP1   1 
ATOM   287  O  OP2   . DT  A 1 15 ? 31.184 34.081  26.807  1.00 49.99 ? 11  DT  A OP2   1 
ATOM   288  O  "O5'" . DT  A 1 15 ? 29.887 33.251  24.860  1.00 50.53 ? 11  DT  A "O5'" 1 
ATOM   289  C  "C5'" . DT  A 1 15 ? 28.562 33.153  25.334  1.00 51.76 ? 11  DT  A "C5'" 1 
ATOM   290  C  "C4'" . DT  A 1 15 ? 27.576 33.450  24.237  1.00 51.57 ? 11  DT  A "C4'" 1 
ATOM   291  O  "O4'" . DT  A 1 15 ? 26.282 33.415  24.868  1.00 50.49 ? 11  DT  A "O4'" 1 
ATOM   292  C  "C3'" . DT  A 1 15 ? 27.706 34.851  23.649  1.00 52.35 ? 11  DT  A "C3'" 1 
ATOM   293  O  "O3'" . DT  A 1 15 ? 27.181 34.849  22.314  1.00 53.30 ? 11  DT  A "O3'" 1 
ATOM   294  C  "C2'" . DT  A 1 15 ? 26.880 35.694  24.603  1.00 51.26 ? 11  DT  A "C2'" 1 
ATOM   295  C  "C1'" . DT  A 1 15 ? 25.793 34.728  25.072  1.00 49.95 ? 11  DT  A "C1'" 1 
ATOM   296  N  N1    . DT  A 1 15 ? 25.432 34.842  26.497  1.00 47.65 ? 11  DT  A N1    1 
ATOM   297  C  C2    . DT  A 1 15 ? 24.111 34.671  26.820  1.00 45.86 ? 11  DT  A C2    1 
ATOM   298  O  O2    . DT  A 1 15 ? 23.256 34.428  25.987  1.00 45.68 ? 11  DT  A O2    1 
ATOM   299  N  N3    . DT  A 1 15 ? 23.828 34.788  28.155  1.00 44.63 ? 11  DT  A N3    1 
ATOM   300  C  C4    . DT  A 1 15 ? 24.717 35.048  29.178  1.00 43.88 ? 11  DT  A C4    1 
ATOM   301  O  O4    . DT  A 1 15 ? 24.315 35.118  30.337  1.00 43.98 ? 11  DT  A O4    1 
ATOM   302  C  C5    . DT  A 1 15 ? 26.091 35.219  28.769  1.00 44.14 ? 11  DT  A C5    1 
ATOM   303  C  C7    . DT  A 1 15 ? 27.125 35.511  29.812  1.00 41.82 ? 11  DT  A C7    1 
ATOM   304  C  C6    . DT  A 1 15 ? 26.378 35.106  27.465  1.00 44.94 ? 11  DT  A C6    1 
ATOM   305  P  P     . DG  A 1 16 ? 27.279 36.171  21.409  1.00 53.83 ? 12  DG  A P     1 
ATOM   306  O  OP1   . DG  A 1 16 ? 27.529 35.708  20.022  1.00 53.03 ? 12  DG  A OP1   1 
ATOM   307  O  OP2   . DG  A 1 16 ? 28.214 37.138  22.043  1.00 52.96 ? 12  DG  A OP2   1 
ATOM   308  O  "O5'" . DG  A 1 16 ? 25.809 36.777  21.482  1.00 52.93 ? 12  DG  A "O5'" 1 
ATOM   309  C  "C5'" . DG  A 1 16 ? 24.701 36.061  20.941  1.00 51.65 ? 12  DG  A "C5'" 1 
ATOM   310  C  "C4'" . DG  A 1 16 ? 23.424 36.842  21.148  1.00 51.29 ? 12  DG  A "C4'" 1 
ATOM   311  O  "O4'" . DG  A 1 16 ? 23.028 36.808  22.543  1.00 50.01 ? 12  DG  A "O4'" 1 
ATOM   312  C  "C3'" . DG  A 1 16 ? 23.525 38.321  20.780  1.00 50.63 ? 12  DG  A "C3'" 1 
ATOM   313  O  "O3'" . DG  A 1 16 ? 22.235 38.752  20.370  1.00 51.33 ? 12  DG  A "O3'" 1 
ATOM   314  C  "C2'" . DG  A 1 16 ? 23.789 38.981  22.119  1.00 49.12 ? 12  DG  A "C2'" 1 
ATOM   315  C  "C1'" . DG  A 1 16 ? 22.939 38.133  23.048  1.00 48.35 ? 12  DG  A "C1'" 1 
ATOM   316  N  N9    . DG  A 1 16 ? 23.384 38.120  24.439  1.00 46.24 ? 12  DG  A N9    1 
ATOM   317  C  C8    . DG  A 1 16 ? 24.679 38.161  24.892  1.00 45.24 ? 12  DG  A C8    1 
ATOM   318  N  N7    . DG  A 1 16 ? 24.768 38.167  26.195  1.00 44.26 ? 12  DG  A N7    1 
ATOM   319  C  C5    . DG  A 1 16 ? 23.454 38.122  26.630  1.00 43.20 ? 12  DG  A C5    1 
ATOM   320  C  C6    . DG  A 1 16 ? 22.928 38.118  27.942  1.00 41.95 ? 12  DG  A C6    1 
ATOM   321  O  O6    . DG  A 1 16 ? 23.539 38.153  29.015  1.00 40.86 ? 12  DG  A O6    1 
ATOM   322  N  N1    . DG  A 1 16 ? 21.541 38.069  27.935  1.00 40.39 ? 12  DG  A N1    1 
ATOM   323  C  C2    . DG  A 1 16 ? 20.757 38.028  26.808  1.00 41.92 ? 12  DG  A C2    1 
ATOM   324  N  N2    . DG  A 1 16 ? 19.427 37.976  27.013  1.00 41.01 ? 12  DG  A N2    1 
ATOM   325  N  N3    . DG  A 1 16 ? 21.237 38.036  25.572  1.00 42.20 ? 12  DG  A N3    1 
ATOM   326  C  C4    . DG  A 1 16 ? 22.584 38.084  25.559  1.00 44.29 ? 12  DG  A C4    1 
ATOM   327  O  "O5'" . DC  B 2 1  ? 16.793 37.122  35.297  1.00 50.79 ? 13  DC  B "O5'" 1 
ATOM   328  C  "C5'" . DC  B 2 1  ? 15.857 38.198  35.121  1.00 50.16 ? 13  DC  B "C5'" 1 
ATOM   329  C  "C4'" . DC  B 2 1  ? 15.359 38.241  33.696  1.00 49.47 ? 13  DC  B "C4'" 1 
ATOM   330  O  "O4'" . DC  B 2 1  ? 16.372 38.859  32.862  1.00 48.43 ? 13  DC  B "O4'" 1 
ATOM   331  C  "C3'" . DC  B 2 1  ? 15.130 36.842  33.133  1.00 49.38 ? 13  DC  B "C3'" 1 
ATOM   332  O  "O3'" . DC  B 2 1  ? 13.931 36.723  32.380  1.00 49.64 ? 13  DC  B "O3'" 1 
ATOM   333  C  "C2'" . DC  B 2 1  ? 16.338 36.583  32.258  1.00 48.39 ? 13  DC  B "C2'" 1 
ATOM   334  C  "C1'" . DC  B 2 1  ? 16.810 37.967  31.846  1.00 46.79 ? 13  DC  B "C1'" 1 
ATOM   335  N  N1    . DC  B 2 1  ? 18.279 38.016  31.803  1.00 43.26 ? 13  DC  B N1    1 
ATOM   336  C  C2    . DC  B 2 1  ? 18.922 38.145  30.565  1.00 42.45 ? 13  DC  B C2    1 
ATOM   337  O  O2    . DC  B 2 1  ? 18.228 38.269  29.537  1.00 42.04 ? 13  DC  B O2    1 
ATOM   338  N  N3    . DC  B 2 1  ? 20.279 38.127  30.522  1.00 39.45 ? 13  DC  B N3    1 
ATOM   339  C  C4    . DC  B 2 1  ? 20.980 37.991  31.653  1.00 39.84 ? 13  DC  B C4    1 
ATOM   340  N  N4    . DC  B 2 1  ? 22.310 37.965  31.573  1.00 39.00 ? 13  DC  B N4    1 
ATOM   341  C  C5    . DC  B 2 1  ? 20.347 37.877  32.923  1.00 40.57 ? 13  DC  B C5    1 
ATOM   342  C  C6    . DC  B 2 1  ? 19.009 37.902  32.951  1.00 41.63 ? 13  DC  B C6    1 
ATOM   343  P  P     . DA  B 2 2  ? 13.336 35.255  32.105  1.00 51.05 ? 14  DA  B P     1 
ATOM   344  O  OP1   . DA  B 2 2  ? 11.851 35.364  32.100  1.00 50.47 ? 14  DA  B OP1   1 
ATOM   345  O  OP2   . DA  B 2 2  ? 14.003 34.312  33.047  1.00 47.58 ? 14  DA  B OP2   1 
ATOM   346  O  "O5'" . DA  B 2 2  ? 13.847 34.914  30.633  1.00 49.28 ? 14  DA  B "O5'" 1 
ATOM   347  C  "C5'" . DA  B 2 2  ? 13.406 35.673  29.510  1.00 49.12 ? 14  DA  B "C5'" 1 
ATOM   348  C  "C4'" . DA  B 2 2  ? 13.990 35.108  28.237  1.00 48.29 ? 14  DA  B "C4'" 1 
ATOM   349  O  "O4'" . DA  B 2 2  ? 15.422 35.314  28.237  1.00 47.09 ? 14  DA  B "O4'" 1 
ATOM   350  C  "C3'" . DA  B 2 2  ? 13.778 33.606  28.053  1.00 48.33 ? 14  DA  B "C3'" 1 
ATOM   351  O  "O3'" . DA  B 2 2  ? 13.498 33.317  26.683  1.00 49.44 ? 14  DA  B "O3'" 1 
ATOM   352  C  "C2'" . DA  B 2 2  ? 15.101 32.997  28.486  1.00 47.10 ? 14  DA  B "C2'" 1 
ATOM   353  C  "C1'" . DA  B 2 2  ? 16.112 34.075  28.136  1.00 45.97 ? 14  DA  B "C1'" 1 
ATOM   354  N  N9    . DA  B 2 2  ? 17.245 34.136  29.059  1.00 44.86 ? 14  DA  B N9    1 
ATOM   355  C  C8    . DA  B 2 2  ? 17.201 34.015  30.423  1.00 44.56 ? 14  DA  B C8    1 
ATOM   356  N  N7    . DA  B 2 2  ? 18.371 34.136  31.006  1.00 44.81 ? 14  DA  B N7    1 
ATOM   357  C  C5    . DA  B 2 2  ? 19.248 34.347  29.954  1.00 42.80 ? 14  DA  B C5    1 
ATOM   358  C  C6    . DA  B 2 2  ? 20.645 34.555  29.907  1.00 41.93 ? 14  DA  B C6    1 
ATOM   359  N  N6    . DA  B 2 2  ? 21.436 34.584  30.989  1.00 38.16 ? 14  DA  B N6    1 
ATOM   360  N  N1    . DA  B 2 2  ? 21.207 34.732  28.693  1.00 40.64 ? 14  DA  B N1    1 
ATOM   361  C  C2    . DA  B 2 2  ? 20.420 34.698  27.608  1.00 42.02 ? 14  DA  B C2    1 
ATOM   362  N  N3    . DA  B 2 2  ? 19.102 34.511  27.524  1.00 42.82 ? 14  DA  B N3    1 
ATOM   363  C  C4    . DA  B 2 2  ? 18.569 34.343  28.745  1.00 43.37 ? 14  DA  B C4    1 
ATOM   364  P  P     . DA  B 2 3  ? 13.201 31.801  26.233  1.00 49.25 ? 15  DA  B P     1 
ATOM   365  O  OP1   . DA  B 2 3  ? 12.147 31.867  25.184  1.00 50.48 ? 15  DA  B OP1   1 
ATOM   366  O  OP2   . DA  B 2 3  ? 12.995 30.953  27.433  1.00 49.06 ? 15  DA  B OP2   1 
ATOM   367  O  "O5'" . DA  B 2 3  ? 14.557 31.342  25.538  1.00 46.16 ? 15  DA  B "O5'" 1 
ATOM   368  C  "C5'" . DA  B 2 3  ? 15.039 32.033  24.396  1.00 41.48 ? 15  DA  B "C5'" 1 
ATOM   369  C  "C4'" . DA  B 2 3  ? 16.385 31.492  23.978  1.00 38.93 ? 15  DA  B "C4'" 1 
ATOM   370  O  "O4'" . DA  B 2 3  ? 17.380 31.771  24.992  1.00 37.94 ? 15  DA  B "O4'" 1 
ATOM   371  C  "C3'" . DA  B 2 3  ? 16.451 29.987  23.725  1.00 38.48 ? 15  DA  B "C3'" 1 
ATOM   372  O  "O3'" . DA  B 2 3  ? 17.265 29.781  22.562  1.00 36.86 ? 15  DA  B "O3'" 1 
ATOM   373  C  "C2'" . DA  B 2 3  ? 17.124 29.456  24.986  1.00 37.36 ? 15  DA  B "C2'" 1 
ATOM   374  C  "C1'" . DA  B 2 3  ? 18.087 30.585  25.314  1.00 36.76 ? 15  DA  B "C1'" 1 
ATOM   375  N  N9    . DA  B 2 3  ? 18.519 30.696  26.710  1.00 37.30 ? 15  DA  B N9    1 
ATOM   376  C  C8    . DA  B 2 3  ? 17.732 30.646  27.832  1.00 37.51 ? 15  DA  B C8    1 
ATOM   377  N  N7    . DA  B 2 3  ? 18.394 30.823  28.951  1.00 36.96 ? 15  DA  B N7    1 
ATOM   378  C  C5    . DA  B 2 3  ? 19.708 30.994  28.541  1.00 35.58 ? 15  DA  B C5    1 
ATOM   379  C  C6    . DA  B 2 3  ? 20.902 31.227  29.255  1.00 34.44 ? 15  DA  B C6    1 
ATOM   380  N  N6    . DA  B 2 3  ? 20.964 31.334  30.585  1.00 32.81 ? 15  DA  B N6    1 
ATOM   381  N  N1    . DA  B 2 3  ? 22.046 31.347  28.545  1.00 33.97 ? 15  DA  B N1    1 
ATOM   382  C  C2    . DA  B 2 3  ? 21.985 31.239  27.211  1.00 33.86 ? 15  DA  B C2    1 
ATOM   383  N  N3    . DA  B 2 3  ? 20.929 31.021  26.429  1.00 35.61 ? 15  DA  B N3    1 
ATOM   384  C  C4    . DA  B 2 3  ? 19.805 30.907  27.164  1.00 36.20 ? 15  DA  B C4    1 
ATOM   385  P  P     . DG  B 2 4  ? 17.050 28.481  21.649  1.00 38.77 ? 16  DG  B P     1 
ATOM   386  O  OP1   . DG  B 2 4  ? 17.386 28.856  20.246  1.00 40.42 ? 16  DG  B OP1   1 
ATOM   387  O  OP2   . DG  B 2 4  ? 15.736 27.855  21.960  1.00 40.27 ? 16  DG  B OP2   1 
ATOM   388  O  "O5'" . DG  B 2 4  ? 18.189 27.515  22.158  1.00 35.84 ? 16  DG  B "O5'" 1 
ATOM   389  C  "C5'" . DG  B 2 4  ? 18.937 27.907  23.273  1.00 35.03 ? 16  DG  B "C5'" 1 
ATOM   390  C  "C4'" . DG  B 2 4  ? 20.294 27.267  23.250  1.00 32.10 ? 16  DG  B "C4'" 1 
ATOM   391  O  "O4'" . DG  B 2 4  ? 20.921 27.714  24.469  1.00 29.80 ? 16  DG  B "O4'" 1 
ATOM   392  C  "C3'" . DG  B 2 4  ? 20.213 25.746  23.342  1.00 29.80 ? 16  DG  B "C3'" 1 
ATOM   393  O  "O3'" . DG  B 2 4  ? 21.390 25.189  22.770  1.00 27.12 ? 16  DG  B "O3'" 1 
ATOM   394  C  "C2'" . DG  B 2 4  ? 20.167 25.505  24.833  1.00 29.06 ? 16  DG  B "C2'" 1 
ATOM   395  C  "C1'" . DG  B 2 4  ? 21.038 26.631  25.363  1.00 29.63 ? 16  DG  B "C1'" 1 
ATOM   396  N  N9    . DG  B 2 4  ? 20.666 27.100  26.689  1.00 29.88 ? 16  DG  B N9    1 
ATOM   397  C  C8    . DG  B 2 4  ? 19.410 27.185  27.253  1.00 29.21 ? 16  DG  B C8    1 
ATOM   398  N  N7    . DG  B 2 4  ? 19.443 27.535  28.512  1.00 29.51 ? 16  DG  B N7    1 
ATOM   399  C  C5    . DG  B 2 4  ? 20.796 27.715  28.778  1.00 29.03 ? 16  DG  B C5    1 
ATOM   400  C  C6    . DG  B 2 4  ? 21.462 28.076  29.970  1.00 27.47 ? 16  DG  B C6    1 
ATOM   401  O  O6    . DG  B 2 4  ? 20.976 28.321  31.074  1.00 27.09 ? 16  DG  B O6    1 
ATOM   402  N  N1    . DG  B 2 4  ? 22.842 28.138  29.785  1.00 28.86 ? 16  DG  B N1    1 
ATOM   403  C  C2    . DG  B 2 4  ? 23.495 27.888  28.597  1.00 29.00 ? 16  DG  B C2    1 
ATOM   404  N  N2    . DG  B 2 4  ? 24.826 27.998  28.589  1.00 27.45 ? 16  DG  B N2    1 
ATOM   405  N  N3    . DG  B 2 4  ? 22.882 27.551  27.488  1.00 28.73 ? 16  DG  B N3    1 
ATOM   406  C  C4    . DG  B 2 4  ? 21.551 27.480  27.649  1.00 29.59 ? 16  DG  B C4    1 
ATOM   407  P  P     . DC  B 2 5  ? 21.538 23.602  22.606  1.00 24.57 ? 17  DC  B P     1 
ATOM   408  O  OP1   . DC  B 2 5  ? 21.786 23.404  21.160  1.00 26.05 ? 17  DC  B OP1   1 
ATOM   409  O  OP2   . DC  B 2 5  ? 20.424 22.876  23.279  1.00 25.67 ? 17  DC  B OP2   1 
ATOM   410  O  "O5'" . DC  B 2 5  ? 22.908 23.300  23.366  1.00 24.86 ? 17  DC  B "O5'" 1 
ATOM   411  C  "C5'" . DC  B 2 5  ? 24.083 24.037  23.007  1.00 24.24 ? 17  DC  B "C5'" 1 
ATOM   412  C  "C4'" . DC  B 2 5  ? 25.212 23.737  23.959  1.00 22.03 ? 17  DC  B "C4'" 1 
ATOM   413  O  "O4'" . DC  B 2 5  ? 24.938 24.369  25.226  1.00 22.71 ? 17  DC  B "O4'" 1 
ATOM   414  C  "C3'" . DC  B 2 5  ? 25.427 22.254  24.253  1.00 24.03 ? 17  DC  B "C3'" 1 
ATOM   415  O  "O3'" . DC  B 2 5  ? 26.820 21.994  24.272  1.00 25.64 ? 17  DC  B "O3'" 1 
ATOM   416  C  "C2'" . DC  B 2 5  ? 24.814 22.059  25.633  1.00 22.96 ? 17  DC  B "C2'" 1 
ATOM   417  C  "C1'" . DC  B 2 5  ? 24.982 23.420  26.282  1.00 20.90 ? 17  DC  B "C1'" 1 
ATOM   418  N  N1    . DC  B 2 5  ? 23.922 23.777  27.234  1.00 21.38 ? 17  DC  B N1    1 
ATOM   419  C  C2    . DC  B 2 5  ? 24.286 24.176  28.529  1.00 21.05 ? 17  DC  B C2    1 
ATOM   420  O  O2    . DC  B 2 5  ? 25.485 24.208  28.817  1.00 22.43 ? 17  DC  B O2    1 
ATOM   421  N  N3    . DC  B 2 5  ? 23.317 24.512  29.424  1.00 18.14 ? 17  DC  B N3    1 
ATOM   422  C  C4    . DC  B 2 5  ? 22.031 24.467  29.057  1.00 20.19 ? 17  DC  B C4    1 
ATOM   423  N  N4    . DC  B 2 5  ? 21.102 24.812  29.964  1.00 19.13 ? 17  DC  B N4    1 
ATOM   424  C  C5    . DC  B 2 5  ? 21.632 24.064  27.736  1.00 17.15 ? 17  DC  B C5    1 
ATOM   425  C  C6    . DC  B 2 5  ? 22.599 23.728  26.872  1.00 20.70 ? 17  DC  B C6    1 
ATOM   426  P  P     . DA  B 2 6  ? 27.347 20.506  24.494  1.00 27.35 ? 18  DA  B P     1 
ATOM   427  O  OP1   . DA  B 2 6  ? 28.694 20.525  23.889  1.00 29.97 ? 18  DA  B OP1   1 
ATOM   428  O  OP2   . DA  B 2 6  ? 26.346 19.507  24.025  1.00 29.08 ? 18  DA  B OP2   1 
ATOM   429  O  "O5'" . DA  B 2 6  ? 27.464 20.395  26.077  1.00 28.02 ? 18  DA  B "O5'" 1 
ATOM   430  C  "C5'" . DA  B 2 6  ? 28.285 21.304  26.793  1.00 29.29 ? 18  DA  B "C5'" 1 
ATOM   431  C  "C4'" . DA  B 2 6  ? 28.405 20.885  28.238  1.00 27.79 ? 18  DA  B "C4'" 1 
ATOM   432  O  "O4'" . DA  B 2 6  ? 27.284 21.392  29.004  1.00 27.31 ? 18  DA  B "O4'" 1 
ATOM   433  C  "C3'" . DA  B 2 6  ? 28.467 19.378  28.481  1.00 29.32 ? 18  DA  B "C3'" 1 
ATOM   434  O  "O3'" . DA  B 2 6  ? 29.580 19.077  29.328  1.00 32.24 ? 18  DA  B "O3'" 1 
ATOM   435  C  "C2'" . DA  B 2 6  ? 27.140 19.064  29.160  1.00 27.52 ? 18  DA  B "C2'" 1 
ATOM   436  C  "C1'" . DA  B 2 6  ? 26.775 20.380  29.843  1.00 26.21 ? 18  DA  B "C1'" 1 
ATOM   437  N  N9    . DA  B 2 6  ? 25.343 20.636  30.012  1.00 25.34 ? 18  DA  B N9    1 
ATOM   438  C  C8    . DA  B 2 6  ? 24.351 20.471  29.077  1.00 23.17 ? 18  DA  B C8    1 
ATOM   439  N  N7    . DA  B 2 6  ? 23.161 20.815  29.503  1.00 23.30 ? 18  DA  B N7    1 
ATOM   440  C  C5    . DA  B 2 6  ? 23.376 21.227  30.810  1.00 21.96 ? 18  DA  B C5    1 
ATOM   441  C  C6    . DA  B 2 6  ? 22.501 21.713  31.816  1.00 22.07 ? 18  DA  B C6    1 
ATOM   442  N  N6    . DA  B 2 6  ? 21.179 21.891  31.644  1.00 17.96 ? 18  DA  B N6    1 
ATOM   443  N  N1    . DA  B 2 6  ? 23.040 22.019  33.020  1.00 23.29 ? 18  DA  B N1    1 
ATOM   444  C  C2    . DA  B 2 6  ? 24.360 21.854  33.190  1.00 22.96 ? 18  DA  B C2    1 
ATOM   445  N  N3    . DA  B 2 6  ? 25.280 21.414  32.321  1.00 24.16 ? 18  DA  B N3    1 
ATOM   446  C  C4    . DA  B 2 6  ? 24.716 21.114  31.140  1.00 22.91 ? 18  DA  B C4    1 
ATOM   447  P  P     . DA  B 2 7  ? 29.898 17.554  29.724  1.00 32.85 ? 19  DA  B P     1 
ATOM   448  O  OP1   . DA  B 2 7  ? 31.372 17.391  29.770  1.00 35.42 ? 19  DA  B OP1   1 
ATOM   449  O  OP2   . DA  B 2 7  ? 29.094 16.623  28.895  1.00 34.84 ? 19  DA  B OP2   1 
ATOM   450  O  "O5'" . DA  B 2 7  ? 29.352 17.500  31.215  1.00 33.89 ? 19  DA  B "O5'" 1 
ATOM   451  C  "C5'" . DA  B 2 7  ? 29.643 18.567  32.109  1.00 33.86 ? 19  DA  B "C5'" 1 
ATOM   452  C  "C4'" . DA  B 2 7  ? 28.966 18.342  33.438  1.00 33.60 ? 19  DA  B "C4'" 1 
ATOM   453  O  "O4'" . DA  B 2 7  ? 27.600 18.828  33.423  1.00 32.06 ? 19  DA  B "O4'" 1 
ATOM   454  C  "C3'" . DA  B 2 7  ? 28.915 16.886  33.904  1.00 33.54 ? 19  DA  B "C3'" 1 
ATOM   455  O  "O3'" . DA  B 2 7  ? 29.405 16.802  35.245  1.00 33.71 ? 19  DA  B "O3'" 1 
ATOM   456  C  "C2'" . DA  B 2 7  ? 27.435 16.534  33.819  1.00 32.33 ? 19  DA  B "C2'" 1 
ATOM   457  C  "C1'" . DA  B 2 7  ? 26.756 17.881  34.053  1.00 31.27 ? 19  DA  B "C1'" 1 
ATOM   458  N  N9    . DA  B 2 7  ? 25.410 18.016  33.479  1.00 29.16 ? 19  DA  B N9    1 
ATOM   459  C  C8    . DA  B 2 7  ? 25.005 17.667  32.217  1.00 27.40 ? 19  DA  B C8    1 
ATOM   460  N  N7    . DA  B 2 7  ? 23.732 17.883  31.991  1.00 26.60 ? 19  DA  B N7    1 
ATOM   461  C  C5    . DA  B 2 7  ? 23.260 18.410  33.181  1.00 25.28 ? 19  DA  B C5    1 
ATOM   462  C  C6    . DA  B 2 7  ? 21.974 18.841  33.590  1.00 25.76 ? 19  DA  B C6    1 
ATOM   463  N  N6    . DA  B 2 7  ? 20.884 18.790  32.818  1.00 21.40 ? 19  DA  B N6    1 
ATOM   464  N  N1    . DA  B 2 7  ? 21.848 19.330  34.841  1.00 24.88 ? 19  DA  B N1    1 
ATOM   465  C  C2    . DA  B 2 7  ? 22.939 19.374  35.621  1.00 26.33 ? 19  DA  B C2    1 
ATOM   466  N  N3    . DA  B 2 7  ? 24.188 18.991  35.356  1.00 25.96 ? 19  DA  B N3    1 
ATOM   467  C  C4    . DA  B 2 7  ? 24.285 18.512  34.106  1.00 27.29 ? 19  DA  B C4    1 
ATOM   468  P  P     . DA  B 2 8  ? 29.624 15.366  35.934  1.00 36.29 ? 20  DA  B P     1 
ATOM   469  O  OP1   . DA  B 2 8  ? 30.757 15.518  36.880  1.00 38.22 ? 20  DA  B OP1   1 
ATOM   470  O  OP2   . DA  B 2 8  ? 29.665 14.289  34.913  1.00 35.83 ? 20  DA  B OP2   1 
ATOM   471  O  "O5'" . DA  B 2 8  ? 28.306 15.226  36.806  1.00 34.84 ? 20  DA  B "O5'" 1 
ATOM   472  C  "C5'" . DA  B 2 8  ? 27.849 16.350  37.537  1.00 34.62 ? 20  DA  B "C5'" 1 
ATOM   473  C  "C4'" . DA  B 2 8  ? 26.510 16.059  38.161  1.00 36.22 ? 20  DA  B "C4'" 1 
ATOM   474  O  "O4'" . DA  B 2 8  ? 25.412 16.407  37.278  1.00 35.42 ? 20  DA  B "O4'" 1 
ATOM   475  C  "C3'" . DA  B 2 8  ? 26.304 14.601  38.569  1.00 36.63 ? 20  DA  B "C3'" 1 
ATOM   476  O  "O3'" . DA  B 2 8  ? 25.797 14.582  39.891  1.00 39.33 ? 20  DA  B "O3'" 1 
ATOM   477  C  "C2'" . DA  B 2 8  ? 25.227 14.113  37.610  1.00 34.61 ? 20  DA  B "C2'" 1 
ATOM   478  C  "C1'" . DA  B 2 8  ? 24.433 15.389  37.371  1.00 31.56 ? 20  DA  B "C1'" 1 
ATOM   479  N  N9    . DA  B 2 8  ? 23.611 15.418  36.157  1.00 27.97 ? 20  DA  B N9    1 
ATOM   480  C  C8    . DA  B 2 8  ? 23.951 15.007  34.891  1.00 26.50 ? 20  DA  B C8    1 
ATOM   481  N  N7    . DA  B 2 8  ? 22.975 15.100  34.026  1.00 24.98 ? 20  DA  B N7    1 
ATOM   482  C  C5    . DA  B 2 8  ? 21.921 15.616  34.763  1.00 24.05 ? 20  DA  B C5    1 
ATOM   483  C  C6    . DA  B 2 8  ? 20.589 15.941  34.421  1.00 22.23 ? 20  DA  B C6    1 
ATOM   484  N  N6    . DA  B 2 8  ? 20.070 15.758  33.210  1.00 22.21 ? 20  DA  B N6    1 
ATOM   485  N  N1    . DA  B 2 8  ? 19.804 16.461  35.385  1.00 18.61 ? 20  DA  B N1    1 
ATOM   486  C  C2    . DA  B 2 8  ? 20.319 16.628  36.606  1.00 19.90 ? 20  DA  B C2    1 
ATOM   487  N  N3    . DA  B 2 8  ? 21.540 16.349  37.053  1.00 21.78 ? 20  DA  B N3    1 
ATOM   488  C  C4    . DA  B 2 8  ? 22.304 15.838  36.072  1.00 24.94 ? 20  DA  B C4    1 
ATOM   489  P  P     . DA  B 2 9  ? 26.040 13.302  40.826  1.00 40.73 ? 21  DA  B P     1 
ATOM   490  O  OP1   . DA  B 2 9  ? 27.194 13.631  41.698  1.00 43.40 ? 21  DA  B OP1   1 
ATOM   491  O  OP2   . DA  B 2 9  ? 26.050 12.046  40.037  1.00 40.33 ? 21  DA  B OP2   1 
ATOM   492  O  "O5'" . DA  B 2 9  ? 24.740 13.350  41.734  1.00 39.30 ? 21  DA  B "O5'" 1 
ATOM   493  C  "C5'" . DA  B 2 9  ? 24.331 14.590  42.296  1.00 36.68 ? 21  DA  B "C5'" 1 
ATOM   494  C  "C4'" . DA  B 2 9  ? 22.875 14.526  42.674  1.00 36.11 ? 21  DA  B "C4'" 1 
ATOM   495  O  "O4'" . DA  B 2 9  ? 22.036 14.683  41.504  1.00 34.02 ? 21  DA  B "O4'" 1 
ATOM   496  C  "C3'" . DA  B 2 9  ? 22.484 13.196  43.313  1.00 35.49 ? 21  DA  B "C3'" 1 
ATOM   497  O  "O3'" . DA  B 2 9  ? 21.565 13.453  44.375  1.00 37.38 ? 21  DA  B "O3'" 1 
ATOM   498  C  "C2'" . DA  B 2 9  ? 21.841 12.433  42.164  1.00 34.11 ? 21  DA  B "C2'" 1 
ATOM   499  C  "C1'" . DA  B 2 9  ? 21.194 13.544  41.340  1.00 31.82 ? 21  DA  B "C1'" 1 
ATOM   500  N  N9    . DA  B 2 9  ? 21.086 13.278  39.900  1.00 29.66 ? 21  DA  B N9    1 
ATOM   501  C  C8    . DA  B 2 9  ? 22.077 12.838  39.053  1.00 29.16 ? 21  DA  B C8    1 
ATOM   502  N  N7    . DA  B 2 9  ? 21.696 12.737  37.799  1.00 28.09 ? 21  DA  B N7    1 
ATOM   503  C  C5    . DA  B 2 9  ? 20.366 13.130  37.822  1.00 27.04 ? 21  DA  B C5    1 
ATOM   504  C  C6    . DA  B 2 9  ? 19.397 13.239  36.809  1.00 25.63 ? 21  DA  B C6    1 
ATOM   505  N  N6    . DA  B 2 9  ? 19.635 12.964  35.531  1.00 25.31 ? 21  DA  B N6    1 
ATOM   506  N  N1    . DA  B 2 9  ? 18.159 13.643  37.163  1.00 26.60 ? 21  DA  B N1    1 
ATOM   507  C  C2    . DA  B 2 9  ? 17.922 13.917  38.456  1.00 25.85 ? 21  DA  B C2    1 
ATOM   508  N  N3    . DA  B 2 9  ? 18.750 13.855  39.495  1.00 23.20 ? 21  DA  B N3    1 
ATOM   509  C  C4    . DA  B 2 9  ? 19.970 13.452  39.109  1.00 26.77 ? 21  DA  B C4    1 
ATOM   510  P  P     . DC  B 2 10 ? 21.245 12.306  45.449  1.00 38.68 ? 22  DC  B P     1 
ATOM   511  O  OP1   . DC  B 2 10 ? 21.154 12.973  46.768  1.00 39.78 ? 22  DC  B OP1   1 
ATOM   512  O  OP2   . DC  B 2 10 ? 22.178 11.163  45.251  1.00 36.22 ? 22  DC  B OP2   1 
ATOM   513  O  "O5'" . DC  B 2 10 ? 19.775 11.858  45.047  1.00 38.86 ? 22  DC  B "O5'" 1 
ATOM   514  C  "C5'" . DC  B 2 10 ? 19.338 12.050  43.718  1.00 39.11 ? 22  DC  B "C5'" 1 
ATOM   515  C  "C4'" . DC  B 2 10 ? 17.883 11.697  43.578  1.00 37.09 ? 22  DC  B "C4'" 1 
ATOM   516  O  "O4'" . DC  B 2 10 ? 17.618 11.698  42.159  1.00 35.57 ? 22  DC  B "O4'" 1 
ATOM   517  C  "C3'" . DC  B 2 10 ? 17.566 10.287  44.060  1.00 37.24 ? 22  DC  B "C3'" 1 
ATOM   518  O  "O3'" . DC  B 2 10 ? 16.225 10.263  44.548  1.00 37.85 ? 22  DC  B "O3'" 1 
ATOM   519  C  "C2'" . DC  B 2 10 ? 17.768 9.433   42.819  1.00 34.82 ? 22  DC  B "C2'" 1 
ATOM   520  C  "C1'" . DC  B 2 10 ? 17.379 10.382  41.695  1.00 33.38 ? 22  DC  B "C1'" 1 
ATOM   521  N  N1    . DC  B 2 10 ? 18.099 10.223  40.418  1.00 30.17 ? 22  DC  B N1    1 
ATOM   522  C  C2    . DC  B 2 10 ? 17.407 10.524  39.248  1.00 27.37 ? 22  DC  B C2    1 
ATOM   523  O  O2    . DC  B 2 10 ? 16.236 10.928  39.345  1.00 23.95 ? 22  DC  B O2    1 
ATOM   524  N  N3    . DC  B 2 10 ? 18.021 10.376  38.049  1.00 25.16 ? 22  DC  B N3    1 
ATOM   525  C  C4    . DC  B 2 10 ? 19.281 9.954   37.995  1.00 26.52 ? 22  DC  B C4    1 
ATOM   526  N  N4    . DC  B 2 10 ? 19.836 9.822   36.788  1.00 23.28 ? 22  DC  B N4    1 
ATOM   527  C  C5    . DC  B 2 10 ? 20.027 9.646   39.181  1.00 27.85 ? 22  DC  B C5    1 
ATOM   528  C  C6    . DC  B 2 10 ? 19.400 9.793   40.362  1.00 28.79 ? 22  DC  B C6    1 
ATOM   529  P  P     . DA  B 2 11 ? 15.651 8.932   45.228  1.00 38.55 ? 23  DA  B P     1 
ATOM   530  O  OP1   . DA  B 2 11 ? 14.744 9.373   46.317  1.00 38.85 ? 23  DA  B OP1   1 
ATOM   531  O  OP2   . DA  B 2 11 ? 16.767 8.000   45.522  1.00 37.05 ? 23  DA  B OP2   1 
ATOM   532  O  "O5'" . DA  B 2 11 ? 14.773 8.285   44.066  1.00 39.26 ? 23  DA  B "O5'" 1 
ATOM   533  C  "C5'" . DA  B 2 11 ? 13.633 8.968   43.545  1.00 37.89 ? 23  DA  B "C5'" 1 
ATOM   534  C  "C4'" . DA  B 2 11 ? 12.995 8.146   42.449  1.00 37.99 ? 23  DA  B "C4'" 1 
ATOM   535  O  "O4'" . DA  B 2 11 ? 13.770 8.205   41.220  1.00 35.12 ? 23  DA  B "O4'" 1 
ATOM   536  C  "C3'" . DA  B 2 11 ? 12.874 6.660   42.791  1.00 37.94 ? 23  DA  B "C3'" 1 
ATOM   537  O  "O3'" . DA  B 2 11 ? 11.674 6.165   42.209  1.00 39.86 ? 23  DA  B "O3'" 1 
ATOM   538  C  "C2'" . DA  B 2 11 ? 14.052 6.047   42.056  1.00 36.81 ? 23  DA  B "C2'" 1 
ATOM   539  C  "C1'" . DA  B 2 11 ? 14.029 6.882   40.787  1.00 34.39 ? 23  DA  B "C1'" 1 
ATOM   540  N  N9    . DA  B 2 11 ? 15.258 6.886   39.994  1.00 33.17 ? 23  DA  B N9    1 
ATOM   541  C  C8    . DA  B 2 11 ? 16.559 6.787   40.418  1.00 29.98 ? 23  DA  B C8    1 
ATOM   542  N  N7    . DA  B 2 11 ? 17.434 6.816   39.442  1.00 29.35 ? 23  DA  B N7    1 
ATOM   543  C  C5    . DA  B 2 11 ? 16.658 6.947   38.299  1.00 28.81 ? 23  DA  B C5    1 
ATOM   544  C  C6    . DA  B 2 11 ? 16.987 7.037   36.937  1.00 26.58 ? 23  DA  B C6    1 
ATOM   545  N  N6    . DA  B 2 11 ? 18.238 7.017   36.477  1.00 24.40 ? 23  DA  B N6    1 
ATOM   546  N  N1    . DA  B 2 11 ? 15.971 7.148   36.051  1.00 24.95 ? 23  DA  B N1    1 
ATOM   547  C  C2    . DA  B 2 11 ? 14.718 7.172   36.513  1.00 25.50 ? 23  DA  B C2    1 
ATOM   548  N  N3    . DA  B 2 11 ? 14.285 7.102   37.764  1.00 28.27 ? 23  DA  B N3    1 
ATOM   549  C  C4    . DA  B 2 11 ? 15.317 6.987   38.621  1.00 30.53 ? 23  DA  B C4    1 
ATOM   550  P  P     . DA  B 2 12 ? 10.802 5.060   42.977  1.00 39.31 ? 24  DA  B P     1 
ATOM   551  O  OP1   . DA  B 2 12 ? 10.083 5.772   44.052  1.00 38.69 ? 24  DA  B OP1   1 
ATOM   552  O  OP2   . DA  B 2 12 ? 11.652 3.882   43.300  1.00 38.60 ? 24  DA  B OP2   1 
ATOM   553  O  "O5'" . DA  B 2 12 ? 9.762  4.637   41.855  1.00 39.19 ? 24  DA  B "O5'" 1 
ATOM   554  C  "C5'" . DA  B 2 12 ? 9.199  5.623   40.998  1.00 36.58 ? 24  DA  B "C5'" 1 
ATOM   555  C  "C4'" . DA  B 2 12 ? 9.094  5.098   39.585  1.00 37.38 ? 24  DA  B "C4'" 1 
ATOM   556  O  "O4'" . DA  B 2 12 ? 10.363 5.188   38.890  1.00 34.66 ? 24  DA  B "O4'" 1 
ATOM   557  C  "C3'" . DA  B 2 12 ? 8.628  3.647   39.463  1.00 36.63 ? 24  DA  B "C3'" 1 
ATOM   558  O  "O3'" . DA  B 2 12 ? 7.620  3.566   38.458  1.00 38.13 ? 24  DA  B "O3'" 1 
ATOM   559  C  "C2'" . DA  B 2 12 ? 9.889  2.893   39.067  1.00 35.34 ? 24  DA  B "C2'" 1 
ATOM   560  C  "C1'" . DA  B 2 12 ? 10.697 3.940   38.307  1.00 34.34 ? 24  DA  B "C1'" 1 
ATOM   561  N  N9    . DA  B 2 12 ? 12.154 3.789   38.404  1.00 33.71 ? 24  DA  B N9    1 
ATOM   562  C  C8    . DA  B 2 12 ? 12.905 3.605   39.542  1.00 32.34 ? 24  DA  B C8    1 
ATOM   563  N  N7    . DA  B 2 12 ? 14.199 3.541   39.318  1.00 33.41 ? 24  DA  B N7    1 
ATOM   564  C  C5    . DA  B 2 12 ? 14.307 3.682   37.938  1.00 32.42 ? 24  DA  B C5    1 
ATOM   565  C  C6    . DA  B 2 12 ? 15.414 3.702   37.072  1.00 30.26 ? 24  DA  B C6    1 
ATOM   566  N  N6    . DA  B 2 12 ? 16.677 3.591   37.482  1.00 29.16 ? 24  DA  B N6    1 
ATOM   567  N  N1    . DA  B 2 12 ? 15.178 3.850   35.752  1.00 29.06 ? 24  DA  B N1    1 
ATOM   568  C  C2    . DA  B 2 12 ? 13.914 3.976   35.341  1.00 29.51 ? 24  DA  B C2    1 
ATOM   569  N  N3    . DA  B 2 12 ? 12.791 3.981   36.056  1.00 32.11 ? 24  DA  B N3    1 
ATOM   570  C  C4    . DA  B 2 12 ? 13.057 3.827   37.363  1.00 32.22 ? 24  DA  B C4    1 
ATOM   571  P  P     . DA  B 2 13 ? 6.917  2.161   38.144  1.00 40.95 ? 25  DA  B P     1 
ATOM   572  O  OP1   . DA  B 2 13 ? 5.526  2.490   37.756  1.00 42.03 ? 25  DA  B OP1   1 
ATOM   573  O  OP2   . DA  B 2 13 ? 7.162  1.218   39.260  1.00 40.61 ? 25  DA  B OP2   1 
ATOM   574  O  "O5'" . DA  B 2 13 ? 7.701  1.661   36.848  1.00 39.89 ? 25  DA  B "O5'" 1 
ATOM   575  C  "C5'" . DA  B 2 13 ? 7.854  2.534   35.731  1.00 35.97 ? 25  DA  B "C5'" 1 
ATOM   576  C  "C4'" . DA  B 2 13 ? 8.703  1.897   34.653  1.00 34.91 ? 25  DA  B "C4'" 1 
ATOM   577  O  "O4'" . DA  B 2 13 ? 10.118 1.920   34.961  1.00 33.80 ? 25  DA  B "O4'" 1 
ATOM   578  C  "C3'" . DA  B 2 13 ? 8.375  0.455   34.286  1.00 34.49 ? 25  DA  B "C3'" 1 
ATOM   579  O  "O3'" . DA  B 2 13 ? 8.424  0.354   32.868  1.00 34.85 ? 25  DA  B "O3'" 1 
ATOM   580  C  "C2'" . DA  B 2 13 ? 9.521  -0.330  34.907  1.00 32.68 ? 25  DA  B "C2'" 1 
ATOM   581  C  "C1'" . DA  B 2 13 ? 10.682 0.634   34.735  1.00 31.36 ? 25  DA  B "C1'" 1 
ATOM   582  N  N9    . DA  B 2 13 ? 11.792 0.461   35.681  1.00 30.13 ? 25  DA  B N9    1 
ATOM   583  C  C8    . DA  B 2 13 ? 11.699 0.273   37.039  1.00 27.58 ? 25  DA  B C8    1 
ATOM   584  N  N7    . DA  B 2 13 ? 12.859 0.217   37.646  1.00 26.51 ? 25  DA  B N7    1 
ATOM   585  C  C5    . DA  B 2 13 ? 13.783 0.364   36.619  1.00 26.40 ? 25  DA  B C5    1 
ATOM   586  C  C6    . DA  B 2 13 ? 15.192 0.394   36.612  1.00 25.74 ? 25  DA  B C6    1 
ATOM   587  N  N6    . DA  B 2 13 ? 15.939 0.294   37.715  1.00 23.16 ? 25  DA  B N6    1 
ATOM   588  N  N1    . DA  B 2 13 ? 15.812 0.538   35.421  1.00 24.45 ? 25  DA  B N1    1 
ATOM   589  C  C2    . DA  B 2 13 ? 15.057 0.648   34.319  1.00 25.89 ? 25  DA  B C2    1 
ATOM   590  N  N3    . DA  B 2 13 ? 13.726 0.640   34.201  1.00 27.18 ? 25  DA  B N3    1 
ATOM   591  C  C4    . DA  B 2 13 ? 13.142 0.496   35.401  1.00 26.37 ? 25  DA  B C4    1 
ATOM   592  P  P     . DC  B 2 14 ? 7.819  -0.940  32.140  1.00 35.34 ? 26  DC  B P     1 
ATOM   593  O  OP1   . DC  B 2 14 ? 7.036  -0.430  30.972  1.00 35.40 ? 26  DC  B OP1   1 
ATOM   594  O  OP2   . DC  B 2 14 ? 7.188  -1.806  33.156  1.00 33.08 ? 26  DC  B OP2   1 
ATOM   595  O  "O5'" . DC  B 2 14 ? 9.095  -1.682  31.565  1.00 33.06 ? 26  DC  B "O5'" 1 
ATOM   596  C  "C5'" . DC  B 2 14 ? 10.354 -1.420  32.125  1.00 35.38 ? 26  DC  B "C5'" 1 
ATOM   597  C  "C4'" . DC  B 2 14 ? 11.430 -1.535  31.080  1.00 35.78 ? 26  DC  B "C4'" 1 
ATOM   598  O  "O4'" . DC  B 2 14 ? 12.669 -1.365  31.793  1.00 35.75 ? 26  DC  B "O4'" 1 
ATOM   599  C  "C3'" . DC  B 2 14 ? 11.513 -2.922  30.453  1.00 35.94 ? 26  DC  B "C3'" 1 
ATOM   600  O  "O3'" . DC  B 2 14 ? 12.126 -2.821  29.170  1.00 37.03 ? 26  DC  B "O3'" 1 
ATOM   601  C  "C2'" . DC  B 2 14 ? 12.376 -3.690  31.434  1.00 34.28 ? 26  DC  B "C2'" 1 
ATOM   602  C  "C1'" . DC  B 2 14 ? 13.299 -2.617  32.002  1.00 34.48 ? 26  DC  B "C1'" 1 
ATOM   603  N  N1    . DC  B 2 14 ? 13.563 -2.741  33.445  1.00 32.99 ? 26  DC  B N1    1 
ATOM   604  C  C2    . DC  B 2 14 ? 14.881 -2.688  33.877  1.00 32.76 ? 26  DC  B C2    1 
ATOM   605  O  O2    . DC  B 2 14 ? 15.776 -2.528  33.024  1.00 35.32 ? 26  DC  B O2    1 
ATOM   606  N  N3    . DC  B 2 14 ? 15.155 -2.810  35.200  1.00 30.66 ? 26  DC  B N3    1 
ATOM   607  C  C4    . DC  B 2 14 ? 14.161 -2.979  36.073  1.00 29.82 ? 26  DC  B C4    1 
ATOM   608  N  N4    . DC  B 2 14 ? 14.475 -3.092  37.362  1.00 27.92 ? 26  DC  B N4    1 
ATOM   609  C  C5    . DC  B 2 14 ? 12.796 -3.038  35.657  1.00 30.87 ? 26  DC  B C5    1 
ATOM   610  C  C6    . DC  B 2 14 ? 12.546 -2.910  34.344  1.00 32.52 ? 26  DC  B C6    1 
ATOM   611  P  P     . DC  B 2 15 ? 12.226 -4.114  28.237  1.00 38.75 ? 27  DC  B P     1 
ATOM   612  O  OP1   . DC  B 2 15 ? 12.572 -3.623  26.877  1.00 39.51 ? 27  DC  B OP1   1 
ATOM   613  O  OP2   . DC  B 2 15 ? 11.021 -4.960  28.439  1.00 39.12 ? 27  DC  B OP2   1 
ATOM   614  O  "O5'" . DC  B 2 15 ? 13.465 -4.920  28.826  1.00 40.25 ? 27  DC  B "O5'" 1 
ATOM   615  C  "C5'" . DC  B 2 15 ? 14.791 -4.420  28.689  1.00 39.79 ? 27  DC  B "C5'" 1 
ATOM   616  C  "C4'" . DC  B 2 15 ? 15.770 -5.405  29.282  1.00 41.02 ? 27  DC  B "C4'" 1 
ATOM   617  O  "O4'" . DC  B 2 15 ? 15.740 -5.365  30.732  1.00 39.80 ? 27  DC  B "O4'" 1 
ATOM   618  C  "C3'" . DC  B 2 15 ? 15.477 -6.857  28.896  1.00 40.96 ? 27  DC  B "C3'" 1 
ATOM   619  O  "O3'" . DC  B 2 15 ? 16.715 -7.539  28.756  1.00 43.85 ? 27  DC  B "O3'" 1 
ATOM   620  C  "C2'" . DC  B 2 15 ? 14.779 -7.401  30.131  1.00 39.39 ? 27  DC  B "C2'" 1 
ATOM   621  C  "C1'" . DC  B 2 15 ? 15.576 -6.694  31.207  1.00 38.46 ? 27  DC  B "C1'" 1 
ATOM   622  N  N1    . DC  B 2 15 ? 15.003 -6.642  32.560  1.00 35.92 ? 27  DC  B N1    1 
ATOM   623  C  C2    . DC  B 2 15 ? 15.886 -6.604  33.646  1.00 34.81 ? 27  DC  B C2    1 
ATOM   624  O  O2    . DC  B 2 15 ? 17.111 -6.641  33.423  1.00 35.31 ? 27  DC  B O2    1 
ATOM   625  N  N3    . DC  B 2 15 ? 15.391 -6.532  34.901  1.00 32.82 ? 27  DC  B N3    1 
ATOM   626  C  C4    . DC  B 2 15 ? 14.073 -6.511  35.099  1.00 32.52 ? 27  DC  B C4    1 
ATOM   627  N  N4    . DC  B 2 15 ? 13.637 -6.446  36.356  1.00 31.76 ? 27  DC  B N4    1 
ATOM   628  C  C5    . DC  B 2 15 ? 13.144 -6.560  34.014  1.00 33.77 ? 27  DC  B C5    1 
ATOM   629  C  C6    . DC  B 2 15 ? 13.650 -6.625  32.770  1.00 35.69 ? 27  DC  B C6    1 
ATOM   630  P  P     . DA  B 2 16 ? 17.232 -7.987  27.307  1.00 46.12 ? 28  DA  B P     1 
ATOM   631  O  OP1   . DA  B 2 16 ? 17.490 -6.759  26.509  1.00 45.95 ? 28  DA  B OP1   1 
ATOM   632  O  OP2   . DA  B 2 16 ? 16.327 -9.037  26.767  1.00 44.13 ? 28  DA  B OP2   1 
ATOM   633  O  "O5'" . DA  B 2 16 ? 18.659 -8.608  27.649  1.00 45.31 ? 28  DA  B "O5'" 1 
ATOM   634  C  "C5'" . DA  B 2 16 ? 19.737 -7.756  28.044  1.00 44.44 ? 28  DA  B "C5'" 1 
ATOM   635  C  "C4'" . DA  B 2 16 ? 20.636 -8.462  29.032  1.00 45.17 ? 28  DA  B "C4'" 1 
ATOM   636  O  "O4'" . DA  B 2 16 ? 19.997 -8.546  30.329  1.00 46.03 ? 28  DA  B "O4'" 1 
ATOM   637  C  "C3'" . DA  B 2 16 ? 20.999 -9.898  28.658  1.00 46.04 ? 28  DA  B "C3'" 1 
ATOM   638  O  "O3'" . DA  B 2 16 ? 22.277 -10.159 29.264  1.00 46.45 ? 28  DA  B "O3'" 1 
ATOM   639  C  "C2'" . DA  B 2 16 ? 19.950 -10.704 29.408  1.00 44.22 ? 28  DA  B "C2'" 1 
ATOM   640  C  "C1'" . DA  B 2 16 ? 19.848 -9.915  30.705  1.00 43.94 ? 28  DA  B "C1'" 1 
ATOM   641  N  N9    . DA  B 2 16 ? 18.585 -10.041 31.436  1.00 42.02 ? 28  DA  B N9    1 
ATOM   642  C  C8    . DA  B 2 16 ? 17.326 -10.247 30.928  1.00 41.79 ? 28  DA  B C8    1 
ATOM   643  N  N7    . DA  B 2 16 ? 16.383 -10.260 31.842  1.00 41.18 ? 28  DA  B N7    1 
ATOM   644  C  C5    . DA  B 2 16 ? 17.069 -10.061 33.033  1.00 40.34 ? 28  DA  B C5    1 
ATOM   645  C  C6    . DA  B 2 16 ? 16.637 -9.970  34.373  1.00 41.25 ? 28  DA  B C6    1 
ATOM   646  N  N6    . DA  B 2 16 ? 15.356 -10.062 34.749  1.00 39.82 ? 28  DA  B N6    1 
ATOM   647  N  N1    . DA  B 2 16 ? 17.578 -9.778  35.324  1.00 40.70 ? 28  DA  B N1    1 
ATOM   648  C  C2    . DA  B 2 16 ? 18.860 -9.683  34.943  1.00 41.09 ? 28  DA  B C2    1 
ATOM   649  N  N3    . DA  B 2 16 ? 19.386 -9.751  33.721  1.00 40.37 ? 28  DA  B N3    1 
ATOM   650  C  C4    . DA  B 2 16 ? 18.427 -9.941  32.800  1.00 40.79 ? 28  DA  B C4    1 
ATOM   651  O  "O5'" . DT  C 1 1  ? 20.060 8.705   -12.400 1.00 67.51 ? -4  DT  D "O5'" 1 
ATOM   652  C  "C5'" . DT  C 1 1  ? 19.929 8.913   -10.984 1.00 66.54 ? -4  DT  D "C5'" 1 
ATOM   653  C  "C4'" . DT  C 1 1  ? 20.953 8.101   -10.228 1.00 65.00 ? -4  DT  D "C4'" 1 
ATOM   654  O  "O4'" . DT  C 1 1  ? 20.610 8.075   -8.822  1.00 63.78 ? -4  DT  D "O4'" 1 
ATOM   655  C  "C3'" . DT  C 1 1  ? 21.022 6.642   -10.667 1.00 64.66 ? -4  DT  D "C3'" 1 
ATOM   656  O  "O3'" . DT  C 1 1  ? 22.368 6.184   -10.568 1.00 65.36 ? -4  DT  D "O3'" 1 
ATOM   657  C  "C2'" . DT  C 1 1  ? 20.137 5.932   -9.659  1.00 62.92 ? -4  DT  D "C2'" 1 
ATOM   658  C  "C1'" . DT  C 1 1  ? 20.381 6.737   -8.394  1.00 61.39 ? -4  DT  D "C1'" 1 
ATOM   659  N  N1    . DT  C 1 1  ? 19.246 6.757   -7.450  1.00 58.17 ? -4  DT  D N1    1 
ATOM   660  C  C2    . DT  C 1 1  ? 19.521 6.778   -6.101  1.00 56.35 ? -4  DT  D C2    1 
ATOM   661  O  O2    . DT  C 1 1  ? 20.651 6.761   -5.650  1.00 54.67 ? -4  DT  D O2    1 
ATOM   662  N  N3    . DT  C 1 1  ? 18.414 6.820   -5.293  1.00 55.38 ? -4  DT  D N3    1 
ATOM   663  C  C4    . DT  C 1 1  ? 17.094 6.839   -5.689  1.00 55.11 ? -4  DT  D C4    1 
ATOM   664  O  O4    . DT  C 1 1  ? 16.205 6.883   -4.847  1.00 55.67 ? -4  DT  D O4    1 
ATOM   665  C  C5    . DT  C 1 1  ? 16.879 6.807   -7.115  1.00 55.59 ? -4  DT  D C5    1 
ATOM   666  C  C7    . DT  C 1 1  ? 15.477 6.820   -7.634  1.00 55.95 ? -4  DT  D C7    1 
ATOM   667  C  C6    . DT  C 1 1  ? 17.950 6.767   -7.914  1.00 56.43 ? -4  DT  D C6    1 
ATOM   668  P  P     . DG  C 1 2  ? 22.845 4.923   -11.441 1.00 67.08 ? -3  DG  D P     1 
ATOM   669  O  OP1   . DG  C 1 2  ? 23.842 5.423   -12.426 1.00 66.99 ? -3  DG  D OP1   1 
ATOM   670  O  OP2   . DG  C 1 2  ? 21.647 4.175   -11.918 1.00 66.64 ? -3  DG  D OP2   1 
ATOM   671  O  "O5'" . DG  C 1 2  ? 23.600 4.013   -10.377 1.00 63.51 ? -3  DG  D "O5'" 1 
ATOM   672  C  "C5'" . DG  C 1 2  ? 24.484 4.595   -9.425  1.00 59.27 ? -3  DG  D "C5'" 1 
ATOM   673  C  "C4'" . DG  C 1 2  ? 24.478 3.782   -8.153  1.00 55.71 ? -3  DG  D "C4'" 1 
ATOM   674  O  "O4'" . DG  C 1 2  ? 23.231 3.958   -7.438  1.00 53.43 ? -3  DG  D "O4'" 1 
ATOM   675  C  "C3'" . DG  C 1 2  ? 24.615 2.277   -8.378  1.00 54.70 ? -3  DG  D "C3'" 1 
ATOM   676  O  "O3'" . DG  C 1 2  ? 25.351 1.740   -7.290  1.00 54.55 ? -3  DG  D "O3'" 1 
ATOM   677  C  "C2'" . DG  C 1 2  ? 23.181 1.788   -8.306  1.00 52.36 ? -3  DG  D "C2'" 1 
ATOM   678  C  "C1'" . DG  C 1 2  ? 22.640 2.685   -7.212  1.00 51.26 ? -3  DG  D "C1'" 1 
ATOM   679  N  N9    . DG  C 1 2  ? 21.191 2.855   -7.200  1.00 47.44 ? -3  DG  D N9    1 
ATOM   680  C  C8    . DG  C 1 2  ? 20.334 2.827   -8.275  1.00 46.55 ? -3  DG  D C8    1 
ATOM   681  N  N7    . DG  C 1 2  ? 19.088 3.033   -7.941  1.00 44.97 ? -3  DG  D N7    1 
ATOM   682  C  C5    . DG  C 1 2  ? 19.125 3.198   -6.561  1.00 43.64 ? -3  DG  D C5    1 
ATOM   683  C  C6    . DG  C 1 2  ? 18.082 3.452   -5.640  1.00 41.46 ? -3  DG  D C6    1 
ATOM   684  O  O6    . DG  C 1 2  ? 16.872 3.587   -5.865  1.00 40.62 ? -3  DG  D O6    1 
ATOM   685  N  N1    . DG  C 1 2  ? 18.564 3.550   -4.340  1.00 40.05 ? -3  DG  D N1    1 
ATOM   686  C  C2    . DG  C 1 2  ? 19.879 3.426   -3.973  1.00 40.23 ? -3  DG  D C2    1 
ATOM   687  N  N2    . DG  C 1 2  ? 20.143 3.557   -2.671  1.00 39.80 ? -3  DG  D N2    1 
ATOM   688  N  N3    . DG  C 1 2  ? 20.863 3.191   -4.821  1.00 41.56 ? -3  DG  D N3    1 
ATOM   689  C  C4    . DG  C 1 2  ? 20.416 3.088   -6.090  1.00 44.27 ? -3  DG  D C4    1 
ATOM   690  P  P     . DG  C 1 3  ? 25.808 0.210   -7.316  1.00 54.99 ? -2  DG  D P     1 
ATOM   691  O  OP1   . DG  C 1 3  ? 27.263 0.202   -7.616  1.00 55.26 ? -2  DG  D OP1   1 
ATOM   692  O  OP2   . DG  C 1 3  ? 24.869 -0.574  -8.159  1.00 53.13 ? -2  DG  D OP2   1 
ATOM   693  O  "O5'" . DG  C 1 3  ? 25.642 -0.209  -5.794  1.00 52.75 ? -2  DG  D "O5'" 1 
ATOM   694  C  "C5'" . DG  C 1 3  ? 26.089 0.672   -4.773  1.00 49.31 ? -2  DG  D "C5'" 1 
ATOM   695  C  "C4'" . DG  C 1 3  ? 25.307 0.438   -3.505  1.00 46.75 ? -2  DG  D "C4'" 1 
ATOM   696  O  "O4'" . DG  C 1 3  ? 23.918 0.794   -3.720  1.00 44.77 ? -2  DG  D "O4'" 1 
ATOM   697  C  "C3'" . DG  C 1 3  ? 25.308 -1.012  -3.019  1.00 45.06 ? -2  DG  D "C3'" 1 
ATOM   698  O  "O3'" . DG  C 1 3  ? 25.446 -1.011  -1.598  1.00 45.46 ? -2  DG  D "O3'" 1 
ATOM   699  C  "C2'" . DG  C 1 3  ? 23.942 -1.526  -3.440  1.00 43.40 ? -2  DG  D "C2'" 1 
ATOM   700  C  "C1'" . DG  C 1 3  ? 23.089 -0.277  -3.302  1.00 41.72 ? -2  DG  D "C1'" 1 
ATOM   701  N  N9    . DG  C 1 3  ? 21.867 -0.242  -4.102  1.00 38.38 ? -2  DG  D N9    1 
ATOM   702  C  C8    . DG  C 1 3  ? 21.747 -0.383  -5.461  1.00 35.24 ? -2  DG  D C8    1 
ATOM   703  N  N7    . DG  C 1 3  ? 20.513 -0.291  -5.878  1.00 35.28 ? -2  DG  D N7    1 
ATOM   704  C  C5    . DG  C 1 3  ? 19.772 -0.080  -4.724  1.00 33.57 ? -2  DG  D C5    1 
ATOM   705  C  C6    . DG  C 1 3  ? 18.367 0.106   -4.541  1.00 32.62 ? -2  DG  D C6    1 
ATOM   706  O  O6    . DG  C 1 3  ? 17.468 0.121   -5.401  1.00 31.15 ? -2  DG  D O6    1 
ATOM   707  N  N1    . DG  C 1 3  ? 18.049 0.293   -3.196  1.00 29.81 ? -2  DG  D N1    1 
ATOM   708  C  C2    . DG  C 1 3  ? 18.957 0.307   -2.166  1.00 30.94 ? -2  DG  D C2    1 
ATOM   709  N  N2    . DG  C 1 3  ? 18.467 0.504   -0.939  1.00 31.21 ? -2  DG  D N2    1 
ATOM   710  N  N3    . DG  C 1 3  ? 20.258 0.142   -2.324  1.00 33.32 ? -2  DG  D N3    1 
ATOM   711  C  C4    . DG  C 1 3  ? 20.592 -0.047  -3.619  1.00 35.60 ? -2  DG  D C4    1 
ATOM   712  P  P     . DT  C 1 4  ? 25.722 -2.387  -0.811  1.00 46.15 ? -1  DT  D P     1 
ATOM   713  O  OP1   . DT  C 1 4  ? 27.023 -2.253  -0.101  1.00 47.42 ? -1  DT  D OP1   1 
ATOM   714  O  OP2   . DT  C 1 4  ? 25.484 -3.540  -1.724  1.00 43.81 ? -1  DT  D OP2   1 
ATOM   715  O  "O5'" . DT  C 1 4  ? 24.577 -2.373  0.283   1.00 43.42 ? -1  DT  D "O5'" 1 
ATOM   716  C  "C5'" . DT  C 1 4  ? 23.294 -1.936  -0.089  1.00 39.93 ? -1  DT  D "C5'" 1 
ATOM   717  C  "C4'" . DT  C 1 4  ? 22.382 -1.877  1.107   1.00 37.38 ? -1  DT  D "C4'" 1 
ATOM   718  O  "O4'" . DT  C 1 4  ? 21.081 -1.640  0.532   1.00 35.64 ? -1  DT  D "O4'" 1 
ATOM   719  C  "C3'" . DT  C 1 4  ? 22.259 -3.195  1.875   1.00 36.14 ? -1  DT  D "C3'" 1 
ATOM   720  O  "O3'" . DT  C 1 4  ? 21.883 -2.928  3.237   1.00 35.91 ? -1  DT  D "O3'" 1 
ATOM   721  C  "C2'" . DT  C 1 4  ? 21.192 -3.945  1.096   1.00 34.91 ? -1  DT  D "C2'" 1 
ATOM   722  C  "C1'" . DT  C 1 4  ? 20.310 -2.829  0.541   1.00 32.78 ? -1  DT  D "C1'" 1 
ATOM   723  N  N1    . DT  C 1 4  ? 19.838 -3.043  -0.828  1.00 29.02 ? -1  DT  D N1    1 
ATOM   724  C  C2    . DT  C 1 4  ? 18.487 -2.974  -1.034  1.00 27.26 ? -1  DT  D C2    1 
ATOM   725  O  O2    . DT  C 1 4  ? 17.696 -2.777  -0.132  1.00 29.37 ? -1  DT  D O2    1 
ATOM   726  N  N3    . DT  C 1 4  ? 18.093 -3.140  -2.331  1.00 24.56 ? -1  DT  D N3    1 
ATOM   727  C  C4    . DT  C 1 4  ? 18.902 -3.373  -3.424  1.00 25.49 ? -1  DT  D C4    1 
ATOM   728  O  O4    . DT  C 1 4  ? 18.399 -3.501  -4.542  1.00 23.67 ? -1  DT  D O4    1 
ATOM   729  C  C5    . DT  C 1 4  ? 20.322 -3.449  -3.136  1.00 26.07 ? -1  DT  D C5    1 
ATOM   730  C  C7    . DT  C 1 4  ? 21.278 -3.706  -4.263  1.00 26.07 ? -1  DT  D C7    1 
ATOM   731  C  C6    . DT  C 1 4  ? 20.714 -3.284  -1.866  1.00 27.58 ? -1  DT  D C6    1 
ATOM   732  P  P     . DT  C 1 5  ? 21.493 -4.138  4.225   1.00 35.21 ? 1   DT  D P     1 
ATOM   733  O  OP1   . DT  C 1 5  ? 21.696 -3.634  5.605   1.00 38.72 ? 1   DT  D OP1   1 
ATOM   734  O  OP2   . DT  C 1 5  ? 22.165 -5.383  3.802   1.00 36.69 ? 1   DT  D OP2   1 
ATOM   735  O  "O5'" . DT  C 1 5  ? 19.920 -4.317  4.015   1.00 36.14 ? 1   DT  D "O5'" 1 
ATOM   736  C  "C5'" . DT  C 1 5  ? 19.012 -3.257  4.342   1.00 30.45 ? 1   DT  D "C5'" 1 
ATOM   737  C  "C4'" . DT  C 1 5  ? 17.576 -3.687  4.138   1.00 28.73 ? 1   DT  D "C4'" 1 
ATOM   738  O  "O4'" . DT  C 1 5  ? 17.277 -3.870  2.727   1.00 28.34 ? 1   DT  D "O4'" 1 
ATOM   739  C  "C3'" . DT  C 1 5  ? 17.141 -4.982  4.840   1.00 27.61 ? 1   DT  D "C3'" 1 
ATOM   740  O  "O3'" . DT  C 1 5  ? 15.851 -4.766  5.432   1.00 25.47 ? 1   DT  D "O3'" 1 
ATOM   741  C  "C2'" . DT  C 1 5  ? 17.046 -5.984  3.698   1.00 25.67 ? 1   DT  D "C2'" 1 
ATOM   742  C  "C1'" . DT  C 1 5  ? 16.595 -5.104  2.543   1.00 27.37 ? 1   DT  D "C1'" 1 
ATOM   743  N  N1    . DT  C 1 5  ? 16.907 -5.596  1.181   1.00 26.84 ? 1   DT  D N1    1 
ATOM   744  C  C2    . DT  C 1 5  ? 15.880 -5.674  0.256   1.00 27.08 ? 1   DT  D C2    1 
ATOM   745  O  O2    . DT  C 1 5  ? 14.714 -5.422  0.521   1.00 24.09 ? 1   DT  D O2    1 
ATOM   746  N  N3    . DT  C 1 5  ? 16.273 -6.063  -1.004  1.00 27.77 ? 1   DT  D N3    1 
ATOM   747  C  C4    . DT  C 1 5  ? 17.551 -6.383  -1.417  1.00 26.88 ? 1   DT  D C4    1 
ATOM   748  O  O4    . DT  C 1 5  ? 17.755 -6.690  -2.588  1.00 28.71 ? 1   DT  D O4    1 
ATOM   749  C  C5    . DT  C 1 5  ? 18.563 -6.317  -0.391  1.00 26.15 ? 1   DT  D C5    1 
ATOM   750  C  C7    . DT  C 1 5  ? 19.971 -6.672  -0.741  1.00 26.86 ? 1   DT  D C7    1 
ATOM   751  C  C6    . DT  C 1 5  ? 18.196 -5.936  0.840   1.00 27.26 ? 1   DT  D C6    1 
ATOM   752  P  P     . DT  C 1 6  ? 15.274 -5.793  6.530   1.00 22.99 ? 2   DT  D P     1 
ATOM   753  O  OP1   . DT  C 1 6  ? 14.811 -4.966  7.666   1.00 25.12 ? 2   DT  D OP1   1 
ATOM   754  O  OP2   . DT  C 1 6  ? 16.216 -6.903  6.756   1.00 20.93 ? 2   DT  D OP2   1 
ATOM   755  O  "O5'" . DT  C 1 6  ? 13.969 -6.360  5.839   1.00 23.08 ? 2   DT  D "O5'" 1 
ATOM   756  C  "C5'" . DT  C 1 6  ? 14.002 -6.632  4.473   1.00 24.01 ? 2   DT  D "C5'" 1 
ATOM   757  C  "C4'" . DT  C 1 6  ? 12.614 -6.766  3.910   1.00 21.87 ? 2   DT  D "C4'" 1 
ATOM   758  O  "O4'" . DT  C 1 6  ? 12.900 -6.918  2.510   1.00 22.12 ? 2   DT  D "O4'" 1 
ATOM   759  C  "C3'" . DT  C 1 6  ? 11.869 -8.039  4.328   1.00 20.33 ? 2   DT  D "C3'" 1 
ATOM   760  O  "O3'" . DT  C 1 6  ? 10.452 -7.865  4.171   1.00 19.18 ? 2   DT  D "O3'" 1 
ATOM   761  C  "C2'" . DT  C 1 6  ? 12.414 -9.080  3.369   1.00 18.16 ? 2   DT  D "C2'" 1 
ATOM   762  C  "C1'" . DT  C 1 6  ? 12.714 -8.259  2.107   1.00 21.43 ? 2   DT  D "C1'" 1 
ATOM   763  N  N1    . DT  C 1 6  ? 13.910 -8.645  1.340   1.00 19.46 ? 2   DT  D N1    1 
ATOM   764  C  C2    . DT  C 1 6  ? 13.762 -8.785  -0.012  1.00 20.11 ? 2   DT  D C2    1 
ATOM   765  O  O2    . DT  C 1 6  ? 12.696 -8.625  -0.578  1.00 19.72 ? 2   DT  D O2    1 
ATOM   766  N  N3    . DT  C 1 6  ? 14.915 -9.120  -0.687  1.00 18.26 ? 2   DT  D N3    1 
ATOM   767  C  C4    . DT  C 1 6  ? 16.164 -9.327  -0.153  1.00 17.51 ? 2   DT  D C4    1 
ATOM   768  O  O4    . DT  C 1 6  ? 17.104 -9.608  -0.893  1.00 19.19 ? 2   DT  D O4    1 
ATOM   769  C  C5    . DT  C 1 6  ? 16.254 -9.182  1.285   1.00 19.52 ? 2   DT  D C5    1 
ATOM   770  C  C7    . DT  C 1 6  ? 17.575 -9.414  1.959   1.00 16.27 ? 2   DT  D C7    1 
ATOM   771  C  C6    . DT  C 1 6  ? 15.134 -8.849  1.953   1.00 20.50 ? 2   DT  D C6    1 
ATOM   772  P  P     . DG  C 1 7  ? 9.424  -8.952  4.792   1.00 19.25 ? 3   DG  D P     1 
ATOM   773  O  OP1   . DG  C 1 7  ? 8.112  -8.257  4.914   1.00 17.15 ? 3   DG  D OP1   1 
ATOM   774  O  OP2   . DG  C 1 7  ? 10.003 -9.645  5.976   1.00 19.66 ? 3   DG  D OP2   1 
ATOM   775  O  "O5'" . DG  C 1 7  ? 9.277  -10.057 3.671   1.00 16.88 ? 3   DG  D "O5'" 1 
ATOM   776  C  "C5'" . DG  C 1 7  ? 8.721  -9.711  2.429   1.00 18.75 ? 3   DG  D "C5'" 1 
ATOM   777  C  "C4'" . DG  C 1 7  ? 8.923  -10.816 1.422   1.00 18.57 ? 3   DG  D "C4'" 1 
ATOM   778  O  "O4'" . DG  C 1 7  ? 10.260 -10.822 0.878   1.00 18.53 ? 3   DG  D "O4'" 1 
ATOM   779  C  "C3'" . DG  C 1 7  ? 8.600  -12.257 1.829   1.00 19.90 ? 3   DG  D "C3'" 1 
ATOM   780  O  "O3'" . DG  C 1 7  ? 7.547  -12.654 0.966   1.00 20.25 ? 3   DG  D "O3'" 1 
ATOM   781  C  "C2'" . DG  C 1 7  ? 9.886  -13.021 1.512   1.00 18.72 ? 3   DG  D "C2'" 1 
ATOM   782  C  "C1'" . DG  C 1 7  ? 10.530 -12.137 0.446   1.00 17.54 ? 3   DG  D "C1'" 1 
ATOM   783  N  N9    . DG  C 1 7  ? 11.972 -12.247 0.239   1.00 17.01 ? 3   DG  D N9    1 
ATOM   784  C  C8    . DG  C 1 7  ? 12.958 -12.168 1.187   1.00 15.16 ? 3   DG  D C8    1 
ATOM   785  N  N7    . DG  C 1 7  ? 14.161 -12.302 0.687   1.00 17.02 ? 3   DG  D N7    1 
ATOM   786  C  C5    . DG  C 1 7  ? 13.958 -12.483 -0.674  1.00 14.15 ? 3   DG  D C5    1 
ATOM   787  C  C6    . DG  C 1 7  ? 14.900 -12.684 -1.743  1.00 17.17 ? 3   DG  D C6    1 
ATOM   788  O  O6    . DG  C 1 7  ? 16.134 -12.762 -1.688  1.00 10.86 ? 3   DG  D O6    1 
ATOM   789  N  N1    . DG  C 1 7  ? 14.256 -12.803 -2.977  1.00 17.50 ? 3   DG  D N1    1 
ATOM   790  C  C2    . DG  C 1 7  ? 12.891 -12.745 -3.159  1.00 20.20 ? 3   DG  D C2    1 
ATOM   791  N  N2    . DG  C 1 7  ? 12.448 -12.872 -4.429  1.00 21.48 ? 3   DG  D N2    1 
ATOM   792  N  N3    . DG  C 1 7  ? 12.016 -12.571 -2.173  1.00 18.14 ? 3   DG  D N3    1 
ATOM   793  C  C4    . DG  C 1 7  ? 12.614 -12.446 -0.972  1.00 15.99 ? 3   DG  D C4    1 
ATOM   794  P  P     . DT  C 1 8  ? 6.827  -14.065 1.149   1.00 22.05 ? 4   DT  D P     1 
ATOM   795  O  OP1   . DT  C 1 8  ? 5.394  -13.783 0.938   1.00 23.28 ? 4   DT  D OP1   1 
ATOM   796  O  OP2   . DT  C 1 8  ? 7.259  -14.796 2.370   1.00 24.72 ? 4   DT  D OP2   1 
ATOM   797  O  "O5'" . DT  C 1 8  ? 7.347  -14.852 -0.131  1.00 25.84 ? 4   DT  D "O5'" 1 
ATOM   798  C  "C5'" . DT  C 1 8  ? 7.249  -14.244 -1.416  1.00 22.70 ? 4   DT  D "C5'" 1 
ATOM   799  C  "C4'" . DT  C 1 8  ? 7.777  -15.170 -2.484  1.00 22.11 ? 4   DT  D "C4'" 1 
ATOM   800  O  "O4'" . DT  C 1 8  ? 9.214  -15.046 -2.603  1.00 19.53 ? 4   DT  D "O4'" 1 
ATOM   801  C  "C3'" . DT  C 1 8  ? 7.471  -16.659 -2.290  1.00 22.73 ? 4   DT  D "C3'" 1 
ATOM   802  O  "O3'" . DT  C 1 8  ? 6.887  -17.157 -3.499  1.00 23.93 ? 4   DT  D "O3'" 1 
ATOM   803  C  "C2'" . DT  C 1 8  ? 8.837  -17.274 -1.994  1.00 18.61 ? 4   DT  D "C2'" 1 
ATOM   804  C  "C1'" . DT  C 1 8  ? 9.793  -16.334 -2.711  1.00 18.96 ? 4   DT  D "C1'" 1 
ATOM   805  N  N1    . DT  C 1 8  ? 11.176 -16.244 -2.185  1.00 19.34 ? 4   DT  D N1    1 
ATOM   806  C  C2    . DT  C 1 8  ? 12.196 -16.235 -3.114  1.00 19.27 ? 4   DT  D C2    1 
ATOM   807  O  O2    . DT  C 1 8  ? 12.003 -16.296 -4.310  1.00 20.85 ? 4   DT  D O2    1 
ATOM   808  N  N3    . DT  C 1 8  ? 13.451 -16.139 -2.592  1.00 17.51 ? 4   DT  D N3    1 
ATOM   809  C  C4    . DT  C 1 8  ? 13.799 -16.044 -1.264  1.00 19.24 ? 4   DT  D C4    1 
ATOM   810  O  O4    . DT  C 1 8  ? 14.985 -15.961 -0.947  1.00 18.90 ? 4   DT  D O4    1 
ATOM   811  C  C5    . DT  C 1 8  ? 12.685 -16.053 -0.332  1.00 19.28 ? 4   DT  D C5    1 
ATOM   812  C  C7    . DT  C 1 8  ? 12.974 -15.948 1.134   1.00 15.87 ? 4   DT  D C7    1 
ATOM   813  C  C6    . DT  C 1 8  ? 11.442 -16.157 -0.834  1.00 16.93 ? 4   DT  D C6    1 
ATOM   814  P  P     . DT  C 1 9  ? 6.135  -18.575 -3.514  1.00 25.82 ? 5   DT  D P     1 
ATOM   815  O  OP1   . DT  C 1 9  ? 4.923  -18.431 -4.349  1.00 30.72 ? 5   DT  D OP1   1 
ATOM   816  O  OP2   . DT  C 1 9  ? 6.033  -19.144 -2.144  1.00 29.03 ? 5   DT  D OP2   1 
ATOM   817  O  "O5'" . DT  C 1 9  ? 7.164  -19.448 -4.333  1.00 28.37 ? 5   DT  D "O5'" 1 
ATOM   818  C  "C5'" . DT  C 1 9  ? 8.495  -19.014 -4.349  1.00 30.07 ? 5   DT  D "C5'" 1 
ATOM   819  C  "C4'" . DT  C 1 9  ? 9.270  -19.688 -5.437  1.00 27.52 ? 5   DT  D "C4'" 1 
ATOM   820  O  "O4'" . DT  C 1 9  ? 10.612 -19.271 -5.115  1.00 27.17 ? 5   DT  D "O4'" 1 
ATOM   821  C  "C3'" . DT  C 1 9  ? 9.237  -21.214 -5.353  1.00 27.01 ? 5   DT  D "C3'" 1 
ATOM   822  O  "O3'" . DT  C 1 9  ? 9.162  -21.788 -6.652  1.00 27.39 ? 5   DT  D "O3'" 1 
ATOM   823  C  "C2'" . DT  C 1 9  ? 10.513 -21.585 -4.625  1.00 24.43 ? 5   DT  D "C2'" 1 
ATOM   824  C  "C1'" . DT  C 1 9  ? 11.424 -20.374 -4.785  1.00 26.14 ? 5   DT  D "C1'" 1 
ATOM   825  N  N1    . DT  C 1 9  ? 12.156 -20.027 -3.552  1.00 23.07 ? 5   DT  D N1    1 
ATOM   826  C  C2    . DT  C 1 9  ? 13.473 -19.671 -3.671  1.00 21.22 ? 5   DT  D C2    1 
ATOM   827  O  O2    . DT  C 1 9  ? 14.028 -19.582 -4.743  1.00 18.75 ? 5   DT  D O2    1 
ATOM   828  N  N3    . DT  C 1 9  ? 14.115 -19.425 -2.478  1.00 20.36 ? 5   DT  D N3    1 
ATOM   829  C  C4    . DT  C 1 9  ? 13.566 -19.501 -1.206  1.00 19.39 ? 5   DT  D C4    1 
ATOM   830  O  O4    . DT  C 1 9  ? 14.268 -19.275 -0.224  1.00 17.82 ? 5   DT  D O4    1 
ATOM   831  C  C5    . DT  C 1 9  ? 12.155 -19.862 -1.165  1.00 20.24 ? 5   DT  D C5    1 
ATOM   832  C  C7    . DT  C 1 9  ? 11.459 -19.968 0.157   1.00 17.68 ? 5   DT  D C7    1 
ATOM   833  C  C6    . DT  C 1 9  ? 11.534 -20.091 -2.324  1.00 19.75 ? 5   DT  D C6    1 
ATOM   834  P  P     . DT  C 1 10 ? 9.067  -23.385 -6.826  1.00 27.76 ? 6   DT  D P     1 
ATOM   835  O  OP1   . DT  C 1 10 ? 8.261  -23.571 -8.061  1.00 31.50 ? 6   DT  D OP1   1 
ATOM   836  O  OP2   . DT  C 1 10 ? 8.667  -24.078 -5.578  1.00 27.91 ? 6   DT  D OP2   1 
ATOM   837  O  "O5'" . DT  C 1 10 ? 10.577 -23.775 -7.136  1.00 26.35 ? 6   DT  D "O5'" 1 
ATOM   838  C  "C5'" . DT  C 1 10 ? 11.325 -22.972 -8.033  1.00 23.86 ? 6   DT  D "C5'" 1 
ATOM   839  C  "C4'" . DT  C 1 10 ? 12.745 -23.466 -8.120  1.00 25.96 ? 6   DT  D "C4'" 1 
ATOM   840  O  "O4'" . DT  C 1 10 ? 13.557 -22.911 -7.062  1.00 25.77 ? 6   DT  D "O4'" 1 
ATOM   841  C  "C3'" . DT  C 1 10 ? 12.944 -24.983 -8.091  1.00 25.58 ? 6   DT  D "C3'" 1 
ATOM   842  O  "O3'" . DT  C 1 10 ? 13.780 -25.350 -9.199  1.00 25.06 ? 6   DT  D "O3'" 1 
ATOM   843  C  "C2'" . DT  C 1 10 ? 13.614 -25.228 -6.746  1.00 22.98 ? 6   DT  D "C2'" 1 
ATOM   844  C  "C1'" . DT  C 1 10 ? 14.351 -23.924 -6.476  1.00 24.37 ? 6   DT  D "C1'" 1 
ATOM   845  N  N1    . DT  C 1 10 ? 14.516 -23.566 -5.045  1.00 22.92 ? 6   DT  D N1    1 
ATOM   846  C  C2    . DT  C 1 10 ? 15.745 -23.114 -4.610  1.00 22.86 ? 6   DT  D C2    1 
ATOM   847  O  O2    . DT  C 1 10 ? 16.725 -23.023 -5.334  1.00 23.20 ? 6   DT  D O2    1 
ATOM   848  N  N3    . DT  C 1 10 ? 15.783 -22.759 -3.288  1.00 22.03 ? 6   DT  D N3    1 
ATOM   849  C  C4    . DT  C 1 10 ? 14.742 -22.813 -2.377  1.00 21.57 ? 6   DT  D C4    1 
ATOM   850  O  O4    . DT  C 1 10 ? 14.923 -22.452 -1.227  1.00 22.16 ? 6   DT  D O4    1 
ATOM   851  C  C5    . DT  C 1 10 ? 13.496 -23.311 -2.893  1.00 22.18 ? 6   DT  D C5    1 
ATOM   852  C  C7    . DT  C 1 10 ? 12.319 -23.419 -1.975  1.00 22.05 ? 6   DT  D C7    1 
ATOM   853  C  C6    . DT  C 1 10 ? 13.446 -23.660 -4.184  1.00 22.29 ? 6   DT  D C6    1 
ATOM   854  P  P     . DT  C 1 11 ? 14.247 -26.876 -9.401  1.00 25.12 ? 7   DT  D P     1 
ATOM   855  O  OP1   . DT  C 1 11 ? 14.347 -27.032 -10.876 1.00 26.90 ? 7   DT  D OP1   1 
ATOM   856  O  OP2   . DT  C 1 11 ? 13.412 -27.813 -8.624  1.00 24.22 ? 7   DT  D OP2   1 
ATOM   857  O  "O5'" . DT  C 1 11 ? 15.717 -26.866 -8.798  1.00 24.71 ? 7   DT  D "O5'" 1 
ATOM   858  C  "C5'" . DT  C 1 11 ? 16.623 -25.854 -9.191  1.00 21.97 ? 7   DT  D "C5'" 1 
ATOM   859  C  "C4'" . DT  C 1 11 ? 17.914 -25.977 -8.422  1.00 24.68 ? 7   DT  D "C4'" 1 
ATOM   860  O  "O4'" . DT  C 1 11 ? 17.763 -25.491 -7.062  1.00 24.71 ? 7   DT  D "O4'" 1 
ATOM   861  C  "C3'" . DT  C 1 11 ? 18.509 -27.387 -8.323  1.00 25.39 ? 7   DT  D "C3'" 1 
ATOM   862  O  "O3'" . DT  C 1 11 ? 19.906 -27.297 -8.660  1.00 28.32 ? 7   DT  D "O3'" 1 
ATOM   863  C  "C2'" . DT  C 1 11 ? 18.292 -27.759 -6.860  1.00 24.26 ? 7   DT  D "C2'" 1 
ATOM   864  C  "C1'" . DT  C 1 11 ? 18.376 -26.403 -6.166  1.00 22.71 ? 7   DT  D "C1'" 1 
ATOM   865  N  N1    . DT  C 1 11 ? 17.691 -26.293 -4.852  1.00 20.66 ? 7   DT  D N1    1 
ATOM   866  C  C2    . DT  C 1 11 ? 18.396 -25.773 -3.786  1.00 19.19 ? 7   DT  D C2    1 
ATOM   867  O  O2    . DT  C 1 11 ? 19.559 -25.406 -3.860  1.00 19.93 ? 7   DT  D O2    1 
ATOM   868  N  N3    . DT  C 1 11 ? 17.683 -25.689 -2.618  1.00 20.77 ? 7   DT  D N3    1 
ATOM   869  C  C4    . DT  C 1 11 ? 16.372 -26.072 -2.409  1.00 21.44 ? 7   DT  D C4    1 
ATOM   870  O  O4    . DT  C 1 11 ? 15.872 -25.945 -1.304  1.00 23.53 ? 7   DT  D O4    1 
ATOM   871  C  C5    . DT  C 1 11 ? 15.694 -26.611 -3.562  1.00 21.97 ? 7   DT  D C5    1 
ATOM   872  C  C7    . DT  C 1 11 ? 14.267 -27.048 -3.426  1.00 19.49 ? 7   DT  D C7    1 
ATOM   873  C  C6    . DT  C 1 11 ? 16.380 -26.694 -4.710  1.00 21.50 ? 7   DT  D C6    1 
ATOM   874  P  P     . DG  C 1 12 ? 20.865 -28.588 -8.542  1.00 29.08 ? 8   DG  D P     1 
ATOM   875  O  OP1   . DG  C 1 12 ? 21.846 -28.479 -9.654  1.00 29.05 ? 8   DG  D OP1   1 
ATOM   876  O  OP2   . DG  C 1 12 ? 20.068 -29.822 -8.380  1.00 26.66 ? 8   DG  D OP2   1 
ATOM   877  O  "O5'" . DG  C 1 12 ? 21.688 -28.319 -7.205  1.00 29.50 ? 8   DG  D "O5'" 1 
ATOM   878  C  "C5'" . DG  C 1 12 ? 22.514 -27.161 -7.090  1.00 29.72 ? 8   DG  D "C5'" 1 
ATOM   879  C  "C4'" . DG  C 1 12 ? 23.334 -27.217 -5.821  1.00 31.69 ? 8   DG  D "C4'" 1 
ATOM   880  O  "O4'" . DG  C 1 12 ? 22.488 -27.077 -4.645  1.00 31.99 ? 8   DG  D "O4'" 1 
ATOM   881  C  "C3'" . DG  C 1 12 ? 24.122 -28.507 -5.610  1.00 30.36 ? 8   DG  D "C3'" 1 
ATOM   882  O  "O3'" . DG  C 1 12 ? 25.366 -28.169 -4.978  1.00 33.70 ? 8   DG  D "O3'" 1 
ATOM   883  C  "C2'" . DG  C 1 12 ? 23.232 -29.293 -4.660  1.00 30.49 ? 8   DG  D "C2'" 1 
ATOM   884  C  "C1'" . DG  C 1 12 ? 22.700 -28.176 -3.770  1.00 29.58 ? 8   DG  D "C1'" 1 
ATOM   885  N  N9    . DG  C 1 12 ? 21.446 -28.419 -3.058  1.00 28.71 ? 8   DG  D N9    1 
ATOM   886  C  C8    . DG  C 1 12 ? 20.222 -28.727 -3.603  1.00 27.21 ? 8   DG  D C8    1 
ATOM   887  N  N7    . DG  C 1 12 ? 19.266 -28.797 -2.713  1.00 24.62 ? 8   DG  D N7    1 
ATOM   888  C  C5    . DG  C 1 12 ? 19.901 -28.540 -1.503  1.00 25.01 ? 8   DG  D C5    1 
ATOM   889  C  C6    . DG  C 1 12 ? 19.376 -28.466 -0.174  1.00 23.76 ? 8   DG  D C6    1 
ATOM   890  O  O6    . DG  C 1 12 ? 18.208 -28.615 0.205   1.00 21.49 ? 8   DG  D O6    1 
ATOM   891  N  N1    . DG  C 1 12 ? 20.373 -28.182 0.753   1.00 21.64 ? 8   DG  D N1    1 
ATOM   892  C  C2    . DG  C 1 12 ? 21.696 -27.984 0.455   1.00 22.80 ? 8   DG  D C2    1 
ATOM   893  N  N2    . DG  C 1 12 ? 22.504 -27.723 1.495   1.00 19.94 ? 8   DG  D N2    1 
ATOM   894  N  N3    . DG  C 1 12 ? 22.196 -28.040 -0.773  1.00 25.52 ? 8   DG  D N3    1 
ATOM   895  C  C4    . DG  C 1 12 ? 21.250 -28.323 -1.694  1.00 26.15 ? 8   DG  D C4    1 
ATOM   896  P  P     . DC  C 1 13 ? 26.503 -29.293 -4.790  1.00 36.75 ? 9   DC  D P     1 
ATOM   897  O  OP1   . DC  C 1 13 ? 27.790 -28.735 -5.294  1.00 34.23 ? 9   DC  D OP1   1 
ATOM   898  O  OP2   . DC  C 1 13 ? 25.983 -30.586 -5.310  1.00 34.51 ? 9   DC  D OP2   1 
ATOM   899  O  "O5'" . DC  C 1 13 ? 26.672 -29.450 -3.222  1.00 37.08 ? 9   DC  D "O5'" 1 
ATOM   900  C  "C5'" . DC  C 1 13 ? 25.554 -29.437 -2.364  1.00 36.95 ? 9   DC  D "C5'" 1 
ATOM   901  C  "C4'" . DC  C 1 13 ? 26.022 -29.527 -0.937  1.00 36.27 ? 9   DC  D "C4'" 1 
ATOM   902  O  "O4'" . DC  C 1 13 ? 24.852 -29.562 -0.096  1.00 35.64 ? 9   DC  D "O4'" 1 
ATOM   903  C  "C3'" . DC  C 1 13 ? 26.777 -30.822 -0.659  1.00 36.14 ? 9   DC  D "C3'" 1 
ATOM   904  O  "O3'" . DC  C 1 13 ? 27.771 -30.588 0.341   1.00 37.48 ? 9   DC  D "O3'" 1 
ATOM   905  C  "C2'" . DC  C 1 13 ? 25.683 -31.776 -0.222  1.00 34.45 ? 9   DC  D "C2'" 1 
ATOM   906  C  "C1'" . DC  C 1 13 ? 24.642 -30.866 0.413   1.00 34.37 ? 9   DC  D "C1'" 1 
ATOM   907  N  N1    . DC  C 1 13 ? 23.248 -31.217 0.113   1.00 32.55 ? 9   DC  D N1    1 
ATOM   908  C  C2    . DC  C 1 13 ? 22.344 -31.219 1.157   1.00 30.22 ? 9   DC  D C2    1 
ATOM   909  O  O2    . DC  C 1 13 ? 22.765 -30.989 2.297   1.00 28.98 ? 9   DC  D O2    1 
ATOM   910  N  N3    . DC  C 1 13 ? 21.042 -31.470 0.908   1.00 29.23 ? 9   DC  D N3    1 
ATOM   911  C  C4    . DC  C 1 13 ? 20.636 -31.727 -0.333  1.00 30.10 ? 9   DC  D C4    1 
ATOM   912  N  N4    . DC  C 1 13 ? 19.335 -31.947 -0.524  1.00 26.89 ? 9   DC  D N4    1 
ATOM   913  C  C5    . DC  C 1 13 ? 21.549 -31.766 -1.428  1.00 30.24 ? 9   DC  D C5    1 
ATOM   914  C  C6    . DC  C 1 13 ? 22.840 -31.508 -1.160  1.00 32.02 ? 9   DC  D C6    1 
ATOM   915  P  P     . DT  C 1 14 ? 28.630 -31.814 0.935   1.00 39.12 ? 10  DT  D P     1 
ATOM   916  O  OP1   . DT  C 1 14 ? 29.911 -31.200 1.392   1.00 39.21 ? 10  DT  D OP1   1 
ATOM   917  O  OP2   . DT  C 1 14 ? 28.655 -32.962 -0.007  1.00 37.59 ? 10  DT  D OP2   1 
ATOM   918  O  "O5'" . DT  C 1 14 ? 27.801 -32.234 2.226   1.00 39.91 ? 10  DT  D "O5'" 1 
ATOM   919  C  "C5'" . DT  C 1 14 ? 27.553 -31.270 3.243   1.00 39.98 ? 10  DT  D "C5'" 1 
ATOM   920  C  "C4'" . DT  C 1 14 ? 26.896 -31.919 4.434   1.00 41.37 ? 10  DT  D "C4'" 1 
ATOM   921  O  "O4'" . DT  C 1 14 ? 25.505 -32.187 4.151   1.00 39.56 ? 10  DT  D "O4'" 1 
ATOM   922  C  "C3'" . DT  C 1 14 ? 27.515 -33.246 4.876   1.00 42.39 ? 10  DT  D "C3'" 1 
ATOM   923  O  "O3'" . DT  C 1 14 ? 27.553 -33.260 6.305   1.00 47.19 ? 10  DT  D "O3'" 1 
ATOM   924  C  "C2'" . DT  C 1 14 ? 26.535 -34.282 4.351   1.00 39.87 ? 10  DT  D "C2'" 1 
ATOM   925  C  "C1'" . DT  C 1 14 ? 25.208 -33.539 4.443   1.00 38.41 ? 10  DT  D "C1'" 1 
ATOM   926  N  N1    . DT  C 1 14 ? 24.157 -33.964 3.506   1.00 34.79 ? 10  DT  D N1    1 
ATOM   927  C  C2    . DT  C 1 14 ? 22.891 -34.146 4.009   1.00 32.83 ? 10  DT  D C2    1 
ATOM   928  O  O2    . DT  C 1 14 ? 22.628 -34.033 5.191   1.00 32.17 ? 10  DT  D O2    1 
ATOM   929  N  N3    . DT  C 1 14 ? 21.939 -34.471 3.070   1.00 31.71 ? 10  DT  D N3    1 
ATOM   930  C  C4    . DT  C 1 14 ? 22.135 -34.646 1.712   1.00 30.55 ? 10  DT  D C4    1 
ATOM   931  O  O4    . DT  C 1 14 ? 21.184 -34.928 0.996   1.00 28.82 ? 10  DT  D O4    1 
ATOM   932  C  C5    . DT  C 1 14 ? 23.508 -34.472 1.255   1.00 32.32 ? 10  DT  D C5    1 
ATOM   933  C  C7    . DT  C 1 14 ? 23.834 -34.670 -0.198  1.00 31.54 ? 10  DT  D C7    1 
ATOM   934  C  C6    . DT  C 1 14 ? 24.432 -34.143 2.166   1.00 33.45 ? 10  DT  D C6    1 
ATOM   935  P  P     . DT  C 1 15 ? 28.508 -34.299 7.081   1.00 50.72 ? 11  DT  D P     1 
ATOM   936  O  OP1   . DT  C 1 15 ? 29.337 -33.493 8.022   1.00 49.38 ? 11  DT  D OP1   1 
ATOM   937  O  OP2   . DT  C 1 15 ? 29.162 -35.223 6.117   1.00 46.02 ? 11  DT  D OP2   1 
ATOM   938  O  "O5'" . DT  C 1 15 ? 27.448 -35.126 7.922   1.00 48.01 ? 11  DT  D "O5'" 1 
ATOM   939  C  "C5'" . DT  C 1 15 ? 26.146 -35.291 7.398   1.00 49.05 ? 11  DT  D "C5'" 1 
ATOM   940  C  "C4'" . DT  C 1 15 ? 25.155 -35.550 8.502   1.00 47.55 ? 11  DT  D "C4'" 1 
ATOM   941  O  "O4'" . DT  C 1 15 ? 23.857 -35.622 7.880   1.00 47.05 ? 11  DT  D "O4'" 1 
ATOM   942  C  "C3'" . DT  C 1 15 ? 25.356 -36.893 9.188   1.00 47.69 ? 11  DT  D "C3'" 1 
ATOM   943  O  "O3'" . DT  C 1 15 ? 24.889 -36.806 10.531  1.00 49.83 ? 11  DT  D "O3'" 1 
ATOM   944  C  "C2'" . DT  C 1 15 ? 24.534 -37.847 8.338   1.00 45.53 ? 11  DT  D "C2'" 1 
ATOM   945  C  "C1'" . DT  C 1 15 ? 23.417 -36.969 7.786   1.00 44.32 ? 11  DT  D "C1'" 1 
ATOM   946  N  N1    . DT  C 1 15 ? 23.091 -37.218 6.370   1.00 41.80 ? 11  DT  D N1    1 
ATOM   947  C  C2    . DT  C 1 15 ? 21.767 -37.375 6.034   1.00 40.07 ? 11  DT  D C2    1 
ATOM   948  O  O2    . DT  C 1 15 ? 20.864 -37.316 6.849   1.00 39.48 ? 11  DT  D O2    1 
ATOM   949  N  N3    . DT  C 1 15 ? 21.537 -37.598 4.703   1.00 38.49 ? 11  DT  D N3    1 
ATOM   950  C  C4    . DT  C 1 15 ? 22.474 -37.673 3.693   1.00 38.21 ? 11  DT  D C4    1 
ATOM   951  O  O4    . DT  C 1 15 ? 22.108 -37.869 2.534   1.00 37.77 ? 11  DT  D O4    1 
ATOM   952  C  C5    . DT  C 1 15 ? 23.849 -37.502 4.114   1.00 38.80 ? 11  DT  D C5    1 
ATOM   953  C  C7    . DT  C 1 15 ? 24.936 -37.576 3.089   1.00 38.07 ? 11  DT  D C7    1 
ATOM   954  C  C6    . DT  C 1 15 ? 24.086 -37.284 5.415   1.00 39.32 ? 11  DT  D C6    1 
ATOM   955  P  P     . DG  C 1 16 ? 24.895 -38.112 11.461  1.00 51.27 ? 12  DG  D P     1 
ATOM   956  O  OP1   . DG  C 1 16 ? 24.758 -37.617 12.847  1.00 51.31 ? 12  DG  D OP1   1 
ATOM   957  O  OP2   . DG  C 1 16 ? 26.043 -38.984 11.092  1.00 51.08 ? 12  DG  D OP2   1 
ATOM   958  O  "O5'" . DG  C 1 16 ? 23.541 -38.845 11.070  1.00 50.31 ? 12  DG  D "O5'" 1 
ATOM   959  C  "C5'" . DG  C 1 16 ? 22.291 -38.260 11.418  1.00 49.98 ? 12  DG  D "C5'" 1 
ATOM   960  C  "C4'" . DG  C 1 16 ? 21.188 -39.280 11.288  1.00 48.92 ? 12  DG  D "C4'" 1 
ATOM   961  O  "O4'" . DG  C 1 16 ? 20.850 -39.463 9.892   1.00 48.05 ? 12  DG  D "O4'" 1 
ATOM   962  C  "C3'" . DG  C 1 16 ? 21.575 -40.659 11.815  1.00 48.86 ? 12  DG  D "C3'" 1 
ATOM   963  O  "O3'" . DG  C 1 16 ? 20.406 -41.287 12.323  1.00 48.98 ? 12  DG  D "O3'" 1 
ATOM   964  C  "C2'" . DG  C 1 16 ? 22.025 -41.382 10.557  1.00 48.07 ? 12  DG  D "C2'" 1 
ATOM   965  C  "C1'" . DG  C 1 16 ? 21.066 -40.815 9.522   1.00 47.53 ? 12  DG  D "C1'" 1 
ATOM   966  N  N9    . DG  C 1 16 ? 21.537 -40.830 8.140   1.00 45.10 ? 12  DG  D N9    1 
ATOM   967  C  C8    . DG  C 1 16 ? 22.834 -40.740 7.692   1.00 45.28 ? 12  DG  D C8    1 
ATOM   968  N  N7    . DG  C 1 16 ? 22.930 -40.782 6.388   1.00 44.95 ? 12  DG  D N7    1 
ATOM   969  C  C5    . DG  C 1 16 ? 21.616 -40.905 5.953   1.00 43.69 ? 12  DG  D C5    1 
ATOM   970  C  C6    . DG  C 1 16 ? 21.087 -41.003 4.639   1.00 42.14 ? 12  DG  D C6    1 
ATOM   971  O  O6    . DG  C 1 16 ? 21.693 -41.000 3.562   1.00 42.47 ? 12  DG  D O6    1 
ATOM   972  N  N1    . DG  C 1 16 ? 19.702 -41.117 4.654   1.00 40.17 ? 12  DG  D N1    1 
ATOM   973  C  C2    . DG  C 1 16 ? 18.922 -41.136 5.785   1.00 41.95 ? 12  DG  D C2    1 
ATOM   974  N  N2    . DG  C 1 16 ? 17.597 -41.248 5.595   1.00 41.36 ? 12  DG  D N2    1 
ATOM   975  N  N3    . DG  C 1 16 ? 19.402 -41.050 7.014   1.00 42.55 ? 12  DG  D N3    1 
ATOM   976  C  C4    . DG  C 1 16 ? 20.746 -40.938 7.023   1.00 43.98 ? 12  DG  D C4    1 
ATOM   977  O  "O5'" . DC  D 2 1  ? 15.099 -40.966 -2.741  1.00 56.32 ? 13  DC  E "O5'" 1 
ATOM   978  C  "C5'" . DC  D 2 1  ? 14.056 -41.933 -2.570  1.00 53.53 ? 13  DC  E "C5'" 1 
ATOM   979  C  "C4'" . DC  D 2 1  ? 13.519 -41.886 -1.160  1.00 51.92 ? 13  DC  E "C4'" 1 
ATOM   980  O  "O4'" . DC  D 2 1  ? 14.560 -42.333 -0.252  1.00 50.23 ? 13  DC  E "O4'" 1 
ATOM   981  C  "C3'" . DC  D 2 1  ? 13.144 -40.471 -0.728  1.00 51.11 ? 13  DC  E "C3'" 1 
ATOM   982  O  "O3'" . DC  D 2 1  ? 11.922 -40.428 -0.001  1.00 51.84 ? 13  DC  E "O3'" 1 
ATOM   983  C  "C2'" . DC  D 2 1  ? 14.304 -40.024 0.139   1.00 49.31 ? 13  DC  E "C2'" 1 
ATOM   984  C  "C1'" . DC  D 2 1  ? 14.903 -41.314 0.673   1.00 47.87 ? 13  DC  E "C1'" 1 
ATOM   985  N  N1    . DC  D 2 1  ? 16.372 -41.224 0.723   1.00 45.17 ? 13  DC  E N1    1 
ATOM   986  C  C2    . DC  D 2 1  ? 17.022 -41.342 1.953   1.00 42.39 ? 13  DC  E C2    1 
ATOM   987  O  O2    . DC  D 2 1  ? 16.348 -41.596 2.964   1.00 42.08 ? 13  DC  E O2    1 
ATOM   988  N  N3    . DC  D 2 1  ? 18.364 -41.177 2.009   1.00 40.30 ? 13  DC  E N3    1 
ATOM   989  C  C4    . DC  D 2 1  ? 19.052 -40.916 0.897   1.00 39.72 ? 13  DC  E C4    1 
ATOM   990  N  N4    . DC  D 2 1  ? 20.370 -40.743 0.999   1.00 40.43 ? 13  DC  E N4    1 
ATOM   991  C  C5    . DC  D 2 1  ? 18.420 -40.820 -0.372  1.00 41.77 ? 13  DC  E C5    1 
ATOM   992  C  C6    . DC  D 2 1  ? 17.091 -40.986 -0.415  1.00 43.97 ? 13  DC  E C6    1 
ATOM   993  P  P     . DA  D 2 2  ? 11.263 -38.998 0.346   1.00 52.15 ? 14  DA  E P     1 
ATOM   994  O  OP1   . DA  D 2 2  ? 9.790  -39.193 0.335   1.00 52.43 ? 14  DA  E OP1   1 
ATOM   995  O  OP2   . DA  D 2 2  ? 11.874 -37.934 -0.496  1.00 50.17 ? 14  DA  E OP2   1 
ATOM   996  O  "O5'" . DA  D 2 2  ? 11.727 -38.738 1.842   1.00 50.27 ? 14  DA  E "O5'" 1 
ATOM   997  C  "C5'" . DA  D 2 2  ? 11.398 -39.660 2.874   1.00 48.95 ? 14  DA  E "C5'" 1 
ATOM   998  C  "C4'" . DA  D 2 2  ? 11.843 -39.102 4.201   1.00 48.65 ? 14  DA  E "C4'" 1 
ATOM   999  O  "O4'" . DA  D 2 2  ? 13.289 -39.099 4.253   1.00 48.55 ? 14  DA  E "O4'" 1 
ATOM   1000 C  "C3'" . DA  D 2 2  ? 11.415 -37.652 4.394   1.00 48.92 ? 14  DA  E "C3'" 1 
ATOM   1001 O  "O3'" . DA  D 2 2  ? 11.116 -37.427 5.767   1.00 51.02 ? 14  DA  E "O3'" 1 
ATOM   1002 C  "C2'" . DA  D 2 2  ? 12.627 -36.855 3.945   1.00 47.11 ? 14  DA  E "C2'" 1 
ATOM   1003 C  "C1'" . DA  D 2 2  ? 13.789 -37.769 4.307   1.00 45.83 ? 14  DA  E "C1'" 1 
ATOM   1004 N  N9    . DA  D 2 2  ? 14.933 -37.693 3.395   1.00 42.35 ? 14  DA  E N9    1 
ATOM   1005 C  C8    . DA  D 2 2  ? 14.925 -37.592 2.027   1.00 41.13 ? 14  DA  E C8    1 
ATOM   1006 N  N7    . DA  D 2 2  ? 16.124 -37.562 1.491   1.00 40.67 ? 14  DA  E N7    1 
ATOM   1007 C  C5    . DA  D 2 2  ? 16.978 -37.645 2.583   1.00 39.47 ? 14  DA  E C5    1 
ATOM   1008 C  C6    . DA  D 2 2  ? 18.384 -37.668 2.694   1.00 37.80 ? 14  DA  E C6    1 
ATOM   1009 N  N6    . DA  D 2 2  ? 19.220 -37.610 1.654   1.00 36.00 ? 14  DA  E N6    1 
ATOM   1010 N  N1    . DA  D 2 2  ? 18.910 -37.753 3.930   1.00 37.34 ? 14  DA  E N1    1 
ATOM   1011 C  C2    . DA  D 2 2  ? 18.082 -37.818 4.977   1.00 39.25 ? 14  DA  E C2    1 
ATOM   1012 N  N3    . DA  D 2 2  ? 16.753 -37.808 5.003   1.00 39.38 ? 14  DA  E N3    1 
ATOM   1013 C  C4    . DA  D 2 2  ? 16.257 -37.719 3.760   1.00 39.91 ? 14  DA  E C4    1 
ATOM   1014 P  P     . DA  D 2 3  ? 10.414 -36.058 6.209   1.00 52.01 ? 15  DA  E P     1 
ATOM   1015 O  OP1   . DA  D 2 3  ? 9.380  -36.439 7.209   1.00 49.25 ? 15  DA  E OP1   1 
ATOM   1016 O  OP2   . DA  D 2 3  ? 10.026 -35.291 4.989   1.00 48.72 ? 15  DA  E OP2   1 
ATOM   1017 O  "O5'" . DA  D 2 3  ? 11.596 -35.283 6.936   1.00 47.90 ? 15  DA  E "O5'" 1 
ATOM   1018 C  "C5'" . DA  D 2 3  ? 12.360 -35.932 7.940   1.00 45.41 ? 15  DA  E "C5'" 1 
ATOM   1019 C  "C4'" . DA  D 2 3  ? 13.553 -35.088 8.313   1.00 43.40 ? 15  DA  E "C4'" 1 
ATOM   1020 O  "O4'" . DA  D 2 3  ? 14.597 -35.187 7.316   1.00 42.23 ? 15  DA  E "O4'" 1 
ATOM   1021 C  "C3'" . DA  D 2 3  ? 13.243 -33.600 8.460   1.00 42.97 ? 15  DA  E "C3'" 1 
ATOM   1022 O  "O3'" . DA  D 2 3  ? 13.869 -33.119 9.652   1.00 43.64 ? 15  DA  E "O3'" 1 
ATOM   1023 C  "C2'" . DA  D 2 3  ? 13.853 -32.983 7.208   1.00 40.69 ? 15  DA  E "C2'" 1 
ATOM   1024 C  "C1'" . DA  D 2 3  ? 15.046 -33.888 6.971   1.00 39.04 ? 15  DA  E "C1'" 1 
ATOM   1025 N  N9    . DA  D 2 3  ? 15.569 -33.950 5.605   1.00 36.39 ? 15  DA  E N9    1 
ATOM   1026 C  C8    . DA  D 2 3  ? 14.886 -33.866 4.420   1.00 35.97 ? 15  DA  E C8    1 
ATOM   1027 N  N7    . DA  D 2 3  ? 15.649 -34.002 3.359   1.00 34.42 ? 15  DA  E N7    1 
ATOM   1028 C  C5    . DA  D 2 3  ? 16.922 -34.175 3.883   1.00 34.09 ? 15  DA  E C5    1 
ATOM   1029 C  C6    . DA  D 2 3  ? 18.180 -34.373 3.278   1.00 33.24 ? 15  DA  E C6    1 
ATOM   1030 N  N6    . DA  D 2 3  ? 18.367 -34.438 1.959   1.00 32.16 ? 15  DA  E N6    1 
ATOM   1031 N  N1    . DA  D 2 3  ? 19.254 -34.510 4.087   1.00 33.99 ? 15  DA  E N1    1 
ATOM   1032 C  C2    . DA  D 2 3  ? 19.066 -34.453 5.410   1.00 33.53 ? 15  DA  E C2    1 
ATOM   1033 N  N3    . DA  D 2 3  ? 17.937 -34.274 6.096   1.00 35.18 ? 15  DA  E N3    1 
ATOM   1034 C  C4    . DA  D 2 3  ? 16.889 -34.139 5.264   1.00 34.85 ? 15  DA  E C4    1 
ATOM   1035 P  P     . DG  D 2 4  ? 13.135 -32.001 10.533  1.00 41.61 ? 16  DG  E P     1 
ATOM   1036 O  OP1   . DG  D 2 4  ? 13.146 -32.411 11.962  1.00 44.48 ? 16  DG  E OP1   1 
ATOM   1037 O  OP2   . DG  D 2 4  ? 11.864 -31.653 9.859   1.00 41.07 ? 16  DG  E OP2   1 
ATOM   1038 O  "O5'" . DG  D 2 4  ? 14.101 -30.771 10.385  1.00 40.57 ? 16  DG  E "O5'" 1 
ATOM   1039 C  "C5'" . DG  D 2 4  ? 14.655 -30.524 9.137   1.00 37.36 ? 16  DG  E "C5'" 1 
ATOM   1040 C  "C4'" . DG  D 2 4  ? 16.094 -30.123 9.287   1.00 35.59 ? 16  DG  E "C4'" 1 
ATOM   1041 O  "O4'" . DG  D 2 4  ? 16.790 -30.685 8.156   1.00 33.09 ? 16  DG  E "O4'" 1 
ATOM   1042 C  "C3'" . DG  D 2 4  ? 16.248 -28.612 9.174   1.00 32.07 ? 16  DG  E "C3'" 1 
ATOM   1043 O  "O3'" . DG  D 2 4  ? 17.474 -28.235 9.777   1.00 32.05 ? 16  DG  E "O3'" 1 
ATOM   1044 C  "C2'" . DG  D 2 4  ? 16.323 -28.427 7.680   1.00 32.99 ? 16  DG  E "C2'" 1 
ATOM   1045 C  "C1'" . DG  D 2 4  ? 17.115 -29.655 7.261   1.00 32.27 ? 16  DG  E "C1'" 1 
ATOM   1046 N  N9    . DG  D 2 4  ? 16.841 -30.126 5.913   1.00 32.25 ? 16  DG  E N9    1 
ATOM   1047 C  C8    . DG  D 2 4  ? 15.634 -30.208 5.262   1.00 31.01 ? 16  DG  E C8    1 
ATOM   1048 N  N7    . DG  D 2 4  ? 15.756 -30.576 4.016   1.00 31.00 ? 16  DG  E N7    1 
ATOM   1049 C  C5    . DG  D 2 4  ? 17.124 -30.768 3.855   1.00 30.31 ? 16  DG  E C5    1 
ATOM   1050 C  C6    . DG  D 2 4  ? 17.870 -31.152 2.722   1.00 29.41 ? 16  DG  E C6    1 
ATOM   1051 O  O6    . DG  D 2 4  ? 17.456 -31.409 1.584   1.00 28.04 ? 16  DG  E O6    1 
ATOM   1052 N  N1    . DG  D 2 4  ? 19.234 -31.226 3.011   1.00 26.87 ? 16  DG  E N1    1 
ATOM   1053 C  C2    . DG  D 2 4  ? 19.795 -30.963 4.236   1.00 28.59 ? 16  DG  E C2    1 
ATOM   1054 N  N2    . DG  D 2 4  ? 21.122 -31.093 4.354   1.00 27.49 ? 16  DG  E N2    1 
ATOM   1055 N  N3    . DG  D 2 4  ? 19.106 -30.597 5.285   1.00 29.06 ? 16  DG  E N3    1 
ATOM   1056 C  C4    . DG  D 2 4  ? 17.792 -30.519 5.026   1.00 29.86 ? 16  DG  E C4    1 
ATOM   1057 P  P     . DC  D 2 5  ? 17.723 -26.722 10.229  1.00 28.55 ? 17  DC  E P     1 
ATOM   1058 O  OP1   . DC  D 2 5  ? 17.850 -26.815 11.690  1.00 30.69 ? 17  DC  E OP1   1 
ATOM   1059 O  OP2   . DC  D 2 5  ? 16.736 -25.788 9.637   1.00 30.28 ? 17  DC  E OP2   1 
ATOM   1060 O  "O5'" . DC  D 2 5  ? 19.164 -26.432 9.628   1.00 27.39 ? 17  DC  E "O5'" 1 
ATOM   1061 C  "C5'" . DC  D 2 5  ? 20.267 -27.255 10.017  1.00 26.11 ? 17  DC  E "C5'" 1 
ATOM   1062 C  "C4'" . DC  D 2 5  ? 21.406 -27.134 9.028   1.00 22.30 ? 17  DC  E "C4'" 1 
ATOM   1063 O  "O4'" . DC  D 2 5  ? 21.049 -27.747 7.766   1.00 21.00 ? 17  DC  E "O4'" 1 
ATOM   1064 C  "C3'" . DC  D 2 5  ? 21.824 -25.706 8.704   1.00 23.27 ? 17  DC  E "C3'" 1 
ATOM   1065 O  "O3'" . DC  D 2 5  ? 23.253 -25.643 8.631   1.00 24.42 ? 17  DC  E "O3'" 1 
ATOM   1066 C  "C2'" . DC  D 2 5  ? 21.172 -25.451 7.355   1.00 21.19 ? 17  DC  E "C2'" 1 
ATOM   1067 C  "C1'" . DC  D 2 5  ? 21.208 -26.820 6.705   1.00 19.71 ? 17  DC  E "C1'" 1 
ATOM   1068 N  N1    . DC  D 2 5  ? 20.129 -27.058 5.727   1.00 20.25 ? 17  DC  E N1    1 
ATOM   1069 C  C2    . DC  D 2 5  ? 20.460 -27.574 4.459   1.00 19.83 ? 17  DC  E C2    1 
ATOM   1070 O  O2    . DC  D 2 5  ? 21.643 -27.833 4.208   1.00 22.11 ? 17  DC  E O2    1 
ATOM   1071 N  N3    . DC  D 2 5  ? 19.479 -27.773 3.546   1.00 18.99 ? 17  DC  E N3    1 
ATOM   1072 C  C4    . DC  D 2 5  ? 18.209 -27.481 3.855   1.00 21.56 ? 17  DC  E C4    1 
ATOM   1073 N  N4    . DC  D 2 5  ? 17.275 -27.679 2.918   1.00 20.67 ? 17  DC  E N4    1 
ATOM   1074 C  C5    . DC  D 2 5  ? 17.840 -26.967 5.144   1.00 20.22 ? 17  DC  E C5    1 
ATOM   1075 C  C6    . DC  D 2 5  ? 18.824 -26.775 6.038   1.00 19.94 ? 17  DC  E C6    1 
ATOM   1076 P  P     . DA  D 2 6  ? 23.977 -24.260 8.271   1.00 27.58 ? 18  DA  E P     1 
ATOM   1077 O  OP1   . DA  D 2 6  ? 25.384 -24.339 8.744   1.00 28.00 ? 18  DA  E OP1   1 
ATOM   1078 O  OP2   . DA  D 2 6  ? 23.122 -23.129 8.716   1.00 28.25 ? 18  DA  E OP2   1 
ATOM   1079 O  "O5'" . DA  D 2 6  ? 23.968 -24.250 6.681   1.00 28.14 ? 18  DA  E "O5'" 1 
ATOM   1080 C  "C5'" . DA  D 2 6  ? 24.685 -25.231 5.951   1.00 27.61 ? 18  DA  E "C5'" 1 
ATOM   1081 C  "C4'" . DA  D 2 6  ? 24.761 -24.849 4.491   1.00 26.04 ? 18  DA  E "C4'" 1 
ATOM   1082 O  "O4'" . DA  D 2 6  ? 23.538 -25.200 3.804   1.00 26.25 ? 18  DA  E "O4'" 1 
ATOM   1083 C  "C3'" . DA  D 2 6  ? 25.023 -23.371 4.190   1.00 26.26 ? 18  DA  E "C3'" 1 
ATOM   1084 O  "O3'" . DA  D 2 6  ? 26.159 -23.273 3.339   1.00 26.82 ? 18  DA  E "O3'" 1 
ATOM   1085 C  "C2'" . DA  D 2 6  ? 23.752 -22.897 3.490   1.00 23.95 ? 18  DA  E "C2'" 1 
ATOM   1086 C  "C1'" . DA  D 2 6  ? 23.190 -24.174 2.886   1.00 23.64 ? 18  DA  E "C1'" 1 
ATOM   1087 N  N9    . DA  D 2 6  ? 21.734 -24.225 2.719   1.00 23.68 ? 18  DA  E N9    1 
ATOM   1088 C  C8    . DA  D 2 6  ? 20.778 -24.018 3.681   1.00 21.64 ? 18  DA  E C8    1 
ATOM   1089 N  N7    . DA  D 2 6  ? 19.545 -24.193 3.248   1.00 23.29 ? 18  DA  E N7    1 
ATOM   1090 C  C5    . DA  D 2 6  ? 19.702 -24.527 1.907   1.00 20.53 ? 18  DA  E C5    1 
ATOM   1091 C  C6    . DA  D 2 6  ? 18.768 -24.841 0.876   1.00 20.28 ? 18  DA  E C6    1 
ATOM   1092 N  N6    . DA  D 2 6  ? 17.439 -24.881 1.048   1.00 16.76 ? 18  DA  E N6    1 
ATOM   1093 N  N1    . DA  D 2 6  ? 19.260 -25.120 -0.352  1.00 19.10 ? 18  DA  E N1    1 
ATOM   1094 C  C2    . DA  D 2 6  ? 20.588 -25.086 -0.527  1.00 20.89 ? 18  DA  E C2    1 
ATOM   1095 N  N3    . DA  D 2 6  ? 21.556 -24.814 0.353   1.00 21.36 ? 18  DA  E N3    1 
ATOM   1096 C  C4    . DA  D 2 6  ? 21.043 -24.539 1.564   1.00 21.63 ? 18  DA  E C4    1 
ATOM   1097 P  P     . DA  D 2 7  ? 26.702 -21.842 2.888   1.00 28.13 ? 19  DA  E P     1 
ATOM   1098 O  OP1   . DA  D 2 7  ? 28.176 -21.948 2.865   1.00 31.16 ? 19  DA  E OP1   1 
ATOM   1099 O  OP2   . DA  D 2 7  ? 26.065 -20.762 3.662   1.00 30.47 ? 19  DA  E OP2   1 
ATOM   1100 O  "O5'" . DA  D 2 7  ? 26.171 -21.748 1.390   1.00 30.53 ? 19  DA  E "O5'" 1 
ATOM   1101 C  "C5'" . DA  D 2 7  ? 26.248 -22.889 0.545   1.00 28.27 ? 19  DA  E "C5'" 1 
ATOM   1102 C  "C4'" . DA  D 2 7  ? 25.587 -22.616 -0.785  1.00 29.73 ? 19  DA  E "C4'" 1 
ATOM   1103 O  "O4'" . DA  D 2 7  ? 24.155 -22.835 -0.721  1.00 27.60 ? 19  DA  E "O4'" 1 
ATOM   1104 C  "C3'" . DA  D 2 7  ? 25.793 -21.216 -1.368  1.00 29.21 ? 19  DA  E "C3'" 1 
ATOM   1105 O  "O3'" . DA  D 2 7  ? 26.199 -21.328 -2.740  1.00 30.93 ? 19  DA  E "O3'" 1 
ATOM   1106 C  "C2'" . DA  D 2 7  ? 24.413 -20.586 -1.257  1.00 26.35 ? 19  DA  E "C2'" 1 
ATOM   1107 C  "C1'" . DA  D 2 7  ? 23.493 -21.790 -1.398  1.00 25.04 ? 19  DA  E "C1'" 1 
ATOM   1108 N  N9    . DA  D 2 7  ? 22.158 -21.653 -0.809  1.00 25.07 ? 19  DA  E N9    1 
ATOM   1109 C  C8    . DA  D 2 7  ? 21.825 -21.269 0.469   1.00 23.43 ? 19  DA  E C8    1 
ATOM   1110 N  N7    . DA  D 2 7  ? 20.532 -21.242 0.694   1.00 19.19 ? 19  DA  E N7    1 
ATOM   1111 C  C5    . DA  D 2 7  ? 19.972 -21.634 -0.513  1.00 20.76 ? 19  DA  E C5    1 
ATOM   1112 C  C6    . DA  D 2 7  ? 18.634 -21.808 -0.930  1.00 20.63 ? 19  DA  E C6    1 
ATOM   1113 N  N6    . DA  D 2 7  ? 17.570 -21.600 -0.145  1.00 19.21 ? 19  DA  E N6    1 
ATOM   1114 N  N1    . DA  D 2 7  ? 18.423 -22.209 -2.201  1.00 20.97 ? 19  DA  E N1    1 
ATOM   1115 C  C2    . DA  D 2 7  ? 19.486 -22.418 -2.989  1.00 23.00 ? 19  DA  E C2    1 
ATOM   1116 N  N3    . DA  D 2 7  ? 20.784 -22.291 -2.714  1.00 20.32 ? 19  DA  E N3    1 
ATOM   1117 C  C4    . DA  D 2 7  ? 20.962 -21.892 -1.448  1.00 22.61 ? 19  DA  E C4    1 
ATOM   1118 P  P     . DA  D 2 8  ? 26.790 -20.040 -3.510  1.00 33.17 ? 20  DA  E P     1 
ATOM   1119 O  OP1   . DA  D 2 8  ? 27.938 -20.520 -4.338  1.00 36.01 ? 20  DA  E OP1   1 
ATOM   1120 O  OP2   . DA  D 2 8  ? 26.968 -18.897 -2.579  1.00 32.52 ? 20  DA  E OP2   1 
ATOM   1121 O  "O5'" . DA  D 2 8  ? 25.624 -19.642 -4.498  1.00 31.44 ? 20  DA  E "O5'" 1 
ATOM   1122 C  "C5'" . DA  D 2 8  ? 24.308 -19.960 -4.149  1.00 35.04 ? 20  DA  E "C5'" 1 
ATOM   1123 C  "C4'" . DA  D 2 8  ? 23.437 -20.018 -5.370  1.00 33.68 ? 20  DA  E "C4'" 1 
ATOM   1124 O  "O4'" . DA  D 2 8  ? 22.113 -20.234 -4.842  1.00 31.41 ? 20  DA  E "O4'" 1 
ATOM   1125 C  "C3'" . DA  D 2 8  ? 23.395 -18.678 -6.101  1.00 33.44 ? 20  DA  E "C3'" 1 
ATOM   1126 O  "O3'" . DA  D 2 8  ? 23.154 -18.878 -7.496  1.00 35.83 ? 20  DA  E "O3'" 1 
ATOM   1127 C  "C2'" . DA  D 2 8  ? 22.266 -17.940 -5.406  1.00 30.36 ? 20  DA  E "C2'" 1 
ATOM   1128 C  "C1'" . DA  D 2 8  ? 21.332 -19.061 -4.973  1.00 30.51 ? 20  DA  E "C1'" 1 
ATOM   1129 N  N9    . DA  D 2 8  ? 20.642 -18.839 -3.701  1.00 27.60 ? 20  DA  E N9    1 
ATOM   1130 C  C8    . DA  D 2 8  ? 21.130 -18.370 -2.501  1.00 27.53 ? 20  DA  E C8    1 
ATOM   1131 N  N7    . DA  D 2 8  ? 20.211 -18.245 -1.571  1.00 25.84 ? 20  DA  E N7    1 
ATOM   1132 C  C5    . DA  D 2 8  ? 19.045 -18.667 -2.198  1.00 25.52 ? 20  DA  E C5    1 
ATOM   1133 C  C6    . DA  D 2 8  ? 17.707 -18.772 -1.763  1.00 23.87 ? 20  DA  E C6    1 
ATOM   1134 N  N6    . DA  D 2 8  ? 17.283 -18.413 -0.551  1.00 22.47 ? 20  DA  E N6    1 
ATOM   1135 N  N1    . DA  D 2 8  ? 16.800 -19.256 -2.642  1.00 24.21 ? 20  DA  E N1    1 
ATOM   1136 C  C2    . DA  D 2 8  ? 17.209 -19.592 -3.871  1.00 25.34 ? 20  DA  E C2    1 
ATOM   1137 N  N3    . DA  D 2 8  ? 18.428 -19.528 -4.400  1.00 24.64 ? 20  DA  E N3    1 
ATOM   1138 C  C4    . DA  D 2 8  ? 19.306 -19.052 -3.504  1.00 25.05 ? 20  DA  E C4    1 
ATOM   1139 P  P     . DA  D 2 9  ? 23.366 -17.659 -8.526  1.00 38.67 ? 21  DA  E P     1 
ATOM   1140 O  OP1   . DA  D 2 9  ? 24.198 -18.181 -9.635  1.00 41.04 ? 21  DA  E OP1   1 
ATOM   1141 O  OP2   . DA  D 2 9  ? 23.799 -16.433 -7.799  1.00 37.51 ? 21  DA  E OP2   1 
ATOM   1142 O  "O5'" . DA  D 2 9  ? 21.900 -17.419 -9.091  1.00 36.75 ? 21  DA  E "O5'" 1 
ATOM   1143 C  "C5'" . DA  D 2 9  ? 21.192 -18.482 -9.711  1.00 35.05 ? 21  DA  E "C5'" 1 
ATOM   1144 C  "C4'" . DA  D 2 9  ? 19.792 -18.039 -10.060 1.00 35.53 ? 21  DA  E "C4'" 1 
ATOM   1145 O  "O4'" . DA  D 2 9  ? 18.953 -17.997 -8.881  1.00 34.77 ? 21  DA  E "O4'" 1 
ATOM   1146 C  "C3'" . DA  D 2 9  ? 19.715 -16.654 -10.690 1.00 34.41 ? 21  DA  E "C3'" 1 
ATOM   1147 O  "O3'" . DA  D 2 9  ? 18.794 -16.691 -11.776 1.00 36.58 ? 21  DA  E "O3'" 1 
ATOM   1148 C  "C2'" . DA  D 2 9  ? 19.223 -15.768 -9.557  1.00 33.60 ? 21  DA  E "C2'" 1 
ATOM   1149 C  "C1'" . DA  D 2 9  ? 18.373 -16.713 -8.721  1.00 32.66 ? 21  DA  E "C1'" 1 
ATOM   1150 N  N9    . DA  D 2 9  ? 18.376 -16.415 -7.287  1.00 32.15 ? 21  DA  E N9    1 
ATOM   1151 C  C8    . DA  D 2 9  ? 19.458 -16.066 -6.512  1.00 32.60 ? 21  DA  E C8    1 
ATOM   1152 N  N7    . DA  D 2 9  ? 19.166 -15.890 -5.243  1.00 31.80 ? 21  DA  E N7    1 
ATOM   1153 C  C5    . DA  D 2 9  ? 17.799 -16.128 -5.179  1.00 29.80 ? 21  DA  E C5    1 
ATOM   1154 C  C6    . DA  D 2 9  ? 16.878 -16.100 -4.111  1.00 27.96 ? 21  DA  E C6    1 
ATOM   1155 N  N6    . DA  D 2 9  ? 17.208 -15.814 -2.854  1.00 27.89 ? 21  DA  E N6    1 
ATOM   1156 N  N1    . DA  D 2 9  ? 15.590 -16.383 -4.387  1.00 28.04 ? 21  DA  E N1    1 
ATOM   1157 C  C2    . DA  D 2 9  ? 15.254 -16.673 -5.647  1.00 27.90 ? 21  DA  E C2    1 
ATOM   1158 N  N3    . DA  D 2 9  ? 16.024 -16.731 -6.735  1.00 29.35 ? 21  DA  E N3    1 
ATOM   1159 C  C4    . DA  D 2 9  ? 17.299 -16.446 -6.431  1.00 29.03 ? 21  DA  E C4    1 
ATOM   1160 P  P     . DC  D 2 10 ? 18.667 -15.427 -12.756 1.00 37.49 ? 22  DC  E P     1 
ATOM   1161 O  OP1   . DC  D 2 10 ? 18.225 -15.947 -14.071 1.00 38.74 ? 22  DC  E OP1   1 
ATOM   1162 O  OP2   . DC  D 2 10 ? 19.885 -14.579 -12.655 1.00 36.22 ? 22  DC  E OP2   1 
ATOM   1163 O  "O5'" . DC  D 2 10 ? 17.443 -14.640 -12.120 1.00 38.06 ? 22  DC  E "O5'" 1 
ATOM   1164 C  "C5'" . DC  D 2 10 ? 16.271 -15.352 -11.736 1.00 36.36 ? 22  DC  E "C5'" 1 
ATOM   1165 C  "C4'" . DC  D 2 10 ? 15.311 -14.429 -11.032 1.00 35.49 ? 22  DC  E "C4'" 1 
ATOM   1166 O  "O4'" . DC  D 2 10 ? 15.525 -14.441 -9.596  1.00 33.77 ? 22  DC  E "O4'" 1 
ATOM   1167 C  "C3'" . DC  D 2 10 ? 15.428 -12.972 -11.486 1.00 35.79 ? 22  DC  E "C3'" 1 
ATOM   1168 O  "O3'" . DC  D 2 10 ? 14.155 -12.500 -11.898 1.00 37.56 ? 22  DC  E "O3'" 1 
ATOM   1169 C  "C2'" . DC  D 2 10 ? 15.924 -12.234 -10.247 1.00 34.69 ? 22  DC  E "C2'" 1 
ATOM   1170 C  "C1'" . DC  D 2 10 ? 15.414 -13.113 -9.113  1.00 33.18 ? 22  DC  E "C1'" 1 
ATOM   1171 N  N1    . DC  D 2 10 ? 16.137 -13.021 -7.828  1.00 30.68 ? 22  DC  E N1    1 
ATOM   1172 C  C2    . DC  D 2 10 ? 15.402 -13.172 -6.632  1.00 28.53 ? 22  DC  E C2    1 
ATOM   1173 O  O2    . DC  D 2 10 ? 14.185 -13.405 -6.702  1.00 26.42 ? 22  DC  E O2    1 
ATOM   1174 N  N3    . DC  D 2 10 ? 16.035 -13.067 -5.440  1.00 26.04 ? 22  DC  E N3    1 
ATOM   1175 C  C4    . DC  D 2 10 ? 17.349 -12.832 -5.402  1.00 27.25 ? 22  DC  E C4    1 
ATOM   1176 N  N4    . DC  D 2 10 ? 17.932 -12.732 -4.200  1.00 21.96 ? 22  DC  E N4    1 
ATOM   1177 C  C5    . DC  D 2 10 ? 18.128 -12.688 -6.601  1.00 29.11 ? 22  DC  E C5    1 
ATOM   1178 C  C6    . DC  D 2 10 ? 17.484 -12.788 -7.781  1.00 29.75 ? 22  DC  E C6    1 
ATOM   1179 P  P     . DA  D 2 11 ? 14.021 -11.047 -12.559 1.00 39.32 ? 23  DA  E P     1 
ATOM   1180 O  OP1   . DA  D 2 11 ? 13.135 -11.215 -13.728 1.00 38.67 ? 23  DA  E OP1   1 
ATOM   1181 O  OP2   . DA  D 2 11 ? 15.345 -10.400 -12.722 1.00 36.62 ? 23  DA  E OP2   1 
ATOM   1182 O  "O5'" . DA  D 2 11 ? 13.221 -10.250 -11.436 1.00 39.92 ? 23  DA  E "O5'" 1 
ATOM   1183 C  "C5'" . DA  D 2 11 ? 12.020 -10.798 -10.889 1.00 38.66 ? 23  DA  E "C5'" 1 
ATOM   1184 C  "C4'" . DA  D 2 11 ? 11.488 -9.909  -9.789  1.00 37.69 ? 23  DA  E "C4'" 1 
ATOM   1185 O  "O4'" . DA  D 2 11 ? 12.192 -10.137 -8.544  1.00 35.96 ? 23  DA  E "O4'" 1 
ATOM   1186 C  "C3'" . DA  D 2 11 ? 11.602 -8.412  -10.072 1.00 37.71 ? 23  DA  E "C3'" 1 
ATOM   1187 O  "O3'" . DA  D 2 11 ? 10.460 -7.775  -9.522  1.00 41.08 ? 23  DA  E "O3'" 1 
ATOM   1188 C  "C2'" . DA  D 2 11 ? 12.811 -8.006  -9.252  1.00 36.43 ? 23  DA  E "C2'" 1 
ATOM   1189 C  "C1'" . DA  D 2 11 ? 12.627 -8.890  -8.034  1.00 34.07 ? 23  DA  E "C1'" 1 
ATOM   1190 N  N9    . DA  D 2 11 ? 13.827 -9.115  -7.230  1.00 31.74 ? 23  DA  E N9    1 
ATOM   1191 C  C8    . DA  D 2 11 ? 15.127 -9.205  -7.656  1.00 31.56 ? 23  DA  E C8    1 
ATOM   1192 N  N7    . DA  D 2 11 ? 15.989 -9.392  -6.687  1.00 29.97 ? 23  DA  E N7    1 
ATOM   1193 C  C5    . DA  D 2 11 ? 15.203 -9.435  -5.545  1.00 28.40 ? 23  DA  E C5    1 
ATOM   1194 C  C6    . DA  D 2 11 ? 15.517 -9.610  -4.190  1.00 25.77 ? 23  DA  E C6    1 
ATOM   1195 N  N6    . DA  D 2 11 ? 16.758 -9.792  -3.737  1.00 23.12 ? 23  DA  E N6    1 
ATOM   1196 N  N1    . DA  D 2 11 ? 14.501 -9.592  -3.305  1.00 27.06 ? 23  DA  E N1    1 
ATOM   1197 C  C2    . DA  D 2 11 ? 13.253 -9.416  -3.759  1.00 27.33 ? 23  DA  E C2    1 
ATOM   1198 N  N3    . DA  D 2 11 ? 12.831 -9.249  -5.003  1.00 28.78 ? 23  DA  E N3    1 
ATOM   1199 C  C4    . DA  D 2 11 ? 13.869 -9.266  -5.863  1.00 30.58 ? 23  DA  E C4    1 
ATOM   1200 P  P     . DA  D 2 12 ? 9.826  -6.491  -10.240 1.00 42.20 ? 24  DA  E P     1 
ATOM   1201 O  OP1   . DA  D 2 12 ? 8.993  -6.989  -11.364 1.00 40.90 ? 24  DA  E OP1   1 
ATOM   1202 O  OP2   . DA  D 2 12 ? 10.880 -5.472  -10.485 1.00 40.46 ? 24  DA  E OP2   1 
ATOM   1203 O  "O5'" . DA  D 2 12 ? 8.851  -5.930  -9.118  1.00 41.39 ? 24  DA  E "O5'" 1 
ATOM   1204 C  "C5'" . DA  D 2 12 ? 8.112  -6.826  -8.295  1.00 38.39 ? 24  DA  E "C5'" 1 
ATOM   1205 C  "C4'" . DA  D 2 12 ? 8.099  -6.328  -6.870  1.00 37.03 ? 24  DA  E "C4'" 1 
ATOM   1206 O  "O4'" . DA  D 2 12 ? 9.354  -6.622  -6.207  1.00 34.19 ? 24  DA  E "O4'" 1 
ATOM   1207 C  "C3'" . DA  D 2 12 ? 7.884  -4.823  -6.735  1.00 37.59 ? 24  DA  E "C3'" 1 
ATOM   1208 O  "O3'" . DA  D 2 12 ? 6.946  -4.573  -5.692  1.00 37.93 ? 24  DA  E "O3'" 1 
ATOM   1209 C  "C2'" . DA  D 2 12 ? 9.265  -4.290  -6.380  1.00 35.68 ? 24  DA  E "C2'" 1 
ATOM   1210 C  "C1'" . DA  D 2 12 ? 9.881  -5.450  -5.616  1.00 32.52 ? 24  DA  E "C1'" 1 
ATOM   1211 N  N9    . DA  D 2 12 ? 11.337 -5.539  -5.707  1.00 30.39 ? 24  DA  E N9    1 
ATOM   1212 C  C8    . DA  D 2 12 ? 12.104 -5.482  -6.842  1.00 29.35 ? 24  DA  E C8    1 
ATOM   1213 N  N7    . DA  D 2 12 ? 13.387 -5.631  -6.622  1.00 28.99 ? 24  DA  E N7    1 
ATOM   1214 C  C5    . DA  D 2 12 ? 13.476 -5.789  -5.245  1.00 28.15 ? 24  DA  E C5    1 
ATOM   1215 C  C6    . DA  D 2 12 ? 14.564 -5.995  -4.387  1.00 24.60 ? 24  DA  E C6    1 
ATOM   1216 N  N6    . DA  D 2 12 ? 15.825 -6.089  -4.801  1.00 19.80 ? 24  DA  E N6    1 
ATOM   1217 N  N1    . DA  D 2 12 ? 14.309 -6.106  -3.066  1.00 25.82 ? 24  DA  E N1    1 
ATOM   1218 C  C2    . DA  D 2 12 ? 13.041 -6.025  -2.650  1.00 25.66 ? 24  DA  E C2    1 
ATOM   1219 N  N3    . DA  D 2 12 ? 11.933 -5.840  -3.358  1.00 27.14 ? 24  DA  E N3    1 
ATOM   1220 C  C4    . DA  D 2 12 ? 12.221 -5.726  -4.666  1.00 29.01 ? 24  DA  E C4    1 
ATOM   1221 P  P     . DA  D 2 13 ? 6.432  -3.077  -5.421  1.00 39.53 ? 25  DA  E P     1 
ATOM   1222 O  OP1   . DA  D 2 13 ? 4.983  -3.219  -5.105  1.00 39.65 ? 25  DA  E OP1   1 
ATOM   1223 O  OP2   . DA  D 2 13 ? 6.867  -2.149  -6.500  1.00 38.08 ? 25  DA  E OP2   1 
ATOM   1224 O  "O5'" . DA  D 2 13 ? 7.211  -2.689  -4.091  1.00 38.26 ? 25  DA  E "O5'" 1 
ATOM   1225 C  "C5'" . DA  D 2 13 ? 7.222  -3.589  -2.990  1.00 35.49 ? 25  DA  E "C5'" 1 
ATOM   1226 C  "C4'" . DA  D 2 13 ? 8.184  -3.109  -1.930  1.00 35.96 ? 25  DA  E "C4'" 1 
ATOM   1227 O  "O4'" . DA  D 2 13 ? 9.558  -3.370  -2.302  1.00 33.91 ? 25  DA  E "O4'" 1 
ATOM   1228 C  "C3'" . DA  D 2 13 ? 8.102  -1.622  -1.579  1.00 35.21 ? 25  DA  E "C3'" 1 
ATOM   1229 O  "O3'" . DA  D 2 13 ? 8.116  -1.528  -0.155  1.00 36.85 ? 25  DA  E "O3'" 1 
ATOM   1230 C  "C2'" . DA  D 2 13 ? 9.366  -1.042  -2.198  1.00 33.06 ? 25  DA  E "C2'" 1 
ATOM   1231 C  "C1'" . DA  D 2 13 ? 10.342 -2.208  -2.090  1.00 32.15 ? 25  DA  E "C1'" 1 
ATOM   1232 N  N9    . DA  D 2 13 ? 11.443 -2.231  -3.063  1.00 29.72 ? 25  DA  E N9    1 
ATOM   1233 C  C8    . DA  D 2 13 ? 11.376 -2.001  -4.418  1.00 29.25 ? 25  DA  E C8    1 
ATOM   1234 N  N7    . DA  D 2 13 ? 12.529 -2.121  -5.030  1.00 27.90 ? 25  DA  E N7    1 
ATOM   1235 C  C5    . DA  D 2 13 ? 13.415 -2.448  -4.013  1.00 27.38 ? 25  DA  E C5    1 
ATOM   1236 C  C6    . DA  D 2 13 ? 14.796 -2.712  -4.009  1.00 27.38 ? 25  DA  E C6    1 
ATOM   1237 N  N6    . DA  D 2 13 ? 15.567 -2.692  -5.103  1.00 28.83 ? 25  DA  E N6    1 
ATOM   1238 N  N1    . DA  D 2 13 ? 15.371 -3.003  -2.826  1.00 27.01 ? 25  DA  E N1    1 
ATOM   1239 C  C2    . DA  D 2 13 ? 14.608 -3.027  -1.736  1.00 27.12 ? 25  DA  E C2    1 
ATOM   1240 N  N3    . DA  D 2 13 ? 13.310 -2.801  -1.613  1.00 25.57 ? 25  DA  E N3    1 
ATOM   1241 C  C4    . DA  D 2 13 ? 12.764 -2.512  -2.799  1.00 26.29 ? 25  DA  E C4    1 
ATOM   1242 P  P     . DC  D 2 14 ? 7.776  -0.140  0.577   1.00 35.17 ? 26  DC  E P     1 
ATOM   1243 O  OP1   . DC  D 2 14 ? 6.837  -0.486  1.676   1.00 38.12 ? 26  DC  E OP1   1 
ATOM   1244 O  OP2   . DC  D 2 14 ? 7.448  0.934   -0.382  1.00 34.78 ? 26  DC  E OP2   1 
ATOM   1245 O  "O5'" . DC  D 2 14 ? 9.163  0.218   1.241   1.00 38.27 ? 26  DC  E "O5'" 1 
ATOM   1246 C  "C5'" . DC  D 2 14 ? 10.347 -0.245  0.633   1.00 38.71 ? 26  DC  E "C5'" 1 
ATOM   1247 C  "C4'" . DC  D 2 14 ? 11.478 -0.227  1.621   1.00 38.55 ? 26  DC  E "C4'" 1 
ATOM   1248 O  "O4'" . DC  D 2 14 ? 12.663 -0.542  0.862   1.00 38.22 ? 26  DC  E "O4'" 1 
ATOM   1249 C  "C3'" . DC  D 2 14 ? 11.713 1.160   2.205   1.00 38.78 ? 26  DC  E "C3'" 1 
ATOM   1250 O  "O3'" . DC  D 2 14 ? 12.279 1.031   3.513   1.00 38.53 ? 26  DC  E "O3'" 1 
ATOM   1251 C  "C2'" . DC  D 2 14 ? 12.648 1.807   1.197   1.00 36.95 ? 26  DC  E "C2'" 1 
ATOM   1252 C  "C1'" . DC  D 2 14 ? 13.428 0.626   0.626   1.00 35.94 ? 26  DC  E "C1'" 1 
ATOM   1253 N  N1    . DC  D 2 14 ? 13.683 0.688   -0.818  1.00 32.27 ? 26  DC  E N1    1 
ATOM   1254 C  C2    . DC  D 2 14 ? 14.960 0.397   -1.271  1.00 32.37 ? 26  DC  E C2    1 
ATOM   1255 O  O2    . DC  D 2 14 ? 15.827 0.096   -0.440  1.00 33.58 ? 26  DC  E O2    1 
ATOM   1256 N  N3    . DC  D 2 14 ? 15.224 0.449   -2.592  1.00 31.82 ? 26  DC  E N3    1 
ATOM   1257 C  C4    . DC  D 2 14 ? 14.262 0.779   -3.448  1.00 30.88 ? 26  DC  E C4    1 
ATOM   1258 N  N4    . DC  D 2 14 ? 14.574 0.823   -4.741  1.00 30.73 ? 26  DC  E N4    1 
ATOM   1259 C  C5    . DC  D 2 14 ? 12.938 1.077   -3.013  1.00 30.77 ? 26  DC  E C5    1 
ATOM   1260 C  C6    . DC  D 2 14 ? 12.696 1.020   -1.700  1.00 31.59 ? 26  DC  E C6    1 
ATOM   1261 P  P     . DC  D 2 15 ? 12.651 2.343   4.355   1.00 40.18 ? 27  DC  E P     1 
ATOM   1262 O  OP1   . DC  D 2 15 ? 12.927 1.881   5.735   1.00 39.53 ? 27  DC  E OP1   1 
ATOM   1263 O  OP2   . DC  D 2 15 ? 11.639 3.400   4.107   1.00 40.79 ? 27  DC  E OP2   1 
ATOM   1264 O  "O5'" . DC  D 2 15 ? 14.021 2.836   3.716   1.00 40.55 ? 27  DC  E "O5'" 1 
ATOM   1265 C  "C5'" . DC  D 2 15 ? 15.228 2.115   3.940   1.00 41.65 ? 27  DC  E "C5'" 1 
ATOM   1266 C  "C4'" . DC  D 2 15 ? 16.394 2.864   3.341   1.00 42.88 ? 27  DC  E "C4'" 1 
ATOM   1267 O  "O4'" . DC  D 2 15 ? 16.405 2.744   1.897   1.00 42.26 ? 27  DC  E "O4'" 1 
ATOM   1268 C  "C3'" . DC  D 2 15 ? 16.380 4.365   3.637   1.00 44.13 ? 27  DC  E "C3'" 1 
ATOM   1269 O  "O3'" . DC  D 2 15 ? 17.713 4.800   3.871   1.00 46.14 ? 27  DC  E "O3'" 1 
ATOM   1270 C  "C2'" . DC  D 2 15 ? 15.891 4.971   2.333   1.00 42.24 ? 27  DC  E "C2'" 1 
ATOM   1271 C  "C1'" . DC  D 2 15 ? 16.556 4.042   1.344   1.00 41.45 ? 27  DC  E "C1'" 1 
ATOM   1272 N  N1    . DC  D 2 15 ? 16.021 4.031   -0.025  1.00 39.92 ? 27  DC  E N1    1 
ATOM   1273 C  C2    . DC  D 2 15 ? 16.921 3.868   -1.075  1.00 39.49 ? 27  DC  E C2    1 
ATOM   1274 O  O2    . DC  D 2 15 ? 18.127 3.754   -0.805  1.00 39.12 ? 27  DC  E O2    1 
ATOM   1275 N  N3    . DC  D 2 15 ? 16.460 3.839   -2.349  1.00 39.25 ? 27  DC  E N3    1 
ATOM   1276 C  C4    . DC  D 2 15 ? 15.148 3.972   -2.585  1.00 41.35 ? 27  DC  E C4    1 
ATOM   1277 N  N4    . DC  D 2 15 ? 14.725 3.938   -3.855  1.00 40.90 ? 27  DC  E N4    1 
ATOM   1278 C  C5    . DC  D 2 15 ? 14.206 4.146   -1.526  1.00 40.92 ? 27  DC  E C5    1 
ATOM   1279 C  C6    . DC  D 2 15 ? 14.684 4.169   -0.273  1.00 41.21 ? 27  DC  E C6    1 
ATOM   1280 P  P     . DA  D 2 16 ? 18.173 5.190   5.356   1.00 47.38 ? 28  DA  E P     1 
ATOM   1281 O  OP1   . DA  D 2 16 ? 18.085 3.943   6.157   1.00 48.22 ? 28  DA  E OP1   1 
ATOM   1282 O  OP2   . DA  D 2 16 ? 17.435 6.411   5.797   1.00 45.09 ? 28  DA  E OP2   1 
ATOM   1283 O  "O5'" . DA  D 2 16 ? 19.715 5.540   5.175   1.00 46.29 ? 28  DA  E "O5'" 1 
ATOM   1284 C  "C5'" . DA  D 2 16 ? 20.651 4.531   4.799   1.00 46.09 ? 28  DA  E "C5'" 1 
ATOM   1285 C  "C4'" . DA  D 2 16 ? 21.660 5.091   3.823   1.00 45.07 ? 28  DA  E "C4'" 1 
ATOM   1286 O  "O4'" . DA  D 2 16 ? 21.043 5.263   2.525   1.00 45.80 ? 28  DA  E "O4'" 1 
ATOM   1287 C  "C3'" . DA  D 2 16 ? 22.217 6.465   4.200   1.00 45.10 ? 28  DA  E "C3'" 1 
ATOM   1288 O  "O3'" . DA  D 2 16 ? 23.527 6.594   3.627   1.00 44.85 ? 28  DA  E "O3'" 1 
ATOM   1289 C  "C2'" . DA  D 2 16 ? 21.301 7.411   3.441   1.00 43.70 ? 28  DA  E "C2'" 1 
ATOM   1290 C  "C1'" . DA  D 2 16 ? 21.087 6.639   2.150   1.00 43.05 ? 28  DA  E "C1'" 1 
ATOM   1291 N  N9    . DA  D 2 16 ? 19.859 6.945   1.413   1.00 40.59 ? 28  DA  E N9    1 
ATOM   1292 C  C8    . DA  D 2 16 ? 18.642 7.363   1.899   1.00 39.71 ? 28  DA  E C8    1 
ATOM   1293 N  N7    . DA  D 2 16 ? 17.729 7.525   0.968   1.00 38.76 ? 28  DA  E N7    1 
ATOM   1294 C  C5    . DA  D 2 16 ? 18.390 7.197   -0.207  1.00 39.02 ? 28  DA  E C5    1 
ATOM   1295 C  C6    . DA  D 2 16 ? 17.975 7.168   -1.549  1.00 38.50 ? 28  DA  E C6    1 
ATOM   1296 N  N6    . DA  D 2 16 ? 16.740 7.478   -1.947  1.00 40.26 ? 28  DA  E N6    1 
ATOM   1297 N  N1    . DA  D 2 16 ? 18.882 6.805   -2.481  1.00 39.20 ? 28  DA  E N1    1 
ATOM   1298 C  C2    . DA  D 2 16 ? 20.121 6.490   -2.081  1.00 39.58 ? 28  DA  E C2    1 
ATOM   1299 N  N3    . DA  D 2 16 ? 20.631 6.477   -0.849  1.00 39.67 ? 28  DA  E N3    1 
ATOM   1300 C  C4    . DA  D 2 16 ? 19.703 6.845   0.051   1.00 39.07 ? 28  DA  E C4    1 
ATOM   1301 N  N     . ARG E 3 7  ? 29.661 28.956  13.253  1.00 46.27 ? 156 ARG C N     1 
ATOM   1302 C  CA    . ARG E 3 7  ? 28.804 27.782  13.603  1.00 46.18 ? 156 ARG C CA    1 
ATOM   1303 C  C     . ARG E 3 7  ? 28.630 27.674  15.115  1.00 45.30 ? 156 ARG C C     1 
ATOM   1304 O  O     . ARG E 3 7  ? 29.586 27.416  15.850  1.00 46.25 ? 156 ARG C O     1 
ATOM   1305 C  CB    . ARG E 3 7  ? 29.425 26.496  13.057  1.00 47.24 ? 156 ARG C CB    1 
ATOM   1306 C  CG    . ARG E 3 7  ? 29.599 26.506  11.543  1.00 50.52 ? 156 ARG C CG    1 
ATOM   1307 C  CD    . ARG E 3 7  ? 30.480 25.357  11.089  1.00 52.92 ? 156 ARG C CD    1 
ATOM   1308 N  NE    . ARG E 3 7  ? 29.856 24.052  11.300  1.00 54.94 ? 156 ARG C NE    1 
ATOM   1309 C  CZ    . ARG E 3 7  ? 29.039 23.459  10.433  1.00 55.74 ? 156 ARG C CZ    1 
ATOM   1310 N  NH1   . ARG E 3 7  ? 28.741 24.056  9.280   1.00 56.39 ? 156 ARG C NH1   1 
ATOM   1311 N  NH2   . ARG E 3 7  ? 28.533 22.263  10.714  1.00 54.76 ? 156 ARG C NH2   1 
ATOM   1312 N  N     . ARG E 3 8  ? 27.396 27.871  15.563  1.00 43.22 ? 157 ARG C N     1 
ATOM   1313 C  CA    . ARG E 3 8  ? 27.035 27.823  16.976  1.00 42.09 ? 157 ARG C CA    1 
ATOM   1314 C  C     . ARG E 3 8  ? 27.600 26.607  17.724  1.00 40.15 ? 157 ARG C C     1 
ATOM   1315 O  O     . ARG E 3 8  ? 28.252 26.759  18.760  1.00 39.51 ? 157 ARG C O     1 
ATOM   1316 C  CB    . ARG E 3 8  ? 25.509 27.864  17.091  1.00 43.72 ? 157 ARG C CB    1 
ATOM   1317 C  CG    . ARG E 3 8  ? 24.977 28.410  18.395  1.00 48.57 ? 157 ARG C CG    1 
ATOM   1318 C  CD    . ARG E 3 8  ? 23.604 29.003  18.162  1.00 51.73 ? 157 ARG C CD    1 
ATOM   1319 N  NE    . ARG E 3 8  ? 23.686 30.166  17.282  1.00 55.17 ? 157 ARG C NE    1 
ATOM   1320 C  CZ    . ARG E 3 8  ? 22.692 30.606  16.512  1.00 56.70 ? 157 ARG C CZ    1 
ATOM   1321 N  NH1   . ARG E 3 8  ? 21.523 29.976  16.501  1.00 57.08 ? 157 ARG C NH1   1 
ATOM   1322 N  NH2   . ARG E 3 8  ? 22.863 31.684  15.755  1.00 56.15 ? 157 ARG C NH2   1 
ATOM   1323 N  N     . ASN E 3 9  ? 27.360 25.404  17.207  1.00 36.98 ? 158 ASN C N     1 
ATOM   1324 C  CA    . ASN E 3 9  ? 27.857 24.200  17.857  1.00 34.94 ? 158 ASN C CA    1 
ATOM   1325 C  C     . ASN E 3 9  ? 28.685 23.375  16.898  1.00 34.65 ? 158 ASN C C     1 
ATOM   1326 O  O     . ASN E 3 9  ? 28.757 23.676  15.711  1.00 34.61 ? 158 ASN C O     1 
ATOM   1327 C  CB    . ASN E 3 9  ? 26.702 23.341  18.350  1.00 35.81 ? 158 ASN C CB    1 
ATOM   1328 C  CG    . ASN E 3 9  ? 25.692 24.133  19.120  1.00 36.65 ? 158 ASN C CG    1 
ATOM   1329 O  OD1   . ASN E 3 9  ? 26.010 24.718  20.156  1.00 37.55 ? 158 ASN C OD1   1 
ATOM   1330 N  ND2   . ASN E 3 9  ? 24.460 24.171  18.617  1.00 37.34 ? 158 ASN C ND2   1 
ATOM   1331 N  N     . ALA E 3 10 ? 29.288 22.316  17.420  1.00 33.14 ? 159 ALA C N     1 
ATOM   1332 C  CA    . ALA E 3 10 ? 30.107 21.436  16.614  1.00 31.83 ? 159 ALA C CA    1 
ATOM   1333 C  C     . ALA E 3 10 ? 29.306 20.685  15.552  1.00 31.67 ? 159 ALA C C     1 
ATOM   1334 O  O     . ALA E 3 10 ? 29.902 20.088  14.657  1.00 32.68 ? 159 ALA C O     1 
ATOM   1335 C  CB    . ALA E 3 10 ? 30.840 20.450  17.511  1.00 32.68 ? 159 ALA C CB    1 
ATOM   1336 N  N     . TRP E 3 11 ? 27.971 20.703  15.640  1.00 29.69 ? 160 TRP C N     1 
ATOM   1337 C  CA    . TRP E 3 11 ? 27.136 20.009  14.648  1.00 27.06 ? 160 TRP C CA    1 
ATOM   1338 C  C     . TRP E 3 11 ? 26.423 20.990  13.726  1.00 26.92 ? 160 TRP C C     1 
ATOM   1339 O  O     . TRP E 3 11 ? 25.687 20.586  12.822  1.00 28.46 ? 160 TRP C O     1 
ATOM   1340 C  CB    . TRP E 3 11 ? 26.095 19.100  15.329  1.00 25.23 ? 160 TRP C CB    1 
ATOM   1341 C  CG    . TRP E 3 11 ? 25.184 19.827  16.282  1.00 23.03 ? 160 TRP C CG    1 
ATOM   1342 C  CD1   . TRP E 3 11 ? 24.078 20.566  15.968  1.00 22.20 ? 160 TRP C CD1   1 
ATOM   1343 C  CD2   . TRP E 3 11 ? 25.364 19.959  17.694  1.00 22.63 ? 160 TRP C CD2   1 
ATOM   1344 N  NE1   . TRP E 3 11 ? 23.560 21.156  17.099  1.00 20.09 ? 160 TRP C NE1   1 
ATOM   1345 C  CE2   . TRP E 3 11 ? 24.333 20.801  18.173  1.00 22.29 ? 160 TRP C CE2   1 
ATOM   1346 C  CE3   . TRP E 3 11 ? 26.304 19.454  18.605  1.00 24.18 ? 160 TRP C CE3   1 
ATOM   1347 C  CZ2   . TRP E 3 11 ? 24.216 21.150  19.524  1.00 21.51 ? 160 TRP C CZ2   1 
ATOM   1348 C  CZ3   . TRP E 3 11 ? 26.186 19.803  19.949  1.00 22.81 ? 160 TRP C CZ3   1 
ATOM   1349 C  CH2   . TRP E 3 11 ? 25.148 20.644  20.390  1.00 22.30 ? 160 TRP C CH2   1 
ATOM   1350 N  N     . GLY E 3 12 ? 26.653 22.279  13.936  1.00 25.16 ? 161 GLY C N     1 
ATOM   1351 C  CA    . GLY E 3 12 ? 26.002 23.273  13.106  1.00 24.09 ? 161 GLY C CA    1 
ATOM   1352 C  C     . GLY E 3 12 ? 25.281 24.307  13.950  1.00 23.70 ? 161 GLY C C     1 
ATOM   1353 O  O     . GLY E 3 12 ? 25.535 24.404  15.148  1.00 23.53 ? 161 GLY C O     1 
ATOM   1354 N  N     . ASN E 3 13 ? 24.372 25.066  13.342  1.00 23.88 ? 162 ASN C N     1 
ATOM   1355 C  CA    . ASN E 3 13 ? 23.647 26.104  14.070  1.00 25.69 ? 162 ASN C CA    1 
ATOM   1356 C  C     . ASN E 3 13 ? 22.340 25.662  14.702  1.00 25.86 ? 162 ASN C C     1 
ATOM   1357 O  O     . ASN E 3 13 ? 21.698 26.444  15.414  1.00 25.42 ? 162 ASN C O     1 
ATOM   1358 C  CB    . ASN E 3 13 ? 23.362 27.303  13.165  1.00 28.28 ? 162 ASN C CB    1 
ATOM   1359 C  CG    . ASN E 3 13 ? 24.627 28.060  12.775  1.00 31.05 ? 162 ASN C CG    1 
ATOM   1360 O  OD1   . ASN E 3 13 ? 25.592 28.129  13.540  1.00 31.17 ? 162 ASN C OD1   1 
ATOM   1361 N  ND2   . ASN E 3 13 ? 24.612 28.649  11.588  1.00 30.41 ? 162 ASN C ND2   1 
ATOM   1362 N  N     . LEU E 3 14 ? 21.930 24.426  14.427  1.00 25.49 ? 163 LEU C N     1 
ATOM   1363 C  CA    . LEU E 3 14 ? 20.694 23.895  15.001  1.00 24.62 ? 163 LEU C CA    1 
ATOM   1364 C  C     . LEU E 3 14 ? 20.901 23.494  16.456  1.00 22.62 ? 163 LEU C C     1 
ATOM   1365 O  O     . LEU E 3 14 ? 21.953 22.972  16.818  1.00 21.16 ? 163 LEU C O     1 
ATOM   1366 C  CB    . LEU E 3 14 ? 20.206 22.684  14.207  1.00 22.32 ? 163 LEU C CB    1 
ATOM   1367 C  CG    . LEU E 3 14 ? 19.638 22.978  12.813  1.00 26.52 ? 163 LEU C CG    1 
ATOM   1368 C  CD1   . LEU E 3 14 ? 18.724 21.840  12.367  1.00 25.27 ? 163 LEU C CD1   1 
ATOM   1369 C  CD2   . LEU E 3 14 ? 18.853 24.264  12.851  1.00 26.73 ? 163 LEU C CD2   1 
ATOM   1370 N  N     . SER E 3 15 ? 19.892 23.750  17.282  1.00 21.86 ? 164 SER C N     1 
ATOM   1371 C  CA    . SER E 3 15 ? 19.926 23.392  18.708  1.00 21.61 ? 164 SER C CA    1 
ATOM   1372 C  C     . SER E 3 15 ? 19.532 21.929  18.883  1.00 20.41 ? 164 SER C C     1 
ATOM   1373 O  O     . SER E 3 15 ? 19.029 21.295  17.960  1.00 21.46 ? 164 SER C O     1 
ATOM   1374 C  CB    . SER E 3 15 ? 18.904 24.213  19.490  1.00 23.86 ? 164 SER C CB    1 
ATOM   1375 O  OG    . SER E 3 15 ? 17.592 23.768  19.156  1.00 24.34 ? 164 SER C OG    1 
ATOM   1376 N  N     . TYR E 3 16 ? 19.759 21.388  20.070  1.00 18.43 ? 165 TYR C N     1 
ATOM   1377 C  CA    . TYR E 3 16 ? 19.342 20.017  20.325  1.00 18.51 ? 165 TYR C CA    1 
ATOM   1378 C  C     . TYR E 3 16 ? 17.834 19.889  20.074  1.00 17.53 ? 165 TYR C C     1 
ATOM   1379 O  O     . TYR E 3 16 ? 17.384 18.920  19.468  1.00 16.38 ? 165 TYR C O     1 
ATOM   1380 C  CB    . TYR E 3 16 ? 19.647 19.630  21.759  1.00 16.50 ? 165 TYR C CB    1 
ATOM   1381 C  CG    . TYR E 3 16 ? 21.056 19.152  21.940  1.00 18.34 ? 165 TYR C CG    1 
ATOM   1382 C  CD1   . TYR E 3 16 ? 21.939 19.836  22.766  1.00 15.34 ? 165 TYR C CD1   1 
ATOM   1383 C  CD2   . TYR E 3 16 ? 21.504 17.993  21.299  1.00 17.03 ? 165 TYR C CD2   1 
ATOM   1384 C  CE1   . TYR E 3 16 ? 23.237 19.377  22.961  1.00 16.68 ? 165 TYR C CE1   1 
ATOM   1385 C  CE2   . TYR E 3 16 ? 22.803 17.524  21.484  1.00 18.28 ? 165 TYR C CE2   1 
ATOM   1386 C  CZ    . TYR E 3 16 ? 23.665 18.226  22.328  1.00 17.29 ? 165 TYR C CZ    1 
ATOM   1387 O  OH    . TYR E 3 16 ? 24.938 17.763  22.564  1.00 17.01 ? 165 TYR C OH    1 
ATOM   1388 N  N     . ALA E 3 17 ? 17.068 20.875  20.541  1.00 16.21 ? 166 ALA C N     1 
ATOM   1389 C  CA    . ALA E 3 17 ? 15.620 20.860  20.363  1.00 17.54 ? 166 ALA C CA    1 
ATOM   1390 C  C     . ALA E 3 17 ? 15.277 20.802  18.883  1.00 19.27 ? 166 ALA C C     1 
ATOM   1391 O  O     . ALA E 3 17 ? 14.373 20.057  18.480  1.00 18.70 ? 166 ALA C O     1 
ATOM   1392 C  CB    . ALA E 3 17 ? 14.993 22.095  20.986  1.00 14.69 ? 166 ALA C CB    1 
ATOM   1393 N  N     . ASP E 3 18 ? 15.992 21.592  18.078  1.00 20.06 ? 167 ASP C N     1 
ATOM   1394 C  CA    . ASP E 3 18 ? 15.760 21.624  16.624  1.00 20.92 ? 167 ASP C CA    1 
ATOM   1395 C  C     . ASP E 3 18 ? 15.974 20.253  16.013  1.00 20.34 ? 167 ASP C C     1 
ATOM   1396 O  O     . ASP E 3 18 ? 15.179 19.795  15.198  1.00 20.18 ? 167 ASP C O     1 
ATOM   1397 C  CB    . ASP E 3 18 ? 16.705 22.619  15.919  1.00 21.51 ? 167 ASP C CB    1 
ATOM   1398 C  CG    . ASP E 3 18 ? 16.403 24.077  16.266  1.00 22.66 ? 167 ASP C CG    1 
ATOM   1399 O  OD1   . ASP E 3 18 ? 15.246 24.380  16.623  1.00 25.87 ? 167 ASP C OD1   1 
ATOM   1400 O  OD2   . ASP E 3 18 ? 17.319 24.928  16.169  1.00 24.66 ? 167 ASP C OD2   1 
ATOM   1401 N  N     . LEU E 3 19 ? 17.072 19.610  16.397  1.00 20.15 ? 168 LEU C N     1 
ATOM   1402 C  CA    . LEU E 3 19 ? 17.392 18.295  15.878  1.00 19.78 ? 168 LEU C CA    1 
ATOM   1403 C  C     . LEU E 3 19 ? 16.285 17.293  16.239  1.00 19.15 ? 168 LEU C C     1 
ATOM   1404 O  O     . LEU E 3 19 ? 15.822 16.518  15.386  1.00 15.57 ? 168 LEU C O     1 
ATOM   1405 C  CB    . LEU E 3 19 ? 18.736 17.821  16.436  1.00 20.30 ? 168 LEU C CB    1 
ATOM   1406 C  CG    . LEU E 3 19 ? 19.974 18.616  15.999  1.00 24.06 ? 168 LEU C CG    1 
ATOM   1407 C  CD1   . LEU E 3 19 ? 21.209 18.006  16.646  1.00 22.13 ? 168 LEU C CD1   1 
ATOM   1408 C  CD2   . LEU E 3 19 ? 20.103 18.625  14.466  1.00 23.14 ? 168 LEU C CD2   1 
ATOM   1409 N  N     . ILE E 3 20 ? 15.868 17.307  17.503  1.00 17.20 ? 169 ILE C N     1 
ATOM   1410 C  CA    . ILE E 3 20 ? 14.811 16.397  17.946  1.00 18.14 ? 169 ILE C CA    1 
ATOM   1411 C  C     . ILE E 3 20 ? 13.571 16.618  17.081  1.00 17.62 ? 169 ILE C C     1 
ATOM   1412 O  O     . ILE E 3 20 ? 12.883 15.674  16.714  1.00 19.61 ? 169 ILE C O     1 
ATOM   1413 C  CB    . ILE E 3 20 ? 14.456 16.635  19.428  1.00 17.36 ? 169 ILE C CB    1 
ATOM   1414 C  CG1   . ILE E 3 20 ? 15.643 16.215  20.301  1.00 16.69 ? 169 ILE C CG1   1 
ATOM   1415 C  CG2   . ILE E 3 20 ? 13.198 15.825  19.816  1.00 18.67 ? 169 ILE C CG2   1 
ATOM   1416 C  CD1   . ILE E 3 20 ? 15.599 16.812  21.709  1.00 19.07 ? 169 ILE C CD1   1 
ATOM   1417 N  N     . THR E 3 21 ? 13.312 17.867  16.729  1.00 17.40 ? 170 THR C N     1 
ATOM   1418 C  CA    . THR E 3 21 ? 12.160 18.175  15.919  1.00 20.29 ? 170 THR C CA    1 
ATOM   1419 C  C     . THR E 3 21 ? 12.284 17.542  14.530  1.00 22.61 ? 170 THR C C     1 
ATOM   1420 O  O     . THR E 3 21 ? 11.331 16.922  14.017  1.00 22.21 ? 170 THR C O     1 
ATOM   1421 C  CB    . THR E 3 21 ? 11.985 19.689  15.819  1.00 19.04 ? 170 THR C CB    1 
ATOM   1422 O  OG1   . THR E 3 21 ? 11.817 20.208  17.139  1.00 18.15 ? 170 THR C OG1   1 
ATOM   1423 C  CG2   . THR E 3 21 ? 10.767 20.049  14.971  1.00 18.50 ? 170 THR C CG2   1 
ATOM   1424 N  N     . LYS E 3 22 ? 13.460 17.674  13.927  1.00 22.20 ? 171 LYS C N     1 
ATOM   1425 C  CA    . LYS E 3 22 ? 13.661 17.103  12.608  1.00 22.71 ? 171 LYS C CA    1 
ATOM   1426 C  C     . LYS E 3 22 ? 13.548 15.589  12.663  1.00 22.60 ? 171 LYS C C     1 
ATOM   1427 O  O     . LYS E 3 22 ? 13.031 14.963  11.729  1.00 23.08 ? 171 LYS C O     1 
ATOM   1428 C  CB    . LYS E 3 22 ? 15.019 17.515  12.042  1.00 23.54 ? 171 LYS C CB    1 
ATOM   1429 C  CG    . LYS E 3 22 ? 15.081 18.990  11.678  1.00 27.84 ? 171 LYS C CG    1 
ATOM   1430 C  CD    . LYS E 3 22 ? 16.439 19.369  11.073  1.00 30.22 ? 171 LYS C CD    1 
ATOM   1431 C  CE    . LYS E 3 22 ? 16.662 18.658  9.756   1.00 32.79 ? 171 LYS C CE    1 
ATOM   1432 N  NZ    . LYS E 3 22 ? 18.034 18.900  9.258   1.00 35.78 ? 171 LYS C NZ    1 
ATOM   1433 N  N     . ALA E 3 23 ? 14.031 15.000  13.753  1.00 20.75 ? 172 ALA C N     1 
ATOM   1434 C  CA    . ALA E 3 23 ? 13.959 13.556  13.905  1.00 20.58 ? 172 ALA C CA    1 
ATOM   1435 C  C     . ALA E 3 23 ? 12.487 13.113  13.902  1.00 19.66 ? 172 ALA C C     1 
ATOM   1436 O  O     . ALA E 3 23 ? 12.113 12.180  13.194  1.00 20.63 ? 172 ALA C O     1 
ATOM   1437 C  CB    . ALA E 3 23 ? 14.650 13.114  15.204  1.00 15.32 ? 172 ALA C CB    1 
ATOM   1438 N  N     . ILE E 3 24 ? 11.657 13.783  14.690  1.00 19.47 ? 173 ILE C N     1 
ATOM   1439 C  CA    . ILE E 3 24 ? 10.249 13.430  14.754  1.00 19.22 ? 173 ILE C CA    1 
ATOM   1440 C  C     . ILE E 3 24 ? 9.490  13.753  13.460  1.00 20.03 ? 173 ILE C C     1 
ATOM   1441 O  O     . ILE E 3 24 ? 8.650  12.967  13.014  1.00 20.08 ? 173 ILE C O     1 
ATOM   1442 C  CB    . ILE E 3 24 ? 9.551  14.152  15.941  1.00 19.04 ? 173 ILE C CB    1 
ATOM   1443 C  CG1   . ILE E 3 24 ? 10.055 13.577  17.275  1.00 16.55 ? 173 ILE C CG1   1 
ATOM   1444 C  CG2   . ILE E 3 24 ? 8.027  14.011  15.825  1.00 15.46 ? 173 ILE C CG2   1 
ATOM   1445 C  CD1   . ILE E 3 24 ? 9.607  14.406  18.487  1.00 17.26 ? 173 ILE C CD1   1 
ATOM   1446 N  N     . GLU E 3 25 ? 9.764  14.902  12.859  1.00 22.10 ? 174 GLU C N     1 
ATOM   1447 C  CA    . GLU E 3 25 ? 9.067  15.265  11.622  1.00 23.81 ? 174 GLU C CA    1 
ATOM   1448 C  C     . GLU E 3 25 ? 9.438  14.327  10.480  1.00 23.19 ? 174 GLU C C     1 
ATOM   1449 O  O     . GLU E 3 25 ? 8.700  14.232  9.504   1.00 24.15 ? 174 GLU C O     1 
ATOM   1450 C  CB    . GLU E 3 25 ? 9.391  16.701  11.206  1.00 25.33 ? 174 GLU C CB    1 
ATOM   1451 C  CG    . GLU E 3 25 ? 8.899  17.759  12.168  1.00 29.64 ? 174 GLU C CG    1 
ATOM   1452 C  CD    . GLU E 3 25 ? 9.356  19.173  11.794  1.00 32.92 ? 174 GLU C CD    1 
ATOM   1453 O  OE1   . GLU E 3 25 ? 10.517 19.339  11.331  1.00 32.68 ? 174 GLU C OE1   1 
ATOM   1454 O  OE2   . GLU E 3 25 ? 8.558  20.118  11.989  1.00 32.51 ? 174 GLU C OE2   1 
ATOM   1455 N  N     . SER E 3 26 ? 10.566 13.627  10.610  1.00 21.41 ? 175 SER C N     1 
ATOM   1456 C  CA    . SER E 3 26 ? 11.023 12.719  9.568   1.00 20.18 ? 175 SER C CA    1 
ATOM   1457 C  C     . SER E 3 26 ? 10.293 11.383  9.609   1.00 21.69 ? 175 SER C C     1 
ATOM   1458 O  O     . SER E 3 26 ? 10.425 10.572  8.685   1.00 19.39 ? 175 SER C O     1 
ATOM   1459 C  CB    . SER E 3 26 ? 12.519 12.437  9.704   1.00 20.57 ? 175 SER C CB    1 
ATOM   1460 O  OG    . SER E 3 26 ? 12.754 11.336  10.579  1.00 19.14 ? 175 SER C OG    1 
ATOM   1461 N  N     . SER E 3 27 ? 9.583  11.116  10.703  1.00 20.42 ? 176 SER C N     1 
ATOM   1462 C  CA    . SER E 3 27 ? 8.851  9.858   10.789  1.00 20.85 ? 176 SER C CA    1 
ATOM   1463 C  C     . SER E 3 27 ? 7.499  10.089  10.124  1.00 18.36 ? 176 SER C C     1 
ATOM   1464 O  O     . SER E 3 27 ? 6.905  11.153  10.270  1.00 16.70 ? 176 SER C O     1 
ATOM   1465 C  CB    . SER E 3 27 ? 8.649  9.440   12.254  1.00 23.00 ? 176 SER C CB    1 
ATOM   1466 O  OG    . SER E 3 27 ? 7.875  10.400  12.954  1.00 22.44 ? 176 SER C OG    1 
ATOM   1467 N  N     . ALA E 3 28 ? 7.022  9.103   9.383   1.00 19.05 ? 177 ALA C N     1 
ATOM   1468 C  CA    . ALA E 3 28 ? 5.716  9.232   8.720   1.00 20.66 ? 177 ALA C CA    1 
ATOM   1469 C  C     . ALA E 3 28 ? 4.601  9.472   9.744   1.00 20.02 ? 177 ALA C C     1 
ATOM   1470 O  O     . ALA E 3 28 ? 3.669  10.229  9.483   1.00 21.16 ? 177 ALA C O     1 
ATOM   1471 C  CB    . ALA E 3 28 ? 5.407  7.980   7.943   1.00 18.46 ? 177 ALA C CB    1 
ATOM   1472 N  N     . GLU E 3 29 ? 4.705  8.827   10.903  1.00 17.92 ? 178 GLU C N     1 
ATOM   1473 C  CA    . GLU E 3 29 ? 3.683  8.962   11.935  1.00 19.25 ? 178 GLU C CA    1 
ATOM   1474 C  C     . GLU E 3 29 ? 3.898  10.127  12.902  1.00 19.49 ? 178 GLU C C     1 
ATOM   1475 O  O     . GLU E 3 29 ? 3.110  10.330  13.816  1.00 20.95 ? 178 GLU C O     1 
ATOM   1476 C  CB    . GLU E 3 29 ? 3.523  7.628   12.677  1.00 20.02 ? 178 GLU C CB    1 
ATOM   1477 C  CG    . GLU E 3 29 ? 2.928  6.559   11.750  1.00 22.91 ? 178 GLU C CG    1 
ATOM   1478 C  CD    . GLU E 3 29 ? 2.761  5.186   12.375  1.00 26.33 ? 178 GLU C CD    1 
ATOM   1479 O  OE1   . GLU E 3 29 ? 2.313  5.083   13.538  1.00 27.16 ? 178 GLU C OE1   1 
ATOM   1480 O  OE2   . GLU E 3 29 ? 3.059  4.194   11.675  1.00 30.76 ? 178 GLU C OE2   1 
ATOM   1481 N  N     . LYS E 3 30 ? 4.959  10.903  12.693  1.00 17.83 ? 179 LYS C N     1 
ATOM   1482 C  CA    . LYS E 3 30 ? 5.194  12.064  13.528  1.00 17.25 ? 179 LYS C CA    1 
ATOM   1483 C  C     . LYS E 3 30 ? 5.331  11.745  15.015  1.00 17.28 ? 179 LYS C C     1 
ATOM   1484 O  O     . LYS E 3 30 ? 4.809  12.477  15.869  1.00 18.29 ? 179 LYS C O     1 
ATOM   1485 C  CB    . LYS E 3 30 ? 4.049  13.062  13.327  1.00 17.94 ? 179 LYS C CB    1 
ATOM   1486 C  CG    . LYS E 3 30 ? 3.740  13.348  11.879  1.00 19.70 ? 179 LYS C CG    1 
ATOM   1487 C  CD    . LYS E 3 30 ? 4.913  13.978  11.144  1.00 22.51 ? 179 LYS C CD    1 
ATOM   1488 C  CE    . LYS E 3 30 ? 4.642  13.964  9.639   1.00 27.00 ? 179 LYS C CE    1 
ATOM   1489 N  NZ    . LYS E 3 30 ? 5.817  14.378  8.837   1.00 27.07 ? 179 LYS C NZ    1 
ATOM   1490 N  N     . ARG E 3 31 ? 6.026  10.652  15.324  1.00 15.12 ? 180 ARG C N     1 
ATOM   1491 C  CA    . ARG E 3 31 ? 6.270  10.270  16.703  1.00 13.99 ? 180 ARG C CA    1 
ATOM   1492 C  C     . ARG E 3 31 ? 7.424  9.276   16.716  1.00 14.43 ? 180 ARG C C     1 
ATOM   1493 O  O     . ARG E 3 31 ? 7.572  8.462   15.800  1.00 14.73 ? 180 ARG C O     1 
ATOM   1494 C  CB    . ARG E 3 31 ? 5.011  9.672   17.333  1.00 12.11 ? 180 ARG C CB    1 
ATOM   1495 C  CG    . ARG E 3 31 ? 4.537  8.341   16.752  1.00 9.69  ? 180 ARG C CG    1 
ATOM   1496 C  CD    . ARG E 3 31 ? 3.178  7.955   17.344  1.00 11.98 ? 180 ARG C CD    1 
ATOM   1497 N  NE    . ARG E 3 31 ? 2.842  6.552   17.087  1.00 17.00 ? 180 ARG C NE    1 
ATOM   1498 C  CZ    . ARG E 3 31 ? 1.772  5.924   17.580  1.00 18.68 ? 180 ARG C CZ    1 
ATOM   1499 N  NH1   . ARG E 3 31 ? 0.905  6.563   18.362  1.00 16.17 ? 180 ARG C NH1   1 
ATOM   1500 N  NH2   . ARG E 3 31 ? 1.575  4.642   17.300  1.00 19.27 ? 180 ARG C NH2   1 
ATOM   1501 N  N     . LEU E 3 32 ? 8.251  9.341   17.746  1.00 15.08 ? 181 LEU C N     1 
ATOM   1502 C  CA    . LEU E 3 32 ? 9.390  8.428   17.832  1.00 16.09 ? 181 LEU C CA    1 
ATOM   1503 C  C     . LEU E 3 32 ? 9.695  8.092   19.280  1.00 14.28 ? 181 LEU C C     1 
ATOM   1504 O  O     . LEU E 3 32 ? 9.413  8.896   20.158  1.00 14.16 ? 181 LEU C O     1 
ATOM   1505 C  CB    . LEU E 3 32 ? 10.622 9.092   17.201  1.00 16.50 ? 181 LEU C CB    1 
ATOM   1506 C  CG    . LEU E 3 32 ? 10.702 9.356   15.687  1.00 17.35 ? 181 LEU C CG    1 
ATOM   1507 C  CD1   . LEU E 3 32 ? 11.909 10.209  15.382  1.00 18.37 ? 181 LEU C CD1   1 
ATOM   1508 C  CD2   . LEU E 3 32 ? 10.822 8.042   14.932  1.00 15.75 ? 181 LEU C CD2   1 
ATOM   1509 N  N     . THR E 3 33 ? 10.255 6.910   19.539  1.00 15.23 ? 182 THR C N     1 
ATOM   1510 C  CA    . THR E 3 33 ? 10.646 6.569   20.908  1.00 15.02 ? 182 THR C CA    1 
ATOM   1511 C  C     . THR E 3 33 ? 12.020 7.249   21.116  1.00 16.40 ? 182 THR C C     1 
ATOM   1512 O  O     . THR E 3 33 ? 12.622 7.729   20.164  1.00 14.44 ? 182 THR C O     1 
ATOM   1513 C  CB    . THR E 3 33 ? 10.848 5.054   21.116  1.00 17.14 ? 182 THR C CB    1 
ATOM   1514 O  OG1   . THR E 3 33 ? 11.795 4.570   20.152  1.00 15.83 ? 182 THR C OG1   1 
ATOM   1515 C  CG2   . THR E 3 33 ? 9.514  4.281   20.986  1.00 15.22 ? 182 THR C CG2   1 
ATOM   1516 N  N     . LEU E 3 34 ? 12.509 7.277   22.352  1.00 15.46 ? 183 LEU C N     1 
ATOM   1517 C  CA    . LEU E 3 34 ? 13.796 7.887   22.642  1.00 16.09 ? 183 LEU C CA    1 
ATOM   1518 C  C     . LEU E 3 34 ? 14.923 7.201   21.854  1.00 17.55 ? 183 LEU C C     1 
ATOM   1519 O  O     . LEU E 3 34 ? 15.813 7.854   21.318  1.00 17.24 ? 183 LEU C O     1 
ATOM   1520 C  CB    . LEU E 3 34 ? 14.076 7.783   24.139  1.00 15.21 ? 183 LEU C CB    1 
ATOM   1521 C  CG    . LEU E 3 34 ? 15.428 8.267   24.662  1.00 15.48 ? 183 LEU C CG    1 
ATOM   1522 C  CD1   . LEU E 3 34 ? 15.575 9.758   24.423  1.00 11.89 ? 183 LEU C CD1   1 
ATOM   1523 C  CD2   . LEU E 3 34 ? 15.535 7.955   26.157  1.00 13.32 ? 183 LEU C CD2   1 
ATOM   1524 N  N     . SER E 3 35 ? 14.868 5.877   21.798  1.00 17.50 ? 184 SER C N     1 
ATOM   1525 C  CA    . SER E 3 35 ? 15.863 5.080   21.104  1.00 19.80 ? 184 SER C CA    1 
ATOM   1526 C  C     . SER E 3 35 ? 15.904 5.434   19.608  1.00 20.84 ? 184 SER C C     1 
ATOM   1527 O  O     . SER E 3 35 ? 16.980 5.483   18.993  1.00 18.49 ? 184 SER C O     1 
ATOM   1528 C  CB    . SER E 3 35 ? 15.530 3.600   21.290  1.00 21.52 ? 184 SER C CB    1 
ATOM   1529 O  OG    . SER E 3 35 ? 16.526 2.789   20.716  1.00 28.82 ? 184 SER C OG    1 
ATOM   1530 N  N     . GLN E 3 36 ? 14.731 5.666   19.023  1.00 18.85 ? 185 GLN C N     1 
ATOM   1531 C  CA    . GLN E 3 36 ? 14.669 6.019   17.611  1.00 19.50 ? 185 GLN C CA    1 
ATOM   1532 C  C     . GLN E 3 36 ? 15.243 7.420   17.377  1.00 17.80 ? 185 GLN C C     1 
ATOM   1533 O  O     . GLN E 3 36 ? 15.830 7.706   16.324  1.00 16.55 ? 185 GLN C O     1 
ATOM   1534 C  CB    . GLN E 3 36 ? 13.221 5.941   17.095  1.00 19.22 ? 185 GLN C CB    1 
ATOM   1535 C  CG    . GLN E 3 36 ? 12.652 4.522   17.039  1.00 18.90 ? 185 GLN C CG    1 
ATOM   1536 C  CD    . GLN E 3 36 ? 11.202 4.503   16.536  1.00 21.76 ? 185 GLN C CD    1 
ATOM   1537 O  OE1   . GLN E 3 36 ? 10.319 5.138   17.114  1.00 18.82 ? 185 GLN C OE1   1 
ATOM   1538 N  NE2   . GLN E 3 36 ? 10.961 3.773   15.449  1.00 22.49 ? 185 GLN C NE2   1 
ATOM   1539 N  N     . ILE E 3 37 ? 15.076 8.301   18.354  1.00 16.22 ? 186 ILE C N     1 
ATOM   1540 C  CA    . ILE E 3 37 ? 15.616 9.637   18.194  1.00 15.29 ? 186 ILE C CA    1 
ATOM   1541 C  C     . ILE E 3 37 ? 17.157 9.525   18.217  1.00 16.06 ? 186 ILE C C     1 
ATOM   1542 O  O     . ILE E 3 37 ? 17.825 10.159  17.406  1.00 16.14 ? 186 ILE C O     1 
ATOM   1543 C  CB    . ILE E 3 37 ? 15.069 10.604  19.286  1.00 13.80 ? 186 ILE C CB    1 
ATOM   1544 C  CG1   . ILE E 3 37 ? 13.552 10.784  19.080  1.00 11.32 ? 186 ILE C CG1   1 
ATOM   1545 C  CG2   . ILE E 3 37 ? 15.772 11.980  19.179  1.00 9.66  ? 186 ILE C CG2   1 
ATOM   1546 C  CD1   . ILE E 3 37 ? 12.871 11.654  20.102  1.00 7.47  ? 186 ILE C CD1   1 
ATOM   1547 N  N     . TYR E 3 38 ? 17.708 8.706   19.115  1.00 14.41 ? 187 TYR C N     1 
ATOM   1548 C  CA    . TYR E 3 38 ? 19.162 8.498   19.149  1.00 18.18 ? 187 TYR C CA    1 
ATOM   1549 C  C     . TYR E 3 38 ? 19.603 7.991   17.773  1.00 19.23 ? 187 TYR C C     1 
ATOM   1550 O  O     . TYR E 3 38 ? 20.503 8.562   17.163  1.00 18.07 ? 187 TYR C O     1 
ATOM   1551 C  CB    . TYR E 3 38 ? 19.582 7.446   20.182  1.00 15.12 ? 187 TYR C CB    1 
ATOM   1552 C  CG    . TYR E 3 38 ? 19.268 7.789   21.621  1.00 16.27 ? 187 TYR C CG    1 
ATOM   1553 C  CD1   . TYR E 3 38 ? 19.234 9.113   22.060  1.00 12.82 ? 187 TYR C CD1   1 
ATOM   1554 C  CD2   . TYR E 3 38 ? 19.098 6.774   22.564  1.00 15.47 ? 187 TYR C CD2   1 
ATOM   1555 C  CE1   . TYR E 3 38 ? 19.044 9.414   23.411  1.00 15.94 ? 187 TYR C CE1   1 
ATOM   1556 C  CE2   . TYR E 3 38 ? 18.917 7.063   23.903  1.00 16.84 ? 187 TYR C CE2   1 
ATOM   1557 C  CZ    . TYR E 3 38 ? 18.888 8.385   24.326  1.00 15.96 ? 187 TYR C CZ    1 
ATOM   1558 O  OH    . TYR E 3 38 ? 18.683 8.650   25.664  1.00 18.61 ? 187 TYR C OH    1 
ATOM   1559 N  N     . GLU E 3 39 ? 18.960 6.919   17.305  1.00 20.64 ? 188 GLU C N     1 
ATOM   1560 C  CA    . GLU E 3 39 ? 19.252 6.338   15.997  1.00 22.98 ? 188 GLU C CA    1 
ATOM   1561 C  C     . GLU E 3 39 ? 19.219 7.385   14.880  1.00 23.45 ? 188 GLU C C     1 
ATOM   1562 O  O     . GLU E 3 39 ? 20.045 7.353   13.968  1.00 24.15 ? 188 GLU C O     1 
ATOM   1563 C  CB    . GLU E 3 39 ? 18.259 5.219   15.669  1.00 25.27 ? 188 GLU C CB    1 
ATOM   1564 C  CG    . GLU E 3 39 ? 18.522 3.921   16.415  1.00 33.48 ? 188 GLU C CG    1 
ATOM   1565 C  CD    . GLU E 3 39 ? 17.424 2.882   16.213  1.00 38.53 ? 188 GLU C CD    1 
ATOM   1566 O  OE1   . GLU E 3 39 ? 17.089 2.574   15.040  1.00 41.90 ? 188 GLU C OE1   1 
ATOM   1567 O  OE2   . GLU E 3 39 ? 16.895 2.374   17.232  1.00 41.20 ? 188 GLU C OE2   1 
ATOM   1568 N  N     . TRP E 3 40 ? 18.274 8.317   14.944  1.00 22.26 ? 189 TRP C N     1 
ATOM   1569 C  CA    . TRP E 3 40 ? 18.199 9.342   13.913  1.00 21.07 ? 189 TRP C CA    1 
ATOM   1570 C  C     . TRP E 3 40 ? 19.407 10.292  13.950  1.00 20.72 ? 189 TRP C C     1 
ATOM   1571 O  O     . TRP E 3 40 ? 19.898 10.729  12.912  1.00 21.63 ? 189 TRP C O     1 
ATOM   1572 C  CB    . TRP E 3 40 ? 16.921 10.151  14.063  1.00 20.15 ? 189 TRP C CB    1 
ATOM   1573 C  CG    . TRP E 3 40 ? 16.731 11.094  12.963  1.00 21.09 ? 189 TRP C CG    1 
ATOM   1574 C  CD1   . TRP E 3 40 ? 16.076 10.863  11.780  1.00 23.44 ? 189 TRP C CD1   1 
ATOM   1575 C  CD2   . TRP E 3 40 ? 17.195 12.441  12.910  1.00 21.68 ? 189 TRP C CD2   1 
ATOM   1576 N  NE1   . TRP E 3 40 ? 16.104 11.998  10.995  1.00 22.72 ? 189 TRP C NE1   1 
ATOM   1577 C  CE2   . TRP E 3 40 ? 16.781 12.980  11.667  1.00 22.19 ? 189 TRP C CE2   1 
ATOM   1578 C  CE3   . TRP E 3 40 ? 17.919 13.252  13.794  1.00 20.32 ? 189 TRP C CE3   1 
ATOM   1579 C  CZ2   . TRP E 3 40 ? 17.068 14.290  11.289  1.00 21.60 ? 189 TRP C CZ2   1 
ATOM   1580 C  CZ3   . TRP E 3 40 ? 18.202 14.543  13.420  1.00 21.23 ? 189 TRP C CZ3   1 
ATOM   1581 C  CH2   . TRP E 3 40 ? 17.778 15.056  12.175  1.00 21.98 ? 189 TRP C CH2   1 
ATOM   1582 N  N     . MET E 3 41 ? 19.871 10.625  15.144  1.00 20.88 ? 190 MET C N     1 
ATOM   1583 C  CA    . MET E 3 41 ? 21.022 11.512  15.283  1.00 23.22 ? 190 MET C CA    1 
ATOM   1584 C  C     . MET E 3 41 ? 22.260 10.878  14.651  1.00 21.64 ? 190 MET C C     1 
ATOM   1585 O  O     . MET E 3 41 ? 22.936 11.478  13.832  1.00 22.51 ? 190 MET C O     1 
ATOM   1586 C  CB    . MET E 3 41 ? 21.325 11.757  16.756  1.00 23.89 ? 190 MET C CB    1 
ATOM   1587 C  CG    . MET E 3 41 ? 20.196 12.362  17.544  1.00 28.50 ? 190 MET C CG    1 
ATOM   1588 S  SD    . MET E 3 41 ? 20.286 14.121  17.493  1.00 30.46 ? 190 MET C SD    1 
ATOM   1589 C  CE    . MET E 3 41 ? 18.734 14.486  16.663  1.00 35.75 ? 190 MET C CE    1 
ATOM   1590 N  N     . VAL E 3 42 ? 22.545 9.657   15.067  1.00 21.57 ? 191 VAL C N     1 
ATOM   1591 C  CA    . VAL E 3 42 ? 23.699 8.941   14.589  1.00 25.41 ? 191 VAL C CA    1 
ATOM   1592 C  C     . VAL E 3 42 ? 23.670 8.694   13.090  1.00 26.98 ? 191 VAL C C     1 
ATOM   1593 O  O     . VAL E 3 42 ? 24.715 8.689   12.459  1.00 28.44 ? 191 VAL C O     1 
ATOM   1594 C  CB    . VAL E 3 42 ? 23.854 7.622   15.344  1.00 23.43 ? 191 VAL C CB    1 
ATOM   1595 C  CG1   . VAL E 3 42 ? 24.944 6.763   14.714  1.00 25.69 ? 191 VAL C CG1   1 
ATOM   1596 C  CG2   . VAL E 3 42 ? 24.207 7.926   16.780  1.00 23.16 ? 191 VAL C CG2   1 
ATOM   1597 N  N     . LYS E 3 43 ? 22.484 8.513   12.519  1.00 27.60 ? 192 LYS C N     1 
ATOM   1598 C  CA    . LYS E 3 43 ? 22.381 8.278   11.091  1.00 29.42 ? 192 LYS C CA    1 
ATOM   1599 C  C     . LYS E 3 43 ? 22.283 9.570   10.281  1.00 30.66 ? 192 LYS C C     1 
ATOM   1600 O  O     . LYS E 3 43 ? 22.780 9.641   9.160   1.00 31.03 ? 192 LYS C O     1 
ATOM   1601 C  CB    . LYS E 3 43 ? 21.173 7.387   10.790  1.00 29.73 ? 192 LYS C CB    1 
ATOM   1602 N  N     . SER E 3 44 ? 21.693 10.608  10.864  1.00 31.97 ? 193 SER C N     1 
ATOM   1603 C  CA    . SER E 3 44 ? 21.464 11.854  10.135  1.00 31.35 ? 193 SER C CA    1 
ATOM   1604 C  C     . SER E 3 44 ? 22.350 13.058  10.361  1.00 30.68 ? 193 SER C C     1 
ATOM   1605 O  O     . SER E 3 44 ? 22.408 13.930  9.506   1.00 29.89 ? 193 SER C O     1 
ATOM   1606 C  CB    . SER E 3 44 ? 20.024 12.304  10.358  1.00 30.99 ? 193 SER C CB    1 
ATOM   1607 O  OG    . SER E 3 44 ? 19.142 11.217  10.173  1.00 31.93 ? 193 SER C OG    1 
ATOM   1608 N  N     . VAL E 3 45 ? 23.006 13.147  11.507  1.00 30.38 ? 194 VAL C N     1 
ATOM   1609 C  CA    . VAL E 3 45 ? 23.846 14.310  11.754  1.00 30.86 ? 194 VAL C CA    1 
ATOM   1610 C  C     . VAL E 3 45 ? 25.320 13.913  11.698  1.00 30.79 ? 194 VAL C C     1 
ATOM   1611 O  O     . VAL E 3 45 ? 25.793 13.124  12.517  1.00 29.22 ? 194 VAL C O     1 
ATOM   1612 C  CB    . VAL E 3 45 ? 23.505 14.945  13.111  1.00 31.44 ? 194 VAL C CB    1 
ATOM   1613 C  CG1   . VAL E 3 45 ? 24.293 16.220  13.301  1.00 30.76 ? 194 VAL C CG1   1 
ATOM   1614 C  CG2   . VAL E 3 45 ? 22.003 15.231  13.175  1.00 31.72 ? 194 VAL C CG2   1 
ATOM   1615 N  N     . PRO E 3 46 ? 26.062 14.467  10.717  1.00 31.14 ? 195 PRO C N     1 
ATOM   1616 C  CA    . PRO E 3 46 ? 27.489 14.214  10.480  1.00 31.92 ? 195 PRO C CA    1 
ATOM   1617 C  C     . PRO E 3 46 ? 28.330 14.150  11.742  1.00 32.04 ? 195 PRO C C     1 
ATOM   1618 O  O     . PRO E 3 46 ? 29.098 13.215  11.932  1.00 32.62 ? 195 PRO C O     1 
ATOM   1619 C  CB    . PRO E 3 46 ? 27.896 15.365  9.563   1.00 32.44 ? 195 PRO C CB    1 
ATOM   1620 C  CG    . PRO E 3 46 ? 26.635 15.606  8.761   1.00 30.63 ? 195 PRO C CG    1 
ATOM   1621 C  CD    . PRO E 3 46 ? 25.577 15.555  9.845   1.00 30.56 ? 195 PRO C CD    1 
ATOM   1622 N  N     . TYR E 3 47 ? 28.170 15.137  12.612  1.00 33.55 ? 196 TYR C N     1 
ATOM   1623 C  CA    . TYR E 3 47 ? 28.925 15.179  13.864  1.00 33.58 ? 196 TYR C CA    1 
ATOM   1624 C  C     . TYR E 3 47 ? 28.719 13.960  14.749  1.00 33.43 ? 196 TYR C C     1 
ATOM   1625 O  O     . TYR E 3 47 ? 29.666 13.472  15.365  1.00 33.20 ? 196 TYR C O     1 
ATOM   1626 C  CB    . TYR E 3 47 ? 28.558 16.432  14.662  1.00 35.90 ? 196 TYR C CB    1 
ATOM   1627 C  CG    . TYR E 3 47 ? 29.304 16.556  15.972  1.00 38.81 ? 196 TYR C CG    1 
ATOM   1628 C  CD1   . TYR E 3 47 ? 30.680 16.808  15.994  1.00 40.06 ? 196 TYR C CD1   1 
ATOM   1629 C  CD2   . TYR E 3 47 ? 28.640 16.413  17.193  1.00 39.64 ? 196 TYR C CD2   1 
ATOM   1630 C  CE1   . TYR E 3 47 ? 31.377 16.916  17.199  1.00 40.77 ? 196 TYR C CE1   1 
ATOM   1631 C  CE2   . TYR E 3 47 ? 29.331 16.518  18.408  1.00 40.80 ? 196 TYR C CE2   1 
ATOM   1632 C  CZ    . TYR E 3 47 ? 30.695 16.770  18.402  1.00 41.75 ? 196 TYR C CZ    1 
ATOM   1633 O  OH    . TYR E 3 47 ? 31.375 16.888  19.593  1.00 41.40 ? 196 TYR C OH    1 
ATOM   1634 N  N     . PHE E 3 48 ? 27.490 13.453  14.808  1.00 32.50 ? 197 PHE C N     1 
ATOM   1635 C  CA    . PHE E 3 48 ? 27.199 12.313  15.675  1.00 32.61 ? 197 PHE C CA    1 
ATOM   1636 C  C     . PHE E 3 48 ? 27.404 10.920  15.063  1.00 34.64 ? 197 PHE C C     1 
ATOM   1637 O  O     . PHE E 3 48 ? 27.285 9.908   15.765  1.00 34.42 ? 197 PHE C O     1 
ATOM   1638 C  CB    . PHE E 3 48 ? 25.762 12.424  16.211  1.00 29.05 ? 197 PHE C CB    1 
ATOM   1639 C  CG    . PHE E 3 48 ? 25.490 13.698  16.959  1.00 25.44 ? 197 PHE C CG    1 
ATOM   1640 C  CD1   . PHE E 3 48 ? 24.914 14.787  16.315  1.00 24.13 ? 197 PHE C CD1   1 
ATOM   1641 C  CD2   . PHE E 3 48 ? 25.854 13.826  18.302  1.00 24.37 ? 197 PHE C CD2   1 
ATOM   1642 C  CE1   . PHE E 3 48 ? 24.705 15.994  16.993  1.00 24.30 ? 197 PHE C CE1   1 
ATOM   1643 C  CE2   . PHE E 3 48 ? 25.652 15.022  18.990  1.00 21.91 ? 197 PHE C CE2   1 
ATOM   1644 C  CZ    . PHE E 3 48 ? 25.078 16.110  18.339  1.00 22.75 ? 197 PHE C CZ    1 
ATOM   1645 N  N     . LYS E 3 49 ? 27.723 10.865  13.772  1.00 36.79 ? 198 LYS C N     1 
ATOM   1646 C  CA    . LYS E 3 49 ? 27.905 9.586   13.084  1.00 38.65 ? 198 LYS C CA    1 
ATOM   1647 C  C     . LYS E 3 49 ? 28.832 8.622   13.797  1.00 40.22 ? 198 LYS C C     1 
ATOM   1648 O  O     . LYS E 3 49 ? 28.543 7.424   13.873  1.00 40.51 ? 198 LYS C O     1 
ATOM   1649 C  CB    . LYS E 3 49 ? 28.398 9.816   11.645  1.00 40.11 ? 198 LYS C CB    1 
ATOM   1650 N  N     . ASP E 3 50 ? 29.939 9.136   14.330  1.00 41.87 ? 199 ASP C N     1 
ATOM   1651 C  CA    . ASP E 3 50 ? 30.909 8.284   15.014  1.00 43.18 ? 199 ASP C CA    1 
ATOM   1652 C  C     . ASP E 3 50 ? 30.872 8.394   16.541  1.00 43.12 ? 199 ASP C C     1 
ATOM   1653 O  O     . ASP E 3 50 ? 31.829 8.020   17.229  1.00 42.33 ? 199 ASP C O     1 
ATOM   1654 C  CB    . ASP E 3 50 ? 32.325 8.590   14.495  1.00 45.98 ? 199 ASP C CB    1 
ATOM   1655 C  CG    . ASP E 3 50 ? 32.886 9.906   15.030  1.00 48.68 ? 199 ASP C CG    1 
ATOM   1656 O  OD1   . ASP E 3 50 ? 32.172 10.936  14.975  1.00 49.45 ? 199 ASP C OD1   1 
ATOM   1657 O  OD2   . ASP E 3 50 ? 34.054 9.907   15.497  1.00 49.84 ? 199 ASP C OD2   1 
ATOM   1658 N  N     . LYS E 3 51 ? 29.761 8.895   17.072  1.00 42.54 ? 200 LYS C N     1 
ATOM   1659 C  CA    . LYS E 3 51 ? 29.623 9.036   18.517  1.00 42.12 ? 200 LYS C CA    1 
ATOM   1660 C  C     . LYS E 3 51 ? 28.372 8.334   19.027  1.00 41.23 ? 200 LYS C C     1 
ATOM   1661 O  O     . LYS E 3 51 ? 27.697 8.824   19.919  1.00 40.34 ? 200 LYS C O     1 
ATOM   1662 C  CB    . LYS E 3 51 ? 29.602 10.519  18.882  1.00 41.91 ? 200 LYS C CB    1 
ATOM   1663 C  CG    . LYS E 3 51 ? 30.825 11.250  18.356  1.00 42.50 ? 200 LYS C CG    1 
ATOM   1664 C  CD    . LYS E 3 51 ? 30.780 12.735  18.646  1.00 42.98 ? 200 LYS C CD    1 
ATOM   1665 C  CE    . LYS E 3 51 ? 32.055 13.426  18.150  1.00 43.06 ? 200 LYS C CE    1 
ATOM   1666 N  NZ    . LYS E 3 51 ? 32.323 13.191  16.699  1.00 42.09 ? 200 LYS C NZ    1 
ATOM   1667 N  N     . GLY E 3 52 ? 28.076 7.175   18.449  1.00 42.57 ? 201 GLY C N     1 
ATOM   1668 C  CA    . GLY E 3 52 ? 26.905 6.417   18.853  1.00 44.07 ? 201 GLY C CA    1 
ATOM   1669 C  C     . GLY E 3 52 ? 27.215 5.388   19.921  1.00 45.49 ? 201 GLY C C     1 
ATOM   1670 O  O     . GLY E 3 52 ? 26.311 4.907   20.614  1.00 45.25 ? 201 GLY C O     1 
ATOM   1671 N  N     . ASP E 3 53 ? 28.497 5.052   20.060  1.00 46.37 ? 202 ASP C N     1 
ATOM   1672 C  CA    . ASP E 3 53 ? 28.929 4.071   21.050  1.00 47.89 ? 202 ASP C CA    1 
ATOM   1673 C  C     . ASP E 3 53 ? 28.769 4.584   22.481  1.00 47.28 ? 202 ASP C C     1 
ATOM   1674 O  O     . ASP E 3 53 ? 28.687 5.785   22.726  1.00 45.24 ? 202 ASP C O     1 
ATOM   1675 C  CB    . ASP E 3 53 ? 30.391 3.674   20.810  1.00 50.68 ? 202 ASP C CB    1 
ATOM   1676 C  CG    . ASP E 3 53 ? 31.328 4.872   20.813  1.00 53.34 ? 202 ASP C CG    1 
ATOM   1677 O  OD1   . ASP E 3 53 ? 31.290 5.661   19.838  1.00 54.99 ? 202 ASP C OD1   1 
ATOM   1678 O  OD2   . ASP E 3 53 ? 32.091 5.029   21.795  1.00 54.52 ? 202 ASP C OD2   1 
ATOM   1679 N  N     . SER E 3 54 ? 28.735 3.648   23.420  1.00 47.74 ? 203 SER C N     1 
ATOM   1680 C  CA    . SER E 3 54 ? 28.575 3.959   24.830  1.00 48.77 ? 203 SER C CA    1 
ATOM   1681 C  C     . SER E 3 54 ? 29.652 4.915   25.355  1.00 48.51 ? 203 SER C C     1 
ATOM   1682 O  O     . SER E 3 54 ? 29.363 5.818   26.142  1.00 48.88 ? 203 SER C O     1 
ATOM   1683 C  CB    . SER E 3 54 ? 28.588 2.658   25.634  1.00 49.12 ? 203 SER C CB    1 
ATOM   1684 O  OG    . SER E 3 54 ? 28.285 2.898   26.995  1.00 52.74 ? 203 SER C OG    1 
ATOM   1685 N  N     . ASN E 3 55 ? 30.884 4.722   24.896  1.00 48.17 ? 204 ASN C N     1 
ATOM   1686 C  CA    . ASN E 3 55 ? 32.019 5.532   25.324  1.00 46.92 ? 204 ASN C CA    1 
ATOM   1687 C  C     . ASN E 3 55 ? 31.953 7.015   24.977  1.00 46.30 ? 204 ASN C C     1 
ATOM   1688 O  O     . ASN E 3 55 ? 32.681 7.817   25.570  1.00 46.90 ? 204 ASN C O     1 
ATOM   1689 C  CB    . ASN E 3 55 ? 33.313 4.941   24.769  1.00 47.19 ? 204 ASN C CB    1 
ATOM   1690 N  N     . SER E 3 56 ? 31.105 7.403   24.030  1.00 43.60 ? 205 SER C N     1 
ATOM   1691 C  CA    . SER E 3 56 ? 31.048 8.818   23.676  1.00 41.56 ? 205 SER C CA    1 
ATOM   1692 C  C     . SER E 3 56 ? 29.648 9.414   23.545  1.00 39.24 ? 205 SER C C     1 
ATOM   1693 O  O     . SER E 3 56 ? 29.495 10.617  23.349  1.00 38.75 ? 205 SER C O     1 
ATOM   1694 C  CB    . SER E 3 56 ? 31.839 9.052   22.382  1.00 42.63 ? 205 SER C CB    1 
ATOM   1695 O  OG    . SER E 3 56 ? 31.514 8.083   21.398  1.00 43.32 ? 205 SER C OG    1 
ATOM   1696 N  N     . SER E 3 57 ? 28.631 8.577   23.687  1.00 36.89 ? 206 SER C N     1 
ATOM   1697 C  CA    . SER E 3 57 ? 27.250 9.033   23.552  1.00 34.74 ? 206 SER C CA    1 
ATOM   1698 C  C     . SER E 3 57 ? 26.577 9.511   24.840  1.00 32.55 ? 206 SER C C     1 
ATOM   1699 O  O     . SER E 3 57 ? 25.503 10.108  24.794  1.00 32.00 ? 206 SER C O     1 
ATOM   1700 C  CB    . SER E 3 57 ? 26.404 7.911   22.952  1.00 34.43 ? 206 SER C CB    1 
ATOM   1701 O  OG    . SER E 3 57 ? 26.267 6.847   23.873  1.00 33.54 ? 206 SER C OG    1 
ATOM   1702 N  N     . ALA E 3 58 ? 27.197 9.255   25.982  1.00 30.19 ? 207 ALA C N     1 
ATOM   1703 C  CA    . ALA E 3 58 ? 26.594 9.633   27.251  1.00 28.87 ? 207 ALA C CA    1 
ATOM   1704 C  C     . ALA E 3 58 ? 26.155 11.090  27.323  1.00 27.29 ? 207 ALA C C     1 
ATOM   1705 O  O     . ALA E 3 58 ? 25.010 11.385  27.642  1.00 26.34 ? 207 ALA C O     1 
ATOM   1706 C  CB    . ALA E 3 58 ? 27.551 9.321   28.397  1.00 28.57 ? 207 ALA C CB    1 
ATOM   1707 N  N     . GLY E 3 59 ? 27.072 12.002  27.027  1.00 25.64 ? 208 GLY C N     1 
ATOM   1708 C  CA    . GLY E 3 59 ? 26.755 13.419  27.102  1.00 23.54 ? 208 GLY C CA    1 
ATOM   1709 C  C     . GLY E 3 59 ? 25.612 13.918  26.231  1.00 21.49 ? 208 GLY C C     1 
ATOM   1710 O  O     . GLY E 3 59 ? 24.707 14.583  26.746  1.00 20.42 ? 208 GLY C O     1 
ATOM   1711 N  N     . TRP E 3 60 ? 25.631 13.606  24.933  1.00 18.54 ? 209 TRP C N     1 
ATOM   1712 C  CA    . TRP E 3 60 ? 24.572 14.102  24.059  1.00 18.42 ? 209 TRP C CA    1 
ATOM   1713 C  C     . TRP E 3 60 ? 23.226 13.425  24.269  1.00 16.82 ? 209 TRP C C     1 
ATOM   1714 O  O     . TRP E 3 60 ? 22.198 14.082  24.174  1.00 16.70 ? 209 TRP C O     1 
ATOM   1715 C  CB    . TRP E 3 60 ? 24.977 14.057  22.571  1.00 17.41 ? 209 TRP C CB    1 
ATOM   1716 C  CG    . TRP E 3 60 ? 25.159 12.721  21.940  1.00 17.74 ? 209 TRP C CG    1 
ATOM   1717 C  CD1   . TRP E 3 60 ? 26.346 12.067  21.734  1.00 20.03 ? 209 TRP C CD1   1 
ATOM   1718 C  CD2   . TRP E 3 60 ? 24.147 11.923  21.300  1.00 19.64 ? 209 TRP C CD2   1 
ATOM   1719 N  NE1   . TRP E 3 60 ? 26.140 10.924  20.998  1.00 19.11 ? 209 TRP C NE1   1 
ATOM   1720 C  CE2   . TRP E 3 60 ? 24.802 10.806  20.720  1.00 18.72 ? 209 TRP C CE2   1 
ATOM   1721 C  CE3   . TRP E 3 60 ? 22.752 12.047  21.155  1.00 17.26 ? 209 TRP C CE3   1 
ATOM   1722 C  CZ2   . TRP E 3 60 ? 24.111 9.811   20.013  1.00 18.51 ? 209 TRP C CZ2   1 
ATOM   1723 C  CZ3   . TRP E 3 60 ? 22.061 11.060  20.449  1.00 17.15 ? 209 TRP C CZ3   1 
ATOM   1724 C  CH2   . TRP E 3 60 ? 22.744 9.950   19.888  1.00 18.16 ? 209 TRP C CH2   1 
ATOM   1725 N  N     . LYS E 3 61 ? 23.231 12.129  24.568  1.00 15.96 ? 210 LYS C N     1 
ATOM   1726 C  CA    . LYS E 3 61 ? 21.989 11.422  24.826  1.00 17.35 ? 210 LYS C CA    1 
ATOM   1727 C  C     . LYS E 3 61 ? 21.344 12.059  26.065  1.00 18.01 ? 210 LYS C C     1 
ATOM   1728 O  O     . LYS E 3 61 ? 20.144 12.331  26.076  1.00 16.44 ? 210 LYS C O     1 
ATOM   1729 C  CB    . LYS E 3 61 ? 22.252 9.930   25.027  1.00 17.28 ? 210 LYS C CB    1 
ATOM   1730 C  CG    . LYS E 3 61 ? 22.588 9.198   23.708  1.00 17.30 ? 210 LYS C CG    1 
ATOM   1731 C  CD    . LYS E 3 61 ? 22.939 7.735   23.963  1.00 18.39 ? 210 LYS C CD    1 
ATOM   1732 C  CE    . LYS E 3 61 ? 22.934 6.902   22.662  1.00 19.17 ? 210 LYS C CE    1 
ATOM   1733 N  NZ    . LYS E 3 61 ? 23.286 5.456   22.924  1.00 18.45 ? 210 LYS C NZ    1 
ATOM   1734 N  N     . ASN E 3 62 ? 22.147 12.336  27.090  1.00 18.47 ? 211 ASN C N     1 
ATOM   1735 C  CA    . ASN E 3 62 ? 21.622 12.986  28.300  1.00 19.96 ? 211 ASN C CA    1 
ATOM   1736 C  C     . ASN E 3 62 ? 20.914 14.308  27.921  1.00 18.79 ? 211 ASN C C     1 
ATOM   1737 O  O     . ASN E 3 62 ? 19.831 14.606  28.424  1.00 18.51 ? 211 ASN C O     1 
ATOM   1738 C  CB    . ASN E 3 62 ? 22.767 13.240  29.302  1.00 19.32 ? 211 ASN C CB    1 
ATOM   1739 C  CG    . ASN E 3 62 ? 22.343 14.095  30.494  1.00 24.23 ? 211 ASN C CG    1 
ATOM   1740 O  OD1   . ASN E 3 62 ? 21.362 13.800  31.200  1.00 23.59 ? 211 ASN C OD1   1 
ATOM   1741 N  ND2   . ASN E 3 62 ? 23.101 15.159  30.740  1.00 26.79 ? 211 ASN C ND2   1 
ATOM   1742 N  N     . SER E 3 63 ? 21.516 15.096  27.029  1.00 17.64 ? 212 SER C N     1 
ATOM   1743 C  CA    . SER E 3 63 ? 20.893 16.349  26.613  1.00 16.07 ? 212 SER C CA    1 
ATOM   1744 C  C     . SER E 3 63 ? 19.606 16.131  25.813  1.00 15.48 ? 212 SER C C     1 
ATOM   1745 O  O     . SER E 3 63 ? 18.701 16.976  25.848  1.00 16.12 ? 212 SER C O     1 
ATOM   1746 C  CB    . SER E 3 63 ? 21.868 17.195  25.781  1.00 20.10 ? 212 SER C CB    1 
ATOM   1747 O  OG    . SER E 3 63 ? 22.728 17.948  26.621  1.00 20.44 ? 212 SER C OG    1 
ATOM   1748 N  N     . ILE E 3 64 ? 19.531 15.027  25.068  1.00 14.80 ? 213 ILE C N     1 
ATOM   1749 C  CA    . ILE E 3 64 ? 18.316 14.712  24.304  1.00 14.30 ? 213 ILE C CA    1 
ATOM   1750 C  C     . ILE E 3 64 ? 17.188 14.443  25.326  1.00 14.05 ? 213 ILE C C     1 
ATOM   1751 O  O     . ILE E 3 64 ? 16.105 15.037  25.235  1.00 12.56 ? 213 ILE C O     1 
ATOM   1752 C  CB    . ILE E 3 64 ? 18.491 13.456  23.416  1.00 14.54 ? 213 ILE C CB    1 
ATOM   1753 C  CG1   . ILE E 3 64 ? 19.399 13.761  22.216  1.00 14.03 ? 213 ILE C CG1   1 
ATOM   1754 C  CG2   . ILE E 3 64 ? 17.129 12.946  22.950  1.00 12.72 ? 213 ILE C CG2   1 
ATOM   1755 C  CD1   . ILE E 3 64 ? 18.927 14.904  21.333  1.00 16.14 ? 213 ILE C CD1   1 
ATOM   1756 N  N     . ARG E 3 65 ? 17.453 13.573  26.305  1.00 14.25 ? 214 ARG C N     1 
ATOM   1757 C  CA    . ARG E 3 65 ? 16.450 13.269  27.343  1.00 15.41 ? 214 ARG C CA    1 
ATOM   1758 C  C     . ARG E 3 65 ? 16.061 14.555  28.070  1.00 14.64 ? 214 ARG C C     1 
ATOM   1759 O  O     . ARG E 3 65 ? 14.882 14.806  28.324  1.00 13.04 ? 214 ARG C O     1 
ATOM   1760 C  CB    . ARG E 3 65 ? 16.979 12.230  28.351  1.00 13.29 ? 214 ARG C CB    1 
ATOM   1761 C  CG    . ARG E 3 65 ? 17.260 10.873  27.711  1.00 14.33 ? 214 ARG C CG    1 
ATOM   1762 C  CD    . ARG E 3 65 ? 17.530 9.768   28.753  1.00 14.53 ? 214 ARG C CD    1 
ATOM   1763 N  NE    . ARG E 3 65 ? 18.693 10.042  29.592  1.00 14.63 ? 214 ARG C NE    1 
ATOM   1764 C  CZ    . ARG E 3 65 ? 19.962 9.876   29.215  1.00 16.12 ? 214 ARG C CZ    1 
ATOM   1765 N  NH1   . ARG E 3 65 ? 20.276 9.430   27.990  1.00 12.86 ? 214 ARG C NH1   1 
ATOM   1766 N  NH2   . ARG E 3 65 ? 20.929 10.130  30.085  1.00 16.52 ? 214 ARG C NH2   1 
ATOM   1767 N  N     . HIS E 3 66 ? 17.063 15.386  28.358  1.00 16.80 ? 215 HIS C N     1 
ATOM   1768 C  CA    . HIS E 3 66 ? 16.865 16.673  29.041  1.00 15.67 ? 215 HIS C CA    1 
ATOM   1769 C  C     . HIS E 3 66 ? 15.905 17.592  28.274  1.00 16.79 ? 215 HIS C C     1 
ATOM   1770 O  O     . HIS E 3 66 ? 14.956 18.166  28.838  1.00 16.59 ? 215 HIS C O     1 
ATOM   1771 C  CB    . HIS E 3 66 ? 18.220 17.370  29.180  1.00 15.88 ? 215 HIS C CB    1 
ATOM   1772 C  CG    . HIS E 3 66 ? 18.142 18.793  29.649  1.00 16.22 ? 215 HIS C CG    1 
ATOM   1773 N  ND1   . HIS E 3 66 ? 17.785 19.138  30.936  1.00 16.45 ? 215 HIS C ND1   1 
ATOM   1774 C  CD2   . HIS E 3 66 ? 18.455 19.954  29.021  1.00 14.25 ? 215 HIS C CD2   1 
ATOM   1775 C  CE1   . HIS E 3 66 ? 17.890 20.451  31.083  1.00 16.19 ? 215 HIS C CE1   1 
ATOM   1776 N  NE2   . HIS E 3 66 ? 18.298 20.969  29.936  1.00 15.55 ? 215 HIS C NE2   1 
ATOM   1777 N  N     . ASN E 3 67 ? 16.183 17.759  26.989  1.00 14.34 ? 216 ASN C N     1 
ATOM   1778 C  CA    . ASN E 3 67 ? 15.367 18.608  26.153  1.00 14.33 ? 216 ASN C CA    1 
ATOM   1779 C  C     . ASN E 3 67 ? 13.949 18.038  26.032  1.00 14.90 ? 216 ASN C C     1 
ATOM   1780 O  O     . ASN E 3 67 ? 12.967 18.775  26.170  1.00 15.04 ? 216 ASN C O     1 
ATOM   1781 C  CB    . ASN E 3 67 ? 16.012 18.748  24.770  1.00 12.92 ? 216 ASN C CB    1 
ATOM   1782 C  CG    . ASN E 3 67 ? 17.018 19.887  24.708  1.00 14.72 ? 216 ASN C CG    1 
ATOM   1783 O  OD1   . ASN E 3 67 ? 16.668 21.015  24.348  1.00 13.38 ? 216 ASN C OD1   1 
ATOM   1784 N  ND2   . ASN E 3 67 ? 18.268 19.604  25.080  1.00 14.69 ? 216 ASN C ND2   1 
ATOM   1785 N  N     . LEU E 3 68 ? 13.847 16.736  25.781  1.00 11.99 ? 217 LEU C N     1 
ATOM   1786 C  CA    . LEU E 3 68 ? 12.537 16.119  25.655  1.00 15.10 ? 217 LEU C CA    1 
ATOM   1787 C  C     . LEU E 3 68 ? 11.664 16.422  26.881  1.00 16.18 ? 217 LEU C C     1 
ATOM   1788 O  O     . LEU E 3 68 ? 10.528 16.842  26.717  1.00 14.73 ? 217 LEU C O     1 
ATOM   1789 C  CB    . LEU E 3 68 ? 12.655 14.595  25.458  1.00 13.04 ? 217 LEU C CB    1 
ATOM   1790 C  CG    . LEU E 3 68 ? 13.024 14.114  24.039  1.00 12.56 ? 217 LEU C CG    1 
ATOM   1791 C  CD1   . LEU E 3 68 ? 13.177 12.610  24.020  1.00 11.29 ? 217 LEU C CD1   1 
ATOM   1792 C  CD2   . LEU E 3 68 ? 11.956 14.544  23.048  1.00 11.26 ? 217 LEU C CD2   1 
ATOM   1793 N  N     . SER E 3 69 ? 12.195 16.232  28.094  1.00 16.36 ? 218 SER C N     1 
ATOM   1794 C  CA    . SER E 3 69 ? 11.403 16.490  29.295  1.00 19.96 ? 218 SER C CA    1 
ATOM   1795 C  C     . SER E 3 69 ? 11.167 17.945  29.608  1.00 19.43 ? 218 SER C C     1 
ATOM   1796 O  O     . SER E 3 69 ? 10.064 18.321  29.977  1.00 20.59 ? 218 SER C O     1 
ATOM   1797 C  CB    . SER E 3 69 ? 12.032 15.850  30.542  1.00 21.62 ? 218 SER C CB    1 
ATOM   1798 O  OG    . SER E 3 69 ? 11.948 14.440  30.502  1.00 27.01 ? 218 SER C OG    1 
ATOM   1799 N  N     . LEU E 3 70 ? 12.197 18.765  29.456  1.00 20.83 ? 219 LEU C N     1 
ATOM   1800 C  CA    . LEU E 3 70 ? 12.098 20.180  29.786  1.00 23.58 ? 219 LEU C CA    1 
ATOM   1801 C  C     . LEU E 3 70 ? 11.196 21.064  28.934  1.00 23.70 ? 219 LEU C C     1 
ATOM   1802 O  O     . LEU E 3 70 ? 10.461 21.888  29.474  1.00 23.42 ? 219 LEU C O     1 
ATOM   1803 C  CB    . LEU E 3 70 ? 13.501 20.807  29.816  1.00 25.50 ? 219 LEU C CB    1 
ATOM   1804 C  CG    . LEU E 3 70 ? 13.632 22.228  30.373  1.00 28.06 ? 219 LEU C CG    1 
ATOM   1805 C  CD1   . LEU E 3 70 ? 13.360 22.189  31.874  1.00 26.90 ? 219 LEU C CD1   1 
ATOM   1806 C  CD2   . LEU E 3 70 ? 15.045 22.785  30.108  1.00 28.91 ? 219 LEU C CD2   1 
ATOM   1807 N  N     . HIS E 3 71 ? 11.241 20.913  27.616  1.00 23.58 ? 220 HIS C N     1 
ATOM   1808 C  CA    . HIS E 3 71 ? 10.456 21.797  26.761  1.00 24.12 ? 220 HIS C CA    1 
ATOM   1809 C  C     . HIS E 3 71 ? 9.050  21.324  26.445  1.00 24.87 ? 220 HIS C C     1 
ATOM   1810 O  O     . HIS E 3 71 ? 8.842  20.174  26.045  1.00 23.66 ? 220 HIS C O     1 
ATOM   1811 C  CB    . HIS E 3 71 ? 11.205 22.071  25.454  1.00 25.77 ? 220 HIS C CB    1 
ATOM   1812 C  CG    . HIS E 3 71 ? 12.646 22.421  25.649  1.00 28.52 ? 220 HIS C CG    1 
ATOM   1813 N  ND1   . HIS E 3 71 ? 13.065 23.409  26.518  1.00 30.18 ? 220 HIS C ND1   1 
ATOM   1814 C  CD2   . HIS E 3 71 ? 13.771 21.896  25.106  1.00 29.04 ? 220 HIS C CD2   1 
ATOM   1815 C  CE1   . HIS E 3 71 ? 14.386 23.472  26.503  1.00 30.22 ? 220 HIS C CE1   1 
ATOM   1816 N  NE2   . HIS E 3 71 ? 14.839 22.563  25.654  1.00 27.86 ? 220 HIS C NE2   1 
ATOM   1817 N  N     . SER E 3 72 ? 8.092  22.240  26.601  1.00 24.64 ? 221 SER C N     1 
ATOM   1818 C  CA    . SER E 3 72 ? 6.685  21.962  26.347  1.00 25.08 ? 221 SER C CA    1 
ATOM   1819 C  C     . SER E 3 72 ? 6.431  21.722  24.859  1.00 25.11 ? 221 SER C C     1 
ATOM   1820 O  O     . SER E 3 72 ? 5.357  21.273  24.468  1.00 25.70 ? 221 SER C O     1 
ATOM   1821 C  CB    . SER E 3 72 ? 5.825  23.120  26.855  1.00 24.04 ? 221 SER C CB    1 
ATOM   1822 O  OG    . SER E 3 72 ? 6.167  24.312  26.185  1.00 25.05 ? 221 SER C OG    1 
ATOM   1823 N  N     . LYS E 3 73 ? 7.426  22.021  24.031  1.00 25.00 ? 222 LYS C N     1 
ATOM   1824 C  CA    . LYS E 3 73 ? 7.320  21.788  22.589  1.00 25.14 ? 222 LYS C CA    1 
ATOM   1825 C  C     . LYS E 3 73 ? 7.182  20.277  22.316  1.00 23.95 ? 222 LYS C C     1 
ATOM   1826 O  O     . LYS E 3 73 ? 6.655  19.858  21.290  1.00 24.22 ? 222 LYS C O     1 
ATOM   1827 C  CB    . LYS E 3 73 ? 8.569  22.325  21.892  1.00 27.80 ? 222 LYS C CB    1 
ATOM   1828 C  CG    . LYS E 3 73 ? 8.637  22.011  20.425  1.00 32.16 ? 222 LYS C CG    1 
ATOM   1829 C  CD    . LYS E 3 73 ? 9.878  22.634  19.779  1.00 35.17 ? 222 LYS C CD    1 
ATOM   1830 C  CE    . LYS E 3 73 ? 9.917  22.329  18.282  1.00 35.57 ? 222 LYS C CE    1 
ATOM   1831 N  NZ    . LYS E 3 73 ? 11.086 22.960  17.642  1.00 38.09 ? 222 LYS C NZ    1 
ATOM   1832 N  N     . PHE E 3 74 ? 7.654  19.460  23.248  1.00 21.21 ? 223 PHE C N     1 
ATOM   1833 C  CA    . PHE E 3 74 ? 7.571  18.017  23.094  1.00 20.19 ? 223 PHE C CA    1 
ATOM   1834 C  C     . PHE E 3 74 ? 6.583  17.417  24.084  1.00 20.56 ? 223 PHE C C     1 
ATOM   1835 O  O     . PHE E 3 74 ? 6.503  17.865  25.230  1.00 19.94 ? 223 PHE C O     1 
ATOM   1836 C  CB    . PHE E 3 74 ? 8.942  17.395  23.336  1.00 17.36 ? 223 PHE C CB    1 
ATOM   1837 C  CG    . PHE E 3 74 ? 10.026 18.012  22.515  1.00 19.28 ? 223 PHE C CG    1 
ATOM   1838 C  CD1   . PHE E 3 74 ? 10.023 17.889  21.125  1.00 18.48 ? 223 PHE C CD1   1 
ATOM   1839 C  CD2   . PHE E 3 74 ? 11.042 18.740  23.119  1.00 17.70 ? 223 PHE C CD2   1 
ATOM   1840 C  CE1   . PHE E 3 74 ? 11.021 18.487  20.351  1.00 20.13 ? 223 PHE C CE1   1 
ATOM   1841 C  CE2   . PHE E 3 74 ? 12.044 19.343  22.350  1.00 16.58 ? 223 PHE C CE2   1 
ATOM   1842 C  CZ    . PHE E 3 74 ? 12.032 19.215  20.968  1.00 15.27 ? 223 PHE C CZ    1 
ATOM   1843 N  N     . ILE E 3 75 ? 5.816  16.423  23.653  1.00 19.24 ? 224 ILE C N     1 
ATOM   1844 C  CA    . ILE E 3 75 ? 4.913  15.769  24.588  1.00 21.44 ? 224 ILE C CA    1 
ATOM   1845 C  C     . ILE E 3 75 ? 5.135  14.271  24.539  1.00 21.09 ? 224 ILE C C     1 
ATOM   1846 O  O     . ILE E 3 75 ? 5.514  13.704  23.511  1.00 18.54 ? 224 ILE C O     1 
ATOM   1847 C  CB    . ILE E 3 75 ? 3.425  16.087  24.335  1.00 22.60 ? 224 ILE C CB    1 
ATOM   1848 C  CG1   . ILE E 3 75 ? 2.964  15.491  23.021  1.00 24.66 ? 224 ILE C CG1   1 
ATOM   1849 C  CG2   . ILE E 3 75 ? 3.224  17.597  24.338  1.00 24.16 ? 224 ILE C CG2   1 
ATOM   1850 C  CD1   . ILE E 3 75 ? 1.453  15.509  22.877  1.00 27.69 ? 224 ILE C CD1   1 
ATOM   1851 N  N     . ARG E 3 76 ? 4.911  13.645  25.679  1.00 20.77 ? 225 ARG C N     1 
ATOM   1852 C  CA    . ARG E 3 76 ? 5.095  12.221  25.846  1.00 21.90 ? 225 ARG C CA    1 
ATOM   1853 C  C     . ARG E 3 76 ? 3.742  11.498  25.760  1.00 21.85 ? 225 ARG C C     1 
ATOM   1854 O  O     . ARG E 3 76 ? 2.762  11.958  26.336  1.00 19.53 ? 225 ARG C O     1 
ATOM   1855 C  CB    . ARG E 3 76 ? 5.729  11.996  27.222  1.00 24.09 ? 225 ARG C CB    1 
ATOM   1856 C  CG    . ARG E 3 76 ? 6.395  10.677  27.413  1.00 26.56 ? 225 ARG C CG    1 
ATOM   1857 C  CD    . ARG E 3 76 ? 7.163  10.700  28.724  1.00 31.51 ? 225 ARG C CD    1 
ATOM   1858 N  NE    . ARG E 3 76 ? 6.267  10.803  29.866  1.00 33.76 ? 225 ARG C NE    1 
ATOM   1859 C  CZ    . ARG E 3 76 ? 5.544  9.790   30.330  1.00 37.85 ? 225 ARG C CZ    1 
ATOM   1860 N  NH1   . ARG E 3 76 ? 5.615  8.596   29.748  1.00 37.42 ? 225 ARG C NH1   1 
ATOM   1861 N  NH2   . ARG E 3 76 ? 4.742  9.969   31.373  1.00 39.44 ? 225 ARG C NH2   1 
ATOM   1862 N  N     . VAL E 3 77 ? 3.699  10.381  25.035  1.00 20.08 ? 226 VAL C N     1 
ATOM   1863 C  CA    . VAL E 3 77 ? 2.478  9.599   24.905  1.00 20.17 ? 226 VAL C CA    1 
ATOM   1864 C  C     . VAL E 3 77 ? 2.734  8.146   25.295  1.00 21.80 ? 226 VAL C C     1 
ATOM   1865 O  O     . VAL E 3 77 ? 3.662  7.505   24.789  1.00 19.16 ? 226 VAL C O     1 
ATOM   1866 C  CB    . VAL E 3 77 ? 1.913  9.615   23.454  1.00 20.17 ? 226 VAL C CB    1 
ATOM   1867 C  CG1   . VAL E 3 77 ? 0.674  8.727   23.368  1.00 17.66 ? 226 VAL C CG1   1 
ATOM   1868 C  CG2   . VAL E 3 77 ? 1.559  11.022  23.048  1.00 21.07 ? 226 VAL C CG2   1 
ATOM   1869 N  N     . GLN E 3 78 ? 1.895  7.645   26.200  1.00 25.27 ? 227 GLN C N     1 
ATOM   1870 C  CA    . GLN E 3 78 ? 1.958  6.269   26.702  1.00 29.57 ? 227 GLN C CA    1 
ATOM   1871 C  C     . GLN E 3 78 ? 1.986  5.297   25.547  1.00 28.72 ? 227 GLN C C     1 
ATOM   1872 O  O     . GLN E 3 78 ? 1.157  5.392   24.649  1.00 29.03 ? 227 GLN C O     1 
ATOM   1873 C  CB    . GLN E 3 78 ? 0.743  5.985   27.588  1.00 33.31 ? 227 GLN C CB    1 
ATOM   1874 C  CG    . GLN E 3 78 ? 0.603  4.525   27.990  1.00 38.04 ? 227 GLN C CG    1 
ATOM   1875 C  CD    . GLN E 3 78 ? 1.830  4.002   28.715  1.00 38.79 ? 227 GLN C CD    1 
ATOM   1876 O  OE1   . GLN E 3 78 ? 2.251  4.563   29.736  1.00 39.66 ? 227 GLN C OE1   1 
ATOM   1877 N  NE2   . GLN E 3 78 ? 2.414  2.922   28.189  1.00 39.96 ? 227 GLN C NE2   1 
ATOM   1878 N  N     . ASN E 3 79 ? 2.942  4.363   25.579  1.00 30.43 ? 228 ASN C N     1 
ATOM   1879 C  CA    . ASN E 3 79 ? 3.133  3.390   24.503  1.00 31.48 ? 228 ASN C CA    1 
ATOM   1880 C  C     . ASN E 3 79 ? 2.317  2.136   24.663  1.00 35.13 ? 228 ASN C C     1 
ATOM   1881 O  O     . ASN E 3 79 ? 1.860  1.791   25.769  1.00 34.22 ? 228 ASN C O     1 
ATOM   1882 C  CB    . ASN E 3 79 ? 4.604  2.974   24.376  1.00 30.88 ? 228 ASN C CB    1 
ATOM   1883 C  CG    . ASN E 3 79 ? 4.947  2.373   22.989  1.00 33.73 ? 228 ASN C CG    1 
ATOM   1884 O  OD1   . ASN E 3 79 ? 4.269  1.465   22.492  1.00 25.42 ? 228 ASN C OD1   1 
ATOM   1885 N  ND2   . ASN E 3 79 ? 6.034  2.887   22.369  1.00 33.11 ? 228 ASN C ND2   1 
ATOM   1886 N  N     . GLU E 3 80 ? 2.188  1.457   23.528  1.00 36.16 ? 229 GLU C N     1 
ATOM   1887 C  CA    . GLU E 3 80 ? 1.440  0.227   23.387  1.00 41.06 ? 229 GLU C CA    1 
ATOM   1888 C  C     . GLU E 3 80 ? 2.260  -0.988  23.742  1.00 42.16 ? 229 GLU C C     1 
ATOM   1889 O  O     . GLU E 3 80 ? 3.329  -1.244  23.167  1.00 42.68 ? 229 GLU C O     1 
ATOM   1890 C  CB    . GLU E 3 80 ? 0.940  0.054   21.938  1.00 42.10 ? 229 GLU C CB    1 
ATOM   1891 C  CG    . GLU E 3 80 ? 2.004  -0.355  20.916  1.00 44.21 ? 229 GLU C CG    1 
ATOM   1892 C  CD    . GLU E 3 80 ? 2.398  0.792   20.006  1.00 46.23 ? 229 GLU C CD    1 
ATOM   1893 O  OE1   . GLU E 3 80 ? 3.203  0.557   19.067  1.00 46.41 ? 229 GLU C OE1   1 
ATOM   1894 O  OE2   . GLU E 3 80 ? 1.900  1.924   20.235  1.00 46.64 ? 229 GLU C OE2   1 
ATOM   1895 N  N     . GLY E 3 81 ? 1.760  -1.754  24.690  1.00 41.75 ? 230 GLY C N     1 
ATOM   1896 C  CA    . GLY E 3 81 ? 2.503  -2.934  25.033  1.00 41.30 ? 230 GLY C CA    1 
ATOM   1897 C  C     . GLY E 3 81 ? 3.518  -2.799  26.133  1.00 39.77 ? 230 GLY C C     1 
ATOM   1898 O  O     . GLY E 3 81 ? 4.068  -1.736  26.442  1.00 39.01 ? 230 GLY C O     1 
ATOM   1899 N  N     . THR E 3 82 ? 3.752  -3.965  26.701  1.00 37.85 ? 231 THR C N     1 
ATOM   1900 C  CA    . THR E 3 82 ? 4.633  -4.181  27.800  1.00 35.49 ? 231 THR C CA    1 
ATOM   1901 C  C     . THR E 3 82 ? 6.067  -3.790  27.548  1.00 32.48 ? 231 THR C C     1 
ATOM   1902 O  O     . THR E 3 82 ? 6.647  -4.127  26.524  1.00 30.99 ? 231 THR C O     1 
ATOM   1903 C  CB    . THR E 3 82 ? 4.559  -5.649  28.161  1.00 37.91 ? 231 THR C CB    1 
ATOM   1904 O  OG1   . THR E 3 82 ? 3.230  -6.114  27.863  1.00 38.85 ? 231 THR C OG1   1 
ATOM   1905 C  CG2   . THR E 3 82 ? 4.871  -5.853  29.643  1.00 37.15 ? 231 THR C CG2   1 
ATOM   1906 N  N     . GLY E 3 83 ? 6.621  -3.061  28.503  1.00 30.65 ? 232 GLY C N     1 
ATOM   1907 C  CA    . GLY E 3 83 ? 8.005  -2.649  28.430  1.00 29.15 ? 232 GLY C CA    1 
ATOM   1908 C  C     . GLY E 3 83 ? 8.433  -1.633  27.392  1.00 28.15 ? 232 GLY C C     1 
ATOM   1909 O  O     . GLY E 3 83 ? 9.596  -1.232  27.415  1.00 30.07 ? 232 GLY C O     1 
ATOM   1910 N  N     . LYS E 3 84 ? 7.549  -1.215  26.489  1.00 24.75 ? 233 LYS C N     1 
ATOM   1911 C  CA    . LYS E 3 84 ? 7.952  -0.235  25.487  1.00 23.11 ? 233 LYS C CA    1 
ATOM   1912 C  C     . LYS E 3 84 ? 7.902  1.171   26.058  1.00 19.94 ? 233 LYS C C     1 
ATOM   1913 O  O     . LYS E 3 84 ? 7.004  1.513   26.820  1.00 19.01 ? 233 LYS C O     1 
ATOM   1914 C  CB    . LYS E 3 84 ? 7.077  -0.345  24.224  1.00 26.50 ? 233 LYS C CB    1 
ATOM   1915 C  CG    . LYS E 3 84 ? 7.306  -1.657  23.436  1.00 29.68 ? 233 LYS C CG    1 
ATOM   1916 C  CD    . LYS E 3 84 ? 6.417  -1.778  22.204  1.00 33.65 ? 233 LYS C CD    1 
ATOM   1917 C  CE    . LYS E 3 84 ? 6.523  -3.183  21.560  1.00 37.38 ? 233 LYS C CE    1 
ATOM   1918 N  NZ    . LYS E 3 84 ? 6.067  -4.310  22.470  1.00 38.39 ? 233 LYS C NZ    1 
ATOM   1919 N  N     . SER E 3 85 ? 8.875  1.995   25.678  1.00 17.99 ? 234 SER C N     1 
ATOM   1920 C  CA    . SER E 3 85 ? 8.937  3.349   26.181  1.00 15.57 ? 234 SER C CA    1 
ATOM   1921 C  C     . SER E 3 85 ? 8.000  4.293   25.441  1.00 16.53 ? 234 SER C C     1 
ATOM   1922 O  O     . SER E 3 85 ? 7.379  3.926   24.428  1.00 17.15 ? 234 SER C O     1 
ATOM   1923 C  CB    . SER E 3 85 ? 10.375 3.850   26.128  1.00 15.79 ? 234 SER C CB    1 
ATOM   1924 O  OG    . SER E 3 85 ? 10.832 3.886   24.795  1.00 17.39 ? 234 SER C OG    1 
ATOM   1925 N  N     . SER E 3 86 ? 7.905  5.519   25.932  1.00 13.83 ? 235 SER C N     1 
ATOM   1926 C  CA    . SER E 3 86 ? 6.979  6.474   25.351  1.00 14.99 ? 235 SER C CA    1 
ATOM   1927 C  C     . SER E 3 86 ? 7.186  6.865   23.898  1.00 14.24 ? 235 SER C C     1 
ATOM   1928 O  O     . SER E 3 86 ? 8.246  6.672   23.324  1.00 14.83 ? 235 SER C O     1 
ATOM   1929 C  CB    . SER E 3 86 ? 6.965  7.753   26.181  1.00 14.33 ? 235 SER C CB    1 
ATOM   1930 O  OG    . SER E 3 86 ? 6.744  7.480   27.550  1.00 19.21 ? 235 SER C OG    1 
ATOM   1931 N  N     . TRP E 3 87 ? 6.130  7.410   23.315  1.00 12.81 ? 236 TRP C N     1 
ATOM   1932 C  CA    . TRP E 3 87 ? 6.184  7.932   21.970  1.00 14.57 ? 236 TRP C CA    1 
ATOM   1933 C  C     . TRP E 3 87 ? 6.430  9.404   22.257  1.00 15.57 ? 236 TRP C C     1 
ATOM   1934 O  O     . TRP E 3 87 ? 5.771  9.970   23.127  1.00 16.72 ? 236 TRP C O     1 
ATOM   1935 C  CB    . TRP E 3 87 ? 4.834  7.815   21.261  1.00 14.64 ? 236 TRP C CB    1 
ATOM   1936 C  CG    . TRP E 3 87 ? 4.526  6.480   20.684  1.00 15.32 ? 236 TRP C CG    1 
ATOM   1937 C  CD1   . TRP E 3 87 ? 3.464  5.685   20.995  1.00 14.55 ? 236 TRP C CD1   1 
ATOM   1938 C  CD2   . TRP E 3 87 ? 5.276  5.778   19.680  1.00 15.92 ? 236 TRP C CD2   1 
ATOM   1939 N  NE1   . TRP E 3 87 ? 3.505  4.534   20.247  1.00 16.34 ? 236 TRP C NE1   1 
ATOM   1940 C  CE2   . TRP E 3 87 ? 4.605  4.563   19.435  1.00 14.47 ? 236 TRP C CE2   1 
ATOM   1941 C  CE3   . TRP E 3 87 ? 6.451  6.060   18.965  1.00 17.81 ? 236 TRP C CE3   1 
ATOM   1942 C  CZ2   . TRP E 3 87 ? 5.064  3.627   18.509  1.00 18.18 ? 236 TRP C CZ2   1 
ATOM   1943 C  CZ3   . TRP E 3 87 ? 6.911  5.122   18.036  1.00 18.32 ? 236 TRP C CZ3   1 
ATOM   1944 C  CH2   . TRP E 3 87 ? 6.217  3.922   17.819  1.00 17.70 ? 236 TRP C CH2   1 
ATOM   1945 N  N     . TRP E 3 88 ? 7.377  10.023  21.570  1.00 15.25 ? 237 TRP C N     1 
ATOM   1946 C  CA    . TRP E 3 88 ? 7.606  11.452  21.768  1.00 15.26 ? 237 TRP C CA    1 
ATOM   1947 C  C     . TRP E 3 88 ? 7.137  12.148  20.505  1.00 15.90 ? 237 TRP C C     1 
ATOM   1948 O  O     . TRP E 3 88 ? 7.438  11.702  19.396  1.00 16.97 ? 237 TRP C O     1 
ATOM   1949 C  CB    . TRP E 3 88 ? 9.093  11.772  21.992  1.00 10.73 ? 237 TRP C CB    1 
ATOM   1950 C  CG    . TRP E 3 88 ? 9.597  11.365  23.320  1.00 11.35 ? 237 TRP C CG    1 
ATOM   1951 C  CD1   . TRP E 3 88 ? 10.278 10.218  23.632  1.00 9.41  ? 237 TRP C CD1   1 
ATOM   1952 C  CD2   . TRP E 3 88 ? 9.440  12.087  24.548  1.00 11.79 ? 237 TRP C CD2   1 
ATOM   1953 N  NE1   . TRP E 3 88 ? 10.548 10.184  24.977  1.00 11.19 ? 237 TRP C NE1   1 
ATOM   1954 C  CE2   . TRP E 3 88 ? 10.047 11.320  25.563  1.00 10.94 ? 237 TRP C CE2   1 
ATOM   1955 C  CE3   . TRP E 3 88 ? 8.838  13.307  24.887  1.00 10.93 ? 237 TRP C CE3   1 
ATOM   1956 C  CZ2   . TRP E 3 88 ? 10.076 11.734  26.899  1.00 13.25 ? 237 TRP C CZ2   1 
ATOM   1957 C  CZ3   . TRP E 3 88 ? 8.862  13.718  26.224  1.00 10.50 ? 237 TRP C CZ3   1 
ATOM   1958 C  CH2   . TRP E 3 88 ? 9.476  12.936  27.207  1.00 10.38 ? 237 TRP C CH2   1 
ATOM   1959 N  N     . MET E 3 89 ? 6.400  13.234  20.659  1.00 17.91 ? 238 MET C N     1 
ATOM   1960 C  CA    . MET E 3 89 ? 5.935  13.939  19.488  1.00 21.49 ? 238 MET C CA    1 
ATOM   1961 C  C     . MET E 3 89 ? 5.900  15.433  19.690  1.00 22.55 ? 238 MET C C     1 
ATOM   1962 O  O     . MET E 3 89 ? 6.121  15.906  20.797  1.00 20.38 ? 238 MET C O     1 
ATOM   1963 C  CB    . MET E 3 89 ? 4.564  13.398  19.046  1.00 21.87 ? 238 MET C CB    1 
ATOM   1964 C  CG    . MET E 3 89 ? 3.436  13.466  20.042  1.00 26.67 ? 238 MET C CG    1 
ATOM   1965 S  SD    . MET E 3 89 ? 2.022  12.362  19.542  1.00 27.87 ? 238 MET C SD    1 
ATOM   1966 C  CE    . MET E 3 89 ? 1.748  12.880  17.859  1.00 25.36 ? 238 MET C CE    1 
ATOM   1967 N  N     . LEU E 3 90 ? 5.661  16.169  18.609  1.00 24.61 ? 239 LEU C N     1 
ATOM   1968 C  CA    . LEU E 3 90 ? 5.586  17.619  18.676  1.00 29.57 ? 239 LEU C CA    1 
ATOM   1969 C  C     . LEU E 3 90 ? 4.235  18.063  19.211  1.00 32.36 ? 239 LEU C C     1 
ATOM   1970 O  O     . LEU E 3 90 ? 3.185  17.607  18.754  1.00 33.14 ? 239 LEU C O     1 
ATOM   1971 C  CB    . LEU E 3 90 ? 5.833  18.257  17.305  1.00 27.91 ? 239 LEU C CB    1 
ATOM   1972 C  CG    . LEU E 3 90 ? 7.298  18.354  16.855  1.00 30.42 ? 239 LEU C CG    1 
ATOM   1973 C  CD1   . LEU E 3 90 ? 8.173  18.961  17.942  1.00 29.17 ? 239 LEU C CD1   1 
ATOM   1974 C  CD2   . LEU E 3 90 ? 7.801  16.996  16.530  1.00 30.44 ? 239 LEU C CD2   1 
ATOM   1975 N  N     . ASN E 3 91 ? 4.289  18.952  20.194  1.00 35.77 ? 240 ASN C N     1 
ATOM   1976 C  CA    . ASN E 3 91 ? 3.101  19.497  20.837  1.00 40.21 ? 240 ASN C CA    1 
ATOM   1977 C  C     . ASN E 3 91 ? 2.401  20.481  19.913  1.00 42.57 ? 240 ASN C C     1 
ATOM   1978 O  O     . ASN E 3 91 ? 2.979  21.489  19.515  1.00 42.84 ? 240 ASN C O     1 
ATOM   1979 C  CB    . ASN E 3 91 ? 3.501  20.189  22.147  1.00 41.11 ? 240 ASN C CB    1 
ATOM   1980 C  CG    . ASN E 3 91 ? 2.320  20.818  22.874  1.00 42.92 ? 240 ASN C CG    1 
ATOM   1981 O  OD1   . ASN E 3 91 ? 1.211  20.280  22.879  1.00 42.78 ? 240 ASN C OD1   1 
ATOM   1982 N  ND2   . ASN E 3 91 ? 2.565  21.954  23.514  1.00 43.59 ? 240 ASN C ND2   1 
ATOM   1983 N  N     . PRO E 3 92 ? 1.145  20.186  19.543  1.00 45.47 ? 241 PRO C N     1 
ATOM   1984 C  CA    . PRO E 3 92 ? 0.386  21.075  18.660  1.00 47.39 ? 241 PRO C CA    1 
ATOM   1985 C  C     . PRO E 3 92 ? -0.054 22.355  19.383  1.00 49.68 ? 241 PRO C C     1 
ATOM   1986 O  O     . PRO E 3 92 ? -1.270 22.647  19.344  1.00 51.41 ? 241 PRO C O     1 
ATOM   1987 C  CB    . PRO E 3 92 ? -0.797 20.204  18.250  1.00 47.23 ? 241 PRO C CB    1 
ATOM   1988 C  CG    . PRO E 3 92 ? -1.039 19.379  19.471  1.00 46.01 ? 241 PRO C CG    1 
ATOM   1989 C  CD    . PRO E 3 92 ? 0.372  18.967  19.847  1.00 46.24 ? 241 PRO C CD    1 
ATOM   1990 N  N     . SER F 3 6  ? 26.620 -34.458 20.652  1.00 48.97 ? 155 SER F N     1 
ATOM   1991 C  CA    . SER F 3 6  ? 25.434 -34.170 21.515  1.00 49.47 ? 155 SER F CA    1 
ATOM   1992 C  C     . SER F 3 6  ? 24.584 -33.005 20.985  1.00 49.32 ? 155 SER F C     1 
ATOM   1993 O  O     . SER F 3 6  ? 23.490 -32.752 21.495  1.00 48.84 ? 155 SER F O     1 
ATOM   1994 C  CB    . SER F 3 6  ? 25.891 -33.872 22.950  1.00 49.91 ? 155 SER F CB    1 
ATOM   1995 O  OG    . SER F 3 6  ? 26.815 -32.792 22.992  1.00 50.03 ? 155 SER F OG    1 
ATOM   1996 N  N     . ARG F 3 7  ? 25.096 -32.305 19.968  1.00 48.82 ? 156 ARG F N     1 
ATOM   1997 C  CA    . ARG F 3 7  ? 24.393 -31.176 19.348  1.00 48.13 ? 156 ARG F CA    1 
ATOM   1998 C  C     . ARG F 3 7  ? 24.122 -31.390 17.861  1.00 46.85 ? 156 ARG F C     1 
ATOM   1999 O  O     . ARG F 3 7  ? 25.058 -31.488 17.067  1.00 45.74 ? 156 ARG F O     1 
ATOM   2000 C  CB    . ARG F 3 7  ? 25.197 -29.882 19.498  1.00 48.88 ? 156 ARG F CB    1 
ATOM   2001 C  CG    . ARG F 3 7  ? 25.283 -29.363 20.908  1.00 51.22 ? 156 ARG F CG    1 
ATOM   2002 C  CD    . ARG F 3 7  ? 25.652 -27.894 20.942  1.00 51.66 ? 156 ARG F CD    1 
ATOM   2003 N  NE    . ARG F 3 7  ? 25.475 -27.372 22.292  1.00 53.88 ? 156 ARG F NE    1 
ATOM   2004 C  CZ    . ARG F 3 7  ? 25.538 -26.087 22.619  1.00 55.19 ? 156 ARG F CZ    1 
ATOM   2005 N  NH1   . ARG F 3 7  ? 25.776 -25.171 21.687  1.00 54.52 ? 156 ARG F NH1   1 
ATOM   2006 N  NH2   . ARG F 3 7  ? 25.357 -25.719 23.884  1.00 56.34 ? 156 ARG F NH2   1 
ATOM   2007 N  N     . ARG F 3 8  ? 22.846 -31.445 17.484  1.00 45.43 ? 157 ARG F N     1 
ATOM   2008 C  CA    . ARG F 3 8  ? 22.472 -31.626 16.084  1.00 42.84 ? 157 ARG F CA    1 
ATOM   2009 C  C     . ARG F 3 8  ? 23.165 -30.564 15.227  1.00 40.21 ? 157 ARG F C     1 
ATOM   2010 O  O     . ARG F 3 8  ? 23.765 -30.878 14.204  1.00 39.89 ? 157 ARG F O     1 
ATOM   2011 C  CB    . ARG F 3 8  ? 20.956 -31.520 15.918  1.00 45.03 ? 157 ARG F CB    1 
ATOM   2012 C  CG    . ARG F 3 8  ? 20.369 -32.541 14.959  1.00 49.71 ? 157 ARG F CG    1 
ATOM   2013 C  CD    . ARG F 3 8  ? 18.867 -32.328 14.753  1.00 52.98 ? 157 ARG F CD    1 
ATOM   2014 N  NE    . ARG F 3 8  ? 18.227 -33.458 14.070  1.00 56.38 ? 157 ARG F NE    1 
ATOM   2015 C  CZ    . ARG F 3 8  ? 18.443 -33.812 12.801  1.00 57.31 ? 157 ARG F CZ    1 
ATOM   2016 N  NH1   . ARG F 3 8  ? 17.808 -34.862 12.286  1.00 56.85 ? 157 ARG F NH1   1 
ATOM   2017 N  NH2   . ARG F 3 8  ? 19.280 -33.116 12.040  1.00 57.96 ? 157 ARG F NH2   1 
ATOM   2018 N  N     . ASN F 3 9  ? 23.095 -29.308 15.652  1.00 36.99 ? 158 ASN F N     1 
ATOM   2019 C  CA    . ASN F 3 9  ? 23.731 -28.221 14.913  1.00 35.38 ? 158 ASN F CA    1 
ATOM   2020 C  C     . ASN F 3 9  ? 24.714 -27.537 15.841  1.00 34.85 ? 158 ASN F C     1 
ATOM   2021 O  O     . ASN F 3 9  ? 24.793 -27.883 17.016  1.00 36.52 ? 158 ASN F O     1 
ATOM   2022 C  CB    . ASN F 3 9  ? 22.679 -27.212 14.458  1.00 35.38 ? 158 ASN F CB    1 
ATOM   2023 C  CG    . ASN F 3 9  ? 21.476 -27.875 13.845  1.00 35.04 ? 158 ASN F CG    1 
ATOM   2024 O  OD1   . ASN F 3 9  ? 21.587 -28.554 12.828  1.00 35.30 ? 158 ASN F OD1   1 
ATOM   2025 N  ND2   . ASN F 3 9  ? 20.314 -27.693 14.463  1.00 34.08 ? 158 ASN F ND2   1 
ATOM   2026 N  N     . ALA F 3 10 ? 25.448 -26.556 15.331  1.00 33.30 ? 159 ALA F N     1 
ATOM   2027 C  CA    . ALA F 3 10 ? 26.423 -25.839 16.150  1.00 32.98 ? 159 ALA F CA    1 
ATOM   2028 C  C     . ALA F 3 10 ? 25.790 -25.070 17.322  1.00 33.99 ? 159 ALA F C     1 
ATOM   2029 O  O     . ALA F 3 10 ? 26.376 -24.957 18.405  1.00 34.44 ? 159 ALA F O     1 
ATOM   2030 C  CB    . ALA F 3 10 ? 27.220 -24.874 15.281  1.00 34.12 ? 159 ALA F CB    1 
ATOM   2031 N  N     . TRP F 3 11 ? 24.592 -24.541 17.111  1.00 31.71 ? 160 TRP F N     1 
ATOM   2032 C  CA    . TRP F 3 11 ? 23.929 -23.770 18.149  1.00 29.12 ? 160 TRP F CA    1 
ATOM   2033 C  C     . TRP F 3 11 ? 23.071 -24.615 19.094  1.00 28.07 ? 160 TRP F C     1 
ATOM   2034 O  O     . TRP F 3 11 ? 22.574 -24.101 20.084  1.00 28.63 ? 160 TRP F O     1 
ATOM   2035 C  CB    . TRP F 3 11 ? 23.067 -22.684 17.494  1.00 27.15 ? 160 TRP F CB    1 
ATOM   2036 C  CG    . TRP F 3 11 ? 22.009 -23.258 16.602  1.00 24.24 ? 160 TRP F CG    1 
ATOM   2037 C  CD1   . TRP F 3 11 ? 20.793 -23.753 16.980  1.00 23.64 ? 160 TRP F CD1   1 
ATOM   2038 C  CD2   . TRP F 3 11 ? 22.115 -23.485 15.195  1.00 24.39 ? 160 TRP F CD2   1 
ATOM   2039 N  NE1   . TRP F 3 11 ? 20.137 -24.278 15.891  1.00 22.53 ? 160 TRP F NE1   1 
ATOM   2040 C  CE2   . TRP F 3 11 ? 20.929 -24.125 14.784  1.00 24.00 ? 160 TRP F CE2   1 
ATOM   2041 C  CE3   . TRP F 3 11 ? 23.107 -23.213 14.238  1.00 27.02 ? 160 TRP F CE3   1 
ATOM   2042 C  CZ2   . TRP F 3 11 ? 20.704 -24.504 13.451  1.00 26.83 ? 160 TRP F CZ2   1 
ATOM   2043 C  CZ3   . TRP F 3 11 ? 22.882 -23.590 12.912  1.00 27.47 ? 160 TRP F CZ3   1 
ATOM   2044 C  CH2   . TRP F 3 11 ? 21.690 -24.228 12.536  1.00 26.40 ? 160 TRP F CH2   1 
ATOM   2045 N  N     . GLY F 3 12 ? 22.890 -25.898 18.796  1.00 27.57 ? 161 GLY F N     1 
ATOM   2046 C  CA    . GLY F 3 12 ? 22.063 -26.729 19.660  1.00 27.18 ? 161 GLY F CA    1 
ATOM   2047 C  C     . GLY F 3 12 ? 21.192 -27.691 18.872  1.00 27.70 ? 161 GLY F C     1 
ATOM   2048 O  O     . GLY F 3 12 ? 21.475 -27.949 17.706  1.00 27.87 ? 161 GLY F O     1 
ATOM   2049 N  N     . ASN F 3 13 ? 20.136 -28.222 19.489  1.00 27.42 ? 162 ASN F N     1 
ATOM   2050 C  CA    . ASN F 3 13 ? 19.259 -29.173 18.802  1.00 27.66 ? 162 ASN F CA    1 
ATOM   2051 C  C     . ASN F 3 13 ? 18.029 -28.560 18.129  1.00 26.83 ? 162 ASN F C     1 
ATOM   2052 O  O     . ASN F 3 13 ? 17.265 -29.261 17.454  1.00 25.38 ? 162 ASN F O     1 
ATOM   2053 C  CB    . ASN F 3 13 ? 18.781 -30.271 19.759  1.00 30.39 ? 162 ASN F CB    1 
ATOM   2054 C  CG    . ASN F 3 13 ? 19.923 -31.049 20.388  1.00 33.06 ? 162 ASN F CG    1 
ATOM   2055 O  OD1   . ASN F 3 13 ? 21.021 -31.162 19.822  1.00 33.14 ? 162 ASN F OD1   1 
ATOM   2056 N  ND2   . ASN F 3 13 ? 19.660 -31.610 21.563  1.00 32.93 ? 162 ASN F ND2   1 
ATOM   2057 N  N     . LEU F 3 14 ? 17.817 -27.267 18.317  1.00 24.76 ? 163 LEU F N     1 
ATOM   2058 C  CA    . LEU F 3 14 ? 16.671 -26.630 17.679  1.00 25.05 ? 163 LEU F CA    1 
ATOM   2059 C  C     . LEU F 3 14 ? 16.985 -26.276 16.225  1.00 22.55 ? 163 LEU F C     1 
ATOM   2060 O  O     . LEU F 3 14 ? 18.084 -25.828 15.910  1.00 20.48 ? 163 LEU F O     1 
ATOM   2061 C  CB    . LEU F 3 14 ? 16.279 -25.352 18.413  1.00 24.75 ? 163 LEU F CB    1 
ATOM   2062 C  CG    . LEU F 3 14 ? 15.906 -25.405 19.890  1.00 27.76 ? 163 LEU F CG    1 
ATOM   2063 C  CD1   . LEU F 3 14 ? 15.124 -24.145 20.193  1.00 25.85 ? 163 LEU F CD1   1 
ATOM   2064 C  CD2   . LEU F 3 14 ? 15.069 -26.628 20.212  1.00 28.03 ? 163 LEU F CD2   1 
ATOM   2065 N  N     . SER F 3 15 ? 16.009 -26.487 15.355  1.00 22.91 ? 164 SER F N     1 
ATOM   2066 C  CA    . SER F 3 15 ? 16.123 -26.165 13.922  1.00 22.44 ? 164 SER F CA    1 
ATOM   2067 C  C     . SER F 3 15 ? 15.968 -24.655 13.772  1.00 21.15 ? 164 SER F C     1 
ATOM   2068 O  O     . SER F 3 15 ? 15.524 -23.997 14.706  1.00 21.01 ? 164 SER F O     1 
ATOM   2069 C  CB    . SER F 3 15 ? 14.977 -26.814 13.146  1.00 23.33 ? 164 SER F CB    1 
ATOM   2070 O  OG    . SER F 3 15 ? 13.728 -26.270 13.570  1.00 22.86 ? 164 SER F OG    1 
ATOM   2071 N  N     . TYR F 3 16 ? 16.316 -24.099 12.612  1.00 18.87 ? 165 TYR F N     1 
ATOM   2072 C  CA    . TYR F 3 16 ? 16.124 -22.657 12.417  1.00 16.12 ? 165 TYR F CA    1 
ATOM   2073 C  C     . TYR F 3 16 ? 14.653 -22.292 12.608  1.00 15.11 ? 165 TYR F C     1 
ATOM   2074 O  O     . TYR F 3 16 ? 14.336 -21.213 13.104  1.00 16.43 ? 165 TYR F O     1 
ATOM   2075 C  CB    . TYR F 3 16 ? 16.520 -22.226 11.008  1.00 18.22 ? 165 TYR F CB    1 
ATOM   2076 C  CG    . TYR F 3 16 ? 17.998 -21.991 10.797  1.00 16.94 ? 165 TYR F CG    1 
ATOM   2077 C  CD1   . TYR F 3 16 ? 18.733 -22.810 9.942   1.00 15.82 ? 165 TYR F CD1   1 
ATOM   2078 C  CD2   . TYR F 3 16 ? 18.650 -20.927 11.419  1.00 15.96 ? 165 TYR F CD2   1 
ATOM   2079 C  CE1   . TYR F 3 16 ? 20.085 -22.567 9.712   1.00 16.47 ? 165 TYR F CE1   1 
ATOM   2080 C  CE2   . TYR F 3 16 ? 19.988 -20.679 11.193  1.00 16.31 ? 165 TYR F CE2   1 
ATOM   2081 C  CZ    . TYR F 3 16 ? 20.702 -21.508 10.333  1.00 14.78 ? 165 TYR F CZ    1 
ATOM   2082 O  OH    . TYR F 3 16 ? 22.031 -21.265 10.085  1.00 18.97 ? 165 TYR F OH    1 
ATOM   2083 N  N     . ALA F 3 17 ? 13.756 -23.174 12.176  1.00 13.98 ? 166 ALA F N     1 
ATOM   2084 C  CA    . ALA F 3 17 ? 12.329 -22.916 12.311  1.00 15.25 ? 166 ALA F CA    1 
ATOM   2085 C  C     . ALA F 3 17 ? 11.949 -22.839 13.791  1.00 17.12 ? 166 ALA F C     1 
ATOM   2086 O  O     . ALA F 3 17 ? 11.144 -21.984 14.188  1.00 16.47 ? 166 ALA F O     1 
ATOM   2087 C  CB    . ALA F 3 17 ? 11.526 -24.018 11.616  1.00 15.37 ? 166 ALA F CB    1 
ATOM   2088 N  N     . ASP F 3 18 ? 12.528 -23.723 14.603  1.00 17.56 ? 167 ASP F N     1 
ATOM   2089 C  CA    . ASP F 3 18 ? 12.237 -23.727 16.035  1.00 18.95 ? 167 ASP F CA    1 
ATOM   2090 C  C     . ASP F 3 18 ? 12.736 -22.435 16.658  1.00 18.73 ? 167 ASP F C     1 
ATOM   2091 O  O     . ASP F 3 18 ? 12.085 -21.874 17.524  1.00 21.06 ? 167 ASP F O     1 
ATOM   2092 C  CB    . ASP F 3 18 ? 12.896 -24.916 16.763  1.00 19.05 ? 167 ASP F CB    1 
ATOM   2093 C  CG    . ASP F 3 18 ? 12.401 -26.280 16.272  1.00 22.98 ? 167 ASP F CG    1 
ATOM   2094 O  OD1   . ASP F 3 18 ? 11.211 -26.416 15.893  1.00 23.36 ? 167 ASP F OD1   1 
ATOM   2095 O  OD2   . ASP F 3 18 ? 13.212 -27.243 16.290  1.00 24.07 ? 167 ASP F OD2   1 
ATOM   2096 N  N     . LEU F 3 19 ? 13.894 -21.957 16.220  1.00 18.94 ? 168 LEU F N     1 
ATOM   2097 C  CA    . LEU F 3 19 ? 14.441 -20.717 16.757  1.00 18.45 ? 168 LEU F CA    1 
ATOM   2098 C  C     . LEU F 3 19 ? 13.542 -19.506 16.430  1.00 19.55 ? 168 LEU F C     1 
ATOM   2099 O  O     . LEU F 3 19 ? 13.319 -18.629 17.270  1.00 17.42 ? 168 LEU F O     1 
ATOM   2100 C  CB    . LEU F 3 19 ? 15.840 -20.482 16.199  1.00 17.54 ? 168 LEU F CB    1 
ATOM   2101 C  CG    . LEU F 3 19 ? 16.919 -21.496 16.605  1.00 20.03 ? 168 LEU F CG    1 
ATOM   2102 C  CD1   . LEU F 3 19 ? 18.241 -21.118 15.890  1.00 17.93 ? 168 LEU F CD1   1 
ATOM   2103 C  CD2   . LEU F 3 19 ? 17.121 -21.501 18.131  1.00 18.90 ? 168 LEU F CD2   1 
ATOM   2104 N  N     . ILE F 3 20 ? 13.053 -19.457 15.198  1.00 18.18 ? 169 ILE F N     1 
ATOM   2105 C  CA    . ILE F 3 20 ? 12.181 -18.369 14.784  1.00 18.80 ? 169 ILE F CA    1 
ATOM   2106 C  C     . ILE F 3 20 ? 10.927 -18.476 15.643  1.00 17.96 ? 169 ILE F C     1 
ATOM   2107 O  O     . ILE F 3 20 ? 10.392 -17.467 16.112  1.00 18.13 ? 169 ILE F O     1 
ATOM   2108 C  CB    . ILE F 3 20 ? 11.770 -18.496 13.286  1.00 18.77 ? 169 ILE F CB    1 
ATOM   2109 C  CG1   . ILE F 3 20 ? 13.003 -18.382 12.383  1.00 19.25 ? 169 ILE F CG1   1 
ATOM   2110 C  CG2   . ILE F 3 20 ? 10.734 -17.435 12.951  1.00 17.35 ? 169 ILE F CG2   1 
ATOM   2111 C  CD1   . ILE F 3 20 ? 12.758 -18.853 10.944  1.00 16.66 ? 169 ILE F CD1   1 
ATOM   2112 N  N     . THR F 3 21 ? 10.469 -19.707 15.850  1.00 18.30 ? 170 THR F N     1 
ATOM   2113 C  CA    . THR F 3 21 ? 9.278  -19.937 16.662  1.00 20.57 ? 170 THR F CA    1 
ATOM   2114 C  C     . THR F 3 21 ? 9.485  -19.363 18.061  1.00 20.91 ? 170 THR F C     1 
ATOM   2115 O  O     . THR F 3 21 ? 8.660  -18.582 18.520  1.00 20.48 ? 170 THR F O     1 
ATOM   2116 C  CB    . THR F 3 21 ? 8.898  -21.451 16.702  1.00 20.51 ? 170 THR F CB    1 
ATOM   2117 O  OG1   . THR F 3 21 ? 8.520  -21.865 15.381  1.00 18.44 ? 170 THR F OG1   1 
ATOM   2118 C  CG2   . THR F 3 21 ? 7.712  -21.710 17.651  1.00 17.89 ? 170 THR F CG2   1 
ATOM   2119 N  N     . LYS F 3 22 ? 10.588 -19.701 18.726  1.00 21.70 ? 171 LYS F N     1 
ATOM   2120 C  CA    . LYS F 3 22 ? 10.845 -19.141 20.064  1.00 22.30 ? 171 LYS F CA    1 
ATOM   2121 C  C     . LYS F 3 22 ? 10.926 -17.622 20.023  1.00 21.15 ? 171 LYS F C     1 
ATOM   2122 O  O     . LYS F 3 22 ? 10.452 -16.954 20.928  1.00 21.06 ? 171 LYS F O     1 
ATOM   2123 C  CB    . LYS F 3 22 ? 12.174 -19.642 20.659  1.00 24.37 ? 171 LYS F CB    1 
ATOM   2124 C  CG    . LYS F 3 22 ? 12.165 -21.052 21.199  1.00 28.91 ? 171 LYS F CG    1 
ATOM   2125 C  CD    . LYS F 3 22 ? 13.578 -21.487 21.596  1.00 29.93 ? 171 LYS F CD    1 
ATOM   2126 C  CE    . LYS F 3 22 ? 14.121 -20.682 22.765  1.00 32.13 ? 171 LYS F CE    1 
ATOM   2127 N  NZ    . LYS F 3 22 ? 13.570 -21.137 24.069  1.00 31.39 ? 171 LYS F NZ    1 
ATOM   2128 N  N     . ALA F 3 23 ? 11.549 -17.078 18.986  1.00 19.07 ? 172 ALA F N     1 
ATOM   2129 C  CA    . ALA F 3 23 ? 11.700 -15.633 18.889  1.00 19.05 ? 172 ALA F CA    1 
ATOM   2130 C  C     . ALA F 3 23 ? 10.321 -14.970 18.881  1.00 19.38 ? 172 ALA F C     1 
ATOM   2131 O  O     . ALA F 3 23 ? 10.028 -14.066 19.681  1.00 20.22 ? 172 ALA F O     1 
ATOM   2132 C  CB    . ALA F 3 23 ? 12.499 -15.264 17.615  1.00 17.37 ? 172 ALA F CB    1 
ATOM   2133 N  N     . ILE F 3 24 ? 9.470  -15.434 17.981  1.00 19.50 ? 173 ILE F N     1 
ATOM   2134 C  CA    . ILE F 3 24 ? 8.133  -14.892 17.873  1.00 19.80 ? 173 ILE F CA    1 
ATOM   2135 C  C     . ILE F 3 24 ? 7.388  -15.088 19.184  1.00 20.42 ? 173 ILE F C     1 
ATOM   2136 O  O     . ILE F 3 24 ? 6.736  -14.167 19.670  1.00 19.93 ? 173 ILE F O     1 
ATOM   2137 C  CB    . ILE F 3 24 ? 7.345  -15.561 16.711  1.00 18.19 ? 173 ILE F CB    1 
ATOM   2138 C  CG1   . ILE F 3 24 ? 7.984  -15.170 15.367  1.00 18.77 ? 173 ILE F CG1   1 
ATOM   2139 C  CG2   . ILE F 3 24 ? 5.882  -15.142 16.751  1.00 13.92 ? 173 ILE F CG2   1 
ATOM   2140 C  CD1   . ILE F 3 24 ? 7.326  -15.841 14.164  1.00 19.79 ? 173 ILE F CD1   1 
ATOM   2141 N  N     . GLU F 3 25 ? 7.488  -16.275 19.770  1.00 22.54 ? 174 GLU F N     1 
ATOM   2142 C  CA    . GLU F 3 25 ? 6.779  -16.530 21.022  1.00 23.50 ? 174 GLU F CA    1 
ATOM   2143 C  C     . GLU F 3 25 ? 7.248  -15.658 22.175  1.00 23.63 ? 174 GLU F C     1 
ATOM   2144 O  O     . GLU F 3 25 ? 6.484  -15.404 23.097  1.00 24.10 ? 174 GLU F O     1 
ATOM   2145 C  CB    . GLU F 3 25 ? 6.876  -18.002 21.410  1.00 25.74 ? 174 GLU F CB    1 
ATOM   2146 C  CG    . GLU F 3 25 ? 6.039  -18.911 20.514  1.00 30.09 ? 174 GLU F CG    1 
ATOM   2147 C  CD    . GLU F 3 25 ? 6.221  -20.392 20.822  1.00 34.22 ? 174 GLU F CD    1 
ATOM   2148 O  OE1   . GLU F 3 25 ? 7.348  -20.779 21.209  1.00 35.94 ? 174 GLU F OE1   1 
ATOM   2149 O  OE2   . GLU F 3 25 ? 5.248  -21.175 20.659  1.00 35.88 ? 174 GLU F OE2   1 
ATOM   2150 N  N     . SER F 3 26 ? 8.483  -15.173 22.111  1.00 22.12 ? 175 SER F N     1 
ATOM   2151 C  CA    . SER F 3 26 ? 9.015  -14.335 23.179  1.00 22.45 ? 175 SER F CA    1 
ATOM   2152 C  C     . SER F 3 26 ? 8.469  -12.908 23.158  1.00 22.93 ? 175 SER F C     1 
ATOM   2153 O  O     . SER F 3 26 ? 8.596  -12.189 24.151  1.00 22.45 ? 175 SER F O     1 
ATOM   2154 C  CB    . SER F 3 26 ? 10.541 -14.268 23.102  1.00 21.91 ? 175 SER F CB    1 
ATOM   2155 O  OG    . SER F 3 26 ? 10.955 -13.251 22.199  1.00 22.40 ? 175 SER F OG    1 
ATOM   2156 N  N     . SER F 3 27 ? 7.905  -12.479 22.025  1.00 20.36 ? 176 SER F N     1 
ATOM   2157 C  CA    . SER F 3 27 ? 7.353  -11.131 21.941  1.00 20.86 ? 176 SER F CA    1 
ATOM   2158 C  C     . SER F 3 27 ? 5.993  -11.152 22.645  1.00 19.13 ? 176 SER F C     1 
ATOM   2159 O  O     . SER F 3 27 ? 5.271  -12.136 22.586  1.00 19.19 ? 176 SER F O     1 
ATOM   2160 C  CB    . SER F 3 27 ? 7.163  -10.708 20.476  1.00 22.94 ? 176 SER F CB    1 
ATOM   2161 O  OG    . SER F 3 27 ? 6.134  -11.472 19.858  1.00 21.91 ? 176 SER F OG    1 
ATOM   2162 N  N     . ALA F 3 28 ? 5.648  -10.073 23.319  1.00 20.29 ? 177 ALA F N     1 
ATOM   2163 C  CA    . ALA F 3 28 ? 4.361  -10.028 23.999  1.00 21.48 ? 177 ALA F CA    1 
ATOM   2164 C  C     . ALA F 3 28 ? 3.215  -10.055 22.984  1.00 21.54 ? 177 ALA F C     1 
ATOM   2165 O  O     . ALA F 3 28 ? 2.163  -10.615 23.266  1.00 23.04 ? 177 ALA F O     1 
ATOM   2166 C  CB    . ALA F 3 28 ? 4.267  -8.780  24.867  1.00 21.11 ? 177 ALA F CB    1 
ATOM   2167 N  N     . GLU F 3 29 ? 3.417  -9.472  21.801  1.00 19.90 ? 178 GLU F N     1 
ATOM   2168 C  CA    . GLU F 3 29 ? 2.349  -9.448  20.802  1.00 20.11 ? 178 GLU F CA    1 
ATOM   2169 C  C     . GLU F 3 29 ? 2.383  -10.637 19.841  1.00 19.87 ? 178 GLU F C     1 
ATOM   2170 O  O     . GLU F 3 29 ? 1.558  -10.742 18.935  1.00 19.82 ? 178 GLU F O     1 
ATOM   2171 C  CB    . GLU F 3 29 ? 2.359  -8.112  20.039  1.00 20.35 ? 178 GLU F CB    1 
ATOM   2172 C  CG    . GLU F 3 29 ? 2.503  -6.903  20.981  1.00 24.39 ? 178 GLU F CG    1 
ATOM   2173 C  CD    . GLU F 3 29 ? 1.987  -5.586  20.413  1.00 27.10 ? 178 GLU F CD    1 
ATOM   2174 O  OE1   . GLU F 3 29 ? 1.978  -5.390  19.181  1.00 27.94 ? 178 GLU F OE1   1 
ATOM   2175 O  OE2   . GLU F 3 29 ? 1.600  -4.719  21.220  1.00 31.92 ? 178 GLU F OE2   1 
ATOM   2176 N  N     . LYS F 3 30 ? 3.323  -11.552 20.057  1.00 18.78 ? 179 LYS F N     1 
ATOM   2177 C  CA    . LYS F 3 30 ? 3.421  -12.749 19.226  1.00 17.24 ? 179 LYS F CA    1 
ATOM   2178 C  C     . LYS F 3 30 ? 3.610  -12.442 17.729  1.00 15.42 ? 179 LYS F C     1 
ATOM   2179 O  O     . LYS F 3 30 ? 2.965  -13.050 16.867  1.00 15.86 ? 179 LYS F O     1 
ATOM   2180 C  CB    . LYS F 3 30 ? 2.164  -13.611 19.400  1.00 18.68 ? 179 LYS F CB    1 
ATOM   2181 C  CG    . LYS F 3 30 ? 1.775  -13.889 20.842  1.00 21.89 ? 179 LYS F CG    1 
ATOM   2182 C  CD    . LYS F 3 30 ? 2.934  -14.489 21.650  1.00 24.66 ? 179 LYS F CD    1 
ATOM   2183 C  CE    . LYS F 3 30 ? 2.529  -14.665 23.104  1.00 23.79 ? 179 LYS F CE    1 
ATOM   2184 N  NZ    . LYS F 3 30 ? 3.676  -15.026 23.969  1.00 27.47 ? 179 LYS F NZ    1 
ATOM   2185 N  N     . ARG F 3 31 ? 4.478  -11.490 17.431  1.00 13.91 ? 180 ARG F N     1 
ATOM   2186 C  CA    . ARG F 3 31 ? 4.774  -11.119 16.053  1.00 13.39 ? 180 ARG F CA    1 
ATOM   2187 C  C     . ARG F 3 31 ? 6.044  -10.285 16.068  1.00 14.20 ? 180 ARG F C     1 
ATOM   2188 O  O     . ARG F 3 31 ? 6.278  -9.522  17.002  1.00 14.12 ? 180 ARG F O     1 
ATOM   2189 C  CB    . ARG F 3 31 ? 3.620  -10.324 15.430  1.00 13.12 ? 180 ARG F CB    1 
ATOM   2190 C  CG    . ARG F 3 31 ? 3.320  -8.946  16.067  1.00 11.01 ? 180 ARG F CG    1 
ATOM   2191 C  CD    . ARG F 3 31 ? 2.192  -8.266  15.306  1.00 13.23 ? 180 ARG F CD    1 
ATOM   2192 N  NE    . ARG F 3 31 ? 2.037  -6.866  15.677  1.00 15.24 ? 180 ARG F NE    1 
ATOM   2193 C  CZ    . ARG F 3 31 ? 1.065  -6.068  15.236  1.00 16.53 ? 180 ARG F CZ    1 
ATOM   2194 N  NH1   . ARG F 3 31 ? 0.134  -6.521  14.400  1.00 15.95 ? 180 ARG F NH1   1 
ATOM   2195 N  NH2   . ARG F 3 31 ? 1.037  -4.798  15.616  1.00 18.14 ? 180 ARG F NH2   1 
ATOM   2196 N  N     . LEU F 3 32 ? 6.870  -10.445 15.041  1.00 13.69 ? 181 LEU F N     1 
ATOM   2197 C  CA    . LEU F 3 32 ? 8.118  -9.695  14.948  1.00 12.05 ? 181 LEU F CA    1 
ATOM   2198 C  C     . LEU F 3 32 ? 8.463  -9.419  13.482  1.00 12.63 ? 181 LEU F C     1 
ATOM   2199 O  O     . LEU F 3 32 ? 8.135  -10.216 12.588  1.00 11.20 ? 181 LEU F O     1 
ATOM   2200 C  CB    . LEU F 3 32 ? 9.247  -10.526 15.552  1.00 12.70 ? 181 LEU F CB    1 
ATOM   2201 C  CG    . LEU F 3 32 ? 9.253  -10.827 17.047  1.00 13.16 ? 181 LEU F CG    1 
ATOM   2202 C  CD1   . LEU F 3 32 ? 10.389 -11.779 17.360  1.00 12.44 ? 181 LEU F CD1   1 
ATOM   2203 C  CD2   . LEU F 3 32 ? 9.411  -9.513  17.820  1.00 12.88 ? 181 LEU F CD2   1 
ATOM   2204 N  N     . THR F 3 33 ? 9.104  -8.291  13.220  1.00 12.53 ? 182 THR F N     1 
ATOM   2205 C  CA    . THR F 3 33 ? 9.518  -8.018  11.860  1.00 13.96 ? 182 THR F CA    1 
ATOM   2206 C  C     . THR F 3 33 ? 10.747 -8.938  11.610  1.00 15.18 ? 182 THR F C     1 
ATOM   2207 O  O     . THR F 3 33 ? 11.300 -9.522  12.551  1.00 14.69 ? 182 THR F O     1 
ATOM   2208 C  CB    . THR F 3 33 ? 9.957  -6.555  11.700  1.00 15.43 ? 182 THR F CB    1 
ATOM   2209 O  OG1   . THR F 3 33 ? 11.024 -6.296  12.609  1.00 13.01 ? 182 THR F OG1   1 
ATOM   2210 C  CG2   . THR F 3 33 ? 8.787  -5.580  11.983  1.00 14.99 ? 182 THR F CG2   1 
ATOM   2211 N  N     . LEU F 3 34 ? 11.157 -9.082  10.354  1.00 14.63 ? 183 LEU F N     1 
ATOM   2212 C  CA    . LEU F 3 34 ? 12.329 -9.898  10.021  1.00 14.02 ? 183 LEU F CA    1 
ATOM   2213 C  C     . LEU F 3 34 ? 13.553 -9.408  10.822  1.00 16.04 ? 183 LEU F C     1 
ATOM   2214 O  O     . LEU F 3 34 ? 14.303 -10.196 11.382  1.00 17.30 ? 183 LEU F O     1 
ATOM   2215 C  CB    . LEU F 3 34 ? 12.626 -9.776  8.524   1.00 13.00 ? 183 LEU F CB    1 
ATOM   2216 C  CG    . LEU F 3 34 ? 13.914 -10.454 8.028   1.00 15.77 ? 183 LEU F CG    1 
ATOM   2217 C  CD1   . LEU F 3 34 ? 13.885 -11.957 8.316   1.00 12.49 ? 183 LEU F CD1   1 
ATOM   2218 C  CD2   . LEU F 3 34 ? 14.059 -10.204 6.546   1.00 15.82 ? 183 LEU F CD2   1 
ATOM   2219 N  N     . SER F 3 35 ? 13.721 -8.092  10.869  1.00 17.03 ? 184 SER F N     1 
ATOM   2220 C  CA    . SER F 3 35 ? 14.821 -7.432  11.563  1.00 19.87 ? 184 SER F CA    1 
ATOM   2221 C  C     . SER F 3 35 ? 14.849 -7.734  13.067  1.00 19.87 ? 184 SER F C     1 
ATOM   2222 O  O     . SER F 3 35 ? 15.915 -7.853  13.673  1.00 20.41 ? 184 SER F O     1 
ATOM   2223 C  CB    . SER F 3 35 ? 14.709 -5.921  11.333  1.00 20.21 ? 184 SER F CB    1 
ATOM   2224 O  OG    . SER F 3 35 ? 15.823 -5.238  11.861  1.00 28.46 ? 184 SER F OG    1 
ATOM   2225 N  N     . GLN F 3 36 ? 13.675 -7.855  13.674  1.00 18.87 ? 185 GLN F N     1 
ATOM   2226 C  CA    . GLN F 3 36 ? 13.624 -8.149  15.089  1.00 19.01 ? 185 GLN F CA    1 
ATOM   2227 C  C     . GLN F 3 36 ? 13.969 -9.619  15.326  1.00 17.86 ? 185 GLN F C     1 
ATOM   2228 O  O     . GLN F 3 36 ? 14.525 -9.965  16.365  1.00 17.98 ? 185 GLN F O     1 
ATOM   2229 C  CB    . GLN F 3 36 ? 12.248 -7.807  15.657  1.00 19.27 ? 185 GLN F CB    1 
ATOM   2230 C  CG    . GLN F 3 36 ? 11.866 -6.348  15.477  1.00 21.72 ? 185 GLN F CG    1 
ATOM   2231 C  CD    . GLN F 3 36 ? 10.458 -6.075  15.961  1.00 24.28 ? 185 GLN F CD    1 
ATOM   2232 O  OE1   . GLN F 3 36 ? 9.511  -6.722  15.530  1.00 22.71 ? 185 GLN F OE1   1 
ATOM   2233 N  NE2   . GLN F 3 36 ? 10.317 -5.112  16.870  1.00 26.90 ? 185 GLN F NE2   1 
ATOM   2234 N  N     . ILE F 3 37 ? 13.645 -10.482 14.367  1.00 17.55 ? 186 ILE F N     1 
ATOM   2235 C  CA    . ILE F 3 37 ? 13.971 -11.894 14.513  1.00 17.10 ? 186 ILE F CA    1 
ATOM   2236 C  C     . ILE F 3 37 ? 15.491 -12.035 14.471  1.00 17.49 ? 186 ILE F C     1 
ATOM   2237 O  O     . ILE F 3 37 ? 16.061 -12.826 15.231  1.00 17.19 ? 186 ILE F O     1 
ATOM   2238 C  CB    . ILE F 3 37 ? 13.282 -12.748 13.426  1.00 16.15 ? 186 ILE F CB    1 
ATOM   2239 C  CG1   . ILE F 3 37 ? 11.765 -12.753 13.699  1.00 14.52 ? 186 ILE F CG1   1 
ATOM   2240 C  CG2   . ILE F 3 37 ? 13.822 -14.186 13.449  1.00 11.61 ? 186 ILE F CG2   1 
ATOM   2241 C  CD1   . ILE F 3 37 ? 10.919 -13.279 12.571  1.00 13.95 ? 186 ILE F CD1   1 
ATOM   2242 N  N     . TYR F 3 38 ? 16.147 -11.254 13.615  1.00 16.66 ? 187 TYR F N     1 
ATOM   2243 C  CA    . TYR F 3 38 ? 17.617 -11.275 13.547  1.00 19.07 ? 187 TYR F CA    1 
ATOM   2244 C  C     . TYR F 3 38 ? 18.186 -10.870 14.914  1.00 19.79 ? 187 TYR F C     1 
ATOM   2245 O  O     . TYR F 3 38 ? 19.064 -11.547 15.470  1.00 22.67 ? 187 TYR F O     1 
ATOM   2246 C  CB    . TYR F 3 38 ? 18.160 -10.269 12.515  1.00 17.63 ? 187 TYR F CB    1 
ATOM   2247 C  CG    . TYR F 3 38 ? 17.874 -10.582 11.065  1.00 16.88 ? 187 TYR F CG    1 
ATOM   2248 C  CD1   . TYR F 3 38 ? 17.546 -11.874 10.654  1.00 15.83 ? 187 TYR F CD1   1 
ATOM   2249 C  CD2   . TYR F 3 38 ? 17.963 -9.587  10.097  1.00 16.93 ? 187 TYR F CD2   1 
ATOM   2250 C  CE1   . TYR F 3 38 ? 17.312 -12.168 9.320   1.00 18.08 ? 187 TYR F CE1   1 
ATOM   2251 C  CE2   . TYR F 3 38 ? 17.736 -9.867  8.759   1.00 19.76 ? 187 TYR F CE2   1 
ATOM   2252 C  CZ    . TYR F 3 38 ? 17.407 -11.164 8.373   1.00 19.57 ? 187 TYR F CZ    1 
ATOM   2253 O  OH    . TYR F 3 38 ? 17.155 -11.441 7.047   1.00 20.12 ? 187 TYR F OH    1 
ATOM   2254 N  N     . GLU F 3 39 ? 17.668 -9.765  15.442  1.00 18.44 ? 188 GLU F N     1 
ATOM   2255 C  CA    . GLU F 3 39 ? 18.099 -9.224  16.731  1.00 20.71 ? 188 GLU F CA    1 
ATOM   2256 C  C     . GLU F 3 39 ? 17.930 -10.242 17.861  1.00 21.12 ? 188 GLU F C     1 
ATOM   2257 O  O     . GLU F 3 39 ? 18.824 -10.411 18.688  1.00 22.59 ? 188 GLU F O     1 
ATOM   2258 C  CB    . GLU F 3 39 ? 17.329 -7.923  17.044  1.00 20.00 ? 188 GLU F CB    1 
ATOM   2259 N  N     . TRP F 3 40 ? 16.792 -10.932 17.880  1.00 19.88 ? 189 TRP F N     1 
ATOM   2260 C  CA    . TRP F 3 40 ? 16.547 -11.946 18.873  1.00 20.24 ? 189 TRP F CA    1 
ATOM   2261 C  C     . TRP F 3 40 ? 17.575 -13.071 18.752  1.00 21.49 ? 189 TRP F C     1 
ATOM   2262 O  O     . TRP F 3 40 ? 17.978 -13.652 19.751  1.00 21.51 ? 189 TRP F O     1 
ATOM   2263 C  CB    . TRP F 3 40 ? 15.172 -12.567 18.688  1.00 18.52 ? 189 TRP F CB    1 
ATOM   2264 C  CG    . TRP F 3 40 ? 14.840 -13.518 19.780  1.00 19.27 ? 189 TRP F CG    1 
ATOM   2265 C  CD1   . TRP F 3 40 ? 14.234 -13.218 20.963  1.00 20.57 ? 189 TRP F CD1   1 
ATOM   2266 C  CD2   . TRP F 3 40 ? 15.111 -14.925 19.816  1.00 19.74 ? 189 TRP F CD2   1 
ATOM   2267 N  NE1   . TRP F 3 40 ? 14.106 -14.344 21.729  1.00 18.94 ? 189 TRP F NE1   1 
ATOM   2268 C  CE2   . TRP F 3 40 ? 14.636 -15.407 21.051  1.00 20.25 ? 189 TRP F CE2   1 
ATOM   2269 C  CE3   . TRP F 3 40 ? 15.707 -15.824 18.923  1.00 19.54 ? 189 TRP F CE3   1 
ATOM   2270 C  CZ2   . TRP F 3 40 ? 14.735 -16.757 21.422  1.00 21.97 ? 189 TRP F CZ2   1 
ATOM   2271 C  CZ3   . TRP F 3 40 ? 15.804 -17.163 19.291  1.00 20.31 ? 189 TRP F CZ3   1 
ATOM   2272 C  CH2   . TRP F 3 40 ? 15.321 -17.615 20.528  1.00 21.20 ? 189 TRP F CH2   1 
ATOM   2273 N  N     . MET F 3 41 ? 17.959 -13.417 17.530  1.00 22.44 ? 190 MET F N     1 
ATOM   2274 C  CA    . MET F 3 41 ? 18.931 -14.495 17.348  1.00 25.05 ? 190 MET F CA    1 
ATOM   2275 C  C     . MET F 3 41 ? 20.272 -14.086 17.965  1.00 24.61 ? 190 MET F C     1 
ATOM   2276 O  O     . MET F 3 41 ? 20.871 -14.826 18.739  1.00 24.96 ? 190 MET F O     1 
ATOM   2277 C  CB    . MET F 3 41 ? 19.139 -14.781 15.859  1.00 26.62 ? 190 MET F CB    1 
ATOM   2278 C  CG    . MET F 3 41 ? 17.946 -15.370 15.154  1.00 29.19 ? 190 MET F CG    1 
ATOM   2279 S  SD    . MET F 3 41 ? 18.024 -17.138 15.164  1.00 35.50 ? 190 MET F SD    1 
ATOM   2280 C  CE    . MET F 3 41 ? 17.150 -17.499 16.575  1.00 36.60 ? 190 MET F CE    1 
ATOM   2281 N  N     . VAL F 3 42 ? 20.723 -12.896 17.605  1.00 24.69 ? 191 VAL F N     1 
ATOM   2282 C  CA    . VAL F 3 42 ? 21.983 -12.369 18.083  1.00 27.58 ? 191 VAL F CA    1 
ATOM   2283 C  C     . VAL F 3 42 ? 22.035 -12.198 19.593  1.00 29.48 ? 191 VAL F C     1 
ATOM   2284 O  O     . VAL F 3 42 ? 23.055 -12.482 20.219  1.00 30.98 ? 191 VAL F O     1 
ATOM   2285 C  CB    . VAL F 3 42 ? 22.272 -11.044 17.384  1.00 28.49 ? 191 VAL F CB    1 
ATOM   2286 C  CG1   . VAL F 3 42 ? 23.488 -10.362 17.996  1.00 28.47 ? 191 VAL F CG1   1 
ATOM   2287 C  CG2   . VAL F 3 42 ? 22.498 -11.323 15.893  1.00 27.28 ? 191 VAL F CG2   1 
ATOM   2288 N  N     . LYS F 3 43 ? 20.935 -11.753 20.189  1.00 30.67 ? 192 LYS F N     1 
ATOM   2289 C  CA    . LYS F 3 43 ? 20.906 -11.563 21.630  1.00 30.24 ? 192 LYS F CA    1 
ATOM   2290 C  C     . LYS F 3 43 ? 20.538 -12.812 22.408  1.00 30.07 ? 192 LYS F C     1 
ATOM   2291 O  O     . LYS F 3 43 ? 20.905 -12.937 23.565  1.00 31.47 ? 192 LYS F O     1 
ATOM   2292 C  CB    . LYS F 3 43 ? 19.935 -10.432 21.993  1.00 31.25 ? 192 LYS F CB    1 
ATOM   2293 N  N     . SER F 3 44 ? 19.853 -13.761 21.783  1.00 30.15 ? 193 SER F N     1 
ATOM   2294 C  CA    . SER F 3 44 ? 19.390 -14.940 22.519  1.00 29.85 ? 193 SER F CA    1 
ATOM   2295 C  C     . SER F 3 44 ? 20.059 -16.281 22.319  1.00 29.22 ? 193 SER F C     1 
ATOM   2296 O  O     . SER F 3 44 ? 19.912 -17.164 23.165  1.00 28.52 ? 193 SER F O     1 
ATOM   2297 C  CB    . SER F 3 44 ? 17.887 -15.126 22.287  1.00 31.67 ? 193 SER F CB    1 
ATOM   2298 O  OG    . SER F 3 44 ? 17.173 -13.941 22.595  1.00 33.77 ? 193 SER F OG    1 
ATOM   2299 N  N     . VAL F 3 45 ? 20.754 -16.463 21.202  1.00 29.04 ? 194 VAL F N     1 
ATOM   2300 C  CA    . VAL F 3 45 ? 21.421 -17.733 20.935  1.00 28.39 ? 194 VAL F CA    1 
ATOM   2301 C  C     . VAL F 3 45 ? 22.931 -17.479 20.990  1.00 29.70 ? 194 VAL F C     1 
ATOM   2302 O  O     . VAL F 3 45 ? 23.495 -16.805 20.113  1.00 26.04 ? 194 VAL F O     1 
ATOM   2303 C  CB    . VAL F 3 45 ? 21.011 -18.295 19.548  1.00 30.03 ? 194 VAL F CB    1 
ATOM   2304 C  CG1   . VAL F 3 45 ? 21.712 -19.637 19.278  1.00 29.07 ? 194 VAL F CG1   1 
ATOM   2305 C  CG2   . VAL F 3 45 ? 19.492 -18.467 19.497  1.00 29.31 ? 194 VAL F CG2   1 
ATOM   2306 N  N     . PRO F 3 46 ? 23.602 -18.009 22.036  1.00 30.66 ? 195 PRO F N     1 
ATOM   2307 C  CA    . PRO F 3 46 ? 25.051 -17.828 22.209  1.00 32.35 ? 195 PRO F CA    1 
ATOM   2308 C  C     . PRO F 3 46 ? 25.850 -17.972 20.925  1.00 32.14 ? 195 PRO F C     1 
ATOM   2309 O  O     . PRO F 3 46 ? 26.625 -17.097 20.590  1.00 33.26 ? 195 PRO F O     1 
ATOM   2310 C  CB    . PRO F 3 46 ? 25.420 -18.861 23.289  1.00 32.23 ? 195 PRO F CB    1 
ATOM   2311 C  CG    . PRO F 3 46 ? 24.239 -19.814 23.326  1.00 33.69 ? 195 PRO F CG    1 
ATOM   2312 C  CD    . PRO F 3 46 ? 23.059 -18.926 23.053  1.00 30.91 ? 195 PRO F CD    1 
ATOM   2313 N  N     . TYR F 3 47 ? 25.636 -19.059 20.191  1.00 34.13 ? 196 TYR F N     1 
ATOM   2314 C  CA    . TYR F 3 47 ? 26.346 -19.275 18.934  1.00 33.91 ? 196 TYR F CA    1 
ATOM   2315 C  C     . TYR F 3 47 ? 26.287 -18.110 17.939  1.00 33.28 ? 196 TYR F C     1 
ATOM   2316 O  O     . TYR F 3 47 ? 27.244 -17.887 17.205  1.00 34.20 ? 196 TYR F O     1 
ATOM   2317 C  CB    . TYR F 3 47 ? 25.830 -20.541 18.241  1.00 36.21 ? 196 TYR F CB    1 
ATOM   2318 C  CG    . TYR F 3 47 ? 26.476 -20.780 16.896  1.00 39.96 ? 196 TYR F CG    1 
ATOM   2319 C  CD1   . TYR F 3 47 ? 27.834 -21.114 16.796  1.00 43.02 ? 196 TYR F CD1   1 
ATOM   2320 C  CD2   . TYR F 3 47 ? 25.747 -20.636 15.719  1.00 41.21 ? 196 TYR F CD2   1 
ATOM   2321 C  CE1   . TYR F 3 47 ? 28.445 -21.298 15.552  1.00 43.57 ? 196 TYR F CE1   1 
ATOM   2322 C  CE2   . TYR F 3 47 ? 26.345 -20.817 14.474  1.00 42.54 ? 196 TYR F CE2   1 
ATOM   2323 C  CZ    . TYR F 3 47 ? 27.691 -21.148 14.396  1.00 44.59 ? 196 TYR F CZ    1 
ATOM   2324 O  OH    . TYR F 3 47 ? 28.274 -21.318 13.158  1.00 45.52 ? 196 TYR F OH    1 
ATOM   2325 N  N     . PHE F 3 48 ? 25.181 -17.365 17.894  1.00 32.38 ? 197 PHE F N     1 
ATOM   2326 C  CA    . PHE F 3 48 ? 25.085 -16.254 16.936  1.00 31.94 ? 197 PHE F CA    1 
ATOM   2327 C  C     . PHE F 3 48 ? 25.448 -14.884 17.492  1.00 32.83 ? 197 PHE F C     1 
ATOM   2328 O  O     . PHE F 3 48 ? 25.543 -13.918 16.736  1.00 32.07 ? 197 PHE F O     1 
ATOM   2329 C  CB    . PHE F 3 48 ? 23.680 -16.167 16.321  1.00 29.84 ? 197 PHE F CB    1 
ATOM   2330 C  CG    . PHE F 3 48 ? 23.280 -17.384 15.530  1.00 27.34 ? 197 PHE F CG    1 
ATOM   2331 C  CD1   . PHE F 3 48 ? 22.536 -18.401 16.117  1.00 25.18 ? 197 PHE F CD1   1 
ATOM   2332 C  CD2   . PHE F 3 48 ? 23.657 -17.513 14.199  1.00 25.56 ? 197 PHE F CD2   1 
ATOM   2333 C  CE1   . PHE F 3 48 ? 22.172 -19.529 15.390  1.00 26.07 ? 197 PHE F CE1   1 
ATOM   2334 C  CE2   . PHE F 3 48 ? 23.303 -18.635 13.460  1.00 24.27 ? 197 PHE F CE2   1 
ATOM   2335 C  CZ    . PHE F 3 48 ? 22.554 -19.650 14.057  1.00 25.02 ? 197 PHE F CZ    1 
ATOM   2336 N  N     . LYS F 3 49 ? 25.652 -14.801 18.805  1.00 35.13 ? 198 LYS F N     1 
ATOM   2337 C  CA    . LYS F 3 49 ? 25.985 -13.538 19.466  1.00 36.97 ? 198 LYS F CA    1 
ATOM   2338 C  C     . LYS F 3 49 ? 27.164 -12.827 18.809  1.00 38.59 ? 198 LYS F C     1 
ATOM   2339 O  O     . LYS F 3 49 ? 27.237 -11.597 18.796  1.00 37.58 ? 198 LYS F O     1 
ATOM   2340 C  CB    . LYS F 3 49 ? 26.288 -13.787 20.957  1.00 37.45 ? 198 LYS F CB    1 
ATOM   2341 N  N     . ASP F 3 50 ? 28.082 -13.612 18.253  1.00 41.31 ? 199 ASP F N     1 
ATOM   2342 C  CA    . ASP F 3 50 ? 29.274 -13.070 17.612  1.00 44.56 ? 199 ASP F CA    1 
ATOM   2343 C  C     . ASP F 3 50 ? 29.180 -13.120 16.090  1.00 45.78 ? 199 ASP F C     1 
ATOM   2344 O  O     . ASP F 3 50 ? 30.189 -12.967 15.394  1.00 46.55 ? 199 ASP F O     1 
ATOM   2345 C  CB    . ASP F 3 50 ? 30.482 -13.882 18.051  1.00 47.12 ? 199 ASP F CB    1 
ATOM   2346 C  CG    . ASP F 3 50 ? 30.309 -15.357 17.752  1.00 50.37 ? 199 ASP F CG    1 
ATOM   2347 O  OD1   . ASP F 3 50 ? 29.431 -15.992 18.383  1.00 51.64 ? 199 ASP F OD1   1 
ATOM   2348 O  OD2   . ASP F 3 50 ? 31.034 -15.876 16.876  1.00 51.83 ? 199 ASP F OD2   1 
ATOM   2349 N  N     . LYS F 3 51 ? 27.979 -13.331 15.566  1.00 45.18 ? 200 LYS F N     1 
ATOM   2350 C  CA    . LYS F 3 51 ? 27.814 -13.415 14.125  1.00 44.96 ? 200 LYS F CA    1 
ATOM   2351 C  C     . LYS F 3 51 ? 26.738 -12.474 13.584  1.00 44.87 ? 200 LYS F C     1 
ATOM   2352 O  O     . LYS F 3 51 ? 26.017 -12.815 12.642  1.00 43.46 ? 200 LYS F O     1 
ATOM   2353 C  CB    . LYS F 3 51 ? 27.501 -14.862 13.749  1.00 45.19 ? 200 LYS F CB    1 
ATOM   2354 C  CG    . LYS F 3 51 ? 28.569 -15.834 14.213  1.00 46.55 ? 200 LYS F CG    1 
ATOM   2355 C  CD    . LYS F 3 51 ? 28.216 -17.273 13.869  1.00 47.11 ? 200 LYS F CD    1 
ATOM   2356 C  CE    . LYS F 3 51 ? 29.335 -18.237 14.264  1.00 47.66 ? 200 LYS F CE    1 
ATOM   2357 N  NZ    . LYS F 3 51 ? 29.637 -18.205 15.728  1.00 47.61 ? 200 LYS F NZ    1 
ATOM   2358 N  N     . GLY F 3 52 ? 26.649 -11.285 14.175  1.00 44.78 ? 201 GLY F N     1 
ATOM   2359 C  CA    . GLY F 3 52 ? 25.657 -10.311 13.753  1.00 45.03 ? 201 GLY F CA    1 
ATOM   2360 C  C     . GLY F 3 52 ? 26.179 -9.314  12.739  1.00 45.57 ? 201 GLY F C     1 
ATOM   2361 O  O     . GLY F 3 52 ? 25.398 -8.652  12.050  1.00 45.11 ? 201 GLY F O     1 
ATOM   2362 N  N     . ASP F 3 53 ? 27.502 -9.212  12.649  1.00 46.17 ? 202 ASP F N     1 
ATOM   2363 C  CA    . ASP F 3 53 ? 28.163 -8.297  11.719  1.00 47.65 ? 202 ASP F CA    1 
ATOM   2364 C  C     . ASP F 3 53 ? 27.830 -8.595  10.255  1.00 46.93 ? 202 ASP F C     1 
ATOM   2365 O  O     . ASP F 3 53 ? 27.636 -9.746  9.866   1.00 45.52 ? 202 ASP F O     1 
ATOM   2366 C  CB    . ASP F 3 53 ? 29.673 -8.392  11.888  1.00 51.33 ? 202 ASP F CB    1 
ATOM   2367 C  CG    . ASP F 3 53 ? 30.182 -9.805  11.677  1.00 54.33 ? 202 ASP F CG    1 
ATOM   2368 O  OD1   . ASP F 3 53 ? 30.097 -10.612 12.639  1.00 55.54 ? 202 ASP F OD1   1 
ATOM   2369 O  OD2   . ASP F 3 53 ? 30.636 -10.110 10.546  1.00 55.07 ? 202 ASP F OD2   1 
ATOM   2370 N  N     . SER F 3 54 ? 27.792 -7.544  9.446   1.00 47.55 ? 203 SER F N     1 
ATOM   2371 C  CA    . SER F 3 54 ? 27.490 -7.673  8.028   1.00 48.39 ? 203 SER F CA    1 
ATOM   2372 C  C     . SER F 3 54 ? 28.149 -8.916  7.455   1.00 48.78 ? 203 SER F C     1 
ATOM   2373 O  O     . SER F 3 54 ? 27.486 -9.780  6.876   1.00 49.41 ? 203 SER F O     1 
ATOM   2374 C  CB    . SER F 3 54 ? 27.978 -6.440  7.278   1.00 47.80 ? 203 SER F CB    1 
ATOM   2375 N  N     . ASN F 3 55 ? 29.461 -9.007  7.640   1.00 48.61 ? 204 ASN F N     1 
ATOM   2376 C  CA    . ASN F 3 55 ? 30.201 -10.135 7.111   1.00 48.02 ? 204 ASN F CA    1 
ATOM   2377 C  C     . ASN F 3 55 ? 29.612 -11.518 7.323   1.00 47.38 ? 204 ASN F C     1 
ATOM   2378 O  O     . ASN F 3 55 ? 29.003 -12.101 6.415   1.00 48.02 ? 204 ASN F O     1 
ATOM   2379 N  N     . SER F 3 56 ? 29.779 -12.027 8.538   1.00 44.75 ? 205 SER F N     1 
ATOM   2380 C  CA    . SER F 3 56 ? 29.348 -13.368 8.912   1.00 43.27 ? 205 SER F CA    1 
ATOM   2381 C  C     . SER F 3 56 ? 27.866 -13.681 9.157   1.00 41.15 ? 205 SER F C     1 
ATOM   2382 O  O     . SER F 3 56 ? 27.539 -14.751 9.683   1.00 40.48 ? 205 SER F O     1 
ATOM   2383 C  CB    . SER F 3 56 ? 30.149 -13.791 10.138  1.00 44.26 ? 205 SER F CB    1 
ATOM   2384 O  OG    . SER F 3 56 ? 30.109 -12.759 11.108  1.00 45.83 ? 205 SER F OG    1 
ATOM   2385 N  N     . SER F 3 57 ? 26.965 -12.789 8.772   1.00 38.82 ? 206 SER F N     1 
ATOM   2386 C  CA    . SER F 3 57 ? 25.544 -13.049 9.004   1.00 36.05 ? 206 SER F CA    1 
ATOM   2387 C  C     . SER F 3 57 ? 24.776 -13.402 7.730   1.00 34.27 ? 206 SER F C     1 
ATOM   2388 O  O     . SER F 3 57 ? 23.629 -13.842 7.796   1.00 33.32 ? 206 SER F O     1 
ATOM   2389 C  CB    . SER F 3 57 ? 24.896 -11.828 9.650   1.00 36.04 ? 206 SER F CB    1 
ATOM   2390 O  OG    . SER F 3 57 ? 25.011 -10.708 8.793   1.00 35.97 ? 206 SER F OG    1 
ATOM   2391 N  N     . ALA F 3 58 ? 25.407 -13.205 6.578   1.00 31.19 ? 207 ALA F N     1 
ATOM   2392 C  CA    . ALA F 3 58 ? 24.766 -13.474 5.304   1.00 29.71 ? 207 ALA F CA    1 
ATOM   2393 C  C     . ALA F 3 58 ? 24.089 -14.841 5.283   1.00 28.92 ? 207 ALA F C     1 
ATOM   2394 O  O     . ALA F 3 58 ? 22.884 -14.950 5.030   1.00 28.73 ? 207 ALA F O     1 
ATOM   2395 C  CB    . ALA F 3 58 ? 25.791 -13.379 4.175   1.00 29.59 ? 207 ALA F CB    1 
ATOM   2396 N  N     . GLY F 3 59 ? 24.870 -15.878 5.563   1.00 26.96 ? 208 GLY F N     1 
ATOM   2397 C  CA    . GLY F 3 59 ? 24.357 -17.235 5.551   1.00 24.63 ? 208 GLY F CA    1 
ATOM   2398 C  C     . GLY F 3 59 ? 23.163 -17.536 6.442   1.00 24.91 ? 208 GLY F C     1 
ATOM   2399 O  O     . GLY F 3 59 ? 22.114 -17.991 5.964   1.00 24.49 ? 208 GLY F O     1 
ATOM   2400 N  N     . TRP F 3 60 ? 23.298 -17.302 7.739   1.00 23.69 ? 209 TRP F N     1 
ATOM   2401 C  CA    . TRP F 3 60 ? 22.186 -17.625 8.607   1.00 23.97 ? 209 TRP F CA    1 
ATOM   2402 C  C     . TRP F 3 60 ? 20.985 -16.730 8.378   1.00 21.66 ? 209 TRP F C     1 
ATOM   2403 O  O     . TRP F 3 60 ? 19.864 -17.176 8.569   1.00 22.29 ? 209 TRP F O     1 
ATOM   2404 C  CB    . TRP F 3 60 ? 22.590 -17.637 10.102  1.00 21.90 ? 209 TRP F CB    1 
ATOM   2405 C  CG    . TRP F 3 60 ? 22.971 -16.318 10.703  1.00 22.98 ? 209 TRP F CG    1 
ATOM   2406 C  CD1   . TRP F 3 60 ? 24.232 -15.791 10.785  1.00 22.74 ? 209 TRP F CD1   1 
ATOM   2407 C  CD2   . TRP F 3 60 ? 22.102 -15.373 11.360  1.00 22.00 ? 209 TRP F CD2   1 
ATOM   2408 N  NE1   . TRP F 3 60 ? 24.204 -14.596 11.446  1.00 21.69 ? 209 TRP F NE1   1 
ATOM   2409 C  CE2   . TRP F 3 60 ? 22.914 -14.309 11.811  1.00 21.13 ? 209 TRP F CE2   1 
ATOM   2410 C  CE3   . TRP F 3 60 ? 20.719 -15.326 11.609  1.00 19.44 ? 209 TRP F CE3   1 
ATOM   2411 C  CZ2   . TRP F 3 60 ? 22.395 -13.203 12.499  1.00 21.56 ? 209 TRP F CZ2   1 
ATOM   2412 C  CZ3   . TRP F 3 60 ? 20.199 -14.227 12.297  1.00 18.76 ? 209 TRP F CZ3   1 
ATOM   2413 C  CH2   . TRP F 3 60 ? 21.039 -13.179 12.735  1.00 22.47 ? 209 TRP F CH2   1 
ATOM   2414 N  N     . LYS F 3 61 ? 21.197 -15.485 7.960   1.00 21.28 ? 210 LYS F N     1 
ATOM   2415 C  CA    . LYS F 3 61 ? 20.058 -14.606 7.708   1.00 20.39 ? 210 LYS F CA    1 
ATOM   2416 C  C     . LYS F 3 61 ? 19.272 -15.099 6.512   1.00 22.19 ? 210 LYS F C     1 
ATOM   2417 O  O     . LYS F 3 61 ? 18.028 -15.047 6.512   1.00 23.66 ? 210 LYS F O     1 
ATOM   2418 C  CB    . LYS F 3 61 ? 20.497 -13.154 7.482   1.00 18.41 ? 210 LYS F CB    1 
ATOM   2419 C  CG    . LYS F 3 61 ? 20.663 -12.364 8.785   1.00 17.59 ? 210 LYS F CG    1 
ATOM   2420 C  CD    . LYS F 3 61 ? 21.291 -10.974 8.587   1.00 16.32 ? 210 LYS F CD    1 
ATOM   2421 C  CE    . LYS F 3 61 ? 21.485 -10.282 9.936   1.00 15.08 ? 210 LYS F CE    1 
ATOM   2422 N  NZ    . LYS F 3 61 ? 22.153 -8.943  9.795   1.00 16.71 ? 210 LYS F NZ    1 
ATOM   2423 N  N     . ASN F 3 62 ? 19.983 -15.586 5.498   1.00 19.95 ? 211 ASN F N     1 
ATOM   2424 C  CA    . ASN F 3 62 ? 19.328 -16.093 4.296   1.00 20.45 ? 211 ASN F CA    1 
ATOM   2425 C  C     . ASN F 3 62 ? 18.463 -17.295 4.708   1.00 19.93 ? 211 ASN F C     1 
ATOM   2426 O  O     . ASN F 3 62 ? 17.323 -17.474 4.243   1.00 17.61 ? 211 ASN F O     1 
ATOM   2427 C  CB    . ASN F 3 62 ? 20.385 -16.498 3.257   1.00 22.58 ? 211 ASN F CB    1 
ATOM   2428 C  CG    . ASN F 3 62 ? 19.786 -17.176 2.035   1.00 23.09 ? 211 ASN F CG    1 
ATOM   2429 O  OD1   . ASN F 3 62 ? 18.916 -16.628 1.357   1.00 23.30 ? 211 ASN F OD1   1 
ATOM   2430 N  ND2   . ASN F 3 62 ? 20.262 -18.376 1.743   1.00 24.84 ? 211 ASN F ND2   1 
ATOM   2431 N  N     . SER F 3 63 ? 19.010 -18.105 5.604   1.00 17.52 ? 212 SER F N     1 
ATOM   2432 C  CA    . SER F 3 63 ? 18.289 -19.255 6.105   1.00 16.65 ? 212 SER F CA    1 
ATOM   2433 C  C     . SER F 3 63 ? 17.046 -18.810 6.884   1.00 15.33 ? 212 SER F C     1 
ATOM   2434 O  O     . SER F 3 63 ? 16.029 -19.483 6.846   1.00 15.45 ? 212 SER F O     1 
ATOM   2435 C  CB    . SER F 3 63 ? 19.195 -20.104 7.001   1.00 16.80 ? 212 SER F CB    1 
ATOM   2436 O  OG    . SER F 3 63 ? 19.710 -21.204 6.268   1.00 18.62 ? 212 SER F OG    1 
ATOM   2437 N  N     . ILE F 3 64 ? 17.126 -17.687 7.596   1.00 14.70 ? 213 ILE F N     1 
ATOM   2438 C  CA    . ILE F 3 64 ? 15.948 -17.217 8.333   1.00 14.30 ? 213 ILE F CA    1 
ATOM   2439 C  C     . ILE F 3 64 ? 14.832 -16.862 7.334   1.00 12.78 ? 213 ILE F C     1 
ATOM   2440 O  O     . ILE F 3 64 ? 13.703 -17.338 7.462   1.00 12.40 ? 213 ILE F O     1 
ATOM   2441 C  CB    . ILE F 3 64 ? 16.232 -15.960 9.204   1.00 13.03 ? 213 ILE F CB    1 
ATOM   2442 C  CG1   . ILE F 3 64 ? 17.239 -16.290 10.311  1.00 13.98 ? 213 ILE F CG1   1 
ATOM   2443 C  CG2   . ILE F 3 64 ? 14.914 -15.473 9.853   1.00 10.81 ? 213 ILE F CG2   1 
ATOM   2444 C  CD1   . ILE F 3 64 ? 16.783 -17.380 11.235  1.00 17.07 ? 213 ILE F CD1   1 
ATOM   2445 N  N     . ARG F 3 65 ? 15.152 -16.035 6.344   1.00 12.32 ? 214 ARG F N     1 
ATOM   2446 C  CA    . ARG F 3 65 ? 14.158 -15.638 5.335   1.00 13.51 ? 214 ARG F CA    1 
ATOM   2447 C  C     . ARG F 3 65 ? 13.589 -16.852 4.626   1.00 14.62 ? 214 ARG F C     1 
ATOM   2448 O  O     . ARG F 3 65 ? 12.376 -16.943 4.400   1.00 14.80 ? 214 ARG F O     1 
ATOM   2449 C  CB    . ARG F 3 65 ? 14.788 -14.685 4.317   1.00 11.49 ? 214 ARG F CB    1 
ATOM   2450 C  CG    . ARG F 3 65 ? 15.350 -13.420 4.994   1.00 13.09 ? 214 ARG F CG    1 
ATOM   2451 C  CD    . ARG F 3 65 ? 15.706 -12.352 3.979   1.00 15.03 ? 214 ARG F CD    1 
ATOM   2452 N  NE    . ARG F 3 65 ? 16.765 -12.792 3.085   1.00 14.73 ? 214 ARG F NE    1 
ATOM   2453 C  CZ    . ARG F 3 65 ? 18.058 -12.807 3.397   1.00 16.71 ? 214 ARG F CZ    1 
ATOM   2454 N  NH1   . ARG F 3 65 ? 18.466 -12.405 4.597   1.00 14.57 ? 214 ARG F NH1   1 
ATOM   2455 N  NH2   . ARG F 3 65 ? 18.952 -13.203 2.494   1.00 15.53 ? 214 ARG F NH2   1 
ATOM   2456 N  N     . HIS F 3 66 ? 14.473 -17.796 4.306   1.00 14.97 ? 215 HIS F N     1 
ATOM   2457 C  CA    . HIS F 3 66 ? 14.097 -19.027 3.608   1.00 15.50 ? 215 HIS F CA    1 
ATOM   2458 C  C     . HIS F 3 66 ? 13.028 -19.808 4.378   1.00 16.69 ? 215 HIS F C     1 
ATOM   2459 O  O     . HIS F 3 66 ? 12.022 -20.262 3.793   1.00 16.49 ? 215 HIS F O     1 
ATOM   2460 C  CB    . HIS F 3 66 ? 15.347 -19.903 3.405   1.00 15.43 ? 215 HIS F CB    1 
ATOM   2461 C  CG    . HIS F 3 66 ? 15.054 -21.311 2.977   1.00 18.29 ? 215 HIS F CG    1 
ATOM   2462 N  ND1   . HIS F 3 66 ? 14.580 -21.631 1.723   1.00 16.17 ? 215 HIS F ND1   1 
ATOM   2463 C  CD2   . HIS F 3 66 ? 15.174 -22.486 3.643   1.00 18.42 ? 215 HIS F CD2   1 
ATOM   2464 C  CE1   . HIS F 3 66 ? 14.419 -22.938 1.634   1.00 17.91 ? 215 HIS F CE1   1 
ATOM   2465 N  NE2   . HIS F 3 66 ? 14.772 -23.481 2.785   1.00 19.30 ? 215 HIS F NE2   1 
ATOM   2466 N  N     . ASN F 3 67 ? 13.257 -19.961 5.679   1.00 13.88 ? 216 ASN F N     1 
ATOM   2467 C  CA    . ASN F 3 67 ? 12.341 -20.699 6.538   1.00 16.98 ? 216 ASN F CA    1 
ATOM   2468 C  C     . ASN F 3 67 ? 11.007 -19.966 6.676   1.00 16.61 ? 216 ASN F C     1 
ATOM   2469 O  O     . ASN F 3 67 ? 9.949  -20.584 6.603   1.00 16.14 ? 216 ASN F O     1 
ATOM   2470 C  CB    . ASN F 3 67 ? 12.962 -20.910 7.927   1.00 14.57 ? 216 ASN F CB    1 
ATOM   2471 C  CG    . ASN F 3 67 ? 13.829 -22.158 8.004   1.00 18.17 ? 216 ASN F CG    1 
ATOM   2472 O  OD1   . ASN F 3 67 ? 13.355 -23.237 8.383   1.00 15.62 ? 216 ASN F OD1   1 
ATOM   2473 N  ND2   . ASN F 3 67 ? 15.107 -22.022 7.629   1.00 13.93 ? 216 ASN F ND2   1 
ATOM   2474 N  N     . LEU F 3 68 ? 11.067 -18.652 6.876   1.00 16.35 ? 217 LEU F N     1 
ATOM   2475 C  CA    . LEU F 3 68 ? 9.847  -17.872 7.027   1.00 16.22 ? 217 LEU F CA    1 
ATOM   2476 C  C     . LEU F 3 68 ? 8.938  -18.081 5.816   1.00 17.64 ? 217 LEU F C     1 
ATOM   2477 O  O     . LEU F 3 68 ? 7.765  -18.419 5.975   1.00 17.98 ? 217 LEU F O     1 
ATOM   2478 C  CB    . LEU F 3 68 ? 10.171 -16.378 7.217   1.00 13.16 ? 217 LEU F CB    1 
ATOM   2479 C  CG    . LEU F 3 68 ? 10.748 -16.060 8.609   1.00 9.60  ? 217 LEU F CG    1 
ATOM   2480 C  CD1   . LEU F 3 68 ? 11.253 -14.660 8.663   1.00 8.02  ? 217 LEU F CD1   1 
ATOM   2481 C  CD2   . LEU F 3 68 ? 9.664  -16.256 9.665   1.00 11.34 ? 217 LEU F CD2   1 
ATOM   2482 N  N     . SER F 3 69 ? 9.487  -17.906 4.621   1.00 17.01 ? 218 SER F N     1 
ATOM   2483 C  CA    . SER F 3 69 ? 8.720  -18.080 3.401   1.00 19.43 ? 218 SER F CA    1 
ATOM   2484 C  C     . SER F 3 69 ? 8.310  -19.504 3.125   1.00 18.63 ? 218 SER F C     1 
ATOM   2485 O  O     . SER F 3 69 ? 7.183  -19.754 2.717   1.00 19.44 ? 218 SER F O     1 
ATOM   2486 C  CB    . SER F 3 69 ? 9.510  -17.575 2.187   1.00 22.14 ? 218 SER F CB    1 
ATOM   2487 O  OG    . SER F 3 69 ? 9.517  -16.161 2.141   1.00 25.59 ? 218 SER F OG    1 
ATOM   2488 N  N     . LEU F 3 70 ? 9.226  -20.440 3.340   1.00 20.38 ? 219 LEU F N     1 
ATOM   2489 C  CA    . LEU F 3 70 ? 8.964  -21.844 3.058   1.00 20.19 ? 219 LEU F CA    1 
ATOM   2490 C  C     . LEU F 3 70 ? 7.893  -22.537 3.888   1.00 20.98 ? 219 LEU F C     1 
ATOM   2491 O  O     . LEU F 3 70 ? 7.022  -23.204 3.331   1.00 22.09 ? 219 LEU F O     1 
ATOM   2492 C  CB    . LEU F 3 70 ? 10.245 -22.667 3.201   1.00 20.41 ? 219 LEU F CB    1 
ATOM   2493 C  CG    . LEU F 3 70 ? 10.569 -23.749 2.148   1.00 27.02 ? 219 LEU F CG    1 
ATOM   2494 C  CD1   . LEU F 3 70 ? 11.515 -24.776 2.777   1.00 25.50 ? 219 LEU F CD1   1 
ATOM   2495 C  CD2   . LEU F 3 70 ? 9.303  -24.453 1.627   1.00 24.31 ? 219 LEU F CD2   1 
ATOM   2496 N  N     . HIS F 3 71 ? 7.952  -22.390 5.211   1.00 21.13 ? 220 HIS F N     1 
ATOM   2497 C  CA    . HIS F 3 71 ? 7.027  -23.123 6.079   1.00 22.54 ? 220 HIS F CA    1 
ATOM   2498 C  C     . HIS F 3 71 ? 5.708  -22.472 6.379   1.00 21.67 ? 220 HIS F C     1 
ATOM   2499 O  O     . HIS F 3 71 ? 5.641  -21.339 6.840   1.00 20.88 ? 220 HIS F O     1 
ATOM   2500 C  CB    . HIS F 3 71 ? 7.732  -23.506 7.382   1.00 22.56 ? 220 HIS F CB    1 
ATOM   2501 C  CG    . HIS F 3 71 ? 9.061  -24.160 7.158   1.00 26.59 ? 220 HIS F CG    1 
ATOM   2502 N  ND1   . HIS F 3 71 ? 9.199  -25.335 6.449   1.00 26.96 ? 220 HIS F ND1   1 
ATOM   2503 C  CD2   . HIS F 3 71 ? 10.317 -23.761 7.471   1.00 26.36 ? 220 HIS F CD2   1 
ATOM   2504 C  CE1   . HIS F 3 71 ? 10.482 -25.626 6.328   1.00 27.54 ? 220 HIS F CE1   1 
ATOM   2505 N  NE2   . HIS F 3 71 ? 11.182 -24.687 6.940   1.00 27.78 ? 220 HIS F NE2   1 
ATOM   2506 N  N     . SER F 3 72 ? 4.650  -23.227 6.133   1.00 21.54 ? 221 SER F N     1 
ATOM   2507 C  CA    . SER F 3 72 ? 3.305  -22.734 6.339   1.00 23.17 ? 221 SER F CA    1 
ATOM   2508 C  C     . SER F 3 72 ? 2.996  -22.415 7.805   1.00 23.29 ? 221 SER F C     1 
ATOM   2509 O  O     . SER F 3 72 ? 1.991  -21.784 8.081   1.00 24.32 ? 221 SER F O     1 
ATOM   2510 C  CB    . SER F 3 72 ? 2.304  -23.749 5.792   1.00 24.24 ? 221 SER F CB    1 
ATOM   2511 O  OG    . SER F 3 72 ? 2.478  -24.995 6.435   1.00 29.08 ? 221 SER F OG    1 
ATOM   2512 N  N     . LYS F 3 73 ? 3.852  -22.830 8.738   1.00 22.45 ? 222 LYS F N     1 
ATOM   2513 C  CA    . LYS F 3 73 ? 3.602  -22.528 10.144  1.00 23.52 ? 222 LYS F CA    1 
ATOM   2514 C  C     . LYS F 3 73 ? 3.874  -21.048 10.452  1.00 22.56 ? 222 LYS F C     1 
ATOM   2515 O  O     . LYS F 3 73 ? 3.549  -20.573 11.540  1.00 23.94 ? 222 LYS F O     1 
ATOM   2516 C  CB    . LYS F 3 73 ? 4.455  -23.405 11.074  1.00 25.00 ? 222 LYS F CB    1 
ATOM   2517 C  CG    . LYS F 3 73 ? 5.925  -23.012 11.170  1.00 27.63 ? 222 LYS F CG    1 
ATOM   2518 C  CD    . LYS F 3 73 ? 6.664  -23.872 12.206  1.00 29.08 ? 222 LYS F CD    1 
ATOM   2519 C  CE    . LYS F 3 73 ? 6.174  -23.557 13.633  1.00 31.62 ? 222 LYS F CE    1 
ATOM   2520 N  NZ    . LYS F 3 73 ? 6.862  -24.357 14.692  1.00 30.43 ? 222 LYS F NZ    1 
ATOM   2521 N  N     . PHE F 3 74 ? 4.481  -20.333 9.507   1.00 19.35 ? 223 PHE F N     1 
ATOM   2522 C  CA    . PHE F 3 74 ? 4.749  -18.899 9.681   1.00 18.44 ? 223 PHE F CA    1 
ATOM   2523 C  C     . PHE F 3 74 ? 3.897  -18.141 8.678   1.00 19.30 ? 223 PHE F C     1 
ATOM   2524 O  O     . PHE F 3 74 ? 3.809  -18.538 7.517   1.00 17.01 ? 223 PHE F O     1 
ATOM   2525 C  CB    . PHE F 3 74 ? 6.209  -18.546 9.379   1.00 15.30 ? 223 PHE F CB    1 
ATOM   2526 C  CG    . PHE F 3 74 ? 7.193  -19.349 10.159  1.00 13.80 ? 223 PHE F CG    1 
ATOM   2527 C  CD1   . PHE F 3 74 ? 7.191  -19.303 11.545  1.00 11.72 ? 223 PHE F CD1   1 
ATOM   2528 C  CD2   . PHE F 3 74 ? 8.116  -20.145 9.508   1.00 10.07 ? 223 PHE F CD2   1 
ATOM   2529 C  CE1   . PHE F 3 74 ? 8.110  -20.046 12.289  1.00 17.14 ? 223 PHE F CE1   1 
ATOM   2530 C  CE2   . PHE F 3 74 ? 9.053  -20.907 10.244  1.00 14.48 ? 223 PHE F CE2   1 
ATOM   2531 C  CZ    . PHE F 3 74 ? 9.046  -20.854 11.637  1.00 11.44 ? 223 PHE F CZ    1 
ATOM   2532 N  N     . ILE F 3 75 ? 3.256  -17.067 9.114   1.00 18.76 ? 224 ILE F N     1 
ATOM   2533 C  CA    . ILE F 3 75 ? 2.483  -16.303 8.167   1.00 20.90 ? 224 ILE F CA    1 
ATOM   2534 C  C     . ILE F 3 75 ? 2.931  -14.862 8.172   1.00 19.87 ? 224 ILE F C     1 
ATOM   2535 O  O     . ILE F 3 75 ? 3.401  -14.345 9.182   1.00 19.02 ? 224 ILE F O     1 
ATOM   2536 C  CB    . ILE F 3 75 ? 0.988  -16.404 8.434   1.00 24.33 ? 224 ILE F CB    1 
ATOM   2537 C  CG1   . ILE F 3 75 ? 0.679  -15.956 9.855   1.00 25.44 ? 224 ILE F CG1   1 
ATOM   2538 C  CG2   . ILE F 3 75 ? 0.525  -17.845 8.196   1.00 24.94 ? 224 ILE F CG2   1 
ATOM   2539 C  CD1   . ILE F 3 75 ? -0.674 -15.325 9.950   1.00 27.72 ? 224 ILE F CD1   1 
ATOM   2540 N  N     . ARG F 3 76 ? 2.805  -14.232 7.015   1.00 19.62 ? 225 ARG F N     1 
ATOM   2541 C  CA    . ARG F 3 76 ? 3.215  -12.858 6.827   1.00 21.39 ? 225 ARG F CA    1 
ATOM   2542 C  C     . ARG F 3 76 ? 2.022  -11.911 6.967   1.00 20.95 ? 225 ARG F C     1 
ATOM   2543 O  O     . ARG F 3 76 ? 0.970  -12.140 6.362   1.00 20.13 ? 225 ARG F O     1 
ATOM   2544 C  CB    . ARG F 3 76 ? 3.826  -12.721 5.437   1.00 22.20 ? 225 ARG F CB    1 
ATOM   2545 C  CG    . ARG F 3 76 ? 4.559  -11.437 5.216   1.00 27.10 ? 225 ARG F CG    1 
ATOM   2546 C  CD    . ARG F 3 76 ? 5.524  -11.573 4.055   1.00 28.76 ? 225 ARG F CD    1 
ATOM   2547 N  NE    . ARG F 3 76 ? 4.853  -11.578 2.765   1.00 30.10 ? 225 ARG F NE    1 
ATOM   2548 C  CZ    . ARG F 3 76 ? 4.243  -10.519 2.239   1.00 33.88 ? 225 ARG F CZ    1 
ATOM   2549 N  NH1   . ARG F 3 76 ? 4.215  -9.366  2.903   1.00 32.03 ? 225 ARG F NH1   1 
ATOM   2550 N  NH2   . ARG F 3 76 ? 3.671  -10.611 1.040   1.00 35.06 ? 225 ARG F NH2   1 
ATOM   2551 N  N     . VAL F 3 77 ? 2.181  -10.863 7.767   1.00 19.51 ? 226 VAL F N     1 
ATOM   2552 C  CA    . VAL F 3 77 ? 1.109  -9.894  7.937   1.00 21.14 ? 226 VAL F CA    1 
ATOM   2553 C  C     . VAL F 3 77 ? 1.580  -8.505  7.518   1.00 22.03 ? 226 VAL F C     1 
ATOM   2554 O  O     . VAL F 3 77 ? 2.522  -7.951  8.089   1.00 20.61 ? 226 VAL F O     1 
ATOM   2555 C  CB    . VAL F 3 77 ? 0.585  -9.839  9.410   1.00 21.46 ? 226 VAL F CB    1 
ATOM   2556 C  CG1   . VAL F 3 77 ? -0.406 -8.697  9.567   1.00 20.14 ? 226 VAL F CG1   1 
ATOM   2557 C  CG2   . VAL F 3 77 ? -0.106 -11.147 9.779   1.00 22.50 ? 226 VAL F CG2   1 
ATOM   2558 N  N     . GLN F 3 78 ? 0.918  -7.969  6.497   1.00 24.68 ? 227 GLN F N     1 
ATOM   2559 C  CA    . GLN F 3 78 ? 1.193  -6.637  5.954   1.00 28.28 ? 227 GLN F CA    1 
ATOM   2560 C  C     . GLN F 3 78 ? 1.366  -5.635  7.084   1.00 27.75 ? 227 GLN F C     1 
ATOM   2561 O  O     . GLN F 3 78 ? 0.516  -5.557  7.956   1.00 27.72 ? 227 GLN F O     1 
ATOM   2562 C  CB    . GLN F 3 78 ? 0.026  -6.205  5.057   1.00 30.95 ? 227 GLN F CB    1 
ATOM   2563 C  CG    . GLN F 3 78 ? 0.014  -4.721  4.753   1.00 34.99 ? 227 GLN F CG    1 
ATOM   2564 C  CD    . GLN F 3 78 ? 1.310  -4.270  4.127   1.00 36.94 ? 227 GLN F CD    1 
ATOM   2565 O  OE1   . GLN F 3 78 ? 1.691  -4.749  3.053   1.00 39.41 ? 227 GLN F OE1   1 
ATOM   2566 N  NE2   . GLN F 3 78 ? 2.011  -3.353  4.799   1.00 38.51 ? 227 GLN F NE2   1 
ATOM   2567 N  N     . ASN F 3 79 ? 2.456  -4.871  7.068   1.00 30.48 ? 228 ASN F N     1 
ATOM   2568 C  CA    . ASN F 3 79 ? 2.711  -3.911  8.143   1.00 32.32 ? 228 ASN F CA    1 
ATOM   2569 C  C     . ASN F 3 79 ? 1.988  -2.593  7.992   1.00 37.21 ? 228 ASN F C     1 
ATOM   2570 O  O     . ASN F 3 79 ? 1.594  -2.146  6.898   1.00 37.06 ? 228 ASN F O     1 
ATOM   2571 C  CB    . ASN F 3 79 ? 4.208  -3.620  8.329   1.00 33.40 ? 228 ASN F CB    1 
ATOM   2572 C  CG    . ASN F 3 79 ? 4.543  -3.039  9.733   1.00 35.71 ? 228 ASN F CG    1 
ATOM   2573 O  OD1   . ASN F 3 79 ? 3.985  -2.022  10.165  1.00 28.92 ? 228 ASN F OD1   1 
ATOM   2574 N  ND2   . ASN F 3 79 ? 5.473  -3.699  10.439  1.00 36.54 ? 228 ASN F ND2   1 
ATOM   2575 N  N     . GLU F 3 80 ? 1.868  -1.963  9.145   1.00 38.63 ? 229 GLU F N     1 
ATOM   2576 C  CA    . GLU F 3 80 ? 1.172  -0.726  9.323   1.00 41.20 ? 229 GLU F CA    1 
ATOM   2577 C  C     . GLU F 3 80 ? 1.869  0.554   8.842   1.00 41.39 ? 229 GLU F C     1 
ATOM   2578 O  O     . GLU F 3 80 ? 1.278  1.349   8.102   1.00 40.93 ? 229 GLU F O     1 
ATOM   2579 C  CB    . GLU F 3 80 ? 0.802  -0.644  10.807  1.00 42.50 ? 229 GLU F CB    1 
ATOM   2580 C  CG    . GLU F 3 80 ? 0.001  -1.851  11.321  1.00 45.86 ? 229 GLU F CG    1 
ATOM   2581 C  CD    . GLU F 3 80 ? 0.847  -2.802  12.098  1.00 44.67 ? 229 GLU F CD    1 
ATOM   2582 O  OE1   . GLU F 3 80 ? 1.732  -2.300  12.821  1.00 44.30 ? 229 GLU F OE1   1 
ATOM   2583 O  OE2   . GLU F 3 80 ? 0.606  -4.030  11.995  1.00 45.78 ? 229 GLU F OE2   1 
ATOM   2584 N  N     . GLY F 3 81 ? 3.116  0.759   9.251   1.00 40.13 ? 230 GLY F N     1 
ATOM   2585 C  CA    . GLY F 3 81 ? 3.815  1.955   8.825   1.00 38.57 ? 230 GLY F CA    1 
ATOM   2586 C  C     . GLY F 3 81 ? 4.315  1.961   7.383   1.00 37.24 ? 230 GLY F C     1 
ATOM   2587 O  O     . GLY F 3 81 ? 4.613  0.918   6.787   1.00 37.10 ? 230 GLY F O     1 
ATOM   2588 N  N     . THR F 3 82 ? 4.394  3.165   6.831   1.00 35.45 ? 231 THR F N     1 
ATOM   2589 C  CA    . THR F 3 82 ? 4.886  3.409   5.486   1.00 33.07 ? 231 THR F CA    1 
ATOM   2590 C  C     . THR F 3 82 ? 6.339  2.961   5.430   1.00 31.50 ? 231 THR F C     1 
ATOM   2591 O  O     . THR F 3 82 ? 7.143  3.380   6.250   1.00 29.40 ? 231 THR F O     1 
ATOM   2592 C  CB    . THR F 3 82 ? 4.858  4.909   5.187   1.00 35.89 ? 231 THR F CB    1 
ATOM   2593 O  OG1   . THR F 3 82 ? 3.497  5.370   5.190   1.00 36.94 ? 231 THR F OG1   1 
ATOM   2594 C  CG2   . THR F 3 82 ? 5.528  5.205   3.849   1.00 34.93 ? 231 THR F CG2   1 
ATOM   2595 N  N     . GLY F 3 83 ? 6.678  2.110   4.470   1.00 31.05 ? 232 GLY F N     1 
ATOM   2596 C  CA    . GLY F 3 83 ? 8.052  1.648   4.361   1.00 28.79 ? 232 GLY F CA    1 
ATOM   2597 C  C     . GLY F 3 83 ? 8.464  0.553   5.341   1.00 28.23 ? 232 GLY F C     1 
ATOM   2598 O  O     . GLY F 3 83 ? 9.622  0.140   5.354   1.00 28.06 ? 232 GLY F O     1 
ATOM   2599 N  N     . LYS F 3 84 ? 7.528  0.063   6.150   1.00 25.73 ? 233 LYS F N     1 
ATOM   2600 C  CA    . LYS F 3 84 ? 7.848  -0.973  7.119   1.00 23.32 ? 233 LYS F CA    1 
ATOM   2601 C  C     . LYS F 3 84 ? 7.566  -2.376  6.596   1.00 20.91 ? 233 LYS F C     1 
ATOM   2602 O  O     . LYS F 3 84 ? 6.604  -2.598  5.862   1.00 16.28 ? 233 LYS F O     1 
ATOM   2603 C  CB    . LYS F 3 84 ? 7.085  -0.711  8.416   1.00 27.67 ? 233 LYS F CB    1 
ATOM   2604 C  CG    . LYS F 3 84 ? 7.645  0.464   9.190   1.00 32.10 ? 233 LYS F CG    1 
ATOM   2605 C  CD    . LYS F 3 84 ? 6.844  0.740   10.451  1.00 36.34 ? 233 LYS F CD    1 
ATOM   2606 C  CE    . LYS F 3 84 ? 7.563  1.770   11.308  1.00 39.05 ? 233 LYS F CE    1 
ATOM   2607 N  NZ    . LYS F 3 84 ? 7.910  2.989   10.523  1.00 38.75 ? 233 LYS F NZ    1 
ATOM   2608 N  N     . SER F 3 85 ? 8.418  -3.321  6.984   1.00 18.84 ? 234 SER F N     1 
ATOM   2609 C  CA    . SER F 3 85 ? 8.285  -4.692  6.528   1.00 17.96 ? 234 SER F CA    1 
ATOM   2610 C  C     . SER F 3 85 ? 7.231  -5.465  7.314   1.00 17.90 ? 234 SER F C     1 
ATOM   2611 O  O     . SER F 3 85 ? 6.711  -4.992  8.332   1.00 16.41 ? 234 SER F O     1 
ATOM   2612 C  CB    . SER F 3 85 ? 9.649  -5.403  6.569   1.00 19.41 ? 234 SER F CB    1 
ATOM   2613 O  OG    . SER F 3 85 ? 10.106 -5.627  7.887   1.00 19.62 ? 234 SER F OG    1 
ATOM   2614 N  N     . SER F 3 86 ? 6.911  -6.655  6.833   1.00 14.12 ? 235 SER F N     1 
ATOM   2615 C  CA    . SER F 3 86 ? 5.869  -7.447  7.455   1.00 15.98 ? 235 SER F CA    1 
ATOM   2616 C  C     . SER F 3 86 ? 6.086  -7.911  8.882   1.00 14.77 ? 235 SER F C     1 
ATOM   2617 O  O     . SER F 3 86 ? 7.191  -8.005  9.378   1.00 16.32 ? 235 SER F O     1 
ATOM   2618 C  CB    . SER F 3 86 ? 5.574  -8.687  6.603   1.00 17.62 ? 235 SER F CB    1 
ATOM   2619 O  OG    . SER F 3 86 ? 5.526  -8.373  5.222   1.00 20.67 ? 235 SER F OG    1 
ATOM   2620 N  N     . TRP F 3 87 ? 4.978  -8.204  9.529   1.00 13.28 ? 236 TRP F N     1 
ATOM   2621 C  CA    . TRP F 3 87 ? 4.989  -8.760  10.849  1.00 13.46 ? 236 TRP F CA    1 
ATOM   2622 C  C     . TRP F 3 87 ? 4.956  -10.264 10.538  1.00 13.21 ? 236 TRP F C     1 
ATOM   2623 O  O     . TRP F 3 87 ? 4.194  -10.706 9.659   1.00 11.49 ? 236 TRP F O     1 
ATOM   2624 C  CB    . TRP F 3 87 ? 3.707  -8.407  11.607  1.00 14.16 ? 236 TRP F CB    1 
ATOM   2625 C  CG    . TRP F 3 87 ? 3.627  -7.022  12.136  1.00 15.14 ? 236 TRP F CG    1 
ATOM   2626 C  CD1   . TRP F 3 87 ? 2.688  -6.104  11.830  1.00 15.43 ? 236 TRP F CD1   1 
ATOM   2627 C  CD2   . TRP F 3 87 ? 4.500  -6.404  13.097  1.00 18.80 ? 236 TRP F CD2   1 
ATOM   2628 N  NE1   . TRP F 3 87 ? 2.906  -4.951  12.532  1.00 18.67 ? 236 TRP F NE1   1 
ATOM   2629 C  CE2   . TRP F 3 87 ? 4.014  -5.100  13.317  1.00 18.48 ? 236 TRP F CE2   1 
ATOM   2630 C  CE3   . TRP F 3 87 ? 5.648  -6.825  13.790  1.00 19.32 ? 236 TRP F CE3   1 
ATOM   2631 C  CZ2   . TRP F 3 87 ? 4.630  -4.197  14.202  1.00 21.86 ? 236 TRP F CZ2   1 
ATOM   2632 C  CZ3   . TRP F 3 87 ? 6.270  -5.920  14.682  1.00 19.91 ? 236 TRP F CZ3   1 
ATOM   2633 C  CH2   . TRP F 3 87 ? 5.754  -4.622  14.874  1.00 20.63 ? 236 TRP F CH2   1 
ATOM   2634 N  N     . TRP F 3 88 ? 5.771  -11.044 11.237  1.00 11.96 ? 237 TRP F N     1 
ATOM   2635 C  CA    . TRP F 3 88 ? 5.772  -12.485 11.054  1.00 12.21 ? 237 TRP F CA    1 
ATOM   2636 C  C     . TRP F 3 88 ? 5.203  -13.139 12.299  1.00 11.95 ? 237 TRP F C     1 
ATOM   2637 O  O     . TRP F 3 88 ? 5.631  -12.850 13.398  1.00 14.28 ? 237 TRP F O     1 
ATOM   2638 C  CB    . TRP F 3 88 ? 7.183  -13.015 10.821  1.00 13.16 ? 237 TRP F CB    1 
ATOM   2639 C  CG    . TRP F 3 88 ? 7.715  -12.696 9.483   1.00 13.56 ? 237 TRP F CG    1 
ATOM   2640 C  CD1   . TRP F 3 88 ? 8.584  -11.693 9.161   1.00 12.25 ? 237 TRP F CD1   1 
ATOM   2641 C  CD2   . TRP F 3 88 ? 7.449  -13.408 8.274   1.00 12.21 ? 237 TRP F CD2   1 
ATOM   2642 N  NE1   . TRP F 3 88 ? 8.882  -11.746 7.819   1.00 12.51 ? 237 TRP F NE1   1 
ATOM   2643 C  CE2   . TRP F 3 88 ? 8.197  -12.789 7.252   1.00 13.21 ? 237 TRP F CE2   1 
ATOM   2644 C  CE3   . TRP F 3 88 ? 6.654  -14.509 7.956   1.00 10.64 ? 237 TRP F CE3   1 
ATOM   2645 C  CZ2   . TRP F 3 88 ? 8.173  -13.241 5.926   1.00 12.72 ? 237 TRP F CZ2   1 
ATOM   2646 C  CZ3   . TRP F 3 88 ? 6.630  -14.956 6.640   1.00 12.59 ? 237 TRP F CZ3   1 
ATOM   2647 C  CH2   . TRP F 3 88 ? 7.383  -14.325 5.645   1.00 12.43 ? 237 TRP F CH2   1 
ATOM   2648 N  N     . MET F 3 89 ? 4.237  -14.023 12.134  1.00 15.38 ? 238 MET F N     1 
ATOM   2649 C  CA    . MET F 3 89 ? 3.670  -14.678 13.299  1.00 18.91 ? 238 MET F CA    1 
ATOM   2650 C  C     . MET F 3 89 ? 3.444  -16.156 13.058  1.00 19.62 ? 238 MET F C     1 
ATOM   2651 O  O     . MET F 3 89 ? 3.632  -16.647 11.944  1.00 18.69 ? 238 MET F O     1 
ATOM   2652 C  CB    . MET F 3 89 ? 2.380  -13.969 13.751  1.00 19.89 ? 238 MET F CB    1 
ATOM   2653 C  CG    . MET F 3 89 ? 1.441  -13.536 12.645  1.00 23.53 ? 238 MET F CG    1 
ATOM   2654 S  SD    . MET F 3 89 ? 0.118  -12.393 13.210  1.00 28.97 ? 238 MET F SD    1 
ATOM   2655 C  CE    . MET F 3 89 ? -0.551 -13.257 14.607  1.00 24.99 ? 238 MET F CE    1 
ATOM   2656 N  N     . LEU F 3 90 ? 3.074  -16.863 14.115  1.00 20.32 ? 239 LEU F N     1 
ATOM   2657 C  CA    . LEU F 3 90 ? 2.856  -18.286 14.033  1.00 24.75 ? 239 LEU F CA    1 
ATOM   2658 C  C     . LEU F 3 90 ? 1.467  -18.585 13.515  1.00 27.91 ? 239 LEU F C     1 
ATOM   2659 O  O     . LEU F 3 90 ? 0.508  -17.897 13.852  1.00 27.28 ? 239 LEU F O     1 
ATOM   2660 C  CB    . LEU F 3 90 ? 3.075  -18.922 15.409  1.00 23.47 ? 239 LEU F CB    1 
ATOM   2661 C  CG    . LEU F 3 90 ? 4.515  -18.714 15.903  1.00 25.52 ? 239 LEU F CG    1 
ATOM   2662 C  CD1   . LEU F 3 90 ? 4.616  -18.995 17.395  1.00 28.10 ? 239 LEU F CD1   1 
ATOM   2663 C  CD2   . LEU F 3 90 ? 5.442  -19.609 15.128  1.00 25.13 ? 239 LEU F CD2   1 
ATOM   2664 N  N     . ASN F 3 91 ? 1.365  -19.610 12.677  1.00 31.78 ? 240 ASN F N     1 
ATOM   2665 C  CA    . ASN F 3 91 ? 0.084  -19.968 12.121  1.00 35.75 ? 240 ASN F CA    1 
ATOM   2666 C  C     . ASN F 3 91 ? -0.833 -20.515 13.193  1.00 38.52 ? 240 ASN F C     1 
ATOM   2667 O  O     . ASN F 3 91 ? -0.562 -21.564 13.800  1.00 35.58 ? 240 ASN F O     1 
ATOM   2668 C  CB    . ASN F 3 91 ? 0.233  -20.985 11.002  1.00 37.93 ? 240 ASN F CB    1 
ATOM   2669 C  CG    . ASN F 3 91 ? -1.100 -21.406 10.447  1.00 40.56 ? 240 ASN F CG    1 
ATOM   2670 O  OD1   . ASN F 3 91 ? -1.825 -22.188 11.066  1.00 42.11 ? 240 ASN F OD1   1 
ATOM   2671 N  ND2   . ASN F 3 91 ? -1.450 -20.871 9.285   1.00 42.00 ? 240 ASN F ND2   1 
ATOM   2672 N  N     . PRO F 3 92 ? -1.949 -19.805 13.429  1.00 41.96 ? 241 PRO F N     1 
ATOM   2673 C  CA    . PRO F 3 92 ? -2.956 -20.168 14.428  1.00 45.01 ? 241 PRO F CA    1 
ATOM   2674 C  C     . PRO F 3 92 ? -3.423 -21.604 14.239  1.00 47.93 ? 241 PRO F C     1 
ATOM   2675 O  O     . PRO F 3 92 ? -3.275 -22.386 15.212  1.00 49.90 ? 241 PRO F O     1 
ATOM   2676 C  CB    . PRO F 3 92 ? -4.066 -19.140 14.190  1.00 45.20 ? 241 PRO F CB    1 
ATOM   2677 C  CG    . PRO F 3 92 ? -3.945 -18.833 12.722  1.00 45.30 ? 241 PRO F CG    1 
ATOM   2678 C  CD    . PRO F 3 92 ? -2.446 -18.728 12.549  1.00 43.29 ? 241 PRO F CD    1 
HETATM 2679 CA CA    . CA  G 4 .  ? 8.089  17.838  27.629  1.00 50.77 ? 1   CA  C CA    1 
HETATM 2680 CA CA    . CA  H 4 .  ? 5.091  -18.925 5.035   1.00 55.51 ? 2   CA  F CA    1 
HETATM 2681 O  O     . HOH I 5 .  ? 18.338 6.496   27.184  1.00 13.71 ? 13  HOH A O     1 
HETATM 2682 O  O     . HOH I 5 .  ? 7.261  15.523  29.629  1.00 38.21 ? 14  HOH A O     1 
HETATM 2683 O  O     . HOH I 5 .  ? 8.086  5.356   29.872  1.00 46.19 ? 15  HOH A O     1 
HETATM 2684 O  O     . HOH I 5 .  ? 19.495 -4.081  30.363  1.00 43.96 ? 16  HOH A O     1 
HETATM 2685 O  O     . HOH I 5 .  ? 28.962 24.350  29.491  1.00 48.28 ? 17  HOH A O     1 
HETATM 2686 O  O     . HOH I 5 .  ? 20.167 9.959   32.910  1.00 21.08 ? 18  HOH A O     1 
HETATM 2687 O  O     . HOH I 5 .  ? 13.386 10.112  28.486  1.00 32.55 ? 19  HOH A O     1 
HETATM 2688 O  O     . HOH I 5 .  ? 23.773 28.705  38.627  1.00 30.25 ? 20  HOH A O     1 
HETATM 2689 O  O     . HOH I 5 .  ? 20.437 27.639  35.487  1.00 39.91 ? 21  HOH A O     1 
HETATM 2690 O  O     . HOH I 5 .  ? 20.989 5.337   27.534  1.00 19.01 ? 22  HOH A O     1 
HETATM 2691 O  O     . HOH I 5 .  ? 19.068 3.160   23.768  1.00 26.51 ? 23  HOH A O     1 
HETATM 2692 O  O     . HOH I 5 .  ? 17.936 24.281  32.197  1.00 25.65 ? 24  HOH A O     1 
HETATM 2693 O  O     . HOH I 5 .  ? 14.858 -4.684  40.891  1.00 38.73 ? 25  HOH A O     1 
HETATM 2694 O  O     . HOH I 5 .  ? 21.712 4.089   29.710  1.00 20.88 ? 26  HOH A O     1 
HETATM 2695 O  O     . HOH I 5 .  ? 26.571 30.759  37.341  1.00 47.60 ? 27  HOH A O     1 
HETATM 2696 O  O     . HOH I 5 .  ? 22.971 6.124   31.298  1.00 35.70 ? 28  HOH A O     1 
HETATM 2697 O  O     . HOH I 5 .  ? 21.213 7.379   33.277  1.00 31.02 ? 29  HOH A O     1 
HETATM 2698 O  O     . HOH I 5 .  ? 13.681 14.840  39.641  1.00 30.14 ? 30  HOH A O     1 
HETATM 2699 O  O     . HOH I 5 .  ? 15.373 24.680  33.648  1.00 35.99 ? 31  HOH A O     1 
HETATM 2700 O  O     . HOH I 5 .  ? 28.353 24.163  34.909  1.00 44.26 ? 32  HOH A O     1 
HETATM 2701 O  O     . HOH I 5 .  ? 14.598 0.336   29.650  1.00 28.89 ? 33  HOH A O     1 
HETATM 2702 O  O     . HOH I 5 .  ? 14.552 23.365  37.326  1.00 30.44 ? 34  HOH A O     1 
HETATM 2703 O  O     . HOH I 5 .  ? 11.255 7.087   33.991  1.00 28.25 ? 35  HOH A O     1 
HETATM 2704 O  O     . HOH J 5 .  ? 21.566 17.958  29.984  1.00 18.16 ? 3   HOH B O     1 
HETATM 2705 O  O     . HOH J 5 .  ? 29.313 19.285  21.792  1.00 30.25 ? 4   HOH B O     1 
HETATM 2706 O  O     . HOH J 5 .  ? 17.981 22.706  22.646  1.00 22.76 ? 8   HOH B O     1 
HETATM 2707 O  O     . HOH J 5 .  ? 19.916 21.789  25.632  1.00 18.97 ? 9   HOH B O     1 
HETATM 2708 O  O     . HOH J 5 .  ? 13.033 26.721  23.186  1.00 43.12 ? 42  HOH B O     1 
HETATM 2709 O  O     . HOH J 5 .  ? 25.928 19.415  37.589  1.00 39.03 ? 45  HOH B O     1 
HETATM 2710 O  O     . HOH J 5 .  ? 23.369 11.449  35.977  1.00 20.16 ? 46  HOH B O     1 
HETATM 2711 O  O     . HOH J 5 .  ? 23.470 10.003  40.432  1.00 41.83 ? 55  HOH B O     1 
HETATM 2712 O  O     . HOH J 5 .  ? 16.140 24.844  23.052  1.00 27.66 ? 82  HOH B O     1 
HETATM 2713 O  O     . HOH J 5 .  ? 27.463 16.373  26.886  1.00 29.35 ? 91  HOH B O     1 
HETATM 2714 O  O     . HOH J 5 .  ? 16.853 25.988  25.674  1.00 31.34 ? 94  HOH B O     1 
HETATM 2715 O  O     . HOH J 5 .  ? 21.580 30.973  23.700  1.00 34.29 ? 111 HOH B O     1 
HETATM 2716 O  O     . HOH J 5 .  ? 13.123 1.796   31.786  1.00 29.61 ? 112 HOH B O     1 
HETATM 2717 O  O     . HOH J 5 .  ? 16.594 -1.056  31.121  1.00 21.95 ? 113 HOH B O     1 
HETATM 2718 O  O     . HOH J 5 .  ? 19.393 26.901  32.825  1.00 33.47 ? 121 HOH B O     1 
HETATM 2719 O  O     . HOH J 5 .  ? 13.845 -0.553  26.757  1.00 31.26 ? 138 HOH B O     1 
HETATM 2720 O  O     . HOH J 5 .  ? 27.703 21.860  33.774  1.00 41.29 ? 151 HOH B O     1 
HETATM 2721 O  O     . HOH J 5 .  ? 21.918 16.884  39.590  1.00 28.55 ? 153 HOH B O     1 
HETATM 2722 O  O     . HOH J 5 .  ? 17.519 2.976   40.312  1.00 34.33 ? 154 HOH B O     1 
HETATM 2723 O  O     . HOH J 5 .  ? 12.336 -3.432  39.656  1.00 37.71 ? 155 HOH B O     1 
HETATM 2724 O  O     . HOH J 5 .  ? 18.422 30.334  32.017  1.00 41.14 ? 179 HOH B O     1 
HETATM 2725 O  O     . HOH J 5 .  ? 10.762 3.189   31.894  1.00 44.41 ? 203 HOH B O     1 
HETATM 2726 O  O     . HOH J 5 .  ? 10.773 4.677   34.712  1.00 36.00 ? 206 HOH B O     1 
HETATM 2727 O  O     . HOH K 5 .  ? 5.172  -16.378 3.302   1.00 18.79 ? 13  HOH D O     1 
HETATM 2728 O  O     . HOH K 5 .  ? 19.715 -10.585 -0.762  1.00 23.75 ? 14  HOH D O     1 
HETATM 2729 O  O     . HOH K 5 .  ? 17.072 -8.997  5.419   1.00 12.23 ? 15  HOH D O     1 
HETATM 2730 O  O     . HOH K 5 .  ? 12.751 -5.934  9.236   1.00 19.39 ? 16  HOH D O     1 
HETATM 2731 O  O     . HOH K 5 .  ? 7.562  -6.111  3.204   1.00 26.41 ? 17  HOH D O     1 
HETATM 2732 O  O     . HOH K 5 .  ? 12.612 -4.051  1.122   1.00 25.07 ? 18  HOH D O     1 
HETATM 2733 O  O     . HOH K 5 .  ? 16.526 -30.073 -2.718  1.00 23.06 ? 19  HOH D O     1 
HETATM 2734 O  O     . HOH K 5 .  ? 9.747  -13.357 -4.848  1.00 22.34 ? 20  HOH D O     1 
HETATM 2735 O  O     . HOH K 5 .  ? 23.859 -25.934 -1.009  1.00 28.96 ? 21  HOH D O     1 
HETATM 2736 O  O     . HOH K 5 .  ? 23.608 -30.125 7.268   1.00 37.65 ? 22  HOH D O     1 
HETATM 2737 O  O     . HOH K 5 .  ? 16.546 -15.170 1.195   1.00 16.94 ? 23  HOH D O     1 
HETATM 2738 O  O     . HOH K 5 .  ? 19.816 -8.812  5.105   1.00 19.47 ? 24  HOH D O     1 
HETATM 2739 O  O     . HOH K 5 .  ? 18.243 -6.159  8.662   1.00 22.36 ? 25  HOH D O     1 
HETATM 2740 O  O     . HOH K 5 .  ? 9.877  -4.999  0.934   1.00 41.08 ? 26  HOH D O     1 
HETATM 2741 O  O     . HOH K 5 .  ? 17.221 -1.065  -7.927  1.00 51.56 ? 27  HOH D O     1 
HETATM 2742 O  O     . HOH K 5 .  ? 21.770 -24.109 -4.557  1.00 16.60 ? 28  HOH D O     1 
HETATM 2743 O  O     . HOH K 5 .  ? 11.649 -11.948 4.610   1.00 28.08 ? 29  HOH D O     1 
HETATM 2744 O  O     . HOH K 5 .  ? 20.519 -7.302  2.887   1.00 25.30 ? 30  HOH D O     1 
HETATM 2745 O  O     . HOH K 5 .  ? 18.309 -12.937 -0.313  1.00 17.71 ? 31  HOH D O     1 
HETATM 2746 O  O     . HOH K 5 .  ? 8.167  -21.532 -9.753  1.00 38.71 ? 32  HOH D O     1 
HETATM 2747 O  O     . HOH K 5 .  ? 18.051 -22.833 -7.603  1.00 32.44 ? 33  HOH D O     1 
HETATM 2748 O  O     . HOH K 5 .  ? 21.191 -23.029 -7.237  1.00 40.93 ? 34  HOH D O     1 
HETATM 2749 O  O     . HOH K 5 .  ? 15.817 -2.805  8.518   1.00 33.25 ? 35  HOH D O     1 
HETATM 2750 O  O     . HOH K 5 .  ? 25.902 -27.934 2.697   1.00 39.86 ? 36  HOH D O     1 
HETATM 2751 O  O     . HOH K 5 .  ? 22.606 -32.600 7.824   1.00 43.40 ? 37  HOH D O     1 
HETATM 2752 O  O     . HOH K 5 .  ? 14.784 -20.016 -8.011  1.00 41.84 ? 38  HOH D O     1 
HETATM 2753 O  O     . HOH K 5 .  ? 9.591  -11.086 -2.879  1.00 27.12 ? 39  HOH D O     1 
HETATM 2754 O  O     . HOH K 5 .  ? 24.296 -7.406  0.587   1.00 39.27 ? 40  HOH D O     1 
HETATM 2755 O  O     . HOH K 5 .  ? 21.756 -9.479  1.261   1.00 47.95 ? 41  HOH D O     1 
HETATM 2756 O  O     . HOH K 5 .  ? 23.192 -5.612  -1.520  1.00 44.87 ? 42  HOH D O     1 
HETATM 2757 O  O     . HOH K 5 .  ? 20.251 -7.528  -4.107  1.00 49.24 ? 43  HOH D O     1 
HETATM 2758 O  O     . HOH K 5 .  ? 11.225 -26.895 -1.190  1.00 32.15 ? 44  HOH D O     1 
HETATM 2759 O  O     . HOH K 5 .  ? 13.489 -26.273 0.254   1.00 37.24 ? 45  HOH D O     1 
HETATM 2760 O  O     . HOH L 5 .  ? 18.573 -21.103 2.919   1.00 17.10 ? 29  HOH E O     1 
HETATM 2761 O  O     . HOH L 5 .  ? 14.191 -25.181 10.032  1.00 19.46 ? 30  HOH E O     1 
HETATM 2762 O  O     . HOH L 5 .  ? 22.390 -21.409 6.792   1.00 22.43 ? 31  HOH E O     1 
HETATM 2763 O  O     . HOH L 5 .  ? 12.823 1.896   -6.742  1.00 36.34 ? 32  HOH E O     1 
HETATM 2764 O  O     . HOH L 5 .  ? 16.561 -1.272  1.546   1.00 26.87 ? 33  HOH E O     1 
HETATM 2765 O  O     . HOH L 5 .  ? 20.959 -12.248 -4.067  1.00 36.49 ? 34  HOH E O     1 
HETATM 2766 O  O     . HOH L 5 .  ? 16.487 -24.774 7.239   1.00 24.23 ? 35  HOH E O     1 
HETATM 2767 O  O     . HOH L 5 .  ? 13.609 -30.892 1.847   1.00 33.98 ? 36  HOH E O     1 
HETATM 2768 O  O     . HOH L 5 .  ? 23.770 -19.730 2.514   1.00 27.70 ? 37  HOH E O     1 
HETATM 2769 O  O     . HOH L 5 .  ? 24.497 -24.751 -3.282  1.00 26.11 ? 38  HOH E O     1 
HETATM 2770 O  O     . HOH L 5 .  ? 18.419 -20.118 -7.129  1.00 33.39 ? 39  HOH E O     1 
HETATM 2771 O  O     . HOH L 5 .  ? 26.306 -20.584 8.461   1.00 37.70 ? 40  HOH E O     1 
HETATM 2772 O  O     . HOH L 5 .  ? 21.129 -14.777 -3.303  1.00 36.51 ? 41  HOH E O     1 
HETATM 2773 O  O     . HOH L 5 .  ? 18.227 -28.915 12.951  1.00 35.19 ? 42  HOH E O     1 
HETATM 2774 O  O     . HOH L 5 .  ? 14.204 -2.425  3.217   1.00 41.75 ? 43  HOH E O     1 
HETATM 2775 O  O     . HOH L 5 .  ? 13.585 -1.238  6.003   1.00 40.83 ? 44  HOH E O     1 
HETATM 2776 O  O     . HOH L 5 .  ? 28.901 -24.554 2.722   1.00 41.07 ? 45  HOH E O     1 
HETATM 2777 O  O     . HOH L 5 .  ? 29.232 -20.778 0.563   1.00 42.91 ? 46  HOH E O     1 
HETATM 2778 O  O     . HOH L 5 .  ? 24.095 -29.170 4.491   1.00 39.20 ? 47  HOH E O     1 
HETATM 2779 O  O     . HOH L 5 .  ? 24.978 -20.454 6.117   1.00 34.19 ? 48  HOH E O     1 
HETATM 2780 O  O     . HOH L 5 .  ? 19.264 -9.117  -6.499  1.00 44.82 ? 49  HOH E O     1 
HETATM 2781 O  O     . HOH L 5 .  ? 20.716 -15.301 -16.587 1.00 44.89 ? 50  HOH E O     1 
HETATM 2782 O  O     . HOH L 5 .  ? 16.464 -14.529 -15.845 1.00 44.31 ? 51  HOH E O     1 
HETATM 2783 O  O     . HOH L 5 .  ? 12.050 -14.696 -7.772  1.00 44.42 ? 52  HOH E O     1 
HETATM 2784 O  O     . HOH M 5 .  ? 28.476 12.717  24.352  1.00 33.84 ? 267 HOH C O     1 
HETATM 2785 O  O     . HOH M 5 .  ? 13.069 12.690  28.518  1.00 13.14 ? 268 HOH C O     1 
HETATM 2786 O  O     . HOH M 5 .  ? 21.513 20.170  27.110  1.00 18.09 ? 269 HOH C O     1 
HETATM 2787 O  O     . HOH M 5 .  ? 18.191 23.619  29.281  1.00 28.41 ? 270 HOH C O     1 
HETATM 2788 O  O     . HOH M 5 .  ? 4.782  15.217  16.171  1.00 20.03 ? 271 HOH C O     1 
HETATM 2789 O  O     . HOH M 5 .  ? 5.165  4.135   27.503  1.00 21.12 ? 272 HOH C O     1 
HETATM 2790 O  O     . HOH M 5 .  ? 11.558 0.908   27.780  1.00 33.42 ? 273 HOH C O     1 
HETATM 2791 O  O     . HOH M 5 .  ? 13.353 4.037   23.705  1.00 12.93 ? 274 HOH C O     1 
HETATM 2792 O  O     . HOH M 5 .  ? 7.642  20.369  29.373  1.00 22.99 ? 275 HOH C O     1 
HETATM 2793 O  O     . HOH M 5 .  ? 18.887 27.937  14.191  1.00 59.97 ? 276 HOH C O     1 
HETATM 2794 O  O     . HOH M 5 .  ? 16.019 25.514  20.004  1.00 37.47 ? 277 HOH C O     1 
HETATM 2795 O  O     . HOH M 5 .  ? 8.130  17.088  31.616  1.00 28.22 ? 278 HOH C O     1 
HETATM 2796 O  O     . HOH M 5 .  ? 25.211 5.935   26.555  1.00 43.82 ? 279 HOH C O     1 
HETATM 2797 O  O     . HOH M 5 .  ? 21.924 12.029  33.590  1.00 21.07 ? 280 HOH C O     1 
HETATM 2798 O  O     . HOH M 5 .  ? 6.645  6.313   14.410  1.00 21.92 ? 281 HOH C O     1 
HETATM 2799 O  O     . HOH M 5 .  ? 13.345 23.489  18.542  1.00 24.61 ? 282 HOH C O     1 
HETATM 2800 O  O     . HOH M 5 .  ? 4.421  5.102   15.227  1.00 32.81 ? 283 HOH C O     1 
HETATM 2801 O  O     . HOH M 5 .  ? 1.037  2.852   14.265  1.00 25.86 ? 284 HOH C O     1 
HETATM 2802 O  O     . HOH M 5 .  ? 14.843 6.540   13.786  1.00 27.72 ? 285 HOH C O     1 
HETATM 2803 O  O     . HOH M 5 .  ? 0.157  13.405  26.151  1.00 31.55 ? 286 HOH C O     1 
HETATM 2804 O  O     . HOH M 5 .  ? 26.828 17.720  11.934  1.00 31.36 ? 287 HOH C O     1 
HETATM 2805 O  O     . HOH M 5 .  ? 17.807 23.329  26.608  1.00 19.83 ? 288 HOH C O     1 
HETATM 2806 O  O     . HOH M 5 .  ? 22.781 22.003  12.616  1.00 32.53 ? 289 HOH C O     1 
HETATM 2807 O  O     . HOH M 5 .  ? 22.365 25.793  19.641  1.00 30.86 ? 290 HOH C O     1 
HETATM 2808 O  O     . HOH M 5 .  ? 21.997 19.945  11.257  1.00 30.34 ? 291 HOH C O     1 
HETATM 2809 O  O     . HOH M 5 .  ? 13.930 21.696  13.829  1.00 26.49 ? 292 HOH C O     1 
HETATM 2810 O  O     . HOH M 5 .  ? 0.623  9.166   13.781  1.00 25.93 ? 293 HOH C O     1 
HETATM 2811 O  O     . HOH M 5 .  ? 10.746 6.596   24.472  1.00 13.91 ? 294 HOH C O     1 
HETATM 2812 O  O     . HOH M 5 .  ? 24.666 16.090  28.880  1.00 27.51 ? 295 HOH C O     1 
HETATM 2813 O  O     . HOH M 5 .  ? 28.153 16.924  22.183  1.00 45.96 ? 296 HOH C O     1 
HETATM 2814 O  O     . HOH M 5 .  ? 21.454 4.269   25.087  1.00 29.12 ? 297 HOH C O     1 
HETATM 2815 O  O     . HOH M 5 .  ? 18.912 12.351  31.479  1.00 26.79 ? 298 HOH C O     1 
HETATM 2816 O  O     . HOH M 5 .  ? 12.044 21.489  11.610  1.00 26.05 ? 299 HOH C O     1 
HETATM 2817 O  O     . HOH M 5 .  ? 25.481 17.921  26.372  1.00 28.99 ? 300 HOH C O     1 
HETATM 2818 O  O     . HOH M 5 .  ? 9.499  24.754  24.420  1.00 34.43 ? 301 HOH C O     1 
HETATM 2819 O  O     . HOH M 5 .  ? 4.040  2.073   12.077  1.00 31.61 ? 302 HOH C O     1 
HETATM 2820 O  O     . HOH M 5 .  ? 20.744 27.181  18.075  1.00 31.32 ? 303 HOH C O     1 
HETATM 2821 O  O     . HOH M 5 .  ? 13.672 21.882  9.391   1.00 29.55 ? 304 HOH C O     1 
HETATM 2822 O  O     . HOH M 5 .  ? 11.209 25.648  27.868  1.00 36.96 ? 305 HOH C O     1 
HETATM 2823 O  O     . HOH M 5 .  ? 10.652 0.707   23.902  1.00 32.87 ? 306 HOH C O     1 
HETATM 2824 O  O     . HOH M 5 .  ? 7.788  1.181   20.329  1.00 23.55 ? 307 HOH C O     1 
HETATM 2825 O  O     . HOH M 5 .  ? 4.186  15.236  28.077  1.00 41.35 ? 308 HOH C O     1 
HETATM 2826 O  O     . HOH M 5 .  ? 8.656  14.013  6.295   1.00 28.54 ? 309 HOH C O     1 
HETATM 2827 O  O     . HOH M 5 .  ? 34.038 15.403  20.970  1.00 48.04 ? 310 HOH C O     1 
HETATM 2828 O  O     . HOH M 5 .  ? 30.054 11.762  26.479  1.00 43.28 ? 311 HOH C O     1 
HETATM 2829 O  O     . HOH M 5 .  ? 1.078  -9.381  26.960  1.00 30.16 ? 312 HOH C O     1 
HETATM 2830 O  O     . HOH M 5 .  ? 1.199  -7.210  25.794  1.00 35.24 ? 313 HOH C O     1 
HETATM 2831 O  O     . HOH M 5 .  ? 4.191  1.046   27.469  1.00 34.16 ? 314 HOH C O     1 
HETATM 2832 O  O     . HOH M 5 .  ? 22.270 29.499  10.115  1.00 40.01 ? 315 HOH C O     1 
HETATM 2833 O  O     . HOH M 5 .  ? 28.140 23.360  21.454  1.00 35.03 ? 316 HOH C O     1 
HETATM 2834 O  O     . HOH M 5 .  ? 20.020 18.006  10.904  1.00 39.60 ? 317 HOH C O     1 
HETATM 2835 O  O     . HOH M 5 .  ? 34.527 15.210  16.020  1.00 43.21 ? 318 HOH C O     1 
HETATM 2836 O  O     . HOH M 5 .  ? 12.561 16.239  9.195   1.00 40.02 ? 319 HOH C O     1 
HETATM 2837 O  O     . HOH N 5 .  ? 4.202  -21.199 2.963   1.00 39.01 ? 267 HOH F O     1 
HETATM 2838 O  O     . HOH N 5 .  ? 21.409 -19.940 3.550   1.00 21.84 ? 268 HOH F O     1 
HETATM 2839 O  O     . HOH N 5 .  ? 13.950 -25.789 6.274   1.00 13.04 ? 269 HOH F O     1 
HETATM 2840 O  O     . HOH N 5 .  ? 10.831 -14.536 4.150   1.00 17.97 ? 270 HOH F O     1 
HETATM 2841 O  O     . HOH N 5 .  ? 7.169  -2.552  12.535  1.00 31.92 ? 271 HOH F O     1 
HETATM 2842 O  O     . HOH N 5 .  ? 4.689  -4.844  5.533   1.00 23.45 ? 272 HOH F O     1 
HETATM 2843 O  O     . HOH N 5 .  ? 5.364  -25.559 8.452   1.00 17.46 ? 273 HOH F O     1 
HETATM 2844 O  O     . HOH N 5 .  ? 9.483  -25.300 14.185  1.00 21.38 ? 274 HOH F O     1 
HETATM 2845 O  O     . HOH N 5 .  ? 26.249 -17.611 8.471   1.00 39.68 ? 275 HOH F O     1 
HETATM 2846 O  O     . HOH N 5 .  ? 24.090 -10.207 6.039   1.00 28.74 ? 276 HOH F O     1 
HETATM 2847 O  O     . HOH N 5 .  ? 14.585 -26.068 3.263   1.00 25.15 ? 277 HOH F O     1 
HETATM 2848 O  O     . HOH N 5 .  ? 23.384 -33.595 12.701  1.00 46.01 ? 278 HOH F O     1 
HETATM 2849 O  O     . HOH N 5 .  ? 18.471 -23.339 5.708   1.00 14.18 ? 279 HOH F O     1 
HETATM 2850 O  O     . HOH N 5 .  ? 21.878 -12.913 3.405   1.00 31.89 ? 280 HOH F O     1 
HETATM 2851 O  O     . HOH N 5 .  ? 20.299 -7.390  7.504   1.00 33.36 ? 281 HOH F O     1 
HETATM 2852 O  O     . HOH N 5 .  ? 13.829 -8.671  18.933  1.00 32.73 ? 282 HOH F O     1 
HETATM 2853 O  O     . HOH N 5 .  ? 5.200  -26.104 5.363   1.00 36.55 ? 283 HOH F O     1 
HETATM 2854 O  O     . HOH N 5 .  ? 24.492 -21.207 20.691  1.00 31.91 ? 284 HOH F O     1 
HETATM 2855 O  O     . HOH N 5 .  ? 7.644  -7.822  23.556  1.00 36.62 ? 285 HOH F O     1 
HETATM 2856 O  O     . HOH N 5 .  ? 5.401  -7.595  21.224  1.00 32.71 ? 286 HOH F O     1 
HETATM 2857 O  O     . HOH N 5 .  ? 0.600  -3.084  18.316  1.00 28.79 ? 287 HOH F O     1 
HETATM 2858 O  O     . HOH N 5 .  ? 13.591 -14.195 25.024  1.00 31.01 ? 288 HOH F O     1 
HETATM 2859 O  O     . HOH N 5 .  ? 9.804  -18.405 23.415  1.00 35.57 ? 289 HOH F O     1 
HETATM 2860 O  O     . HOH N 5 .  ? 10.585 -23.585 19.144  1.00 23.83 ? 290 HOH F O     1 
HETATM 2861 O  O     . HOH N 5 .  ? 2.233  -15.518 16.511  1.00 23.24 ? 291 HOH F O     1 
HETATM 2862 O  O     . HOH N 5 .  ? -0.848 -16.456 16.155  1.00 42.64 ? 292 HOH F O     1 
HETATM 2863 O  O     . HOH N 5 .  ? 9.526  -8.118  8.369   1.00 9.47  ? 293 HOH F O     1 
HETATM 2864 O  O     . HOH N 5 .  ? 20.524 -8.097  18.947  1.00 29.21 ? 294 HOH F O     1 
HETATM 2865 O  O     . HOH N 5 .  ? 23.578 -14.461 21.946  1.00 36.36 ? 295 HOH F O     1 
HETATM 2866 O  O     . HOH N 5 .  ? 2.467  -15.591 4.608   1.00 36.49 ? 296 HOH F O     1 
HETATM 2867 O  O     . HOH N 5 .  ? 10.662 -2.298  8.466   1.00 36.84 ? 297 HOH F O     1 
HETATM 2868 O  O     . HOH N 5 .  ? 4.224  -1.478  4.743   1.00 36.46 ? 298 HOH F O     1 
HETATM 2869 O  O     . HOH N 5 .  ? 6.002  -7.125  18.252  1.00 22.66 ? 299 HOH F O     1 
HETATM 2870 O  O     . HOH N 5 .  ? 11.794 -27.777 12.363  1.00 33.00 ? 300 HOH F O     1 
HETATM 2871 O  O     . HOH N 5 .  ? 11.042 -2.466  4.972   1.00 29.51 ? 301 HOH F O     1 
HETATM 2872 O  O     . HOH N 5 .  ? 9.208  -13.055 26.702  1.00 33.85 ? 302 HOH F O     1 
HETATM 2873 O  O     . HOH N 5 .  ? 17.418 -19.516 23.409  1.00 42.45 ? 303 HOH F O     1 
HETATM 2874 O  O     . HOH N 5 .  ? 28.180 -26.534 25.166  1.00 48.34 ? 304 HOH F O     1 
HETATM 2875 O  O     . HOH N 5 .  ? 25.216 -26.613 12.221  1.00 41.17 ? 305 HOH F O     1 
HETATM 2876 O  O     . HOH N 5 .  ? -1.777 -13.413 6.699   1.00 39.04 ? 306 HOH F O     1 
HETATM 2877 O  O     . HOH N 5 .  ? -0.790 -9.192  19.018  1.00 29.75 ? 307 HOH F O     1 
HETATM 2878 O  O     . HOH N 5 .  ? 2.222  -5.433  24.107  1.00 23.85 ? 308 HOH F O     1 
HETATM 2879 O  O     . HOH N 5 .  ? 1.555  -11.670 25.771  1.00 21.57 ? 309 HOH F O     1 
HETATM 2880 O  O     . HOH N 5 .  ? 19.650 -15.208 -1.016  1.00 23.27 ? 310 HOH F O     1 
HETATM 2881 O  O     . HOH N 5 .  ? 2.874  4.887   8.425   1.00 24.51 ? 311 HOH F O     1 
HETATM 2882 O  O     . HOH N 5 .  ? 20.307 -30.777 11.514  1.00 36.19 ? 312 HOH F O     1 
HETATM 2883 O  O     . HOH N 5 .  ? 23.842 -28.532 11.265  1.00 41.67 ? 313 HOH F O     1 
HETATM 2884 O  O     . HOH N 5 .  ? 8.785  -22.676 21.016  1.00 33.12 ? 314 HOH F O     1 
HETATM 2885 O  O     . HOH N 5 .  ? 4.075  -5.570  17.508  1.00 22.46 ? 315 HOH F O     1 
HETATM 2886 O  O     . HOH N 5 .  ? 3.447  -13.428 26.379  1.00 46.41 ? 316 HOH F O     1 
HETATM 2887 O  O     . HOH N 5 .  ? 1.264  -20.023 5.280   1.00 40.27 ? 317 HOH F O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DT  1   -4  -4  DT  DT  A . n 
A 1 2   DG  2   -3  -3  DG  DG  A . n 
A 1 3   DG  3   -2  -2  DG  DG  A . n 
A 1 4   DT  4   -1  -1  DT  DT  A . n 
A 1 5   DT  5   1   1   DT  DT  A . n 
A 1 6   DT  6   2   2   DT  DT  A . n 
A 1 7   DG  7   3   3   DG  DG  A . n 
A 1 8   DT  8   4   4   DT  DT  A . n 
A 1 9   DT  9   5   5   DT  DT  A . n 
A 1 10  DT  10  6   6   DT  DT  A . n 
A 1 11  DT  11  7   7   DT  DT  A . n 
A 1 12  DG  12  8   8   DG  DG  A . n 
A 1 13  DC  13  9   9   DC  DC  A . n 
A 1 14  DT  14  10  10  DT  DT  A . n 
A 1 15  DT  15  11  11  DT  DT  A . n 
A 1 16  DG  16  12  12  DG  DG  A . n 
B 2 1   DC  1   13  13  DC  DC  B . n 
B 2 2   DA  2   14  14  DA  DA  B . n 
B 2 3   DA  3   15  15  DA  DA  B . n 
B 2 4   DG  4   16  16  DG  DG  B . n 
B 2 5   DC  5   17  17  DC  DC  B . n 
B 2 6   DA  6   18  18  DA  DA  B . n 
B 2 7   DA  7   19  19  DA  DA  B . n 
B 2 8   DA  8   20  20  DA  DA  B . n 
B 2 9   DA  9   21  21  DA  DA  B . n 
B 2 10  DC  10  22  22  DC  DC  B . n 
B 2 11  DA  11  23  23  DA  DA  B . n 
B 2 12  DA  12  24  24  DA  DA  B . n 
B 2 13  DA  13  25  25  DA  DA  B . n 
B 2 14  DC  14  26  26  DC  DC  B . n 
B 2 15  DC  15  27  27  DC  DC  B . n 
B 2 16  DA  16  28  28  DA  DA  B . n 
C 1 1   DT  1   -4  -4  DT  DT  D . n 
C 1 2   DG  2   -3  -3  DG  DG  D . n 
C 1 3   DG  3   -2  -2  DG  DG  D . n 
C 1 4   DT  4   -1  -1  DT  DT  D . n 
C 1 5   DT  5   1   1   DT  DT  D . n 
C 1 6   DT  6   2   2   DT  DT  D . n 
C 1 7   DG  7   3   3   DG  DG  D . n 
C 1 8   DT  8   4   4   DT  DT  D . n 
C 1 9   DT  9   5   5   DT  DT  D . n 
C 1 10  DT  10  6   6   DT  DT  D . n 
C 1 11  DT  11  7   7   DT  DT  D . n 
C 1 12  DG  12  8   8   DG  DG  D . n 
C 1 13  DC  13  9   9   DC  DC  D . n 
C 1 14  DT  14  10  10  DT  DT  D . n 
C 1 15  DT  15  11  11  DT  DT  D . n 
C 1 16  DG  16  12  12  DG  DG  D . n 
D 2 1   DC  1   13  13  DC  DC  E . n 
D 2 2   DA  2   14  14  DA  DA  E . n 
D 2 3   DA  3   15  15  DA  DA  E . n 
D 2 4   DG  4   16  16  DG  DG  E . n 
D 2 5   DC  5   17  17  DC  DC  E . n 
D 2 6   DA  6   18  18  DA  DA  E . n 
D 2 7   DA  7   19  19  DA  DA  E . n 
D 2 8   DA  8   20  20  DA  DA  E . n 
D 2 9   DA  9   21  21  DA  DA  E . n 
D 2 10  DC  10  22  22  DC  DC  E . n 
D 2 11  DA  11  23  23  DA  DA  E . n 
D 2 12  DA  12  24  24  DA  DA  E . n 
D 2 13  DA  13  25  25  DA  DA  E . n 
D 2 14  DC  14  26  26  DC  DC  E . n 
D 2 15  DC  15  27  27  DC  DC  E . n 
D 2 16  DA  16  28  28  DA  DA  E . n 
E 3 1   SER 1   150 ?   ?   ?   C . n 
E 3 2   LYS 2   151 ?   ?   ?   C . n 
E 3 3   SER 3   152 ?   ?   ?   C . n 
E 3 4   SER 4   153 ?   ?   ?   C . n 
E 3 5   SER 5   154 ?   ?   ?   C . n 
E 3 6   SER 6   155 ?   ?   ?   C . n 
E 3 7   ARG 7   156 156 ARG ARG C . n 
E 3 8   ARG 8   157 157 ARG ARG C . n 
E 3 9   ASN 9   158 158 ASN ASN C . n 
E 3 10  ALA 10  159 159 ALA ALA C . n 
E 3 11  TRP 11  160 160 TRP TRP C . n 
E 3 12  GLY 12  161 161 GLY GLY C . n 
E 3 13  ASN 13  162 162 ASN ASN C . n 
E 3 14  LEU 14  163 163 LEU LEU C . n 
E 3 15  SER 15  164 164 SER SER C . n 
E 3 16  TYR 16  165 165 TYR TYR C . n 
E 3 17  ALA 17  166 166 ALA ALA C . n 
E 3 18  ASP 18  167 167 ASP ASP C . n 
E 3 19  LEU 19  168 168 LEU LEU C . n 
E 3 20  ILE 20  169 169 ILE ILE C . n 
E 3 21  THR 21  170 170 THR THR C . n 
E 3 22  LYS 22  171 171 LYS LYS C . n 
E 3 23  ALA 23  172 172 ALA ALA C . n 
E 3 24  ILE 24  173 173 ILE ILE C . n 
E 3 25  GLU 25  174 174 GLU GLU C . n 
E 3 26  SER 26  175 175 SER SER C . n 
E 3 27  SER 27  176 176 SER SER C . n 
E 3 28  ALA 28  177 177 ALA ALA C . n 
E 3 29  GLU 29  178 178 GLU GLU C . n 
E 3 30  LYS 30  179 179 LYS LYS C . n 
E 3 31  ARG 31  180 180 ARG ARG C . n 
E 3 32  LEU 32  181 181 LEU LEU C . n 
E 3 33  THR 33  182 182 THR THR C . n 
E 3 34  LEU 34  183 183 LEU LEU C . n 
E 3 35  SER 35  184 184 SER SER C . n 
E 3 36  GLN 36  185 185 GLN GLN C . n 
E 3 37  ILE 37  186 186 ILE ILE C . n 
E 3 38  TYR 38  187 187 TYR TYR C . n 
E 3 39  GLU 39  188 188 GLU GLU C . n 
E 3 40  TRP 40  189 189 TRP TRP C . n 
E 3 41  MET 41  190 190 MET MET C . n 
E 3 42  VAL 42  191 191 VAL VAL C . n 
E 3 43  LYS 43  192 192 LYS LYS C . n 
E 3 44  SER 44  193 193 SER SER C . n 
E 3 45  VAL 45  194 194 VAL VAL C . n 
E 3 46  PRO 46  195 195 PRO PRO C . n 
E 3 47  TYR 47  196 196 TYR TYR C . n 
E 3 48  PHE 48  197 197 PHE PHE C . n 
E 3 49  LYS 49  198 198 LYS LYS C . n 
E 3 50  ASP 50  199 199 ASP ASP C . n 
E 3 51  LYS 51  200 200 LYS LYS C . n 
E 3 52  GLY 52  201 201 GLY GLY C . n 
E 3 53  ASP 53  202 202 ASP ASP C . n 
E 3 54  SER 54  203 203 SER SER C . n 
E 3 55  ASN 55  204 204 ASN ASN C . n 
E 3 56  SER 56  205 205 SER SER C . n 
E 3 57  SER 57  206 206 SER SER C . n 
E 3 58  ALA 58  207 207 ALA ALA C . n 
E 3 59  GLY 59  208 208 GLY GLY C . n 
E 3 60  TRP 60  209 209 TRP TRP C . n 
E 3 61  LYS 61  210 210 LYS LYS C . n 
E 3 62  ASN 62  211 211 ASN ASN C . n 
E 3 63  SER 63  212 212 SER SER C . n 
E 3 64  ILE 64  213 213 ILE ILE C . n 
E 3 65  ARG 65  214 214 ARG ARG C . n 
E 3 66  HIS 66  215 215 HIS HIS C . n 
E 3 67  ASN 67  216 216 ASN ASN C . n 
E 3 68  LEU 68  217 217 LEU LEU C . n 
E 3 69  SER 69  218 218 SER SER C . n 
E 3 70  LEU 70  219 219 LEU LEU C . n 
E 3 71  HIS 71  220 220 HIS HIS C . n 
E 3 72  SER 72  221 221 SER SER C . n 
E 3 73  LYS 73  222 222 LYS LYS C . n 
E 3 74  PHE 74  223 223 PHE PHE C . n 
E 3 75  ILE 75  224 224 ILE ILE C . n 
E 3 76  ARG 76  225 225 ARG ARG C . n 
E 3 77  VAL 77  226 226 VAL VAL C . n 
E 3 78  GLN 78  227 227 GLN GLN C . n 
E 3 79  ASN 79  228 228 ASN ASN C . n 
E 3 80  GLU 80  229 229 GLU GLU C . n 
E 3 81  GLY 81  230 230 GLY GLY C . n 
E 3 82  THR 82  231 231 THR THR C . n 
E 3 83  GLY 83  232 232 GLY GLY C . n 
E 3 84  LYS 84  233 233 LYS LYS C . n 
E 3 85  SER 85  234 234 SER SER C . n 
E 3 86  SER 86  235 235 SER SER C . n 
E 3 87  TRP 87  236 236 TRP TRP C . n 
E 3 88  TRP 88  237 237 TRP TRP C . n 
E 3 89  MET 89  238 238 MET MET C . n 
E 3 90  LEU 90  239 239 LEU LEU C . n 
E 3 91  ASN 91  240 240 ASN ASN C . n 
E 3 92  PRO 92  241 241 PRO PRO C . n 
E 3 93  GLU 93  242 ?   ?   ?   C . n 
E 3 94  GLY 94  243 ?   ?   ?   C . n 
E 3 95  GLY 95  244 ?   ?   ?   C . n 
E 3 96  LYS 96  245 ?   ?   ?   C . n 
E 3 97  SER 97  246 ?   ?   ?   C . n 
E 3 98  GLY 98  247 ?   ?   ?   C . n 
E 3 99  LYS 99  248 ?   ?   ?   C . n 
E 3 100 SER 100 249 ?   ?   ?   C . n 
E 3 101 PRO 101 250 ?   ?   ?   C . n 
E 3 102 ARG 102 251 ?   ?   ?   C . n 
E 3 103 ARG 103 252 ?   ?   ?   C . n 
E 3 104 ARG 104 253 ?   ?   ?   C . n 
E 3 105 ALA 105 254 ?   ?   ?   C . n 
E 3 106 ALA 106 255 ?   ?   ?   C . n 
E 3 107 SER 107 256 ?   ?   ?   C . n 
E 3 108 MET 108 257 ?   ?   ?   C . n 
E 3 109 ASP 109 258 ?   ?   ?   C . n 
E 3 110 ASN 110 259 ?   ?   ?   C . n 
E 3 111 ASN 111 260 ?   ?   ?   C . n 
E 3 112 SER 112 261 ?   ?   ?   C . n 
E 3 113 LYS 113 262 ?   ?   ?   C . n 
E 3 114 PHE 114 263 ?   ?   ?   C . n 
E 3 115 ALA 115 264 ?   ?   ?   C . n 
E 3 116 LYS 116 265 ?   ?   ?   C . n 
E 3 117 SER 117 266 ?   ?   ?   C . n 
F 3 1   SER 1   150 ?   ?   ?   F . n 
F 3 2   LYS 2   151 ?   ?   ?   F . n 
F 3 3   SER 3   152 ?   ?   ?   F . n 
F 3 4   SER 4   153 ?   ?   ?   F . n 
F 3 5   SER 5   154 ?   ?   ?   F . n 
F 3 6   SER 6   155 155 SER SER F . n 
F 3 7   ARG 7   156 156 ARG ARG F . n 
F 3 8   ARG 8   157 157 ARG ARG F . n 
F 3 9   ASN 9   158 158 ASN ASN F . n 
F 3 10  ALA 10  159 159 ALA ALA F . n 
F 3 11  TRP 11  160 160 TRP TRP F . n 
F 3 12  GLY 12  161 161 GLY GLY F . n 
F 3 13  ASN 13  162 162 ASN ASN F . n 
F 3 14  LEU 14  163 163 LEU LEU F . n 
F 3 15  SER 15  164 164 SER SER F . n 
F 3 16  TYR 16  165 165 TYR TYR F . n 
F 3 17  ALA 17  166 166 ALA ALA F . n 
F 3 18  ASP 18  167 167 ASP ASP F . n 
F 3 19  LEU 19  168 168 LEU LEU F . n 
F 3 20  ILE 20  169 169 ILE ILE F . n 
F 3 21  THR 21  170 170 THR THR F . n 
F 3 22  LYS 22  171 171 LYS LYS F . n 
F 3 23  ALA 23  172 172 ALA ALA F . n 
F 3 24  ILE 24  173 173 ILE ILE F . n 
F 3 25  GLU 25  174 174 GLU GLU F . n 
F 3 26  SER 26  175 175 SER SER F . n 
F 3 27  SER 27  176 176 SER SER F . n 
F 3 28  ALA 28  177 177 ALA ALA F . n 
F 3 29  GLU 29  178 178 GLU GLU F . n 
F 3 30  LYS 30  179 179 LYS LYS F . n 
F 3 31  ARG 31  180 180 ARG ARG F . n 
F 3 32  LEU 32  181 181 LEU LEU F . n 
F 3 33  THR 33  182 182 THR THR F . n 
F 3 34  LEU 34  183 183 LEU LEU F . n 
F 3 35  SER 35  184 184 SER SER F . n 
F 3 36  GLN 36  185 185 GLN GLN F . n 
F 3 37  ILE 37  186 186 ILE ILE F . n 
F 3 38  TYR 38  187 187 TYR TYR F . n 
F 3 39  GLU 39  188 188 GLU GLU F . n 
F 3 40  TRP 40  189 189 TRP TRP F . n 
F 3 41  MET 41  190 190 MET MET F . n 
F 3 42  VAL 42  191 191 VAL VAL F . n 
F 3 43  LYS 43  192 192 LYS LYS F . n 
F 3 44  SER 44  193 193 SER SER F . n 
F 3 45  VAL 45  194 194 VAL VAL F . n 
F 3 46  PRO 46  195 195 PRO PRO F . n 
F 3 47  TYR 47  196 196 TYR TYR F . n 
F 3 48  PHE 48  197 197 PHE PHE F . n 
F 3 49  LYS 49  198 198 LYS LYS F . n 
F 3 50  ASP 50  199 199 ASP ASP F . n 
F 3 51  LYS 51  200 200 LYS LYS F . n 
F 3 52  GLY 52  201 201 GLY GLY F . n 
F 3 53  ASP 53  202 202 ASP ASP F . n 
F 3 54  SER 54  203 203 SER SER F . n 
F 3 55  ASN 55  204 204 ASN ASN F . n 
F 3 56  SER 56  205 205 SER SER F . n 
F 3 57  SER 57  206 206 SER SER F . n 
F 3 58  ALA 58  207 207 ALA ALA F . n 
F 3 59  GLY 59  208 208 GLY GLY F . n 
F 3 60  TRP 60  209 209 TRP TRP F . n 
F 3 61  LYS 61  210 210 LYS LYS F . n 
F 3 62  ASN 62  211 211 ASN ASN F . n 
F 3 63  SER 63  212 212 SER SER F . n 
F 3 64  ILE 64  213 213 ILE ILE F . n 
F 3 65  ARG 65  214 214 ARG ARG F . n 
F 3 66  HIS 66  215 215 HIS HIS F . n 
F 3 67  ASN 67  216 216 ASN ASN F . n 
F 3 68  LEU 68  217 217 LEU LEU F . n 
F 3 69  SER 69  218 218 SER SER F . n 
F 3 70  LEU 70  219 219 LEU LEU F . n 
F 3 71  HIS 71  220 220 HIS HIS F . n 
F 3 72  SER 72  221 221 SER SER F . n 
F 3 73  LYS 73  222 222 LYS LYS F . n 
F 3 74  PHE 74  223 223 PHE PHE F . n 
F 3 75  ILE 75  224 224 ILE ILE F . n 
F 3 76  ARG 76  225 225 ARG ARG F . n 
F 3 77  VAL 77  226 226 VAL VAL F . n 
F 3 78  GLN 78  227 227 GLN GLN F . n 
F 3 79  ASN 79  228 228 ASN ASN F . n 
F 3 80  GLU 80  229 229 GLU GLU F . n 
F 3 81  GLY 81  230 230 GLY GLY F . n 
F 3 82  THR 82  231 231 THR THR F . n 
F 3 83  GLY 83  232 232 GLY GLY F . n 
F 3 84  LYS 84  233 233 LYS LYS F . n 
F 3 85  SER 85  234 234 SER SER F . n 
F 3 86  SER 86  235 235 SER SER F . n 
F 3 87  TRP 87  236 236 TRP TRP F . n 
F 3 88  TRP 88  237 237 TRP TRP F . n 
F 3 89  MET 89  238 238 MET MET F . n 
F 3 90  LEU 90  239 239 LEU LEU F . n 
F 3 91  ASN 91  240 240 ASN ASN F . n 
F 3 92  PRO 92  241 241 PRO PRO F . n 
F 3 93  GLU 93  242 ?   ?   ?   F . n 
F 3 94  GLY 94  243 ?   ?   ?   F . n 
F 3 95  GLY 95  244 ?   ?   ?   F . n 
F 3 96  LYS 96  245 ?   ?   ?   F . n 
F 3 97  SER 97  246 ?   ?   ?   F . n 
F 3 98  GLY 98  247 ?   ?   ?   F . n 
F 3 99  LYS 99  248 ?   ?   ?   F . n 
F 3 100 SER 100 249 ?   ?   ?   F . n 
F 3 101 PRO 101 250 ?   ?   ?   F . n 
F 3 102 ARG 102 251 ?   ?   ?   F . n 
F 3 103 ARG 103 252 ?   ?   ?   F . n 
F 3 104 ARG 104 253 ?   ?   ?   F . n 
F 3 105 ALA 105 254 ?   ?   ?   F . n 
F 3 106 ALA 106 255 ?   ?   ?   F . n 
F 3 107 SER 107 256 ?   ?   ?   F . n 
F 3 108 MET 108 257 ?   ?   ?   F . n 
F 3 109 ASP 109 258 ?   ?   ?   F . n 
F 3 110 ASN 110 259 ?   ?   ?   F . n 
F 3 111 ASN 111 260 ?   ?   ?   F . n 
F 3 112 SER 112 261 ?   ?   ?   F . n 
F 3 113 LYS 113 262 ?   ?   ?   F . n 
F 3 114 PHE 114 263 ?   ?   ?   F . n 
F 3 115 ALA 115 264 ?   ?   ?   F . n 
F 3 116 LYS 116 265 ?   ?   ?   F . n 
F 3 117 SER 117 266 ?   ?   ?   F . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 4 CA  1  1   1   CA  CA  C . 
H 4 CA  1  2   2   CA  CA  F . 
I 5 HOH 1  13  6   HOH HOH A . 
I 5 HOH 2  14  27  HOH HOH A . 
I 5 HOH 3  15  38  HOH HOH A . 
I 5 HOH 4  16  39  HOH HOH A . 
I 5 HOH 5  17  44  HOH HOH A . 
I 5 HOH 6  18  47  HOH HOH A . 
I 5 HOH 7  19  48  HOH HOH A . 
I 5 HOH 8  20  50  HOH HOH A . 
I 5 HOH 9  21  51  HOH HOH A . 
I 5 HOH 10 22  54  HOH HOH A . 
I 5 HOH 11 23  72  HOH HOH A . 
I 5 HOH 12 24  93  HOH HOH A . 
I 5 HOH 13 25  107 HOH HOH A . 
I 5 HOH 14 26  108 HOH HOH A . 
I 5 HOH 15 27  139 HOH HOH A . 
I 5 HOH 16 28  140 HOH HOH A . 
I 5 HOH 17 29  141 HOH HOH A . 
I 5 HOH 18 30  144 HOH HOH A . 
I 5 HOH 19 31  149 HOH HOH A . 
I 5 HOH 20 32  152 HOH HOH A . 
I 5 HOH 21 33  157 HOH HOH A . 
I 5 HOH 22 34  204 HOH HOH A . 
I 5 HOH 23 35  205 HOH HOH A . 
J 5 HOH 1  3   3   HOH HOH B . 
J 5 HOH 2  4   4   HOH HOH B . 
J 5 HOH 3  8   8   HOH HOH B . 
J 5 HOH 4  9   9   HOH HOH B . 
J 5 HOH 5  42  42  HOH HOH B . 
J 5 HOH 6  45  45  HOH HOH B . 
J 5 HOH 7  46  46  HOH HOH B . 
J 5 HOH 8  55  55  HOH HOH B . 
J 5 HOH 9  82  82  HOH HOH B . 
J 5 HOH 10 91  91  HOH HOH B . 
J 5 HOH 11 94  94  HOH HOH B . 
J 5 HOH 12 111 111 HOH HOH B . 
J 5 HOH 13 112 112 HOH HOH B . 
J 5 HOH 14 113 113 HOH HOH B . 
J 5 HOH 15 121 121 HOH HOH B . 
J 5 HOH 16 138 138 HOH HOH B . 
J 5 HOH 17 151 151 HOH HOH B . 
J 5 HOH 18 153 153 HOH HOH B . 
J 5 HOH 19 154 154 HOH HOH B . 
J 5 HOH 20 155 155 HOH HOH B . 
J 5 HOH 21 179 179 HOH HOH B . 
J 5 HOH 22 203 203 HOH HOH B . 
J 5 HOH 23 206 206 HOH HOH B . 
K 5 HOH 1  13  2   HOH HOH D . 
K 5 HOH 2  14  20  HOH HOH D . 
K 5 HOH 3  15  22  HOH HOH D . 
K 5 HOH 4  16  23  HOH HOH D . 
K 5 HOH 5  17  30  HOH HOH D . 
K 5 HOH 6  18  33  HOH HOH D . 
K 5 HOH 7  19  37  HOH HOH D . 
K 5 HOH 8  20  59  HOH HOH D . 
K 5 HOH 9  21  60  HOH HOH D . 
K 5 HOH 10 22  61  HOH HOH D . 
K 5 HOH 11 23  63  HOH HOH D . 
K 5 HOH 12 24  65  HOH HOH D . 
K 5 HOH 13 25  67  HOH HOH D . 
K 5 HOH 14 26  114 HOH HOH D . 
K 5 HOH 15 27  115 HOH HOH D . 
K 5 HOH 16 28  125 HOH HOH D . 
K 5 HOH 17 29  129 HOH HOH D . 
K 5 HOH 18 30  130 HOH HOH D . 
K 5 HOH 19 31  133 HOH HOH D . 
K 5 HOH 20 32  134 HOH HOH D . 
K 5 HOH 21 33  135 HOH HOH D . 
K 5 HOH 22 34  167 HOH HOH D . 
K 5 HOH 23 35  169 HOH HOH D . 
K 5 HOH 24 36  170 HOH HOH D . 
K 5 HOH 25 37  182 HOH HOH D . 
K 5 HOH 26 38  202 HOH HOH D . 
K 5 HOH 27 39  207 HOH HOH D . 
K 5 HOH 28 40  208 HOH HOH D . 
K 5 HOH 29 41  209 HOH HOH D . 
K 5 HOH 30 42  210 HOH HOH D . 
K 5 HOH 31 43  211 HOH HOH D . 
K 5 HOH 32 44  216 HOH HOH D . 
K 5 HOH 33 45  217 HOH HOH D . 
L 5 HOH 1  29  17  HOH HOH E . 
L 5 HOH 2  30  19  HOH HOH E . 
L 5 HOH 3  31  25  HOH HOH E . 
L 5 HOH 4  32  58  HOH HOH E . 
L 5 HOH 5  33  77  HOH HOH E . 
L 5 HOH 6  34  78  HOH HOH E . 
L 5 HOH 7  35  106 HOH HOH E . 
L 5 HOH 8  36  116 HOH HOH E . 
L 5 HOH 9  37  122 HOH HOH E . 
L 5 HOH 10 38  124 HOH HOH E . 
L 5 HOH 11 39  126 HOH HOH E . 
L 5 HOH 12 40  132 HOH HOH E . 
L 5 HOH 13 41  136 HOH HOH E . 
L 5 HOH 14 42  146 HOH HOH E . 
L 5 HOH 15 43  162 HOH HOH E . 
L 5 HOH 16 44  164 HOH HOH E . 
L 5 HOH 17 45  171 HOH HOH E . 
L 5 HOH 18 46  172 HOH HOH E . 
L 5 HOH 19 47  183 HOH HOH E . 
L 5 HOH 20 48  201 HOH HOH E . 
L 5 HOH 21 49  212 HOH HOH E . 
L 5 HOH 22 50  213 HOH HOH E . 
L 5 HOH 23 51  214 HOH HOH E . 
L 5 HOH 24 52  215 HOH HOH E . 
M 5 HOH 1  267 5   HOH HOH C . 
M 5 HOH 2  268 7   HOH HOH C . 
M 5 HOH 3  269 10  HOH HOH C . 
M 5 HOH 4  270 11  HOH HOH C . 
M 5 HOH 5  271 12  HOH HOH C . 
M 5 HOH 6  272 13  HOH HOH C . 
M 5 HOH 7  273 14  HOH HOH C . 
M 5 HOH 8  274 15  HOH HOH C . 
M 5 HOH 9  275 26  HOH HOH C . 
M 5 HOH 10 276 41  HOH HOH C . 
M 5 HOH 11 277 43  HOH HOH C . 
M 5 HOH 12 278 49  HOH HOH C . 
M 5 HOH 13 279 52  HOH HOH C . 
M 5 HOH 14 280 53  HOH HOH C . 
M 5 HOH 15 281 56  HOH HOH C . 
M 5 HOH 16 282 57  HOH HOH C . 
M 5 HOH 17 283 70  HOH HOH C . 
M 5 HOH 18 284 73  HOH HOH C . 
M 5 HOH 19 285 79  HOH HOH C . 
M 5 HOH 20 286 80  HOH HOH C . 
M 5 HOH 21 287 81  HOH HOH C . 
M 5 HOH 22 288 83  HOH HOH C . 
M 5 HOH 23 289 84  HOH HOH C . 
M 5 HOH 24 290 85  HOH HOH C . 
M 5 HOH 25 291 86  HOH HOH C . 
M 5 HOH 26 292 87  HOH HOH C . 
M 5 HOH 27 293 88  HOH HOH C . 
M 5 HOH 28 294 89  HOH HOH C . 
M 5 HOH 29 295 90  HOH HOH C . 
M 5 HOH 30 296 92  HOH HOH C . 
M 5 HOH 31 297 109 HOH HOH C . 
M 5 HOH 32 298 110 HOH HOH C . 
M 5 HOH 33 299 117 HOH HOH C . 
M 5 HOH 34 300 119 HOH HOH C . 
M 5 HOH 35 301 120 HOH HOH C . 
M 5 HOH 36 302 137 HOH HOH C . 
M 5 HOH 37 303 142 HOH HOH C . 
M 5 HOH 38 304 143 HOH HOH C . 
M 5 HOH 39 305 148 HOH HOH C . 
M 5 HOH 40 306 158 HOH HOH C . 
M 5 HOH 41 307 159 HOH HOH C . 
M 5 HOH 42 308 160 HOH HOH C . 
M 5 HOH 43 309 174 HOH HOH C . 
M 5 HOH 44 310 180 HOH HOH C . 
M 5 HOH 45 311 181 HOH HOH C . 
M 5 HOH 46 312 184 HOH HOH C . 
M 5 HOH 47 313 186 HOH HOH C . 
M 5 HOH 48 314 190 HOH HOH C . 
M 5 HOH 49 315 191 HOH HOH C . 
M 5 HOH 50 316 192 HOH HOH C . 
M 5 HOH 51 317 193 HOH HOH C . 
M 5 HOH 52 318 194 HOH HOH C . 
M 5 HOH 53 319 218 HOH HOH C . 
N 5 HOH 1  267 1   HOH HOH F . 
N 5 HOH 2  268 16  HOH HOH F . 
N 5 HOH 3  269 18  HOH HOH F . 
N 5 HOH 4  270 21  HOH HOH F . 
N 5 HOH 5  271 28  HOH HOH F . 
N 5 HOH 6  272 29  HOH HOH F . 
N 5 HOH 7  273 31  HOH HOH F . 
N 5 HOH 8  274 32  HOH HOH F . 
N 5 HOH 9  275 34  HOH HOH F . 
N 5 HOH 10 276 35  HOH HOH F . 
N 5 HOH 11 277 36  HOH HOH F . 
N 5 HOH 12 278 40  HOH HOH F . 
N 5 HOH 13 279 62  HOH HOH F . 
N 5 HOH 14 280 64  HOH HOH F . 
N 5 HOH 15 281 66  HOH HOH F . 
N 5 HOH 16 282 68  HOH HOH F . 
N 5 HOH 17 283 71  HOH HOH F . 
N 5 HOH 18 284 74  HOH HOH F . 
N 5 HOH 19 285 95  HOH HOH F . 
N 5 HOH 20 286 96  HOH HOH F . 
N 5 HOH 21 287 97  HOH HOH F . 
N 5 HOH 22 288 98  HOH HOH F . 
N 5 HOH 23 289 99  HOH HOH F . 
N 5 HOH 24 290 100 HOH HOH F . 
N 5 HOH 25 291 101 HOH HOH F . 
N 5 HOH 26 292 102 HOH HOH F . 
N 5 HOH 27 293 103 HOH HOH F . 
N 5 HOH 28 294 104 HOH HOH F . 
N 5 HOH 29 295 105 HOH HOH F . 
N 5 HOH 30 296 123 HOH HOH F . 
N 5 HOH 31 297 127 HOH HOH F . 
N 5 HOH 32 298 128 HOH HOH F . 
N 5 HOH 33 299 131 HOH HOH F . 
N 5 HOH 34 300 147 HOH HOH F . 
N 5 HOH 35 301 163 HOH HOH F . 
N 5 HOH 36 302 165 HOH HOH F . 
N 5 HOH 37 303 166 HOH HOH F . 
N 5 HOH 38 304 175 HOH HOH F . 
N 5 HOH 39 305 176 HOH HOH F . 
N 5 HOH 40 306 177 HOH HOH F . 
N 5 HOH 41 307 178 HOH HOH F . 
N 5 HOH 42 308 185 HOH HOH F . 
N 5 HOH 43 309 187 HOH HOH F . 
N 5 HOH 44 310 188 HOH HOH F . 
N 5 HOH 45 311 189 HOH HOH F . 
N 5 HOH 46 312 195 HOH HOH F . 
N 5 HOH 47 313 196 HOH HOH F . 
N 5 HOH 48 314 197 HOH HOH F . 
N 5 HOH 49 315 198 HOH HOH F . 
N 5 HOH 50 316 199 HOH HOH F . 
N 5 HOH 51 317 200 HOH HOH F . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA trimeric 3 
2 author_and_software_defined_assembly PISA trimeric 3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,G,I,J,M 
2 1 C,D,F,H,K,L,N 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3090  ? 
1 MORE         -37.1 ? 
1 'SSA (A^2)'  9790  ? 
2 'ABSA (A^2)' 3140  ? 
2 MORE         -33.6 ? 
2 'SSA (A^2)'  9720  ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 O ? E LEU 68 ? C LEU 217 ? 1_555 CA ? G CA . ? C CA 1 ? 1_555 O ? E HIS 71 ? C HIS 220 ? 1_555 83.3  ? 
2 O ? E LEU 68 ? C LEU 217 ? 1_555 CA ? G CA . ? C CA 1 ? 1_555 O ? E PHE 74 ? C PHE 223 ? 1_555 102.3 ? 
3 O ? E HIS 71 ? C HIS 220 ? 1_555 CA ? G CA . ? C CA 1 ? 1_555 O ? E PHE 74 ? C PHE 223 ? 1_555 71.5  ? 
4 O ? F LEU 68 ? F LEU 217 ? 1_555 CA ? H CA . ? F CA 2 ? 1_555 O ? F PHE 74 ? F PHE 223 ? 1_555 96.4  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-09-16 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-10-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
DENZO       .     ?                    package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu    'data reduction'  
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 1 
SCALEPACK   .     ?                    package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu    'data scaling'    
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 2 
CNS         .     ?                    package 'Axel T. Brunger'    axel.brunger@yale.edu    refinement        
http://cns.csb.yale.edu/v1.1/                    Fortran_77 ? 3 
PDB_EXTRACT 3.005 'September 10, 2007' package PDB                  sw-help@rcsb.rutgers.edu 'data extraction' 
http://pdb.rutgers.edu/software/                 C++        ? 4 
SOLVE       .     ?                    ?       ?                    ?                        phasing           ? ?          ? 5 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 CB C GLU 229 ? ? 1_555 CB C GLU 229 ? ? 2_555 1.88 
2 1 CB F GLU 229 ? ? 1_555 CB F GLU 229 ? ? 2_555 2.06 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    ASN 
_pdbx_validate_torsion.auth_asym_id    F 
_pdbx_validate_torsion.auth_seq_id     204 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -45.69 
_pdbx_validate_torsion.psi             -77.88 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 C LYS 192 ? CG  ? E LYS 43 CG  
2  1 Y 1 C LYS 192 ? CD  ? E LYS 43 CD  
3  1 Y 1 C LYS 192 ? CE  ? E LYS 43 CE  
4  1 Y 1 C LYS 192 ? NZ  ? E LYS 43 NZ  
5  1 Y 1 C LYS 198 ? CG  ? E LYS 49 CG  
6  1 Y 1 C LYS 198 ? CD  ? E LYS 49 CD  
7  1 Y 1 C LYS 198 ? CE  ? E LYS 49 CE  
8  1 Y 1 C LYS 198 ? NZ  ? E LYS 49 NZ  
9  1 Y 1 C ASN 204 ? CG  ? E ASN 55 CG  
10 1 Y 1 C ASN 204 ? OD1 ? E ASN 55 OD1 
11 1 Y 1 C ASN 204 ? ND2 ? E ASN 55 ND2 
12 1 Y 1 F GLU 188 ? CG  ? F GLU 39 CG  
13 1 Y 1 F GLU 188 ? CD  ? F GLU 39 CD  
14 1 Y 1 F GLU 188 ? OE1 ? F GLU 39 OE1 
15 1 Y 1 F GLU 188 ? OE2 ? F GLU 39 OE2 
16 1 Y 1 F LYS 192 ? CG  ? F LYS 43 CG  
17 1 Y 1 F LYS 192 ? CD  ? F LYS 43 CD  
18 1 Y 1 F LYS 192 ? CE  ? F LYS 43 CE  
19 1 Y 1 F LYS 192 ? NZ  ? F LYS 43 NZ  
20 1 Y 1 F LYS 198 ? CG  ? F LYS 49 CG  
21 1 Y 1 F LYS 198 ? CD  ? F LYS 49 CD  
22 1 Y 1 F LYS 198 ? CE  ? F LYS 49 CE  
23 1 Y 1 F LYS 198 ? NZ  ? F LYS 49 NZ  
24 1 Y 1 F SER 203 ? OG  ? F SER 54 OG  
25 1 Y 1 F ASN 204 ? CB  ? F ASN 55 CB  
26 1 Y 1 F ASN 204 ? CG  ? F ASN 55 CG  
27 1 Y 1 F ASN 204 ? OD1 ? F ASN 55 OD1 
28 1 Y 1 F ASN 204 ? ND2 ? F ASN 55 ND2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 C SER 150 ? E SER 1   
2  1 Y 1 C LYS 151 ? E LYS 2   
3  1 Y 1 C SER 152 ? E SER 3   
4  1 Y 1 C SER 153 ? E SER 4   
5  1 Y 1 C SER 154 ? E SER 5   
6  1 Y 1 C SER 155 ? E SER 6   
7  1 Y 1 C GLU 242 ? E GLU 93  
8  1 Y 1 C GLY 243 ? E GLY 94  
9  1 Y 1 C GLY 244 ? E GLY 95  
10 1 Y 1 C LYS 245 ? E LYS 96  
11 1 Y 1 C SER 246 ? E SER 97  
12 1 Y 1 C GLY 247 ? E GLY 98  
13 1 Y 1 C LYS 248 ? E LYS 99  
14 1 Y 1 C SER 249 ? E SER 100 
15 1 Y 1 C PRO 250 ? E PRO 101 
16 1 Y 1 C ARG 251 ? E ARG 102 
17 1 Y 1 C ARG 252 ? E ARG 103 
18 1 Y 1 C ARG 253 ? E ARG 104 
19 1 Y 1 C ALA 254 ? E ALA 105 
20 1 Y 1 C ALA 255 ? E ALA 106 
21 1 Y 1 C SER 256 ? E SER 107 
22 1 Y 1 C MET 257 ? E MET 108 
23 1 Y 1 C ASP 258 ? E ASP 109 
24 1 Y 1 C ASN 259 ? E ASN 110 
25 1 Y 1 C ASN 260 ? E ASN 111 
26 1 Y 1 C SER 261 ? E SER 112 
27 1 Y 1 C LYS 262 ? E LYS 113 
28 1 Y 1 C PHE 263 ? E PHE 114 
29 1 Y 1 C ALA 264 ? E ALA 115 
30 1 Y 1 C LYS 265 ? E LYS 116 
31 1 Y 1 C SER 266 ? E SER 117 
32 1 Y 1 F SER 150 ? F SER 1   
33 1 Y 1 F LYS 151 ? F LYS 2   
34 1 Y 1 F SER 152 ? F SER 3   
35 1 Y 1 F SER 153 ? F SER 4   
36 1 Y 1 F SER 154 ? F SER 5   
37 1 Y 1 F GLU 242 ? F GLU 93  
38 1 Y 1 F GLY 243 ? F GLY 94  
39 1 Y 1 F GLY 244 ? F GLY 95  
40 1 Y 1 F LYS 245 ? F LYS 96  
41 1 Y 1 F SER 246 ? F SER 97  
42 1 Y 1 F GLY 247 ? F GLY 98  
43 1 Y 1 F LYS 248 ? F LYS 99  
44 1 Y 1 F SER 249 ? F SER 100 
45 1 Y 1 F PRO 250 ? F PRO 101 
46 1 Y 1 F ARG 251 ? F ARG 102 
47 1 Y 1 F ARG 252 ? F ARG 103 
48 1 Y 1 F ARG 253 ? F ARG 104 
49 1 Y 1 F ALA 254 ? F ALA 105 
50 1 Y 1 F ALA 255 ? F ALA 106 
51 1 Y 1 F SER 256 ? F SER 107 
52 1 Y 1 F MET 257 ? F MET 108 
53 1 Y 1 F ASP 258 ? F ASP 109 
54 1 Y 1 F ASN 259 ? F ASN 110 
55 1 Y 1 F ASN 260 ? F ASN 111 
56 1 Y 1 F SER 261 ? F SER 112 
57 1 Y 1 F LYS 262 ? F LYS 113 
58 1 Y 1 F PHE 263 ? F PHE 114 
59 1 Y 1 F ALA 264 ? F ALA 115 
60 1 Y 1 F LYS 265 ? F LYS 116 
61 1 Y 1 F SER 266 ? F SER 117 
# 
_ndb_struct_conf_na.entry_id   3COA 
_ndb_struct_conf_na.feature    'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DT 1  1_555 B DA 16 1_555 -0.068 -0.129 0.288  -7.336  -12.494 2.940  1  A_DT-4:DA28_B A -4 ? B 28 ? 20 1 
1 A DG 2  1_555 B DC 15 1_555 -0.250 -0.052 0.072  3.433   -3.927  1.841  2  A_DG-3:DC27_B A -3 ? B 27 ? 19 1 
1 A DG 3  1_555 B DC 14 1_555 -0.268 -0.154 -0.219 -0.325  -14.143 3.798  3  A_DG-2:DC26_B A -2 ? B 26 ? 19 1 
1 A DT 4  1_555 B DA 13 1_555 -0.012 -0.127 -0.004 -6.784  -14.665 2.471  4  A_DT-1:DA25_B A -1 ? B 25 ? 20 1 
1 A DT 5  1_555 B DA 12 1_555 0.001  -0.104 0.184  -12.164 -13.536 2.068  5  A_DT1:DA24_B  A 1  ? B 24 ? 20 1 
1 A DT 6  1_555 B DA 11 1_555 -0.073 -0.173 -0.171 -11.009 -5.484  2.021  6  A_DT2:DA23_B  A 2  ? B 23 ? 20 1 
1 A DG 7  1_555 B DC 10 1_555 -0.216 0.030  -0.449 -13.789 -6.817  2.590  7  A_DG3:DC22_B  A 3  ? B 22 ? 19 1 
1 A DT 8  1_555 B DA 9  1_555 -0.192 -0.080 0.069  -1.988  -7.508  -0.858 8  A_DT4:DA21_B  A 4  ? B 21 ? 20 1 
1 A DT 9  1_555 B DA 8  1_555 0.022  -0.142 -0.189 1.949   -11.724 7.185  9  A_DT5:DA20_B  A 5  ? B 20 ? 20 1 
1 A DT 10 1_555 B DA 7  1_555 -0.023 -0.052 -0.373 4.789   -9.304  0.245  10 A_DT6:DA19_B  A 6  ? B 19 ? 20 1 
1 A DT 11 1_555 B DA 6  1_555 0.044  -0.076 -0.164 3.846   -11.061 3.244  11 A_DT7:DA18_B  A 7  ? B 18 ? 20 1 
1 A DG 12 1_555 B DC 5  1_555 -0.117 -0.114 -0.133 -1.208  -5.346  -0.143 12 A_DG8:DC17_B  A 8  ? B 17 ? 19 1 
1 A DC 13 1_555 B DG 4  1_555 0.075  -0.178 -0.131 -1.181  -8.482  0.877  13 A_DC9:DG16_B  A 9  ? B 16 ? 19 1 
1 A DT 14 1_555 B DA 3  1_555 -0.061 0.003  0.411  -8.289  -9.166  1.919  14 A_DT10:DA15_B A 10 ? B 15 ? 20 1 
1 A DT 15 1_555 B DA 2  1_555 0.011  -0.232 -0.172 -2.640  -10.850 6.871  15 A_DT11:DA14_B A 11 ? B 14 ? 20 1 
1 A DG 16 1_555 B DC 1  1_555 -0.165 -0.166 -0.189 -3.263  -6.050  -1.193 16 A_DG12:DC13_B A 12 ? B 13 ? 19 1 
1 C DT 1  1_555 D DA 16 1_555 -0.102 -0.095 0.062  -3.629  -15.389 0.831  17 D_DT-4:DA28_E D -4 ? E 28 ? 20 1 
1 C DG 2  1_555 D DC 15 1_555 -0.367 -0.143 -0.087 3.474   -1.194  1.211  18 D_DG-3:DC27_E D -3 ? E 27 ? 19 1 
1 C DG 3  1_555 D DC 14 1_555 -0.366 -0.126 -0.258 -2.577  -13.751 5.054  19 D_DG-2:DC26_E D -2 ? E 26 ? 19 1 
1 C DT 4  1_555 D DA 13 1_555 -0.124 -0.147 0.084  -10.132 -15.487 3.779  20 D_DT-1:DA25_E D -1 ? E 25 ? 20 1 
1 C DT 5  1_555 D DA 12 1_555 -0.202 -0.080 0.180  -12.846 -16.351 0.674  21 D_DT1:DA24_E  D 1  ? E 24 ? 20 1 
1 C DT 6  1_555 D DA 11 1_555 0.030  -0.276 -0.248 -12.702 -6.579  3.808  22 D_DT2:DA23_E  D 2  ? E 23 ? 20 1 
1 C DG 7  1_555 D DC 10 1_555 -0.241 0.074  -0.327 -13.152 -8.434  1.549  23 D_DG3:DC22_E  D 3  ? E 22 ? 19 1 
1 C DT 8  1_555 D DA 9  1_555 -0.112 -0.141 -0.173 -1.358  -9.818  1.984  24 D_DT4:DA21_E  D 4  ? E 21 ? 20 1 
1 C DT 9  1_555 D DA 8  1_555 -0.059 -0.168 -0.308 4.210   -14.379 10.443 25 D_DT5:DA20_E  D 5  ? E 20 ? 20 1 
1 C DT 10 1_555 D DA 7  1_555 -0.041 -0.038 -0.262 10.392  -9.258  -0.116 26 D_DT6:DA19_E  D 6  ? E 19 ? 20 1 
1 C DT 11 1_555 D DA 6  1_555 0.019  -0.099 -0.312 7.697   -12.760 3.686  27 D_DT7:DA18_E  D 7  ? E 18 ? 20 1 
1 C DG 12 1_555 D DC 5  1_555 -0.280 -0.023 -0.293 -15.392 -15.674 1.716  28 D_DG8:DC17_E  D 8  ? E 17 ? 19 1 
1 C DC 13 1_555 D DG 4  1_555 0.076  -0.187 0.117  -15.826 -5.609  3.025  29 D_DC9:DG16_E  D 9  ? E 16 ? 19 1 
1 C DT 14 1_555 D DA 3  1_555 -0.009 -0.046 0.303  -16.637 -12.068 0.886  30 D_DT10:DA15_E D 10 ? E 15 ? 20 1 
1 C DT 15 1_555 D DA 2  1_555 -0.157 -0.148 0.213  -8.831  -10.206 5.210  31 D_DT11:DA14_E D 11 ? E 14 ? 20 1 
1 C DG 16 1_555 D DC 1  1_555 -0.120 -0.071 -0.091 -7.112  -8.103  -1.923 32 D_DG12:DC13_E D 12 ? E 13 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DT 1  1_555 B DA 16 1_555 A DG 2  1_555 B DC 15 1_555 0.905  1.298  3.174 3.350  -2.266 36.460 2.363  -0.993 3.159 -3.609 
-5.333 36.677 1  AA_DT-4DG-3:DC27DA28_BB A -4 ? B 28 ? A -3 ? B 27 ? 
1 A DG 2  1_555 B DC 15 1_555 A DG 3  1_555 B DC 14 1_555 -0.786 0.261  3.508 -1.448 5.472  33.644 -0.496 1.090  3.535 9.371  
2.480  34.104 2  AA_DG-3DG-2:DC26DC27_BB A -3 ? B 27 ? A -2 ? B 26 ? 
1 A DG 3  1_555 B DC 14 1_555 A DT 4  1_555 B DA 13 1_555 -0.352 -0.693 3.414 -1.810 -1.104 37.795 -0.919 0.298  3.445 -1.703 
2.792  37.852 3  AA_DG-2DT-1:DA25DC26_BB A -2 ? B 26 ? A -1 ? B 25 ? 
1 A DT 4  1_555 B DA 13 1_555 A DT 5  1_555 B DA 12 1_555 -0.295 -0.403 3.395 -2.485 -0.585 37.545 -0.546 0.121  3.412 -0.908 
3.855  37.629 4  AA_DT-1DT1:DA24DA25_BB  A -1 ? B 25 ? A 1  ? B 24 ? 
1 A DT 5  1_555 B DA 12 1_555 A DT 6  1_555 B DA 11 1_555 0.493  0.245  3.204 2.533  -1.610 38.250 0.571  -0.439 3.216 -2.452 
-3.858 38.363 5  AA_DT1DT2:DA23DA24_BB   A 1  ? B 24 ? A 2  ? B 23 ? 
1 A DT 6  1_555 B DA 11 1_555 A DG 7  1_555 B DC 10 1_555 0.232  -0.338 3.470 2.173  12.200 27.018 -3.344 0.026  3.045 24.540 
-4.371 29.676 6  AA_DT2DG3:DC22DA23_BB   A 2  ? B 23 ? A 3  ? B 22 ? 
1 A DG 7  1_555 B DC 10 1_555 A DT 8  1_555 B DA 9  1_555 -0.503 -0.682 3.123 -3.309 3.376  28.970 -2.037 0.316  3.063 6.691  
6.560  29.345 7  AA_DG3DT4:DA21DC22_BB   A 3  ? B 22 ? A 4  ? B 21 ? 
1 A DT 8  1_555 B DA 9  1_555 A DT 9  1_555 B DA 8  1_555 1.383  -0.055 3.197 5.321  3.344  36.333 -0.544 -1.461 3.341 5.314  
-8.455 36.854 8  AA_DT4DT5:DA20DA21_BB   A 4  ? B 21 ? A 5  ? B 20 ? 
1 A DT 9  1_555 B DA 8  1_555 A DT 10 1_555 B DA 7  1_555 -0.751 -0.561 3.224 0.692  8.477  27.391 -2.970 1.666  2.904 17.378 
-1.420 28.657 9  AA_DT5DT6:DA19DA20_BB   A 5  ? B 20 ? A 6  ? B 19 ? 
1 A DT 10 1_555 B DA 7  1_555 A DT 11 1_555 B DA 6  1_555 0.150  -0.567 3.391 -0.739 1.867  31.157 -1.419 -0.424 3.348 3.471  
1.373  31.220 10 AA_DT6DT7:DA18DA19_BB   A 6  ? B 19 ? A 7  ? B 18 ? 
1 A DT 11 1_555 B DA 6  1_555 A DG 12 1_555 B DC 5  1_555 -0.386 -0.551 3.495 -1.759 8.927  32.264 -2.501 0.366  3.248 15.679 
3.089  33.490 11 AA_DT7DG8:DC17DA18_BB   A 7  ? B 18 ? A 8  ? B 17 ? 
1 A DG 12 1_555 B DC 5  1_555 A DC 13 1_555 B DG 4  1_555 0.685  -0.263 3.271 2.817  6.188  35.483 -1.301 -0.706 3.224 10.040 
-4.571 36.108 12 AA_DG8DC9:DG16DC17_BB   A 8  ? B 17 ? A 9  ? B 16 ? 
1 A DC 13 1_555 B DG 4  1_555 A DT 14 1_555 B DA 3  1_555 -0.434 -0.536 3.560 -3.929 9.796  28.590 -3.122 -0.017 3.235 19.036 
7.635  30.438 13 AA_DC9DT10:DA15DG16_BB  A 9  ? B 16 ? A 10 ? B 15 ? 
1 A DT 14 1_555 B DA 3  1_555 A DT 15 1_555 B DA 2  1_555 0.186  -0.224 3.076 5.423  5.995  35.044 -1.167 0.426  2.993 9.795  
-8.861 35.936 14 AA_DT10DT11:DA14DA15_BB A 10 ? B 15 ? A 11 ? B 14 ? 
1 A DT 15 1_555 B DA 2  1_555 A DG 16 1_555 B DC 1  1_555 -0.171 0.523  3.466 -4.188 7.876  36.498 -0.299 -0.326 3.498 12.350 
6.566  37.537 15 AA_DT11DG12:DC13DA14_BB A 11 ? B 14 ? A 12 ? B 13 ? 
1 C DT 1  1_555 D DA 16 1_555 C DG 2  1_555 D DC 15 1_555 0.708  1.576  3.216 1.065  -2.078 38.190 2.659  -0.950 3.147 -3.172 
-1.626 38.258 16 DD_DT-4DG-3:DC27DA28_EE D -4 ? E 28 ? D -3 ? E 27 ? 
1 C DG 2  1_555 D DC 15 1_555 C DG 3  1_555 D DC 14 1_555 -0.398 -0.116 3.467 -0.245 5.798  31.888 -1.289 0.668  3.396 10.445 
0.442  32.398 17 DD_DG-3DG-2:DC26DC27_EE D -3 ? E 27 ? D -2 ? E 26 ? 
1 C DG 3  1_555 D DC 14 1_555 C DT 4  1_555 D DA 13 1_555 -0.402 -0.709 3.443 -2.847 0.404  38.557 -1.123 0.237  3.456 0.611  
4.304  38.660 18 DD_DG-2DT-1:DA25DC26_EE D -2 ? E 26 ? D -1 ? E 25 ? 
1 C DT 4  1_555 D DA 13 1_555 C DT 5  1_555 D DA 12 1_555 -0.385 -0.308 3.287 -1.999 -3.464 36.118 -0.004 0.335  3.317 -5.566 
3.212  36.331 19 DD_DT-1DT1:DA24DA25_EE  D -1 ? E 25 ? D 1  ? E 24 ? 
1 C DT 5  1_555 D DA 12 1_555 C DT 6  1_555 D DA 11 1_555 0.620  0.207  3.279 3.884  -0.048 39.700 0.309  -0.456 3.323 -0.071 
-5.702 39.882 20 DD_DT1DT2:DA23DA24_EE   D 1  ? E 24 ? D 2  ? E 23 ? 
1 C DT 6  1_555 D DA 11 1_555 C DG 7  1_555 D DC 10 1_555 0.172  -0.425 3.425 -0.228 12.974 25.684 -3.833 -0.399 2.879 27.093 
0.476  28.726 21 DD_DT2DG3:DC22DA23_EE   D 2  ? E 23 ? D 3  ? E 22 ? 
1 C DG 7  1_555 D DC 10 1_555 C DT 8  1_555 D DA 9  1_555 -0.469 -0.572 3.071 -0.313 4.560  28.040 -2.136 0.889  2.948 9.333  
0.641  28.402 22 DD_DG3DT4:DA21DC22_EE   D 3  ? E 22 ? D 4  ? E 21 ? 
1 C DT 8  1_555 D DA 9  1_555 C DT 9  1_555 D DA 8  1_555 1.212  0.105  3.112 4.411  5.927  35.263 -0.653 -1.348 3.210 9.652  
-7.184 36.005 23 DD_DT4DT5:DA20DA21_EE   D 4  ? E 21 ? D 5  ? E 20 ? 
1 C DT 9  1_555 D DA 8  1_555 C DT 10 1_555 D DA 7  1_555 -0.818 -0.492 3.171 -2.682 5.631  29.585 -2.048 1.042  3.088 10.876 
5.180  30.221 24 DD_DT5DT6:DA19DA20_EE   D 5  ? E 20 ? D 6  ? E 19 ? 
1 C DT 10 1_555 D DA 7  1_555 C DT 11 1_555 D DA 6  1_555 0.282  -0.620 3.380 0.309  -2.141 32.604 -0.716 -0.446 3.415 -3.808 
-0.549 32.674 25 DD_DT6DT7:DA18DA19_EE   D 6  ? E 19 ? D 7  ? E 18 ? 
1 C DT 11 1_555 D DA 6  1_555 C DG 12 1_555 D DC 5  1_555 -0.508 -0.999 3.802 -2.751 8.600  34.457 -3.054 0.378  3.490 14.217 
4.547  35.585 26 DD_DT7DG8:DC17DA18_EE   D 7  ? E 18 ? D 8  ? E 17 ? 
1 C DG 12 1_555 D DC 5  1_555 C DC 13 1_555 D DG 4  1_555 0.337  -0.293 3.226 -0.918 0.357  40.829 -0.458 -0.582 3.216 0.511  
1.315  40.840 27 DD_DG8DC9:DG16DC17_EE   D 8  ? E 17 ? D 9  ? E 16 ? 
1 C DC 13 1_555 D DG 4  1_555 C DT 14 1_555 D DA 3  1_555 -0.801 0.014  3.340 -3.035 6.544  28.801 -1.399 0.903  3.327 12.902 
5.984  29.672 28 DD_DC9DT10:DA15DG16_EE  D 9  ? E 16 ? D 10 ? E 15 ? 
1 C DT 14 1_555 D DA 3  1_555 C DT 15 1_555 D DA 2  1_555 0.039  -0.160 3.106 -0.675 2.889  32.680 -0.754 -0.178 3.079 5.121  
1.196  32.811 29 DD_DT10DT11:DA14DA15_EE D 10 ? E 15 ? D 11 ? E 14 ? 
1 C DT 15 1_555 D DA 2  1_555 C DG 16 1_555 D DC 1  1_555 -0.068 0.304  3.364 0.122  6.640  35.139 -0.499 0.129  3.363 10.878 
-0.201 35.741 30 DD_DT11DG12:DC13DA14_EE D 11 ? E 14 ? D 12 ? E 13 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'CALCIUM ION' CA  
5 water         HOH 
#