data_3CQ6
# 
_entry.id   3CQ6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3CQ6         
RCSB  RCSB047078   
WWPDB D_1000047078 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3CQ4 . unspecified 
PDB 3CQ5 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3CQ6 
_pdbx_database_status.recvd_initial_deposition_date   2008-04-02 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Sandalova, T.'   1 
'Marienhagen, J.' 2 
'Schneider, G.'   3 
# 
_citation.id                        primary 
_citation.title                     
;Insights into the structural basis of substrate recognition by histidinol-phosphate aminotransferase from Corynebacterium glutamicum
;
_citation.journal_abbrev            'Acta Crystallogr.,Sect.D' 
_citation.journal_volume            64 
_citation.page_first                675 
_citation.page_last                 685 
_citation.year                      2008 
_citation.journal_id_ASTM           ABCRE6 
_citation.country                   DK 
_citation.journal_id_ISSN           0907-4449 
_citation.journal_id_CSD            0766 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18560156 
_citation.pdbx_database_id_DOI      10.1107/S0907444908009438 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Marienhagen, J.' 1 
primary 'Sandalova, T.'   2 
primary 'Sahm, H.'        3 
primary 'Eggeling, L.'    4 
primary 'Schneider, G.'   5 
# 
_cell.entry_id           3CQ6 
_cell.length_a           191.798 
_cell.length_b           80.017 
_cell.length_c           88.484 
_cell.angle_alpha        90.00 
_cell.angle_beta         94.79 
_cell.angle_gamma        90.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3CQ6 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Histidinol-phosphate aminotransferase' 40467.496 3   2.6.1.9 ? ? ? 
2 non-polymer syn 'PHOSPHATE ION'                         94.971    7   ?       ? ? ? 
3 water       nat water                                   18.015    361 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Imidazole acetol-phosphate transaminase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;GSHMTKITLSDLPLREELRGEHAYGAPQLNVDIRLNTNENPYPPSEALVADLVATVDKIATELNRYPERDAVELRDELAA
YITKQTGVAVTRDNLWAANGSNEILQQLLQAFGGPGRTALGFQPSYSMHPILAKGTHTEFIAVSRGADFRIDMDVALEEI
RAKQPDIVFVTTPNNPTGDVTSLDDVERIINVAPGIVIVDEAYAEFSPSPSATTLLEKYPTKLVVSRTMS(LLP)AFDFA
GGRLGYFVANPAFIDAVMLVRLPYHLSALSQAAAIVALRHSADTLGTVEKLSVERVRVAARLEELGYAVVPSESNFVFFG
DFSDQHAAWQAFLDRGVLIRDVGIAGHLRTTIGVPEENDAFLDAAAEIIKLNL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSHMTKITLSDLPLREELRGEHAYGAPQLNVDIRLNTNENPYPPSEALVADLVATVDKIATELNRYPERDAVELRDELAA
YITKQTGVAVTRDNLWAANGSNEILQQLLQAFGGPGRTALGFQPSYSMHPILAKGTHTEFIAVSRGADFRIDMDVALEEI
RAKQPDIVFVTTPNNPTGDVTSLDDVERIINVAPGIVIVDEAYAEFSPSPSATTLLEKYPTKLVVSRTMSKAFDFAGGRL
GYFVANPAFIDAVMLVRLPYHLSALSQAAAIVALRHSADTLGTVEKLSVERVRVAARLEELGYAVVPSESNFVFFGDFSD
QHAAWQAFLDRGVLIRDVGIAGHLRTTIGVPEENDAFLDAAAEIIKLNL
;
_entity_poly.pdbx_strand_id                 A,C,E 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   MET n 
1 5   THR n 
1 6   LYS n 
1 7   ILE n 
1 8   THR n 
1 9   LEU n 
1 10  SER n 
1 11  ASP n 
1 12  LEU n 
1 13  PRO n 
1 14  LEU n 
1 15  ARG n 
1 16  GLU n 
1 17  GLU n 
1 18  LEU n 
1 19  ARG n 
1 20  GLY n 
1 21  GLU n 
1 22  HIS n 
1 23  ALA n 
1 24  TYR n 
1 25  GLY n 
1 26  ALA n 
1 27  PRO n 
1 28  GLN n 
1 29  LEU n 
1 30  ASN n 
1 31  VAL n 
1 32  ASP n 
1 33  ILE n 
1 34  ARG n 
1 35  LEU n 
1 36  ASN n 
1 37  THR n 
1 38  ASN n 
1 39  GLU n 
1 40  ASN n 
1 41  PRO n 
1 42  TYR n 
1 43  PRO n 
1 44  PRO n 
1 45  SER n 
1 46  GLU n 
1 47  ALA n 
1 48  LEU n 
1 49  VAL n 
1 50  ALA n 
1 51  ASP n 
1 52  LEU n 
1 53  VAL n 
1 54  ALA n 
1 55  THR n 
1 56  VAL n 
1 57  ASP n 
1 58  LYS n 
1 59  ILE n 
1 60  ALA n 
1 61  THR n 
1 62  GLU n 
1 63  LEU n 
1 64  ASN n 
1 65  ARG n 
1 66  TYR n 
1 67  PRO n 
1 68  GLU n 
1 69  ARG n 
1 70  ASP n 
1 71  ALA n 
1 72  VAL n 
1 73  GLU n 
1 74  LEU n 
1 75  ARG n 
1 76  ASP n 
1 77  GLU n 
1 78  LEU n 
1 79  ALA n 
1 80  ALA n 
1 81  TYR n 
1 82  ILE n 
1 83  THR n 
1 84  LYS n 
1 85  GLN n 
1 86  THR n 
1 87  GLY n 
1 88  VAL n 
1 89  ALA n 
1 90  VAL n 
1 91  THR n 
1 92  ARG n 
1 93  ASP n 
1 94  ASN n 
1 95  LEU n 
1 96  TRP n 
1 97  ALA n 
1 98  ALA n 
1 99  ASN n 
1 100 GLY n 
1 101 SER n 
1 102 ASN n 
1 103 GLU n 
1 104 ILE n 
1 105 LEU n 
1 106 GLN n 
1 107 GLN n 
1 108 LEU n 
1 109 LEU n 
1 110 GLN n 
1 111 ALA n 
1 112 PHE n 
1 113 GLY n 
1 114 GLY n 
1 115 PRO n 
1 116 GLY n 
1 117 ARG n 
1 118 THR n 
1 119 ALA n 
1 120 LEU n 
1 121 GLY n 
1 122 PHE n 
1 123 GLN n 
1 124 PRO n 
1 125 SER n 
1 126 TYR n 
1 127 SER n 
1 128 MET n 
1 129 HIS n 
1 130 PRO n 
1 131 ILE n 
1 132 LEU n 
1 133 ALA n 
1 134 LYS n 
1 135 GLY n 
1 136 THR n 
1 137 HIS n 
1 138 THR n 
1 139 GLU n 
1 140 PHE n 
1 141 ILE n 
1 142 ALA n 
1 143 VAL n 
1 144 SER n 
1 145 ARG n 
1 146 GLY n 
1 147 ALA n 
1 148 ASP n 
1 149 PHE n 
1 150 ARG n 
1 151 ILE n 
1 152 ASP n 
1 153 MET n 
1 154 ASP n 
1 155 VAL n 
1 156 ALA n 
1 157 LEU n 
1 158 GLU n 
1 159 GLU n 
1 160 ILE n 
1 161 ARG n 
1 162 ALA n 
1 163 LYS n 
1 164 GLN n 
1 165 PRO n 
1 166 ASP n 
1 167 ILE n 
1 168 VAL n 
1 169 PHE n 
1 170 VAL n 
1 171 THR n 
1 172 THR n 
1 173 PRO n 
1 174 ASN n 
1 175 ASN n 
1 176 PRO n 
1 177 THR n 
1 178 GLY n 
1 179 ASP n 
1 180 VAL n 
1 181 THR n 
1 182 SER n 
1 183 LEU n 
1 184 ASP n 
1 185 ASP n 
1 186 VAL n 
1 187 GLU n 
1 188 ARG n 
1 189 ILE n 
1 190 ILE n 
1 191 ASN n 
1 192 VAL n 
1 193 ALA n 
1 194 PRO n 
1 195 GLY n 
1 196 ILE n 
1 197 VAL n 
1 198 ILE n 
1 199 VAL n 
1 200 ASP n 
1 201 GLU n 
1 202 ALA n 
1 203 TYR n 
1 204 ALA n 
1 205 GLU n 
1 206 PHE n 
1 207 SER n 
1 208 PRO n 
1 209 SER n 
1 210 PRO n 
1 211 SER n 
1 212 ALA n 
1 213 THR n 
1 214 THR n 
1 215 LEU n 
1 216 LEU n 
1 217 GLU n 
1 218 LYS n 
1 219 TYR n 
1 220 PRO n 
1 221 THR n 
1 222 LYS n 
1 223 LEU n 
1 224 VAL n 
1 225 VAL n 
1 226 SER n 
1 227 ARG n 
1 228 THR n 
1 229 MET n 
1 230 SER n 
1 231 LLP n 
1 232 ALA n 
1 233 PHE n 
1 234 ASP n 
1 235 PHE n 
1 236 ALA n 
1 237 GLY n 
1 238 GLY n 
1 239 ARG n 
1 240 LEU n 
1 241 GLY n 
1 242 TYR n 
1 243 PHE n 
1 244 VAL n 
1 245 ALA n 
1 246 ASN n 
1 247 PRO n 
1 248 ALA n 
1 249 PHE n 
1 250 ILE n 
1 251 ASP n 
1 252 ALA n 
1 253 VAL n 
1 254 MET n 
1 255 LEU n 
1 256 VAL n 
1 257 ARG n 
1 258 LEU n 
1 259 PRO n 
1 260 TYR n 
1 261 HIS n 
1 262 LEU n 
1 263 SER n 
1 264 ALA n 
1 265 LEU n 
1 266 SER n 
1 267 GLN n 
1 268 ALA n 
1 269 ALA n 
1 270 ALA n 
1 271 ILE n 
1 272 VAL n 
1 273 ALA n 
1 274 LEU n 
1 275 ARG n 
1 276 HIS n 
1 277 SER n 
1 278 ALA n 
1 279 ASP n 
1 280 THR n 
1 281 LEU n 
1 282 GLY n 
1 283 THR n 
1 284 VAL n 
1 285 GLU n 
1 286 LYS n 
1 287 LEU n 
1 288 SER n 
1 289 VAL n 
1 290 GLU n 
1 291 ARG n 
1 292 VAL n 
1 293 ARG n 
1 294 VAL n 
1 295 ALA n 
1 296 ALA n 
1 297 ARG n 
1 298 LEU n 
1 299 GLU n 
1 300 GLU n 
1 301 LEU n 
1 302 GLY n 
1 303 TYR n 
1 304 ALA n 
1 305 VAL n 
1 306 VAL n 
1 307 PRO n 
1 308 SER n 
1 309 GLU n 
1 310 SER n 
1 311 ASN n 
1 312 PHE n 
1 313 VAL n 
1 314 PHE n 
1 315 PHE n 
1 316 GLY n 
1 317 ASP n 
1 318 PHE n 
1 319 SER n 
1 320 ASP n 
1 321 GLN n 
1 322 HIS n 
1 323 ALA n 
1 324 ALA n 
1 325 TRP n 
1 326 GLN n 
1 327 ALA n 
1 328 PHE n 
1 329 LEU n 
1 330 ASP n 
1 331 ARG n 
1 332 GLY n 
1 333 VAL n 
1 334 LEU n 
1 335 ILE n 
1 336 ARG n 
1 337 ASP n 
1 338 VAL n 
1 339 GLY n 
1 340 ILE n 
1 341 ALA n 
1 342 GLY n 
1 343 HIS n 
1 344 LEU n 
1 345 ARG n 
1 346 THR n 
1 347 THR n 
1 348 ILE n 
1 349 GLY n 
1 350 VAL n 
1 351 PRO n 
1 352 GLU n 
1 353 GLU n 
1 354 ASN n 
1 355 ASP n 
1 356 ALA n 
1 357 PHE n 
1 358 LEU n 
1 359 ASP n 
1 360 ALA n 
1 361 ALA n 
1 362 ALA n 
1 363 GLU n 
1 364 ILE n 
1 365 ILE n 
1 366 LYS n 
1 367 LEU n 
1 368 ASN n 
1 369 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 HisC 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Corynebacterium glutamicum' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     ? 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pET28a(+)' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    HIS8_CORGL 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MTKITLSDLPLREELRGEHAYGAPQLNVDIRLNTNENPYPPSEALVADLVATVDKIATELNRYPERDAVELRDELAAYIT
KQTGVAVTRDNLWAANGSNEILQQLLQAFGGPGRTALGFQPSYSMHPILAKGTHTEFIAVSRGADFRIDMDVALEEIRAK
QPDIVFVTTPNNPTGDVTSLDDVERIINVAPGIVIVDEAYAEFSPSPSATTLLEKYPTKLVVSRTMSKAFDFAGGRLGYF
VANPAFIDAVMLVRLPYHLSALSQAAAIVALRHSADTLGTVEKLSVERVRVAARLEELGYAVVPSESNFVFFGDFSDQHA
AWQAFLDRGVLIRDVGIAGHLRTTIGVPEENDAFLDAAAEIIKLNL
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_accession          Q9KJU4 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3CQ6 A 4 ? 369 ? Q9KJU4 1 ? 366 ? 1 366 
2 1 3CQ6 C 4 ? 369 ? Q9KJU4 1 ? 366 ? 1 366 
3 1 3CQ6 E 4 ? 369 ? Q9KJU4 1 ? 366 ? 1 366 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3CQ6 GLY A 1 ? UNP Q9KJU4 ? ? 'EXPRESSION TAG' -2 1 
1 3CQ6 SER A 2 ? UNP Q9KJU4 ? ? 'EXPRESSION TAG' -1 2 
1 3CQ6 HIS A 3 ? UNP Q9KJU4 ? ? 'EXPRESSION TAG' 0  3 
2 3CQ6 GLY C 1 ? UNP Q9KJU4 ? ? 'EXPRESSION TAG' -2 4 
2 3CQ6 SER C 2 ? UNP Q9KJU4 ? ? 'EXPRESSION TAG' -1 5 
2 3CQ6 HIS C 3 ? UNP Q9KJU4 ? ? 'EXPRESSION TAG' 0  6 
3 3CQ6 GLY E 1 ? UNP Q9KJU4 ? ? 'EXPRESSION TAG' -2 7 
3 3CQ6 SER E 2 ? UNP Q9KJU4 ? ? 'EXPRESSION TAG' -1 8 
3 3CQ6 HIS E 3 ? UNP Q9KJU4 ? ? 'EXPRESSION TAG' 0  9 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                                                 
?                                      'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                                                                                
?                                      'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                              
?                                      'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                                         
?                                      'C4 H7 N O4'      133.103 
GLN 'L-peptide linking' y GLUTAMINE                                                                                               
?                                      'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                                         
?                                      'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                                                                                 
?                                      'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                               
?                                      'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                                                                                   
?                                      'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                                              
?                                      'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                                 
?                                      'C6 H13 N O2'     131.173 
LLP 'L-peptide linking' n '(2S)-2-amino-6-[[3-hydroxy-2-methyl-5-(phosphonooxymethyl)pyridin-4-yl]methylideneamino]hexanoic acid' 
"N'-PYRIDOXYL-LYSINE-5'-MONOPHOSPHATE" 'C14 H22 N3 O7 P' 375.314 
LYS 'L-peptide linking' y LYSINE                                                                                                  
?                                      'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                                                                              
?                                      'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                                           
?                                      'C9 H11 N O2'     165.189 
PO4 non-polymer         . 'PHOSPHATE ION'                                                                                         
?                                      'O4 P -3'         94.971  
PRO 'L-peptide linking' y PROLINE                                                                                                 
?                                      'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                                                                                  
?                                      'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                                                                               
?                                      'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                              
?                                      'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                                
?                                      'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                                                                                  
?                                      'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          3CQ6 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.79 
_exptl_crystal.density_percent_sol   55.86 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    
'0.4M NaH2PO4, 1.6M K2HPO4, 0.2M NaCl, 0.1M imidazole, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2006-07-14 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Silicon (1 1 1) channel-cut' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.939 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID23-1' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID23-1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.939 
# 
_reflns.entry_id                     3CQ6 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.d_resolution_high            2.1 
_reflns.d_resolution_low             88 
_reflns.number_all                   75438 
_reflns.number_obs                   75438 
_reflns.percent_possible_obs         96.9 
_reflns.pdbx_Rmerge_I_obs            0.09 
_reflns.pdbx_Rsym_value              0.09 
_reflns.pdbx_netI_over_sigmaI        10.4 
_reflns.B_iso_Wilson_estimate        28.6 
_reflns.pdbx_redundancy              2.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.1 
_reflns_shell.d_res_low              2.21 
_reflns_shell.percent_possible_all   96.8 
_reflns_shell.Rmerge_I_obs           0.45 
_reflns_shell.pdbx_Rsym_value        0.45 
_reflns_shell.meanI_over_sigI_obs    1.8 
_reflns_shell.pdbx_redundancy        2.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      10992 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3CQ6 
_refine.ls_number_reflns_obs                     71661 
_refine.ls_number_reflns_all                     71661 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.79 
_refine.ls_d_res_high                            2.10 
_refine.ls_percent_reflns_obs                    96.68 
_refine.ls_R_factor_obs                          0.19962 
_refine.ls_R_factor_all                          0.19962 
_refine.ls_R_factor_R_work                       0.19767 
_refine.ls_R_factor_R_free                       0.23837 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  3751 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.949 
_refine.correlation_coeff_Fo_to_Fc_free          0.928 
_refine.B_iso_mean                               24.872 
_refine.aniso_B[1][1]                            1.47 
_refine.aniso_B[2][2]                            1.55 
_refine.aniso_B[3][3]                            -3.11 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -0.49 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 3CQ5' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ISOTROPIC 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.211 
_refine.pdbx_overall_ESU_R_Free                  0.181 
_refine.overall_SU_ML                            0.143 
_refine.overall_SU_B                             5.508 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8442 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         35 
_refine_hist.number_atoms_solvent             361 
_refine_hist.number_atoms_total               8838 
_refine_hist.d_res_high                       2.10 
_refine_hist.d_res_low                        30.79 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.010  0.022  ? 8641  'X-RAY DIFFRACTION' ? 
r_bond_other_d           0.001  0.020  ? 5655  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.228  1.977  ? 11799 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        0.903  3.000  ? 13788 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   5.632  5.000  ? 1089  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   34.816 23.969 ? 393   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   14.525 15.000 ? 1347  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   22.122 15.000 ? 66    'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.067  0.200  ? 1365  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.004  0.020  ? 9705  'X-RAY DIFFRACTION' ? 
r_gen_planes_other       0.001  0.020  ? 1725  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.210  0.200  ? 1805  'X-RAY DIFFRACTION' ? 
r_nbd_other              0.196  0.200  ? 6205  'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.175  0.200  ? 4319  'X-RAY DIFFRACTION' ? 
r_nbtor_other            0.086  0.200  ? 4457  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.145  0.200  ? 393   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.109  0.200  ? 11    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     0.287  0.200  ? 60    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.157  0.200  ? 12    'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.738  1.500  ? 6963  'X-RAY DIFFRACTION' ? 
r_mcbond_other           0.146  1.500  ? 2187  'X-RAY DIFFRACTION' ? 
r_mcangle_it             0.854  2.000  ? 8802  'X-RAY DIFFRACTION' ? 
r_scbond_it              1.536  3.000  ? 3639  'X-RAY DIFFRACTION' ? 
r_scangle_it             2.302  4.500  ? 2997  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 1978 0.17 0.50  'medium positional' 1 'X-RAY DIFFRACTION' 1  ? ? ? 
2 C 1978 0.17 0.50  'medium positional' 1 'X-RAY DIFFRACTION' 2  ? ? ? 
3 E 1978 0.10 0.50  'medium positional' 1 'X-RAY DIFFRACTION' 3  ? ? ? 
1 C 163  0.09 0.50  'medium positional' 2 'X-RAY DIFFRACTION' 4  ? ? ? 
1 A 2358 0.37 5.00  'loose positional'  1 'X-RAY DIFFRACTION' 5  ? ? ? 
2 C 2358 0.30 5.00  'loose positional'  1 'X-RAY DIFFRACTION' 6  ? ? ? 
3 E 2358 0.25 5.00  'loose positional'  1 'X-RAY DIFFRACTION' 7  ? ? ? 
1 C 200  0.22 5.00  'loose positional'  2 'X-RAY DIFFRACTION' 8  ? ? ? 
1 A 1978 0.58 2.00  'medium thermal'    1 'X-RAY DIFFRACTION' 9  ? ? ? 
2 C 1978 0.74 2.00  'medium thermal'    1 'X-RAY DIFFRACTION' 10 ? ? ? 
3 E 1978 1.07 2.00  'medium thermal'    1 'X-RAY DIFFRACTION' 11 ? ? ? 
1 C 163  0.65 2.00  'medium thermal'    2 'X-RAY DIFFRACTION' 12 ? ? ? 
1 A 2358 1.07 10.00 'loose thermal'     1 'X-RAY DIFFRACTION' 13 ? ? ? 
2 C 2358 1.10 10.00 'loose thermal'     1 'X-RAY DIFFRACTION' 14 ? ? ? 
3 E 2358 1.53 10.00 'loose thermal'     1 'X-RAY DIFFRACTION' 15 ? ? ? 
1 C 200  1.02 10.00 'loose thermal'     2 'X-RAY DIFFRACTION' 16 ? ? ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.100 
_refine_ls_shell.d_res_low                        2.154 
_refine_ls_shell.number_reflns_R_work             5253 
_refine_ls_shell.R_factor_R_work                  0.288 
_refine_ls_shell.percent_reflns_obs               96.64 
_refine_ls_shell.R_factor_R_free                  0.323 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             306 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                5253 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 A 
1 2 C 
1 3 E 
2 1 C 
2 2 E 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 31 A 366 1 5 A ARG 34 ? A LEU 369 ? 1 ? 
2 C 31 C 366 1 5 B ARG 34 ? B LEU 369 ? 1 ? 
3 E 31 E 366 1 5 C ARG 34 ? C LEU 369 ? 1 ? 
1 C 3  C 30  1 5 B LYS 6  ? B ILE 33  ? 2 ? 
2 E 3  E 30  1 5 C LYS 6  ? C ILE 33  ? 2 ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
# 
_struct.entry_id                  3CQ6 
_struct.title                     
'Histidinol-phosphate aminotransferase from Corynebacterium glutamicum holo-form (PLP covalently bound )' 
_struct.pdbx_descriptor           'Histidinol-phosphate aminotransferase (E.C.2.6.1.9)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3CQ6 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;histidinol-phosphate aminotransferase, Corynebacterium glutamicum, PLP, Amino-acid biosynthesis, Histidine biosynthesis, Pyridoxal phosphate, Transferase
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 2 ? 
J N N 2 ? 
K N N 3 ? 
L N N 3 ? 
M N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 8   ? LEU A 12  ? THR A 5   LEU A 9   5 ? 5  
HELX_P HELX_P2  2  ARG A 15  ? ARG A 19  ? ARG A 12  ARG A 16  5 ? 5  
HELX_P HELX_P3  3  SER A 45  ? ALA A 60  ? SER A 42  ALA A 57  1 ? 16 
HELX_P HELX_P4  4  THR A 61  ? LEU A 63  ? THR A 58  LEU A 60  5 ? 3  
HELX_P HELX_P5  5  ALA A 71  ? GLY A 87  ? ALA A 68  GLY A 84  1 ? 17 
HELX_P HELX_P6  6  THR A 91  ? ASP A 93  ? THR A 88  ASP A 90  5 ? 3  
HELX_P HELX_P7  7  ASN A 99  ? GLY A 113 ? ASN A 96  GLY A 110 1 ? 15 
HELX_P HELX_P8  8  SER A 127 ? THR A 136 ? SER A 124 THR A 133 1 ? 10 
HELX_P HELX_P9  9  ASP A 152 ? GLN A 164 ? ASP A 149 GLN A 161 1 ? 13 
HELX_P HELX_P10 10 SER A 182 ? ALA A 193 ? SER A 179 ALA A 190 1 ? 12 
HELX_P HELX_P11 11 TYR A 203 ? SER A 207 ? TYR A 200 SER A 204 5 ? 5  
HELX_P HELX_P12 12 SER A 211 ? LEU A 216 ? SER A 208 LEU A 213 5 ? 6  
HELX_P HELX_P13 13 PHE A 235 ? ARG A 239 ? PHE A 232 ARG A 236 5 ? 5  
HELX_P HELX_P14 14 ASN A 246 ? LEU A 255 ? ASN A 243 LEU A 252 1 ? 10 
HELX_P HELX_P15 15 SER A 263 ? HIS A 276 ? SER A 260 HIS A 273 1 ? 14 
HELX_P HELX_P16 16 HIS A 276 ? GLY A 282 ? HIS A 273 GLY A 279 1 ? 7  
HELX_P HELX_P17 17 GLY A 282 ? GLY A 302 ? GLY A 279 GLY A 299 1 ? 21 
HELX_P HELX_P18 18 ASP A 320 ? ARG A 331 ? ASP A 317 ARG A 328 1 ? 12 
HELX_P HELX_P19 19 VAL A 350 ? LEU A 367 ? VAL A 347 LEU A 364 1 ? 18 
HELX_P HELX_P20 20 THR B 8   ? LEU B 12  ? THR C 5   LEU C 9   5 ? 5  
HELX_P HELX_P21 21 ARG B 15  ? ARG B 19  ? ARG C 12  ARG C 16  5 ? 5  
HELX_P HELX_P22 22 SER B 45  ? ALA B 60  ? SER C 42  ALA C 57  1 ? 16 
HELX_P HELX_P23 23 THR B 61  ? LEU B 63  ? THR C 58  LEU C 60  5 ? 3  
HELX_P HELX_P24 24 ALA B 71  ? GLY B 87  ? ALA C 68  GLY C 84  1 ? 17 
HELX_P HELX_P25 25 THR B 91  ? ASP B 93  ? THR C 88  ASP C 90  5 ? 3  
HELX_P HELX_P26 26 ASN B 99  ? GLY B 113 ? ASN C 96  GLY C 110 1 ? 15 
HELX_P HELX_P27 27 SER B 127 ? THR B 136 ? SER C 124 THR C 133 1 ? 10 
HELX_P HELX_P28 28 ASP B 152 ? GLN B 164 ? ASP C 149 GLN C 161 1 ? 13 
HELX_P HELX_P29 29 SER B 182 ? ALA B 193 ? SER C 179 ALA C 190 1 ? 12 
HELX_P HELX_P30 30 TYR B 203 ? SER B 207 ? TYR C 200 SER C 204 5 ? 5  
HELX_P HELX_P31 31 SER B 211 ? LEU B 216 ? SER C 208 LEU C 213 5 ? 6  
HELX_P HELX_P32 32 PHE B 235 ? ARG B 239 ? PHE C 232 ARG C 236 5 ? 5  
HELX_P HELX_P33 33 ASN B 246 ? LEU B 255 ? ASN C 243 LEU C 252 1 ? 10 
HELX_P HELX_P34 34 SER B 263 ? ARG B 275 ? SER C 260 ARG C 272 1 ? 13 
HELX_P HELX_P35 35 HIS B 276 ? GLY B 302 ? HIS C 273 GLY C 299 1 ? 27 
HELX_P HELX_P36 36 ASP B 320 ? ARG B 331 ? ASP C 317 ARG C 328 1 ? 12 
HELX_P HELX_P37 37 VAL B 350 ? ASN B 368 ? VAL C 347 ASN C 365 1 ? 19 
HELX_P HELX_P38 38 THR C 8   ? LEU C 12  ? THR E 5   LEU E 9   5 ? 5  
HELX_P HELX_P39 39 ARG C 15  ? ARG C 19  ? ARG E 12  ARG E 16  5 ? 5  
HELX_P HELX_P40 40 SER C 45  ? ALA C 60  ? SER E 42  ALA E 57  1 ? 16 
HELX_P HELX_P41 41 THR C 61  ? LEU C 63  ? THR E 58  LEU E 60  5 ? 3  
HELX_P HELX_P42 42 ALA C 71  ? GLY C 87  ? ALA E 68  GLY E 84  1 ? 17 
HELX_P HELX_P43 43 THR C 91  ? ASP C 93  ? THR E 88  ASP E 90  5 ? 3  
HELX_P HELX_P44 44 ASN C 99  ? GLY C 113 ? ASN E 96  GLY E 110 1 ? 15 
HELX_P HELX_P45 45 SER C 127 ? THR C 136 ? SER E 124 THR E 133 1 ? 10 
HELX_P HELX_P46 46 ASP C 152 ? GLN C 164 ? ASP E 149 GLN E 161 1 ? 13 
HELX_P HELX_P47 47 SER C 182 ? ALA C 193 ? SER E 179 ALA E 190 1 ? 12 
HELX_P HELX_P48 48 TYR C 203 ? SER C 207 ? TYR E 200 SER E 204 5 ? 5  
HELX_P HELX_P49 49 SER C 211 ? LEU C 216 ? SER E 208 LEU E 213 5 ? 6  
HELX_P HELX_P50 50 PHE C 235 ? ARG C 239 ? PHE E 232 ARG E 236 5 ? 5  
HELX_P HELX_P51 51 ASN C 246 ? MET C 254 ? ASN E 243 MET E 251 1 ? 9  
HELX_P HELX_P52 52 SER C 263 ? HIS C 276 ? SER E 260 HIS E 273 1 ? 14 
HELX_P HELX_P53 53 HIS C 276 ? LEU C 281 ? HIS E 273 LEU E 278 1 ? 6  
HELX_P HELX_P54 54 GLY C 282 ? GLY C 302 ? GLY E 279 GLY E 299 1 ? 21 
HELX_P HELX_P55 55 ASP C 320 ? ARG C 331 ? ASP E 317 ARG E 328 1 ? 12 
HELX_P HELX_P56 56 VAL C 350 ? LYS C 366 ? VAL E 347 LYS E 363 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A SER 230 C ? ? ? 1_555 A LLP 231 N ? ? A SER 227 A LLP 228 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale2 covale ? ? A LLP 231 C ? ? ? 1_555 A ALA 232 N ? ? A LLP 228 A ALA 229 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale3 covale ? ? B SER 230 C ? ? ? 1_555 B LLP 231 N ? ? C SER 227 C LLP 228 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale4 covale ? ? B LLP 231 C ? ? ? 1_555 B ALA 232 N ? ? C LLP 228 C ALA 229 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale5 covale ? ? C SER 230 C ? ? ? 1_555 C LLP 231 N ? ? E SER 227 E LLP 228 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale6 covale ? ? C LLP 231 C ? ? ? 1_555 C ALA 232 N ? ? E LLP 228 E ALA 229 1_555 ? ? ? ? ? ? ? 1.333 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  GLN 123 A . ? GLN 120 A PRO 124 A ? PRO 121 A 1 2.11  
2  THR 172 A . ? THR 169 A PRO 173 A ? PRO 170 A 1 -7.19 
3  ASN 175 A . ? ASN 172 A PRO 176 A ? PRO 173 A 1 17.06 
4  GLY 316 A . ? GLY 313 A ASP 317 A ? ASP 314 A 1 4.79  
5  GLN 123 B . ? GLN 120 C PRO 124 B ? PRO 121 C 1 -0.16 
6  THR 172 B . ? THR 169 C PRO 173 B ? PRO 170 C 1 -8.02 
7  ASN 175 B . ? ASN 172 C PRO 176 B ? PRO 173 C 1 11.08 
8  GLY 316 B . ? GLY 313 C ASP 317 B ? ASP 314 C 1 -3.64 
9  GLN 123 C . ? GLN 120 E PRO 124 C ? PRO 121 E 1 -0.60 
10 THR 172 C . ? THR 169 E PRO 173 C ? PRO 170 E 1 -6.81 
11 ASN 175 C . ? ASN 172 E PRO 176 C ? PRO 173 E 1 13.30 
12 GLY 316 C . ? GLY 313 E ASP 317 C ? ASP 314 E 1 -3.59 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 7 ? 
C ? 3 ? 
D ? 2 ? 
E ? 7 ? 
F ? 3 ? 
G ? 2 ? 
H ? 7 ? 
I ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? parallel      
B 6 7 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? parallel      
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? parallel      
E 4 5 ? parallel      
E 5 6 ? parallel      
E 6 7 ? parallel      
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
G 1 2 ? parallel      
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? parallel      
H 4 5 ? parallel      
H 5 6 ? parallel      
H 6 7 ? parallel      
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 33  ? ARG A 34  ? ILE A 30  ARG A 31  
A 2 VAL A 333 ? LEU A 334 ? VAL A 330 LEU A 331 
B 1 LEU A 95  ? ALA A 98  ? LEU A 92  ALA A 95  
B 2 GLY A 241 ? VAL A 244 ? GLY A 238 VAL A 241 
B 3 LEU A 223 ? THR A 228 ? LEU A 220 THR A 225 
B 4 ILE A 196 ? ASP A 200 ? ILE A 193 ASP A 197 
B 5 ILE A 167 ? THR A 171 ? ILE A 164 THR A 168 
B 6 THR A 118 ? GLN A 123 ? THR A 115 GLN A 120 
B 7 GLU A 139 ? SER A 144 ? GLU A 136 SER A 141 
C 1 ALA A 304 ? VAL A 306 ? ALA A 301 VAL A 303 
C 2 PHE A 312 ? GLY A 316 ? PHE A 309 GLY A 313 
C 3 LEU A 344 ? THR A 347 ? LEU A 341 THR A 344 
D 1 ILE B 33  ? ARG B 34  ? ILE C 30  ARG C 31  
D 2 VAL B 333 ? LEU B 334 ? VAL C 330 LEU C 331 
E 1 LEU B 95  ? ALA B 98  ? LEU C 92  ALA C 95  
E 2 GLY B 241 ? VAL B 244 ? GLY C 238 VAL C 241 
E 3 LEU B 223 ? THR B 228 ? LEU C 220 THR C 225 
E 4 ILE B 196 ? ASP B 200 ? ILE C 193 ASP C 197 
E 5 ILE B 167 ? THR B 171 ? ILE C 164 THR C 168 
E 6 THR B 118 ? GLN B 123 ? THR C 115 GLN C 120 
E 7 GLU B 139 ? SER B 144 ? GLU C 136 SER C 141 
F 1 ALA B 304 ? VAL B 306 ? ALA C 301 VAL C 303 
F 2 PHE B 312 ? GLY B 316 ? PHE C 309 GLY C 313 
F 3 LEU B 344 ? THR B 347 ? LEU C 341 THR C 344 
G 1 ILE C 33  ? ARG C 34  ? ILE E 30  ARG E 31  
G 2 VAL C 333 ? LEU C 334 ? VAL E 330 LEU E 331 
H 1 LEU C 95  ? ALA C 98  ? LEU E 92  ALA E 95  
H 2 GLY C 241 ? VAL C 244 ? GLY E 238 VAL E 241 
H 3 LEU C 223 ? THR C 228 ? LEU E 220 THR E 225 
H 4 ILE C 196 ? ASP C 200 ? ILE E 193 ASP E 197 
H 5 ILE C 167 ? THR C 171 ? ILE E 164 THR E 168 
H 6 THR C 118 ? GLN C 123 ? THR E 115 GLN E 120 
H 7 GLU C 139 ? SER C 144 ? GLU E 136 SER E 141 
I 1 ALA C 304 ? VAL C 306 ? ALA E 301 VAL E 303 
I 2 PHE C 312 ? GLY C 316 ? PHE E 309 GLY E 313 
I 3 LEU C 344 ? THR C 347 ? LEU E 341 THR E 344 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 33  ? N ILE A 30  O LEU A 334 ? O LEU A 331 
B 1 2 N ALA A 98  ? N ALA A 95  O GLY A 241 ? O GLY A 238 
B 2 3 O TYR A 242 ? O TYR A 239 N ARG A 227 ? N ARG A 224 
B 3 4 O SER A 226 ? O SER A 223 N VAL A 199 ? N VAL A 196 
B 4 5 O ILE A 198 ? O ILE A 195 N VAL A 168 ? N VAL A 165 
B 5 6 O PHE A 169 ? O PHE A 166 N LEU A 120 ? N LEU A 117 
B 6 7 N ALA A 119 ? N ALA A 116 O GLU A 139 ? O GLU A 136 
C 1 2 N ALA A 304 ? N ALA A 301 O GLY A 316 ? O GLY A 313 
C 2 3 N VAL A 313 ? N VAL A 310 O THR A 346 ? O THR A 343 
D 1 2 N ILE B 33  ? N ILE C 30  O LEU B 334 ? O LEU C 331 
E 1 2 N ALA B 98  ? N ALA C 95  O GLY B 241 ? O GLY C 238 
E 2 3 O TYR B 242 ? O TYR C 239 N ARG B 227 ? N ARG C 224 
E 3 4 O VAL B 224 ? O VAL C 221 N VAL B 199 ? N VAL C 196 
E 4 5 O ILE B 198 ? O ILE C 195 N VAL B 168 ? N VAL C 165 
E 5 6 O PHE B 169 ? O PHE C 166 N LEU B 120 ? N LEU C 117 
E 6 7 N ALA B 119 ? N ALA C 116 O ILE B 141 ? O ILE C 138 
F 1 2 N VAL B 306 ? N VAL C 303 O PHE B 314 ? O PHE C 311 
F 2 3 N VAL B 313 ? N VAL C 310 O THR B 346 ? O THR C 343 
G 1 2 N ILE C 33  ? N ILE E 30  O LEU C 334 ? O LEU E 331 
H 1 2 N ALA C 98  ? N ALA E 95  O GLY C 241 ? O GLY E 238 
H 2 3 O TYR C 242 ? O TYR E 239 N ARG C 227 ? N ARG E 224 
H 3 4 O VAL C 224 ? O VAL E 221 N VAL C 199 ? N VAL E 196 
H 4 5 O ILE C 198 ? O ILE E 195 N VAL C 168 ? N VAL E 165 
H 5 6 O PHE C 169 ? O PHE E 166 N LEU C 120 ? N LEU E 117 
H 6 7 N ALA C 119 ? N ALA E 116 O GLU C 139 ? O GLU E 136 
I 1 2 N ALA C 304 ? N ALA E 301 O GLY C 316 ? O GLY E 313 
I 2 3 N PHE C 315 ? N PHE E 312 O LEU C 344 ? O LEU E 341 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE PO4 A 402' 
AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE PO4 C 403' 
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE PO4 A 404' 
AC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PO4 A 405' 
AC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE PO4 C 402' 
AC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE PO4 C 404' 
AC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE PO4 E 402' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 TYR A 24  ? TYR A 21  . ? 1_555 ? 
2  AC1 6 TYR A 126 ? TYR A 123 . ? 1_555 ? 
3  AC1 6 SER A 127 ? SER A 124 . ? 1_555 ? 
4  AC1 6 ASN A 175 ? ASN A 172 . ? 1_555 ? 
5  AC1 6 ARG A 336 ? ARG A 333 . ? 1_555 ? 
6  AC1 6 ARG A 345 ? ARG A 342 . ? 1_555 ? 
7  AC2 3 ARG A 117 ? ARG A 114 . ? 1_555 ? 
8  AC2 3 ARG B 15  ? ARG C 12  . ? 1_555 ? 
9  AC2 3 GLU B 16  ? GLU C 13  . ? 1_555 ? 
10 AC3 5 PRO A 27  ? PRO A 24  . ? 1_555 ? 
11 AC3 5 TRP A 325 ? TRP A 322 . ? 1_555 ? 
12 AC3 5 ILE A 335 ? ILE A 332 . ? 1_555 ? 
13 AC3 5 ARG A 336 ? ARG A 333 . ? 1_555 ? 
14 AC3 5 ASP A 337 ? ASP A 334 . ? 1_555 ? 
15 AC4 1 ASP A 317 ? ASP A 314 . ? 1_555 ? 
16 AC5 5 TYR B 24  ? TYR C 21  . ? 1_555 ? 
17 AC5 5 SER B 127 ? SER C 124 . ? 1_555 ? 
18 AC5 5 ASN B 175 ? ASN C 172 . ? 1_555 ? 
19 AC5 5 ARG B 336 ? ARG C 333 . ? 1_555 ? 
20 AC5 5 ARG B 345 ? ARG C 342 . ? 1_555 ? 
21 AC6 6 GLN B 85  ? GLN C 82  . ? 1_555 ? 
22 AC6 6 THR B 86  ? THR C 83  . ? 1_555 ? 
23 AC6 6 ALA B 204 ? ALA C 201 . ? 1_555 ? 
24 AC6 6 GLU B 205 ? GLU C 202 . ? 1_555 ? 
25 AC6 6 SER B 211 ? SER C 208 . ? 1_555 ? 
26 AC6 6 ARG B 227 ? ARG C 224 . ? 1_555 ? 
27 AC7 6 TYR C 24  ? TYR E 21  . ? 1_555 ? 
28 AC7 6 TYR C 126 ? TYR E 123 . ? 1_555 ? 
29 AC7 6 SER C 127 ? SER E 124 . ? 1_555 ? 
30 AC7 6 ASN C 175 ? ASN E 172 . ? 1_555 ? 
31 AC7 6 ARG C 336 ? ARG E 333 . ? 1_555 ? 
32 AC7 6 ARG C 345 ? ARG E 342 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3CQ6 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3CQ6 
_atom_sites.fract_transf_matrix[1][1]   0.005214 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000436 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012497 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011341 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . LYS A 1 6   ? 52.198  7.260   55.261  1.00 39.31 ? 3   LYS A N     1 
ATOM   2    C CA    . LYS A 1 6   ? 51.653  7.766   53.968  1.00 39.16 ? 3   LYS A CA    1 
ATOM   3    C C     . LYS A 1 6   ? 52.686  8.706   53.346  1.00 39.01 ? 3   LYS A C     1 
ATOM   4    O O     . LYS A 1 6   ? 53.015  9.744   53.919  1.00 39.53 ? 3   LYS A O     1 
ATOM   5    C CB    . LYS A 1 6   ? 50.308  8.483   54.186  1.00 39.14 ? 3   LYS A CB    1 
ATOM   6    N N     . ILE A 1 7   ? 53.221  8.326   52.188  1.00 38.60 ? 4   ILE A N     1 
ATOM   7    C CA    . ILE A 1 7   ? 54.263  9.126   51.547  1.00 37.97 ? 4   ILE A CA    1 
ATOM   8    C C     . ILE A 1 7   ? 53.833  9.561   50.161  1.00 37.22 ? 4   ILE A C     1 
ATOM   9    O O     . ILE A 1 7   ? 52.861  9.049   49.592  1.00 36.76 ? 4   ILE A O     1 
ATOM   10   C CB    . ILE A 1 7   ? 55.628  8.386   51.492  1.00 38.06 ? 4   ILE A CB    1 
ATOM   11   C CG1   . ILE A 1 7   ? 55.502  7.041   50.782  1.00 37.90 ? 4   ILE A CG1   1 
ATOM   12   C CG2   . ILE A 1 7   ? 56.183  8.169   52.904  1.00 37.96 ? 4   ILE A CG2   1 
ATOM   13   C CD1   . ILE A 1 7   ? 56.747  6.665   50.001  1.00 38.47 ? 4   ILE A CD1   1 
ATOM   14   N N     . THR A 1 8   ? 54.557  10.534  49.631  1.00 36.59 ? 5   THR A N     1 
ATOM   15   C CA    . THR A 1 8   ? 54.247  11.079  48.328  1.00 36.41 ? 5   THR A CA    1 
ATOM   16   C C     . THR A 1 8   ? 55.213  10.496  47.323  1.00 35.93 ? 5   THR A C     1 
ATOM   17   O O     . THR A 1 8   ? 56.279  9.989   47.667  1.00 35.42 ? 5   THR A O     1 
ATOM   18   C CB    . THR A 1 8   ? 54.318  12.629  48.310  1.00 36.25 ? 5   THR A CB    1 
ATOM   19   O OG1   . THR A 1 8   ? 55.663  13.052  48.555  1.00 36.12 ? 5   THR A OG1   1 
ATOM   20   C CG2   . THR A 1 8   ? 53.408  13.225  49.385  1.00 35.88 ? 5   THR A CG2   1 
ATOM   21   N N     . LEU A 1 9   ? 54.820  10.575  46.067  1.00 35.92 ? 6   LEU A N     1 
ATOM   22   C CA    . LEU A 1 9   ? 55.644  10.092  44.975  1.00 35.93 ? 6   LEU A CA    1 
ATOM   23   C C     . LEU A 1 9   ? 56.969  10.851  45.006  1.00 35.54 ? 6   LEU A C     1 
ATOM   24   O O     . LEU A 1 9   ? 58.017  10.271  44.755  1.00 35.47 ? 6   LEU A O     1 
ATOM   25   C CB    . LEU A 1 9   ? 54.891  10.275  43.645  1.00 35.86 ? 6   LEU A CB    1 
ATOM   26   C CG    . LEU A 1 9   ? 55.211  9.424   42.419  1.00 36.29 ? 6   LEU A CG    1 
ATOM   27   C CD1   . LEU A 1 9   ? 55.560  7.993   42.769  1.00 37.19 ? 6   LEU A CD1   1 
ATOM   28   C CD2   . LEU A 1 9   ? 54.026  9.465   41.463  1.00 35.89 ? 6   LEU A CD2   1 
ATOM   29   N N     . SER A 1 10  ? 56.917  12.132  45.372  1.00 35.44 ? 7   SER A N     1 
ATOM   30   C CA    . SER A 1 10  ? 58.111  12.959  45.480  1.00 35.48 ? 7   SER A CA    1 
ATOM   31   C C     . SER A 1 10  ? 59.131  12.455  46.516  1.00 34.89 ? 7   SER A C     1 
ATOM   32   O O     . SER A 1 10  ? 60.310  12.754  46.398  1.00 34.57 ? 7   SER A O     1 
ATOM   33   C CB    . SER A 1 10  ? 57.738  14.433  45.710  1.00 35.74 ? 7   SER A CB    1 
ATOM   34   O OG    . SER A 1 10  ? 56.704  14.564  46.665  1.00 37.93 ? 7   SER A OG    1 
ATOM   35   N N     . ASP A 1 11  ? 58.692  11.667  47.494  1.00 34.69 ? 8   ASP A N     1 
ATOM   36   C CA    . ASP A 1 11  ? 59.611  10.966  48.422  1.00 34.57 ? 8   ASP A CA    1 
ATOM   37   C C     . ASP A 1 11  ? 60.297  9.717   47.832  1.00 34.19 ? 8   ASP A C     1 
ATOM   38   O O     . ASP A 1 11  ? 61.233  9.189   48.439  1.00 33.06 ? 8   ASP A O     1 
ATOM   39   C CB    . ASP A 1 11  ? 58.872  10.511  49.682  1.00 35.05 ? 8   ASP A CB    1 
ATOM   40   C CG    . ASP A 1 11  ? 58.302  11.662  50.481  1.00 36.88 ? 8   ASP A CG    1 
ATOM   41   O OD1   . ASP A 1 11  ? 58.940  12.742  50.523  1.00 38.06 ? 8   ASP A OD1   1 
ATOM   42   O OD2   . ASP A 1 11  ? 57.214  11.473  51.076  1.00 40.66 ? 8   ASP A OD2   1 
ATOM   43   N N     . LEU A 1 12  ? 59.801  9.222   46.694  1.00 33.46 ? 9   LEU A N     1 
ATOM   44   C CA    . LEU A 1 12  ? 60.470  8.142   45.969  1.00 33.57 ? 9   LEU A CA    1 
ATOM   45   C C     . LEU A 1 12  ? 61.433  8.760   44.960  1.00 33.03 ? 9   LEU A C     1 
ATOM   46   O O     . LEU A 1 12  ? 61.145  9.826   44.441  1.00 32.53 ? 9   LEU A O     1 
ATOM   47   C CB    . LEU A 1 12  ? 59.458  7.251   45.235  1.00 33.33 ? 9   LEU A CB    1 
ATOM   48   C CG    . LEU A 1 12  ? 58.401  6.563   46.100  1.00 33.14 ? 9   LEU A CG    1 
ATOM   49   C CD1   . LEU A 1 12  ? 57.593  5.583   45.252  1.00 33.52 ? 9   LEU A CD1   1 
ATOM   50   C CD2   . LEU A 1 12  ? 59.040  5.852   47.318  1.00 31.73 ? 9   LEU A CD2   1 
ATOM   51   N N     . PRO A 1 13  ? 62.565  8.090   44.681  1.00 32.82 ? 10  PRO A N     1 
ATOM   52   C CA    . PRO A 1 13  ? 63.546  8.540   43.686  1.00 33.15 ? 10  PRO A CA    1 
ATOM   53   C C     . PRO A 1 13  ? 63.173  8.233   42.227  1.00 33.26 ? 10  PRO A C     1 
ATOM   54   O O     . PRO A 1 13  ? 63.998  7.766   41.451  1.00 32.80 ? 10  PRO A O     1 
ATOM   55   C CB    . PRO A 1 13  ? 64.814  7.790   44.095  1.00 32.81 ? 10  PRO A CB    1 
ATOM   56   C CG    . PRO A 1 13  ? 64.322  6.537   44.707  1.00 32.72 ? 10  PRO A CG    1 
ATOM   57   C CD    . PRO A 1 13  ? 63.006  6.850   45.354  1.00 32.89 ? 10  PRO A CD    1 
ATOM   58   N N     . LEU A 1 14  ? 61.931  8.521   41.876  1.00 33.93 ? 11  LEU A N     1 
ATOM   59   C CA    . LEU A 1 14  ? 61.419  8.409   40.517  1.00 34.43 ? 11  LEU A CA    1 
ATOM   60   C C     . LEU A 1 14  ? 62.253  9.239   39.543  1.00 35.03 ? 11  LEU A C     1 
ATOM   61   O O     . LEU A 1 14  ? 62.680  10.347  39.875  1.00 35.08 ? 11  LEU A O     1 
ATOM   62   C CB    . LEU A 1 14  ? 59.987  8.928   40.512  1.00 34.13 ? 11  LEU A CB    1 
ATOM   63   C CG    . LEU A 1 14  ? 59.128  8.715   39.280  1.00 34.51 ? 11  LEU A CG    1 
ATOM   64   C CD1   . LEU A 1 14  ? 58.742  7.249   39.174  1.00 34.96 ? 11  LEU A CD1   1 
ATOM   65   C CD2   . LEU A 1 14  ? 57.897  9.590   39.364  1.00 33.97 ? 11  LEU A CD2   1 
ATOM   66   N N     . ARG A 1 15  ? 62.478  8.711   38.344  1.00 35.60 ? 12  ARG A N     1 
ATOM   67   C CA    . ARG A 1 15  ? 63.154  9.480   37.303  1.00 36.69 ? 12  ARG A CA    1 
ATOM   68   C C     . ARG A 1 15  ? 62.442  10.820  37.086  1.00 37.59 ? 12  ARG A C     1 
ATOM   69   O O     . ARG A 1 15  ? 61.223  10.904  37.197  1.00 37.22 ? 12  ARG A O     1 
ATOM   70   C CB    . ARG A 1 15  ? 63.213  8.705   35.993  1.00 36.31 ? 12  ARG A CB    1 
ATOM   71   C CG    . ARG A 1 15  ? 64.147  7.526   36.024  1.00 35.80 ? 12  ARG A CG    1 
ATOM   72   C CD    . ARG A 1 15  ? 64.211  6.875   34.668  1.00 35.67 ? 12  ARG A CD    1 
ATOM   73   N NE    . ARG A 1 15  ? 64.793  7.762   33.670  1.00 34.78 ? 12  ARG A NE    1 
ATOM   74   C CZ    . ARG A 1 15  ? 66.093  8.028   33.530  1.00 35.23 ? 12  ARG A CZ    1 
ATOM   75   N NH1   . ARG A 1 15  ? 67.001  7.489   34.331  1.00 35.80 ? 12  ARG A NH1   1 
ATOM   76   N NH2   . ARG A 1 15  ? 66.486  8.856   32.579  1.00 34.86 ? 12  ARG A NH2   1 
ATOM   77   N N     . GLU A 1 16  ? 63.218  11.854  36.768  1.00 39.65 ? 13  GLU A N     1 
ATOM   78   C CA    . GLU A 1 16  ? 62.716  13.237  36.769  1.00 40.07 ? 13  GLU A CA    1 
ATOM   79   C C     . GLU A 1 16  ? 61.674  13.510  35.672  1.00 40.73 ? 13  GLU A C     1 
ATOM   80   O O     . GLU A 1 16  ? 60.725  14.274  35.881  1.00 41.21 ? 13  GLU A O     1 
ATOM   81   C CB    . GLU A 1 16  ? 63.883  14.229  36.662  1.00 40.96 ? 13  GLU A CB    1 
ATOM   82   C CG    . GLU A 1 16  ? 63.615  15.603  37.324  1.00 42.19 ? 13  GLU A CG    1 
ATOM   83   C CD    . GLU A 1 16  ? 63.495  15.541  38.863  1.00 46.70 ? 13  GLU A CD    1 
ATOM   84   O OE1   . GLU A 1 16  ? 64.212  14.725  39.505  1.00 48.34 ? 13  GLU A OE1   1 
ATOM   85   O OE2   . GLU A 1 16  ? 62.689  16.326  39.430  1.00 48.75 ? 13  GLU A OE2   1 
ATOM   86   N N     . GLU A 1 17  ? 61.827  12.873  34.518  1.00 40.96 ? 14  GLU A N     1 
ATOM   87   C CA    . GLU A 1 17  ? 60.878  13.067  33.426  1.00 41.43 ? 14  GLU A CA    1 
ATOM   88   C C     . GLU A 1 17  ? 59.498  12.449  33.698  1.00 41.64 ? 14  GLU A C     1 
ATOM   89   O O     . GLU A 1 17  ? 58.538  12.734  32.989  1.00 41.70 ? 14  GLU A O     1 
ATOM   90   C CB    . GLU A 1 17  ? 61.450  12.538  32.111  1.00 41.84 ? 14  GLU A CB    1 
ATOM   91   C CG    . GLU A 1 17  ? 61.486  11.022  31.981  1.00 43.42 ? 14  GLU A CG    1 
ATOM   92   C CD    . GLU A 1 17  ? 62.785  10.385  32.453  1.00 46.19 ? 14  GLU A CD    1 
ATOM   93   O OE1   . GLU A 1 17  ? 63.656  11.085  33.034  1.00 47.50 ? 14  GLU A OE1   1 
ATOM   94   O OE2   . GLU A 1 17  ? 62.918  9.156   32.232  1.00 46.98 ? 14  GLU A OE2   1 
ATOM   95   N N     . LEU A 1 18  ? 59.409  11.592  34.710  1.00 41.72 ? 15  LEU A N     1 
ATOM   96   C CA    . LEU A 1 18  ? 58.142  10.993  35.092  1.00 41.93 ? 15  LEU A CA    1 
ATOM   97   C C     . LEU A 1 18  ? 57.445  11.830  36.155  1.00 42.24 ? 15  LEU A C     1 
ATOM   98   O O     . LEU A 1 18  ? 56.289  11.577  36.477  1.00 42.15 ? 15  LEU A O     1 
ATOM   99   C CB    . LEU A 1 18  ? 58.359  9.560   35.597  1.00 41.88 ? 15  LEU A CB    1 
ATOM   100  C CG    . LEU A 1 18  ? 58.996  8.583   34.599  1.00 41.30 ? 15  LEU A CG    1 
ATOM   101  C CD1   . LEU A 1 18  ? 59.336  7.256   35.281  1.00 39.78 ? 15  LEU A CD1   1 
ATOM   102  C CD2   . LEU A 1 18  ? 58.075  8.377   33.382  1.00 39.45 ? 15  LEU A CD2   1 
ATOM   103  N N     . ARG A 1 19  ? 58.145  12.825  36.698  1.00 42.79 ? 16  ARG A N     1 
ATOM   104  C CA    . ARG A 1 19  ? 57.557  13.720  37.697  1.00 43.02 ? 16  ARG A CA    1 
ATOM   105  C C     . ARG A 1 19  ? 56.374  14.466  37.086  1.00 43.12 ? 16  ARG A C     1 
ATOM   106  O O     . ARG A 1 19  ? 56.443  14.929  35.946  1.00 42.71 ? 16  ARG A O     1 
ATOM   107  C CB    . ARG A 1 19  ? 58.584  14.741  38.202  1.00 43.27 ? 16  ARG A CB    1 
ATOM   108  C CG    . ARG A 1 19  ? 59.792  14.163  38.934  1.00 43.75 ? 16  ARG A CG    1 
ATOM   109  C CD    . ARG A 1 19  ? 59.407  13.504  40.237  1.00 44.72 ? 16  ARG A CD    1 
ATOM   110  N NE    . ARG A 1 19  ? 60.559  13.276  41.120  1.00 45.28 ? 16  ARG A NE    1 
ATOM   111  C CZ    . ARG A 1 19  ? 60.529  12.514  42.216  1.00 45.69 ? 16  ARG A CZ    1 
ATOM   112  N NH1   . ARG A 1 19  ? 59.405  11.886  42.568  1.00 45.23 ? 16  ARG A NH1   1 
ATOM   113  N NH2   . ARG A 1 19  ? 61.627  12.369  42.963  1.00 44.99 ? 16  ARG A NH2   1 
ATOM   114  N N     . GLY A 1 20  ? 55.292  14.580  37.849  1.00 43.42 ? 17  GLY A N     1 
ATOM   115  C CA    . GLY A 1 20  ? 54.092  15.275  37.385  1.00 43.76 ? 17  GLY A CA    1 
ATOM   116  C C     . GLY A 1 20  ? 53.481  14.709  36.107  1.00 44.11 ? 17  GLY A C     1 
ATOM   117  O O     . GLY A 1 20  ? 52.816  15.438  35.358  1.00 44.66 ? 17  GLY A O     1 
ATOM   118  N N     . GLU A 1 21  ? 53.712  13.421  35.845  1.00 43.82 ? 18  GLU A N     1 
ATOM   119  C CA    . GLU A 1 21  ? 53.069  12.741  34.734  1.00 43.68 ? 18  GLU A CA    1 
ATOM   120  C C     . GLU A 1 21  ? 51.825  12.030  35.237  1.00 43.23 ? 18  GLU A C     1 
ATOM   121  O O     . GLU A 1 21  ? 51.622  11.890  36.440  1.00 42.79 ? 18  GLU A O     1 
ATOM   122  C CB    . GLU A 1 21  ? 54.015  11.745  34.072  1.00 44.11 ? 18  GLU A CB    1 
ATOM   123  C CG    . GLU A 1 21  ? 55.194  12.384  33.374  1.00 46.01 ? 18  GLU A CG    1 
ATOM   124  C CD    . GLU A 1 21  ? 54.798  13.267  32.194  1.00 49.36 ? 18  GLU A CD    1 
ATOM   125  O OE1   . GLU A 1 21  ? 53.681  13.110  31.659  1.00 51.08 ? 18  GLU A OE1   1 
ATOM   126  O OE2   . GLU A 1 21  ? 55.616  14.124  31.795  1.00 52.13 ? 18  GLU A OE2   1 
ATOM   127  N N     . HIS A 1 22  ? 50.991  11.597  34.299  1.00 43.07 ? 19  HIS A N     1 
ATOM   128  C CA    . HIS A 1 22  ? 49.736  10.930  34.613  1.00 42.85 ? 19  HIS A CA    1 
ATOM   129  C C     . HIS A 1 22  ? 49.648  9.619   33.860  1.00 41.98 ? 19  HIS A C     1 
ATOM   130  O O     . HIS A 1 22  ? 50.200  9.487   32.771  1.00 42.21 ? 19  HIS A O     1 
ATOM   131  C CB    . HIS A 1 22  ? 48.557  11.829  34.252  1.00 43.69 ? 19  HIS A CB    1 
ATOM   132  C CG    . HIS A 1 22  ? 48.464  13.061  35.099  1.00 46.50 ? 19  HIS A CG    1 
ATOM   133  N ND1   . HIS A 1 22  ? 48.935  14.292  34.683  1.00 48.89 ? 19  HIS A ND1   1 
ATOM   134  C CD2   . HIS A 1 22  ? 47.970  13.249  36.348  1.00 48.91 ? 19  HIS A CD2   1 
ATOM   135  C CE1   . HIS A 1 22  ? 48.724  15.185  35.636  1.00 49.50 ? 19  HIS A CE1   1 
ATOM   136  N NE2   . HIS A 1 22  ? 48.142  14.578  36.658  1.00 49.74 ? 19  HIS A NE2   1 
ATOM   137  N N     . ALA A 1 23  ? 48.960  8.651   34.457  1.00 40.84 ? 20  ALA A N     1 
ATOM   138  C CA    . ALA A 1 23  ? 48.798  7.339   33.862  1.00 40.17 ? 20  ALA A CA    1 
ATOM   139  C C     . ALA A 1 23  ? 47.815  7.413   32.696  1.00 39.59 ? 20  ALA A C     1 
ATOM   140  O O     . ALA A 1 23  ? 46.787  8.100   32.758  1.00 39.66 ? 20  ALA A O     1 
ATOM   141  C CB    . ALA A 1 23  ? 48.316  6.324   34.908  1.00 40.03 ? 20  ALA A CB    1 
ATOM   142  N N     . TYR A 1 24  ? 48.138  6.691   31.632  1.00 38.55 ? 21  TYR A N     1 
ATOM   143  C CA    . TYR A 1 24  ? 47.311  6.670   30.449  1.00 37.69 ? 21  TYR A CA    1 
ATOM   144  C C     . TYR A 1 24  ? 46.147  5.686   30.627  1.00 36.95 ? 21  TYR A C     1 
ATOM   145  O O     . TYR A 1 24  ? 46.286  4.661   31.299  1.00 36.96 ? 21  TYR A O     1 
ATOM   146  C CB    . TYR A 1 24  ? 48.158  6.307   29.216  1.00 37.96 ? 21  TYR A CB    1 
ATOM   147  C CG    . TYR A 1 24  ? 47.319  5.894   28.031  1.00 38.36 ? 21  TYR A CG    1 
ATOM   148  C CD1   . TYR A 1 24  ? 46.942  6.815   27.052  1.00 37.87 ? 21  TYR A CD1   1 
ATOM   149  C CD2   . TYR A 1 24  ? 46.856  4.587   27.923  1.00 38.38 ? 21  TYR A CD2   1 
ATOM   150  C CE1   . TYR A 1 24  ? 46.151  6.429   25.986  1.00 37.95 ? 21  TYR A CE1   1 
ATOM   151  C CE2   . TYR A 1 24  ? 46.060  4.195   26.874  1.00 38.98 ? 21  TYR A CE2   1 
ATOM   152  C CZ    . TYR A 1 24  ? 45.712  5.112   25.906  1.00 38.79 ? 21  TYR A CZ    1 
ATOM   153  O OH    . TYR A 1 24  ? 44.913  4.671   24.868  1.00 39.87 ? 21  TYR A OH    1 
ATOM   154  N N     . GLY A 1 25  ? 45.010  5.991   30.000  1.00 35.79 ? 22  GLY A N     1 
ATOM   155  C CA    . GLY A 1 25  ? 43.896  5.044   29.905  1.00 35.23 ? 22  GLY A CA    1 
ATOM   156  C C     . GLY A 1 25  ? 42.529  5.702   29.996  1.00 34.39 ? 22  GLY A C     1 
ATOM   157  O O     . GLY A 1 25  ? 42.331  6.648   30.775  1.00 33.76 ? 22  GLY A O     1 
ATOM   158  N N     . ALA A 1 26  ? 41.594  5.195   29.193  1.00 33.45 ? 23  ALA A N     1 
ATOM   159  C CA    . ALA A 1 26  ? 40.200  5.648   29.216  1.00 33.42 ? 23  ALA A CA    1 
ATOM   160  C C     . ALA A 1 26  ? 39.513  5.275   30.527  1.00 32.62 ? 23  ALA A C     1 
ATOM   161  O O     . ALA A 1 26  ? 39.709  4.187   31.026  1.00 32.33 ? 23  ALA A O     1 
ATOM   162  C CB    . ALA A 1 26  ? 39.429  5.041   28.042  1.00 32.93 ? 23  ALA A CB    1 
ATOM   163  N N     . PRO A 1 27  ? 38.672  6.163   31.079  1.00 32.74 ? 24  PRO A N     1 
ATOM   164  C CA    . PRO A 1 27  ? 37.953  5.801   32.305  1.00 32.66 ? 24  PRO A CA    1 
ATOM   165  C C     . PRO A 1 27  ? 37.210  4.482   32.155  1.00 32.27 ? 24  PRO A C     1 
ATOM   166  O O     . PRO A 1 27  ? 36.565  4.241   31.138  1.00 32.23 ? 24  PRO A O     1 
ATOM   167  C CB    . PRO A 1 27  ? 36.961  6.958   32.502  1.00 32.67 ? 24  PRO A CB    1 
ATOM   168  C CG    . PRO A 1 27  ? 36.965  7.717   31.231  1.00 33.17 ? 24  PRO A CG    1 
ATOM   169  C CD    . PRO A 1 27  ? 38.316  7.509   30.622  1.00 32.73 ? 24  PRO A CD    1 
ATOM   170  N N     . GLN A 1 28  ? 37.324  3.626   33.156  1.00 32.63 ? 25  GLN A N     1 
ATOM   171  C CA    . GLN A 1 28  ? 36.634  2.338   33.148  1.00 32.76 ? 25  GLN A CA    1 
ATOM   172  C C     . GLN A 1 28  ? 35.276  2.538   33.826  1.00 32.81 ? 25  GLN A C     1 
ATOM   173  O O     . GLN A 1 28  ? 35.127  2.374   35.039  1.00 32.35 ? 25  GLN A O     1 
ATOM   174  C CB    . GLN A 1 28  ? 37.480  1.276   33.837  1.00 32.74 ? 25  GLN A CB    1 
ATOM   175  C CG    . GLN A 1 28  ? 38.842  1.068   33.146  1.00 33.68 ? 25  GLN A CG    1 
ATOM   176  C CD    . GLN A 1 28  ? 39.554  -0.191  33.601  1.00 33.87 ? 25  GLN A CD    1 
ATOM   177  O OE1   . GLN A 1 28  ? 40.050  -0.259  34.732  1.00 37.99 ? 25  GLN A OE1   1 
ATOM   178  N NE2   . GLN A 1 28  ? 39.623  -1.187  32.723  1.00 31.88 ? 25  GLN A NE2   1 
ATOM   179  N N     . LEU A 1 29  ? 34.304  2.942   33.014  1.00 32.62 ? 26  LEU A N     1 
ATOM   180  C CA    . LEU A 1 29  ? 32.990  3.327   33.489  1.00 32.71 ? 26  LEU A CA    1 
ATOM   181  C C     . LEU A 1 29  ? 32.000  2.267   33.042  1.00 32.74 ? 26  LEU A C     1 
ATOM   182  O O     . LEU A 1 29  ? 31.981  1.881   31.882  1.00 33.13 ? 26  LEU A O     1 
ATOM   183  C CB    . LEU A 1 29  ? 32.596  4.709   32.944  1.00 31.96 ? 26  LEU A CB    1 
ATOM   184  C CG    . LEU A 1 29  ? 33.350  5.917   33.522  1.00 31.77 ? 26  LEU A CG    1 
ATOM   185  C CD1   . LEU A 1 29  ? 33.196  7.136   32.621  1.00 28.26 ? 26  LEU A CD1   1 
ATOM   186  C CD2   . LEU A 1 29  ? 32.925  6.249   34.970  1.00 30.10 ? 26  LEU A CD2   1 
ATOM   187  N N     . ASN A 1 30  ? 31.159  1.827   33.967  1.00 33.42 ? 27  ASN A N     1 
ATOM   188  C CA    . ASN A 1 30  ? 30.267  0.712   33.733  1.00 33.77 ? 27  ASN A CA    1 
ATOM   189  C C     . ASN A 1 30  ? 28.930  1.170   33.133  1.00 33.97 ? 27  ASN A C     1 
ATOM   190  O O     . ASN A 1 30  ? 27.880  1.192   33.785  1.00 34.16 ? 27  ASN A O     1 
ATOM   191  C CB    . ASN A 1 30  ? 30.079  -0.047  35.034  1.00 34.40 ? 27  ASN A CB    1 
ATOM   192  C CG    . ASN A 1 30  ? 29.495  -1.421  34.826  1.00 36.55 ? 27  ASN A CG    1 
ATOM   193  O OD1   . ASN A 1 30  ? 29.698  -2.061  33.784  1.00 39.49 ? 27  ASN A OD1   1 
ATOM   194  N ND2   . ASN A 1 30  ? 28.763  -1.891  35.824  1.00 38.25 ? 27  ASN A ND2   1 
ATOM   195  N N     . VAL A 1 31  ? 28.996  1.521   31.858  1.00 33.93 ? 28  VAL A N     1 
ATOM   196  C CA    . VAL A 1 31  ? 27.894  2.131   31.141  1.00 33.78 ? 28  VAL A CA    1 
ATOM   197  C C     . VAL A 1 31  ? 27.275  1.055   30.229  1.00 33.92 ? 28  VAL A C     1 
ATOM   198  O O     . VAL A 1 31  ? 27.897  0.006   29.987  1.00 33.92 ? 28  VAL A O     1 
ATOM   199  C CB    . VAL A 1 31  ? 28.448  3.349   30.365  1.00 33.88 ? 28  VAL A CB    1 
ATOM   200  C CG1   . VAL A 1 31  ? 28.926  2.940   28.987  1.00 33.84 ? 28  VAL A CG1   1 
ATOM   201  C CG2   . VAL A 1 31  ? 27.435  4.458   30.299  1.00 34.83 ? 28  VAL A CG2   1 
ATOM   202  N N     . ASP A 1 32  ? 26.051  1.280   29.753  1.00 33.74 ? 29  ASP A N     1 
ATOM   203  C CA    . ASP A 1 32  ? 25.363  0.291   28.895  1.00 32.86 ? 29  ASP A CA    1 
ATOM   204  C C     . ASP A 1 32  ? 25.942  0.272   27.476  1.00 32.10 ? 29  ASP A C     1 
ATOM   205  O O     . ASP A 1 32  ? 25.988  -0.783  26.832  1.00 32.07 ? 29  ASP A O     1 
ATOM   206  C CB    . ASP A 1 32  ? 23.857  0.592   28.839  1.00 33.68 ? 29  ASP A CB    1 
ATOM   207  C CG    . ASP A 1 32  ? 23.047  -0.497  28.123  1.00 35.07 ? 29  ASP A CG    1 
ATOM   208  O OD1   . ASP A 1 32  ? 23.385  -1.702  28.221  1.00 38.83 ? 29  ASP A OD1   1 
ATOM   209  O OD2   . ASP A 1 32  ? 22.046  -0.136  27.461  1.00 39.59 ? 29  ASP A OD2   1 
ATOM   210  N N     . ILE A 1 33  ? 26.375  1.438   26.990  1.00 30.35 ? 30  ILE A N     1 
ATOM   211  C CA    . ILE A 1 33  ? 26.875  1.557   25.625  1.00 29.77 ? 30  ILE A CA    1 
ATOM   212  C C     . ILE A 1 33  ? 28.340  2.004   25.605  1.00 28.77 ? 30  ILE A C     1 
ATOM   213  O O     . ILE A 1 33  ? 28.649  3.177   25.795  1.00 28.70 ? 30  ILE A O     1 
ATOM   214  C CB    . ILE A 1 33  ? 26.015  2.536   24.795  1.00 29.60 ? 30  ILE A CB    1 
ATOM   215  C CG1   . ILE A 1 33  ? 24.509  2.251   24.982  1.00 29.90 ? 30  ILE A CG1   1 
ATOM   216  C CG2   . ILE A 1 33  ? 26.413  2.475   23.337  1.00 29.50 ? 30  ILE A CG2   1 
ATOM   217  C CD1   . ILE A 1 33  ? 24.098  0.852   24.624  1.00 28.65 ? 30  ILE A CD1   1 
ATOM   218  N N     . ARG A 1 34  ? 29.223  1.054   25.343  1.00 27.76 ? 31  ARG A N     1 
ATOM   219  C CA    . ARG A 1 34  ? 30.656  1.262   25.417  1.00 27.50 ? 31  ARG A CA    1 
ATOM   220  C C     . ARG A 1 34  ? 31.241  1.367   24.007  1.00 26.17 ? 31  ARG A C     1 
ATOM   221  O O     . ARG A 1 34  ? 31.353  0.366   23.307  1.00 25.49 ? 31  ARG A O     1 
ATOM   222  C CB    . ARG A 1 34  ? 31.315  0.087   26.140  1.00 28.01 ? 31  ARG A CB    1 
ATOM   223  C CG    . ARG A 1 34  ? 32.825  0.163   26.093  1.00 29.11 ? 31  ARG A CG    1 
ATOM   224  C CD    . ARG A 1 34  ? 33.544  -0.988  26.778  1.00 30.34 ? 31  ARG A CD    1 
ATOM   225  N NE    . ARG A 1 34  ? 34.956  -0.632  26.838  1.00 32.80 ? 31  ARG A NE    1 
ATOM   226  C CZ    . ARG A 1 34  ? 35.918  -1.362  27.390  1.00 35.71 ? 31  ARG A CZ    1 
ATOM   227  N NH1   . ARG A 1 34  ? 35.648  -2.551  27.937  1.00 38.65 ? 31  ARG A NH1   1 
ATOM   228  N NH2   . ARG A 1 34  ? 37.171  -0.908  27.370  1.00 34.33 ? 31  ARG A NH2   1 
ATOM   229  N N     . LEU A 1 35  ? 31.619  2.572   23.599  1.00 24.65 ? 32  LEU A N     1 
ATOM   230  C CA    . LEU A 1 35  ? 32.083  2.802   22.240  1.00 24.02 ? 32  LEU A CA    1 
ATOM   231  C C     . LEU A 1 35  ? 33.340  3.666   22.247  1.00 23.13 ? 32  LEU A C     1 
ATOM   232  O O     . LEU A 1 35  ? 33.468  4.574   21.446  1.00 22.89 ? 32  LEU A O     1 
ATOM   233  C CB    . LEU A 1 35  ? 30.953  3.457   21.432  1.00 23.59 ? 32  LEU A CB    1 
ATOM   234  C CG    . LEU A 1 35  ? 29.646  2.657   21.304  1.00 24.13 ? 32  LEU A CG    1 
ATOM   235  C CD1   . LEU A 1 35  ? 28.529  3.487   20.704  1.00 23.79 ? 32  LEU A CD1   1 
ATOM   236  C CD2   . LEU A 1 35  ? 29.819  1.368   20.494  1.00 22.51 ? 32  LEU A CD2   1 
ATOM   237  N N     . ASN A 1 36  ? 34.268  3.360   23.151  1.00 22.40 ? 33  ASN A N     1 
ATOM   238  C CA    . ASN A 1 36  ? 35.420  4.239   23.436  1.00 22.33 ? 33  ASN A CA    1 
ATOM   239  C C     . ASN A 1 36  ? 36.813  3.672   23.124  1.00 21.97 ? 33  ASN A C     1 
ATOM   240  O O     . ASN A 1 36  ? 37.789  4.389   23.234  1.00 21.99 ? 33  ASN A O     1 
ATOM   241  C CB    . ASN A 1 36  ? 35.411  4.645   24.911  1.00 21.24 ? 33  ASN A CB    1 
ATOM   242  C CG    . ASN A 1 36  ? 35.631  3.454   25.836  1.00 20.47 ? 33  ASN A CG    1 
ATOM   243  O OD1   . ASN A 1 36  ? 35.280  2.317   25.495  1.00 18.13 ? 33  ASN A OD1   1 
ATOM   244  N ND2   . ASN A 1 36  ? 36.230  3.699   26.989  1.00 14.91 ? 33  ASN A ND2   1 
ATOM   245  N N     . THR A 1 37  ? 36.922  2.397   22.773  1.00 22.38 ? 34  THR A N     1 
ATOM   246  C CA    . THR A 1 37  ? 38.253  1.775   22.657  1.00 22.75 ? 34  THR A CA    1 
ATOM   247  C C     . THR A 1 37  ? 38.497  0.962   21.390  1.00 21.96 ? 34  THR A C     1 
ATOM   248  O O     . THR A 1 37  ? 39.492  0.258   21.300  1.00 21.83 ? 34  THR A O     1 
ATOM   249  C CB    . THR A 1 37  ? 38.541  0.896   23.895  1.00 23.53 ? 34  THR A CB    1 
ATOM   250  O OG1   . THR A 1 37  ? 37.502  -0.098  24.031  1.00 24.94 ? 34  THR A OG1   1 
ATOM   251  C CG2   . THR A 1 37  ? 38.605  1.764   25.154  1.00 24.16 ? 34  THR A CG2   1 
ATOM   252  N N     . ASN A 1 38  ? 37.599  1.091   20.415  1.00 21.84 ? 35  ASN A N     1 
ATOM   253  C CA    . ASN A 1 38  ? 37.739  0.497   19.087  1.00 21.45 ? 35  ASN A CA    1 
ATOM   254  C C     . ASN A 1 38  ? 37.692  -1.032  19.113  1.00 21.54 ? 35  ASN A C     1 
ATOM   255  O O     . ASN A 1 38  ? 38.197  -1.698  18.222  1.00 21.45 ? 35  ASN A O     1 
ATOM   256  C CB    . ASN A 1 38  ? 38.998  1.033   18.369  1.00 21.47 ? 35  ASN A CB    1 
ATOM   257  C CG    . ASN A 1 38  ? 38.911  2.543   18.080  1.00 20.77 ? 35  ASN A CG    1 
ATOM   258  O OD1   . ASN A 1 38  ? 37.846  3.119   18.146  1.00 18.16 ? 35  ASN A OD1   1 
ATOM   259  N ND2   . ASN A 1 38  ? 40.034  3.161   17.751  1.00 20.80 ? 35  ASN A ND2   1 
ATOM   260  N N     . GLU A 1 39  ? 37.050  -1.576  20.136  1.00 21.78 ? 36  GLU A N     1 
ATOM   261  C CA    . GLU A 1 39  ? 36.818  -3.013  20.225  1.00 21.58 ? 36  GLU A CA    1 
ATOM   262  C C     . GLU A 1 39  ? 35.721  -3.409  19.245  1.00 21.93 ? 36  GLU A C     1 
ATOM   263  O O     . GLU A 1 39  ? 34.757  -2.659  19.015  1.00 21.68 ? 36  GLU A O     1 
ATOM   264  C CB    . GLU A 1 39  ? 36.365  -3.407  21.634  1.00 21.74 ? 36  GLU A CB    1 
ATOM   265  C CG    . GLU A 1 39  ? 37.364  -3.116  22.769  1.00 21.47 ? 36  GLU A CG    1 
ATOM   266  C CD    . GLU A 1 39  ? 36.688  -2.764  24.094  1.00 20.78 ? 36  GLU A CD    1 
ATOM   267  O OE1   . GLU A 1 39  ? 35.683  -2.020  24.097  1.00 22.13 ? 36  GLU A OE1   1 
ATOM   268  O OE2   . GLU A 1 39  ? 37.196  -3.186  25.145  1.00 19.02 ? 36  GLU A OE2   1 
ATOM   269  N N     . ASN A 1 40  ? 35.886  -4.585  18.668  1.00 22.21 ? 37  ASN A N     1 
ATOM   270  C CA    . ASN A 1 40  ? 34.807  -5.269  17.994  1.00 22.43 ? 37  ASN A CA    1 
ATOM   271  C C     . ASN A 1 40  ? 33.701  -5.593  19.014  1.00 22.74 ? 37  ASN A C     1 
ATOM   272  O O     . ASN A 1 40  ? 33.974  -6.238  20.028  1.00 22.46 ? 37  ASN A O     1 
ATOM   273  C CB    . ASN A 1 40  ? 35.362  -6.546  17.383  1.00 21.96 ? 37  ASN A CB    1 
ATOM   274  C CG    . ASN A 1 40  ? 34.395  -7.206  16.439  1.00 19.87 ? 37  ASN A CG    1 
ATOM   275  O OD1   . ASN A 1 40  ? 33.182  -7.211  16.675  1.00 18.75 ? 37  ASN A OD1   1 
ATOM   276  N ND2   . ASN A 1 40  ? 34.922  -7.781  15.365  1.00 15.86 ? 37  ASN A ND2   1 
ATOM   277  N N     . PRO A 1 41  ? 32.456  -5.142  18.755  1.00 23.52 ? 38  PRO A N     1 
ATOM   278  C CA    . PRO A 1 41  ? 31.356  -5.252  19.735  1.00 24.12 ? 38  PRO A CA    1 
ATOM   279  C C     . PRO A 1 41  ? 30.677  -6.606  19.819  1.00 24.65 ? 38  PRO A C     1 
ATOM   280  O O     . PRO A 1 41  ? 29.800  -6.797  20.668  1.00 24.94 ? 38  PRO A O     1 
ATOM   281  C CB    . PRO A 1 41  ? 30.347  -4.219  19.228  1.00 23.92 ? 38  PRO A CB    1 
ATOM   282  C CG    . PRO A 1 41  ? 30.500  -4.319  17.754  1.00 24.55 ? 38  PRO A CG    1 
ATOM   283  C CD    . PRO A 1 41  ? 32.001  -4.467  17.531  1.00 23.32 ? 38  PRO A CD    1 
ATOM   284  N N     . TYR A 1 42  ? 31.050  -7.523  18.932  1.00 25.50 ? 39  TYR A N     1 
ATOM   285  C CA    . TYR A 1 42  ? 30.470  -8.850  18.919  1.00 26.00 ? 39  TYR A CA    1 
ATOM   286  C C     . TYR A 1 42  ? 31.216  -9.776  19.864  1.00 26.40 ? 39  TYR A C     1 
ATOM   287  O O     . TYR A 1 42  ? 32.453  -9.810  19.856  1.00 26.26 ? 39  TYR A O     1 
ATOM   288  C CB    . TYR A 1 42  ? 30.475  -9.434  17.506  1.00 26.27 ? 39  TYR A CB    1 
ATOM   289  C CG    . TYR A 1 42  ? 29.542  -8.707  16.588  1.00 26.02 ? 39  TYR A CG    1 
ATOM   290  C CD1   . TYR A 1 42  ? 30.019  -7.727  15.738  1.00 25.90 ? 39  TYR A CD1   1 
ATOM   291  C CD2   . TYR A 1 42  ? 28.172  -8.970  16.597  1.00 26.29 ? 39  TYR A CD2   1 
ATOM   292  C CE1   . TYR A 1 42  ? 29.171  -7.018  14.913  1.00 26.72 ? 39  TYR A CE1   1 
ATOM   293  C CE2   . TYR A 1 42  ? 27.306  -8.273  15.757  1.00 27.32 ? 39  TYR A CE2   1 
ATOM   294  C CZ    . TYR A 1 42  ? 27.822  -7.294  14.916  1.00 26.82 ? 39  TYR A CZ    1 
ATOM   295  O OH    . TYR A 1 42  ? 27.009  -6.573  14.078  1.00 27.05 ? 39  TYR A OH    1 
ATOM   296  N N     . PRO A 1 43  ? 30.473  -10.543 20.679  1.00 27.13 ? 40  PRO A N     1 
ATOM   297  C CA    . PRO A 1 43  ? 31.151  -11.526 21.502  1.00 27.82 ? 40  PRO A CA    1 
ATOM   298  C C     . PRO A 1 43  ? 31.791  -12.609 20.652  1.00 28.32 ? 40  PRO A C     1 
ATOM   299  O O     . PRO A 1 43  ? 31.299  -12.909 19.559  1.00 28.42 ? 40  PRO A O     1 
ATOM   300  C CB    . PRO A 1 43  ? 30.023  -12.126 22.345  1.00 27.90 ? 40  PRO A CB    1 
ATOM   301  C CG    . PRO A 1 43  ? 28.884  -11.152 22.223  1.00 27.99 ? 40  PRO A CG    1 
ATOM   302  C CD    . PRO A 1 43  ? 29.011  -10.567 20.881  1.00 27.20 ? 40  PRO A CD    1 
ATOM   303  N N     . PRO A 1 44  ? 32.885  -13.201 21.142  1.00 29.31 ? 41  PRO A N     1 
ATOM   304  C CA    . PRO A 1 44  ? 33.413  -14.385 20.449  1.00 29.65 ? 41  PRO A CA    1 
ATOM   305  C C     . PRO A 1 44  ? 32.318  -15.429 20.199  1.00 30.26 ? 41  PRO A C     1 
ATOM   306  O O     . PRO A 1 44  ? 31.434  -15.615 21.055  1.00 30.11 ? 41  PRO A O     1 
ATOM   307  C CB    . PRO A 1 44  ? 34.459  -14.907 21.423  1.00 29.42 ? 41  PRO A CB    1 
ATOM   308  C CG    . PRO A 1 44  ? 34.926  -13.678 22.133  1.00 29.29 ? 41  PRO A CG    1 
ATOM   309  C CD    . PRO A 1 44  ? 33.710  -12.842 22.312  1.00 29.25 ? 41  PRO A CD    1 
ATOM   310  N N     . SER A 1 45  ? 32.372  -16.080 19.033  1.00 30.71 ? 42  SER A N     1 
ATOM   311  C CA    . SER A 1 45  ? 31.365  -17.068 18.629  1.00 31.18 ? 42  SER A CA    1 
ATOM   312  C C     . SER A 1 45  ? 31.316  -18.230 19.593  1.00 31.38 ? 42  SER A C     1 
ATOM   313  O O     . SER A 1 45  ? 32.290  -18.494 20.275  1.00 31.64 ? 42  SER A O     1 
ATOM   314  C CB    . SER A 1 45  ? 31.675  -17.612 17.231  1.00 31.22 ? 42  SER A CB    1 
ATOM   315  O OG    . SER A 1 45  ? 32.862  -18.399 17.228  1.00 31.40 ? 42  SER A OG    1 
ATOM   316  N N     . GLU A 1 46  ? 30.195  -18.939 19.636  1.00 31.99 ? 43  GLU A N     1 
ATOM   317  C CA    . GLU A 1 46  ? 30.100  -20.142 20.475  1.00 32.74 ? 43  GLU A CA    1 
ATOM   318  C C     . GLU A 1 46  ? 31.090  -21.203 20.025  1.00 32.27 ? 43  GLU A C     1 
ATOM   319  O O     . GLU A 1 46  ? 31.685  -21.886 20.861  1.00 31.98 ? 43  GLU A O     1 
ATOM   320  C CB    . GLU A 1 46  ? 28.678  -20.712 20.496  1.00 33.11 ? 43  GLU A CB    1 
ATOM   321  C CG    . GLU A 1 46  ? 27.698  -19.791 21.226  1.00 35.29 ? 43  GLU A CG    1 
ATOM   322  C CD    . GLU A 1 46  ? 26.271  -20.329 21.277  1.00 36.21 ? 43  GLU A CD    1 
ATOM   323  O OE1   . GLU A 1 46  ? 26.092  -21.546 21.546  1.00 40.54 ? 43  GLU A OE1   1 
ATOM   324  O OE2   . GLU A 1 46  ? 25.330  -19.520 21.075  1.00 40.31 ? 43  GLU A OE2   1 
ATOM   325  N N     . ALA A 1 47  ? 31.289  -21.318 18.712  1.00 31.62 ? 44  ALA A N     1 
ATOM   326  C CA    . ALA A 1 47  ? 32.258  -22.281 18.161  1.00 31.30 ? 44  ALA A CA    1 
ATOM   327  C C     . ALA A 1 47  ? 33.668  -22.036 18.678  1.00 30.83 ? 44  ALA A C     1 
ATOM   328  O O     . ALA A 1 47  ? 34.379  -22.981 18.999  1.00 30.23 ? 44  ALA A O     1 
ATOM   329  C CB    . ALA A 1 47  ? 32.267  -22.241 16.634  1.00 31.24 ? 44  ALA A CB    1 
ATOM   330  N N     . LEU A 1 48  ? 34.069  -20.763 18.723  1.00 30.51 ? 45  LEU A N     1 
ATOM   331  C CA    . LEU A 1 48  ? 35.398  -20.370 19.186  1.00 30.17 ? 45  LEU A CA    1 
ATOM   332  C C     . LEU A 1 48  ? 35.527  -20.645 20.675  1.00 29.72 ? 45  LEU A C     1 
ATOM   333  O O     . LEU A 1 48  ? 36.551  -21.135 21.135  1.00 29.09 ? 45  LEU A O     1 
ATOM   334  C CB    . LEU A 1 48  ? 35.658  -18.879 18.920  1.00 30.31 ? 45  LEU A CB    1 
ATOM   335  C CG    . LEU A 1 48  ? 37.097  -18.385 19.185  1.00 30.39 ? 45  LEU A CG    1 
ATOM   336  C CD1   . LEU A 1 48  ? 37.344  -17.110 18.417  1.00 29.74 ? 45  LEU A CD1   1 
ATOM   337  C CD2   . LEU A 1 48  ? 37.360  -18.173 20.674  1.00 30.59 ? 45  LEU A CD2   1 
ATOM   338  N N     . VAL A 1 49  ? 34.481  -20.303 21.418  1.00 29.07 ? 46  VAL A N     1 
ATOM   339  C CA    . VAL A 1 49  ? 34.490  -20.458 22.853  1.00 29.14 ? 46  VAL A CA    1 
ATOM   340  C C     . VAL A 1 49  ? 34.610  -21.944 23.241  1.00 28.80 ? 46  VAL A C     1 
ATOM   341  O O     . VAL A 1 49  ? 35.442  -22.306 24.071  1.00 27.78 ? 46  VAL A O     1 
ATOM   342  C CB    . VAL A 1 49  ? 33.242  -19.779 23.475  1.00 29.09 ? 46  VAL A CB    1 
ATOM   343  C CG1   . VAL A 1 49  ? 33.075  -20.159 24.944  1.00 29.02 ? 46  VAL A CG1   1 
ATOM   344  C CG2   . VAL A 1 49  ? 33.342  -18.251 23.300  1.00 28.72 ? 46  VAL A CG2   1 
ATOM   345  N N     . ALA A 1 50  ? 33.803  -22.792 22.611  1.00 28.64 ? 47  ALA A N     1 
ATOM   346  C CA    . ALA A 1 50  ? 33.855  -24.242 22.850  1.00 29.23 ? 47  ALA A CA    1 
ATOM   347  C C     . ALA A 1 50  ? 35.240  -24.801 22.552  1.00 29.28 ? 47  ALA A C     1 
ATOM   348  O O     . ALA A 1 50  ? 35.772  -25.591 23.315  1.00 29.81 ? 47  ALA A O     1 
ATOM   349  C CB    . ALA A 1 50  ? 32.801  -24.960 22.007  1.00 29.02 ? 47  ALA A CB    1 
ATOM   350  N N     . ASP A 1 51  ? 35.830  -24.376 21.442  1.00 29.73 ? 48  ASP A N     1 
ATOM   351  C CA    . ASP A 1 51  ? 37.198  -24.770 21.106  1.00 29.62 ? 48  ASP A CA    1 
ATOM   352  C C     . ASP A 1 51  ? 38.180  -24.320 22.198  1.00 29.56 ? 48  ASP A C     1 
ATOM   353  O O     . ASP A 1 51  ? 39.041  -25.088 22.638  1.00 29.36 ? 48  ASP A O     1 
ATOM   354  C CB    . ASP A 1 51  ? 37.568  -24.171 19.756  1.00 29.85 ? 48  ASP A CB    1 
ATOM   355  C CG    . ASP A 1 51  ? 38.808  -24.795 19.133  1.00 30.34 ? 48  ASP A CG    1 
ATOM   356  O OD1   . ASP A 1 51  ? 39.517  -25.611 19.761  1.00 31.14 ? 48  ASP A OD1   1 
ATOM   357  O OD2   . ASP A 1 51  ? 39.078  -24.446 17.974  1.00 31.41 ? 48  ASP A OD2   1 
ATOM   358  N N     . LEU A 1 52  ? 38.045  -23.078 22.640  1.00 29.34 ? 49  LEU A N     1 
ATOM   359  C CA    . LEU A 1 52  ? 38.906  -22.535 23.686  1.00 29.51 ? 49  LEU A CA    1 
ATOM   360  C C     . LEU A 1 52  ? 38.856  -23.353 24.973  1.00 29.21 ? 49  LEU A C     1 
ATOM   361  O O     . LEU A 1 52  ? 39.883  -23.749 25.503  1.00 29.06 ? 49  LEU A O     1 
ATOM   362  C CB    . LEU A 1 52  ? 38.509  -21.086 23.999  1.00 29.40 ? 49  LEU A CB    1 
ATOM   363  C CG    . LEU A 1 52  ? 39.384  -20.391 25.025  1.00 29.73 ? 49  LEU A CG    1 
ATOM   364  C CD1   . LEU A 1 52  ? 40.855  -20.473 24.598  1.00 29.38 ? 49  LEU A CD1   1 
ATOM   365  C CD2   . LEU A 1 52  ? 38.934  -18.940 25.194  1.00 29.96 ? 49  LEU A CD2   1 
ATOM   366  N N     . VAL A 1 53  ? 37.649  -23.570 25.476  1.00 29.22 ? 50  VAL A N     1 
ATOM   367  C CA    . VAL A 1 53  ? 37.427  -24.359 26.668  1.00 29.56 ? 50  VAL A CA    1 
ATOM   368  C C     . VAL A 1 53  ? 38.032  -25.768 26.544  1.00 29.60 ? 50  VAL A C     1 
ATOM   369  O O     . VAL A 1 53  ? 38.700  -26.253 27.457  1.00 29.82 ? 50  VAL A O     1 
ATOM   370  C CB    . VAL A 1 53  ? 35.909  -24.456 26.979  1.00 29.71 ? 50  VAL A CB    1 
ATOM   371  C CG1   . VAL A 1 53  ? 35.660  -25.470 28.083  1.00 30.44 ? 50  VAL A CG1   1 
ATOM   372  C CG2   . VAL A 1 53  ? 35.343  -23.073 27.350  1.00 28.91 ? 50  VAL A CG2   1 
ATOM   373  N N     . ALA A 1 54  ? 37.803  -26.418 25.410  1.00 29.57 ? 51  ALA A N     1 
ATOM   374  C CA    . ALA A 1 54  ? 38.360  -27.739 25.168  1.00 29.87 ? 51  ALA A CA    1 
ATOM   375  C C     . ALA A 1 54  ? 39.894  -27.720 25.166  1.00 30.23 ? 51  ALA A C     1 
ATOM   376  O O     . ALA A 1 54  ? 40.541  -28.664 25.637  1.00 29.88 ? 51  ALA A O     1 
ATOM   377  C CB    . ALA A 1 54  ? 37.839  -28.285 23.848  1.00 29.49 ? 51  ALA A CB    1 
ATOM   378  N N     . THR A 1 55  ? 40.468  -26.656 24.613  1.00 30.27 ? 52  THR A N     1 
ATOM   379  C CA    . THR A 1 55  ? 41.924  -26.505 24.525  1.00 30.99 ? 52  THR A CA    1 
ATOM   380  C C     . THR A 1 55  ? 42.551  -26.216 25.884  1.00 31.61 ? 52  THR A C     1 
ATOM   381  O O     . THR A 1 55  ? 43.652  -26.672 26.178  1.00 31.59 ? 52  THR A O     1 
ATOM   382  C CB    . THR A 1 55  ? 42.289  -25.370 23.567  1.00 30.54 ? 52  THR A CB    1 
ATOM   383  O OG1   . THR A 1 55  ? 41.642  -25.604 22.314  1.00 31.95 ? 52  THR A OG1   1 
ATOM   384  C CG2   . THR A 1 55  ? 43.796  -25.281 23.343  1.00 29.84 ? 52  THR A CG2   1 
ATOM   385  N N     . VAL A 1 56  ? 41.848  -25.443 26.705  1.00 32.56 ? 53  VAL A N     1 
ATOM   386  C CA    . VAL A 1 56  ? 42.315  -25.143 28.042  1.00 33.47 ? 53  VAL A CA    1 
ATOM   387  C C     . VAL A 1 56  ? 42.360  -26.424 28.849  1.00 34.19 ? 53  VAL A C     1 
ATOM   388  O O     . VAL A 1 56  ? 43.334  -26.681 29.553  1.00 34.19 ? 53  VAL A O     1 
ATOM   389  C CB    . VAL A 1 56  ? 41.411  -24.111 28.731  1.00 33.68 ? 53  VAL A CB    1 
ATOM   390  C CG1   . VAL A 1 56  ? 41.716  -24.035 30.236  1.00 33.41 ? 53  VAL A CG1   1 
ATOM   391  C CG2   . VAL A 1 56  ? 41.592  -22.750 28.059  1.00 33.51 ? 53  VAL A CG2   1 
ATOM   392  N N     . ASP A 1 57  ? 41.309  -27.233 28.727  1.00 35.32 ? 54  ASP A N     1 
ATOM   393  C CA    . ASP A 1 57  ? 41.256  -28.547 29.373  1.00 35.64 ? 54  ASP A CA    1 
ATOM   394  C C     . ASP A 1 57  ? 42.501  -29.364 29.021  1.00 35.99 ? 54  ASP A C     1 
ATOM   395  O O     . ASP A 1 57  ? 43.056  -30.053 29.858  1.00 36.85 ? 54  ASP A O     1 
ATOM   396  C CB    . ASP A 1 57  ? 39.964  -29.276 28.964  1.00 36.25 ? 54  ASP A CB    1 
ATOM   397  C CG    . ASP A 1 57  ? 39.800  -30.635 29.627  1.00 37.46 ? 54  ASP A CG    1 
ATOM   398  O OD1   . ASP A 1 57  ? 38.963  -30.752 30.553  1.00 41.10 ? 54  ASP A OD1   1 
ATOM   399  O OD2   . ASP A 1 57  ? 40.483  -31.598 29.199  1.00 43.18 ? 54  ASP A OD2   1 
ATOM   400  N N     . LYS A 1 58  ? 42.955  -29.253 27.784  1.00 36.24 ? 55  LYS A N     1 
ATOM   401  C CA    . LYS A 1 58  ? 44.124  -29.983 27.319  1.00 35.87 ? 55  LYS A CA    1 
ATOM   402  C C     . LYS A 1 58  ? 45.449  -29.416 27.847  1.00 35.23 ? 55  LYS A C     1 
ATOM   403  O O     . LYS A 1 58  ? 46.241  -30.152 28.424  1.00 35.00 ? 55  LYS A O     1 
ATOM   404  C CB    . LYS A 1 58  ? 44.116  -30.023 25.786  1.00 36.27 ? 55  LYS A CB    1 
ATOM   405  C CG    . LYS A 1 58  ? 45.257  -30.812 25.143  1.00 37.29 ? 55  LYS A CG    1 
ATOM   406  C CD    . LYS A 1 58  ? 45.306  -30.593 23.612  1.00 38.24 ? 55  LYS A CD    1 
ATOM   407  C CE    . LYS A 1 58  ? 45.890  -29.207 23.235  1.00 40.36 ? 55  LYS A CE    1 
ATOM   408  N NZ    . LYS A 1 58  ? 45.827  -28.878 21.765  1.00 40.09 ? 55  LYS A NZ    1 
ATOM   409  N N     . ILE A 1 59  ? 45.709  -28.126 27.647  1.00 34.35 ? 56  ILE A N     1 
ATOM   410  C CA    . ILE A 1 59  ? 47.032  -27.568 27.983  1.00 33.99 ? 56  ILE A CA    1 
ATOM   411  C C     . ILE A 1 59  ? 47.249  -27.215 29.466  1.00 33.48 ? 56  ILE A C     1 
ATOM   412  O O     . ILE A 1 59  ? 48.393  -27.033 29.902  1.00 33.23 ? 56  ILE A O     1 
ATOM   413  C CB    . ILE A 1 59  ? 47.373  -26.294 27.148  1.00 34.16 ? 56  ILE A CB    1 
ATOM   414  C CG1   . ILE A 1 59  ? 46.403  -25.142 27.461  1.00 34.14 ? 56  ILE A CG1   1 
ATOM   415  C CG2   . ILE A 1 59  ? 47.387  -26.608 25.658  1.00 33.75 ? 56  ILE A CG2   1 
ATOM   416  C CD1   . ILE A 1 59  ? 47.098  -23.794 27.596  1.00 34.67 ? 56  ILE A CD1   1 
ATOM   417  N N     . ALA A 1 60  ? 46.168  -27.105 30.234  1.00 32.58 ? 57  ALA A N     1 
ATOM   418  C CA    . ALA A 1 60  ? 46.256  -26.591 31.604  1.00 32.12 ? 57  ALA A CA    1 
ATOM   419  C C     . ALA A 1 60  ? 47.187  -27.433 32.485  1.00 31.39 ? 57  ALA A C     1 
ATOM   420  O O     . ALA A 1 60  ? 47.864  -26.906 33.363  1.00 30.72 ? 57  ALA A O     1 
ATOM   421  C CB    . ALA A 1 60  ? 44.848  -26.458 32.230  1.00 31.81 ? 57  ALA A CB    1 
ATOM   422  N N     . THR A 1 61  ? 47.254  -28.732 32.200  1.00 31.04 ? 58  THR A N     1 
ATOM   423  C CA    . THR A 1 61  ? 48.161  -29.657 32.879  1.00 30.82 ? 58  THR A CA    1 
ATOM   424  C C     . THR A 1 61  ? 49.655  -29.296 32.759  1.00 30.62 ? 58  THR A C     1 
ATOM   425  O O     . THR A 1 61  ? 50.481  -29.801 33.528  1.00 30.92 ? 58  THR A O     1 
ATOM   426  C CB    . THR A 1 61  ? 47.967  -31.111 32.330  1.00 31.41 ? 58  THR A CB    1 
ATOM   427  O OG1   . THR A 1 61  ? 48.367  -31.182 30.948  1.00 30.44 ? 58  THR A OG1   1 
ATOM   428  C CG2   . THR A 1 61  ? 46.492  -31.534 32.441  1.00 32.32 ? 58  THR A CG2   1 
ATOM   429  N N     . GLU A 1 62  ? 50.010  -28.447 31.797  1.00 29.72 ? 59  GLU A N     1 
ATOM   430  C CA    . GLU A 1 62  ? 51.413  -28.072 31.593  1.00 29.19 ? 59  GLU A CA    1 
ATOM   431  C C     . GLU A 1 62  ? 51.777  -26.706 32.208  1.00 27.62 ? 59  GLU A C     1 
ATOM   432  O O     . GLU A 1 62  ? 52.899  -26.245 32.035  1.00 26.43 ? 59  GLU A O     1 
ATOM   433  C CB    . GLU A 1 62  ? 51.720  -28.056 30.088  1.00 30.36 ? 59  GLU A CB    1 
ATOM   434  C CG    . GLU A 1 62  ? 51.399  -29.370 29.336  1.00 34.53 ? 59  GLU A CG    1 
ATOM   435  C CD    . GLU A 1 62  ? 52.264  -30.562 29.775  1.00 41.25 ? 59  GLU A CD    1 
ATOM   436  O OE1   . GLU A 1 62  ? 53.472  -30.364 30.119  1.00 45.19 ? 59  GLU A OE1   1 
ATOM   437  O OE2   . GLU A 1 62  ? 51.729  -31.703 29.776  1.00 44.67 ? 59  GLU A OE2   1 
ATOM   438  N N     . LEU A 1 63  ? 50.845  -26.082 32.946  1.00 26.32 ? 60  LEU A N     1 
ATOM   439  C CA    . LEU A 1 63  ? 51.016  -24.692 33.408  1.00 25.28 ? 60  LEU A CA    1 
ATOM   440  C C     . LEU A 1 63  ? 52.044  -24.477 34.527  1.00 24.48 ? 60  LEU A C     1 
ATOM   441  O O     . LEU A 1 63  ? 52.413  -23.331 34.823  1.00 24.00 ? 60  LEU A O     1 
ATOM   442  C CB    . LEU A 1 63  ? 49.677  -24.081 33.826  1.00 25.71 ? 60  LEU A CB    1 
ATOM   443  C CG    . LEU A 1 63  ? 48.741  -23.558 32.731  1.00 25.44 ? 60  LEU A CG    1 
ATOM   444  C CD1   . LEU A 1 63  ? 47.602  -22.816 33.363  1.00 22.80 ? 60  LEU A CD1   1 
ATOM   445  C CD2   . LEU A 1 63  ? 49.473  -22.642 31.783  1.00 26.13 ? 60  LEU A CD2   1 
ATOM   446  N N     . ASN A 1 64  ? 52.514  -25.562 35.137  1.00 22.83 ? 61  ASN A N     1 
ATOM   447  C CA    . ASN A 1 64  ? 53.645  -25.495 36.040  1.00 22.28 ? 61  ASN A CA    1 
ATOM   448  C C     . ASN A 1 64  ? 54.961  -25.293 35.285  1.00 21.62 ? 61  ASN A C     1 
ATOM   449  O O     . ASN A 1 64  ? 55.970  -24.996 35.904  1.00 20.12 ? 61  ASN A O     1 
ATOM   450  C CB    . ASN A 1 64  ? 53.753  -26.770 36.898  1.00 21.59 ? 61  ASN A CB    1 
ATOM   451  C CG    . ASN A 1 64  ? 53.859  -28.039 36.059  1.00 20.88 ? 61  ASN A CG    1 
ATOM   452  O OD1   . ASN A 1 64  ? 53.105  -28.214 35.091  1.00 18.83 ? 61  ASN A OD1   1 
ATOM   453  N ND2   . ASN A 1 64  ? 54.797  -28.919 36.412  1.00 17.27 ? 61  ASN A ND2   1 
ATOM   454  N N     . ARG A 1 65  ? 54.956  -25.476 33.965  1.00 21.45 ? 62  ARG A N     1 
ATOM   455  C CA    . ARG A 1 65  ? 56.178  -25.275 33.186  1.00 21.87 ? 62  ARG A CA    1 
ATOM   456  C C     . ARG A 1 65  ? 56.148  -23.921 32.520  1.00 21.50 ? 62  ARG A C     1 
ATOM   457  O O     . ARG A 1 65  ? 55.090  -23.365 32.267  1.00 21.45 ? 62  ARG A O     1 
ATOM   458  C CB    . ARG A 1 65  ? 56.354  -26.354 32.119  1.00 21.66 ? 62  ARG A CB    1 
ATOM   459  C CG    . ARG A 1 65  ? 56.345  -27.774 32.646  1.00 23.09 ? 62  ARG A CG    1 
ATOM   460  C CD    . ARG A 1 65  ? 57.572  -28.051 33.449  1.00 23.59 ? 62  ARG A CD    1 
ATOM   461  N NE    . ARG A 1 65  ? 57.644  -29.430 33.923  1.00 23.62 ? 62  ARG A NE    1 
ATOM   462  C CZ    . ARG A 1 65  ? 58.604  -29.878 34.728  1.00 25.37 ? 62  ARG A CZ    1 
ATOM   463  N NH1   . ARG A 1 65  ? 59.571  -29.055 35.122  1.00 24.58 ? 62  ARG A NH1   1 
ATOM   464  N NH2   . ARG A 1 65  ? 58.610  -31.143 35.134  1.00 24.82 ? 62  ARG A NH2   1 
ATOM   465  N N     . TYR A 1 66  ? 57.324  -23.398 32.227  1.00 21.54 ? 63  TYR A N     1 
ATOM   466  C CA    . TYR A 1 66  ? 57.417  -22.194 31.434  1.00 22.06 ? 63  TYR A CA    1 
ATOM   467  C C     . TYR A 1 66  ? 56.827  -22.490 30.064  1.00 22.36 ? 63  TYR A C     1 
ATOM   468  O O     . TYR A 1 66  ? 56.929  -23.633 29.562  1.00 22.26 ? 63  TYR A O     1 
ATOM   469  C CB    . TYR A 1 66  ? 58.858  -21.698 31.337  1.00 21.66 ? 63  TYR A CB    1 
ATOM   470  C CG    . TYR A 1 66  ? 59.270  -20.907 32.559  1.00 22.26 ? 63  TYR A CG    1 
ATOM   471  C CD1   . TYR A 1 66  ? 59.809  -21.532 33.673  1.00 22.36 ? 63  TYR A CD1   1 
ATOM   472  C CD2   . TYR A 1 66  ? 59.086  -19.523 32.609  1.00 21.76 ? 63  TYR A CD2   1 
ATOM   473  C CE1   . TYR A 1 66  ? 60.163  -20.801 34.799  1.00 22.16 ? 63  TYR A CE1   1 
ATOM   474  C CE2   . TYR A 1 66  ? 59.457  -18.791 33.716  1.00 20.35 ? 63  TYR A CE2   1 
ATOM   475  C CZ    . TYR A 1 66  ? 59.971  -19.432 34.803  1.00 21.01 ? 63  TYR A CZ    1 
ATOM   476  O OH    . TYR A 1 66  ? 60.321  -18.710 35.899  1.00 22.18 ? 63  TYR A OH    1 
ATOM   477  N N     . PRO A 1 67  ? 56.208  -21.472 29.451  1.00 22.28 ? 64  PRO A N     1 
ATOM   478  C CA    . PRO A 1 67  ? 55.587  -21.689 28.162  1.00 22.85 ? 64  PRO A CA    1 
ATOM   479  C C     . PRO A 1 67  ? 56.663  -21.831 27.104  1.00 23.39 ? 64  PRO A C     1 
ATOM   480  O O     . PRO A 1 67  ? 57.827  -21.495 27.357  1.00 23.17 ? 64  PRO A O     1 
ATOM   481  C CB    . PRO A 1 67  ? 54.764  -20.411 27.951  1.00 22.78 ? 64  PRO A CB    1 
ATOM   482  C CG    . PRO A 1 67  ? 55.449  -19.374 28.729  1.00 22.29 ? 64  PRO A CG    1 
ATOM   483  C CD    . PRO A 1 67  ? 56.132  -20.061 29.882  1.00 22.14 ? 64  PRO A CD    1 
ATOM   484  N N     . GLU A 1 68  ? 56.299  -22.349 25.940  1.00 24.95 ? 65  GLU A N     1 
ATOM   485  C CA    . GLU A 1 68  ? 57.258  -22.390 24.831  1.00 25.31 ? 65  GLU A CA    1 
ATOM   486  C C     . GLU A 1 68  ? 57.740  -20.974 24.533  1.00 25.43 ? 65  GLU A C     1 
ATOM   487  O O     . GLU A 1 68  ? 56.955  -20.077 24.232  1.00 25.31 ? 65  GLU A O     1 
ATOM   488  C CB    . GLU A 1 68  ? 56.656  -23.035 23.574  1.00 25.80 ? 65  GLU A CB    1 
ATOM   489  C CG    . GLU A 1 68  ? 57.725  -23.725 22.708  1.00 26.98 ? 65  GLU A CG    1 
ATOM   490  C CD    . GLU A 1 68  ? 58.354  -22.766 21.696  1.00 31.14 ? 65  GLU A CD    1 
ATOM   491  O OE1   . GLU A 1 68  ? 57.596  -22.330 20.790  1.00 32.87 ? 65  GLU A OE1   1 
ATOM   492  O OE2   . GLU A 1 68  ? 59.579  -22.456 21.807  1.00 31.53 ? 65  GLU A OE2   1 
ATOM   493  N N     . ARG A 1 69  ? 59.040  -20.781 24.615  1.00 26.00 ? 66  ARG A N     1 
ATOM   494  C CA    . ARG A 1 69  ? 59.604  -19.435 24.640  1.00 26.49 ? 66  ARG A CA    1 
ATOM   495  C C     . ARG A 1 69  ? 59.495  -18.648 23.330  1.00 26.63 ? 66  ARG A C     1 
ATOM   496  O O     . ARG A 1 69  ? 59.291  -17.420 23.358  1.00 26.03 ? 66  ARG A O     1 
ATOM   497  C CB    . ARG A 1 69  ? 61.064  -19.497 25.039  1.00 26.45 ? 66  ARG A CB    1 
ATOM   498  C CG    . ARG A 1 69  ? 61.626  -18.153 25.431  1.00 26.95 ? 66  ARG A CG    1 
ATOM   499  C CD    . ARG A 1 69  ? 63.116  -18.198 25.337  1.00 28.54 ? 66  ARG A CD    1 
ATOM   500  N NE    . ARG A 1 69  ? 63.635  -18.903 26.477  1.00 30.95 ? 66  ARG A NE    1 
ATOM   501  C CZ    . ARG A 1 69  ? 64.672  -19.728 26.470  1.00 29.96 ? 66  ARG A CZ    1 
ATOM   502  N NH1   . ARG A 1 69  ? 65.357  -19.992 25.360  1.00 30.75 ? 66  ARG A NH1   1 
ATOM   503  N NH2   . ARG A 1 69  ? 65.003  -20.300 27.613  1.00 28.21 ? 66  ARG A NH2   1 
ATOM   504  N N     . ASP A 1 70  ? 59.665  -19.346 22.207  1.00 26.68 ? 67  ASP A N     1 
ATOM   505  C CA    . ASP A 1 70  ? 59.680  -18.712 20.890  1.00 26.70 ? 67  ASP A CA    1 
ATOM   506  C C     . ASP A 1 70  ? 58.326  -18.738 20.197  1.00 26.70 ? 67  ASP A C     1 
ATOM   507  O O     . ASP A 1 70  ? 58.187  -18.224 19.088  1.00 26.26 ? 67  ASP A O     1 
ATOM   508  C CB    . ASP A 1 70  ? 60.755  -19.353 20.007  1.00 27.66 ? 67  ASP A CB    1 
ATOM   509  C CG    . ASP A 1 70  ? 62.152  -19.217 20.606  1.00 28.56 ? 67  ASP A CG    1 
ATOM   510  O OD1   . ASP A 1 70  ? 62.441  -18.190 21.246  1.00 27.84 ? 67  ASP A OD1   1 
ATOM   511  O OD2   . ASP A 1 70  ? 62.953  -20.153 20.456  1.00 33.30 ? 67  ASP A OD2   1 
ATOM   512  N N     . ALA A 1 71  ? 57.312  -19.301 20.852  1.00 25.98 ? 68  ALA A N     1 
ATOM   513  C CA    . ALA A 1 71  ? 55.958  -19.207 20.339  1.00 25.89 ? 68  ALA A CA    1 
ATOM   514  C C     . ALA A 1 71  ? 55.868  -19.654 18.870  1.00 26.04 ? 68  ALA A C     1 
ATOM   515  O O     . ALA A 1 71  ? 55.197  -19.016 18.050  1.00 25.69 ? 68  ALA A O     1 
ATOM   516  C CB    . ALA A 1 71  ? 55.443  -17.785 20.498  1.00 25.43 ? 68  ALA A CB    1 
ATOM   517  N N     . VAL A 1 72  ? 56.518  -20.782 18.572  1.00 25.91 ? 69  VAL A N     1 
ATOM   518  C CA    . VAL A 1 72  ? 56.643  -21.296 17.214  1.00 25.96 ? 69  VAL A CA    1 
ATOM   519  C C     . VAL A 1 72  ? 55.298  -21.655 16.589  1.00 25.92 ? 69  VAL A C     1 
ATOM   520  O O     . VAL A 1 72  ? 55.022  -21.293 15.449  1.00 26.23 ? 69  VAL A O     1 
ATOM   521  C CB    . VAL A 1 72  ? 57.636  -22.494 17.158  1.00 25.67 ? 69  VAL A CB    1 
ATOM   522  C CG1   . VAL A 1 72  ? 57.440  -23.311 15.902  1.00 27.10 ? 69  VAL A CG1   1 
ATOM   523  C CG2   . VAL A 1 72  ? 59.082  -21.979 17.232  1.00 26.03 ? 69  VAL A CG2   1 
ATOM   524  N N     . GLU A 1 73  ? 54.444  -22.339 17.328  1.00 26.12 ? 70  GLU A N     1 
ATOM   525  C CA    . GLU A 1 73  ? 53.149  -22.728 16.783  1.00 26.18 ? 70  GLU A CA    1 
ATOM   526  C C     . GLU A 1 73  ? 52.266  -21.524 16.456  1.00 25.68 ? 70  GLU A C     1 
ATOM   527  O O     . GLU A 1 73  ? 51.697  -21.432 15.359  1.00 25.75 ? 70  GLU A O     1 
ATOM   528  C CB    . GLU A 1 73  ? 52.422  -23.654 17.737  1.00 26.19 ? 70  GLU A CB    1 
ATOM   529  C CG    . GLU A 1 73  ? 51.241  -24.352 17.091  1.00 27.53 ? 70  GLU A CG    1 
ATOM   530  C CD    . GLU A 1 73  ? 50.682  -25.489 17.945  1.00 29.88 ? 70  GLU A CD    1 
ATOM   531  O OE1   . GLU A 1 73  ? 51.470  -26.089 18.723  1.00 34.19 ? 70  GLU A OE1   1 
ATOM   532  O OE2   . GLU A 1 73  ? 49.458  -25.788 17.817  1.00 34.99 ? 70  GLU A OE2   1 
ATOM   533  N N     . LEU A 1 74  ? 52.144  -20.611 17.414  1.00 24.94 ? 71  LEU A N     1 
ATOM   534  C CA    . LEU A 1 74  ? 51.418  -19.364 17.207  1.00 24.43 ? 71  LEU A CA    1 
ATOM   535  C C     . LEU A 1 74  ? 51.915  -18.620 15.985  1.00 23.86 ? 71  LEU A C     1 
ATOM   536  O O     . LEU A 1 74  ? 51.135  -18.125 15.186  1.00 23.35 ? 71  LEU A O     1 
ATOM   537  C CB    . LEU A 1 74  ? 51.588  -18.453 18.416  1.00 24.37 ? 71  LEU A CB    1 
ATOM   538  C CG    . LEU A 1 74  ? 50.966  -17.056 18.313  1.00 23.97 ? 71  LEU A CG    1 
ATOM   539  C CD1   . LEU A 1 74  ? 49.490  -17.149 17.966  1.00 22.28 ? 71  LEU A CD1   1 
ATOM   540  C CD2   . LEU A 1 74  ? 51.200  -16.302 19.625  1.00 23.86 ? 71  LEU A CD2   1 
ATOM   541  N N     . ARG A 1 75  ? 53.225  -18.509 15.859  1.00 24.08 ? 72  ARG A N     1 
ATOM   542  C CA    . ARG A 1 75  ? 53.785  -17.763 14.747  1.00 23.72 ? 72  ARG A CA    1 
ATOM   543  C C     . ARG A 1 75  ? 53.507  -18.463 13.420  1.00 23.80 ? 72  ARG A C     1 
ATOM   544  O O     . ARG A 1 75  ? 53.284  -17.789 12.418  1.00 23.30 ? 72  ARG A O     1 
ATOM   545  C CB    . ARG A 1 75  ? 55.263  -17.499 14.968  1.00 23.52 ? 72  ARG A CB    1 
ATOM   546  C CG    . ARG A 1 75  ? 55.519  -16.509 16.084  1.00 22.88 ? 72  ARG A CG    1 
ATOM   547  C CD    . ARG A 1 75  ? 56.916  -16.602 16.637  1.00 22.82 ? 72  ARG A CD    1 
ATOM   548  N NE    . ARG A 1 75  ? 57.919  -16.359 15.607  1.00 24.69 ? 72  ARG A NE    1 
ATOM   549  C CZ    . ARG A 1 75  ? 59.142  -16.887 15.588  1.00 24.89 ? 72  ARG A CZ    1 
ATOM   550  N NH1   . ARG A 1 75  ? 59.548  -17.716 16.533  1.00 26.48 ? 72  ARG A NH1   1 
ATOM   551  N NH2   . ARG A 1 75  ? 59.963  -16.605 14.590  1.00 25.02 ? 72  ARG A NH2   1 
ATOM   552  N N     . ASP A 1 76  ? 53.501  -19.801 13.415  1.00 24.58 ? 73  ASP A N     1 
ATOM   553  C CA    . ASP A 1 76  ? 53.093  -20.574 12.234  1.00 24.95 ? 73  ASP A CA    1 
ATOM   554  C C     . ASP A 1 76  ? 51.701  -20.184 11.768  1.00 24.76 ? 73  ASP A C     1 
ATOM   555  O O     . ASP A 1 76  ? 51.480  -19.946 10.585  1.00 24.64 ? 73  ASP A O     1 
ATOM   556  C CB    . ASP A 1 76  ? 53.068  -22.076 12.514  1.00 25.64 ? 73  ASP A CB    1 
ATOM   557  C CG    . ASP A 1 76  ? 54.434  -22.711 12.508  1.00 27.44 ? 73  ASP A CG    1 
ATOM   558  O OD1   . ASP A 1 76  ? 55.390  -22.130 11.933  1.00 31.37 ? 73  ASP A OD1   1 
ATOM   559  O OD2   . ASP A 1 76  ? 54.535  -23.828 13.068  1.00 30.61 ? 73  ASP A OD2   1 
ATOM   560  N N     . GLU A 1 77  ? 50.768  -20.117 12.711  1.00 25.17 ? 74  GLU A N     1 
ATOM   561  C CA    . GLU A 1 77  ? 49.378  -19.821 12.390  1.00 25.37 ? 74  GLU A CA    1 
ATOM   562  C C     . GLU A 1 77  ? 49.175  -18.359 12.032  1.00 25.04 ? 74  GLU A C     1 
ATOM   563  O O     . GLU A 1 77  ? 48.343  -18.043 11.175  1.00 24.78 ? 74  GLU A O     1 
ATOM   564  C CB    . GLU A 1 77  ? 48.452  -20.253 13.527  1.00 25.99 ? 74  GLU A CB    1 
ATOM   565  C CG    . GLU A 1 77  ? 48.589  -21.725 13.891  1.00 28.67 ? 74  GLU A CG    1 
ATOM   566  C CD    . GLU A 1 77  ? 48.362  -22.688 12.705  1.00 33.01 ? 74  GLU A CD    1 
ATOM   567  O OE1   . GLU A 1 77  ? 47.683  -22.314 11.721  1.00 33.92 ? 74  GLU A OE1   1 
ATOM   568  O OE2   . GLU A 1 77  ? 48.863  -23.842 12.767  1.00 38.18 ? 74  GLU A OE2   1 
ATOM   569  N N     . LEU A 1 78  ? 49.940  -17.469 12.663  1.00 25.09 ? 75  LEU A N     1 
ATOM   570  C CA    . LEU A 1 78  ? 49.907  -16.053 12.308  1.00 24.93 ? 75  LEU A CA    1 
ATOM   571  C C     . LEU A 1 78  ? 50.389  -15.877 10.865  1.00 25.22 ? 75  LEU A C     1 
ATOM   572  O O     . LEU A 1 78  ? 49.794  -15.123 10.098  1.00 25.09 ? 75  LEU A O     1 
ATOM   573  C CB    . LEU A 1 78  ? 50.746  -15.204 13.284  1.00 24.99 ? 75  LEU A CB    1 
ATOM   574  C CG    . LEU A 1 78  ? 50.170  -14.934 14.685  1.00 23.79 ? 75  LEU A CG    1 
ATOM   575  C CD1   . LEU A 1 78  ? 51.263  -14.469 15.639  1.00 22.71 ? 75  LEU A CD1   1 
ATOM   576  C CD2   . LEU A 1 78  ? 49.035  -13.924 14.605  1.00 22.15 ? 75  LEU A CD2   1 
ATOM   577  N N     . ALA A 1 79  ? 51.447  -16.603 10.494  1.00 25.41 ? 76  ALA A N     1 
ATOM   578  C CA    . ALA A 1 79  ? 51.961  -16.575 9.127   1.00 25.51 ? 76  ALA A CA    1 
ATOM   579  C C     . ALA A 1 79  ? 50.930  -17.094 8.122   1.00 25.64 ? 76  ALA A C     1 
ATOM   580  O O     . ALA A 1 79  ? 50.740  -16.495 7.068   1.00 25.56 ? 76  ALA A O     1 
ATOM   581  C CB    . ALA A 1 79  ? 53.271  -17.350 9.022   1.00 25.22 ? 76  ALA A CB    1 
ATOM   582  N N     . ALA A 1 80  ? 50.245  -18.184 8.467   1.00 25.76 ? 77  ALA A N     1 
ATOM   583  C CA    . ALA A 1 80  ? 49.173  -18.712 7.623   1.00 26.05 ? 77  ALA A CA    1 
ATOM   584  C C     . ALA A 1 80  ? 48.069  -17.679 7.418   1.00 26.35 ? 77  ALA A C     1 
ATOM   585  O O     . ALA A 1 80  ? 47.571  -17.512 6.297   1.00 26.73 ? 77  ALA A O     1 
ATOM   586  C CB    . ALA A 1 80  ? 48.580  -19.992 8.229   1.00 25.98 ? 77  ALA A CB    1 
ATOM   587  N N     . TYR A 1 81  ? 47.676  -17.016 8.506   1.00 26.03 ? 78  TYR A N     1 
ATOM   588  C CA    . TYR A 1 81  ? 46.619  -16.017 8.455   1.00 26.28 ? 78  TYR A CA    1 
ATOM   589  C C     . TYR A 1 81  ? 47.038  -14.852 7.548   1.00 26.54 ? 78  TYR A C     1 
ATOM   590  O O     . TYR A 1 81  ? 46.306  -14.470 6.640   1.00 25.84 ? 78  TYR A O     1 
ATOM   591  C CB    . TYR A 1 81  ? 46.234  -15.492 9.849   1.00 25.75 ? 78  TYR A CB    1 
ATOM   592  C CG    . TYR A 1 81  ? 45.412  -14.220 9.760   1.00 25.37 ? 78  TYR A CG    1 
ATOM   593  C CD1   . TYR A 1 81  ? 44.069  -14.264 9.388   1.00 24.76 ? 78  TYR A CD1   1 
ATOM   594  C CD2   . TYR A 1 81  ? 45.993  -12.976 9.975   1.00 25.08 ? 78  TYR A CD2   1 
ATOM   595  C CE1   . TYR A 1 81  ? 43.316  -13.092 9.256   1.00 26.14 ? 78  TYR A CE1   1 
ATOM   596  C CE2   . TYR A 1 81  ? 45.258  -11.801 9.851   1.00 25.71 ? 78  TYR A CE2   1 
ATOM   597  C CZ    . TYR A 1 81  ? 43.928  -11.860 9.493   1.00 25.61 ? 78  TYR A CZ    1 
ATOM   598  O OH    . TYR A 1 81  ? 43.204  -10.707 9.379   1.00 26.53 ? 78  TYR A OH    1 
ATOM   599  N N     . ILE A 1 82  ? 48.216  -14.302 7.787   1.00 26.92 ? 79  ILE A N     1 
ATOM   600  C CA    . ILE A 1 82  ? 48.705  -13.183 6.959   1.00 27.79 ? 79  ILE A CA    1 
ATOM   601  C C     . ILE A 1 82  ? 48.782  -13.520 5.457   1.00 28.19 ? 79  ILE A C     1 
ATOM   602  O O     . ILE A 1 82  ? 48.378  -12.721 4.610   1.00 28.35 ? 79  ILE A O     1 
ATOM   603  C CB    . ILE A 1 82  ? 50.076  -12.677 7.456   1.00 27.46 ? 79  ILE A CB    1 
ATOM   604  C CG1   . ILE A 1 82  ? 49.885  -11.853 8.728   1.00 28.14 ? 79  ILE A CG1   1 
ATOM   605  C CG2   . ILE A 1 82  ? 50.775  -11.812 6.399   1.00 27.24 ? 79  ILE A CG2   1 
ATOM   606  C CD1   . ILE A 1 82  ? 49.115  -10.546 8.510   1.00 25.16 ? 79  ILE A CD1   1 
ATOM   607  N N     . THR A 1 83  ? 49.305  -14.699 5.153   1.00 28.56 ? 80  THR A N     1 
ATOM   608  C CA    . THR A 1 83  ? 49.435  -15.195 3.785   1.00 29.10 ? 80  THR A CA    1 
ATOM   609  C C     . THR A 1 83  ? 48.102  -15.226 3.058   1.00 29.57 ? 80  THR A C     1 
ATOM   610  O O     . THR A 1 83  ? 47.990  -14.735 1.933   1.00 29.80 ? 80  THR A O     1 
ATOM   611  C CB    . THR A 1 83  ? 50.033  -16.625 3.775   1.00 29.08 ? 80  THR A CB    1 
ATOM   612  O OG1   . THR A 1 83  ? 51.386  -16.590 4.252   1.00 29.18 ? 80  THR A OG1   1 
ATOM   613  C CG2   . THR A 1 83  ? 49.998  -17.224 2.360   1.00 28.68 ? 80  THR A CG2   1 
ATOM   614  N N     . LYS A 1 84  ? 47.096  -15.792 3.714   1.00 30.39 ? 81  LYS A N     1 
ATOM   615  C CA    . LYS A 1 84  ? 45.745  -15.801 3.188   1.00 31.02 ? 81  LYS A CA    1 
ATOM   616  C C     . LYS A 1 84  ? 45.098  -14.399 3.189   1.00 31.13 ? 81  LYS A C     1 
ATOM   617  O O     . LYS A 1 84  ? 44.408  -14.037 2.240   1.00 30.64 ? 81  LYS A O     1 
ATOM   618  C CB    . LYS A 1 84  ? 44.884  -16.788 3.978   1.00 31.10 ? 81  LYS A CB    1 
ATOM   619  C CG    . LYS A 1 84  ? 43.411  -16.817 3.558   1.00 32.31 ? 81  LYS A CG    1 
ATOM   620  C CD    . LYS A 1 84  ? 42.598  -17.837 4.383   1.00 33.10 ? 81  LYS A CD    1 
ATOM   621  C CE    . LYS A 1 84  ? 41.085  -17.723 4.100   1.00 34.75 ? 81  LYS A CE    1 
ATOM   622  N NZ    . LYS A 1 84  ? 40.248  -18.275 5.221   1.00 35.19 ? 81  LYS A NZ    1 
ATOM   623  N N     . GLN A 1 85  ? 45.311  -13.624 4.251   1.00 31.30 ? 82  GLN A N     1 
ATOM   624  C CA    . GLN A 1 85  ? 44.628  -12.329 4.415   1.00 31.24 ? 82  GLN A CA    1 
ATOM   625  C C     . GLN A 1 85  ? 45.164  -11.277 3.460   1.00 31.46 ? 82  GLN A C     1 
ATOM   626  O O     . GLN A 1 85  ? 44.387  -10.513 2.905   1.00 32.03 ? 82  GLN A O     1 
ATOM   627  C CB    . GLN A 1 85  ? 44.752  -11.830 5.862   1.00 31.05 ? 82  GLN A CB    1 
ATOM   628  C CG    . GLN A 1 85  ? 44.298  -10.372 6.140   1.00 31.20 ? 82  GLN A CG    1 
ATOM   629  C CD    . GLN A 1 85  ? 42.813  -10.142 5.918   1.00 30.54 ? 82  GLN A CD    1 
ATOM   630  O OE1   . GLN A 1 85  ? 42.051  -11.086 5.837   1.00 28.08 ? 82  GLN A OE1   1 
ATOM   631  N NE2   . GLN A 1 85  ? 42.405  -8.869  5.809   1.00 30.07 ? 82  GLN A NE2   1 
ATOM   632  N N     . THR A 1 86  ? 46.483  -11.211 3.301   1.00 31.57 ? 83  THR A N     1 
ATOM   633  C CA    . THR A 1 86  ? 47.114  -10.159 2.494   1.00 31.58 ? 83  THR A CA    1 
ATOM   634  C C     . THR A 1 86  ? 47.644  -10.645 1.148   1.00 31.82 ? 83  THR A C     1 
ATOM   635  O O     . THR A 1 86  ? 48.027  -9.826  0.314   1.00 32.26 ? 83  THR A O     1 
ATOM   636  C CB    . THR A 1 86  ? 48.278  -9.461  3.239   1.00 31.61 ? 83  THR A CB    1 
ATOM   637  O OG1   . THR A 1 86  ? 49.423  -10.329 3.289   1.00 31.48 ? 83  THR A OG1   1 
ATOM   638  C CG2   . THR A 1 86  ? 47.852  -9.036  4.659   1.00 31.08 ? 83  THR A CG2   1 
ATOM   639  N N     . GLY A 1 87  ? 47.681  -11.960 0.941   1.00 31.93 ? 84  GLY A N     1 
ATOM   640  C CA    . GLY A 1 87  ? 48.174  -12.533 -0.309  1.00 31.64 ? 84  GLY A CA    1 
ATOM   641  C C     . GLY A 1 87  ? 49.685  -12.545 -0.435  1.00 31.73 ? 84  GLY A C     1 
ATOM   642  O O     . GLY A 1 87  ? 50.224  -12.817 -1.516  1.00 32.09 ? 84  GLY A O     1 
ATOM   643  N N     . VAL A 1 88  ? 50.378  -12.263 0.661   1.00 31.37 ? 85  VAL A N     1 
ATOM   644  C CA    . VAL A 1 88  ? 51.829  -12.261 0.675   1.00 31.16 ? 85  VAL A CA    1 
ATOM   645  C C     . VAL A 1 88  ? 52.298  -13.521 1.396   1.00 31.35 ? 85  VAL A C     1 
ATOM   646  O O     . VAL A 1 88  ? 51.958  -13.742 2.561   1.00 31.47 ? 85  VAL A O     1 
ATOM   647  C CB    . VAL A 1 88  ? 52.353  -11.001 1.370   1.00 31.28 ? 85  VAL A CB    1 
ATOM   648  C CG1   . VAL A 1 88  ? 53.891  -10.965 1.394   1.00 31.24 ? 85  VAL A CG1   1 
ATOM   649  C CG2   . VAL A 1 88  ? 51.778  -9.764  0.683   1.00 31.14 ? 85  VAL A CG2   1 
ATOM   650  N N     . ALA A 1 89  ? 53.058  -14.355 0.684   1.00 31.11 ? 86  ALA A N     1 
ATOM   651  C CA    . ALA A 1 89  ? 53.627  -15.575 1.248   1.00 30.53 ? 86  ALA A CA    1 
ATOM   652  C C     . ALA A 1 89  ? 54.644  -15.258 2.352   1.00 30.18 ? 86  ALA A C     1 
ATOM   653  O O     . ALA A 1 89  ? 55.710  -14.692 2.087   1.00 29.92 ? 86  ALA A O     1 
ATOM   654  C CB    . ALA A 1 89  ? 54.281  -16.421 0.151   1.00 30.70 ? 86  ALA A CB    1 
ATOM   655  N N     . VAL A 1 90  ? 54.291  -15.629 3.584   1.00 29.72 ? 87  VAL A N     1 
ATOM   656  C CA    . VAL A 1 90  ? 55.186  -15.538 4.729   1.00 29.29 ? 87  VAL A CA    1 
ATOM   657  C C     . VAL A 1 90  ? 55.133  -16.823 5.561   1.00 29.24 ? 87  VAL A C     1 
ATOM   658  O O     . VAL A 1 90  ? 54.213  -17.635 5.451   1.00 28.88 ? 87  VAL A O     1 
ATOM   659  C CB    . VAL A 1 90  ? 54.846  -14.331 5.640   1.00 29.14 ? 87  VAL A CB    1 
ATOM   660  C CG1   . VAL A 1 90  ? 55.227  -13.015 4.969   1.00 27.84 ? 87  VAL A CG1   1 
ATOM   661  C CG2   . VAL A 1 90  ? 53.371  -14.336 6.024   1.00 28.33 ? 87  VAL A CG2   1 
ATOM   662  N N     . THR A 1 91  ? 56.139  -16.979 6.405   1.00 29.31 ? 88  THR A N     1 
ATOM   663  C CA    . THR A 1 91  ? 56.261  -18.103 7.305   1.00 29.56 ? 88  THR A CA    1 
ATOM   664  C C     . THR A 1 91  ? 56.526  -17.541 8.698   1.00 29.58 ? 88  THR A C     1 
ATOM   665  O O     . THR A 1 91  ? 56.614  -16.329 8.893   1.00 29.56 ? 88  THR A O     1 
ATOM   666  C CB    . THR A 1 91  ? 57.451  -19.011 6.896   1.00 29.72 ? 88  THR A CB    1 
ATOM   667  O OG1   . THR A 1 91  ? 58.686  -18.412 7.314   1.00 29.28 ? 88  THR A OG1   1 
ATOM   668  C CG2   . THR A 1 91  ? 57.477  -19.224 5.386   1.00 30.10 ? 88  THR A CG2   1 
ATOM   669  N N     . ARG A 1 92  ? 56.680  -18.426 9.667   1.00 29.71 ? 89  ARG A N     1 
ATOM   670  C CA    . ARG A 1 92  ? 56.923  -17.993 11.029  1.00 29.97 ? 89  ARG A CA    1 
ATOM   671  C C     . ARG A 1 92  ? 58.191  -17.171 11.193  1.00 29.24 ? 89  ARG A C     1 
ATOM   672  O O     . ARG A 1 92  ? 58.250  -16.347 12.081  1.00 29.32 ? 89  ARG A O     1 
ATOM   673  C CB    . ARG A 1 92  ? 56.957  -19.180 11.971  1.00 30.74 ? 89  ARG A CB    1 
ATOM   674  C CG    . ARG A 1 92  ? 58.071  -20.185 11.709  1.00 31.19 ? 89  ARG A CG    1 
ATOM   675  C CD    . ARG A 1 92  ? 58.482  -20.821 13.019  1.00 32.90 ? 89  ARG A CD    1 
ATOM   676  N NE    . ARG A 1 92  ? 59.527  -21.819 12.849  1.00 34.15 ? 89  ARG A NE    1 
ATOM   677  C CZ    . ARG A 1 92  ? 59.309  -23.050 12.396  1.00 37.30 ? 89  ARG A CZ    1 
ATOM   678  N NH1   . ARG A 1 92  ? 58.086  -23.430 12.044  1.00 37.06 ? 89  ARG A NH1   1 
ATOM   679  N NH2   . ARG A 1 92  ? 60.329  -23.904 12.285  1.00 38.68 ? 89  ARG A NH2   1 
ATOM   680  N N     . ASP A 1 93  ? 59.198  -17.379 10.345  1.00 29.03 ? 90  ASP A N     1 
ATOM   681  C CA    . ASP A 1 93  ? 60.409  -16.547 10.372  1.00 28.49 ? 90  ASP A CA    1 
ATOM   682  C C     . ASP A 1 93  ? 60.157  -15.061 10.118  1.00 27.63 ? 90  ASP A C     1 
ATOM   683  O O     . ASP A 1 93  ? 61.019  -14.221 10.429  1.00 27.11 ? 90  ASP A O     1 
ATOM   684  C CB    . ASP A 1 93  ? 61.422  -17.038 9.340   1.00 29.43 ? 90  ASP A CB    1 
ATOM   685  C CG    . ASP A 1 93  ? 61.930  -18.445 9.631   1.00 31.50 ? 90  ASP A CG    1 
ATOM   686  O OD1   . ASP A 1 93  ? 62.107  -18.804 10.821  1.00 34.87 ? 90  ASP A OD1   1 
ATOM   687  O OD2   . ASP A 1 93  ? 62.162  -19.187 8.655   1.00 36.05 ? 90  ASP A OD2   1 
ATOM   688  N N     . ASN A 1 94  ? 59.012  -14.743 9.515   1.00 26.72 ? 91  ASN A N     1 
ATOM   689  C CA    . ASN A 1 94  ? 58.601  -13.357 9.257   1.00 26.59 ? 91  ASN A CA    1 
ATOM   690  C C     . ASN A 1 94  ? 57.714  -12.781 10.357  1.00 26.20 ? 91  ASN A C     1 
ATOM   691  O O     . ASN A 1 94  ? 57.490  -11.569 10.391  1.00 26.33 ? 91  ASN A O     1 
ATOM   692  C CB    . ASN A 1 94  ? 57.831  -13.270 7.940   1.00 26.44 ? 91  ASN A CB    1 
ATOM   693  C CG    . ASN A 1 94  ? 58.648  -13.747 6.763   1.00 26.51 ? 91  ASN A CG    1 
ATOM   694  O OD1   . ASN A 1 94  ? 59.569  -13.073 6.336   1.00 25.65 ? 91  ASN A OD1   1 
ATOM   695  N ND2   . ASN A 1 94  ? 58.329  -14.925 6.253   1.00 24.35 ? 91  ASN A ND2   1 
ATOM   696  N N     . LEU A 1 95  ? 57.210  -13.644 11.240  1.00 25.62 ? 92  LEU A N     1 
ATOM   697  C CA    . LEU A 1 95  ? 56.262  -13.224 12.278  1.00 25.48 ? 92  LEU A CA    1 
ATOM   698  C C     . LEU A 1 95  ? 56.817  -13.212 13.699  1.00 25.12 ? 92  LEU A C     1 
ATOM   699  O O     . LEU A 1 95  ? 57.654  -14.030 14.060  1.00 25.11 ? 92  LEU A O     1 
ATOM   700  C CB    . LEU A 1 95  ? 54.976  -14.054 12.190  1.00 25.38 ? 92  LEU A CB    1 
ATOM   701  C CG    . LEU A 1 95  ? 54.051  -13.354 11.189  1.00 25.37 ? 92  LEU A CG    1 
ATOM   702  C CD1   . LEU A 1 95  ? 54.234  -13.874 9.773   1.00 24.40 ? 92  LEU A CD1   1 
ATOM   703  C CD2   . LEU A 1 95  ? 52.630  -13.420 11.633  1.00 26.58 ? 92  LEU A CD2   1 
ATOM   704  N N     . TRP A 1 96  ? 56.364  -12.237 14.483  1.00 24.49 ? 93  TRP A N     1 
ATOM   705  C CA    . TRP A 1 96  ? 56.734  -12.127 15.888  1.00 24.01 ? 93  TRP A CA    1 
ATOM   706  C C     . TRP A 1 96  ? 55.519  -11.665 16.655  1.00 23.20 ? 93  TRP A C     1 
ATOM   707  O O     . TRP A 1 96  ? 54.886  -10.715 16.236  1.00 24.08 ? 93  TRP A O     1 
ATOM   708  C CB    . TRP A 1 96  ? 57.846  -11.119 16.075  1.00 24.14 ? 93  TRP A CB    1 
ATOM   709  C CG    . TRP A 1 96  ? 58.297  -11.027 17.488  1.00 24.52 ? 93  TRP A CG    1 
ATOM   710  C CD1   . TRP A 1 96  ? 58.199  -9.946  18.321  1.00 24.40 ? 93  TRP A CD1   1 
ATOM   711  C CD2   . TRP A 1 96  ? 58.903  -12.067 18.246  1.00 24.95 ? 93  TRP A CD2   1 
ATOM   712  N NE1   . TRP A 1 96  ? 58.725  -10.249 19.556  1.00 24.18 ? 93  TRP A NE1   1 
ATOM   713  C CE2   . TRP A 1 96  ? 59.163  -11.547 19.537  1.00 24.89 ? 93  TRP A CE2   1 
ATOM   714  C CE3   . TRP A 1 96  ? 59.285  -13.386 17.953  1.00 25.00 ? 93  TRP A CE3   1 
ATOM   715  C CZ2   . TRP A 1 96  ? 59.771  -12.302 20.536  1.00 25.13 ? 93  TRP A CZ2   1 
ATOM   716  C CZ3   . TRP A 1 96  ? 59.878  -14.140 18.940  1.00 24.94 ? 93  TRP A CZ3   1 
ATOM   717  C CH2   . TRP A 1 96  ? 60.122  -13.601 20.221  1.00 25.82 ? 93  TRP A CH2   1 
ATOM   718  N N     . ALA A 1 97  ? 55.221  -12.316 17.779  1.00 22.52 ? 94  ALA A N     1 
ATOM   719  C CA    . ALA A 1 97  ? 54.045  -11.987 18.591  1.00 22.32 ? 94  ALA A CA    1 
ATOM   720  C C     . ALA A 1 97  ? 54.486  -11.530 19.960  1.00 22.17 ? 94  ALA A C     1 
ATOM   721  O O     . ALA A 1 97  ? 55.566  -11.919 20.435  1.00 22.29 ? 94  ALA A O     1 
ATOM   722  C CB    . ALA A 1 97  ? 53.118  -13.197 18.713  1.00 21.46 ? 94  ALA A CB    1 
ATOM   723  N N     . ALA A 1 98  ? 53.642  -10.708 20.589  1.00 21.50 ? 95  ALA A N     1 
ATOM   724  C CA    . ALA A 1 98  ? 53.880  -10.201 21.929  1.00 21.64 ? 95  ALA A CA    1 
ATOM   725  C C     . ALA A 1 98  ? 52.541  -9.822  22.608  1.00 21.44 ? 95  ALA A C     1 
ATOM   726  O O     . ALA A 1 98  ? 51.462  -9.961  22.023  1.00 20.16 ? 95  ALA A O     1 
ATOM   727  C CB    . ALA A 1 98  ? 54.812  -8.997  21.883  1.00 20.77 ? 95  ALA A CB    1 
ATOM   728  N N     . ASN A 1 99  ? 52.633  -9.342  23.841  1.00 21.87 ? 96  ASN A N     1 
ATOM   729  C CA    . ASN A 1 99  ? 51.438  -9.013  24.632  1.00 22.68 ? 96  ASN A CA    1 
ATOM   730  C C     . ASN A 1 99  ? 50.841  -7.671  24.187  1.00 22.27 ? 96  ASN A C     1 
ATOM   731  O O     . ASN A 1 99  ? 51.048  -6.637  24.812  1.00 22.09 ? 96  ASN A O     1 
ATOM   732  C CB    . ASN A 1 99  ? 51.766  -9.024  26.124  1.00 23.17 ? 96  ASN A CB    1 
ATOM   733  C CG    . ASN A 1 99  ? 51.922  -10.438 26.673  1.00 25.32 ? 96  ASN A CG    1 
ATOM   734  O OD1   . ASN A 1 99  ? 50.931  -11.120 26.950  1.00 29.03 ? 96  ASN A OD1   1 
ATOM   735  N ND2   . ASN A 1 99  ? 53.154  -10.887 26.817  1.00 26.62 ? 96  ASN A ND2   1 
ATOM   736  N N     . GLY A 1 100 ? 50.119  -7.714  23.074  1.00 22.55 ? 97  GLY A N     1 
ATOM   737  C CA    . GLY A 1 100 ? 49.599  -6.517  22.433  1.00 23.31 ? 97  GLY A CA    1 
ATOM   738  C C     . GLY A 1 100 ? 50.568  -5.866  21.465  1.00 23.35 ? 97  GLY A C     1 
ATOM   739  O O     . GLY A 1 100 ? 51.763  -6.120  21.502  1.00 22.71 ? 97  GLY A O     1 
ATOM   740  N N     . SER A 1 101 ? 50.029  -5.037  20.571  1.00 24.18 ? 98  SER A N     1 
ATOM   741  C CA    . SER A 1 101 ? 50.849  -4.130  19.761  1.00 24.44 ? 98  SER A CA    1 
ATOM   742  C C     . SER A 1 101 ? 51.688  -3.216  20.609  1.00 24.70 ? 98  SER A C     1 
ATOM   743  O O     . SER A 1 101 ? 52.762  -2.806  20.193  1.00 25.64 ? 98  SER A O     1 
ATOM   744  C CB    . SER A 1 101 ? 49.982  -3.276  18.844  1.00 24.48 ? 98  SER A CB    1 
ATOM   745  O OG    . SER A 1 101 ? 49.477  -4.063  17.816  1.00 24.40 ? 98  SER A OG    1 
ATOM   746  N N     . ASN A 1 102 ? 51.194  -2.872  21.794  1.00 25.23 ? 99  ASN A N     1 
ATOM   747  C CA    . ASN A 1 102 ? 51.970  -2.074  22.731  1.00 25.05 ? 99  ASN A CA    1 
ATOM   748  C C     . ASN A 1 102 ? 53.333  -2.662  23.032  1.00 24.80 ? 99  ASN A C     1 
ATOM   749  O O     . ASN A 1 102 ? 54.322  -1.940  23.003  1.00 24.45 ? 99  ASN A O     1 
ATOM   750  C CB    . ASN A 1 102 ? 51.228  -1.922  24.064  1.00 26.10 ? 99  ASN A CB    1 
ATOM   751  C CG    . ASN A 1 102 ? 50.081  -0.922  24.003  1.00 27.26 ? 99  ASN A CG    1 
ATOM   752  O OD1   . ASN A 1 102 ? 49.282  -0.869  24.935  1.00 31.14 ? 99  ASN A OD1   1 
ATOM   753  N ND2   . ASN A 1 102 ? 49.982  -0.145  22.912  1.00 27.59 ? 99  ASN A ND2   1 
ATOM   754  N N     . GLU A 1 103 ? 53.379  -3.949  23.384  1.00 24.21 ? 100 GLU A N     1 
ATOM   755  C CA    . GLU A 1 103 ? 54.662  -4.606  23.657  1.00 24.20 ? 100 GLU A CA    1 
ATOM   756  C C     . GLU A 1 103 ? 55.484  -4.769  22.382  1.00 23.48 ? 100 GLU A C     1 
ATOM   757  O O     . GLU A 1 103 ? 56.694  -4.601  22.409  1.00 24.08 ? 100 GLU A O     1 
ATOM   758  C CB    . GLU A 1 103 ? 54.502  -5.955  24.387  1.00 24.19 ? 100 GLU A CB    1 
ATOM   759  C CG    . GLU A 1 103 ? 55.759  -6.330  25.177  1.00 24.21 ? 100 GLU A CG    1 
ATOM   760  C CD    . GLU A 1 103 ? 55.723  -7.689  25.890  1.00 25.46 ? 100 GLU A CD    1 
ATOM   761  O OE1   . GLU A 1 103 ? 54.933  -8.591  25.500  1.00 26.85 ? 100 GLU A OE1   1 
ATOM   762  O OE2   . GLU A 1 103 ? 56.534  -7.859  26.842  1.00 26.26 ? 100 GLU A OE2   1 
ATOM   763  N N     . ILE A 1 104 ? 54.827  -5.065  21.265  1.00 23.26 ? 101 ILE A N     1 
ATOM   764  C CA    . ILE A 1 104 ? 55.493  -5.139  19.961  1.00 23.56 ? 101 ILE A CA    1 
ATOM   765  C C     . ILE A 1 104 ? 56.225  -3.834  19.649  1.00 23.96 ? 101 ILE A C     1 
ATOM   766  O O     . ILE A 1 104 ? 57.386  -3.850  19.215  1.00 24.11 ? 101 ILE A O     1 
ATOM   767  C CB    . ILE A 1 104 ? 54.484  -5.408  18.798  1.00 23.46 ? 101 ILE A CB    1 
ATOM   768  C CG1   . ILE A 1 104 ? 53.927  -6.839  18.864  1.00 22.82 ? 101 ILE A CG1   1 
ATOM   769  C CG2   . ILE A 1 104 ? 55.129  -5.116  17.441  1.00 22.63 ? 101 ILE A CG2   1 
ATOM   770  C CD1   . ILE A 1 104 ? 54.896  -7.927  18.459  1.00 20.27 ? 101 ILE A CD1   1 
ATOM   771  N N     . LEU A 1 105 ? 55.545  -2.705  19.848  1.00 23.74 ? 102 LEU A N     1 
ATOM   772  C CA    . LEU A 1 105 ? 56.140  -1.411  19.539  1.00 24.38 ? 102 LEU A CA    1 
ATOM   773  C C     . LEU A 1 105 ? 57.213  -1.082  20.560  1.00 24.43 ? 102 LEU A C     1 
ATOM   774  O O     . LEU A 1 105 ? 58.292  -0.598  20.201  1.00 24.92 ? 102 LEU A O     1 
ATOM   775  C CB    . LEU A 1 105 ? 55.077  -0.315  19.468  1.00 24.33 ? 102 LEU A CB    1 
ATOM   776  C CG    . LEU A 1 105 ? 54.064  -0.522  18.331  1.00 25.76 ? 102 LEU A CG    1 
ATOM   777  C CD1   . LEU A 1 105 ? 52.839  0.402   18.539  1.00 27.38 ? 102 LEU A CD1   1 
ATOM   778  C CD2   . LEU A 1 105 ? 54.686  -0.319  16.943  1.00 23.45 ? 102 LEU A CD2   1 
ATOM   779  N N     . GLN A 1 106 ? 56.946  -1.375  21.826  1.00 24.48 ? 103 GLN A N     1 
ATOM   780  C CA    . GLN A 1 106 ? 57.961  -1.189  22.866  1.00 24.88 ? 103 GLN A CA    1 
ATOM   781  C C     . GLN A 1 106 ? 59.273  -1.912  22.479  1.00 24.82 ? 103 GLN A C     1 
ATOM   782  O O     . GLN A 1 106 ? 60.346  -1.333  22.564  1.00 24.45 ? 103 GLN A O     1 
ATOM   783  C CB    . GLN A 1 106 ? 57.464  -1.703  24.220  1.00 24.72 ? 103 GLN A CB    1 
ATOM   784  C CG    . GLN A 1 106 ? 58.395  -1.385  25.363  1.00 25.56 ? 103 GLN A CG    1 
ATOM   785  C CD    . GLN A 1 106 ? 57.939  -1.979  26.667  1.00 26.59 ? 103 GLN A CD    1 
ATOM   786  O OE1   . GLN A 1 106 ? 58.086  -3.173  26.891  1.00 31.66 ? 103 GLN A OE1   1 
ATOM   787  N NE2   . GLN A 1 106 ? 57.384  -1.146  27.545  1.00 30.41 ? 103 GLN A NE2   1 
ATOM   788  N N     . GLN A 1 107 ? 59.158  -3.171  22.063  1.00 24.46 ? 104 GLN A N     1 
ATOM   789  C CA    . GLN A 1 107 ? 60.313  -3.991  21.698  1.00 24.69 ? 104 GLN A CA    1 
ATOM   790  C C     . GLN A 1 107 ? 61.036  -3.441  20.469  1.00 25.23 ? 104 GLN A C     1 
ATOM   791  O O     . GLN A 1 107 ? 62.255  -3.446  20.422  1.00 26.14 ? 104 GLN A O     1 
ATOM   792  C CB    . GLN A 1 107 ? 59.883  -5.443  21.429  1.00 24.11 ? 104 GLN A CB    1 
ATOM   793  C CG    . GLN A 1 107 ? 59.486  -6.240  22.667  1.00 23.08 ? 104 GLN A CG    1 
ATOM   794  C CD    . GLN A 1 107 ? 58.873  -7.607  22.344  1.00 23.46 ? 104 GLN A CD    1 
ATOM   795  O OE1   . GLN A 1 107 ? 58.529  -7.895  21.194  1.00 22.13 ? 104 GLN A OE1   1 
ATOM   796  N NE2   . GLN A 1 107 ? 58.692  -8.439  23.379  1.00 21.67 ? 104 GLN A NE2   1 
ATOM   797  N N     . LEU A 1 108 ? 60.284  -3.000  19.469  1.00 25.66 ? 105 LEU A N     1 
ATOM   798  C CA    . LEU A 1 108 ? 60.877  -2.356  18.291  1.00 25.67 ? 105 LEU A CA    1 
ATOM   799  C C     . LEU A 1 108 ? 61.614  -1.072  18.640  1.00 26.33 ? 105 LEU A C     1 
ATOM   800  O O     . LEU A 1 108 ? 62.725  -0.830  18.137  1.00 25.92 ? 105 LEU A O     1 
ATOM   801  C CB    . LEU A 1 108 ? 59.805  -2.085  17.232  1.00 25.40 ? 105 LEU A CB    1 
ATOM   802  C CG    . LEU A 1 108 ? 59.346  -3.352  16.506  1.00 24.21 ? 105 LEU A CG    1 
ATOM   803  C CD1   . LEU A 1 108 ? 58.047  -3.110  15.760  1.00 22.83 ? 105 LEU A CD1   1 
ATOM   804  C CD2   . LEU A 1 108 ? 60.446  -3.921  15.562  1.00 23.63 ? 105 LEU A CD2   1 
ATOM   805  N N     . LEU A 1 109 ? 61.002  -0.258  19.499  1.00 26.74 ? 106 LEU A N     1 
ATOM   806  C CA    . LEU A 1 109 ? 61.639  0.964   20.003  1.00 27.10 ? 106 LEU A CA    1 
ATOM   807  C C     . LEU A 1 109 ? 62.901  0.656   20.813  1.00 27.74 ? 106 LEU A C     1 
ATOM   808  O O     . LEU A 1 109 ? 63.886  1.381   20.706  1.00 28.07 ? 106 LEU A O     1 
ATOM   809  C CB    . LEU A 1 109 ? 60.662  1.810   20.840  1.00 26.82 ? 106 LEU A CB    1 
ATOM   810  C CG    . LEU A 1 109 ? 59.641  2.658   20.077  1.00 27.02 ? 106 LEU A CG    1 
ATOM   811  C CD1   . LEU A 1 109 ? 58.459  3.125   20.999  1.00 26.43 ? 106 LEU A CD1   1 
ATOM   812  C CD2   . LEU A 1 109 ? 60.304  3.854   19.421  1.00 26.11 ? 106 LEU A CD2   1 
ATOM   813  N N     . GLN A 1 110 ? 62.891  -0.418  21.601  1.00 28.24 ? 107 GLN A N     1 
ATOM   814  C CA    . GLN A 1 110 ? 64.085  -0.812  22.352  1.00 28.45 ? 107 GLN A CA    1 
ATOM   815  C C     . GLN A 1 110 ? 65.249  -1.117  21.410  1.00 28.65 ? 107 GLN A C     1 
ATOM   816  O O     . GLN A 1 110 ? 66.388  -0.773  21.707  1.00 28.50 ? 107 GLN A O     1 
ATOM   817  C CB    . GLN A 1 110 ? 63.833  -2.052  23.231  1.00 28.56 ? 107 GLN A CB    1 
ATOM   818  C CG    . GLN A 1 110 ? 62.937  -1.842  24.469  1.00 29.24 ? 107 GLN A CG    1 
ATOM   819  C CD    . GLN A 1 110 ? 62.550  -3.170  25.130  1.00 28.98 ? 107 GLN A CD    1 
ATOM   820  O OE1   . GLN A 1 110 ? 61.467  -3.693  24.909  1.00 31.19 ? 107 GLN A OE1   1 
ATOM   821  N NE2   . GLN A 1 110 ? 63.454  -3.727  25.914  1.00 31.13 ? 107 GLN A NE2   1 
ATOM   822  N N     . ALA A 1 111 ? 64.948  -1.769  20.286  1.00 28.88 ? 108 ALA A N     1 
ATOM   823  C CA    . ALA A 1 111 ? 65.970  -2.332  19.405  1.00 29.07 ? 108 ALA A CA    1 
ATOM   824  C C     . ALA A 1 111 ? 66.469  -1.319  18.374  1.00 29.31 ? 108 ALA A C     1 
ATOM   825  O O     . ALA A 1 111 ? 67.638  -1.356  17.968  1.00 29.14 ? 108 ALA A O     1 
ATOM   826  C CB    . ALA A 1 111 ? 65.431  -3.557  18.707  1.00 28.66 ? 108 ALA A CB    1 
ATOM   827  N N     . PHE A 1 112 ? 65.579  -0.418  17.969  1.00 29.38 ? 109 PHE A N     1 
ATOM   828  C CA    . PHE A 1 112 ? 65.846  0.524   16.888  1.00 29.92 ? 109 PHE A CA    1 
ATOM   829  C C     . PHE A 1 112 ? 65.730  1.990   17.280  1.00 30.39 ? 109 PHE A C     1 
ATOM   830  O O     . PHE A 1 112 ? 66.178  2.848   16.535  1.00 30.67 ? 109 PHE A O     1 
ATOM   831  C CB    . PHE A 1 112 ? 64.920  0.212   15.700  1.00 29.52 ? 109 PHE A CB    1 
ATOM   832  C CG    . PHE A 1 112 ? 65.174  -1.137  15.110  1.00 29.07 ? 109 PHE A CG    1 
ATOM   833  C CD1   . PHE A 1 112 ? 66.296  -1.350  14.311  1.00 28.87 ? 109 PHE A CD1   1 
ATOM   834  C CD2   . PHE A 1 112 ? 64.344  -2.213  15.399  1.00 28.94 ? 109 PHE A CD2   1 
ATOM   835  C CE1   . PHE A 1 112 ? 66.574  -2.611  13.801  1.00 28.48 ? 109 PHE A CE1   1 
ATOM   836  C CE2   . PHE A 1 112 ? 64.607  -3.472  14.886  1.00 28.23 ? 109 PHE A CE2   1 
ATOM   837  C CZ    . PHE A 1 112 ? 65.721  -3.676  14.086  1.00 28.59 ? 109 PHE A CZ    1 
ATOM   838  N N     . GLY A 1 113 ? 65.121  2.285   18.422  1.00 30.76 ? 110 GLY A N     1 
ATOM   839  C CA    . GLY A 1 113 ? 65.051  3.656   18.930  1.00 30.96 ? 110 GLY A CA    1 
ATOM   840  C C     . GLY A 1 113 ? 65.970  3.757   20.132  1.00 31.48 ? 110 GLY A C     1 
ATOM   841  O O     . GLY A 1 113 ? 67.113  3.296   20.079  1.00 31.58 ? 110 GLY A O     1 
ATOM   842  N N     . GLY A 1 114 ? 65.471  4.334   21.220  1.00 31.65 ? 111 GLY A N     1 
ATOM   843  C CA    . GLY A 1 114 ? 66.232  4.432   22.458  1.00 31.91 ? 111 GLY A CA    1 
ATOM   844  C C     . GLY A 1 114 ? 67.008  5.728   22.618  1.00 32.20 ? 111 GLY A C     1 
ATOM   845  O O     . GLY A 1 114 ? 66.833  6.662   21.843  1.00 32.07 ? 111 GLY A O     1 
ATOM   846  N N     . PRO A 1 115 ? 67.850  5.801   23.657  1.00 32.69 ? 112 PRO A N     1 
ATOM   847  C CA    . PRO A 1 115 ? 68.653  6.984   23.950  1.00 33.21 ? 112 PRO A CA    1 
ATOM   848  C C     . PRO A 1 115 ? 69.520  7.433   22.771  1.00 33.52 ? 112 PRO A C     1 
ATOM   849  O O     . PRO A 1 115 ? 70.239  6.627   22.195  1.00 33.51 ? 112 PRO A O     1 
ATOM   850  C CB    . PRO A 1 115 ? 69.529  6.527   25.123  1.00 33.33 ? 112 PRO A CB    1 
ATOM   851  C CG    . PRO A 1 115 ? 68.725  5.466   25.783  1.00 33.21 ? 112 PRO A CG    1 
ATOM   852  C CD    . PRO A 1 115 ? 68.045  4.745   24.664  1.00 32.37 ? 112 PRO A CD    1 
ATOM   853  N N     . GLY A 1 116 ? 69.427  8.711   22.416  1.00 33.66 ? 113 GLY A N     1 
ATOM   854  C CA    . GLY A 1 116 ? 70.199  9.271   21.319  1.00 33.83 ? 113 GLY A CA    1 
ATOM   855  C C     . GLY A 1 116 ? 69.471  9.222   19.992  1.00 34.12 ? 113 GLY A C     1 
ATOM   856  O O     . GLY A 1 116 ? 69.938  9.806   19.012  1.00 34.64 ? 113 GLY A O     1 
ATOM   857  N N     . ARG A 1 117 ? 68.326  8.540   19.957  1.00 33.86 ? 114 ARG A N     1 
ATOM   858  C CA    . ARG A 1 117 ? 67.584  8.322   18.724  1.00 33.63 ? 114 ARG A CA    1 
ATOM   859  C C     . ARG A 1 117 ? 66.194  8.942   18.758  1.00 33.86 ? 114 ARG A C     1 
ATOM   860  O O     . ARG A 1 117 ? 65.720  9.389   19.806  1.00 34.34 ? 114 ARG A O     1 
ATOM   861  C CB    . ARG A 1 117 ? 67.502  6.829   18.440  1.00 33.44 ? 114 ARG A CB    1 
ATOM   862  C CG    . ARG A 1 117 ? 68.837  6.219   18.083  1.00 32.83 ? 114 ARG A CG    1 
ATOM   863  C CD    . ARG A 1 117 ? 68.659  4.870   17.430  1.00 32.72 ? 114 ARG A CD    1 
ATOM   864  N NE    . ARG A 1 117 ? 69.925  4.302   16.997  1.00 31.54 ? 114 ARG A NE    1 
ATOM   865  C CZ    . ARG A 1 117 ? 70.042  3.206   16.264  1.00 32.04 ? 114 ARG A CZ    1 
ATOM   866  N NH1   . ARG A 1 117 ? 68.966  2.537   15.880  1.00 31.79 ? 114 ARG A NH1   1 
ATOM   867  N NH2   . ARG A 1 117 ? 71.249  2.775   15.902  1.00 32.69 ? 114 ARG A NH2   1 
ATOM   868  N N     . THR A 1 118 ? 65.546  8.970   17.597  1.00 34.06 ? 115 THR A N     1 
ATOM   869  C CA    . THR A 1 118 ? 64.320  9.736   17.411  1.00 34.10 ? 115 THR A CA    1 
ATOM   870  C C     . THR A 1 118 ? 63.277  8.931   16.633  1.00 33.80 ? 115 THR A C     1 
ATOM   871  O O     . THR A 1 118 ? 63.616  8.202   15.704  1.00 33.35 ? 115 THR A O     1 
ATOM   872  C CB    . THR A 1 118 ? 64.610  11.063  16.642  1.00 34.58 ? 115 THR A CB    1 
ATOM   873  O OG1   . THR A 1 118 ? 65.261  10.780  15.390  1.00 36.01 ? 115 THR A OG1   1 
ATOM   874  C CG2   . THR A 1 118 ? 65.510  11.976  17.449  1.00 34.81 ? 115 THR A CG2   1 
ATOM   875  N N     . ALA A 1 119 ? 62.014  9.069   17.035  1.00 33.65 ? 116 ALA A N     1 
ATOM   876  C CA    . ALA A 1 119 ? 60.879  8.571   16.269  1.00 33.65 ? 116 ALA A CA    1 
ATOM   877  C C     . ALA A 1 119 ? 60.057  9.749   15.767  1.00 33.52 ? 116 ALA A C     1 
ATOM   878  O O     . ALA A 1 119 ? 59.915  10.752  16.466  1.00 34.35 ? 116 ALA A O     1 
ATOM   879  C CB    . ALA A 1 119 ? 60.005  7.638   17.121  1.00 33.68 ? 116 ALA A CB    1 
ATOM   880  N N     . LEU A 1 120 ? 59.493  9.609   14.570  1.00 33.33 ? 117 LEU A N     1 
ATOM   881  C CA    . LEU A 1 120 ? 58.684  10.659  13.952  1.00 33.02 ? 117 LEU A CA    1 
ATOM   882  C C     . LEU A 1 120 ? 57.274  10.152  13.597  1.00 32.86 ? 117 LEU A C     1 
ATOM   883  O O     . LEU A 1 120 ? 57.107  9.081   13.005  1.00 32.15 ? 117 LEU A O     1 
ATOM   884  C CB    . LEU A 1 120 ? 59.405  11.207  12.717  1.00 33.12 ? 117 LEU A CB    1 
ATOM   885  C CG    . LEU A 1 120 ? 58.774  12.382  11.969  1.00 33.34 ? 117 LEU A CG    1 
ATOM   886  C CD1   . LEU A 1 120 ? 59.839  13.336  11.436  1.00 34.38 ? 117 LEU A CD1   1 
ATOM   887  C CD2   . LEU A 1 120 ? 57.903  11.869  10.848  1.00 33.45 ? 117 LEU A CD2   1 
ATOM   888  N N     . GLY A 1 121 ? 56.269  10.928  13.988  1.00 32.43 ? 118 GLY A N     1 
ATOM   889  C CA    . GLY A 1 121 ? 54.877  10.581  13.750  1.00 32.33 ? 118 GLY A CA    1 
ATOM   890  C C     . GLY A 1 121 ? 54.084  11.749  13.205  1.00 32.16 ? 118 GLY A C     1 
ATOM   891  O O     . GLY A 1 121 ? 54.542  12.894  13.228  1.00 31.95 ? 118 GLY A O     1 
ATOM   892  N N     . PHE A 1 122 ? 52.885  11.444  12.721  1.00 32.12 ? 119 PHE A N     1 
ATOM   893  C CA    . PHE A 1 122 ? 52.043  12.398  12.027  1.00 31.96 ? 119 PHE A CA    1 
ATOM   894  C C     . PHE A 1 122 ? 50.776  12.650  12.826  1.00 32.13 ? 119 PHE A C     1 
ATOM   895  O O     . PHE A 1 122 ? 49.801  11.894  12.750  1.00 32.05 ? 119 PHE A O     1 
ATOM   896  C CB    . PHE A 1 122 ? 51.734  11.887  10.626  1.00 31.44 ? 119 PHE A CB    1 
ATOM   897  C CG    . PHE A 1 122 ? 52.972  11.586  9.818   1.00 31.55 ? 119 PHE A CG    1 
ATOM   898  C CD1   . PHE A 1 122 ? 53.781  12.611  9.365   1.00 31.17 ? 119 PHE A CD1   1 
ATOM   899  C CD2   . PHE A 1 122 ? 53.348  10.273  9.549   1.00 31.00 ? 119 PHE A CD2   1 
ATOM   900  C CE1   . PHE A 1 122 ? 54.934  12.334  8.635   1.00 30.68 ? 119 PHE A CE1   1 
ATOM   901  C CE2   . PHE A 1 122 ? 54.492  9.990   8.820   1.00 30.57 ? 119 PHE A CE2   1 
ATOM   902  C CZ    . PHE A 1 122 ? 55.283  11.017  8.360   1.00 31.51 ? 119 PHE A CZ    1 
ATOM   903  N N     . GLN A 1 123 ? 50.803  13.730  13.596  1.00 31.91 ? 120 GLN A N     1 
ATOM   904  C CA    . GLN A 1 123 ? 49.775  13.996  14.573  1.00 32.06 ? 120 GLN A CA    1 
ATOM   905  C C     . GLN A 1 123 ? 48.608  14.712  13.915  1.00 31.40 ? 120 GLN A C     1 
ATOM   906  O O     . GLN A 1 123 ? 48.819  15.523  13.018  1.00 31.16 ? 120 GLN A O     1 
ATOM   907  C CB    . GLN A 1 123 ? 50.340  14.831  15.732  1.00 32.59 ? 120 GLN A CB    1 
ATOM   908  C CG    . GLN A 1 123 ? 51.456  14.137  16.523  1.00 34.38 ? 120 GLN A CG    1 
ATOM   909  C CD    . GLN A 1 123 ? 50.959  13.000  17.426  1.00 36.28 ? 120 GLN A CD    1 
ATOM   910  O OE1   . GLN A 1 123 ? 50.150  12.169  17.020  1.00 37.26 ? 120 GLN A OE1   1 
ATOM   911  N NE2   . GLN A 1 123 ? 51.462  12.962  18.657  1.00 37.06 ? 120 GLN A NE2   1 
ATOM   912  N N     . PRO A 1 124 ? 47.369  14.414  14.357  1.00 30.50 ? 121 PRO A N     1 
ATOM   913  C CA    . PRO A 1 124 ? 47.079  13.493  15.443  1.00 30.04 ? 121 PRO A CA    1 
ATOM   914  C C     . PRO A 1 124 ? 47.040  12.050  14.947  1.00 29.43 ? 121 PRO A C     1 
ATOM   915  O O     . PRO A 1 124 ? 46.406  11.748  13.942  1.00 29.54 ? 121 PRO A O     1 
ATOM   916  C CB    . PRO A 1 124 ? 45.692  13.932  15.910  1.00 29.86 ? 121 PRO A CB    1 
ATOM   917  C CG    . PRO A 1 124 ? 45.029  14.408  14.659  1.00 30.32 ? 121 PRO A CG    1 
ATOM   918  C CD    . PRO A 1 124 ? 46.133  14.962  13.773  1.00 30.22 ? 121 PRO A CD    1 
ATOM   919  N N     . SER A 1 125 ? 47.755  11.186  15.646  1.00 29.34 ? 122 SER A N     1 
ATOM   920  C CA    . SER A 1 125 ? 47.677  9.757   15.433  1.00 29.02 ? 122 SER A CA    1 
ATOM   921  C C     . SER A 1 125 ? 47.599  9.078   16.807  1.00 28.85 ? 122 SER A C     1 
ATOM   922  O O     . SER A 1 125 ? 47.214  9.711   17.810  1.00 28.38 ? 122 SER A O     1 
ATOM   923  C CB    . SER A 1 125 ? 48.872  9.263   14.615  1.00 28.86 ? 122 SER A CB    1 
ATOM   924  O OG    . SER A 1 125 ? 48.646  7.943   14.145  1.00 29.60 ? 122 SER A OG    1 
ATOM   925  N N     . TYR A 1 126 ? 47.934  7.788   16.838  1.00 28.39 ? 123 TYR A N     1 
ATOM   926  C CA    . TYR A 1 126 ? 47.771  6.961   18.029  1.00 27.95 ? 123 TYR A CA    1 
ATOM   927  C C     . TYR A 1 126 ? 48.535  7.527   19.230  1.00 27.83 ? 123 TYR A C     1 
ATOM   928  O O     . TYR A 1 126 ? 49.701  7.868   19.136  1.00 27.38 ? 123 TYR A O     1 
ATOM   929  C CB    . TYR A 1 126 ? 48.223  5.545   17.703  1.00 27.97 ? 123 TYR A CB    1 
ATOM   930  C CG    . TYR A 1 126 ? 47.998  4.485   18.772  1.00 27.63 ? 123 TYR A CG    1 
ATOM   931  C CD1   . TYR A 1 126 ? 48.936  3.476   18.972  1.00 26.95 ? 123 TYR A CD1   1 
ATOM   932  C CD2   . TYR A 1 126 ? 46.848  4.476   19.550  1.00 27.36 ? 123 TYR A CD2   1 
ATOM   933  C CE1   . TYR A 1 126 ? 48.734  2.495   19.914  1.00 27.74 ? 123 TYR A CE1   1 
ATOM   934  C CE2   . TYR A 1 126 ? 46.639  3.502   20.508  1.00 27.17 ? 123 TYR A CE2   1 
ATOM   935  C CZ    . TYR A 1 126 ? 47.579  2.516   20.688  1.00 27.95 ? 123 TYR A CZ    1 
ATOM   936  O OH    . TYR A 1 126 ? 47.356  1.557   21.651  1.00 28.23 ? 123 TYR A OH    1 
ATOM   937  N N     . SER A 1 127 ? 47.830  7.629   20.348  1.00 27.84 ? 124 SER A N     1 
ATOM   938  C CA    . SER A 1 127 ? 48.338  8.181   21.595  1.00 28.26 ? 124 SER A CA    1 
ATOM   939  C C     . SER A 1 127 ? 49.560  7.466   22.157  1.00 28.06 ? 124 SER A C     1 
ATOM   940  O O     . SER A 1 127 ? 50.390  8.080   22.821  1.00 28.07 ? 124 SER A O     1 
ATOM   941  C CB    . SER A 1 127 ? 47.220  8.098   22.637  1.00 28.70 ? 124 SER A CB    1 
ATOM   942  O OG    . SER A 1 127 ? 46.802  6.731   22.789  1.00 30.85 ? 124 SER A OG    1 
ATOM   943  N N     . MET A 1 128 ? 49.666  6.163   21.918  1.00 28.12 ? 125 MET A N     1 
ATOM   944  C CA    . MET A 1 128 ? 50.748  5.371   22.503  1.00 28.04 ? 125 MET A CA    1 
ATOM   945  C C     . MET A 1 128 ? 52.074  5.483   21.759  1.00 28.02 ? 125 MET A C     1 
ATOM   946  O O     . MET A 1 128 ? 53.106  5.065   22.292  1.00 27.76 ? 125 MET A O     1 
ATOM   947  C CB    . MET A 1 128 ? 50.367  3.890   22.566  1.00 28.60 ? 125 MET A CB    1 
ATOM   948  C CG    . MET A 1 128 ? 49.202  3.565   23.515  1.00 28.95 ? 125 MET A CG    1 
ATOM   949  S SD    . MET A 1 128 ? 49.471  4.135   25.194  1.00 32.94 ? 125 MET A SD    1 
ATOM   950  C CE    . MET A 1 128 ? 51.032  3.386   25.653  1.00 25.61 ? 125 MET A CE    1 
ATOM   951  N N     . HIS A 1 129 ? 52.076  5.995   20.531  1.00 27.34 ? 126 HIS A N     1 
ATOM   952  C CA    . HIS A 1 129 ? 53.356  6.095   19.817  1.00 27.14 ? 126 HIS A CA    1 
ATOM   953  C C     . HIS A 1 129 ? 54.306  7.041   20.564  1.00 26.77 ? 126 HIS A C     1 
ATOM   954  O O     . HIS A 1 129 ? 55.388  6.633   20.944  1.00 26.40 ? 126 HIS A O     1 
ATOM   955  C CB    . HIS A 1 129 ? 53.187  6.463   18.339  1.00 26.93 ? 126 HIS A CB    1 
ATOM   956  C CG    . HIS A 1 129 ? 52.619  5.358   17.504  1.00 26.42 ? 126 HIS A CG    1 
ATOM   957  N ND1   . HIS A 1 129 ? 52.095  5.566   16.244  1.00 25.92 ? 126 HIS A ND1   1 
ATOM   958  C CD2   . HIS A 1 129 ? 52.474  4.034   17.759  1.00 26.03 ? 126 HIS A CD2   1 
ATOM   959  C CE1   . HIS A 1 129 ? 51.654  4.419   15.761  1.00 26.92 ? 126 HIS A CE1   1 
ATOM   960  N NE2   . HIS A 1 129 ? 51.867  3.473   16.664  1.00 26.55 ? 126 HIS A NE2   1 
ATOM   961  N N     . PRO A 1 130 ? 53.894  8.290   20.809  1.00 27.01 ? 127 PRO A N     1 
ATOM   962  C CA    . PRO A 1 130 ? 54.744  9.141   21.647  1.00 27.21 ? 127 PRO A CA    1 
ATOM   963  C C     . PRO A 1 130 ? 54.952  8.644   23.083  1.00 27.35 ? 127 PRO A C     1 
ATOM   964  O O     . PRO A 1 130 ? 56.045  8.789   23.612  1.00 27.28 ? 127 PRO A O     1 
ATOM   965  C CB    . PRO A 1 130 ? 54.009  10.488  21.629  1.00 26.92 ? 127 PRO A CB    1 
ATOM   966  C CG    . PRO A 1 130 ? 52.624  10.162  21.282  1.00 26.86 ? 127 PRO A CG    1 
ATOM   967  C CD    . PRO A 1 130 ? 52.715  9.028   20.332  1.00 27.26 ? 127 PRO A CD    1 
ATOM   968  N N     . ILE A 1 131 ? 53.919  8.067   23.705  1.00 27.43 ? 128 ILE A N     1 
ATOM   969  C CA    . ILE A 1 131 ? 54.048  7.512   25.058  1.00 27.66 ? 128 ILE A CA    1 
ATOM   970  C C     . ILE A 1 131 ? 55.115  6.408   25.106  1.00 27.41 ? 128 ILE A C     1 
ATOM   971  O O     . ILE A 1 131 ? 55.961  6.375   26.003  1.00 26.97 ? 128 ILE A O     1 
ATOM   972  C CB    . ILE A 1 131 ? 52.678  6.967   25.595  1.00 27.38 ? 128 ILE A CB    1 
ATOM   973  C CG1   . ILE A 1 131 ? 51.715  8.140   25.857  1.00 27.31 ? 128 ILE A CG1   1 
ATOM   974  C CG2   . ILE A 1 131 ? 52.888  6.152   26.853  1.00 27.40 ? 128 ILE A CG2   1 
ATOM   975  C CD1   . ILE A 1 131 ? 50.338  7.764   26.420  1.00 27.25 ? 128 ILE A CD1   1 
ATOM   976  N N     . LEU A 1 132 ? 55.071  5.507   24.138  1.00 27.87 ? 129 LEU A N     1 
ATOM   977  C CA    . LEU A 1 132 ? 56.054  4.422   24.069  1.00 28.57 ? 129 LEU A CA    1 
ATOM   978  C C     . LEU A 1 132 ? 57.437  4.962   23.727  1.00 28.84 ? 129 LEU A C     1 
ATOM   979  O O     . LEU A 1 132 ? 58.442  4.511   24.284  1.00 28.78 ? 129 LEU A O     1 
ATOM   980  C CB    . LEU A 1 132 ? 55.634  3.362   23.051  1.00 28.41 ? 129 LEU A CB    1 
ATOM   981  C CG    . LEU A 1 132 ? 54.400  2.540   23.431  1.00 28.61 ? 129 LEU A CG    1 
ATOM   982  C CD1   . LEU A 1 132 ? 53.888  1.789   22.228  1.00 28.98 ? 129 LEU A CD1   1 
ATOM   983  C CD2   . LEU A 1 132 ? 54.694  1.588   24.581  1.00 28.76 ? 129 LEU A CD2   1 
ATOM   984  N N     . ALA A 1 133 ? 57.486  5.940   22.827  1.00 29.26 ? 130 ALA A N     1 
ATOM   985  C CA    . ALA A 1 133 ? 58.743  6.589   22.489  1.00 30.08 ? 130 ALA A CA    1 
ATOM   986  C C     . ALA A 1 133 ? 59.418  7.105   23.761  1.00 30.57 ? 130 ALA A C     1 
ATOM   987  O O     . ALA A 1 133 ? 60.576  6.799   24.018  1.00 29.83 ? 130 ALA A O     1 
ATOM   988  C CB    . ALA A 1 133 ? 58.516  7.731   21.500  1.00 29.95 ? 130 ALA A CB    1 
ATOM   989  N N     . LYS A 1 134 ? 58.668  7.860   24.558  1.00 31.54 ? 131 LYS A N     1 
ATOM   990  C CA    . LYS A 1 134 ? 59.186  8.461   25.789  1.00 32.09 ? 131 LYS A CA    1 
ATOM   991  C C     . LYS A 1 134 ? 59.594  7.398   26.804  1.00 31.90 ? 131 LYS A C     1 
ATOM   992  O O     . LYS A 1 134 ? 60.626  7.523   27.453  1.00 32.31 ? 131 LYS A O     1 
ATOM   993  C CB    . LYS A 1 134 ? 58.135  9.402   26.391  1.00 32.31 ? 131 LYS A CB    1 
ATOM   994  C CG    . LYS A 1 134 ? 58.480  10.006  27.744  1.00 32.92 ? 131 LYS A CG    1 
ATOM   995  C CD    . LYS A 1 134 ? 57.430  11.058  28.128  1.00 33.79 ? 131 LYS A CD    1 
ATOM   996  C CE    . LYS A 1 134 ? 57.599  11.599  29.555  1.00 35.20 ? 131 LYS A CE    1 
ATOM   997  N NZ    . LYS A 1 134 ? 56.862  12.922  29.697  1.00 36.39 ? 131 LYS A NZ    1 
ATOM   998  N N     . GLY A 1 135 ? 58.789  6.352   26.926  1.00 31.95 ? 132 GLY A N     1 
ATOM   999  C CA    . GLY A 1 135 ? 59.081  5.253   27.842  1.00 31.85 ? 132 GLY A CA    1 
ATOM   1000 C C     . GLY A 1 135 ? 60.349  4.477   27.515  1.00 31.82 ? 132 GLY A C     1 
ATOM   1001 O O     . GLY A 1 135 ? 60.927  3.834   28.385  1.00 32.19 ? 132 GLY A O     1 
ATOM   1002 N N     . THR A 1 136 ? 60.768  4.517   26.256  1.00 31.61 ? 133 THR A N     1 
ATOM   1003 C CA    . THR A 1 136 ? 61.972  3.834   25.797  1.00 31.51 ? 133 THR A CA    1 
ATOM   1004 C C     . THR A 1 136 ? 63.123  4.817   25.621  1.00 31.55 ? 133 THR A C     1 
ATOM   1005 O O     . THR A 1 136 ? 64.164  4.463   25.076  1.00 30.96 ? 133 THR A O     1 
ATOM   1006 C CB    . THR A 1 136 ? 61.706  3.102   24.469  1.00 31.32 ? 133 THR A CB    1 
ATOM   1007 O OG1   . THR A 1 136 ? 61.171  4.016   23.500  1.00 30.31 ? 133 THR A OG1   1 
ATOM   1008 C CG2   . THR A 1 136 ? 60.732  1.954   24.681  1.00 31.87 ? 133 THR A CG2   1 
ATOM   1009 N N     . HIS A 1 137 ? 62.923  6.044   26.106  1.00 32.19 ? 134 HIS A N     1 
ATOM   1010 C CA    . HIS A 1 137 ? 63.883  7.146   25.988  1.00 32.70 ? 134 HIS A CA    1 
ATOM   1011 C C     . HIS A 1 137 ? 64.211  7.481   24.552  1.00 32.92 ? 134 HIS A C     1 
ATOM   1012 O O     . HIS A 1 137 ? 65.344  7.822   24.220  1.00 33.22 ? 134 HIS A O     1 
ATOM   1013 C CB    . HIS A 1 137 ? 65.142  6.860   26.801  1.00 32.97 ? 134 HIS A CB    1 
ATOM   1014 C CG    . HIS A 1 137 ? 64.842  6.489   28.214  1.00 34.88 ? 134 HIS A CG    1 
ATOM   1015 N ND1   . HIS A 1 137 ? 64.412  7.411   29.147  1.00 35.11 ? 134 HIS A ND1   1 
ATOM   1016 C CD2   . HIS A 1 137 ? 64.856  5.288   28.843  1.00 35.49 ? 134 HIS A CD2   1 
ATOM   1017 C CE1   . HIS A 1 137 ? 64.191  6.794   30.294  1.00 35.68 ? 134 HIS A CE1   1 
ATOM   1018 N NE2   . HIS A 1 137 ? 64.454  5.507   30.138  1.00 36.93 ? 134 HIS A NE2   1 
ATOM   1019 N N     . THR A 1 138 ? 63.189  7.395   23.708  1.00 33.42 ? 135 THR A N     1 
ATOM   1020 C CA    . THR A 1 138 ? 63.267  7.821   22.331  1.00 33.51 ? 135 THR A CA    1 
ATOM   1021 C C     . THR A 1 138 ? 62.584  9.189   22.226  1.00 34.14 ? 135 THR A C     1 
ATOM   1022 O O     . THR A 1 138 ? 61.495  9.386   22.752  1.00 33.89 ? 135 THR A O     1 
ATOM   1023 C CB    . THR A 1 138 ? 62.561  6.824   21.398  1.00 33.61 ? 135 THR A CB    1 
ATOM   1024 O OG1   . THR A 1 138 ? 63.013  5.489   21.673  1.00 31.40 ? 135 THR A OG1   1 
ATOM   1025 C CG2   . THR A 1 138 ? 62.828  7.184   19.949  1.00 33.12 ? 135 THR A CG2   1 
ATOM   1026 N N     . GLU A 1 139 ? 63.246  10.124  21.554  1.00 34.72 ? 136 GLU A N     1 
ATOM   1027 C CA    . GLU A 1 139 ? 62.720  11.463  21.329  1.00 35.03 ? 136 GLU A CA    1 
ATOM   1028 C C     . GLU A 1 139 ? 61.639  11.387  20.261  1.00 34.96 ? 136 GLU A C     1 
ATOM   1029 O O     . GLU A 1 139 ? 61.810  10.695  19.256  1.00 35.41 ? 136 GLU A O     1 
ATOM   1030 C CB    . GLU A 1 139 ? 63.857  12.374  20.864  1.00 35.10 ? 136 GLU A CB    1 
ATOM   1031 C CG    . GLU A 1 139 ? 63.465  13.814  20.548  1.00 35.93 ? 136 GLU A CG    1 
ATOM   1032 C CD    . GLU A 1 139 ? 64.626  14.623  19.951  1.00 37.44 ? 136 GLU A CD    1 
ATOM   1033 O OE1   . GLU A 1 139 ? 65.735  14.063  19.762  1.00 40.45 ? 136 GLU A OE1   1 
ATOM   1034 O OE2   . GLU A 1 139 ? 64.423  15.828  19.680  1.00 41.82 ? 136 GLU A OE2   1 
ATOM   1035 N N     . PHE A 1 140 ? 60.521  12.075  20.482  1.00 34.65 ? 137 PHE A N     1 
ATOM   1036 C CA    . PHE A 1 140 ? 59.409  12.038  19.547  1.00 34.66 ? 137 PHE A CA    1 
ATOM   1037 C C     . PHE A 1 140 ? 59.292  13.347  18.784  1.00 34.67 ? 137 PHE A C     1 
ATOM   1038 O O     . PHE A 1 140 ? 59.312  14.418  19.383  1.00 34.48 ? 137 PHE A O     1 
ATOM   1039 C CB    . PHE A 1 140 ? 58.083  11.754  20.256  1.00 34.09 ? 137 PHE A CB    1 
ATOM   1040 C CG    . PHE A 1 140 ? 56.957  11.454  19.303  1.00 33.96 ? 137 PHE A CG    1 
ATOM   1041 C CD1   . PHE A 1 140 ? 56.883  10.222  18.663  1.00 33.31 ? 137 PHE A CD1   1 
ATOM   1042 C CD2   . PHE A 1 140 ? 55.989  12.403  19.023  1.00 32.80 ? 137 PHE A CD2   1 
ATOM   1043 C CE1   . PHE A 1 140 ? 55.855  9.935   17.765  1.00 32.85 ? 137 PHE A CE1   1 
ATOM   1044 C CE2   . PHE A 1 140 ? 54.955  12.120  18.130  1.00 33.19 ? 137 PHE A CE2   1 
ATOM   1045 C CZ    . PHE A 1 140 ? 54.895  10.889  17.493  1.00 33.31 ? 137 PHE A CZ    1 
ATOM   1046 N N     . ILE A 1 141 ? 59.162  13.237  17.463  1.00 34.98 ? 138 ILE A N     1 
ATOM   1047 C CA    . ILE A 1 141 ? 58.959  14.384  16.591  1.00 35.09 ? 138 ILE A CA    1 
ATOM   1048 C C     . ILE A 1 141 ? 57.554  14.328  16.014  1.00 35.17 ? 138 ILE A C     1 
ATOM   1049 O O     . ILE A 1 141 ? 57.226  13.425  15.244  1.00 34.78 ? 138 ILE A O     1 
ATOM   1050 C CB    . ILE A 1 141 ? 59.977  14.406  15.441  1.00 35.23 ? 138 ILE A CB    1 
ATOM   1051 C CG1   . ILE A 1 141 ? 61.403  14.382  15.994  1.00 35.23 ? 138 ILE A CG1   1 
ATOM   1052 C CG2   . ILE A 1 141 ? 59.772  15.642  14.544  1.00 34.99 ? 138 ILE A CG2   1 
ATOM   1053 C CD1   . ILE A 1 141 ? 62.450  14.249  14.911  1.00 35.27 ? 138 ILE A CD1   1 
ATOM   1054 N N     . ALA A 1 142 ? 56.731  15.293  16.413  1.00 35.50 ? 139 ALA A N     1 
ATOM   1055 C CA    . ALA A 1 142 ? 55.374  15.425  15.919  1.00 35.77 ? 139 ALA A CA    1 
ATOM   1056 C C     . ALA A 1 142 ? 55.407  16.291  14.670  1.00 36.09 ? 139 ALA A C     1 
ATOM   1057 O O     . ALA A 1 142 ? 55.947  17.389  14.701  1.00 36.22 ? 139 ALA A O     1 
ATOM   1058 C CB    . ALA A 1 142 ? 54.471  16.059  16.987  1.00 35.58 ? 139 ALA A CB    1 
ATOM   1059 N N     . VAL A 1 143 ? 54.860  15.767  13.573  1.00 36.36 ? 140 VAL A N     1 
ATOM   1060 C CA    . VAL A 1 143 ? 54.667  16.511  12.337  1.00 36.40 ? 140 VAL A CA    1 
ATOM   1061 C C     . VAL A 1 143 ? 53.172  16.553  12.069  1.00 36.56 ? 140 VAL A C     1 
ATOM   1062 O O     . VAL A 1 143 ? 52.514  15.515  12.060  1.00 36.19 ? 140 VAL A O     1 
ATOM   1063 C CB    . VAL A 1 143 ? 55.354  15.835  11.152  1.00 36.38 ? 140 VAL A CB    1 
ATOM   1064 C CG1   . VAL A 1 143 ? 54.943  16.521  9.846   1.00 36.77 ? 140 VAL A CG1   1 
ATOM   1065 C CG2   . VAL A 1 143 ? 56.866  15.863  11.330  1.00 36.47 ? 140 VAL A CG2   1 
ATOM   1066 N N     . SER A 1 144 ? 52.636  17.751  11.850  1.00 36.53 ? 141 SER A N     1 
ATOM   1067 C CA    . SER A 1 144 ? 51.192  17.919  11.768  1.00 36.66 ? 141 SER A CA    1 
ATOM   1068 C C     . SER A 1 144 ? 50.640  17.371  10.469  1.00 36.46 ? 141 SER A C     1 
ATOM   1069 O O     . SER A 1 144 ? 51.191  17.604  9.401   1.00 36.24 ? 141 SER A O     1 
ATOM   1070 C CB    . SER A 1 144 ? 50.807  19.391  11.896  1.00 36.74 ? 141 SER A CB    1 
ATOM   1071 O OG    . SER A 1 144 ? 51.375  19.934  13.068  1.00 38.15 ? 141 SER A OG    1 
ATOM   1072 N N     . ARG A 1 145 ? 49.545  16.631  10.577  1.00 36.35 ? 142 ARG A N     1 
ATOM   1073 C CA    . ARG A 1 145 ? 48.767  16.254  9.413   1.00 36.44 ? 142 ARG A CA    1 
ATOM   1074 C C     . ARG A 1 145 ? 48.132  17.520  8.837   1.00 36.50 ? 142 ARG A C     1 
ATOM   1075 O O     . ARG A 1 145 ? 48.204  18.578  9.458   1.00 36.10 ? 142 ARG A O     1 
ATOM   1076 C CB    . ARG A 1 145 ? 47.721  15.201  9.792   1.00 36.20 ? 142 ARG A CB    1 
ATOM   1077 C CG    . ARG A 1 145 ? 48.330  13.810  9.947   1.00 35.59 ? 142 ARG A CG    1 
ATOM   1078 C CD    . ARG A 1 145 ? 47.439  12.843  10.727  1.00 35.33 ? 142 ARG A CD    1 
ATOM   1079 N NE    . ARG A 1 145 ? 47.911  11.473  10.557  1.00 33.28 ? 142 ARG A NE    1 
ATOM   1080 C CZ    . ARG A 1 145 ? 47.442  10.602  9.671   1.00 33.00 ? 142 ARG A CZ    1 
ATOM   1081 N NH1   . ARG A 1 145 ? 46.441  10.895  8.852   1.00 32.97 ? 142 ARG A NH1   1 
ATOM   1082 N NH2   . ARG A 1 145 ? 47.975  9.396   9.622   1.00 34.42 ? 142 ARG A NH2   1 
ATOM   1083 N N     . GLY A 1 146 ? 47.550  17.417  7.643   1.00 37.01 ? 143 GLY A N     1 
ATOM   1084 C CA    . GLY A 1 146 ? 46.929  18.570  6.978   1.00 37.58 ? 143 GLY A CA    1 
ATOM   1085 C C     . GLY A 1 146 ? 45.559  18.916  7.536   1.00 38.21 ? 143 GLY A C     1 
ATOM   1086 O O     . GLY A 1 146 ? 45.125  18.326  8.521   1.00 38.39 ? 143 GLY A O     1 
ATOM   1087 N N     . ALA A 1 147 ? 44.873  19.869  6.896   1.00 38.83 ? 144 ALA A N     1 
ATOM   1088 C CA    . ALA A 1 147 ? 43.589  20.389  7.399   1.00 38.88 ? 144 ALA A CA    1 
ATOM   1089 C C     . ALA A 1 147 ? 42.467  19.373  7.236   1.00 39.04 ? 144 ALA A C     1 
ATOM   1090 O O     . ALA A 1 147 ? 41.466  19.410  7.957   1.00 38.99 ? 144 ALA A O     1 
ATOM   1091 C CB    . ALA A 1 147 ? 43.224  21.688  6.685   1.00 39.32 ? 144 ALA A CB    1 
ATOM   1092 N N     . ASP A 1 148 ? 42.648  18.476  6.272   1.00 38.99 ? 145 ASP A N     1 
ATOM   1093 C CA    . ASP A 1 148 ? 41.752  17.341  6.062   1.00 39.05 ? 145 ASP A CA    1 
ATOM   1094 C C     . ASP A 1 148 ? 42.114  16.135  6.966   1.00 38.94 ? 145 ASP A C     1 
ATOM   1095 O O     . ASP A 1 148 ? 41.602  15.033  6.767   1.00 38.49 ? 145 ASP A O     1 
ATOM   1096 C CB    . ASP A 1 148 ? 41.805  16.927  4.586   1.00 39.13 ? 145 ASP A CB    1 
ATOM   1097 C CG    . ASP A 1 148 ? 43.212  16.537  4.138   1.00 39.91 ? 145 ASP A CG    1 
ATOM   1098 O OD1   . ASP A 1 148 ? 44.152  16.664  4.955   1.00 38.64 ? 145 ASP A OD1   1 
ATOM   1099 O OD2   . ASP A 1 148 ? 43.378  16.106  2.973   1.00 41.85 ? 145 ASP A OD2   1 
ATOM   1100 N N     . PHE A 1 149 ? 43.011  16.359  7.930   1.00 38.79 ? 146 PHE A N     1 
ATOM   1101 C CA    . PHE A 1 149 ? 43.510  15.329  8.856   1.00 39.04 ? 146 PHE A CA    1 
ATOM   1102 C C     . PHE A 1 149 ? 44.263  14.178  8.190   1.00 38.99 ? 146 PHE A C     1 
ATOM   1103 O O     . PHE A 1 149 ? 44.527  13.162  8.826   1.00 38.73 ? 146 PHE A O     1 
ATOM   1104 C CB    . PHE A 1 149 ? 42.386  14.798  9.758   1.00 38.68 ? 146 PHE A CB    1 
ATOM   1105 C CG    . PHE A 1 149 ? 41.917  15.788  10.776  1.00 38.17 ? 146 PHE A CG    1 
ATOM   1106 C CD1   . PHE A 1 149 ? 42.629  15.985  11.945  1.00 38.27 ? 146 PHE A CD1   1 
ATOM   1107 C CD2   . PHE A 1 149 ? 40.773  16.530  10.568  1.00 39.05 ? 146 PHE A CD2   1 
ATOM   1108 C CE1   . PHE A 1 149 ? 42.203  16.898  12.900  1.00 38.44 ? 146 PHE A CE1   1 
ATOM   1109 C CE2   . PHE A 1 149 ? 40.340  17.444  11.518  1.00 39.35 ? 146 PHE A CE2   1 
ATOM   1110 C CZ    . PHE A 1 149 ? 41.064  17.624  12.693  1.00 38.35 ? 146 PHE A CZ    1 
ATOM   1111 N N     . ARG A 1 150 ? 44.631  14.351  6.925   1.00 39.24 ? 147 ARG A N     1 
ATOM   1112 C CA    . ARG A 1 150 ? 45.402  13.349  6.203   1.00 39.64 ? 147 ARG A CA    1 
ATOM   1113 C C     . ARG A 1 150 ? 46.855  13.792  6.225   1.00 39.39 ? 147 ARG A C     1 
ATOM   1114 O O     . ARG A 1 150 ? 47.141  14.967  6.453   1.00 38.98 ? 147 ARG A O     1 
ATOM   1115 C CB    . ARG A 1 150 ? 44.871  13.192  4.773   1.00 39.68 ? 147 ARG A CB    1 
ATOM   1116 C CG    . ARG A 1 150 ? 43.343  12.971  4.715   1.00 40.49 ? 147 ARG A CG    1 
ATOM   1117 C CD    . ARG A 1 150 ? 42.831  12.679  3.315   1.00 41.09 ? 147 ARG A CD    1 
ATOM   1118 N NE    . ARG A 1 150 ? 43.324  11.383  2.885   1.00 43.37 ? 147 ARG A NE    1 
ATOM   1119 C CZ    . ARG A 1 150 ? 42.597  10.279  2.721   1.00 43.76 ? 147 ARG A CZ    1 
ATOM   1120 N NH1   . ARG A 1 150 ? 41.273  10.270  2.893   1.00 44.44 ? 147 ARG A NH1   1 
ATOM   1121 N NH2   . ARG A 1 150 ? 43.218  9.163   2.354   1.00 43.67 ? 147 ARG A NH2   1 
ATOM   1122 N N     . ILE A 1 151 ? 47.779  12.858  6.032   1.00 39.62 ? 148 ILE A N     1 
ATOM   1123 C CA    . ILE A 1 151 ? 49.205  13.212  5.993   1.00 40.06 ? 148 ILE A CA    1 
ATOM   1124 C C     . ILE A 1 151 ? 49.453  14.230  4.864   1.00 40.43 ? 148 ILE A C     1 
ATOM   1125 O O     . ILE A 1 151 ? 49.090  13.997  3.709   1.00 40.34 ? 148 ILE A O     1 
ATOM   1126 C CB    . ILE A 1 151 ? 50.124  11.962  5.804   1.00 39.91 ? 148 ILE A CB    1 
ATOM   1127 C CG1   . ILE A 1 151 ? 50.043  11.041  7.032   1.00 40.05 ? 148 ILE A CG1   1 
ATOM   1128 C CG2   . ILE A 1 151 ? 51.580  12.375  5.561   1.00 39.10 ? 148 ILE A CG2   1 
ATOM   1129 C CD1   . ILE A 1 151 ? 50.795  9.714   6.898   1.00 38.99 ? 148 ILE A CD1   1 
ATOM   1130 N N     . ASP A 1 152 ? 50.037  15.370  5.218   1.00 41.34 ? 149 ASP A N     1 
ATOM   1131 C CA    . ASP A 1 152 ? 50.505  16.344  4.221   1.00 41.55 ? 149 ASP A CA    1 
ATOM   1132 C C     . ASP A 1 152 ? 51.870  15.869  3.713   1.00 41.49 ? 149 ASP A C     1 
ATOM   1133 O O     . ASP A 1 152 ? 52.891  16.049  4.371   1.00 40.90 ? 149 ASP A O     1 
ATOM   1134 C CB    . ASP A 1 152 ? 50.587  17.754  4.832   1.00 41.77 ? 149 ASP A CB    1 
ATOM   1135 C CG    . ASP A 1 152 ? 50.983  18.834  3.806   1.00 42.55 ? 149 ASP A CG    1 
ATOM   1136 O OD1   . ASP A 1 152 ? 51.881  18.576  2.963   1.00 43.81 ? 149 ASP A OD1   1 
ATOM   1137 O OD2   . ASP A 1 152 ? 50.408  19.954  3.863   1.00 44.59 ? 149 ASP A OD2   1 
ATOM   1138 N N     . MET A 1 153 ? 51.869  15.264  2.536   1.00 42.06 ? 150 MET A N     1 
ATOM   1139 C CA    . MET A 1 153 ? 53.050  14.585  2.011   1.00 42.60 ? 150 MET A CA    1 
ATOM   1140 C C     . MET A 1 153 ? 54.248  15.489  1.738   1.00 43.22 ? 150 MET A C     1 
ATOM   1141 O O     . MET A 1 153 ? 55.388  15.080  1.984   1.00 43.68 ? 150 MET A O     1 
ATOM   1142 C CB    . MET A 1 153 ? 52.695  13.814  0.745   1.00 42.42 ? 150 MET A CB    1 
ATOM   1143 C CG    . MET A 1 153 ? 51.895  12.566  1.022   1.00 42.10 ? 150 MET A CG    1 
ATOM   1144 S SD    . MET A 1 153 ? 52.755  11.433  2.124   1.00 40.99 ? 150 MET A SD    1 
ATOM   1145 C CE    . MET A 1 153 ? 54.235  11.056  1.159   1.00 39.41 ? 150 MET A CE    1 
ATOM   1146 N N     . ASP A 1 154 ? 54.008  16.699  1.236   1.00 43.69 ? 151 ASP A N     1 
ATOM   1147 C CA    . ASP A 1 154 ? 55.097  17.665  1.022   1.00 43.87 ? 151 ASP A CA    1 
ATOM   1148 C C     . ASP A 1 154 ? 55.791  18.048  2.331   1.00 43.75 ? 151 ASP A C     1 
ATOM   1149 O O     . ASP A 1 154 ? 57.015  18.112  2.387   1.00 43.46 ? 151 ASP A O     1 
ATOM   1150 C CB    . ASP A 1 154 ? 54.586  18.924  0.303   1.00 44.30 ? 151 ASP A CB    1 
ATOM   1151 C CG    . ASP A 1 154 ? 54.482  18.735  -1.207  1.00 45.95 ? 151 ASP A CG    1 
ATOM   1152 O OD1   . ASP A 1 154 ? 54.963  17.698  -1.718  1.00 47.47 ? 151 ASP A OD1   1 
ATOM   1153 O OD2   . ASP A 1 154 ? 53.914  19.624  -1.888  1.00 48.18 ? 151 ASP A OD2   1 
ATOM   1154 N N     . VAL A 1 155 ? 55.000  18.295  3.371   1.00 43.75 ? 152 VAL A N     1 
ATOM   1155 C CA    . VAL A 1 155 ? 55.524  18.560  4.714   1.00 43.95 ? 152 VAL A CA    1 
ATOM   1156 C C     . VAL A 1 155 ? 56.157  17.304  5.330   1.00 44.01 ? 152 VAL A C     1 
ATOM   1157 O O     . VAL A 1 155 ? 57.178  17.386  6.012   1.00 43.87 ? 152 VAL A O     1 
ATOM   1158 C CB    . VAL A 1 155 ? 54.410  19.083  5.660   1.00 44.10 ? 152 VAL A CB    1 
ATOM   1159 C CG1   . VAL A 1 155 ? 54.895  19.128  7.108   1.00 43.49 ? 152 VAL A CG1   1 
ATOM   1160 C CG2   . VAL A 1 155 ? 53.909  20.472  5.199   1.00 43.53 ? 152 VAL A CG2   1 
ATOM   1161 N N     . ALA A 1 156 ? 55.550  16.148  5.085   1.00 44.08 ? 153 ALA A N     1 
ATOM   1162 C CA    . ALA A 1 156 ? 56.047  14.895  5.637   1.00 44.28 ? 153 ALA A CA    1 
ATOM   1163 C C     . ALA A 1 156 ? 57.454  14.606  5.111   1.00 44.22 ? 153 ALA A C     1 
ATOM   1164 O O     . ALA A 1 156 ? 58.391  14.458  5.882   1.00 43.89 ? 153 ALA A O     1 
ATOM   1165 C CB    . ALA A 1 156 ? 55.094  13.756  5.310   1.00 43.96 ? 153 ALA A CB    1 
ATOM   1166 N N     . LEU A 1 157 ? 57.595  14.574  3.794   1.00 44.62 ? 154 LEU A N     1 
ATOM   1167 C CA    . LEU A 1 157 ? 58.884  14.286  3.156   1.00 44.92 ? 154 LEU A CA    1 
ATOM   1168 C C     . LEU A 1 157 ? 59.964  15.323  3.503   1.00 45.21 ? 154 LEU A C     1 
ATOM   1169 O O     . LEU A 1 157 ? 61.120  14.972  3.707   1.00 45.22 ? 154 LEU A O     1 
ATOM   1170 C CB    . LEU A 1 157 ? 58.709  14.166  1.641   1.00 44.59 ? 154 LEU A CB    1 
ATOM   1171 C CG    . LEU A 1 157 ? 57.744  13.065  1.171   1.00 44.83 ? 154 LEU A CG    1 
ATOM   1172 C CD1   . LEU A 1 157 ? 57.599  13.082  -0.343  1.00 44.12 ? 154 LEU A CD1   1 
ATOM   1173 C CD2   . LEU A 1 157 ? 58.164  11.669  1.657   1.00 44.43 ? 154 LEU A CD2   1 
ATOM   1174 N N     . GLU A 1 158 ? 59.572  16.591  3.584   1.00 45.76 ? 155 GLU A N     1 
ATOM   1175 C CA    . GLU A 1 158 ? 60.473  17.677  3.952   1.00 45.91 ? 155 GLU A CA    1 
ATOM   1176 C C     . GLU A 1 158 ? 61.056  17.461  5.349   1.00 45.70 ? 155 GLU A C     1 
ATOM   1177 O O     . GLU A 1 158 ? 62.271  17.592  5.558   1.00 45.43 ? 155 GLU A O     1 
ATOM   1178 C CB    . GLU A 1 158 ? 59.709  19.003  3.899   1.00 46.04 ? 155 GLU A CB    1 
ATOM   1179 C CG    . GLU A 1 158 ? 60.512  20.269  4.211   1.00 46.79 ? 155 GLU A CG    1 
ATOM   1180 C CD    . GLU A 1 158 ? 59.642  21.546  4.155   1.00 48.50 ? 155 GLU A CD    1 
ATOM   1181 O OE1   . GLU A 1 158 ? 58.470  21.501  4.629   1.00 51.12 ? 155 GLU A OE1   1 
ATOM   1182 O OE2   . GLU A 1 158 ? 60.134  22.595  3.646   1.00 51.75 ? 155 GLU A OE2   1 
ATOM   1183 N N     . GLU A 1 159 ? 60.184  17.122  6.295   1.00 45.47 ? 156 GLU A N     1 
ATOM   1184 C CA    . GLU A 1 159 ? 60.581  16.945  7.695   1.00 45.49 ? 156 GLU A CA    1 
ATOM   1185 C C     . GLU A 1 159 ? 61.398  15.655  7.942   1.00 44.81 ? 156 GLU A C     1 
ATOM   1186 O O     . GLU A 1 159 ? 62.271  15.627  8.799   1.00 44.55 ? 156 GLU A O     1 
ATOM   1187 C CB    . GLU A 1 159 ? 59.339  16.980  8.594   1.00 45.91 ? 156 GLU A CB    1 
ATOM   1188 C CG    . GLU A 1 159 ? 59.490  17.853  9.829   1.00 48.01 ? 156 GLU A CG    1 
ATOM   1189 C CD    . GLU A 1 159 ? 59.709  19.327  9.503   1.00 50.26 ? 156 GLU A CD    1 
ATOM   1190 O OE1   . GLU A 1 159 ? 59.226  19.794  8.442   1.00 51.17 ? 156 GLU A OE1   1 
ATOM   1191 O OE2   . GLU A 1 159 ? 60.368  20.016  10.320  1.00 52.06 ? 156 GLU A OE2   1 
ATOM   1192 N N     . ILE A 1 160 ? 61.116  14.596  7.194   1.00 44.27 ? 157 ILE A N     1 
ATOM   1193 C CA    . ILE A 1 160 ? 61.914  13.367  7.272   1.00 44.32 ? 157 ILE A CA    1 
ATOM   1194 C C     . ILE A 1 160 ? 63.345  13.601  6.742   1.00 44.37 ? 157 ILE A C     1 
ATOM   1195 O O     . ILE A 1 160 ? 64.332  13.194  7.380   1.00 43.63 ? 157 ILE A O     1 
ATOM   1196 C CB    . ILE A 1 160 ? 61.229  12.196  6.527   1.00 44.10 ? 157 ILE A CB    1 
ATOM   1197 C CG1   . ILE A 1 160 ? 59.984  11.730  7.303   1.00 43.49 ? 157 ILE A CG1   1 
ATOM   1198 C CG2   . ILE A 1 160 ? 62.190  11.029  6.351   1.00 44.10 ? 157 ILE A CG2   1 
ATOM   1199 C CD1   . ILE A 1 160 ? 59.056  10.840  6.506   1.00 43.20 ? 157 ILE A CD1   1 
ATOM   1200 N N     . ARG A 1 161 ? 63.451  14.283  5.600   1.00 44.46 ? 158 ARG A N     1 
ATOM   1201 C CA    . ARG A 1 161 ? 64.761  14.694  5.063   1.00 44.73 ? 158 ARG A CA    1 
ATOM   1202 C C     . ARG A 1 161 ? 65.533  15.537  6.058   1.00 44.02 ? 158 ARG A C     1 
ATOM   1203 O O     . ARG A 1 161 ? 66.712  15.296  6.297   1.00 44.03 ? 158 ARG A O     1 
ATOM   1204 C CB    . ARG A 1 161 ? 64.614  15.478  3.758   1.00 45.01 ? 158 ARG A CB    1 
ATOM   1205 C CG    . ARG A 1 161 ? 64.479  14.593  2.537   1.00 46.09 ? 158 ARG A CG    1 
ATOM   1206 C CD    . ARG A 1 161 ? 63.796  15.329  1.387   1.00 47.28 ? 158 ARG A CD    1 
ATOM   1207 N NE    . ARG A 1 161 ? 63.282  14.405  0.370   1.00 48.39 ? 158 ARG A NE    1 
ATOM   1208 C CZ    . ARG A 1 161 ? 62.244  14.653  -0.432  1.00 50.12 ? 158 ARG A CZ    1 
ATOM   1209 N NH1   . ARG A 1 161 ? 61.580  15.812  -0.352  1.00 50.93 ? 158 ARG A NH1   1 
ATOM   1210 N NH2   . ARG A 1 161 ? 61.856  13.730  -1.319  1.00 49.71 ? 158 ARG A NH2   1 
ATOM   1211 N N     . ALA A 1 162 ? 64.861  16.525  6.633   1.00 43.58 ? 159 ALA A N     1 
ATOM   1212 C CA    . ALA A 1 162 ? 65.496  17.437  7.580   1.00 43.23 ? 159 ALA A CA    1 
ATOM   1213 C C     . ALA A 1 162 ? 65.909  16.725  8.860   1.00 42.68 ? 159 ALA A C     1 
ATOM   1214 O O     . ALA A 1 162 ? 67.056  16.810  9.273   1.00 42.88 ? 159 ALA A O     1 
ATOM   1215 C CB    . ALA A 1 162 ? 64.562  18.606  7.903   1.00 43.17 ? 159 ALA A CB    1 
ATOM   1216 N N     . LYS A 1 163 ? 64.979  16.011  9.479   1.00 42.02 ? 160 LYS A N     1 
ATOM   1217 C CA    . LYS A 1 163 ? 65.220  15.430  10.800  1.00 41.54 ? 160 LYS A CA    1 
ATOM   1218 C C     . LYS A 1 163 ? 66.009  14.113  10.762  1.00 40.80 ? 160 LYS A C     1 
ATOM   1219 O O     . LYS A 1 163 ? 66.687  13.761  11.737  1.00 40.56 ? 160 LYS A O     1 
ATOM   1220 C CB    . LYS A 1 163 ? 63.883  15.228  11.536  1.00 42.17 ? 160 LYS A CB    1 
ATOM   1221 C CG    . LYS A 1 163 ? 63.040  16.501  11.712  1.00 42.38 ? 160 LYS A CG    1 
ATOM   1222 C CD    . LYS A 1 163 ? 63.750  17.546  12.553  1.00 43.90 ? 160 LYS A CD    1 
ATOM   1223 C CE    . LYS A 1 163 ? 62.973  18.849  12.588  1.00 44.68 ? 160 LYS A CE    1 
ATOM   1224 N NZ    . LYS A 1 163 ? 61.703  18.706  13.369  1.00 46.42 ? 160 LYS A NZ    1 
ATOM   1225 N N     . GLN A 1 164 ? 65.915  13.389  9.649   1.00 39.82 ? 161 GLN A N     1 
ATOM   1226 C CA    . GLN A 1 164 ? 66.564  12.072  9.502   1.00 39.13 ? 161 GLN A CA    1 
ATOM   1227 C C     . GLN A 1 164 ? 66.241  11.120  10.673  1.00 38.39 ? 161 GLN A C     1 
ATOM   1228 O O     . GLN A 1 164 ? 67.142  10.608  11.344  1.00 38.30 ? 161 GLN A O     1 
ATOM   1229 C CB    . GLN A 1 164 ? 68.079  12.243  9.317   1.00 39.15 ? 161 GLN A CB    1 
ATOM   1230 C CG    . GLN A 1 164 ? 68.459  12.957  8.029   1.00 38.74 ? 161 GLN A CG    1 
ATOM   1231 C CD    . GLN A 1 164 ? 68.108  12.143  6.798   1.00 39.82 ? 161 GLN A CD    1 
ATOM   1232 O OE1   . GLN A 1 164 ? 68.613  11.038  6.612   1.00 40.35 ? 161 GLN A OE1   1 
ATOM   1233 N NE2   . GLN A 1 164 ? 67.239  12.685  5.948   1.00 39.91 ? 161 GLN A NE2   1 
ATOM   1234 N N     . PRO A 1 165 ? 64.941  10.869  10.907  1.00 37.30 ? 162 PRO A N     1 
ATOM   1235 C CA    . PRO A 1 165 ? 64.521  10.126  12.094  1.00 36.51 ? 162 PRO A CA    1 
ATOM   1236 C C     . PRO A 1 165 ? 64.812  8.630   11.994  1.00 35.54 ? 162 PRO A C     1 
ATOM   1237 O O     . PRO A 1 165 ? 64.667  8.031   10.922  1.00 35.34 ? 162 PRO A O     1 
ATOM   1238 C CB    . PRO A 1 165 ? 63.015  10.377  12.149  1.00 36.49 ? 162 PRO A CB    1 
ATOM   1239 C CG    . PRO A 1 165 ? 62.623  10.567  10.720  1.00 37.21 ? 162 PRO A CG    1 
ATOM   1240 C CD    . PRO A 1 165 ? 63.794  11.248  10.061  1.00 37.26 ? 162 PRO A CD    1 
ATOM   1241 N N     . ASP A 1 166 ? 65.206  8.047   13.121  1.00 34.41 ? 163 ASP A N     1 
ATOM   1242 C CA    . ASP A 1 166 ? 65.538  6.621   13.195  1.00 33.53 ? 163 ASP A CA    1 
ATOM   1243 C C     . ASP A 1 166 ? 64.325  5.713   12.963  1.00 32.64 ? 163 ASP A C     1 
ATOM   1244 O O     . ASP A 1 166 ? 64.451  4.651   12.354  1.00 32.20 ? 163 ASP A O     1 
ATOM   1245 C CB    . ASP A 1 166 ? 66.201  6.329   14.543  1.00 33.44 ? 163 ASP A CB    1 
ATOM   1246 C CG    . ASP A 1 166 ? 67.468  7.149   14.747  1.00 33.88 ? 163 ASP A CG    1 
ATOM   1247 O OD1   . ASP A 1 166 ? 68.540  6.729   14.260  1.00 33.15 ? 163 ASP A OD1   1 
ATOM   1248 O OD2   . ASP A 1 166 ? 67.381  8.228   15.368  1.00 34.50 ? 163 ASP A OD2   1 
ATOM   1249 N N     . ILE A 1 167 ? 63.155  6.160   13.434  1.00 31.37 ? 164 ILE A N     1 
ATOM   1250 C CA    . ILE A 1 167 ? 61.889  5.453   13.250  1.00 30.43 ? 164 ILE A CA    1 
ATOM   1251 C C     . ILE A 1 167 ? 60.835  6.408   12.694  1.00 29.29 ? 164 ILE A C     1 
ATOM   1252 O O     . ILE A 1 167 ? 60.691  7.525   13.184  1.00 28.69 ? 164 ILE A O     1 
ATOM   1253 C CB    . ILE A 1 167 ? 61.382  4.906   14.593  1.00 30.14 ? 164 ILE A CB    1 
ATOM   1254 C CG1   . ILE A 1 167 ? 62.331  3.816   15.115  1.00 30.08 ? 164 ILE A CG1   1 
ATOM   1255 C CG2   . ILE A 1 167 ? 59.933  4.392   14.456  1.00 30.88 ? 164 ILE A CG2   1 
ATOM   1256 C CD1   . ILE A 1 167 ? 62.199  3.537   16.613  1.00 30.30 ? 164 ILE A CD1   1 
ATOM   1257 N N     . VAL A 1 168 ? 60.106  5.974   11.672  1.00 28.49 ? 165 VAL A N     1 
ATOM   1258 C CA    . VAL A 1 168 ? 58.898  6.683   11.229  1.00 28.06 ? 165 VAL A CA    1 
ATOM   1259 C C     . VAL A 1 168 ? 57.652  5.815   11.454  1.00 27.59 ? 165 VAL A C     1 
ATOM   1260 O O     . VAL A 1 168 ? 57.588  4.664   11.035  1.00 26.93 ? 165 VAL A O     1 
ATOM   1261 C CB    . VAL A 1 168 ? 58.968  7.108   9.738   1.00 27.97 ? 165 VAL A CB    1 
ATOM   1262 C CG1   . VAL A 1 168 ? 57.699  7.860   9.337   1.00 27.44 ? 165 VAL A CG1   1 
ATOM   1263 C CG2   . VAL A 1 168 ? 60.204  7.951   9.470   1.00 26.50 ? 165 VAL A CG2   1 
ATOM   1264 N N     . PHE A 1 169 ? 56.669  6.383   12.138  1.00 27.67 ? 166 PHE A N     1 
ATOM   1265 C CA    . PHE A 1 169 ? 55.383  5.736   12.331  1.00 27.38 ? 166 PHE A CA    1 
ATOM   1266 C C     . PHE A 1 169 ? 54.417  6.196   11.260  1.00 27.45 ? 166 PHE A C     1 
ATOM   1267 O O     . PHE A 1 169 ? 54.216  7.407   11.064  1.00 28.21 ? 166 PHE A O     1 
ATOM   1268 C CB    . PHE A 1 169 ? 54.791  6.122   13.685  1.00 27.74 ? 166 PHE A CB    1 
ATOM   1269 C CG    . PHE A 1 169 ? 55.462  5.475   14.845  1.00 27.29 ? 166 PHE A CG    1 
ATOM   1270 C CD1   . PHE A 1 169 ? 56.205  6.221   15.733  1.00 27.10 ? 166 PHE A CD1   1 
ATOM   1271 C CD2   . PHE A 1 169 ? 55.321  4.111   15.063  1.00 27.60 ? 166 PHE A CD2   1 
ATOM   1272 C CE1   . PHE A 1 169 ? 56.816  5.618   16.835  1.00 28.33 ? 166 PHE A CE1   1 
ATOM   1273 C CE2   . PHE A 1 169 ? 55.919  3.504   16.138  1.00 27.43 ? 166 PHE A CE2   1 
ATOM   1274 C CZ    . PHE A 1 169 ? 56.679  4.253   17.029  1.00 28.51 ? 166 PHE A CZ    1 
ATOM   1275 N N     . VAL A 1 170 ? 53.805  5.246   10.574  1.00 26.87 ? 167 VAL A N     1 
ATOM   1276 C CA    . VAL A 1 170 ? 52.638  5.543   9.763   1.00 26.39 ? 167 VAL A CA    1 
ATOM   1277 C C     . VAL A 1 170 ? 51.499  4.609   10.192  1.00 26.13 ? 167 VAL A C     1 
ATOM   1278 O O     . VAL A 1 170 ? 51.595  3.398   10.050  1.00 25.50 ? 167 VAL A O     1 
ATOM   1279 C CB    . VAL A 1 170 ? 52.913  5.388   8.257   1.00 26.79 ? 167 VAL A CB    1 
ATOM   1280 C CG1   . VAL A 1 170 ? 51.679  5.833   7.458   1.00 25.75 ? 167 VAL A CG1   1 
ATOM   1281 C CG2   . VAL A 1 170 ? 54.177  6.181   7.835   1.00 25.26 ? 167 VAL A CG2   1 
ATOM   1282 N N     . THR A 1 171 ? 50.436  5.193   10.735  1.00 25.49 ? 168 THR A N     1 
ATOM   1283 C CA    . THR A 1 171 ? 49.220  4.452   11.097  1.00 25.36 ? 168 THR A CA    1 
ATOM   1284 C C     . THR A 1 171 ? 48.178  4.566   9.997   1.00 25.06 ? 168 THR A C     1 
ATOM   1285 O O     . THR A 1 171 ? 47.715  5.667   9.692   1.00 24.56 ? 168 THR A O     1 
ATOM   1286 C CB    . THR A 1 171 ? 48.607  5.001   12.390  1.00 25.31 ? 168 THR A CB    1 
ATOM   1287 O OG1   . THR A 1 171 ? 49.644  5.206   13.355  1.00 24.85 ? 168 THR A OG1   1 
ATOM   1288 C CG2   . THR A 1 171 ? 47.541  4.052   12.941  1.00 24.95 ? 168 THR A CG2   1 
ATOM   1289 N N     . THR A 1 172 ? 47.802  3.429   9.418   1.00 24.75 ? 169 THR A N     1 
ATOM   1290 C CA    . THR A 1 172 ? 46.870  3.400   8.293   1.00 25.14 ? 169 THR A CA    1 
ATOM   1291 C C     . THR A 1 172 ? 46.019  2.119   8.302   1.00 24.91 ? 169 THR A C     1 
ATOM   1292 O O     . THR A 1 172 ? 46.556  1.008   8.211   1.00 24.61 ? 169 THR A O     1 
ATOM   1293 C CB    . THR A 1 172 ? 47.611  3.528   6.939   1.00 25.35 ? 169 THR A CB    1 
ATOM   1294 O OG1   . THR A 1 172 ? 46.690  3.309   5.855   1.00 26.52 ? 169 THR A OG1   1 
ATOM   1295 C CG2   . THR A 1 172 ? 48.744  2.525   6.857   1.00 24.58 ? 169 THR A CG2   1 
ATOM   1296 N N     . PRO A 1 173 ? 44.690  2.261   8.434   1.00 24.46 ? 170 PRO A N     1 
ATOM   1297 C CA    . PRO A 1 173 ? 43.940  3.497   8.719   1.00 24.74 ? 170 PRO A CA    1 
ATOM   1298 C C     . PRO A 1 173 ? 44.431  4.194   9.999   1.00 24.68 ? 170 PRO A C     1 
ATOM   1299 O O     . PRO A 1 173 ? 44.947  3.538   10.903  1.00 25.00 ? 170 PRO A O     1 
ATOM   1300 C CB    . PRO A 1 173 ? 42.490  3.023   8.889   1.00 24.68 ? 170 PRO A CB    1 
ATOM   1301 C CG    . PRO A 1 173 ? 42.424  1.657   8.315   1.00 24.73 ? 170 PRO A CG    1 
ATOM   1302 C CD    . PRO A 1 173 ? 43.819  1.088   8.269   1.00 24.49 ? 170 PRO A CD    1 
ATOM   1303 N N     . ASN A 1 174 ? 44.312  5.519   10.045  1.00 24.72 ? 171 ASN A N     1 
ATOM   1304 C CA    . ASN A 1 174 ? 44.762  6.282   11.195  1.00 24.78 ? 171 ASN A CA    1 
ATOM   1305 C C     . ASN A 1 174 ? 43.752  6.255   12.337  1.00 25.06 ? 171 ASN A C     1 
ATOM   1306 O O     . ASN A 1 174 ? 42.541  6.279   12.117  1.00 25.29 ? 171 ASN A O     1 
ATOM   1307 C CB    . ASN A 1 174 ? 45.043  7.740   10.818  1.00 24.47 ? 171 ASN A CB    1 
ATOM   1308 C CG    . ASN A 1 174 ? 45.801  8.482   11.895  1.00 23.72 ? 171 ASN A CG    1 
ATOM   1309 O OD1   . ASN A 1 174 ? 46.706  7.930   12.513  1.00 24.07 ? 171 ASN A OD1   1 
ATOM   1310 N ND2   . ASN A 1 174 ? 45.428  9.734   12.140  1.00 23.26 ? 171 ASN A ND2   1 
ATOM   1311 N N     . ASN A 1 175 ? 44.282  6.194   13.551  1.00 25.25 ? 172 ASN A N     1 
ATOM   1312 C CA    . ASN A 1 175 ? 43.524  6.403   14.758  1.00 25.53 ? 172 ASN A CA    1 
ATOM   1313 C C     . ASN A 1 175 ? 44.032  7.757   15.246  1.00 25.93 ? 172 ASN A C     1 
ATOM   1314 O O     . ASN A 1 175 ? 45.212  7.870   15.533  1.00 26.11 ? 172 ASN A O     1 
ATOM   1315 C CB    . ASN A 1 175 ? 43.847  5.287   15.763  1.00 26.03 ? 172 ASN A CB    1 
ATOM   1316 C CG    . ASN A 1 175 ? 43.194  5.494   17.119  1.00 26.34 ? 172 ASN A CG    1 
ATOM   1317 O OD1   . ASN A 1 175 ? 42.290  6.315   17.264  1.00 28.34 ? 172 ASN A OD1   1 
ATOM   1318 N ND2   . ASN A 1 175 ? 43.664  4.752   18.125  1.00 25.43 ? 172 ASN A ND2   1 
ATOM   1319 N N     . PRO A 1 176 ? 43.157  8.766   15.401  1.00 25.70 ? 173 PRO A N     1 
ATOM   1320 C CA    . PRO A 1 176 ? 41.705  8.741   15.497  1.00 26.50 ? 173 PRO A CA    1 
ATOM   1321 C C     . PRO A 1 176 ? 40.879  9.174   14.291  1.00 26.52 ? 173 PRO A C     1 
ATOM   1322 O O     . PRO A 1 176 ? 39.658  9.202   14.409  1.00 26.67 ? 173 PRO A O     1 
ATOM   1323 C CB    . PRO A 1 176 ? 41.457  9.754   16.620  1.00 26.25 ? 173 PRO A CB    1 
ATOM   1324 C CG    . PRO A 1 176 ? 42.493  10.827  16.356  1.00 26.04 ? 173 PRO A CG    1 
ATOM   1325 C CD    . PRO A 1 176 ? 43.654  10.137  15.607  1.00 25.64 ? 173 PRO A CD    1 
ATOM   1326 N N     . THR A 1 177 ? 41.505  9.462   13.156  1.00 27.31 ? 174 THR A N     1 
ATOM   1327 C CA    . THR A 1 177 ? 40.817  10.147  12.039  1.00 27.81 ? 174 THR A CA    1 
ATOM   1328 C C     . THR A 1 177 ? 40.179  9.195   11.032  1.00 28.32 ? 174 THR A C     1 
ATOM   1329 O O     . THR A 1 177 ? 39.185  9.531   10.394  1.00 28.74 ? 174 THR A O     1 
ATOM   1330 C CB    . THR A 1 177 ? 41.777  11.104  11.299  1.00 28.11 ? 174 THR A CB    1 
ATOM   1331 O OG1   . THR A 1 177 ? 42.908  10.373  10.817  1.00 26.95 ? 174 THR A OG1   1 
ATOM   1332 C CG2   . THR A 1 177 ? 42.255  12.236  12.231  1.00 27.34 ? 174 THR A CG2   1 
ATOM   1333 N N     . GLY A 1 178 ? 40.758  8.010   10.883  1.00 29.04 ? 175 GLY A N     1 
ATOM   1334 C CA    . GLY A 1 178 ? 40.139  6.937   10.118  1.00 29.01 ? 175 GLY A CA    1 
ATOM   1335 C C     . GLY A 1 178 ? 40.629  6.775   8.688   1.00 29.27 ? 175 GLY A C     1 
ATOM   1336 O O     . GLY A 1 178 ? 40.195  5.858   8.000   1.00 28.96 ? 175 GLY A O     1 
ATOM   1337 N N     . ASP A 1 179 ? 41.535  7.645   8.245   1.00 29.74 ? 176 ASP A N     1 
ATOM   1338 C CA    . ASP A 1 179 ? 41.987  7.651   6.843   1.00 29.77 ? 176 ASP A CA    1 
ATOM   1339 C C     . ASP A 1 179 ? 43.135  6.682   6.538   1.00 29.53 ? 176 ASP A C     1 
ATOM   1340 O O     . ASP A 1 179 ? 44.046  6.493   7.348   1.00 28.72 ? 176 ASP A O     1 
ATOM   1341 C CB    . ASP A 1 179 ? 42.398  9.070   6.399   1.00 30.46 ? 176 ASP A CB    1 
ATOM   1342 C CG    . ASP A 1 179 ? 43.514  9.650   7.238   1.00 30.31 ? 176 ASP A CG    1 
ATOM   1343 O OD1   . ASP A 1 179 ? 43.199  10.190  8.316   1.00 31.07 ? 176 ASP A OD1   1 
ATOM   1344 O OD2   . ASP A 1 179 ? 44.688  9.578   6.812   1.00 30.16 ? 176 ASP A OD2   1 
ATOM   1345 N N     . VAL A 1 180 ? 43.070  6.092   5.346   1.00 29.37 ? 177 VAL A N     1 
ATOM   1346 C CA    . VAL A 1 180 ? 44.138  5.267   4.813   1.00 29.61 ? 177 VAL A CA    1 
ATOM   1347 C C     . VAL A 1 180 ? 45.151  6.143   4.088   1.00 29.80 ? 177 VAL A C     1 
ATOM   1348 O O     . VAL A 1 180 ? 44.780  6.992   3.297   1.00 29.61 ? 177 VAL A O     1 
ATOM   1349 C CB    . VAL A 1 180 ? 43.591  4.217   3.829   1.00 29.49 ? 177 VAL A CB    1 
ATOM   1350 C CG1   . VAL A 1 180 ? 44.722  3.598   3.006   1.00 30.11 ? 177 VAL A CG1   1 
ATOM   1351 C CG2   . VAL A 1 180 ? 42.814  3.148   4.575   1.00 28.39 ? 177 VAL A CG2   1 
ATOM   1352 N N     . THR A 1 181 ? 46.430  5.943   4.387   1.00 30.17 ? 178 THR A N     1 
ATOM   1353 C CA    . THR A 1 181 ? 47.521  6.545   3.633   1.00 30.17 ? 178 THR A CA    1 
ATOM   1354 C C     . THR A 1 181 ? 47.886  5.533   2.555   1.00 30.56 ? 178 THR A C     1 
ATOM   1355 O O     . THR A 1 181 ? 48.241  4.406   2.875   1.00 30.23 ? 178 THR A O     1 
ATOM   1356 C CB    . THR A 1 181 ? 48.720  6.810   4.542   1.00 30.31 ? 178 THR A CB    1 
ATOM   1357 O OG1   . THR A 1 181 ? 48.349  7.774   5.534   1.00 29.59 ? 178 THR A OG1   1 
ATOM   1358 C CG2   . THR A 1 181 ? 49.940  7.323   3.745   1.00 29.31 ? 178 THR A CG2   1 
ATOM   1359 N N     . SER A 1 182 ? 47.775  5.915   1.286   1.00 30.89 ? 179 SER A N     1 
ATOM   1360 C CA    . SER A 1 182 ? 48.008  4.967   0.182   1.00 31.22 ? 179 SER A CA    1 
ATOM   1361 C C     . SER A 1 182 ? 49.407  4.365   0.226   1.00 31.20 ? 179 SER A C     1 
ATOM   1362 O O     . SER A 1 182 ? 50.338  4.966   0.765   1.00 30.13 ? 179 SER A O     1 
ATOM   1363 C CB    . SER A 1 182 ? 47.816  5.645   -1.178  1.00 31.39 ? 179 SER A CB    1 
ATOM   1364 O OG    . SER A 1 182 ? 48.866  6.570   -1.441  1.00 30.77 ? 179 SER A OG    1 
ATOM   1365 N N     . LEU A 1 183 ? 49.536  3.170   -0.341  1.00 31.85 ? 180 LEU A N     1 
ATOM   1366 C CA    . LEU A 1 183 ? 50.814  2.487   -0.386  1.00 32.97 ? 180 LEU A CA    1 
ATOM   1367 C C     . LEU A 1 183 ? 51.842  3.277   -1.199  1.00 33.57 ? 180 LEU A C     1 
ATOM   1368 O O     . LEU A 1 183 ? 53.023  3.192   -0.912  1.00 33.94 ? 180 LEU A O     1 
ATOM   1369 C CB    . LEU A 1 183 ? 50.674  1.056   -0.933  1.00 32.91 ? 180 LEU A CB    1 
ATOM   1370 C CG    . LEU A 1 183 ? 50.019  0.000   -0.036  1.00 33.36 ? 180 LEU A CG    1 
ATOM   1371 C CD1   . LEU A 1 183 ? 50.205  -1.395  -0.633  1.00 33.79 ? 180 LEU A CD1   1 
ATOM   1372 C CD2   . LEU A 1 183 ? 50.556  0.015   1.392   1.00 34.41 ? 180 LEU A CD2   1 
ATOM   1373 N N     . ASP A 1 184 ? 51.393  4.041   -2.197  1.00 34.56 ? 181 ASP A N     1 
ATOM   1374 C CA    . ASP A 1 184 ? 52.273  4.956   -2.944  1.00 35.15 ? 181 ASP A CA    1 
ATOM   1375 C C     . ASP A 1 184 ? 52.845  6.051   -2.036  1.00 35.32 ? 181 ASP A C     1 
ATOM   1376 O O     . ASP A 1 184 ? 54.034  6.359   -2.100  1.00 35.21 ? 181 ASP A O     1 
ATOM   1377 C CB    . ASP A 1 184 ? 51.535  5.583   -4.139  1.00 35.69 ? 181 ASP A CB    1 
ATOM   1378 C CG    . ASP A 1 184 ? 51.222  4.568   -5.259  1.00 37.20 ? 181 ASP A CG    1 
ATOM   1379 O OD1   . ASP A 1 184 ? 51.661  3.391   -5.180  1.00 38.28 ? 181 ASP A OD1   1 
ATOM   1380 O OD2   . ASP A 1 184 ? 50.529  4.957   -6.234  1.00 39.45 ? 181 ASP A OD2   1 
ATOM   1381 N N     . ASP A 1 185 ? 52.003  6.621   -1.179  1.00 35.50 ? 182 ASP A N     1 
ATOM   1382 C CA    . ASP A 1 185 ? 52.464  7.586   -0.170  1.00 35.71 ? 182 ASP A CA    1 
ATOM   1383 C C     . ASP A 1 185 ? 53.344  6.924   0.894   1.00 35.52 ? 182 ASP A C     1 
ATOM   1384 O O     . ASP A 1 185 ? 54.328  7.505   1.341   1.00 35.75 ? 182 ASP A O     1 
ATOM   1385 C CB    . ASP A 1 185 ? 51.264  8.309   0.475   1.00 36.10 ? 182 ASP A CB    1 
ATOM   1386 C CG    . ASP A 1 185 ? 50.573  9.280   -0.486  1.00 38.05 ? 182 ASP A CG    1 
ATOM   1387 O OD1   . ASP A 1 185 ? 51.012  9.389   -1.653  1.00 41.69 ? 182 ASP A OD1   1 
ATOM   1388 O OD2   . ASP A 1 185 ? 49.594  9.952   -0.086  1.00 40.28 ? 182 ASP A OD2   1 
ATOM   1389 N N     . VAL A 1 186 ? 53.001  5.698   1.280   1.00 35.48 ? 183 VAL A N     1 
ATOM   1390 C CA    . VAL A 1 186 ? 53.834  4.913   2.191   1.00 35.16 ? 183 VAL A CA    1 
ATOM   1391 C C     . VAL A 1 186 ? 55.215  4.681   1.562   1.00 34.99 ? 183 VAL A C     1 
ATOM   1392 O O     . VAL A 1 186 ? 56.234  4.861   2.230   1.00 34.08 ? 183 VAL A O     1 
ATOM   1393 C CB    . VAL A 1 186 ? 53.167  3.545   2.558   1.00 34.94 ? 183 VAL A CB    1 
ATOM   1394 C CG1   . VAL A 1 186 ? 54.113  2.685   3.370   1.00 34.82 ? 183 VAL A CG1   1 
ATOM   1395 C CG2   . VAL A 1 186 ? 51.837  3.756   3.327   1.00 35.45 ? 183 VAL A CG2   1 
ATOM   1396 N N     . GLU A 1 187 ? 55.235  4.284   0.285   1.00 34.91 ? 184 GLU A N     1 
ATOM   1397 C CA    . GLU A 1 187 ? 56.494  4.091   -0.451  1.00 35.65 ? 184 GLU A CA    1 
ATOM   1398 C C     . GLU A 1 187 ? 57.363  5.345   -0.475  1.00 35.60 ? 184 GLU A C     1 
ATOM   1399 O O     . GLU A 1 187 ? 58.561  5.268   -0.229  1.00 35.79 ? 184 GLU A O     1 
ATOM   1400 C CB    . GLU A 1 187 ? 56.248  3.634   -1.886  1.00 35.43 ? 184 GLU A CB    1 
ATOM   1401 C CG    . GLU A 1 187 ? 55.952  2.166   -2.042  1.00 35.40 ? 184 GLU A CG    1 
ATOM   1402 C CD    . GLU A 1 187 ? 56.415  1.614   -3.390  1.00 36.84 ? 184 GLU A CD    1 
ATOM   1403 O OE1   . GLU A 1 187 ? 57.637  1.667   -3.686  1.00 37.45 ? 184 GLU A OE1   1 
ATOM   1404 O OE2   . GLU A 1 187 ? 55.557  1.109   -4.146  1.00 38.93 ? 184 GLU A OE2   1 
ATOM   1405 N N     . ARG A 1 188 ? 56.760  6.492   -0.769  1.00 35.92 ? 185 ARG A N     1 
ATOM   1406 C CA    . ARG A 1 188 ? 57.490  7.769   -0.748  1.00 36.22 ? 185 ARG A CA    1 
ATOM   1407 C C     . ARG A 1 188 ? 58.101  8.067   0.629   1.00 35.90 ? 185 ARG A C     1 
ATOM   1408 O O     . ARG A 1 188 ? 59.227  8.556   0.718   1.00 35.53 ? 185 ARG A O     1 
ATOM   1409 C CB    . ARG A 1 188 ? 56.581  8.929   -1.174  1.00 36.15 ? 185 ARG A CB    1 
ATOM   1410 C CG    . ARG A 1 188 ? 56.160  8.901   -2.647  1.00 37.39 ? 185 ARG A CG    1 
ATOM   1411 C CD    . ARG A 1 188 ? 54.935  9.794   -2.919  1.00 38.44 ? 185 ARG A CD    1 
ATOM   1412 N NE    . ARG A 1 188 ? 55.244  11.227  -2.830  1.00 40.57 ? 185 ARG A NE    1 
ATOM   1413 C CZ    . ARG A 1 188 ? 54.340  12.202  -2.668  1.00 41.03 ? 185 ARG A CZ    1 
ATOM   1414 N NH1   . ARG A 1 188 ? 53.039  11.923  -2.569  1.00 43.68 ? 185 ARG A NH1   1 
ATOM   1415 N NH2   . ARG A 1 188 ? 54.735  13.471  -2.597  1.00 40.81 ? 185 ARG A NH2   1 
ATOM   1416 N N     . ILE A 1 189 ? 57.353  7.785   1.696   1.00 35.50 ? 186 ILE A N     1 
ATOM   1417 C CA    . ILE A 1 189 ? 57.848  8.003   3.050   1.00 35.34 ? 186 ILE A CA    1 
ATOM   1418 C C     . ILE A 1 189 ? 59.041  7.086   3.316   1.00 34.91 ? 186 ILE A C     1 
ATOM   1419 O O     . ILE A 1 189 ? 60.057  7.523   3.844   1.00 33.95 ? 186 ILE A O     1 
ATOM   1420 C CB    . ILE A 1 189 ? 56.737  7.781   4.126   1.00 35.30 ? 186 ILE A CB    1 
ATOM   1421 C CG1   . ILE A 1 189 ? 55.694  8.902   4.041   1.00 35.79 ? 186 ILE A CG1   1 
ATOM   1422 C CG2   . ILE A 1 189 ? 57.334  7.775   5.532   1.00 35.17 ? 186 ILE A CG2   1 
ATOM   1423 C CD1   . ILE A 1 189 ? 54.478  8.731   4.933   1.00 34.61 ? 186 ILE A CD1   1 
ATOM   1424 N N     . ILE A 1 190 ? 58.896  5.817   2.944   1.00 35.16 ? 187 ILE A N     1 
ATOM   1425 C CA    . ILE A 1 190 ? 59.940  4.819   3.148   1.00 35.61 ? 187 ILE A CA    1 
ATOM   1426 C C     . ILE A 1 190 ? 61.244  5.231   2.455   1.00 36.07 ? 187 ILE A C     1 
ATOM   1427 O O     . ILE A 1 190 ? 62.322  5.122   3.033   1.00 36.29 ? 187 ILE A O     1 
ATOM   1428 C CB    . ILE A 1 190 ? 59.501  3.408   2.645   1.00 35.63 ? 187 ILE A CB    1 
ATOM   1429 C CG1   . ILE A 1 190 ? 58.392  2.825   3.541   1.00 35.22 ? 187 ILE A CG1   1 
ATOM   1430 C CG2   . ILE A 1 190 ? 60.688  2.462   2.647   1.00 34.90 ? 187 ILE A CG2   1 
ATOM   1431 C CD1   . ILE A 1 190 ? 57.744  1.554   2.999   1.00 34.82 ? 187 ILE A CD1   1 
ATOM   1432 N N     . ASN A 1 191 ? 61.138  5.731   1.231   1.00 36.45 ? 188 ASN A N     1 
ATOM   1433 C CA    . ASN A 1 191 ? 62.329  6.105   0.460   1.00 36.53 ? 188 ASN A CA    1 
ATOM   1434 C C     . ASN A 1 191 ? 63.129  7.265   1.053   1.00 36.36 ? 188 ASN A C     1 
ATOM   1435 O O     . ASN A 1 191 ? 64.355  7.274   0.937   1.00 36.20 ? 188 ASN A O     1 
ATOM   1436 C CB    . ASN A 1 191 ? 61.969  6.358   -1.010  1.00 36.91 ? 188 ASN A CB    1 
ATOM   1437 C CG    . ASN A 1 191 ? 61.773  5.069   -1.785  1.00 38.64 ? 188 ASN A CG    1 
ATOM   1438 O OD1   . ASN A 1 191 ? 60.697  4.808   -2.333  1.00 41.29 ? 188 ASN A OD1   1 
ATOM   1439 N ND2   . ASN A 1 191 ? 62.818  4.241   -1.824  1.00 41.07 ? 188 ASN A ND2   1 
ATOM   1440 N N     . VAL A 1 192 ? 62.464  8.220   1.706   1.00 36.06 ? 189 VAL A N     1 
ATOM   1441 C CA    . VAL A 1 192 ? 63.189  9.282   2.440   1.00 35.83 ? 189 VAL A CA    1 
ATOM   1442 C C     . VAL A 1 192 ? 63.621  8.881   3.865   1.00 35.86 ? 189 VAL A C     1 
ATOM   1443 O O     . VAL A 1 192 ? 64.567  9.456   4.420   1.00 35.83 ? 189 VAL A O     1 
ATOM   1444 C CB    . VAL A 1 192 ? 62.400  10.621  2.489   1.00 36.07 ? 189 VAL A CB    1 
ATOM   1445 C CG1   . VAL A 1 192 ? 62.221  11.188  1.076   1.00 36.31 ? 189 VAL A CG1   1 
ATOM   1446 C CG2   . VAL A 1 192 ? 61.040  10.465  3.200   1.00 35.66 ? 189 VAL A CG2   1 
ATOM   1447 N N     . ALA A 1 193 ? 62.937  7.896   4.450   1.00 35.50 ? 190 ALA A N     1 
ATOM   1448 C CA    . ALA A 1 193 ? 63.238  7.434   5.813   1.00 34.98 ? 190 ALA A CA    1 
ATOM   1449 C C     . ALA A 1 193 ? 64.600  6.718   5.876   1.00 34.34 ? 190 ALA A C     1 
ATOM   1450 O O     . ALA A 1 193 ? 64.825  5.758   5.154   1.00 34.55 ? 190 ALA A O     1 
ATOM   1451 C CB    . ALA A 1 193 ? 62.118  6.512   6.317   1.00 34.63 ? 190 ALA A CB    1 
ATOM   1452 N N     . PRO A 1 194 ? 65.521  7.208   6.720   1.00 33.65 ? 191 PRO A N     1 
ATOM   1453 C CA    . PRO A 1 194 ? 66.855  6.619   6.796   1.00 33.45 ? 191 PRO A CA    1 
ATOM   1454 C C     . PRO A 1 194 ? 66.964  5.337   7.638   1.00 33.28 ? 191 PRO A C     1 
ATOM   1455 O O     . PRO A 1 194 ? 67.850  4.523   7.377   1.00 32.85 ? 191 PRO A O     1 
ATOM   1456 C CB    . PRO A 1 194 ? 67.691  7.739   7.428   1.00 33.25 ? 191 PRO A CB    1 
ATOM   1457 C CG    . PRO A 1 194 ? 66.731  8.477   8.284   1.00 33.35 ? 191 PRO A CG    1 
ATOM   1458 C CD    . PRO A 1 194 ? 65.392  8.387   7.598   1.00 33.73 ? 191 PRO A CD    1 
ATOM   1459 N N     . GLY A 1 195 ? 66.095  5.172   8.639   1.00 32.38 ? 192 GLY A N     1 
ATOM   1460 C CA    . GLY A 1 195 ? 66.208  4.039   9.571   1.00 31.69 ? 192 GLY A CA    1 
ATOM   1461 C C     . GLY A 1 195 ? 65.189  2.972   9.267   1.00 31.06 ? 192 GLY A C     1 
ATOM   1462 O O     . GLY A 1 195 ? 65.312  2.272   8.267   1.00 31.07 ? 192 GLY A O     1 
ATOM   1463 N N     . ILE A 1 196 ? 64.167  2.857   10.118  1.00 30.18 ? 193 ILE A N     1 
ATOM   1464 C CA    . ILE A 1 196 ? 63.056  1.960   9.837   1.00 29.28 ? 193 ILE A CA    1 
ATOM   1465 C C     . ILE A 1 196 ? 61.734  2.719   9.826   1.00 28.48 ? 193 ILE A C     1 
ATOM   1466 O O     . ILE A 1 196 ? 61.601  3.778   10.432  1.00 28.34 ? 193 ILE A O     1 
ATOM   1467 C CB    . ILE A 1 196 ? 62.974  0.759   10.838  1.00 29.68 ? 193 ILE A CB    1 
ATOM   1468 C CG1   . ILE A 1 196 ? 62.397  1.193   12.199  1.00 29.63 ? 193 ILE A CG1   1 
ATOM   1469 C CG2   . ILE A 1 196 ? 64.340  0.081   10.990  1.00 29.27 ? 193 ILE A CG2   1 
ATOM   1470 C CD1   . ILE A 1 196 ? 62.284  0.073   13.198  1.00 29.29 ? 193 ILE A CD1   1 
ATOM   1471 N N     . VAL A 1 197 ? 60.771  2.159   9.108   1.00 27.33 ? 194 VAL A N     1 
ATOM   1472 C CA    . VAL A 1 197 ? 59.419  2.665   9.063   1.00 26.49 ? 194 VAL A CA    1 
ATOM   1473 C C     . VAL A 1 197 ? 58.509  1.583   9.656   1.00 25.42 ? 194 VAL A C     1 
ATOM   1474 O O     . VAL A 1 197 ? 58.513  0.440   9.208   1.00 24.26 ? 194 VAL A O     1 
ATOM   1475 C CB    . VAL A 1 197 ? 59.015  2.984   7.616   1.00 26.48 ? 194 VAL A CB    1 
ATOM   1476 C CG1   . VAL A 1 197 ? 57.586  3.533   7.537   1.00 26.07 ? 194 VAL A CG1   1 
ATOM   1477 C CG2   . VAL A 1 197 ? 60.007  3.976   6.997   1.00 26.54 ? 194 VAL A CG2   1 
ATOM   1478 N N     . ILE A 1 198 ? 57.762  1.946   10.689  1.00 24.75 ? 195 ILE A N     1 
ATOM   1479 C CA    . ILE A 1 198 ? 56.783  1.046   11.279  1.00 24.51 ? 195 ILE A CA    1 
ATOM   1480 C C     . ILE A 1 198 ? 55.411  1.442   10.783  1.00 23.99 ? 195 ILE A C     1 
ATOM   1481 O O     . ILE A 1 198 ? 54.902  2.503   11.137  1.00 23.06 ? 195 ILE A O     1 
ATOM   1482 C CB    . ILE A 1 198 ? 56.787  1.107   12.807  1.00 24.67 ? 195 ILE A CB    1 
ATOM   1483 C CG1   . ILE A 1 198 ? 58.152  0.708   13.356  1.00 23.78 ? 195 ILE A CG1   1 
ATOM   1484 C CG2   . ILE A 1 198 ? 55.672  0.208   13.365  1.00 24.53 ? 195 ILE A CG2   1 
ATOM   1485 C CD1   . ILE A 1 198 ? 58.314  0.984   14.845  1.00 24.26 ? 195 ILE A CD1   1 
ATOM   1486 N N     . VAL A 1 199 ? 54.826  0.599   9.937   1.00 23.62 ? 196 VAL A N     1 
ATOM   1487 C CA    . VAL A 1 199 ? 53.468  0.803   9.510   1.00 23.61 ? 196 VAL A CA    1 
ATOM   1488 C C     . VAL A 1 199 ? 52.526  0.113   10.519  1.00 23.82 ? 196 VAL A C     1 
ATOM   1489 O O     . VAL A 1 199 ? 52.475  -1.115  10.620  1.00 23.66 ? 196 VAL A O     1 
ATOM   1490 C CB    . VAL A 1 199 ? 53.252  0.331   8.065   1.00 23.82 ? 196 VAL A CB    1 
ATOM   1491 C CG1   . VAL A 1 199 ? 51.798  0.534   7.633   1.00 23.39 ? 196 VAL A CG1   1 
ATOM   1492 C CG2   . VAL A 1 199 ? 54.207  1.105   7.104   1.00 22.14 ? 196 VAL A CG2   1 
ATOM   1493 N N     . ASP A 1 200 ? 51.816  0.929   11.290  1.00 23.85 ? 197 ASP A N     1 
ATOM   1494 C CA    . ASP A 1 200 ? 50.831  0.424   12.238  1.00 23.91 ? 197 ASP A CA    1 
ATOM   1495 C C     . ASP A 1 200 ? 49.540  0.127   11.503  1.00 23.76 ? 197 ASP A C     1 
ATOM   1496 O O     . ASP A 1 200 ? 48.764  1.034   11.183  1.00 22.97 ? 197 ASP A O     1 
ATOM   1497 C CB    . ASP A 1 200 ? 50.592  1.402   13.401  1.00 23.72 ? 197 ASP A CB    1 
ATOM   1498 C CG    . ASP A 1 200 ? 49.778  0.770   14.531  1.00 23.42 ? 197 ASP A CG    1 
ATOM   1499 O OD1   . ASP A 1 200 ? 49.017  -0.176  14.250  1.00 21.16 ? 197 ASP A OD1   1 
ATOM   1500 O OD2   . ASP A 1 200 ? 49.919  1.188   15.697  1.00 24.98 ? 197 ASP A OD2   1 
ATOM   1501 N N     . GLU A 1 201 ? 49.324  -1.163  11.240  1.00 24.16 ? 198 GLU A N     1 
ATOM   1502 C CA    . GLU A 1 201 ? 48.145  -1.633  10.541  1.00 24.70 ? 198 GLU A CA    1 
ATOM   1503 C C     . GLU A 1 201 ? 47.110  -2.237  11.504  1.00 24.20 ? 198 GLU A C     1 
ATOM   1504 O O     . GLU A 1 201 ? 46.433  -3.208  11.167  1.00 23.72 ? 198 GLU A O     1 
ATOM   1505 C CB    . GLU A 1 201 ? 48.541  -2.638  9.460   1.00 24.85 ? 198 GLU A CB    1 
ATOM   1506 C CG    . GLU A 1 201 ? 49.269  -1.999  8.290   1.00 26.89 ? 198 GLU A CG    1 
ATOM   1507 C CD    . GLU A 1 201 ? 49.117  -2.781  6.989   1.00 27.57 ? 198 GLU A CD    1 
ATOM   1508 O OE1   . GLU A 1 201 ? 48.843  -4.005  7.030   1.00 27.82 ? 198 GLU A OE1   1 
ATOM   1509 O OE2   . GLU A 1 201 ? 49.287  -2.157  5.913   1.00 32.17 ? 198 GLU A OE2   1 
ATOM   1510 N N     . ALA A 1 202 ? 46.960  -1.640  12.684  1.00 24.04 ? 199 ALA A N     1 
ATOM   1511 C CA    . ALA A 1 202 ? 45.962  -2.133  13.666  1.00 24.04 ? 199 ALA A CA    1 
ATOM   1512 C C     . ALA A 1 202 ? 44.565  -2.305  13.073  1.00 23.31 ? 199 ALA A C     1 
ATOM   1513 O O     . ALA A 1 202 ? 43.861  -3.226  13.447  1.00 23.10 ? 199 ALA A O     1 
ATOM   1514 C CB    . ALA A 1 202 ? 45.902  -1.240  14.908  1.00 22.71 ? 199 ALA A CB    1 
ATOM   1515 N N     . TYR A 1 203 ? 44.160  -1.422  12.159  1.00 23.76 ? 200 TYR A N     1 
ATOM   1516 C CA    . TYR A 1 203 ? 42.820  -1.498  11.563  1.00 24.40 ? 200 TYR A CA    1 
ATOM   1517 C C     . TYR A 1 203 ? 42.783  -1.968  10.103  1.00 24.73 ? 200 TYR A C     1 
ATOM   1518 O O     . TYR A 1 203 ? 41.768  -1.821  9.426   1.00 25.18 ? 200 TYR A O     1 
ATOM   1519 C CB    . TYR A 1 203 ? 42.127  -0.151  11.718  1.00 24.54 ? 200 TYR A CB    1 
ATOM   1520 C CG    . TYR A 1 203 ? 42.141  0.332   13.154  1.00 24.37 ? 200 TYR A CG    1 
ATOM   1521 C CD1   . TYR A 1 203 ? 41.105  0.012   14.015  1.00 25.27 ? 200 TYR A CD1   1 
ATOM   1522 C CD2   . TYR A 1 203 ? 43.196  1.095   13.649  1.00 24.00 ? 200 TYR A CD2   1 
ATOM   1523 C CE1   . TYR A 1 203 ? 41.116  0.434   15.332  1.00 24.28 ? 200 TYR A CE1   1 
ATOM   1524 C CE2   . TYR A 1 203 ? 43.219  1.525   14.971  1.00 24.65 ? 200 TYR A CE2   1 
ATOM   1525 C CZ    . TYR A 1 203 ? 42.159  1.187   15.806  1.00 25.10 ? 200 TYR A CZ    1 
ATOM   1526 O OH    . TYR A 1 203 ? 42.147  1.598   17.120  1.00 25.28 ? 200 TYR A OH    1 
ATOM   1527 N N     . ALA A 1 204 ? 43.872  -2.559  9.637   1.00 25.23 ? 201 ALA A N     1 
ATOM   1528 C CA    . ALA A 1 204 ? 44.010  -3.010  8.252   1.00 25.80 ? 201 ALA A CA    1 
ATOM   1529 C C     . ALA A 1 204 ? 42.827  -3.832  7.777   1.00 26.19 ? 201 ALA A C     1 
ATOM   1530 O O     . ALA A 1 204 ? 42.337  -3.629  6.676   1.00 27.34 ? 201 ALA A O     1 
ATOM   1531 C CB    . ALA A 1 204 ? 45.315  -3.826  8.086   1.00 25.72 ? 201 ALA A CB    1 
ATOM   1532 N N     . GLU A 1 205 ? 42.353  -4.748  8.613   1.00 26.54 ? 202 GLU A N     1 
ATOM   1533 C CA    . GLU A 1 205 ? 41.244  -5.607  8.236   1.00 26.74 ? 202 GLU A CA    1 
ATOM   1534 C C     . GLU A 1 205 ? 39.964  -4.839  7.879   1.00 26.76 ? 202 GLU A C     1 
ATOM   1535 O O     . GLU A 1 205 ? 39.122  -5.361  7.156   1.00 26.33 ? 202 GLU A O     1 
ATOM   1536 C CB    . GLU A 1 205 ? 40.944  -6.625  9.335   1.00 26.99 ? 202 GLU A CB    1 
ATOM   1537 C CG    . GLU A 1 205 ? 41.927  -7.783  9.422   1.00 27.84 ? 202 GLU A CG    1 
ATOM   1538 C CD    . GLU A 1 205 ? 43.128  -7.530  10.332  1.00 28.61 ? 202 GLU A CD    1 
ATOM   1539 O OE1   . GLU A 1 205 ? 43.263  -6.420  10.910  1.00 31.16 ? 202 GLU A OE1   1 
ATOM   1540 O OE2   . GLU A 1 205 ? 43.948  -8.463  10.458  1.00 28.35 ? 202 GLU A OE2   1 
ATOM   1541 N N     . PHE A 1 206 ? 39.824  -3.610  8.369   1.00 27.03 ? 203 PHE A N     1 
ATOM   1542 C CA    . PHE A 1 206 ? 38.610  -2.826  8.127   1.00 27.82 ? 203 PHE A CA    1 
ATOM   1543 C C     . PHE A 1 206 ? 38.583  -2.116  6.771   1.00 28.57 ? 203 PHE A C     1 
ATOM   1544 O O     . PHE A 1 206 ? 37.567  -1.541  6.406   1.00 28.91 ? 203 PHE A O     1 
ATOM   1545 C CB    . PHE A 1 206 ? 38.373  -1.815  9.255   1.00 26.98 ? 203 PHE A CB    1 
ATOM   1546 C CG    . PHE A 1 206 ? 37.955  -2.445  10.551  1.00 27.31 ? 203 PHE A CG    1 
ATOM   1547 C CD1   . PHE A 1 206 ? 36.693  -3.020  10.686  1.00 26.37 ? 203 PHE A CD1   1 
ATOM   1548 C CD2   . PHE A 1 206 ? 38.817  -2.467  11.642  1.00 25.36 ? 203 PHE A CD2   1 
ATOM   1549 C CE1   . PHE A 1 206 ? 36.301  -3.619  11.872  1.00 25.31 ? 203 PHE A CE1   1 
ATOM   1550 C CE2   . PHE A 1 206 ? 38.432  -3.059  12.831  1.00 26.68 ? 203 PHE A CE2   1 
ATOM   1551 C CZ    . PHE A 1 206 ? 37.164  -3.637  12.949  1.00 26.45 ? 203 PHE A CZ    1 
ATOM   1552 N N     . SER A 1 207 ? 39.686  -2.158  6.029   1.00 29.59 ? 204 SER A N     1 
ATOM   1553 C CA    . SER A 1 207 ? 39.767  -1.527  4.725   1.00 29.95 ? 204 SER A CA    1 
ATOM   1554 C C     . SER A 1 207 ? 40.056  -2.574  3.663   1.00 30.36 ? 204 SER A C     1 
ATOM   1555 O O     . SER A 1 207 ? 40.896  -3.446  3.882   1.00 30.16 ? 204 SER A O     1 
ATOM   1556 C CB    . SER A 1 207 ? 40.872  -0.482  4.710   1.00 30.22 ? 204 SER A CB    1 
ATOM   1557 O OG    . SER A 1 207 ? 40.996  0.112   3.428   1.00 31.34 ? 204 SER A OG    1 
ATOM   1558 N N     . PRO A 1 208 ? 39.371  -2.487  2.505   1.00 30.98 ? 205 PRO A N     1 
ATOM   1559 C CA    . PRO A 1 208 ? 39.670  -3.368  1.376   1.00 31.34 ? 205 PRO A CA    1 
ATOM   1560 C C     . PRO A 1 208 ? 41.019  -3.074  0.713   1.00 31.47 ? 205 PRO A C     1 
ATOM   1561 O O     . PRO A 1 208 ? 41.535  -3.911  -0.024  1.00 31.92 ? 205 PRO A O     1 
ATOM   1562 C CB    . PRO A 1 208 ? 38.527  -3.113  0.385   1.00 31.57 ? 205 PRO A CB    1 
ATOM   1563 C CG    . PRO A 1 208 ? 37.663  -2.095  0.968   1.00 31.93 ? 205 PRO A CG    1 
ATOM   1564 C CD    . PRO A 1 208 ? 38.295  -1.532  2.197   1.00 31.36 ? 205 PRO A CD    1 
ATOM   1565 N N     . SER A 1 209 ? 41.591  -1.908  0.977   1.00 31.54 ? 206 SER A N     1 
ATOM   1566 C CA    . SER A 1 209 ? 42.889  -1.547  0.424   1.00 31.75 ? 206 SER A CA    1 
ATOM   1567 C C     . SER A 1 209 ? 43.998  -2.537  0.812   1.00 31.98 ? 206 SER A C     1 
ATOM   1568 O O     . SER A 1 209 ? 43.903  -3.191  1.851   1.00 32.09 ? 206 SER A O     1 
ATOM   1569 C CB    . SER A 1 209 ? 43.271  -0.161  0.923   1.00 32.02 ? 206 SER A CB    1 
ATOM   1570 O OG    . SER A 1 209 ? 42.390  0.805   0.368   1.00 35.26 ? 206 SER A OG    1 
ATOM   1571 N N     . PRO A 1 210 ? 45.074  -2.614  -0.004  1.00 31.43 ? 207 PRO A N     1 
ATOM   1572 C CA    . PRO A 1 210 ? 46.160  -3.551  0.244   1.00 30.83 ? 207 PRO A CA    1 
ATOM   1573 C C     . PRO A 1 210 ? 46.958  -3.255  1.500   1.00 30.36 ? 207 PRO A C     1 
ATOM   1574 O O     . PRO A 1 210 ? 47.104  -2.094  1.887   1.00 30.26 ? 207 PRO A O     1 
ATOM   1575 C CB    . PRO A 1 210 ? 47.059  -3.375  -0.988  1.00 30.89 ? 207 PRO A CB    1 
ATOM   1576 C CG    . PRO A 1 210 ? 46.791  -2.014  -1.448  1.00 31.02 ? 207 PRO A CG    1 
ATOM   1577 C CD    . PRO A 1 210 ? 45.330  -1.812  -1.213  1.00 31.43 ? 207 PRO A CD    1 
ATOM   1578 N N     . SER A 1 211 ? 47.470  -4.315  2.117   1.00 29.69 ? 208 SER A N     1 
ATOM   1579 C CA    . SER A 1 211 ? 48.375  -4.216  3.257   1.00 29.44 ? 208 SER A CA    1 
ATOM   1580 C C     . SER A 1 211 ? 49.786  -3.815  2.815   1.00 29.47 ? 208 SER A C     1 
ATOM   1581 O O     . SER A 1 211 ? 50.267  -4.225  1.749   1.00 29.32 ? 208 SER A O     1 
ATOM   1582 C CB    . SER A 1 211 ? 48.444  -5.578  3.975   1.00 28.93 ? 208 SER A CB    1 
ATOM   1583 O OG    . SER A 1 211 ? 49.471  -5.612  4.965   1.00 28.82 ? 208 SER A OG    1 
ATOM   1584 N N     . ALA A 1 212 ? 50.471  -3.083  3.676   1.00 29.37 ? 209 ALA A N     1 
ATOM   1585 C CA    . ALA A 1 212 ? 51.880  -2.778  3.489   1.00 29.31 ? 209 ALA A CA    1 
ATOM   1586 C C     . ALA A 1 212 ? 52.761  -4.023  3.490   1.00 29.38 ? 209 ALA A C     1 
ATOM   1587 O O     . ALA A 1 212 ? 53.948  -3.938  3.163   1.00 28.81 ? 209 ALA A O     1 
ATOM   1588 C CB    . ALA A 1 212 ? 52.347  -1.813  4.555   1.00 28.69 ? 209 ALA A CB    1 
ATOM   1589 N N     . THR A 1 213 ? 52.209  -5.182  3.857   1.00 29.74 ? 210 THR A N     1 
ATOM   1590 C CA    . THR A 1 213 ? 52.963  -6.430  3.706   1.00 30.13 ? 210 THR A CA    1 
ATOM   1591 C C     . THR A 1 213 ? 53.366  -6.656  2.244   1.00 30.40 ? 210 THR A C     1 
ATOM   1592 O O     . THR A 1 213 ? 54.315  -7.379  1.978   1.00 31.08 ? 210 THR A O     1 
ATOM   1593 C CB    . THR A 1 213 ? 52.190  -7.668  4.182   1.00 29.66 ? 210 THR A CB    1 
ATOM   1594 O OG1   . THR A 1 213 ? 51.028  -7.829  3.367   1.00 30.35 ? 210 THR A OG1   1 
ATOM   1595 C CG2   . THR A 1 213 ? 51.790  -7.541  5.651   1.00 29.29 ? 210 THR A CG2   1 
ATOM   1596 N N     . THR A 1 214 ? 52.630  -6.053  1.310   1.00 30.71 ? 211 THR A N     1 
ATOM   1597 C CA    . THR A 1 214 ? 52.968  -6.107  -0.104  1.00 30.92 ? 211 THR A CA    1 
ATOM   1598 C C     . THR A 1 214 ? 54.278  -5.374  -0.428  1.00 31.36 ? 211 THR A C     1 
ATOM   1599 O O     . THR A 1 214 ? 54.886  -5.620  -1.463  1.00 31.60 ? 211 THR A O     1 
ATOM   1600 C CB    . THR A 1 214 ? 51.845  -5.534  -0.994  1.00 30.90 ? 211 THR A CB    1 
ATOM   1601 O OG1   . THR A 1 214 ? 51.648  -4.143  -0.710  1.00 30.42 ? 211 THR A OG1   1 
ATOM   1602 C CG2   . THR A 1 214 ? 50.544  -6.288  -0.794  1.00 28.95 ? 211 THR A CG2   1 
ATOM   1603 N N     . LEU A 1 215 ? 54.709  -4.483  0.455   1.00 31.76 ? 212 LEU A N     1 
ATOM   1604 C CA    . LEU A 1 215 ? 55.934  -3.723  0.251   1.00 32.16 ? 212 LEU A CA    1 
ATOM   1605 C C     . LEU A 1 215 ? 57.162  -4.362  0.927   1.00 32.62 ? 212 LEU A C     1 
ATOM   1606 O O     . LEU A 1 215 ? 58.288  -3.867  0.788   1.00 32.08 ? 212 LEU A O     1 
ATOM   1607 C CB    . LEU A 1 215 ? 55.736  -2.295  0.765   1.00 32.26 ? 212 LEU A CB    1 
ATOM   1608 C CG    . LEU A 1 215 ? 54.635  -1.477  0.070   1.00 33.07 ? 212 LEU A CG    1 
ATOM   1609 C CD1   . LEU A 1 215 ? 54.325  -0.176  0.850   1.00 32.90 ? 212 LEU A CD1   1 
ATOM   1610 C CD2   . LEU A 1 215 ? 55.004  -1.167  -1.391  1.00 33.08 ? 212 LEU A CD2   1 
ATOM   1611 N N     . LEU A 1 216 ? 56.954  -5.469  1.641   1.00 32.89 ? 213 LEU A N     1 
ATOM   1612 C CA    . LEU A 1 216 ? 58.033  -6.064  2.421   1.00 33.31 ? 213 LEU A CA    1 
ATOM   1613 C C     . LEU A 1 216 ? 59.150  -6.608  1.526   1.00 34.05 ? 213 LEU A C     1 
ATOM   1614 O O     . LEU A 1 216 ? 60.326  -6.476  1.867   1.00 33.74 ? 213 LEU A O     1 
ATOM   1615 C CB    . LEU A 1 216 ? 57.512  -7.171  3.351   1.00 32.80 ? 213 LEU A CB    1 
ATOM   1616 C CG    . LEU A 1 216 ? 56.870  -6.771  4.688   1.00 30.98 ? 213 LEU A CG    1 
ATOM   1617 C CD1   . LEU A 1 216 ? 56.425  -8.036  5.417   1.00 29.89 ? 213 LEU A CD1   1 
ATOM   1618 C CD2   . LEU A 1 216 ? 57.815  -5.966  5.561   1.00 29.30 ? 213 LEU A CD2   1 
ATOM   1619 N N     . GLU A 1 217 ? 58.791  -7.220  0.400   1.00 35.01 ? 214 GLU A N     1 
ATOM   1620 C CA    . GLU A 1 217 ? 59.802  -7.782  -0.495  1.00 35.91 ? 214 GLU A CA    1 
ATOM   1621 C C     . GLU A 1 217 ? 60.718  -6.680  -1.027  1.00 36.12 ? 214 GLU A C     1 
ATOM   1622 O O     . GLU A 1 217 ? 61.910  -6.882  -1.151  1.00 36.44 ? 214 GLU A O     1 
ATOM   1623 C CB    . GLU A 1 217 ? 59.166  -8.549  -1.657  1.00 36.16 ? 214 GLU A CB    1 
ATOM   1624 C CG    . GLU A 1 217 ? 60.126  -9.546  -2.318  1.00 37.04 ? 214 GLU A CG    1 
ATOM   1625 C CD    . GLU A 1 217 ? 59.510  -10.294 -3.499  1.00 38.67 ? 214 GLU A CD    1 
ATOM   1626 O OE1   . GLU A 1 217 ? 59.142  -9.633  -4.496  1.00 43.50 ? 214 GLU A OE1   1 
ATOM   1627 O OE2   . GLU A 1 217 ? 59.406  -11.548 -3.443  1.00 44.13 ? 214 GLU A OE2   1 
ATOM   1628 N N     . LYS A 1 218 ? 60.146  -5.505  -1.274  1.00 36.57 ? 215 LYS A N     1 
ATOM   1629 C CA    . LYS A 1 218 ? 60.849  -4.359  -1.838  1.00 36.50 ? 215 LYS A CA    1 
ATOM   1630 C C     . LYS A 1 218 ? 61.735  -3.579  -0.836  1.00 36.49 ? 215 LYS A C     1 
ATOM   1631 O O     . LYS A 1 218 ? 62.809  -3.077  -1.214  1.00 36.05 ? 215 LYS A O     1 
ATOM   1632 C CB    . LYS A 1 218 ? 59.808  -3.434  -2.496  1.00 37.06 ? 215 LYS A CB    1 
ATOM   1633 C CG    . LYS A 1 218 ? 60.365  -2.397  -3.486  1.00 37.22 ? 215 LYS A CG    1 
ATOM   1634 C CD    . LYS A 1 218 ? 59.251  -1.839  -4.375  1.00 37.62 ? 215 LYS A CD    1 
ATOM   1635 C CE    . LYS A 1 218 ? 59.673  -0.564  -5.120  1.00 39.03 ? 215 LYS A CE    1 
ATOM   1636 N NZ    . LYS A 1 218 ? 58.540  0.059   -5.911  1.00 38.89 ? 215 LYS A NZ    1 
ATOM   1637 N N     . TYR A 1 219 ? 61.308  -3.480  0.429   1.00 36.12 ? 216 TYR A N     1 
ATOM   1638 C CA    . TYR A 1 219 ? 62.058  -2.714  1.444   1.00 35.80 ? 216 TYR A CA    1 
ATOM   1639 C C     . TYR A 1 219 ? 62.427  -3.527  2.694   1.00 35.78 ? 216 TYR A C     1 
ATOM   1640 O O     . TYR A 1 219 ? 62.050  -3.152  3.801   1.00 35.49 ? 216 TYR A O     1 
ATOM   1641 C CB    . TYR A 1 219 ? 61.251  -1.479  1.865   1.00 36.07 ? 216 TYR A CB    1 
ATOM   1642 C CG    . TYR A 1 219 ? 60.846  -0.610  0.706   1.00 35.56 ? 216 TYR A CG    1 
ATOM   1643 C CD1   . TYR A 1 219 ? 61.746  0.290   0.145   1.00 35.89 ? 216 TYR A CD1   1 
ATOM   1644 C CD2   . TYR A 1 219 ? 59.573  -0.692  0.163   1.00 35.65 ? 216 TYR A CD2   1 
ATOM   1645 C CE1   . TYR A 1 219 ? 61.390  1.091   -0.930  1.00 36.00 ? 216 TYR A CE1   1 
ATOM   1646 C CE2   . TYR A 1 219 ? 59.202  0.105   -0.913  1.00 36.30 ? 216 TYR A CE2   1 
ATOM   1647 C CZ    . TYR A 1 219 ? 60.120  0.994   -1.457  1.00 36.38 ? 216 TYR A CZ    1 
ATOM   1648 O OH    . TYR A 1 219 ? 59.764  1.785   -2.520  1.00 36.49 ? 216 TYR A OH    1 
ATOM   1649 N N     . PRO A 1 220 ? 63.195  -4.627  2.523   1.00 35.39 ? 217 PRO A N     1 
ATOM   1650 C CA    . PRO A 1 220 ? 63.434  -5.566  3.629   1.00 34.57 ? 217 PRO A CA    1 
ATOM   1651 C C     . PRO A 1 220 ? 64.208  -5.004  4.821   1.00 33.95 ? 217 PRO A C     1 
ATOM   1652 O O     . PRO A 1 220 ? 64.022  -5.483  5.922   1.00 33.56 ? 217 PRO A O     1 
ATOM   1653 C CB    . PRO A 1 220 ? 64.229  -6.705  2.968   1.00 34.86 ? 217 PRO A CB    1 
ATOM   1654 C CG    . PRO A 1 220 ? 64.838  -6.110  1.751   1.00 34.84 ? 217 PRO A CG    1 
ATOM   1655 C CD    . PRO A 1 220 ? 63.876  -5.054  1.283   1.00 35.49 ? 217 PRO A CD    1 
ATOM   1656 N N     . THR A 1 221 ? 65.053  -3.995  4.610   1.00 33.32 ? 218 THR A N     1 
ATOM   1657 C CA    . THR A 1 221 ? 65.891  -3.450  5.685   1.00 32.77 ? 218 THR A CA    1 
ATOM   1658 C C     . THR A 1 221 ? 65.237  -2.272  6.424   1.00 32.18 ? 218 THR A C     1 
ATOM   1659 O O     . THR A 1 221 ? 65.795  -1.740  7.391   1.00 32.08 ? 218 THR A O     1 
ATOM   1660 C CB    . THR A 1 221 ? 67.261  -2.969  5.135   1.00 32.84 ? 218 THR A CB    1 
ATOM   1661 O OG1   . THR A 1 221 ? 67.058  -1.897  4.207   1.00 32.92 ? 218 THR A OG1   1 
ATOM   1662 C CG2   . THR A 1 221 ? 68.003  -4.121  4.434   1.00 31.88 ? 218 THR A CG2   1 
ATOM   1663 N N     . LYS A 1 222 ? 64.058  -1.876  5.968   1.00 31.45 ? 219 LYS A N     1 
ATOM   1664 C CA    . LYS A 1 222 ? 63.399  -0.683  6.466   1.00 31.18 ? 219 LYS A CA    1 
ATOM   1665 C C     . LYS A 1 222 ? 62.009  -0.903  7.077   1.00 30.58 ? 219 LYS A C     1 
ATOM   1666 O O     . LYS A 1 222 ? 61.636  -0.204  8.024   1.00 30.51 ? 219 LYS A O     1 
ATOM   1667 C CB    . LYS A 1 222 ? 63.259  0.305   5.317   1.00 31.68 ? 219 LYS A CB    1 
ATOM   1668 C CG    . LYS A 1 222 ? 64.536  1.042   4.936   1.00 31.83 ? 219 LYS A CG    1 
ATOM   1669 C CD    . LYS A 1 222 ? 64.187  2.166   3.973   1.00 32.08 ? 219 LYS A CD    1 
ATOM   1670 C CE    . LYS A 1 222 ? 65.344  3.103   3.717   1.00 32.74 ? 219 LYS A CE    1 
ATOM   1671 N NZ    . LYS A 1 222 ? 64.885  4.254   2.880   1.00 33.67 ? 219 LYS A NZ    1 
ATOM   1672 N N     . LEU A 1 223 ? 61.238  -1.849  6.536   1.00 29.47 ? 220 LEU A N     1 
ATOM   1673 C CA    . LEU A 1 223 ? 59.798  -1.906  6.815   1.00 28.78 ? 220 LEU A CA    1 
ATOM   1674 C C     . LEU A 1 223 ? 59.371  -3.023  7.774   1.00 28.24 ? 220 LEU A C     1 
ATOM   1675 O O     . LEU A 1 223 ? 59.761  -4.185  7.618   1.00 27.84 ? 220 LEU A O     1 
ATOM   1676 C CB    . LEU A 1 223 ? 59.012  -2.029  5.500   1.00 28.55 ? 220 LEU A CB    1 
ATOM   1677 C CG    . LEU A 1 223 ? 57.476  -2.032  5.622   1.00 28.59 ? 220 LEU A CG    1 
ATOM   1678 C CD1   . LEU A 1 223 ? 56.927  -0.701  6.147   1.00 28.34 ? 220 LEU A CD1   1 
ATOM   1679 C CD2   . LEU A 1 223 ? 56.826  -2.413  4.291   1.00 28.02 ? 220 LEU A CD2   1 
ATOM   1680 N N     . VAL A 1 224 ? 58.548  -2.641  8.754   1.00 27.52 ? 221 VAL A N     1 
ATOM   1681 C CA    . VAL A 1 224 ? 57.902  -3.570  9.680   1.00 26.59 ? 221 VAL A CA    1 
ATOM   1682 C C     . VAL A 1 224 ? 56.416  -3.239  9.700   1.00 26.00 ? 221 VAL A C     1 
ATOM   1683 O O     . VAL A 1 224 ? 56.031  -2.088  9.890   1.00 26.03 ? 221 VAL A O     1 
ATOM   1684 C CB    . VAL A 1 224 ? 58.443  -3.421  11.131  1.00 26.55 ? 221 VAL A CB    1 
ATOM   1685 C CG1   . VAL A 1 224 ? 57.718  -4.372  12.082  1.00 25.43 ? 221 VAL A CG1   1 
ATOM   1686 C CG2   . VAL A 1 224 ? 59.919  -3.651  11.175  1.00 25.98 ? 221 VAL A CG2   1 
ATOM   1687 N N     . VAL A 1 225 ? 55.581  -4.246  9.512   1.00 25.21 ? 222 VAL A N     1 
ATOM   1688 C CA    . VAL A 1 225 ? 54.147  -4.042  9.504   1.00 25.02 ? 222 VAL A CA    1 
ATOM   1689 C C     . VAL A 1 225 ? 53.587  -4.551  10.828  1.00 24.48 ? 222 VAL A C     1 
ATOM   1690 O O     . VAL A 1 225 ? 53.647  -5.730  11.128  1.00 24.93 ? 222 VAL A O     1 
ATOM   1691 C CB    . VAL A 1 225 ? 53.507  -4.736  8.304   1.00 24.84 ? 222 VAL A CB    1 
ATOM   1692 C CG1   . VAL A 1 225 ? 51.998  -4.587  8.336   1.00 25.01 ? 222 VAL A CG1   1 
ATOM   1693 C CG2   . VAL A 1 225 ? 54.109  -4.190  7.016   1.00 24.28 ? 222 VAL A CG2   1 
ATOM   1694 N N     . SER A 1 226 ? 53.066  -3.635  11.621  1.00 23.98 ? 223 SER A N     1 
ATOM   1695 C CA    . SER A 1 226 ? 52.539  -3.955  12.926  1.00 23.99 ? 223 SER A CA    1 
ATOM   1696 C C     . SER A 1 226 ? 51.034  -4.230  12.846  1.00 23.21 ? 223 SER A C     1 
ATOM   1697 O O     . SER A 1 226 ? 50.301  -3.522  12.161  1.00 23.28 ? 223 SER A O     1 
ATOM   1698 C CB    . SER A 1 226 ? 52.845  -2.816  13.892  1.00 23.40 ? 223 SER A CB    1 
ATOM   1699 O OG    . SER A 1 226 ? 52.283  -3.076  15.143  1.00 26.00 ? 223 SER A OG    1 
ATOM   1700 N N     . ARG A 1 227 ? 50.598  -5.267  13.555  1.00 22.85 ? 224 ARG A N     1 
ATOM   1701 C CA    . ARG A 1 227 ? 49.227  -5.755  13.501  1.00 22.78 ? 224 ARG A CA    1 
ATOM   1702 C C     . ARG A 1 227 ? 48.712  -6.146  14.892  1.00 22.31 ? 224 ARG A C     1 
ATOM   1703 O O     . ARG A 1 227 ? 49.463  -6.243  15.834  1.00 22.29 ? 224 ARG A O     1 
ATOM   1704 C CB    . ARG A 1 227 ? 49.151  -7.006  12.608  1.00 23.07 ? 224 ARG A CB    1 
ATOM   1705 C CG    . ARG A 1 227 ? 49.806  -6.940  11.237  1.00 23.52 ? 224 ARG A CG    1 
ATOM   1706 C CD    . ARG A 1 227 ? 48.952  -6.298  10.191  1.00 24.69 ? 224 ARG A CD    1 
ATOM   1707 N NE    . ARG A 1 227 ? 47.691  -6.988  9.938   1.00 24.83 ? 224 ARG A NE    1 
ATOM   1708 C CZ    . ARG A 1 227 ? 47.074  -7.063  8.756   1.00 23.85 ? 224 ARG A CZ    1 
ATOM   1709 N NH1   . ARG A 1 227 ? 47.609  -6.562  7.659   1.00 25.83 ? 224 ARG A NH1   1 
ATOM   1710 N NH2   . ARG A 1 227 ? 45.912  -7.676  8.666   1.00 23.18 ? 224 ARG A NH2   1 
ATOM   1711 N N     . THR A 1 228 ? 47.418  -6.406  14.998  1.00 22.43 ? 225 THR A N     1 
ATOM   1712 C CA    . THR A 1 228 ? 46.820  -6.798  16.274  1.00 22.13 ? 225 THR A CA    1 
ATOM   1713 C C     . THR A 1 228 ? 45.624  -7.732  16.105  1.00 21.75 ? 225 THR A C     1 
ATOM   1714 O O     . THR A 1 228 ? 44.965  -7.750  15.046  1.00 20.25 ? 225 THR A O     1 
ATOM   1715 C CB    . THR A 1 228 ? 46.365  -5.560  17.123  1.00 22.34 ? 225 THR A CB    1 
ATOM   1716 O OG1   . THR A 1 228 ? 45.845  -6.015  18.377  1.00 21.46 ? 225 THR A OG1   1 
ATOM   1717 C CG2   . THR A 1 228 ? 45.308  -4.754  16.417  1.00 22.51 ? 225 THR A CG2   1 
ATOM   1718 N N     . MET A 1 229 ? 45.342  -8.485  17.170  1.00 21.64 ? 226 MET A N     1 
ATOM   1719 C CA    . MET A 1 229 ? 44.111  -9.282  17.251  1.00 22.23 ? 226 MET A CA    1 
ATOM   1720 C C     . MET A 1 229 ? 43.052  -8.574  18.096  1.00 22.50 ? 226 MET A C     1 
ATOM   1721 O O     . MET A 1 229 ? 41.965  -9.109  18.358  1.00 22.81 ? 226 MET A O     1 
ATOM   1722 C CB    . MET A 1 229 ? 44.413  -10.666 17.821  1.00 22.41 ? 226 MET A CB    1 
ATOM   1723 C CG    . MET A 1 229 ? 45.470  -11.450 17.039  1.00 21.86 ? 226 MET A CG    1 
ATOM   1724 S SD    . MET A 1 229 ? 45.567  -13.224 17.491  1.00 23.04 ? 226 MET A SD    1 
ATOM   1725 C CE    . MET A 1 229 ? 43.990  -13.828 16.953  1.00 22.41 ? 226 MET A CE    1 
ATOM   1726 N N     . SER A 1 230 ? 43.340  -7.345  18.499  1.00 22.80 ? 227 SER A N     1 
ATOM   1727 C CA    . SER A 1 230 ? 42.467  -6.637  19.430  1.00 23.05 ? 227 SER A CA    1 
ATOM   1728 C C     . SER A 1 230 ? 41.214  -6.029  18.811  1.00 23.22 ? 227 SER A C     1 
ATOM   1729 O O     . SER A 1 230 ? 40.198  -5.882  19.487  1.00 23.22 ? 227 SER A O     1 
ATOM   1730 C CB    . SER A 1 230 ? 43.251  -5.549  20.169  1.00 22.87 ? 227 SER A CB    1 
ATOM   1731 O OG    . SER A 1 230 ? 44.189  -6.160  21.019  1.00 24.26 ? 227 SER A OG    1 
HETATM 1732 N N1    . LLP A 1 231 ? 47.732  0.805   17.128  1.00 25.22 ? 228 LLP A N1    1 
HETATM 1733 C C2    . LLP A 1 231 ? 46.669  1.665   17.094  1.00 25.74 ? 228 LLP A C2    1 
HETATM 1734 C "C2'" . LLP A 1 231 ? 46.780  2.908   16.268  1.00 25.24 ? 228 LLP A "C2'" 1 
HETATM 1735 C C3    . LLP A 1 231 ? 45.511  1.388   17.820  1.00 25.28 ? 228 LLP A C3    1 
HETATM 1736 O O3    . LLP A 1 231 ? 44.568  2.171   17.782  1.00 25.40 ? 228 LLP A O3    1 
HETATM 1737 C C4    . LLP A 1 231 ? 45.434  0.227   18.592  1.00 25.59 ? 228 LLP A C4    1 
HETATM 1738 C "C4'" . LLP A 1 231 ? 44.198  -0.148  19.380  1.00 26.11 ? 228 LLP A "C4'" 1 
HETATM 1739 C C5    . LLP A 1 231 ? 46.519  -0.635  18.606  1.00 26.81 ? 228 LLP A C5    1 
HETATM 1740 C C6    . LLP A 1 231 ? 47.670  -0.345  17.878  1.00 26.64 ? 228 LLP A C6    1 
HETATM 1741 C "C5'" . LLP A 1 231 ? 46.410  -1.912  19.381  1.00 26.27 ? 228 LLP A "C5'" 1 
HETATM 1742 O OP4   . LLP A 1 231 ? 47.094  -2.130  20.604  1.00 26.68 ? 228 LLP A OP4   1 
HETATM 1743 P P     . LLP A 1 231 ? 46.951  -3.574  21.253  1.00 25.99 ? 228 LLP A P     1 
HETATM 1744 O OP1   . LLP A 1 231 ? 45.563  -3.552  21.743  1.00 26.63 ? 228 LLP A OP1   1 
HETATM 1745 O OP2   . LLP A 1 231 ? 47.218  -4.621  20.249  1.00 24.76 ? 228 LLP A OP2   1 
HETATM 1746 O OP3   . LLP A 1 231 ? 48.029  -3.429  22.255  1.00 25.66 ? 228 LLP A OP3   1 
HETATM 1747 N N     . LLP A 1 231 ? 41.281  -5.687  17.531  1.00 23.72 ? 228 LLP A N     1 
HETATM 1748 C CA    . LLP A 1 231 ? 40.278  -4.829  16.916  1.00 23.76 ? 228 LLP A CA    1 
HETATM 1749 C CB    . LLP A 1 231 ? 40.966  -3.659  16.175  1.00 23.84 ? 228 LLP A CB    1 
HETATM 1750 C CG    . LLP A 1 231 ? 41.961  -2.850  17.062  1.00 24.21 ? 228 LLP A CG    1 
HETATM 1751 C CD    . LLP A 1 231 ? 41.250  -1.942  18.072  1.00 25.70 ? 228 LLP A CD    1 
HETATM 1752 C CE    . LLP A 1 231 ? 42.168  -1.399  19.181  1.00 25.53 ? 228 LLP A CE    1 
HETATM 1753 N NZ    . LLP A 1 231 ? 43.503  -1.032  18.630  1.00 27.21 ? 228 LLP A NZ    1 
HETATM 1754 C C     . LLP A 1 231 ? 39.320  -5.649  16.046  1.00 23.70 ? 228 LLP A C     1 
HETATM 1755 O O     . LLP A 1 231 ? 38.301  -6.128  16.552  1.00 23.82 ? 228 LLP A O     1 
ATOM   1756 N N     . ALA A 1 232 ? 39.617  -5.828  14.764  1.00 23.37 ? 229 ALA A N     1 
ATOM   1757 C CA    . ALA A 1 232 ? 38.735  -6.607  13.900  1.00 23.44 ? 229 ALA A CA    1 
ATOM   1758 C C     . ALA A 1 232 ? 38.691  -8.070  14.320  1.00 23.44 ? 229 ALA A C     1 
ATOM   1759 O O     . ALA A 1 232 ? 37.643  -8.736  14.190  1.00 23.53 ? 229 ALA A O     1 
ATOM   1760 C CB    . ALA A 1 232 ? 39.151  -6.481  12.426  1.00 23.57 ? 229 ALA A CB    1 
ATOM   1761 N N     . PHE A 1 233 ? 39.808  -8.561  14.854  1.00 23.12 ? 230 PHE A N     1 
ATOM   1762 C CA    . PHE A 1 233 ? 39.920  -9.977  15.229  1.00 23.48 ? 230 PHE A CA    1 
ATOM   1763 C C     . PHE A 1 233 ? 39.204  -10.289 16.544  1.00 22.98 ? 230 PHE A C     1 
ATOM   1764 O O     . PHE A 1 233 ? 39.260  -11.410 17.002  1.00 23.53 ? 230 PHE A O     1 
ATOM   1765 C CB    . PHE A 1 233 ? 41.392  -10.387 15.298  1.00 23.45 ? 230 PHE A CB    1 
ATOM   1766 C CG    . PHE A 1 233 ? 41.750  -11.603 14.479  1.00 23.36 ? 230 PHE A CG    1 
ATOM   1767 C CD1   . PHE A 1 233 ? 41.104  -12.819 14.668  1.00 25.28 ? 230 PHE A CD1   1 
ATOM   1768 C CD2   . PHE A 1 233 ? 42.791  -11.547 13.561  1.00 24.96 ? 230 PHE A CD2   1 
ATOM   1769 C CE1   . PHE A 1 233 ? 41.459  -13.939 13.939  1.00 24.01 ? 230 PHE A CE1   1 
ATOM   1770 C CE2   . PHE A 1 233 ? 43.156  -12.675 12.828  1.00 24.53 ? 230 PHE A CE2   1 
ATOM   1771 C CZ    . PHE A 1 233 ? 42.485  -13.870 13.027  1.00 24.10 ? 230 PHE A CZ    1 
ATOM   1772 N N     . ASP A 1 234 ? 38.572  -9.295  17.171  1.00 23.20 ? 231 ASP A N     1 
ATOM   1773 C CA    . ASP A 1 234 ? 37.573  -9.544  18.220  1.00 23.09 ? 231 ASP A CA    1 
ATOM   1774 C C     . ASP A 1 234 ? 38.174  -10.197 19.481  1.00 23.17 ? 231 ASP A C     1 
ATOM   1775 O O     . ASP A 1 234 ? 37.504  -10.972 20.179  1.00 22.89 ? 231 ASP A O     1 
ATOM   1776 C CB    . ASP A 1 234 ? 36.468  -10.422 17.617  1.00 23.03 ? 231 ASP A CB    1 
ATOM   1777 C CG    . ASP A 1 234 ? 35.159  -10.403 18.409  1.00 23.53 ? 231 ASP A CG    1 
ATOM   1778 O OD1   . ASP A 1 234 ? 34.663  -9.315  18.751  1.00 20.65 ? 231 ASP A OD1   1 
ATOM   1779 O OD2   . ASP A 1 234 ? 34.606  -11.504 18.656  1.00 24.82 ? 231 ASP A OD2   1 
ATOM   1780 N N     . PHE A 1 235 ? 39.427  -9.861  19.785  1.00 22.83 ? 232 PHE A N     1 
ATOM   1781 C CA    . PHE A 1 235 ? 40.179  -10.565 20.811  1.00 22.83 ? 232 PHE A CA    1 
ATOM   1782 C C     . PHE A 1 235 ? 41.081  -9.657  21.664  1.00 22.29 ? 232 PHE A C     1 
ATOM   1783 O O     . PHE A 1 235 ? 42.177  -10.048 22.045  1.00 22.25 ? 232 PHE A O     1 
ATOM   1784 C CB    . PHE A 1 235 ? 41.003  -11.666 20.127  1.00 23.96 ? 232 PHE A CB    1 
ATOM   1785 C CG    . PHE A 1 235 ? 41.154  -12.915 20.949  1.00 24.35 ? 232 PHE A CG    1 
ATOM   1786 C CD1   . PHE A 1 235 ? 40.042  -13.685 21.265  1.00 25.81 ? 232 PHE A CD1   1 
ATOM   1787 C CD2   . PHE A 1 235 ? 42.402  -13.335 21.375  1.00 25.13 ? 232 PHE A CD2   1 
ATOM   1788 C CE1   . PHE A 1 235 ? 40.180  -14.852 22.016  1.00 26.55 ? 232 PHE A CE1   1 
ATOM   1789 C CE2   . PHE A 1 235 ? 42.551  -14.487 22.119  1.00 25.22 ? 232 PHE A CE2   1 
ATOM   1790 C CZ    . PHE A 1 235 ? 41.436  -15.248 22.450  1.00 25.30 ? 232 PHE A CZ    1 
ATOM   1791 N N     . ALA A 1 236 ? 40.617  -8.448  21.963  1.00 21.43 ? 233 ALA A N     1 
ATOM   1792 C CA    . ALA A 1 236 ? 41.398  -7.500  22.771  1.00 21.38 ? 233 ALA A CA    1 
ATOM   1793 C C     . ALA A 1 236 ? 41.733  -8.043  24.163  1.00 21.19 ? 233 ALA A C     1 
ATOM   1794 O O     . ALA A 1 236 ? 42.829  -7.809  24.676  1.00 21.33 ? 233 ALA A O     1 
ATOM   1795 C CB    . ALA A 1 236 ? 40.668  -6.164  22.882  1.00 20.75 ? 233 ALA A CB    1 
ATOM   1796 N N     . GLY A 1 237 ? 40.796  -8.790  24.755  1.00 21.18 ? 234 GLY A N     1 
ATOM   1797 C CA    . GLY A 1 237 ? 41.018  -9.481  26.019  1.00 21.02 ? 234 GLY A CA    1 
ATOM   1798 C C     . GLY A 1 237 ? 42.224  -10.408 26.045  1.00 21.12 ? 234 GLY A C     1 
ATOM   1799 O O     . GLY A 1 237 ? 42.810  -10.623 27.113  1.00 21.26 ? 234 GLY A O     1 
ATOM   1800 N N     . GLY A 1 238 ? 42.580  -10.970 24.890  1.00 21.19 ? 235 GLY A N     1 
ATOM   1801 C CA    . GLY A 1 238 ? 43.748  -11.876 24.763  1.00 21.32 ? 235 GLY A CA    1 
ATOM   1802 C C     . GLY A 1 238 ? 45.097  -11.202 24.578  1.00 21.40 ? 235 GLY A C     1 
ATOM   1803 O O     . GLY A 1 238 ? 46.125  -11.861 24.616  1.00 22.27 ? 235 GLY A O     1 
ATOM   1804 N N     . ARG A 1 239 ? 45.092  -9.889  24.374  1.00 21.24 ? 236 ARG A N     1 
ATOM   1805 C CA    . ARG A 1 239 ? 46.306  -9.091  24.299  1.00 21.19 ? 236 ARG A CA    1 
ATOM   1806 C C     . ARG A 1 239 ? 47.355  -9.736  23.403  1.00 21.02 ? 236 ARG A C     1 
ATOM   1807 O O     . ARG A 1 239 ? 48.371  -10.237 23.878  1.00 20.66 ? 236 ARG A O     1 
ATOM   1808 C CB    . ARG A 1 239 ? 46.880  -8.867  25.706  1.00 21.22 ? 236 ARG A CB    1 
ATOM   1809 C CG    . ARG A 1 239 ? 45.889  -8.389  26.757  1.00 20.41 ? 236 ARG A CG    1 
ATOM   1810 C CD    . ARG A 1 239 ? 45.282  -7.045  26.439  1.00 20.05 ? 236 ARG A CD    1 
ATOM   1811 N NE    . ARG A 1 239 ? 46.307  -6.078  26.088  1.00 17.26 ? 236 ARG A NE    1 
ATOM   1812 C CZ    . ARG A 1 239 ? 46.439  -5.480  24.901  1.00 18.64 ? 236 ARG A CZ    1 
ATOM   1813 N NH1   . ARG A 1 239 ? 45.605  -5.696  23.890  1.00 20.26 ? 236 ARG A NH1   1 
ATOM   1814 N NH2   . ARG A 1 239 ? 47.440  -4.644  24.733  1.00 19.73 ? 236 ARG A NH2   1 
ATOM   1815 N N     . LEU A 1 240 ? 47.087  -9.750  22.102  1.00 21.24 ? 237 LEU A N     1 
ATOM   1816 C CA    . LEU A 1 240 ? 47.996  -10.375 21.152  1.00 21.11 ? 237 LEU A CA    1 
ATOM   1817 C C     . LEU A 1 240 ? 48.223  -9.440  19.996  1.00 20.82 ? 237 LEU A C     1 
ATOM   1818 O O     . LEU A 1 240 ? 47.314  -9.139  19.230  1.00 21.04 ? 237 LEU A O     1 
ATOM   1819 C CB    . LEU A 1 240 ? 47.435  -11.722 20.669  1.00 21.29 ? 237 LEU A CB    1 
ATOM   1820 C CG    . LEU A 1 240 ? 48.460  -12.760 20.198  1.00 21.55 ? 237 LEU A CG    1 
ATOM   1821 C CD1   . LEU A 1 240 ? 49.079  -12.377 18.843  1.00 21.10 ? 237 LEU A CD1   1 
ATOM   1822 C CD2   . LEU A 1 240 ? 49.541  -13.002 21.263  1.00 21.48 ? 237 LEU A CD2   1 
ATOM   1823 N N     . GLY A 1 241 ? 49.436  -8.940  19.906  1.00 20.62 ? 238 GLY A N     1 
ATOM   1824 C CA    . GLY A 1 241 ? 49.849  -8.145  18.769  1.00 20.92 ? 238 GLY A CA    1 
ATOM   1825 C C     . GLY A 1 241 ? 51.020  -8.846  18.137  1.00 20.94 ? 238 GLY A C     1 
ATOM   1826 O O     . GLY A 1 241 ? 51.675  -9.657  18.762  1.00 20.96 ? 238 GLY A O     1 
ATOM   1827 N N     . TYR A 1 242 ? 51.283  -8.526  16.889  1.00 21.20 ? 239 TYR A N     1 
ATOM   1828 C CA    . TYR A 1 242 ? 52.381  -9.135  16.173  1.00 21.33 ? 239 TYR A CA    1 
ATOM   1829 C C     . TYR A 1 242 ? 52.858  -8.198  15.079  1.00 21.66 ? 239 TYR A C     1 
ATOM   1830 O O     . TYR A 1 242 ? 52.211  -7.197  14.775  1.00 21.34 ? 239 TYR A O     1 
ATOM   1831 C CB    . TYR A 1 242 ? 51.942  -10.477 15.581  1.00 20.44 ? 239 TYR A CB    1 
ATOM   1832 C CG    . TYR A 1 242 ? 50.798  -10.381 14.596  1.00 19.51 ? 239 TYR A CG    1 
ATOM   1833 C CD1   . TYR A 1 242 ? 49.489  -10.223 15.033  1.00 18.27 ? 239 TYR A CD1   1 
ATOM   1834 C CD2   . TYR A 1 242 ? 51.016  -10.464 13.236  1.00 19.49 ? 239 TYR A CD2   1 
ATOM   1835 C CE1   . TYR A 1 242 ? 48.450  -10.117 14.147  1.00 18.03 ? 239 TYR A CE1   1 
ATOM   1836 C CE2   . TYR A 1 242 ? 49.962  -10.378 12.339  1.00 20.32 ? 239 TYR A CE2   1 
ATOM   1837 C CZ    . TYR A 1 242 ? 48.682  -10.215 12.812  1.00 18.76 ? 239 TYR A CZ    1 
ATOM   1838 O OH    . TYR A 1 242 ? 47.636  -10.110 11.943  1.00 20.16 ? 239 TYR A OH    1 
ATOM   1839 N N     . PHE A 1 243 ? 54.013  -8.510  14.508  1.00 22.82 ? 240 PHE A N     1 
ATOM   1840 C CA    . PHE A 1 243 ? 54.451  -7.822  13.306  1.00 23.03 ? 240 PHE A CA    1 
ATOM   1841 C C     . PHE A 1 243 ? 54.878  -8.794  12.210  1.00 23.60 ? 240 PHE A C     1 
ATOM   1842 O O     . PHE A 1 243 ? 55.264  -9.940  12.481  1.00 22.79 ? 240 PHE A O     1 
ATOM   1843 C CB    . PHE A 1 243 ? 55.519  -6.755  13.593  1.00 23.35 ? 240 PHE A CB    1 
ATOM   1844 C CG    . PHE A 1 243 ? 56.897  -7.277  13.884  1.00 23.29 ? 240 PHE A CG    1 
ATOM   1845 C CD1   . PHE A 1 243 ? 57.660  -7.897  12.893  1.00 24.61 ? 240 PHE A CD1   1 
ATOM   1846 C CD2   . PHE A 1 243 ? 57.464  -7.084  15.135  1.00 23.24 ? 240 PHE A CD2   1 
ATOM   1847 C CE1   . PHE A 1 243 ? 58.940  -8.358  13.164  1.00 24.01 ? 240 PHE A CE1   1 
ATOM   1848 C CE2   . PHE A 1 243 ? 58.740  -7.533  15.417  1.00 23.83 ? 240 PHE A CE2   1 
ATOM   1849 C CZ    . PHE A 1 243 ? 59.489  -8.160  14.428  1.00 25.10 ? 240 PHE A CZ    1 
ATOM   1850 N N     . VAL A 1 244 ? 54.771  -8.309  10.972  1.00 23.60 ? 241 VAL A N     1 
ATOM   1851 C CA    . VAL A 1 244 ? 55.278  -9.012  9.812   1.00 23.83 ? 241 VAL A CA    1 
ATOM   1852 C C     . VAL A 1 244 ? 56.479  -8.221  9.262   1.00 24.15 ? 241 VAL A C     1 
ATOM   1853 O O     . VAL A 1 244 ? 56.407  -7.006  9.084   1.00 24.15 ? 241 VAL A O     1 
ATOM   1854 C CB    . VAL A 1 244 ? 54.190  -9.193  8.728   1.00 23.95 ? 241 VAL A CB    1 
ATOM   1855 C CG1   . VAL A 1 244 ? 54.615  -10.258 7.737   1.00 22.51 ? 241 VAL A CG1   1 
ATOM   1856 C CG2   . VAL A 1 244 ? 52.817  -9.567  9.360   1.00 22.28 ? 241 VAL A CG2   1 
ATOM   1857 N N     . ALA A 1 245 ? 57.583  -8.911  9.013   1.00 24.58 ? 242 ALA A N     1 
ATOM   1858 C CA    . ALA A 1 245 ? 58.786  -8.263  8.502   1.00 24.89 ? 242 ALA A CA    1 
ATOM   1859 C C     . ALA A 1 245 ? 59.768  -9.285  7.943   1.00 25.34 ? 242 ALA A C     1 
ATOM   1860 O O     . ALA A 1 245 ? 59.465  -10.480 7.875   1.00 25.03 ? 242 ALA A O     1 
ATOM   1861 C CB    . ALA A 1 245 ? 59.439  -7.436  9.594   1.00 24.48 ? 242 ALA A CB    1 
ATOM   1862 N N     . ASN A 1 246 ? 60.936  -8.799  7.527   1.00 25.89 ? 243 ASN A N     1 
ATOM   1863 C CA    . ASN A 1 246 ? 62.044  -9.657  7.116   1.00 26.23 ? 243 ASN A CA    1 
ATOM   1864 C C     . ASN A 1 246 ? 62.634  -10.357 8.359   1.00 26.62 ? 243 ASN A C     1 
ATOM   1865 O O     . ASN A 1 246 ? 62.782  -9.736  9.411   1.00 25.86 ? 243 ASN A O     1 
ATOM   1866 C CB    . ASN A 1 246 ? 63.098  -8.822  6.379   1.00 26.31 ? 243 ASN A CB    1 
ATOM   1867 C CG    . ASN A 1 246 ? 64.308  -9.632  5.952   1.00 26.71 ? 243 ASN A CG    1 
ATOM   1868 O OD1   . ASN A 1 246 ? 65.209  -9.896  6.757   1.00 27.59 ? 243 ASN A OD1   1 
ATOM   1869 N ND2   . ASN A 1 246 ? 64.337  -10.031 4.685   1.00 25.74 ? 243 ASN A ND2   1 
ATOM   1870 N N     . PRO A 1 247 ? 62.973  -11.658 8.246   1.00 27.06 ? 244 PRO A N     1 
ATOM   1871 C CA    . PRO A 1 247 ? 63.392  -12.408 9.433   1.00 27.60 ? 244 PRO A CA    1 
ATOM   1872 C C     . PRO A 1 247 ? 64.515  -11.802 10.274  1.00 28.09 ? 244 PRO A C     1 
ATOM   1873 O O     . PRO A 1 247 ? 64.634  -12.147 11.452  1.00 28.71 ? 244 PRO A O     1 
ATOM   1874 C CB    . PRO A 1 247 ? 63.823  -13.764 8.856   1.00 27.71 ? 244 PRO A CB    1 
ATOM   1875 C CG    . PRO A 1 247 ? 63.053  -13.900 7.616   1.00 27.29 ? 244 PRO A CG    1 
ATOM   1876 C CD    . PRO A 1 247 ? 62.973  -12.517 7.047   1.00 27.48 ? 244 PRO A CD    1 
ATOM   1877 N N     . ALA A 1 248 ? 65.328  -10.923 9.690   1.00 28.19 ? 245 ALA A N     1 
ATOM   1878 C CA    . ALA A 1 248 ? 66.355  -10.202 10.446  1.00 28.16 ? 245 ALA A CA    1 
ATOM   1879 C C     . ALA A 1 248 ? 65.744  -9.390  11.592  1.00 28.17 ? 245 ALA A C     1 
ATOM   1880 O O     . ALA A 1 248 ? 66.350  -9.236  12.648  1.00 28.14 ? 245 ALA A O     1 
ATOM   1881 C CB    . ALA A 1 248 ? 67.155  -9.299  9.520   1.00 27.77 ? 245 ALA A CB    1 
ATOM   1882 N N     . PHE A 1 249 ? 64.539  -8.868  11.389  1.00 28.82 ? 246 PHE A N     1 
ATOM   1883 C CA    . PHE A 1 249 ? 63.844  -8.124  12.466  1.00 28.85 ? 246 PHE A CA    1 
ATOM   1884 C C     . PHE A 1 249 ? 63.487  -9.012  13.663  1.00 28.88 ? 246 PHE A C     1 
ATOM   1885 O O     . PHE A 1 249 ? 63.489  -8.560  14.811  1.00 28.34 ? 246 PHE A O     1 
ATOM   1886 C CB    . PHE A 1 249 ? 62.602  -7.423  11.931  1.00 28.52 ? 246 PHE A CB    1 
ATOM   1887 C CG    . PHE A 1 249 ? 62.908  -6.166  11.190  1.00 28.91 ? 246 PHE A CG    1 
ATOM   1888 C CD1   . PHE A 1 249 ? 63.163  -4.990  11.880  1.00 28.48 ? 246 PHE A CD1   1 
ATOM   1889 C CD2   . PHE A 1 249 ? 62.955  -6.151  9.801   1.00 28.00 ? 246 PHE A CD2   1 
ATOM   1890 C CE1   . PHE A 1 249 ? 63.448  -3.816  11.197  1.00 29.06 ? 246 PHE A CE1   1 
ATOM   1891 C CE2   . PHE A 1 249 ? 63.246  -4.973  9.114   1.00 27.99 ? 246 PHE A CE2   1 
ATOM   1892 C CZ    . PHE A 1 249 ? 63.492  -3.813  9.809   1.00 28.12 ? 246 PHE A CZ    1 
ATOM   1893 N N     . ILE A 1 250 ? 63.214  -10.282 13.396  1.00 29.15 ? 247 ILE A N     1 
ATOM   1894 C CA    . ILE A 1 250 ? 62.945  -11.236 14.468  1.00 29.37 ? 247 ILE A CA    1 
ATOM   1895 C C     . ILE A 1 250 ? 64.197  -11.504 15.294  1.00 29.71 ? 247 ILE A C     1 
ATOM   1896 O O     . ILE A 1 250 ? 64.138  -11.566 16.522  1.00 30.02 ? 247 ILE A O     1 
ATOM   1897 C CB    . ILE A 1 250 ? 62.358  -12.551 13.924  1.00 29.05 ? 247 ILE A CB    1 
ATOM   1898 C CG1   . ILE A 1 250 ? 60.875  -12.378 13.612  1.00 29.15 ? 247 ILE A CG1   1 
ATOM   1899 C CG2   . ILE A 1 250 ? 62.491  -13.670 14.951  1.00 30.04 ? 247 ILE A CG2   1 
ATOM   1900 C CD1   . ILE A 1 250 ? 60.550  -11.439 12.433  1.00 29.28 ? 247 ILE A CD1   1 
ATOM   1901 N N     . ASP A 1 251 ? 65.334  -11.650 14.621  1.00 30.03 ? 248 ASP A N     1 
ATOM   1902 C CA    . ASP A 1 251 ? 66.617  -11.731 15.306  1.00 30.10 ? 248 ASP A CA    1 
ATOM   1903 C C     . ASP A 1 251 ? 66.818  -10.515 16.210  1.00 29.57 ? 248 ASP A C     1 
ATOM   1904 O O     . ASP A 1 251 ? 67.266  -10.649 17.339  1.00 29.65 ? 248 ASP A O     1 
ATOM   1905 C CB    . ASP A 1 251 ? 67.781  -11.812 14.300  1.00 30.58 ? 248 ASP A CB    1 
ATOM   1906 C CG    . ASP A 1 251 ? 67.804  -13.117 13.516  1.00 33.47 ? 248 ASP A CG    1 
ATOM   1907 O OD1   . ASP A 1 251 ? 66.825  -13.895 13.572  1.00 36.12 ? 248 ASP A OD1   1 
ATOM   1908 O OD2   . ASP A 1 251 ? 68.816  -13.363 12.821  1.00 38.89 ? 248 ASP A OD2   1 
ATOM   1909 N N     . ALA A 1 252 ? 66.502  -9.333  15.687  1.00 29.49 ? 249 ALA A N     1 
ATOM   1910 C CA    . ALA A 1 252 ? 66.656  -8.068  16.412  1.00 29.36 ? 249 ALA A CA    1 
ATOM   1911 C C     . ALA A 1 252 ? 65.852  -8.014  17.717  1.00 29.32 ? 249 ALA A C     1 
ATOM   1912 O O     . ALA A 1 252 ? 66.399  -7.704  18.780  1.00 28.78 ? 249 ALA A O     1 
ATOM   1913 C CB    . ALA A 1 252 ? 66.245  -6.905  15.512  1.00 29.12 ? 249 ALA A CB    1 
ATOM   1914 N N     . VAL A 1 253 ? 64.552  -8.287  17.636  1.00 29.22 ? 250 VAL A N     1 
ATOM   1915 C CA    . VAL A 1 253 ? 63.699  -8.147  18.826  1.00 29.69 ? 250 VAL A CA    1 
ATOM   1916 C C     . VAL A 1 253 ? 63.930  -9.256  19.845  1.00 29.98 ? 250 VAL A C     1 
ATOM   1917 O O     . VAL A 1 253 ? 63.606  -9.099  21.016  1.00 29.73 ? 250 VAL A O     1 
ATOM   1918 C CB    . VAL A 1 253 ? 62.194  -8.004  18.486  1.00 29.28 ? 250 VAL A CB    1 
ATOM   1919 C CG1   . VAL A 1 253 ? 61.968  -6.727  17.666  1.00 28.56 ? 250 VAL A CG1   1 
ATOM   1920 C CG2   . VAL A 1 253 ? 61.654  -9.247  17.788  1.00 28.00 ? 250 VAL A CG2   1 
ATOM   1921 N N     . MET A 1 254 ? 64.529  -10.356 19.404  1.00 30.68 ? 251 MET A N     1 
ATOM   1922 C CA    . MET A 1 254 ? 64.893  -11.441 20.311  1.00 31.43 ? 251 MET A CA    1 
ATOM   1923 C C     . MET A 1 254 ? 66.005  -11.062 21.276  1.00 30.87 ? 251 MET A C     1 
ATOM   1924 O O     . MET A 1 254 ? 66.136  -11.684 22.321  1.00 31.34 ? 251 MET A O     1 
ATOM   1925 C CB    . MET A 1 254 ? 65.266  -12.709 19.531  1.00 31.92 ? 251 MET A CB    1 
ATOM   1926 C CG    . MET A 1 254 ? 64.058  -13.606 19.272  1.00 33.36 ? 251 MET A CG    1 
ATOM   1927 S SD    . MET A 1 254 ? 64.495  -15.089 18.366  1.00 36.95 ? 251 MET A SD    1 
ATOM   1928 C CE    . MET A 1 254 ? 65.514  -15.946 19.587  1.00 38.05 ? 251 MET A CE    1 
ATOM   1929 N N     . LEU A 1 255 ? 66.792  -10.044 20.924  1.00 30.23 ? 252 LEU A N     1 
ATOM   1930 C CA    . LEU A 1 255 ? 67.789  -9.488  21.816  1.00 29.60 ? 252 LEU A CA    1 
ATOM   1931 C C     . LEU A 1 255 ? 67.208  -8.584  22.908  1.00 29.21 ? 252 LEU A C     1 
ATOM   1932 O O     . LEU A 1 255 ? 67.907  -8.277  23.886  1.00 28.76 ? 252 LEU A O     1 
ATOM   1933 C CB    . LEU A 1 255 ? 68.811  -8.668  21.018  1.00 30.11 ? 252 LEU A CB    1 
ATOM   1934 C CG    . LEU A 1 255 ? 69.598  -9.394  19.933  1.00 30.51 ? 252 LEU A CG    1 
ATOM   1935 C CD1   . LEU A 1 255 ? 70.536  -8.419  19.243  1.00 31.61 ? 252 LEU A CD1   1 
ATOM   1936 C CD2   . LEU A 1 255 ? 70.363  -10.570 20.522  1.00 30.60 ? 252 LEU A CD2   1 
ATOM   1937 N N     . VAL A 1 256 ? 65.960  -8.135  22.737  1.00 27.97 ? 253 VAL A N     1 
ATOM   1938 C CA    . VAL A 1 256 ? 65.353  -7.184  23.677  1.00 27.49 ? 253 VAL A CA    1 
ATOM   1939 C C     . VAL A 1 256 ? 64.095  -7.688  24.413  1.00 26.94 ? 253 VAL A C     1 
ATOM   1940 O O     . VAL A 1 256 ? 63.775  -7.194  25.499  1.00 26.32 ? 253 VAL A O     1 
ATOM   1941 C CB    . VAL A 1 256 ? 65.044  -5.836  22.980  1.00 27.45 ? 253 VAL A CB    1 
ATOM   1942 C CG1   . VAL A 1 256 ? 66.336  -5.239  22.362  1.00 26.00 ? 253 VAL A CG1   1 
ATOM   1943 C CG2   . VAL A 1 256 ? 63.983  -6.032  21.914  1.00 27.03 ? 253 VAL A CG2   1 
ATOM   1944 N N     . ARG A 1 257 ? 63.395  -8.661  23.837  1.00 26.46 ? 254 ARG A N     1 
ATOM   1945 C CA    . ARG A 1 257 ? 62.204  -9.222  24.473  1.00 26.45 ? 254 ARG A CA    1 
ATOM   1946 C C     . ARG A 1 257 ? 62.529  -9.865  25.814  1.00 25.85 ? 254 ARG A C     1 
ATOM   1947 O O     . ARG A 1 257 ? 63.621  -10.383 25.997  1.00 25.69 ? 254 ARG A O     1 
ATOM   1948 C CB    . ARG A 1 257 ? 61.536  -10.248 23.555  1.00 27.41 ? 254 ARG A CB    1 
ATOM   1949 C CG    . ARG A 1 257 ? 62.366  -11.489 23.251  1.00 28.08 ? 254 ARG A CG    1 
ATOM   1950 C CD    . ARG A 1 257 ? 62.051  -12.641 24.186  1.00 30.44 ? 254 ARG A CD    1 
ATOM   1951 N NE    . ARG A 1 257 ? 62.838  -13.821 23.826  1.00 31.34 ? 254 ARG A NE    1 
ATOM   1952 C CZ    . ARG A 1 257 ? 64.041  -14.109 24.333  1.00 33.42 ? 254 ARG A CZ    1 
ATOM   1953 N NH1   . ARG A 1 257 ? 64.629  -13.311 25.220  1.00 33.83 ? 254 ARG A NH1   1 
ATOM   1954 N NH2   . ARG A 1 257 ? 64.672  -15.207 23.936  1.00 33.76 ? 254 ARG A NH2   1 
ATOM   1955 N N     . LEU A 1 258 ? 61.580  -9.807  26.747  1.00 25.49 ? 255 LEU A N     1 
ATOM   1956 C CA    . LEU A 1 258 ? 61.660  -10.553 28.012  1.00 25.20 ? 255 LEU A CA    1 
ATOM   1957 C C     . LEU A 1 258 ? 61.457  -12.025 27.686  1.00 24.60 ? 255 LEU A C     1 
ATOM   1958 O O     . LEU A 1 258 ? 60.515  -12.373 26.977  1.00 24.66 ? 255 LEU A O     1 
ATOM   1959 C CB    . LEU A 1 258 ? 60.573  -10.102 29.005  1.00 24.84 ? 255 LEU A CB    1 
ATOM   1960 C CG    . LEU A 1 258 ? 60.602  -8.632  29.453  1.00 24.69 ? 255 LEU A CG    1 
ATOM   1961 C CD1   . LEU A 1 258 ? 59.354  -8.255  30.254  1.00 22.78 ? 255 LEU A CD1   1 
ATOM   1962 C CD2   . LEU A 1 258 ? 61.839  -8.365  30.257  1.00 22.98 ? 255 LEU A CD2   1 
ATOM   1963 N N     . PRO A 1 259 ? 62.364  -12.890 28.132  1.00 24.35 ? 256 PRO A N     1 
ATOM   1964 C CA    . PRO A 1 259 ? 62.111  -14.291 27.849  1.00 24.60 ? 256 PRO A CA    1 
ATOM   1965 C C     . PRO A 1 259 ? 60.806  -14.771 28.479  1.00 24.25 ? 256 PRO A C     1 
ATOM   1966 O O     . PRO A 1 259 ? 60.460  -14.345 29.568  1.00 24.19 ? 256 PRO A O     1 
ATOM   1967 C CB    . PRO A 1 259 ? 63.335  -15.005 28.432  1.00 24.53 ? 256 PRO A CB    1 
ATOM   1968 C CG    . PRO A 1 259 ? 63.976  -14.057 29.326  1.00 24.64 ? 256 PRO A CG    1 
ATOM   1969 C CD    . PRO A 1 259 ? 63.647  -12.689 28.825  1.00 24.81 ? 256 PRO A CD    1 
ATOM   1970 N N     . TYR A 1 260 ? 60.090  -15.624 27.752  1.00 24.61 ? 257 TYR A N     1 
ATOM   1971 C CA    . TYR A 1 260 ? 58.772  -16.156 28.157  1.00 24.45 ? 257 TYR A CA    1 
ATOM   1972 C C     . TYR A 1 260 ? 57.724  -15.053 28.285  1.00 24.30 ? 257 TYR A C     1 
ATOM   1973 O O     . TYR A 1 260 ? 56.791  -15.142 29.088  1.00 23.66 ? 257 TYR A O     1 
ATOM   1974 C CB    . TYR A 1 260 ? 58.868  -16.959 29.459  1.00 24.87 ? 257 TYR A CB    1 
ATOM   1975 C CG    . TYR A 1 260 ? 60.020  -17.940 29.513  1.00 24.39 ? 257 TYR A CG    1 
ATOM   1976 C CD1   . TYR A 1 260 ? 60.002  -19.120 28.774  1.00 24.91 ? 257 TYR A CD1   1 
ATOM   1977 C CD2   . TYR A 1 260 ? 61.113  -17.705 30.342  1.00 25.56 ? 257 TYR A CD2   1 
ATOM   1978 C CE1   . TYR A 1 260 ? 61.076  -20.053 28.845  1.00 24.79 ? 257 TYR A CE1   1 
ATOM   1979 C CE2   . TYR A 1 260 ? 62.184  -18.614 30.416  1.00 25.96 ? 257 TYR A CE2   1 
ATOM   1980 C CZ    . TYR A 1 260 ? 62.161  -19.779 29.665  1.00 25.93 ? 257 TYR A CZ    1 
ATOM   1981 O OH    . TYR A 1 260 ? 63.228  -20.668 29.780  1.00 27.41 ? 257 TYR A OH    1 
ATOM   1982 N N     . HIS A 1 261 ? 57.853  -14.019 27.465  1.00 24.28 ? 258 HIS A N     1 
ATOM   1983 C CA    . HIS A 1 261 ? 56.971  -12.858 27.596  1.00 24.42 ? 258 HIS A CA    1 
ATOM   1984 C C     . HIS A 1 261 ? 55.511  -13.202 27.297  1.00 24.61 ? 258 HIS A C     1 
ATOM   1985 O O     . HIS A 1 261 ? 54.599  -12.527 27.774  1.00 25.48 ? 258 HIS A O     1 
ATOM   1986 C CB    . HIS A 1 261 ? 57.465  -11.685 26.730  1.00 25.00 ? 258 HIS A CB    1 
ATOM   1987 C CG    . HIS A 1 261 ? 57.313  -11.895 25.254  1.00 24.91 ? 258 HIS A CG    1 
ATOM   1988 N ND1   . HIS A 1 261 ? 57.906  -12.940 24.584  1.00 25.73 ? 258 HIS A ND1   1 
ATOM   1989 C CD2   . HIS A 1 261 ? 56.655  -11.173 24.314  1.00 25.53 ? 258 HIS A CD2   1 
ATOM   1990 C CE1   . HIS A 1 261 ? 57.601  -12.873 23.301  1.00 25.34 ? 258 HIS A CE1   1 
ATOM   1991 N NE2   . HIS A 1 261 ? 56.849  -11.806 23.110  1.00 26.27 ? 258 HIS A NE2   1 
ATOM   1992 N N     . LEU A 1 262 ? 55.288  -14.300 26.574  1.00 24.44 ? 259 LEU A N     1 
ATOM   1993 C CA    . LEU A 1 262 ? 53.950  -14.681 26.115  1.00 23.73 ? 259 LEU A CA    1 
ATOM   1994 C C     . LEU A 1 262 ? 53.543  -15.977 26.816  1.00 23.35 ? 259 LEU A C     1 
ATOM   1995 O O     . LEU A 1 262 ? 54.265  -16.963 26.740  1.00 22.41 ? 259 LEU A O     1 
ATOM   1996 C CB    . LEU A 1 262 ? 53.994  -14.855 24.600  1.00 23.56 ? 259 LEU A CB    1 
ATOM   1997 C CG    . LEU A 1 262 ? 52.953  -14.200 23.700  1.00 24.45 ? 259 LEU A CG    1 
ATOM   1998 C CD1   . LEU A 1 262 ? 52.594  -12.759 24.089  1.00 23.36 ? 259 LEU A CD1   1 
ATOM   1999 C CD2   . LEU A 1 262 ? 53.477  -14.262 22.272  1.00 23.22 ? 259 LEU A CD2   1 
ATOM   2000 N N     . SER A 1 263 ? 52.400  -15.969 27.504  1.00 22.69 ? 260 SER A N     1 
ATOM   2001 C CA    . SER A 1 263 ? 52.020  -17.093 28.354  1.00 22.93 ? 260 SER A CA    1 
ATOM   2002 C C     . SER A 1 263 ? 51.482  -18.264 27.560  1.00 23.03 ? 260 SER A C     1 
ATOM   2003 O O     . SER A 1 263 ? 51.077  -18.122 26.417  1.00 23.70 ? 260 SER A O     1 
ATOM   2004 C CB    . SER A 1 263 ? 50.999  -16.682 29.423  1.00 22.61 ? 260 SER A CB    1 
ATOM   2005 O OG    . SER A 1 263 ? 49.773  -16.266 28.847  1.00 22.64 ? 260 SER A OG    1 
ATOM   2006 N N     . ALA A 1 264 ? 51.475  -19.428 28.197  1.00 23.50 ? 261 ALA A N     1 
ATOM   2007 C CA    . ALA A 1 264 ? 50.938  -20.646 27.623  1.00 23.50 ? 261 ALA A CA    1 
ATOM   2008 C C     . ALA A 1 264 ? 49.480  -20.448 27.172  1.00 23.65 ? 261 ALA A C     1 
ATOM   2009 O O     . ALA A 1 264 ? 49.116  -20.796 26.040  1.00 24.20 ? 261 ALA A O     1 
ATOM   2010 C CB    . ALA A 1 264 ? 51.048  -21.780 28.655  1.00 23.35 ? 261 ALA A CB    1 
ATOM   2011 N N     . LEU A 1 265 ? 48.657  -19.878 28.052  1.00 23.68 ? 262 LEU A N     1 
ATOM   2012 C CA    . LEU A 1 265 ? 47.266  -19.545 27.725  1.00 23.96 ? 262 LEU A CA    1 
ATOM   2013 C C     . LEU A 1 265 ? 47.145  -18.501 26.623  1.00 23.35 ? 262 LEU A C     1 
ATOM   2014 O O     . LEU A 1 265 ? 46.338  -18.653 25.722  1.00 23.74 ? 262 LEU A O     1 
ATOM   2015 C CB    . LEU A 1 265 ? 46.504  -19.052 28.964  1.00 23.91 ? 262 LEU A CB    1 
ATOM   2016 C CG    . LEU A 1 265 ? 46.286  -20.082 30.073  1.00 26.37 ? 262 LEU A CG    1 
ATOM   2017 C CD1   . LEU A 1 265 ? 45.394  -19.494 31.203  1.00 27.56 ? 262 LEU A CD1   1 
ATOM   2018 C CD2   . LEU A 1 265 ? 45.701  -21.378 29.520  1.00 26.38 ? 262 LEU A CD2   1 
ATOM   2019 N N     . SER A 1 266 ? 47.934  -17.437 26.686  1.00 23.30 ? 263 SER A N     1 
ATOM   2020 C CA    . SER A 1 266 ? 47.898  -16.460 25.605  1.00 23.36 ? 263 SER A CA    1 
ATOM   2021 C C     . SER A 1 266 ? 48.176  -17.159 24.286  1.00 22.93 ? 263 SER A C     1 
ATOM   2022 O O     . SER A 1 266 ? 47.415  -17.016 23.331  1.00 22.24 ? 263 SER A O     1 
ATOM   2023 C CB    . SER A 1 266 ? 48.919  -15.347 25.805  1.00 23.05 ? 263 SER A CB    1 
ATOM   2024 O OG    . SER A 1 266 ? 48.564  -14.561 26.915  1.00 24.87 ? 263 SER A OG    1 
ATOM   2025 N N     . GLN A 1 267 ? 49.272  -17.914 24.233  1.00 22.64 ? 264 GLN A N     1 
ATOM   2026 C CA    . GLN A 1 267 ? 49.631  -18.590 22.985  1.00 23.10 ? 264 GLN A CA    1 
ATOM   2027 C C     . GLN A 1 267 ? 48.485  -19.472 22.483  1.00 23.30 ? 264 GLN A C     1 
ATOM   2028 O O     . GLN A 1 267 ? 48.044  -19.336 21.341  1.00 23.94 ? 264 GLN A O     1 
ATOM   2029 C CB    . GLN A 1 267 ? 50.926  -19.384 23.140  1.00 23.01 ? 264 GLN A CB    1 
ATOM   2030 C CG    . GLN A 1 267 ? 52.150  -18.493 23.344  1.00 22.55 ? 264 GLN A CG    1 
ATOM   2031 C CD    . GLN A 1 267 ? 53.424  -19.294 23.416  1.00 22.30 ? 264 GLN A CD    1 
ATOM   2032 O OE1   . GLN A 1 267 ? 54.225  -19.128 24.332  1.00 21.20 ? 264 GLN A OE1   1 
ATOM   2033 N NE2   . GLN A 1 267 ? 53.600  -20.197 22.477  1.00 20.24 ? 264 GLN A NE2   1 
ATOM   2034 N N     . ALA A 1 268 ? 47.972  -20.325 23.367  1.00 23.40 ? 265 ALA A N     1 
ATOM   2035 C CA    . ALA A 1 268 ? 46.960  -21.327 23.004  1.00 23.05 ? 265 ALA A CA    1 
ATOM   2036 C C     . ALA A 1 268 ? 45.647  -20.703 22.556  1.00 22.73 ? 265 ALA A C     1 
ATOM   2037 O O     . ALA A 1 268 ? 45.021  -21.181 21.607  1.00 22.38 ? 265 ALA A O     1 
ATOM   2038 C CB    . ALA A 1 268 ? 46.712  -22.246 24.164  1.00 22.01 ? 265 ALA A CB    1 
ATOM   2039 N N     . ALA A 1 269 ? 45.235  -19.648 23.263  1.00 22.97 ? 266 ALA A N     1 
ATOM   2040 C CA    . ALA A 1 269 ? 43.996  -18.939 22.968  1.00 22.80 ? 266 ALA A CA    1 
ATOM   2041 C C     . ALA A 1 269 ? 44.084  -18.210 21.638  1.00 23.01 ? 266 ALA A C     1 
ATOM   2042 O O     . ALA A 1 269 ? 43.100  -18.152 20.897  1.00 23.93 ? 266 ALA A O     1 
ATOM   2043 C CB    . ALA A 1 269 ? 43.636  -17.948 24.113  1.00 22.41 ? 266 ALA A CB    1 
ATOM   2044 N N     . ALA A 1 270 ? 45.243  -17.646 21.323  1.00 22.84 ? 267 ALA A N     1 
ATOM   2045 C CA    . ALA A 1 270 ? 45.408  -16.942 20.041  1.00 22.66 ? 267 ALA A CA    1 
ATOM   2046 C C     . ALA A 1 270 ? 45.365  -17.956 18.892  1.00 22.65 ? 267 ALA A C     1 
ATOM   2047 O O     . ALA A 1 270 ? 44.781  -17.712 17.837  1.00 21.52 ? 267 ALA A O     1 
ATOM   2048 C CB    . ALA A 1 270 ? 46.698  -16.169 20.022  1.00 22.07 ? 267 ALA A CB    1 
ATOM   2049 N N     . ILE A 1 271 ? 45.982  -19.112 19.118  1.00 23.33 ? 268 ILE A N     1 
ATOM   2050 C CA    . ILE A 1 271 ? 45.892  -20.213 18.163  1.00 23.14 ? 268 ILE A CA    1 
ATOM   2051 C C     . ILE A 1 271 ? 44.431  -20.591 17.915  1.00 23.17 ? 268 ILE A C     1 
ATOM   2052 O O     . ILE A 1 271 ? 44.022  -20.736 16.764  1.00 23.73 ? 268 ILE A O     1 
ATOM   2053 C CB    . ILE A 1 271 ? 46.753  -21.415 18.596  1.00 23.35 ? 268 ILE A CB    1 
ATOM   2054 C CG1   . ILE A 1 271 ? 48.230  -21.111 18.329  1.00 22.32 ? 268 ILE A CG1   1 
ATOM   2055 C CG2   . ILE A 1 271 ? 46.345  -22.672 17.825  1.00 23.67 ? 268 ILE A CG2   1 
ATOM   2056 C CD1   . ILE A 1 271 ? 49.225  -21.913 19.182  1.00 22.97 ? 268 ILE A CD1   1 
ATOM   2057 N N     . VAL A 1 272 ? 43.629  -20.718 18.971  1.00 23.48 ? 269 VAL A N     1 
ATOM   2058 C CA    . VAL A 1 272 ? 42.212  -21.077 18.786  1.00 23.15 ? 269 VAL A CA    1 
ATOM   2059 C C     . VAL A 1 272 ? 41.524  -19.997 17.954  1.00 23.57 ? 269 VAL A C     1 
ATOM   2060 O O     . VAL A 1 272 ? 40.862  -20.286 16.946  1.00 23.23 ? 269 VAL A O     1 
ATOM   2061 C CB    . VAL A 1 272 ? 41.492  -21.284 20.132  1.00 23.31 ? 269 VAL A CB    1 
ATOM   2062 C CG1   . VAL A 1 272 ? 39.982  -21.341 19.951  1.00 23.10 ? 269 VAL A CG1   1 
ATOM   2063 C CG2   . VAL A 1 272 ? 42.016  -22.562 20.827  1.00 23.44 ? 269 VAL A CG2   1 
ATOM   2064 N N     . ALA A 1 273 ? 41.715  -18.750 18.363  1.00 23.49 ? 270 ALA A N     1 
ATOM   2065 C CA    . ALA A 1 273 ? 41.129  -17.606 17.662  1.00 23.80 ? 270 ALA A CA    1 
ATOM   2066 C C     . ALA A 1 273 ? 41.465  -17.618 16.173  1.00 23.70 ? 270 ALA A C     1 
ATOM   2067 O O     . ALA A 1 273 ? 40.582  -17.528 15.336  1.00 23.08 ? 270 ALA A O     1 
ATOM   2068 C CB    . ALA A 1 273 ? 41.594  -16.302 18.318  1.00 23.74 ? 270 ALA A CB    1 
ATOM   2069 N N     . LEU A 1 274 ? 42.743  -17.786 15.845  1.00 24.00 ? 271 LEU A N     1 
ATOM   2070 C CA    . LEU A 1 274 ? 43.168  -17.836 14.456  1.00 24.45 ? 271 LEU A CA    1 
ATOM   2071 C C     . LEU A 1 274 ? 42.419  -18.871 13.605  1.00 25.45 ? 271 LEU A C     1 
ATOM   2072 O O     . LEU A 1 274 ? 42.109  -18.599 12.437  1.00 25.68 ? 271 LEU A O     1 
ATOM   2073 C CB    . LEU A 1 274 ? 44.678  -18.076 14.358  1.00 23.86 ? 271 LEU A CB    1 
ATOM   2074 C CG    . LEU A 1 274 ? 45.503  -16.853 14.757  1.00 22.74 ? 271 LEU A CG    1 
ATOM   2075 C CD1   . LEU A 1 274 ? 46.997  -17.210 15.013  1.00 21.63 ? 271 LEU A CD1   1 
ATOM   2076 C CD2   . LEU A 1 274 ? 45.372  -15.752 13.720  1.00 21.36 ? 271 LEU A CD2   1 
ATOM   2077 N N     . ARG A 1 275 ? 42.111  -20.043 14.162  1.00 25.97 ? 272 ARG A N     1 
ATOM   2078 C CA    . ARG A 1 275 ? 41.454  -21.070 13.342  1.00 26.76 ? 272 ARG A CA    1 
ATOM   2079 C C     . ARG A 1 275 ? 39.941  -20.846 13.205  1.00 27.16 ? 272 ARG A C     1 
ATOM   2080 O O     . ARG A 1 275 ? 39.249  -21.588 12.501  1.00 26.56 ? 272 ARG A O     1 
ATOM   2081 C CB    . ARG A 1 275 ? 41.813  -22.504 13.793  1.00 26.74 ? 272 ARG A CB    1 
ATOM   2082 C CG    . ARG A 1 275 ? 41.419  -22.915 15.177  1.00 26.81 ? 272 ARG A CG    1 
ATOM   2083 C CD    . ARG A 1 275 ? 41.827  -24.394 15.431  1.00 27.26 ? 272 ARG A CD    1 
ATOM   2084 N NE    . ARG A 1 275 ? 41.674  -24.788 16.839  1.00 26.23 ? 272 ARG A NE    1 
ATOM   2085 C CZ    . ARG A 1 275 ? 42.661  -25.171 17.648  1.00 25.57 ? 272 ARG A CZ    1 
ATOM   2086 N NH1   . ARG A 1 275 ? 43.914  -25.273 17.223  1.00 25.08 ? 272 ARG A NH1   1 
ATOM   2087 N NH2   . ARG A 1 275 ? 42.378  -25.506 18.898  1.00 26.34 ? 272 ARG A NH2   1 
ATOM   2088 N N     . HIS A 1 276 ? 39.438  -19.798 13.849  1.00 27.81 ? 273 HIS A N     1 
ATOM   2089 C CA    . HIS A 1 276 ? 38.058  -19.376 13.655  1.00 27.82 ? 273 HIS A CA    1 
ATOM   2090 C C     . HIS A 1 276 ? 37.966  -18.029 12.928  1.00 28.07 ? 273 HIS A C     1 
ATOM   2091 O O     . HIS A 1 276 ? 36.936  -17.354 12.987  1.00 27.60 ? 273 HIS A O     1 
ATOM   2092 C CB    . HIS A 1 276 ? 37.369  -19.306 15.006  1.00 27.82 ? 273 HIS A CB    1 
ATOM   2093 C CG    . HIS A 1 276 ? 37.059  -20.644 15.576  1.00 27.63 ? 273 HIS A CG    1 
ATOM   2094 N ND1   . HIS A 1 276 ? 37.907  -21.299 16.441  1.00 30.20 ? 273 HIS A ND1   1 
ATOM   2095 C CD2   . HIS A 1 276 ? 36.005  -21.465 15.386  1.00 28.07 ? 273 HIS A CD2   1 
ATOM   2096 C CE1   . HIS A 1 276 ? 37.375  -22.461 16.771  1.00 29.77 ? 273 HIS A CE1   1 
ATOM   2097 N NE2   . HIS A 1 276 ? 36.219  -22.583 16.151  1.00 29.12 ? 273 HIS A NE2   1 
ATOM   2098 N N     . SER A 1 277 ? 39.028  -17.667 12.214  1.00 28.29 ? 274 SER A N     1 
ATOM   2099 C CA    . SER A 1 277 ? 39.169  -16.322 11.661  1.00 28.89 ? 274 SER A CA    1 
ATOM   2100 C C     . SER A 1 277 ? 38.102  -15.948 10.621  1.00 29.46 ? 274 SER A C     1 
ATOM   2101 O O     . SER A 1 277 ? 37.570  -14.840 10.657  1.00 29.69 ? 274 SER A O     1 
ATOM   2102 C CB    . SER A 1 277 ? 40.579  -16.127 11.080  1.00 29.05 ? 274 SER A CB    1 
ATOM   2103 O OG    . SER A 1 277 ? 40.825  -16.992 9.981   1.00 29.24 ? 274 SER A OG    1 
ATOM   2104 N N     . ALA A 1 278 ? 37.778  -16.863 9.710   1.00 29.92 ? 275 ALA A N     1 
ATOM   2105 C CA    . ALA A 1 278 ? 36.785  -16.580 8.667   1.00 30.35 ? 275 ALA A CA    1 
ATOM   2106 C C     . ALA A 1 278 ? 35.434  -16.179 9.260   1.00 30.83 ? 275 ALA A C     1 
ATOM   2107 O O     . ALA A 1 278 ? 34.872  -15.142 8.889   1.00 31.26 ? 275 ALA A O     1 
ATOM   2108 C CB    . ALA A 1 278 ? 36.629  -17.772 7.722   1.00 30.48 ? 275 ALA A CB    1 
ATOM   2109 N N     . ASP A 1 279 ? 34.928  -16.969 10.203  1.00 31.36 ? 276 ASP A N     1 
ATOM   2110 C CA    . ASP A 1 279 ? 33.676  -16.628 10.870  1.00 30.86 ? 276 ASP A CA    1 
ATOM   2111 C C     . ASP A 1 279 ? 33.774  -15.288 11.617  1.00 30.63 ? 276 ASP A C     1 
ATOM   2112 O O     . ASP A 1 279 ? 32.976  -14.397 11.366  1.00 30.61 ? 276 ASP A O     1 
ATOM   2113 C CB    . ASP A 1 279 ? 33.240  -17.719 11.839  1.00 31.74 ? 276 ASP A CB    1 
ATOM   2114 C CG    . ASP A 1 279 ? 31.819  -17.500 12.353  1.00 33.25 ? 276 ASP A CG    1 
ATOM   2115 O OD1   . ASP A 1 279 ? 30.876  -17.592 11.521  1.00 40.06 ? 276 ASP A OD1   1 
ATOM   2116 O OD2   . ASP A 1 279 ? 31.637  -17.231 13.571  1.00 37.34 ? 276 ASP A OD2   1 
ATOM   2117 N N     . THR A 1 280 ? 34.764  -15.154 12.508  1.00 29.63 ? 277 THR A N     1 
ATOM   2118 C CA    . THR A 1 280 ? 34.944  -13.934 13.308  1.00 28.97 ? 277 THR A CA    1 
ATOM   2119 C C     . THR A 1 280 ? 35.055  -12.680 12.443  1.00 28.31 ? 277 THR A C     1 
ATOM   2120 O O     . THR A 1 280 ? 34.396  -11.673 12.714  1.00 27.89 ? 277 THR A O     1 
ATOM   2121 C CB    . THR A 1 280 ? 36.225  -13.982 14.196  1.00 28.91 ? 277 THR A CB    1 
ATOM   2122 O OG1   . THR A 1 280 ? 36.223  -15.149 15.027  1.00 27.23 ? 277 THR A OG1   1 
ATOM   2123 C CG2   . THR A 1 280 ? 36.328  -12.707 15.073  1.00 29.16 ? 277 THR A CG2   1 
ATOM   2124 N N     . LEU A 1 281 ? 35.900  -12.746 11.413  1.00 28.00 ? 278 LEU A N     1 
ATOM   2125 C CA    . LEU A 1 281 ? 36.164  -11.586 10.551  1.00 27.89 ? 278 LEU A CA    1 
ATOM   2126 C C     . LEU A 1 281 ? 35.005  -11.281 9.605   1.00 27.28 ? 278 LEU A C     1 
ATOM   2127 O O     . LEU A 1 281 ? 34.985  -10.248 8.955   1.00 27.04 ? 278 LEU A O     1 
ATOM   2128 C CB    . LEU A 1 281 ? 37.490  -11.760 9.790   1.00 27.98 ? 278 LEU A CB    1 
ATOM   2129 C CG    . LEU A 1 281 ? 38.728  -11.724 10.698  1.00 28.78 ? 278 LEU A CG    1 
ATOM   2130 C CD1   . LEU A 1 281 ? 40.009  -12.265 10.014  1.00 28.96 ? 278 LEU A CD1   1 
ATOM   2131 C CD2   . LEU A 1 281 ? 38.959  -10.288 11.192  1.00 28.09 ? 278 LEU A CD2   1 
ATOM   2132 N N     . GLY A 1 282 ? 34.015  -12.162 9.557   1.00 27.46 ? 279 GLY A N     1 
ATOM   2133 C CA    . GLY A 1 282 ? 32.745  -11.844 8.906   1.00 27.53 ? 279 GLY A CA    1 
ATOM   2134 C C     . GLY A 1 282 ? 32.056  -10.605 9.484   1.00 27.46 ? 279 GLY A C     1 
ATOM   2135 O O     . GLY A 1 282 ? 31.263  -9.944  8.790   1.00 27.33 ? 279 GLY A O     1 
ATOM   2136 N N     . THR A 1 283 ? 32.352  -10.289 10.745  1.00 26.74 ? 280 THR A N     1 
ATOM   2137 C CA    . THR A 1 283 ? 31.740  -9.132  11.419  1.00 27.02 ? 280 THR A CA    1 
ATOM   2138 C C     . THR A 1 283 ? 32.166  -7.791  10.810  1.00 27.10 ? 280 THR A C     1 
ATOM   2139 O O     . THR A 1 283 ? 31.453  -6.802  10.944  1.00 26.88 ? 280 THR A O     1 
ATOM   2140 C CB    . THR A 1 283 ? 32.066  -9.099  12.936  1.00 26.87 ? 280 THR A CB    1 
ATOM   2141 O OG1   . THR A 1 283 ? 33.482  -8.990  13.123  1.00 25.73 ? 280 THR A OG1   1 
ATOM   2142 C CG2   . THR A 1 283 ? 31.546  -10.363 13.639  1.00 26.93 ? 280 THR A CG2   1 
ATOM   2143 N N     . VAL A 1 284 ? 33.323  -7.767  10.151  1.00 27.19 ? 281 VAL A N     1 
ATOM   2144 C CA    . VAL A 1 284 ? 33.843  -6.555  9.528   1.00 28.12 ? 281 VAL A CA    1 
ATOM   2145 C C     . VAL A 1 284 ? 32.836  -5.945  8.538   1.00 28.76 ? 281 VAL A C     1 
ATOM   2146 O O     . VAL A 1 284 ? 32.615  -4.730  8.547   1.00 28.56 ? 281 VAL A O     1 
ATOM   2147 C CB    . VAL A 1 284 ? 35.222  -6.831  8.826   1.00 27.87 ? 281 VAL A CB    1 
ATOM   2148 C CG1   . VAL A 1 284 ? 35.650  -5.646  7.963   1.00 28.53 ? 281 VAL A CG1   1 
ATOM   2149 C CG2   . VAL A 1 284 ? 36.297  -7.139  9.859   1.00 26.60 ? 281 VAL A CG2   1 
ATOM   2150 N N     . GLU A 1 285 ? 32.224  -6.793  7.706   1.00 29.09 ? 282 GLU A N     1 
ATOM   2151 C CA    . GLU A 1 285 ? 31.241  -6.338  6.731   1.00 30.10 ? 282 GLU A CA    1 
ATOM   2152 C C     . GLU A 1 285 ? 30.129  -5.542  7.396   1.00 29.73 ? 282 GLU A C     1 
ATOM   2153 O O     . GLU A 1 285 ? 29.810  -4.445  6.945   1.00 29.45 ? 282 GLU A O     1 
ATOM   2154 C CB    . GLU A 1 285 ? 30.611  -7.507  5.971   1.00 30.35 ? 282 GLU A CB    1 
ATOM   2155 C CG    . GLU A 1 285 ? 31.539  -8.215  5.012   1.00 32.70 ? 282 GLU A CG    1 
ATOM   2156 C CD    . GLU A 1 285 ? 30.919  -9.499  4.462   1.00 34.16 ? 282 GLU A CD    1 
ATOM   2157 O OE1   . GLU A 1 285 ? 31.541  -10.588 4.638   1.00 38.67 ? 282 GLU A OE1   1 
ATOM   2158 O OE2   . GLU A 1 285 ? 29.801  -9.411  3.882   1.00 38.66 ? 282 GLU A OE2   1 
ATOM   2159 N N     . LYS A 1 286 ? 29.545  -6.098  8.457   1.00 29.61 ? 283 LYS A N     1 
ATOM   2160 C CA    . LYS A 1 286 ? 28.448  -5.430  9.162   1.00 29.69 ? 283 LYS A CA    1 
ATOM   2161 C C     . LYS A 1 286 ? 28.918  -4.078  9.729   1.00 29.08 ? 283 LYS A C     1 
ATOM   2162 O O     . LYS A 1 286 ? 28.201  -3.070  9.623   1.00 28.47 ? 283 LYS A O     1 
ATOM   2163 C CB    . LYS A 1 286 ? 27.921  -6.287  10.321  1.00 30.23 ? 283 LYS A CB    1 
ATOM   2164 C CG    . LYS A 1 286 ? 27.425  -7.709  9.978   1.00 31.63 ? 283 LYS A CG    1 
ATOM   2165 C CD    . LYS A 1 286 ? 26.992  -8.462  11.284  1.00 31.50 ? 283 LYS A CD    1 
ATOM   2166 C CE    . LYS A 1 286 ? 26.856  -9.996  11.076  1.00 32.88 ? 283 LYS A CE    1 
ATOM   2167 N NZ    . LYS A 1 286 ? 27.138  -10.791 12.331  1.00 33.40 ? 283 LYS A NZ    1 
ATOM   2168 N N     . LEU A 1 287 ? 30.118  -4.073  10.321  1.00 28.25 ? 284 LEU A N     1 
ATOM   2169 C CA    . LEU A 1 287 ? 30.649  -2.895  11.013  1.00 28.04 ? 284 LEU A CA    1 
ATOM   2170 C C     . LEU A 1 287 ? 31.020  -1.773  10.053  1.00 27.69 ? 284 LEU A C     1 
ATOM   2171 O O     . LEU A 1 287 ? 30.898  -0.597  10.395  1.00 26.64 ? 284 LEU A O     1 
ATOM   2172 C CB    . LEU A 1 287 ? 31.882  -3.251  11.863  1.00 28.03 ? 284 LEU A CB    1 
ATOM   2173 C CG    . LEU A 1 287 ? 31.716  -4.178  13.077  1.00 27.97 ? 284 LEU A CG    1 
ATOM   2174 C CD1   . LEU A 1 287 ? 33.050  -4.498  13.692  1.00 27.02 ? 284 LEU A CD1   1 
ATOM   2175 C CD2   . LEU A 1 287 ? 30.798  -3.575  14.107  1.00 27.72 ? 284 LEU A CD2   1 
ATOM   2176 N N     . SER A 1 288 ? 31.507  -2.140  8.866   1.00 27.78 ? 285 SER A N     1 
ATOM   2177 C CA    . SER A 1 288 ? 31.887  -1.139  7.855   1.00 27.49 ? 285 SER A CA    1 
ATOM   2178 C C     . SER A 1 288 ? 30.672  -0.435  7.272   1.00 27.02 ? 285 SER A C     1 
ATOM   2179 O O     . SER A 1 288 ? 30.740  0.737   6.943   1.00 26.82 ? 285 SER A O     1 
ATOM   2180 C CB    . SER A 1 288 ? 32.710  -1.770  6.737   1.00 27.35 ? 285 SER A CB    1 
ATOM   2181 O OG    . SER A 1 288 ? 33.781  -2.509  7.289   1.00 26.44 ? 285 SER A OG    1 
ATOM   2182 N N     . VAL A 1 289 ? 29.560  -1.143  7.165   1.00 26.98 ? 286 VAL A N     1 
ATOM   2183 C CA    . VAL A 1 289 ? 28.316  -0.531  6.685   1.00 27.13 ? 286 VAL A CA    1 
ATOM   2184 C C     . VAL A 1 289 ? 27.653  0.288   7.792   1.00 26.99 ? 286 VAL A C     1 
ATOM   2185 O O     . VAL A 1 289 ? 27.011  1.325   7.524   1.00 26.95 ? 286 VAL A O     1 
ATOM   2186 C CB    . VAL A 1 289 ? 27.336  -1.590  6.107   1.00 27.45 ? 286 VAL A CB    1 
ATOM   2187 C CG1   . VAL A 1 289 ? 26.067  -0.946  5.616   1.00 27.64 ? 286 VAL A CG1   1 
ATOM   2188 C CG2   . VAL A 1 289 ? 27.978  -2.321  4.965   1.00 27.58 ? 286 VAL A CG2   1 
ATOM   2189 N N     . GLU A 1 290 ? 27.820  -0.144  9.033   1.00 26.64 ? 287 GLU A N     1 
ATOM   2190 C CA    . GLU A 1 290 ? 27.284  0.617   10.160  1.00 26.84 ? 287 GLU A CA    1 
ATOM   2191 C C     . GLU A 1 290 ? 28.034  1.930   10.324  1.00 26.41 ? 287 GLU A C     1 
ATOM   2192 O O     . GLU A 1 290 ? 27.448  2.960   10.642  1.00 25.06 ? 287 GLU A O     1 
ATOM   2193 C CB    . GLU A 1 290 ? 27.342  -0.196  11.448  1.00 27.12 ? 287 GLU A CB    1 
ATOM   2194 C CG    . GLU A 1 290 ? 26.159  -1.107  11.643  1.00 28.31 ? 287 GLU A CG    1 
ATOM   2195 C CD    . GLU A 1 290 ? 24.853  -0.338  11.837  1.00 31.53 ? 287 GLU A CD    1 
ATOM   2196 O OE1   . GLU A 1 290 ? 23.932  -0.517  11.001  1.00 32.48 ? 287 GLU A OE1   1 
ATOM   2197 O OE2   . GLU A 1 290 ? 24.751  0.453   12.816  1.00 31.97 ? 287 GLU A OE2   1 
ATOM   2198 N N     . ARG A 1 291 ? 29.338  1.887   10.080  1.00 26.48 ? 288 ARG A N     1 
ATOM   2199 C CA    . ARG A 1 291 ? 30.167  3.090   10.132  1.00 26.16 ? 288 ARG A CA    1 
ATOM   2200 C C     . ARG A 1 291 ? 29.659  4.142   9.163   1.00 25.75 ? 288 ARG A C     1 
ATOM   2201 O O     . ARG A 1 291 ? 29.588  5.334   9.487   1.00 25.48 ? 288 ARG A O     1 
ATOM   2202 C CB    . ARG A 1 291 ? 31.618  2.740   9.794   1.00 26.30 ? 288 ARG A CB    1 
ATOM   2203 C CG    . ARG A 1 291 ? 32.586  3.919   9.887   1.00 26.77 ? 288 ARG A CG    1 
ATOM   2204 C CD    . ARG A 1 291 ? 33.183  4.236   8.535   1.00 28.82 ? 288 ARG A CD    1 
ATOM   2205 N NE    . ARG A 1 291 ? 33.938  3.083   8.054   1.00 29.74 ? 288 ARG A NE    1 
ATOM   2206 C CZ    . ARG A 1 291 ? 34.095  2.746   6.784   1.00 30.44 ? 288 ARG A CZ    1 
ATOM   2207 N NH1   . ARG A 1 291 ? 33.547  3.466   5.806   1.00 32.73 ? 288 ARG A NH1   1 
ATOM   2208 N NH2   . ARG A 1 291 ? 34.799  1.657   6.497   1.00 32.05 ? 288 ARG A NH2   1 
ATOM   2209 N N     . VAL A 1 292 ? 29.335  3.694   7.957   1.00 25.96 ? 289 VAL A N     1 
ATOM   2210 C CA    . VAL A 1 292 ? 28.796  4.574   6.922   1.00 25.91 ? 289 VAL A CA    1 
ATOM   2211 C C     . VAL A 1 292 ? 27.450  5.137   7.375   1.00 25.88 ? 289 VAL A C     1 
ATOM   2212 O O     . VAL A 1 292 ? 27.217  6.331   7.281   1.00 25.49 ? 289 VAL A O     1 
ATOM   2213 C CB    . VAL A 1 292 ? 28.700  3.835   5.543   1.00 25.96 ? 289 VAL A CB    1 
ATOM   2214 C CG1   . VAL A 1 292 ? 28.096  4.728   4.481   1.00 25.57 ? 289 VAL A CG1   1 
ATOM   2215 C CG2   . VAL A 1 292 ? 30.108  3.361   5.088   1.00 24.73 ? 289 VAL A CG2   1 
ATOM   2216 N N     . ARG A 1 293 ? 26.568  4.289   7.884   1.00 26.14 ? 290 ARG A N     1 
ATOM   2217 C CA    . ARG A 1 293 ? 25.310  4.786   8.445   1.00 26.18 ? 290 ARG A CA    1 
ATOM   2218 C C     . ARG A 1 293 ? 25.545  5.825   9.530   1.00 25.88 ? 290 ARG A C     1 
ATOM   2219 O O     . ARG A 1 293 ? 25.031  6.926   9.445   1.00 25.28 ? 290 ARG A O     1 
ATOM   2220 C CB    . ARG A 1 293 ? 24.474  3.653   9.013   1.00 26.47 ? 290 ARG A CB    1 
ATOM   2221 C CG    . ARG A 1 293 ? 23.068  4.068   9.372   1.00 27.35 ? 290 ARG A CG    1 
ATOM   2222 C CD    . ARG A 1 293 ? 22.197  2.850   9.630   1.00 29.03 ? 290 ARG A CD    1 
ATOM   2223 N NE    . ARG A 1 293 ? 22.490  2.221   10.913  1.00 31.81 ? 290 ARG A NE    1 
ATOM   2224 C CZ    . ARG A 1 293 ? 22.128  2.714   12.099  1.00 33.43 ? 290 ARG A CZ    1 
ATOM   2225 N NH1   . ARG A 1 293 ? 21.476  3.884   12.203  1.00 33.40 ? 290 ARG A NH1   1 
ATOM   2226 N NH2   . ARG A 1 293 ? 22.445  2.042   13.201  1.00 32.76 ? 290 ARG A NH2   1 
ATOM   2227 N N     . VAL A 1 294 ? 26.324  5.478   10.555  1.00 25.65 ? 291 VAL A N     1 
ATOM   2228 C CA    . VAL A 1 294 ? 26.586  6.409   11.647  1.00 25.56 ? 291 VAL A CA    1 
ATOM   2229 C C     . VAL A 1 294 ? 27.174  7.754   11.159  1.00 25.51 ? 291 VAL A C     1 
ATOM   2230 O O     . VAL A 1 294 ? 26.656  8.813   11.507  1.00 24.50 ? 291 VAL A O     1 
ATOM   2231 C CB    . VAL A 1 294 ? 27.500  5.778   12.721  1.00 25.07 ? 291 VAL A CB    1 
ATOM   2232 C CG1   . VAL A 1 294 ? 27.982  6.832   13.713  1.00 24.32 ? 291 VAL A CG1   1 
ATOM   2233 C CG2   . VAL A 1 294 ? 26.760  4.658   13.440  1.00 25.15 ? 291 VAL A CG2   1 
ATOM   2234 N N     . ALA A 1 295 ? 28.239  7.705   10.356  1.00 25.65 ? 292 ALA A N     1 
ATOM   2235 C CA    . ALA A 1 295 ? 28.873  8.917   9.840   1.00 26.09 ? 292 ALA A CA    1 
ATOM   2236 C C     . ALA A 1 295 ? 27.901  9.757   9.009   1.00 26.76 ? 292 ALA A C     1 
ATOM   2237 O O     . ALA A 1 295 ? 27.887  10.979  9.121   1.00 26.50 ? 292 ALA A O     1 
ATOM   2238 C CB    . ALA A 1 295 ? 30.102  8.574   9.012   1.00 25.38 ? 292 ALA A CB    1 
ATOM   2239 N N     . ALA A 1 296 ? 27.076  9.103   8.195   1.00 27.36 ? 293 ALA A N     1 
ATOM   2240 C CA    . ALA A 1 296 ? 26.070  9.802   7.409   1.00 28.44 ? 293 ALA A CA    1 
ATOM   2241 C C     . ALA A 1 296 ? 25.033  10.516  8.286   1.00 29.21 ? 293 ALA A C     1 
ATOM   2242 O O     . ALA A 1 296 ? 24.685  11.676  8.024   1.00 29.42 ? 293 ALA A O     1 
ATOM   2243 C CB    . ALA A 1 296 ? 25.375  8.841   6.448   1.00 28.31 ? 293 ALA A CB    1 
ATOM   2244 N N     . ARG A 1 297 ? 24.553  9.848   9.327   1.00 29.87 ? 294 ARG A N     1 
ATOM   2245 C CA    . ARG A 1 297 ? 23.564  10.457  10.215  1.00 30.35 ? 294 ARG A CA    1 
ATOM   2246 C C     . ARG A 1 297 ? 24.152  11.639  11.004  1.00 30.85 ? 294 ARG A C     1 
ATOM   2247 O O     . ARG A 1 297 ? 23.478  12.648  11.215  1.00 30.47 ? 294 ARG A O     1 
ATOM   2248 C CB    . ARG A 1 297 ? 22.975  9.406   11.150  1.00 31.01 ? 294 ARG A CB    1 
ATOM   2249 C CG    . ARG A 1 297 ? 21.948  9.910   12.168  1.00 31.17 ? 294 ARG A CG    1 
ATOM   2250 C CD    . ARG A 1 297 ? 20.773  10.650  11.554  1.00 34.84 ? 294 ARG A CD    1 
ATOM   2251 N NE    . ARG A 1 297 ? 19.736  10.861  12.565  1.00 35.15 ? 294 ARG A NE    1 
ATOM   2252 C CZ    . ARG A 1 297 ? 18.797  11.805  12.535  1.00 37.51 ? 294 ARG A CZ    1 
ATOM   2253 N NH1   . ARG A 1 297 ? 18.720  12.674  11.526  1.00 38.02 ? 294 ARG A NH1   1 
ATOM   2254 N NH2   . ARG A 1 297 ? 17.927  11.887  13.541  1.00 37.35 ? 294 ARG A NH2   1 
ATOM   2255 N N     . LEU A 1 298 ? 25.415  11.525  11.415  1.00 31.09 ? 295 LEU A N     1 
ATOM   2256 C CA    . LEU A 1 298 ? 26.076  12.630  12.101  1.00 31.38 ? 295 LEU A CA    1 
ATOM   2257 C C     . LEU A 1 298 ? 26.123  13.880  11.216  1.00 31.74 ? 295 LEU A C     1 
ATOM   2258 O O     . LEU A 1 298 ? 25.823  14.983  11.683  1.00 31.12 ? 295 LEU A O     1 
ATOM   2259 C CB    . LEU A 1 298 ? 27.479  12.234  12.581  1.00 30.77 ? 295 LEU A CB    1 
ATOM   2260 C CG    . LEU A 1 298 ? 27.576  11.361  13.854  1.00 29.00 ? 295 LEU A CG    1 
ATOM   2261 C CD1   . LEU A 1 298 ? 29.015  11.015  14.158  1.00 25.41 ? 295 LEU A CD1   1 
ATOM   2262 C CD2   . LEU A 1 298 ? 26.923  12.046  15.060  1.00 26.11 ? 295 LEU A CD2   1 
ATOM   2263 N N     . GLU A 1 299 ? 26.487  13.705  9.948   1.00 32.70 ? 296 GLU A N     1 
ATOM   2264 C CA    . GLU A 1 299 ? 26.479  14.816  8.980   1.00 33.99 ? 296 GLU A CA    1 
ATOM   2265 C C     . GLU A 1 299 ? 25.078  15.366  8.744   1.00 33.88 ? 296 GLU A C     1 
ATOM   2266 O O     . GLU A 1 299 ? 24.886  16.561  8.717   1.00 34.12 ? 296 GLU A O     1 
ATOM   2267 C CB    . GLU A 1 299 ? 27.107  14.404  7.644   1.00 34.23 ? 296 GLU A CB    1 
ATOM   2268 C CG    . GLU A 1 299 ? 28.617  14.492  7.657   1.00 35.42 ? 296 GLU A CG    1 
ATOM   2269 C CD    . GLU A 1 299 ? 29.271  13.941  6.396   1.00 36.54 ? 296 GLU A CD    1 
ATOM   2270 O OE1   . GLU A 1 299 ? 28.670  13.043  5.744   1.00 39.57 ? 296 GLU A OE1   1 
ATOM   2271 O OE2   . GLU A 1 299 ? 30.404  14.397  6.067   1.00 39.81 ? 296 GLU A OE2   1 
ATOM   2272 N N     . GLU A 1 300 ? 24.099  14.492  8.577   1.00 34.53 ? 297 GLU A N     1 
ATOM   2273 C CA    . GLU A 1 300 ? 22.703  14.929  8.524   1.00 34.68 ? 297 GLU A CA    1 
ATOM   2274 C C     . GLU A 1 300 ? 22.369  15.824  9.720   1.00 34.41 ? 297 GLU A C     1 
ATOM   2275 O O     . GLU A 1 300 ? 21.763  16.871  9.567   1.00 34.63 ? 297 GLU A O     1 
ATOM   2276 C CB    . GLU A 1 300 ? 21.773  13.722  8.513   1.00 34.85 ? 297 GLU A CB    1 
ATOM   2277 C CG    . GLU A 1 300 ? 20.307  14.067  8.326   1.00 35.53 ? 297 GLU A CG    1 
ATOM   2278 C CD    . GLU A 1 300 ? 19.450  12.843  7.993   1.00 37.36 ? 297 GLU A CD    1 
ATOM   2279 O OE1   . GLU A 1 300 ? 19.754  11.725  8.506   1.00 39.76 ? 297 GLU A OE1   1 
ATOM   2280 O OE2   . GLU A 1 300 ? 18.474  13.009  7.206   1.00 41.46 ? 297 GLU A OE2   1 
ATOM   2281 N N     . LEU A 1 301 ? 22.791  15.406  10.911  1.00 33.98 ? 298 LEU A N     1 
ATOM   2282 C CA    . LEU A 1 301 ? 22.503  16.147  12.140  1.00 33.41 ? 298 LEU A CA    1 
ATOM   2283 C C     . LEU A 1 301 ? 23.148  17.538  12.172  1.00 33.00 ? 298 LEU A C     1 
ATOM   2284 O O     . LEU A 1 301 ? 22.651  18.438  12.855  1.00 33.20 ? 298 LEU A O     1 
ATOM   2285 C CB    . LEU A 1 301 ? 22.945  15.329  13.360  1.00 33.27 ? 298 LEU A CB    1 
ATOM   2286 C CG    . LEU A 1 301 ? 21.937  14.457  14.113  1.00 33.37 ? 298 LEU A CG    1 
ATOM   2287 C CD1   . LEU A 1 301 ? 20.722  14.148  13.307  1.00 34.17 ? 298 LEU A CD1   1 
ATOM   2288 C CD2   . LEU A 1 301 ? 22.589  13.163  14.595  1.00 30.93 ? 298 LEU A CD2   1 
ATOM   2289 N N     . GLY A 1 302 ? 24.242  17.708  11.434  1.00 32.41 ? 299 GLY A N     1 
ATOM   2290 C CA    . GLY A 1 302 ? 24.963  18.982  11.372  1.00 31.84 ? 299 GLY A CA    1 
ATOM   2291 C C     . GLY A 1 302 ? 26.373  18.945  11.951  1.00 31.57 ? 299 GLY A C     1 
ATOM   2292 O O     . GLY A 1 302 ? 27.036  19.995  12.053  1.00 31.39 ? 299 GLY A O     1 
ATOM   2293 N N     . TYR A 1 303 ? 26.847  17.755  12.331  1.00 30.47 ? 300 TYR A N     1 
ATOM   2294 C CA    . TYR A 1 303 ? 28.214  17.603  12.832  1.00 30.12 ? 300 TYR A CA    1 
ATOM   2295 C C     . TYR A 1 303 ? 29.228  17.686  11.692  1.00 29.91 ? 300 TYR A C     1 
ATOM   2296 O O     . TYR A 1 303 ? 28.880  17.510  10.531  1.00 29.36 ? 300 TYR A O     1 
ATOM   2297 C CB    . TYR A 1 303 ? 28.397  16.265  13.567  1.00 28.82 ? 300 TYR A CB    1 
ATOM   2298 C CG    . TYR A 1 303 ? 27.772  16.209  14.938  1.00 28.37 ? 300 TYR A CG    1 
ATOM   2299 C CD1   . TYR A 1 303 ? 28.414  16.761  16.048  1.00 27.39 ? 300 TYR A CD1   1 
ATOM   2300 C CD2   . TYR A 1 303 ? 26.534  15.596  15.134  1.00 26.96 ? 300 TYR A CD2   1 
ATOM   2301 C CE1   . TYR A 1 303 ? 27.830  16.700  17.311  1.00 27.10 ? 300 TYR A CE1   1 
ATOM   2302 C CE2   . TYR A 1 303 ? 25.953  15.534  16.389  1.00 26.46 ? 300 TYR A CE2   1 
ATOM   2303 C CZ    . TYR A 1 303 ? 26.602  16.083  17.475  1.00 26.22 ? 300 TYR A CZ    1 
ATOM   2304 O OH    . TYR A 1 303 ? 26.018  16.009  18.730  1.00 26.33 ? 300 TYR A OH    1 
ATOM   2305 N N     . ALA A 1 304 ? 30.479  17.959  12.056  1.00 30.12 ? 301 ALA A N     1 
ATOM   2306 C CA    . ALA A 1 304 ? 31.615  17.898  11.140  1.00 30.04 ? 301 ALA A CA    1 
ATOM   2307 C C     . ALA A 1 304 ? 32.282  16.534  11.271  1.00 30.16 ? 301 ALA A C     1 
ATOM   2308 O O     . ALA A 1 304 ? 32.892  16.242  12.298  1.00 30.08 ? 301 ALA A O     1 
ATOM   2309 C CB    . ALA A 1 304 ? 32.609  18.987  11.481  1.00 30.17 ? 301 ALA A CB    1 
ATOM   2310 N N     . VAL A 1 305 ? 32.185  15.711  10.228  1.00 29.89 ? 302 VAL A N     1 
ATOM   2311 C CA    . VAL A 1 305 ? 32.728  14.346  10.264  1.00 29.82 ? 302 VAL A CA    1 
ATOM   2312 C C     . VAL A 1 305 ? 33.929  14.182  9.332   1.00 29.80 ? 302 VAL A C     1 
ATOM   2313 O O     . VAL A 1 305 ? 33.867  14.572  8.170   1.00 29.80 ? 302 VAL A O     1 
ATOM   2314 C CB    . VAL A 1 305 ? 31.643  13.315  9.875   1.00 29.31 ? 302 VAL A CB    1 
ATOM   2315 C CG1   . VAL A 1 305 ? 32.170  11.892  10.067  1.00 30.31 ? 302 VAL A CG1   1 
ATOM   2316 C CG2   . VAL A 1 305 ? 30.379  13.537  10.707  1.00 27.72 ? 302 VAL A CG2   1 
ATOM   2317 N N     . VAL A 1 306 ? 35.015  13.614  9.845   1.00 29.44 ? 303 VAL A N     1 
ATOM   2318 C CA    . VAL A 1 306 ? 36.156  13.249  9.016   1.00 29.82 ? 303 VAL A CA    1 
ATOM   2319 C C     . VAL A 1 306 ? 35.875  11.867  8.402   1.00 30.39 ? 303 VAL A C     1 
ATOM   2320 O O     . VAL A 1 306 ? 35.532  10.931  9.129   1.00 30.66 ? 303 VAL A O     1 
ATOM   2321 C CB    . VAL A 1 306 ? 37.467  13.216  9.838   1.00 30.14 ? 303 VAL A CB    1 
ATOM   2322 C CG1   . VAL A 1 306 ? 38.671  12.881  8.946   1.00 29.00 ? 303 VAL A CG1   1 
ATOM   2323 C CG2   . VAL A 1 306 ? 37.679  14.551  10.542  1.00 29.34 ? 303 VAL A CG2   1 
ATOM   2324 N N     . PRO A 1 307 ? 35.987  11.733  7.066   1.00 30.45 ? 304 PRO A N     1 
ATOM   2325 C CA    . PRO A 1 307 ? 35.690  10.445  6.438   1.00 30.32 ? 304 PRO A CA    1 
ATOM   2326 C C     . PRO A 1 307 ? 36.602  9.327   6.924   1.00 30.14 ? 304 PRO A C     1 
ATOM   2327 O O     . PRO A 1 307 ? 37.820  9.492   6.948   1.00 30.70 ? 304 PRO A O     1 
ATOM   2328 C CB    . PRO A 1 307 ? 35.924  10.701  4.941   1.00 30.62 ? 304 PRO A CB    1 
ATOM   2329 C CG    . PRO A 1 307 ? 35.992  12.148  4.775   1.00 30.72 ? 304 PRO A CG    1 
ATOM   2330 C CD    . PRO A 1 307 ? 36.376  12.755  6.082   1.00 30.69 ? 304 PRO A CD    1 
ATOM   2331 N N     . SER A 1 308 ? 36.014  8.188   7.271   1.00 29.66 ? 305 SER A N     1 
ATOM   2332 C CA    . SER A 1 308 ? 36.751  7.097   7.882   1.00 29.58 ? 305 SER A CA    1 
ATOM   2333 C C     . SER A 1 308 ? 36.709  5.821   7.042   1.00 29.23 ? 305 SER A C     1 
ATOM   2334 O O     . SER A 1 308 ? 35.799  5.628   6.249   1.00 28.30 ? 305 SER A O     1 
ATOM   2335 C CB    . SER A 1 308 ? 36.182  6.833   9.265   1.00 29.30 ? 305 SER A CB    1 
ATOM   2336 O OG    . SER A 1 308 ? 36.805  5.719   9.848   1.00 28.74 ? 305 SER A OG    1 
ATOM   2337 N N     . GLU A 1 309 ? 37.715  4.968   7.209   1.00 29.09 ? 306 GLU A N     1 
ATOM   2338 C CA    . GLU A 1 309 ? 37.737  3.658   6.552   1.00 29.70 ? 306 GLU A CA    1 
ATOM   2339 C C     . GLU A 1 309 ? 37.982  2.537   7.564   1.00 29.27 ? 306 GLU A C     1 
ATOM   2340 O O     . GLU A 1 309 ? 38.500  1.475   7.201   1.00 29.19 ? 306 GLU A O     1 
ATOM   2341 C CB    . GLU A 1 309 ? 38.808  3.632   5.450   1.00 29.91 ? 306 GLU A CB    1 
ATOM   2342 C CG    . GLU A 1 309 ? 38.559  4.647   4.340   1.00 30.84 ? 306 GLU A CG    1 
ATOM   2343 C CD    . GLU A 1 309 ? 39.810  4.967   3.525   1.00 31.72 ? 306 GLU A CD    1 
ATOM   2344 O OE1   . GLU A 1 309 ? 40.226  4.097   2.729   1.00 32.84 ? 306 GLU A OE1   1 
ATOM   2345 O OE2   . GLU A 1 309 ? 40.360  6.096   3.676   1.00 33.84 ? 306 GLU A OE2   1 
ATOM   2346 N N     . SER A 1 310 ? 37.597  2.784   8.822   1.00 28.51 ? 307 SER A N     1 
ATOM   2347 C CA    . SER A 1 310 ? 37.805  1.846   9.936   1.00 28.42 ? 307 SER A CA    1 
ATOM   2348 C C     . SER A 1 310 ? 36.509  1.719   10.753  1.00 27.32 ? 307 SER A C     1 
ATOM   2349 O O     . SER A 1 310 ? 35.457  2.125   10.292  1.00 27.09 ? 307 SER A O     1 
ATOM   2350 C CB    . SER A 1 310 ? 38.944  2.345   10.825  1.00 28.61 ? 307 SER A CB    1 
ATOM   2351 O OG    . SER A 1 310 ? 38.605  3.634   11.326  1.00 32.48 ? 307 SER A OG    1 
ATOM   2352 N N     . ASN A 1 311 ? 36.599  1.176   11.966  1.00 26.56 ? 308 ASN A N     1 
ATOM   2353 C CA    . ASN A 1 311 ? 35.413  0.937   12.826  1.00 25.90 ? 308 ASN A CA    1 
ATOM   2354 C C     . ASN A 1 311 ? 35.135  2.060   13.832  1.00 25.25 ? 308 ASN A C     1 
ATOM   2355 O O     . ASN A 1 311 ? 34.644  1.816   14.941  1.00 24.77 ? 308 ASN A O     1 
ATOM   2356 C CB    . ASN A 1 311 ? 35.571  -0.391  13.569  1.00 25.25 ? 308 ASN A CB    1 
ATOM   2357 C CG    . ASN A 1 311 ? 36.775  -0.407  14.492  1.00 24.97 ? 308 ASN A CG    1 
ATOM   2358 O OD1   . ASN A 1 311 ? 37.759  0.309   14.273  1.00 24.18 ? 308 ASN A OD1   1 
ATOM   2359 N ND2   . ASN A 1 311 ? 36.713  -1.241  15.521  1.00 23.96 ? 308 ASN A ND2   1 
ATOM   2360 N N     . PHE A 1 312 ? 35.443  3.293   13.446  1.00 24.62 ? 309 PHE A N     1 
ATOM   2361 C CA    . PHE A 1 312 ? 35.193  4.435   14.310  1.00 24.40 ? 309 PHE A CA    1 
ATOM   2362 C C     . PHE A 1 312 ? 35.070  5.683   13.469  1.00 24.35 ? 309 PHE A C     1 
ATOM   2363 O O     . PHE A 1 312 ? 35.456  5.697   12.304  1.00 24.36 ? 309 PHE A O     1 
ATOM   2364 C CB    . PHE A 1 312 ? 36.319  4.618   15.348  1.00 24.05 ? 309 PHE A CB    1 
ATOM   2365 C CG    . PHE A 1 312 ? 37.702  4.682   14.739  1.00 22.75 ? 309 PHE A CG    1 
ATOM   2366 C CD1   . PHE A 1 312 ? 38.223  5.877   14.294  1.00 22.84 ? 309 PHE A CD1   1 
ATOM   2367 C CD2   . PHE A 1 312 ? 38.466  3.544   14.616  1.00 22.06 ? 309 PHE A CD2   1 
ATOM   2368 C CE1   . PHE A 1 312 ? 39.485  5.933   13.715  1.00 24.09 ? 309 PHE A CE1   1 
ATOM   2369 C CE2   . PHE A 1 312 ? 39.734  3.592   14.064  1.00 24.00 ? 309 PHE A CE2   1 
ATOM   2370 C CZ    . PHE A 1 312 ? 40.238  4.780   13.610  1.00 24.15 ? 309 PHE A CZ    1 
ATOM   2371 N N     . VAL A 1 313 ? 34.536  6.734   14.080  1.00 24.72 ? 310 VAL A N     1 
ATOM   2372 C CA    . VAL A 1 313 ? 34.279  7.975   13.387  1.00 24.74 ? 310 VAL A CA    1 
ATOM   2373 C C     . VAL A 1 313 ? 34.692  9.132   14.272  1.00 25.14 ? 310 VAL A C     1 
ATOM   2374 O O     . VAL A 1 313 ? 34.284  9.210   15.428  1.00 25.24 ? 310 VAL A O     1 
ATOM   2375 C CB    . VAL A 1 313 ? 32.800  8.092   12.993  1.00 24.99 ? 310 VAL A CB    1 
ATOM   2376 C CG1   . VAL A 1 313 ? 32.490  9.500   12.404  1.00 23.66 ? 310 VAL A CG1   1 
ATOM   2377 C CG2   . VAL A 1 313 ? 32.436  7.005   12.002  1.00 22.97 ? 310 VAL A CG2   1 
ATOM   2378 N N     . PHE A 1 314 ? 35.505  10.017  13.698  1.00 25.39 ? 311 PHE A N     1 
ATOM   2379 C CA    . PHE A 1 314 ? 36.017  11.229  14.334  1.00 25.55 ? 311 PHE A CA    1 
ATOM   2380 C C     . PHE A 1 314 ? 35.096  12.389  13.946  1.00 25.68 ? 311 PHE A C     1 
ATOM   2381 O O     . PHE A 1 314 ? 34.885  12.633  12.755  1.00 24.84 ? 311 PHE A O     1 
ATOM   2382 C CB    . PHE A 1 314 ? 37.428  11.454  13.789  1.00 25.98 ? 311 PHE A CB    1 
ATOM   2383 C CG    . PHE A 1 314 ? 38.252  12.431  14.551  1.00 26.46 ? 311 PHE A CG    1 
ATOM   2384 C CD1   . PHE A 1 314 ? 38.534  12.233  15.891  1.00 27.26 ? 311 PHE A CD1   1 
ATOM   2385 C CD2   . PHE A 1 314 ? 38.805  13.541  13.906  1.00 28.03 ? 311 PHE A CD2   1 
ATOM   2386 C CE1   . PHE A 1 314 ? 39.325  13.133  16.585  1.00 27.65 ? 311 PHE A CE1   1 
ATOM   2387 C CE2   . PHE A 1 314 ? 39.604  14.458  14.604  1.00 27.07 ? 311 PHE A CE2   1 
ATOM   2388 C CZ    . PHE A 1 314 ? 39.869  14.251  15.928  1.00 27.12 ? 311 PHE A CZ    1 
ATOM   2389 N N     . PHE A 1 315 ? 34.548  13.096  14.937  1.00 26.14 ? 312 PHE A N     1 
ATOM   2390 C CA    . PHE A 1 315 ? 33.588  14.186  14.673  1.00 26.76 ? 312 PHE A CA    1 
ATOM   2391 C C     . PHE A 1 315 ? 33.689  15.408  15.607  1.00 27.40 ? 312 PHE A C     1 
ATOM   2392 O O     . PHE A 1 315 ? 34.200  15.336  16.704  1.00 27.59 ? 312 PHE A O     1 
ATOM   2393 C CB    . PHE A 1 315 ? 32.152  13.646  14.641  1.00 25.63 ? 312 PHE A CB    1 
ATOM   2394 C CG    . PHE A 1 315 ? 31.641  13.170  15.971  1.00 24.78 ? 312 PHE A CG    1 
ATOM   2395 C CD1   . PHE A 1 315 ? 32.133  12.014  16.551  1.00 22.67 ? 312 PHE A CD1   1 
ATOM   2396 C CD2   . PHE A 1 315 ? 30.640  13.875  16.639  1.00 24.91 ? 312 PHE A CD2   1 
ATOM   2397 C CE1   . PHE A 1 315 ? 31.652  11.567  17.778  1.00 24.35 ? 312 PHE A CE1   1 
ATOM   2398 C CE2   . PHE A 1 315 ? 30.143  13.425  17.868  1.00 25.00 ? 312 PHE A CE2   1 
ATOM   2399 C CZ    . PHE A 1 315 ? 30.654  12.263  18.436  1.00 24.29 ? 312 PHE A CZ    1 
ATOM   2400 N N     . GLY A 1 316 ? 33.205  16.536  15.116  1.00 29.01 ? 313 GLY A N     1 
ATOM   2401 C CA    . GLY A 1 316 ? 33.283  17.826  15.807  1.00 29.71 ? 313 GLY A CA    1 
ATOM   2402 C C     . GLY A 1 316 ? 32.125  18.715  15.367  1.00 31.14 ? 313 GLY A C     1 
ATOM   2403 O O     . GLY A 1 316 ? 31.177  18.223  14.765  1.00 31.16 ? 313 GLY A O     1 
ATOM   2404 N N     . ASP A 1 317 ? 32.166  20.015  15.642  1.00 33.16 ? 314 ASP A N     1 
ATOM   2405 C CA    . ASP A 1 317 ? 33.288  20.722  16.260  1.00 33.70 ? 314 ASP A CA    1 
ATOM   2406 C C     . ASP A 1 317 ? 32.802  21.456  17.531  1.00 33.80 ? 314 ASP A C     1 
ATOM   2407 O O     . ASP A 1 317 ? 32.239  22.547  17.461  1.00 34.26 ? 314 ASP A O     1 
ATOM   2408 C CB    . ASP A 1 317 ? 33.859  21.697  15.225  1.00 34.49 ? 314 ASP A CB    1 
ATOM   2409 C CG    . ASP A 1 317 ? 35.185  22.299  15.635  1.00 35.61 ? 314 ASP A CG    1 
ATOM   2410 O OD1   . ASP A 1 317 ? 35.740  21.928  16.687  1.00 40.31 ? 314 ASP A OD1   1 
ATOM   2411 O OD2   . ASP A 1 317 ? 35.682  23.161  14.881  1.00 42.45 ? 314 ASP A OD2   1 
ATOM   2412 N N     . PHE A 1 318 ? 33.033  20.848  18.691  1.00 33.30 ? 315 PHE A N     1 
ATOM   2413 C CA    . PHE A 1 318 ? 32.501  21.350  19.952  1.00 33.05 ? 315 PHE A CA    1 
ATOM   2414 C C     . PHE A 1 318 ? 33.352  22.495  20.500  1.00 33.29 ? 315 PHE A C     1 
ATOM   2415 O O     . PHE A 1 318 ? 34.561  22.542  20.263  1.00 32.81 ? 315 PHE A O     1 
ATOM   2416 C CB    . PHE A 1 318 ? 32.454  20.234  21.002  1.00 32.60 ? 315 PHE A CB    1 
ATOM   2417 C CG    . PHE A 1 318 ? 31.661  19.028  20.587  1.00 31.30 ? 315 PHE A CG    1 
ATOM   2418 C CD1   . PHE A 1 318 ? 30.285  19.016  20.703  1.00 31.45 ? 315 PHE A CD1   1 
ATOM   2419 C CD2   . PHE A 1 318 ? 32.297  17.903  20.101  1.00 31.21 ? 315 PHE A CD2   1 
ATOM   2420 C CE1   . PHE A 1 318 ? 29.554  17.901  20.334  1.00 32.31 ? 315 PHE A CE1   1 
ATOM   2421 C CE2   . PHE A 1 318 ? 31.578  16.776  19.720  1.00 31.68 ? 315 PHE A CE2   1 
ATOM   2422 C CZ    . PHE A 1 318 ? 30.204  16.772  19.843  1.00 32.28 ? 315 PHE A CZ    1 
ATOM   2423 N N     . SER A 1 319 ? 32.712  23.416  21.225  1.00 33.37 ? 316 SER A N     1 
ATOM   2424 C CA    . SER A 1 319 ? 33.427  24.459  21.962  1.00 33.60 ? 316 SER A CA    1 
ATOM   2425 C C     . SER A 1 319 ? 34.222  23.847  23.114  1.00 33.44 ? 316 SER A C     1 
ATOM   2426 O O     . SER A 1 319 ? 35.309  24.314  23.446  1.00 33.18 ? 316 SER A O     1 
ATOM   2427 C CB    . SER A 1 319 ? 32.458  25.487  22.551  1.00 34.17 ? 316 SER A CB    1 
ATOM   2428 O OG    . SER A 1 319 ? 31.312  25.643  21.753  1.00 36.35 ? 316 SER A OG    1 
ATOM   2429 N N     . ASP A 1 320 ? 33.653  22.812  23.733  1.00 33.14 ? 317 ASP A N     1 
ATOM   2430 C CA    . ASP A 1 320 ? 34.338  22.054  24.778  1.00 32.50 ? 317 ASP A CA    1 
ATOM   2431 C C     . ASP A 1 320 ? 33.953  20.571  24.654  1.00 31.81 ? 317 ASP A C     1 
ATOM   2432 O O     . ASP A 1 320 ? 32.921  20.136  25.155  1.00 30.98 ? 317 ASP A O     1 
ATOM   2433 C CB    . ASP A 1 320 ? 33.967  22.634  26.152  1.00 33.01 ? 317 ASP A CB    1 
ATOM   2434 C CG    . ASP A 1 320 ? 34.679  21.943  27.310  1.00 33.25 ? 317 ASP A CG    1 
ATOM   2435 O OD1   . ASP A 1 320 ? 35.306  20.880  27.114  1.00 35.16 ? 317 ASP A OD1   1 
ATOM   2436 O OD2   . ASP A 1 320 ? 34.606  22.486  28.432  1.00 34.21 ? 317 ASP A OD2   1 
ATOM   2437 N N     . GLN A 1 321 ? 34.799  19.798  23.983  1.00 31.16 ? 318 GLN A N     1 
ATOM   2438 C CA    . GLN A 1 321 ? 34.480  18.396  23.710  1.00 30.70 ? 318 GLN A CA    1 
ATOM   2439 C C     . GLN A 1 321 ? 34.451  17.536  24.955  1.00 29.91 ? 318 GLN A C     1 
ATOM   2440 O O     . GLN A 1 321 ? 33.804  16.487  24.954  1.00 28.92 ? 318 GLN A O     1 
ATOM   2441 C CB    . GLN A 1 321 ? 35.396  17.759  22.657  1.00 30.74 ? 318 GLN A CB    1 
ATOM   2442 C CG    . GLN A 1 321 ? 36.702  18.447  22.406  1.00 32.52 ? 318 GLN A CG    1 
ATOM   2443 C CD    . GLN A 1 321 ? 37.688  18.343  23.526  1.00 33.28 ? 318 GLN A CD    1 
ATOM   2444 O OE1   . GLN A 1 321 ? 37.782  17.317  24.185  1.00 37.20 ? 318 GLN A OE1   1 
ATOM   2445 N NE2   . GLN A 1 321 ? 38.472  19.390  23.718  1.00 31.77 ? 318 GLN A NE2   1 
ATOM   2446 N N     . HIS A 1 322 ? 35.127  17.961  26.020  1.00 29.36 ? 319 HIS A N     1 
ATOM   2447 C CA    . HIS A 1 322 ? 35.007  17.233  27.262  1.00 28.99 ? 319 HIS A CA    1 
ATOM   2448 C C     . HIS A 1 322 ? 33.577  17.370  27.821  1.00 28.47 ? 319 HIS A C     1 
ATOM   2449 O O     . HIS A 1 322 ? 32.985  16.379  28.253  1.00 27.50 ? 319 HIS A O     1 
ATOM   2450 C CB    . HIS A 1 322 ? 36.055  17.665  28.283  1.00 29.98 ? 319 HIS A CB    1 
ATOM   2451 C CG    . HIS A 1 322 ? 36.157  16.739  29.453  1.00 30.47 ? 319 HIS A CG    1 
ATOM   2452 N ND1   . HIS A 1 322 ? 35.665  17.060  30.699  1.00 32.88 ? 319 HIS A ND1   1 
ATOM   2453 C CD2   . HIS A 1 322 ? 36.659  15.484  29.557  1.00 32.05 ? 319 HIS A CD2   1 
ATOM   2454 C CE1   . HIS A 1 322 ? 35.881  16.054  31.528  1.00 33.27 ? 319 HIS A CE1   1 
ATOM   2455 N NE2   . HIS A 1 322 ? 36.479  15.083  30.859  1.00 32.22 ? 319 HIS A NE2   1 
ATOM   2456 N N     . ALA A 1 323 ? 33.012  18.576  27.768  1.00 27.09 ? 320 ALA A N     1 
ATOM   2457 C CA    . ALA A 1 323 ? 31.608  18.769  28.120  1.00 26.72 ? 320 ALA A CA    1 
ATOM   2458 C C     . ALA A 1 323 ? 30.686  17.949  27.212  1.00 26.38 ? 320 ALA A C     1 
ATOM   2459 O O     . ALA A 1 323 ? 29.684  17.370  27.662  1.00 26.03 ? 320 ALA A O     1 
ATOM   2460 C CB    . ALA A 1 323 ? 31.237  20.237  28.062  1.00 26.74 ? 320 ALA A CB    1 
ATOM   2461 N N     . ALA A 1 324 ? 31.014  17.895  25.926  1.00 25.56 ? 321 ALA A N     1 
ATOM   2462 C CA    . ALA A 1 324 ? 30.232  17.085  24.991  1.00 24.77 ? 321 ALA A CA    1 
ATOM   2463 C C     . ALA A 1 324 ? 30.354  15.610  25.401  1.00 24.27 ? 321 ALA A C     1 
ATOM   2464 O O     . ALA A 1 324 ? 29.369  14.870  25.429  1.00 24.41 ? 321 ALA A O     1 
ATOM   2465 C CB    . ALA A 1 324 ? 30.701  17.307  23.585  1.00 24.21 ? 321 ALA A CB    1 
ATOM   2466 N N     . TRP A 1 325 ? 31.558  15.214  25.775  1.00 23.29 ? 322 TRP A N     1 
ATOM   2467 C CA    . TRP A 1 325 ? 31.823  13.864  26.239  1.00 23.51 ? 322 TRP A CA    1 
ATOM   2468 C C     . TRP A 1 325 ? 30.966  13.491  27.474  1.00 23.53 ? 322 TRP A C     1 
ATOM   2469 O O     . TRP A 1 325 ? 30.378  12.394  27.532  1.00 21.57 ? 322 TRP A O     1 
ATOM   2470 C CB    . TRP A 1 325 ? 33.320  13.691  26.524  1.00 22.74 ? 322 TRP A CB    1 
ATOM   2471 C CG    . TRP A 1 325 ? 33.676  12.338  27.076  1.00 23.01 ? 322 TRP A CG    1 
ATOM   2472 C CD1   . TRP A 1 325 ? 33.822  11.186  26.378  1.00 22.58 ? 322 TRP A CD1   1 
ATOM   2473 C CD2   . TRP A 1 325 ? 33.890  12.011  28.448  1.00 21.96 ? 322 TRP A CD2   1 
ATOM   2474 N NE1   . TRP A 1 325 ? 34.137  10.164  27.218  1.00 22.05 ? 322 TRP A NE1   1 
ATOM   2475 C CE2   . TRP A 1 325 ? 34.174  10.638  28.503  1.00 22.73 ? 322 TRP A CE2   1 
ATOM   2476 C CE3   . TRP A 1 325 ? 33.863  12.751  29.642  1.00 22.46 ? 322 TRP A CE3   1 
ATOM   2477 C CZ2   . TRP A 1 325 ? 34.449  9.977   29.701  1.00 22.58 ? 322 TRP A CZ2   1 
ATOM   2478 C CZ3   . TRP A 1 325 ? 34.115  12.103  30.830  1.00 23.10 ? 322 TRP A CZ3   1 
ATOM   2479 C CH2   . TRP A 1 325 ? 34.418  10.718  30.849  1.00 23.16 ? 322 TRP A CH2   1 
ATOM   2480 N N     . GLN A 1 326 ? 30.902  14.416  28.438  1.00 23.95 ? 323 GLN A N     1 
ATOM   2481 C CA    . GLN A 1 326 ? 30.097  14.251  29.637  1.00 24.53 ? 323 GLN A CA    1 
ATOM   2482 C C     . GLN A 1 326 ? 28.620  14.100  29.307  1.00 23.89 ? 323 GLN A C     1 
ATOM   2483 O O     . GLN A 1 326 ? 27.932  13.310  29.925  1.00 24.50 ? 323 GLN A O     1 
ATOM   2484 C CB    . GLN A 1 326 ? 30.290  15.435  30.594  1.00 24.89 ? 323 GLN A CB    1 
ATOM   2485 C CG    . GLN A 1 326 ? 31.669  15.490  31.230  1.00 26.81 ? 323 GLN A CG    1 
ATOM   2486 C CD    . GLN A 1 326 ? 31.859  16.688  32.164  1.00 28.31 ? 323 GLN A CD    1 
ATOM   2487 O OE1   . GLN A 1 326 ? 31.144  17.691  32.064  1.00 33.34 ? 323 GLN A OE1   1 
ATOM   2488 N NE2   . GLN A 1 326 ? 32.843  16.588  33.074  1.00 33.93 ? 323 GLN A NE2   1 
ATOM   2489 N N     . ALA A 1 327 ? 28.134  14.859  28.334  1.00 23.54 ? 324 ALA A N     1 
ATOM   2490 C CA    . ALA A 1 327 ? 26.732  14.783  27.919  1.00 23.12 ? 324 ALA A CA    1 
ATOM   2491 C C     . ALA A 1 327 ? 26.376  13.410  27.355  1.00 22.62 ? 324 ALA A C     1 
ATOM   2492 O O     . ALA A 1 327 ? 25.273  12.929  27.571  1.00 22.43 ? 324 ALA A O     1 
ATOM   2493 C CB    . ALA A 1 327 ? 26.407  15.870  26.893  1.00 22.59 ? 324 ALA A CB    1 
ATOM   2494 N N     . PHE A 1 328 ? 27.295  12.816  26.601  1.00 22.22 ? 325 PHE A N     1 
ATOM   2495 C CA    . PHE A 1 328 ? 27.133  11.459  26.072  1.00 22.54 ? 325 PHE A CA    1 
ATOM   2496 C C     . PHE A 1 328 ? 27.106  10.461  27.205  1.00 22.55 ? 325 PHE A C     1 
ATOM   2497 O O     . PHE A 1 328 ? 26.229  9.596   27.248  1.00 21.90 ? 325 PHE A O     1 
ATOM   2498 C CB    . PHE A 1 328 ? 28.265  11.100  25.090  1.00 22.02 ? 325 PHE A CB    1 
ATOM   2499 C CG    . PHE A 1 328 ? 28.006  11.534  23.682  1.00 21.75 ? 325 PHE A CG    1 
ATOM   2500 C CD1   . PHE A 1 328 ? 27.151  10.803  22.863  1.00 22.08 ? 325 PHE A CD1   1 
ATOM   2501 C CD2   . PHE A 1 328 ? 28.624  12.670  23.158  1.00 21.66 ? 325 PHE A CD2   1 
ATOM   2502 C CE1   . PHE A 1 328 ? 26.895  11.206  21.550  1.00 21.43 ? 325 PHE A CE1   1 
ATOM   2503 C CE2   . PHE A 1 328 ? 28.390  13.073  21.854  1.00 22.01 ? 325 PHE A CE2   1 
ATOM   2504 C CZ    . PHE A 1 328 ? 27.529  12.346  21.042  1.00 21.70 ? 325 PHE A CZ    1 
ATOM   2505 N N     . LEU A 1 329 ? 28.074  10.590  28.122  1.00 23.15 ? 326 LEU A N     1 
ATOM   2506 C CA    . LEU A 1 329 ? 28.149  9.752   29.308  1.00 23.57 ? 326 LEU A CA    1 
ATOM   2507 C C     . LEU A 1 329 ? 26.854  9.817   30.121  1.00 24.26 ? 326 LEU A C     1 
ATOM   2508 O O     . LEU A 1 329 ? 26.313  8.785   30.516  1.00 24.01 ? 326 LEU A O     1 
ATOM   2509 C CB    . LEU A 1 329 ? 29.350  10.152  30.180  1.00 23.53 ? 326 LEU A CB    1 
ATOM   2510 C CG    . LEU A 1 329 ? 29.566  9.353   31.472  1.00 23.74 ? 326 LEU A CG    1 
ATOM   2511 C CD1   . LEU A 1 329 ? 29.913  7.907   31.124  1.00 23.93 ? 326 LEU A CD1   1 
ATOM   2512 C CD2   . LEU A 1 329 ? 30.645  9.971   32.394  1.00 23.66 ? 326 LEU A CD2   1 
ATOM   2513 N N     . ASP A 1 330 ? 26.348  11.023  30.354  1.00 25.08 ? 327 ASP A N     1 
ATOM   2514 C CA    . ASP A 1 330 ? 25.069  11.205  31.056  1.00 25.87 ? 327 ASP A CA    1 
ATOM   2515 C C     . ASP A 1 330 ? 23.892  10.538  30.373  1.00 26.54 ? 327 ASP A C     1 
ATOM   2516 O O     . ASP A 1 330 ? 22.911  10.210  31.033  1.00 27.30 ? 327 ASP A O     1 
ATOM   2517 C CB    . ASP A 1 330 ? 24.743  12.681  31.213  1.00 26.18 ? 327 ASP A CB    1 
ATOM   2518 C CG    . ASP A 1 330 ? 25.564  13.347  32.299  1.00 28.34 ? 327 ASP A CG    1 
ATOM   2519 O OD1   . ASP A 1 330 ? 26.182  12.609  33.111  1.00 28.11 ? 327 ASP A OD1   1 
ATOM   2520 O OD2   . ASP A 1 330 ? 25.564  14.608  32.355  1.00 30.22 ? 327 ASP A OD2   1 
ATOM   2521 N N     . ARG A 1 331 ? 23.980  10.350  29.056  1.00 26.77 ? 328 ARG A N     1 
ATOM   2522 C CA    . ARG A 1 331 ? 22.950  9.628   28.302  1.00 26.33 ? 328 ARG A CA    1 
ATOM   2523 C C     . ARG A 1 331 ? 23.285  8.133   28.118  1.00 26.17 ? 328 ARG A C     1 
ATOM   2524 O O     . ARG A 1 331 ? 22.631  7.439   27.334  1.00 25.96 ? 328 ARG A O     1 
ATOM   2525 C CB    . ARG A 1 331 ? 22.707  10.313  26.954  1.00 26.74 ? 328 ARG A CB    1 
ATOM   2526 C CG    . ARG A 1 331 ? 22.042  11.693  27.089  1.00 27.24 ? 328 ARG A CG    1 
ATOM   2527 C CD    . ARG A 1 331 ? 22.312  12.584  25.898  1.00 27.40 ? 328 ARG A CD    1 
ATOM   2528 N NE    . ARG A 1 331 ? 21.611  13.862  25.990  1.00 28.22 ? 328 ARG A NE    1 
ATOM   2529 C CZ    . ARG A 1 331 ? 21.953  14.864  26.800  1.00 29.61 ? 328 ARG A CZ    1 
ATOM   2530 N NH1   . ARG A 1 331 ? 22.993  14.778  27.617  1.00 29.01 ? 328 ARG A NH1   1 
ATOM   2531 N NH2   . ARG A 1 331 ? 21.240  15.986  26.782  1.00 32.84 ? 328 ARG A NH2   1 
ATOM   2532 N N     . GLY A 1 332 ? 24.271  7.636   28.863  1.00 25.35 ? 329 GLY A N     1 
ATOM   2533 C CA    . GLY A 1 332 ? 24.608  6.203   28.855  1.00 25.24 ? 329 GLY A CA    1 
ATOM   2534 C C     . GLY A 1 332 ? 25.550  5.724   27.757  1.00 24.92 ? 329 GLY A C     1 
ATOM   2535 O O     . GLY A 1 332 ? 25.707  4.508   27.547  1.00 25.30 ? 329 GLY A O     1 
ATOM   2536 N N     . VAL A 1 333 ? 26.204  6.660   27.075  1.00 24.44 ? 330 VAL A N     1 
ATOM   2537 C CA    . VAL A 1 333 ? 27.060  6.335   25.938  1.00 24.06 ? 330 VAL A CA    1 
ATOM   2538 C C     . VAL A 1 333 ? 28.458  6.794   26.254  1.00 23.92 ? 330 VAL A C     1 
ATOM   2539 O O     . VAL A 1 333 ? 28.703  8.000   26.463  1.00 23.81 ? 330 VAL A O     1 
ATOM   2540 C CB    . VAL A 1 333 ? 26.563  7.017   24.621  1.00 24.48 ? 330 VAL A CB    1 
ATOM   2541 C CG1   . VAL A 1 333 ? 27.433  6.608   23.416  1.00 24.17 ? 330 VAL A CG1   1 
ATOM   2542 C CG2   . VAL A 1 333 ? 25.089  6.694   24.375  1.00 22.61 ? 330 VAL A CG2   1 
ATOM   2543 N N     . LEU A 1 334 ? 29.369  5.830   26.322  1.00 23.12 ? 331 LEU A N     1 
ATOM   2544 C CA    . LEU A 1 334 ? 30.764  6.113   26.531  1.00 23.06 ? 331 LEU A CA    1 
ATOM   2545 C C     . LEU A 1 334 ? 31.519  6.100   25.210  1.00 22.61 ? 331 LEU A C     1 
ATOM   2546 O O     . LEU A 1 334 ? 31.691  5.055   24.592  1.00 21.92 ? 331 LEU A O     1 
ATOM   2547 C CB    . LEU A 1 334 ? 31.374  5.084   27.488  1.00 23.32 ? 331 LEU A CB    1 
ATOM   2548 C CG    . LEU A 1 334 ? 32.831  5.316   27.890  1.00 22.98 ? 331 LEU A CG    1 
ATOM   2549 C CD1   . LEU A 1 334 ? 33.014  6.681   28.571  1.00 22.61 ? 331 LEU A CD1   1 
ATOM   2550 C CD2   . LEU A 1 334 ? 33.335  4.177   28.779  1.00 23.07 ? 331 LEU A CD2   1 
ATOM   2551 N N     . ILE A 1 335 ? 31.958  7.276   24.788  1.00 22.50 ? 332 ILE A N     1 
ATOM   2552 C CA    . ILE A 1 335 ? 32.884  7.403   23.664  1.00 22.68 ? 332 ILE A CA    1 
ATOM   2553 C C     . ILE A 1 335 ? 34.249  7.906   24.164  1.00 22.69 ? 332 ILE A C     1 
ATOM   2554 O O     . ILE A 1 335 ? 34.522  7.882   25.358  1.00 21.98 ? 332 ILE A O     1 
ATOM   2555 C CB    . ILE A 1 335 ? 32.273  8.225   22.502  1.00 21.98 ? 332 ILE A CB    1 
ATOM   2556 C CG1   . ILE A 1 335 ? 32.038  9.682   22.894  1.00 21.80 ? 332 ILE A CG1   1 
ATOM   2557 C CG2   . ILE A 1 335 ? 30.959  7.592   22.058  1.00 22.92 ? 332 ILE A CG2   1 
ATOM   2558 C CD1   . ILE A 1 335 ? 31.473  10.511  21.769  1.00 21.81 ? 332 ILE A CD1   1 
ATOM   2559 N N     . ARG A 1 336 ? 35.118  8.305   23.240  1.00 24.15 ? 333 ARG A N     1 
ATOM   2560 C CA    . ARG A 1 336 ? 36.489  8.648   23.539  1.00 24.58 ? 333 ARG A CA    1 
ATOM   2561 C C     . ARG A 1 336 ? 36.766  10.141  23.311  1.00 25.27 ? 333 ARG A C     1 
ATOM   2562 O O     . ARG A 1 336 ? 36.516  10.678  22.224  1.00 24.42 ? 333 ARG A O     1 
ATOM   2563 C CB    . ARG A 1 336 ? 37.396  7.803   22.655  1.00 25.22 ? 333 ARG A CB    1 
ATOM   2564 C CG    . ARG A 1 336 ? 38.887  7.868   22.940  1.00 25.79 ? 333 ARG A CG    1 
ATOM   2565 C CD    . ARG A 1 336 ? 39.335  7.005   24.115  1.00 30.05 ? 333 ARG A CD    1 
ATOM   2566 N NE    . ARG A 1 336 ? 39.861  7.830   25.180  1.00 32.07 ? 333 ARG A NE    1 
ATOM   2567 C CZ    . ARG A 1 336 ? 41.033  7.679   25.799  1.00 33.67 ? 333 ARG A CZ    1 
ATOM   2568 N NH1   . ARG A 1 336 ? 41.901  6.732   25.478  1.00 33.30 ? 333 ARG A NH1   1 
ATOM   2569 N NH2   . ARG A 1 336 ? 41.340  8.526   26.768  1.00 33.70 ? 333 ARG A NH2   1 
ATOM   2570 N N     . ASP A 1 337 ? 37.276  10.797  24.355  1.00 25.87 ? 334 ASP A N     1 
ATOM   2571 C CA    . ASP A 1 337 ? 37.886  12.107  24.231  1.00 26.38 ? 334 ASP A CA    1 
ATOM   2572 C C     . ASP A 1 337 ? 39.356  11.852  24.000  1.00 26.86 ? 334 ASP A C     1 
ATOM   2573 O O     . ASP A 1 337 ? 40.075  11.504  24.916  1.00 26.46 ? 334 ASP A O     1 
ATOM   2574 C CB    . ASP A 1 337 ? 37.657  12.932  25.497  1.00 26.40 ? 334 ASP A CB    1 
ATOM   2575 C CG    . ASP A 1 337 ? 38.277  14.340  25.431  1.00 27.00 ? 334 ASP A CG    1 
ATOM   2576 O OD1   . ASP A 1 337 ? 39.037  14.689  24.490  1.00 27.40 ? 334 ASP A OD1   1 
ATOM   2577 O OD2   . ASP A 1 337 ? 38.007  15.103  26.371  1.00 30.14 ? 334 ASP A OD2   1 
ATOM   2578 N N     . VAL A 1 338 ? 39.793  12.015  22.758  1.00 27.75 ? 335 VAL A N     1 
ATOM   2579 C CA    . VAL A 1 338 ? 41.190  11.752  22.376  1.00 28.63 ? 335 VAL A CA    1 
ATOM   2580 C C     . VAL A 1 338 ? 42.137  12.935  22.611  1.00 29.35 ? 335 VAL A C     1 
ATOM   2581 O O     . VAL A 1 338 ? 43.271  12.918  22.145  1.00 29.64 ? 335 VAL A O     1 
ATOM   2582 C CB    . VAL A 1 338 ? 41.277  11.327  20.890  1.00 28.67 ? 335 VAL A CB    1 
ATOM   2583 C CG1   . VAL A 1 338 ? 40.551  10.008  20.673  1.00 28.35 ? 335 VAL A CG1   1 
ATOM   2584 C CG2   . VAL A 1 338 ? 40.700  12.422  19.981  1.00 29.34 ? 335 VAL A CG2   1 
ATOM   2585 N N     . GLY A 1 339 ? 41.676  13.963  23.322  1.00 30.09 ? 336 GLY A N     1 
ATOM   2586 C CA    . GLY A 1 339 ? 42.513  15.123  23.629  1.00 29.99 ? 336 GLY A CA    1 
ATOM   2587 C C     . GLY A 1 339 ? 42.680  16.098  22.476  1.00 30.16 ? 336 GLY A C     1 
ATOM   2588 O O     . GLY A 1 339 ? 43.611  16.888  22.475  1.00 31.14 ? 336 GLY A O     1 
ATOM   2589 N N     . ILE A 1 340 ? 41.788  16.053  21.492  1.00 30.19 ? 337 ILE A N     1 
ATOM   2590 C CA    . ILE A 1 340 ? 41.863  16.959  20.342  1.00 29.97 ? 337 ILE A CA    1 
ATOM   2591 C C     . ILE A 1 340 ? 40.719  17.944  20.487  1.00 29.60 ? 337 ILE A C     1 
ATOM   2592 O O     . ILE A 1 340 ? 39.551  17.550  20.587  1.00 29.69 ? 337 ILE A O     1 
ATOM   2593 C CB    . ILE A 1 340 ? 41.740  16.226  18.969  1.00 30.03 ? 337 ILE A CB    1 
ATOM   2594 C CG1   . ILE A 1 340 ? 42.771  15.093  18.825  1.00 31.28 ? 337 ILE A CG1   1 
ATOM   2595 C CG2   . ILE A 1 340 ? 41.876  17.216  17.795  1.00 29.75 ? 337 ILE A CG2   1 
ATOM   2596 C CD1   . ILE A 1 340 ? 44.198  15.535  18.859  1.00 33.45 ? 337 ILE A CD1   1 
ATOM   2597 N N     . ALA A 1 341 ? 41.065  19.222  20.505  1.00 29.36 ? 338 ALA A N     1 
ATOM   2598 C CA    . ALA A 1 341 ? 40.093  20.290  20.688  1.00 29.02 ? 338 ALA A CA    1 
ATOM   2599 C C     . ALA A 1 341 ? 38.999  20.236  19.632  1.00 28.52 ? 338 ALA A C     1 
ATOM   2600 O O     . ALA A 1 341 ? 39.267  20.217  18.430  1.00 28.40 ? 338 ALA A O     1 
ATOM   2601 C CB    . ALA A 1 341 ? 40.784  21.639  20.676  1.00 29.15 ? 338 ALA A CB    1 
ATOM   2602 N N     . GLY A 1 342 ? 37.758  20.197  20.109  1.00 28.18 ? 339 GLY A N     1 
ATOM   2603 C CA    . GLY A 1 342 ? 36.579  20.192  19.259  1.00 27.69 ? 339 GLY A CA    1 
ATOM   2604 C C     . GLY A 1 342 ? 36.048  18.840  18.823  1.00 27.60 ? 339 GLY A C     1 
ATOM   2605 O O     . GLY A 1 342 ? 34.935  18.753  18.310  1.00 28.43 ? 339 GLY A O     1 
ATOM   2606 N N     . HIS A 1 343 ? 36.823  17.781  19.022  1.00 26.96 ? 340 HIS A N     1 
ATOM   2607 C CA    . HIS A 1 343 ? 36.491  16.481  18.429  1.00 26.03 ? 340 HIS A CA    1 
ATOM   2608 C C     . HIS A 1 343 ? 36.403  15.363  19.449  1.00 25.05 ? 340 HIS A C     1 
ATOM   2609 O O     . HIS A 1 343 ? 37.013  15.429  20.514  1.00 24.79 ? 340 HIS A O     1 
ATOM   2610 C CB    . HIS A 1 343 ? 37.529  16.139  17.357  1.00 26.44 ? 340 HIS A CB    1 
ATOM   2611 C CG    . HIS A 1 343 ? 37.528  17.104  16.214  1.00 27.43 ? 340 HIS A CG    1 
ATOM   2612 N ND1   . HIS A 1 343 ? 38.038  18.381  16.321  1.00 29.63 ? 340 HIS A ND1   1 
ATOM   2613 C CD2   . HIS A 1 343 ? 37.030  17.002  14.958  1.00 29.01 ? 340 HIS A CD2   1 
ATOM   2614 C CE1   . HIS A 1 343 ? 37.873  19.016  15.172  1.00 29.74 ? 340 HIS A CE1   1 
ATOM   2615 N NE2   . HIS A 1 343 ? 37.254  18.205  14.332  1.00 29.66 ? 340 HIS A NE2   1 
ATOM   2616 N N     . LEU A 1 344 ? 35.625  14.346  19.103  1.00 23.98 ? 341 LEU A N     1 
ATOM   2617 C CA    . LEU A 1 344 ? 35.518  13.116  19.877  1.00 23.58 ? 341 LEU A CA    1 
ATOM   2618 C C     . LEU A 1 344 ? 35.572  11.959  18.896  1.00 22.93 ? 341 LEU A C     1 
ATOM   2619 O O     . LEU A 1 344 ? 35.348  12.152  17.694  1.00 23.08 ? 341 LEU A O     1 
ATOM   2620 C CB    . LEU A 1 344 ? 34.191  13.065  20.671  1.00 22.93 ? 341 LEU A CB    1 
ATOM   2621 C CG    . LEU A 1 344 ? 33.968  14.126  21.753  1.00 23.72 ? 341 LEU A CG    1 
ATOM   2622 C CD1   . LEU A 1 344 ? 32.569  13.978  22.414  1.00 22.67 ? 341 LEU A CD1   1 
ATOM   2623 C CD2   . LEU A 1 344 ? 35.067  14.087  22.814  1.00 21.54 ? 341 LEU A CD2   1 
ATOM   2624 N N     . ARG A 1 345 ? 35.833  10.757  19.409  1.00 22.26 ? 342 ARG A N     1 
ATOM   2625 C CA    . ARG A 1 345 ? 35.873  9.567   18.568  1.00 22.38 ? 342 ARG A CA    1 
ATOM   2626 C C     . ARG A 1 345 ? 34.912  8.508   19.102  1.00 22.30 ? 342 ARG A C     1 
ATOM   2627 O O     . ARG A 1 345 ? 35.040  8.075   20.255  1.00 22.30 ? 342 ARG A O     1 
ATOM   2628 C CB    . ARG A 1 345 ? 37.301  9.016   18.489  1.00 21.99 ? 342 ARG A CB    1 
ATOM   2629 C CG    . ARG A 1 345 ? 37.457  7.790   17.587  1.00 22.16 ? 342 ARG A CG    1 
ATOM   2630 C CD    . ARG A 1 345 ? 38.743  7.050   17.866  1.00 22.28 ? 342 ARG A CD    1 
ATOM   2631 N NE    . ARG A 1 345 ? 38.609  6.189   19.044  1.00 22.43 ? 342 ARG A NE    1 
ATOM   2632 C CZ    . ARG A 1 345 ? 39.603  5.896   19.873  1.00 22.76 ? 342 ARG A CZ    1 
ATOM   2633 N NH1   . ARG A 1 345 ? 40.834  6.350   19.653  1.00 22.52 ? 342 ARG A NH1   1 
ATOM   2634 N NH2   . ARG A 1 345 ? 39.365  5.132   20.929  1.00 22.94 ? 342 ARG A NH2   1 
ATOM   2635 N N     . THR A 1 346 ? 33.950  8.110   18.260  1.00 22.29 ? 343 THR A N     1 
ATOM   2636 C CA    . THR A 1 346 ? 33.015  7.041   18.589  1.00 22.43 ? 343 THR A CA    1 
ATOM   2637 C C     . THR A 1 346 ? 33.391  5.760   17.843  1.00 22.62 ? 343 THR A C     1 
ATOM   2638 O O     . THR A 1 346 ? 33.692  5.778   16.648  1.00 23.68 ? 343 THR A O     1 
ATOM   2639 C CB    . THR A 1 346 ? 31.523  7.398   18.292  1.00 22.15 ? 343 THR A CB    1 
ATOM   2640 O OG1   . THR A 1 346 ? 30.681  6.306   18.704  1.00 22.28 ? 343 THR A OG1   1 
ATOM   2641 C CG2   . THR A 1 346 ? 31.290  7.666   16.816  1.00 22.94 ? 343 THR A CG2   1 
ATOM   2642 N N     . THR A 1 347 ? 33.357  4.655   18.569  1.00 22.24 ? 344 THR A N     1 
ATOM   2643 C CA    . THR A 1 347 ? 33.545  3.336   17.989  1.00 22.04 ? 344 THR A CA    1 
ATOM   2644 C C     . THR A 1 347 ? 32.205  2.859   17.437  1.00 21.85 ? 344 THR A C     1 
ATOM   2645 O O     . THR A 1 347 ? 31.131  3.234   17.933  1.00 22.35 ? 344 THR A O     1 
ATOM   2646 C CB    . THR A 1 347 ? 34.137  2.353   19.044  1.00 21.83 ? 344 THR A CB    1 
ATOM   2647 O OG1   . THR A 1 347 ? 35.416  2.840   19.477  1.00 20.79 ? 344 THR A OG1   1 
ATOM   2648 C CG2   . THR A 1 347 ? 34.285  0.935   18.485  1.00 21.45 ? 344 THR A CG2   1 
ATOM   2649 N N     . ILE A 1 348 ? 32.277  2.052   16.388  1.00 21.76 ? 345 ILE A N     1 
ATOM   2650 C CA    . ILE A 1 348 ? 31.096  1.459   15.795  1.00 21.78 ? 345 ILE A CA    1 
ATOM   2651 C C     . ILE A 1 348 ? 30.750  0.183   16.545  1.00 21.91 ? 345 ILE A C     1 
ATOM   2652 O O     . ILE A 1 348 ? 31.553  -0.759  16.637  1.00 20.04 ? 345 ILE A O     1 
ATOM   2653 C CB    . ILE A 1 348 ? 31.287  1.211   14.276  1.00 21.22 ? 345 ILE A CB    1 
ATOM   2654 C CG1   . ILE A 1 348 ? 31.575  2.550   13.567  1.00 20.50 ? 345 ILE A CG1   1 
ATOM   2655 C CG2   . ILE A 1 348 ? 30.090  0.518   13.689  1.00 21.97 ? 345 ILE A CG2   1 
ATOM   2656 C CD1   . ILE A 1 348 ? 30.609  3.692   13.855  1.00 17.06 ? 345 ILE A CD1   1 
ATOM   2657 N N     . GLY A 1 349 ? 29.537  0.165   17.090  1.00 22.48 ? 346 GLY A N     1 
ATOM   2658 C CA    . GLY A 1 349 ? 29.042  -1.009  17.758  1.00 23.16 ? 346 GLY A CA    1 
ATOM   2659 C C     . GLY A 1 349 ? 28.100  -1.855  16.921  1.00 24.34 ? 346 GLY A C     1 
ATOM   2660 O O     . GLY A 1 349 ? 28.083  -1.806  15.687  1.00 24.47 ? 346 GLY A O     1 
ATOM   2661 N N     . VAL A 1 350 ? 27.299  -2.633  17.631  1.00 25.37 ? 347 VAL A N     1 
ATOM   2662 C CA    . VAL A 1 350 ? 26.194  -3.334  17.035  1.00 26.44 ? 347 VAL A CA    1 
ATOM   2663 C C     . VAL A 1 350 ? 25.076  -2.302  16.821  1.00 27.07 ? 347 VAL A C     1 
ATOM   2664 O O     . VAL A 1 350 ? 25.040  -1.286  17.521  1.00 26.82 ? 347 VAL A O     1 
ATOM   2665 C CB    . VAL A 1 350 ? 25.747  -4.501  17.928  1.00 26.33 ? 347 VAL A CB    1 
ATOM   2666 C CG1   . VAL A 1 350 ? 26.977  -5.334  18.364  1.00 25.75 ? 347 VAL A CG1   1 
ATOM   2667 C CG2   . VAL A 1 350 ? 24.962  -4.008  19.132  1.00 26.16 ? 347 VAL A CG2   1 
ATOM   2668 N N     . PRO A 1 351 ? 24.172  -2.556  15.846  1.00 27.79 ? 348 PRO A N     1 
ATOM   2669 C CA    . PRO A 1 351 ? 23.161  -1.586  15.397  1.00 28.26 ? 348 PRO A CA    1 
ATOM   2670 C C     . PRO A 1 351 ? 22.357  -0.873  16.504  1.00 28.61 ? 348 PRO A C     1 
ATOM   2671 O O     . PRO A 1 351 ? 22.097  0.325   16.399  1.00 28.37 ? 348 PRO A O     1 
ATOM   2672 C CB    . PRO A 1 351 ? 22.234  -2.439  14.525  1.00 28.25 ? 348 PRO A CB    1 
ATOM   2673 C CG    . PRO A 1 351 ? 23.156  -3.507  13.978  1.00 27.78 ? 348 PRO A CG    1 
ATOM   2674 C CD    . PRO A 1 351 ? 24.063  -3.834  15.111  1.00 27.47 ? 348 PRO A CD    1 
ATOM   2675 N N     . GLU A 1 352 ? 21.981  -1.596  17.546  1.00 29.07 ? 349 GLU A N     1 
ATOM   2676 C CA    . GLU A 1 352 ? 21.228  -0.996  18.646  1.00 29.63 ? 349 GLU A CA    1 
ATOM   2677 C C     . GLU A 1 352 ? 22.101  -0.013  19.444  1.00 29.47 ? 349 GLU A C     1 
ATOM   2678 O O     . GLU A 1 352 ? 21.603  1.009   19.906  1.00 28.94 ? 349 GLU A O     1 
ATOM   2679 C CB    . GLU A 1 352 ? 20.653  -2.077  19.555  1.00 30.33 ? 349 GLU A CB    1 
ATOM   2680 C CG    . GLU A 1 352 ? 19.756  -3.088  18.808  1.00 33.72 ? 349 GLU A CG    1 
ATOM   2681 C CD    . GLU A 1 352 ? 20.473  -4.410  18.383  1.00 37.47 ? 349 GLU A CD    1 
ATOM   2682 O OE1   . GLU A 1 352 ? 21.607  -4.381  17.807  1.00 33.44 ? 349 GLU A OE1   1 
ATOM   2683 O OE2   . GLU A 1 352 ? 19.849  -5.487  18.615  1.00 40.96 ? 349 GLU A OE2   1 
ATOM   2684 N N     . GLU A 1 353 ? 23.401  -0.320  19.566  1.00 29.16 ? 350 GLU A N     1 
ATOM   2685 C CA    . GLU A 1 353 ? 24.381  0.577   20.203  1.00 28.76 ? 350 GLU A CA    1 
ATOM   2686 C C     . GLU A 1 353 ? 24.558  1.843   19.367  1.00 28.09 ? 350 GLU A C     1 
ATOM   2687 O O     . GLU A 1 353 ? 24.527  2.963   19.892  1.00 27.58 ? 350 GLU A O     1 
ATOM   2688 C CB    . GLU A 1 353 ? 25.735  -0.121  20.413  1.00 28.64 ? 350 GLU A CB    1 
ATOM   2689 C CG    . GLU A 1 353 ? 25.735  -1.105  21.571  1.00 29.47 ? 350 GLU A CG    1 
ATOM   2690 C CD    . GLU A 1 353 ? 26.955  -2.037  21.623  1.00 30.41 ? 350 GLU A CD    1 
ATOM   2691 O OE1   . GLU A 1 353 ? 27.811  -2.025  20.699  1.00 31.70 ? 350 GLU A OE1   1 
ATOM   2692 O OE2   . GLU A 1 353 ? 27.058  -2.788  22.622  1.00 33.21 ? 350 GLU A OE2   1 
ATOM   2693 N N     . ASN A 1 354 ? 24.716  1.668   18.064  1.00 27.30 ? 351 ASN A N     1 
ATOM   2694 C CA    . ASN A 1 354 ? 24.796  2.812   17.172  1.00 27.31 ? 351 ASN A CA    1 
ATOM   2695 C C     . ASN A 1 354 ? 23.543  3.675   17.218  1.00 27.27 ? 351 ASN A C     1 
ATOM   2696 O O     . ASN A 1 354 ? 23.619  4.901   17.254  1.00 26.39 ? 351 ASN A O     1 
ATOM   2697 C CB    . ASN A 1 354 ? 25.102  2.351   15.754  1.00 27.17 ? 351 ASN A CB    1 
ATOM   2698 C CG    . ASN A 1 354 ? 26.448  1.667   15.667  1.00 25.74 ? 351 ASN A CG    1 
ATOM   2699 O OD1   . ASN A 1 354 ? 27.378  2.028   16.402  1.00 24.70 ? 351 ASN A OD1   1 
ATOM   2700 N ND2   . ASN A 1 354 ? 26.548  0.650   14.830  1.00 24.55 ? 351 ASN A ND2   1 
ATOM   2701 N N     . ASP A 1 355 ? 22.383  3.039   17.265  1.00 27.58 ? 352 ASP A N     1 
ATOM   2702 C CA    . ASP A 1 355 ? 21.146  3.798   17.396  1.00 27.49 ? 352 ASP A CA    1 
ATOM   2703 C C     . ASP A 1 355 ? 21.180  4.685   18.649  1.00 27.07 ? 352 ASP A C     1 
ATOM   2704 O O     . ASP A 1 355 ? 20.873  5.869   18.563  1.00 27.41 ? 352 ASP A O     1 
ATOM   2705 C CB    . ASP A 1 355 ? 19.938  2.860   17.360  1.00 28.19 ? 352 ASP A CB    1 
ATOM   2706 C CG    . ASP A 1 355 ? 19.622  2.338   15.925  1.00 31.59 ? 352 ASP A CG    1 
ATOM   2707 O OD1   . ASP A 1 355 ? 20.331  2.703   14.950  1.00 34.20 ? 352 ASP A OD1   1 
ATOM   2708 O OD2   . ASP A 1 355 ? 18.637  1.569   15.767  1.00 35.89 ? 352 ASP A OD2   1 
ATOM   2709 N N     . ALA A 1 356 ? 21.603  4.135   19.790  1.00 26.48 ? 353 ALA A N     1 
ATOM   2710 C CA    . ALA A 1 356 ? 21.718  4.903   21.034  1.00 25.95 ? 353 ALA A CA    1 
ATOM   2711 C C     . ALA A 1 356 ? 22.717  6.046   20.945  1.00 25.52 ? 353 ALA A C     1 
ATOM   2712 O O     . ALA A 1 356 ? 22.446  7.150   21.417  1.00 24.16 ? 353 ALA A O     1 
ATOM   2713 C CB    . ALA A 1 356 ? 22.094  3.999   22.179  1.00 26.22 ? 353 ALA A CB    1 
ATOM   2714 N N     . PHE A 1 357 ? 23.881  5.778   20.362  1.00 25.28 ? 354 PHE A N     1 
ATOM   2715 C CA    . PHE A 1 357 ? 24.848  6.827   20.119  1.00 25.52 ? 354 PHE A CA    1 
ATOM   2716 C C     . PHE A 1 357 ? 24.240  7.964   19.302  1.00 25.44 ? 354 PHE A C     1 
ATOM   2717 O O     . PHE A 1 357 ? 24.359  9.122   19.665  1.00 25.42 ? 354 PHE A O     1 
ATOM   2718 C CB    . PHE A 1 357 ? 26.084  6.291   19.396  1.00 25.28 ? 354 PHE A CB    1 
ATOM   2719 C CG    . PHE A 1 357 ? 26.914  7.369   18.806  1.00 24.91 ? 354 PHE A CG    1 
ATOM   2720 C CD1   . PHE A 1 357 ? 27.600  8.252   19.634  1.00 25.05 ? 354 PHE A CD1   1 
ATOM   2721 C CD2   . PHE A 1 357 ? 26.978  7.549   17.446  1.00 25.09 ? 354 PHE A CD2   1 
ATOM   2722 C CE1   . PHE A 1 357 ? 28.354  9.278   19.111  1.00 24.13 ? 354 PHE A CE1   1 
ATOM   2723 C CE2   . PHE A 1 357 ? 27.737  8.588   16.920  1.00 25.42 ? 354 PHE A CE2   1 
ATOM   2724 C CZ    . PHE A 1 357 ? 28.418  9.449   17.763  1.00 24.70 ? 354 PHE A CZ    1 
ATOM   2725 N N     . LEU A 1 358 ? 23.590  7.614   18.197  1.00 26.04 ? 355 LEU A N     1 
ATOM   2726 C CA    . LEU A 1 358 ? 22.908  8.577   17.318  1.00 26.53 ? 355 LEU A CA    1 
ATOM   2727 C C     . LEU A 1 358 ? 21.773  9.352   18.009  1.00 26.94 ? 355 LEU A C     1 
ATOM   2728 O O     . LEU A 1 358 ? 21.614  10.559  17.798  1.00 26.45 ? 355 LEU A O     1 
ATOM   2729 C CB    . LEU A 1 358 ? 22.345  7.836   16.100  1.00 26.30 ? 355 LEU A CB    1 
ATOM   2730 C CG    . LEU A 1 358 ? 23.104  7.818   14.775  1.00 26.85 ? 355 LEU A CG    1 
ATOM   2731 C CD1   . LEU A 1 358 ? 24.503  8.412   14.856  1.00 25.72 ? 355 LEU A CD1   1 
ATOM   2732 C CD2   . LEU A 1 358 ? 23.132  6.394   14.184  1.00 26.56 ? 355 LEU A CD2   1 
ATOM   2733 N N     . ASP A 1 359 ? 20.972  8.660   18.815  1.00 27.62 ? 356 ASP A N     1 
ATOM   2734 C CA    . ASP A 1 359 ? 19.939  9.337   19.598  1.00 28.45 ? 356 ASP A CA    1 
ATOM   2735 C C     . ASP A 1 359 ? 20.563  10.397  20.499  1.00 28.95 ? 356 ASP A C     1 
ATOM   2736 O O     . ASP A 1 359 ? 20.098  11.533  20.540  1.00 29.00 ? 356 ASP A O     1 
ATOM   2737 C CB    . ASP A 1 359 ? 19.135  8.336   20.433  1.00 29.12 ? 356 ASP A CB    1 
ATOM   2738 C CG    . ASP A 1 359 ? 18.142  7.537   19.598  1.00 31.48 ? 356 ASP A CG    1 
ATOM   2739 O OD1   . ASP A 1 359 ? 17.717  8.047   18.518  1.00 34.44 ? 356 ASP A OD1   1 
ATOM   2740 O OD2   . ASP A 1 359 ? 17.775  6.402   20.027  1.00 35.25 ? 356 ASP A OD2   1 
ATOM   2741 N N     . ALA A 1 360 ? 21.637  10.039  21.198  1.00 28.88 ? 357 ALA A N     1 
ATOM   2742 C CA    . ALA A 1 360 ? 22.279  10.985  22.083  1.00 28.80 ? 357 ALA A CA    1 
ATOM   2743 C C     . ALA A 1 360 ? 22.906  12.122  21.276  1.00 28.83 ? 357 ALA A C     1 
ATOM   2744 O O     . ALA A 1 360 ? 22.821  13.284  21.665  1.00 27.78 ? 357 ALA A O     1 
ATOM   2745 C CB    . ALA A 1 360 ? 23.329  10.291  22.951  1.00 28.74 ? 357 ALA A CB    1 
ATOM   2746 N N     . ALA A 1 361 ? 23.530  11.783  20.150  1.00 29.08 ? 358 ALA A N     1 
ATOM   2747 C CA    . ALA A 1 361 ? 24.207  12.778  19.327  1.00 29.47 ? 358 ALA A CA    1 
ATOM   2748 C C     . ALA A 1 361 ? 23.240  13.837  18.821  1.00 29.69 ? 358 ALA A C     1 
ATOM   2749 O O     . ALA A 1 361 ? 23.627  14.995  18.614  1.00 29.52 ? 358 ALA A O     1 
ATOM   2750 C CB    . ALA A 1 361 ? 24.915  12.106  18.153  1.00 29.32 ? 358 ALA A CB    1 
ATOM   2751 N N     . ALA A 1 362 ? 21.991  13.431  18.610  1.00 30.45 ? 359 ALA A N     1 
ATOM   2752 C CA    . ALA A 1 362 ? 20.937  14.323  18.142  1.00 30.97 ? 359 ALA A CA    1 
ATOM   2753 C C     . ALA A 1 362 ? 20.455  15.308  19.228  1.00 31.55 ? 359 ALA A C     1 
ATOM   2754 O O     . ALA A 1 362 ? 20.119  16.460  18.937  1.00 31.04 ? 359 ALA A O     1 
ATOM   2755 C CB    . ALA A 1 362 ? 19.766  13.506  17.597  1.00 30.61 ? 359 ALA A CB    1 
ATOM   2756 N N     . GLU A 1 363 ? 20.415  14.855  20.474  1.00 32.52 ? 360 GLU A N     1 
ATOM   2757 C CA    . GLU A 1 363 ? 20.056  15.737  21.588  1.00 32.99 ? 360 GLU A CA    1 
ATOM   2758 C C     . GLU A 1 363 ? 21.192  16.707  21.847  1.00 32.93 ? 360 GLU A C     1 
ATOM   2759 O O     . GLU A 1 363 ? 20.971  17.901  22.095  1.00 33.07 ? 360 GLU A O     1 
ATOM   2760 C CB    . GLU A 1 363 ? 19.780  14.929  22.853  1.00 33.24 ? 360 GLU A CB    1 
ATOM   2761 C CG    . GLU A 1 363 ? 18.499  14.110  22.805  1.00 34.26 ? 360 GLU A CG    1 
ATOM   2762 C CD    . GLU A 1 363 ? 18.191  13.384  24.126  1.00 35.04 ? 360 GLU A CD    1 
ATOM   2763 O OE1   . GLU A 1 363 ? 18.883  13.615  25.150  1.00 36.59 ? 360 GLU A OE1   1 
ATOM   2764 O OE2   . GLU A 1 363 ? 17.243  12.567  24.137  1.00 37.91 ? 360 GLU A OE2   1 
ATOM   2765 N N     . ILE A 1 364 ? 22.416  16.199  21.756  1.00 32.63 ? 361 ILE A N     1 
ATOM   2766 C CA    . ILE A 1 364 ? 23.577  16.974  22.155  1.00 32.98 ? 361 ILE A CA    1 
ATOM   2767 C C     . ILE A 1 364 ? 23.869  18.136  21.213  1.00 33.21 ? 361 ILE A C     1 
ATOM   2768 O O     . ILE A 1 364 ? 24.340  19.173  21.662  1.00 33.34 ? 361 ILE A O     1 
ATOM   2769 C CB    . ILE A 1 364 ? 24.823  16.086  22.327  1.00 32.66 ? 361 ILE A CB    1 
ATOM   2770 C CG1   . ILE A 1 364 ? 24.630  15.140  23.516  1.00 31.94 ? 361 ILE A CG1   1 
ATOM   2771 C CG2   . ILE A 1 364 ? 26.064  16.950  22.532  1.00 32.38 ? 361 ILE A CG2   1 
ATOM   2772 C CD1   . ILE A 1 364 ? 25.567  13.940  23.520  1.00 32.62 ? 361 ILE A CD1   1 
ATOM   2773 N N     . ILE A 1 365 ? 23.578  17.986  19.922  1.00 33.94 ? 362 ILE A N     1 
ATOM   2774 C CA    . ILE A 1 365 ? 23.890  19.049  18.957  1.00 34.26 ? 362 ILE A CA    1 
ATOM   2775 C C     . ILE A 1 365 ? 23.051  20.308  19.226  1.00 34.90 ? 362 ILE A C     1 
ATOM   2776 O O     . ILE A 1 365 ? 23.508  21.427  19.008  1.00 34.90 ? 362 ILE A O     1 
ATOM   2777 C CB    . ILE A 1 365 ? 23.778  18.562  17.474  1.00 33.85 ? 362 ILE A CB    1 
ATOM   2778 C CG1   . ILE A 1 365 ? 24.400  19.593  16.521  1.00 33.45 ? 362 ILE A CG1   1 
ATOM   2779 C CG2   . ILE A 1 365 ? 22.333  18.251  17.093  1.00 33.10 ? 362 ILE A CG2   1 
ATOM   2780 C CD1   . ILE A 1 365 ? 25.174  18.996  15.393  1.00 33.61 ? 362 ILE A CD1   1 
ATOM   2781 N N     . LYS A 1 366 ? 21.845  20.104  19.748  1.00 36.05 ? 363 LYS A N     1 
ATOM   2782 C CA    . LYS A 1 366 ? 20.958  21.192  20.157  1.00 36.82 ? 363 LYS A CA    1 
ATOM   2783 C C     . LYS A 1 366 ? 21.469  21.992  21.370  1.00 37.48 ? 363 LYS A C     1 
ATOM   2784 O O     . LYS A 1 366 ? 21.146  23.172  21.512  1.00 37.73 ? 363 LYS A O     1 
ATOM   2785 C CB    . LYS A 1 366 ? 19.552  20.643  20.418  1.00 36.69 ? 363 LYS A CB    1 
ATOM   2786 C CG    . LYS A 1 366 ? 18.986  19.921  19.202  1.00 37.31 ? 363 LYS A CG    1 
ATOM   2787 C CD    . LYS A 1 366 ? 17.465  19.976  19.091  1.00 38.07 ? 363 LYS A CD    1 
ATOM   2788 C CE    . LYS A 1 366 ? 16.757  19.007  20.030  1.00 39.00 ? 363 LYS A CE    1 
ATOM   2789 N NZ    . LYS A 1 366 ? 15.382  18.698  19.528  1.00 38.67 ? 363 LYS A NZ    1 
ATOM   2790 N N     . LEU A 1 367 ? 22.280  21.363  22.219  1.00 38.27 ? 364 LEU A N     1 
ATOM   2791 C CA    . LEU A 1 367 ? 22.877  22.032  23.386  1.00 38.64 ? 364 LEU A CA    1 
ATOM   2792 C C     . LEU A 1 367 ? 24.005  23.008  23.030  1.00 39.17 ? 364 LEU A C     1 
ATOM   2793 O O     . LEU A 1 367 ? 24.362  23.846  23.849  1.00 39.46 ? 364 LEU A O     1 
ATOM   2794 C CB    . LEU A 1 367 ? 23.431  21.002  24.387  1.00 38.57 ? 364 LEU A CB    1 
ATOM   2795 C CG    . LEU A 1 367 ? 22.507  19.882  24.878  1.00 38.58 ? 364 LEU A CG    1 
ATOM   2796 C CD1   . LEU A 1 367 ? 23.193  19.118  25.988  1.00 38.23 ? 364 LEU A CD1   1 
ATOM   2797 C CD2   . LEU A 1 367 ? 21.148  20.405  25.346  1.00 38.81 ? 364 LEU A CD2   1 
ATOM   2798 N N     . ASN A 1 368 ? 24.581  22.881  21.835  1.00 39.79 ? 365 ASN A N     1 
ATOM   2799 C CA    . ASN A 1 368 ? 25.688  23.745  21.395  1.00 39.84 ? 365 ASN A CA    1 
ATOM   2800 C C     . ASN A 1 368 ? 26.827  23.785  22.417  1.00 40.09 ? 365 ASN A C     1 
ATOM   2801 O O     . ASN A 1 368 ? 27.244  24.858  22.873  1.00 40.47 ? 365 ASN A O     1 
ATOM   2802 C CB    . ASN A 1 368 ? 25.188  25.162  21.084  1.00 39.95 ? 365 ASN A CB    1 
ATOM   2803 C CG    . ASN A 1 368 ? 26.212  25.996  20.303  1.00 40.73 ? 365 ASN A CG    1 
ATOM   2804 O OD1   . ASN A 1 368 ? 26.997  25.468  19.506  1.00 41.65 ? 365 ASN A OD1   1 
ATOM   2805 N ND2   . ASN A 1 368 ? 26.198  27.315  20.528  1.00 43.11 ? 365 ASN A ND2   1 
ATOM   2806 N N     . LEU A 1 369 ? 27.313  22.596  22.766  1.00 39.96 ? 366 LEU A N     1 
ATOM   2807 C CA    . LEU A 1 369 ? 28.437  22.422  23.690  1.00 40.12 ? 366 LEU A CA    1 
ATOM   2808 C C     . LEU A 1 369 ? 29.801  22.614  23.016  1.00 40.67 ? 366 LEU A C     1 
ATOM   2809 O O     . LEU A 1 369 ? 30.808  22.726  23.728  1.00 41.09 ? 366 LEU A O     1 
ATOM   2810 C CB    . LEU A 1 369 ? 28.396  21.027  24.338  1.00 39.55 ? 366 LEU A CB    1 
ATOM   2811 C CG    . LEU A 1 369 ? 27.270  20.778  25.342  1.00 38.78 ? 366 LEU A CG    1 
ATOM   2812 C CD1   . LEU A 1 369 ? 27.366  19.372  25.903  1.00 36.43 ? 366 LEU A CD1   1 
ATOM   2813 C CD2   . LEU A 1 369 ? 27.297  21.817  26.467  1.00 37.11 ? 366 LEU A CD2   1 
ATOM   2814 O OXT   . LEU A 1 369 ? 29.940  22.648  21.779  1.00 40.60 ? 366 LEU A OXT   1 
ATOM   2815 N N     . LYS B 1 6   ? 69.162  -11.327 -0.387  1.00 48.42 ? 3   LYS C N     1 
ATOM   2816 C CA    . LYS B 1 6   ? 69.214  -11.791 1.034   1.00 48.28 ? 3   LYS C CA    1 
ATOM   2817 C C     . LYS B 1 6   ? 69.843  -10.716 1.913   1.00 48.25 ? 3   LYS C C     1 
ATOM   2818 O O     . LYS B 1 6   ? 70.843  -10.113 1.514   1.00 48.50 ? 3   LYS C O     1 
ATOM   2819 C CB    . LYS B 1 6   ? 70.007  -13.080 1.146   1.00 48.48 ? 3   LYS C CB    1 
ATOM   2820 N N     . ILE B 1 7   ? 69.252  -10.481 3.092   1.00 47.72 ? 4   ILE C N     1 
ATOM   2821 C CA    . ILE B 1 7   ? 69.831  -9.594  4.116   1.00 47.04 ? 4   ILE C CA    1 
ATOM   2822 C C     . ILE B 1 7   ? 69.907  -10.296 5.473   1.00 46.55 ? 4   ILE C C     1 
ATOM   2823 O O     . ILE B 1 7   ? 69.281  -11.334 5.669   1.00 46.43 ? 4   ILE C O     1 
ATOM   2824 C CB    . ILE B 1 7   ? 69.039  -8.256  4.277   1.00 47.18 ? 4   ILE C CB    1 
ATOM   2825 C CG1   . ILE B 1 7   ? 67.672  -8.482  4.938   1.00 46.62 ? 4   ILE C CG1   1 
ATOM   2826 C CG2   . ILE B 1 7   ? 68.867  -7.549  2.930   1.00 46.68 ? 4   ILE C CG2   1 
ATOM   2827 C CD1   . ILE B 1 7   ? 67.318  -7.402  5.921   1.00 46.69 ? 4   ILE C CD1   1 
ATOM   2828 N N     . THR B 1 8   ? 70.672  -9.711  6.395   1.00 46.09 ? 5   THR C N     1 
ATOM   2829 C CA    . THR B 1 8   ? 70.867  -10.243 7.749   1.00 45.83 ? 5   THR C CA    1 
ATOM   2830 C C     . THR B 1 8   ? 70.825  -9.095  8.773   1.00 45.44 ? 5   THR C C     1 
ATOM   2831 O O     . THR B 1 8   ? 70.741  -7.923  8.396   1.00 45.16 ? 5   THR C O     1 
ATOM   2832 C CB    . THR B 1 8   ? 72.233  -10.978 7.895   1.00 46.03 ? 5   THR C CB    1 
ATOM   2833 O OG1   . THR B 1 8   ? 73.299  -10.019 7.986   1.00 46.23 ? 5   THR C OG1   1 
ATOM   2834 C CG2   . THR B 1 8   ? 72.486  -11.928 6.717   1.00 46.01 ? 5   THR C CG2   1 
ATOM   2835 N N     . LEU B 1 9   ? 70.915  -9.439  10.059  1.00 44.73 ? 6   LEU C N     1 
ATOM   2836 C CA    . LEU B 1 9   ? 70.818  -8.449  11.138  1.00 44.60 ? 6   LEU C CA    1 
ATOM   2837 C C     . LEU B 1 9   ? 71.812  -7.291  11.003  1.00 44.19 ? 6   LEU C C     1 
ATOM   2838 O O     . LEU B 1 9   ? 71.511  -6.174  11.413  1.00 43.80 ? 6   LEU C O     1 
ATOM   2839 C CB    . LEU B 1 9   ? 70.976  -9.116  12.511  1.00 44.49 ? 6   LEU C CB    1 
ATOM   2840 C CG    . LEU B 1 9   ? 70.750  -8.248  13.760  1.00 44.56 ? 6   LEU C CG    1 
ATOM   2841 C CD1   . LEU B 1 9   ? 69.387  -7.569  13.741  1.00 44.19 ? 6   LEU C CD1   1 
ATOM   2842 C CD2   . LEU B 1 9   ? 70.921  -9.070  15.052  1.00 44.44 ? 6   LEU C CD2   1 
ATOM   2843 N N     . SER B 1 10  ? 72.984  -7.545  10.427  1.00 43.97 ? 7   SER C N     1 
ATOM   2844 C CA    . SER B 1 10  ? 73.980  -6.484  10.231  1.00 43.90 ? 7   SER C CA    1 
ATOM   2845 C C     . SER B 1 10  ? 73.516  -5.406  9.232   1.00 43.54 ? 7   SER C C     1 
ATOM   2846 O O     . SER B 1 10  ? 73.971  -4.269  9.283   1.00 43.43 ? 7   SER C O     1 
ATOM   2847 C CB    . SER B 1 10  ? 75.318  -7.080  9.789   1.00 44.09 ? 7   SER C CB    1 
ATOM   2848 O OG    . SER B 1 10  ? 75.156  -7.899  8.644   1.00 44.61 ? 7   SER C OG    1 
ATOM   2849 N N     . ASP B 1 11  ? 72.595  -5.767  8.341   1.00 43.28 ? 8   ASP C N     1 
ATOM   2850 C CA    . ASP B 1 11  ? 72.041  -4.832  7.364   1.00 43.00 ? 8   ASP C CA    1 
ATOM   2851 C C     . ASP B 1 11  ? 70.926  -3.938  7.970   1.00 42.74 ? 8   ASP C C     1 
ATOM   2852 O O     . ASP B 1 11  ? 70.446  -3.004  7.318   1.00 42.67 ? 8   ASP C O     1 
ATOM   2853 C CB    . ASP B 1 11  ? 71.536  -5.616  6.141   1.00 43.05 ? 8   ASP C CB    1 
ATOM   2854 C CG    . ASP B 1 11  ? 72.649  -6.458  5.467   1.00 44.14 ? 8   ASP C CG    1 
ATOM   2855 O OD1   . ASP B 1 11  ? 73.711  -5.888  5.130   1.00 44.88 ? 8   ASP C OD1   1 
ATOM   2856 O OD2   . ASP B 1 11  ? 72.470  -7.686  5.266   1.00 45.17 ? 8   ASP C OD2   1 
ATOM   2857 N N     . LEU B 1 12  ? 70.525  -4.210  9.214   1.00 42.16 ? 9   LEU C N     1 
ATOM   2858 C CA    . LEU B 1 12  ? 69.485  -3.419  9.876   1.00 41.98 ? 9   LEU C CA    1 
ATOM   2859 C C     . LEU B 1 12  ? 70.085  -2.364  10.788  1.00 41.56 ? 9   LEU C C     1 
ATOM   2860 O O     . LEU B 1 12  ? 71.148  -2.573  11.355  1.00 41.26 ? 9   LEU C O     1 
ATOM   2861 C CB    . LEU B 1 12  ? 68.549  -4.314  10.696  1.00 41.42 ? 9   LEU C CB    1 
ATOM   2862 C CG    . LEU B 1 12  ? 67.795  -5.398  9.950   1.00 40.54 ? 9   LEU C CG    1 
ATOM   2863 C CD1   . LEU B 1 12  ? 66.812  -6.075  10.908  1.00 40.21 ? 9   LEU C CD1   1 
ATOM   2864 C CD2   . LEU B 1 12  ? 67.083  -4.828  8.740   1.00 38.94 ? 9   LEU C CD2   1 
ATOM   2865 N N     . PRO B 1 13  ? 69.391  -1.231  10.958  1.00 41.63 ? 10  PRO C N     1 
ATOM   2866 C CA    . PRO B 1 13  ? 69.852  -0.174  11.851  1.00 42.12 ? 10  PRO C CA    1 
ATOM   2867 C C     . PRO B 1 13  ? 69.691  -0.478  13.352  1.00 42.33 ? 10  PRO C C     1 
ATOM   2868 O O     . PRO B 1 13  ? 69.300  0.394   14.121  1.00 42.26 ? 10  PRO C O     1 
ATOM   2869 C CB    . PRO B 1 13  ? 68.989  1.020   11.434  1.00 41.91 ? 10  PRO C CB    1 
ATOM   2870 C CG    . PRO B 1 13  ? 67.753  0.417   10.945  1.00 41.43 ? 10  PRO C CG    1 
ATOM   2871 C CD    . PRO B 1 13  ? 68.140  -0.855  10.281  1.00 41.71 ? 10  PRO C CD    1 
ATOM   2872 N N     . LEU B 1 14  ? 70.028  -1.695  13.764  1.00 42.61 ? 11  LEU C N     1 
ATOM   2873 C CA    . LEU B 1 14  ? 70.054  -2.054  15.175  1.00 43.03 ? 11  LEU C CA    1 
ATOM   2874 C C     . LEU B 1 14  ? 70.908  -1.061  15.984  1.00 43.33 ? 11  LEU C C     1 
ATOM   2875 O O     . LEU B 1 14  ? 71.896  -0.529  15.472  1.00 43.09 ? 11  LEU C O     1 
ATOM   2876 C CB    . LEU B 1 14  ? 70.604  -3.478  15.326  1.00 42.87 ? 11  LEU C CB    1 
ATOM   2877 C CG    . LEU B 1 14  ? 70.511  -4.120  16.707  1.00 42.73 ? 11  LEU C CG    1 
ATOM   2878 C CD1   . LEU B 1 14  ? 69.057  -4.420  17.078  1.00 42.32 ? 11  LEU C CD1   1 
ATOM   2879 C CD2   . LEU B 1 14  ? 71.350  -5.386  16.743  1.00 42.79 ? 11  LEU C CD2   1 
ATOM   2880 N N     . ARG B 1 15  ? 70.513  -0.796  17.229  1.00 43.71 ? 12  ARG C N     1 
ATOM   2881 C CA    . ARG B 1 15  ? 71.365  -0.039  18.152  1.00 44.35 ? 12  ARG C CA    1 
ATOM   2882 C C     . ARG B 1 15  ? 72.732  -0.703  18.254  1.00 45.17 ? 12  ARG C C     1 
ATOM   2883 O O     . ARG B 1 15  ? 72.819  -1.922  18.358  1.00 44.94 ? 12  ARG C O     1 
ATOM   2884 C CB    . ARG B 1 15  ? 70.752  0.042   19.548  1.00 44.01 ? 12  ARG C CB    1 
ATOM   2885 C CG    . ARG B 1 15  ? 69.597  1.015   19.675  1.00 43.35 ? 12  ARG C CG    1 
ATOM   2886 C CD    . ARG B 1 15  ? 69.077  1.057   21.108  1.00 42.83 ? 12  ARG C CD    1 
ATOM   2887 N NE    . ARG B 1 15  ? 70.035  1.630   22.049  1.00 41.85 ? 12  ARG C NE    1 
ATOM   2888 C CZ    . ARG B 1 15  ? 70.376  2.922   22.121  1.00 41.46 ? 12  ARG C CZ    1 
ATOM   2889 N NH1   . ARG B 1 15  ? 69.852  3.827   21.302  1.00 41.26 ? 12  ARG C NH1   1 
ATOM   2890 N NH2   . ARG B 1 15  ? 71.256  3.319   23.029  1.00 41.33 ? 12  ARG C NH2   1 
ATOM   2891 N N     . GLU B 1 16  ? 73.790  0.103   18.253  1.00 46.80 ? 13  GLU C N     1 
ATOM   2892 C CA    . GLU B 1 16  ? 75.163  -0.412  18.137  1.00 47.43 ? 13  GLU C CA    1 
ATOM   2893 C C     . GLU B 1 16  ? 75.534  -1.339  19.296  1.00 48.06 ? 13  GLU C C     1 
ATOM   2894 O O     . GLU B 1 16  ? 76.141  -2.386  19.095  1.00 48.01 ? 13  GLU C O     1 
ATOM   2895 C CB    . GLU B 1 16  ? 76.184  0.737   18.030  1.00 47.79 ? 13  GLU C CB    1 
ATOM   2896 C CG    . GLU B 1 16  ? 77.388  0.415   17.127  1.00 48.54 ? 13  GLU C CG    1 
ATOM   2897 C CD    . GLU B 1 16  ? 77.008  0.332   15.639  1.00 51.80 ? 13  GLU C CD    1 
ATOM   2898 O OE1   . GLU B 1 16  ? 76.469  1.331   15.099  1.00 53.35 ? 13  GLU C OE1   1 
ATOM   2899 O OE2   . GLU B 1 16  ? 77.244  -0.731  15.010  1.00 52.34 ? 13  GLU C OE2   1 
ATOM   2900 N N     . GLU B 1 17  ? 75.150  -0.959  20.508  1.00 48.74 ? 14  GLU C N     1 
ATOM   2901 C CA    . GLU B 1 17  ? 75.452  -1.768  21.691  1.00 49.23 ? 14  GLU C CA    1 
ATOM   2902 C C     . GLU B 1 17  ? 74.801  -3.151  21.682  1.00 49.16 ? 14  GLU C C     1 
ATOM   2903 O O     . GLU B 1 17  ? 75.214  -4.024  22.441  1.00 49.17 ? 14  GLU C O     1 
ATOM   2904 C CB    . GLU B 1 17  ? 75.050  -1.026  22.962  1.00 49.42 ? 14  GLU C CB    1 
ATOM   2905 C CG    . GLU B 1 17  ? 73.552  -0.778  23.092  1.00 50.46 ? 14  GLU C CG    1 
ATOM   2906 C CD    . GLU B 1 17  ? 73.243  0.498   23.849  1.00 51.07 ? 14  GLU C CD    1 
ATOM   2907 O OE1   . GLU B 1 17  ? 73.873  1.537   23.554  1.00 54.22 ? 14  GLU C OE1   1 
ATOM   2908 O OE2   . GLU B 1 17  ? 72.371  0.463   24.739  1.00 54.54 ? 14  GLU C OE2   1 
ATOM   2909 N N     . LEU B 1 18  ? 73.787  -3.349  20.841  1.00 49.17 ? 15  LEU C N     1 
ATOM   2910 C CA    . LEU B 1 18  ? 73.158  -4.665  20.693  1.00 49.24 ? 15  LEU C CA    1 
ATOM   2911 C C     . LEU B 1 18  ? 73.889  -5.549  19.678  1.00 49.52 ? 15  LEU C C     1 
ATOM   2912 O O     . LEU B 1 18  ? 73.599  -6.734  19.571  1.00 49.09 ? 15  LEU C O     1 
ATOM   2913 C CB    . LEU B 1 18  ? 71.686  -4.523  20.298  1.00 48.79 ? 15  LEU C CB    1 
ATOM   2914 C CG    . LEU B 1 18  ? 70.740  -4.014  21.389  1.00 47.86 ? 15  LEU C CG    1 
ATOM   2915 C CD1   . LEU B 1 18  ? 69.440  -3.536  20.784  1.00 45.23 ? 15  LEU C CD1   1 
ATOM   2916 C CD2   . LEU B 1 18  ? 70.487  -5.096  22.414  1.00 46.63 ? 15  LEU C CD2   1 
ATOM   2917 N N     . ARG B 1 19  ? 74.834  -4.976  18.933  1.00 50.17 ? 16  ARG C N     1 
ATOM   2918 C CA    . ARG B 1 19  ? 75.603  -5.741  17.955  1.00 50.44 ? 16  ARG C CA    1 
ATOM   2919 C C     . ARG B 1 19  ? 76.429  -6.799  18.674  1.00 50.73 ? 16  ARG C C     1 
ATOM   2920 O O     . ARG B 1 19  ? 77.011  -6.537  19.741  1.00 50.64 ? 16  ARG C O     1 
ATOM   2921 C CB    . ARG B 1 19  ? 76.532  -4.838  17.144  1.00 50.74 ? 16  ARG C CB    1 
ATOM   2922 C CG    . ARG B 1 19  ? 75.840  -3.751  16.327  1.00 51.16 ? 16  ARG C CG    1 
ATOM   2923 C CD    . ARG B 1 19  ? 75.038  -4.309  15.164  1.00 52.21 ? 16  ARG C CD    1 
ATOM   2924 N NE    . ARG B 1 19  ? 74.855  -3.305  14.112  1.00 52.32 ? 16  ARG C NE    1 
ATOM   2925 C CZ    . ARG B 1 19  ? 73.998  -3.405  13.096  1.00 52.21 ? 16  ARG C CZ    1 
ATOM   2926 N NH1   . ARG B 1 19  ? 73.210  -4.468  12.970  1.00 51.19 ? 16  ARG C NH1   1 
ATOM   2927 N NH2   . ARG B 1 19  ? 73.928  -2.422  12.197  1.00 52.17 ? 16  ARG C NH2   1 
ATOM   2928 N N     . GLY B 1 20  ? 76.454  -8.000  18.100  1.00 50.93 ? 17  GLY C N     1 
ATOM   2929 C CA    . GLY B 1 20  ? 77.191  -9.116  18.685  1.00 51.09 ? 17  GLY C CA    1 
ATOM   2930 C C     . GLY B 1 20  ? 76.601  -9.695  19.962  1.00 51.29 ? 17  GLY C C     1 
ATOM   2931 O O     . GLY B 1 20  ? 77.179  -10.618 20.534  1.00 51.58 ? 17  GLY C O     1 
ATOM   2932 N N     . GLU B 1 21  ? 75.461  -9.171  20.415  1.00 51.24 ? 18  GLU C N     1 
ATOM   2933 C CA    . GLU B 1 21  ? 74.785  -9.710  21.591  1.00 51.14 ? 18  GLU C CA    1 
ATOM   2934 C C     . GLU B 1 21  ? 74.102  -11.022 21.256  1.00 50.75 ? 18  GLU C C     1 
ATOM   2935 O O     . GLU B 1 21  ? 73.809  -11.298 20.093  1.00 50.27 ? 18  GLU C O     1 
ATOM   2936 C CB    . GLU B 1 21  ? 73.742  -8.732  22.130  1.00 51.53 ? 18  GLU C CB    1 
ATOM   2937 C CG    . GLU B 1 21  ? 74.327  -7.443  22.688  1.00 53.10 ? 18  GLU C CG    1 
ATOM   2938 C CD    . GLU B 1 21  ? 75.275  -7.689  23.844  1.00 55.39 ? 18  GLU C CD    1 
ATOM   2939 O OE1   . GLU B 1 21  ? 74.887  -8.413  24.790  1.00 57.24 ? 18  GLU C OE1   1 
ATOM   2940 O OE2   . GLU B 1 21  ? 76.408  -7.160  23.810  1.00 57.15 ? 18  GLU C OE2   1 
ATOM   2941 N N     . HIS B 1 22  ? 73.854  -11.822 22.291  1.00 50.54 ? 19  HIS C N     1 
ATOM   2942 C CA    . HIS B 1 22  ? 73.094  -13.067 22.162  1.00 50.37 ? 19  HIS C CA    1 
ATOM   2943 C C     . HIS B 1 22  ? 71.831  -12.998 23.027  1.00 49.66 ? 19  HIS C C     1 
ATOM   2944 O O     . HIS B 1 22  ? 71.860  -12.503 24.155  1.00 49.48 ? 19  HIS C O     1 
ATOM   2945 C CB    . HIS B 1 22  ? 73.946  -14.269 22.580  1.00 51.05 ? 19  HIS C CB    1 
ATOM   2946 C CG    . HIS B 1 22  ? 75.197  -14.432 21.771  1.00 53.16 ? 19  HIS C CG    1 
ATOM   2947 N ND1   . HIS B 1 22  ? 76.427  -13.970 22.197  1.00 54.86 ? 19  HIS C ND1   1 
ATOM   2948 C CD2   . HIS B 1 22  ? 75.407  -15.002 20.559  1.00 54.74 ? 19  HIS C CD2   1 
ATOM   2949 C CE1   . HIS B 1 22  ? 77.340  -14.251 21.282  1.00 55.22 ? 19  HIS C CE1   1 
ATOM   2950 N NE2   . HIS B 1 22  ? 76.748  -14.877 20.278  1.00 55.07 ? 19  HIS C NE2   1 
ATOM   2951 N N     . ALA B 1 23  ? 70.725  -13.493 22.484  1.00 48.74 ? 20  ALA C N     1 
ATOM   2952 C CA    . ALA B 1 23  ? 69.470  -13.586 23.221  1.00 47.94 ? 20  ALA C CA    1 
ATOM   2953 C C     . ALA B 1 23  ? 69.632  -14.526 24.413  1.00 47.19 ? 20  ALA C C     1 
ATOM   2954 O O     . ALA B 1 23  ? 70.172  -15.621 24.246  1.00 47.17 ? 20  ALA C O     1 
ATOM   2955 C CB    . ALA B 1 23  ? 68.368  -14.109 22.299  1.00 47.67 ? 20  ALA C CB    1 
ATOM   2956 N N     . TYR B 1 24  ? 69.176  -14.101 25.600  1.00 46.07 ? 21  TYR C N     1 
ATOM   2957 C CA    . TYR B 1 24  ? 69.029  -15.010 26.741  1.00 45.34 ? 21  TYR C CA    1 
ATOM   2958 C C     . TYR B 1 24  ? 68.495  -16.312 26.194  1.00 44.45 ? 21  TYR C C     1 
ATOM   2959 O O     . TYR B 1 24  ? 67.441  -16.329 25.570  1.00 44.73 ? 21  TYR C O     1 
ATOM   2960 C CB    . TYR B 1 24  ? 68.041  -14.482 27.790  1.00 45.30 ? 21  TYR C CB    1 
ATOM   2961 C CG    . TYR B 1 24  ? 67.724  -15.485 28.896  1.00 45.48 ? 21  TYR C CG    1 
ATOM   2962 C CD1   . TYR B 1 24  ? 68.508  -15.547 30.049  1.00 45.59 ? 21  TYR C CD1   1 
ATOM   2963 C CD2   . TYR B 1 24  ? 66.655  -16.386 28.781  1.00 45.84 ? 21  TYR C CD2   1 
ATOM   2964 C CE1   . TYR B 1 24  ? 68.239  -16.467 31.062  1.00 45.88 ? 21  TYR C CE1   1 
ATOM   2965 C CE2   . TYR B 1 24  ? 66.373  -17.318 29.800  1.00 44.92 ? 21  TYR C CE2   1 
ATOM   2966 C CZ    . TYR B 1 24  ? 67.168  -17.341 30.936  1.00 45.59 ? 21  TYR C CZ    1 
ATOM   2967 O OH    . TYR B 1 24  ? 66.920  -18.231 31.949  1.00 45.36 ? 21  TYR C OH    1 
ATOM   2968 N N     . GLY B 1 25  ? 69.217  -17.399 26.420  1.00 43.60 ? 22  GLY C N     1 
ATOM   2969 C CA    . GLY B 1 25  ? 68.889  -18.666 25.775  1.00 42.74 ? 22  GLY C CA    1 
ATOM   2970 C C     . GLY B 1 25  ? 69.219  -19.866 26.622  1.00 41.89 ? 22  GLY C C     1 
ATOM   2971 O O     . GLY B 1 25  ? 69.844  -20.811 26.138  1.00 42.06 ? 22  GLY C O     1 
ATOM   2972 N N     . ALA B 1 26  ? 68.804  -19.826 27.887  1.00 40.69 ? 23  ALA C N     1 
ATOM   2973 C CA    . ALA B 1 26  ? 68.894  -20.993 28.754  1.00 39.70 ? 23  ALA C CA    1 
ATOM   2974 C C     . ALA B 1 26  ? 68.183  -22.140 28.027  1.00 38.61 ? 23  ALA C C     1 
ATOM   2975 O O     . ALA B 1 26  ? 67.148  -21.924 27.403  1.00 38.03 ? 23  ALA C O     1 
ATOM   2976 C CB    . ALA B 1 26  ? 68.245  -20.716 30.119  1.00 39.47 ? 23  ALA C CB    1 
ATOM   2977 N N     . PRO B 1 27  ? 68.761  -23.347 28.046  1.00 37.29 ? 24  PRO C N     1 
ATOM   2978 C CA    . PRO B 1 27  ? 68.088  -24.444 27.343  1.00 37.08 ? 24  PRO C CA    1 
ATOM   2979 C C     . PRO B 1 27  ? 66.660  -24.723 27.822  1.00 36.29 ? 24  PRO C C     1 
ATOM   2980 O O     . PRO B 1 27  ? 66.412  -24.834 29.027  1.00 35.80 ? 24  PRO C O     1 
ATOM   2981 C CB    . PRO B 1 27  ? 68.996  -25.653 27.618  1.00 36.80 ? 24  PRO C CB    1 
ATOM   2982 C CG    . PRO B 1 27  ? 70.329  -25.063 27.905  1.00 37.11 ? 24  PRO C CG    1 
ATOM   2983 C CD    . PRO B 1 27  ? 70.040  -23.775 28.634  1.00 37.39 ? 24  PRO C CD    1 
ATOM   2984 N N     . GLN B 1 28  ? 65.738  -24.810 26.868  1.00 35.84 ? 25  GLN C N     1 
ATOM   2985 C CA    . GLN B 1 28  ? 64.382  -25.268 27.126  1.00 35.60 ? 25  GLN C CA    1 
ATOM   2986 C C     . GLN B 1 28  ? 64.098  -26.484 26.245  1.00 35.35 ? 25  GLN C C     1 
ATOM   2987 O O     . GLN B 1 28  ? 63.783  -26.354 25.061  1.00 34.93 ? 25  GLN C O     1 
ATOM   2988 C CB    . GLN B 1 28  ? 63.353  -24.165 26.892  1.00 35.16 ? 25  GLN C CB    1 
ATOM   2989 C CG    . GLN B 1 28  ? 61.943  -24.595 27.294  1.00 35.63 ? 25  GLN C CG    1 
ATOM   2990 C CD    . GLN B 1 28  ? 60.898  -23.531 27.062  1.00 35.24 ? 25  GLN C CD    1 
ATOM   2991 O OE1   . GLN B 1 28  ? 60.934  -22.820 26.060  1.00 34.84 ? 25  GLN C OE1   1 
ATOM   2992 N NE2   . GLN B 1 28  ? 59.942  -23.429 27.985  1.00 36.24 ? 25  GLN C NE2   1 
ATOM   2993 N N     . LEU B 1 29  ? 64.212  -27.662 26.850  1.00 35.32 ? 26  LEU C N     1 
ATOM   2994 C CA    . LEU B 1 29  ? 64.067  -28.931 26.159  1.00 35.55 ? 26  LEU C CA    1 
ATOM   2995 C C     . LEU B 1 29  ? 62.970  -29.745 26.812  1.00 35.64 ? 26  LEU C C     1 
ATOM   2996 O O     . LEU B 1 29  ? 62.867  -29.782 28.033  1.00 35.72 ? 26  LEU C O     1 
ATOM   2997 C CB    . LEU B 1 29  ? 65.381  -29.699 26.234  1.00 35.49 ? 26  LEU C CB    1 
ATOM   2998 C CG    . LEU B 1 29  ? 66.523  -29.071 25.438  1.00 35.83 ? 26  LEU C CG    1 
ATOM   2999 C CD1   . LEU B 1 29  ? 67.830  -29.778 25.743  1.00 36.92 ? 26  LEU C CD1   1 
ATOM   3000 C CD2   . LEU B 1 29  ? 66.209  -29.090 23.946  1.00 34.74 ? 26  LEU C CD2   1 
ATOM   3001 N N     . ASN B 1 30  ? 62.132  -30.387 26.008  1.00 36.18 ? 27  ASN C N     1 
ATOM   3002 C CA    . ASN B 1 30  ? 61.141  -31.276 26.569  1.00 35.85 ? 27  ASN C CA    1 
ATOM   3003 C C     . ASN B 1 30  ? 61.687  -32.689 26.589  1.00 35.65 ? 27  ASN C C     1 
ATOM   3004 O O     . ASN B 1 30  ? 61.342  -33.523 25.744  1.00 35.81 ? 27  ASN C O     1 
ATOM   3005 C CB    . ASN B 1 30  ? 59.795  -31.191 25.839  1.00 36.80 ? 27  ASN C CB    1 
ATOM   3006 C CG    . ASN B 1 30  ? 58.628  -31.725 26.696  1.00 37.54 ? 27  ASN C CG    1 
ATOM   3007 O OD1   . ASN B 1 30  ? 58.836  -32.356 27.757  1.00 39.78 ? 27  ASN C OD1   1 
ATOM   3008 N ND2   . ASN B 1 30  ? 57.400  -31.448 26.251  1.00 39.80 ? 27  ASN C ND2   1 
ATOM   3009 N N     . VAL B 1 31  ? 62.563  -32.932 27.563  1.00 34.77 ? 28  VAL C N     1 
ATOM   3010 C CA    . VAL B 1 31  ? 63.078  -34.266 27.838  1.00 34.05 ? 28  VAL C CA    1 
ATOM   3011 C C     . VAL B 1 31  ? 62.256  -34.861 28.975  1.00 33.72 ? 28  VAL C C     1 
ATOM   3012 O O     . VAL B 1 31  ? 61.340  -34.218 29.489  1.00 33.23 ? 28  VAL C O     1 
ATOM   3013 C CB    . VAL B 1 31  ? 64.588  -34.239 28.171  1.00 34.23 ? 28  VAL C CB    1 
ATOM   3014 C CG1   . VAL B 1 31  ? 65.384  -33.725 26.962  1.00 33.91 ? 28  VAL C CG1   1 
ATOM   3015 C CG2   . VAL B 1 31  ? 64.879  -33.402 29.413  1.00 33.33 ? 28  VAL C CG2   1 
ATOM   3016 N N     . ASP B 1 32  ? 62.551  -36.102 29.348  1.00 33.32 ? 29  ASP C N     1 
ATOM   3017 C CA    . ASP B 1 32  ? 61.772  -36.779 30.389  1.00 32.73 ? 29  ASP C CA    1 
ATOM   3018 C C     . ASP B 1 32  ? 62.089  -36.268 31.804  1.00 31.29 ? 29  ASP C C     1 
ATOM   3019 O O     . ASP B 1 32  ? 61.181  -36.166 32.630  1.00 31.45 ? 29  ASP C O     1 
ATOM   3020 C CB    . ASP B 1 32  ? 61.931  -38.316 30.302  1.00 33.75 ? 29  ASP C CB    1 
ATOM   3021 C CG    . ASP B 1 32  ? 61.033  -38.946 29.219  1.00 37.90 ? 29  ASP C CG    1 
ATOM   3022 O OD1   . ASP B 1 32  ? 59.845  -38.539 29.106  1.00 41.65 ? 29  ASP C OD1   1 
ATOM   3023 O OD2   . ASP B 1 32  ? 61.508  -39.860 28.481  1.00 43.44 ? 29  ASP C OD2   1 
ATOM   3024 N N     . ILE B 1 33  ? 63.348  -35.935 32.089  1.00 29.36 ? 30  ILE C N     1 
ATOM   3025 C CA    . ILE B 1 33  ? 63.703  -35.454 33.425  1.00 28.48 ? 30  ILE C CA    1 
ATOM   3026 C C     . ILE B 1 33  ? 64.187  -34.006 33.361  1.00 27.60 ? 30  ILE C C     1 
ATOM   3027 O O     . ILE B 1 33  ? 65.330  -33.714 32.978  1.00 27.33 ? 30  ILE C O     1 
ATOM   3028 C CB    . ILE B 1 33  ? 64.748  -36.324 34.132  1.00 28.59 ? 30  ILE C CB    1 
ATOM   3029 C CG1   . ILE B 1 33  ? 64.379  -37.829 34.074  1.00 28.17 ? 30  ILE C CG1   1 
ATOM   3030 C CG2   . ILE B 1 33  ? 64.940  -35.834 35.571  1.00 28.42 ? 30  ILE C CG2   1 
ATOM   3031 C CD1   . ILE B 1 33  ? 63.074  -38.198 34.738  1.00 27.15 ? 30  ILE C CD1   1 
ATOM   3032 N N     . ARG B 1 34  ? 63.291  -33.106 33.746  1.00 26.24 ? 31  ARG C N     1 
ATOM   3033 C CA    . ARG B 1 34  ? 63.523  -31.671 33.658  1.00 25.44 ? 31  ARG C CA    1 
ATOM   3034 C C     . ARG B 1 34  ? 63.728  -31.067 35.035  1.00 23.91 ? 31  ARG C C     1 
ATOM   3035 O O     . ARG B 1 34  ? 62.767  -30.868 35.794  1.00 22.50 ? 31  ARG C O     1 
ATOM   3036 C CB    . ARG B 1 34  ? 62.330  -30.998 33.029  1.00 26.21 ? 31  ARG C CB    1 
ATOM   3037 C CG    . ARG B 1 34  ? 62.127  -31.245 31.575  1.00 28.30 ? 31  ARG C CG    1 
ATOM   3038 C CD    . ARG B 1 34  ? 61.474  -29.986 31.035  1.00 31.94 ? 31  ARG C CD    1 
ATOM   3039 N NE    . ARG B 1 34  ? 60.155  -30.163 30.474  1.00 32.64 ? 31  ARG C NE    1 
ATOM   3040 C CZ    . ARG B 1 34  ? 59.429  -29.167 29.978  1.00 32.26 ? 31  ARG C CZ    1 
ATOM   3041 N NH1   . ARG B 1 34  ? 59.872  -27.910 30.014  1.00 32.86 ? 31  ARG C NH1   1 
ATOM   3042 N NH2   . ARG B 1 34  ? 58.242  -29.429 29.459  1.00 33.43 ? 31  ARG C NH2   1 
ATOM   3043 N N     . LEU B 1 35  ? 64.984  -30.779 35.349  1.00 22.29 ? 32  LEU C N     1 
ATOM   3044 C CA    . LEU B 1 35  ? 65.363  -30.312 36.665  1.00 21.97 ? 32  LEU C CA    1 
ATOM   3045 C C     . LEU B 1 35  ? 66.229  -29.066 36.529  1.00 21.24 ? 32  LEU C C     1 
ATOM   3046 O O     . LEU B 1 35  ? 67.204  -28.899 37.260  1.00 19.94 ? 32  LEU C O     1 
ATOM   3047 C CB    . LEU B 1 35  ? 66.095  -31.433 37.412  1.00 21.05 ? 32  LEU C CB    1 
ATOM   3048 C CG    . LEU B 1 35  ? 65.279  -32.713 37.610  1.00 20.52 ? 32  LEU C CG    1 
ATOM   3049 C CD1   . LEU B 1 35  ? 66.147  -33.805 38.192  1.00 17.18 ? 32  LEU C CD1   1 
ATOM   3050 C CD2   . LEU B 1 35  ? 64.048  -32.441 38.526  1.00 18.07 ? 32  LEU C CD2   1 
ATOM   3051 N N     . ASN B 1 36  ? 65.832  -28.184 35.607  1.00 20.90 ? 33  ASN C N     1 
ATOM   3052 C CA    . ASN B 1 36  ? 66.707  -27.120 35.138  1.00 21.51 ? 33  ASN C CA    1 
ATOM   3053 C C     . ASN B 1 36  ? 66.221  -25.675 35.307  1.00 21.77 ? 33  ASN C C     1 
ATOM   3054 O O     . ASN B 1 36  ? 67.022  -24.753 35.128  1.00 21.42 ? 33  ASN C O     1 
ATOM   3055 C CB    . ASN B 1 36  ? 67.072  -27.353 33.669  1.00 20.84 ? 33  ASN C CB    1 
ATOM   3056 C CG    . ASN B 1 36  ? 65.854  -27.392 32.759  1.00 21.96 ? 33  ASN C CG    1 
ATOM   3057 O OD1   . ASN B 1 36  ? 64.909  -28.149 32.991  1.00 21.58 ? 33  ASN C OD1   1 
ATOM   3058 N ND2   . ASN B 1 36  ? 65.867  -26.569 31.724  1.00 22.43 ? 33  ASN C ND2   1 
ATOM   3059 N N     . THR B 1 37  ? 64.944  -25.453 35.632  1.00 22.34 ? 34  THR C N     1 
ATOM   3060 C CA    . THR B 1 37  ? 64.410  -24.077 35.617  1.00 22.57 ? 34  THR C CA    1 
ATOM   3061 C C     . THR B 1 37  ? 63.662  -23.711 36.904  1.00 22.51 ? 34  THR C C     1 
ATOM   3062 O O     . THR B 1 37  ? 62.966  -22.703 36.965  1.00 22.87 ? 34  THR C O     1 
ATOM   3063 C CB    . THR B 1 37  ? 63.548  -23.836 34.338  1.00 23.01 ? 34  THR C CB    1 
ATOM   3064 O OG1   . THR B 1 37  ? 64.303  -24.203 33.178  1.00 25.23 ? 34  THR C OG1   1 
ATOM   3065 C CG2   . THR B 1 37  ? 63.164  -22.369 34.164  1.00 22.84 ? 34  THR C CG2   1 
ATOM   3066 N N     . ASN B 1 38  ? 63.892  -24.501 37.945  1.00 22.43 ? 35  ASN C N     1 
ATOM   3067 C CA    . ASN B 1 38  ? 63.282  -24.343 39.265  1.00 22.41 ? 35  ASN C CA    1 
ATOM   3068 C C     . ASN B 1 38  ? 61.756  -24.322 39.221  1.00 22.31 ? 35  ASN C C     1 
ATOM   3069 O O     . ASN B 1 38  ? 61.109  -23.728 40.078  1.00 22.06 ? 35  ASN C O     1 
ATOM   3070 C CB    . ASN B 1 38  ? 63.858  -23.128 40.004  1.00 22.08 ? 35  ASN C CB    1 
ATOM   3071 C CG    . ASN B 1 38  ? 65.361  -23.220 40.189  1.00 22.04 ? 35  ASN C CG    1 
ATOM   3072 O OD1   . ASN B 1 38  ? 65.932  -24.314 40.237  1.00 22.05 ? 35  ASN C OD1   1 
ATOM   3073 N ND2   . ASN B 1 38  ? 66.012  -22.076 40.279  1.00 18.21 ? 35  ASN C ND2   1 
ATOM   3074 N N     . GLU B 1 39  ? 61.196  -25.026 38.244  1.00 22.49 ? 36  GLU C N     1 
ATOM   3075 C CA    . GLU B 1 39  ? 59.755  -25.167 38.134  1.00 22.62 ? 36  GLU C CA    1 
ATOM   3076 C C     . GLU B 1 39  ? 59.297  -26.180 39.184  1.00 22.41 ? 36  GLU C C     1 
ATOM   3077 O O     . GLU B 1 39  ? 60.037  -27.112 39.515  1.00 22.62 ? 36  GLU C O     1 
ATOM   3078 C CB    . GLU B 1 39  ? 59.364  -25.663 36.740  1.00 23.14 ? 36  GLU C CB    1 
ATOM   3079 C CG    . GLU B 1 39  ? 59.714  -24.707 35.582  1.00 23.90 ? 36  GLU C CG    1 
ATOM   3080 C CD    . GLU B 1 39  ? 59.991  -25.428 34.262  1.00 23.44 ? 36  GLU C CD    1 
ATOM   3081 O OE1   . GLU B 1 39  ? 60.714  -26.453 34.269  1.00 26.17 ? 36  GLU C OE1   1 
ATOM   3082 O OE2   . GLU B 1 39  ? 59.510  -24.958 33.208  1.00 23.66 ? 36  GLU C OE2   1 
ATOM   3083 N N     . ASN B 1 40  ? 58.104  -25.976 39.726  1.00 21.63 ? 37  ASN C N     1 
ATOM   3084 C CA    . ASN B 1 40  ? 57.479  -26.952 40.582  1.00 21.95 ? 37  ASN C CA    1 
ATOM   3085 C C     . ASN B 1 40  ? 57.132  -28.186 39.736  1.00 22.12 ? 37  ASN C C     1 
ATOM   3086 O O     . ASN B 1 40  ? 56.480  -28.063 38.698  1.00 21.64 ? 37  ASN C O     1 
ATOM   3087 C CB    . ASN B 1 40  ? 56.233  -26.333 41.214  1.00 22.01 ? 37  ASN C CB    1 
ATOM   3088 C CG    . ASN B 1 40  ? 55.605  -27.207 42.289  1.00 21.53 ? 37  ASN C CG    1 
ATOM   3089 O OD1   . ASN B 1 40  ? 55.561  -28.441 42.176  1.00 17.99 ? 37  ASN C OD1   1 
ATOM   3090 N ND2   . ASN B 1 40  ? 55.123  -26.566 43.346  1.00 20.15 ? 37  ASN C ND2   1 
ATOM   3091 N N     . PRO B 1 41  ? 57.603  -29.373 40.147  1.00 22.58 ? 38  PRO C N     1 
ATOM   3092 C CA    . PRO B 1 41  ? 57.463  -30.572 39.315  1.00 23.36 ? 38  PRO C CA    1 
ATOM   3093 C C     . PRO B 1 41  ? 56.081  -31.173 39.258  1.00 24.16 ? 38  PRO C C     1 
ATOM   3094 O O     . PRO B 1 41  ? 55.869  -32.127 38.491  1.00 24.66 ? 38  PRO C O     1 
ATOM   3095 C CB    . PRO B 1 41  ? 58.409  -31.566 40.000  1.00 23.14 ? 38  PRO C CB    1 
ATOM   3096 C CG    . PRO B 1 41  ? 58.344  -31.196 41.395  1.00 22.65 ? 38  PRO C CG    1 
ATOM   3097 C CD    . PRO B 1 41  ? 58.323  -29.684 41.388  1.00 22.39 ? 38  PRO C CD    1 
ATOM   3098 N N     . TYR B 1 42  ? 55.162  -30.669 40.080  1.00 24.77 ? 39  TYR C N     1 
ATOM   3099 C CA    . TYR B 1 42  ? 53.814  -31.210 40.139  1.00 25.34 ? 39  TYR C CA    1 
ATOM   3100 C C     . TYR B 1 42  ? 52.925  -30.519 39.117  1.00 26.22 ? 39  TYR C C     1 
ATOM   3101 O O     . TYR B 1 42  ? 52.853  -29.284 39.071  1.00 26.07 ? 39  TYR C O     1 
ATOM   3102 C CB    . TYR B 1 42  ? 53.236  -31.108 41.561  1.00 25.64 ? 39  TYR C CB    1 
ATOM   3103 C CG    . TYR B 1 42  ? 54.004  -31.968 42.548  1.00 26.36 ? 39  TYR C CG    1 
ATOM   3104 C CD1   . TYR B 1 42  ? 55.053  -31.447 43.277  1.00 25.78 ? 39  TYR C CD1   1 
ATOM   3105 C CD2   . TYR B 1 42  ? 53.712  -33.319 42.703  1.00 27.82 ? 39  TYR C CD2   1 
ATOM   3106 C CE1   . TYR B 1 42  ? 55.779  -32.228 44.163  1.00 25.99 ? 39  TYR C CE1   1 
ATOM   3107 C CE2   . TYR B 1 42  ? 54.436  -34.121 43.607  1.00 27.41 ? 39  TYR C CE2   1 
ATOM   3108 C CZ    . TYR B 1 42  ? 55.475  -33.561 44.324  1.00 26.26 ? 39  TYR C CZ    1 
ATOM   3109 O OH    . TYR B 1 42  ? 56.208  -34.326 45.208  1.00 26.73 ? 39  TYR C OH    1 
ATOM   3110 N N     . PRO B 1 43  ? 52.251  -31.308 38.274  1.00 27.31 ? 40  PRO C N     1 
ATOM   3111 C CA    . PRO B 1 43  ? 51.303  -30.654 37.397  1.00 28.26 ? 40  PRO C CA    1 
ATOM   3112 C C     . PRO B 1 43  ? 50.163  -30.071 38.237  1.00 28.68 ? 40  PRO C C     1 
ATOM   3113 O O     . PRO B 1 43  ? 49.915  -30.550 39.354  1.00 28.57 ? 40  PRO C O     1 
ATOM   3114 C CB    . PRO B 1 43  ? 50.805  -31.784 36.483  1.00 28.34 ? 40  PRO C CB    1 
ATOM   3115 C CG    . PRO B 1 43  ? 51.719  -32.919 36.704  1.00 28.54 ? 40  PRO C CG    1 
ATOM   3116 C CD    . PRO B 1 43  ? 52.279  -32.764 38.077  1.00 27.56 ? 40  PRO C CD    1 
ATOM   3117 N N     . PRO B 1 44  ? 49.508  -29.015 37.732  1.00 29.27 ? 41  PRO C N     1 
ATOM   3118 C CA    . PRO B 1 44  ? 48.370  -28.438 38.437  1.00 29.71 ? 41  PRO C CA    1 
ATOM   3119 C C     . PRO B 1 44  ? 47.340  -29.485 38.831  1.00 29.98 ? 41  PRO C C     1 
ATOM   3120 O O     . PRO B 1 44  ? 47.086  -30.411 38.078  1.00 29.64 ? 41  PRO C O     1 
ATOM   3121 C CB    . PRO B 1 44  ? 47.799  -27.453 37.417  1.00 29.85 ? 41  PRO C CB    1 
ATOM   3122 C CG    . PRO B 1 44  ? 48.977  -27.033 36.629  1.00 29.61 ? 41  PRO C CG    1 
ATOM   3123 C CD    . PRO B 1 44  ? 49.817  -28.271 36.497  1.00 29.30 ? 41  PRO C CD    1 
ATOM   3124 N N     . SER B 1 45  ? 46.752  -29.353 40.011  1.00 30.84 ? 42  SER C N     1 
ATOM   3125 C CA    . SER B 1 45  ? 45.774  -30.351 40.444  1.00 31.21 ? 42  SER C CA    1 
ATOM   3126 C C     . SER B 1 45  ? 44.550  -30.376 39.524  1.00 31.88 ? 42  SER C C     1 
ATOM   3127 O O     . SER B 1 45  ? 44.171  -29.354 38.923  1.00 31.16 ? 42  SER C O     1 
ATOM   3128 C CB    . SER B 1 45  ? 45.322  -30.092 41.875  1.00 31.37 ? 42  SER C CB    1 
ATOM   3129 O OG    . SER B 1 45  ? 44.556  -28.914 41.943  1.00 30.82 ? 42  SER C OG    1 
ATOM   3130 N N     . GLU B 1 46  ? 43.935  -31.554 39.429  1.00 31.80 ? 43  GLU C N     1 
ATOM   3131 C CA    . GLU B 1 46  ? 42.666  -31.715 38.722  1.00 32.63 ? 43  GLU C CA    1 
ATOM   3132 C C     . GLU B 1 46  ? 41.603  -30.702 39.185  1.00 32.00 ? 43  GLU C C     1 
ATOM   3133 O O     . GLU B 1 46  ? 40.826  -30.207 38.364  1.00 32.25 ? 43  GLU C O     1 
ATOM   3134 C CB    . GLU B 1 46  ? 42.149  -33.159 38.858  1.00 32.78 ? 43  GLU C CB    1 
ATOM   3135 C CG    . GLU B 1 46  ? 43.071  -34.210 38.167  1.00 35.45 ? 43  GLU C CG    1 
ATOM   3136 C CD    . GLU B 1 46  ? 42.735  -35.692 38.512  1.00 36.00 ? 43  GLU C CD    1 
ATOM   3137 O OE1   . GLU B 1 46  ? 42.126  -36.389 37.649  1.00 40.41 ? 43  GLU C OE1   1 
ATOM   3138 O OE2   . GLU B 1 46  ? 43.089  -36.149 39.629  1.00 39.08 ? 43  GLU C OE2   1 
ATOM   3139 N N     . ALA B 1 47  ? 41.580  -30.377 40.474  1.00 31.37 ? 44  ALA C N     1 
ATOM   3140 C CA    . ALA B 1 47  ? 40.597  -29.420 40.998  1.00 31.43 ? 44  ALA C CA    1 
ATOM   3141 C C     . ALA B 1 47  ? 40.843  -28.051 40.384  1.00 30.92 ? 44  ALA C C     1 
ATOM   3142 O O     . ALA B 1 47  ? 39.920  -27.419 39.872  1.00 30.73 ? 44  ALA C O     1 
ATOM   3143 C CB    . ALA B 1 47  ? 40.647  -29.343 42.530  1.00 31.11 ? 44  ALA C CB    1 
ATOM   3144 N N     . LEU B 1 48  ? 42.106  -27.624 40.424  1.00 30.77 ? 45  LEU C N     1 
ATOM   3145 C CA    . LEU B 1 48  ? 42.531  -26.368 39.841  1.00 30.37 ? 45  LEU C CA    1 
ATOM   3146 C C     . LEU B 1 48  ? 42.143  -26.315 38.372  1.00 29.95 ? 45  LEU C C     1 
ATOM   3147 O O     . LEU B 1 48  ? 41.578  -25.311 37.925  1.00 29.38 ? 45  LEU C O     1 
ATOM   3148 C CB    . LEU B 1 48  ? 44.045  -26.167 39.997  1.00 30.46 ? 45  LEU C CB    1 
ATOM   3149 C CG    . LEU B 1 48  ? 44.576  -24.737 39.760  1.00 30.94 ? 45  LEU C CG    1 
ATOM   3150 C CD1   . LEU B 1 48  ? 45.894  -24.525 40.466  1.00 29.99 ? 45  LEU C CD1   1 
ATOM   3151 C CD2   . LEU B 1 48  ? 44.735  -24.410 38.279  1.00 31.88 ? 45  LEU C CD2   1 
ATOM   3152 N N     . VAL B 1 49  ? 42.432  -27.391 37.634  1.00 29.31 ? 46  VAL C N     1 
ATOM   3153 C CA    . VAL B 1 49  ? 42.213  -27.403 36.185  1.00 29.40 ? 46  VAL C CA    1 
ATOM   3154 C C     . VAL B 1 49  ? 40.723  -27.308 35.854  1.00 29.24 ? 46  VAL C C     1 
ATOM   3155 O O     . VAL B 1 49  ? 40.326  -26.505 35.020  1.00 29.03 ? 46  VAL C O     1 
ATOM   3156 C CB    . VAL B 1 49  ? 42.844  -28.631 35.501  1.00 29.58 ? 46  VAL C CB    1 
ATOM   3157 C CG1   . VAL B 1 49  ? 42.430  -28.689 34.021  1.00 29.65 ? 46  VAL C CG1   1 
ATOM   3158 C CG2   . VAL B 1 49  ? 44.378  -28.585 35.630  1.00 28.82 ? 46  VAL C CG2   1 
ATOM   3159 N N     . ALA B 1 50  ? 39.909  -28.123 36.526  1.00 28.93 ? 47  ALA C N     1 
ATOM   3160 C CA    . ALA B 1 50  ? 38.453  -28.055 36.411  1.00 28.54 ? 47  ALA C CA    1 
ATOM   3161 C C     . ALA B 1 50  ? 37.958  -26.632 36.645  1.00 28.19 ? 47  ALA C C     1 
ATOM   3162 O O     . ALA B 1 50  ? 37.185  -26.118 35.867  1.00 28.34 ? 47  ALA C O     1 
ATOM   3163 C CB    . ALA B 1 50  ? 37.805  -29.002 37.402  1.00 27.69 ? 47  ALA C CB    1 
ATOM   3164 N N     . ASP B 1 51  ? 38.421  -25.997 37.711  1.00 28.27 ? 48  ASP C N     1 
ATOM   3165 C CA    . ASP B 1 51  ? 38.059  -24.606 38.008  1.00 28.45 ? 48  ASP C CA    1 
ATOM   3166 C C     . ASP B 1 51  ? 38.469  -23.650 36.863  1.00 28.49 ? 48  ASP C C     1 
ATOM   3167 O O     . ASP B 1 51  ? 37.692  -22.786 36.432  1.00 27.28 ? 48  ASP C O     1 
ATOM   3168 C CB    . ASP B 1 51  ? 38.706  -24.186 39.338  1.00 28.67 ? 48  ASP C CB    1 
ATOM   3169 C CG    . ASP B 1 51  ? 38.096  -22.912 39.938  1.00 29.15 ? 48  ASP C CG    1 
ATOM   3170 O OD1   . ASP B 1 51  ? 37.220  -22.301 39.303  1.00 30.24 ? 48  ASP C OD1   1 
ATOM   3171 O OD2   . ASP B 1 51  ? 38.505  -22.519 41.057  1.00 29.42 ? 48  ASP C OD2   1 
ATOM   3172 N N     . LEU B 1 52  ? 39.685  -23.842 36.357  1.00 28.74 ? 49  LEU C N     1 
ATOM   3173 C CA    . LEU B 1 52  ? 40.202  -23.050 35.248  1.00 28.78 ? 49  LEU C CA    1 
ATOM   3174 C C     . LEU B 1 52  ? 39.335  -23.192 33.990  1.00 28.64 ? 49  LEU C C     1 
ATOM   3175 O O     . LEU B 1 52  ? 38.979  -22.204 33.350  1.00 28.45 ? 49  LEU C O     1 
ATOM   3176 C CB    . LEU B 1 52  ? 41.638  -23.471 34.947  1.00 29.12 ? 49  LEU C CB    1 
ATOM   3177 C CG    . LEU B 1 52  ? 42.457  -22.476 34.138  1.00 29.89 ? 49  LEU C CG    1 
ATOM   3178 C CD1   . LEU B 1 52  ? 42.767  -21.251 34.995  1.00 29.89 ? 49  LEU C CD1   1 
ATOM   3179 C CD2   . LEU B 1 52  ? 43.743  -23.140 33.612  1.00 29.36 ? 49  LEU C CD2   1 
ATOM   3180 N N     . VAL B 1 53  ? 38.983  -24.425 33.653  1.00 28.56 ? 50  VAL C N     1 
ATOM   3181 C CA    . VAL B 1 53  ? 38.114  -24.689 32.512  1.00 28.55 ? 50  VAL C CA    1 
ATOM   3182 C C     . VAL B 1 53  ? 36.732  -24.035 32.682  1.00 28.71 ? 50  VAL C C     1 
ATOM   3183 O O     . VAL B 1 53  ? 36.231  -23.421 31.752  1.00 28.75 ? 50  VAL C O     1 
ATOM   3184 C CB    . VAL B 1 53  ? 37.995  -26.206 32.235  1.00 28.08 ? 50  VAL C CB    1 
ATOM   3185 C CG1   . VAL B 1 53  ? 36.869  -26.499 31.262  1.00 27.28 ? 50  VAL C CG1   1 
ATOM   3186 C CG2   . VAL B 1 53  ? 39.336  -26.757 31.721  1.00 26.36 ? 50  VAL C CG2   1 
ATOM   3187 N N     . ALA B 1 54  ? 36.130  -24.146 33.862  1.00 28.81 ? 51  ALA C N     1 
ATOM   3188 C CA    . ALA B 1 54  ? 34.832  -23.507 34.113  1.00 29.20 ? 51  ALA C CA    1 
ATOM   3189 C C     . ALA B 1 54  ? 34.925  -21.973 34.017  1.00 29.48 ? 51  ALA C C     1 
ATOM   3190 O O     . ALA B 1 54  ? 34.033  -21.322 33.495  1.00 29.35 ? 51  ALA C O     1 
ATOM   3191 C CB    . ALA B 1 54  ? 34.273  -23.927 35.456  1.00 28.53 ? 51  ALA C CB    1 
ATOM   3192 N N     . THR B 1 55  ? 36.020  -21.411 34.504  1.00 30.34 ? 52  THR C N     1 
ATOM   3193 C CA    . THR B 1 55  ? 36.220  -19.965 34.494  1.00 30.80 ? 52  THR C CA    1 
ATOM   3194 C C     . THR B 1 55  ? 36.393  -19.402 33.077  1.00 31.58 ? 52  THR C C     1 
ATOM   3195 O O     . THR B 1 55  ? 35.923  -18.303 32.777  1.00 31.88 ? 52  THR C O     1 
ATOM   3196 C CB    . THR B 1 55  ? 37.441  -19.578 35.342  1.00 30.55 ? 52  THR C CB    1 
ATOM   3197 O OG1   . THR B 1 55  ? 37.217  -19.976 36.692  1.00 29.23 ? 52  THR C OG1   1 
ATOM   3198 C CG2   . THR B 1 55  ? 37.690  -18.073 35.303  1.00 30.56 ? 52  THR C CG2   1 
ATOM   3199 N N     . VAL B 1 56  ? 37.077  -20.153 32.221  1.00 32.41 ? 53  VAL C N     1 
ATOM   3200 C CA    . VAL B 1 56  ? 37.302  -19.754 30.846  1.00 32.77 ? 53  VAL C CA    1 
ATOM   3201 C C     . VAL B 1 56  ? 35.962  -19.769 30.123  1.00 33.54 ? 53  VAL C C     1 
ATOM   3202 O O     . VAL B 1 56  ? 35.644  -18.868 29.353  1.00 33.26 ? 53  VAL C O     1 
ATOM   3203 C CB    . VAL B 1 56  ? 38.329  -20.696 30.157  1.00 32.69 ? 53  VAL C CB    1 
ATOM   3204 C CG1   . VAL B 1 56  ? 38.363  -20.468 28.645  1.00 32.42 ? 53  VAL C CG1   1 
ATOM   3205 C CG2   . VAL B 1 56  ? 39.700  -20.485 30.762  1.00 32.04 ? 53  VAL C CG2   1 
ATOM   3206 N N     . ASP B 1 57  ? 35.164  -20.787 30.416  1.00 34.82 ? 54  ASP C N     1 
ATOM   3207 C CA    . ASP B 1 57  ? 33.823  -20.893 29.874  1.00 34.82 ? 54  ASP C CA    1 
ATOM   3208 C C     . ASP B 1 57  ? 32.991  -19.669 30.262  1.00 35.07 ? 54  ASP C C     1 
ATOM   3209 O O     . ASP B 1 57  ? 32.196  -19.198 29.456  1.00 35.61 ? 54  ASP C O     1 
ATOM   3210 C CB    . ASP B 1 57  ? 33.156  -22.201 30.332  1.00 35.33 ? 54  ASP C CB    1 
ATOM   3211 C CG    . ASP B 1 57  ? 31.917  -22.548 29.519  1.00 36.67 ? 54  ASP C CG    1 
ATOM   3212 O OD1   . ASP B 1 57  ? 32.048  -22.822 28.302  1.00 41.16 ? 54  ASP C OD1   1 
ATOM   3213 O OD2   . ASP B 1 57  ? 30.803  -22.550 30.095  1.00 41.54 ? 54  ASP C OD2   1 
ATOM   3214 N N     . LYS B 1 58  ? 33.197  -19.134 31.465  1.00 34.94 ? 55  LYS C N     1 
ATOM   3215 C CA    . LYS B 1 58  ? 32.446  -17.963 31.930  1.00 34.81 ? 55  LYS C CA    1 
ATOM   3216 C C     . LYS B 1 58  ? 32.891  -16.672 31.242  1.00 34.14 ? 55  LYS C C     1 
ATOM   3217 O O     . LYS B 1 58  ? 32.062  -15.917 30.734  1.00 33.82 ? 55  LYS C O     1 
ATOM   3218 C CB    . LYS B 1 58  ? 32.590  -17.795 33.441  1.00 35.04 ? 55  LYS C CB    1 
ATOM   3219 C CG    . LYS B 1 58  ? 31.491  -16.965 34.092  1.00 35.93 ? 55  LYS C CG    1 
ATOM   3220 C CD    . LYS B 1 58  ? 31.923  -16.415 35.472  1.00 37.45 ? 55  LYS C CD    1 
ATOM   3221 C CE    . LYS B 1 58  ? 32.858  -15.166 35.330  1.00 39.76 ? 55  LYS C CE    1 
ATOM   3222 N NZ    . LYS B 1 58  ? 33.129  -14.442 36.617  1.00 39.43 ? 55  LYS C NZ    1 
ATOM   3223 N N     . ILE B 1 59  ? 34.198  -16.438 31.206  1.00 33.46 ? 56  ILE C N     1 
ATOM   3224 C CA    . ILE B 1 59  ? 34.750  -15.157 30.741  1.00 32.81 ? 56  ILE C CA    1 
ATOM   3225 C C     . ILE B 1 59  ? 35.072  -15.081 29.243  1.00 32.07 ? 56  ILE C C     1 
ATOM   3226 O O     . ILE B 1 59  ? 35.268  -13.992 28.726  1.00 31.86 ? 56  ILE C O     1 
ATOM   3227 C CB    . ILE B 1 59  ? 36.022  -14.743 31.552  1.00 32.90 ? 56  ILE C CB    1 
ATOM   3228 C CG1   . ILE B 1 59  ? 37.216  -15.661 31.254  1.00 32.69 ? 56  ILE C CG1   1 
ATOM   3229 C CG2   . ILE B 1 59  ? 35.726  -14.719 33.054  1.00 32.78 ? 56  ILE C CG2   1 
ATOM   3230 C CD1   . ILE B 1 59  ? 38.515  -14.918 31.213  1.00 33.19 ? 56  ILE C CD1   1 
ATOM   3231 N N     . ALA B 1 60  ? 35.135  -16.223 28.557  1.00 31.47 ? 57  ALA C N     1 
ATOM   3232 C CA    . ALA B 1 60  ? 35.445  -16.252 27.118  1.00 30.89 ? 57  ALA C CA    1 
ATOM   3233 C C     . ALA B 1 60  ? 34.590  -15.289 26.275  1.00 30.30 ? 57  ALA C C     1 
ATOM   3234 O O     . ALA B 1 60  ? 35.096  -14.666 25.349  1.00 29.84 ? 57  ALA C O     1 
ATOM   3235 C CB    . ALA B 1 60  ? 35.331  -17.673 26.561  1.00 30.95 ? 57  ALA C CB    1 
ATOM   3236 N N     . THR B 1 61  ? 33.312  -15.153 26.616  1.00 29.48 ? 58  THR C N     1 
ATOM   3237 C CA    . THR B 1 61  ? 32.381  -14.302 25.887  1.00 29.05 ? 58  THR C CA    1 
ATOM   3238 C C     . THR B 1 61  ? 32.663  -12.791 26.006  1.00 28.42 ? 58  THR C C     1 
ATOM   3239 O O     . THR B 1 61  ? 32.018  -11.981 25.336  1.00 27.79 ? 58  THR C O     1 
ATOM   3240 C CB    . THR B 1 61  ? 30.929  -14.576 26.344  1.00 29.19 ? 58  THR C CB    1 
ATOM   3241 O OG1   . THR B 1 61  ? 30.897  -14.721 27.769  1.00 28.78 ? 58  THR C OG1   1 
ATOM   3242 C CG2   . THR B 1 61  ? 30.384  -15.851 25.692  1.00 30.13 ? 58  THR C CG2   1 
ATOM   3243 N N     . GLU B 1 62  ? 33.615  -12.411 26.848  1.00 28.02 ? 59  GLU C N     1 
ATOM   3244 C CA    . GLU B 1 62  ? 34.022  -11.023 26.962  1.00 28.08 ? 59  GLU C CA    1 
ATOM   3245 C C     . GLU B 1 62  ? 35.463  -10.804 26.464  1.00 26.87 ? 59  GLU C C     1 
ATOM   3246 O O     . GLU B 1 62  ? 36.040  -9.754  26.723  1.00 25.91 ? 59  GLU C O     1 
ATOM   3247 C CB    . GLU B 1 62  ? 33.884  -10.560 28.416  1.00 28.93 ? 59  GLU C CB    1 
ATOM   3248 C CG    . GLU B 1 62  ? 32.466  -10.741 29.036  1.00 32.66 ? 59  GLU C CG    1 
ATOM   3249 C CD    . GLU B 1 62  ? 31.461  -9.643  28.626  1.00 38.28 ? 59  GLU C CD    1 
ATOM   3250 O OE1   . GLU B 1 62  ? 31.831  -8.429  28.646  1.00 39.96 ? 59  GLU C OE1   1 
ATOM   3251 O OE2   . GLU B 1 62  ? 30.290  -10.005 28.303  1.00 41.08 ? 59  GLU C OE2   1 
ATOM   3252 N N     . LEU B 1 63  ? 36.030  -11.766 25.735  1.00 26.06 ? 60  LEU C N     1 
ATOM   3253 C CA    . LEU B 1 63  ? 37.426  -11.648 25.263  1.00 25.89 ? 60  LEU C CA    1 
ATOM   3254 C C     . LEU B 1 63  ? 37.626  -10.645 24.126  1.00 25.44 ? 60  LEU C C     1 
ATOM   3255 O O     . LEU B 1 63  ? 38.767  -10.374 23.723  1.00 25.87 ? 60  LEU C O     1 
ATOM   3256 C CB    . LEU B 1 63  ? 37.986  -13.016 24.851  1.00 26.14 ? 60  LEU C CB    1 
ATOM   3257 C CG    . LEU B 1 63  ? 38.321  -13.983 25.997  1.00 26.45 ? 60  LEU C CG    1 
ATOM   3258 C CD1   . LEU B 1 63  ? 38.672  -15.368 25.434  1.00 26.66 ? 60  LEU C CD1   1 
ATOM   3259 C CD2   . LEU B 1 63  ? 39.426  -13.453 26.905  1.00 23.63 ? 60  LEU C CD2   1 
ATOM   3260 N N     . ASN B 1 64  ? 36.525  -10.129 23.585  1.00 24.47 ? 61  ASN C N     1 
ATOM   3261 C CA    . ASN B 1 64  ? 36.579  -9.057  22.616  1.00 24.15 ? 61  ASN C CA    1 
ATOM   3262 C C     . ASN B 1 64  ? 36.870  -7.695  23.257  1.00 23.75 ? 61  ASN C C     1 
ATOM   3263 O O     . ASN B 1 64  ? 37.287  -6.757  22.580  1.00 23.16 ? 61  ASN C O     1 
ATOM   3264 C CB    . ASN B 1 64  ? 35.289  -8.993  21.794  1.00 23.86 ? 61  ASN C CB    1 
ATOM   3265 C CG    . ASN B 1 64  ? 34.035  -8.843  22.649  1.00 23.84 ? 61  ASN C CG    1 
ATOM   3266 O OD1   . ASN B 1 64  ? 33.807  -9.622  23.574  1.00 21.76 ? 61  ASN C OD1   1 
ATOM   3267 N ND2   . ASN B 1 64  ? 33.208  -7.853  22.322  1.00 21.71 ? 61  ASN C ND2   1 
ATOM   3268 N N     . ARG B 1 65  ? 36.646  -7.599  24.559  1.00 23.37 ? 62  ARG C N     1 
ATOM   3269 C CA    . ARG B 1 65  ? 36.877  -6.365  25.283  1.00 23.04 ? 62  ARG C CA    1 
ATOM   3270 C C     . ARG B 1 65  ? 38.252  -6.377  25.904  1.00 22.53 ? 62  ARG C C     1 
ATOM   3271 O O     . ARG B 1 65  ? 38.778  -7.427  26.270  1.00 22.09 ? 62  ARG C O     1 
ATOM   3272 C CB    . ARG B 1 65  ? 35.829  -6.186  26.385  1.00 22.85 ? 62  ARG C CB    1 
ATOM   3273 C CG    . ARG B 1 65  ? 34.407  -6.206  25.901  1.00 22.90 ? 62  ARG C CG    1 
ATOM   3274 C CD    . ARG B 1 65  ? 34.069  -4.945  25.160  1.00 23.01 ? 62  ARG C CD    1 
ATOM   3275 N NE    . ARG B 1 65  ? 32.704  -4.976  24.668  1.00 23.73 ? 62  ARG C NE    1 
ATOM   3276 C CZ    . ARG B 1 65  ? 32.151  -4.046  23.898  1.00 24.61 ? 62  ARG C CZ    1 
ATOM   3277 N NH1   . ARG B 1 65  ? 32.847  -2.967  23.532  1.00 26.07 ? 62  ARG C NH1   1 
ATOM   3278 N NH2   . ARG B 1 65  ? 30.891  -4.185  23.505  1.00 24.95 ? 62  ARG C NH2   1 
ATOM   3279 N N     . TYR B 1 66  ? 38.823  -5.189  26.053  1.00 22.15 ? 63  TYR C N     1 
ATOM   3280 C CA    . TYR B 1 66  ? 40.033  -5.032  26.837  1.00 22.33 ? 63  TYR C CA    1 
ATOM   3281 C C     . TYR B 1 66  ? 39.819  -5.501  28.257  1.00 22.47 ? 63  TYR C C     1 
ATOM   3282 O O     . TYR B 1 66  ? 38.716  -5.348  28.807  1.00 22.03 ? 63  TYR C O     1 
ATOM   3283 C CB    . TYR B 1 66  ? 40.499  -3.580  26.838  1.00 22.03 ? 63  TYR C CB    1 
ATOM   3284 C CG    . TYR B 1 66  ? 41.246  -3.264  25.582  1.00 21.74 ? 63  TYR C CG    1 
ATOM   3285 C CD1   . TYR B 1 66  ? 40.590  -2.733  24.467  1.00 21.90 ? 63  TYR C CD1   1 
ATOM   3286 C CD2   . TYR B 1 66  ? 42.584  -3.558  25.477  1.00 20.82 ? 63  TYR C CD2   1 
ATOM   3287 C CE1   . TYR B 1 66  ? 41.272  -2.453  23.295  1.00 21.89 ? 63  TYR C CE1   1 
ATOM   3288 C CE2   . TYR B 1 66  ? 43.276  -3.290  24.307  1.00 21.57 ? 63  TYR C CE2   1 
ATOM   3289 C CZ    . TYR B 1 66  ? 42.611  -2.738  23.220  1.00 21.55 ? 63  TYR C CZ    1 
ATOM   3290 O OH    . TYR B 1 66  ? 43.287  -2.475  22.064  1.00 22.30 ? 63  TYR C OH    1 
ATOM   3291 N N     . PRO B 1 67  ? 40.875  -6.070  28.864  1.00 22.79 ? 64  PRO C N     1 
ATOM   3292 C CA    . PRO B 1 67  ? 40.764  -6.536  30.235  1.00 23.52 ? 64  PRO C CA    1 
ATOM   3293 C C     . PRO B 1 67  ? 40.647  -5.371  31.186  1.00 23.99 ? 64  PRO C C     1 
ATOM   3294 O O     . PRO B 1 67  ? 40.879  -4.221  30.802  1.00 23.93 ? 64  PRO C O     1 
ATOM   3295 C CB    . PRO B 1 67  ? 42.080  -7.290  30.475  1.00 23.12 ? 64  PRO C CB    1 
ATOM   3296 C CG    . PRO B 1 67  ? 43.033  -6.741  29.504  1.00 23.44 ? 64  PRO C CG    1 
ATOM   3297 C CD    . PRO B 1 67  ? 42.224  -6.282  28.310  1.00 22.76 ? 64  PRO C CD    1 
ATOM   3298 N N     . GLU B 1 68  ? 40.295  -5.665  32.426  1.00 24.85 ? 65  GLU C N     1 
ATOM   3299 C CA    . GLU B 1 68  ? 40.316  -4.636  33.452  1.00 25.44 ? 65  GLU C CA    1 
ATOM   3300 C C     . GLU B 1 68  ? 41.772  -4.197  33.624  1.00 25.46 ? 65  GLU C C     1 
ATOM   3301 O O     . GLU B 1 68  ? 42.622  -4.992  33.999  1.00 26.15 ? 65  GLU C O     1 
ATOM   3302 C CB    . GLU B 1 68  ? 39.684  -5.118  34.765  1.00 25.42 ? 65  GLU C CB    1 
ATOM   3303 C CG    . GLU B 1 68  ? 39.299  -3.954  35.693  1.00 26.74 ? 65  GLU C CG    1 
ATOM   3304 C CD    . GLU B 1 68  ? 40.444  -3.516  36.596  1.00 27.91 ? 65  GLU C CD    1 
ATOM   3305 O OE1   . GLU B 1 68  ? 40.961  -4.396  37.327  1.00 29.42 ? 65  GLU C OE1   1 
ATOM   3306 O OE2   . GLU B 1 68  ? 40.819  -2.313  36.576  1.00 27.04 ? 65  GLU C OE2   1 
ATOM   3307 N N     . ARG B 1 69  ? 42.036  -2.932  33.314  1.00 25.84 ? 66  ARG C N     1 
ATOM   3308 C CA    . ARG B 1 69  ? 43.394  -2.383  33.189  1.00 26.14 ? 66  ARG C CA    1 
ATOM   3309 C C     . ARG B 1 69  ? 44.255  -2.479  34.447  1.00 26.10 ? 66  ARG C C     1 
ATOM   3310 O O     . ARG B 1 69  ? 45.459  -2.736  34.371  1.00 24.99 ? 66  ARG C O     1 
ATOM   3311 C CB    . ARG B 1 69  ? 43.325  -0.914  32.770  1.00 25.99 ? 66  ARG C CB    1 
ATOM   3312 C CG    . ARG B 1 69  ? 44.637  -0.357  32.234  1.00 26.20 ? 66  ARG C CG    1 
ATOM   3313 C CD    . ARG B 1 69  ? 44.585  1.151   32.183  1.00 27.65 ? 66  ARG C CD    1 
ATOM   3314 N NE    . ARG B 1 69  ? 43.432  1.528   31.410  1.00 29.50 ? 66  ARG C NE    1 
ATOM   3315 C CZ    . ARG B 1 69  ? 42.432  2.306   31.793  1.00 28.31 ? 66  ARG C CZ    1 
ATOM   3316 N NH1   . ARG B 1 69  ? 42.410  2.944   32.951  1.00 27.87 ? 66  ARG C NH1   1 
ATOM   3317 N NH2   . ARG B 1 69  ? 41.455  2.487   30.931  1.00 29.60 ? 66  ARG C NH2   1 
ATOM   3318 N N     . ASP B 1 70  ? 43.652  -2.235  35.600  1.00 25.92 ? 67  ASP C N     1 
ATOM   3319 C CA    . ASP B 1 70  ? 44.426  -2.201  36.836  1.00 26.20 ? 67  ASP C CA    1 
ATOM   3320 C C     . ASP B 1 70  ? 44.386  -3.520  37.608  1.00 25.81 ? 67  ASP C C     1 
ATOM   3321 O O     . ASP B 1 70  ? 44.865  -3.570  38.714  1.00 26.52 ? 67  ASP C O     1 
ATOM   3322 C CB    . ASP B 1 70  ? 43.960  -1.051  37.729  1.00 26.25 ? 67  ASP C CB    1 
ATOM   3323 C CG    . ASP B 1 70  ? 44.148  0.310   37.074  1.00 28.51 ? 67  ASP C CG    1 
ATOM   3324 O OD1   . ASP B 1 70  ? 45.042  0.443   36.189  1.00 26.51 ? 67  ASP C OD1   1 
ATOM   3325 O OD2   . ASP B 1 70  ? 43.387  1.243   37.449  1.00 29.71 ? 67  ASP C OD2   1 
ATOM   3326 N N     . ALA B 1 71  ? 43.825  -4.579  37.036  1.00 25.81 ? 68  ALA C N     1 
ATOM   3327 C CA    . ALA B 1 71  ? 43.842  -5.917  37.677  1.00 25.53 ? 68  ALA C CA    1 
ATOM   3328 C C     . ALA B 1 71  ? 43.440  -5.889  39.167  1.00 25.40 ? 68  ALA C C     1 
ATOM   3329 O O     . ALA B 1 71  ? 44.032  -6.556  40.014  1.00 25.04 ? 68  ALA C O     1 
ATOM   3330 C CB    . ALA B 1 71  ? 45.211  -6.573  37.491  1.00 24.91 ? 68  ALA C CB    1 
ATOM   3331 N N     . VAL B 1 72  ? 42.418  -5.100  39.479  1.00 25.69 ? 69  VAL C N     1 
ATOM   3332 C CA    . VAL B 1 72  ? 41.981  -4.905  40.863  1.00 25.62 ? 69  VAL C CA    1 
ATOM   3333 C C     . VAL B 1 72  ? 41.632  -6.216  41.604  1.00 25.17 ? 69  VAL C C     1 
ATOM   3334 O O     . VAL B 1 72  ? 42.104  -6.457  42.720  1.00 24.08 ? 69  VAL C O     1 
ATOM   3335 C CB    . VAL B 1 72  ? 40.792  -3.940  40.904  1.00 25.95 ? 69  VAL C CB    1 
ATOM   3336 C CG1   . VAL B 1 72  ? 40.107  -4.027  42.221  1.00 28.16 ? 69  VAL C CG1   1 
ATOM   3337 C CG2   . VAL B 1 72  ? 41.269  -2.501  40.636  1.00 26.85 ? 69  VAL C CG2   1 
ATOM   3338 N N     . GLU B 1 73  ? 40.837  -7.077  40.985  1.00 25.58 ? 70  GLU C N     1 
ATOM   3339 C CA    . GLU B 1 73  ? 40.423  -8.323  41.643  1.00 25.37 ? 70  GLU C CA    1 
ATOM   3340 C C     . GLU B 1 73  ? 41.630  -9.219  41.930  1.00 24.83 ? 70  GLU C C     1 
ATOM   3341 O O     . GLU B 1 73  ? 41.756  -9.780  43.019  1.00 24.62 ? 70  GLU C O     1 
ATOM   3342 C CB    . GLU B 1 73  ? 39.394  -9.057  40.798  1.00 25.93 ? 70  GLU C CB    1 
ATOM   3343 C CG    . GLU B 1 73  ? 38.810  -10.296 41.482  1.00 27.44 ? 70  GLU C CG    1 
ATOM   3344 C CD    . GLU B 1 73  ? 37.708  -10.980 40.685  1.00 28.24 ? 70  GLU C CD    1 
ATOM   3345 O OE1   . GLU B 1 73  ? 37.171  -10.392 39.702  1.00 31.41 ? 70  GLU C OE1   1 
ATOM   3346 O OE2   . GLU B 1 73  ? 37.374  -12.130 41.070  1.00 35.09 ? 70  GLU C OE2   1 
ATOM   3347 N N     . LEU B 1 74  ? 42.542  -9.329  40.963  1.00 24.14 ? 71  LEU C N     1 
ATOM   3348 C CA    . LEU B 1 74  ? 43.764  -10.124 41.154  1.00 23.33 ? 71  LEU C CA    1 
ATOM   3349 C C     . LEU B 1 74  ? 44.592  -9.580  42.323  1.00 22.71 ? 71  LEU C C     1 
ATOM   3350 O O     . LEU B 1 74  ? 45.114  -10.340 43.145  1.00 21.51 ? 71  LEU C O     1 
ATOM   3351 C CB    . LEU B 1 74  ? 44.596  -10.160 39.856  1.00 22.93 ? 71  LEU C CB    1 
ATOM   3352 C CG    . LEU B 1 74  ? 45.997  -10.764 39.897  1.00 23.64 ? 71  LEU C CG    1 
ATOM   3353 C CD1   . LEU B 1 74  ? 45.977  -12.212 40.392  1.00 22.75 ? 71  LEU C CD1   1 
ATOM   3354 C CD2   . LEU B 1 74  ? 46.690  -10.663 38.507  1.00 22.54 ? 71  LEU C CD2   1 
ATOM   3355 N N     . ARG B 1 75  ? 44.704  -8.258  42.392  1.00 22.64 ? 72  ARG C N     1 
ATOM   3356 C CA    . ARG B 1 75  ? 45.491  -7.604  43.417  1.00 23.04 ? 72  ARG C CA    1 
ATOM   3357 C C     . ARG B 1 75  ? 44.874  -7.742  44.800  1.00 22.96 ? 72  ARG C C     1 
ATOM   3358 O O     . ARG B 1 75  ? 45.605  -7.881  45.780  1.00 22.36 ? 72  ARG C O     1 
ATOM   3359 C CB    . ARG B 1 75  ? 45.724  -6.138  43.057  1.00 23.07 ? 72  ARG C CB    1 
ATOM   3360 C CG    . ARG B 1 75  ? 46.713  -5.963  41.885  1.00 22.73 ? 72  ARG C CG    1 
ATOM   3361 C CD    . ARG B 1 75  ? 46.504  -4.618  41.206  1.00 24.30 ? 72  ARG C CD    1 
ATOM   3362 N NE    . ARG B 1 75  ? 46.750  -3.519  42.141  1.00 24.79 ? 72  ARG C NE    1 
ATOM   3363 C CZ    . ARG B 1 75  ? 46.271  -2.282  42.030  1.00 25.53 ? 72  ARG C CZ    1 
ATOM   3364 N NH1   . ARG B 1 75  ? 45.501  -1.920  41.003  1.00 23.94 ? 72  ARG C NH1   1 
ATOM   3365 N NH2   . ARG B 1 75  ? 46.566  -1.398  42.980  1.00 24.85 ? 72  ARG C NH2   1 
ATOM   3366 N N     . ASP B 1 76  ? 43.543  -7.725  44.875  1.00 23.50 ? 73  ASP C N     1 
ATOM   3367 C CA    . ASP B 1 76  ? 42.828  -8.074  46.102  1.00 24.24 ? 73  ASP C CA    1 
ATOM   3368 C C     . ASP B 1 76  ? 43.226  -9.478  46.585  1.00 24.23 ? 73  ASP C C     1 
ATOM   3369 O O     . ASP B 1 76  ? 43.523  -9.679  47.765  1.00 23.91 ? 73  ASP C O     1 
ATOM   3370 C CB    . ASP B 1 76  ? 41.301  -8.057  45.890  1.00 24.47 ? 73  ASP C CB    1 
ATOM   3371 C CG    . ASP B 1 76  ? 40.723  -6.663  45.848  1.00 27.24 ? 73  ASP C CG    1 
ATOM   3372 O OD1   . ASP B 1 76  ? 41.358  -5.737  46.394  1.00 30.31 ? 73  ASP C OD1   1 
ATOM   3373 O OD2   . ASP B 1 76  ? 39.621  -6.489  45.266  1.00 31.26 ? 73  ASP C OD2   1 
ATOM   3374 N N     . GLU B 1 77  ? 43.234  -10.450 45.677  1.00 24.62 ? 74  GLU C N     1 
ATOM   3375 C CA    . GLU B 1 77  ? 43.526  -11.838 46.078  1.00 24.86 ? 74  GLU C CA    1 
ATOM   3376 C C     . GLU B 1 77  ? 45.002  -12.066 46.393  1.00 24.84 ? 74  GLU C C     1 
ATOM   3377 O O     . GLU B 1 77  ? 45.338  -12.903 47.244  1.00 24.27 ? 74  GLU C O     1 
ATOM   3378 C CB    . GLU B 1 77  ? 43.061  -12.819 45.019  1.00 25.70 ? 74  GLU C CB    1 
ATOM   3379 C CG    . GLU B 1 77  ? 41.541  -12.809 44.779  1.00 29.04 ? 74  GLU C CG    1 
ATOM   3380 C CD    . GLU B 1 77  ? 40.714  -13.110 46.042  1.00 33.45 ? 74  GLU C CD    1 
ATOM   3381 O OE1   . GLU B 1 77  ? 41.153  -13.950 46.877  1.00 35.09 ? 74  GLU C OE1   1 
ATOM   3382 O OE2   . GLU B 1 77  ? 39.618  -12.512 46.184  1.00 35.26 ? 74  GLU C OE2   1 
ATOM   3383 N N     . LEU B 1 78  ? 45.883  -11.336 45.708  1.00 24.43 ? 75  LEU C N     1 
ATOM   3384 C CA    . LEU B 1 78  ? 47.300  -11.397 46.012  1.00 24.58 ? 75  LEU C CA    1 
ATOM   3385 C C     . LEU B 1 78  ? 47.581  -10.807 47.403  1.00 24.78 ? 75  LEU C C     1 
ATOM   3386 O O     . LEU B 1 78  ? 48.408  -11.326 48.153  1.00 24.93 ? 75  LEU C O     1 
ATOM   3387 C CB    . LEU B 1 78  ? 48.131  -10.659 44.959  1.00 23.79 ? 75  LEU C CB    1 
ATOM   3388 C CG    . LEU B 1 78  ? 48.335  -11.286 43.579  1.00 23.29 ? 75  LEU C CG    1 
ATOM   3389 C CD1   . LEU B 1 78  ? 48.987  -10.270 42.630  1.00 22.47 ? 75  LEU C CD1   1 
ATOM   3390 C CD2   . LEU B 1 78  ? 49.171  -12.565 43.683  1.00 22.10 ? 75  LEU C CD2   1 
ATOM   3391 N N     . ALA B 1 79  ? 46.903  -9.717  47.735  1.00 24.92 ? 76  ALA C N     1 
ATOM   3392 C CA    . ALA B 1 79  ? 47.050  -9.106  49.050  1.00 24.98 ? 76  ALA C CA    1 
ATOM   3393 C C     . ALA B 1 79  ? 46.494  -10.014 50.146  1.00 24.98 ? 76  ALA C C     1 
ATOM   3394 O O     . ALA B 1 79  ? 47.050  -10.069 51.227  1.00 25.28 ? 76  ALA C O     1 
ATOM   3395 C CB    . ALA B 1 79  ? 46.384  -7.735  49.083  1.00 24.58 ? 76  ALA C CB    1 
ATOM   3396 N N     . ALA B 1 80  ? 45.413  -10.731 49.871  1.00 25.24 ? 77  ALA C N     1 
ATOM   3397 C CA    . ALA B 1 80  ? 44.869  -11.680 50.846  1.00 25.85 ? 77  ALA C CA    1 
ATOM   3398 C C     . ALA B 1 80  ? 45.866  -12.835 51.083  1.00 26.39 ? 77  ALA C C     1 
ATOM   3399 O O     . ALA B 1 80  ? 46.101  -13.233 52.236  1.00 27.16 ? 77  ALA C O     1 
ATOM   3400 C CB    . ALA B 1 80  ? 43.527  -12.213 50.388  1.00 25.51 ? 77  ALA C CB    1 
ATOM   3401 N N     . TYR B 1 81  ? 46.474  -13.339 50.007  1.00 26.22 ? 78  TYR C N     1 
ATOM   3402 C CA    . TYR B 1 81  ? 47.518  -14.373 50.118  1.00 26.23 ? 78  TYR C CA    1 
ATOM   3403 C C     . TYR B 1 81  ? 48.691  -13.886 50.960  1.00 26.32 ? 78  TYR C C     1 
ATOM   3404 O O     . TYR B 1 81  ? 49.155  -14.580 51.862  1.00 25.93 ? 78  TYR C O     1 
ATOM   3405 C CB    . TYR B 1 81  ? 48.048  -14.817 48.730  1.00 25.94 ? 78  TYR C CB    1 
ATOM   3406 C CG    . TYR B 1 81  ? 49.313  -15.661 48.842  1.00 25.74 ? 78  TYR C CG    1 
ATOM   3407 C CD1   . TYR B 1 81  ? 49.261  -16.954 49.337  1.00 25.02 ? 78  TYR C CD1   1 
ATOM   3408 C CD2   . TYR B 1 81  ? 50.556  -15.144 48.508  1.00 24.53 ? 78  TYR C CD2   1 
ATOM   3409 C CE1   . TYR B 1 81  ? 50.401  -17.718 49.473  1.00 24.75 ? 78  TYR C CE1   1 
ATOM   3410 C CE2   . TYR B 1 81  ? 51.695  -15.888 48.650  1.00 24.84 ? 78  TYR C CE2   1 
ATOM   3411 C CZ    . TYR B 1 81  ? 51.616  -17.175 49.123  1.00 25.18 ? 78  TYR C CZ    1 
ATOM   3412 O OH    . TYR B 1 81  ? 52.755  -17.921 49.274  1.00 25.71 ? 78  TYR C OH    1 
ATOM   3413 N N     . ILE B 1 82  ? 49.198  -12.705 50.633  1.00 26.75 ? 79  ILE C N     1 
ATOM   3414 C CA    . ILE B 1 82  ? 50.381  -12.169 51.315  1.00 26.93 ? 79  ILE C CA    1 
ATOM   3415 C C     . ILE B 1 82  ? 50.085  -11.930 52.786  1.00 26.93 ? 79  ILE C C     1 
ATOM   3416 O O     . ILE B 1 82  ? 50.895  -12.253 53.645  1.00 26.53 ? 79  ILE C O     1 
ATOM   3417 C CB    . ILE B 1 82  ? 50.902  -10.875 50.652  1.00 26.73 ? 79  ILE C CB    1 
ATOM   3418 C CG1   . ILE B 1 82  ? 51.707  -11.205 49.383  1.00 27.03 ? 79  ILE C CG1   1 
ATOM   3419 C CG2   . ILE B 1 82  ? 51.757  -10.086 51.624  1.00 26.43 ? 79  ILE C CG2   1 
ATOM   3420 C CD1   . ILE B 1 82  ? 53.018  -11.932 49.626  1.00 26.03 ? 79  ILE C CD1   1 
ATOM   3421 N N     . THR B 1 83  ? 48.911  -11.386 53.070  1.00 27.65 ? 80  THR C N     1 
ATOM   3422 C CA    . THR B 1 83  ? 48.472  -11.184 54.452  1.00 28.20 ? 80  THR C CA    1 
ATOM   3423 C C     . THR B 1 83  ? 48.501  -12.481 55.244  1.00 28.64 ? 80  THR C C     1 
ATOM   3424 O O     . THR B 1 83  ? 49.081  -12.536 56.322  1.00 28.19 ? 80  THR C O     1 
ATOM   3425 C CB    . THR B 1 83  ? 47.076  -10.562 54.510  1.00 27.94 ? 80  THR C CB    1 
ATOM   3426 O OG1   . THR B 1 83  ? 47.129  -9.259  53.914  1.00 27.91 ? 80  THR C OG1   1 
ATOM   3427 C CG2   . THR B 1 83  ? 46.589  -10.455 55.961  1.00 27.59 ? 80  THR C CG2   1 
ATOM   3428 N N     . LYS B 1 84  ? 47.903  -13.530 54.697  1.00 29.76 ? 81  LYS C N     1 
ATOM   3429 C CA    . LYS B 1 84  ? 47.916  -14.826 55.354  1.00 30.25 ? 81  LYS C CA    1 
ATOM   3430 C C     . LYS B 1 84  ? 49.315  -15.431 55.389  1.00 30.29 ? 81  LYS C C     1 
ATOM   3431 O O     . LYS B 1 84  ? 49.745  -15.929 56.417  1.00 30.34 ? 81  LYS C O     1 
ATOM   3432 C CB    . LYS B 1 84  ? 46.951  -15.800 54.677  1.00 30.95 ? 81  LYS C CB    1 
ATOM   3433 C CG    . LYS B 1 84  ? 46.551  -16.956 55.574  1.00 31.75 ? 81  LYS C CG    1 
ATOM   3434 C CD    . LYS B 1 84  ? 46.069  -18.188 54.813  1.00 32.58 ? 81  LYS C CD    1 
ATOM   3435 C CE    . LYS B 1 84  ? 45.977  -19.415 55.771  1.00 34.58 ? 81  LYS C CE    1 
ATOM   3436 N NZ    . LYS B 1 84  ? 45.060  -20.507 55.258  1.00 34.88 ? 81  LYS C NZ    1 
ATOM   3437 N N     . GLN B 1 85  ? 50.025  -15.378 54.271  1.00 30.19 ? 82  GLN C N     1 
ATOM   3438 C CA    . GLN B 1 85  ? 51.314  -16.058 54.147  1.00 30.04 ? 82  GLN C CA    1 
ATOM   3439 C C     . GLN B 1 85  ? 52.380  -15.469 55.071  1.00 30.18 ? 82  GLN C C     1 
ATOM   3440 O O     . GLN B 1 85  ? 53.053  -16.201 55.800  1.00 29.67 ? 82  GLN C O     1 
ATOM   3441 C CB    . GLN B 1 85  ? 51.790  -16.016 52.686  1.00 29.75 ? 82  GLN C CB    1 
ATOM   3442 C CG    . GLN B 1 85  ? 53.148  -16.637 52.410  1.00 30.10 ? 82  GLN C CG    1 
ATOM   3443 C CD    . GLN B 1 85  ? 53.209  -18.108 52.723  1.00 30.70 ? 82  GLN C CD    1 
ATOM   3444 O OE1   . GLN B 1 85  ? 52.185  -18.771 52.827  1.00 32.04 ? 82  GLN C OE1   1 
ATOM   3445 N NE2   . GLN B 1 85  ? 54.416  -18.628 52.879  1.00 31.18 ? 82  GLN C NE2   1 
ATOM   3446 N N     . THR B 1 86  ? 52.534  -14.150 55.025  1.00 30.17 ? 83  THR C N     1 
ATOM   3447 C CA    . THR B 1 86  ? 53.621  -13.472 55.707  1.00 30.11 ? 83  THR C CA    1 
ATOM   3448 C C     . THR B 1 86  ? 53.207  -12.843 57.039  1.00 30.67 ? 83  THR C C     1 
ATOM   3449 O O     . THR B 1 86  ? 54.070  -12.394 57.798  1.00 30.45 ? 83  THR C O     1 
ATOM   3450 C CB    . THR B 1 86  ? 54.179  -12.313 54.849  1.00 30.11 ? 83  THR C CB    1 
ATOM   3451 O OG1   . THR B 1 86  ? 53.203  -11.274 54.779  1.00 28.13 ? 83  THR C OG1   1 
ATOM   3452 C CG2   . THR B 1 86  ? 54.539  -12.775 53.455  1.00 29.10 ? 83  THR C CG2   1 
ATOM   3453 N N     . GLY B 1 87  ? 51.901  -12.764 57.300  1.00 30.41 ? 84  GLY C N     1 
ATOM   3454 C CA    . GLY B 1 87  ? 51.397  -12.112 58.506  1.00 30.51 ? 84  GLY C CA    1 
ATOM   3455 C C     . GLY B 1 87  ? 51.336  -10.589 58.463  1.00 30.69 ? 84  GLY C C     1 
ATOM   3456 O O     . GLY B 1 87  ? 50.966  -9.964  59.450  1.00 31.39 ? 84  GLY C O     1 
ATOM   3457 N N     . VAL B 1 88  ? 51.689  -9.972  57.339  1.00 30.30 ? 85  VAL C N     1 
ATOM   3458 C CA    . VAL B 1 88  ? 51.674  -8.514  57.252  1.00 29.88 ? 85  VAL C CA    1 
ATOM   3459 C C     . VAL B 1 88  ? 50.401  -8.091  56.559  1.00 29.94 ? 85  VAL C C     1 
ATOM   3460 O O     . VAL B 1 88  ? 50.141  -8.503  55.433  1.00 29.70 ? 85  VAL C O     1 
ATOM   3461 C CB    . VAL B 1 88  ? 52.899  -7.962  56.493  1.00 29.84 ? 85  VAL C CB    1 
ATOM   3462 C CG1   . VAL B 1 88  ? 52.834  -6.440  56.398  1.00 28.87 ? 85  VAL C CG1   1 
ATOM   3463 C CG2   . VAL B 1 88  ? 54.194  -8.411  57.180  1.00 28.41 ? 85  VAL C CG2   1 
ATOM   3464 N N     . ALA B 1 89  ? 49.597  -7.280  57.247  1.00 29.97 ? 86  ALA C N     1 
ATOM   3465 C CA    . ALA B 1 89  ? 48.364  -6.762  56.677  1.00 29.88 ? 86  ALA C CA    1 
ATOM   3466 C C     . ALA B 1 89  ? 48.647  -5.815  55.513  1.00 29.77 ? 86  ALA C C     1 
ATOM   3467 O O     . ALA B 1 89  ? 49.248  -4.750  55.709  1.00 29.81 ? 86  ALA C O     1 
ATOM   3468 C CB    . ALA B 1 89  ? 47.533  -6.047  57.745  1.00 29.98 ? 86  ALA C CB    1 
ATOM   3469 N N     . VAL B 1 90  ? 48.195  -6.207  54.315  1.00 29.21 ? 87  VAL C N     1 
ATOM   3470 C CA    . VAL B 1 90  ? 48.311  -5.377  53.114  1.00 29.11 ? 87  VAL C CA    1 
ATOM   3471 C C     . VAL B 1 90  ? 47.045  -5.488  52.272  1.00 28.98 ? 87  VAL C C     1 
ATOM   3472 O O     . VAL B 1 90  ? 46.342  -6.479  52.358  1.00 28.82 ? 87  VAL C O     1 
ATOM   3473 C CB    . VAL B 1 90  ? 49.528  -5.794  52.236  1.00 28.84 ? 87  VAL C CB    1 
ATOM   3474 C CG1   . VAL B 1 90  ? 50.821  -5.481  52.928  1.00 27.75 ? 87  VAL C CG1   1 
ATOM   3475 C CG2   . VAL B 1 90  ? 49.456  -7.267  51.873  1.00 28.00 ? 87  VAL C CG2   1 
ATOM   3476 N N     . THR B 1 91  ? 46.779  -4.473  51.449  1.00 29.21 ? 88  THR C N     1 
ATOM   3477 C CA    . THR B 1 91  ? 45.629  -4.457  50.545  1.00 29.04 ? 88  THR C CA    1 
ATOM   3478 C C     . THR B 1 91  ? 46.086  -4.354  49.091  1.00 28.82 ? 88  THR C C     1 
ATOM   3479 O O     . THR B 1 91  ? 47.288  -4.303  48.806  1.00 27.59 ? 88  THR C O     1 
ATOM   3480 C CB    . THR B 1 91  ? 44.685  -3.278  50.882  1.00 29.31 ? 88  THR C CB    1 
ATOM   3481 O OG1   . THR B 1 91  ? 45.277  -2.032  50.478  1.00 30.37 ? 88  THR C OG1   1 
ATOM   3482 C CG2   . THR B 1 91  ? 44.370  -3.247  52.380  1.00 29.70 ? 88  THR C CG2   1 
ATOM   3483 N N     . ARG B 1 92  ? 45.129  -4.325  48.166  1.00 28.83 ? 89  ARG C N     1 
ATOM   3484 C CA    . ARG B 1 92  ? 45.470  -4.189  46.742  1.00 29.54 ? 89  ARG C CA    1 
ATOM   3485 C C     . ARG B 1 92  ? 46.345  -2.977  46.445  1.00 29.10 ? 89  ARG C C     1 
ATOM   3486 O O     . ARG B 1 92  ? 47.149  -2.995  45.507  1.00 28.91 ? 89  ARG C O     1 
ATOM   3487 C CB    . ARG B 1 92  ? 44.221  -4.154  45.869  1.00 29.73 ? 89  ARG C CB    1 
ATOM   3488 C CG    . ARG B 1 92  ? 43.290  -2.981  46.122  1.00 30.32 ? 89  ARG C CG    1 
ATOM   3489 C CD    . ARG B 1 92  ? 42.116  -3.065  45.186  1.00 32.19 ? 89  ARG C CD    1 
ATOM   3490 N NE    . ARG B 1 92  ? 41.328  -1.847  45.202  1.00 34.17 ? 89  ARG C NE    1 
ATOM   3491 C CZ    . ARG B 1 92  ? 40.025  -1.795  44.967  1.00 38.11 ? 89  ARG C CZ    1 
ATOM   3492 N NH1   . ARG B 1 92  ? 39.334  -2.910  44.688  1.00 39.73 ? 89  ARG C NH1   1 
ATOM   3493 N NH2   . ARG B 1 92  ? 39.404  -0.613  45.005  1.00 39.88 ? 89  ARG C NH2   1 
ATOM   3494 N N     . ASP B 1 93  ? 46.200  -1.935  47.256  1.00 29.10 ? 90  ASP C N     1 
ATOM   3495 C CA    . ASP B 1 93  ? 47.017  -0.727  47.133  1.00 28.87 ? 90  ASP C CA    1 
ATOM   3496 C C     . ASP B 1 93  ? 48.497  -0.972  47.368  1.00 28.15 ? 90  ASP C C     1 
ATOM   3497 O O     . ASP B 1 93  ? 49.327  -0.163  46.953  1.00 27.98 ? 90  ASP C O     1 
ATOM   3498 C CB    . ASP B 1 93  ? 46.527  0.341   48.103  1.00 29.89 ? 90  ASP C CB    1 
ATOM   3499 C CG    . ASP B 1 93  ? 45.161  0.873   47.736  1.00 32.22 ? 90  ASP C CG    1 
ATOM   3500 O OD1   . ASP B 1 93  ? 44.877  1.030   46.527  1.00 37.50 ? 90  ASP C OD1   1 
ATOM   3501 O OD2   . ASP B 1 93  ? 44.365  1.144   48.657  1.00 37.85 ? 90  ASP C OD2   1 
ATOM   3502 N N     . ASN B 1 94  ? 48.831  -2.074  48.033  1.00 26.92 ? 91  ASN C N     1 
ATOM   3503 C CA    . ASN B 1 94  ? 50.227  -2.466  48.214  1.00 26.60 ? 91  ASN C CA    1 
ATOM   3504 C C     . ASN B 1 94  ? 50.755  -3.432  47.164  1.00 26.13 ? 91  ASN C C     1 
ATOM   3505 O O     . ASN B 1 94  ? 51.934  -3.781  47.200  1.00 26.12 ? 91  ASN C O     1 
ATOM   3506 C CB    . ASN B 1 94  ? 50.411  -3.101  49.583  1.00 26.44 ? 91  ASN C CB    1 
ATOM   3507 C CG    . ASN B 1 94  ? 50.084  -2.143  50.693  1.00 25.30 ? 91  ASN C CG    1 
ATOM   3508 O OD1   . ASN B 1 94  ? 50.868  -1.256  50.999  1.00 25.33 ? 91  ASN C OD1   1 
ATOM   3509 N ND2   . ASN B 1 94  ? 48.924  -2.306  51.285  1.00 21.09 ? 91  ASN C ND2   1 
ATOM   3510 N N     . LEU B 1 95  ? 49.894  -3.850  46.238  1.00 25.51 ? 92  LEU C N     1 
ATOM   3511 C CA    . LEU B 1 95  ? 50.225  -4.925  45.329  1.00 25.40 ? 92  LEU C CA    1 
ATOM   3512 C C     . LEU B 1 95  ? 50.143  -4.492  43.895  1.00 24.83 ? 92  LEU C C     1 
ATOM   3513 O O     . LEU B 1 95  ? 49.286  -3.707  43.535  1.00 24.05 ? 92  LEU C O     1 
ATOM   3514 C CB    . LEU B 1 95  ? 49.331  -6.155  45.581  1.00 25.75 ? 92  LEU C CB    1 
ATOM   3515 C CG    . LEU B 1 95  ? 50.011  -7.034  46.639  1.00 26.82 ? 92  LEU C CG    1 
ATOM   3516 C CD1   . LEU B 1 95  ? 49.342  -6.888  47.966  1.00 25.58 ? 92  LEU C CD1   1 
ATOM   3517 C CD2   . LEU B 1 95  ? 50.100  -8.480  46.201  1.00 28.00 ? 92  LEU C CD2   1 
ATOM   3518 N N     . TRP B 1 96  ? 51.086  -4.995  43.103  1.00 23.99 ? 93  TRP C N     1 
ATOM   3519 C CA    . TRP B 1 96  ? 51.121  -4.779  41.665  1.00 23.46 ? 93  TRP C CA    1 
ATOM   3520 C C     . TRP B 1 96  ? 51.543  -6.058  40.960  1.00 22.96 ? 93  TRP C C     1 
ATOM   3521 O O     . TRP B 1 96  ? 52.568  -6.612  41.314  1.00 23.22 ? 93  TRP C O     1 
ATOM   3522 C CB    . TRP B 1 96  ? 52.145  -3.709  41.314  1.00 22.89 ? 93  TRP C CB    1 
ATOM   3523 C CG    . TRP B 1 96  ? 52.142  -3.415  39.860  1.00 22.79 ? 93  TRP C CG    1 
ATOM   3524 C CD1   . TRP B 1 96  ? 53.129  -3.691  38.952  1.00 21.70 ? 93  TRP C CD1   1 
ATOM   3525 C CD2   . TRP B 1 96  ? 51.079  -2.811  39.127  1.00 21.69 ? 93  TRP C CD2   1 
ATOM   3526 N NE1   . TRP B 1 96  ? 52.736  -3.282  37.702  1.00 21.64 ? 93  TRP C NE1   1 
ATOM   3527 C CE2   . TRP B 1 96  ? 51.486  -2.736  37.785  1.00 21.56 ? 93  TRP C CE2   1 
ATOM   3528 C CE3   . TRP B 1 96  ? 49.827  -2.310  39.482  1.00 22.07 ? 93  TRP C CE3   1 
ATOM   3529 C CZ2   . TRP B 1 96  ? 50.681  -2.189  36.794  1.00 22.98 ? 93  TRP C CZ2   1 
ATOM   3530 C CZ3   . TRP B 1 96  ? 49.023  -1.789  38.501  1.00 22.11 ? 93  TRP C CZ3   1 
ATOM   3531 C CH2   . TRP B 1 96  ? 49.448  -1.724  37.177  1.00 22.74 ? 93  TRP C CH2   1 
ATOM   3532 N N     . ALA B 1 97  ? 50.780  -6.468  39.947  1.00 22.44 ? 94  ALA C N     1 
ATOM   3533 C CA    . ALA B 1 97  ? 51.030  -7.667  39.172  1.00 22.44 ? 94  ALA C CA    1 
ATOM   3534 C C     . ALA B 1 97  ? 51.453  -7.346  37.738  1.00 22.02 ? 94  ALA C C     1 
ATOM   3535 O O     . ALA B 1 97  ? 51.079  -6.322  37.164  1.00 21.48 ? 94  ALA C O     1 
ATOM   3536 C CB    . ALA B 1 97  ? 49.783  -8.554  39.158  1.00 21.95 ? 94  ALA C CB    1 
ATOM   3537 N N     . ALA B 1 98  ? 52.218  -8.261  37.161  1.00 21.40 ? 95  ALA C N     1 
ATOM   3538 C CA    . ALA B 1 98  ? 52.648  -8.152  35.781  1.00 21.91 ? 95  ALA C CA    1 
ATOM   3539 C C     . ALA B 1 98  ? 52.951  -9.541  35.209  1.00 21.98 ? 95  ALA C C     1 
ATOM   3540 O O     . ALA B 1 98  ? 52.767  -10.565 35.891  1.00 22.30 ? 95  ALA C O     1 
ATOM   3541 C CB    . ALA B 1 98  ? 53.854  -7.233  35.672  1.00 21.10 ? 95  ALA C CB    1 
ATOM   3542 N N     . ASN B 1 99  ? 53.390  -9.567  33.958  1.00 22.58 ? 96  ASN C N     1 
ATOM   3543 C CA    . ASN B 1 99  ? 53.707  -10.812 33.262  1.00 22.86 ? 96  ASN C CA    1 
ATOM   3544 C C     . ASN B 1 99  ? 55.030  -11.383 33.728  1.00 22.49 ? 96  ASN C C     1 
ATOM   3545 O O     . ASN B 1 99  ? 56.059  -11.212 33.080  1.00 21.77 ? 96  ASN C O     1 
ATOM   3546 C CB    . ASN B 1 99  ? 53.711  -10.607 31.750  1.00 23.27 ? 96  ASN C CB    1 
ATOM   3547 C CG    . ASN B 1 99  ? 52.337  -10.389 31.201  1.00 25.31 ? 96  ASN C CG    1 
ATOM   3548 O OD1   . ASN B 1 99  ? 51.543  -11.325 31.137  1.00 28.36 ? 96  ASN C OD1   1 
ATOM   3549 N ND2   . ASN B 1 99  ? 52.031  -9.151  30.806  1.00 26.01 ? 96  ASN C ND2   1 
ATOM   3550 N N     . GLY B 1 100 ? 54.977  -12.106 34.839  1.00 22.80 ? 97  GLY C N     1 
ATOM   3551 C CA    . GLY B 1 100 ? 56.179  -12.596 35.496  1.00 22.57 ? 97  GLY C CA    1 
ATOM   3552 C C     . GLY B 1 100 ? 56.962  -11.500 36.194  1.00 22.81 ? 97  GLY C C     1 
ATOM   3553 O O     . GLY B 1 100 ? 56.758  -10.294 35.959  1.00 21.76 ? 97  GLY C O     1 
ATOM   3554 N N     . SER B 1 101 ? 57.880  -11.933 37.055  1.00 23.00 ? 98  SER C N     1 
ATOM   3555 C CA    . SER B 1 101 ? 58.854  -11.053 37.665  1.00 23.49 ? 98  SER C CA    1 
ATOM   3556 C C     . SER B 1 101 ? 59.736  -10.348 36.659  1.00 23.75 ? 98  SER C C     1 
ATOM   3557 O O     . SER B 1 101 ? 60.263  -9.285  36.959  1.00 22.88 ? 98  SER C O     1 
ATOM   3558 C CB    . SER B 1 101 ? 59.752  -11.820 38.639  1.00 23.26 ? 98  SER C CB    1 
ATOM   3559 O OG    . SER B 1 101 ? 59.000  -12.274 39.731  1.00 24.06 ? 98  SER C OG    1 
ATOM   3560 N N     . ASN B 1 102 ? 59.926  -10.931 35.477  1.00 24.34 ? 99  ASN C N     1 
ATOM   3561 C CA    . ASN B 1 102 ? 60.688  -10.224 34.440  1.00 24.80 ? 99  ASN C CA    1 
ATOM   3562 C C     . ASN B 1 102 ? 60.089  -8.850  34.136  1.00 24.58 ? 99  ASN C C     1 
ATOM   3563 O O     . ASN B 1 102 ? 60.813  -7.876  34.005  1.00 24.58 ? 99  ASN C O     1 
ATOM   3564 C CB    . ASN B 1 102 ? 60.764  -11.037 33.146  1.00 25.23 ? 99  ASN C CB    1 
ATOM   3565 C CG    . ASN B 1 102 ? 61.733  -12.199 33.233  1.00 26.64 ? 99  ASN C CG    1 
ATOM   3566 O OD1   . ASN B 1 102 ? 61.554  -13.222 32.550  1.00 28.84 ? 99  ASN C OD1   1 
ATOM   3567 N ND2   . ASN B 1 102 ? 62.768  -12.051 34.055  1.00 25.39 ? 99  ASN C ND2   1 
ATOM   3568 N N     . GLU B 1 103 ? 58.769  -8.778  34.026  1.00 24.85 ? 100 GLU C N     1 
ATOM   3569 C CA    . GLU B 1 103 ? 58.113  -7.517  33.643  1.00 24.63 ? 100 GLU C CA    1 
ATOM   3570 C C     . GLU B 1 103 ? 57.953  -6.586  34.847  1.00 24.31 ? 100 GLU C C     1 
ATOM   3571 O O     . GLU B 1 103 ? 58.107  -5.372  34.711  1.00 24.41 ? 100 GLU C O     1 
ATOM   3572 C CB    . GLU B 1 103 ? 56.776  -7.759  32.911  1.00 24.60 ? 100 GLU C CB    1 
ATOM   3573 C CG    . GLU B 1 103 ? 56.084  -6.447  32.470  1.00 25.08 ? 100 GLU C CG    1 
ATOM   3574 C CD    . GLU B 1 103 ? 54.848  -6.634  31.601  1.00 25.61 ? 100 GLU C CD    1 
ATOM   3575 O OE1   . GLU B 1 103 ? 53.954  -7.451  31.954  1.00 27.25 ? 100 GLU C OE1   1 
ATOM   3576 O OE2   . GLU B 1 103 ? 54.750  -5.909  30.569  1.00 28.78 ? 100 GLU C OE2   1 
ATOM   3577 N N     . ILE B 1 104 ? 57.646  -7.154  36.010  1.00 23.65 ? 101 ILE C N     1 
ATOM   3578 C CA    . ILE B 1 104 ? 57.717  -6.429  37.281  1.00 23.82 ? 101 ILE C CA    1 
ATOM   3579 C C     . ILE B 1 104 ? 59.021  -5.654  37.439  1.00 23.81 ? 101 ILE C C     1 
ATOM   3580 O O     . ILE B 1 104 ? 59.044  -4.458  37.746  1.00 23.50 ? 101 ILE C O     1 
ATOM   3581 C CB    . ILE B 1 104 ? 57.588  -7.406  38.495  1.00 23.49 ? 101 ILE C CB    1 
ATOM   3582 C CG1   . ILE B 1 104 ? 56.129  -7.845  38.672  1.00 21.58 ? 101 ILE C CG1   1 
ATOM   3583 C CG2   . ILE B 1 104 ? 58.109  -6.751  39.815  1.00 22.91 ? 101 ILE C CG2   1 
ATOM   3584 C CD1   . ILE B 1 104 ? 55.136  -6.682  38.901  1.00 21.35 ? 101 ILE C CD1   1 
ATOM   3585 N N     . LEU B 1 105 ? 60.112  -6.371  37.268  1.00 24.36 ? 102 LEU C N     1 
ATOM   3586 C CA    . LEU B 1 105 ? 61.431  -5.802  37.455  1.00 24.67 ? 102 LEU C CA    1 
ATOM   3587 C C     . LEU B 1 105 ? 61.764  -4.814  36.343  1.00 24.63 ? 102 LEU C C     1 
ATOM   3588 O O     . LEU B 1 105 ? 62.374  -3.773  36.607  1.00 24.90 ? 102 LEU C O     1 
ATOM   3589 C CB    . LEU B 1 105 ? 62.463  -6.918  37.545  1.00 25.13 ? 102 LEU C CB    1 
ATOM   3590 C CG    . LEU B 1 105 ? 62.286  -7.790  38.802  1.00 26.19 ? 102 LEU C CG    1 
ATOM   3591 C CD1   . LEU B 1 105 ? 63.280  -8.956  38.801  1.00 28.14 ? 102 LEU C CD1   1 
ATOM   3592 C CD2   . LEU B 1 105 ? 62.415  -6.956  40.079  1.00 28.09 ? 102 LEU C CD2   1 
ATOM   3593 N N     . GLN B 1 106 ? 61.338  -5.130  35.123  1.00 24.32 ? 103 GLN C N     1 
ATOM   3594 C CA    . GLN B 1 106 ? 61.525  -4.245  33.987  1.00 24.48 ? 103 GLN C CA    1 
ATOM   3595 C C     . GLN B 1 106 ? 60.907  -2.888  34.295  1.00 24.35 ? 103 GLN C C     1 
ATOM   3596 O O     . GLN B 1 106 ? 61.558  -1.863  34.129  1.00 24.15 ? 103 GLN C O     1 
ATOM   3597 C CB    . GLN B 1 106 ? 60.904  -4.820  32.700  1.00 24.04 ? 103 GLN C CB    1 
ATOM   3598 C CG    . GLN B 1 106 ? 61.127  -3.914  31.481  1.00 24.72 ? 103 GLN C CG    1 
ATOM   3599 C CD    . GLN B 1 106 ? 60.490  -4.413  30.193  1.00 24.92 ? 103 GLN C CD    1 
ATOM   3600 O OE1   . GLN B 1 106 ? 59.272  -4.424  30.045  1.00 27.74 ? 103 GLN C OE1   1 
ATOM   3601 N NE2   . GLN B 1 106 ? 61.317  -4.784  29.242  1.00 25.51 ? 103 GLN C NE2   1 
ATOM   3602 N N     . GLN B 1 107 ? 59.643  -2.907  34.734  1.00 23.99 ? 104 GLN C N     1 
ATOM   3603 C CA    . GLN B 1 107 ? 58.904  -1.705  35.109  1.00 23.68 ? 104 GLN C CA    1 
ATOM   3604 C C     . GLN B 1 107 ? 59.558  -0.915  36.253  1.00 23.89 ? 104 GLN C C     1 
ATOM   3605 O O     . GLN B 1 107 ? 59.578  0.310   36.233  1.00 23.69 ? 104 GLN C O     1 
ATOM   3606 C CB    . GLN B 1 107 ? 57.465  -2.083  35.493  1.00 23.54 ? 104 GLN C CB    1 
ATOM   3607 C CG    . GLN B 1 107 ? 56.581  -2.547  34.334  1.00 22.45 ? 104 GLN C CG    1 
ATOM   3608 C CD    . GLN B 1 107 ? 55.258  -3.149  34.802  1.00 22.32 ? 104 GLN C CD    1 
ATOM   3609 O OE1   . GLN B 1 107 ? 55.024  -3.268  35.991  1.00 23.10 ? 104 GLN C OE1   1 
ATOM   3610 N NE2   . GLN B 1 107 ? 54.398  -3.530  33.867  1.00 20.81 ? 104 GLN C NE2   1 
ATOM   3611 N N     . LEU B 1 108 ? 60.081  -1.606  37.258  1.00 24.21 ? 105 LEU C N     1 
ATOM   3612 C CA    . LEU B 1 108 ? 60.750  -0.918  38.360  1.00 24.41 ? 105 LEU C CA    1 
ATOM   3613 C C     . LEU B 1 108 ? 62.032  -0.243  37.878  1.00 25.04 ? 105 LEU C C     1 
ATOM   3614 O O     . LEU B 1 108 ? 62.322  0.897   38.255  1.00 24.45 ? 105 LEU C O     1 
ATOM   3615 C CB    . LEU B 1 108 ? 61.041  -1.885  39.502  1.00 24.19 ? 105 LEU C CB    1 
ATOM   3616 C CG    . LEU B 1 108 ? 59.807  -2.298  40.309  1.00 23.99 ? 105 LEU C CG    1 
ATOM   3617 C CD1   . LEU B 1 108 ? 60.094  -3.565  41.116  1.00 22.41 ? 105 LEU C CD1   1 
ATOM   3618 C CD2   . LEU B 1 108 ? 59.361  -1.165  41.212  1.00 20.88 ? 105 LEU C CD2   1 
ATOM   3619 N N     . LEU B 1 109 ? 62.775  -0.943  37.023  1.00 25.28 ? 106 LEU C N     1 
ATOM   3620 C CA    . LEU B 1 109 ? 63.957  -0.373  36.382  1.00 26.10 ? 106 LEU C CA    1 
ATOM   3621 C C     . LEU B 1 109 ? 63.623  0.837   35.511  1.00 26.89 ? 106 LEU C C     1 
ATOM   3622 O O     . LEU B 1 109 ? 64.364  1.811   35.516  1.00 27.35 ? 106 LEU C O     1 
ATOM   3623 C CB    . LEU B 1 109 ? 64.726  -1.449  35.576  1.00 25.83 ? 106 LEU C CB    1 
ATOM   3624 C CG    . LEU B 1 109 ? 65.538  -2.435  36.439  1.00 26.26 ? 106 LEU C CG    1 
ATOM   3625 C CD1   . LEU B 1 109 ? 65.709  -3.828  35.749  1.00 27.42 ? 106 LEU C CD1   1 
ATOM   3626 C CD2   . LEU B 1 109 ? 66.874  -1.872  36.840  1.00 23.91 ? 106 LEU C CD2   1 
ATOM   3627 N N     . GLN B 1 110 ? 62.507  0.802   34.778  1.00 27.78 ? 107 GLN C N     1 
ATOM   3628 C CA    . GLN B 1 110 ? 62.108  1.964   33.976  1.00 27.78 ? 107 GLN C CA    1 
ATOM   3629 C C     . GLN B 1 110 ? 61.862  3.189   34.844  1.00 28.42 ? 107 GLN C C     1 
ATOM   3630 O O     . GLN B 1 110 ? 62.257  4.299   34.489  1.00 28.55 ? 107 GLN C O     1 
ATOM   3631 C CB    . GLN B 1 110 ? 60.834  1.688   33.190  1.00 28.09 ? 107 GLN C CB    1 
ATOM   3632 C CG    . GLN B 1 110 ? 60.989  0.746   32.041  1.00 28.55 ? 107 GLN C CG    1 
ATOM   3633 C CD    . GLN B 1 110 ? 59.669  0.443   31.379  1.00 29.01 ? 107 GLN C CD    1 
ATOM   3634 O OE1   . GLN B 1 110 ? 58.909  -0.418  31.822  1.00 30.27 ? 107 GLN C OE1   1 
ATOM   3635 N NE2   . GLN B 1 110 ? 59.384  1.157   30.306  1.00 33.62 ? 107 GLN C NE2   1 
ATOM   3636 N N     . ALA B 1 111 ? 61.199  2.971   35.977  1.00 28.41 ? 108 ALA C N     1 
ATOM   3637 C CA    . ALA B 1 111 ? 60.775  4.037   36.861  1.00 28.17 ? 108 ALA C CA    1 
ATOM   3638 C C     . ALA B 1 111 ? 61.901  4.521   37.784  1.00 27.97 ? 108 ALA C C     1 
ATOM   3639 O O     . ALA B 1 111 ? 61.983  5.713   38.096  1.00 26.86 ? 108 ALA C O     1 
ATOM   3640 C CB    . ALA B 1 111 ? 59.561  3.574   37.688  1.00 27.61 ? 108 ALA C CB    1 
ATOM   3641 N N     . PHE B 1 112 ? 62.765  3.611   38.223  1.00 28.15 ? 109 PHE C N     1 
ATOM   3642 C CA    . PHE B 1 112 ? 63.771  3.974   39.222  1.00 28.63 ? 109 PHE C CA    1 
ATOM   3643 C C     . PHE B 1 112 ? 65.232  3.757   38.798  1.00 28.85 ? 109 PHE C C     1 
ATOM   3644 O O     . PHE B 1 112 ? 66.145  4.147   39.529  1.00 28.62 ? 109 PHE C O     1 
ATOM   3645 C CB    . PHE B 1 112 ? 63.470  3.275   40.553  1.00 28.16 ? 109 PHE C CB    1 
ATOM   3646 C CG    . PHE B 1 112 ? 62.129  3.629   41.120  1.00 27.52 ? 109 PHE C CG    1 
ATOM   3647 C CD1   . PHE B 1 112 ? 61.938  4.835   41.768  1.00 28.30 ? 109 PHE C CD1   1 
ATOM   3648 C CD2   . PHE B 1 112 ? 61.051  2.782   40.969  1.00 26.47 ? 109 PHE C CD2   1 
ATOM   3649 C CE1   . PHE B 1 112 ? 60.690  5.184   42.274  1.00 28.04 ? 109 PHE C CE1   1 
ATOM   3650 C CE2   . PHE B 1 112 ? 59.801  3.117   41.473  1.00 26.76 ? 109 PHE C CE2   1 
ATOM   3651 C CZ    . PHE B 1 112 ? 59.617  4.312   42.124  1.00 27.73 ? 109 PHE C CZ    1 
ATOM   3652 N N     . GLY B 1 113 ? 65.446  3.152   37.636  1.00 29.30 ? 110 GLY C N     1 
ATOM   3653 C CA    . GLY B 1 113 ? 66.789  2.989   37.074  1.00 30.00 ? 110 GLY C CA    1 
ATOM   3654 C C     . GLY B 1 113 ? 66.890  3.791   35.794  1.00 30.50 ? 110 GLY C C     1 
ATOM   3655 O O     . GLY B 1 113 ? 66.492  4.948   35.752  1.00 30.83 ? 110 GLY C O     1 
ATOM   3656 N N     . GLY B 1 114 ? 67.409  3.176   34.744  1.00 30.95 ? 111 GLY C N     1 
ATOM   3657 C CA    . GLY B 1 114 ? 67.459  3.800   33.436  1.00 31.24 ? 111 GLY C CA    1 
ATOM   3658 C C     . GLY B 1 114 ? 68.737  4.579   33.220  1.00 31.31 ? 111 GLY C C     1 
ATOM   3659 O O     . GLY B 1 114 ? 69.633  4.502   34.031  1.00 31.13 ? 111 GLY C O     1 
ATOM   3660 N N     . PRO B 1 115 ? 68.828  5.317   32.099  1.00 31.81 ? 112 PRO C N     1 
ATOM   3661 C CA    . PRO B 1 115 ? 70.008  6.080   31.696  1.00 32.33 ? 112 PRO C CA    1 
ATOM   3662 C C     . PRO B 1 115 ? 70.538  7.014   32.777  1.00 32.87 ? 112 PRO C C     1 
ATOM   3663 O O     . PRO B 1 115 ? 69.764  7.764   33.375  1.00 32.53 ? 112 PRO C O     1 
ATOM   3664 C CB    . PRO B 1 115 ? 69.502  6.877   30.493  1.00 32.41 ? 112 PRO C CB    1 
ATOM   3665 C CG    . PRO B 1 115 ? 68.472  5.997   29.907  1.00 32.10 ? 112 PRO C CG    1 
ATOM   3666 C CD    . PRO B 1 115 ? 67.762  5.422   31.090  1.00 31.70 ? 112 PRO C CD    1 
ATOM   3667 N N     . GLY B 1 116 ? 71.844  6.937   33.031  1.00 33.26 ? 113 GLY C N     1 
ATOM   3668 C CA    . GLY B 1 116 ? 72.493  7.712   34.089  1.00 33.61 ? 113 GLY C CA    1 
ATOM   3669 C C     . GLY B 1 116 ? 72.476  7.067   35.466  1.00 33.85 ? 113 GLY C C     1 
ATOM   3670 O O     . GLY B 1 116 ? 73.178  7.524   36.370  1.00 34.44 ? 113 GLY C O     1 
ATOM   3671 N N     . ARG B 1 117 ? 71.695  6.006   35.643  1.00 33.76 ? 114 ARG C N     1 
ATOM   3672 C CA    . ARG B 1 117 ? 71.576  5.351   36.950  1.00 33.70 ? 114 ARG C CA    1 
ATOM   3673 C C     . ARG B 1 117 ? 72.185  3.971   36.952  1.00 33.65 ? 114 ARG C C     1 
ATOM   3674 O O     . ARG B 1 117 ? 72.492  3.429   35.894  1.00 33.79 ? 114 ARG C O     1 
ATOM   3675 C CB    . ARG B 1 117 ? 70.119  5.253   37.347  1.00 33.40 ? 114 ARG C CB    1 
ATOM   3676 C CG    . ARG B 1 117 ? 69.508  6.594   37.524  1.00 33.88 ? 114 ARG C CG    1 
ATOM   3677 C CD    . ARG B 1 117 ? 68.217  6.514   38.272  1.00 34.08 ? 114 ARG C CD    1 
ATOM   3678 N NE    . ARG B 1 117 ? 67.676  7.841   38.483  1.00 34.20 ? 114 ARG C NE    1 
ATOM   3679 C CZ    . ARG B 1 117 ? 66.542  8.097   39.117  1.00 34.32 ? 114 ARG C CZ    1 
ATOM   3680 N NH1   . ARG B 1 117 ? 65.818  7.106   39.607  1.00 33.39 ? 114 ARG C NH1   1 
ATOM   3681 N NH2   . ARG B 1 117 ? 66.138  9.352   39.260  1.00 34.36 ? 114 ARG C NH2   1 
ATOM   3682 N N     . THR B 1 118 ? 72.345  3.412   38.151  1.00 33.50 ? 115 THR C N     1 
ATOM   3683 C CA    . THR B 1 118 ? 72.949  2.094   38.335  1.00 33.41 ? 115 THR C CA    1 
ATOM   3684 C C     . THR B 1 118 ? 72.106  1.146   39.225  1.00 33.14 ? 115 THR C C     1 
ATOM   3685 O O     . THR B 1 118 ? 71.319  1.580   40.068  1.00 32.57 ? 115 THR C O     1 
ATOM   3686 C CB    . THR B 1 118 ? 74.361  2.229   38.946  1.00 33.74 ? 115 THR C CB    1 
ATOM   3687 O OG1   . THR B 1 118 ? 74.257  2.715   40.292  1.00 33.58 ? 115 THR C OG1   1 
ATOM   3688 C CG2   . THR B 1 118 ? 75.236  3.184   38.110  1.00 32.81 ? 115 THR C CG2   1 
ATOM   3689 N N     . ALA B 1 119 ? 72.275  -0.152  38.996  1.00 33.08 ? 116 ALA C N     1 
ATOM   3690 C CA    . ALA B 1 119 ? 71.747  -1.191  39.864  1.00 32.72 ? 116 ALA C CA    1 
ATOM   3691 C C     . ALA B 1 119 ? 72.914  -2.057  40.350  1.00 32.63 ? 116 ALA C C     1 
ATOM   3692 O O     . ALA B 1 119 ? 73.814  -2.381  39.575  1.00 32.58 ? 116 ALA C O     1 
ATOM   3693 C CB    . ALA B 1 119 ? 70.717  -2.029  39.133  1.00 32.57 ? 116 ALA C CB    1 
ATOM   3694 N N     . LEU B 1 120 ? 72.903  -2.405  41.637  1.00 32.52 ? 117 LEU C N     1 
ATOM   3695 C CA    . LEU B 1 120 ? 73.943  -3.225  42.255  1.00 32.24 ? 117 LEU C CA    1 
ATOM   3696 C C     . LEU B 1 120 ? 73.377  -4.588  42.683  1.00 31.97 ? 117 LEU C C     1 
ATOM   3697 O O     . LEU B 1 120 ? 72.318  -4.667  43.318  1.00 31.05 ? 117 LEU C O     1 
ATOM   3698 C CB    . LEU B 1 120 ? 74.537  -2.499  43.463  1.00 32.17 ? 117 LEU C CB    1 
ATOM   3699 C CG    . LEU B 1 120 ? 75.819  -3.071  44.091  1.00 32.77 ? 117 LEU C CG    1 
ATOM   3700 C CD1   . LEU B 1 120 ? 76.691  -1.954  44.706  1.00 33.32 ? 117 LEU C CD1   1 
ATOM   3701 C CD2   . LEU B 1 120 ? 75.516  -4.131  45.136  1.00 32.94 ? 117 LEU C CD2   1 
ATOM   3702 N N     . GLY B 1 121 ? 74.094  -5.652  42.324  1.00 31.92 ? 118 GLY C N     1 
ATOM   3703 C CA    . GLY B 1 121 ? 73.747  -7.012  42.722  1.00 31.97 ? 118 GLY C CA    1 
ATOM   3704 C C     . GLY B 1 121 ? 74.949  -7.755  43.281  1.00 32.48 ? 118 GLY C C     1 
ATOM   3705 O O     . GLY B 1 121 ? 76.116  -7.405  42.991  1.00 32.35 ? 118 GLY C O     1 
ATOM   3706 N N     . PHE B 1 122 ? 74.666  -8.801  44.060  1.00 32.00 ? 119 PHE C N     1 
ATOM   3707 C CA    . PHE B 1 122 ? 75.707  -9.610  44.673  1.00 31.75 ? 119 PHE C CA    1 
ATOM   3708 C C     . PHE B 1 122 ? 75.834  -10.951 43.959  1.00 31.48 ? 119 PHE C C     1 
ATOM   3709 O O     . PHE B 1 122 ? 75.019  -11.849 44.139  1.00 30.46 ? 119 PHE C O     1 
ATOM   3710 C CB    . PHE B 1 122 ? 75.432  -9.764  46.159  1.00 31.75 ? 119 PHE C CB    1 
ATOM   3711 C CG    . PHE B 1 122 ? 75.121  -8.467  46.829  1.00 31.96 ? 119 PHE C CG    1 
ATOM   3712 C CD1   . PHE B 1 122 ? 76.142  -7.604  47.198  1.00 32.22 ? 119 PHE C CD1   1 
ATOM   3713 C CD2   . PHE B 1 122 ? 73.811  -8.076  47.045  1.00 31.47 ? 119 PHE C CD2   1 
ATOM   3714 C CE1   . PHE B 1 122 ? 75.858  -6.391  47.802  1.00 31.70 ? 119 PHE C CE1   1 
ATOM   3715 C CE2   . PHE B 1 122 ? 73.522  -6.865  47.638  1.00 31.11 ? 119 PHE C CE2   1 
ATOM   3716 C CZ    . PHE B 1 122 ? 74.542  -6.023  48.023  1.00 31.69 ? 119 PHE C CZ    1 
ATOM   3717 N N     . GLN B 1 123 ? 76.879  -11.061 43.143  1.00 31.49 ? 120 GLN C N     1 
ATOM   3718 C CA    . GLN B 1 123 ? 77.070  -12.198 42.260  1.00 31.59 ? 120 GLN C CA    1 
ATOM   3719 C C     . GLN B 1 123 ? 77.826  -13.304 42.963  1.00 31.05 ? 120 GLN C C     1 
ATOM   3720 O O     . GLN B 1 123 ? 78.665  -13.027 43.812  1.00 31.27 ? 120 GLN C O     1 
ATOM   3721 C CB    . GLN B 1 123 ? 77.830  -11.777 41.007  1.00 32.03 ? 120 GLN C CB    1 
ATOM   3722 C CG    . GLN B 1 123 ? 77.098  -10.741 40.147  1.00 33.22 ? 120 GLN C CG    1 
ATOM   3723 C CD    . GLN B 1 123 ? 75.874  -11.312 39.433  1.00 35.63 ? 120 GLN C CD    1 
ATOM   3724 O OE1   . GLN B 1 123 ? 74.907  -11.740 40.077  1.00 38.90 ? 120 GLN C OE1   1 
ATOM   3725 N NE2   . GLN B 1 123 ? 75.898  -11.297 38.103  1.00 33.98 ? 120 GLN C NE2   1 
ATOM   3726 N N     . PRO B 1 124 ? 77.521  -14.574 42.628  1.00 30.22 ? 121 PRO C N     1 
ATOM   3727 C CA    . PRO B 1 124 ? 76.523  -15.003 41.648  1.00 29.72 ? 121 PRO C CA    1 
ATOM   3728 C C     . PRO B 1 124 ? 75.084  -14.926 42.178  1.00 29.22 ? 121 PRO C C     1 
ATOM   3729 O O     . PRO B 1 124 ? 74.810  -15.369 43.285  1.00 29.21 ? 121 PRO C O     1 
ATOM   3730 C CB    . PRO B 1 124 ? 76.901  -16.459 41.390  1.00 30.00 ? 121 PRO C CB    1 
ATOM   3731 C CG    . PRO B 1 124 ? 77.532  -16.923 42.658  1.00 29.70 ? 121 PRO C CG    1 
ATOM   3732 C CD    . PRO B 1 124 ? 78.203  -15.719 43.262  1.00 30.28 ? 121 PRO C CD    1 
ATOM   3733 N N     . SER B 1 125 ? 74.192  -14.342 41.391  1.00 28.64 ? 122 SER C N     1 
ATOM   3734 C CA    . SER B 1 125 ? 72.770  -14.339 41.709  1.00 28.38 ? 122 SER C CA    1 
ATOM   3735 C C     . SER B 1 125 ? 72.002  -14.537 40.405  1.00 28.08 ? 122 SER C C     1 
ATOM   3736 O O     . SER B 1 125 ? 72.537  -15.127 39.472  1.00 27.50 ? 122 SER C O     1 
ATOM   3737 C CB    . SER B 1 125 ? 72.346  -13.059 42.444  1.00 28.01 ? 122 SER C CB    1 
ATOM   3738 O OG    . SER B 1 125 ? 71.038  -13.179 43.010  1.00 27.11 ? 122 SER C OG    1 
ATOM   3739 N N     . TYR B 1 126 ? 70.759  -14.060 40.357  1.00 27.39 ? 123 TYR C N     1 
ATOM   3740 C CA    . TYR B 1 126 ? 69.848  -14.320 39.234  1.00 27.44 ? 123 TYR C CA    1 
ATOM   3741 C C     . TYR B 1 126 ? 70.342  -13.807 37.874  1.00 27.67 ? 123 TYR C C     1 
ATOM   3742 O O     . TYR B 1 126 ? 70.700  -12.628 37.724  1.00 27.75 ? 123 TYR C O     1 
ATOM   3743 C CB    . TYR B 1 126 ? 68.482  -13.712 39.541  1.00 26.68 ? 123 TYR C CB    1 
ATOM   3744 C CG    . TYR B 1 126 ? 67.340  -14.139 38.648  1.00 26.71 ? 123 TYR C CG    1 
ATOM   3745 C CD1   . TYR B 1 126 ? 66.262  -13.293 38.454  1.00 26.63 ? 123 TYR C CD1   1 
ATOM   3746 C CD2   . TYR B 1 126 ? 67.318  -15.382 38.015  1.00 26.39 ? 123 TYR C CD2   1 
ATOM   3747 C CE1   . TYR B 1 126 ? 65.203  -13.651 37.675  1.00 25.60 ? 123 TYR C CE1   1 
ATOM   3748 C CE2   . TYR B 1 126 ? 66.253  -15.749 37.217  1.00 25.37 ? 123 TYR C CE2   1 
ATOM   3749 C CZ    . TYR B 1 126 ? 65.195  -14.880 37.060  1.00 25.55 ? 123 TYR C CZ    1 
ATOM   3750 O OH    . TYR B 1 126 ? 64.125  -15.212 36.272  1.00 27.32 ? 123 TYR C OH    1 
ATOM   3751 N N     . SER B 1 127 ? 70.321  -14.699 36.883  1.00 27.71 ? 124 SER C N     1 
ATOM   3752 C CA    . SER B 1 127 ? 70.770  -14.389 35.519  1.00 27.77 ? 124 SER C CA    1 
ATOM   3753 C C     . SER B 1 127 ? 70.052  -13.177 34.935  1.00 27.55 ? 124 SER C C     1 
ATOM   3754 O O     . SER B 1 127 ? 70.652  -12.367 34.228  1.00 27.10 ? 124 SER C O     1 
ATOM   3755 C CB    . SER B 1 127 ? 70.547  -15.599 34.600  1.00 27.79 ? 124 SER C CB    1 
ATOM   3756 O OG    . SER B 1 127 ? 69.185  -16.010 34.637  1.00 28.06 ? 124 SER C OG    1 
ATOM   3757 N N     . MET B 1 128 ? 68.771  -13.038 35.262  1.00 27.41 ? 125 MET C N     1 
ATOM   3758 C CA    . MET B 1 128 ? 67.959  -11.986 34.664  1.00 27.39 ? 125 MET C CA    1 
ATOM   3759 C C     . MET B 1 128 ? 68.228  -10.584 35.168  1.00 26.83 ? 125 MET C C     1 
ATOM   3760 O O     . MET B 1 128 ? 67.965  -9.643  34.451  1.00 27.21 ? 125 MET C O     1 
ATOM   3761 C CB    . MET B 1 128 ? 66.466  -12.302 34.806  1.00 27.51 ? 125 MET C CB    1 
ATOM   3762 C CG    . MET B 1 128 ? 65.977  -13.393 33.856  1.00 29.56 ? 125 MET C CG    1 
ATOM   3763 S SD    . MET B 1 128 ? 66.511  -13.199 32.135  1.00 30.80 ? 125 MET C SD    1 
ATOM   3764 C CE    . MET B 1 128 ? 65.865  -11.573 31.723  1.00 32.73 ? 125 MET C CE    1 
ATOM   3765 N N     . HIS B 1 129 ? 68.726  -10.421 36.381  1.00 26.68 ? 126 HIS C N     1 
ATOM   3766 C CA    . HIS B 1 129 ? 68.905  -9.085  36.923  1.00 26.69 ? 126 HIS C CA    1 
ATOM   3767 C C     . HIS B 1 129 ? 69.826  -8.195  36.056  1.00 27.14 ? 126 HIS C C     1 
ATOM   3768 O O     . HIS B 1 129 ? 69.409  -7.117  35.662  1.00 27.13 ? 126 HIS C O     1 
ATOM   3769 C CB    . HIS B 1 129 ? 69.378  -9.127  38.375  1.00 26.71 ? 126 HIS C CB    1 
ATOM   3770 C CG    . HIS B 1 129 ? 68.333  -9.596  39.339  1.00 26.76 ? 126 HIS C CG    1 
ATOM   3771 N ND1   . HIS B 1 129 ? 68.608  -9.847  40.668  1.00 25.53 ? 126 HIS C ND1   1 
ATOM   3772 C CD2   . HIS B 1 129 ? 67.019  -9.886  39.161  1.00 27.57 ? 126 HIS C CD2   1 
ATOM   3773 C CE1   . HIS B 1 129 ? 67.499  -10.255 41.270  1.00 28.23 ? 126 HIS C CE1   1 
ATOM   3774 N NE2   . HIS B 1 129 ? 66.521  -10.289 40.378  1.00 26.79 ? 126 HIS C NE2   1 
ATOM   3775 N N     . PRO B 1 130 ? 71.071  -8.637  35.753  1.00 27.30 ? 127 PRO C N     1 
ATOM   3776 C CA    . PRO B 1 130 ? 71.894  -7.814  34.852  1.00 27.36 ? 127 PRO C CA    1 
ATOM   3777 C C     . PRO B 1 130 ? 71.319  -7.709  33.436  1.00 27.67 ? 127 PRO C C     1 
ATOM   3778 O O     . PRO B 1 130 ? 71.459  -6.667  32.793  1.00 27.96 ? 127 PRO C O     1 
ATOM   3779 C CB    . PRO B 1 130 ? 73.265  -8.513  34.864  1.00 27.53 ? 127 PRO C CB    1 
ATOM   3780 C CG    . PRO B 1 130 ? 73.014  -9.884  35.351  1.00 27.75 ? 127 PRO C CG    1 
ATOM   3781 C CD    . PRO B 1 130 ? 71.779  -9.844  36.207  1.00 27.25 ? 127 PRO C CD    1 
ATOM   3782 N N     . ILE B 1 131 ? 70.642  -8.759  32.966  1.00 27.66 ? 128 ILE C N     1 
ATOM   3783 C CA    . ILE B 1 131 ? 69.989  -8.719  31.647  1.00 27.73 ? 128 ILE C CA    1 
ATOM   3784 C C     . ILE B 1 131 ? 68.889  -7.656  31.564  1.00 27.93 ? 128 ILE C C     1 
ATOM   3785 O O     . ILE B 1 131 ? 68.781  -6.929  30.570  1.00 27.20 ? 128 ILE C O     1 
ATOM   3786 C CB    . ILE B 1 131 ? 69.393  -10.082 31.256  1.00 27.38 ? 128 ILE C CB    1 
ATOM   3787 C CG1   . ILE B 1 131 ? 70.512  -11.115 31.082  1.00 28.04 ? 128 ILE C CG1   1 
ATOM   3788 C CG2   . ILE B 1 131 ? 68.596  -9.972  29.965  1.00 27.47 ? 128 ILE C CG2   1 
ATOM   3789 C CD1   . ILE B 1 131 ? 70.018  -12.479 30.680  1.00 28.09 ? 128 ILE C CD1   1 
ATOM   3790 N N     . LEU B 1 132 ? 68.063  -7.578  32.599  1.00 27.99 ? 129 LEU C N     1 
ATOM   3791 C CA    . LEU B 1 132 ? 66.993  -6.604  32.625  1.00 28.42 ? 129 LEU C CA    1 
ATOM   3792 C C     . LEU B 1 132 ? 67.557  -5.206  32.821  1.00 28.49 ? 129 LEU C C     1 
ATOM   3793 O O     . LEU B 1 132 ? 67.031  -4.256  32.259  1.00 27.89 ? 129 LEU C O     1 
ATOM   3794 C CB    . LEU B 1 132 ? 65.988  -6.923  33.739  1.00 28.51 ? 129 LEU C CB    1 
ATOM   3795 C CG    . LEU B 1 132 ? 65.158  -8.167  33.475  1.00 28.98 ? 129 LEU C CG    1 
ATOM   3796 C CD1   . LEU B 1 132 ? 64.500  -8.684  34.761  1.00 31.77 ? 129 LEU C CD1   1 
ATOM   3797 C CD2   . LEU B 1 132 ? 64.115  -7.872  32.410  1.00 30.78 ? 129 LEU C CD2   1 
ATOM   3798 N N     . ALA B 1 133 ? 68.612  -5.094  33.629  1.00 28.61 ? 130 ALA C N     1 
ATOM   3799 C CA    . ALA B 1 133 ? 69.271  -3.810  33.872  1.00 29.58 ? 130 ALA C CA    1 
ATOM   3800 C C     . ALA B 1 133 ? 69.818  -3.231  32.579  1.00 29.92 ? 130 ALA C C     1 
ATOM   3801 O O     . ALA B 1 133 ? 69.499  -2.106  32.204  1.00 28.92 ? 130 ALA C O     1 
ATOM   3802 C CB    . ALA B 1 133 ? 70.377  -3.948  34.927  1.00 29.13 ? 130 ALA C CB    1 
ATOM   3803 N N     . LYS B 1 134 ? 70.615  -4.024  31.883  1.00 31.14 ? 131 LYS C N     1 
ATOM   3804 C CA    . LYS B 1 134 ? 71.118  -3.643  30.571  1.00 31.78 ? 131 LYS C CA    1 
ATOM   3805 C C     . LYS B 1 134 ? 69.976  -3.326  29.582  1.00 31.94 ? 131 LYS C C     1 
ATOM   3806 O O     . LYS B 1 134 ? 70.063  -2.381  28.780  1.00 31.70 ? 131 LYS C O     1 
ATOM   3807 C CB    . LYS B 1 134 ? 71.982  -4.778  30.020  1.00 32.30 ? 131 LYS C CB    1 
ATOM   3808 C CG    . LYS B 1 134 ? 72.882  -4.382  28.879  1.00 32.83 ? 131 LYS C CG    1 
ATOM   3809 C CD    . LYS B 1 134 ? 73.667  -5.610  28.394  1.00 34.27 ? 131 LYS C CD    1 
ATOM   3810 C CE    . LYS B 1 134 ? 74.575  -5.276  27.204  1.00 35.78 ? 131 LYS C CE    1 
ATOM   3811 N NZ    . LYS B 1 134 ? 74.802  -6.513  26.355  1.00 37.26 ? 131 LYS C NZ    1 
ATOM   3812 N N     . GLY B 1 135 ? 68.903  -4.113  29.645  1.00 31.89 ? 132 GLY C N     1 
ATOM   3813 C CA    . GLY B 1 135 ? 67.751  -3.909  28.766  1.00 31.71 ? 132 GLY C CA    1 
ATOM   3814 C C     . GLY B 1 135 ? 66.961  -2.632  29.033  1.00 31.91 ? 132 GLY C C     1 
ATOM   3815 O O     . GLY B 1 135 ? 66.173  -2.201  28.191  1.00 31.97 ? 132 GLY C O     1 
ATOM   3816 N N     . THR B 1 136 ? 67.156  -2.038  30.208  1.00 31.56 ? 133 THR C N     1 
ATOM   3817 C CA    . THR B 1 136 ? 66.483  -0.796  30.577  1.00 31.32 ? 133 THR C CA    1 
ATOM   3818 C C     . THR B 1 136 ? 67.475  0.368   30.581  1.00 31.56 ? 133 THR C C     1 
ATOM   3819 O O     . THR B 1 136 ? 67.133  1.460   31.022  1.00 31.76 ? 133 THR C O     1 
ATOM   3820 C CB    . THR B 1 136 ? 65.808  -0.927  31.970  1.00 31.04 ? 133 THR C CB    1 
ATOM   3821 O OG1   . THR B 1 136 ? 66.731  -1.490  32.908  1.00 28.63 ? 133 THR C OG1   1 
ATOM   3822 C CG2   . THR B 1 136 ? 64.561  -1.812  31.896  1.00 29.73 ? 133 THR C CG2   1 
ATOM   3823 N N     . HIS B 1 137 ? 68.688  0.122   30.066  1.00 31.85 ? 134 HIS C N     1 
ATOM   3824 C CA    . HIS B 1 137 ? 69.792  1.101   30.020  1.00 32.32 ? 134 HIS C CA    1 
ATOM   3825 C C     . HIS B 1 137 ? 70.290  1.529   31.399  1.00 32.40 ? 134 HIS C C     1 
ATOM   3826 O O     . HIS B 1 137 ? 70.714  2.670   31.607  1.00 32.67 ? 134 HIS C O     1 
ATOM   3827 C CB    . HIS B 1 137 ? 69.441  2.314   29.148  1.00 32.30 ? 134 HIS C CB    1 
ATOM   3828 C CG    . HIS B 1 137 ? 69.184  1.958   27.723  1.00 32.51 ? 134 HIS C CG    1 
ATOM   3829 N ND1   . HIS B 1 137 ? 70.200  1.727   26.818  1.00 33.35 ? 134 HIS C ND1   1 
ATOM   3830 C CD2   . HIS B 1 137 ? 68.025  1.756   27.054  1.00 33.61 ? 134 HIS C CD2   1 
ATOM   3831 C CE1   . HIS B 1 137 ? 69.672  1.406   25.649  1.00 34.41 ? 134 HIS C CE1   1 
ATOM   3832 N NE2   . HIS B 1 137 ? 68.354  1.419   25.764  1.00 34.73 ? 134 HIS C NE2   1 
ATOM   3833 N N     . THR B 1 138 ? 70.255  0.575   32.316  1.00 32.50 ? 135 THR C N     1 
ATOM   3834 C CA    . THR B 1 138 ? 70.669  0.762   33.687  1.00 32.99 ? 135 THR C CA    1 
ATOM   3835 C C     . THR B 1 138 ? 72.001  0.048   33.810  1.00 33.74 ? 135 THR C C     1 
ATOM   3836 O O     . THR B 1 138 ? 72.108  -1.136  33.462  1.00 34.12 ? 135 THR C O     1 
ATOM   3837 C CB    . THR B 1 138 ? 69.642  0.129   34.652  1.00 32.71 ? 135 THR C CB    1 
ATOM   3838 O OG1   . THR B 1 138 ? 68.319  0.514   34.263  1.00 30.05 ? 135 THR C OG1   1 
ATOM   3839 C CG2   . THR B 1 138 ? 69.892  0.545   36.088  1.00 32.32 ? 135 THR C CG2   1 
ATOM   3840 N N     . GLU B 1 139 ? 73.015  0.766   34.276  1.00 34.33 ? 136 GLU C N     1 
ATOM   3841 C CA    . GLU B 1 139 ? 74.329  0.177   34.497  1.00 34.74 ? 136 GLU C CA    1 
ATOM   3842 C C     . GLU B 1 139 ? 74.259  -0.807  35.660  1.00 34.36 ? 136 GLU C C     1 
ATOM   3843 O O     . GLU B 1 139 ? 73.633  -0.525  36.666  1.00 34.45 ? 136 GLU C O     1 
ATOM   3844 C CB    . GLU B 1 139 ? 75.351  1.270   34.800  1.00 34.69 ? 136 GLU C CB    1 
ATOM   3845 C CG    . GLU B 1 139 ? 76.776  0.848   34.561  1.00 35.74 ? 136 GLU C CG    1 
ATOM   3846 C CD    . GLU B 1 139 ? 77.784  1.652   35.370  1.00 37.08 ? 136 GLU C CD    1 
ATOM   3847 O OE1   . GLU B 1 139 ? 77.583  2.891   35.511  1.00 39.78 ? 136 GLU C OE1   1 
ATOM   3848 O OE2   . GLU B 1 139 ? 78.767  1.033   35.877  1.00 40.53 ? 136 GLU C OE2   1 
ATOM   3849 N N     . PHE B 1 140 ? 74.890  -1.963  35.508  1.00 34.43 ? 137 PHE C N     1 
ATOM   3850 C CA    . PHE B 1 140 ? 74.884  -2.990  36.537  1.00 34.31 ? 137 PHE C CA    1 
ATOM   3851 C C     . PHE B 1 140 ? 76.249  -3.086  37.182  1.00 34.40 ? 137 PHE C C     1 
ATOM   3852 O O     . PHE B 1 140 ? 77.248  -3.253  36.496  1.00 34.45 ? 137 PHE C O     1 
ATOM   3853 C CB    . PHE B 1 140 ? 74.513  -4.342  35.943  1.00 34.01 ? 137 PHE C CB    1 
ATOM   3854 C CG    . PHE B 1 140 ? 74.280  -5.415  36.977  1.00 33.96 ? 137 PHE C CG    1 
ATOM   3855 C CD1   . PHE B 1 140 ? 73.055  -5.519  37.623  1.00 33.92 ? 137 PHE C CD1   1 
ATOM   3856 C CD2   . PHE B 1 140 ? 75.280  -6.314  37.307  1.00 33.25 ? 137 PHE C CD2   1 
ATOM   3857 C CE1   . PHE B 1 140 ? 72.833  -6.507  38.580  1.00 33.46 ? 137 PHE C CE1   1 
ATOM   3858 C CE2   . PHE B 1 140 ? 75.064  -7.306  38.255  1.00 33.66 ? 137 PHE C CE2   1 
ATOM   3859 C CZ    . PHE B 1 140 ? 73.829  -7.399  38.889  1.00 33.85 ? 137 PHE C CZ    1 
ATOM   3860 N N     . ILE B 1 141 ? 76.270  -2.989  38.506  1.00 34.57 ? 138 ILE C N     1 
ATOM   3861 C CA    . ILE B 1 141 ? 77.464  -3.180  39.315  1.00 34.50 ? 138 ILE C CA    1 
ATOM   3862 C C     . ILE B 1 141 ? 77.388  -4.534  40.005  1.00 34.63 ? 138 ILE C C     1 
ATOM   3863 O O     . ILE B 1 141 ? 76.446  -4.813  40.755  1.00 34.10 ? 138 ILE C O     1 
ATOM   3864 C CB    . ILE B 1 141 ? 77.559  -2.099  40.397  1.00 34.53 ? 138 ILE C CB    1 
ATOM   3865 C CG1   . ILE B 1 141 ? 77.557  -0.714  39.756  1.00 33.95 ? 138 ILE C CG1   1 
ATOM   3866 C CG2   . ILE B 1 141 ? 78.801  -2.287  41.252  1.00 34.47 ? 138 ILE C CG2   1 
ATOM   3867 C CD1   . ILE B 1 141 ? 77.760  0.386   40.757  1.00 34.70 ? 138 ILE C CD1   1 
ATOM   3868 N N     . ALA B 1 142 ? 78.376  -5.380  39.739  1.00 34.76 ? 139 ALA C N     1 
ATOM   3869 C CA    . ALA B 1 142 ? 78.448  -6.687  40.360  1.00 35.00 ? 139 ALA C CA    1 
ATOM   3870 C C     . ALA B 1 142 ? 79.374  -6.604  41.568  1.00 35.01 ? 139 ALA C C     1 
ATOM   3871 O O     . ALA B 1 142 ? 80.511  -6.170  41.450  1.00 35.25 ? 139 ALA C O     1 
ATOM   3872 C CB    . ALA B 1 142 ? 78.945  -7.720  39.358  1.00 34.94 ? 139 ALA C CB    1 
ATOM   3873 N N     . VAL B 1 143 ? 78.861  -6.988  42.729  1.00 35.32 ? 140 VAL C N     1 
ATOM   3874 C CA    . VAL B 1 143 ? 79.656  -7.129  43.947  1.00 35.53 ? 140 VAL C CA    1 
ATOM   3875 C C     . VAL B 1 143 ? 79.693  -8.617  44.278  1.00 35.92 ? 140 VAL C C     1 
ATOM   3876 O O     . VAL B 1 143 ? 78.665  -9.283  44.249  1.00 36.09 ? 140 VAL C O     1 
ATOM   3877 C CB    . VAL B 1 143 ? 79.039  -6.311  45.116  1.00 35.64 ? 140 VAL C CB    1 
ATOM   3878 C CG1   . VAL B 1 143 ? 79.611  -6.740  46.468  1.00 35.09 ? 140 VAL C CG1   1 
ATOM   3879 C CG2   . VAL B 1 143 ? 79.255  -4.803  44.888  1.00 34.91 ? 140 VAL C CG2   1 
ATOM   3880 N N     . SER B 1 144 ? 80.879  -9.143  44.562  1.00 36.18 ? 141 SER C N     1 
ATOM   3881 C CA    . SER B 1 144 ? 81.058  -10.583 44.758  1.00 35.95 ? 141 SER C CA    1 
ATOM   3882 C C     . SER B 1 144 ? 80.614  -11.062 46.124  1.00 35.99 ? 141 SER C C     1 
ATOM   3883 O O     . SER B 1 144 ? 80.900  -10.437 47.150  1.00 36.19 ? 141 SER C O     1 
ATOM   3884 C CB    . SER B 1 144 ? 82.524  -10.980 44.564  1.00 36.02 ? 141 SER C CB    1 
ATOM   3885 O OG    . SER B 1 144 ? 82.965  -10.621 43.270  1.00 35.96 ? 141 SER C OG    1 
ATOM   3886 N N     . ARG B 1 145 ? 79.934  -12.203 46.120  1.00 36.19 ? 142 ARG C N     1 
ATOM   3887 C CA    . ARG B 1 145 ? 79.616  -12.930 47.337  1.00 35.94 ? 142 ARG C CA    1 
ATOM   3888 C C     . ARG B 1 145 ? 80.889  -13.578 47.884  1.00 36.28 ? 142 ARG C C     1 
ATOM   3889 O O     . ARG B 1 145 ? 81.903  -13.634 47.190  1.00 35.91 ? 142 ARG C O     1 
ATOM   3890 C CB    . ARG B 1 145 ? 78.524  -13.967 47.055  1.00 35.42 ? 142 ARG C CB    1 
ATOM   3891 C CG    . ARG B 1 145 ? 77.145  -13.334 46.887  1.00 34.84 ? 142 ARG C CG    1 
ATOM   3892 C CD    . ARG B 1 145 ? 76.139  -14.226 46.162  1.00 34.65 ? 142 ARG C CD    1 
ATOM   3893 N NE    . ARG B 1 145 ? 74.767  -13.722 46.290  1.00 33.36 ? 142 ARG C NE    1 
ATOM   3894 C CZ    . ARG B 1 145 ? 73.949  -13.986 47.308  1.00 32.70 ? 142 ARG C CZ    1 
ATOM   3895 N NH1   . ARG B 1 145 ? 74.317  -14.774 48.302  1.00 33.64 ? 142 ARG C NH1   1 
ATOM   3896 N NH2   . ARG B 1 145 ? 72.734  -13.470 47.325  1.00 32.42 ? 142 ARG C NH2   1 
ATOM   3897 N N     . GLY B 1 146 ? 80.822  -14.055 49.126  1.00 36.70 ? 143 GLY C N     1 
ATOM   3898 C CA    . GLY B 1 146 ? 81.961  -14.671 49.800  1.00 37.11 ? 143 GLY C CA    1 
ATOM   3899 C C     . GLY B 1 146 ? 82.305  -16.045 49.259  1.00 37.53 ? 143 GLY C C     1 
ATOM   3900 O O     . GLY B 1 146 ? 81.717  -16.510 48.283  1.00 37.59 ? 143 GLY C O     1 
ATOM   3901 N N     . ALA B 1 147 ? 83.263  -16.695 49.903  1.00 38.04 ? 144 ALA C N     1 
ATOM   3902 C CA    . ALA B 1 147 ? 83.736  -18.008 49.477  1.00 38.26 ? 144 ALA C CA    1 
ATOM   3903 C C     . ALA B 1 147 ? 82.684  -19.074 49.743  1.00 38.50 ? 144 ALA C C     1 
ATOM   3904 O O     . ALA B 1 147 ? 82.658  -20.091 49.059  1.00 39.25 ? 144 ALA C O     1 
ATOM   3905 C CB    . ALA B 1 147 ? 85.046  -18.360 50.188  1.00 38.47 ? 144 ALA C CB    1 
ATOM   3906 N N     . ASP B 1 148 ? 81.815  -18.834 50.724  1.00 38.70 ? 145 ASP C N     1 
ATOM   3907 C CA    . ASP B 1 148 ? 80.703  -19.740 51.023  1.00 38.68 ? 145 ASP C CA    1 
ATOM   3908 C C     . ASP B 1 148 ? 79.438  -19.422 50.216  1.00 38.78 ? 145 ASP C C     1 
ATOM   3909 O O     . ASP B 1 148 ? 78.364  -19.974 50.502  1.00 38.05 ? 145 ASP C O     1 
ATOM   3910 C CB    . ASP B 1 148 ? 80.388  -19.729 52.529  1.00 38.87 ? 145 ASP C CB    1 
ATOM   3911 C CG    . ASP B 1 148 ? 79.937  -18.366 53.041  1.00 39.40 ? 145 ASP C CG    1 
ATOM   3912 O OD1   . ASP B 1 148 ? 79.899  -17.388 52.261  1.00 39.14 ? 145 ASP C OD1   1 
ATOM   3913 O OD2   . ASP B 1 148 ? 79.626  -18.282 54.251  1.00 40.86 ? 145 ASP C OD2   1 
ATOM   3914 N N     . PHE B 1 149 ? 79.577  -18.517 49.235  1.00 38.81 ? 146 PHE C N     1 
ATOM   3915 C CA    . PHE B 1 149 ? 78.488  -18.082 48.337  1.00 39.03 ? 146 PHE C CA    1 
ATOM   3916 C C     . PHE B 1 149 ? 77.399  -17.221 48.996  1.00 39.13 ? 146 PHE C C     1 
ATOM   3917 O O     . PHE B 1 149 ? 76.411  -16.892 48.345  1.00 39.23 ? 146 PHE C O     1 
ATOM   3918 C CB    . PHE B 1 149 ? 77.834  -19.274 47.607  1.00 38.52 ? 146 PHE C CB    1 
ATOM   3919 C CG    . PHE B 1 149 ? 78.733  -19.947 46.609  1.00 38.36 ? 146 PHE C CG    1 
ATOM   3920 C CD1   . PHE B 1 149 ? 79.079  -19.305 45.421  1.00 37.60 ? 146 PHE C CD1   1 
ATOM   3921 C CD2   . PHE B 1 149 ? 79.217  -21.235 46.843  1.00 38.57 ? 146 PHE C CD2   1 
ATOM   3922 C CE1   . PHE B 1 149 ? 79.907  -19.923 44.484  1.00 37.32 ? 146 PHE C CE1   1 
ATOM   3923 C CE2   . PHE B 1 149 ? 80.044  -21.859 45.911  1.00 37.87 ? 146 PHE C CE2   1 
ATOM   3924 C CZ    . PHE B 1 149 ? 80.390  -21.196 44.730  1.00 38.16 ? 146 PHE C CZ    1 
ATOM   3925 N N     . ARG B 1 150 ? 77.578  -16.851 50.264  1.00 39.47 ? 147 ARG C N     1 
ATOM   3926 C CA    . ARG B 1 150 ? 76.635  -15.969 50.951  1.00 39.63 ? 147 ARG C CA    1 
ATOM   3927 C C     . ARG B 1 150 ? 77.125  -14.535 50.752  1.00 39.56 ? 147 ARG C C     1 
ATOM   3928 O O     . ARG B 1 150 ? 78.294  -14.319 50.397  1.00 38.74 ? 147 ARG C O     1 
ATOM   3929 C CB    . ARG B 1 150 ? 76.536  -16.328 52.440  1.00 39.70 ? 147 ARG C CB    1 
ATOM   3930 C CG    . ARG B 1 150 ? 76.351  -17.826 52.709  1.00 39.91 ? 147 ARG C CG    1 
ATOM   3931 C CD    . ARG B 1 150 ? 76.146  -18.138 54.179  1.00 41.17 ? 147 ARG C CD    1 
ATOM   3932 N NE    . ARG B 1 150 ? 74.854  -17.620 54.624  1.00 42.99 ? 147 ARG C NE    1 
ATOM   3933 C CZ    . ARG B 1 150 ? 73.741  -18.333 54.812  1.00 43.30 ? 147 ARG C CZ    1 
ATOM   3934 N NH1   . ARG B 1 150 ? 73.709  -19.654 54.648  1.00 43.79 ? 147 ARG C NH1   1 
ATOM   3935 N NH2   . ARG B 1 150 ? 72.636  -17.704 55.190  1.00 43.93 ? 147 ARG C NH2   1 
ATOM   3936 N N     . ILE B 1 151 ? 76.236  -13.559 50.941  1.00 39.51 ? 148 ILE C N     1 
ATOM   3937 C CA    . ILE B 1 151 ? 76.630  -12.152 50.834  1.00 39.79 ? 148 ILE C CA    1 
ATOM   3938 C C     . ILE B 1 151 ? 77.688  -11.827 51.887  1.00 40.11 ? 148 ILE C C     1 
ATOM   3939 O O     . ILE B 1 151 ? 77.497  -12.113 53.068  1.00 39.65 ? 148 ILE C O     1 
ATOM   3940 C CB    . ILE B 1 151 ? 75.440  -11.187 51.001  1.00 39.65 ? 148 ILE C CB    1 
ATOM   3941 C CG1   . ILE B 1 151 ? 74.487  -11.297 49.807  1.00 39.80 ? 148 ILE C CG1   1 
ATOM   3942 C CG2   . ILE B 1 151 ? 75.927  -9.741  51.126  1.00 39.32 ? 148 ILE C CG2   1 
ATOM   3943 C CD1   . ILE B 1 151 ? 73.366  -10.269 49.816  1.00 39.09 ? 148 ILE C CD1   1 
ATOM   3944 N N     . ASP B 1 152 ? 78.804  -11.246 51.446  1.00 40.78 ? 149 ASP C N     1 
ATOM   3945 C CA    . ASP B 1 152 ? 79.831  -10.753 52.354  1.00 41.13 ? 149 ASP C CA    1 
ATOM   3946 C C     . ASP B 1 152 ? 79.478  -9.341  52.813  1.00 41.52 ? 149 ASP C C     1 
ATOM   3947 O O     . ASP B 1 152 ? 79.754  -8.365  52.124  1.00 41.01 ? 149 ASP C O     1 
ATOM   3948 C CB    . ASP B 1 152 ? 81.198  -10.766 51.669  1.00 41.36 ? 149 ASP C CB    1 
ATOM   3949 C CG    . ASP B 1 152 ? 82.329  -10.364 52.607  1.00 41.44 ? 149 ASP C CG    1 
ATOM   3950 O OD1   . ASP B 1 152 ? 82.155  -9.454  53.445  1.00 41.32 ? 149 ASP C OD1   1 
ATOM   3951 O OD2   . ASP B 1 152 ? 83.404  -10.975 52.507  1.00 45.00 ? 149 ASP C OD2   1 
ATOM   3952 N N     . MET B 1 153 ? 78.891  -9.237  54.000  1.00 42.19 ? 150 MET C N     1 
ATOM   3953 C CA    . MET B 1 153 ? 78.291  -7.980  54.446  1.00 42.51 ? 150 MET C CA    1 
ATOM   3954 C C     . MET B 1 153 ? 79.256  -6.798  54.501  1.00 43.12 ? 150 MET C C     1 
ATOM   3955 O O     . MET B 1 153 ? 78.901  -5.696  54.101  1.00 43.03 ? 150 MET C O     1 
ATOM   3956 C CB    . MET B 1 153 ? 77.634  -8.173  55.807  1.00 42.27 ? 150 MET C CB    1 
ATOM   3957 C CG    . MET B 1 153 ? 76.386  -8.995  55.749  1.00 41.74 ? 150 MET C CG    1 
ATOM   3958 S SD    . MET B 1 153 ? 75.159  -8.305  54.627  1.00 41.85 ? 150 MET C SD    1 
ATOM   3959 C CE    . MET B 1 153 ? 74.908  -6.660  55.314  1.00 39.64 ? 150 MET C CE    1 
ATOM   3960 N N     . ASP B 1 154 ? 80.470  -7.029  54.989  1.00 43.76 ? 151 ASP C N     1 
ATOM   3961 C CA    . ASP B 1 154 ? 81.469  -5.968  55.066  1.00 44.14 ? 151 ASP C CA    1 
ATOM   3962 C C     . ASP B 1 154 ? 81.739  -5.362  53.694  1.00 44.36 ? 151 ASP C C     1 
ATOM   3963 O O     . ASP B 1 154 ? 81.704  -4.139  53.542  1.00 44.54 ? 151 ASP C O     1 
ATOM   3964 C CB    . ASP B 1 154 ? 82.776  -6.479  55.687  1.00 44.57 ? 151 ASP C CB    1 
ATOM   3965 C CG    . ASP B 1 154 ? 82.721  -6.562  57.220  1.00 45.96 ? 151 ASP C CG    1 
ATOM   3966 O OD1   . ASP B 1 154 ? 81.649  -6.316  57.829  1.00 46.25 ? 151 ASP C OD1   1 
ATOM   3967 O OD2   . ASP B 1 154 ? 83.776  -6.886  57.820  1.00 49.02 ? 151 ASP C OD2   1 
ATOM   3968 N N     . VAL B 1 155 ? 81.998  -6.201  52.693  1.00 44.63 ? 152 VAL C N     1 
ATOM   3969 C CA    . VAL B 1 155 ? 82.194  -5.701  51.325  1.00 44.55 ? 152 VAL C CA    1 
ATOM   3970 C C     . VAL B 1 155 ? 80.907  -5.118  50.757  1.00 44.22 ? 152 VAL C C     1 
ATOM   3971 O O     . VAL B 1 155 ? 80.948  -4.131  50.037  1.00 44.19 ? 152 VAL C O     1 
ATOM   3972 C CB    . VAL B 1 155 ? 82.739  -6.781  50.348  1.00 44.90 ? 152 VAL C CB    1 
ATOM   3973 C CG1   . VAL B 1 155 ? 81.745  -7.886  50.168  1.00 45.60 ? 152 VAL C CG1   1 
ATOM   3974 C CG2   . VAL B 1 155 ? 83.046  -6.165  48.980  1.00 44.92 ? 152 VAL C CG2   1 
ATOM   3975 N N     . ALA B 1 156 ? 79.768  -5.722  51.090  1.00 44.27 ? 153 ALA C N     1 
ATOM   3976 C CA    . ALA B 1 156 ? 78.474  -5.265  50.581  1.00 44.22 ? 153 ALA C CA    1 
ATOM   3977 C C     . ALA B 1 156 ? 78.210  -3.814  50.971  1.00 44.34 ? 153 ALA C C     1 
ATOM   3978 O O     . ALA B 1 156 ? 77.898  -2.982  50.109  1.00 44.08 ? 153 ALA C O     1 
ATOM   3979 C CB    . ALA B 1 156 ? 77.349  -6.158  51.087  1.00 43.92 ? 153 ALA C CB    1 
ATOM   3980 N N     . LEU B 1 157 ? 78.359  -3.514  52.263  1.00 44.25 ? 154 LEU C N     1 
ATOM   3981 C CA    . LEU B 1 157 ? 78.033  -2.188  52.785  1.00 44.49 ? 154 LEU C CA    1 
ATOM   3982 C C     . LEU B 1 157 ? 79.065  -1.165  52.321  1.00 44.72 ? 154 LEU C C     1 
ATOM   3983 O O     . LEU B 1 157 ? 78.719  -0.047  51.948  1.00 44.32 ? 154 LEU C O     1 
ATOM   3984 C CB    . LEU B 1 157 ? 77.911  -2.218  54.309  1.00 44.06 ? 154 LEU C CB    1 
ATOM   3985 C CG    . LEU B 1 157 ? 76.849  -3.185  54.859  1.00 43.64 ? 154 LEU C CG    1 
ATOM   3986 C CD1   . LEU B 1 157 ? 76.889  -3.214  56.378  1.00 44.14 ? 154 LEU C CD1   1 
ATOM   3987 C CD2   . LEU B 1 157 ? 75.455  -2.841  54.373  1.00 42.57 ? 154 LEU C CD2   1 
ATOM   3988 N N     . GLU B 1 158 ? 80.327  -1.578  52.334  1.00 45.32 ? 155 GLU C N     1 
ATOM   3989 C CA    . GLU B 1 158 ? 81.432  -0.806  51.783  1.00 45.61 ? 155 GLU C CA    1 
ATOM   3990 C C     . GLU B 1 158 ? 81.104  -0.336  50.365  1.00 45.52 ? 155 GLU C C     1 
ATOM   3991 O O     . GLU B 1 158 ? 81.126  0.866   50.076  1.00 45.62 ? 155 GLU C O     1 
ATOM   3992 C CB    . GLU B 1 158 ? 82.696  -1.680  51.793  1.00 45.53 ? 155 GLU C CB    1 
ATOM   3993 C CG    . GLU B 1 158 ? 83.985  -1.007  51.366  1.00 46.06 ? 155 GLU C CG    1 
ATOM   3994 C CD    . GLU B 1 158 ? 85.222  -1.899  51.591  1.00 47.82 ? 155 GLU C CD    1 
ATOM   3995 O OE1   . GLU B 1 158 ? 85.084  -3.162  51.648  1.00 49.37 ? 155 GLU C OE1   1 
ATOM   3996 O OE2   . GLU B 1 158 ? 86.338  -1.325  51.706  1.00 49.90 ? 155 GLU C OE2   1 
ATOM   3997 N N     . GLU B 1 159 ? 80.746  -1.281  49.501  1.00 45.48 ? 156 GLU C N     1 
ATOM   3998 C CA    . GLU B 1 159 ? 80.532  -0.987  48.083  1.00 45.51 ? 156 GLU C CA    1 
ATOM   3999 C C     . GLU B 1 159 ? 79.282  -0.156  47.808  1.00 45.10 ? 156 GLU C C     1 
ATOM   4000 O O     . GLU B 1 159 ? 79.277  0.661   46.890  1.00 45.21 ? 156 GLU C O     1 
ATOM   4001 C CB    . GLU B 1 159 ? 80.496  -2.278  47.256  1.00 45.91 ? 156 GLU C CB    1 
ATOM   4002 C CG    . GLU B 1 159 ? 81.391  -2.223  46.025  1.00 48.03 ? 156 GLU C CG    1 
ATOM   4003 C CD    . GLU B 1 159 ? 82.868  -2.021  46.367  1.00 50.30 ? 156 GLU C CD    1 
ATOM   4004 O OE1   . GLU B 1 159 ? 83.301  -2.456  47.465  1.00 51.66 ? 156 GLU C OE1   1 
ATOM   4005 O OE2   . GLU B 1 159 ? 83.589  -1.419  45.533  1.00 52.51 ? 156 GLU C OE2   1 
ATOM   4006 N N     . ILE B 1 160 ? 78.226  -0.365  48.590  1.00 44.62 ? 157 ILE C N     1 
ATOM   4007 C CA    . ILE B 1 160 ? 77.019  0.458   48.478  1.00 44.49 ? 157 ILE C CA    1 
ATOM   4008 C C     . ILE B 1 160 ? 77.319  1.906   48.870  1.00 44.34 ? 157 ILE C C     1 
ATOM   4009 O O     . ILE B 1 160 ? 76.932  2.834   48.161  1.00 43.75 ? 157 ILE C O     1 
ATOM   4010 C CB    . ILE B 1 160 ? 75.852  -0.106  49.334  1.00 44.34 ? 157 ILE C CB    1 
ATOM   4011 C CG1   . ILE B 1 160 ? 75.346  -1.419  48.728  1.00 43.59 ? 157 ILE C CG1   1 
ATOM   4012 C CG2   . ILE B 1 160 ? 74.714  0.907   49.433  1.00 44.05 ? 157 ILE C CG2   1 
ATOM   4013 C CD1   . ILE B 1 160 ? 74.515  -2.246  49.669  1.00 44.14 ? 157 ILE C CD1   1 
ATOM   4014 N N     . ARG B 1 161 ? 78.019  2.084   49.991  1.00 44.48 ? 158 ARG C N     1 
ATOM   4015 C CA    . ARG B 1 161 ? 78.489  3.408   50.430  1.00 44.70 ? 158 ARG C CA    1 
ATOM   4016 C C     . ARG B 1 161 ? 79.329  4.118   49.361  1.00 44.11 ? 158 ARG C C     1 
ATOM   4017 O O     . ARG B 1 161 ? 79.120  5.292   49.081  1.00 44.05 ? 158 ARG C O     1 
ATOM   4018 C CB    . ARG B 1 161 ? 79.287  3.295   51.739  1.00 44.86 ? 158 ARG C CB    1 
ATOM   4019 C CG    . ARG B 1 161 ? 78.407  3.147   52.972  1.00 45.97 ? 158 ARG C CG    1 
ATOM   4020 C CD    . ARG B 1 161 ? 79.151  2.588   54.210  1.00 47.00 ? 158 ARG C CD    1 
ATOM   4021 N NE    . ARG B 1 161 ? 78.267  2.556   55.386  1.00 48.54 ? 158 ARG C NE    1 
ATOM   4022 C CZ    . ARG B 1 161 ? 78.261  1.615   56.343  1.00 50.45 ? 158 ARG C CZ    1 
ATOM   4023 N NH1   . ARG B 1 161 ? 79.100  0.575   56.309  1.00 50.94 ? 158 ARG C NH1   1 
ATOM   4024 N NH2   . ARG B 1 161 ? 77.390  1.706   57.351  1.00 50.02 ? 158 ARG C NH2   1 
ATOM   4025 N N     . ALA B 1 162 ? 80.264  3.392   48.756  1.00 43.88 ? 159 ALA C N     1 
ATOM   4026 C CA    . ALA B 1 162 ? 81.158  3.967   47.746  1.00 43.38 ? 159 ALA C CA    1 
ATOM   4027 C C     . ALA B 1 162 ? 80.414  4.356   46.466  1.00 43.11 ? 159 ALA C C     1 
ATOM   4028 O O     . ALA B 1 162 ? 80.650  5.425   45.903  1.00 43.27 ? 159 ALA C O     1 
ATOM   4029 C CB    . ALA B 1 162 ? 82.293  2.980   47.413  1.00 43.25 ? 159 ALA C CB    1 
ATOM   4030 N N     . LYS B 1 163 ? 79.508  3.493   46.017  1.00 42.43 ? 160 LYS C N     1 
ATOM   4031 C CA    . LYS B 1 163 ? 78.931  3.621   44.677  1.00 41.72 ? 160 LYS C CA    1 
ATOM   4032 C C     . LYS B 1 163 ? 77.585  4.355   44.645  1.00 41.09 ? 160 LYS C C     1 
ATOM   4033 O O     . LYS B 1 163 ? 77.163  4.822   43.588  1.00 41.14 ? 160 LYS C O     1 
ATOM   4034 C CB    . LYS B 1 163 ? 78.788  2.233   44.049  1.00 41.95 ? 160 LYS C CB    1 
ATOM   4035 C CG    . LYS B 1 163 ? 80.110  1.481   43.889  1.00 42.47 ? 160 LYS C CG    1 
ATOM   4036 C CD    . LYS B 1 163 ? 81.001  2.123   42.829  1.00 43.54 ? 160 LYS C CD    1 
ATOM   4037 C CE    . LYS B 1 163 ? 82.295  1.333   42.632  1.00 44.03 ? 160 LYS C CE    1 
ATOM   4038 N NZ    . LYS B 1 163 ? 82.063  -0.008  42.019  1.00 44.33 ? 160 LYS C NZ    1 
ATOM   4039 N N     . GLN B 1 164 ? 76.921  4.449   45.796  1.00 40.05 ? 161 GLN C N     1 
ATOM   4040 C CA    . GLN B 1 164 ? 75.589  5.052   45.896  1.00 38.99 ? 161 GLN C CA    1 
ATOM   4041 C C     . GLN B 1 164 ? 74.644  4.565   44.793  1.00 37.98 ? 161 GLN C C     1 
ATOM   4042 O O     . GLN B 1 164 ? 74.153  5.363   44.003  1.00 37.36 ? 161 GLN C O     1 
ATOM   4043 C CB    . GLN B 1 164 ? 75.695  6.585   45.872  1.00 39.07 ? 161 GLN C CB    1 
ATOM   4044 C CG    . GLN B 1 164 ? 76.400  7.181   47.084  1.00 39.13 ? 161 GLN C CG    1 
ATOM   4045 C CD    . GLN B 1 164 ? 75.632  6.954   48.379  1.00 39.21 ? 161 GLN C CD    1 
ATOM   4046 O OE1   . GLN B 1 164 ? 74.609  7.591   48.625  1.00 39.10 ? 161 GLN C OE1   1 
ATOM   4047 N NE2   . GLN B 1 164 ? 76.133  6.055   49.217  1.00 38.21 ? 161 GLN C NE2   1 
ATOM   4048 N N     . PRO B 1 165 ? 74.398  3.244   44.729  1.00 36.91 ? 162 PRO C N     1 
ATOM   4049 C CA    . PRO B 1 165 ? 73.554  2.729   43.656  1.00 36.15 ? 162 PRO C CA    1 
ATOM   4050 C C     . PRO B 1 165 ? 72.105  3.178   43.772  1.00 35.32 ? 162 PRO C C     1 
ATOM   4051 O O     . PRO B 1 165 ? 71.568  3.274   44.866  1.00 34.90 ? 162 PRO C O     1 
ATOM   4052 C CB    . PRO B 1 165 ? 73.668  1.204   43.803  1.00 35.85 ? 162 PRO C CB    1 
ATOM   4053 C CG    . PRO B 1 165 ? 74.108  0.973   45.181  1.00 36.39 ? 162 PRO C CG    1 
ATOM   4054 C CD    . PRO B 1 165 ? 74.901  2.169   45.603  1.00 36.78 ? 162 PRO C CD    1 
ATOM   4055 N N     . ASP B 1 166 ? 71.483  3.438   42.633  1.00 34.51 ? 163 ASP C N     1 
ATOM   4056 C CA    . ASP B 1 166 ? 70.088  3.843   42.605  1.00 33.85 ? 163 ASP C CA    1 
ATOM   4057 C C     . ASP B 1 166 ? 69.187  2.693   43.003  1.00 32.89 ? 163 ASP C C     1 
ATOM   4058 O O     . ASP B 1 166 ? 68.179  2.904   43.686  1.00 33.29 ? 163 ASP C O     1 
ATOM   4059 C CB    . ASP B 1 166 ? 69.735  4.359   41.222  1.00 34.17 ? 163 ASP C CB    1 
ATOM   4060 C CG    . ASP B 1 166 ? 70.603  5.526   40.820  1.00 35.56 ? 163 ASP C CG    1 
ATOM   4061 O OD1   . ASP B 1 166 ? 70.275  6.675   41.190  1.00 37.10 ? 163 ASP C OD1   1 
ATOM   4062 O OD2   . ASP B 1 166 ? 71.633  5.285   40.157  1.00 37.53 ? 163 ASP C OD2   1 
ATOM   4063 N N     . ILE B 1 167 ? 69.571  1.484   42.587  1.00 31.36 ? 164 ILE C N     1 
ATOM   4064 C CA    . ILE B 1 167 ? 68.857  0.258   42.925  1.00 30.60 ? 164 ILE C CA    1 
ATOM   4065 C C     . ILE B 1 167 ? 69.834  -0.794  43.449  1.00 29.60 ? 164 ILE C C     1 
ATOM   4066 O O     . ILE B 1 167 ? 70.903  -0.989  42.881  1.00 28.78 ? 164 ILE C O     1 
ATOM   4067 C CB    . ILE B 1 167 ? 68.135  -0.338  41.685  1.00 30.20 ? 164 ILE C CB    1 
ATOM   4068 C CG1   . ILE B 1 167 ? 67.101  0.647   41.140  1.00 30.16 ? 164 ILE C CG1   1 
ATOM   4069 C CG2   . ILE B 1 167 ? 67.508  -1.693  42.031  1.00 30.70 ? 164 ILE C CG2   1 
ATOM   4070 C CD1   . ILE B 1 167 ? 66.490  0.247   39.818  1.00 30.17 ? 164 ILE C CD1   1 
ATOM   4071 N N     . VAL B 1 168 ? 69.461  -1.453  44.537  1.00 28.91 ? 165 VAL C N     1 
ATOM   4072 C CA    . VAL B 1 168 ? 70.170  -2.643  45.026  1.00 28.45 ? 165 VAL C CA    1 
ATOM   4073 C C     . VAL B 1 168 ? 69.248  -3.860  44.989  1.00 28.04 ? 165 VAL C C     1 
ATOM   4074 O O     . VAL B 1 168 ? 68.142  -3.828  45.540  1.00 27.31 ? 165 VAL C O     1 
ATOM   4075 C CB    . VAL B 1 168 ? 70.679  -2.457  46.466  1.00 28.24 ? 165 VAL C CB    1 
ATOM   4076 C CG1   . VAL B 1 168 ? 71.293  -3.772  46.991  1.00 27.91 ? 165 VAL C CG1   1 
ATOM   4077 C CG2   . VAL B 1 168 ? 71.677  -1.287  46.532  1.00 26.92 ? 165 VAL C CG2   1 
ATOM   4078 N N     . PHE B 1 169 ? 69.717  -4.925  44.334  1.00 27.99 ? 166 PHE C N     1 
ATOM   4079 C CA    . PHE B 1 169 ? 69.029  -6.215  44.330  1.00 27.72 ? 166 PHE C CA    1 
ATOM   4080 C C     . PHE B 1 169 ? 69.555  -7.102  45.447  1.00 27.22 ? 166 PHE C C     1 
ATOM   4081 O O     . PHE B 1 169 ? 70.760  -7.233  45.615  1.00 26.91 ? 166 PHE C O     1 
ATOM   4082 C CB    . PHE B 1 169 ? 69.247  -6.947  43.005  1.00 27.92 ? 166 PHE C CB    1 
ATOM   4083 C CG    . PHE B 1 169 ? 68.590  -6.309  41.828  1.00 28.04 ? 166 PHE C CG    1 
ATOM   4084 C CD1   . PHE B 1 169 ? 69.356  -5.730  40.820  1.00 28.41 ? 166 PHE C CD1   1 
ATOM   4085 C CD2   . PHE B 1 169 ? 67.207  -6.325  41.691  1.00 29.08 ? 166 PHE C CD2   1 
ATOM   4086 C CE1   . PHE B 1 169 ? 68.759  -5.157  39.709  1.00 28.41 ? 166 PHE C CE1   1 
ATOM   4087 C CE2   . PHE B 1 169 ? 66.596  -5.752  40.568  1.00 28.53 ? 166 PHE C CE2   1 
ATOM   4088 C CZ    . PHE B 1 169 ? 67.384  -5.162  39.578  1.00 28.60 ? 166 PHE C CZ    1 
ATOM   4089 N N     . VAL B 1 170 ? 68.648  -7.694  46.213  1.00 26.82 ? 167 VAL C N     1 
ATOM   4090 C CA    . VAL B 1 170 ? 68.993  -8.769  47.138  1.00 26.62 ? 167 VAL C CA    1 
ATOM   4091 C C     . VAL B 1 170 ? 68.087  -9.941  46.857  1.00 26.40 ? 167 VAL C C     1 
ATOM   4092 O O     . VAL B 1 170 ? 66.885  -9.827  47.063  1.00 26.47 ? 167 VAL C O     1 
ATOM   4093 C CB    . VAL B 1 170 ? 68.785  -8.365  48.621  1.00 27.00 ? 167 VAL C CB    1 
ATOM   4094 C CG1   . VAL B 1 170 ? 69.358  -9.444  49.549  1.00 26.09 ? 167 VAL C CG1   1 
ATOM   4095 C CG2   . VAL B 1 170 ? 69.412  -7.005  48.905  1.00 25.33 ? 167 VAL C CG2   1 
ATOM   4096 N N     . THR B 1 171 ? 68.654  -11.071 46.421  1.00 26.23 ? 168 THR C N     1 
ATOM   4097 C CA    . THR B 1 171 ? 67.855  -12.256 46.123  1.00 25.99 ? 168 THR C CA    1 
ATOM   4098 C C     . THR B 1 171 ? 67.899  -13.231 47.282  1.00 25.69 ? 168 THR C C     1 
ATOM   4099 O O     . THR B 1 171 ? 68.956  -13.773 47.610  1.00 25.33 ? 168 THR C O     1 
ATOM   4100 C CB    . THR B 1 171 ? 68.329  -12.956 44.837  1.00 26.17 ? 168 THR C CB    1 
ATOM   4101 O OG1   . THR B 1 171 ? 68.517  -11.987 43.805  1.00 25.93 ? 168 THR C OG1   1 
ATOM   4102 C CG2   . THR B 1 171 ? 67.305  -13.984 44.373  1.00 25.62 ? 168 THR C CG2   1 
ATOM   4103 N N     . THR B 1 172 ? 66.753  -13.454 47.914  1.00 25.46 ? 169 THR C N     1 
ATOM   4104 C CA    . THR B 1 172 ? 66.737  -14.258 49.114  1.00 25.46 ? 169 THR C CA    1 
ATOM   4105 C C     . THR B 1 172 ? 65.460  -15.062 49.278  1.00 24.89 ? 169 THR C C     1 
ATOM   4106 O O     . THR B 1 172 ? 64.377  -14.490 49.396  1.00 25.37 ? 169 THR C O     1 
ATOM   4107 C CB    . THR B 1 172 ? 67.011  -13.392 50.381  1.00 25.62 ? 169 THR C CB    1 
ATOM   4108 O OG1   . THR B 1 172 ? 67.071  -14.251 51.532  1.00 26.10 ? 169 THR C OG1   1 
ATOM   4109 C CG2   . THR B 1 172 ? 65.945  -12.327 50.576  1.00 24.71 ? 169 THR C CG2   1 
ATOM   4110 N N     . PRO B 1 173 ? 65.570  -16.402 49.264  1.00 24.40 ? 170 PRO C N     1 
ATOM   4111 C CA    . PRO B 1 173 ? 66.751  -17.254 48.951  1.00 23.95 ? 170 PRO C CA    1 
ATOM   4112 C C     . PRO B 1 173 ? 67.411  -16.949 47.599  1.00 23.81 ? 170 PRO C C     1 
ATOM   4113 O O     . PRO B 1 173 ? 66.735  -16.598 46.634  1.00 23.74 ? 170 PRO C O     1 
ATOM   4114 C CB    . PRO B 1 173 ? 66.178  -18.656 48.932  1.00 23.72 ? 170 PRO C CB    1 
ATOM   4115 C CG    . PRO B 1 173 ? 64.932  -18.579 49.791  1.00 24.01 ? 170 PRO C CG    1 
ATOM   4116 C CD    . PRO B 1 173 ? 64.389  -17.197 49.633  1.00 23.64 ? 170 PRO C CD    1 
ATOM   4117 N N     . ASN B 1 174 ? 68.725  -17.082 47.533  1.00 23.79 ? 171 ASN C N     1 
ATOM   4118 C CA    . ASN B 1 174 ? 69.445  -16.763 46.314  1.00 24.01 ? 171 ASN C CA    1 
ATOM   4119 C C     . ASN B 1 174 ? 69.361  -17.881 45.303  1.00 24.44 ? 171 ASN C C     1 
ATOM   4120 O O     . ASN B 1 174 ? 69.468  -19.052 45.647  1.00 25.35 ? 171 ASN C O     1 
ATOM   4121 C CB    . ASN B 1 174 ? 70.921  -16.467 46.592  1.00 23.25 ? 171 ASN C CB    1 
ATOM   4122 C CG    . ASN B 1 174 ? 71.618  -15.847 45.403  1.00 22.43 ? 171 ASN C CG    1 
ATOM   4123 O OD1   . ASN B 1 174 ? 71.011  -15.098 44.653  1.00 23.74 ? 171 ASN C OD1   1 
ATOM   4124 N ND2   . ASN B 1 174 ? 72.892  -16.148 45.224  1.00 19.64 ? 171 ASN C ND2   1 
ATOM   4125 N N     . ASN B 1 175 ? 69.134  -17.489 44.059  1.00 24.74 ? 172 ASN C N     1 
ATOM   4126 C CA    . ASN B 1 175 ? 69.329  -18.320 42.905  1.00 24.98 ? 172 ASN C CA    1 
ATOM   4127 C C     . ASN B 1 175 ? 70.664  -17.833 42.321  1.00 25.32 ? 172 ASN C C     1 
ATOM   4128 O O     . ASN B 1 175 ? 70.764  -16.672 41.943  1.00 25.42 ? 172 ASN C O     1 
ATOM   4129 C CB    . ASN B 1 175 ? 68.168  -18.078 41.934  1.00 24.92 ? 172 ASN C CB    1 
ATOM   4130 C CG    . ASN B 1 175 ? 68.372  -18.721 40.577  1.00 25.03 ? 172 ASN C CG    1 
ATOM   4131 O OD1   . ASN B 1 175 ? 69.347  -19.439 40.365  1.00 22.19 ? 172 ASN C OD1   1 
ATOM   4132 N ND2   . ASN B 1 175 ? 67.438  -18.461 39.639  1.00 24.70 ? 172 ASN C ND2   1 
ATOM   4133 N N     . PRO B 1 176 ? 71.662  -18.726 42.162  1.00 25.48 ? 173 PRO C N     1 
ATOM   4134 C CA    . PRO B 1 176 ? 71.727  -20.192 42.240  1.00 25.98 ? 173 PRO C CA    1 
ATOM   4135 C C     . PRO B 1 176 ? 72.211  -20.892 43.517  1.00 26.39 ? 173 PRO C C     1 
ATOM   4136 O O     . PRO B 1 176 ? 72.245  -22.125 43.542  1.00 26.13 ? 173 PRO C O     1 
ATOM   4137 C CB    . PRO B 1 176 ? 72.744  -20.513 41.137  1.00 25.81 ? 173 PRO C CB    1 
ATOM   4138 C CG    . PRO B 1 176 ? 73.713  -19.410 41.228  1.00 25.06 ? 173 PRO C CG    1 
ATOM   4139 C CD    . PRO B 1 176 ? 72.946  -18.181 41.677  1.00 25.46 ? 173 PRO C CD    1 
ATOM   4140 N N     . THR B 1 177 ? 72.568  -20.148 44.554  1.00 27.00 ? 174 THR C N     1 
ATOM   4141 C CA    . THR B 1 177 ? 73.281  -20.716 45.696  1.00 27.45 ? 174 THR C CA    1 
ATOM   4142 C C     . THR B 1 177 ? 72.378  -21.295 46.795  1.00 28.21 ? 174 THR C C     1 
ATOM   4143 O O     . THR B 1 177 ? 72.786  -22.218 47.507  1.00 28.81 ? 174 THR C O     1 
ATOM   4144 C CB    . THR B 1 177 ? 74.218  -19.673 46.278  1.00 27.51 ? 174 THR C CB    1 
ATOM   4145 O OG1   . THR B 1 177 ? 73.477  -18.486 46.574  1.00 28.40 ? 174 THR C OG1   1 
ATOM   4146 C CG2   . THR B 1 177 ? 75.301  -19.319 45.261  1.00 26.80 ? 174 THR C CG2   1 
ATOM   4147 N N     . GLY B 1 178 ? 71.158  -20.778 46.930  1.00 28.93 ? 175 GLY C N     1 
ATOM   4148 C CA    . GLY B 1 178 ? 70.153  -21.370 47.835  1.00 29.13 ? 175 GLY C CA    1 
ATOM   4149 C C     . GLY B 1 178 ? 70.054  -20.761 49.233  1.00 29.68 ? 175 GLY C C     1 
ATOM   4150 O O     . GLY B 1 178 ? 69.192  -21.149 50.013  1.00 30.36 ? 175 GLY C O     1 
ATOM   4151 N N     . ASP B 1 179 ? 70.914  -19.792 49.539  1.00 30.21 ? 176 ASP C N     1 
ATOM   4152 C CA    . ASP B 1 179 ? 71.025  -19.232 50.884  1.00 30.09 ? 176 ASP C CA    1 
ATOM   4153 C C     . ASP B 1 179 ? 70.111  -18.026 51.092  1.00 30.02 ? 176 ASP C C     1 
ATOM   4154 O O     . ASP B 1 179 ? 69.866  -17.239 50.164  1.00 29.13 ? 176 ASP C O     1 
ATOM   4155 C CB    . ASP B 1 179 ? 72.477  -18.843 51.202  1.00 30.53 ? 176 ASP C CB    1 
ATOM   4156 C CG    . ASP B 1 179 ? 73.056  -17.816 50.217  1.00 32.60 ? 176 ASP C CG    1 
ATOM   4157 O OD1   . ASP B 1 179 ? 73.773  -18.248 49.292  1.00 35.29 ? 176 ASP C OD1   1 
ATOM   4158 O OD2   . ASP B 1 179 ? 72.803  -16.591 50.363  1.00 33.67 ? 176 ASP C OD2   1 
ATOM   4159 N N     . VAL B 1 180 ? 69.619  -17.916 52.325  1.00 29.88 ? 177 VAL C N     1 
ATOM   4160 C CA    . VAL B 1 180 ? 68.832  -16.786 52.788  1.00 29.68 ? 177 VAL C CA    1 
ATOM   4161 C C     . VAL B 1 180 ? 69.749  -15.709 53.373  1.00 29.57 ? 177 VAL C C     1 
ATOM   4162 O O     . VAL B 1 180 ? 70.605  -15.984 54.191  1.00 29.30 ? 177 VAL C O     1 
ATOM   4163 C CB    . VAL B 1 180 ? 67.790  -17.235 53.848  1.00 29.33 ? 177 VAL C CB    1 
ATOM   4164 C CG1   . VAL B 1 180 ? 67.246  -16.062 54.629  1.00 29.14 ? 177 VAL C CG1   1 
ATOM   4165 C CG2   . VAL B 1 180 ? 66.668  -17.994 53.184  1.00 29.62 ? 177 VAL C CG2   1 
ATOM   4166 N N     . THR B 1 181 ? 69.554  -14.477 52.932  1.00 29.70 ? 178 THR C N     1 
ATOM   4167 C CA    . THR B 1 181 ? 70.140  -13.312 53.585  1.00 30.00 ? 178 THR C CA    1 
ATOM   4168 C C     . THR B 1 181 ? 69.130  -12.901 54.669  1.00 30.05 ? 178 THR C C     1 
ATOM   4169 O O     . THR B 1 181 ? 67.984  -12.587 54.363  1.00 29.39 ? 178 THR C O     1 
ATOM   4170 C CB    . THR B 1 181 ? 70.393  -12.168 52.564  1.00 29.46 ? 178 THR C CB    1 
ATOM   4171 O OG1   . THR B 1 181 ? 71.357  -12.600 51.593  1.00 29.51 ? 178 THR C OG1   1 
ATOM   4172 C CG2   . THR B 1 181 ? 70.894  -10.907 53.254  1.00 29.78 ? 178 THR C CG2   1 
ATOM   4173 N N     . SER B 1 182 ? 69.559  -12.944 55.931  1.00 30.38 ? 179 SER C N     1 
ATOM   4174 C CA    . SER B 1 182 ? 68.686  -12.659 57.075  1.00 30.67 ? 179 SER C CA    1 
ATOM   4175 C C     . SER B 1 182 ? 68.103  -11.240 56.991  1.00 30.60 ? 179 SER C C     1 
ATOM   4176 O O     . SER B 1 182 ? 68.701  -10.362 56.378  1.00 29.26 ? 179 SER C O     1 
ATOM   4177 C CB    . SER B 1 182 ? 69.489  -12.783 58.375  1.00 30.74 ? 179 SER C CB    1 
ATOM   4178 O OG    . SER B 1 182 ? 70.308  -11.638 58.548  1.00 30.33 ? 179 SER C OG    1 
ATOM   4179 N N     . LEU B 1 183 ? 66.947  -11.019 57.613  1.00 31.30 ? 180 LEU C N     1 
ATOM   4180 C CA    . LEU B 1 183 ? 66.321  -9.699  57.579  1.00 32.38 ? 180 LEU C CA    1 
ATOM   4181 C C     . LEU B 1 183 ? 67.176  -8.610  58.229  1.00 32.91 ? 180 LEU C C     1 
ATOM   4182 O O     . LEU B 1 183 ? 67.158  -7.472  57.764  1.00 32.98 ? 180 LEU C O     1 
ATOM   4183 C CB    . LEU B 1 183 ? 64.912  -9.707  58.207  1.00 32.39 ? 180 LEU C CB    1 
ATOM   4184 C CG    . LEU B 1 183 ? 63.777  -10.386 57.422  1.00 32.31 ? 180 LEU C CG    1 
ATOM   4185 C CD1   . LEU B 1 183 ? 62.440  -10.076 58.097  1.00 32.93 ? 180 LEU C CD1   1 
ATOM   4186 C CD2   . LEU B 1 183 ? 63.752  -10.012 55.929  1.00 31.17 ? 180 LEU C CD2   1 
ATOM   4187 N N     . ASP B 1 184 ? 67.920  -8.957  59.283  1.00 33.93 ? 181 ASP C N     1 
ATOM   4188 C CA    . ASP B 1 184 ? 68.861  -8.026  59.916  1.00 34.87 ? 181 ASP C CA    1 
ATOM   4189 C C     . ASP B 1 184 ? 69.951  -7.556  58.949  1.00 35.14 ? 181 ASP C C     1 
ATOM   4190 O O     . ASP B 1 184 ? 70.294  -6.369  58.919  1.00 35.30 ? 181 ASP C O     1 
ATOM   4191 C CB    . ASP B 1 184 ? 69.520  -8.658  61.150  1.00 35.77 ? 181 ASP C CB    1 
ATOM   4192 C CG    . ASP B 1 184 ? 68.562  -8.799  62.344  1.00 37.92 ? 181 ASP C CG    1 
ATOM   4193 O OD1   . ASP B 1 184 ? 67.357  -8.466  62.221  1.00 40.11 ? 181 ASP C OD1   1 
ATOM   4194 O OD2   . ASP B 1 184 ? 69.033  -9.252  63.421  1.00 41.10 ? 181 ASP C OD2   1 
ATOM   4195 N N     . ASP B 1 185 ? 70.490  -8.474  58.156  1.00 35.29 ? 182 ASP C N     1 
ATOM   4196 C CA    . ASP B 1 185 ? 71.413  -8.083  57.083  1.00 35.81 ? 182 ASP C CA    1 
ATOM   4197 C C     . ASP B 1 185 ? 70.735  -7.234  55.999  1.00 35.98 ? 182 ASP C C     1 
ATOM   4198 O O     . ASP B 1 185 ? 71.355  -6.319  55.460  1.00 35.77 ? 182 ASP C O     1 
ATOM   4199 C CB    . ASP B 1 185 ? 72.078  -9.298  56.442  1.00 35.78 ? 182 ASP C CB    1 
ATOM   4200 C CG    . ASP B 1 185 ? 73.137  -9.918  57.334  1.00 36.76 ? 182 ASP C CG    1 
ATOM   4201 O OD1   . ASP B 1 185 ? 73.770  -9.179  58.112  1.00 37.12 ? 182 ASP C OD1   1 
ATOM   4202 O OD2   . ASP B 1 185 ? 73.326  -11.147 57.269  1.00 38.83 ? 182 ASP C OD2   1 
ATOM   4203 N N     . VAL B 1 186 ? 69.479  -7.548  55.683  1.00 35.90 ? 183 VAL C N     1 
ATOM   4204 C CA    . VAL B 1 186 ? 68.731  -6.778  54.700  1.00 36.11 ? 183 VAL C CA    1 
ATOM   4205 C C     . VAL B 1 186 ? 68.524  -5.352  55.210  1.00 36.25 ? 183 VAL C C     1 
ATOM   4206 O O     . VAL B 1 186 ? 68.692  -4.400  54.448  1.00 35.75 ? 183 VAL C O     1 
ATOM   4207 C CB    . VAL B 1 186 ? 67.368  -7.430  54.350  1.00 35.94 ? 183 VAL C CB    1 
ATOM   4208 C CG1   . VAL B 1 186 ? 66.557  -6.531  53.439  1.00 35.54 ? 183 VAL C CG1   1 
ATOM   4209 C CG2   . VAL B 1 186 ? 67.583  -8.789  53.687  1.00 36.14 ? 183 VAL C CG2   1 
ATOM   4210 N N     . GLU B 1 187 ? 68.175  -5.206  56.490  1.00 36.22 ? 184 GLU C N     1 
ATOM   4211 C CA    . GLU B 1 187 ? 68.025  -3.870  57.083  1.00 36.65 ? 184 GLU C CA    1 
ATOM   4212 C C     . GLU B 1 187 ? 69.329  -3.090  56.958  1.00 36.22 ? 184 GLU C C     1 
ATOM   4213 O O     . GLU B 1 187 ? 69.329  -1.918  56.615  1.00 35.98 ? 184 GLU C O     1 
ATOM   4214 C CB    . GLU B 1 187 ? 67.626  -3.933  58.564  1.00 36.61 ? 184 GLU C CB    1 
ATOM   4215 C CG    . GLU B 1 187 ? 66.240  -4.500  58.823  1.00 37.78 ? 184 GLU C CG    1 
ATOM   4216 C CD    . GLU B 1 187 ? 65.613  -3.987  60.130  1.00 37.96 ? 184 GLU C CD    1 
ATOM   4217 O OE1   . GLU B 1 187 ? 65.505  -2.751  60.307  1.00 39.12 ? 184 GLU C OE1   1 
ATOM   4218 O OE2   . GLU B 1 187 ? 65.215  -4.826  60.965  1.00 39.55 ? 184 GLU C OE2   1 
ATOM   4219 N N     . ARG B 1 188 ? 70.439  -3.753  57.251  1.00 36.21 ? 185 ARG C N     1 
ATOM   4220 C CA    . ARG B 1 188 ? 71.751  -3.124  57.156  1.00 36.48 ? 185 ARG C CA    1 
ATOM   4221 C C     . ARG B 1 188 ? 71.996  -2.602  55.743  1.00 36.10 ? 185 ARG C C     1 
ATOM   4222 O O     . ARG B 1 188 ? 72.414  -1.465  55.563  1.00 36.36 ? 185 ARG C O     1 
ATOM   4223 C CB    . ARG B 1 188 ? 72.852  -4.100  57.590  1.00 36.33 ? 185 ARG C CB    1 
ATOM   4224 C CG    . ARG B 1 188 ? 72.915  -4.305  59.100  1.00 37.71 ? 185 ARG C CG    1 
ATOM   4225 C CD    . ARG B 1 188 ? 73.730  -5.542  59.493  1.00 38.22 ? 185 ARG C CD    1 
ATOM   4226 N NE    . ARG B 1 188 ? 75.157  -5.392  59.192  1.00 40.09 ? 185 ARG C NE    1 
ATOM   4227 C CZ    . ARG B 1 188 ? 76.057  -6.379  59.243  1.00 40.75 ? 185 ARG C CZ    1 
ATOM   4228 N NH1   . ARG B 1 188 ? 75.691  -7.618  59.575  1.00 41.77 ? 185 ARG C NH1   1 
ATOM   4229 N NH2   . ARG B 1 188 ? 77.334  -6.130  58.954  1.00 40.99 ? 185 ARG C NH2   1 
ATOM   4230 N N     . ILE B 1 189 ? 71.704  -3.434  54.746  1.00 35.98 ? 186 ILE C N     1 
ATOM   4231 C CA    . ILE B 1 189 ? 71.770  -3.026  53.344  1.00 35.61 ? 186 ILE C CA    1 
ATOM   4232 C C     . ILE B 1 189 ? 70.839  -1.858  53.043  1.00 35.12 ? 186 ILE C C     1 
ATOM   4233 O O     . ILE B 1 189 ? 71.271  -0.866  52.455  1.00 34.11 ? 186 ILE C O     1 
ATOM   4234 C CB    . ILE B 1 189 ? 71.455  -4.212  52.389  1.00 35.59 ? 186 ILE C CB    1 
ATOM   4235 C CG1   . ILE B 1 189 ? 72.629  -5.188  52.379  1.00 35.40 ? 186 ILE C CG1   1 
ATOM   4236 C CG2   . ILE B 1 189 ? 71.178  -3.708  50.960  1.00 35.41 ? 186 ILE C CG2   1 
ATOM   4237 C CD1   . ILE B 1 189 ? 72.305  -6.539  51.812  1.00 35.77 ? 186 ILE C CD1   1 
ATOM   4238 N N     . ILE B 1 190 ? 69.571  -1.978  53.437  1.00 35.15 ? 187 ILE C N     1 
ATOM   4239 C CA    . ILE B 1 190 ? 68.579  -0.913  53.211  1.00 35.44 ? 187 ILE C CA    1 
ATOM   4240 C C     . ILE B 1 190 ? 69.020  0.436   53.793  1.00 35.80 ? 187 ILE C C     1 
ATOM   4241 O O     . ILE B 1 190 ? 68.782  1.485   53.189  1.00 36.04 ? 187 ILE C O     1 
ATOM   4242 C CB    . ILE B 1 190 ? 67.184  -1.270  53.797  1.00 35.44 ? 187 ILE C CB    1 
ATOM   4243 C CG1   . ILE B 1 190 ? 66.540  -2.431  53.026  1.00 35.38 ? 187 ILE C CG1   1 
ATOM   4244 C CG2   . ILE B 1 190 ? 66.248  -0.065  53.745  1.00 35.16 ? 187 ILE C CG2   1 
ATOM   4245 C CD1   . ILE B 1 190 ? 65.296  -2.988  53.673  1.00 34.58 ? 187 ILE C CD1   1 
ATOM   4246 N N     . ASN B 1 191 ? 69.673  0.423   54.950  1.00 36.03 ? 188 ASN C N     1 
ATOM   4247 C CA    . ASN B 1 191 ? 70.065  1.689   55.587  1.00 36.42 ? 188 ASN C CA    1 
ATOM   4248 C C     . ASN B 1 191 ? 71.189  2.468   54.885  1.00 36.57 ? 188 ASN C C     1 
ATOM   4249 O O     . ASN B 1 191 ? 71.183  3.691   54.903  1.00 36.84 ? 188 ASN C O     1 
ATOM   4250 C CB    . ASN B 1 191 ? 70.342  1.495   57.085  1.00 36.36 ? 188 ASN C CB    1 
ATOM   4251 C CG    . ASN B 1 191 ? 69.067  1.568   57.910  1.00 37.08 ? 188 ASN C CG    1 
ATOM   4252 O OD1   . ASN B 1 191 ? 68.641  0.583   58.519  1.00 37.39 ? 188 ASN C OD1   1 
ATOM   4253 N ND2   . ASN B 1 191 ? 68.426  2.736   57.899  1.00 36.23 ? 188 ASN C ND2   1 
ATOM   4254 N N     . VAL B 1 192 ? 72.118  1.770   54.241  1.00 36.57 ? 189 VAL C N     1 
ATOM   4255 C CA    . VAL B 1 192 ? 73.142  2.437   53.422  1.00 36.18 ? 189 VAL C CA    1 
ATOM   4256 C C     . VAL B 1 192 ? 72.650  2.760   51.993  1.00 36.05 ? 189 VAL C C     1 
ATOM   4257 O O     . VAL B 1 192 ? 73.122  3.706   51.374  1.00 36.11 ? 189 VAL C O     1 
ATOM   4258 C CB    . VAL B 1 192 ? 74.453  1.613   53.372  1.00 36.15 ? 189 VAL C CB    1 
ATOM   4259 C CG1   . VAL B 1 192 ? 75.116  1.621   54.725  1.00 36.22 ? 189 VAL C CG1   1 
ATOM   4260 C CG2   . VAL B 1 192 ? 74.191  0.189   52.932  1.00 36.01 ? 189 VAL C CG2   1 
ATOM   4261 N N     . ALA B 1 193 ? 71.696  1.979   51.479  1.00 35.88 ? 190 ALA C N     1 
ATOM   4262 C CA    . ALA B 1 193 ? 71.125  2.211   50.137  1.00 35.22 ? 190 ALA C CA    1 
ATOM   4263 C C     . ALA B 1 193 ? 70.524  3.611   50.026  1.00 34.85 ? 190 ALA C C     1 
ATOM   4264 O O     . ALA B 1 193 ? 69.685  3.991   50.838  1.00 35.16 ? 190 ALA C O     1 
ATOM   4265 C CB    . ALA B 1 193 ? 70.065  1.173   49.819  1.00 35.35 ? 190 ALA C CB    1 
ATOM   4266 N N     . PRO B 1 194 ? 70.973  4.397   49.038  1.00 34.33 ? 191 PRO C N     1 
ATOM   4267 C CA    . PRO B 1 194 ? 70.408  5.728   48.831  1.00 33.85 ? 191 PRO C CA    1 
ATOM   4268 C C     . PRO B 1 194 ? 69.087  5.789   48.039  1.00 33.69 ? 191 PRO C C     1 
ATOM   4269 O O     . PRO B 1 194 ? 68.302  6.713   48.257  1.00 33.33 ? 191 PRO C O     1 
ATOM   4270 C CB    . PRO B 1 194 ? 71.500  6.439   48.042  1.00 34.00 ? 191 PRO C CB    1 
ATOM   4271 C CG    . PRO B 1 194 ? 72.168  5.374   47.284  1.00 34.03 ? 191 PRO C CG    1 
ATOM   4272 C CD    . PRO B 1 194 ? 72.068  4.111   48.094  1.00 34.12 ? 191 PRO C CD    1 
ATOM   4273 N N     . GLY B 1 195 ? 68.864  4.841   47.121  1.00 32.86 ? 192 GLY C N     1 
ATOM   4274 C CA    . GLY B 1 195 ? 67.684  4.847   46.240  1.00 31.86 ? 192 GLY C CA    1 
ATOM   4275 C C     . GLY B 1 195 ? 66.641  3.837   46.683  1.00 31.37 ? 192 GLY C C     1 
ATOM   4276 O O     . GLY B 1 195 ? 66.004  4.046   47.722  1.00 31.78 ? 192 GLY C O     1 
ATOM   4277 N N     . ILE B 1 196 ? 66.439  2.764   45.904  1.00 29.82 ? 193 ILE C N     1 
ATOM   4278 C CA    . ILE B 1 196 ? 65.555  1.667   46.343  1.00 28.86 ? 193 ILE C CA    1 
ATOM   4279 C C     . ILE B 1 196 ? 66.287  0.324   46.461  1.00 28.12 ? 193 ILE C C     1 
ATOM   4280 O O     . ILE B 1 196 ? 67.356  0.111   45.884  1.00 27.52 ? 193 ILE C O     1 
ATOM   4281 C CB    . ILE B 1 196 ? 64.287  1.497   45.438  1.00 28.94 ? 193 ILE C CB    1 
ATOM   4282 C CG1   . ILE B 1 196 ? 64.639  0.900   44.074  1.00 27.93 ? 193 ILE C CG1   1 
ATOM   4283 C CG2   . ILE B 1 196 ? 63.569  2.831   45.249  1.00 28.36 ? 193 ILE C CG2   1 
ATOM   4284 C CD1   . ILE B 1 196 ? 63.439  0.537   43.222  1.00 27.73 ? 193 ILE C CD1   1 
ATOM   4285 N N     . VAL B 1 197 ? 65.687  -0.572  47.232  1.00 27.32 ? 194 VAL C N     1 
ATOM   4286 C CA    . VAL B 1 197 ? 66.175  -1.929  47.387  1.00 26.74 ? 194 VAL C CA    1 
ATOM   4287 C C     . VAL B 1 197 ? 65.074  -2.864  46.980  1.00 25.98 ? 194 VAL C C     1 
ATOM   4288 O O     . VAL B 1 197 ? 64.002  -2.856  47.590  1.00 25.73 ? 194 VAL C O     1 
ATOM   4289 C CB    . VAL B 1 197 ? 66.544  -2.254  48.844  1.00 26.68 ? 194 VAL C CB    1 
ATOM   4290 C CG1   . VAL B 1 197 ? 66.962  -3.720  48.986  1.00 25.37 ? 194 VAL C CG1   1 
ATOM   4291 C CG2   . VAL B 1 197 ? 67.642  -1.337  49.327  1.00 27.61 ? 194 VAL C CG2   1 
ATOM   4292 N N     . ILE B 1 198 ? 65.346  -3.678  45.967  1.00 25.32 ? 195 ILE C N     1 
ATOM   4293 C CA    . ILE B 1 198 ? 64.426  -4.721  45.546  1.00 24.95 ? 195 ILE C CA    1 
ATOM   4294 C C     . ILE B 1 198 ? 64.866  -6.059  46.133  1.00 24.44 ? 195 ILE C C     1 
ATOM   4295 O O     . ILE B 1 198 ? 65.929  -6.579  45.811  1.00 24.21 ? 195 ILE C O     1 
ATOM   4296 C CB    . ILE B 1 198 ? 64.342  -4.815  44.031  1.00 24.97 ? 195 ILE C CB    1 
ATOM   4297 C CG1   . ILE B 1 198 ? 63.917  -3.460  43.433  1.00 25.11 ? 195 ILE C CG1   1 
ATOM   4298 C CG2   . ILE B 1 198 ? 63.368  -5.915  43.628  1.00 24.93 ? 195 ILE C CG2   1 
ATOM   4299 C CD1   . ILE B 1 198 ? 64.111  -3.370  41.950  1.00 24.24 ? 195 ILE C CD1   1 
ATOM   4300 N N     . VAL B 1 199 ? 64.047  -6.603  47.025  1.00 24.14 ? 196 VAL C N     1 
ATOM   4301 C CA    . VAL B 1 199 ? 64.330  -7.897  47.607  1.00 24.44 ? 196 VAL C CA    1 
ATOM   4302 C C     . VAL B 1 199 ? 63.593  -8.908  46.754  1.00 24.28 ? 196 VAL C C     1 
ATOM   4303 O O     . VAL B 1 199 ? 62.366  -8.918  46.742  1.00 24.68 ? 196 VAL C O     1 
ATOM   4304 C CB    . VAL B 1 199 ? 63.898  -7.968  49.069  1.00 24.59 ? 196 VAL C CB    1 
ATOM   4305 C CG1   . VAL B 1 199 ? 64.272  -9.329  49.687  1.00 25.54 ? 196 VAL C CG1   1 
ATOM   4306 C CG2   . VAL B 1 199 ? 64.530  -6.807  49.857  1.00 24.70 ? 196 VAL C CG2   1 
ATOM   4307 N N     . ASP B 1 200 ? 64.335  -9.723  46.005  1.00 23.70 ? 197 ASP C N     1 
ATOM   4308 C CA    . ASP B 1 200 ? 63.723  -10.709 45.128  1.00 23.95 ? 197 ASP C CA    1 
ATOM   4309 C C     . ASP B 1 200 ? 63.441  -11.970 45.952  1.00 23.67 ? 197 ASP C C     1 
ATOM   4310 O O     . ASP B 1 200 ? 64.340  -12.753 46.267  1.00 22.58 ? 197 ASP C O     1 
ATOM   4311 C CB    . ASP B 1 200 ? 64.615  -10.988 43.912  1.00 24.20 ? 197 ASP C CB    1 
ATOM   4312 C CG    . ASP B 1 200 ? 63.917  -11.824 42.826  1.00 24.46 ? 197 ASP C CG    1 
ATOM   4313 O OD1   . ASP B 1 200 ? 62.900  -12.485 43.088  1.00 25.84 ? 197 ASP C OD1   1 
ATOM   4314 O OD2   . ASP B 1 200 ? 64.406  -11.833 41.679  1.00 26.15 ? 197 ASP C OD2   1 
ATOM   4315 N N     . GLU B 1 201 ? 62.170  -12.130 46.311  1.00 23.94 ? 198 GLU C N     1 
ATOM   4316 C CA    . GLU B 1 201 ? 61.708  -13.249 47.111  1.00 24.42 ? 198 GLU C CA    1 
ATOM   4317 C C     . GLU B 1 201 ? 61.005  -14.332 46.262  1.00 24.42 ? 198 GLU C C     1 
ATOM   4318 O O     . GLU B 1 201 ? 59.946  -14.847 46.648  1.00 23.93 ? 198 GLU C O     1 
ATOM   4319 C CB    . GLU B 1 201 ? 60.801  -12.720 48.230  1.00 24.38 ? 198 GLU C CB    1 
ATOM   4320 C CG    . GLU B 1 201 ? 61.580  -12.027 49.336  1.00 25.45 ? 198 GLU C CG    1 
ATOM   4321 C CD    . GLU B 1 201 ? 60.808  -11.875 50.658  1.00 26.23 ? 198 GLU C CD    1 
ATOM   4322 O OE1   . GLU B 1 201 ? 59.566  -12.030 50.681  1.00 29.82 ? 198 GLU C OE1   1 
ATOM   4323 O OE2   . GLU B 1 201 ? 61.462  -11.581 51.686  1.00 28.77 ? 198 GLU C OE2   1 
ATOM   4324 N N     . ALA B 1 202 ? 61.618  -14.691 45.123  1.00 24.15 ? 199 ALA C N     1 
ATOM   4325 C CA    . ALA B 1 202 ? 61.082  -15.741 44.231  1.00 24.00 ? 199 ALA C CA    1 
ATOM   4326 C C     . ALA B 1 202 ? 60.854  -17.087 44.947  1.00 23.83 ? 199 ALA C C     1 
ATOM   4327 O O     . ALA B 1 202 ? 59.895  -17.801 44.638  1.00 23.24 ? 199 ALA C O     1 
ATOM   4328 C CB    . ALA B 1 202 ? 61.995  -15.940 43.014  1.00 23.30 ? 199 ALA C CB    1 
ATOM   4329 N N     . TYR B 1 203 ? 61.723  -17.414 45.904  1.00 23.75 ? 200 TYR C N     1 
ATOM   4330 C CA    . TYR B 1 203 ? 61.684  -18.706 46.587  1.00 24.24 ? 200 TYR C CA    1 
ATOM   4331 C C     . TYR B 1 203 ? 61.230  -18.640 48.055  1.00 24.69 ? 200 TYR C C     1 
ATOM   4332 O O     . TYR B 1 203 ? 61.367  -19.626 48.773  1.00 24.11 ? 200 TYR C O     1 
ATOM   4333 C CB    . TYR B 1 203 ? 63.068  -19.369 46.477  1.00 23.51 ? 200 TYR C CB    1 
ATOM   4334 C CG    . TYR B 1 203 ? 63.472  -19.520 45.036  1.00 22.85 ? 200 TYR C CG    1 
ATOM   4335 C CD1   . TYR B 1 203 ? 62.895  -20.498 44.249  1.00 22.27 ? 200 TYR C CD1   1 
ATOM   4336 C CD2   . TYR B 1 203 ? 64.391  -18.648 44.443  1.00 23.00 ? 200 TYR C CD2   1 
ATOM   4337 C CE1   . TYR B 1 203 ? 63.222  -20.634 42.914  1.00 22.88 ? 200 TYR C CE1   1 
ATOM   4338 C CE2   . TYR B 1 203 ? 64.726  -18.768 43.094  1.00 22.32 ? 200 TYR C CE2   1 
ATOM   4339 C CZ    . TYR B 1 203 ? 64.136  -19.767 42.337  1.00 22.30 ? 200 TYR C CZ    1 
ATOM   4340 O OH    . TYR B 1 203 ? 64.441  -19.922 41.018  1.00 21.90 ? 200 TYR C OH    1 
ATOM   4341 N N     . ALA B 1 204 ? 60.671  -17.500 48.484  1.00 25.31 ? 201 ALA C N     1 
ATOM   4342 C CA    . ALA B 1 204 ? 60.311  -17.279 49.902  1.00 25.72 ? 201 ALA C CA    1 
ATOM   4343 C C     . ALA B 1 204 ? 59.500  -18.414 50.524  1.00 26.27 ? 201 ALA C C     1 
ATOM   4344 O O     . ALA B 1 204 ? 59.687  -18.752 51.681  1.00 26.89 ? 201 ALA C O     1 
ATOM   4345 C CB    . ALA B 1 204 ? 59.543  -15.990 50.052  1.00 25.76 ? 201 ALA C CB    1 
ATOM   4346 N N     . GLU B 1 205 ? 58.599  -18.998 49.756  1.00 26.58 ? 202 GLU C N     1 
ATOM   4347 C CA    . GLU B 1 205 ? 57.717  -20.039 50.280  1.00 26.88 ? 202 GLU C CA    1 
ATOM   4348 C C     . GLU B 1 205 ? 58.462  -21.284 50.731  1.00 27.17 ? 202 GLU C C     1 
ATOM   4349 O O     . GLU B 1 205 ? 57.924  -22.080 51.494  1.00 26.91 ? 202 GLU C O     1 
ATOM   4350 C CB    . GLU B 1 205 ? 56.681  -20.429 49.234  1.00 27.01 ? 202 GLU C CB    1 
ATOM   4351 C CG    . GLU B 1 205 ? 55.539  -19.434 49.085  1.00 27.57 ? 202 GLU C CG    1 
ATOM   4352 C CD    . GLU B 1 205 ? 55.805  -18.335 48.068  1.00 29.54 ? 202 GLU C CD    1 
ATOM   4353 O OE1   . GLU B 1 205 ? 56.920  -18.276 47.461  1.00 30.98 ? 202 GLU C OE1   1 
ATOM   4354 O OE2   . GLU B 1 205 ? 54.880  -17.522 47.877  1.00 26.37 ? 202 GLU C OE2   1 
ATOM   4355 N N     . PHE B 1 206 ? 59.696  -21.445 50.258  1.00 27.26 ? 203 PHE C N     1 
ATOM   4356 C CA    . PHE B 1 206 ? 60.517  -22.589 50.591  1.00 27.54 ? 203 PHE C CA    1 
ATOM   4357 C C     . PHE B 1 206 ? 61.360  -22.367 51.851  1.00 28.00 ? 203 PHE C C     1 
ATOM   4358 O O     . PHE B 1 206 ? 62.026  -23.285 52.323  1.00 27.38 ? 203 PHE C O     1 
ATOM   4359 C CB    . PHE B 1 206 ? 61.437  -22.916 49.412  1.00 27.32 ? 203 PHE C CB    1 
ATOM   4360 C CG    . PHE B 1 206 ? 60.709  -23.347 48.183  1.00 26.91 ? 203 PHE C CG    1 
ATOM   4361 C CD1   . PHE B 1 206 ? 60.088  -24.584 48.132  1.00 26.94 ? 203 PHE C CD1   1 
ATOM   4362 C CD2   . PHE B 1 206 ? 60.660  -22.533 47.066  1.00 27.39 ? 203 PHE C CD2   1 
ATOM   4363 C CE1   . PHE B 1 206 ? 59.424  -25.003 46.996  1.00 26.81 ? 203 PHE C CE1   1 
ATOM   4364 C CE2   . PHE B 1 206 ? 59.996  -22.949 45.922  1.00 26.89 ? 203 PHE C CE2   1 
ATOM   4365 C CZ    . PHE B 1 206 ? 59.380  -24.188 45.895  1.00 26.64 ? 203 PHE C CZ    1 
ATOM   4366 N N     . SER B 1 207 ? 61.343  -21.147 52.377  1.00 28.53 ? 204 SER C N     1 
ATOM   4367 C CA    . SER B 1 207 ? 62.026  -20.815 53.616  1.00 28.89 ? 204 SER C CA    1 
ATOM   4368 C C     . SER B 1 207 ? 61.023  -20.565 54.757  1.00 29.22 ? 204 SER C C     1 
ATOM   4369 O O     . SER B 1 207 ? 60.059  -19.822 54.576  1.00 28.81 ? 204 SER C O     1 
ATOM   4370 C CB    . SER B 1 207 ? 62.861  -19.554 53.426  1.00 29.03 ? 204 SER C CB    1 
ATOM   4371 O OG    . SER B 1 207 ? 63.702  -19.341 54.549  1.00 29.66 ? 204 SER C OG    1 
ATOM   4372 N N     . PRO B 1 208 ? 61.267  -21.160 55.938  1.00 29.14 ? 205 PRO C N     1 
ATOM   4373 C CA    . PRO B 1 208 ? 60.503  -20.832 57.140  1.00 29.64 ? 205 PRO C CA    1 
ATOM   4374 C C     . PRO B 1 208 ? 60.697  -19.383 57.592  1.00 29.70 ? 205 PRO C C     1 
ATOM   4375 O O     . PRO B 1 208 ? 59.849  -18.829 58.280  1.00 28.94 ? 205 PRO C O     1 
ATOM   4376 C CB    . PRO B 1 208 ? 61.079  -21.772 58.206  1.00 29.43 ? 205 PRO C CB    1 
ATOM   4377 C CG    . PRO B 1 208 ? 61.844  -22.791 57.491  1.00 29.66 ? 205 PRO C CG    1 
ATOM   4378 C CD    . PRO B 1 208 ? 62.286  -22.188 56.198  1.00 29.19 ? 205 PRO C CD    1 
ATOM   4379 N N     . SER B 1 209 ? 61.822  -18.799 57.211  1.00 30.04 ? 206 SER C N     1 
ATOM   4380 C CA    . SER B 1 209 ? 62.195  -17.463 57.666  1.00 30.70 ? 206 SER C CA    1 
ATOM   4381 C C     . SER B 1 209 ? 61.244  -16.375 57.153  1.00 30.59 ? 206 SER C C     1 
ATOM   4382 O O     . SER B 1 209 ? 60.601  -16.529 56.103  1.00 30.52 ? 206 SER C O     1 
ATOM   4383 C CB    . SER B 1 209 ? 63.638  -17.170 57.255  1.00 31.06 ? 206 SER C CB    1 
ATOM   4384 O OG    . SER B 1 209 ? 64.516  -18.030 57.965  1.00 33.19 ? 206 SER C OG    1 
ATOM   4385 N N     . PRO B 1 210 ? 61.123  -15.280 57.917  1.00 30.66 ? 207 PRO C N     1 
ATOM   4386 C CA    . PRO B 1 210 ? 60.126  -14.273 57.591  1.00 30.44 ? 207 PRO C CA    1 
ATOM   4387 C C     . PRO B 1 210 ? 60.406  -13.516 56.297  1.00 30.51 ? 207 PRO C C     1 
ATOM   4388 O O     . PRO B 1 210 ? 61.565  -13.385 55.881  1.00 30.56 ? 207 PRO C O     1 
ATOM   4389 C CB    . PRO B 1 210 ? 60.166  -13.324 58.795  1.00 30.73 ? 207 PRO C CB    1 
ATOM   4390 C CG    . PRO B 1 210 ? 61.468  -13.551 59.445  1.00 30.63 ? 207 PRO C CG    1 
ATOM   4391 C CD    . PRO B 1 210 ? 61.886  -14.946 59.133  1.00 30.66 ? 207 PRO C CD    1 
ATOM   4392 N N     . SER B 1 211 ? 59.330  -13.032 55.679  1.00 30.09 ? 208 SER C N     1 
ATOM   4393 C CA    . SER B 1 211 ? 59.417  -12.236 54.476  1.00 29.85 ? 208 SER C CA    1 
ATOM   4394 C C     . SER B 1 211 ? 59.829  -10.821 54.807  1.00 29.86 ? 208 SER C C     1 
ATOM   4395 O O     . SER B 1 211 ? 59.426  -10.260 55.842  1.00 29.17 ? 208 SER C O     1 
ATOM   4396 C CB    . SER B 1 211 ? 58.068  -12.199 53.749  1.00 29.97 ? 208 SER C CB    1 
ATOM   4397 O OG    . SER B 1 211 ? 58.060  -11.224 52.711  1.00 28.99 ? 208 SER C OG    1 
ATOM   4398 N N     . ALA B 1 212 ? 60.605  -10.240 53.894  1.00 29.82 ? 209 ALA C N     1 
ATOM   4399 C CA    . ALA B 1 212 ? 60.911  -8.820  53.906  1.00 29.90 ? 209 ALA C CA    1 
ATOM   4400 C C     . ALA B 1 212 ? 59.673  -7.911  53.898  1.00 29.95 ? 209 ALA C C     1 
ATOM   4401 O O     . ALA B 1 212 ? 59.797  -6.719  54.171  1.00 29.21 ? 209 ALA C O     1 
ATOM   4402 C CB    . ALA B 1 212 ? 61.832  -8.474  52.740  1.00 29.65 ? 209 ALA C CB    1 
ATOM   4403 N N     . THR B 1 213 ? 58.487  -8.450  53.582  1.00 30.52 ? 210 THR C N     1 
ATOM   4404 C CA    . THR B 1 213 ? 57.249  -7.681  53.737  1.00 30.95 ? 210 THR C CA    1 
ATOM   4405 C C     . THR B 1 213 ? 57.098  -7.122  55.162  1.00 31.16 ? 210 THR C C     1 
ATOM   4406 O O     . THR B 1 213 ? 56.507  -6.064  55.363  1.00 31.29 ? 210 THR C O     1 
ATOM   4407 C CB    . THR B 1 213 ? 55.999  -8.494  53.380  1.00 31.16 ? 210 THR C CB    1 
ATOM   4408 O OG1   . THR B 1 213 ? 55.906  -9.634  54.239  1.00 32.03 ? 210 THR C OG1   1 
ATOM   4409 C CG2   . THR B 1 213 ? 56.050  -8.944  51.931  1.00 31.53 ? 210 THR C CG2   1 
ATOM   4410 N N     . THR B 1 214 ? 57.662  -7.823  56.139  1.00 31.52 ? 211 THR C N     1 
ATOM   4411 C CA    . THR B 1 214 ? 57.674  -7.360  57.532  1.00 31.80 ? 211 THR C CA    1 
ATOM   4412 C C     . THR B 1 214 ? 58.487  -6.070  57.741  1.00 32.16 ? 211 THR C C     1 
ATOM   4413 O O     . THR B 1 214 ? 58.307  -5.384  58.747  1.00 32.23 ? 211 THR C O     1 
ATOM   4414 C CB    . THR B 1 214 ? 58.245  -8.429  58.453  1.00 31.68 ? 211 THR C CB    1 
ATOM   4415 O OG1   . THR B 1 214 ? 59.589  -8.704  58.054  1.00 32.10 ? 211 THR C OG1   1 
ATOM   4416 C CG2   . THR B 1 214 ? 57.405  -9.728  58.383  1.00 31.78 ? 211 THR C CG2   1 
ATOM   4417 N N     . LEU B 1 215 ? 59.389  -5.763  56.811  1.00 32.07 ? 212 LEU C N     1 
ATOM   4418 C CA    . LEU B 1 215 ? 60.184  -4.548  56.854  1.00 32.17 ? 212 LEU C CA    1 
ATOM   4419 C C     . LEU B 1 215 ? 59.561  -3.362  56.109  1.00 32.49 ? 212 LEU C C     1 
ATOM   4420 O O     . LEU B 1 215 ? 60.107  -2.264  56.178  1.00 32.48 ? 212 LEU C O     1 
ATOM   4421 C CB    . LEU B 1 215 ? 61.591  -4.805  56.275  1.00 31.97 ? 212 LEU C CB    1 
ATOM   4422 C CG    . LEU B 1 215 ? 62.520  -5.824  56.945  1.00 30.91 ? 212 LEU C CG    1 
ATOM   4423 C CD1   . LEU B 1 215 ? 63.889  -5.812  56.254  1.00 29.15 ? 212 LEU C CD1   1 
ATOM   4424 C CD2   . LEU B 1 215 ? 62.672  -5.544  58.426  1.00 30.51 ? 212 LEU C CD2   1 
ATOM   4425 N N     . LEU B 1 216 ? 58.442  -3.559  55.406  1.00 33.06 ? 213 LEU C N     1 
ATOM   4426 C CA    . LEU B 1 216 ? 57.856  -2.493  54.578  1.00 33.76 ? 213 LEU C CA    1 
ATOM   4427 C C     . LEU B 1 216 ? 57.356  -1.293  55.378  1.00 34.58 ? 213 LEU C C     1 
ATOM   4428 O O     . LEU B 1 216 ? 57.477  -0.153  54.926  1.00 34.36 ? 213 LEU C O     1 
ATOM   4429 C CB    . LEU B 1 216 ? 56.699  -3.017  53.707  1.00 33.47 ? 213 LEU C CB    1 
ATOM   4430 C CG    . LEU B 1 216 ? 57.070  -3.875  52.486  1.00 33.17 ? 213 LEU C CG    1 
ATOM   4431 C CD1   . LEU B 1 216 ? 55.819  -4.514  51.874  1.00 30.25 ? 213 LEU C CD1   1 
ATOM   4432 C CD2   . LEU B 1 216 ? 57.843  -3.042  51.452  1.00 31.55 ? 213 LEU C CD2   1 
ATOM   4433 N N     . GLU B 1 217 ? 56.778  -1.558  56.547  1.00 35.52 ? 214 GLU C N     1 
ATOM   4434 C CA    . GLU B 1 217 ? 56.334  -0.501  57.459  1.00 36.08 ? 214 GLU C CA    1 
ATOM   4435 C C     . GLU B 1 217 ? 57.484  0.449   57.815  1.00 36.04 ? 214 GLU C C     1 
ATOM   4436 O O     . GLU B 1 217 ? 57.321  1.666   57.797  1.00 35.60 ? 214 GLU C O     1 
ATOM   4437 C CB    . GLU B 1 217 ? 55.735  -1.105  58.740  1.00 36.03 ? 214 GLU C CB    1 
ATOM   4438 C CG    . GLU B 1 217 ? 54.891  -0.137  59.570  1.00 36.90 ? 214 GLU C CG    1 
ATOM   4439 C CD    . GLU B 1 217 ? 54.148  -0.839  60.714  1.00 38.72 ? 214 GLU C CD    1 
ATOM   4440 O OE1   . GLU B 1 217 ? 54.060  -0.259  61.826  1.00 41.71 ? 214 GLU C OE1   1 
ATOM   4441 O OE2   . GLU B 1 217 ? 53.666  -1.984  60.507  1.00 42.93 ? 214 GLU C OE2   1 
ATOM   4442 N N     . LYS B 1 218 ? 58.643  -0.129  58.101  1.00 36.29 ? 215 LYS C N     1 
ATOM   4443 C CA    . LYS B 1 218 ? 59.826  0.625   58.501  1.00 36.26 ? 215 LYS C CA    1 
ATOM   4444 C C     . LYS B 1 218 ? 60.510  1.419   57.377  1.00 36.05 ? 215 LYS C C     1 
ATOM   4445 O O     . LYS B 1 218 ? 61.087  2.474   57.650  1.00 35.87 ? 215 LYS C O     1 
ATOM   4446 C CB    . LYS B 1 218 ? 60.836  -0.334  59.134  1.00 36.64 ? 215 LYS C CB    1 
ATOM   4447 C CG    . LYS B 1 218 ? 61.939  0.332   59.965  1.00 37.37 ? 215 LYS C CG    1 
ATOM   4448 C CD    . LYS B 1 218 ? 62.603  -0.695  60.897  1.00 37.75 ? 215 LYS C CD    1 
ATOM   4449 C CE    . LYS B 1 218 ? 63.819  -0.117  61.638  1.00 39.23 ? 215 LYS C CE    1 
ATOM   4450 N NZ    . LYS B 1 218 ? 64.634  -1.196  62.285  1.00 38.72 ? 215 LYS C NZ    1 
ATOM   4451 N N     . TYR B 1 219 ? 60.486  0.916   56.137  1.00 35.48 ? 216 TYR C N     1 
ATOM   4452 C CA    . TYR B 1 219 ? 61.213  1.565   55.025  1.00 35.07 ? 216 TYR C CA    1 
ATOM   4453 C C     . TYR B 1 219 ? 60.331  1.810   53.787  1.00 34.68 ? 216 TYR C C     1 
ATOM   4454 O O     . TYR B 1 219 ? 60.622  1.320   52.698  1.00 34.42 ? 216 TYR C O     1 
ATOM   4455 C CB    . TYR B 1 219 ? 62.458  0.755   54.647  1.00 35.34 ? 216 TYR C CB    1 
ATOM   4456 C CG    . TYR B 1 219 ? 63.379  0.465   55.815  1.00 35.12 ? 216 TYR C CG    1 
ATOM   4457 C CD1   . TYR B 1 219 ? 64.343  1.391   56.220  1.00 35.45 ? 216 TYR C CD1   1 
ATOM   4458 C CD2   . TYR B 1 219 ? 63.280  -0.731  56.518  1.00 34.81 ? 216 TYR C CD2   1 
ATOM   4459 C CE1   . TYR B 1 219 ? 65.191  1.122   57.300  1.00 35.72 ? 216 TYR C CE1   1 
ATOM   4460 C CE2   . TYR B 1 219 ? 64.116  -1.009  57.596  1.00 35.81 ? 216 TYR C CE2   1 
ATOM   4461 C CZ    . TYR B 1 219 ? 65.068  -0.083  57.981  1.00 35.67 ? 216 TYR C CZ    1 
ATOM   4462 O OH    . TYR B 1 219 ? 65.891  -0.369  59.048  1.00 36.54 ? 216 TYR C OH    1 
ATOM   4463 N N     . PRO B 1 220 ? 59.264  2.610   53.948  1.00 33.98 ? 217 PRO C N     1 
ATOM   4464 C CA    . PRO B 1 220 ? 58.304  2.843   52.873  1.00 33.30 ? 217 PRO C CA    1 
ATOM   4465 C C     . PRO B 1 220 ? 58.905  3.440   51.593  1.00 32.63 ? 217 PRO C C     1 
ATOM   4466 O O     . PRO B 1 220 ? 58.428  3.143   50.511  1.00 32.68 ? 217 PRO C O     1 
ATOM   4467 C CB    . PRO B 1 220 ? 57.307  3.828   53.503  1.00 33.27 ? 217 PRO C CB    1 
ATOM   4468 C CG    . PRO B 1 220 ? 58.059  4.469   54.622  1.00 33.45 ? 217 PRO C CG    1 
ATOM   4469 C CD    . PRO B 1 220 ? 58.931  3.393   55.153  1.00 33.97 ? 217 PRO C CD    1 
ATOM   4470 N N     . THR B 1 221 ? 59.934  4.263   51.716  1.00 31.53 ? 218 THR C N     1 
ATOM   4471 C CA    . THR B 1 221 ? 60.467  5.000   50.579  1.00 31.30 ? 218 THR C CA    1 
ATOM   4472 C C     . THR B 1 221 ? 61.583  4.257   49.846  1.00 30.95 ? 218 THR C C     1 
ATOM   4473 O O     . THR B 1 221 ? 62.052  4.727   48.811  1.00 30.76 ? 218 THR C O     1 
ATOM   4474 C CB    . THR B 1 221 ? 61.048  6.363   51.025  1.00 31.26 ? 218 THR C CB    1 
ATOM   4475 O OG1   . THR B 1 221 ? 62.186  6.138   51.868  1.00 31.97 ? 218 THR C OG1   1 
ATOM   4476 C CG2   . THR B 1 221 ? 59.993  7.202   51.765  1.00 29.82 ? 218 THR C CG2   1 
ATOM   4477 N N     . LYS B 1 222 ? 62.005  3.113   50.386  1.00 30.29 ? 219 LYS C N     1 
ATOM   4478 C CA    . LYS B 1 222 ? 63.179  2.392   49.883  1.00 29.92 ? 219 LYS C CA    1 
ATOM   4479 C C     . LYS B 1 222 ? 62.918  0.940   49.428  1.00 29.19 ? 219 LYS C C     1 
ATOM   4480 O O     . LYS B 1 222 ? 63.588  0.457   48.521  1.00 28.54 ? 219 LYS C O     1 
ATOM   4481 C CB    . LYS B 1 222 ? 64.249  2.354   50.977  1.00 30.03 ? 219 LYS C CB    1 
ATOM   4482 C CG    . LYS B 1 222 ? 65.059  3.633   51.150  1.00 30.17 ? 219 LYS C CG    1 
ATOM   4483 C CD    . LYS B 1 222 ? 66.018  3.461   52.336  1.00 30.62 ? 219 LYS C CD    1 
ATOM   4484 C CE    . LYS B 1 222 ? 67.092  4.544   52.406  1.00 31.89 ? 219 LYS C CE    1 
ATOM   4485 N NZ    . LYS B 1 222 ? 68.339  4.029   53.089  1.00 32.42 ? 219 LYS C NZ    1 
ATOM   4486 N N     . LEU B 1 223 ? 61.972  0.256   50.075  1.00 28.00 ? 220 LEU C N     1 
ATOM   4487 C CA    . LEU B 1 223 ? 61.815  -1.202  49.937  1.00 27.52 ? 220 LEU C CA    1 
ATOM   4488 C C     . LEU B 1 223 ? 60.709  -1.623  48.963  1.00 27.04 ? 220 LEU C C     1 
ATOM   4489 O O     . LEU B 1 223 ? 59.562  -1.206  49.107  1.00 26.17 ? 220 LEU C O     1 
ATOM   4490 C CB    . LEU B 1 223 ? 61.529  -1.822  51.316  1.00 27.26 ? 220 LEU C CB    1 
ATOM   4491 C CG    . LEU B 1 223 ? 61.446  -3.351  51.384  1.00 27.11 ? 220 LEU C CG    1 
ATOM   4492 C CD1   . LEU B 1 223 ? 62.686  -3.980  50.763  1.00 27.96 ? 220 LEU C CD1   1 
ATOM   4493 C CD2   . LEU B 1 223 ? 61.233  -3.858  52.798  1.00 26.85 ? 220 LEU C CD2   1 
ATOM   4494 N N     . VAL B 1 224 ? 61.059  -2.465  47.987  1.00 26.55 ? 221 VAL C N     1 
ATOM   4495 C CA    . VAL B 1 224 ? 60.066  -3.230  47.206  1.00 25.97 ? 221 VAL C CA    1 
ATOM   4496 C C     . VAL B 1 224 ? 60.330  -4.751  47.307  1.00 25.78 ? 221 VAL C C     1 
ATOM   4497 O O     . VAL B 1 224 ? 61.455  -5.202  47.088  1.00 26.13 ? 221 VAL C O     1 
ATOM   4498 C CB    . VAL B 1 224 ? 60.098  -2.828  45.741  1.00 26.05 ? 221 VAL C CB    1 
ATOM   4499 C CG1   . VAL B 1 224 ? 59.159  -3.675  44.942  1.00 25.07 ? 221 VAL C CG1   1 
ATOM   4500 C CG2   . VAL B 1 224 ? 59.753  -1.357  45.578  1.00 26.13 ? 221 VAL C CG2   1 
ATOM   4501 N N     . VAL B 1 225 ? 59.297  -5.533  47.622  1.00 24.73 ? 222 VAL C N     1 
ATOM   4502 C CA    . VAL B 1 225 ? 59.414  -6.993  47.731  1.00 24.40 ? 222 VAL C CA    1 
ATOM   4503 C C     . VAL B 1 225 ? 58.809  -7.664  46.508  1.00 23.83 ? 222 VAL C C     1 
ATOM   4504 O O     . VAL B 1 225 ? 57.615  -7.587  46.294  1.00 24.00 ? 222 VAL C O     1 
ATOM   4505 C CB    . VAL B 1 225 ? 58.742  -7.534  49.014  1.00 24.23 ? 222 VAL C CB    1 
ATOM   4506 C CG1   . VAL B 1 225 ? 58.931  -9.025  49.138  1.00 24.23 ? 222 VAL C CG1   1 
ATOM   4507 C CG2   . VAL B 1 225 ? 59.309  -6.826  50.250  1.00 23.73 ? 222 VAL C CG2   1 
ATOM   4508 N N     . SER B 1 226 ? 59.666  -8.313  45.722  1.00 22.92 ? 223 SER C N     1 
ATOM   4509 C CA    . SER B 1 226 ? 59.306  -8.973  44.481  1.00 22.69 ? 223 SER C CA    1 
ATOM   4510 C C     . SER B 1 226 ? 58.962  -10.446 44.739  1.00 22.29 ? 223 SER C C     1 
ATOM   4511 O O     . SER B 1 226 ? 59.653  -11.143 45.477  1.00 22.16 ? 223 SER C O     1 
ATOM   4512 C CB    . SER B 1 226 ? 60.494  -8.919  43.516  1.00 22.40 ? 223 SER C CB    1 
ATOM   4513 O OG    . SER B 1 226 ? 60.105  -9.271  42.205  1.00 22.66 ? 223 SER C OG    1 
ATOM   4514 N N     . ARG B 1 227 ? 57.885  -10.908 44.133  1.00 21.88 ? 224 ARG C N     1 
ATOM   4515 C CA    . ARG B 1 227 ? 57.430  -12.275 44.314  1.00 21.81 ? 224 ARG C CA    1 
ATOM   4516 C C     . ARG B 1 227 ? 56.915  -12.816 42.994  1.00 21.25 ? 224 ARG C C     1 
ATOM   4517 O O     . ARG B 1 227 ? 56.673  -12.062 42.050  1.00 20.08 ? 224 ARG C O     1 
ATOM   4518 C CB    . ARG B 1 227 ? 56.278  -12.309 45.306  1.00 22.16 ? 224 ARG C CB    1 
ATOM   4519 C CG    . ARG B 1 227 ? 56.512  -11.620 46.635  1.00 23.89 ? 224 ARG C CG    1 
ATOM   4520 C CD    . ARG B 1 227 ? 57.211  -12.478 47.624  1.00 25.31 ? 224 ARG C CD    1 
ATOM   4521 N NE    . ARG B 1 227 ? 56.410  -13.645 47.999  1.00 27.35 ? 224 ARG C NE    1 
ATOM   4522 C CZ    . ARG B 1 227 ? 56.345  -14.162 49.221  1.00 26.92 ? 224 ARG C CZ    1 
ATOM   4523 N NH1   . ARG B 1 227 ? 56.997  -13.600 50.220  1.00 27.62 ? 224 ARG C NH1   1 
ATOM   4524 N NH2   . ARG B 1 227 ? 55.603  -15.241 49.440  1.00 27.10 ? 224 ARG C NH2   1 
ATOM   4525 N N     . THR B 1 228 ? 56.692  -14.125 42.953  1.00 20.68 ? 225 THR C N     1 
ATOM   4526 C CA    . THR B 1 228 ? 56.225  -14.775 41.750  1.00 20.81 ? 225 THR C CA    1 
ATOM   4527 C C     . THR B 1 228 ? 55.368  -15.999 42.051  1.00 20.43 ? 225 THR C C     1 
ATOM   4528 O O     . THR B 1 228 ? 55.475  -16.600 43.124  1.00 18.76 ? 225 THR C O     1 
ATOM   4529 C CB    . THR B 1 228 ? 57.389  -15.268 40.869  1.00 20.59 ? 225 THR C CB    1 
ATOM   4530 O OG1   . THR B 1 228 ? 56.866  -15.854 39.669  1.00 20.16 ? 225 THR C OG1   1 
ATOM   4531 C CG2   . THR B 1 228 ? 58.160  -16.300 41.581  1.00 19.37 ? 225 THR C CG2   1 
ATOM   4532 N N     . MET B 1 229 ? 54.547  -16.351 41.063  1.00 20.57 ? 226 MET C N     1 
ATOM   4533 C CA    . MET B 1 229 ? 53.754  -17.570 41.082  1.00 21.51 ? 226 MET C CA    1 
ATOM   4534 C C     . MET B 1 229 ? 54.412  -18.702 40.280  1.00 21.33 ? 226 MET C C     1 
ATOM   4535 O O     . MET B 1 229 ? 53.845  -19.776 40.154  1.00 20.91 ? 226 MET C O     1 
ATOM   4536 C CB    . MET B 1 229 ? 52.339  -17.282 40.562  1.00 21.51 ? 226 MET C CB    1 
ATOM   4537 C CG    . MET B 1 229 ? 51.544  -16.283 41.426  1.00 22.61 ? 226 MET C CG    1 
ATOM   4538 S SD    . MET B 1 229 ? 49.786  -16.108 40.977  1.00 24.58 ? 226 MET C SD    1 
ATOM   4539 C CE    . MET B 1 229 ? 49.210  -17.768 41.461  1.00 19.50 ? 226 MET C CE    1 
ATOM   4540 N N     . SER B 1 230 ? 55.618  -18.469 39.762  1.00 21.17 ? 227 SER C N     1 
ATOM   4541 C CA    . SER B 1 230 ? 56.276  -19.413 38.884  1.00 21.72 ? 227 SER C CA    1 
ATOM   4542 C C     . SER B 1 230 ? 56.915  -20.620 39.586  1.00 22.27 ? 227 SER C C     1 
ATOM   4543 O O     . SER B 1 230 ? 57.159  -21.636 38.935  1.00 22.82 ? 227 SER C O     1 
ATOM   4544 C CB    . SER B 1 230 ? 57.352  -18.698 38.044  1.00 21.58 ? 227 SER C CB    1 
ATOM   4545 O OG    . SER B 1 230 ? 56.792  -17.646 37.277  1.00 21.65 ? 227 SER C OG    1 
HETATM 4546 N N1    . LLP B 1 231 ? 63.621  -14.155 40.655  1.00 21.17 ? 228 LLP C N1    1 
HETATM 4547 C C2    . LLP B 1 231 ? 64.454  -15.242 40.709  1.00 22.07 ? 228 LLP C C2    1 
HETATM 4548 C "C2'" . LLP B 1 231 ? 65.748  -15.107 41.464  1.00 23.49 ? 228 LLP C "C2'" 1 
HETATM 4549 C C3    . LLP B 1 231 ? 64.096  -16.437 40.079  1.00 23.39 ? 228 LLP C C3    1 
HETATM 4550 O O3    . LLP B 1 231 ? 64.856  -17.400 40.111  1.00 21.65 ? 228 LLP C O3    1 
HETATM 4551 C C4    . LLP B 1 231 ? 62.875  -16.531 39.396  1.00 23.86 ? 228 LLP C C4    1 
HETATM 4552 C "C4'" . LLP B 1 231 ? 62.484  -17.821 38.706  1.00 24.69 ? 228 LLP C "C4'" 1 
HETATM 4553 C C5    . LLP B 1 231 ? 62.039  -15.408 39.367  1.00 24.12 ? 228 LLP C C5    1 
HETATM 4554 C C6    . LLP B 1 231 ? 62.418  -14.217 39.999  1.00 23.56 ? 228 LLP C C6    1 
HETATM 4555 C "C5'" . LLP B 1 231 ? 60.706  -15.430 38.690  1.00 24.41 ? 228 LLP C "C5'" 1 
HETATM 4556 O OP4   . LLP B 1 231 ? 60.581  -15.277 37.280  1.00 22.87 ? 228 LLP C OP4   1 
HETATM 4557 P P     . LLP B 1 231 ? 59.151  -15.123 36.624  1.00 24.12 ? 228 LLP C P     1 
HETATM 4558 O OP1   . LLP B 1 231 ? 58.962  -16.509 36.145  1.00 18.88 ? 228 LLP C OP1   1 
HETATM 4559 O OP2   . LLP B 1 231 ? 58.139  -14.665 37.598  1.00 23.21 ? 228 LLP C OP2   1 
HETATM 4560 O OP3   . LLP B 1 231 ? 59.476  -14.081 35.643  1.00 18.54 ? 228 LLP C OP3   1 
HETATM 4561 N N     . LLP B 1 231 ? 57.196  -20.520 40.887  1.00 22.42 ? 228 LLP C N     1 
HETATM 4562 C CA    . LLP B 1 231 ? 57.977  -21.547 41.568  1.00 22.87 ? 228 LLP C CA    1 
HETATM 4563 C CB    . LLP B 1 231 ? 59.224  -20.915 42.184  1.00 22.55 ? 228 LLP C CB    1 
HETATM 4564 C CG    . LLP B 1 231 ? 59.990  -19.998 41.217  1.00 23.73 ? 228 LLP C CG    1 
HETATM 4565 C CD    . LLP B 1 231 ? 60.696  -20.753 40.096  1.00 22.97 ? 228 LLP C CD    1 
HETATM 4566 C CE    . LLP B 1 231 ? 61.222  -19.854 38.975  1.00 23.62 ? 228 LLP C CE    1 
HETATM 4567 N NZ    . LLP B 1 231 ? 61.616  -18.501 39.481  1.00 26.24 ? 228 LLP C NZ    1 
HETATM 4568 C C     . LLP B 1 231 ? 57.139  -22.362 42.573  1.00 23.03 ? 228 LLP C C     1 
HETATM 4569 O O     . LLP B 1 231 ? 56.463  -23.308 42.175  1.00 23.03 ? 228 LLP C O     1 
ATOM   4570 N N     . ALA B 1 232 ? 57.165  -22.012 43.855  1.00 23.31 ? 229 ALA C N     1 
ATOM   4571 C CA    . ALA B 1 232 ? 56.322  -22.703 44.827  1.00 23.40 ? 229 ALA C CA    1 
ATOM   4572 C C     . ALA B 1 232 ? 54.867  -22.802 44.332  1.00 22.97 ? 229 ALA C C     1 
ATOM   4573 O O     . ALA B 1 232 ? 54.237  -23.828 44.494  1.00 22.98 ? 229 ALA C O     1 
ATOM   4574 C CB    . ALA B 1 232 ? 56.393  -22.011 46.177  1.00 22.97 ? 229 ALA C CB    1 
ATOM   4575 N N     . PHE B 1 233 ? 54.377  -21.749 43.688  1.00 23.03 ? 230 PHE C N     1 
ATOM   4576 C CA    . PHE B 1 233 ? 52.957  -21.634 43.270  1.00 23.06 ? 230 PHE C CA    1 
ATOM   4577 C C     . PHE B 1 233 ? 52.623  -22.332 41.962  1.00 22.95 ? 230 PHE C C     1 
ATOM   4578 O O     . PHE B 1 233 ? 51.481  -22.258 41.513  1.00 22.93 ? 230 PHE C O     1 
ATOM   4579 C CB    . PHE B 1 233 ? 52.557  -20.158 43.137  1.00 23.26 ? 230 PHE C CB    1 
ATOM   4580 C CG    . PHE B 1 233 ? 51.486  -19.705 44.098  1.00 23.48 ? 230 PHE C CG    1 
ATOM   4581 C CD1   . PHE B 1 233 ? 50.225  -20.291 44.083  1.00 24.91 ? 230 PHE C CD1   1 
ATOM   4582 C CD2   . PHE B 1 233 ? 51.719  -18.655 44.970  1.00 22.83 ? 230 PHE C CD2   1 
ATOM   4583 C CE1   . PHE B 1 233 ? 49.220  -19.850 44.949  1.00 23.98 ? 230 PHE C CE1   1 
ATOM   4584 C CE2   . PHE B 1 233 ? 50.722  -18.207 45.836  1.00 23.51 ? 230 PHE C CE2   1 
ATOM   4585 C CZ    . PHE B 1 233 ? 49.475  -18.797 45.824  1.00 22.72 ? 230 PHE C CZ    1 
ATOM   4586 N N     . ASP B 1 234 ? 53.615  -22.963 41.331  1.00 23.19 ? 231 ASP C N     1 
ATOM   4587 C CA    . ASP B 1 234 ? 53.356  -24.064 40.421  1.00 23.03 ? 231 ASP C CA    1 
ATOM   4588 C C     . ASP B 1 234 ? 52.647  -23.579 39.154  1.00 23.03 ? 231 ASP C C     1 
ATOM   4589 O O     . ASP B 1 234 ? 51.858  -24.300 38.551  1.00 22.57 ? 231 ASP C O     1 
ATOM   4590 C CB    . ASP B 1 234 ? 52.516  -25.093 41.200  1.00 24.16 ? 231 ASP C CB    1 
ATOM   4591 C CG    . ASP B 1 234 ? 52.440  -26.447 40.534  1.00 24.23 ? 231 ASP C CG    1 
ATOM   4592 O OD1   . ASP B 1 234 ? 53.465  -26.962 40.061  1.00 26.65 ? 231 ASP C OD1   1 
ATOM   4593 O OD2   . ASP B 1 234 ? 51.320  -26.998 40.512  1.00 29.68 ? 231 ASP C OD2   1 
ATOM   4594 N N     . PHE B 1 235 ? 52.954  -22.348 38.751  1.00 22.36 ? 232 PHE C N     1 
ATOM   4595 C CA    . PHE B 1 235 ? 52.204  -21.661 37.716  1.00 22.72 ? 232 PHE C CA    1 
ATOM   4596 C C     . PHE B 1 235 ? 53.099  -20.830 36.803  1.00 21.83 ? 232 PHE C C     1 
ATOM   4597 O O     . PHE B 1 235 ? 52.668  -19.805 36.309  1.00 21.29 ? 232 PHE C O     1 
ATOM   4598 C CB    . PHE B 1 235 ? 51.139  -20.745 38.385  1.00 24.21 ? 232 PHE C CB    1 
ATOM   4599 C CG    . PHE B 1 235 ? 49.857  -20.620 37.606  1.00 25.65 ? 232 PHE C CG    1 
ATOM   4600 C CD1   . PHE B 1 235 ? 49.062  -21.733 37.377  1.00 27.77 ? 232 PHE C CD1   1 
ATOM   4601 C CD2   . PHE B 1 235 ? 49.416  -19.389 37.144  1.00 27.61 ? 232 PHE C CD2   1 
ATOM   4602 C CE1   . PHE B 1 235 ? 47.862  -21.627 36.679  1.00 27.67 ? 232 PHE C CE1   1 
ATOM   4603 C CE2   . PHE B 1 235 ? 48.216  -19.281 36.433  1.00 27.46 ? 232 PHE C CE2   1 
ATOM   4604 C CZ    . PHE B 1 235 ? 47.443  -20.399 36.206  1.00 27.09 ? 232 PHE C CZ    1 
ATOM   4605 N N     . ALA B 1 236 ? 54.324  -21.291 36.551  1.00 21.22 ? 233 ALA C N     1 
ATOM   4606 C CA    . ALA B 1 236 ? 55.266  -20.583 35.666  1.00 21.12 ? 233 ALA C CA    1 
ATOM   4607 C C     . ALA B 1 236 ? 54.680  -20.299 34.294  1.00 21.11 ? 233 ALA C C     1 
ATOM   4608 O O     . ALA B 1 236 ? 54.909  -19.221 33.722  1.00 22.16 ? 233 ALA C O     1 
ATOM   4609 C CB    . ALA B 1 236 ? 56.586  -21.355 35.531  1.00 20.52 ? 233 ALA C CB    1 
ATOM   4610 N N     . GLY B 1 237 ? 53.874  -21.216 33.780  1.00 21.08 ? 234 GLY C N     1 
ATOM   4611 C CA    . GLY B 1 237 ? 53.231  -21.029 32.476  1.00 21.21 ? 234 GLY C CA    1 
ATOM   4612 C C     . GLY B 1 237 ? 52.149  -19.972 32.410  1.00 21.54 ? 234 GLY C C     1 
ATOM   4613 O O     . GLY B 1 237 ? 51.691  -19.630 31.313  1.00 21.53 ? 234 GLY C O     1 
ATOM   4614 N N     . GLY B 1 238 ? 51.701  -19.477 33.573  1.00 21.84 ? 235 GLY C N     1 
ATOM   4615 C CA    . GLY B 1 238 ? 50.732  -18.378 33.631  1.00 21.31 ? 235 GLY C CA    1 
ATOM   4616 C C     . GLY B 1 238 ? 51.406  -17.005 33.655  1.00 21.66 ? 235 GLY C C     1 
ATOM   4617 O O     . GLY B 1 238 ? 50.728  -15.976 33.554  1.00 21.62 ? 235 GLY C O     1 
ATOM   4618 N N     . ARG B 1 239 ? 52.733  -16.993 33.788  1.00 21.30 ? 236 ARG C N     1 
ATOM   4619 C CA    . ARG B 1 239 ? 53.524  -15.759 33.776  1.00 21.01 ? 236 ARG C CA    1 
ATOM   4620 C C     . ARG B 1 239 ? 52.854  -14.676 34.639  1.00 20.78 ? 236 ARG C C     1 
ATOM   4621 O O     . ARG B 1 239 ? 52.196  -13.772 34.124  1.00 21.18 ? 236 ARG C O     1 
ATOM   4622 C CB    . ARG B 1 239 ? 53.727  -15.239 32.345  1.00 21.10 ? 236 ARG C CB    1 
ATOM   4623 C CG    . ARG B 1 239 ? 54.221  -16.264 31.310  1.00 20.50 ? 236 ARG C CG    1 
ATOM   4624 C CD    . ARG B 1 239 ? 55.558  -16.854 31.660  1.00 18.75 ? 236 ARG C CD    1 
ATOM   4625 N NE    . ARG B 1 239 ? 56.518  -15.801 31.937  1.00 19.16 ? 236 ARG C NE    1 
ATOM   4626 C CZ    . ARG B 1 239 ? 57.176  -15.633 33.080  1.00 19.45 ? 236 ARG C CZ    1 
ATOM   4627 N NH1   . ARG B 1 239 ? 57.027  -16.467 34.089  1.00 21.78 ? 236 ARG C NH1   1 
ATOM   4628 N NH2   . ARG B 1 239 ? 58.019  -14.625 33.200  1.00 20.58 ? 236 ARG C NH2   1 
ATOM   4629 N N     . LEU B 1 240 ? 53.008  -14.792 35.949  1.00 20.24 ? 237 LEU C N     1 
ATOM   4630 C CA    . LEU B 1 240 ? 52.408  -13.860 36.885  1.00 20.57 ? 237 LEU C CA    1 
ATOM   4631 C C     . LEU B 1 240 ? 53.381  -13.580 38.006  1.00 20.33 ? 237 LEU C C     1 
ATOM   4632 O O     . LEU B 1 240 ? 53.618  -14.429 38.857  1.00 20.53 ? 237 LEU C O     1 
ATOM   4633 C CB    . LEU B 1 240 ? 51.105  -14.442 37.458  1.00 20.45 ? 237 LEU C CB    1 
ATOM   4634 C CG    . LEU B 1 240 ? 50.121  -13.403 38.014  1.00 20.16 ? 237 LEU C CG    1 
ATOM   4635 C CD1   . LEU B 1 240 ? 50.693  -12.630 39.202  1.00 18.38 ? 237 LEU C CD1   1 
ATOM   4636 C CD2   . LEU B 1 240 ? 49.631  -12.462 36.876  1.00 19.16 ? 237 LEU C CD2   1 
ATOM   4637 N N     . GLY B 1 241 ? 53.967  -12.397 37.980  1.00 20.53 ? 238 GLY C N     1 
ATOM   4638 C CA    . GLY B 1 241 ? 54.832  -11.932 39.052  1.00 20.91 ? 238 GLY C CA    1 
ATOM   4639 C C     . GLY B 1 241 ? 54.202  -10.705 39.671  1.00 20.89 ? 238 GLY C C     1 
ATOM   4640 O O     . GLY B 1 241 ? 53.334  -10.080 39.075  1.00 21.22 ? 238 GLY C O     1 
ATOM   4641 N N     . TYR B 1 242 ? 54.624  -10.367 40.874  1.00 20.74 ? 239 TYR C N     1 
ATOM   4642 C CA    . TYR B 1 242 ? 54.048  -9.234  41.566  1.00 21.11 ? 239 TYR C CA    1 
ATOM   4643 C C     . TYR B 1 242 ? 55.007  -8.682  42.582  1.00 21.47 ? 239 TYR C C     1 
ATOM   4644 O O     . TYR B 1 242 ? 55.976  -9.329  42.915  1.00 20.84 ? 239 TYR C O     1 
ATOM   4645 C CB    . TYR B 1 242 ? 52.737  -9.638  42.255  1.00 20.81 ? 239 TYR C CB    1 
ATOM   4646 C CG    . TYR B 1 242 ? 52.843  -10.705 43.330  1.00 20.53 ? 239 TYR C CG    1 
ATOM   4647 C CD1   . TYR B 1 242 ? 52.877  -12.060 42.999  1.00 21.33 ? 239 TYR C CD1   1 
ATOM   4648 C CD2   . TYR B 1 242 ? 52.860  -10.361 44.680  1.00 19.40 ? 239 TYR C CD2   1 
ATOM   4649 C CE1   . TYR B 1 242 ? 52.940  -13.039 43.978  1.00 20.47 ? 239 TYR C CE1   1 
ATOM   4650 C CE2   . TYR B 1 242 ? 52.925  -11.317 45.660  1.00 19.90 ? 239 TYR C CE2   1 
ATOM   4651 C CZ    . TYR B 1 242 ? 52.959  -12.669 45.310  1.00 20.79 ? 239 TYR C CZ    1 
ATOM   4652 O OH    . TYR B 1 242 ? 53.034  -13.631 46.288  1.00 18.84 ? 239 TYR C OH    1 
ATOM   4653 N N     . PHE B 1 243 ? 54.758  -7.458  43.036  1.00 22.39 ? 240 PHE C N     1 
ATOM   4654 C CA    . PHE B 1 243 ? 55.497  -6.934  44.160  1.00 22.82 ? 240 PHE C CA    1 
ATOM   4655 C C     . PHE B 1 243 ? 54.564  -6.431  45.239  1.00 22.93 ? 240 PHE C C     1 
ATOM   4656 O O     . PHE B 1 243 ? 53.386  -6.235  45.007  1.00 22.44 ? 240 PHE C O     1 
ATOM   4657 C CB    . PHE B 1 243 ? 56.565  -5.897  43.757  1.00 23.25 ? 240 PHE C CB    1 
ATOM   4658 C CG    . PHE B 1 243 ? 56.033  -4.539  43.345  1.00 23.78 ? 240 PHE C CG    1 
ATOM   4659 C CD1   . PHE B 1 243 ? 55.598  -3.619  44.295  1.00 24.82 ? 240 PHE C CD1   1 
ATOM   4660 C CD2   . PHE B 1 243 ? 56.049  -4.151  42.016  1.00 23.73 ? 240 PHE C CD2   1 
ATOM   4661 C CE1   . PHE B 1 243 ? 55.149  -2.358  43.914  1.00 23.91 ? 240 PHE C CE1   1 
ATOM   4662 C CE2   . PHE B 1 243 ? 55.606  -2.886  41.632  1.00 23.31 ? 240 PHE C CE2   1 
ATOM   4663 C CZ    . PHE B 1 243 ? 55.144  -2.001  42.582  1.00 23.59 ? 240 PHE C CZ    1 
ATOM   4664 N N     . VAL B 1 244 ? 55.123  -6.312  46.439  1.00 23.38 ? 241 VAL C N     1 
ATOM   4665 C CA    . VAL B 1 244 ? 54.452  -5.739  47.583  1.00 23.62 ? 241 VAL C CA    1 
ATOM   4666 C C     . VAL B 1 244 ? 55.295  -4.548  48.045  1.00 24.01 ? 241 VAL C C     1 
ATOM   4667 O O     . VAL B 1 244 ? 56.495  -4.677  48.268  1.00 23.56 ? 241 VAL C O     1 
ATOM   4668 C CB    . VAL B 1 244 ? 54.311  -6.730  48.757  1.00 23.61 ? 241 VAL C CB    1 
ATOM   4669 C CG1   . VAL B 1 244 ? 53.380  -6.147  49.798  1.00 22.82 ? 241 VAL C CG1   1 
ATOM   4670 C CG2   . VAL B 1 244 ? 53.795  -8.106  48.273  1.00 22.03 ? 241 VAL C CG2   1 
ATOM   4671 N N     . ALA B 1 245 ? 54.652  -3.393  48.184  1.00 24.54 ? 242 ALA C N     1 
ATOM   4672 C CA    . ALA B 1 245 ? 55.333  -2.175  48.566  1.00 24.79 ? 242 ALA C CA    1 
ATOM   4673 C C     . ALA B 1 245 ? 54.334  -1.146  49.099  1.00 25.14 ? 242 ALA C C     1 
ATOM   4674 O O     . ALA B 1 245 ? 53.143  -1.421  49.209  1.00 25.34 ? 242 ALA C O     1 
ATOM   4675 C CB    . ALA B 1 245 ? 56.104  -1.623  47.387  1.00 24.05 ? 242 ALA C CB    1 
ATOM   4676 N N     . ASN B 1 246 ? 54.845  0.027   49.457  1.00 26.04 ? 243 ASN C N     1 
ATOM   4677 C CA    . ASN B 1 246 ? 54.009  1.192   49.772  1.00 26.14 ? 243 ASN C CA    1 
ATOM   4678 C C     . ASN B 1 246 ? 53.195  1.606   48.542  1.00 26.29 ? 243 ASN C C     1 
ATOM   4679 O O     . ASN B 1 246 ? 53.700  1.552   47.426  1.00 26.37 ? 243 ASN C O     1 
ATOM   4680 C CB    . ASN B 1 246 ? 54.896  2.344   50.227  1.00 26.26 ? 243 ASN C CB    1 
ATOM   4681 C CG    . ASN B 1 246 ? 54.106  3.537   50.743  1.00 26.65 ? 243 ASN C CG    1 
ATOM   4682 O OD1   . ASN B 1 246 ? 53.571  4.329   49.962  1.00 26.97 ? 243 ASN C OD1   1 
ATOM   4683 N ND2   . ASN B 1 246 ? 54.044  3.677   52.062  1.00 26.80 ? 243 ASN C ND2   1 
ATOM   4684 N N     . PRO B 1 247 ? 51.932  2.023   48.735  1.00 26.41 ? 244 PRO C N     1 
ATOM   4685 C CA    . PRO B 1 247 ? 51.125  2.440   47.592  1.00 27.01 ? 244 PRO C CA    1 
ATOM   4686 C C     . PRO B 1 247 ? 51.752  3.452   46.638  1.00 27.10 ? 244 PRO C C     1 
ATOM   4687 O O     . PRO B 1 247 ? 51.390  3.470   45.474  1.00 27.36 ? 244 PRO C O     1 
ATOM   4688 C CB    . PRO B 1 247 ? 49.864  3.038   48.256  1.00 26.98 ? 244 PRO C CB    1 
ATOM   4689 C CG    . PRO B 1 247 ? 49.756  2.318   49.536  1.00 26.28 ? 244 PRO C CG    1 
ATOM   4690 C CD    . PRO B 1 247 ? 51.165  2.113   49.995  1.00 26.72 ? 244 PRO C CD    1 
ATOM   4691 N N     . ALA B 1 248 ? 52.648  4.311   47.119  1.00 27.55 ? 245 ALA C N     1 
ATOM   4692 C CA    . ALA B 1 248 ? 53.337  5.253   46.227  1.00 27.81 ? 245 ALA C CA    1 
ATOM   4693 C C     . ALA B 1 248 ? 54.048  4.558   45.062  1.00 28.01 ? 245 ALA C C     1 
ATOM   4694 O O     . ALA B 1 248 ? 54.121  5.097   43.955  1.00 28.54 ? 245 ALA C O     1 
ATOM   4695 C CB    . ALA B 1 248 ? 54.336  6.100   47.005  1.00 27.42 ? 245 ALA C CB    1 
ATOM   4696 N N     . PHE B 1 249 ? 54.603  3.380   45.319  1.00 28.34 ? 246 PHE C N     1 
ATOM   4697 C CA    . PHE B 1 249 ? 55.320  2.627   44.277  1.00 28.24 ? 246 PHE C CA    1 
ATOM   4698 C C     . PHE B 1 249 ? 54.403  2.148   43.152  1.00 28.15 ? 246 PHE C C     1 
ATOM   4699 O O     . PHE B 1 249 ? 54.840  2.066   42.001  1.00 27.40 ? 246 PHE C O     1 
ATOM   4700 C CB    . PHE B 1 249 ? 56.066  1.430   44.875  1.00 27.98 ? 246 PHE C CB    1 
ATOM   4701 C CG    . PHE B 1 249 ? 57.398  1.783   45.466  1.00 27.78 ? 246 PHE C CG    1 
ATOM   4702 C CD1   . PHE B 1 249 ? 58.502  1.966   44.643  1.00 27.42 ? 246 PHE C CD1   1 
ATOM   4703 C CD2   . PHE B 1 249 ? 57.554  1.922   46.841  1.00 26.75 ? 246 PHE C CD2   1 
ATOM   4704 C CE1   . PHE B 1 249 ? 59.742  2.291   45.173  1.00 27.21 ? 246 PHE C CE1   1 
ATOM   4705 C CE2   . PHE B 1 249 ? 58.798  2.245   47.382  1.00 27.45 ? 246 PHE C CE2   1 
ATOM   4706 C CZ    . PHE B 1 249 ? 59.896  2.427   46.539  1.00 26.98 ? 246 PHE C CZ    1 
ATOM   4707 N N     . ILE B 1 250 ? 53.155  1.819   43.497  1.00 28.17 ? 247 ILE C N     1 
ATOM   4708 C CA    . ILE B 1 250 ? 52.165  1.378   42.515  1.00 28.69 ? 247 ILE C CA    1 
ATOM   4709 C C     . ILE B 1 250 ? 51.832  2.562   41.621  1.00 28.94 ? 247 ILE C C     1 
ATOM   4710 O O     . ILE B 1 250 ? 51.733  2.414   40.410  1.00 28.79 ? 247 ILE C O     1 
ATOM   4711 C CB    . ILE B 1 250 ? 50.855  0.827   43.158  1.00 28.75 ? 247 ILE C CB    1 
ATOM   4712 C CG1   . ILE B 1 250 ? 51.062  -0.561  43.757  1.00 28.78 ? 247 ILE C CG1   1 
ATOM   4713 C CG2   . ILE B 1 250 ? 49.745  0.712   42.105  1.00 27.97 ? 247 ILE C CG2   1 
ATOM   4714 C CD1   . ILE B 1 250 ? 52.142  -0.653  44.820  1.00 27.68 ? 247 ILE C CD1   1 
ATOM   4715 N N     . ASP B 1 251 ? 51.697  3.749   42.214  1.00 29.43 ? 248 ASP C N     1 
ATOM   4716 C CA    . ASP B 1 251 ? 51.512  4.975   41.423  1.00 29.57 ? 248 ASP C CA    1 
ATOM   4717 C C     . ASP B 1 251 ? 52.684  5.182   40.479  1.00 29.26 ? 248 ASP C C     1 
ATOM   4718 O O     . ASP B 1 251 ? 52.497  5.519   39.313  1.00 29.04 ? 248 ASP C O     1 
ATOM   4719 C CB    . ASP B 1 251 ? 51.368  6.200   42.329  1.00 30.25 ? 248 ASP C CB    1 
ATOM   4720 C CG    . ASP B 1 251 ? 50.150  6.114   43.249  1.00 32.17 ? 248 ASP C CG    1 
ATOM   4721 O OD1   . ASP B 1 251 ? 49.183  5.389   42.912  1.00 33.96 ? 248 ASP C OD1   1 
ATOM   4722 O OD2   . ASP B 1 251 ? 50.168  6.776   44.312  1.00 36.22 ? 248 ASP C OD2   1 
ATOM   4723 N N     . ALA B 1 252 ? 53.888  4.965   40.994  1.00 29.10 ? 249 ALA C N     1 
ATOM   4724 C CA    . ALA B 1 252 ? 55.120  5.081   40.194  1.00 28.97 ? 249 ALA C CA    1 
ATOM   4725 C C     . ALA B 1 252 ? 55.083  4.200   38.935  1.00 28.92 ? 249 ALA C C     1 
ATOM   4726 O O     . ALA B 1 252 ? 55.262  4.698   37.824  1.00 28.78 ? 249 ALA C O     1 
ATOM   4727 C CB    . ALA B 1 252 ? 56.322  4.742   41.045  1.00 28.26 ? 249 ALA C CB    1 
ATOM   4728 N N     . VAL B 1 253 ? 54.814  2.904   39.107  1.00 28.74 ? 250 VAL C N     1 
ATOM   4729 C CA    . VAL B 1 253 ? 54.918  1.950   37.995  1.00 28.92 ? 250 VAL C CA    1 
ATOM   4730 C C     . VAL B 1 253 ? 53.762  2.087   37.013  1.00 29.08 ? 250 VAL C C     1 
ATOM   4731 O O     . VAL B 1 253 ? 53.874  1.656   35.867  1.00 28.39 ? 250 VAL C O     1 
ATOM   4732 C CB    . VAL B 1 253 ? 55.042  0.471   38.476  1.00 28.58 ? 250 VAL C CB    1 
ATOM   4733 C CG1   . VAL B 1 253 ? 56.353  0.268   39.244  1.00 28.24 ? 250 VAL C CG1   1 
ATOM   4734 C CG2   . VAL B 1 253 ? 53.851  0.087   39.316  1.00 28.16 ? 250 VAL C CG2   1 
ATOM   4735 N N     . MET B 1 254 ? 52.661  2.695   37.456  1.00 29.35 ? 251 MET C N     1 
ATOM   4736 C CA    . MET B 1 254 ? 51.536  2.966   36.569  1.00 29.97 ? 251 MET C CA    1 
ATOM   4737 C C     . MET B 1 254 ? 51.903  3.987   35.505  1.00 29.47 ? 251 MET C C     1 
ATOM   4738 O O     . MET B 1 254 ? 51.285  4.036   34.449  1.00 29.47 ? 251 MET C O     1 
ATOM   4739 C CB    . MET B 1 254 ? 50.281  3.376   37.356  1.00 30.08 ? 251 MET C CB    1 
ATOM   4740 C CG    . MET B 1 254 ? 49.522  2.152   37.890  1.00 31.30 ? 251 MET C CG    1 
ATOM   4741 S SD    . MET B 1 254 ? 48.000  2.475   38.820  1.00 33.05 ? 251 MET C SD    1 
ATOM   4742 C CE    . MET B 1 254 ? 46.874  2.642   37.438  1.00 32.55 ? 251 MET C CE    1 
ATOM   4743 N N     . LEU B 1 255 ? 52.938  4.775   35.770  1.00 29.61 ? 252 LEU C N     1 
ATOM   4744 C CA    . LEU B 1 255 ? 53.435  5.746   34.799  1.00 29.19 ? 252 LEU C CA    1 
ATOM   4745 C C     . LEU B 1 255 ? 54.241  5.086   33.681  1.00 28.82 ? 252 LEU C C     1 
ATOM   4746 O O     . LEU B 1 255 ? 54.394  5.675   32.622  1.00 29.05 ? 252 LEU C O     1 
ATOM   4747 C CB    . LEU B 1 255 ? 54.275  6.817   35.499  1.00 29.12 ? 252 LEU C CB    1 
ATOM   4748 C CG    . LEU B 1 255 ? 53.543  7.648   36.563  1.00 29.19 ? 252 LEU C CG    1 
ATOM   4749 C CD1   . LEU B 1 255 ? 54.462  8.713   37.129  1.00 29.83 ? 252 LEU C CD1   1 
ATOM   4750 C CD2   . LEU B 1 255 ? 52.283  8.301   36.002  1.00 28.68 ? 252 LEU C CD2   1 
ATOM   4751 N N     . VAL B 1 256 ? 54.746  3.877   33.912  1.00 28.09 ? 253 VAL C N     1 
ATOM   4752 C CA    . VAL B 1 256 ? 55.634  3.205   32.943  1.00 27.63 ? 253 VAL C CA    1 
ATOM   4753 C C     . VAL B 1 256 ? 55.049  1.923   32.354  1.00 27.19 ? 253 VAL C C     1 
ATOM   4754 O O     . VAL B 1 256 ? 55.514  1.444   31.319  1.00 27.10 ? 253 VAL C O     1 
ATOM   4755 C CB    . VAL B 1 256 ? 57.022  2.886   33.568  1.00 27.56 ? 253 VAL C CB    1 
ATOM   4756 C CG1   . VAL B 1 256 ? 57.632  4.142   34.170  1.00 26.98 ? 253 VAL C CG1   1 
ATOM   4757 C CG2   . VAL B 1 256 ? 56.913  1.782   34.632  1.00 27.74 ? 253 VAL C CG2   1 
ATOM   4758 N N     . ARG B 1 257 ? 54.034  1.359   33.001  1.00 26.32 ? 254 ARG C N     1 
ATOM   4759 C CA    . ARG B 1 257 ? 53.509  0.082   32.560  1.00 25.74 ? 254 ARG C CA    1 
ATOM   4760 C C     . ARG B 1 257 ? 52.772  0.278   31.239  1.00 25.55 ? 254 ARG C C     1 
ATOM   4761 O O     . ARG B 1 257 ? 52.234  1.354   30.969  1.00 25.33 ? 254 ARG C O     1 
ATOM   4762 C CB    . ARG B 1 257 ? 52.609  -0.540  33.639  1.00 25.74 ? 254 ARG C CB    1 
ATOM   4763 C CG    . ARG B 1 257 ? 51.366  0.260   34.013  1.00 25.35 ? 254 ARG C CG    1 
ATOM   4764 C CD    . ARG B 1 257 ? 50.176  -0.128  33.173  1.00 25.25 ? 254 ARG C CD    1 
ATOM   4765 N NE    . ARG B 1 257 ? 49.019  0.714   33.437  1.00 25.34 ? 254 ARG C NE    1 
ATOM   4766 C CZ    . ARG B 1 257 ? 48.723  1.831   32.769  1.00 26.90 ? 254 ARG C CZ    1 
ATOM   4767 N NH1   . ARG B 1 257 ? 49.515  2.297   31.807  1.00 25.88 ? 254 ARG C NH1   1 
ATOM   4768 N NH2   . ARG B 1 257 ? 47.631  2.514   33.093  1.00 26.73 ? 254 ARG C NH2   1 
ATOM   4769 N N     . LEU B 1 258 ? 52.787  -0.744  30.395  1.00 24.85 ? 255 LEU C N     1 
ATOM   4770 C CA    . LEU B 1 258 ? 52.017  -0.709  29.167  1.00 24.88 ? 255 LEU C CA    1 
ATOM   4771 C C     . LEU B 1 258 ? 50.546  -0.900  29.534  1.00 24.46 ? 255 LEU C C     1 
ATOM   4772 O O     . LEU B 1 258 ? 50.217  -1.797  30.294  1.00 24.54 ? 255 LEU C O     1 
ATOM   4773 C CB    . LEU B 1 258 ? 52.444  -1.833  28.228  1.00 25.01 ? 255 LEU C CB    1 
ATOM   4774 C CG    . LEU B 1 258 ? 53.890  -1.832  27.716  1.00 24.59 ? 255 LEU C CG    1 
ATOM   4775 C CD1   . LEU B 1 258 ? 54.185  -3.140  27.007  1.00 24.13 ? 255 LEU C CD1   1 
ATOM   4776 C CD2   . LEU B 1 258 ? 54.079  -0.654  26.801  1.00 24.87 ? 255 LEU C CD2   1 
ATOM   4777 N N     . PRO B 1 259 ? 49.658  -0.058  29.001  1.00 24.12 ? 256 PRO C N     1 
ATOM   4778 C CA    . PRO B 1 259 ? 48.267  -0.225  29.368  1.00 24.22 ? 256 PRO C CA    1 
ATOM   4779 C C     . PRO B 1 259 ? 47.733  -1.579  28.932  1.00 24.17 ? 256 PRO C C     1 
ATOM   4780 O O     . PRO B 1 259 ? 48.088  -2.070  27.862  1.00 23.97 ? 256 PRO C O     1 
ATOM   4781 C CB    . PRO B 1 259 ? 47.563  0.934   28.646  1.00 24.18 ? 256 PRO C CB    1 
ATOM   4782 C CG    . PRO B 1 259 ? 48.472  1.307   27.560  1.00 24.75 ? 256 PRO C CG    1 
ATOM   4783 C CD    . PRO B 1 259 ? 49.848  1.060   28.068  1.00 24.24 ? 256 PRO C CD    1 
ATOM   4784 N N     . TYR B 1 260 ? 46.897  -2.175  29.781  1.00 23.98 ? 257 TYR C N     1 
ATOM   4785 C CA    . TYR B 1 260 ? 46.350  -3.500  29.559  1.00 23.91 ? 257 TYR C CA    1 
ATOM   4786 C C     . TYR B 1 260 ? 47.424  -4.584  29.439  1.00 23.69 ? 257 TYR C C     1 
ATOM   4787 O O     . TYR B 1 260 ? 47.267  -5.534  28.694  1.00 22.43 ? 257 TYR C O     1 
ATOM   4788 C CB    . TYR B 1 260 ? 45.433  -3.504  28.330  1.00 24.23 ? 257 TYR C CB    1 
ATOM   4789 C CG    . TYR B 1 260 ? 44.416  -2.401  28.373  1.00 24.35 ? 257 TYR C CG    1 
ATOM   4790 C CD1   . TYR B 1 260 ? 43.292  -2.500  29.180  1.00 23.64 ? 257 TYR C CD1   1 
ATOM   4791 C CD2   . TYR B 1 260 ? 44.596  -1.244  27.620  1.00 24.96 ? 257 TYR C CD2   1 
ATOM   4792 C CE1   . TYR B 1 260 ? 42.352  -1.476  29.222  1.00 24.79 ? 257 TYR C CE1   1 
ATOM   4793 C CE2   . TYR B 1 260 ? 43.681  -0.213  27.668  1.00 26.06 ? 257 TYR C CE2   1 
ATOM   4794 C CZ    . TYR B 1 260 ? 42.564  -0.335  28.469  1.00 25.24 ? 257 TYR C CZ    1 
ATOM   4795 O OH    . TYR B 1 260 ? 41.657  0.684   28.486  1.00 25.76 ? 257 TYR C OH    1 
ATOM   4796 N N     . HIS B 1 261 ? 48.496  -4.452  30.214  1.00 24.13 ? 258 HIS C N     1 
ATOM   4797 C CA    . HIS B 1 261 ? 49.639  -5.356  30.098  1.00 24.08 ? 258 HIS C CA    1 
ATOM   4798 C C     . HIS B 1 261 ? 49.308  -6.772  30.571  1.00 24.24 ? 258 HIS C C     1 
ATOM   4799 O O     . HIS B 1 261 ? 50.025  -7.700  30.236  1.00 25.29 ? 258 HIS C O     1 
ATOM   4800 C CB    . HIS B 1 261 ? 50.843  -4.820  30.874  1.00 24.19 ? 258 HIS C CB    1 
ATOM   4801 C CG    . HIS B 1 261 ? 50.673  -4.889  32.353  1.00 24.04 ? 258 HIS C CG    1 
ATOM   4802 N ND1   . HIS B 1 261 ? 49.600  -4.319  32.999  1.00 22.62 ? 258 HIS C ND1   1 
ATOM   4803 C CD2   . HIS B 1 261 ? 51.414  -5.493  33.307  1.00 23.52 ? 258 HIS C CD2   1 
ATOM   4804 C CE1   . HIS B 1 261 ? 49.686  -4.572  34.291  1.00 23.34 ? 258 HIS C CE1   1 
ATOM   4805 N NE2   . HIS B 1 261 ? 50.787  -5.272  34.505  1.00 23.47 ? 258 HIS C NE2   1 
ATOM   4806 N N     . LEU B 1 262 ? 48.217  -6.933  31.323  1.00 23.96 ? 259 LEU C N     1 
ATOM   4807 C CA    . LEU B 1 262 ? 47.822  -8.231  31.862  1.00 23.71 ? 259 LEU C CA    1 
ATOM   4808 C C     . LEU B 1 262 ? 46.481  -8.650  31.260  1.00 23.58 ? 259 LEU C C     1 
ATOM   4809 O O     . LEU B 1 262 ? 45.459  -7.987  31.478  1.00 23.04 ? 259 LEU C O     1 
ATOM   4810 C CB    . LEU B 1 262 ? 47.755  -8.126  33.392  1.00 24.11 ? 259 LEU C CB    1 
ATOM   4811 C CG    . LEU B 1 262 ? 48.464  -9.176  34.244  1.00 23.41 ? 259 LEU C CG    1 
ATOM   4812 C CD1   . LEU B 1 262 ? 49.806  -9.549  33.721  1.00 24.73 ? 259 LEU C CD1   1 
ATOM   4813 C CD2   . LEU B 1 262 ? 48.584  -8.699  35.670  1.00 24.21 ? 259 LEU C CD2   1 
ATOM   4814 N N     . SER B 1 263 ? 46.483  -9.756  30.511  1.00 23.12 ? 260 SER C N     1 
ATOM   4815 C CA    . SER B 1 263 ? 45.308  -10.172 29.761  1.00 23.22 ? 260 SER C CA    1 
ATOM   4816 C C     . SER B 1 263 ? 44.191  -10.679 30.687  1.00 23.29 ? 260 SER C C     1 
ATOM   4817 O O     . SER B 1 263 ? 44.408  -10.906 31.878  1.00 23.50 ? 260 SER C O     1 
ATOM   4818 C CB    . SER B 1 263 ? 45.663  -11.242 28.723  1.00 23.22 ? 260 SER C CB    1 
ATOM   4819 O OG    . SER B 1 263 ? 45.914  -12.512 29.310  1.00 22.78 ? 260 SER C OG    1 
ATOM   4820 N N     . ALA B 1 264 ? 43.006  -10.853 30.121  1.00 23.07 ? 261 ALA C N     1 
ATOM   4821 C CA    . ALA B 1 264 ? 41.851  -11.349 30.863  1.00 23.48 ? 261 ALA C CA    1 
ATOM   4822 C C     . ALA B 1 264 ? 42.081  -12.790 31.364  1.00 23.69 ? 261 ALA C C     1 
ATOM   4823 O O     . ALA B 1 264 ? 41.745  -13.099 32.497  1.00 23.85 ? 261 ALA C O     1 
ATOM   4824 C CB    . ALA B 1 264 ? 40.610  -11.294 29.993  1.00 22.65 ? 261 ALA C CB    1 
ATOM   4825 N N     . LEU B 1 265 ? 42.643  -13.656 30.524  1.00 23.62 ? 262 LEU C N     1 
ATOM   4826 C CA    . LEU B 1 265 ? 42.870  -15.066 30.902  1.00 23.94 ? 262 LEU C CA    1 
ATOM   4827 C C     . LEU B 1 265 ? 43.975  -15.196 31.938  1.00 23.65 ? 262 LEU C C     1 
ATOM   4828 O O     . LEU B 1 265 ? 43.893  -16.028 32.828  1.00 23.81 ? 262 LEU C O     1 
ATOM   4829 C CB    . LEU B 1 265 ? 43.214  -15.929 29.683  1.00 24.27 ? 262 LEU C CB    1 
ATOM   4830 C CG    . LEU B 1 265 ? 42.144  -16.015 28.587  1.00 26.40 ? 262 LEU C CG    1 
ATOM   4831 C CD1   . LEU B 1 265 ? 42.628  -16.915 27.472  1.00 27.73 ? 262 LEU C CD1   1 
ATOM   4832 C CD2   . LEU B 1 265 ? 40.792  -16.508 29.105  1.00 27.45 ? 262 LEU C CD2   1 
ATOM   4833 N N     . SER B 1 266 ? 45.015  -14.385 31.804  1.00 23.16 ? 263 SER C N     1 
ATOM   4834 C CA    . SER B 1 266 ? 46.052  -14.306 32.817  1.00 23.01 ? 263 SER C CA    1 
ATOM   4835 C C     . SER B 1 266 ? 45.522  -13.845 34.170  1.00 22.46 ? 263 SER C C     1 
ATOM   4836 O O     . SER B 1 266 ? 45.850  -14.415 35.193  1.00 22.56 ? 263 SER C O     1 
ATOM   4837 C CB    . SER B 1 266 ? 47.173  -13.381 32.350  1.00 22.69 ? 263 SER C CB    1 
ATOM   4838 O OG    . SER B 1 266 ? 47.710  -13.881 31.133  1.00 23.30 ? 263 SER C OG    1 
ATOM   4839 N N     . GLN B 1 267 ? 44.731  -12.790 34.185  1.00 22.51 ? 264 GLN C N     1 
ATOM   4840 C CA    . GLN B 1 267 ? 44.138  -12.332 35.446  1.00 22.45 ? 264 GLN C CA    1 
ATOM   4841 C C     . GLN B 1 267 ? 43.230  -13.413 36.059  1.00 22.04 ? 264 GLN C C     1 
ATOM   4842 O O     . GLN B 1 267 ? 43.343  -13.734 37.234  1.00 22.57 ? 264 GLN C O     1 
ATOM   4843 C CB    . GLN B 1 267 ? 43.367  -11.046 35.230  1.00 22.73 ? 264 GLN C CB    1 
ATOM   4844 C CG    . GLN B 1 267 ? 44.262  -9.851  34.888  1.00 21.69 ? 264 GLN C CG    1 
ATOM   4845 C CD    . GLN B 1 267 ? 43.465  -8.558  34.743  1.00 21.63 ? 264 GLN C CD    1 
ATOM   4846 O OE1   . GLN B 1 267 ? 43.669  -7.765  33.815  1.00 22.66 ? 264 GLN C OE1   1 
ATOM   4847 N NE2   . GLN B 1 267 ? 42.538  -8.362  35.639  1.00 18.51 ? 264 GLN C NE2   1 
ATOM   4848 N N     . ALA B 1 268 ? 42.387  -14.007 35.237  1.00 21.91 ? 265 ALA C N     1 
ATOM   4849 C CA    . ALA B 1 268 ? 41.439  -15.025 35.686  1.00 21.93 ? 265 ALA C CA    1 
ATOM   4850 C C     . ALA B 1 268 ? 42.151  -16.318 36.103  1.00 21.79 ? 265 ALA C C     1 
ATOM   4851 O O     . ALA B 1 268 ? 41.806  -16.921 37.113  1.00 21.42 ? 265 ALA C O     1 
ATOM   4852 C CB    . ALA B 1 268 ? 40.413  -15.307 34.589  1.00 21.66 ? 265 ALA C CB    1 
ATOM   4853 N N     . ALA B 1 269 ? 43.158  -16.727 35.331  1.00 21.64 ? 266 ALA C N     1 
ATOM   4854 C CA    . ALA B 1 269 ? 43.927  -17.912 35.660  1.00 21.28 ? 266 ALA C CA    1 
ATOM   4855 C C     . ALA B 1 269 ? 44.652  -17.741 36.999  1.00 21.30 ? 266 ALA C C     1 
ATOM   4856 O O     . ALA B 1 269 ? 44.644  -18.652 37.818  1.00 21.96 ? 266 ALA C O     1 
ATOM   4857 C CB    . ALA B 1 269 ? 44.908  -18.257 34.524  1.00 20.81 ? 266 ALA C CB    1 
ATOM   4858 N N     . ALA B 1 270 ? 45.272  -16.585 37.227  1.00 21.07 ? 267 ALA C N     1 
ATOM   4859 C CA    . ALA B 1 270 ? 45.973  -16.329 38.474  1.00 21.16 ? 267 ALA C CA    1 
ATOM   4860 C C     . ALA B 1 270 ? 45.026  -16.360 39.668  1.00 21.28 ? 267 ALA C C     1 
ATOM   4861 O O     . ALA B 1 270 ? 45.365  -16.906 40.725  1.00 20.47 ? 267 ALA C O     1 
ATOM   4862 C CB    . ALA B 1 270 ? 46.683  -15.006 38.434  1.00 20.83 ? 267 ALA C CB    1 
ATOM   4863 N N     . ILE B 1 271 ? 43.861  -15.743 39.509  1.00 21.51 ? 268 ILE C N     1 
ATOM   4864 C CA    . ILE B 1 271 ? 42.818  -15.787 40.554  1.00 21.80 ? 268 ILE C CA    1 
ATOM   4865 C C     . ILE B 1 271 ? 42.420  -17.235 40.893  1.00 21.81 ? 268 ILE C C     1 
ATOM   4866 O O     . ILE B 1 271 ? 42.430  -17.620 42.048  1.00 22.60 ? 268 ILE C O     1 
ATOM   4867 C CB    . ILE B 1 271 ? 41.588  -14.953 40.159  1.00 21.47 ? 268 ILE C CB    1 
ATOM   4868 C CG1   . ILE B 1 271 ? 41.915  -13.448 40.317  1.00 21.92 ? 268 ILE C CG1   1 
ATOM   4869 C CG2   . ILE B 1 271 ? 40.385  -15.317 41.029  1.00 21.96 ? 268 ILE C CG2   1 
ATOM   4870 C CD1   . ILE B 1 271 ? 41.191  -12.522 39.338  1.00 21.29 ? 268 ILE C CD1   1 
ATOM   4871 N N     . VAL B 1 272 ? 42.093  -18.030 39.892  1.00 21.74 ? 269 VAL C N     1 
ATOM   4872 C CA    . VAL B 1 272 ? 41.802  -19.456 40.118  1.00 22.35 ? 269 VAL C CA    1 
ATOM   4873 C C     . VAL B 1 272 ? 42.939  -20.119 40.897  1.00 22.46 ? 269 VAL C C     1 
ATOM   4874 O O     . VAL B 1 272 ? 42.693  -20.821 41.871  1.00 21.70 ? 269 VAL C O     1 
ATOM   4875 C CB    . VAL B 1 272 ? 41.574  -20.213 38.803  1.00 21.89 ? 269 VAL C CB    1 
ATOM   4876 C CG1   . VAL B 1 272 ? 41.394  -21.723 39.054  1.00 23.26 ? 269 VAL C CG1   1 
ATOM   4877 C CG2   . VAL B 1 272 ? 40.387  -19.643 38.067  1.00 21.09 ? 269 VAL C CG2   1 
ATOM   4878 N N     . ALA B 1 273 ? 44.180  -19.872 40.475  1.00 22.52 ? 270 ALA C N     1 
ATOM   4879 C CA    . ALA B 1 273 ? 45.341  -20.468 41.139  1.00 23.05 ? 270 ALA C CA    1 
ATOM   4880 C C     . ALA B 1 273 ? 45.407  -20.100 42.615  1.00 23.05 ? 270 ALA C C     1 
ATOM   4881 O O     . ALA B 1 273 ? 45.654  -20.950 43.473  1.00 21.91 ? 270 ALA C O     1 
ATOM   4882 C CB    . ALA B 1 273 ? 46.660  -20.062 40.419  1.00 22.37 ? 270 ALA C CB    1 
ATOM   4883 N N     . LEU B 1 274 ? 45.197  -18.817 42.898  1.00 23.29 ? 271 LEU C N     1 
ATOM   4884 C CA    . LEU B 1 274 ? 45.271  -18.309 44.251  1.00 24.20 ? 271 LEU C CA    1 
ATOM   4885 C C     . LEU B 1 274 ? 44.193  -18.881 45.167  1.00 24.58 ? 271 LEU C C     1 
ATOM   4886 O O     . LEU B 1 274 ? 44.443  -19.076 46.354  1.00 24.27 ? 271 LEU C O     1 
ATOM   4887 C CB    . LEU B 1 274 ? 45.164  -16.784 44.268  1.00 23.80 ? 271 LEU C CB    1 
ATOM   4888 C CG    . LEU B 1 274 ? 46.395  -16.088 43.733  1.00 23.12 ? 271 LEU C CG    1 
ATOM   4889 C CD1   . LEU B 1 274 ? 46.082  -14.621 43.467  1.00 20.63 ? 271 LEU C CD1   1 
ATOM   4890 C CD2   . LEU B 1 274 ? 47.558  -16.267 44.715  1.00 22.78 ? 271 LEU C CD2   1 
ATOM   4891 N N     . ARG B 1 275 ? 43.009  -19.156 44.640  1.00 25.42 ? 272 ARG C N     1 
ATOM   4892 C CA    . ARG B 1 275 ? 41.985  -19.760 45.492  1.00 26.81 ? 272 ARG C CA    1 
ATOM   4893 C C     . ARG B 1 275 ? 42.186  -21.264 45.679  1.00 27.28 ? 272 ARG C C     1 
ATOM   4894 O O     . ARG B 1 275 ? 41.432  -21.898 46.418  1.00 26.68 ? 272 ARG C O     1 
ATOM   4895 C CB    . ARG B 1 275 ? 40.566  -19.431 45.047  1.00 26.70 ? 272 ARG C CB    1 
ATOM   4896 C CG    . ARG B 1 275 ? 40.124  -19.937 43.728  1.00 27.89 ? 272 ARG C CG    1 
ATOM   4897 C CD    . ARG B 1 275 ? 38.627  -19.631 43.573  1.00 28.68 ? 272 ARG C CD    1 
ATOM   4898 N NE    . ARG B 1 275 ? 38.128  -19.913 42.227  1.00 29.18 ? 272 ARG C NE    1 
ATOM   4899 C CZ    . ARG B 1 275 ? 37.738  -19.002 41.338  1.00 29.88 ? 272 ARG C CZ    1 
ATOM   4900 N NH1   . ARG B 1 275 ? 37.731  -17.697 41.613  1.00 30.38 ? 272 ARG C NH1   1 
ATOM   4901 N NH2   . ARG B 1 275 ? 37.321  -19.419 40.149  1.00 31.01 ? 272 ARG C NH2   1 
ATOM   4902 N N     . HIS B 1 276 ? 43.224  -21.820 45.051  1.00 27.73 ? 273 HIS C N     1 
ATOM   4903 C CA    . HIS B 1 276 ? 43.597  -23.213 45.284  1.00 28.03 ? 273 HIS C CA    1 
ATOM   4904 C C     . HIS B 1 276 ? 44.934  -23.335 46.002  1.00 28.33 ? 273 HIS C C     1 
ATOM   4905 O O     . HIS B 1 276 ? 45.557  -24.398 45.961  1.00 28.50 ? 273 HIS C O     1 
ATOM   4906 C CB    . HIS B 1 276 ? 43.651  -23.960 43.958  1.00 28.67 ? 273 HIS C CB    1 
ATOM   4907 C CG    . HIS B 1 276 ? 42.321  -24.453 43.503  1.00 28.96 ? 273 HIS C CG    1 
ATOM   4908 N ND1   . HIS B 1 276 ? 41.451  -23.679 42.766  1.00 31.59 ? 273 HIS C ND1   1 
ATOM   4909 C CD2   . HIS B 1 276 ? 41.694  -25.631 43.718  1.00 30.01 ? 273 HIS C CD2   1 
ATOM   4910 C CE1   . HIS B 1 276 ? 40.348  -24.368 42.536  1.00 30.85 ? 273 HIS C CE1   1 
ATOM   4911 N NE2   . HIS B 1 276 ? 40.473  -25.555 43.099  1.00 31.65 ? 273 HIS C NE2   1 
ATOM   4912 N N     . SER B 1 277 ? 45.366  -22.264 46.666  1.00 28.47 ? 274 SER C N     1 
ATOM   4913 C CA    . SER B 1 277 ? 46.730  -22.173 47.202  1.00 29.02 ? 274 SER C CA    1 
ATOM   4914 C C     . SER B 1 277 ? 47.036  -23.174 48.307  1.00 29.13 ? 274 SER C C     1 
ATOM   4915 O O     . SER B 1 277 ? 48.155  -23.662 48.395  1.00 28.81 ? 274 SER C O     1 
ATOM   4916 C CB    . SER B 1 277 ? 47.001  -20.757 47.733  1.00 29.24 ? 274 SER C CB    1 
ATOM   4917 O OG    . SER B 1 277 ? 45.982  -20.377 48.651  1.00 29.44 ? 274 SER C OG    1 
ATOM   4918 N N     . ALA B 1 278 ? 46.048  -23.457 49.153  1.00 29.51 ? 275 ALA C N     1 
ATOM   4919 C CA    . ALA B 1 278 ? 46.221  -24.367 50.275  1.00 29.94 ? 275 ALA C CA    1 
ATOM   4920 C C     . ALA B 1 278 ? 46.719  -25.737 49.804  1.00 30.25 ? 275 ALA C C     1 
ATOM   4921 O O     . ALA B 1 278 ? 47.744  -26.212 50.271  1.00 30.84 ? 275 ALA C O     1 
ATOM   4922 C CB    . ALA B 1 278 ? 44.906  -24.514 51.072  1.00 30.05 ? 275 ALA C CB    1 
ATOM   4923 N N     . ASP B 1 279 ? 46.004  -26.341 48.857  1.00 30.61 ? 276 ASP C N     1 
ATOM   4924 C CA    . ASP B 1 279 ? 46.381  -27.634 48.288  1.00 30.08 ? 276 ASP C CA    1 
ATOM   4925 C C     . ASP B 1 279 ? 47.721  -27.541 47.524  1.00 29.64 ? 276 ASP C C     1 
ATOM   4926 O O     . ASP B 1 279 ? 48.672  -28.276 47.817  1.00 28.97 ? 276 ASP C O     1 
ATOM   4927 C CB    . ASP B 1 279 ? 45.263  -28.128 47.360  1.00 30.62 ? 276 ASP C CB    1 
ATOM   4928 C CG    . ASP B 1 279 ? 45.565  -29.504 46.735  1.00 32.91 ? 276 ASP C CG    1 
ATOM   4929 O OD1   . ASP B 1 279 ? 45.280  -30.544 47.397  1.00 39.05 ? 276 ASP C OD1   1 
ATOM   4930 O OD2   . ASP B 1 279 ? 46.086  -29.545 45.582  1.00 36.94 ? 276 ASP C OD2   1 
ATOM   4931 N N     . THR B 1 280 ? 47.790  -26.627 46.554  1.00 28.61 ? 277 THR C N     1 
ATOM   4932 C CA    . THR B 1 280 ? 49.003  -26.433 45.739  1.00 28.24 ? 277 THR C CA    1 
ATOM   4933 C C     . THR B 1 280 ? 50.275  -26.254 46.579  1.00 28.02 ? 277 THR C C     1 
ATOM   4934 O O     . THR B 1 280 ? 51.294  -26.903 46.326  1.00 27.59 ? 277 THR C O     1 
ATOM   4935 C CB    . THR B 1 280 ? 48.861  -25.208 44.790  1.00 28.05 ? 277 THR C CB    1 
ATOM   4936 O OG1   . THR B 1 280 ? 47.658  -25.330 44.015  1.00 27.29 ? 277 THR C OG1   1 
ATOM   4937 C CG2   . THR B 1 280 ? 50.061  -25.093 43.860  1.00 27.57 ? 277 THR C CG2   1 
ATOM   4938 N N     . LEU B 1 281 ? 50.224  -25.379 47.577  1.00 27.57 ? 278 LEU C N     1 
ATOM   4939 C CA    . LEU B 1 281 ? 51.418  -25.075 48.361  1.00 27.62 ? 278 LEU C CA    1 
ATOM   4940 C C     . LEU B 1 281 ? 51.860  -26.228 49.280  1.00 27.42 ? 278 LEU C C     1 
ATOM   4941 O O     . LEU B 1 281 ? 52.975  -26.227 49.792  1.00 26.52 ? 278 LEU C O     1 
ATOM   4942 C CB    . LEU B 1 281 ? 51.232  -23.764 49.136  1.00 27.75 ? 278 LEU C CB    1 
ATOM   4943 C CG    . LEU B 1 281 ? 51.217  -22.509 48.244  1.00 28.63 ? 278 LEU C CG    1 
ATOM   4944 C CD1   . LEU B 1 281 ? 50.845  -21.278 49.044  1.00 28.24 ? 278 LEU C CD1   1 
ATOM   4945 C CD2   . LEU B 1 281 ? 52.588  -22.318 47.536  1.00 28.80 ? 278 LEU C CD2   1 
ATOM   4946 N N     . GLY B 1 282 ? 50.993  -27.221 49.454  1.00 27.63 ? 279 GLY C N     1 
ATOM   4947 C CA    . GLY B 1 282 ? 51.360  -28.498 50.064  1.00 27.77 ? 279 GLY C CA    1 
ATOM   4948 C C     . GLY B 1 282 ? 52.535  -29.185 49.366  1.00 28.09 ? 279 GLY C C     1 
ATOM   4949 O O     . GLY B 1 282 ? 53.272  -29.967 49.985  1.00 27.96 ? 279 GLY C O     1 
ATOM   4950 N N     . THR B 1 283 ? 52.706  -28.896 48.074  1.00 28.02 ? 280 THR C N     1 
ATOM   4951 C CA    . THR B 1 283 ? 53.892  -29.348 47.325  1.00 27.79 ? 280 THR C CA    1 
ATOM   4952 C C     . THR B 1 283 ? 55.197  -28.846 47.928  1.00 27.33 ? 280 THR C C     1 
ATOM   4953 O O     . THR B 1 283 ? 56.189  -29.559 47.874  1.00 27.77 ? 280 THR C O     1 
ATOM   4954 C CB    . THR B 1 283 ? 53.837  -28.966 45.822  1.00 27.58 ? 280 THR C CB    1 
ATOM   4955 O OG1   . THR B 1 283 ? 53.761  -27.545 45.666  1.00 26.91 ? 280 THR C OG1   1 
ATOM   4956 C CG2   . THR B 1 283 ? 52.639  -29.603 45.145  1.00 27.77 ? 280 THR C CG2   1 
ATOM   4957 N N     . VAL B 1 284 ? 55.192  -27.650 48.514  1.00 27.29 ? 281 VAL C N     1 
ATOM   4958 C CA    . VAL B 1 284 ? 56.380  -27.078 49.158  1.00 27.46 ? 281 VAL C CA    1 
ATOM   4959 C C     . VAL B 1 284 ? 56.968  -28.007 50.215  1.00 27.91 ? 281 VAL C C     1 
ATOM   4960 O O     . VAL B 1 284 ? 58.195  -28.143 50.316  1.00 27.28 ? 281 VAL C O     1 
ATOM   4961 C CB    . VAL B 1 284 ? 56.084  -25.693 49.801  1.00 27.61 ? 281 VAL C CB    1 
ATOM   4962 C CG1   . VAL B 1 284 ? 57.270  -25.195 50.615  1.00 26.73 ? 281 VAL C CG1   1 
ATOM   4963 C CG2   . VAL B 1 284 ? 55.713  -24.672 48.728  1.00 27.23 ? 281 VAL C CG2   1 
ATOM   4964 N N     . GLU B 1 285 ? 56.085  -28.668 50.964  1.00 28.01 ? 282 GLU C N     1 
ATOM   4965 C CA    . GLU B 1 285 ? 56.461  -29.601 52.021  1.00 28.66 ? 282 GLU C CA    1 
ATOM   4966 C C     . GLU B 1 285 ? 57.086  -30.875 51.455  1.00 28.46 ? 282 GLU C C     1 
ATOM   4967 O O     . GLU B 1 285 ? 58.078  -31.353 51.983  1.00 28.30 ? 282 GLU C O     1 
ATOM   4968 C CB    . GLU B 1 285 ? 55.232  -29.967 52.889  1.00 28.68 ? 282 GLU C CB    1 
ATOM   4969 C CG    . GLU B 1 285 ? 54.501  -28.764 53.528  1.00 29.57 ? 282 GLU C CG    1 
ATOM   4970 C CD    . GLU B 1 285 ? 53.065  -29.082 53.972  1.00 31.16 ? 282 GLU C CD    1 
ATOM   4971 O OE1   . GLU B 1 285 ? 52.353  -28.139 54.392  1.00 34.64 ? 282 GLU C OE1   1 
ATOM   4972 O OE2   . GLU B 1 285 ? 52.644  -30.263 53.910  1.00 34.20 ? 282 GLU C OE2   1 
ATOM   4973 N N     . LYS B 1 286 ? 56.487  -31.424 50.400  1.00 28.31 ? 283 LYS C N     1 
ATOM   4974 C CA    . LYS B 1 286 ? 57.029  -32.594 49.705  1.00 28.27 ? 283 LYS C CA    1 
ATOM   4975 C C     . LYS B 1 286 ? 58.408  -32.314 49.130  1.00 27.88 ? 283 LYS C C     1 
ATOM   4976 O O     . LYS B 1 286 ? 59.303  -33.140 49.240  1.00 27.72 ? 283 LYS C O     1 
ATOM   4977 C CB    . LYS B 1 286 ? 56.121  -33.021 48.549  1.00 28.15 ? 283 LYS C CB    1 
ATOM   4978 C CG    . LYS B 1 286 ? 54.789  -33.624 48.954  1.00 29.18 ? 283 LYS C CG    1 
ATOM   4979 C CD    . LYS B 1 286 ? 53.908  -33.806 47.725  1.00 29.30 ? 283 LYS C CD    1 
ATOM   4980 C CE    . LYS B 1 286 ? 52.530  -34.403 48.048  1.00 30.99 ? 283 LYS C CE    1 
ATOM   4981 N NZ    . LYS B 1 286 ? 51.716  -34.557 46.775  1.00 31.31 ? 283 LYS C NZ    1 
ATOM   4982 N N     . LEU B 1 287 ? 58.553  -31.147 48.505  1.00 27.38 ? 284 LEU C N     1 
ATOM   4983 C CA    . LEU B 1 287 ? 59.815  -30.719 47.912  1.00 27.54 ? 284 LEU C CA    1 
ATOM   4984 C C     . LEU B 1 287 ? 60.929  -30.495 48.945  1.00 27.70 ? 284 LEU C C     1 
ATOM   4985 O O     . LEU B 1 287 ? 62.098  -30.798 48.697  1.00 26.75 ? 284 LEU C O     1 
ATOM   4986 C CB    . LEU B 1 287 ? 59.604  -29.442 47.084  1.00 27.30 ? 284 LEU C CB    1 
ATOM   4987 C CG    . LEU B 1 287 ? 58.686  -29.603 45.858  1.00 27.41 ? 284 LEU C CG    1 
ATOM   4988 C CD1   . LEU B 1 287 ? 58.445  -28.258 45.158  1.00 25.01 ? 284 LEU C CD1   1 
ATOM   4989 C CD2   . LEU B 1 287 ? 59.246  -30.646 44.892  1.00 26.04 ? 284 LEU C CD2   1 
ATOM   4990 N N     . SER B 1 288 ? 60.574  -29.970 50.109  1.00 28.16 ? 285 SER C N     1 
ATOM   4991 C CA    . SER B 1 288 ? 61.578  -29.736 51.151  1.00 28.27 ? 285 SER C CA    1 
ATOM   4992 C C     . SER B 1 288 ? 62.160  -31.073 51.653  1.00 28.02 ? 285 SER C C     1 
ATOM   4993 O O     . SER B 1 288 ? 63.367  -31.191 51.866  1.00 28.39 ? 285 SER C O     1 
ATOM   4994 C CB    . SER B 1 288 ? 60.988  -28.911 52.290  1.00 28.59 ? 285 SER C CB    1 
ATOM   4995 O OG    . SER B 1 288 ? 60.456  -29.766 53.278  1.00 30.74 ? 285 SER C OG    1 
ATOM   4996 N N     . VAL B 1 289 ? 61.304  -32.085 51.792  1.00 27.79 ? 286 VAL C N     1 
ATOM   4997 C CA    . VAL B 1 289 ? 61.733  -33.444 52.131  1.00 27.52 ? 286 VAL C CA    1 
ATOM   4998 C C     . VAL B 1 289 ? 62.633  -34.064 51.060  1.00 27.48 ? 286 VAL C C     1 
ATOM   4999 O O     . VAL B 1 289 ? 63.589  -34.747 51.379  1.00 27.50 ? 286 VAL C O     1 
ATOM   5000 C CB    . VAL B 1 289 ? 60.510  -34.374 52.374  1.00 27.88 ? 286 VAL C CB    1 
ATOM   5001 C CG1   . VAL B 1 289 ? 60.929  -35.843 52.563  1.00 27.94 ? 286 VAL C CG1   1 
ATOM   5002 C CG2   . VAL B 1 289 ? 59.723  -33.905 53.576  1.00 26.68 ? 286 VAL C CG2   1 
ATOM   5003 N N     . GLU B 1 290 ? 62.323  -33.839 49.791  1.00 27.31 ? 287 GLU C N     1 
ATOM   5004 C CA    . GLU B 1 290 ? 63.156  -34.366 48.714  1.00 27.25 ? 287 GLU C CA    1 
ATOM   5005 C C     . GLU B 1 290 ? 64.472  -33.614 48.638  1.00 26.64 ? 287 GLU C C     1 
ATOM   5006 O O     . GLU B 1 290 ? 65.509  -34.215 48.401  1.00 26.41 ? 287 GLU C O     1 
ATOM   5007 C CB    . GLU B 1 290 ? 62.414  -34.334 47.369  1.00 27.74 ? 287 GLU C CB    1 
ATOM   5008 C CG    . GLU B 1 290 ? 61.488  -35.549 47.143  1.00 29.50 ? 287 GLU C CG    1 
ATOM   5009 C CD    . GLU B 1 290 ? 62.268  -36.848 46.939  1.00 32.39 ? 287 GLU C CD    1 
ATOM   5010 O OE1   . GLU B 1 290 ? 62.213  -37.747 47.814  1.00 33.26 ? 287 GLU C OE1   1 
ATOM   5011 O OE2   . GLU B 1 290 ? 62.965  -36.956 45.904  1.00 33.94 ? 287 GLU C OE2   1 
ATOM   5012 N N     . ARG B 1 291 ? 64.435  -32.306 48.867  1.00 26.30 ? 288 ARG C N     1 
ATOM   5013 C CA    . ARG B 1 291 ? 65.658  -31.515 48.925  1.00 26.59 ? 288 ARG C CA    1 
ATOM   5014 C C     . ARG B 1 291 ? 66.634  -32.068 49.974  1.00 26.13 ? 288 ARG C C     1 
ATOM   5015 O O     . ARG B 1 291 ? 67.829  -32.212 49.702  1.00 25.90 ? 288 ARG C O     1 
ATOM   5016 C CB    . ARG B 1 291 ? 65.349  -30.038 49.213  1.00 26.80 ? 288 ARG C CB    1 
ATOM   5017 C CG    . ARG B 1 291 ? 66.563  -29.120 49.028  1.00 28.03 ? 288 ARG C CG    1 
ATOM   5018 C CD    . ARG B 1 291 ? 66.693  -28.176 50.201  1.00 32.93 ? 288 ARG C CD    1 
ATOM   5019 N NE    . ARG B 1 291 ? 65.505  -27.344 50.329  1.00 35.20 ? 288 ARG C NE    1 
ATOM   5020 C CZ    . ARG B 1 291 ? 64.931  -27.002 51.474  1.00 37.07 ? 288 ARG C CZ    1 
ATOM   5021 N NH1   . ARG B 1 291 ? 65.405  -27.430 52.638  1.00 39.12 ? 288 ARG C NH1   1 
ATOM   5022 N NH2   . ARG B 1 291 ? 63.856  -26.219 51.447  1.00 38.29 ? 288 ARG C NH2   1 
ATOM   5023 N N     . VAL B 1 292 ? 66.125  -32.389 51.156  1.00 25.63 ? 289 VAL C N     1 
ATOM   5024 C CA    . VAL B 1 292 ? 66.972  -32.910 52.229  1.00 26.16 ? 289 VAL C CA    1 
ATOM   5025 C C     . VAL B 1 292 ? 67.585  -34.244 51.770  1.00 26.61 ? 289 VAL C C     1 
ATOM   5026 O O     . VAL B 1 292 ? 68.797  -34.451 51.860  1.00 26.47 ? 289 VAL C O     1 
ATOM   5027 C CB    . VAL B 1 292 ? 66.184  -33.005 53.570  1.00 26.06 ? 289 VAL C CB    1 
ATOM   5028 C CG1   . VAL B 1 292 ? 66.938  -33.824 54.634  1.00 24.69 ? 289 VAL C CG1   1 
ATOM   5029 C CG2   . VAL B 1 292 ? 65.872  -31.599 54.088  1.00 24.82 ? 289 VAL C CG2   1 
ATOM   5030 N N     . ARG B 1 293 ? 66.755  -35.106 51.197  1.00 27.10 ? 290 ARG C N     1 
ATOM   5031 C CA    . ARG B 1 293 ? 67.236  -36.378 50.656  1.00 26.98 ? 290 ARG C CA    1 
ATOM   5032 C C     . ARG B 1 293 ? 68.270  -36.214 49.515  1.00 26.58 ? 290 ARG C C     1 
ATOM   5033 O O     . ARG B 1 293 ? 69.317  -36.868 49.516  1.00 25.85 ? 290 ARG C O     1 
ATOM   5034 C CB    . ARG B 1 293 ? 66.059  -37.208 50.177  1.00 27.09 ? 290 ARG C CB    1 
ATOM   5035 C CG    . ARG B 1 293 ? 66.434  -38.637 49.863  1.00 28.24 ? 290 ARG C CG    1 
ATOM   5036 C CD    . ARG B 1 293 ? 65.239  -39.471 49.526  1.00 29.53 ? 290 ARG C CD    1 
ATOM   5037 N NE    . ARG B 1 293 ? 64.644  -39.178 48.221  1.00 31.86 ? 290 ARG C NE    1 
ATOM   5038 C CZ    . ARG B 1 293 ? 65.035  -39.713 47.064  1.00 33.44 ? 290 ARG C CZ    1 
ATOM   5039 N NH1   . ARG B 1 293 ? 66.084  -40.520 46.999  1.00 34.53 ? 290 ARG C NH1   1 
ATOM   5040 N NH2   . ARG B 1 293 ? 64.385  -39.411 45.941  1.00 34.42 ? 290 ARG C NH2   1 
ATOM   5041 N N     . VAL B 1 294 ? 67.987  -35.346 48.548  1.00 26.36 ? 291 VAL C N     1 
ATOM   5042 C CA    . VAL B 1 294 ? 68.913  -35.163 47.422  1.00 26.41 ? 291 VAL C CA    1 
ATOM   5043 C C     . VAL B 1 294 ? 70.246  -34.639 47.915  1.00 26.21 ? 291 VAL C C     1 
ATOM   5044 O O     . VAL B 1 294 ? 71.286  -35.164 47.529  1.00 26.34 ? 291 VAL C O     1 
ATOM   5045 C CB    . VAL B 1 294 ? 68.332  -34.235 46.301  1.00 26.72 ? 291 VAL C CB    1 
ATOM   5046 C CG1   . VAL B 1 294 ? 69.424  -33.795 45.328  1.00 25.05 ? 291 VAL C CG1   1 
ATOM   5047 C CG2   . VAL B 1 294 ? 67.202  -34.940 45.574  1.00 25.12 ? 291 VAL C CG2   1 
ATOM   5048 N N     . ALA B 1 295 ? 70.213  -33.625 48.775  1.00 26.22 ? 292 ALA C N     1 
ATOM   5049 C CA    . ALA B 1 295 ? 71.433  -33.015 49.298  1.00 27.20 ? 292 ALA C CA    1 
ATOM   5050 C C     . ALA B 1 295 ? 72.260  -34.028 50.085  1.00 27.63 ? 292 ALA C C     1 
ATOM   5051 O O     . ALA B 1 295 ? 73.480  -34.109 49.908  1.00 27.53 ? 292 ALA C O     1 
ATOM   5052 C CB    . ALA B 1 295 ? 71.116  -31.784 50.162  1.00 27.11 ? 292 ALA C CB    1 
ATOM   5053 N N     . ALA B 1 296 ? 71.593  -34.805 50.935  1.00 28.30 ? 293 ALA C N     1 
ATOM   5054 C CA    . ALA B 1 296 ? 72.259  -35.835 51.721  1.00 29.10 ? 293 ALA C CA    1 
ATOM   5055 C C     . ALA B 1 296 ? 72.970  -36.822 50.804  1.00 29.92 ? 293 ALA C C     1 
ATOM   5056 O O     . ALA B 1 296 ? 74.150  -37.098 50.985  1.00 30.50 ? 293 ALA C O     1 
ATOM   5057 C CB    . ALA B 1 296 ? 71.262  -36.564 52.600  1.00 28.87 ? 293 ALA C CB    1 
ATOM   5058 N N     . ARG B 1 297 ? 72.250  -37.338 49.815  1.00 30.80 ? 294 ARG C N     1 
ATOM   5059 C CA    . ARG B 1 297 ? 72.785  -38.345 48.916  1.00 31.02 ? 294 ARG C CA    1 
ATOM   5060 C C     . ARG B 1 297 ? 73.966  -37.818 48.102  1.00 31.31 ? 294 ARG C C     1 
ATOM   5061 O O     . ARG B 1 297 ? 74.963  -38.517 47.954  1.00 30.81 ? 294 ARG C O     1 
ATOM   5062 C CB    . ARG B 1 297 ? 71.676  -38.884 48.001  1.00 31.96 ? 294 ARG C CB    1 
ATOM   5063 C CG    . ARG B 1 297 ? 72.082  -40.046 47.076  1.00 32.67 ? 294 ARG C CG    1 
ATOM   5064 C CD    . ARG B 1 297 ? 72.960  -41.100 47.745  1.00 36.02 ? 294 ARG C CD    1 
ATOM   5065 N NE    . ARG B 1 297 ? 73.001  -42.341 46.974  1.00 36.10 ? 294 ARG C NE    1 
ATOM   5066 C CZ    . ARG B 1 297 ? 73.845  -43.351 47.201  1.00 39.67 ? 294 ARG C CZ    1 
ATOM   5067 N NH1   . ARG B 1 297 ? 74.745  -43.277 48.181  1.00 40.36 ? 294 ARG C NH1   1 
ATOM   5068 N NH2   . ARG B 1 297 ? 73.797  -44.446 46.436  1.00 39.53 ? 294 ARG C NH2   1 
ATOM   5069 N N     . LEU B 1 298 ? 73.871  -36.583 47.615  1.00 31.23 ? 295 LEU C N     1 
ATOM   5070 C CA    . LEU B 1 298 ? 74.974  -35.967 46.884  1.00 31.67 ? 295 LEU C CA    1 
ATOM   5071 C C     . LEU B 1 298 ? 76.256  -35.886 47.730  1.00 32.22 ? 295 LEU C C     1 
ATOM   5072 O O     . LEU B 1 298 ? 77.352  -36.192 47.236  1.00 30.94 ? 295 LEU C O     1 
ATOM   5073 C CB    . LEU B 1 298 ? 74.580  -34.580 46.347  1.00 31.13 ? 295 LEU C CB    1 
ATOM   5074 C CG    . LEU B 1 298 ? 73.569  -34.545 45.183  1.00 29.39 ? 295 LEU C CG    1 
ATOM   5075 C CD1   . LEU B 1 298 ? 73.182  -33.100 44.826  1.00 26.52 ? 295 LEU C CD1   1 
ATOM   5076 C CD2   . LEU B 1 298 ? 74.114  -35.269 43.951  1.00 27.80 ? 295 LEU C CD2   1 
ATOM   5077 N N     . GLU B 1 299 ? 76.107  -35.486 48.996  1.00 33.30 ? 296 GLU C N     1 
ATOM   5078 C CA    . GLU B 1 299 ? 77.239  -35.419 49.935  1.00 34.41 ? 296 GLU C CA    1 
ATOM   5079 C C     . GLU B 1 299 ? 77.834  -36.797 50.149  1.00 34.73 ? 296 GLU C C     1 
ATOM   5080 O O     . GLU B 1 299 ? 79.060  -36.965 50.127  1.00 34.99 ? 296 GLU C O     1 
ATOM   5081 C CB    . GLU B 1 299 ? 76.823  -34.829 51.286  1.00 34.72 ? 296 GLU C CB    1 
ATOM   5082 C CG    . GLU B 1 299 ? 76.698  -33.295 51.273  1.00 36.25 ? 296 GLU C CG    1 
ATOM   5083 C CD    . GLU B 1 299 ? 76.364  -32.701 52.650  1.00 37.28 ? 296 GLU C CD    1 
ATOM   5084 O OE1   . GLU B 1 299 ? 75.615  -33.364 53.419  1.00 41.68 ? 296 GLU C OE1   1 
ATOM   5085 O OE2   . GLU B 1 299 ? 76.853  -31.577 52.955  1.00 39.39 ? 296 GLU C OE2   1 
ATOM   5086 N N     . GLU B 1 300 ? 76.957  -37.781 50.326  1.00 35.04 ? 297 GLU C N     1 
ATOM   5087 C CA    . GLU B 1 300 ? 77.372  -39.160 50.496  1.00 35.25 ? 297 GLU C CA    1 
ATOM   5088 C C     . GLU B 1 300 ? 78.205  -39.664 49.317  1.00 34.94 ? 297 GLU C C     1 
ATOM   5089 O O     . GLU B 1 300 ? 79.108  -40.465 49.499  1.00 35.01 ? 297 GLU C O     1 
ATOM   5090 C CB    . GLU B 1 300 ? 76.161  -40.056 50.673  1.00 35.14 ? 297 GLU C CB    1 
ATOM   5091 C CG    . GLU B 1 300 ? 76.514  -41.474 51.042  1.00 36.07 ? 297 GLU C CG    1 
ATOM   5092 C CD    . GLU B 1 300 ? 75.296  -42.271 51.502  1.00 38.35 ? 297 GLU C CD    1 
ATOM   5093 O OE1   . GLU B 1 300 ? 74.163  -41.994 51.009  1.00 42.96 ? 297 GLU C OE1   1 
ATOM   5094 O OE2   . GLU B 1 300 ? 75.472  -43.174 52.361  1.00 43.02 ? 297 GLU C OE2   1 
ATOM   5095 N N     . LEU B 1 301 ? 77.872  -39.196 48.120  1.00 34.32 ? 298 LEU C N     1 
ATOM   5096 C CA    . LEU B 1 301 ? 78.553  -39.593 46.898  1.00 34.02 ? 298 LEU C CA    1 
ATOM   5097 C C     . LEU B 1 301 ? 79.945  -38.974 46.817  1.00 33.72 ? 298 LEU C C     1 
ATOM   5098 O O     . LEU B 1 301 ? 80.842  -39.545 46.203  1.00 34.27 ? 298 LEU C O     1 
ATOM   5099 C CB    . LEU B 1 301 ? 77.705  -39.214 45.668  1.00 33.80 ? 298 LEU C CB    1 
ATOM   5100 C CG    . LEU B 1 301 ? 76.849  -40.293 44.977  1.00 34.18 ? 298 LEU C CG    1 
ATOM   5101 C CD1   . LEU B 1 301 ? 76.477  -41.402 45.891  1.00 34.20 ? 298 LEU C CD1   1 
ATOM   5102 C CD2   . LEU B 1 301 ? 75.570  -39.689 44.354  1.00 33.62 ? 298 LEU C CD2   1 
ATOM   5103 N N     . GLY B 1 302 ? 80.125  -37.814 47.449  1.00 33.57 ? 299 GLY C N     1 
ATOM   5104 C CA    . GLY B 1 302 ? 81.396  -37.088 47.403  1.00 32.75 ? 299 GLY C CA    1 
ATOM   5105 C C     . GLY B 1 302 ? 81.305  -35.680 46.855  1.00 32.21 ? 299 GLY C C     1 
ATOM   5106 O O     . GLY B 1 302 ? 82.319  -34.997 46.765  1.00 32.35 ? 299 GLY C O     1 
ATOM   5107 N N     . TYR B 1 303 ? 80.101  -35.228 46.508  1.00 31.65 ? 300 TYR C N     1 
ATOM   5108 C CA    . TYR B 1 303 ? 79.914  -33.893 45.934  1.00 31.11 ? 300 TYR C CA    1 
ATOM   5109 C C     . TYR B 1 303 ? 79.982  -32.791 46.999  1.00 31.11 ? 300 TYR C C     1 
ATOM   5110 O O     . TYR B 1 303 ? 79.564  -32.987 48.142  1.00 31.52 ? 300 TYR C O     1 
ATOM   5111 C CB    . TYR B 1 303 ? 78.573  -33.811 45.197  1.00 30.47 ? 300 TYR C CB    1 
ATOM   5112 C CG    . TYR B 1 303 ? 78.508  -34.596 43.900  1.00 30.10 ? 300 TYR C CG    1 
ATOM   5113 C CD1   . TYR B 1 303 ? 79.042  -34.073 42.725  1.00 28.83 ? 300 TYR C CD1   1 
ATOM   5114 C CD2   . TYR B 1 303 ? 77.903  -35.852 43.846  1.00 29.92 ? 300 TYR C CD2   1 
ATOM   5115 C CE1   . TYR B 1 303 ? 78.978  -34.766 41.529  1.00 29.75 ? 300 TYR C CE1   1 
ATOM   5116 C CE2   . TYR B 1 303 ? 77.834  -36.569 42.646  1.00 30.80 ? 300 TYR C CE2   1 
ATOM   5117 C CZ    . TYR B 1 303 ? 78.381  -36.013 41.487  1.00 30.27 ? 300 TYR C CZ    1 
ATOM   5118 O OH    . TYR B 1 303 ? 78.331  -36.690 40.302  1.00 28.36 ? 300 TYR C OH    1 
ATOM   5119 N N     . ALA B 1 304 ? 80.507  -31.632 46.608  1.00 30.97 ? 301 ALA C N     1 
ATOM   5120 C CA    . ALA B 1 304 ? 80.456  -30.418 47.424  1.00 30.78 ? 301 ALA C CA    1 
ATOM   5121 C C     . ALA B 1 304 ? 79.083  -29.771 47.262  1.00 30.54 ? 301 ALA C C     1 
ATOM   5122 O O     . ALA B 1 304 ? 78.764  -29.238 46.206  1.00 30.92 ? 301 ALA C O     1 
ATOM   5123 C CB    . ALA B 1 304 ? 81.543  -29.449 46.991  1.00 30.94 ? 301 ALA C CB    1 
ATOM   5124 N N     . VAL B 1 305 ? 78.268  -29.831 48.305  1.00 30.10 ? 302 VAL C N     1 
ATOM   5125 C CA    . VAL B 1 305 ? 76.896  -29.359 48.240  1.00 29.69 ? 302 VAL C CA    1 
ATOM   5126 C C     . VAL B 1 305 ? 76.791  -28.056 49.037  1.00 29.34 ? 302 VAL C C     1 
ATOM   5127 O O     . VAL B 1 305 ? 77.213  -27.999 50.192  1.00 28.56 ? 302 VAL C O     1 
ATOM   5128 C CB    . VAL B 1 305 ? 75.939  -30.420 48.821  1.00 29.37 ? 302 VAL C CB    1 
ATOM   5129 C CG1   . VAL B 1 305 ? 74.494  -30.004 48.654  1.00 29.50 ? 302 VAL C CG1   1 
ATOM   5130 C CG2   . VAL B 1 305 ? 76.165  -31.766 48.167  1.00 29.89 ? 302 VAL C CG2   1 
ATOM   5131 N N     . VAL B 1 306 ? 76.254  -27.008 48.416  1.00 29.39 ? 303 VAL C N     1 
ATOM   5132 C CA    . VAL B 1 306 ? 75.968  -25.761 49.123  1.00 29.36 ? 303 VAL C CA    1 
ATOM   5133 C C     . VAL B 1 306 ? 74.585  -25.866 49.823  1.00 29.78 ? 303 VAL C C     1 
ATOM   5134 O O     . VAL B 1 306 ? 73.586  -26.188 49.181  1.00 29.91 ? 303 VAL C O     1 
ATOM   5135 C CB    . VAL B 1 306 ? 75.998  -24.564 48.177  1.00 29.50 ? 303 VAL C CB    1 
ATOM   5136 C CG1   . VAL B 1 306 ? 75.709  -23.266 48.942  1.00 28.89 ? 303 VAL C CG1   1 
ATOM   5137 C CG2   . VAL B 1 306 ? 77.364  -24.477 47.463  1.00 29.17 ? 303 VAL C CG2   1 
ATOM   5138 N N     . PRO B 1 307 ? 74.526  -25.627 51.146  1.00 29.69 ? 304 PRO C N     1 
ATOM   5139 C CA    . PRO B 1 307 ? 73.234  -25.711 51.840  1.00 29.57 ? 304 PRO C CA    1 
ATOM   5140 C C     . PRO B 1 307 ? 72.201  -24.769 51.243  1.00 29.57 ? 304 PRO C C     1 
ATOM   5141 O O     . PRO B 1 307 ? 72.541  -23.646 50.880  1.00 29.68 ? 304 PRO C O     1 
ATOM   5142 C CB    . PRO B 1 307 ? 73.572  -25.282 53.267  1.00 29.78 ? 304 PRO C CB    1 
ATOM   5143 C CG    . PRO B 1 307 ? 75.024  -25.558 53.405  1.00 30.32 ? 304 PRO C CG    1 
ATOM   5144 C CD    . PRO B 1 307 ? 75.618  -25.281 52.067  1.00 29.66 ? 304 PRO C CD    1 
ATOM   5145 N N     . SER B 1 308 ? 70.957  -25.221 51.172  1.00 29.01 ? 305 SER C N     1 
ATOM   5146 C CA    . SER B 1 308 ? 69.910  -24.512 50.459  1.00 28.84 ? 305 SER C CA    1 
ATOM   5147 C C     . SER B 1 308 ? 68.603  -24.409 51.250  1.00 28.62 ? 305 SER C C     1 
ATOM   5148 O O     . SER B 1 308 ? 68.213  -25.344 51.946  1.00 28.29 ? 305 SER C O     1 
ATOM   5149 C CB    . SER B 1 308 ? 69.646  -25.256 49.157  1.00 28.74 ? 305 SER C CB    1 
ATOM   5150 O OG    . SER B 1 308 ? 68.572  -24.692 48.451  1.00 28.97 ? 305 SER C OG    1 
ATOM   5151 N N     . GLU B 1 309 ? 67.923  -23.278 51.112  1.00 28.37 ? 306 GLU C N     1 
ATOM   5152 C CA    . GLU B 1 309 ? 66.574  -23.097 51.655  1.00 28.50 ? 306 GLU C CA    1 
ATOM   5153 C C     . GLU B 1 309 ? 65.527  -22.886 50.528  1.00 27.88 ? 306 GLU C C     1 
ATOM   5154 O O     . GLU B 1 309 ? 64.488  -22.270 50.741  1.00 27.77 ? 306 GLU C O     1 
ATOM   5155 C CB    . GLU B 1 309 ? 66.564  -21.933 52.664  1.00 28.61 ? 306 GLU C CB    1 
ATOM   5156 C CG    . GLU B 1 309 ? 67.294  -22.242 53.998  1.00 29.95 ? 306 GLU C CG    1 
ATOM   5157 C CD    . GLU B 1 309 ? 66.880  -21.320 55.152  1.00 31.24 ? 306 GLU C CD    1 
ATOM   5158 O OE1   . GLU B 1 309 ? 65.658  -21.214 55.453  1.00 33.81 ? 306 GLU C OE1   1 
ATOM   5159 O OE2   . GLU B 1 309 ? 67.785  -20.704 55.770  1.00 36.50 ? 306 GLU C OE2   1 
ATOM   5160 N N     . SER B 1 310 ? 65.794  -23.451 49.347  1.00 27.34 ? 307 SER C N     1 
ATOM   5161 C CA    . SER B 1 310 ? 64.959  -23.270 48.148  1.00 26.44 ? 307 SER C CA    1 
ATOM   5162 C C     . SER B 1 310 ? 64.517  -24.623 47.582  1.00 25.97 ? 307 SER C C     1 
ATOM   5163 O O     . SER B 1 310 ? 64.639  -25.632 48.265  1.00 25.61 ? 307 SER C O     1 
ATOM   5164 C CB    . SER B 1 310 ? 65.752  -22.484 47.104  1.00 26.69 ? 307 SER C CB    1 
ATOM   5165 O OG    . SER B 1 310 ? 66.951  -23.154 46.772  1.00 25.27 ? 307 SER C OG    1 
ATOM   5166 N N     . ASN B 1 311 ? 64.016  -24.640 46.341  1.00 25.24 ? 308 ASN C N     1 
ATOM   5167 C CA    . ASN B 1 311 ? 63.719  -25.892 45.625  1.00 25.00 ? 308 ASN C CA    1 
ATOM   5168 C C     . ASN B 1 311 ? 64.813  -26.376 44.645  1.00 24.28 ? 308 ASN C C     1 
ATOM   5169 O O     . ASN B 1 311 ? 64.515  -27.050 43.646  1.00 23.53 ? 308 ASN C O     1 
ATOM   5170 C CB    . ASN B 1 311 ? 62.384  -25.787 44.888  1.00 24.81 ? 308 ASN C CB    1 
ATOM   5171 C CG    . ASN B 1 311 ? 62.400  -24.737 43.787  1.00 25.43 ? 308 ASN C CG    1 
ATOM   5172 O OD1   . ASN B 1 311 ? 63.134  -23.743 43.864  1.00 24.82 ? 308 ASN C OD1   1 
ATOM   5173 N ND2   . ASN B 1 311 ? 61.565  -24.942 42.763  1.00 25.36 ? 308 ASN C ND2   1 
ATOM   5174 N N     . PHE B 1 312 ? 66.067  -26.049 44.939  1.00 23.99 ? 309 PHE C N     1 
ATOM   5175 C CA    . PHE B 1 312 ? 67.185  -26.527 44.136  1.00 24.35 ? 309 PHE C CA    1 
ATOM   5176 C C     . PHE B 1 312 ? 68.439  -26.679 44.978  1.00 24.32 ? 309 PHE C C     1 
ATOM   5177 O O     . PHE B 1 312 ? 68.497  -26.209 46.095  1.00 24.18 ? 309 PHE C O     1 
ATOM   5178 C CB    . PHE B 1 312 ? 67.456  -25.572 42.971  1.00 23.91 ? 309 PHE C CB    1 
ATOM   5179 C CG    . PHE B 1 312 ? 67.620  -24.151 43.398  1.00 24.02 ? 309 PHE C CG    1 
ATOM   5180 C CD1   . PHE B 1 312 ? 68.859  -23.664 43.775  1.00 24.50 ? 309 PHE C CD1   1 
ATOM   5181 C CD2   . PHE B 1 312 ? 66.520  -23.305 43.462  1.00 24.01 ? 309 PHE C CD2   1 
ATOM   5182 C CE1   . PHE B 1 312 ? 69.005  -22.335 44.182  1.00 24.75 ? 309 PHE C CE1   1 
ATOM   5183 C CE2   . PHE B 1 312 ? 66.657  -21.977 43.856  1.00 24.18 ? 309 PHE C CE2   1 
ATOM   5184 C CZ    . PHE B 1 312 ? 67.881  -21.497 44.224  1.00 23.74 ? 309 PHE C CZ    1 
ATOM   5185 N N     . VAL B 1 313 ? 69.446  -27.342 44.415  1.00 25.11 ? 310 VAL C N     1 
ATOM   5186 C CA    . VAL B 1 313 ? 70.708  -27.566 45.112  1.00 25.23 ? 310 VAL C CA    1 
ATOM   5187 C C     . VAL B 1 313 ? 71.857  -27.198 44.186  1.00 25.18 ? 310 VAL C C     1 
ATOM   5188 O O     . VAL B 1 313 ? 71.900  -27.626 43.033  1.00 24.97 ? 310 VAL C O     1 
ATOM   5189 C CB    . VAL B 1 313 ? 70.845  -29.041 45.597  1.00 25.45 ? 310 VAL C CB    1 
ATOM   5190 C CG1   . VAL B 1 313 ? 72.210  -29.280 46.250  1.00 25.23 ? 310 VAL C CG1   1 
ATOM   5191 C CG2   . VAL B 1 313 ? 69.713  -29.405 46.560  1.00 25.61 ? 310 VAL C CG2   1 
ATOM   5192 N N     . PHE B 1 314 ? 72.773  -26.406 44.723  1.00 25.56 ? 311 PHE C N     1 
ATOM   5193 C CA    . PHE B 1 314 ? 73.993  -25.987 44.053  1.00 26.09 ? 311 PHE C CA    1 
ATOM   5194 C C     . PHE B 1 314 ? 75.068  -26.944 44.540  1.00 26.38 ? 311 PHE C C     1 
ATOM   5195 O O     . PHE B 1 314 ? 75.171  -27.199 45.749  1.00 25.98 ? 311 PHE C O     1 
ATOM   5196 C CB    . PHE B 1 314 ? 74.299  -24.544 44.473  1.00 26.35 ? 311 PHE C CB    1 
ATOM   5197 C CG    . PHE B 1 314 ? 75.222  -23.789 43.545  1.00 25.74 ? 311 PHE C CG    1 
ATOM   5198 C CD1   . PHE B 1 314 ? 74.940  -23.661 42.207  1.00 26.56 ? 311 PHE C CD1   1 
ATOM   5199 C CD2   . PHE B 1 314 ? 76.331  -23.139 44.046  1.00 26.75 ? 311 PHE C CD2   1 
ATOM   5200 C CE1   . PHE B 1 314 ? 75.785  -22.950 41.368  1.00 27.44 ? 311 PHE C CE1   1 
ATOM   5201 C CE2   . PHE B 1 314 ? 77.167  -22.399 43.215  1.00 26.77 ? 311 PHE C CE2   1 
ATOM   5202 C CZ    . PHE B 1 314 ? 76.895  -22.309 41.886  1.00 26.63 ? 311 PHE C CZ    1 
ATOM   5203 N N     . PHE B 1 315 ? 75.832  -27.515 43.609  1.00 27.01 ? 312 PHE C N     1 
ATOM   5204 C CA    . PHE B 1 315 ? 76.801  -28.562 43.939  1.00 27.72 ? 312 PHE C CA    1 
ATOM   5205 C C     . PHE B 1 315 ? 77.975  -28.619 42.943  1.00 28.32 ? 312 PHE C C     1 
ATOM   5206 O O     . PHE B 1 315 ? 77.831  -28.230 41.796  1.00 28.33 ? 312 PHE C O     1 
ATOM   5207 C CB    . PHE B 1 315 ? 76.098  -29.932 44.080  1.00 27.75 ? 312 PHE C CB    1 
ATOM   5208 C CG    . PHE B 1 315 ? 75.679  -30.554 42.770  1.00 27.65 ? 312 PHE C CG    1 
ATOM   5209 C CD1   . PHE B 1 315 ? 74.546  -30.114 42.110  1.00 27.91 ? 312 PHE C CD1   1 
ATOM   5210 C CD2   . PHE B 1 315 ? 76.412  -31.593 42.210  1.00 27.72 ? 312 PHE C CD2   1 
ATOM   5211 C CE1   . PHE B 1 315 ? 74.150  -30.689 40.897  1.00 28.28 ? 312 PHE C CE1   1 
ATOM   5212 C CE2   . PHE B 1 315 ? 76.033  -32.162 41.006  1.00 27.62 ? 312 PHE C CE2   1 
ATOM   5213 C CZ    . PHE B 1 315 ? 74.894  -31.706 40.345  1.00 27.67 ? 312 PHE C CZ    1 
ATOM   5214 N N     . GLY B 1 316 ? 79.132  -29.085 43.412  1.00 29.62 ? 313 GLY C N     1 
ATOM   5215 C CA    . GLY B 1 316 ? 80.398  -29.086 42.633  1.00 30.22 ? 313 GLY C CA    1 
ATOM   5216 C C     . GLY B 1 316 ? 81.290  -30.207 43.136  1.00 31.84 ? 313 GLY C C     1 
ATOM   5217 O O     . GLY B 1 316 ? 80.765  -31.126 43.751  1.00 32.06 ? 313 GLY C O     1 
ATOM   5218 N N     . ASP B 1 317 ? 82.614  -30.197 42.910  1.00 33.39 ? 314 ASP C N     1 
ATOM   5219 C CA    . ASP B 1 317 ? 83.364  -29.215 42.128  1.00 34.58 ? 314 ASP C CA    1 
ATOM   5220 C C     . ASP B 1 317 ? 83.954  -29.926 40.931  1.00 34.37 ? 314 ASP C C     1 
ATOM   5221 O O     . ASP B 1 317 ? 84.871  -30.718 41.105  1.00 34.25 ? 314 ASP C O     1 
ATOM   5222 C CB    . ASP B 1 317 ? 84.567  -28.685 42.913  1.00 35.56 ? 314 ASP C CB    1 
ATOM   5223 C CG    . ASP B 1 317 ? 84.199  -27.645 43.926  1.00 38.81 ? 314 ASP C CG    1 
ATOM   5224 O OD1   . ASP B 1 317 ? 83.555  -28.011 44.944  1.00 42.43 ? 314 ASP C OD1   1 
ATOM   5225 O OD2   . ASP B 1 317 ? 84.592  -26.466 43.712  1.00 43.78 ? 314 ASP C OD2   1 
ATOM   5226 N N     . PHE B 1 318 ? 83.450  -29.636 39.731  1.00 34.17 ? 315 PHE C N     1 
ATOM   5227 C CA    . PHE B 1 318 ? 83.960  -30.255 38.514  1.00 34.03 ? 315 PHE C CA    1 
ATOM   5228 C C     . PHE B 1 318 ? 85.078  -29.394 37.962  1.00 34.44 ? 315 PHE C C     1 
ATOM   5229 O O     . PHE B 1 318 ? 85.131  -28.186 38.224  1.00 34.98 ? 315 PHE C O     1 
ATOM   5230 C CB    . PHE B 1 318 ? 82.869  -30.395 37.455  1.00 33.07 ? 315 PHE C CB    1 
ATOM   5231 C CG    . PHE B 1 318 ? 81.601  -30.990 37.966  1.00 32.22 ? 315 PHE C CG    1 
ATOM   5232 C CD1   . PHE B 1 318 ? 81.439  -32.362 38.026  1.00 32.15 ? 315 PHE C CD1   1 
ATOM   5233 C CD2   . PHE B 1 318 ? 80.559  -30.174 38.390  1.00 31.45 ? 315 PHE C CD2   1 
ATOM   5234 C CE1   . PHE B 1 318 ? 80.249  -32.916 38.502  1.00 31.57 ? 315 PHE C CE1   1 
ATOM   5235 C CE2   . PHE B 1 318 ? 79.380  -30.717 38.877  1.00 31.30 ? 315 PHE C CE2   1 
ATOM   5236 C CZ    . PHE B 1 318 ? 79.222  -32.092 38.922  1.00 31.30 ? 315 PHE C CZ    1 
ATOM   5237 N N     . SER B 1 319 ? 85.975  -30.015 37.202  1.00 34.80 ? 316 SER C N     1 
ATOM   5238 C CA    . SER B 1 319 ? 86.978  -29.270 36.434  1.00 34.73 ? 316 SER C CA    1 
ATOM   5239 C C     . SER B 1 319 ? 86.308  -28.558 35.263  1.00 34.79 ? 316 SER C C     1 
ATOM   5240 O O     . SER B 1 319 ? 86.672  -27.430 34.911  1.00 35.23 ? 316 SER C O     1 
ATOM   5241 C CB    . SER B 1 319 ? 88.066  -30.213 35.926  1.00 35.02 ? 316 SER C CB    1 
ATOM   5242 O OG    . SER B 1 319 ? 88.749  -30.785 37.025  1.00 36.31 ? 316 SER C OG    1 
ATOM   5243 N N     . ASP B 1 320 ? 85.324  -29.225 34.672  1.00 34.49 ? 317 ASP C N     1 
ATOM   5244 C CA    . ASP B 1 320 ? 84.536  -28.655 33.590  1.00 33.87 ? 317 ASP C CA    1 
ATOM   5245 C C     . ASP B 1 320 ? 83.060  -28.964 33.877  1.00 33.04 ? 317 ASP C C     1 
ATOM   5246 O O     . ASP B 1 320 ? 82.598  -30.076 33.628  1.00 32.79 ? 317 ASP C O     1 
ATOM   5247 C CB    . ASP B 1 320 ? 85.022  -29.264 32.261  1.00 34.48 ? 317 ASP C CB    1 
ATOM   5248 C CG    . ASP B 1 320 ? 84.288  -28.730 31.045  1.00 35.44 ? 317 ASP C CG    1 
ATOM   5249 O OD1   . ASP B 1 320 ? 83.553  -27.709 31.127  1.00 38.10 ? 317 ASP C OD1   1 
ATOM   5250 O OD2   . ASP B 1 320 ? 84.464  -29.354 29.984  1.00 39.31 ? 317 ASP C OD2   1 
ATOM   5251 N N     . GLN B 1 321 ? 82.341  -27.976 34.420  1.00 32.34 ? 318 GLN C N     1 
ATOM   5252 C CA    . GLN B 1 321 ? 80.918  -28.141 34.783  1.00 32.00 ? 318 GLN C CA    1 
ATOM   5253 C C     . GLN B 1 321 ? 80.074  -28.421 33.560  1.00 30.79 ? 318 GLN C C     1 
ATOM   5254 O O     . GLN B 1 321 ? 79.076  -29.127 33.654  1.00 29.93 ? 318 GLN C O     1 
ATOM   5255 C CB    . GLN B 1 321 ? 80.274  -26.911 35.453  1.00 31.88 ? 318 GLN C CB    1 
ATOM   5256 C CG    . GLN B 1 321 ? 81.175  -25.821 35.875  1.00 33.76 ? 318 GLN C CG    1 
ATOM   5257 C CD    . GLN B 1 321 ? 81.503  -24.832 34.788  1.00 33.46 ? 318 GLN C CD    1 
ATOM   5258 O OE1   . GLN B 1 321 ? 80.618  -24.232 34.193  1.00 36.48 ? 318 GLN C OE1   1 
ATOM   5259 N NE2   . GLN B 1 321 ? 82.780  -24.629 34.551  1.00 34.82 ? 318 GLN C NE2   1 
ATOM   5260 N N     . HIS B 1 322 ? 80.450  -27.824 32.434  1.00 30.64 ? 319 HIS C N     1 
ATOM   5261 C CA    . HIS B 1 322 ? 79.671  -27.974 31.218  1.00 30.39 ? 319 HIS C CA    1 
ATOM   5262 C C     . HIS B 1 322 ? 79.709  -29.395 30.668  1.00 29.75 ? 319 HIS C C     1 
ATOM   5263 O O     . HIS B 1 322 ? 78.691  -29.904 30.205  1.00 29.58 ? 319 HIS C O     1 
ATOM   5264 C CB    . HIS B 1 322 ? 80.084  -26.989 30.122  1.00 31.11 ? 319 HIS C CB    1 
ATOM   5265 C CG    . HIS B 1 322 ? 79.079  -26.922 29.020  1.00 32.48 ? 319 HIS C CG    1 
ATOM   5266 N ND1   . HIS B 1 322 ? 79.104  -27.788 27.946  1.00 35.27 ? 319 HIS C ND1   1 
ATOM   5267 C CD2   . HIS B 1 322 ? 77.947  -26.188 28.891  1.00 35.66 ? 319 HIS C CD2   1 
ATOM   5268 C CE1   . HIS B 1 322 ? 78.062  -27.546 27.170  1.00 36.56 ? 319 HIS C CE1   1 
ATOM   5269 N NE2   . HIS B 1 322 ? 77.347  -26.576 27.717  1.00 37.31 ? 319 HIS C NE2   1 
ATOM   5270 N N     . ALA B 1 323 ? 80.880  -30.026 30.714  1.00 28.99 ? 320 ALA C N     1 
ATOM   5271 C CA    . ALA B 1 323 ? 80.989  -31.429 30.330  1.00 28.43 ? 320 ALA C CA    1 
ATOM   5272 C C     . ALA B 1 323 ? 80.155  -32.288 31.279  1.00 27.67 ? 320 ALA C C     1 
ATOM   5273 O O     . ALA B 1 323 ? 79.504  -33.245 30.853  1.00 27.99 ? 320 ALA C O     1 
ATOM   5274 C CB    . ALA B 1 323 ? 82.455  -31.888 30.338  1.00 28.49 ? 320 ALA C CB    1 
ATOM   5275 N N     . ALA B 1 324 ? 80.196  -31.952 32.568  1.00 26.49 ? 321 ALA C N     1 
ATOM   5276 C CA    . ALA B 1 324 ? 79.400  -32.658 33.570  1.00 25.87 ? 321 ALA C CA    1 
ATOM   5277 C C     . ALA B 1 324 ? 77.909  -32.512 33.265  1.00 25.04 ? 321 ALA C C     1 
ATOM   5278 O O     . ALA B 1 324 ? 77.140  -33.461 33.381  1.00 24.90 ? 321 ALA C O     1 
ATOM   5279 C CB    . ALA B 1 324 ? 79.722  -32.133 34.971  1.00 25.36 ? 321 ALA C CB    1 
ATOM   5280 N N     . TRP B 1 325 ? 77.538  -31.308 32.855  1.00 24.37 ? 322 TRP C N     1 
ATOM   5281 C CA    . TRP B 1 325 ? 76.169  -30.949 32.530  1.00 24.32 ? 322 TRP C CA    1 
ATOM   5282 C C     . TRP B 1 325 ? 75.656  -31.777 31.358  1.00 24.03 ? 322 TRP C C     1 
ATOM   5283 O O     . TRP B 1 325 ? 74.538  -32.291 31.384  1.00 23.15 ? 322 TRP C O     1 
ATOM   5284 C CB    . TRP B 1 325 ? 76.092  -29.439 32.210  1.00 23.83 ? 322 TRP C CB    1 
ATOM   5285 C CG    . TRP B 1 325 ? 74.756  -29.002 31.766  1.00 23.91 ? 322 TRP C CG    1 
ATOM   5286 C CD1   . TRP B 1 325 ? 73.682  -28.728 32.556  1.00 23.34 ? 322 TRP C CD1   1 
ATOM   5287 C CD2   . TRP B 1 325 ? 74.324  -28.807 30.414  1.00 24.32 ? 322 TRP C CD2   1 
ATOM   5288 N NE1   . TRP B 1 325 ? 72.611  -28.376 31.786  1.00 22.67 ? 322 TRP C NE1   1 
ATOM   5289 C CE2   . TRP B 1 325 ? 72.973  -28.417 30.466  1.00 23.61 ? 322 TRP C CE2   1 
ATOM   5290 C CE3   . TRP B 1 325 ? 74.953  -28.924 29.161  1.00 24.53 ? 322 TRP C CE3   1 
ATOM   5291 C CZ2   . TRP B 1 325 ? 72.231  -28.135 29.317  1.00 24.15 ? 322 TRP C CZ2   1 
ATOM   5292 C CZ3   . TRP B 1 325 ? 74.224  -28.643 28.019  1.00 24.01 ? 322 TRP C CZ3   1 
ATOM   5293 C CH2   . TRP B 1 325 ? 72.871  -28.252 28.102  1.00 24.63 ? 322 TRP C CH2   1 
ATOM   5294 N N     . GLN B 1 326 ? 76.487  -31.884 30.328  1.00 24.12 ? 323 GLN C N     1 
ATOM   5295 C CA    . GLN B 1 326 ? 76.171  -32.677 29.144  1.00 24.09 ? 323 GLN C CA    1 
ATOM   5296 C C     . GLN B 1 326 ? 76.094  -34.164 29.490  1.00 23.67 ? 323 GLN C C     1 
ATOM   5297 O O     . GLN B 1 326 ? 75.271  -34.899 28.936  1.00 24.06 ? 323 GLN C O     1 
ATOM   5298 C CB    . GLN B 1 326 ? 77.238  -32.420 28.056  1.00 24.48 ? 323 GLN C CB    1 
ATOM   5299 C CG    . GLN B 1 326 ? 76.991  -33.143 26.741  1.00 25.16 ? 323 GLN C CG    1 
ATOM   5300 C CD    . GLN B 1 326 ? 75.645  -32.825 26.117  1.00 28.01 ? 323 GLN C CD    1 
ATOM   5301 O OE1   . GLN B 1 326 ? 75.239  -31.658 26.027  1.00 30.19 ? 323 GLN C OE1   1 
ATOM   5302 N NE2   . GLN B 1 326 ? 74.940  -33.867 25.678  1.00 28.18 ? 323 GLN C NE2   1 
ATOM   5303 N N     . ALA B 1 327 ? 76.943  -34.596 30.417  1.00 23.41 ? 324 ALA C N     1 
ATOM   5304 C CA    . ALA B 1 327 ? 76.972  -35.993 30.864  1.00 23.47 ? 324 ALA C CA    1 
ATOM   5305 C C     . ALA B 1 327 ? 75.664  -36.379 31.555  1.00 23.49 ? 324 ALA C C     1 
ATOM   5306 O O     . ALA B 1 327 ? 75.201  -37.505 31.415  1.00 23.49 ? 324 ALA C O     1 
ATOM   5307 C CB    . ALA B 1 327 ? 78.155  -36.216 31.798  1.00 23.66 ? 324 ALA C CB    1 
ATOM   5308 N N     . PHE B 1 328 ? 75.070  -35.428 32.283  1.00 23.35 ? 325 PHE C N     1 
ATOM   5309 C CA    . PHE B 1 328 ? 73.756  -35.617 32.901  1.00 23.34 ? 325 PHE C CA    1 
ATOM   5310 C C     . PHE B 1 328 ? 72.711  -35.682 31.802  1.00 23.69 ? 325 PHE C C     1 
ATOM   5311 O O     . PHE B 1 328 ? 71.812  -36.538 31.811  1.00 23.75 ? 325 PHE C O     1 
ATOM   5312 C CB    . PHE B 1 328 ? 73.434  -34.450 33.858  1.00 23.14 ? 325 PHE C CB    1 
ATOM   5313 C CG    . PHE B 1 328 ? 74.004  -34.607 35.247  1.00 22.63 ? 325 PHE C CG    1 
ATOM   5314 C CD1   . PHE B 1 328 ? 73.398  -35.455 36.168  1.00 21.17 ? 325 PHE C CD1   1 
ATOM   5315 C CD2   . PHE B 1 328 ? 75.122  -33.887 35.643  1.00 21.72 ? 325 PHE C CD2   1 
ATOM   5316 C CE1   . PHE B 1 328 ? 73.908  -35.595 37.458  1.00 21.74 ? 325 PHE C CE1   1 
ATOM   5317 C CE2   . PHE B 1 328 ? 75.640  -34.028 36.927  1.00 22.63 ? 325 PHE C CE2   1 
ATOM   5318 C CZ    . PHE B 1 328 ? 75.021  -34.891 37.838  1.00 22.63 ? 325 PHE C CZ    1 
ATOM   5319 N N     . LEU B 1 329 ? 72.824  -34.766 30.845  1.00 23.97 ? 326 LEU C N     1 
ATOM   5320 C CA    . LEU B 1 329 ? 71.862  -34.701 29.760  1.00 24.64 ? 326 LEU C CA    1 
ATOM   5321 C C     . LEU B 1 329 ? 71.858  -35.972 28.879  1.00 25.52 ? 326 LEU C C     1 
ATOM   5322 O O     . LEU B 1 329 ? 70.794  -36.405 28.452  1.00 26.15 ? 326 LEU C O     1 
ATOM   5323 C CB    . LEU B 1 329 ? 72.068  -33.440 28.929  1.00 24.59 ? 326 LEU C CB    1 
ATOM   5324 C CG    . LEU B 1 329 ? 70.862  -33.073 28.056  1.00 24.38 ? 326 LEU C CG    1 
ATOM   5325 C CD1   . LEU B 1 329 ? 69.580  -33.043 28.906  1.00 23.79 ? 326 LEU C CD1   1 
ATOM   5326 C CD2   . LEU B 1 329 ? 71.088  -31.759 27.332  1.00 23.08 ? 326 LEU C CD2   1 
ATOM   5327 N N     . ASP B 1 330 ? 73.031  -36.570 28.650  1.00 26.33 ? 327 ASP C N     1 
ATOM   5328 C CA    . ASP B 1 330 ? 73.154  -37.849 27.917  1.00 26.82 ? 327 ASP C CA    1 
ATOM   5329 C C     . ASP B 1 330 ? 72.477  -39.009 28.627  1.00 27.35 ? 327 ASP C C     1 
ATOM   5330 O O     . ASP B 1 330 ? 72.117  -40.009 27.991  1.00 28.23 ? 327 ASP C O     1 
ATOM   5331 C CB    . ASP B 1 330 ? 74.623  -38.221 27.711  1.00 26.98 ? 327 ASP C CB    1 
ATOM   5332 C CG    . ASP B 1 330 ? 75.340  -37.264 26.783  1.00 28.45 ? 327 ASP C CG    1 
ATOM   5333 O OD1   . ASP B 1 330 ? 74.659  -36.546 26.024  1.00 30.27 ? 327 ASP C OD1   1 
ATOM   5334 O OD2   . ASP B 1 330 ? 76.586  -37.219 26.819  1.00 32.92 ? 327 ASP C OD2   1 
ATOM   5335 N N     . ARG B 1 331 ? 72.330  -38.885 29.942  1.00 27.44 ? 328 ARG C N     1 
ATOM   5336 C CA    . ARG B 1 331 ? 71.610  -39.859 30.740  1.00 27.33 ? 328 ARG C CA    1 
ATOM   5337 C C     . ARG B 1 331 ? 70.140  -39.444 30.964  1.00 27.02 ? 328 ARG C C     1 
ATOM   5338 O O     . ARG B 1 331 ? 69.444  -40.024 31.789  1.00 27.47 ? 328 ARG C O     1 
ATOM   5339 C CB    . ARG B 1 331 ? 72.344  -40.072 32.059  1.00 27.57 ? 328 ARG C CB    1 
ATOM   5340 C CG    . ARG B 1 331 ? 73.718  -40.716 31.894  1.00 28.15 ? 328 ARG C CG    1 
ATOM   5341 C CD    . ARG B 1 331 ? 74.580  -40.505 33.127  1.00 28.48 ? 328 ARG C CD    1 
ATOM   5342 N NE    . ARG B 1 331 ? 75.853  -41.213 33.049  1.00 30.45 ? 328 ARG C NE    1 
ATOM   5343 C CZ    . ARG B 1 331 ? 76.861  -40.884 32.238  1.00 32.16 ? 328 ARG C CZ    1 
ATOM   5344 N NH1   . ARG B 1 331 ? 76.781  -39.844 31.419  1.00 33.01 ? 328 ARG C NH1   1 
ATOM   5345 N NH2   . ARG B 1 331 ? 77.971  -41.608 32.246  1.00 33.55 ? 328 ARG C NH2   1 
ATOM   5346 N N     . GLY B 1 332 ? 69.668  -38.460 30.207  1.00 26.79 ? 329 GLY C N     1 
ATOM   5347 C CA    . GLY B 1 332 ? 68.262  -38.035 30.271  1.00 26.64 ? 329 GLY C CA    1 
ATOM   5348 C C     . GLY B 1 332 ? 67.902  -37.055 31.375  1.00 26.50 ? 329 GLY C C     1 
ATOM   5349 O O     . GLY B 1 332 ? 66.713  -36.762 31.587  1.00 27.68 ? 329 GLY C O     1 
ATOM   5350 N N     . VAL B 1 333 ? 68.906  -36.527 32.067  1.00 25.75 ? 330 VAL C N     1 
ATOM   5351 C CA    . VAL B 1 333 ? 68.678  -35.611 33.193  1.00 24.81 ? 330 VAL C CA    1 
ATOM   5352 C C     . VAL B 1 333 ? 69.138  -34.194 32.805  1.00 24.36 ? 330 VAL C C     1 
ATOM   5353 O O     . VAL B 1 333 ? 70.327  -33.947 32.545  1.00 23.89 ? 330 VAL C O     1 
ATOM   5354 C CB    . VAL B 1 333 ? 69.390  -36.124 34.470  1.00 25.06 ? 330 VAL C CB    1 
ATOM   5355 C CG1   . VAL B 1 333 ? 69.126  -35.209 35.659  1.00 24.16 ? 330 VAL C CG1   1 
ATOM   5356 C CG2   . VAL B 1 333 ? 68.956  -37.565 34.785  1.00 24.27 ? 330 VAL C CG2   1 
ATOM   5357 N N     . LEU B 1 334 ? 68.178  -33.279 32.711  1.00 23.48 ? 331 LEU C N     1 
ATOM   5358 C CA    . LEU B 1 334 ? 68.462  -31.912 32.337  1.00 23.12 ? 331 LEU C CA    1 
ATOM   5359 C C     . LEU B 1 334 ? 68.475  -31.052 33.588  1.00 23.15 ? 331 LEU C C     1 
ATOM   5360 O O     . LEU B 1 334 ? 67.411  -30.769 34.182  1.00 21.93 ? 331 LEU C O     1 
ATOM   5361 C CB    . LEU B 1 334 ? 67.438  -31.394 31.328  1.00 23.34 ? 331 LEU C CB    1 
ATOM   5362 C CG    . LEU B 1 334 ? 67.589  -29.936 30.864  1.00 22.27 ? 331 LEU C CG    1 
ATOM   5363 C CD1   . LEU B 1 334 ? 68.969  -29.664 30.286  1.00 22.94 ? 331 LEU C CD1   1 
ATOM   5364 C CD2   . LEU B 1 334 ? 66.535  -29.608 29.859  1.00 22.89 ? 331 LEU C CD2   1 
ATOM   5365 N N     . ILE B 1 335 ? 69.683  -30.659 33.986  1.00 22.54 ? 332 ILE C N     1 
ATOM   5366 C CA    . ILE B 1 335 ? 69.879  -29.705 35.081  1.00 23.04 ? 332 ILE C CA    1 
ATOM   5367 C C     . ILE B 1 335 ? 70.406  -28.386 34.511  1.00 22.93 ? 332 ILE C C     1 
ATOM   5368 O O     . ILE B 1 335 ? 70.194  -28.115 33.347  1.00 22.14 ? 332 ILE C O     1 
ATOM   5369 C CB    . ILE B 1 335 ? 70.725  -30.331 36.221  1.00 22.61 ? 332 ILE C CB    1 
ATOM   5370 C CG1   . ILE B 1 335 ? 72.141  -30.672 35.765  1.00 22.89 ? 332 ILE C CG1   1 
ATOM   5371 C CG2   . ILE B 1 335 ? 70.043  -31.636 36.697  1.00 22.02 ? 332 ILE C CG2   1 
ATOM   5372 C CD1   . ILE B 1 335 ? 73.034  -31.177 36.885  1.00 22.73 ? 332 ILE C CD1   1 
ATOM   5373 N N     . ARG B 1 336 ? 71.038  -27.551 35.329  1.00 24.08 ? 333 ARG C N     1 
ATOM   5374 C CA    . ARG B 1 336 ? 71.382  -26.200 34.930  1.00 24.57 ? 333 ARG C CA    1 
ATOM   5375 C C     . ARG B 1 336 ? 72.874  -25.892 35.139  1.00 25.24 ? 333 ARG C C     1 
ATOM   5376 O O     . ARG B 1 336 ? 73.450  -26.110 36.217  1.00 24.16 ? 333 ARG C O     1 
ATOM   5377 C CB    . ARG B 1 336 ? 70.498  -25.194 35.678  1.00 24.57 ? 333 ARG C CB    1 
ATOM   5378 C CG    . ARG B 1 336 ? 70.719  -23.716 35.347  1.00 25.46 ? 333 ARG C CG    1 
ATOM   5379 C CD    . ARG B 1 336 ? 69.798  -23.160 34.280  1.00 29.69 ? 333 ARG C CD    1 
ATOM   5380 N NE    . ARG B 1 336 ? 70.549  -22.826 33.093  1.00 33.24 ? 333 ARG C NE    1 
ATOM   5381 C CZ    . ARG B 1 336 ? 70.873  -21.600 32.681  1.00 33.81 ? 333 ARG C CZ    1 
ATOM   5382 N NH1   . ARG B 1 336 ? 70.461  -20.510 33.310  1.00 35.23 ? 333 ARG C NH1   1 
ATOM   5383 N NH2   . ARG B 1 336 ? 71.606  -21.481 31.588  1.00 33.91 ? 333 ARG C NH2   1 
ATOM   5384 N N     . ASP B 1 337 ? 73.478  -25.369 34.074  1.00 26.18 ? 334 ASP C N     1 
ATOM   5385 C CA    . ASP B 1 337 ? 74.804  -24.812 34.119  1.00 26.72 ? 334 ASP C CA    1 
ATOM   5386 C C     . ASP B 1 337 ? 74.613  -23.304 34.088  1.00 27.63 ? 334 ASP C C     1 
ATOM   5387 O O     . ASP B 1 337 ? 74.257  -22.727 33.057  1.00 28.13 ? 334 ASP C O     1 
ATOM   5388 C CB    . ASP B 1 337 ? 75.608  -25.302 32.914  1.00 27.14 ? 334 ASP C CB    1 
ATOM   5389 C CG    . ASP B 1 337 ? 77.011  -24.746 32.870  1.00 27.03 ? 334 ASP C CG    1 
ATOM   5390 O OD1   . ASP B 1 337 ? 77.395  -23.923 33.727  1.00 29.34 ? 334 ASP C OD1   1 
ATOM   5391 O OD2   . ASP B 1 337 ? 77.735  -25.128 31.941  1.00 30.70 ? 334 ASP C OD2   1 
ATOM   5392 N N     . VAL B 1 338 ? 74.841  -22.673 35.229  1.00 28.07 ? 335 VAL C N     1 
ATOM   5393 C CA    . VAL B 1 338 ? 74.658  -21.238 35.376  1.00 28.83 ? 335 VAL C CA    1 
ATOM   5394 C C     . VAL B 1 338 ? 75.961  -20.474 35.071  1.00 29.36 ? 335 VAL C C     1 
ATOM   5395 O O     . VAL B 1 338 ? 76.066  -19.285 35.340  1.00 29.96 ? 335 VAL C O     1 
ATOM   5396 C CB    . VAL B 1 338 ? 74.167  -20.907 36.801  1.00 29.04 ? 335 VAL C CB    1 
ATOM   5397 C CG1   . VAL B 1 338 ? 72.878  -21.670 37.106  1.00 30.14 ? 335 VAL C CG1   1 
ATOM   5398 C CG2   . VAL B 1 338 ? 75.219  -21.286 37.839  1.00 28.91 ? 335 VAL C CG2   1 
ATOM   5399 N N     . GLY B 1 339 ? 76.953  -21.154 34.507  1.00 29.85 ? 336 GLY C N     1 
ATOM   5400 C CA    . GLY B 1 339 ? 78.210  -20.502 34.140  1.00 29.97 ? 336 GLY C CA    1 
ATOM   5401 C C     . GLY B 1 339 ? 79.079  -20.160 35.331  1.00 30.06 ? 336 GLY C C     1 
ATOM   5402 O O     . GLY B 1 339 ? 79.879  -19.248 35.260  1.00 30.69 ? 336 GLY C O     1 
ATOM   5403 N N     . ILE B 1 340 ? 78.912  -20.872 36.440  1.00 30.13 ? 337 ILE C N     1 
ATOM   5404 C CA    . ILE B 1 340 ? 79.801  -20.703 37.606  1.00 30.00 ? 337 ILE C CA    1 
ATOM   5405 C C     . ILE B 1 340 ? 80.741  -21.892 37.651  1.00 29.69 ? 337 ILE C C     1 
ATOM   5406 O O     . ILE B 1 340 ? 80.290  -23.033 37.668  1.00 29.21 ? 337 ILE C O     1 
ATOM   5407 C CB    . ILE B 1 340 ? 79.037  -20.635 38.933  1.00 30.00 ? 337 ILE C CB    1 
ATOM   5408 C CG1   . ILE B 1 340 ? 77.998  -19.516 38.907  1.00 30.77 ? 337 ILE C CG1   1 
ATOM   5409 C CG2   . ILE B 1 340 ? 80.007  -20.404 40.076  1.00 29.91 ? 337 ILE C CG2   1 
ATOM   5410 C CD1   . ILE B 1 340 ? 78.597  -18.126 38.754  1.00 31.84 ? 337 ILE C CD1   1 
ATOM   5411 N N     . ALA B 1 341 ? 82.040  -21.613 37.655  1.00 29.79 ? 338 ALA C N     1 
ATOM   5412 C CA    . ALA B 1 341 ? 83.069  -22.652 37.603  1.00 29.60 ? 338 ALA C CA    1 
ATOM   5413 C C     . ALA B 1 341 ? 82.833  -23.760 38.630  1.00 29.50 ? 338 ALA C C     1 
ATOM   5414 O O     . ALA B 1 341 ? 82.557  -23.496 39.800  1.00 30.76 ? 338 ALA C O     1 
ATOM   5415 C CB    . ALA B 1 341 ? 84.457  -22.035 37.799  1.00 29.70 ? 338 ALA C CB    1 
ATOM   5416 N N     . GLY B 1 342 ? 82.931  -25.000 38.172  1.00 28.87 ? 339 GLY C N     1 
ATOM   5417 C CA    . GLY B 1 342 ? 82.813  -26.188 39.019  1.00 28.12 ? 339 GLY C CA    1 
ATOM   5418 C C     . GLY B 1 342 ? 81.446  -26.626 39.526  1.00 27.58 ? 339 GLY C C     1 
ATOM   5419 O O     . GLY B 1 342 ? 81.325  -27.690 40.130  1.00 27.11 ? 339 GLY C O     1 
ATOM   5420 N N     . HIS B 1 343 ? 80.420  -25.817 39.316  1.00 26.99 ? 340 HIS C N     1 
ATOM   5421 C CA    . HIS B 1 343 ? 79.128  -26.065 39.961  1.00 26.00 ? 340 HIS C CA    1 
ATOM   5422 C C     . HIS B 1 343 ? 78.015  -26.140 38.972  1.00 25.08 ? 340 HIS C C     1 
ATOM   5423 O O     . HIS B 1 343 ? 78.086  -25.546 37.908  1.00 25.18 ? 340 HIS C O     1 
ATOM   5424 C CB    . HIS B 1 343 ? 78.806  -24.971 40.991  1.00 26.47 ? 340 HIS C CB    1 
ATOM   5425 C CG    . HIS B 1 343 ? 79.730  -24.972 42.164  1.00 27.06 ? 340 HIS C CG    1 
ATOM   5426 N ND1   . HIS B 1 343 ? 80.973  -24.383 42.127  1.00 28.15 ? 340 HIS C ND1   1 
ATOM   5427 C CD2   . HIS B 1 343 ? 79.613  -25.527 43.392  1.00 28.22 ? 340 HIS C CD2   1 
ATOM   5428 C CE1   . HIS B 1 343 ? 81.575  -24.559 43.290  1.00 28.82 ? 340 HIS C CE1   1 
ATOM   5429 N NE2   . HIS B 1 343 ? 80.767  -25.243 44.078  1.00 28.96 ? 340 HIS C NE2   1 
ATOM   5430 N N     . LEU B 1 344 ? 76.988  -26.884 39.358  1.00 24.16 ? 341 LEU C N     1 
ATOM   5431 C CA    . LEU B 1 344 ? 75.738  -26.996 38.624  1.00 23.81 ? 341 LEU C CA    1 
ATOM   5432 C C     . LEU B 1 344 ? 74.601  -26.844 39.622  1.00 22.88 ? 341 LEU C C     1 
ATOM   5433 O O     . LEU B 1 344 ? 74.794  -26.985 40.828  1.00 22.57 ? 341 LEU C O     1 
ATOM   5434 C CB    . LEU B 1 344 ? 75.633  -28.356 37.911  1.00 23.47 ? 341 LEU C CB    1 
ATOM   5435 C CG    . LEU B 1 344 ? 76.705  -28.715 36.862  1.00 23.81 ? 341 LEU C CG    1 
ATOM   5436 C CD1   . LEU B 1 344 ? 76.495  -30.143 36.335  1.00 22.77 ? 341 LEU C CD1   1 
ATOM   5437 C CD2   . LEU B 1 344 ? 76.769  -27.697 35.706  1.00 23.23 ? 341 LEU C CD2   1 
ATOM   5438 N N     . ARG B 1 345 ? 73.426  -26.518 39.107  1.00 22.57 ? 342 ARG C N     1 
ATOM   5439 C CA    . ARG B 1 345 ? 72.226  -26.350 39.926  1.00 22.02 ? 342 ARG C CA    1 
ATOM   5440 C C     . ARG B 1 345 ? 71.202  -27.367 39.493  1.00 21.46 ? 342 ARG C C     1 
ATOM   5441 O O     . ARG B 1 345 ? 70.795  -27.387 38.338  1.00 21.60 ? 342 ARG C O     1 
ATOM   5442 C CB    . ARG B 1 345 ? 71.666  -24.932 39.769  1.00 22.38 ? 342 ARG C CB    1 
ATOM   5443 C CG    . ARG B 1 345 ? 70.518  -24.601 40.724  1.00 22.24 ? 342 ARG C CG    1 
ATOM   5444 C CD    . ARG B 1 345 ? 69.811  -23.343 40.327  1.00 21.49 ? 342 ARG C CD    1 
ATOM   5445 N NE    . ARG B 1 345 ? 69.035  -23.551 39.116  1.00 21.46 ? 342 ARG C NE    1 
ATOM   5446 C CZ    . ARG B 1 345 ? 68.729  -22.598 38.255  1.00 20.09 ? 342 ARG C CZ    1 
ATOM   5447 N NH1   . ARG B 1 345 ? 69.109  -21.356 38.470  1.00 22.36 ? 342 ARG C NH1   1 
ATOM   5448 N NH2   . ARG B 1 345 ? 68.039  -22.893 37.175  1.00 21.28 ? 342 ARG C NH2   1 
ATOM   5449 N N     . THR B 1 346 ? 70.783  -28.227 40.413  1.00 21.01 ? 343 THR C N     1 
ATOM   5450 C CA    . THR B 1 346 ? 69.703  -29.157 40.115  1.00 21.05 ? 343 THR C CA    1 
ATOM   5451 C C     . THR B 1 346 ? 68.455  -28.720 40.869  1.00 20.27 ? 343 THR C C     1 
ATOM   5452 O O     . THR B 1 346 ? 68.514  -28.425 42.053  1.00 19.67 ? 343 THR C O     1 
ATOM   5453 C CB    . THR B 1 346 ? 70.051  -30.615 40.485  1.00 20.54 ? 343 THR C CB    1 
ATOM   5454 O OG1   . THR B 1 346 ? 68.980  -31.488 40.083  1.00 21.01 ? 343 THR C OG1   1 
ATOM   5455 C CG2   . THR B 1 346 ? 70.240  -30.761 41.981  1.00 21.26 ? 343 THR C CG2   1 
ATOM   5456 N N     . THR B 1 347 ? 67.340  -28.684 40.158  1.00 20.58 ? 344 THR C N     1 
ATOM   5457 C CA    . THR B 1 347 ? 66.013  -28.455 40.735  1.00 20.98 ? 344 THR C CA    1 
ATOM   5458 C C     . THR B 1 347 ? 65.472  -29.738 41.366  1.00 21.54 ? 344 THR C C     1 
ATOM   5459 O O     . THR B 1 347 ? 65.622  -30.824 40.812  1.00 22.60 ? 344 THR C O     1 
ATOM   5460 C CB    . THR B 1 347 ? 64.998  -27.983 39.650  1.00 20.56 ? 344 THR C CB    1 
ATOM   5461 O OG1   . THR B 1 347 ? 65.454  -26.755 39.072  1.00 19.24 ? 344 THR C OG1   1 
ATOM   5462 C CG2   . THR B 1 347 ? 63.572  -27.784 40.246  1.00 19.82 ? 344 THR C CG2   1 
ATOM   5463 N N     . ILE B 1 348 ? 64.811  -29.616 42.512  1.00 22.19 ? 345 ILE C N     1 
ATOM   5464 C CA    . ILE B 1 348 ? 64.188  -30.782 43.127  1.00 22.24 ? 345 ILE C CA    1 
ATOM   5465 C C     . ILE B 1 348 ? 62.892  -31.125 42.431  1.00 22.43 ? 345 ILE C C     1 
ATOM   5466 O O     . ILE B 1 348 ? 62.010  -30.287 42.270  1.00 21.84 ? 345 ILE C O     1 
ATOM   5467 C CB    . ILE B 1 348 ? 63.905  -30.629 44.629  1.00 22.44 ? 345 ILE C CB    1 
ATOM   5468 C CG1   . ILE B 1 348 ? 65.178  -30.262 45.386  1.00 22.69 ? 345 ILE C CG1   1 
ATOM   5469 C CG2   . ILE B 1 348 ? 63.349  -31.948 45.171  1.00 21.65 ? 345 ILE C CG2   1 
ATOM   5470 C CD1   . ILE B 1 348 ? 66.304  -31.290 45.243  1.00 23.44 ? 345 ILE C CD1   1 
ATOM   5471 N N     . GLY B 1 349 ? 62.797  -32.387 42.030  1.00 22.77 ? 346 GLY C N     1 
ATOM   5472 C CA    . GLY B 1 349 ? 61.655  -32.881 41.310  1.00 23.84 ? 346 GLY C CA    1 
ATOM   5473 C C     . GLY B 1 349 ? 60.812  -33.765 42.208  1.00 23.98 ? 346 GLY C C     1 
ATOM   5474 O O     . GLY B 1 349 ? 60.901  -33.716 43.427  1.00 23.19 ? 346 GLY C O     1 
ATOM   5475 N N     . VAL B 1 350 ? 59.981  -34.565 41.569  1.00 25.12 ? 347 VAL C N     1 
ATOM   5476 C CA    . VAL B 1 350 ? 59.251  -35.621 42.233  1.00 25.97 ? 347 VAL C CA    1 
ATOM   5477 C C     . VAL B 1 350 ? 60.232  -36.764 42.477  1.00 26.62 ? 347 VAL C C     1 
ATOM   5478 O O     . VAL B 1 350 ? 61.261  -36.860 41.786  1.00 26.33 ? 347 VAL C O     1 
ATOM   5479 C CB    . VAL B 1 350 ? 58.062  -36.094 41.378  1.00 25.93 ? 347 VAL C CB    1 
ATOM   5480 C CG1   . VAL B 1 350 ? 57.049  -34.957 41.217  1.00 25.93 ? 347 VAL C CG1   1 
ATOM   5481 C CG2   . VAL B 1 350 ? 58.535  -36.616 40.029  1.00 25.63 ? 347 VAL C CG2   1 
ATOM   5482 N N     . PRO B 1 351 ? 59.939  -37.618 43.470  1.00 27.30 ? 348 PRO C N     1 
ATOM   5483 C CA    . PRO B 1 351 ? 60.894  -38.662 43.884  1.00 28.11 ? 348 PRO C CA    1 
ATOM   5484 C C     . PRO B 1 351 ? 61.589  -39.416 42.744  1.00 28.85 ? 348 PRO C C     1 
ATOM   5485 O O     . PRO B 1 351 ? 62.824  -39.540 42.742  1.00 29.07 ? 348 PRO C O     1 
ATOM   5486 C CB    . PRO B 1 351 ? 60.029  -39.589 44.730  1.00 28.07 ? 348 PRO C CB    1 
ATOM   5487 C CG    . PRO B 1 351 ? 59.031  -38.626 45.365  1.00 27.80 ? 348 PRO C CG    1 
ATOM   5488 C CD    . PRO B 1 351 ? 58.708  -37.649 44.283  1.00 27.08 ? 348 PRO C CD    1 
ATOM   5489 N N     . GLU B 1 352 ? 60.803  -39.870 41.776  1.00 29.51 ? 349 GLU C N     1 
ATOM   5490 C CA    . GLU B 1 352 ? 61.304  -40.647 40.650  1.00 29.89 ? 349 GLU C CA    1 
ATOM   5491 C C     . GLU B 1 352 ? 62.303  -39.861 39.774  1.00 29.86 ? 349 GLU C C     1 
ATOM   5492 O O     . GLU B 1 352 ? 63.250  -40.442 39.243  1.00 29.65 ? 349 GLU C O     1 
ATOM   5493 C CB    . GLU B 1 352 ? 60.108  -41.113 39.822  1.00 30.32 ? 349 GLU C CB    1 
ATOM   5494 C CG    . GLU B 1 352 ? 60.407  -42.146 38.748  1.00 31.72 ? 349 GLU C CG    1 
ATOM   5495 C CD    . GLU B 1 352 ? 59.137  -42.843 38.248  1.00 33.51 ? 349 GLU C CD    1 
ATOM   5496 O OE1   . GLU B 1 352 ? 58.445  -43.504 39.079  1.00 38.93 ? 349 GLU C OE1   1 
ATOM   5497 O OE2   . GLU B 1 352 ? 58.829  -42.724 37.032  1.00 38.45 ? 349 GLU C OE2   1 
ATOM   5498 N N     . GLU B 1 353 ? 62.096  -38.546 39.634  1.00 29.44 ? 350 GLU C N     1 
ATOM   5499 C CA    . GLU B 1 353 ? 63.043  -37.671 38.919  1.00 28.82 ? 350 GLU C CA    1 
ATOM   5500 C C     . GLU B 1 353 ? 64.319  -37.488 39.723  1.00 28.33 ? 350 GLU C C     1 
ATOM   5501 O O     . GLU B 1 353 ? 65.427  -37.524 39.184  1.00 28.26 ? 350 GLU C O     1 
ATOM   5502 C CB    . GLU B 1 353 ? 62.414  -36.301 38.608  1.00 28.79 ? 350 GLU C CB    1 
ATOM   5503 C CG    . GLU B 1 353 ? 61.209  -36.373 37.659  1.00 28.63 ? 350 GLU C CG    1 
ATOM   5504 C CD    . GLU B 1 353 ? 60.391  -35.069 37.560  1.00 29.03 ? 350 GLU C CD    1 
ATOM   5505 O OE1   . GLU B 1 353 ? 60.596  -34.100 38.343  1.00 25.79 ? 350 GLU C OE1   1 
ATOM   5506 O OE2   . GLU B 1 353 ? 59.523  -35.029 36.658  1.00 31.15 ? 350 GLU C OE2   1 
ATOM   5507 N N     . ASN B 1 354 ? 64.177  -37.301 41.025  1.00 28.09 ? 351 ASN C N     1 
ATOM   5508 C CA    . ASN B 1 354 ? 65.363  -37.215 41.890  1.00 27.92 ? 351 ASN C CA    1 
ATOM   5509 C C     . ASN B 1 354 ? 66.189  -38.504 41.914  1.00 27.75 ? 351 ASN C C     1 
ATOM   5510 O O     . ASN B 1 354 ? 67.417  -38.458 41.927  1.00 27.01 ? 351 ASN C O     1 
ATOM   5511 C CB    . ASN B 1 354 ? 64.959  -36.781 43.290  1.00 27.29 ? 351 ASN C CB    1 
ATOM   5512 C CG    . ASN B 1 354 ? 64.368  -35.404 43.293  1.00 26.64 ? 351 ASN C CG    1 
ATOM   5513 O OD1   . ASN B 1 354 ? 64.831  -34.536 42.558  1.00 23.58 ? 351 ASN C OD1   1 
ATOM   5514 N ND2   . ASN B 1 354 ? 63.310  -35.201 44.072  1.00 23.79 ? 351 ASN C ND2   1 
ATOM   5515 N N     . ASP B 1 355 ? 65.505  -39.644 41.897  1.00 27.96 ? 352 ASP C N     1 
ATOM   5516 C CA    . ASP B 1 355 ? 66.177  -40.941 41.792  1.00 28.21 ? 352 ASP C CA    1 
ATOM   5517 C C     . ASP B 1 355 ? 67.003  -41.063 40.515  1.00 27.81 ? 352 ASP C C     1 
ATOM   5518 O O     . ASP B 1 355 ? 68.136  -41.535 40.551  1.00 27.91 ? 352 ASP C O     1 
ATOM   5519 C CB    . ASP B 1 355 ? 65.160  -42.083 41.879  1.00 28.76 ? 352 ASP C CB    1 
ATOM   5520 C CG    . ASP B 1 355 ? 64.625  -42.298 43.304  1.00 31.15 ? 352 ASP C CG    1 
ATOM   5521 O OD1   . ASP B 1 355 ? 65.176  -41.710 44.268  1.00 33.91 ? 352 ASP C OD1   1 
ATOM   5522 O OD2   . ASP B 1 355 ? 63.637  -43.058 43.462  1.00 35.32 ? 352 ASP C OD2   1 
ATOM   5523 N N     . ALA B 1 356 ? 66.439  -40.624 39.395  1.00 27.33 ? 353 ALA C N     1 
ATOM   5524 C CA    . ALA B 1 356 ? 67.152  -40.622 38.129  1.00 27.24 ? 353 ALA C CA    1 
ATOM   5525 C C     . ALA B 1 356 ? 68.344  -39.663 38.146  1.00 26.99 ? 353 ALA C C     1 
ATOM   5526 O O     . ALA B 1 356 ? 69.412  -40.002 37.639  1.00 27.77 ? 353 ALA C O     1 
ATOM   5527 C CB    . ALA B 1 356 ? 66.191  -40.293 36.967  1.00 27.41 ? 353 ALA C CB    1 
ATOM   5528 N N     . PHE B 1 357 ? 68.170  -38.477 38.720  1.00 26.33 ? 354 PHE C N     1 
ATOM   5529 C CA    . PHE B 1 357 ? 69.279  -37.533 38.907  1.00 26.58 ? 354 PHE C CA    1 
ATOM   5530 C C     . PHE B 1 357 ? 70.403  -38.106 39.785  1.00 26.83 ? 354 PHE C C     1 
ATOM   5531 O O     . PHE B 1 357 ? 71.599  -37.945 39.485  1.00 26.78 ? 354 PHE C O     1 
ATOM   5532 C CB    . PHE B 1 357 ? 68.781  -36.214 39.536  1.00 26.19 ? 354 PHE C CB    1 
ATOM   5533 C CG    . PHE B 1 357 ? 69.877  -35.391 40.157  1.00 25.88 ? 354 PHE C CG    1 
ATOM   5534 C CD1   . PHE B 1 357 ? 70.837  -34.768 39.352  1.00 26.30 ? 354 PHE C CD1   1 
ATOM   5535 C CD2   . PHE B 1 357 ? 69.984  -35.272 41.530  1.00 24.34 ? 354 PHE C CD2   1 
ATOM   5536 C CE1   . PHE B 1 357 ? 71.869  -34.014 39.914  1.00 24.96 ? 354 PHE C CE1   1 
ATOM   5537 C CE2   . PHE B 1 357 ? 71.012  -34.532 42.093  1.00 24.68 ? 354 PHE C CE2   1 
ATOM   5538 C CZ    . PHE B 1 357 ? 71.966  -33.907 41.278  1.00 24.40 ? 354 PHE C CZ    1 
ATOM   5539 N N     . LEU B 1 358 ? 70.011  -38.727 40.891  1.00 26.81 ? 355 LEU C N     1 
ATOM   5540 C CA    . LEU B 1 358 ? 70.972  -39.319 41.825  1.00 27.38 ? 355 LEU C CA    1 
ATOM   5541 C C     . LEU B 1 358 ? 71.704  -40.519 41.202  1.00 27.82 ? 355 LEU C C     1 
ATOM   5542 O O     . LEU B 1 358 ? 72.898  -40.715 41.456  1.00 28.06 ? 355 LEU C O     1 
ATOM   5543 C CB    . LEU B 1 358 ? 70.274  -39.732 43.132  1.00 26.65 ? 355 LEU C CB    1 
ATOM   5544 C CG    . LEU B 1 358 ? 70.309  -38.853 44.394  1.00 26.28 ? 355 LEU C CG    1 
ATOM   5545 C CD1   . LEU B 1 358 ? 70.892  -37.477 44.190  1.00 24.03 ? 355 LEU C CD1   1 
ATOM   5546 C CD2   . LEU B 1 358 ? 68.902  -38.770 45.060  1.00 24.79 ? 355 LEU C CD2   1 
ATOM   5547 N N     . ASP B 1 359 ? 71.000  -41.308 40.387  1.00 28.30 ? 356 ASP C N     1 
ATOM   5548 C CA    . ASP B 1 359 ? 71.637  -42.432 39.680  1.00 28.83 ? 356 ASP C CA    1 
ATOM   5549 C C     . ASP B 1 359 ? 72.647  -41.915 38.673  1.00 28.96 ? 356 ASP C C     1 
ATOM   5550 O O     . ASP B 1 359 ? 73.733  -42.462 38.553  1.00 29.23 ? 356 ASP C O     1 
ATOM   5551 C CB    . ASP B 1 359 ? 70.609  -43.296 38.951  1.00 29.14 ? 356 ASP C CB    1 
ATOM   5552 C CG    . ASP B 1 359 ? 69.723  -44.088 39.891  1.00 31.16 ? 356 ASP C CG    1 
ATOM   5553 O OD1   . ASP B 1 359 ? 70.051  -44.211 41.096  1.00 34.25 ? 356 ASP C OD1   1 
ATOM   5554 O OD2   . ASP B 1 359 ? 68.683  -44.600 39.421  1.00 33.43 ? 356 ASP C OD2   1 
ATOM   5555 N N     . ALA B 1 360 ? 72.285  -40.856 37.951  1.00 29.01 ? 357 ALA C N     1 
ATOM   5556 C CA    . ALA B 1 360 ? 73.197  -40.234 37.005  1.00 29.07 ? 357 ALA C CA    1 
ATOM   5557 C C     . ALA B 1 360 ? 74.404  -39.676 37.736  1.00 29.16 ? 357 ALA C C     1 
ATOM   5558 O O     . ALA B 1 360 ? 75.534  -39.855 37.285  1.00 29.10 ? 357 ALA C O     1 
ATOM   5559 C CB    . ALA B 1 360 ? 72.494  -39.120 36.187  1.00 28.94 ? 357 ALA C CB    1 
ATOM   5560 N N     . ALA B 1 361 ? 74.163  -38.995 38.854  1.00 29.34 ? 358 ALA C N     1 
ATOM   5561 C CA    . ALA B 1 361 ? 75.239  -38.352 39.620  1.00 29.67 ? 358 ALA C CA    1 
ATOM   5562 C C     . ALA B 1 361 ? 76.205  -39.375 40.204  1.00 29.94 ? 358 ALA C C     1 
ATOM   5563 O O     . ALA B 1 361 ? 77.408  -39.102 40.328  1.00 29.48 ? 358 ALA C O     1 
ATOM   5564 C CB    . ALA B 1 361 ? 74.671  -37.459 40.736  1.00 29.19 ? 358 ALA C CB    1 
ATOM   5565 N N     . ALA B 1 362 ? 75.676  -40.540 40.574  1.00 30.43 ? 359 ALA C N     1 
ATOM   5566 C CA    . ALA B 1 362 ? 76.505  -41.648 41.066  1.00 31.34 ? 359 ALA C CA    1 
ATOM   5567 C C     . ALA B 1 362 ? 77.506  -42.093 40.003  1.00 31.92 ? 359 ALA C C     1 
ATOM   5568 O O     . ALA B 1 362 ? 78.681  -42.262 40.305  1.00 32.38 ? 359 ALA C O     1 
ATOM   5569 C CB    . ALA B 1 362 ? 75.626  -42.832 41.494  1.00 31.14 ? 359 ALA C CB    1 
ATOM   5570 N N     . GLU B 1 363 ? 77.037  -42.252 38.765  1.00 32.66 ? 360 GLU C N     1 
ATOM   5571 C CA    . GLU B 1 363 ? 77.890  -42.625 37.626  1.00 33.58 ? 360 GLU C CA    1 
ATOM   5572 C C     . GLU B 1 363 ? 78.870  -41.530 37.243  1.00 33.50 ? 360 GLU C C     1 
ATOM   5573 O O     . GLU B 1 363 ? 80.001  -41.819 36.854  1.00 33.95 ? 360 GLU C O     1 
ATOM   5574 C CB    . GLU B 1 363 ? 77.047  -42.960 36.381  1.00 33.75 ? 360 GLU C CB    1 
ATOM   5575 C CG    . GLU B 1 363 ? 76.085  -44.139 36.558  1.00 35.69 ? 360 GLU C CG    1 
ATOM   5576 C CD    . GLU B 1 363 ? 75.374  -44.551 35.256  1.00 37.02 ? 360 GLU C CD    1 
ATOM   5577 O OE1   . GLU B 1 363 ? 75.229  -43.696 34.348  1.00 42.36 ? 360 GLU C OE1   1 
ATOM   5578 O OE2   . GLU B 1 363 ? 74.955  -45.739 35.140  1.00 40.76 ? 360 GLU C OE2   1 
ATOM   5579 N N     . ILE B 1 364 ? 78.426  -40.282 37.334  1.00 33.33 ? 361 ILE C N     1 
ATOM   5580 C CA    . ILE B 1 364 ? 79.191  -39.153 36.819  1.00 33.81 ? 361 ILE C CA    1 
ATOM   5581 C C     . ILE B 1 364 ? 80.372  -38.782 37.711  1.00 34.18 ? 361 ILE C C     1 
ATOM   5582 O O     . ILE B 1 364 ? 81.427  -38.387 37.205  1.00 34.32 ? 361 ILE C O     1 
ATOM   5583 C CB    . ILE B 1 364 ? 78.278  -37.925 36.551  1.00 33.47 ? 361 ILE C CB    1 
ATOM   5584 C CG1   . ILE B 1 364 ? 77.417  -38.179 35.307  1.00 33.23 ? 361 ILE C CG1   1 
ATOM   5585 C CG2   . ILE B 1 364 ? 79.101  -36.665 36.348  1.00 32.87 ? 361 ILE C CG2   1 
ATOM   5586 C CD1   . ILE B 1 364 ? 76.432  -37.082 34.984  1.00 33.52 ? 361 ILE C CD1   1 
ATOM   5587 N N     . ILE B 1 365 ? 80.211  -38.917 39.023  1.00 34.79 ? 362 ILE C N     1 
ATOM   5588 C CA    . ILE B 1 365 ? 81.301  -38.634 39.963  1.00 35.81 ? 362 ILE C CA    1 
ATOM   5589 C C     . ILE B 1 365 ? 82.549  -39.515 39.703  1.00 36.83 ? 362 ILE C C     1 
ATOM   5590 O O     . ILE B 1 365 ? 83.695  -39.087 39.919  1.00 36.93 ? 362 ILE C O     1 
ATOM   5591 C CB    . ILE B 1 365 ? 80.822  -38.806 41.440  1.00 35.74 ? 362 ILE C CB    1 
ATOM   5592 C CG1   . ILE B 1 365 ? 81.773  -38.113 42.414  1.00 35.61 ? 362 ILE C CG1   1 
ATOM   5593 C CG2   . ILE B 1 365 ? 80.643  -40.287 41.796  1.00 35.76 ? 362 ILE C CG2   1 
ATOM   5594 C CD1   . ILE B 1 365 ? 81.102  -37.687 43.703  1.00 35.72 ? 362 ILE C CD1   1 
ATOM   5595 N N     . LYS B 1 366 ? 82.313  -40.737 39.238  1.00 37.68 ? 363 LYS C N     1 
ATOM   5596 C CA    . LYS B 1 366 ? 83.386  -41.671 38.908  1.00 38.62 ? 363 LYS C CA    1 
ATOM   5597 C C     . LYS B 1 366 ? 84.153  -41.225 37.668  1.00 39.14 ? 363 LYS C C     1 
ATOM   5598 O O     . LYS B 1 366 ? 85.345  -41.491 37.542  1.00 39.78 ? 363 LYS C O     1 
ATOM   5599 C CB    . LYS B 1 366 ? 82.817  -43.077 38.704  1.00 38.84 ? 363 LYS C CB    1 
ATOM   5600 C CG    . LYS B 1 366 ? 82.102  -43.630 39.943  1.00 40.28 ? 363 LYS C CG    1 
ATOM   5601 C CD    . LYS B 1 366 ? 81.583  -45.058 39.736  1.00 40.59 ? 363 LYS C CD    1 
ATOM   5602 C CE    . LYS B 1 366 ? 80.305  -45.089 38.888  1.00 42.88 ? 363 LYS C CE    1 
ATOM   5603 N NZ    . LYS B 1 366 ? 79.856  -46.492 38.531  1.00 43.22 ? 363 LYS C NZ    1 
ATOM   5604 N N     . LEU B 1 367 ? 83.485  -40.522 36.758  1.00 39.82 ? 364 LEU C N     1 
ATOM   5605 C CA    . LEU B 1 367 ? 84.148  -40.031 35.552  1.00 39.95 ? 364 LEU C CA    1 
ATOM   5606 C C     . LEU B 1 367 ? 85.191  -38.959 35.869  1.00 40.25 ? 364 LEU C C     1 
ATOM   5607 O O     . LEU B 1 367 ? 86.113  -38.752 35.090  1.00 40.17 ? 364 LEU C O     1 
ATOM   5608 C CB    . LEU B 1 367 ? 83.129  -39.482 34.548  1.00 40.07 ? 364 LEU C CB    1 
ATOM   5609 C CG    . LEU B 1 367 ? 82.026  -40.430 34.062  1.00 40.54 ? 364 LEU C CG    1 
ATOM   5610 C CD1   . LEU B 1 367 ? 81.152  -39.713 33.041  1.00 40.68 ? 364 LEU C CD1   1 
ATOM   5611 C CD2   . LEU B 1 367 ? 82.588  -41.722 33.474  1.00 41.24 ? 364 LEU C CD2   1 
ATOM   5612 N N     . ASN B 1 368 ? 85.036  -38.274 37.003  1.00 40.90 ? 365 ASN C N     1 
ATOM   5613 C CA    . ASN B 1 368 ? 85.973  -37.230 37.426  1.00 41.03 ? 365 ASN C CA    1 
ATOM   5614 C C     . ASN B 1 368 ? 86.065  -36.106 36.385  1.00 41.30 ? 365 ASN C C     1 
ATOM   5615 O O     . ASN B 1 368 ? 87.149  -35.758 35.903  1.00 41.73 ? 365 ASN C O     1 
ATOM   5616 C CB    . ASN B 1 368 ? 87.348  -37.843 37.718  1.00 41.31 ? 365 ASN C CB    1 
ATOM   5617 C CG    . ASN B 1 368 ? 88.274  -36.903 38.471  1.00 41.52 ? 365 ASN C CG    1 
ATOM   5618 O OD1   . ASN B 1 368 ? 87.835  -36.087 39.279  1.00 43.51 ? 365 ASN C OD1   1 
ATOM   5619 N ND2   . ASN B 1 368 ? 89.575  -37.029 38.216  1.00 41.54 ? 365 ASN C ND2   1 
ATOM   5620 N N     . LEU B 1 369 ? 84.912  -35.539 36.055  1.00 41.23 ? 366 LEU C N     1 
ATOM   5621 C CA    . LEU B 1 369 ? 84.824  -34.515 35.021  1.00 41.62 ? 366 LEU C CA    1 
ATOM   5622 C C     . LEU B 1 369 ? 85.086  -33.113 35.582  1.00 42.18 ? 366 LEU C C     1 
ATOM   5623 O O     . LEU B 1 369 ? 85.063  -32.129 34.819  1.00 42.76 ? 366 LEU C O     1 
ATOM   5624 C CB    . LEU B 1 369 ? 83.453  -34.569 34.333  1.00 41.71 ? 366 LEU C CB    1 
ATOM   5625 C CG    . LEU B 1 369 ? 83.180  -35.787 33.455  1.00 41.52 ? 366 LEU C CG    1 
ATOM   5626 C CD1   . LEU B 1 369 ? 81.746  -35.785 32.986  1.00 41.50 ? 366 LEU C CD1   1 
ATOM   5627 C CD2   . LEU B 1 369 ? 84.129  -35.802 32.262  1.00 42.39 ? 366 LEU C CD2   1 
ATOM   5628 O OXT   . LEU B 1 369 ? 85.337  -32.923 36.789  1.00 42.58 ? 366 LEU C OXT   1 
ATOM   5629 N N     . LYS C 1 6   ? 13.005  -12.410 28.528  1.00 49.34 ? 3   LYS E N     1 
ATOM   5630 C CA    . LYS C 1 6   ? 13.515  -12.200 27.143  1.00 48.95 ? 3   LYS E CA    1 
ATOM   5631 C C     . LYS C 1 6   ? 13.063  -13.350 26.253  1.00 49.03 ? 3   LYS E C     1 
ATOM   5632 O O     . LYS C 1 6   ? 13.239  -14.525 26.612  1.00 49.39 ? 3   LYS E O     1 
ATOM   5633 C CB    . LYS C 1 6   ? 15.039  -12.108 27.147  1.00 49.26 ? 3   LYS E CB    1 
ATOM   5634 N N     . ILE C 1 7   ? 12.469  -13.013 25.106  1.00 48.54 ? 4   ILE E N     1 
ATOM   5635 C CA    . ILE C 1 7   ? 12.118  -14.013 24.094  1.00 47.91 ? 4   ILE E CA    1 
ATOM   5636 C C     . ILE C 1 7   ? 12.688  -13.603 22.739  1.00 47.41 ? 4   ILE E C     1 
ATOM   5637 O O     . ILE C 1 7   ? 13.054  -12.439 22.536  1.00 47.12 ? 4   ILE E O     1 
ATOM   5638 C CB    . ILE C 1 7   ? 10.577  -14.252 24.008  1.00 48.23 ? 4   ILE E CB    1 
ATOM   5639 C CG1   . ILE C 1 7   ? 9.861   -13.166 23.184  1.00 48.11 ? 4   ILE E CG1   1 
ATOM   5640 C CG2   . ILE C 1 7   ? 9.960   -14.350 25.426  1.00 48.33 ? 4   ILE E CG2   1 
ATOM   5641 C CD1   . ILE C 1 7   ? 8.546   -13.641 22.572  1.00 47.53 ? 4   ILE E CD1   1 
ATOM   5642 N N     . THR C 1 8   ? 12.775  -14.566 21.826  1.00 46.75 ? 5   THR E N     1 
ATOM   5643 C CA    . THR C 1 8   ? 13.215  -14.298 20.459  1.00 46.46 ? 5   THR E CA    1 
ATOM   5644 C C     . THR C 1 8   ? 12.265  -14.959 19.464  1.00 46.04 ? 5   THR E C     1 
ATOM   5645 O O     . THR C 1 8   ? 11.311  -15.634 19.849  1.00 45.54 ? 5   THR E O     1 
ATOM   5646 C CB    . THR C 1 8   ? 14.684  -14.780 20.172  1.00 46.34 ? 5   THR E CB    1 
ATOM   5647 O OG1   . THR C 1 8   ? 14.692  -16.168 19.818  1.00 46.70 ? 5   THR E OG1   1 
ATOM   5648 C CG2   . THR C 1 8   ? 15.592  -14.552 21.368  1.00 46.19 ? 5   THR E CG2   1 
ATOM   5649 N N     . LEU C 1 9   ? 12.553  -14.754 18.182  1.00 45.75 ? 6   LEU E N     1 
ATOM   5650 C CA    . LEU C 1 9   ? 11.735  -15.268 17.092  1.00 45.72 ? 6   LEU E CA    1 
ATOM   5651 C C     . LEU C 1 9   ? 11.581  -16.792 17.158  1.00 45.70 ? 6   LEU E C     1 
ATOM   5652 O O     . LEU C 1 9   ? 10.542  -17.331 16.761  1.00 45.62 ? 6   LEU E O     1 
ATOM   5653 C CB    . LEU C 1 9   ? 12.339  -14.833 15.744  1.00 45.74 ? 6   LEU E CB    1 
ATOM   5654 C CG    . LEU C 1 9   ? 11.572  -15.170 14.456  1.00 45.69 ? 6   LEU E CG    1 
ATOM   5655 C CD1   . LEU C 1 9   ? 10.103  -14.758 14.544  1.00 45.17 ? 6   LEU E CD1   1 
ATOM   5656 C CD2   . LEU C 1 9   ? 12.249  -14.529 13.252  1.00 45.20 ? 6   LEU E CD2   1 
ATOM   5657 N N     . SER C 1 10  ? 12.605  -17.476 17.680  1.00 45.69 ? 7   SER E N     1 
ATOM   5658 C CA    . SER C 1 10  ? 12.561  -18.935 17.864  1.00 45.46 ? 7   SER E CA    1 
ATOM   5659 C C     . SER C 1 10  ? 11.492  -19.382 18.887  1.00 45.01 ? 7   SER E C     1 
ATOM   5660 O O     . SER C 1 10  ? 11.021  -20.520 18.836  1.00 45.32 ? 7   SER E O     1 
ATOM   5661 C CB    . SER C 1 10  ? 13.956  -19.484 18.232  1.00 45.72 ? 7   SER E CB    1 
ATOM   5662 O OG    . SER C 1 10  ? 14.413  -18.982 19.482  1.00 46.00 ? 7   SER E OG    1 
ATOM   5663 N N     . ASP C 1 11  ? 11.087  -18.485 19.783  1.00 44.73 ? 8   ASP E N     1 
ATOM   5664 C CA    . ASP C 1 11  ? 10.014  -18.773 20.742  1.00 44.76 ? 8   ASP E CA    1 
ATOM   5665 C C     . ASP C 1 11  ? 8.606   -18.560 20.173  1.00 44.46 ? 8   ASP E C     1 
ATOM   5666 O O     . ASP C 1 11  ? 7.607   -18.799 20.866  1.00 44.30 ? 8   ASP E O     1 
ATOM   5667 C CB    . ASP C 1 11  ? 10.163  -17.900 21.997  1.00 45.25 ? 8   ASP E CB    1 
ATOM   5668 C CG    . ASP C 1 11  ? 11.524  -18.050 22.675  1.00 46.60 ? 8   ASP E CG    1 
ATOM   5669 O OD1   . ASP C 1 11  ? 12.174  -19.112 22.520  1.00 48.70 ? 8   ASP E OD1   1 
ATOM   5670 O OD2   . ASP C 1 11  ? 11.939  -17.095 23.369  1.00 48.13 ? 8   ASP E OD2   1 
ATOM   5671 N N     . LEU C 1 12  ? 8.521   -18.084 18.932  1.00 44.12 ? 9   LEU E N     1 
ATOM   5672 C CA    . LEU C 1 12  ? 7.238   -17.831 18.290  1.00 43.76 ? 9   LEU E CA    1 
ATOM   5673 C C     . LEU C 1 12  ? 6.922   -18.962 17.329  1.00 43.62 ? 9   LEU E C     1 
ATOM   5674 O O     . LEU C 1 12  ? 7.828   -19.563 16.766  1.00 43.39 ? 9   LEU E O     1 
ATOM   5675 C CB    . LEU C 1 12  ? 7.273   -16.507 17.522  1.00 43.65 ? 9   LEU E CB    1 
ATOM   5676 C CG    . LEU C 1 12  ? 7.566   -15.228 18.312  1.00 42.63 ? 9   LEU E CG    1 
ATOM   5677 C CD1   . LEU C 1 12  ? 7.410   -14.020 17.398  1.00 41.23 ? 9   LEU E CD1   1 
ATOM   5678 C CD2   . LEU C 1 12  ? 6.656   -15.120 19.520  1.00 40.87 ? 9   LEU E CD2   1 
ATOM   5679 N N     . PRO C 1 13  ? 5.630   -19.244 17.117  1.00 43.71 ? 10  PRO E N     1 
ATOM   5680 C CA    . PRO C 1 13  ? 5.225   -20.320 16.215  1.00 43.94 ? 10  PRO E CA    1 
ATOM   5681 C C     . PRO C 1 13  ? 5.337   -19.970 14.732  1.00 44.02 ? 10  PRO E C     1 
ATOM   5682 O O     . PRO C 1 13  ? 4.434   -20.268 13.958  1.00 43.73 ? 10  PRO E O     1 
ATOM   5683 C CB    . PRO C 1 13  ? 3.771   -20.575 16.622  1.00 44.02 ? 10  PRO E CB    1 
ATOM   5684 C CG    . PRO C 1 13  ? 3.290   -19.268 17.155  1.00 43.76 ? 10  PRO E CG    1 
ATOM   5685 C CD    . PRO C 1 13  ? 4.475   -18.573 17.745  1.00 43.66 ? 10  PRO E CD    1 
ATOM   5686 N N     . LEU C 1 14  ? 6.454   -19.370 14.336  1.00 44.62 ? 11  LEU E N     1 
ATOM   5687 C CA    . LEU C 1 14  ? 6.708   -19.055 12.930  1.00 45.16 ? 11  LEU E CA    1 
ATOM   5688 C C     . LEU C 1 14  ? 6.620   -20.303 12.068  1.00 45.72 ? 11  LEU E C     1 
ATOM   5689 O O     . LEU C 1 14  ? 6.978   -21.397 12.516  1.00 46.07 ? 11  LEU E O     1 
ATOM   5690 C CB    . LEU C 1 14  ? 8.105   -18.445 12.763  1.00 45.15 ? 11  LEU E CB    1 
ATOM   5691 C CG    . LEU C 1 14  ? 8.386   -17.802 11.400  1.00 45.08 ? 11  LEU E CG    1 
ATOM   5692 C CD1   . LEU C 1 14  ? 7.680   -16.445 11.299  1.00 43.02 ? 11  LEU E CD1   1 
ATOM   5693 C CD2   . LEU C 1 14  ? 9.887   -17.659 11.163  1.00 45.14 ? 11  LEU E CD2   1 
ATOM   5694 N N     . ARG C 1 15  ? 6.149   -20.147 10.832  1.00 46.31 ? 12  ARG E N     1 
ATOM   5695 C CA    . ARG C 1 15  ? 6.220   -21.235 9.866   1.00 46.95 ? 12  ARG E CA    1 
ATOM   5696 C C     . ARG C 1 15  ? 7.669   -21.699 9.759   1.00 47.90 ? 12  ARG E C     1 
ATOM   5697 O O     . ARG C 1 15  ? 8.588   -20.878 9.727   1.00 47.77 ? 12  ARG E O     1 
ATOM   5698 C CB    . ARG C 1 15  ? 5.696   -20.808 8.496   1.00 46.89 ? 12  ARG E CB    1 
ATOM   5699 C CG    . ARG C 1 15  ? 4.188   -20.760 8.405   1.00 46.45 ? 12  ARG E CG    1 
ATOM   5700 C CD    . ARG C 1 15  ? 3.738   -20.190 7.075   1.00 46.28 ? 12  ARG E CD    1 
ATOM   5701 N NE    . ARG C 1 15  ? 4.051   -21.080 5.955   1.00 45.92 ? 12  ARG E NE    1 
ATOM   5702 C CZ    . ARG C 1 15  ? 3.376   -22.183 5.637   1.00 44.98 ? 12  ARG E CZ    1 
ATOM   5703 N NH1   . ARG C 1 15  ? 2.328   -22.576 6.347   1.00 44.28 ? 12  ARG E NH1   1 
ATOM   5704 N NH2   . ARG C 1 15  ? 3.757   -22.901 4.592   1.00 45.45 ? 12  ARG E NH2   1 
ATOM   5705 N N     . GLU C 1 16  ? 7.859   -23.018 9.715   1.00 49.26 ? 13  GLU E N     1 
ATOM   5706 C CA    . GLU C 1 16  ? 9.192   -23.619 9.778   1.00 49.57 ? 13  GLU E CA    1 
ATOM   5707 C C     . GLU C 1 16  ? 10.044  -23.253 8.573   1.00 49.98 ? 13  GLU E C     1 
ATOM   5708 O O     . GLU C 1 16  ? 11.266  -23.117 8.689   1.00 49.92 ? 13  GLU E O     1 
ATOM   5709 C CB    . GLU C 1 16  ? 9.092   -25.150 9.887   1.00 50.18 ? 13  GLU E CB    1 
ATOM   5710 C CG    . GLU C 1 16  ? 10.419  -25.859 10.222  1.00 50.94 ? 13  GLU E CG    1 
ATOM   5711 C CD    . GLU C 1 16  ? 11.010  -25.429 11.570  1.00 54.33 ? 13  GLU E CD    1 
ATOM   5712 O OE1   . GLU C 1 16  ? 10.225  -25.107 12.499  1.00 55.71 ? 13  GLU E OE1   1 
ATOM   5713 O OE2   . GLU C 1 16  ? 12.262  -25.420 11.699  1.00 55.31 ? 13  GLU E OE2   1 
ATOM   5714 N N     . GLU C 1 17  ? 9.398   -23.099 7.421   1.00 50.42 ? 14  GLU E N     1 
ATOM   5715 C CA    . GLU C 1 17  ? 10.103  -22.745 6.187   1.00 51.13 ? 14  GLU E CA    1 
ATOM   5716 C C     . GLU C 1 17  ? 10.609  -21.301 6.170   1.00 51.09 ? 14  GLU E C     1 
ATOM   5717 O O     . GLU C 1 17  ? 11.364  -20.920 5.271   1.00 51.30 ? 14  GLU E O     1 
ATOM   5718 C CB    . GLU C 1 17  ? 9.215   -22.993 4.969   1.00 51.42 ? 14  GLU E CB    1 
ATOM   5719 C CG    . GLU C 1 17  ? 7.814   -22.415 5.086   1.00 52.67 ? 14  GLU E CG    1 
ATOM   5720 C CD    . GLU C 1 17  ? 7.106   -22.333 3.751   1.00 53.52 ? 14  GLU E CD    1 
ATOM   5721 O OE1   . GLU C 1 17  ? 7.212   -23.300 2.950   1.00 56.13 ? 14  GLU E OE1   1 
ATOM   5722 O OE2   . GLU C 1 17  ? 6.438   -21.298 3.508   1.00 57.42 ? 14  GLU E OE2   1 
ATOM   5723 N N     . LEU C 1 18  ? 10.182  -20.500 7.147   1.00 51.13 ? 15  LEU E N     1 
ATOM   5724 C CA    . LEU C 1 18  ? 10.685  -19.135 7.316   1.00 51.21 ? 15  LEU E CA    1 
ATOM   5725 C C     . LEU C 1 18  ? 11.825  -19.074 8.329   1.00 51.29 ? 15  LEU E C     1 
ATOM   5726 O O     . LEU C 1 18  ? 12.494  -18.048 8.444   1.00 51.24 ? 15  LEU E O     1 
ATOM   5727 C CB    . LEU C 1 18  ? 9.558   -18.190 7.754   1.00 51.18 ? 15  LEU E CB    1 
ATOM   5728 C CG    . LEU C 1 18  ? 8.403   -17.963 6.772   1.00 50.93 ? 15  LEU E CG    1 
ATOM   5729 C CD1   . LEU C 1 18  ? 7.296   -17.170 7.455   1.00 50.22 ? 15  LEU E CD1   1 
ATOM   5730 C CD2   . LEU C 1 18  ? 8.875   -17.261 5.500   1.00 50.46 ? 15  LEU E CD2   1 
ATOM   5731 N N     . ARG C 1 19  ? 12.041  -20.161 9.071   1.00 51.71 ? 16  ARG E N     1 
ATOM   5732 C CA    . ARG C 1 19  ? 13.138  -20.219 10.040  1.00 51.93 ? 16  ARG E CA    1 
ATOM   5733 C C     . ARG C 1 19  ? 14.449  -20.135 9.267   1.00 51.87 ? 16  ARG E C     1 
ATOM   5734 O O     . ARG C 1 19  ? 14.585  -20.726 8.192   1.00 51.78 ? 16  ARG E O     1 
ATOM   5735 C CB    . ARG C 1 19  ? 13.105  -21.512 10.862  1.00 52.48 ? 16  ARG E CB    1 
ATOM   5736 C CG    . ARG C 1 19  ? 11.789  -21.815 11.595  1.00 53.29 ? 16  ARG E CG    1 
ATOM   5737 C CD    . ARG C 1 19  ? 11.689  -21.173 12.984  1.00 54.39 ? 16  ARG E CD    1 
ATOM   5738 N NE    . ARG C 1 19  ? 10.668  -21.839 13.807  1.00 54.87 ? 16  ARG E NE    1 
ATOM   5739 C CZ    . ARG C 1 19  ? 10.165  -21.364 14.951  1.00 55.26 ? 16  ARG E CZ    1 
ATOM   5740 N NH1   . ARG C 1 19  ? 10.563  -20.193 15.444  1.00 55.21 ? 16  ARG E NH1   1 
ATOM   5741 N NH2   . ARG C 1 19  ? 9.242   -22.068 15.601  1.00 55.21 ? 16  ARG E NH2   1 
ATOM   5742 N N     . GLY C 1 20  ? 15.399  -19.370 9.791   1.00 52.07 ? 17  GLY E N     1 
ATOM   5743 C CA    . GLY C 1 20  ? 16.694  -19.202 9.132   1.00 52.15 ? 17  GLY E CA    1 
ATOM   5744 C C     . GLY C 1 20  ? 16.705  -18.202 7.984   1.00 52.31 ? 17  GLY E C     1 
ATOM   5745 O O     . GLY C 1 20  ? 17.777  -17.889 7.445   1.00 52.48 ? 17  GLY E O     1 
ATOM   5746 N N     . GLU C 1 21  ? 15.531  -17.690 7.606   1.00 52.29 ? 18  GLU E N     1 
ATOM   5747 C CA    . GLU C 1 21  ? 15.431  -16.724 6.504   1.00 52.09 ? 18  GLU E CA    1 
ATOM   5748 C C     . GLU C 1 21  ? 15.881  -15.334 6.943   1.00 51.66 ? 18  GLU E C     1 
ATOM   5749 O O     . GLU C 1 21  ? 15.732  -14.966 8.108   1.00 51.36 ? 18  GLU E O     1 
ATOM   5750 C CB    . GLU C 1 21  ? 13.994  -16.639 5.985   1.00 52.50 ? 18  GLU E CB    1 
ATOM   5751 C CG    . GLU C 1 21  ? 13.469  -17.932 5.371   1.00 53.88 ? 18  GLU E CG    1 
ATOM   5752 C CD    . GLU C 1 21  ? 14.257  -18.375 4.151   1.00 55.85 ? 18  GLU E CD    1 
ATOM   5753 O OE1   . GLU C 1 21  ? 14.762  -17.500 3.410   1.00 56.82 ? 18  GLU E OE1   1 
ATOM   5754 O OE2   . GLU C 1 21  ? 14.357  -19.604 3.925   1.00 57.33 ? 18  GLU E OE2   1 
ATOM   5755 N N     . HIS C 1 22  ? 16.439  -14.578 5.999   1.00 51.27 ? 19  HIS E N     1 
ATOM   5756 C CA    . HIS C 1 22  ? 16.724  -13.161 6.205   1.00 50.95 ? 19  HIS E CA    1 
ATOM   5757 C C     . HIS C 1 22  ? 15.762  -12.319 5.371   1.00 50.05 ? 19  HIS E C     1 
ATOM   5758 O O     . HIS C 1 22  ? 15.440  -12.667 4.236   1.00 49.73 ? 19  HIS E O     1 
ATOM   5759 C CB    . HIS C 1 22  ? 18.172  -12.832 5.824   1.00 51.81 ? 19  HIS E CB    1 
ATOM   5760 C CG    . HIS C 1 22  ? 19.193  -13.580 6.626   1.00 53.72 ? 19  HIS E CG    1 
ATOM   5761 N ND1   . HIS C 1 22  ? 20.181  -14.350 6.043   1.00 55.44 ? 19  HIS E ND1   1 
ATOM   5762 C CD2   . HIS C 1 22  ? 19.369  -13.691 7.966   1.00 55.39 ? 19  HIS E CD2   1 
ATOM   5763 C CE1   . HIS C 1 22  ? 20.926  -14.894 6.990   1.00 55.87 ? 19  HIS E CE1   1 
ATOM   5764 N NE2   . HIS C 1 22  ? 20.453  -14.513 8.165   1.00 56.19 ? 19  HIS E NE2   1 
ATOM   5765 N N     . ALA C 1 23  ? 15.307  -11.212 5.949   1.00 49.06 ? 20  ALA E N     1 
ATOM   5766 C CA    . ALA C 1 23  ? 14.456  -10.258 5.247   1.00 48.21 ? 20  ALA E CA    1 
ATOM   5767 C C     . ALA C 1 23  ? 15.204  -9.659  4.043   1.00 47.46 ? 20  ALA E C     1 
ATOM   5768 O O     . ALA C 1 23  ? 16.438  -9.550  4.064   1.00 46.96 ? 20  ALA E O     1 
ATOM   5769 C CB    . ALA C 1 23  ? 14.021  -9.150  6.210   1.00 47.93 ? 20  ALA E CB    1 
ATOM   5770 N N     . TYR C 1 24  ? 14.468  -9.292  2.989   1.00 46.41 ? 21  TYR E N     1 
ATOM   5771 C CA    . TYR C 1 24  ? 15.069  -8.526  1.898   1.00 45.66 ? 21  TYR E CA    1 
ATOM   5772 C C     . TYR C 1 24  ? 15.642  -7.282  2.545   1.00 44.68 ? 21  TYR E C     1 
ATOM   5773 O O     . TYR C 1 24  ? 14.933  -6.568  3.236   1.00 44.60 ? 21  TYR E O     1 
ATOM   5774 C CB    . TYR C 1 24  ? 14.048  -8.154  0.818   1.00 45.63 ? 21  TYR E CB    1 
ATOM   5775 C CG    . TYR C 1 24  ? 14.577  -7.181  -0.232  1.00 46.05 ? 21  TYR E CG    1 
ATOM   5776 C CD1   . TYR C 1 24  ? 15.248  -7.639  -1.372  1.00 46.13 ? 21  TYR E CD1   1 
ATOM   5777 C CD2   . TYR C 1 24  ? 14.409  -5.801  -0.081  1.00 45.99 ? 21  TYR E CD2   1 
ATOM   5778 C CE1   . TYR C 1 24  ? 15.734  -6.742  -2.335  1.00 45.96 ? 21  TYR E CE1   1 
ATOM   5779 C CE2   . TYR C 1 24  ? 14.888  -4.898  -1.035  1.00 45.69 ? 21  TYR E CE2   1 
ATOM   5780 C CZ    . TYR C 1 24  ? 15.547  -5.372  -2.158  1.00 46.14 ? 21  TYR E CZ    1 
ATOM   5781 O OH    . TYR C 1 24  ? 16.010  -4.475  -3.098  1.00 45.94 ? 21  TYR E OH    1 
ATOM   5782 N N     . GLY C 1 25  ? 16.936  -7.054  2.354   1.00 43.91 ? 22  GLY E N     1 
ATOM   5783 C CA    . GLY C 1 25  ? 17.622  -5.953  3.015   1.00 43.22 ? 22  GLY E CA    1 
ATOM   5784 C C     . GLY C 1 25  ? 18.720  -5.340  2.172   1.00 42.57 ? 22  GLY E C     1 
ATOM   5785 O O     . GLY C 1 25  ? 19.876  -5.295  2.594   1.00 42.76 ? 22  GLY E O     1 
ATOM   5786 N N     . ALA C 1 26  ? 18.364  -4.868  0.979   1.00 41.42 ? 23  ALA E N     1 
ATOM   5787 C CA    . ALA C 1 26  ? 19.280  -4.061  0.188   1.00 40.32 ? 23  ALA E CA    1 
ATOM   5788 C C     . ALA C 1 26  ? 19.620  -2.792  0.994   1.00 39.34 ? 23  ALA E C     1 
ATOM   5789 O O     . ALA C 1 26  ? 18.739  -2.161  1.571   1.00 38.67 ? 23  ALA E O     1 
ATOM   5790 C CB    . ALA C 1 26  ? 18.651  -3.697  -1.154  1.00 40.48 ? 23  ALA E CB    1 
ATOM   5791 N N     . PRO C 1 27  ? 20.901  -2.422  1.061   1.00 38.05 ? 24  PRO E N     1 
ATOM   5792 C CA    . PRO C 1 27  ? 21.223  -1.246  1.866   1.00 37.54 ? 24  PRO E CA    1 
ATOM   5793 C C     . PRO C 1 27  ? 20.438  -0.001  1.437   1.00 36.71 ? 24  PRO E C     1 
ATOM   5794 O O     . PRO C 1 27  ? 20.334  0.273   0.244   1.00 37.01 ? 24  PRO E O     1 
ATOM   5795 C CB    . PRO C 1 27  ? 22.725  -1.050  1.615   1.00 37.31 ? 24  PRO E CB    1 
ATOM   5796 C CG    . PRO C 1 27  ? 23.219  -2.352  1.188   1.00 37.60 ? 24  PRO E CG    1 
ATOM   5797 C CD    . PRO C 1 27  ? 22.098  -3.011  0.441   1.00 38.16 ? 24  PRO E CD    1 
ATOM   5798 N N     . GLN C 1 28  ? 19.864  0.718   2.398   1.00 35.80 ? 25  GLN E N     1 
ATOM   5799 C CA    . GLN C 1 28  ? 19.234  2.016   2.130   1.00 35.48 ? 25  GLN E CA    1 
ATOM   5800 C C     . GLN C 1 28  ? 19.914  3.036   3.045   1.00 35.28 ? 25  GLN E C     1 
ATOM   5801 O O     . GLN C 1 28  ? 19.590  3.129   4.231   1.00 35.56 ? 25  GLN E O     1 
ATOM   5802 C CB    . GLN C 1 28  ? 17.708  1.962   2.382   1.00 34.96 ? 25  GLN E CB    1 
ATOM   5803 C CG    . GLN C 1 28  ? 16.953  3.211   1.891   1.00 34.67 ? 25  GLN E CG    1 
ATOM   5804 C CD    . GLN C 1 28  ? 15.441  3.183   2.141   1.00 34.09 ? 25  GLN E CD    1 
ATOM   5805 O OE1   . GLN C 1 28  ? 14.979  2.661   3.144   1.00 31.28 ? 25  GLN E OE1   1 
ATOM   5806 N NE2   . GLN C 1 28  ? 14.673  3.779   1.230   1.00 30.64 ? 25  GLN E NE2   1 
ATOM   5807 N N     . LEU C 1 29  ? 20.874  3.777   2.502   1.00 35.19 ? 26  LEU E N     1 
ATOM   5808 C CA    . LEU C 1 29  ? 21.663  4.724   3.283   1.00 35.42 ? 26  LEU E CA    1 
ATOM   5809 C C     . LEU C 1 29  ? 21.590  6.117   2.691   1.00 35.68 ? 26  LEU E C     1 
ATOM   5810 O O     . LEU C 1 29  ? 21.699  6.280   1.483   1.00 36.03 ? 26  LEU E O     1 
ATOM   5811 C CB    . LEU C 1 29  ? 23.126  4.307   3.312   1.00 35.19 ? 26  LEU E CB    1 
ATOM   5812 C CG    . LEU C 1 29  ? 23.433  2.920   3.843   1.00 34.41 ? 26  LEU E CG    1 
ATOM   5813 C CD1   . LEU C 1 29  ? 24.870  2.599   3.501   1.00 34.23 ? 26  LEU E CD1   1 
ATOM   5814 C CD2   . LEU C 1 29  ? 23.165  2.864   5.346   1.00 34.17 ? 26  LEU E CD2   1 
ATOM   5815 N N     . ASN C 1 30  ? 21.426  7.123   3.543   1.00 36.06 ? 27  ASN E N     1 
ATOM   5816 C CA    . ASN C 1 30  ? 21.353  8.497   3.066   1.00 35.76 ? 27  ASN E CA    1 
ATOM   5817 C C     . ASN C 1 30  ? 22.759  9.069   2.967   1.00 35.50 ? 27  ASN E C     1 
ATOM   5818 O O     . ASN C 1 30  ? 23.153  9.915   3.762   1.00 35.78 ? 27  ASN E O     1 
ATOM   5819 C CB    . ASN C 1 30  ? 20.460  9.348   3.970   1.00 36.35 ? 27  ASN E CB    1 
ATOM   5820 C CG    . ASN C 1 30  ? 20.148  10.720  3.366   1.00 38.05 ? 27  ASN E CG    1 
ATOM   5821 O OD1   . ASN C 1 30  ? 20.076  10.883  2.128   1.00 42.09 ? 27  ASN E OD1   1 
ATOM   5822 N ND2   . ASN C 1 30  ? 19.973  11.724  4.241   1.00 41.85 ? 27  ASN E ND2   1 
ATOM   5823 N N     . VAL C 1 31  ? 23.527  8.560   2.005   1.00 35.02 ? 28  VAL E N     1 
ATOM   5824 C CA    . VAL C 1 31  ? 24.864  9.068   1.719   1.00 34.55 ? 28  VAL E CA    1 
ATOM   5825 C C     . VAL C 1 31  ? 24.754  10.047  0.557   1.00 34.48 ? 28  VAL E C     1 
ATOM   5826 O O     . VAL C 1 31  ? 23.683  10.181  -0.052  1.00 34.24 ? 28  VAL E O     1 
ATOM   5827 C CB    . VAL C 1 31  ? 25.861  7.944   1.381   1.00 34.68 ? 28  VAL E CB    1 
ATOM   5828 C CG1   . VAL C 1 31  ? 26.072  7.050   2.603   1.00 34.45 ? 28  VAL E CG1   1 
ATOM   5829 C CG2   . VAL C 1 31  ? 25.389  7.133   0.186   1.00 33.79 ? 28  VAL E CG2   1 
ATOM   5830 N N     . ASP C 1 32  ? 25.861  10.724  0.250   1.00 34.10 ? 29  ASP E N     1 
ATOM   5831 C CA    . ASP C 1 32  ? 25.851  11.804  -0.738  1.00 33.56 ? 29  ASP E CA    1 
ATOM   5832 C C     . ASP C 1 32  ? 25.614  11.338  -2.169  1.00 32.21 ? 29  ASP E C     1 
ATOM   5833 O O     . ASP C 1 32  ? 24.863  11.967  -2.885  1.00 32.35 ? 29  ASP E O     1 
ATOM   5834 C CB    . ASP C 1 32  ? 27.146  12.615  -0.655  1.00 34.63 ? 29  ASP E CB    1 
ATOM   5835 C CG    . ASP C 1 32  ? 27.065  13.739  0.370   1.00 38.65 ? 29  ASP E CG    1 
ATOM   5836 O OD1   . ASP C 1 32  ? 25.981  14.384  0.473   1.00 42.95 ? 29  ASP E OD1   1 
ATOM   5837 O OD2   . ASP C 1 32  ? 28.093  13.983  1.063   1.00 43.72 ? 29  ASP E OD2   1 
ATOM   5838 N N     . ILE C 1 33  ? 26.249  10.241  -2.577  1.00 30.92 ? 30  ILE E N     1 
ATOM   5839 C CA    . ILE C 1 33  ? 26.091  9.718   -3.931  1.00 29.85 ? 30  ILE E CA    1 
ATOM   5840 C C     . ILE C 1 33  ? 25.370  8.373   -3.922  1.00 28.54 ? 30  ILE E C     1 
ATOM   5841 O O     . ILE C 1 33  ? 25.947  7.327   -3.601  1.00 27.88 ? 30  ILE E O     1 
ATOM   5842 C CB    . ILE C 1 33  ? 27.439  9.579   -4.656  1.00 30.31 ? 30  ILE E CB    1 
ATOM   5843 C CG1   . ILE C 1 33  ? 28.305  10.823  -4.431  1.00 30.98 ? 30  ILE E CG1   1 
ATOM   5844 C CG2   . ILE C 1 33  ? 27.199  9.303   -6.144  1.00 30.17 ? 30  ILE E CG2   1 
ATOM   5845 C CD1   . ILE C 1 33  ? 27.611  12.155  -4.771  1.00 33.10 ? 30  ILE E CD1   1 
ATOM   5846 N N     . ARG C 1 34  ? 24.095  8.427   -4.285  1.00 27.56 ? 31  ARG E N     1 
ATOM   5847 C CA    . ARG C 1 34  ? 23.197  7.288   -4.235  1.00 26.69 ? 31  ARG E CA    1 
ATOM   5848 C C     . ARG C 1 34  ? 22.968  6.731   -5.619  1.00 25.45 ? 31  ARG E C     1 
ATOM   5849 O O     . ARG C 1 34  ? 22.240  7.321   -6.387  1.00 25.29 ? 31  ARG E O     1 
ATOM   5850 C CB    . ARG C 1 34  ? 21.847  7.724   -3.703  1.00 26.77 ? 31  ARG E CB    1 
ATOM   5851 C CG    . ARG C 1 34  ? 21.789  8.034   -2.237  1.00 28.64 ? 31  ARG E CG    1 
ATOM   5852 C CD    . ARG C 1 34  ? 20.482  7.469   -1.685  1.00 30.83 ? 31  ARG E CD    1 
ATOM   5853 N NE    . ARG C 1 34  ? 19.713  8.424   -0.934  1.00 31.59 ? 31  ARG E NE    1 
ATOM   5854 C CZ    . ARG C 1 34  ? 18.530  8.162   -0.382  1.00 32.08 ? 31  ARG E CZ    1 
ATOM   5855 N NH1   . ARG C 1 34  ? 17.957  6.961   -0.496  1.00 31.50 ? 31  ARG E NH1   1 
ATOM   5856 N NH2   . ARG C 1 34  ? 17.914  9.118   0.288   1.00 31.93 ? 31  ARG E NH2   1 
ATOM   5857 N N     . LEU C 1 35  ? 23.577  5.589   -5.926  1.00 24.51 ? 32  LEU E N     1 
ATOM   5858 C CA    . LEU C 1 35  ? 23.580  5.039   -7.276  1.00 23.67 ? 32  LEU E CA    1 
ATOM   5859 C C     . LEU C 1 35  ? 23.325  3.542   -7.200  1.00 23.07 ? 32  LEU E C     1 
ATOM   5860 O O     . LEU C 1 35  ? 23.973  2.756   -7.898  1.00 22.60 ? 32  LEU E O     1 
ATOM   5861 C CB    . LEU C 1 35  ? 24.936  5.298   -7.935  1.00 23.39 ? 32  LEU E CB    1 
ATOM   5862 C CG    . LEU C 1 35  ? 25.373  6.757   -8.024  1.00 23.43 ? 32  LEU E CG    1 
ATOM   5863 C CD1   . LEU C 1 35  ? 26.772  6.899   -8.645  1.00 23.55 ? 32  LEU E CD1   1 
ATOM   5864 C CD2   . LEU C 1 35  ? 24.361  7.506   -8.823  1.00 22.35 ? 32  LEU E CD2   1 
ATOM   5865 N N     . ASN C 1 36  ? 22.366  3.169   -6.362  1.00 22.56 ? 33  ASN E N     1 
ATOM   5866 C CA    . ASN C 1 36  ? 22.207  1.783   -5.898  1.00 23.05 ? 33  ASN E CA    1 
ATOM   5867 C C     . ASN C 1 36  ? 20.856  1.125   -6.118  1.00 22.99 ? 33  ASN E C     1 
ATOM   5868 O O     . ASN C 1 36  ? 20.743  -0.107  -5.987  1.00 23.46 ? 33  ASN E O     1 
ATOM   5869 C CB    . ASN C 1 36  ? 22.568  1.693   -4.398  1.00 23.00 ? 33  ASN E CB    1 
ATOM   5870 C CG    . ASN C 1 36  ? 21.637  2.518   -3.500  1.00 23.52 ? 33  ASN E CG    1 
ATOM   5871 O OD1   . ASN C 1 36  ? 21.435  3.729   -3.706  1.00 26.03 ? 33  ASN E OD1   1 
ATOM   5872 N ND2   . ASN C 1 36  ? 21.087  1.869   -2.485  1.00 22.65 ? 33  ASN E ND2   1 
ATOM   5873 N N     . THR C 1 37  ? 19.829  1.904   -6.449  1.00 23.22 ? 34  THR E N     1 
ATOM   5874 C CA    . THR C 1 37  ? 18.460  1.365   -6.452  1.00 23.26 ? 34  THR E CA    1 
ATOM   5875 C C     . THR C 1 37  ? 17.677  1.711   -7.733  1.00 23.04 ? 34  THR E C     1 
ATOM   5876 O O     . THR C 1 37  ? 16.466  1.503   -7.815  1.00 22.92 ? 34  THR E O     1 
ATOM   5877 C CB    . THR C 1 37  ? 17.722  1.776   -5.142  1.00 23.72 ? 34  THR E CB    1 
ATOM   5878 O OG1   . THR C 1 37  ? 18.573  1.487   -4.014  1.00 24.80 ? 34  THR E OG1   1 
ATOM   5879 C CG2   . THR C 1 37  ? 16.396  0.994   -4.955  1.00 23.51 ? 34  THR E CG2   1 
ATOM   5880 N N     . ASN C 1 38  ? 18.402  2.210   -8.736  1.00 22.79 ? 35  ASN E N     1 
ATOM   5881 C CA    . ASN C 1 38  ? 17.848  2.557   -10.047 1.00 22.76 ? 35  ASN E CA    1 
ATOM   5882 C C     . ASN C 1 38  ? 16.770  3.624   -10.056 1.00 22.87 ? 35  ASN E C     1 
ATOM   5883 O O     . ASN C 1 38  ? 15.956  3.686   -10.980 1.00 23.00 ? 35  ASN E O     1 
ATOM   5884 C CB    . ASN C 1 38  ? 17.405  1.300   -10.780 1.00 22.55 ? 35  ASN E CB    1 
ATOM   5885 C CG    . ASN C 1 38  ? 18.556  0.427   -11.110 1.00 21.58 ? 35  ASN E CG    1 
ATOM   5886 O OD1   . ASN C 1 38  ? 19.684  0.913   -11.237 1.00 22.55 ? 35  ASN E OD1   1 
ATOM   5887 N ND2   . ASN C 1 38  ? 18.309  -0.857  -11.244 1.00 20.72 ? 35  ASN E ND2   1 
ATOM   5888 N N     . GLU C 1 39  ? 16.816  4.484   -9.044  1.00 23.11 ? 36  GLU E N     1 
ATOM   5889 C CA    . GLU C 1 39  ? 15.969  5.666   -8.960  1.00 23.36 ? 36  GLU E CA    1 
ATOM   5890 C C     . GLU C 1 39  ? 16.388  6.728   -9.974  1.00 23.65 ? 36  GLU E C     1 
ATOM   5891 O O     . GLU C 1 39  ? 17.569  6.874   -10.297 1.00 24.16 ? 36  GLU E O     1 
ATOM   5892 C CB    . GLU C 1 39  ? 16.084  6.273   -7.564  1.00 23.47 ? 36  GLU E CB    1 
ATOM   5893 C CG    . GLU C 1 39  ? 15.566  5.373   -6.441  1.00 23.92 ? 36  GLU E CG    1 
ATOM   5894 C CD    . GLU C 1 39  ? 16.322  5.525   -5.109  1.00 23.80 ? 36  GLU E CD    1 
ATOM   5895 O OE1   . GLU C 1 39  ? 17.567  5.754   -5.104  1.00 23.27 ? 36  GLU E OE1   1 
ATOM   5896 O OE2   . GLU C 1 39  ? 15.656  5.372   -4.059  1.00 21.45 ? 36  GLU E OE2   1 
ATOM   5897 N N     . ASN C 1 40  ? 15.425  7.494   -10.453 1.00 23.87 ? 37  ASN E N     1 
ATOM   5898 C CA    . ASN C 1 40  ? 15.725  8.691   -11.215 1.00 24.33 ? 37  ASN E CA    1 
ATOM   5899 C C     . ASN C 1 40  ? 16.319  9.696   -10.235 1.00 24.16 ? 37  ASN E C     1 
ATOM   5900 O O     . ASN C 1 40  ? 15.728  9.955   -9.205  1.00 24.44 ? 37  ASN E O     1 
ATOM   5901 C CB    . ASN C 1 40  ? 14.444  9.230   -11.859 1.00 24.55 ? 37  ASN E CB    1 
ATOM   5902 C CG    . ASN C 1 40  ? 14.691  10.356  -12.861 1.00 24.68 ? 37  ASN E CG    1 
ATOM   5903 O OD1   . ASN C 1 40  ? 15.396  11.320  -12.574 1.00 25.24 ? 37  ASN E OD1   1 
ATOM   5904 N ND2   . ASN C 1 40  ? 14.044  10.260  -14.021 1.00 25.92 ? 37  ASN E ND2   1 
ATOM   5905 N N     . PRO C 1 41  ? 17.505  10.238  -10.539 1.00 24.87 ? 38  PRO E N     1 
ATOM   5906 C CA    . PRO C 1 41  ? 18.226  11.115  -9.620  1.00 25.59 ? 38  PRO E CA    1 
ATOM   5907 C C     . PRO C 1 41  ? 17.704  12.545  -9.551  1.00 26.19 ? 38  PRO E C     1 
ATOM   5908 O O     . PRO C 1 41  ? 18.145  13.309  -8.686  1.00 26.75 ? 38  PRO E O     1 
ATOM   5909 C CB    . PRO C 1 41  ? 19.632  11.144  -10.226 1.00 25.55 ? 38  PRO E CB    1 
ATOM   5910 C CG    . PRO C 1 41  ? 19.357  11.053  -11.692 1.00 25.69 ? 38  PRO E CG    1 
ATOM   5911 C CD    . PRO C 1 41  ? 18.263  10.034  -11.788 1.00 25.07 ? 38  PRO E CD    1 
ATOM   5912 N N     . TYR C 1 42  ? 16.839  12.929  -10.480 1.00 26.55 ? 39  TYR E N     1 
ATOM   5913 C CA    . TYR C 1 42  ? 16.322  14.280  -10.500 1.00 27.50 ? 39  TYR E CA    1 
ATOM   5914 C C     . TYR C 1 42  ? 15.146  14.361  -9.543  1.00 28.21 ? 39  TYR E C     1 
ATOM   5915 O O     . TYR C 1 42  ? 14.304  13.466  -9.522  1.00 28.02 ? 39  TYR E O     1 
ATOM   5916 C CB    . TYR C 1 42  ? 15.885  14.673  -11.923 1.00 28.18 ? 39  TYR E CB    1 
ATOM   5917 C CG    . TYR C 1 42  ? 17.046  14.769  -12.886 1.00 28.13 ? 39  TYR E CG    1 
ATOM   5918 C CD1   . TYR C 1 42  ? 17.308  13.758  -13.793 1.00 28.70 ? 39  TYR E CD1   1 
ATOM   5919 C CD2   . TYR C 1 42  ? 17.902  15.867  -12.865 1.00 28.60 ? 39  TYR E CD2   1 
ATOM   5920 C CE1   . TYR C 1 42  ? 18.406  13.842  -14.680 1.00 29.27 ? 39  TYR E CE1   1 
ATOM   5921 C CE2   . TYR C 1 42  ? 18.991  15.957  -13.741 1.00 28.18 ? 39  TYR E CE2   1 
ATOM   5922 C CZ    . TYR C 1 42  ? 19.232  14.940  -14.641 1.00 28.57 ? 39  TYR E CZ    1 
ATOM   5923 O OH    . TYR C 1 42  ? 20.304  15.006  -15.504 1.00 29.27 ? 39  TYR E OH    1 
ATOM   5924 N N     . PRO C 1 43  ? 15.074  15.440  -8.752  1.00 29.31 ? 40  PRO E N     1 
ATOM   5925 C CA    . PRO C 1 43  ? 13.908  15.575  -7.916  1.00 29.66 ? 40  PRO E CA    1 
ATOM   5926 C C     . PRO C 1 43  ? 12.685  15.879  -8.763  1.00 30.24 ? 40  PRO E C     1 
ATOM   5927 O O     . PRO C 1 43  ? 12.806  16.286  -9.925  1.00 30.60 ? 40  PRO E O     1 
ATOM   5928 C CB    . PRO C 1 43  ? 14.235  16.768  -7.018  1.00 29.85 ? 40  PRO E CB    1 
ATOM   5929 C CG    . PRO C 1 43  ? 15.655  17.134  -7.305  1.00 30.43 ? 40  PRO E CG    1 
ATOM   5930 C CD    . PRO C 1 43  ? 16.005  16.574  -8.607  1.00 29.56 ? 40  PRO E CD    1 
ATOM   5931 N N     . PRO C 1 44  ? 11.498  15.667  -8.198  1.00 30.89 ? 41  PRO E N     1 
ATOM   5932 C CA    . PRO C 1 44  ? 10.319  16.127  -8.901  1.00 31.17 ? 41  PRO E CA    1 
ATOM   5933 C C     . PRO C 1 44  ? 10.376  17.638  -9.160  1.00 31.45 ? 41  PRO E C     1 
ATOM   5934 O O     . PRO C 1 44  ? 10.949  18.391  -8.357  1.00 30.77 ? 41  PRO E O     1 
ATOM   5935 C CB    . PRO C 1 44  ? 9.184   15.763  -7.941  1.00 31.28 ? 41  PRO E CB    1 
ATOM   5936 C CG    . PRO C 1 44  ? 9.736   14.602  -7.162  1.00 31.37 ? 41  PRO E CG    1 
ATOM   5937 C CD    . PRO C 1 44  ? 11.157  14.982  -6.941  1.00 30.97 ? 41  PRO E CD    1 
ATOM   5938 N N     . SER C 1 45  ? 9.784   18.042  -10.281 1.00 31.92 ? 42  SER E N     1 
ATOM   5939 C CA    . SER C 1 45  ? 9.779   19.424  -10.733 1.00 32.63 ? 42  SER E CA    1 
ATOM   5940 C C     . SER C 1 45  ? 8.938   20.331  -9.843  1.00 33.17 ? 42  SER E C     1 
ATOM   5941 O O     . SER C 1 45  ? 7.965   19.892  -9.209  1.00 33.37 ? 42  SER E O     1 
ATOM   5942 C CB    . SER C 1 45  ? 9.243   19.490  -12.163 1.00 32.92 ? 42  SER E CB    1 
ATOM   5943 O OG    . SER C 1 45  ? 7.862   19.148  -12.215 1.00 33.84 ? 42  SER E OG    1 
ATOM   5944 N N     . GLU C 1 46  ? 9.315   21.604  -9.816  1.00 33.51 ? 43  GLU E N     1 
ATOM   5945 C CA    . GLU C 1 46  ? 8.591   22.627  -9.066  1.00 34.30 ? 43  GLU E CA    1 
ATOM   5946 C C     . GLU C 1 46  ? 7.103   22.691  -9.446  1.00 33.60 ? 43  GLU E C     1 
ATOM   5947 O O     . GLU C 1 46  ? 6.249   22.897  -8.577  1.00 34.11 ? 43  GLU E O     1 
ATOM   5948 C CB    . GLU C 1 46  ? 9.253   24.007  -9.267  1.00 34.80 ? 43  GLU E CB    1 
ATOM   5949 C CG    . GLU C 1 46  ? 10.609  24.195  -8.544  1.00 36.55 ? 43  GLU E CG    1 
ATOM   5950 C CD    . GLU C 1 46  ? 11.331  25.489  -8.982  1.00 38.39 ? 43  GLU E CD    1 
ATOM   5951 O OE1   . GLU C 1 46  ? 10.622  26.496  -9.286  1.00 43.34 ? 43  GLU E OE1   1 
ATOM   5952 O OE2   . GLU C 1 46  ? 12.598  25.499  -9.035  1.00 41.82 ? 43  GLU E OE2   1 
ATOM   5953 N N     . ALA C 1 47  ? 6.813   22.508  -10.735 1.00 33.12 ? 44  ALA E N     1 
ATOM   5954 C CA    . ALA C 1 47  ? 5.439   22.433  -11.246 1.00 32.73 ? 44  ALA E CA    1 
ATOM   5955 C C     . ALA C 1 47  ? 4.662   21.217  -10.724 1.00 32.16 ? 44  ALA E C     1 
ATOM   5956 O O     . ALA C 1 47  ? 3.496   21.338  -10.330 1.00 32.53 ? 44  ALA E O     1 
ATOM   5957 C CB    . ALA C 1 47  ? 5.435   22.438  -12.792 1.00 32.49 ? 44  ALA E CB    1 
ATOM   5958 N N     . LEU C 1 48  ? 5.285   20.041  -10.737 1.00 31.91 ? 45  LEU E N     1 
ATOM   5959 C CA    . LEU C 1 48  ? 4.615   18.845  -10.230 1.00 31.42 ? 45  LEU E CA    1 
ATOM   5960 C C     . LEU C 1 48  ? 4.306   19.014  -8.742  1.00 31.02 ? 45  LEU E C     1 
ATOM   5961 O O     . LEU C 1 48  ? 3.178   18.737  -8.305  1.00 31.06 ? 45  LEU E O     1 
ATOM   5962 C CB    . LEU C 1 48  ? 5.439   17.576  -10.492 1.00 31.65 ? 45  LEU E CB    1 
ATOM   5963 C CG    . LEU C 1 48  ? 4.685   16.248  -10.298 1.00 32.05 ? 45  LEU E CG    1 
ATOM   5964 C CD1   . LEU C 1 48  ? 5.387   15.143  -11.039 1.00 32.39 ? 45  LEU E CD1   1 
ATOM   5965 C CD2   . LEU C 1 48  ? 4.517   15.867  -8.823  1.00 32.43 ? 45  LEU E CD2   1 
ATOM   5966 N N     . VAL C 1 49  ? 5.293   19.499  -7.987  1.00 30.22 ? 46  VAL E N     1 
ATOM   5967 C CA    . VAL C 1 49  ? 5.157   19.685  -6.553  1.00 30.50 ? 46  VAL E CA    1 
ATOM   5968 C C     . VAL C 1 49  ? 4.037   20.668  -6.216  1.00 30.87 ? 46  VAL E C     1 
ATOM   5969 O O     . VAL C 1 49  ? 3.187   20.383  -5.367  1.00 31.24 ? 46  VAL E O     1 
ATOM   5970 C CB    . VAL C 1 49  ? 6.463   20.186  -5.925  1.00 30.27 ? 46  VAL E CB    1 
ATOM   5971 C CG1   . VAL C 1 49  ? 6.241   20.575  -4.474  1.00 29.85 ? 46  VAL E CG1   1 
ATOM   5972 C CG2   . VAL C 1 49  ? 7.568   19.128  -6.043  1.00 30.27 ? 46  VAL E CG2   1 
ATOM   5973 N N     . ALA C 1 50  ? 4.027   21.821  -6.881  1.00 30.78 ? 47  ALA E N     1 
ATOM   5974 C CA    . ALA C 1 50  ? 2.978   22.822  -6.643  1.00 30.87 ? 47  ALA E CA    1 
ATOM   5975 C C     . ALA C 1 50  ? 1.588   22.255  -6.948  1.00 30.88 ? 47  ALA E C     1 
ATOM   5976 O O     . ALA C 1 50  ? 0.644   22.480  -6.217  1.00 31.47 ? 47  ALA E O     1 
ATOM   5977 C CB    . ALA C 1 50  ? 3.233   24.071  -7.477  1.00 30.81 ? 47  ALA E CB    1 
ATOM   5978 N N     . ASP C 1 51  ? 1.472   21.516  -8.036  1.00 31.40 ? 48  ASP E N     1 
ATOM   5979 C CA    . ASP C 1 51  ? 0.220   20.847  -8.373  1.00 31.31 ? 48  ASP E CA    1 
ATOM   5980 C C     . ASP C 1 51  ? -0.116  19.770  -7.318  1.00 31.30 ? 48  ASP E C     1 
ATOM   5981 O O     . ASP C 1 51  ? -1.244  19.698  -6.816  1.00 31.35 ? 48  ASP E O     1 
ATOM   5982 C CB    . ASP C 1 51  ? 0.343   20.253  -9.778  1.00 31.59 ? 48  ASP E CB    1 
ATOM   5983 C CG    . ASP C 1 51  ? -0.940  19.635  -10.278 1.00 32.39 ? 48  ASP E CG    1 
ATOM   5984 O OD1   . ASP C 1 51  ? -1.984  19.690  -9.579  1.00 35.84 ? 48  ASP E OD1   1 
ATOM   5985 O OD2   . ASP C 1 51  ? -0.898  19.086  -11.393 1.00 32.81 ? 48  ASP E OD2   1 
ATOM   5986 N N     . LEU C 1 52  ? 0.870   18.949  -6.970  1.00 31.39 ? 49  LEU E N     1 
ATOM   5987 C CA    . LEU C 1 52  ? 0.721   17.996  -5.871  1.00 31.49 ? 49  LEU E CA    1 
ATOM   5988 C C     . LEU C 1 52  ? 0.177   18.664  -4.607  1.00 31.18 ? 49  LEU E C     1 
ATOM   5989 O O     . LEU C 1 52  ? -0.770  18.175  -4.000  1.00 31.16 ? 49  LEU E O     1 
ATOM   5990 C CB    . LEU C 1 52  ? 2.064   17.337  -5.553  1.00 31.76 ? 49  LEU E CB    1 
ATOM   5991 C CG    . LEU C 1 52  ? 2.037   16.208  -4.528  1.00 32.32 ? 49  LEU E CG    1 
ATOM   5992 C CD1   . LEU C 1 52  ? 1.117   15.071  -4.978  1.00 34.68 ? 49  LEU E CD1   1 
ATOM   5993 C CD2   . LEU C 1 52  ? 3.458   15.714  -4.299  1.00 32.51 ? 49  LEU E CD2   1 
ATOM   5994 N N     . VAL C 1 53  ? 0.787   19.778  -4.215  1.00 31.13 ? 50  VAL E N     1 
ATOM   5995 C CA    . VAL C 1 53  ? 0.388   20.486  -3.003  1.00 31.15 ? 50  VAL E CA    1 
ATOM   5996 C C     . VAL C 1 53  ? -1.044  21.022  -3.101  1.00 31.18 ? 50  VAL E C     1 
ATOM   5997 O O     . VAL C 1 53  ? -1.819  20.896  -2.157  1.00 31.65 ? 50  VAL E O     1 
ATOM   5998 C CB    . VAL C 1 53  ? 1.328   21.661  -2.705  1.00 31.49 ? 50  VAL E CB    1 
ATOM   5999 C CG1   . VAL C 1 53  ? 0.774   22.504  -1.553  1.00 30.89 ? 50  VAL E CG1   1 
ATOM   6000 C CG2   . VAL C 1 53  ? 2.753   21.153  -2.400  1.00 31.27 ? 50  VAL E CG2   1 
ATOM   6001 N N     . ALA C 1 54  ? -1.382  21.628  -4.230  1.00 31.21 ? 51  ALA E N     1 
ATOM   6002 C CA    . ALA C 1 54  ? -2.733  22.143  -4.457  1.00 31.56 ? 51  ALA E CA    1 
ATOM   6003 C C     . ALA C 1 54  ? -3.774  21.023  -4.459  1.00 31.59 ? 51  ALA E C     1 
ATOM   6004 O O     . ALA C 1 54  ? -4.885  21.190  -3.950  1.00 31.49 ? 51  ALA E O     1 
ATOM   6005 C CB    . ALA C 1 54  ? -2.793  22.907  -5.771  1.00 31.79 ? 51  ALA E CB    1 
ATOM   6006 N N     . THR C 1 55  ? -3.408  19.886  -5.038  1.00 31.71 ? 52  THR E N     1 
ATOM   6007 C CA    . THR C 1 55  ? -4.281  18.717  -5.045  1.00 32.33 ? 52  THR E CA    1 
ATOM   6008 C C     . THR C 1 55  ? -4.555  18.205  -3.644  1.00 32.58 ? 52  THR E C     1 
ATOM   6009 O O     . THR C 1 55  ? -5.703  18.036  -3.266  1.00 32.85 ? 52  THR E O     1 
ATOM   6010 C CB    . THR C 1 55  ? -3.690  17.571  -5.870  1.00 32.19 ? 52  THR E CB    1 
ATOM   6011 O OG1   . THR C 1 55  ? -3.471  18.015  -7.212  1.00 32.71 ? 52  THR E OG1   1 
ATOM   6012 C CG2   . THR C 1 55  ? -4.639  16.383  -5.889  1.00 31.52 ? 52  THR E CG2   1 
ATOM   6013 N N     . VAL C 1 56  ? -3.502  17.967  -2.874  1.00 33.36 ? 53  VAL E N     1 
ATOM   6014 C CA    . VAL C 1 56  ? -3.649  17.502  -1.503  1.00 34.00 ? 53  VAL E CA    1 
ATOM   6015 C C     . VAL C 1 56  ? -4.572  18.419  -0.711  1.00 34.76 ? 53  VAL E C     1 
ATOM   6016 O O     . VAL C 1 56  ? -5.437  17.947  0.024   1.00 34.52 ? 53  VAL E O     1 
ATOM   6017 C CB    . VAL C 1 56  ? -2.286  17.406  -0.803  1.00 34.33 ? 53  VAL E CB    1 
ATOM   6018 C CG1   . VAL C 1 56  ? -2.450  17.233  0.714   1.00 33.37 ? 53  VAL E CG1   1 
ATOM   6019 C CG2   . VAL C 1 56  ? -1.490  16.268  -1.400  1.00 34.65 ? 53  VAL E CG2   1 
ATOM   6020 N N     . ASP C 1 57  ? -4.401  19.728  -0.878  1.00 35.87 ? 54  ASP E N     1 
ATOM   6021 C CA    . ASP C 1 57  ? -5.299  20.690  -0.247  1.00 36.19 ? 54  ASP E CA    1 
ATOM   6022 C C     . ASP C 1 57  ? -6.759  20.512  -0.678  1.00 36.54 ? 54  ASP E C     1 
ATOM   6023 O O     . ASP C 1 57  ? -7.670  20.797  0.103   1.00 37.45 ? 54  ASP E O     1 
ATOM   6024 C CB    . ASP C 1 57  ? -4.837  22.123  -0.525  1.00 37.26 ? 54  ASP E CB    1 
ATOM   6025 C CG    . ASP C 1 57  ? -5.680  23.162  0.203   1.00 38.15 ? 54  ASP E CG    1 
ATOM   6026 O OD1   . ASP C 1 57  ? -5.605  23.242  1.457   1.00 42.51 ? 54  ASP E OD1   1 
ATOM   6027 O OD2   . ASP C 1 57  ? -6.428  23.898  -0.485  1.00 44.32 ? 54  ASP E OD2   1 
ATOM   6028 N N     . LYS C 1 58  ? -6.989  20.045  -1.903  1.00 36.38 ? 55  LYS E N     1 
ATOM   6029 C CA    . LYS C 1 58  ? -8.344  19.786  -2.375  1.00 36.14 ? 55  LYS E CA    1 
ATOM   6030 C C     . LYS C 1 58  ? -8.923  18.502  -1.776  1.00 35.57 ? 55  LYS E C     1 
ATOM   6031 O O     . LYS C 1 58  ? -10.042 18.508  -1.279  1.00 35.73 ? 55  LYS E O     1 
ATOM   6032 C CB    . LYS C 1 58  ? -8.396  19.713  -3.903  1.00 36.32 ? 55  LYS E CB    1 
ATOM   6033 C CG    . LYS C 1 58  ? -9.788  19.382  -4.468  1.00 37.24 ? 55  LYS E CG    1 
ATOM   6034 C CD    . LYS C 1 58  ? -9.752  18.964  -5.947  1.00 38.17 ? 55  LYS E CD    1 
ATOM   6035 C CE    . LYS C 1 58  ? -9.319  17.494  -6.147  1.00 39.32 ? 55  LYS E CE    1 
ATOM   6036 N NZ    . LYS C 1 58  ? -8.755  17.239  -7.528  1.00 38.51 ? 55  LYS E NZ    1 
ATOM   6037 N N     . ILE C 1 59  ? -8.175  17.405  -1.818  1.00 34.95 ? 56  ILE E N     1 
ATOM   6038 C CA    . ILE C 1 59  ? -8.737  16.102  -1.434  1.00 34.56 ? 56  ILE E CA    1 
ATOM   6039 C C     . ILE C 1 59  ? -8.587  15.740  0.044   1.00 33.95 ? 56  ILE E C     1 
ATOM   6040 O O     . ILE C 1 59  ? -9.177  14.760  0.497   1.00 34.05 ? 56  ILE E O     1 
ATOM   6041 C CB    . ILE C 1 59  ? -8.165  14.937  -2.296  1.00 34.74 ? 56  ILE E CB    1 
ATOM   6042 C CG1   . ILE C 1 59  ? -6.686  14.679  -2.008  1.00 34.72 ? 56  ILE E CG1   1 
ATOM   6043 C CG2   . ILE C 1 59  ? -8.370  15.207  -3.783  1.00 35.21 ? 56  ILE E CG2   1 
ATOM   6044 C CD1   . ILE C 1 59  ? -6.268  13.285  -2.425  1.00 35.19 ? 56  ILE E CD1   1 
ATOM   6045 N N     . ALA C 1 60  ? -7.810  16.521  0.789   1.00 33.14 ? 57  ALA E N     1 
ATOM   6046 C CA    . ALA C 1 60  ? -7.515  16.202  2.187   1.00 32.62 ? 57  ALA E CA    1 
ATOM   6047 C C     . ALA C 1 60  ? -8.771  16.122  3.050   1.00 32.02 ? 57  ALA E C     1 
ATOM   6048 O O     . ALA C 1 60  ? -8.837  15.317  3.977   1.00 31.34 ? 57  ALA E O     1 
ATOM   6049 C CB    . ALA C 1 60  ? -6.541  17.208  2.779   1.00 32.29 ? 57  ALA E CB    1 
ATOM   6050 N N     . THR C 1 61  ? -9.770  16.941  2.730   1.00 31.51 ? 58  THR E N     1 
ATOM   6051 C CA    . THR C 1 61  ? -11.003 16.975  3.515   1.00 31.60 ? 58  THR E CA    1 
ATOM   6052 C C     . THR C 1 61  ? -11.848 15.714  3.343   1.00 30.78 ? 58  THR E C     1 
ATOM   6053 O O     . THR C 1 61  ? -12.864 15.572  4.007   1.00 30.66 ? 58  THR E O     1 
ATOM   6054 C CB    . THR C 1 61  ? -11.857 18.195  3.147   1.00 31.69 ? 58  THR E CB    1 
ATOM   6055 O OG1   . THR C 1 61  ? -12.160 18.156  1.748   1.00 33.32 ? 58  THR E OG1   1 
ATOM   6056 C CG2   . THR C 1 61  ? -11.087 19.511  3.475   1.00 34.04 ? 58  THR E CG2   1 
ATOM   6057 N N     . GLU C 1 62  ? -11.445 14.817  2.441   1.00 30.23 ? 59  GLU E N     1 
ATOM   6058 C CA    . GLU C 1 62  ? -12.160 13.554  2.234   1.00 29.98 ? 59  GLU E CA    1 
ATOM   6059 C C     . GLU C 1 62  ? -11.421 12.358  2.803   1.00 28.38 ? 59  GLU E C     1 
ATOM   6060 O O     . GLU C 1 62  ? -11.899 11.256  2.698   1.00 28.23 ? 59  GLU E O     1 
ATOM   6061 C CB    . GLU C 1 62  ? -12.444 13.324  0.741   1.00 31.06 ? 59  GLU E CB    1 
ATOM   6062 C CG    . GLU C 1 62  ? -13.194 14.477  0.038   1.00 35.76 ? 59  GLU E CG    1 
ATOM   6063 C CD    . GLU C 1 62  ? -14.625 14.715  0.582   1.00 41.64 ? 59  GLU E CD    1 
ATOM   6064 O OE1   . GLU C 1 62  ? -15.057 13.984  1.520   1.00 44.84 ? 59  GLU E OE1   1 
ATOM   6065 O OE2   . GLU C 1 62  ? -15.316 15.638  0.060   1.00 45.20 ? 59  GLU E OE2   1 
ATOM   6066 N N     . LEU C 1 63  ? -10.288 12.581  3.457   1.00 27.59 ? 60  LEU E N     1 
ATOM   6067 C CA    . LEU C 1 63  ? -9.468  11.483  3.942   1.00 26.92 ? 60  LEU E CA    1 
ATOM   6068 C C     . LEU C 1 63  ? -10.066 10.657  5.084   1.00 25.98 ? 60  LEU E C     1 
ATOM   6069 O O     . LEU C 1 63  ? -9.508  9.650   5.449   1.00 25.51 ? 60  LEU E O     1 
ATOM   6070 C CB    . LEU C 1 63  ? -8.088  11.983  4.325   1.00 27.18 ? 60  LEU E CB    1 
ATOM   6071 C CG    . LEU C 1 63  ? -7.144  12.303  3.157   1.00 27.69 ? 60  LEU E CG    1 
ATOM   6072 C CD1   . LEU C 1 63  ? -5.798  12.734  3.704   1.00 27.08 ? 60  LEU E CD1   1 
ATOM   6073 C CD2   . LEU C 1 63  ? -6.985  11.100  2.207   1.00 27.10 ? 60  LEU E CD2   1 
ATOM   6074 N N     . ASN C 1 64  ? -11.204 11.062  5.637   1.00 25.52 ? 61  ASN E N     1 
ATOM   6075 C CA    . ASN C 1 64  ? -11.912 10.201  6.594   1.00 24.88 ? 61  ASN E CA    1 
ATOM   6076 C C     . ASN C 1 64  ? -12.607 9.012   5.915   1.00 24.59 ? 61  ASN E C     1 
ATOM   6077 O O     . ASN C 1 64  ? -12.781 7.942   6.535   1.00 25.56 ? 61  ASN E O     1 
ATOM   6078 C CB    . ASN C 1 64  ? -12.916 11.014  7.419   1.00 25.04 ? 61  ASN E CB    1 
ATOM   6079 C CG    . ASN C 1 64  ? -14.007 11.625  6.573   1.00 24.45 ? 61  ASN E CG    1 
ATOM   6080 O OD1   . ASN C 1 64  ? -13.721 12.268  5.582   1.00 24.98 ? 61  ASN E OD1   1 
ATOM   6081 N ND2   . ASN C 1 64  ? -15.270 11.412  6.954   1.00 25.17 ? 61  ASN E ND2   1 
ATOM   6082 N N     . ARG C 1 65  ? -13.015 9.191   4.658   1.00 23.80 ? 62  ARG E N     1 
ATOM   6083 C CA    . ARG C 1 65  ? -13.620 8.109   3.885   1.00 23.63 ? 62  ARG E CA    1 
ATOM   6084 C C     . ARG C 1 65  ? -12.583 7.168   3.285   1.00 23.05 ? 62  ARG E C     1 
ATOM   6085 O O     . ARG C 1 65  ? -11.487 7.582   2.944   1.00 22.77 ? 62  ARG E O     1 
ATOM   6086 C CB    . ARG C 1 65  ? -14.484 8.671   2.744   1.00 23.46 ? 62  ARG E CB    1 
ATOM   6087 C CG    . ARG C 1 65  ? -15.569 9.632   3.172   1.00 23.29 ? 62  ARG E CG    1 
ATOM   6088 C CD    . ARG C 1 65  ? -16.607 8.953   4.029   1.00 24.43 ? 62  ARG E CD    1 
ATOM   6089 N NE    . ARG C 1 65  ? -17.566 9.909   4.563   1.00 24.39 ? 62  ARG E NE    1 
ATOM   6090 C CZ    . ARG C 1 65  ? -18.593 9.602   5.351   1.00 25.64 ? 62  ARG E CZ    1 
ATOM   6091 N NH1   . ARG C 1 65  ? -18.823 8.349   5.716   1.00 25.58 ? 62  ARG E NH1   1 
ATOM   6092 N NH2   . ARG C 1 65  ? -19.389 10.565  5.791   1.00 25.39 ? 62  ARG E NH2   1 
ATOM   6093 N N     . TYR C 1 66  ? -12.950 5.897   3.136   1.00 23.05 ? 63  TYR E N     1 
ATOM   6094 C CA    . TYR C 1 66  ? -12.149 4.967   2.350   1.00 23.07 ? 63  TYR E CA    1 
ATOM   6095 C C     . TYR C 1 66  ? -11.979 5.499   0.941   1.00 23.09 ? 63  TYR E C     1 
ATOM   6096 O O     . TYR C 1 66  ? -12.874 6.147   0.413   1.00 22.06 ? 63  TYR E O     1 
ATOM   6097 C CB    . TYR C 1 66  ? -12.801 3.581   2.277   1.00 23.11 ? 63  TYR E CB    1 
ATOM   6098 C CG    . TYR C 1 66  ? -12.547 2.772   3.511   1.00 22.62 ? 63  TYR E CG    1 
ATOM   6099 C CD1   . TYR C 1 66  ? -13.429 2.798   4.585   1.00 23.59 ? 63  TYR E CD1   1 
ATOM   6100 C CD2   . TYR C 1 66  ? -11.403 2.019   3.629   1.00 21.84 ? 63  TYR E CD2   1 
ATOM   6101 C CE1   . TYR C 1 66  ? -13.162 2.067   5.742   1.00 23.95 ? 63  TYR E CE1   1 
ATOM   6102 C CE2   . TYR C 1 66  ? -11.143 1.275   4.762   1.00 23.22 ? 63  TYR E CE2   1 
ATOM   6103 C CZ    . TYR C 1 66  ? -12.023 1.301   5.818   1.00 22.65 ? 63  TYR E CZ    1 
ATOM   6104 O OH    . TYR C 1 66  ? -11.733 0.569   6.945   1.00 22.61 ? 63  TYR E OH    1 
ATOM   6105 N N     . PRO C 1 67  ? -10.835 5.187   0.313   1.00 23.47 ? 64  PRO E N     1 
ATOM   6106 C CA    . PRO C 1 67  ? -10.617 5.648   -1.037  1.00 23.79 ? 64  PRO E CA    1 
ATOM   6107 C C     . PRO C 1 67  ? -11.519 4.934   -2.023  1.00 24.29 ? 64  PRO E C     1 
ATOM   6108 O O     . PRO C 1 67  ? -12.141 3.910   -1.705  1.00 23.61 ? 64  PRO E O     1 
ATOM   6109 C CB    . PRO C 1 67  ? -9.144  5.286   -1.321  1.00 24.27 ? 64  PRO E CB    1 
ATOM   6110 C CG    . PRO C 1 67  ? -8.753  4.272   -0.333  1.00 24.17 ? 64  PRO E CG    1 
ATOM   6111 C CD    . PRO C 1 67  ? -9.738  4.344   0.821   1.00 23.55 ? 64  PRO E CD    1 
ATOM   6112 N N     . GLU C 1 68  ? -11.572 5.473   -3.228  1.00 24.95 ? 65  GLU E N     1 
ATOM   6113 C CA    . GLU C 1 68  ? -12.277 4.830   -4.312  1.00 25.66 ? 65  GLU E CA    1 
ATOM   6114 C C     . GLU C 1 68  ? -11.607 3.469   -4.581  1.00 26.03 ? 65  GLU E C     1 
ATOM   6115 O O     . GLU C 1 68  ? -10.429 3.377   -4.954  1.00 25.67 ? 65  GLU E O     1 
ATOM   6116 C CB    . GLU C 1 68  ? -12.297 5.738   -5.534  1.00 26.08 ? 65  GLU E CB    1 
ATOM   6117 C CG    . GLU C 1 68  ? -13.464 5.468   -6.461  1.00 28.87 ? 65  GLU E CG    1 
ATOM   6118 C CD    . GLU C 1 68  ? -13.174 4.348   -7.437  1.00 31.79 ? 65  GLU E CD    1 
ATOM   6119 O OE1   . GLU C 1 68  ? -12.292 4.552   -8.296  1.00 33.09 ? 65  GLU E OE1   1 
ATOM   6120 O OE2   . GLU C 1 68  ? -13.810 3.275   -7.333  1.00 32.65 ? 65  GLU E OE2   1 
ATOM   6121 N N     . ARG C 1 69  ? -12.363 2.415   -4.313  1.00 25.98 ? 66  ARG E N     1 
ATOM   6122 C CA    . ARG C 1 69  ? -11.809 1.072   -4.266  1.00 26.51 ? 66  ARG E CA    1 
ATOM   6123 C C     . ARG C 1 69  ? -11.117 0.625   -5.569  1.00 26.43 ? 66  ARG E C     1 
ATOM   6124 O O     . ARG C 1 69  ? -10.114 -0.075  -5.531  1.00 26.30 ? 66  ARG E O     1 
ATOM   6125 C CB    . ARG C 1 69  ? -12.907 0.078   -3.912  1.00 25.70 ? 66  ARG E CB    1 
ATOM   6126 C CG    . ARG C 1 69  ? -12.351 -1.245  -3.477  1.00 27.59 ? 66  ARG E CG    1 
ATOM   6127 C CD    . ARG C 1 69  ? -13.377 -2.349  -3.607  1.00 27.96 ? 66  ARG E CD    1 
ATOM   6128 N NE    . ARG C 1 69  ? -14.275 -2.279  -2.489  1.00 28.99 ? 66  ARG E NE    1 
ATOM   6129 C CZ    . ARG C 1 69  ? -15.603 -2.290  -2.536  1.00 27.96 ? 66  ARG E CZ    1 
ATOM   6130 N NH1   . ARG C 1 69  ? -16.289 -2.418  -3.666  1.00 27.03 ? 66  ARG E NH1   1 
ATOM   6131 N NH2   . ARG C 1 69  ? -16.241 -2.191  -1.392  1.00 28.47 ? 66  ARG E NH2   1 
ATOM   6132 N N     . ASP C 1 70  ? -11.680 1.013   -6.706  1.00 26.64 ? 67  ASP E N     1 
ATOM   6133 C CA    . ASP C 1 70  ? -11.237 0.517   -7.997  1.00 26.63 ? 67  ASP E CA    1 
ATOM   6134 C C     . ASP C 1 70  ? -10.277 1.455   -8.722  1.00 26.58 ? 67  ASP E C     1 
ATOM   6135 O O     . ASP C 1 70  ? -9.861  1.157   -9.839  1.00 26.32 ? 67  ASP E O     1 
ATOM   6136 C CB    . ASP C 1 70  ? -12.456 0.203   -8.876  1.00 26.51 ? 67  ASP E CB    1 
ATOM   6137 C CG    . ASP C 1 70  ? -13.255 -1.007  -8.362  1.00 27.63 ? 67  ASP E CG    1 
ATOM   6138 O OD1   . ASP C 1 70  ? -12.718 -1.773  -7.540  1.00 29.13 ? 67  ASP E OD1   1 
ATOM   6139 O OD2   . ASP C 1 70  ? -14.421 -1.191  -8.768  1.00 28.23 ? 67  ASP E OD2   1 
ATOM   6140 N N     . ALA C 1 71  ? -9.909  2.572   -8.090  1.00 26.27 ? 68  ALA E N     1 
ATOM   6141 C CA    . ALA C 1 71  ? -8.960  3.527   -8.686  1.00 26.22 ? 68  ALA E CA    1 
ATOM   6142 C C     . ALA C 1 71  ? -9.265  3.766   -10.166 1.00 26.12 ? 68  ALA E C     1 
ATOM   6143 O O     . ALA C 1 71  ? -8.399  3.668   -11.029 1.00 25.63 ? 68  ALA E O     1 
ATOM   6144 C CB    . ALA C 1 71  ? -7.518  3.055   -8.496  1.00 25.36 ? 68  ALA E CB    1 
ATOM   6145 N N     . VAL C 1 72  ? -10.511 4.108   -10.446 1.00 26.62 ? 69  VAL E N     1 
ATOM   6146 C CA    . VAL C 1 72  ? -10.989 4.227   -11.833 1.00 26.90 ? 69  VAL E CA    1 
ATOM   6147 C C     . VAL C 1 72  ? -10.315 5.367   -12.608 1.00 27.02 ? 69  VAL E C     1 
ATOM   6148 O O     . VAL C 1 72  ? -9.855  5.184   -13.745 1.00 26.97 ? 69  VAL E O     1 
ATOM   6149 C CB    . VAL C 1 72  ? -12.509 4.391   -11.855 1.00 27.51 ? 69  VAL E CB    1 
ATOM   6150 C CG1   . VAL C 1 72  ? -12.950 5.243   -13.044 1.00 29.07 ? 69  VAL E CG1   1 
ATOM   6151 C CG2   . VAL C 1 72  ? -13.170 3.006   -11.860 1.00 27.38 ? 69  VAL E CG2   1 
ATOM   6152 N N     . GLU C 1 73  ? -10.238 6.526   -11.972 1.00 26.89 ? 70  GLU E N     1 
ATOM   6153 C CA    . GLU C 1 73  ? -9.626  7.694   -12.564 1.00 26.94 ? 70  GLU E CA    1 
ATOM   6154 C C     . GLU C 1 73  ? -8.130  7.513   -12.793 1.00 26.32 ? 70  GLU E C     1 
ATOM   6155 O O     . GLU C 1 73  ? -7.617  7.911   -13.827 1.00 26.58 ? 70  GLU E O     1 
ATOM   6156 C CB    . GLU C 1 73  ? -9.883  8.902   -11.673 1.00 26.92 ? 70  GLU E CB    1 
ATOM   6157 C CG    . GLU C 1 73  ? -9.314  10.209  -12.205 1.00 28.64 ? 70  GLU E CG    1 
ATOM   6158 C CD    . GLU C 1 73  ? -9.708  11.408  -11.341 1.00 30.13 ? 70  GLU E CD    1 
ATOM   6159 O OE1   . GLU C 1 73  ? -10.566 11.229  -10.429 1.00 34.39 ? 70  GLU E OE1   1 
ATOM   6160 O OE2   . GLU C 1 73  ? -9.161  12.524  -11.578 1.00 34.31 ? 70  GLU E OE2   1 
ATOM   6161 N N     . LEU C 1 74  ? -7.428  6.944   -11.821 1.00 25.33 ? 71  LEU E N     1 
ATOM   6162 C CA    . LEU C 1 74  ? -5.995  6.693   -11.965 1.00 25.06 ? 71  LEU E CA    1 
ATOM   6163 C C     . LEU C 1 74  ? -5.761  5.789   -13.173 1.00 24.76 ? 71  LEU E C     1 
ATOM   6164 O O     . LEU C 1 74  ? -4.844  6.013   -13.980 1.00 24.82 ? 71  LEU E O     1 
ATOM   6165 C CB    . LEU C 1 74  ? -5.409  6.046   -10.687 1.00 24.42 ? 71  LEU E CB    1 
ATOM   6166 C CG    . LEU C 1 74  ? -4.010  5.427   -10.844 1.00 24.88 ? 71  LEU E CG    1 
ATOM   6167 C CD1   . LEU C 1 74  ? -3.051  6.498   -11.332 1.00 22.70 ? 71  LEU E CD1   1 
ATOM   6168 C CD2   . LEU C 1 74  ? -3.487  4.749   -9.568  1.00 23.19 ? 71  LEU E CD2   1 
ATOM   6169 N N     . ARG C 1 75  ? -6.595  4.764   -13.263 1.00 24.39 ? 72  ARG E N     1 
ATOM   6170 C CA    . ARG C 1 75  ? -6.535  3.785   -14.325 1.00 24.63 ? 72  ARG E CA    1 
ATOM   6171 C C     . ARG C 1 75  ? -6.889  4.358   -15.720 1.00 24.82 ? 72  ARG E C     1 
ATOM   6172 O O     . ARG C 1 75  ? -6.270  3.972   -16.719 1.00 24.31 ? 72  ARG E O     1 
ATOM   6173 C CB    . ARG C 1 75  ? -7.410  2.584   -13.961 1.00 24.56 ? 72  ARG E CB    1 
ATOM   6174 C CG    . ARG C 1 75  ? -6.790  1.679   -12.881 1.00 23.75 ? 72  ARG E CG    1 
ATOM   6175 C CD    . ARG C 1 75  ? -7.799  0.695   -12.294 1.00 24.24 ? 72  ARG E CD    1 
ATOM   6176 N NE    . ARG C 1 75  ? -8.457  -0.078  -13.336 1.00 23.80 ? 72  ARG E NE    1 
ATOM   6177 C CZ    . ARG C 1 75  ? -9.712  -0.519  -13.300 1.00 25.51 ? 72  ARG E CZ    1 
ATOM   6178 N NH1   . ARG C 1 75  ? -10.514 -0.285  -12.262 1.00 26.07 ? 72  ARG E NH1   1 
ATOM   6179 N NH2   . ARG C 1 75  ? -10.183 -1.198  -14.335 1.00 26.05 ? 72  ARG E NH2   1 
ATOM   6180 N N     . ASP C 1 76  ? -7.847  5.285   -15.782 1.00 25.12 ? 73  ASP E N     1 
ATOM   6181 C CA    . ASP C 1 76  ? -8.086  6.080   -17.000 1.00 25.57 ? 73  ASP E CA    1 
ATOM   6182 C C     . ASP C 1 76  ? -6.782  6.747   -17.454 1.00 25.32 ? 73  ASP E C     1 
ATOM   6183 O O     . ASP C 1 76  ? -6.460  6.742   -18.629 1.00 25.06 ? 73  ASP E O     1 
ATOM   6184 C CB    . ASP C 1 76  ? -9.063  7.242   -16.761 1.00 26.14 ? 73  ASP E CB    1 
ATOM   6185 C CG    . ASP C 1 76  ? -10.526 6.821   -16.682 1.00 28.01 ? 73  ASP E CG    1 
ATOM   6186 O OD1   . ASP C 1 76  ? -10.902 5.762   -17.235 1.00 31.71 ? 73  ASP E OD1   1 
ATOM   6187 O OD2   . ASP C 1 76  ? -11.311 7.607   -16.079 1.00 30.00 ? 73  ASP E OD2   1 
ATOM   6188 N N     . GLU C 1 77  ? -6.061  7.339   -16.509 1.00 25.33 ? 74  GLU E N     1 
ATOM   6189 C CA    . GLU C 1 77  ? -4.896  8.143   -16.831 1.00 25.84 ? 74  GLU E CA    1 
ATOM   6190 C C     . GLU C 1 77  ? -3.670  7.280   -17.150 1.00 25.62 ? 74  GLU E C     1 
ATOM   6191 O O     . GLU C 1 77  ? -2.917  7.585   -18.052 1.00 26.04 ? 74  GLU E O     1 
ATOM   6192 C CB    . GLU C 1 77  ? -4.626  9.144   -15.709 1.00 26.71 ? 74  GLU E CB    1 
ATOM   6193 C CG    . GLU C 1 77  ? -5.793  10.124  -15.455 1.00 28.97 ? 74  GLU E CG    1 
ATOM   6194 C CD    . GLU C 1 77  ? -6.253  10.887  -16.719 1.00 32.58 ? 74  GLU E CD    1 
ATOM   6195 O OE1   . GLU C 1 77  ? -5.385  11.311  -17.548 1.00 32.79 ? 74  GLU E OE1   1 
ATOM   6196 O OE2   . GLU C 1 77  ? -7.491  11.068  -16.871 1.00 34.84 ? 74  GLU E OE2   1 
ATOM   6197 N N     . LEU C 1 78  ? -3.486  6.184   -16.431 1.00 25.83 ? 75  LEU E N     1 
ATOM   6198 C CA    . LEU C 1 78  ? -2.488  5.203   -16.825 1.00 25.61 ? 75  LEU E CA    1 
ATOM   6199 C C     . LEU C 1 78  ? -2.794  4.687   -18.246 1.00 25.94 ? 75  LEU E C     1 
ATOM   6200 O O     . LEU C 1 78  ? -1.886  4.533   -19.052 1.00 25.78 ? 75  LEU E O     1 
ATOM   6201 C CB    . LEU C 1 78  ? -2.409  4.054   -15.821 1.00 25.21 ? 75  LEU E CB    1 
ATOM   6202 C CG    . LEU C 1 78  ? -1.897  4.333   -14.402 1.00 23.69 ? 75  LEU E CG    1 
ATOM   6203 C CD1   . LEU C 1 78  ? -2.251  3.158   -13.484 1.00 19.85 ? 75  LEU E CD1   1 
ATOM   6204 C CD2   . LEU C 1 78  ? -0.397  4.614   -14.422 1.00 23.62 ? 75  LEU E CD2   1 
ATOM   6205 N N     . ALA C 1 79  ? -4.062  4.464   -18.571 1.00 26.06 ? 76  ALA E N     1 
ATOM   6206 C CA    . ALA C 1 79  ? -4.406  3.985   -19.926 1.00 26.56 ? 76  ALA E CA    1 
ATOM   6207 C C     . ALA C 1 79  ? -4.065  5.013   -21.001 1.00 26.91 ? 76  ALA E C     1 
ATOM   6208 O O     . ALA C 1 79  ? -3.547  4.654   -22.063 1.00 27.15 ? 76  ALA E O     1 
ATOM   6209 C CB    . ALA C 1 79  ? -5.863  3.575   -20.022 1.00 26.36 ? 76  ALA E CB    1 
ATOM   6210 N N     . ALA C 1 80  ? -4.342  6.283   -20.715 1.00 27.06 ? 77  ALA E N     1 
ATOM   6211 C CA    . ALA C 1 80  ? -4.007  7.361   -21.629 1.00 27.33 ? 77  ALA E CA    1 
ATOM   6212 C C     . ALA C 1 80  ? -2.502  7.492   -21.805 1.00 27.87 ? 77  ALA E C     1 
ATOM   6213 O O     . ALA C 1 80  ? -2.039  7.826   -22.896 1.00 28.44 ? 77  ALA E O     1 
ATOM   6214 C CB    . ALA C 1 80  ? -4.579  8.683   -21.133 1.00 27.21 ? 77  ALA E CB    1 
ATOM   6215 N N     . TYR C 1 81  ? -1.740  7.286   -20.724 1.00 27.95 ? 78  TYR E N     1 
ATOM   6216 C CA    . TYR C 1 81  ? -0.294  7.411   -20.792 1.00 27.72 ? 78  TYR E CA    1 
ATOM   6217 C C     . TYR C 1 81  ? 0.272   6.315   -21.677 1.00 27.83 ? 78  TYR E C     1 
ATOM   6218 O O     . TYR C 1 81  ? 1.073   6.571   -22.574 1.00 27.52 ? 78  TYR E O     1 
ATOM   6219 C CB    . TYR C 1 81  ? 0.352   7.324   -19.398 1.00 28.14 ? 78  TYR E CB    1 
ATOM   6220 C CG    . TYR C 1 81  ? 1.824   7.024   -19.486 1.00 27.69 ? 78  TYR E CG    1 
ATOM   6221 C CD1   . TYR C 1 81  ? 2.730   8.011   -19.867 1.00 28.15 ? 78  TYR E CD1   1 
ATOM   6222 C CD2   . TYR C 1 81  ? 2.309   5.745   -19.237 1.00 28.48 ? 78  TYR E CD2   1 
ATOM   6223 C CE1   . TYR C 1 81  ? 4.085   7.733   -19.970 1.00 27.78 ? 78  TYR E CE1   1 
ATOM   6224 C CE2   . TYR C 1 81  ? 3.652   5.459   -19.351 1.00 27.34 ? 78  TYR E CE2   1 
ATOM   6225 C CZ    . TYR C 1 81  ? 4.533   6.456   -19.715 1.00 27.70 ? 78  TYR E CZ    1 
ATOM   6226 O OH    . TYR C 1 81  ? 5.881   6.170   -19.828 1.00 29.35 ? 78  TYR E OH    1 
ATOM   6227 N N     . ILE C 1 82  ? -0.142  5.086   -21.401 1.00 28.11 ? 79  ILE E N     1 
ATOM   6228 C CA    . ILE C 1 82  ? 0.339   3.927   -22.138 1.00 28.62 ? 79  ILE E CA    1 
ATOM   6229 C C     . ILE C 1 82  ? -0.025  4.012   -23.619 1.00 29.44 ? 79  ILE E C     1 
ATOM   6230 O O     . ILE C 1 82  ? 0.773   3.627   -24.492 1.00 29.84 ? 79  ILE E O     1 
ATOM   6231 C CB    . ILE C 1 82  ? -0.207  2.612   -21.514 1.00 28.26 ? 79  ILE E CB    1 
ATOM   6232 C CG1   . ILE C 1 82  ? 0.520   2.312   -20.203 1.00 27.31 ? 79  ILE E CG1   1 
ATOM   6233 C CG2   . ILE C 1 82  ? -0.015  1.438   -22.452 1.00 28.50 ? 79  ILE E CG2   1 
ATOM   6234 C CD1   . ILE C 1 82  ? 2.015   2.003   -20.393 1.00 26.17 ? 79  ILE E CD1   1 
ATOM   6235 N N     . THR C 1 83  ? -1.224  4.505   -23.911 1.00 29.87 ? 80  THR E N     1 
ATOM   6236 C CA    . THR C 1 83  ? -1.637  4.669   -25.309 1.00 30.46 ? 80  THR E CA    1 
ATOM   6237 C C     . THR C 1 83  ? -0.619  5.531   -26.053 1.00 30.99 ? 80  THR E C     1 
ATOM   6238 O O     . THR C 1 83  ? -0.063  5.107   -27.064 1.00 30.88 ? 80  THR E O     1 
ATOM   6239 C CB    . THR C 1 83  ? -3.060  5.264   -25.426 1.00 30.52 ? 80  THR E CB    1 
ATOM   6240 O OG1   . THR C 1 83  ? -4.003  4.360   -24.821 1.00 29.73 ? 80  THR E OG1   1 
ATOM   6241 C CG2   . THR C 1 83  ? -3.441  5.478   -26.913 1.00 30.28 ? 80  THR E CG2   1 
ATOM   6242 N N     . LYS C 1 84  ? -0.351  6.714   -25.511 1.00 32.12 ? 81  LYS E N     1 
ATOM   6243 C CA    . LYS C 1 84  ? 0.555   7.675   -26.133 1.00 32.45 ? 81  LYS E CA    1 
ATOM   6244 C C     . LYS C 1 84  ? 1.991   7.168   -26.149 1.00 32.47 ? 81  LYS E C     1 
ATOM   6245 O O     . LYS C 1 84  ? 2.709   7.311   -27.143 1.00 32.63 ? 81  LYS E O     1 
ATOM   6246 C CB    . LYS C 1 84  ? 0.482   9.016   -25.389 1.00 33.07 ? 81  LYS E CB    1 
ATOM   6247 C CG    . LYS C 1 84  ? 1.448   10.109  -25.915 1.00 33.67 ? 81  LYS E CG    1 
ATOM   6248 C CD    . LYS C 1 84  ? 1.515   11.318  -24.977 1.00 34.44 ? 81  LYS E CD    1 
ATOM   6249 C CE    . LYS C 1 84  ? 2.875   12.079  -25.096 1.00 37.10 ? 81  LYS E CE    1 
ATOM   6250 N NZ    . LYS C 1 84  ? 3.057   13.204  -24.078 1.00 37.12 ? 81  LYS E NZ    1 
ATOM   6251 N N     . GLN C 1 85  ? 2.407   6.596   -25.027 1.00 32.54 ? 82  GLN E N     1 
ATOM   6252 C CA    . GLN C 1 85  ? 3.778   6.146   -24.837 1.00 32.48 ? 82  GLN E CA    1 
ATOM   6253 C C     . GLN C 1 85  ? 4.105   4.939   -25.702 1.00 32.49 ? 82  GLN E C     1 
ATOM   6254 O O     . GLN C 1 85  ? 5.223   4.842   -26.225 1.00 32.68 ? 82  GLN E O     1 
ATOM   6255 C CB    . GLN C 1 85  ? 4.020   5.828   -23.346 1.00 32.75 ? 82  GLN E CB    1 
ATOM   6256 C CG    . GLN C 1 85  ? 5.228   4.970   -23.008 1.00 32.93 ? 82  GLN E CG    1 
ATOM   6257 C CD    . GLN C 1 85  ? 6.563   5.628   -23.337 1.00 34.48 ? 82  GLN E CD    1 
ATOM   6258 O OE1   . GLN C 1 85  ? 6.705   6.862   -23.280 1.00 31.08 ? 82  GLN E OE1   1 
ATOM   6259 N NE2   . GLN C 1 85  ? 7.572   4.786   -23.641 1.00 32.56 ? 82  GLN E NE2   1 
ATOM   6260 N N     . THR C 1 86  ? 3.166   4.004   -25.835 1.00 32.24 ? 83  THR E N     1 
ATOM   6261 C CA    . THR C 1 86  ? 3.483   2.742   -26.506 1.00 32.19 ? 83  THR E CA    1 
ATOM   6262 C C     . THR C 1 86  ? 2.919   2.607   -27.914 1.00 32.43 ? 83  THR E C     1 
ATOM   6263 O O     . THR C 1 86  ? 3.353   1.724   -28.657 1.00 32.76 ? 83  THR E O     1 
ATOM   6264 C CB    . THR C 1 86  ? 3.032   1.518   -25.691 1.00 32.24 ? 83  THR E CB    1 
ATOM   6265 O OG1   . THR C 1 86  ? 1.604   1.421   -25.685 1.00 31.11 ? 83  THR E OG1   1 
ATOM   6266 C CG2   . THR C 1 86  ? 3.567   1.609   -24.268 1.00 32.28 ? 83  THR E CG2   1 
ATOM   6267 N N     . GLY C 1 87  ? 1.961   3.461   -28.271 1.00 32.32 ? 84  GLY E N     1 
ATOM   6268 C CA    . GLY C 1 87  ? 1.242   3.328   -29.537 1.00 32.29 ? 84  GLY E CA    1 
ATOM   6269 C C     . GLY C 1 87  ? 0.046   2.376   -29.501 1.00 32.43 ? 84  GLY E C     1 
ATOM   6270 O O     . GLY C 1 87  ? -0.663  2.237   -30.502 1.00 33.51 ? 84  GLY E O     1 
ATOM   6271 N N     . VAL C 1 88  ? -0.199  1.731   -28.362 1.00 31.94 ? 85  VAL E N     1 
ATOM   6272 C CA    . VAL C 1 88  ? -1.238  0.708   -28.271 1.00 31.39 ? 85  VAL E CA    1 
ATOM   6273 C C     . VAL C 1 88  ? -2.455  1.229   -27.516 1.00 31.40 ? 85  VAL E C     1 
ATOM   6274 O O     . VAL C 1 88  ? -2.356  1.593   -26.344 1.00 31.24 ? 85  VAL E O     1 
ATOM   6275 C CB    . VAL C 1 88  ? -0.704  -0.562  -27.590 1.00 31.39 ? 85  VAL E CB    1 
ATOM   6276 C CG1   . VAL C 1 88  ? -1.818  -1.606  -27.423 1.00 30.07 ? 85  VAL E CG1   1 
ATOM   6277 C CG2   . VAL C 1 88  ? 0.461   -1.139  -28.394 1.00 31.64 ? 85  VAL E CG2   1 
ATOM   6278 N N     . ALA C 1 89  ? -3.598  1.242   -28.204 1.00 31.09 ? 86  ALA E N     1 
ATOM   6279 C CA    . ALA C 1 89  ? -4.870  1.728   -27.667 1.00 30.76 ? 86  ALA E CA    1 
ATOM   6280 C C     . ALA C 1 89  ? -5.348  0.861   -26.513 1.00 30.84 ? 86  ALA E C     1 
ATOM   6281 O O     . ALA C 1 89  ? -5.650  -0.332  -26.696 1.00 30.50 ? 86  ALA E O     1 
ATOM   6282 C CB    . ALA C 1 89  ? -5.927  1.739   -28.772 1.00 30.91 ? 86  ALA E CB    1 
ATOM   6283 N N     . VAL C 1 90  ? -5.408  1.464   -25.325 1.00 30.71 ? 87  VAL E N     1 
ATOM   6284 C CA    . VAL C 1 90  ? -5.918  0.797   -24.128 1.00 30.37 ? 87  VAL E CA    1 
ATOM   6285 C C     . VAL C 1 90  ? -6.881  1.706   -23.371 1.00 30.10 ? 87  VAL E C     1 
ATOM   6286 O O     . VAL C 1 90  ? -6.814  2.941   -23.471 1.00 29.78 ? 87  VAL E O     1 
ATOM   6287 C CB    . VAL C 1 90  ? -4.763  0.357   -23.175 1.00 30.54 ? 87  VAL E CB    1 
ATOM   6288 C CG1   . VAL C 1 90  ? -4.049  -0.867  -23.732 1.00 30.64 ? 87  VAL E CG1   1 
ATOM   6289 C CG2   . VAL C 1 90  ? -3.788  1.514   -22.942 1.00 29.31 ? 87  VAL E CG2   1 
ATOM   6290 N N     . THR C 1 91  ? -7.784  1.079   -22.623 1.00 29.79 ? 88  THR E N     1 
ATOM   6291 C CA    . THR C 1 91  ? -8.703  1.796   -21.760 1.00 30.17 ? 88  THR E CA    1 
ATOM   6292 C C     . THR C 1 91  ? -8.401  1.396   -20.318 1.00 30.31 ? 88  THR E C     1 
ATOM   6293 O O     . THR C 1 91  ? -7.514  0.562   -20.054 1.00 29.86 ? 88  THR E O     1 
ATOM   6294 C CB    . THR C 1 91  ? -10.178 1.454   -22.071 1.00 30.27 ? 88  THR E CB    1 
ATOM   6295 O OG1   . THR C 1 91  ? -10.480 0.135   -21.597 1.00 30.30 ? 88  THR E OG1   1 
ATOM   6296 C CG2   . THR C 1 91  ? -10.482 1.545   -23.585 1.00 30.77 ? 88  THR E CG2   1 
ATOM   6297 N N     . ARG C 1 92  ? -9.151  1.977   -19.387 1.00 30.18 ? 89  ARG E N     1 
ATOM   6298 C CA    . ARG C 1 92  ? -9.016  1.608   -17.985 1.00 30.58 ? 89  ARG E CA    1 
ATOM   6299 C C     . ARG C 1 92  ? -9.275  0.138   -17.752 1.00 29.70 ? 89  ARG E C     1 
ATOM   6300 O O     . ARG C 1 92  ? -8.747  -0.432  -16.807 1.00 29.67 ? 89  ARG E O     1 
ATOM   6301 C CB    . ARG C 1 92  ? -9.938  2.434   -17.101 1.00 31.00 ? 89  ARG E CB    1 
ATOM   6302 C CG    . ARG C 1 92  ? -11.408 2.286   -17.382 1.00 32.09 ? 89  ARG E CG    1 
ATOM   6303 C CD    . ARG C 1 92  ? -12.179 2.900   -16.226 1.00 33.44 ? 89  ARG E CD    1 
ATOM   6304 N NE    . ARG C 1 92  ? -13.601 2.612   -16.292 1.00 35.82 ? 89  ARG E NE    1 
ATOM   6305 C CZ    . ARG C 1 92  ? -14.515 3.409   -16.833 1.00 38.94 ? 89  ARG E CZ    1 
ATOM   6306 N NH1   . ARG C 1 92  ? -14.165 4.569   -17.391 1.00 40.28 ? 89  ARG E NH1   1 
ATOM   6307 N NH2   . ARG C 1 92  ? -15.798 3.038   -16.827 1.00 39.47 ? 89  ARG E NH2   1 
ATOM   6308 N N     . ASP C 1 93  ? -10.061 -0.482  -18.621 1.00 29.35 ? 90  ASP E N     1 
ATOM   6309 C CA    . ASP C 1 93  ? -10.389 -1.898  -18.484 1.00 29.30 ? 90  ASP E CA    1 
ATOM   6310 C C     . ASP C 1 93  ? -9.190  -2.807  -18.717 1.00 28.26 ? 90  ASP E C     1 
ATOM   6311 O O     . ASP C 1 93  ? -9.235  -3.974  -18.356 1.00 27.46 ? 90  ASP E O     1 
ATOM   6312 C CB    . ASP C 1 93  ? -11.535 -2.288  -19.430 1.00 30.51 ? 90  ASP E CB    1 
ATOM   6313 C CG    . ASP C 1 93  ? -12.914 -1.869  -18.905 1.00 33.49 ? 90  ASP E CG    1 
ATOM   6314 O OD1   . ASP C 1 93  ? -12.990 -1.000  -18.003 1.00 38.15 ? 90  ASP E OD1   1 
ATOM   6315 O OD2   . ASP C 1 93  ? -13.935 -2.412  -19.407 1.00 38.10 ? 90  ASP E OD2   1 
ATOM   6316 N N     . ASN C 1 94  ? -8.130  -2.259  -19.311 1.00 27.43 ? 91  ASN E N     1 
ATOM   6317 C CA    . ASN C 1 94  ? -6.875  -2.975  -19.528 1.00 27.13 ? 91  ASN E CA    1 
ATOM   6318 C C     . ASN C 1 94  ? -5.810  -2.744  -18.443 1.00 26.83 ? 91  ASN E C     1 
ATOM   6319 O O     . ASN C 1 94  ? -4.790  -3.448  -18.428 1.00 26.52 ? 91  ASN E O     1 
ATOM   6320 C CB    . ASN C 1 94  ? -6.282  -2.552  -20.866 1.00 26.92 ? 91  ASN E CB    1 
ATOM   6321 C CG    . ASN C 1 94  ? -7.192  -2.864  -22.019 1.00 27.37 ? 91  ASN E CG    1 
ATOM   6322 O OD1   . ASN C 1 94  ? -7.405  -4.033  -22.358 1.00 27.27 ? 91  ASN E OD1   1 
ATOM   6323 N ND2   . ASN C 1 94  ? -7.750  -1.827  -22.622 1.00 23.53 ? 91  ASN E ND2   1 
ATOM   6324 N N     . LEU C 1 95  ? -6.041  -1.761  -17.562 1.00 26.12 ? 92  LEU E N     1 
ATOM   6325 C CA    . LEU C 1 95  ? -5.073  -1.394  -16.546 1.00 25.82 ? 92  LEU E CA    1 
ATOM   6326 C C     . LEU C 1 95  ? -5.483  -1.694  -15.134 1.00 25.03 ? 92  LEU E C     1 
ATOM   6327 O O     . LEU C 1 95  ? -6.659  -1.648  -14.781 1.00 24.45 ? 92  LEU E O     1 
ATOM   6328 C CB    . LEU C 1 95  ? -4.680  0.085   -16.656 1.00 25.95 ? 92  LEU E CB    1 
ATOM   6329 C CG    . LEU C 1 95  ? -3.475  0.229   -17.587 1.00 26.26 ? 92  LEU E CG    1 
ATOM   6330 C CD1   . LEU C 1 95  ? -3.936  0.319   -19.054 1.00 26.06 ? 92  LEU E CD1   1 
ATOM   6331 C CD2   . LEU C 1 95  ? -2.629  1.400   -17.181 1.00 26.46 ? 92  LEU E CD2   1 
ATOM   6332 N N     . TRP C 1 96  ? -4.472  -2.030  -14.339 1.00 24.55 ? 93  TRP E N     1 
ATOM   6333 C CA    . TRP C 1 96  ? -4.636  -2.292  -12.930 1.00 23.87 ? 93  TRP E CA    1 
ATOM   6334 C C     . TRP C 1 96  ? -3.441  -1.703  -12.192 1.00 23.65 ? 93  TRP E C     1 
ATOM   6335 O O     . TRP C 1 96  ? -2.289  -1.965  -12.579 1.00 23.45 ? 93  TRP E O     1 
ATOM   6336 C CB    . TRP C 1 96  ? -4.733  -3.797  -12.679 1.00 23.75 ? 93  TRP E CB    1 
ATOM   6337 C CG    . TRP C 1 96  ? -4.946  -4.095  -11.271 1.00 23.42 ? 93  TRP E CG    1 
ATOM   6338 C CD1   . TRP C 1 96  ? -4.051  -4.634  -10.411 1.00 23.52 ? 93  TRP E CD1   1 
ATOM   6339 C CD2   . TRP C 1 96  ? -6.120  -3.813  -10.511 1.00 23.08 ? 93  TRP E CD2   1 
ATOM   6340 N NE1   . TRP C 1 96  ? -4.606  -4.750  -9.168  1.00 22.79 ? 93  TRP E NE1   1 
ATOM   6341 C CE2   . TRP C 1 96  ? -5.877  -4.251  -9.198  1.00 23.07 ? 93  TRP E CE2   1 
ATOM   6342 C CE3   . TRP C 1 96  ? -7.368  -3.253  -10.819 1.00 23.58 ? 93  TRP E CE3   1 
ATOM   6343 C CZ2   . TRP C 1 96  ? -6.827  -4.127  -8.172  1.00 23.18 ? 93  TRP E CZ2   1 
ATOM   6344 C CZ3   . TRP C 1 96  ? -8.316  -3.137  -9.809  1.00 23.03 ? 93  TRP E CZ3   1 
ATOM   6345 C CH2   . TRP C 1 96  ? -8.035  -3.567  -8.497  1.00 23.33 ? 93  TRP E CH2   1 
ATOM   6346 N N     . ALA C 1 97  ? -3.725  -0.916  -11.146 1.00 22.90 ? 94  ALA E N     1 
ATOM   6347 C CA    . ALA C 1 97  ? -2.703  -0.317  -10.288 1.00 22.87 ? 94  ALA E CA    1 
ATOM   6348 C C     . ALA C 1 97  ? -2.662  -0.924  -8.885  1.00 22.53 ? 94  ALA E C     1 
ATOM   6349 O O     . ALA C 1 97  ? -3.681  -1.347  -8.330  1.00 22.22 ? 94  ALA E O     1 
ATOM   6350 C CB    . ALA C 1 97  ? -2.893  1.184   -10.198 1.00 22.00 ? 94  ALA E CB    1 
ATOM   6351 N N     . ALA C 1 98  ? -1.459  -0.966  -8.325  1.00 22.64 ? 95  ALA E N     1 
ATOM   6352 C CA    . ALA C 1 98  ? -1.253  -1.338  -6.923  1.00 22.89 ? 95  ALA E CA    1 
ATOM   6353 C C     . ALA C 1 98  ? -0.048  -0.593  -6.344  1.00 22.82 ? 95  ALA E C     1 
ATOM   6354 O O     . ALA C 1 98  ? 0.564   0.252   -7.017  1.00 22.43 ? 95  ALA E O     1 
ATOM   6355 C CB    . ALA C 1 98  ? -1.088  -2.880  -6.760  1.00 23.02 ? 95  ALA E CB    1 
ATOM   6356 N N     . ASN C 1 99  ? 0.283   -0.920  -5.094  1.00 22.98 ? 96  ASN E N     1 
ATOM   6357 C CA    . ASN C 1 99  ? 1.411   -0.317  -4.397  1.00 23.15 ? 96  ASN E CA    1 
ATOM   6358 C C     . ASN C 1 99  ? 2.749   -0.872  -4.878  1.00 23.17 ? 96  ASN E C     1 
ATOM   6359 O O     . ASN C 1 99  ? 3.354   -1.714  -4.236  1.00 22.26 ? 96  ASN E O     1 
ATOM   6360 C CB    . ASN C 1 99  ? 1.290   -0.499  -2.885  1.00 22.79 ? 96  ASN E CB    1 
ATOM   6361 C CG    . ASN C 1 99  ? 0.192   0.350   -2.279  1.00 25.06 ? 96  ASN E CG    1 
ATOM   6362 O OD1   . ASN C 1 99  ? 0.364   1.556   -2.074  1.00 26.94 ? 96  ASN E OD1   1 
ATOM   6363 N ND2   . ASN C 1 99  ? -0.936  -0.272  -1.972  1.00 26.47 ? 96  ASN E ND2   1 
ATOM   6364 N N     . GLY C 1 100 ? 3.229   -0.339  -5.988  1.00 23.77 ? 97  GLY E N     1 
ATOM   6365 C CA    . GLY C 1 100 ? 4.460   -0.827  -6.598  1.00 23.92 ? 97  GLY E CA    1 
ATOM   6366 C C     . GLY C 1 100 ? 4.232   -2.114  -7.375  1.00 24.06 ? 97  GLY E C     1 
ATOM   6367 O O     . GLY C 1 100 ? 3.236   -2.824  -7.166  1.00 23.35 ? 97  GLY E O     1 
ATOM   6368 N N     . SER C 1 101 ? 5.166   -2.396  -8.287  1.00 24.19 ? 98  SER E N     1 
ATOM   6369 C CA    . SER C 1 101 ? 5.233   -3.678  -8.979  1.00 24.43 ? 98  SER E CA    1 
ATOM   6370 C C     . SER C 1 101 ? 5.286   -4.828  -8.012  1.00 24.61 ? 98  SER E C     1 
ATOM   6371 O O     . SER C 1 101 ? 4.813   -5.909  -8.336  1.00 25.36 ? 98  SER E O     1 
ATOM   6372 C CB    . SER C 1 101 ? 6.495   -3.767  -9.846  1.00 24.41 ? 98  SER E CB    1 
ATOM   6373 O OG    . SER C 1 101 ? 6.479   -2.817  -10.871 1.00 25.93 ? 98  SER E OG    1 
ATOM   6374 N N     . ASN C 1 102 ? 5.887   -4.614  -6.839  1.00 25.25 ? 99  ASN E N     1 
ATOM   6375 C CA    . ASN C 1 102 ? 5.955   -5.651  -5.818  1.00 25.70 ? 99  ASN E CA    1 
ATOM   6376 C C     . ASN C 1 102 ? 4.593   -6.225  -5.528  1.00 25.99 ? 99  ASN E C     1 
ATOM   6377 O O     . ASN C 1 102 ? 4.419   -7.456  -5.535  1.00 26.13 ? 99  ASN E O     1 
ATOM   6378 C CB    . ASN C 1 102 ? 6.552   -5.132  -4.505  1.00 26.63 ? 99  ASN E CB    1 
ATOM   6379 C CG    . ASN C 1 102 ? 8.076   -5.113  -4.508  1.00 28.37 ? 99  ASN E CG    1 
ATOM   6380 O OD1   . ASN C 1 102 ? 8.701   -4.342  -3.764  1.00 29.46 ? 99  ASN E OD1   1 
ATOM   6381 N ND2   . ASN C 1 102 ? 8.681   -5.949  -5.344  1.00 28.52 ? 99  ASN E ND2   1 
ATOM   6382 N N     . GLU C 1 103 ? 3.623   -5.342  -5.282  1.00 26.23 ? 100 GLU E N     1 
ATOM   6383 C CA    . GLU C 1 103 ? 2.272   -5.782  -4.967  1.00 25.95 ? 100 GLU E CA    1 
ATOM   6384 C C     . GLU C 1 103 ? 1.538   -6.242  -6.239  1.00 25.74 ? 100 GLU E C     1 
ATOM   6385 O O     . GLU C 1 103 ? 0.696   -7.147  -6.164  1.00 25.98 ? 100 GLU E O     1 
ATOM   6386 C CB    . GLU C 1 103 ? 1.489   -4.691  -4.243  1.00 25.93 ? 100 GLU E CB    1 
ATOM   6387 C CG    . GLU C 1 103 ? 0.067   -5.122  -3.881  1.00 26.79 ? 100 GLU E CG    1 
ATOM   6388 C CD    . GLU C 1 103 ? -0.658  -4.140  -2.953  1.00 27.72 ? 100 GLU E CD    1 
ATOM   6389 O OE1   . GLU C 1 103 ? -0.615  -2.903  -3.200  1.00 29.57 ? 100 GLU E OE1   1 
ATOM   6390 O OE2   . GLU C 1 103 ? -1.306  -4.624  -1.999  1.00 31.50 ? 100 GLU E OE2   1 
ATOM   6391 N N     . ILE C 1 104 ? 1.846   -5.634  -7.391  1.00 25.37 ? 101 ILE E N     1 
ATOM   6392 C CA    . ILE C 1 104 ? 1.275   -6.095  -8.669  1.00 25.18 ? 101 ILE E CA    1 
ATOM   6393 C C     . ILE C 1 104 ? 1.645   -7.568  -8.891  1.00 25.48 ? 101 ILE E C     1 
ATOM   6394 O O     . ILE C 1 104 ? 0.770   -8.396  -9.116  1.00 25.46 ? 101 ILE E O     1 
ATOM   6395 C CB    . ILE C 1 104 ? 1.720   -5.248  -9.888  1.00 24.80 ? 101 ILE E CB    1 
ATOM   6396 C CG1   . ILE C 1 104 ? 1.013   -3.875  -9.923  1.00 23.91 ? 101 ILE E CG1   1 
ATOM   6397 C CG2   . ILE C 1 104 ? 1.450   -5.991  -11.206 1.00 25.25 ? 101 ILE E CG2   1 
ATOM   6398 C CD1   . ILE C 1 104 ? -0.491  -3.910  -10.263 1.00 21.37 ? 101 ILE E CD1   1 
ATOM   6399 N N     . LEU C 1 105 ? 2.934   -7.882  -8.784  1.00 25.83 ? 102 LEU E N     1 
ATOM   6400 C CA    . LEU C 1 105 ? 3.433   -9.227  -9.048  1.00 25.99 ? 102 LEU E CA    1 
ATOM   6401 C C     . LEU C 1 105 ? 2.969   -10.185 -7.969  1.00 26.38 ? 102 LEU E C     1 
ATOM   6402 O O     . LEU C 1 105 ? 2.743   -11.351 -8.238  1.00 26.96 ? 102 LEU E O     1 
ATOM   6403 C CB    . LEU C 1 105 ? 4.965   -9.242  -9.139  1.00 25.79 ? 102 LEU E CB    1 
ATOM   6404 C CG    . LEU C 1 105 ? 5.606   -8.357  -10.207 1.00 25.20 ? 102 LEU E CG    1 
ATOM   6405 C CD1   . LEU C 1 105 ? 7.130   -8.261  -10.031 1.00 25.36 ? 102 LEU E CD1   1 
ATOM   6406 C CD2   . LEU C 1 105 ? 5.262   -8.822  -11.594 1.00 25.79 ? 102 LEU E CD2   1 
ATOM   6407 N N     . GLN C 1 106 ? 2.812   -9.692  -6.746  1.00 27.26 ? 103 GLN E N     1 
ATOM   6408 C CA    . GLN C 1 106 ? 2.242   -10.500 -5.664  1.00 27.48 ? 103 GLN E CA    1 
ATOM   6409 C C     . GLN C 1 106 ? 0.791   -10.883 -5.969  1.00 27.19 ? 103 GLN E C     1 
ATOM   6410 O O     . GLN C 1 106 ? 0.395   -12.022 -5.766  1.00 27.64 ? 103 GLN E O     1 
ATOM   6411 C CB    . GLN C 1 106 ? 2.325   -9.769  -4.320  1.00 27.65 ? 103 GLN E CB    1 
ATOM   6412 C CG    . GLN C 1 106 ? 1.886   -10.615 -3.145  1.00 28.42 ? 103 GLN E CG    1 
ATOM   6413 C CD    . GLN C 1 106 ? 1.776   -9.847  -1.854  1.00 30.02 ? 103 GLN E CD    1 
ATOM   6414 O OE1   . GLN C 1 106 ? 0.888   -8.990  -1.692  1.00 34.93 ? 103 GLN E OE1   1 
ATOM   6415 N NE2   . GLN C 1 106 ? 2.669   -10.151 -0.906  1.00 31.39 ? 103 GLN E NE2   1 
ATOM   6416 N N     . GLN C 1 107 ? 0.005   -9.934  -6.459  1.00 26.97 ? 104 GLN E N     1 
ATOM   6417 C CA    . GLN C 1 107 ? -1.381  -10.213 -6.816  1.00 27.13 ? 104 GLN E CA    1 
ATOM   6418 C C     . GLN C 1 107 ? -1.507  -11.239 -7.953  1.00 27.31 ? 104 GLN E C     1 
ATOM   6419 O O     . GLN C 1 107 ? -2.383  -12.112 -7.915  1.00 27.08 ? 104 GLN E O     1 
ATOM   6420 C CB    . GLN C 1 107 ? -2.112  -8.920  -7.177  1.00 26.95 ? 104 GLN E CB    1 
ATOM   6421 C CG    . GLN C 1 107 ? -2.573  -8.148  -5.958  1.00 27.23 ? 104 GLN E CG    1 
ATOM   6422 C CD    . GLN C 1 107 ? -2.983  -6.718  -6.257  1.00 27.15 ? 104 GLN E CD    1 
ATOM   6423 O OE1   . GLN C 1 107 ? -2.941  -6.264  -7.399  1.00 27.58 ? 104 GLN E OE1   1 
ATOM   6424 N NE2   . GLN C 1 107 ? -3.370  -5.996  -5.217  1.00 27.04 ? 104 GLN E NE2   1 
ATOM   6425 N N     . LEU C 1 108 ? -0.642  -11.122 -8.962  1.00 27.62 ? 105 LEU E N     1 
ATOM   6426 C CA    . LEU C 1 108 ? -0.658  -12.046 -10.109 1.00 27.68 ? 105 LEU E CA    1 
ATOM   6427 C C     . LEU C 1 108 ? -0.198  -13.433 -9.694  1.00 27.97 ? 105 LEU E C     1 
ATOM   6428 O O     . LEU C 1 108 ? -0.691  -14.422 -10.213 1.00 28.44 ? 105 LEU E O     1 
ATOM   6429 C CB    . LEU C 1 108 ? 0.234   -11.537 -11.242 1.00 27.63 ? 105 LEU E CB    1 
ATOM   6430 C CG    . LEU C 1 108 ? -0.230  -10.300 -12.009 1.00 27.05 ? 105 LEU E CG    1 
ATOM   6431 C CD1   . LEU C 1 108 ? 0.958   -9.635  -12.719 1.00 25.61 ? 105 LEU E CD1   1 
ATOM   6432 C CD2   . LEU C 1 108 ? -1.319  -10.691 -12.987 1.00 27.59 ? 105 LEU E CD2   1 
ATOM   6433 N N     . LEU C 1 109 ? 0.756   -13.503 -8.769  1.00 28.55 ? 106 LEU E N     1 
ATOM   6434 C CA    . LEU C 1 109 ? 1.245   -14.777 -8.258  1.00 28.71 ? 106 LEU E CA    1 
ATOM   6435 C C     . LEU C 1 109 ? 0.199   -15.484 -7.406  1.00 29.42 ? 106 LEU E C     1 
ATOM   6436 O O     . LEU C 1 109 ? 0.093   -16.711 -7.436  1.00 29.31 ? 106 LEU E O     1 
ATOM   6437 C CB    . LEU C 1 109 ? 2.520   -14.585 -7.456  1.00 28.81 ? 106 LEU E CB    1 
ATOM   6438 C CG    . LEU C 1 109 ? 3.795   -14.375 -8.283  1.00 29.80 ? 106 LEU E CG    1 
ATOM   6439 C CD1   . LEU C 1 109 ? 4.850   -13.592 -7.499  1.00 29.81 ? 106 LEU E CD1   1 
ATOM   6440 C CD2   . LEU C 1 109 ? 4.369   -15.699 -8.764  1.00 29.18 ? 106 LEU E CD2   1 
ATOM   6441 N N     . GLN C 1 110 ? -0.577  -14.719 -6.642  1.00 29.96 ? 107 GLN E N     1 
ATOM   6442 C CA    . GLN C 1 110 ? -1.682  -15.294 -5.888  1.00 30.47 ? 107 GLN E CA    1 
ATOM   6443 C C     . GLN C 1 110 ? -2.745  -15.921 -6.810  1.00 30.68 ? 107 GLN E C     1 
ATOM   6444 O O     . GLN C 1 110 ? -3.259  -16.988 -6.514  1.00 31.73 ? 107 GLN E O     1 
ATOM   6445 C CB    . GLN C 1 110 ? -2.343  -14.234 -4.998  1.00 30.86 ? 107 GLN E CB    1 
ATOM   6446 C CG    . GLN C 1 110 ? -1.512  -13.745 -3.821  1.00 31.54 ? 107 GLN E CG    1 
ATOM   6447 C CD    . GLN C 1 110 ? -2.129  -12.508 -3.186  1.00 32.34 ? 107 GLN E CD    1 
ATOM   6448 O OE1   . GLN C 1 110 ? -1.643  -11.390 -3.382  1.00 34.42 ? 107 GLN E OE1   1 
ATOM   6449 N NE2   . GLN C 1 110 ? -3.241  -12.695 -2.467  1.00 34.13 ? 107 GLN E NE2   1 
ATOM   6450 N N     . ALA C 1 111 ? -3.073  -15.261 -7.913  1.00 30.83 ? 108 ALA E N     1 
ATOM   6451 C CA    . ALA C 1 111 ? -4.134  -15.725 -8.818  1.00 31.21 ? 108 ALA E CA    1 
ATOM   6452 C C     . ALA C 1 111 ? -3.686  -16.741 -9.886  1.00 31.55 ? 108 ALA E C     1 
ATOM   6453 O O     . ALA C 1 111 ? -4.504  -17.515 -10.378 1.00 31.31 ? 108 ALA E O     1 
ATOM   6454 C CB    . ALA C 1 111 ? -4.807  -14.526 -9.496  1.00 30.99 ? 108 ALA E CB    1 
ATOM   6455 N N     . PHE C 1 112 ? -2.399  -16.730 -10.248 1.00 32.19 ? 109 PHE E N     1 
ATOM   6456 C CA    . PHE C 1 112 ? -1.882  -17.586 -11.321 1.00 32.42 ? 109 PHE E CA    1 
ATOM   6457 C C     . PHE C 1 112 ? -0.684  -18.459 -10.920 1.00 32.53 ? 109 PHE E C     1 
ATOM   6458 O O     . PHE C 1 112 ? -0.216  -19.262 -11.718 1.00 32.91 ? 109 PHE E O     1 
ATOM   6459 C CB    . PHE C 1 112 ? -1.511  -16.723 -12.527 1.00 33.07 ? 109 PHE E CB    1 
ATOM   6460 C CG    . PHE C 1 112 ? -2.680  -16.006 -13.129 1.00 33.66 ? 109 PHE E CG    1 
ATOM   6461 C CD1   . PHE C 1 112 ? -3.544  -16.667 -13.983 1.00 33.47 ? 109 PHE E CD1   1 
ATOM   6462 C CD2   . PHE C 1 112 ? -2.928  -14.673 -12.830 1.00 34.40 ? 109 PHE E CD2   1 
ATOM   6463 C CE1   . PHE C 1 112 ? -4.624  -16.014 -14.531 1.00 33.88 ? 109 PHE E CE1   1 
ATOM   6464 C CE2   . PHE C 1 112 ? -4.009  -14.012 -13.375 1.00 33.31 ? 109 PHE E CE2   1 
ATOM   6465 C CZ    . PHE C 1 112 ? -4.858  -14.678 -14.230 1.00 34.20 ? 109 PHE E CZ    1 
ATOM   6466 N N     . GLY C 1 113 ? -0.194  -18.304 -9.696  1.00 32.73 ? 110 GLY E N     1 
ATOM   6467 C CA    . GLY C 1 113 ? 0.868   -19.146 -9.159  1.00 33.19 ? 110 GLY E CA    1 
ATOM   6468 C C     . GLY C 1 113 ? 0.360   -19.855 -7.920  1.00 33.54 ? 110 GLY E C     1 
ATOM   6469 O O     . GLY C 1 113 ? -0.735  -20.394 -7.921  1.00 34.13 ? 110 GLY E O     1 
ATOM   6470 N N     . GLY C 1 114 ? 1.157   -19.866 -6.863  1.00 33.75 ? 111 GLY E N     1 
ATOM   6471 C CA    . GLY C 1 114 ? 0.706   -20.372 -5.587  1.00 34.11 ? 111 GLY E CA    1 
ATOM   6472 C C     . GLY C 1 114 ? 1.020   -21.842 -5.392  1.00 34.55 ? 111 GLY E C     1 
ATOM   6473 O O     . GLY C 1 114 ? 1.693   -22.448 -6.225  1.00 34.54 ? 111 GLY E O     1 
ATOM   6474 N N     . PRO C 1 115 ? 0.519   -22.421 -4.288  1.00 35.11 ? 112 PRO E N     1 
ATOM   6475 C CA    . PRO C 1 115 ? 0.809   -23.805 -3.899  1.00 35.58 ? 112 PRO E CA    1 
ATOM   6476 C C     . PRO C 1 115 ? 0.620   -24.776 -5.060  1.00 36.00 ? 112 PRO E C     1 
ATOM   6477 O O     . PRO C 1 115 ? -0.414  -24.747 -5.724  1.00 36.92 ? 112 PRO E O     1 
ATOM   6478 C CB    . PRO C 1 115 ? -0.201  -24.071 -2.778  1.00 35.52 ? 112 PRO E CB    1 
ATOM   6479 C CG    . PRO C 1 115 ? -0.437  -22.715 -2.186  1.00 35.44 ? 112 PRO E CG    1 
ATOM   6480 C CD    . PRO C 1 115 ? -0.388  -21.763 -3.328  1.00 35.08 ? 112 PRO E CD    1 
ATOM   6481 N N     . GLY C 1 116 ? 1.638   -25.587 -5.332  1.00 36.34 ? 113 GLY E N     1 
ATOM   6482 C CA    . GLY C 1 116 ? 1.555   -26.594 -6.385  1.00 36.53 ? 113 GLY E CA    1 
ATOM   6483 C C     . GLY C 1 116 ? 1.854   -26.074 -7.776  1.00 36.87 ? 113 GLY E C     1 
ATOM   6484 O O     . GLY C 1 116 ? 1.933   -26.863 -8.733  1.00 37.34 ? 113 GLY E O     1 
ATOM   6485 N N     . ARG C 1 117 ? 2.019   -24.756 -7.905  1.00 36.62 ? 114 ARG E N     1 
ATOM   6486 C CA    . ARG C 1 117 ? 2.354   -24.153 -9.185  1.00 36.53 ? 114 ARG E CA    1 
ATOM   6487 C C     . ARG C 1 117 ? 3.800   -23.644 -9.171  1.00 36.11 ? 114 ARG E C     1 
ATOM   6488 O O     . ARG C 1 117 ? 4.451   -23.604 -8.114  1.00 35.91 ? 114 ARG E O     1 
ATOM   6489 C CB    . ARG C 1 117 ? 1.380   -23.032 -9.518  1.00 36.75 ? 114 ARG E CB    1 
ATOM   6490 C CG    . ARG C 1 117 ? -0.071  -23.500 -9.645  1.00 37.31 ? 114 ARG E CG    1 
ATOM   6491 C CD    . ARG C 1 117 ? -0.863  -22.548 -10.520 1.00 38.10 ? 114 ARG E CD    1 
ATOM   6492 N NE    . ARG C 1 117 ? -2.188  -23.037 -10.889 1.00 38.57 ? 114 ARG E NE    1 
ATOM   6493 C CZ    . ARG C 1 117 ? -3.003  -22.396 -11.717 1.00 39.43 ? 114 ARG E CZ    1 
ATOM   6494 N NH1   . ARG C 1 117 ? -2.635  -21.240 -12.244 1.00 40.10 ? 114 ARG E NH1   1 
ATOM   6495 N NH2   . ARG C 1 117 ? -4.193  -22.902 -12.017 1.00 41.15 ? 114 ARG E NH2   1 
ATOM   6496 N N     . THR C 1 118 ? 4.293   -23.281 -10.352 1.00 35.73 ? 115 THR E N     1 
ATOM   6497 C CA    . THR C 1 118 ? 5.695   -22.909 -10.525 1.00 35.78 ? 115 THR E CA    1 
ATOM   6498 C C     . THR C 1 118 ? 5.851   -21.658 -11.394 1.00 35.54 ? 115 THR E C     1 
ATOM   6499 O O     . THR C 1 118 ? 5.056   -21.405 -12.302 1.00 35.82 ? 115 THR E O     1 
ATOM   6500 C CB    . THR C 1 118 ? 6.492   -24.056 -11.182 1.00 35.77 ? 115 THR E CB    1 
ATOM   6501 O OG1   . THR C 1 118 ? 5.814   -24.473 -12.368 1.00 36.62 ? 115 THR E OG1   1 
ATOM   6502 C CG2   . THR C 1 118 ? 6.614   -25.247 -10.237 1.00 35.68 ? 115 THR E CG2   1 
ATOM   6503 N N     . ALA C 1 119 ? 6.885   -20.882 -11.097 1.00 35.36 ? 116 ALA E N     1 
ATOM   6504 C CA    . ALA C 1 119 ? 7.245   -19.721 -11.893 1.00 35.17 ? 116 ALA E CA    1 
ATOM   6505 C C     . ALA C 1 119 ? 8.661   -19.931 -12.368 1.00 34.89 ? 116 ALA E C     1 
ATOM   6506 O O     . ALA C 1 119 ? 9.453   -20.550 -11.668 1.00 34.90 ? 116 ALA E O     1 
ATOM   6507 C CB    . ALA C 1 119 ? 7.146   -18.439 -11.055 1.00 35.35 ? 116 ALA E CB    1 
ATOM   6508 N N     . LEU C 1 120 ? 8.970   -19.404 -13.549 1.00 34.75 ? 117 LEU E N     1 
ATOM   6509 C CA    . LEU C 1 120 ? 10.268  -19.592 -14.175 1.00 34.66 ? 117 LEU E CA    1 
ATOM   6510 C C     . LEU C 1 120 ? 10.843  -18.244 -14.578 1.00 34.67 ? 117 LEU E C     1 
ATOM   6511 O O     . LEU C 1 120 ? 10.135  -17.397 -15.130 1.00 34.75 ? 117 LEU E O     1 
ATOM   6512 C CB    . LEU C 1 120 ? 10.131  -20.484 -15.408 1.00 34.74 ? 117 LEU E CB    1 
ATOM   6513 C CG    . LEU C 1 120 ? 11.440  -20.937 -16.064 1.00 35.17 ? 117 LEU E CG    1 
ATOM   6514 C CD1   . LEU C 1 120 ? 11.310  -22.395 -16.543 1.00 36.76 ? 117 LEU E CD1   1 
ATOM   6515 C CD2   . LEU C 1 120 ? 11.872  -19.995 -17.200 1.00 33.91 ? 117 LEU E CD2   1 
ATOM   6516 N N     . GLY C 1 121 ? 12.124  -18.043 -14.284 1.00 34.77 ? 118 GLY E N     1 
ATOM   6517 C CA    . GLY C 1 121 ? 12.808  -16.802 -14.642 1.00 34.61 ? 118 GLY E CA    1 
ATOM   6518 C C     . GLY C 1 121 ? 14.212  -17.099 -15.093 1.00 34.70 ? 118 GLY E C     1 
ATOM   6519 O O     . GLY C 1 121 ? 14.765  -18.159 -14.766 1.00 35.17 ? 118 GLY E O     1 
ATOM   6520 N N     . PHE C 1 122 ? 14.795  -16.140 -15.808 1.00 34.84 ? 119 PHE E N     1 
ATOM   6521 C CA    . PHE C 1 122 ? 16.092  -16.306 -16.458 1.00 34.63 ? 119 PHE E CA    1 
ATOM   6522 C C     . PHE C 1 122 ? 17.179  -15.513 -15.724 1.00 34.22 ? 119 PHE E C     1 
ATOM   6523 O O     . PHE C 1 122 ? 17.410  -14.335 -15.993 1.00 33.42 ? 119 PHE E O     1 
ATOM   6524 C CB    . PHE C 1 122 ? 15.971  -15.862 -17.913 1.00 35.87 ? 119 PHE E CB    1 
ATOM   6525 C CG    . PHE C 1 122 ? 14.752  -16.414 -18.610 1.00 37.04 ? 119 PHE E CG    1 
ATOM   6526 C CD1   . PHE C 1 122 ? 14.660  -17.776 -18.904 1.00 38.61 ? 119 PHE E CD1   1 
ATOM   6527 C CD2   . PHE C 1 122 ? 13.694  -15.585 -18.958 1.00 37.50 ? 119 PHE E CD2   1 
ATOM   6528 C CE1   . PHE C 1 122 ? 13.526  -18.299 -19.541 1.00 37.93 ? 119 PHE E CE1   1 
ATOM   6529 C CE2   . PHE C 1 122 ? 12.568  -16.095 -19.596 1.00 37.68 ? 119 PHE E CE2   1 
ATOM   6530 C CZ    . PHE C 1 122 ? 12.480  -17.455 -19.887 1.00 37.90 ? 119 PHE E CZ    1 
ATOM   6531 N N     . GLN C 1 123 ? 17.839  -16.180 -14.788 1.00 34.05 ? 120 GLN E N     1 
ATOM   6532 C CA    . GLN C 1 123 ? 18.806  -15.540 -13.907 1.00 34.16 ? 120 GLN E CA    1 
ATOM   6533 C C     . GLN C 1 123 ? 20.158  -15.283 -14.581 1.00 33.53 ? 120 GLN E C     1 
ATOM   6534 O O     . GLN C 1 123 ? 20.558  -16.037 -15.463 1.00 33.98 ? 120 GLN E O     1 
ATOM   6535 C CB    . GLN C 1 123 ? 18.985  -16.402 -12.665 1.00 34.59 ? 120 GLN E CB    1 
ATOM   6536 C CG    . GLN C 1 123 ? 17.688  -16.596 -11.849 1.00 36.59 ? 120 GLN E CG    1 
ATOM   6537 C CD    . GLN C 1 123 ? 17.223  -15.318 -11.151 1.00 38.76 ? 120 GLN E CD    1 
ATOM   6538 O OE1   . GLN C 1 123 ? 17.133  -14.244 -11.759 1.00 41.24 ? 120 GLN E OE1   1 
ATOM   6539 N NE2   . GLN C 1 123 ? 16.915  -15.437 -9.870  1.00 41.11 ? 120 GLN E NE2   1 
ATOM   6540 N N     . PRO C 1 124 ? 20.868  -14.207 -14.182 1.00 32.99 ? 121 PRO E N     1 
ATOM   6541 C CA    . PRO C 1 124 ? 20.513  -13.199 -13.162 1.00 31.96 ? 121 PRO E CA    1 
ATOM   6542 C C     . PRO C 1 124 ? 19.497  -12.182 -13.657 1.00 31.46 ? 121 PRO E C     1 
ATOM   6543 O O     . PRO C 1 124 ? 19.725  -11.507 -14.664 1.00 31.48 ? 121 PRO E O     1 
ATOM   6544 C CB    . PRO C 1 124 ? 21.846  -12.516 -12.852 1.00 32.32 ? 121 PRO E CB    1 
ATOM   6545 C CG    . PRO C 1 124 ? 22.684  -12.709 -14.088 1.00 32.83 ? 121 PRO E CG    1 
ATOM   6546 C CD    . PRO C 1 124 ? 22.177  -13.932 -14.803 1.00 32.85 ? 121 PRO E CD    1 
ATOM   6547 N N     . SER C 1 125 ? 18.372  -12.102 -12.950 1.00 30.80 ? 122 SER E N     1 
ATOM   6548 C CA    . SER C 1 125 ? 17.374  -11.077 -13.188 1.00 30.02 ? 122 SER E CA    1 
ATOM   6549 C C     . SER C 1 125 ? 16.962  -10.448 -11.854 1.00 29.27 ? 122 SER E C     1 
ATOM   6550 O O     . SER C 1 125 ? 17.667  -10.565 -10.855 1.00 28.66 ? 122 SER E O     1 
ATOM   6551 C CB    . SER C 1 125 ? 16.165  -11.663 -13.923 1.00 30.16 ? 122 SER E CB    1 
ATOM   6552 O OG    . SER C 1 125 ? 15.535  -10.676 -14.717 1.00 31.71 ? 122 SER E OG    1 
ATOM   6553 N N     . TYR C 1 126 ? 15.816  -9.783  -11.841 1.00 28.81 ? 123 TYR E N     1 
ATOM   6554 C CA    . TYR C 1 126 ? 15.377  -9.035  -10.664 1.00 28.98 ? 123 TYR E CA    1 
ATOM   6555 C C     . TYR C 1 126 ? 15.294  -9.869  -9.382  1.00 28.82 ? 123 TYR E C     1 
ATOM   6556 O O     . TYR C 1 126 ? 14.640  -10.898 -9.341  1.00 28.95 ? 123 TYR E O     1 
ATOM   6557 C CB    . TYR C 1 126 ? 14.042  -8.369  -10.968 1.00 28.76 ? 123 TYR E CB    1 
ATOM   6558 C CG    . TYR C 1 126 ? 13.546  -7.358  -9.957  1.00 28.47 ? 123 TYR E CG    1 
ATOM   6559 C CD1   . TYR C 1 126 ? 12.189  -7.248  -9.698  1.00 28.22 ? 123 TYR E CD1   1 
ATOM   6560 C CD2   . TYR C 1 126 ? 14.424  -6.488  -9.283  1.00 28.50 ? 123 TYR E CD2   1 
ATOM   6561 C CE1   . TYR C 1 126 ? 11.708  -6.319  -8.798  1.00 28.78 ? 123 TYR E CE1   1 
ATOM   6562 C CE2   . TYR C 1 126 ? 13.948  -5.559  -8.375  1.00 27.85 ? 123 TYR E CE2   1 
ATOM   6563 C CZ    . TYR C 1 126 ? 12.584  -5.490  -8.134  1.00 27.84 ? 123 TYR E CZ    1 
ATOM   6564 O OH    . TYR C 1 126 ? 12.071  -4.583  -7.251  1.00 29.59 ? 123 TYR E OH    1 
ATOM   6565 N N     . SER C 1 127 ? 15.965  -9.382  -8.339  1.00 29.38 ? 124 SER E N     1 
ATOM   6566 C CA    . SER C 1 127 ? 16.010  -9.998  -7.002  1.00 29.21 ? 124 SER E CA    1 
ATOM   6567 C C     . SER C 1 127 ? 14.653  -10.378 -6.416  1.00 29.67 ? 124 SER E C     1 
ATOM   6568 O O     . SER C 1 127 ? 14.546  -11.391 -5.726  1.00 30.19 ? 124 SER E O     1 
ATOM   6569 C CB    . SER C 1 127 ? 16.744  -9.061  -6.018  1.00 29.85 ? 124 SER E CB    1 
ATOM   6570 O OG    . SER C 1 127 ? 16.208  -7.735  -6.032  1.00 28.54 ? 124 SER E OG    1 
ATOM   6571 N N     . MET C 1 128 ? 13.618  -9.595  -6.704  1.00 29.47 ? 125 MET E N     1 
ATOM   6572 C CA    . MET C 1 128 ? 12.310  -9.787  -6.073  1.00 29.32 ? 125 MET E CA    1 
ATOM   6573 C C     . MET C 1 128 ? 11.462  -10.905 -6.652  1.00 29.37 ? 125 MET E C     1 
ATOM   6574 O O     . MET C 1 128 ? 10.570  -11.418 -5.966  1.00 29.63 ? 125 MET E O     1 
ATOM   6575 C CB    . MET C 1 128 ? 11.484  -8.493  -6.149  1.00 29.41 ? 125 MET E CB    1 
ATOM   6576 C CG    . MET C 1 128 ? 11.951  -7.371  -5.210  1.00 29.85 ? 125 MET E CG    1 
ATOM   6577 S SD    . MET C 1 128 ? 12.120  -7.850  -3.474  1.00 30.47 ? 125 MET E SD    1 
ATOM   6578 C CE    . MET C 1 128 ? 10.461  -8.427  -3.067  1.00 27.94 ? 125 MET E CE    1 
ATOM   6579 N N     . HIS C 1 129 ? 11.688  -11.260 -7.911  1.00 29.33 ? 126 HIS E N     1 
ATOM   6580 C CA    . HIS C 1 129 ? 10.827  -12.253 -8.564  1.00 29.46 ? 126 HIS E CA    1 
ATOM   6581 C C     . HIS C 1 129 ? 10.795  -13.564 -7.776  1.00 29.60 ? 126 HIS E C     1 
ATOM   6582 O O     . HIS C 1 129 ? 9.720   -13.999 -7.370  1.00 29.71 ? 126 HIS E O     1 
ATOM   6583 C CB    . HIS C 1 129 ? 11.216  -12.481 -10.026 1.00 29.26 ? 126 HIS E CB    1 
ATOM   6584 C CG    . HIS C 1 129 ? 10.871  -11.343 -10.925 1.00 29.01 ? 126 HIS E CG    1 
ATOM   6585 N ND1   . HIS C 1 129 ? 11.354  -11.243 -12.210 1.00 29.86 ? 126 HIS E ND1   1 
ATOM   6586 C CD2   . HIS C 1 129 ? 10.104  -10.245 -10.725 1.00 29.92 ? 126 HIS E CD2   1 
ATOM   6587 C CE1   . HIS C 1 129 ? 10.883  -10.143 -12.772 1.00 30.30 ? 126 HIS E CE1   1 
ATOM   6588 N NE2   . HIS C 1 129 ? 10.128  -9.513  -11.888 1.00 29.13 ? 126 HIS E NE2   1 
ATOM   6589 N N     . PRO C 1 130 ? 11.967  -14.177 -7.530  1.00 29.95 ? 127 PRO E N     1 
ATOM   6590 C CA    . PRO C 1 130 ? 12.004  -15.351 -6.649  1.00 30.05 ? 127 PRO E CA    1 
ATOM   6591 C C     . PRO C 1 130 ? 11.490  -15.124 -5.230  1.00 30.22 ? 127 PRO E C     1 
ATOM   6592 O O     . PRO C 1 130 ? 10.914  -16.034 -4.646  1.00 31.13 ? 127 PRO E O     1 
ATOM   6593 C CB    . PRO C 1 130 ? 13.498  -15.709 -6.596  1.00 30.48 ? 127 PRO E CB    1 
ATOM   6594 C CG    . PRO C 1 130 ? 14.217  -14.506 -7.116  1.00 29.99 ? 127 PRO E CG    1 
ATOM   6595 C CD    . PRO C 1 130 ? 13.300  -13.868 -8.079  1.00 30.00 ? 127 PRO E CD    1 
ATOM   6596 N N     . ILE C 1 131 ? 11.740  -13.949 -4.665  1.00 30.19 ? 128 ILE E N     1 
ATOM   6597 C CA    . ILE C 1 131 ? 11.290  -13.642 -3.320  1.00 30.07 ? 128 ILE E CA    1 
ATOM   6598 C C     . ILE C 1 131 ? 9.763   -13.552 -3.260  1.00 29.75 ? 128 ILE E C     1 
ATOM   6599 O O     . ILE C 1 131 ? 9.151   -13.965 -2.281  1.00 29.86 ? 128 ILE E O     1 
ATOM   6600 C CB    . ILE C 1 131 ? 11.906  -12.320 -2.784  1.00 30.16 ? 128 ILE E CB    1 
ATOM   6601 C CG1   . ILE C 1 131 ? 13.416  -12.479 -2.581  1.00 30.20 ? 128 ILE E CG1   1 
ATOM   6602 C CG2   . ILE C 1 131 ? 11.233  -11.911 -1.466  1.00 30.14 ? 128 ILE E CG2   1 
ATOM   6603 C CD1   . ILE C 1 131 ? 14.082  -11.275 -2.016  1.00 30.33 ? 128 ILE E CD1   1 
ATOM   6604 N N     . LEU C 1 132 ? 9.157   -12.994 -4.299  1.00 29.96 ? 129 LEU E N     1 
ATOM   6605 C CA    . LEU C 1 132 ? 7.707   -12.894 -4.369  1.00 30.33 ? 129 LEU E CA    1 
ATOM   6606 C C     . LEU C 1 132 ? 7.112   -14.276 -4.634  1.00 30.57 ? 129 LEU E C     1 
ATOM   6607 O O     . LEU C 1 132 ? 6.079   -14.637 -4.050  1.00 30.39 ? 129 LEU E O     1 
ATOM   6608 C CB    . LEU C 1 132 ? 7.281   -11.876 -5.438  1.00 30.29 ? 129 LEU E CB    1 
ATOM   6609 C CG    . LEU C 1 132 ? 7.625   -10.407 -5.131  1.00 31.17 ? 129 LEU E CG    1 
ATOM   6610 C CD1   . LEU C 1 132 ? 7.461   -9.535  -6.360  1.00 31.41 ? 129 LEU E CD1   1 
ATOM   6611 C CD2   . LEU C 1 132 ? 6.780   -9.853  -3.995  1.00 31.22 ? 129 LEU E CD2   1 
ATOM   6612 N N     . ALA C 1 133 ? 7.775   -15.050 -5.496  1.00 30.83 ? 130 ALA E N     1 
ATOM   6613 C CA    . ALA C 1 133 ? 7.418   -16.461 -5.716  1.00 31.57 ? 130 ALA E CA    1 
ATOM   6614 C C     . ALA C 1 133 ? 7.388   -17.236 -4.397  1.00 31.93 ? 130 ALA E C     1 
ATOM   6615 O O     . ALA C 1 133 ? 6.414   -17.916 -4.074  1.00 32.02 ? 130 ALA E O     1 
ATOM   6616 C CB    . ALA C 1 133 ? 8.402   -17.113 -6.705  1.00 31.66 ? 130 ALA E CB    1 
ATOM   6617 N N     . LYS C 1 134 ? 8.448   -17.110 -3.610  1.00 32.90 ? 131 LYS E N     1 
ATOM   6618 C CA    . LYS C 1 134 ? 8.493   -17.764 -2.313  1.00 33.32 ? 131 LYS E CA    1 
ATOM   6619 C C     . LYS C 1 134 ? 7.383   -17.251 -1.383  1.00 33.67 ? 131 LYS E C     1 
ATOM   6620 O O     . LYS C 1 134 ? 6.710   -18.028 -0.707  1.00 33.98 ? 131 LYS E O     1 
ATOM   6621 C CB    . LYS C 1 134 ? 9.864   -17.541 -1.679  1.00 34.17 ? 131 LYS E CB    1 
ATOM   6622 C CG    . LYS C 1 134 ? 10.200  -18.457 -0.524  1.00 34.35 ? 131 LYS E CG    1 
ATOM   6623 C CD    . LYS C 1 134 ? 11.692  -18.389 -0.225  1.00 35.51 ? 131 LYS E CD    1 
ATOM   6624 C CE    . LYS C 1 134 ? 12.081  -19.091 1.073   1.00 37.22 ? 131 LYS E CE    1 
ATOM   6625 N NZ    . LYS C 1 134 ? 13.553  -18.879 1.378   1.00 37.47 ? 131 LYS E NZ    1 
ATOM   6626 N N     . GLY C 1 135 ? 7.193   -15.934 -1.343  1.00 33.76 ? 132 GLY E N     1 
ATOM   6627 C CA    . GLY C 1 135 ? 6.181   -15.337 -0.483  1.00 33.25 ? 132 GLY E CA    1 
ATOM   6628 C C     . GLY C 1 135 ? 4.794   -15.871 -0.756  1.00 33.37 ? 132 GLY E C     1 
ATOM   6629 O O     . GLY C 1 135 ? 3.971   -15.988 0.158   1.00 33.93 ? 132 GLY E O     1 
ATOM   6630 N N     . THR C 1 136 ? 4.533   -16.212 -2.013  1.00 33.31 ? 133 THR E N     1 
ATOM   6631 C CA    . THR C 1 136 ? 3.225   -16.704 -2.426  1.00 33.07 ? 133 THR E CA    1 
ATOM   6632 C C     . THR C 1 136 ? 3.165   -18.230 -2.525  1.00 33.28 ? 133 THR E C     1 
ATOM   6633 O O     . THR C 1 136 ? 2.204   -18.764 -3.056  1.00 32.97 ? 133 THR E O     1 
ATOM   6634 C CB    . THR C 1 136 ? 2.856   -16.104 -3.783  1.00 32.72 ? 133 THR E CB    1 
ATOM   6635 O OG1   . THR C 1 136 ? 3.853   -16.465 -4.746  1.00 31.38 ? 133 THR E OG1   1 
ATOM   6636 C CG2   . THR C 1 136 ? 2.777   -14.577 -3.676  1.00 32.39 ? 133 THR E CG2   1 
ATOM   6637 N N     . HIS C 1 137 ? 4.195   -18.917 -2.031  1.00 34.00 ? 134 HIS E N     1 
ATOM   6638 C CA    . HIS C 1 137 ? 4.301   -20.389 -2.102  1.00 34.58 ? 134 HIS E CA    1 
ATOM   6639 C C     . HIS C 1 137 ? 4.292   -20.921 -3.521  1.00 34.90 ? 134 HIS E C     1 
ATOM   6640 O O     . HIS C 1 137 ? 3.831   -22.028 -3.785  1.00 35.27 ? 134 HIS E O     1 
ATOM   6641 C CB    . HIS C 1 137 ? 3.208   -21.057 -1.276  1.00 34.70 ? 134 HIS E CB    1 
ATOM   6642 C CG    . HIS C 1 137 ? 3.146   -20.566 0.133   1.00 35.63 ? 134 HIS E CG    1 
ATOM   6643 N ND1   . HIS C 1 137 ? 4.105   -20.879 1.073   1.00 36.80 ? 134 HIS E ND1   1 
ATOM   6644 C CD2   . HIS C 1 137 ? 2.244   -19.774 0.762   1.00 37.22 ? 134 HIS E CD2   1 
ATOM   6645 C CE1   . HIS C 1 137 ? 3.792   -20.306 2.223   1.00 37.54 ? 134 HIS E CE1   1 
ATOM   6646 N NE2   . HIS C 1 137 ? 2.668   -19.631 2.062   1.00 37.43 ? 134 HIS E NE2   1 
ATOM   6647 N N     . THR C 1 138 ? 4.807   -20.115 -4.439  1.00 35.69 ? 135 THR E N     1 
ATOM   6648 C CA    . THR C 1 138 ? 5.002   -20.543 -5.805  1.00 36.10 ? 135 THR E CA    1 
ATOM   6649 C C     . THR C 1 138 ? 6.434   -21.020 -5.906  1.00 36.60 ? 135 THR E C     1 
ATOM   6650 O O     . THR C 1 138 ? 7.346   -20.421 -5.313  1.00 36.84 ? 135 THR E O     1 
ATOM   6651 C CB    . THR C 1 138 ? 4.750   -19.401 -6.792  1.00 36.21 ? 135 THR E CB    1 
ATOM   6652 O OG1   . THR C 1 138 ? 3.525   -18.745 -6.450  1.00 36.43 ? 135 THR E OG1   1 
ATOM   6653 C CG2   . THR C 1 138 ? 4.643   -19.935 -8.207  1.00 35.87 ? 135 THR E CG2   1 
ATOM   6654 N N     . GLU C 1 139 ? 6.632   -22.116 -6.627  1.00 37.21 ? 136 GLU E N     1 
ATOM   6655 C CA    . GLU C 1 139 ? 7.961   -22.700 -6.771  1.00 37.59 ? 136 GLU E CA    1 
ATOM   6656 C C     . GLU C 1 139 ? 8.706   -21.924 -7.849  1.00 37.11 ? 136 GLU E C     1 
ATOM   6657 O O     . GLU C 1 139 ? 8.167   -21.700 -8.922  1.00 37.27 ? 136 GLU E O     1 
ATOM   6658 C CB    . GLU C 1 139 ? 7.843   -24.181 -7.148  1.00 37.60 ? 136 GLU E CB    1 
ATOM   6659 C CG    . GLU C 1 139 ? 9.174   -24.937 -7.256  1.00 38.82 ? 136 GLU E CG    1 
ATOM   6660 C CD    . GLU C 1 139 ? 8.994   -26.463 -7.441  1.00 40.56 ? 136 GLU E CD    1 
ATOM   6661 O OE1   . GLU C 1 139 ? 7.939   -27.014 -7.022  1.00 44.37 ? 136 GLU E OE1   1 
ATOM   6662 O OE2   . GLU C 1 139 ? 9.918   -27.110 -8.002  1.00 44.33 ? 136 GLU E OE2   1 
ATOM   6663 N N     . PHE C 1 140 ? 9.934   -21.511 -7.571  1.00 36.99 ? 137 PHE E N     1 
ATOM   6664 C CA    . PHE C 1 140 ? 10.693  -20.752 -8.554  1.00 37.27 ? 137 PHE E CA    1 
ATOM   6665 C C     . PHE C 1 140 ? 11.733  -21.618 -9.261  1.00 37.36 ? 137 PHE E C     1 
ATOM   6666 O O     . PHE C 1 140 ? 12.472  -22.364 -8.607  1.00 37.66 ? 137 PHE E O     1 
ATOM   6667 C CB    . PHE C 1 140 ? 11.376  -19.540 -7.912  1.00 37.46 ? 137 PHE E CB    1 
ATOM   6668 C CG    . PHE C 1 140 ? 12.007  -18.614 -8.914  1.00 37.02 ? 137 PHE E CG    1 
ATOM   6669 C CD1   . PHE C 1 140 ? 11.223  -17.750 -9.661  1.00 37.76 ? 137 PHE E CD1   1 
ATOM   6670 C CD2   . PHE C 1 140 ? 13.374  -18.622 -9.125  1.00 36.92 ? 137 PHE E CD2   1 
ATOM   6671 C CE1   . PHE C 1 140 ? 11.796  -16.895 -10.600 1.00 37.94 ? 137 PHE E CE1   1 
ATOM   6672 C CE2   . PHE C 1 140 ? 13.955  -17.768 -10.055 1.00 37.66 ? 137 PHE E CE2   1 
ATOM   6673 C CZ    . PHE C 1 140 ? 13.165  -16.911 -10.800 1.00 37.56 ? 137 PHE E CZ    1 
ATOM   6674 N N     . ILE C 1 141 ? 11.798  -21.492 -10.588 1.00 37.39 ? 138 ILE E N     1 
ATOM   6675 C CA    . ILE C 1 141 ? 12.757  -22.236 -11.408 1.00 37.46 ? 138 ILE E CA    1 
ATOM   6676 C C     . ILE C 1 141 ? 13.727  -21.294 -12.124 1.00 37.22 ? 138 ILE E C     1 
ATOM   6677 O O     . ILE C 1 141 ? 13.326  -20.493 -12.969 1.00 37.35 ? 138 ILE E O     1 
ATOM   6678 C CB    . ILE C 1 141 ? 12.022  -23.119 -12.454 1.00 37.62 ? 138 ILE E CB    1 
ATOM   6679 C CG1   . ILE C 1 141 ? 11.184  -24.179 -11.735 1.00 37.89 ? 138 ILE E CG1   1 
ATOM   6680 C CG2   . ILE C 1 141 ? 13.022  -23.791 -13.406 1.00 37.49 ? 138 ILE E CG2   1 
ATOM   6681 C CD1   . ILE C 1 141 ? 10.240  -24.934 -12.644 1.00 38.04 ? 138 ILE E CD1   1 
ATOM   6682 N N     . ALA C 1 142 ? 15.006  -21.413 -11.790 1.00 37.40 ? 139 ALA E N     1 
ATOM   6683 C CA    . ALA C 1 142 ? 16.044  -20.562 -12.373 1.00 37.58 ? 139 ALA E CA    1 
ATOM   6684 C C     . ALA C 1 142 ? 16.644  -21.237 -13.598 1.00 37.77 ? 139 ALA E C     1 
ATOM   6685 O O     . ALA C 1 142 ? 17.142  -22.363 -13.514 1.00 38.53 ? 139 ALA E O     1 
ATOM   6686 C CB    . ALA C 1 142 ? 17.130  -20.261 -11.332 1.00 37.37 ? 139 ALA E CB    1 
ATOM   6687 N N     . VAL C 1 143 ? 16.545  -20.560 -14.740 1.00 38.04 ? 140 VAL E N     1 
ATOM   6688 C CA    . VAL C 1 143 ? 17.203  -20.959 -15.979 1.00 38.02 ? 140 VAL E CA    1 
ATOM   6689 C C     . VAL C 1 143 ? 18.324  -19.954 -16.248 1.00 38.37 ? 140 VAL E C     1 
ATOM   6690 O O     . VAL C 1 143 ? 18.074  -18.743 -16.334 1.00 38.75 ? 140 VAL E O     1 
ATOM   6691 C CB    . VAL C 1 143 ? 16.212  -20.926 -17.161 1.00 38.00 ? 140 VAL E CB    1 
ATOM   6692 C CG1   . VAL C 1 143 ? 16.919  -21.209 -18.479 1.00 38.47 ? 140 VAL E CG1   1 
ATOM   6693 C CG2   . VAL C 1 143 ? 15.083  -21.897 -16.938 1.00 38.08 ? 140 VAL E CG2   1 
ATOM   6694 N N     . SER C 1 144 ? 19.558  -20.442 -16.388 1.00 38.31 ? 141 SER E N     1 
ATOM   6695 C CA    . SER C 1 144 ? 20.705  -19.555 -16.559 1.00 38.13 ? 141 SER E CA    1 
ATOM   6696 C C     . SER C 1 144 ? 20.704  -18.875 -17.911 1.00 38.12 ? 141 SER E C     1 
ATOM   6697 O O     . SER C 1 144 ? 20.597  -19.526 -18.949 1.00 38.32 ? 141 SER E O     1 
ATOM   6698 C CB    . SER C 1 144 ? 22.022  -20.323 -16.411 1.00 38.48 ? 141 SER E CB    1 
ATOM   6699 O OG    . SER C 1 144 ? 22.055  -21.067 -15.205 1.00 39.01 ? 141 SER E OG    1 
ATOM   6700 N N     . ARG C 1 145 ? 20.839  -17.554 -17.891 1.00 38.01 ? 142 ARG E N     1 
ATOM   6701 C CA    . ARG C 1 145 ? 21.163  -16.798 -19.084 1.00 38.17 ? 142 ARG E CA    1 
ATOM   6702 C C     . ARG C 1 145 ? 22.565  -17.220 -19.576 1.00 38.46 ? 142 ARG E C     1 
ATOM   6703 O O     . ARG C 1 145 ? 23.283  -17.976 -18.903 1.00 38.67 ? 142 ARG E O     1 
ATOM   6704 C CB    . ARG C 1 145 ? 21.120  -15.292 -18.784 1.00 37.97 ? 142 ARG E CB    1 
ATOM   6705 C CG    . ARG C 1 145 ? 19.738  -14.771 -18.445 1.00 37.83 ? 142 ARG E CG    1 
ATOM   6706 C CD    . ARG C 1 145 ? 19.745  -13.325 -17.925 1.00 37.62 ? 142 ARG E CD    1 
ATOM   6707 N NE    . ARG C 1 145 ? 18.394  -12.763 -17.974 1.00 36.99 ? 142 ARG E NE    1 
ATOM   6708 C CZ    . ARG C 1 145 ? 17.948  -11.883 -18.869 1.00 36.27 ? 142 ARG E CZ    1 
ATOM   6709 N NH1   . ARG C 1 145 ? 18.740  -11.358 -19.792 1.00 37.35 ? 142 ARG E NH1   1 
ATOM   6710 N NH2   . ARG C 1 145 ? 16.682  -11.491 -18.811 1.00 36.43 ? 142 ARG E NH2   1 
ATOM   6711 N N     . GLY C 1 146 ? 22.952  -16.732 -20.744 1.00 38.80 ? 143 GLY E N     1 
ATOM   6712 C CA    . GLY C 1 146 ? 24.216  -17.142 -21.361 1.00 39.22 ? 143 GLY E CA    1 
ATOM   6713 C C     . GLY C 1 146 ? 25.411  -16.383 -20.833 1.00 39.64 ? 143 GLY E C     1 
ATOM   6714 O O     . GLY C 1 146 ? 25.287  -15.566 -19.913 1.00 39.85 ? 143 GLY E O     1 
ATOM   6715 N N     . ALA C 1 147 ? 26.574  -16.646 -21.433 1.00 40.22 ? 144 ALA E N     1 
ATOM   6716 C CA    . ALA C 1 147 ? 27.832  -16.036 -21.000 1.00 40.21 ? 144 ALA E CA    1 
ATOM   6717 C C     . ALA C 1 147 ? 27.862  -14.536 -21.305 1.00 40.40 ? 144 ALA E C     1 
ATOM   6718 O O     . ALA C 1 147 ? 28.595  -13.784 -20.661 1.00 40.85 ? 144 ALA E O     1 
ATOM   6719 C CB    . ALA C 1 147 ? 29.014  -16.746 -21.651 1.00 40.67 ? 144 ALA E CB    1 
ATOM   6720 N N     . ASP C 1 148 ? 27.074  -14.105 -22.287 1.00 40.35 ? 145 ASP E N     1 
ATOM   6721 C CA    . ASP C 1 148 ? 26.908  -12.682 -22.565 1.00 40.68 ? 145 ASP E CA    1 
ATOM   6722 C C     . ASP C 1 148 ? 25.798  -12.045 -21.693 1.00 40.76 ? 145 ASP E C     1 
ATOM   6723 O O     . ASP C 1 148 ? 25.461  -10.874 -21.884 1.00 40.71 ? 145 ASP E O     1 
ATOM   6724 C CB    . ASP C 1 148 ? 26.631  -12.450 -24.067 1.00 41.09 ? 145 ASP E CB    1 
ATOM   6725 C CG    . ASP C 1 148 ? 25.304  -13.073 -24.554 1.00 42.71 ? 145 ASP E CG    1 
ATOM   6726 O OD1   . ASP C 1 148 ? 24.731  -13.947 -23.860 1.00 44.14 ? 145 ASP E OD1   1 
ATOM   6727 O OD2   . ASP C 1 148 ? 24.837  -12.685 -25.658 1.00 44.97 ? 145 ASP E OD2   1 
ATOM   6728 N N     . PHE C 1 149 ? 25.235  -12.828 -20.764 1.00 40.83 ? 146 PHE E N     1 
ATOM   6729 C CA    . PHE C 1 149 ? 24.178  -12.387 -19.830 1.00 41.20 ? 146 PHE E CA    1 
ATOM   6730 C C     . PHE C 1 149 ? 22.799  -12.124 -20.458 1.00 41.34 ? 146 PHE E C     1 
ATOM   6731 O O     . PHE C 1 149 ? 21.876  -11.710 -19.751 1.00 41.11 ? 146 PHE E O     1 
ATOM   6732 C CB    . PHE C 1 149 ? 24.630  -11.171 -19.000 1.00 41.70 ? 146 PHE E CB    1 
ATOM   6733 C CG    . PHE C 1 149 ? 25.672  -11.496 -17.964 1.00 41.61 ? 146 PHE E CG    1 
ATOM   6734 C CD1   . PHE C 1 149 ? 25.299  -11.966 -16.713 1.00 42.18 ? 146 PHE E CD1   1 
ATOM   6735 C CD2   . PHE C 1 149 ? 27.019  -11.332 -18.240 1.00 42.46 ? 146 PHE E CD2   1 
ATOM   6736 C CE1   . PHE C 1 149 ? 26.250  -12.264 -15.747 1.00 42.12 ? 146 PHE E CE1   1 
ATOM   6737 C CE2   . PHE C 1 149 ? 27.977  -11.633 -17.286 1.00 42.33 ? 146 PHE E CE2   1 
ATOM   6738 C CZ    . PHE C 1 149 ? 27.589  -12.095 -16.033 1.00 42.68 ? 146 PHE E CZ    1 
ATOM   6739 N N     . ARG C 1 150 ? 22.658  -12.383 -21.763 1.00 41.55 ? 147 ARG E N     1 
ATOM   6740 C CA    . ARG C 1 150 ? 21.368  -12.337 -22.447 1.00 41.75 ? 147 ARG E CA    1 
ATOM   6741 C C     . ARG C 1 150 ? 20.698  -13.693 -22.311 1.00 41.64 ? 147 ARG E C     1 
ATOM   6742 O O     . ARG C 1 150 ? 21.366  -14.680 -22.007 1.00 41.50 ? 147 ARG E O     1 
ATOM   6743 C CB    . ARG C 1 150 ? 21.556  -11.982 -23.916 1.00 41.67 ? 147 ARG E CB    1 
ATOM   6744 C CG    . ARG C 1 150 ? 22.278  -10.662 -24.117 1.00 42.40 ? 147 ARG E CG    1 
ATOM   6745 C CD    . ARG C 1 150 ? 22.365  -10.263 -25.587 1.00 43.96 ? 147 ARG E CD    1 
ATOM   6746 N NE    . ARG C 1 150 ? 21.218  -9.451  -26.011 1.00 46.19 ? 147 ARG E NE    1 
ATOM   6747 C CZ    . ARG C 1 150 ? 21.197  -8.118  -26.086 1.00 47.42 ? 147 ARG E CZ    1 
ATOM   6748 N NH1   . ARG C 1 150 ? 22.273  -7.389  -25.776 1.00 48.03 ? 147 ARG E NH1   1 
ATOM   6749 N NH2   . ARG C 1 150 ? 20.086  -7.504  -26.489 1.00 47.50 ? 147 ARG E NH2   1 
ATOM   6750 N N     . ILE C 1 151 ? 19.378  -13.745 -22.500 1.00 41.83 ? 148 ILE E N     1 
ATOM   6751 C CA    . ILE C 1 151 ? 18.673  -15.033 -22.493 1.00 42.09 ? 148 ILE E CA    1 
ATOM   6752 C C     . ILE C 1 151 ? 19.180  -15.930 -23.636 1.00 42.23 ? 148 ILE E C     1 
ATOM   6753 O O     . ILE C 1 151 ? 19.221  -15.505 -24.796 1.00 42.13 ? 148 ILE E O     1 
ATOM   6754 C CB    . ILE C 1 151 ? 17.139  -14.881 -22.635 1.00 42.00 ? 148 ILE E CB    1 
ATOM   6755 C CG1   . ILE C 1 151 ? 16.551  -14.119 -21.450 1.00 42.03 ? 148 ILE E CG1   1 
ATOM   6756 C CG2   . ILE C 1 151 ? 16.469  -16.245 -22.728 1.00 41.64 ? 148 ILE E CG2   1 
ATOM   6757 C CD1   . ILE C 1 151 ? 15.086  -13.818 -21.600 1.00 41.86 ? 148 ILE E CD1   1 
ATOM   6758 N N     . ASP C 1 152 ? 19.564  -17.159 -23.291 1.00 43.06 ? 149 ASP E N     1 
ATOM   6759 C CA    . ASP C 1 152 ? 19.892  -18.190 -24.278 1.00 43.48 ? 149 ASP E CA    1 
ATOM   6760 C C     . ASP C 1 152 ? 18.588  -18.854 -24.720 1.00 43.65 ? 149 ASP E C     1 
ATOM   6761 O O     . ASP C 1 152 ? 18.055  -19.734 -24.035 1.00 43.31 ? 149 ASP E O     1 
ATOM   6762 C CB    . ASP C 1 152 ? 20.871  -19.225 -23.691 1.00 43.98 ? 149 ASP E CB    1 
ATOM   6763 C CG    . ASP C 1 152 ? 21.233  -20.346 -24.686 1.00 44.45 ? 149 ASP E CG    1 
ATOM   6764 O OD1   . ASP C 1 152 ? 20.315  -20.998 -25.247 1.00 46.44 ? 149 ASP E OD1   1 
ATOM   6765 O OD2   . ASP C 1 152 ? 22.449  -20.578 -24.895 1.00 46.68 ? 149 ASP E OD2   1 
ATOM   6766 N N     . MET C 1 153 ? 18.091  -18.418 -25.873 1.00 44.27 ? 150 MET E N     1 
ATOM   6767 C CA    . MET C 1 153 ? 16.796  -18.855 -26.384 1.00 45.00 ? 150 MET E CA    1 
ATOM   6768 C C     . MET C 1 153 ? 16.683  -20.367 -26.512 1.00 45.41 ? 150 MET E C     1 
ATOM   6769 O O     . MET C 1 153 ? 15.644  -20.944 -26.182 1.00 45.56 ? 150 MET E O     1 
ATOM   6770 C CB    . MET C 1 153 ? 16.512  -18.191 -27.731 1.00 45.40 ? 150 MET E CB    1 
ATOM   6771 C CG    . MET C 1 153 ? 16.221  -16.698 -27.615 1.00 46.73 ? 150 MET E CG    1 
ATOM   6772 S SD    . MET C 1 153 ? 14.803  -16.361 -26.535 1.00 49.46 ? 150 MET E SD    1 
ATOM   6773 C CE    . MET C 1 153 ? 13.454  -17.071 -27.484 1.00 48.21 ? 150 MET E CE    1 
ATOM   6774 N N     . ASP C 1 154 ? 17.758  -21.010 -26.963 1.00 46.06 ? 151 ASP E N     1 
ATOM   6775 C CA    . ASP C 1 154 ? 17.745  -22.456 -27.178 1.00 46.41 ? 151 ASP E CA    1 
ATOM   6776 C C     . ASP C 1 154 ? 17.452  -23.196 -25.865 1.00 46.39 ? 151 ASP E C     1 
ATOM   6777 O O     . ASP C 1 154 ? 16.557  -24.039 -25.812 1.00 46.91 ? 151 ASP E O     1 
ATOM   6778 C CB    . ASP C 1 154 ? 19.060  -22.936 -27.838 1.00 47.07 ? 151 ASP E CB    1 
ATOM   6779 C CG    . ASP C 1 154 ? 19.136  -22.614 -29.358 1.00 49.41 ? 151 ASP E CG    1 
ATOM   6780 O OD1   . ASP C 1 154 ? 18.401  -21.726 -29.865 1.00 51.46 ? 151 ASP E OD1   1 
ATOM   6781 O OD2   . ASP C 1 154 ? 19.960  -23.259 -30.059 1.00 53.80 ? 151 ASP E OD2   1 
ATOM   6782 N N     . VAL C 1 155 ? 18.168  -22.864 -24.796 1.00 46.42 ? 152 VAL E N     1 
ATOM   6783 C CA    . VAL C 1 155 ? 17.890  -23.484 -23.491 1.00 46.45 ? 152 VAL E CA    1 
ATOM   6784 C C     . VAL C 1 155 ? 16.602  -22.936 -22.850 1.00 46.39 ? 152 VAL E C     1 
ATOM   6785 O O     . VAL C 1 155 ? 15.900  -23.655 -22.121 1.00 46.08 ? 152 VAL E O     1 
ATOM   6786 C CB    . VAL C 1 155 ? 19.074  -23.324 -22.499 1.00 46.85 ? 152 VAL E CB    1 
ATOM   6787 C CG1   . VAL C 1 155 ? 19.347  -21.850 -22.200 1.00 47.12 ? 152 VAL E CG1   1 
ATOM   6788 C CG2   . VAL C 1 155 ? 18.797  -24.103 -21.202 1.00 46.76 ? 152 VAL E CG2   1 
ATOM   6789 N N     . ALA C 1 156 ? 16.294  -21.667 -23.120 1.00 46.30 ? 153 ALA E N     1 
ATOM   6790 C CA    . ALA C 1 156 ? 15.072  -21.063 -22.585 1.00 46.50 ? 153 ALA E CA    1 
ATOM   6791 C C     . ALA C 1 156 ? 13.850  -21.873 -23.022 1.00 46.53 ? 153 ALA E C     1 
ATOM   6792 O O     . ALA C 1 156 ? 13.112  -22.391 -22.175 1.00 46.60 ? 153 ALA E O     1 
ATOM   6793 C CB    . ALA C 1 156 ? 14.946  -19.609 -23.033 1.00 46.44 ? 153 ALA E CB    1 
ATOM   6794 N N     . LEU C 1 157 ? 13.668  -22.002 -24.339 1.00 46.72 ? 154 LEU E N     1 
ATOM   6795 C CA    . LEU C 1 157 ? 12.505  -22.704 -24.916 1.00 46.84 ? 154 LEU E CA    1 
ATOM   6796 C C     . LEU C 1 157 ? 12.458  -24.163 -24.494 1.00 46.93 ? 154 LEU E C     1 
ATOM   6797 O O     . LEU C 1 157 ? 11.388  -24.711 -24.206 1.00 46.76 ? 154 LEU E O     1 
ATOM   6798 C CB    . LEU C 1 157 ? 12.523  -22.620 -26.444 1.00 46.85 ? 154 LEU E CB    1 
ATOM   6799 C CG    . LEU C 1 157 ? 12.348  -21.223 -27.053 1.00 47.16 ? 154 LEU E CG    1 
ATOM   6800 C CD1   . LEU C 1 157 ? 12.639  -21.235 -28.549 1.00 47.09 ? 154 LEU E CD1   1 
ATOM   6801 C CD2   . LEU C 1 157 ? 10.951  -20.666 -26.791 1.00 47.69 ? 154 LEU E CD2   1 
ATOM   6802 N N     . GLU C 1 158 ? 13.631  -24.779 -24.466 1.00 47.28 ? 155 GLU E N     1 
ATOM   6803 C CA    . GLU C 1 158 ? 13.796  -26.164 -24.039 1.00 47.45 ? 155 GLU E CA    1 
ATOM   6804 C C     . GLU C 1 158 ? 13.295  -26.366 -22.614 1.00 47.26 ? 155 GLU E C     1 
ATOM   6805 O O     . GLU C 1 158 ? 12.583  -27.339 -22.312 1.00 46.95 ? 155 GLU E O     1 
ATOM   6806 C CB    . GLU C 1 158 ? 15.284  -26.521 -24.132 1.00 47.64 ? 155 GLU E CB    1 
ATOM   6807 C CG    . GLU C 1 158 ? 15.679  -27.934 -23.713 1.00 48.13 ? 155 GLU E CG    1 
ATOM   6808 C CD    . GLU C 1 158 ? 17.196  -28.156 -23.787 1.00 49.35 ? 155 GLU E CD    1 
ATOM   6809 O OE1   . GLU C 1 158 ? 17.934  -27.232 -24.236 1.00 51.70 ? 155 GLU E OE1   1 
ATOM   6810 O OE2   . GLU C 1 158 ? 17.653  -29.259 -23.394 1.00 52.32 ? 155 GLU E OE2   1 
ATOM   6811 N N     . GLU C 1 159 ? 13.670  -25.444 -21.734 1.00 47.27 ? 156 GLU E N     1 
ATOM   6812 C CA    . GLU C 1 159 ? 13.338  -25.588 -20.325 1.00 47.35 ? 156 GLU E CA    1 
ATOM   6813 C C     . GLU C 1 159 ? 11.866  -25.294 -20.073 1.00 46.76 ? 156 GLU E C     1 
ATOM   6814 O O     . GLU C 1 159 ? 11.256  -25.915 -19.200 1.00 47.00 ? 156 GLU E O     1 
ATOM   6815 C CB    . GLU C 1 159 ? 14.239  -24.712 -19.447 1.00 48.03 ? 156 GLU E CB    1 
ATOM   6816 C CG    . GLU C 1 159 ? 14.597  -25.355 -18.103 1.00 50.22 ? 156 GLU E CG    1 
ATOM   6817 C CD    . GLU C 1 159 ? 15.536  -26.556 -18.240 1.00 53.36 ? 156 GLU E CD    1 
ATOM   6818 O OE1   . GLU C 1 159 ? 16.034  -26.815 -19.363 1.00 55.92 ? 156 GLU E OE1   1 
ATOM   6819 O OE2   . GLU C 1 159 ? 15.778  -27.242 -17.218 1.00 55.43 ? 156 GLU E OE2   1 
ATOM   6820 N N     . ILE C 1 160 ? 11.287  -24.378 -20.843 1.00 46.26 ? 157 ILE E N     1 
ATOM   6821 C CA    . ILE C 1 160 ? 9.853   -24.098 -20.726 1.00 46.25 ? 157 ILE E CA    1 
ATOM   6822 C C     . ILE C 1 160 ? 9.044   -25.339 -21.141 1.00 46.25 ? 157 ILE E C     1 
ATOM   6823 O O     . ILE C 1 160 ? 8.158   -25.798 -20.403 1.00 45.92 ? 157 ILE E O     1 
ATOM   6824 C CB    . ILE C 1 160 ? 9.423   -22.893 -21.591 1.00 46.24 ? 157 ILE E CB    1 
ATOM   6825 C CG1   . ILE C 1 160 ? 10.114  -21.602 -21.131 1.00 45.97 ? 157 ILE E CG1   1 
ATOM   6826 C CG2   . ILE C 1 160 ? 7.928   -22.700 -21.511 1.00 46.22 ? 157 ILE E CG2   1 
ATOM   6827 C CD1   . ILE C 1 160 ? 10.037  -20.490 -22.143 1.00 46.10 ? 157 ILE E CD1   1 
ATOM   6828 N N     . ARG C 1 161 ? 9.366   -25.871 -22.325 1.00 46.35 ? 158 ARG E N     1 
ATOM   6829 C CA    . ARG C 1 161 ? 8.783   -27.130 -22.821 1.00 46.36 ? 158 ARG E CA    1 
ATOM   6830 C C     . ARG C 1 161 ? 8.878   -28.252 -21.803 1.00 45.84 ? 158 ARG E C     1 
ATOM   6831 O O     . ARG C 1 161 ? 7.924   -29.000 -21.600 1.00 46.14 ? 158 ARG E O     1 
ATOM   6832 C CB    . ARG C 1 161 ? 9.482   -27.584 -24.110 1.00 46.78 ? 158 ARG E CB    1 
ATOM   6833 C CG    . ARG C 1 161 ? 8.833   -27.096 -25.398 1.00 47.41 ? 158 ARG E CG    1 
ATOM   6834 C CD    . ARG C 1 161 ? 9.813   -27.133 -26.574 1.00 48.21 ? 158 ARG E CD    1 
ATOM   6835 N NE    . ARG C 1 161 ? 9.193   -26.627 -27.807 1.00 50.01 ? 158 ARG E NE    1 
ATOM   6836 C CZ    . ARG C 1 161 ? 9.822   -25.933 -28.763 1.00 51.80 ? 158 ARG E CZ    1 
ATOM   6837 N NH1   . ARG C 1 161 ? 11.121  -25.633 -28.665 1.00 52.22 ? 158 ARG E NH1   1 
ATOM   6838 N NH2   . ARG C 1 161 ? 9.141   -25.524 -29.834 1.00 51.73 ? 158 ARG E NH2   1 
ATOM   6839 N N     . ALA C 1 162 ? 10.034  -28.369 -21.167 1.00 45.31 ? 159 ALA E N     1 
ATOM   6840 C CA    . ALA C 1 162 ? 10.285  -29.471 -20.247 1.00 45.17 ? 159 ALA E CA    1 
ATOM   6841 C C     . ALA C 1 162 ? 9.454   -29.371 -18.974 1.00 44.92 ? 159 ALA E C     1 
ATOM   6842 O O     . ALA C 1 162 ? 8.824   -30.349 -18.559 1.00 44.80 ? 159 ALA E O     1 
ATOM   6843 C CB    . ALA C 1 162 ? 11.771  -29.536 -19.896 1.00 45.37 ? 159 ALA E CB    1 
ATOM   6844 N N     . LYS C 1 163 ? 9.459   -28.187 -18.357 1.00 44.53 ? 160 LYS E N     1 
ATOM   6845 C CA    . LYS C 1 163 ? 8.913   -28.013 -17.008 1.00 44.00 ? 160 LYS E CA    1 
ATOM   6846 C C     . LYS C 1 163 ? 7.433   -27.626 -16.988 1.00 43.32 ? 160 LYS E C     1 
ATOM   6847 O O     . LYS C 1 163 ? 6.751   -27.849 -15.981 1.00 43.54 ? 160 LYS E O     1 
ATOM   6848 C CB    . LYS C 1 163 ? 9.737   -26.974 -16.233 1.00 44.62 ? 160 LYS E CB    1 
ATOM   6849 C CG    . LYS C 1 163 ? 11.185  -27.391 -15.969 1.00 45.52 ? 160 LYS E CG    1 
ATOM   6850 C CD    . LYS C 1 163 ? 11.264  -28.565 -14.983 1.00 47.41 ? 160 LYS E CD    1 
ATOM   6851 C CE    . LYS C 1 163 ? 12.699  -28.856 -14.525 1.00 47.58 ? 160 LYS E CE    1 
ATOM   6852 N NZ    . LYS C 1 163 ? 13.323  -27.694 -13.802 1.00 48.59 ? 160 LYS E NZ    1 
ATOM   6853 N N     . GLN C 1 164 ? 6.940   -27.055 -18.085 1.00 42.45 ? 161 GLN E N     1 
ATOM   6854 C CA    . GLN C 1 164 ? 5.561   -26.570 -18.145 1.00 41.87 ? 161 GLN E CA    1 
ATOM   6855 C C     . GLN C 1 164 ? 5.287   -25.637 -16.953 1.00 41.20 ? 161 GLN E C     1 
ATOM   6856 O O     . GLN C 1 164 ? 4.480   -25.971 -16.059 1.00 40.93 ? 161 GLN E O     1 
ATOM   6857 C CB    . GLN C 1 164 ? 4.563   -27.745 -18.173 1.00 42.39 ? 161 GLN E CB    1 
ATOM   6858 C CG    . GLN C 1 164 ? 4.628   -28.601 -19.442 1.00 43.28 ? 161 GLN E CG    1 
ATOM   6859 C CD    . GLN C 1 164 ? 4.327   -27.806 -20.703 1.00 44.68 ? 161 GLN E CD    1 
ATOM   6860 O OE1   . GLN C 1 164 ? 3.190   -27.375 -20.926 1.00 45.95 ? 161 GLN E OE1   1 
ATOM   6861 N NE2   . GLN C 1 164 ? 5.347   -27.611 -21.541 1.00 45.59 ? 161 GLN E NE2   1 
ATOM   6862 N N     . PRO C 1 165 ? 5.987   -24.480 -16.922 1.00 39.99 ? 162 PRO E N     1 
ATOM   6863 C CA    . PRO C 1 165 ? 5.847   -23.516 -15.835 1.00 39.13 ? 162 PRO E CA    1 
ATOM   6864 C C     . PRO C 1 165 ? 4.553   -22.722 -15.941 1.00 38.22 ? 162 PRO E C     1 
ATOM   6865 O O     . PRO C 1 165 ? 4.203   -22.233 -17.023 1.00 38.39 ? 162 PRO E O     1 
ATOM   6866 C CB    . PRO C 1 165 ? 7.043   -22.589 -16.046 1.00 39.37 ? 162 PRO E CB    1 
ATOM   6867 C CG    . PRO C 1 165 ? 7.246   -22.603 -17.521 1.00 39.73 ? 162 PRO E CG    1 
ATOM   6868 C CD    . PRO C 1 165 ? 6.959   -24.013 -17.933 1.00 39.89 ? 162 PRO E CD    1 
ATOM   6869 N N     . ASP C 1 166 ? 3.867   -22.582 -14.810 1.00 37.36 ? 163 ASP E N     1 
ATOM   6870 C CA    . ASP C 1 166 ? 2.613   -21.836 -14.734 1.00 36.51 ? 163 ASP E CA    1 
ATOM   6871 C C     . ASP C 1 166 ? 2.801   -20.355 -15.055 1.00 35.51 ? 163 ASP E C     1 
ATOM   6872 O O     . ASP C 1 166 ? 1.968   -19.752 -15.743 1.00 35.53 ? 163 ASP E O     1 
ATOM   6873 C CB    . ASP C 1 166 ? 2.007   -22.021 -13.354 1.00 36.95 ? 163 ASP E CB    1 
ATOM   6874 C CG    . ASP C 1 166 ? 1.547   -23.438 -13.129 1.00 39.15 ? 163 ASP E CG    1 
ATOM   6875 O OD1   . ASP C 1 166 ? 0.420   -23.756 -13.582 1.00 42.07 ? 163 ASP E OD1   1 
ATOM   6876 O OD2   . ASP C 1 166 ? 2.306   -24.229 -12.509 1.00 41.77 ? 163 ASP E OD2   1 
ATOM   6877 N N     . ILE C 1 167 ? 3.910   -19.780 -14.576 1.00 34.15 ? 164 ILE E N     1 
ATOM   6878 C CA    . ILE C 1 167 ? 4.264   -18.395 -14.899 1.00 33.16 ? 164 ILE E CA    1 
ATOM   6879 C C     . ILE C 1 167 ? 5.661   -18.360 -15.460 1.00 32.23 ? 164 ILE E C     1 
ATOM   6880 O O     . ILE C 1 167 ? 6.525   -19.066 -14.967 1.00 32.39 ? 164 ILE E O     1 
ATOM   6881 C CB    . ILE C 1 167 ? 4.234   -17.488 -13.640 1.00 33.06 ? 164 ILE E CB    1 
ATOM   6882 C CG1   . ILE C 1 167 ? 2.862   -17.550 -12.968 1.00 32.52 ? 164 ILE E CG1   1 
ATOM   6883 C CG2   . ILE C 1 167 ? 4.579   -16.043 -14.007 1.00 33.35 ? 164 ILE E CG2   1 
ATOM   6884 C CD1   . ILE C 1 167 ? 2.840   -16.906 -11.618 1.00 33.02 ? 164 ILE E CD1   1 
ATOM   6885 N N     . VAL C 1 168 ? 5.886   -17.530 -16.472 1.00 31.56 ? 165 VAL E N     1 
ATOM   6886 C CA    . VAL C 1 168 ? 7.237   -17.241 -16.932 1.00 31.00 ? 165 VAL E CA    1 
ATOM   6887 C C     . VAL C 1 168 ? 7.541   -15.741 -16.808 1.00 30.62 ? 165 VAL E C     1 
ATOM   6888 O O     . VAL C 1 168 ? 6.764   -14.898 -17.261 1.00 30.23 ? 165 VAL E O     1 
ATOM   6889 C CB    . VAL C 1 168 ? 7.456   -17.697 -18.399 1.00 31.28 ? 165 VAL E CB    1 
ATOM   6890 C CG1   . VAL C 1 168 ? 8.794   -17.165 -18.947 1.00 31.26 ? 165 VAL E CG1   1 
ATOM   6891 C CG2   . VAL C 1 168 ? 7.378   -19.222 -18.506 1.00 30.62 ? 165 VAL E CG2   1 
ATOM   6892 N N     . PHE C 1 169 ? 8.691   -15.425 -16.207 1.00 29.85 ? 166 PHE E N     1 
ATOM   6893 C CA    . PHE C 1 169 ? 9.136   -14.049 -16.037 1.00 29.50 ? 166 PHE E CA    1 
ATOM   6894 C C     . PHE C 1 169 ? 10.144  -13.693 -17.106 1.00 29.00 ? 166 PHE E C     1 
ATOM   6895 O O     . PHE C 1 169 ? 11.150  -14.375 -17.252 1.00 28.80 ? 166 PHE E O     1 
ATOM   6896 C CB    . PHE C 1 169 ? 9.804   -13.862 -14.670 1.00 29.75 ? 166 PHE E CB    1 
ATOM   6897 C CG    . PHE C 1 169 ? 8.840   -13.791 -13.523 1.00 30.12 ? 166 PHE E CG    1 
ATOM   6898 C CD1   . PHE C 1 169 ? 8.722   -14.843 -12.625 1.00 30.79 ? 166 PHE E CD1   1 
ATOM   6899 C CD2   . PHE C 1 169 ? 8.043   -12.666 -13.339 1.00 31.14 ? 166 PHE E CD2   1 
ATOM   6900 C CE1   . PHE C 1 169 ? 7.825   -14.774 -11.562 1.00 30.26 ? 166 PHE E CE1   1 
ATOM   6901 C CE2   . PHE C 1 169 ? 7.142   -12.598 -12.276 1.00 30.70 ? 166 PHE E CE2   1 
ATOM   6902 C CZ    . PHE C 1 169 ? 7.042   -13.651 -11.387 1.00 30.46 ? 166 PHE E CZ    1 
ATOM   6903 N N     . VAL C 1 170 ? 9.864   -12.619 -17.837 1.00 28.52 ? 167 VAL E N     1 
ATOM   6904 C CA    . VAL C 1 170 ? 10.815  -12.020 -18.759 1.00 28.22 ? 167 VAL E CA    1 
ATOM   6905 C C     . VAL C 1 170 ? 10.964  -10.537 -18.380 1.00 28.05 ? 167 VAL E C     1 
ATOM   6906 O O     . VAL C 1 170 ? 10.026  -9.761  -18.511 1.00 28.23 ? 167 VAL E O     1 
ATOM   6907 C CB    . VAL C 1 170 ? 10.338  -12.126 -20.246 1.00 28.32 ? 167 VAL E CB    1 
ATOM   6908 C CG1   . VAL C 1 170 ? 11.401  -11.615 -21.189 1.00 28.64 ? 167 VAL E CG1   1 
ATOM   6909 C CG2   . VAL C 1 170 ? 9.971   -13.547 -20.605 1.00 27.41 ? 167 VAL E CG2   1 
ATOM   6910 N N     . THR C 1 171 ? 12.141  -10.152 -17.905 1.00 27.30 ? 168 THR E N     1 
ATOM   6911 C CA    . THR C 1 171 ? 12.420  -8.770  -17.554 1.00 27.16 ? 168 THR E CA    1 
ATOM   6912 C C     . THR C 1 171 ? 13.183  -8.143  -18.706 1.00 27.05 ? 168 THR E C     1 
ATOM   6913 O O     . THR C 1 171 ? 14.245  -8.640  -19.086 1.00 27.04 ? 168 THR E O     1 
ATOM   6914 C CB    . THR C 1 171 ? 13.287  -8.708  -16.281 1.00 27.24 ? 168 THR E CB    1 
ATOM   6915 O OG1   . THR C 1 171 ? 12.830  -9.693  -15.349 1.00 27.51 ? 168 THR E OG1   1 
ATOM   6916 C CG2   . THR C 1 171 ? 13.264  -7.328  -15.649 1.00 26.88 ? 168 THR E CG2   1 
ATOM   6917 N N     . THR C 1 172 ? 12.655  -7.058  -19.266 1.00 26.70 ? 169 THR E N     1 
ATOM   6918 C CA    . THR C 1 172 ? 13.280  -6.434  -20.422 1.00 26.49 ? 169 THR E CA    1 
ATOM   6919 C C     . THR C 1 172 ? 12.953  -4.937  -20.517 1.00 26.08 ? 169 THR E C     1 
ATOM   6920 O O     . THR C 1 172 ? 11.772  -4.570  -20.597 1.00 26.10 ? 169 THR E O     1 
ATOM   6921 C CB    . THR C 1 172 ? 12.889  -7.180  -21.733 1.00 26.35 ? 169 THR E CB    1 
ATOM   6922 O OG1   . THR C 1 172 ? 13.415  -6.488  -22.872 1.00 25.19 ? 169 THR E OG1   1 
ATOM   6923 C CG2   . THR C 1 172 ? 11.384  -7.307  -21.855 1.00 27.75 ? 169 THR E CG2   1 
ATOM   6924 N N     . PRO C 1 173 ? 13.991  -4.067  -20.473 1.00 25.64 ? 170 PRO E N     1 
ATOM   6925 C CA    . PRO C 1 173 ? 15.403  -4.373  -20.206 1.00 25.81 ? 170 PRO E CA    1 
ATOM   6926 C C     . PRO C 1 173 ? 15.618  -5.093  -18.877 1.00 25.72 ? 170 PRO E C     1 
ATOM   6927 O O     . PRO C 1 173 ? 14.846  -4.887  -17.931 1.00 25.71 ? 170 PRO E O     1 
ATOM   6928 C CB    . PRO C 1 173 ? 16.075  -2.997  -20.176 1.00 25.87 ? 170 PRO E CB    1 
ATOM   6929 C CG    . PRO C 1 173 ? 15.134  -2.074  -20.853 1.00 25.72 ? 170 PRO E CG    1 
ATOM   6930 C CD    . PRO C 1 173 ? 13.774  -2.632  -20.713 1.00 25.75 ? 170 PRO E CD    1 
ATOM   6931 N N     . ASN C 1 174 ? 16.654  -5.933  -18.820 1.00 25.70 ? 171 ASN E N     1 
ATOM   6932 C CA    . ASN C 1 174 ? 16.905  -6.758  -17.658 1.00 25.93 ? 171 ASN E CA    1 
ATOM   6933 C C     . ASN C 1 174 ? 17.583  -5.973  -16.569 1.00 26.09 ? 171 ASN E C     1 
ATOM   6934 O O     . ASN C 1 174 ? 18.424  -5.100  -16.834 1.00 26.28 ? 171 ASN E O     1 
ATOM   6935 C CB    . ASN C 1 174 ? 17.765  -7.996  -17.975 1.00 26.16 ? 171 ASN E CB    1 
ATOM   6936 C CG    . ASN C 1 174 ? 17.773  -9.018  -16.824 1.00 25.51 ? 171 ASN E CG    1 
ATOM   6937 O OD1   . ASN C 1 174 ? 16.794  -9.146  -16.098 1.00 27.54 ? 171 ASN E OD1   1 
ATOM   6938 N ND2   . ASN C 1 174 ? 18.869  -9.745  -16.669 1.00 25.39 ? 171 ASN E ND2   1 
ATOM   6939 N N     . ASN C 1 175 ? 17.185  -6.297  -15.342 1.00 26.08 ? 172 ASN E N     1 
ATOM   6940 C CA    . ASN C 1 175 ? 17.867  -5.862  -14.150 1.00 26.20 ? 172 ASN E CA    1 
ATOM   6941 C C     . ASN C 1 175 ? 18.480  -7.142  -13.627 1.00 26.74 ? 172 ASN E C     1 
ATOM   6942 O O     . ASN C 1 175 ? 17.747  -8.092  -13.347 1.00 26.70 ? 172 ASN E O     1 
ATOM   6943 C CB    . ASN C 1 175 ? 16.853  -5.239  -13.174 1.00 26.11 ? 172 ASN E CB    1 
ATOM   6944 C CG    . ASN C 1 175 ? 17.421  -4.998  -11.786 1.00 26.44 ? 172 ASN E CG    1 
ATOM   6945 O OD1   . ASN C 1 175 ? 18.597  -5.216  -11.543 1.00 26.08 ? 172 ASN E OD1   1 
ATOM   6946 N ND2   . ASN C 1 175 ? 16.569  -4.536  -10.863 1.00 25.95 ? 172 ASN E ND2   1 
ATOM   6947 N N     . PRO C 1 176 ? 19.812  -7.170  -13.433 1.00 27.36 ? 173 PRO E N     1 
ATOM   6948 C CA    . PRO C 1 176 ? 20.797  -6.082  -13.396 1.00 27.90 ? 173 PRO E CA    1 
ATOM   6949 C C     . PRO C 1 176 ? 21.660  -5.887  -14.630 1.00 28.17 ? 173 PRO E C     1 
ATOM   6950 O O     . PRO C 1 176 ? 22.549  -5.030  -14.610 1.00 28.50 ? 173 PRO E O     1 
ATOM   6951 C CB    . PRO C 1 176 ? 21.704  -6.521  -12.245 1.00 27.71 ? 173 PRO E CB    1 
ATOM   6952 C CG    . PRO C 1 176 ? 21.597  -8.052  -12.236 1.00 27.71 ? 173 PRO E CG    1 
ATOM   6953 C CD    . PRO C 1 176 ? 20.457  -8.453  -13.116 1.00 27.54 ? 173 PRO E CD    1 
ATOM   6954 N N     . THR C 1 177 ? 21.394  -6.642  -15.690 1.00 28.87 ? 174 THR E N     1 
ATOM   6955 C CA    . THR C 1 177 ? 22.336  -6.773  -16.805 1.00 29.24 ? 174 THR E CA    1 
ATOM   6956 C C     . THR C 1 177 ? 22.155  -5.694  -17.856 1.00 29.65 ? 174 THR E C     1 
ATOM   6957 O O     . THR C 1 177 ? 23.140  -5.255  -18.463 1.00 29.75 ? 174 THR E O     1 
ATOM   6958 C CB    . THR C 1 177 ? 22.280  -8.187  -17.437 1.00 29.40 ? 174 THR E CB    1 
ATOM   6959 O OG1   . THR C 1 177 ? 20.992  -8.435  -18.006 1.00 29.07 ? 174 THR E OG1   1 
ATOM   6960 C CG2   . THR C 1 177 ? 22.548  -9.236  -16.384 1.00 29.65 ? 174 THR E CG2   1 
ATOM   6961 N N     . GLY C 1 178 ? 20.911  -5.258  -18.063 1.00 30.11 ? 175 GLY E N     1 
ATOM   6962 C CA    . GLY C 1 178 ? 20.625  -4.055  -18.859 1.00 30.14 ? 175 GLY E CA    1 
ATOM   6963 C C     . GLY C 1 178 ? 20.126  -4.308  -20.271 1.00 30.34 ? 175 GLY E C     1 
ATOM   6964 O O     . GLY C 1 178 ? 19.769  -3.369  -20.986 1.00 29.44 ? 175 GLY E O     1 
ATOM   6965 N N     . ASP C 1 179 ? 20.076  -5.581  -20.666 1.00 31.40 ? 176 ASP E N     1 
ATOM   6966 C CA    . ASP C 1 179 ? 19.727  -5.957  -22.044 1.00 31.81 ? 176 ASP E CA    1 
ATOM   6967 C C     . ASP C 1 179 ? 18.227  -6.102  -22.341 1.00 32.02 ? 176 ASP E C     1 
ATOM   6968 O O     . ASP C 1 179 ? 17.460  -6.688  -21.560 1.00 32.26 ? 176 ASP E O     1 
ATOM   6969 C CB    . ASP C 1 179 ? 20.418  -7.265  -22.439 1.00 32.85 ? 176 ASP E CB    1 
ATOM   6970 C CG    . ASP C 1 179 ? 20.127  -8.395  -21.477 1.00 34.44 ? 176 ASP E CG    1 
ATOM   6971 O OD1   . ASP C 1 179 ? 20.789  -8.457  -20.417 1.00 37.46 ? 176 ASP E OD1   1 
ATOM   6972 O OD2   . ASP C 1 179 ? 19.245  -9.219  -21.785 1.00 38.96 ? 176 ASP E OD2   1 
ATOM   6973 N N     . VAL C 1 180 ? 17.855  -5.607  -23.522 1.00 32.02 ? 177 VAL E N     1 
ATOM   6974 C CA    . VAL C 1 180 ? 16.528  -5.767  -24.095 1.00 32.19 ? 177 VAL E CA    1 
ATOM   6975 C C     . VAL C 1 180 ? 16.405  -7.140  -24.774 1.00 32.32 ? 177 VAL E C     1 
ATOM   6976 O O     . VAL C 1 180 ? 17.206  -7.480  -25.657 1.00 32.08 ? 177 VAL E O     1 
ATOM   6977 C CB    . VAL C 1 180 ? 16.263  -4.653  -25.136 1.00 32.10 ? 177 VAL E CB    1 
ATOM   6978 C CG1   . VAL C 1 180 ? 14.986  -4.933  -25.929 1.00 33.20 ? 177 VAL E CG1   1 
ATOM   6979 C CG2   . VAL C 1 180 ? 16.200  -3.276  -24.450 1.00 32.49 ? 177 VAL E CG2   1 
ATOM   6980 N N     . THR C 1 181 ? 15.424  -7.936  -24.343 1.00 32.62 ? 178 THR E N     1 
ATOM   6981 C CA    . THR C 1 181 ? 15.062  -9.168  -25.042 1.00 32.75 ? 178 THR E CA    1 
ATOM   6982 C C     . THR C 1 181 ? 14.093  -8.784  -26.156 1.00 33.23 ? 178 THR E C     1 
ATOM   6983 O O     . THR C 1 181 ? 13.068  -8.146  -25.885 1.00 33.53 ? 178 THR E O     1 
ATOM   6984 C CB    . THR C 1 181 ? 14.400  -10.181 -24.103 1.00 33.05 ? 178 THR E CB    1 
ATOM   6985 O OG1   . THR C 1 181 ? 15.374  -10.689 -23.179 1.00 32.19 ? 178 THR E OG1   1 
ATOM   6986 C CG2   . THR C 1 181 ? 13.784  -11.340 -24.887 1.00 32.99 ? 178 THR E CG2   1 
ATOM   6987 N N     . SER C 1 182 ? 14.413  -9.156  -27.406 1.00 33.69 ? 179 SER E N     1 
ATOM   6988 C CA    . SER C 1 182 ? 13.619  -8.721  -28.577 1.00 34.04 ? 179 SER E CA    1 
ATOM   6989 C C     . SER C 1 182 ? 12.184  -9.229  -28.516 1.00 33.70 ? 179 SER E C     1 
ATOM   6990 O O     . SER C 1 182 ? 11.924  -10.313 -27.989 1.00 33.23 ? 179 SER E O     1 
ATOM   6991 C CB    . SER C 1 182 ? 14.264  -9.178  -29.898 1.00 33.99 ? 179 SER E CB    1 
ATOM   6992 O OG    . SER C 1 182 ? 14.108  -10.581 -30.099 1.00 36.16 ? 179 SER E OG    1 
ATOM   6993 N N     . LEU C 1 183 ? 11.256  -8.452  -29.069 1.00 34.54 ? 180 LEU E N     1 
ATOM   6994 C CA    . LEU C 1 183 ? 9.844   -8.866  -29.075 1.00 35.49 ? 180 LEU E CA    1 
ATOM   6995 C C     . LEU C 1 183 ? 9.625   -10.192 -29.823 1.00 36.12 ? 180 LEU E C     1 
ATOM   6996 O O     . LEU C 1 183 ? 8.732   -10.968 -29.458 1.00 36.03 ? 180 LEU E O     1 
ATOM   6997 C CB    . LEU C 1 183 ? 8.927   -7.760  -29.605 1.00 35.73 ? 180 LEU E CB    1 
ATOM   6998 C CG    . LEU C 1 183 ? 8.724   -6.528  -28.695 1.00 36.28 ? 180 LEU E CG    1 
ATOM   6999 C CD1   . LEU C 1 183 ? 7.642   -5.607  -29.277 1.00 36.40 ? 180 LEU E CD1   1 
ATOM   7000 C CD2   . LEU C 1 183 ? 8.376   -6.915  -27.246 1.00 35.41 ? 180 LEU E CD2   1 
ATOM   7001 N N     . ASP C 1 184 ? 10.472  -10.471 -30.824 1.00 36.85 ? 181 ASP E N     1 
ATOM   7002 C CA    . ASP C 1 184 ? 10.446  -11.760 -31.522 1.00 37.26 ? 181 ASP E CA    1 
ATOM   7003 C C     . ASP C 1 184 ? 10.784  -12.920 -30.583 1.00 37.45 ? 181 ASP E C     1 
ATOM   7004 O O     . ASP C 1 184 ? 10.156  -13.986 -30.619 1.00 37.56 ? 181 ASP E O     1 
ATOM   7005 C CB    . ASP C 1 184 ? 11.414  -11.747 -32.715 1.00 38.13 ? 181 ASP E CB    1 
ATOM   7006 C CG    . ASP C 1 184 ? 10.969  -10.803 -33.849 1.00 40.38 ? 181 ASP E CG    1 
ATOM   7007 O OD1   . ASP C 1 184 ? 9.838   -10.263 -33.802 1.00 42.28 ? 181 ASP E OD1   1 
ATOM   7008 O OD2   . ASP C 1 184 ? 11.767  -10.602 -34.805 1.00 44.08 ? 181 ASP E OD2   1 
ATOM   7009 N N     . ASP C 1 185 ? 11.776  -12.710 -29.727 1.00 37.83 ? 182 ASP E N     1 
ATOM   7010 C CA    . ASP C 1 185 ? 12.185  -13.739 -28.771 1.00 37.72 ? 182 ASP E CA    1 
ATOM   7011 C C     . ASP C 1 185 ? 11.167  -13.848 -27.636 1.00 37.52 ? 182 ASP E C     1 
ATOM   7012 O O     . ASP C 1 185 ? 10.980  -14.920 -27.047 1.00 36.86 ? 182 ASP E O     1 
ATOM   7013 C CB    . ASP C 1 185 ? 13.577  -13.428 -28.238 1.00 38.32 ? 182 ASP E CB    1 
ATOM   7014 C CG    . ASP C 1 185 ? 14.663  -13.647 -29.286 1.00 40.59 ? 182 ASP E CG    1 
ATOM   7015 O OD1   . ASP C 1 185 ? 14.633  -14.717 -29.935 1.00 42.76 ? 182 ASP E OD1   1 
ATOM   7016 O OD2   . ASP C 1 185 ? 15.541  -12.759 -29.465 1.00 42.88 ? 182 ASP E OD2   1 
ATOM   7017 N N     . VAL C 1 186 ? 10.506  -12.732 -27.343 1.00 37.36 ? 183 VAL E N     1 
ATOM   7018 C CA    . VAL C 1 186 ? 9.420   -12.727 -26.374 1.00 37.51 ? 183 VAL E CA    1 
ATOM   7019 C C     . VAL C 1 186 ? 8.301   -13.612 -26.924 1.00 37.68 ? 183 VAL E C     1 
ATOM   7020 O O     . VAL C 1 186 ? 7.866   -14.547 -26.251 1.00 37.97 ? 183 VAL E O     1 
ATOM   7021 C CB    . VAL C 1 186 ? 8.941   -11.278 -26.069 1.00 37.53 ? 183 VAL E CB    1 
ATOM   7022 C CG1   . VAL C 1 186 ? 7.751   -11.277 -25.127 1.00 37.51 ? 183 VAL E CG1   1 
ATOM   7023 C CG2   . VAL C 1 186 ? 10.093  -10.454 -25.469 1.00 36.79 ? 183 VAL E CG2   1 
ATOM   7024 N N     . GLU C 1 187 ? 7.877   -13.349 -28.161 1.00 38.03 ? 184 GLU E N     1 
ATOM   7025 C CA    . GLU C 1 187 ? 6.838   -14.158 -28.827 1.00 38.24 ? 184 GLU E CA    1 
ATOM   7026 C C     . GLU C 1 187 ? 7.097   -15.656 -28.700 1.00 38.35 ? 184 GLU E C     1 
ATOM   7027 O O     . GLU C 1 187 ? 6.197   -16.430 -28.316 1.00 38.43 ? 184 GLU E O     1 
ATOM   7028 C CB    . GLU C 1 187 ? 6.737   -13.805 -30.314 1.00 38.24 ? 184 GLU E CB    1 
ATOM   7029 C CG    . GLU C 1 187 ? 6.183   -12.405 -30.610 1.00 39.18 ? 184 GLU E CG    1 
ATOM   7030 C CD    . GLU C 1 187 ? 5.234   -12.362 -31.808 1.00 39.69 ? 184 GLU E CD    1 
ATOM   7031 O OE1   . GLU C 1 187 ? 4.431   -13.307 -31.977 1.00 40.34 ? 184 GLU E OE1   1 
ATOM   7032 O OE2   . GLU C 1 187 ? 5.261   -11.354 -32.555 1.00 41.66 ? 184 GLU E OE2   1 
ATOM   7033 N N     . ARG C 1 188 ? 8.337   -16.045 -29.016 1.00 38.35 ? 185 ARG E N     1 
ATOM   7034 C CA    . ARG C 1 188 ? 8.770   -17.442 -28.994 1.00 38.73 ? 185 ARG E CA    1 
ATOM   7035 C C     . ARG C 1 188 ? 8.614   -18.046 -27.609 1.00 38.22 ? 185 ARG E C     1 
ATOM   7036 O O     . ARG C 1 188 ? 8.171   -19.193 -27.467 1.00 38.08 ? 185 ARG E O     1 
ATOM   7037 C CB    . ARG C 1 188 ? 10.237  -17.567 -29.464 1.00 38.92 ? 185 ARG E CB    1 
ATOM   7038 C CG    . ARG C 1 188 ? 10.447  -17.266 -30.950 1.00 40.62 ? 185 ARG E CG    1 
ATOM   7039 C CD    . ARG C 1 188 ? 11.926  -17.029 -31.322 1.00 41.23 ? 185 ARG E CD    1 
ATOM   7040 N NE    . ARG C 1 188 ? 12.776  -18.177 -30.988 1.00 43.44 ? 185 ARG E NE    1 
ATOM   7041 C CZ    . ARG C 1 188 ? 14.115  -18.183 -31.031 1.00 44.43 ? 185 ARG E CZ    1 
ATOM   7042 N NH1   . ARG C 1 188 ? 14.799  -17.095 -31.395 1.00 45.01 ? 185 ARG E NH1   1 
ATOM   7043 N NH2   . ARG C 1 188 ? 14.783  -19.294 -30.708 1.00 45.24 ? 185 ARG E NH2   1 
ATOM   7044 N N     . ILE C 1 189 ? 8.981   -17.270 -26.589 1.00 37.97 ? 186 ILE E N     1 
ATOM   7045 C CA    . ILE C 1 189 ? 8.795   -17.685 -25.200 1.00 37.87 ? 186 ILE E CA    1 
ATOM   7046 C C     . ILE C 1 189 ? 7.306   -17.826 -24.862 1.00 37.57 ? 186 ILE E C     1 
ATOM   7047 O O     . ILE C 1 189 ? 6.901   -18.809 -24.236 1.00 37.09 ? 186 ILE E O     1 
ATOM   7048 C CB    . ILE C 1 189 ? 9.491   -16.715 -24.203 1.00 38.04 ? 186 ILE E CB    1 
ATOM   7049 C CG1   . ILE C 1 189 ? 11.016  -16.836 -24.329 1.00 38.09 ? 186 ILE E CG1   1 
ATOM   7050 C CG2   . ILE C 1 189 ? 9.073   -17.033 -22.768 1.00 37.88 ? 186 ILE E CG2   1 
ATOM   7051 C CD1   . ILE C 1 189 ? 11.811  -15.912 -23.406 1.00 38.18 ? 186 ILE E CD1   1 
ATOM   7052 N N     . ILE C 1 190 ? 6.492   -16.861 -25.288 1.00 37.69 ? 187 ILE E N     1 
ATOM   7053 C CA    . ILE C 1 190 ? 5.038   -16.935 -25.046 1.00 38.07 ? 187 ILE E CA    1 
ATOM   7054 C C     . ILE C 1 190 ? 4.424   -18.172 -25.696 1.00 38.26 ? 187 ILE E C     1 
ATOM   7055 O O     . ILE C 1 190 ? 3.529   -18.795 -25.124 1.00 38.57 ? 187 ILE E O     1 
ATOM   7056 C CB    . ILE C 1 190 ? 4.251   -15.683 -25.572 1.00 38.39 ? 187 ILE E CB    1 
ATOM   7057 C CG1   . ILE C 1 190 ? 4.765   -14.381 -24.955 1.00 38.14 ? 187 ILE E CG1   1 
ATOM   7058 C CG2   . ILE C 1 190 ? 2.771   -15.807 -25.232 1.00 37.89 ? 187 ILE E CG2   1 
ATOM   7059 C CD1   . ILE C 1 190 ? 4.139   -13.138 -25.563 1.00 38.35 ? 187 ILE E CD1   1 
ATOM   7060 N N     . ASN C 1 191 ? 4.908   -18.537 -26.884 1.00 38.84 ? 188 ASN E N     1 
ATOM   7061 C CA    . ASN C 1 191 ? 4.299   -19.643 -27.643 1.00 38.90 ? 188 ASN E CA    1 
ATOM   7062 C C     . ASN C 1 191 ? 4.553   -21.018 -27.047 1.00 39.02 ? 188 ASN E C     1 
ATOM   7063 O O     . ASN C 1 191 ? 3.744   -21.928 -27.226 1.00 39.49 ? 188 ASN E O     1 
ATOM   7064 C CB    . ASN C 1 191 ? 4.709   -19.604 -29.121 1.00 39.60 ? 188 ASN E CB    1 
ATOM   7065 C CG    . ASN C 1 191 ? 3.699   -18.861 -29.982 1.00 41.53 ? 188 ASN E CG    1 
ATOM   7066 O OD1   . ASN C 1 191 ? 3.947   -17.733 -30.427 1.00 45.04 ? 188 ASN E OD1   1 
ATOM   7067 N ND2   . ASN C 1 191 ? 2.541   -19.481 -30.204 1.00 43.47 ? 188 ASN E ND2   1 
ATOM   7068 N N     . VAL C 1 192 ? 5.659   -21.171 -26.331 1.00 38.79 ? 189 VAL E N     1 
ATOM   7069 C CA    . VAL C 1 192 ? 5.928   -22.413 -25.618 1.00 38.54 ? 189 VAL E CA    1 
ATOM   7070 C C     . VAL C 1 192 ? 5.348   -22.413 -24.210 1.00 38.48 ? 189 VAL E C     1 
ATOM   7071 O O     . VAL C 1 192 ? 4.990   -23.482 -23.681 1.00 38.50 ? 189 VAL E O     1 
ATOM   7072 C CB    . VAL C 1 192 ? 7.442   -22.722 -25.553 1.00 39.22 ? 189 VAL E CB    1 
ATOM   7073 C CG1   . VAL C 1 192 ? 7.923   -23.274 -26.918 1.00 39.57 ? 189 VAL E CG1   1 
ATOM   7074 C CG2   . VAL C 1 192 ? 8.245   -21.490 -25.136 1.00 39.42 ? 189 VAL E CG2   1 
ATOM   7075 N N     . ALA C 1 193 ? 5.268   -21.229 -23.595 1.00 37.89 ? 190 ALA E N     1 
ATOM   7076 C CA    . ALA C 1 193 ? 4.722   -21.101 -22.239 1.00 37.26 ? 190 ALA E CA    1 
ATOM   7077 C C     . ALA C 1 193 ? 3.265   -21.597 -22.224 1.00 36.57 ? 190 ALA E C     1 
ATOM   7078 O O     . ALA C 1 193 ? 2.486   -21.206 -23.081 1.00 36.78 ? 190 ALA E O     1 
ATOM   7079 C CB    . ALA C 1 193 ? 4.807   -19.640 -21.779 1.00 37.54 ? 190 ALA E CB    1 
ATOM   7080 N N     . PRO C 1 194 ? 2.909   -22.494 -21.292 1.00 35.94 ? 191 PRO E N     1 
ATOM   7081 C CA    . PRO C 1 194 ? 1.530   -22.984 -21.183 1.00 35.75 ? 191 PRO E CA    1 
ATOM   7082 C C     . PRO C 1 194 ? 0.575   -22.124 -20.345 1.00 35.62 ? 191 PRO E C     1 
ATOM   7083 O O     . PRO C 1 194 ? -0.626  -22.060 -20.651 1.00 36.11 ? 191 PRO E O     1 
ATOM   7084 C CB    . PRO C 1 194 ? 1.707   -24.333 -20.497 1.00 35.93 ? 191 PRO E CB    1 
ATOM   7085 C CG    . PRO C 1 194 ? 2.902   -24.138 -19.605 1.00 36.18 ? 191 PRO E CG    1 
ATOM   7086 C CD    . PRO C 1 194 ? 3.806   -23.163 -20.333 1.00 36.04 ? 191 PRO E CD    1 
ATOM   7087 N N     . GLY C 1 195 ? 1.091   -21.500 -19.283 1.00 35.13 ? 192 GLY E N     1 
ATOM   7088 C CA    . GLY C 1 195 ? 0.275   -20.672 -18.372 1.00 34.15 ? 192 GLY E CA    1 
ATOM   7089 C C     . GLY C 1 195 ? 0.313   -19.228 -18.818 1.00 33.48 ? 192 GLY E C     1 
ATOM   7090 O O     . GLY C 1 195 ? -0.117  -18.923 -19.928 1.00 34.28 ? 192 GLY E O     1 
ATOM   7091 N N     . ILE C 1 196 ? 0.834   -18.334 -17.977 1.00 32.02 ? 193 ILE E N     1 
ATOM   7092 C CA    . ILE C 1 196 ? 0.960   -16.920 -18.362 1.00 31.19 ? 193 ILE E CA    1 
ATOM   7093 C C     . ILE C 1 196 ? 2.437   -16.505 -18.446 1.00 30.25 ? 193 ILE E C     1 
ATOM   7094 O O     . ILE C 1 196 ? 3.322   -17.175 -17.911 1.00 30.78 ? 193 ILE E O     1 
ATOM   7095 C CB    . ILE C 1 196 ? 0.161   -15.965 -17.404 1.00 31.01 ? 193 ILE E CB    1 
ATOM   7096 C CG1   . ILE C 1 196 ? 0.825   -15.857 -16.033 1.00 30.61 ? 193 ILE E CG1   1 
ATOM   7097 C CG2   . ILE C 1 196 ? -1.283  -16.437 -17.248 1.00 30.36 ? 193 ILE E CG2   1 
ATOM   7098 C CD1   . ILE C 1 196 ? 0.023   -15.041 -15.045 1.00 31.57 ? 193 ILE E CD1   1 
ATOM   7099 N N     . VAL C 1 197 ? 2.683   -15.414 -19.151 1.00 29.10 ? 194 VAL E N     1 
ATOM   7100 C CA    . VAL C 1 197 ? 3.992   -14.809 -19.214 1.00 28.85 ? 194 VAL E CA    1 
ATOM   7101 C C     . VAL C 1 197 ? 3.887   -13.368 -18.721 1.00 28.12 ? 194 VAL E C     1 
ATOM   7102 O O     . VAL C 1 197 ? 3.134   -12.567 -19.274 1.00 27.61 ? 194 VAL E O     1 
ATOM   7103 C CB    . VAL C 1 197 ? 4.533   -14.785 -20.666 1.00 29.02 ? 194 VAL E CB    1 
ATOM   7104 C CG1   . VAL C 1 197 ? 5.868   -14.063 -20.729 1.00 29.64 ? 194 VAL E CG1   1 
ATOM   7105 C CG2   . VAL C 1 197 ? 4.649   -16.209 -21.233 1.00 28.95 ? 194 VAL E CG2   1 
ATOM   7106 N N     . ILE C 1 198 ? 4.649   -13.040 -17.682 1.00 27.87 ? 195 ILE E N     1 
ATOM   7107 C CA    . ILE C 1 198 ? 4.734   -11.663 -17.195 1.00 27.31 ? 195 ILE E CA    1 
ATOM   7108 C C     . ILE C 1 198 ? 6.006   -11.003 -17.709 1.00 26.87 ? 195 ILE E C     1 
ATOM   7109 O O     . ILE C 1 198 ? 7.104   -11.378 -17.303 1.00 27.07 ? 195 ILE E O     1 
ATOM   7110 C CB    . ILE C 1 198 ? 4.704   -11.621 -15.651 1.00 27.69 ? 195 ILE E CB    1 
ATOM   7111 C CG1   . ILE C 1 198 ? 3.397   -12.233 -15.132 1.00 27.39 ? 195 ILE E CG1   1 
ATOM   7112 C CG2   . ILE C 1 198 ? 4.834   -10.195 -15.160 1.00 27.41 ? 195 ILE E CG2   1 
ATOM   7113 C CD1   . ILE C 1 198 ? 3.393   -12.496 -13.654 1.00 26.55 ? 195 ILE E CD1   1 
ATOM   7114 N N     . VAL C 1 199 ? 5.853   -10.024 -18.600 1.00 26.46 ? 196 VAL E N     1 
ATOM   7115 C CA    . VAL C 1 199 ? 6.969   -9.225  -19.085 1.00 26.38 ? 196 VAL E CA    1 
ATOM   7116 C C     . VAL C 1 199 ? 7.102   -7.963  -18.216 1.00 26.26 ? 196 VAL E C     1 
ATOM   7117 O O     . VAL C 1 199 ? 6.271   -7.035  -18.278 1.00 26.09 ? 196 VAL E O     1 
ATOM   7118 C CB    . VAL C 1 199 ? 6.826   -8.833  -20.582 1.00 26.60 ? 196 VAL E CB    1 
ATOM   7119 C CG1   . VAL C 1 199 ? 8.078   -8.087  -21.080 1.00 26.88 ? 196 VAL E CG1   1 
ATOM   7120 C CG2   . VAL C 1 199 ? 6.614   -10.056 -21.423 1.00 27.11 ? 196 VAL E CG2   1 
ATOM   7121 N N     . ASP C 1 200 ? 8.135   -7.964  -17.383 1.00 25.46 ? 197 ASP E N     1 
ATOM   7122 C CA    . ASP C 1 200 ? 8.406   -6.864  -16.510 1.00 25.27 ? 197 ASP E CA    1 
ATOM   7123 C C     . ASP C 1 200 ? 9.161   -5.777  -17.264 1.00 24.95 ? 197 ASP E C     1 
ATOM   7124 O O     . ASP C 1 200 ? 10.369  -5.891  -17.530 1.00 24.81 ? 197 ASP E O     1 
ATOM   7125 C CB    . ASP C 1 200 ? 9.190   -7.364  -15.307 1.00 25.61 ? 197 ASP E CB    1 
ATOM   7126 C CG    . ASP C 1 200 ? 9.407   -6.293  -14.253 1.00 25.31 ? 197 ASP E CG    1 
ATOM   7127 O OD1   . ASP C 1 200 ? 9.409   -5.086  -14.585 1.00 26.95 ? 197 ASP E OD1   1 
ATOM   7128 O OD2   . ASP C 1 200 ? 9.626   -6.671  -13.089 1.00 27.21 ? 197 ASP E OD2   1 
ATOM   7129 N N     . GLU C 1 201 ? 8.433   -4.713  -17.588 1.00 24.96 ? 198 GLU E N     1 
ATOM   7130 C CA    . GLU C 1 201 ? 8.965   -3.592  -18.337 1.00 25.00 ? 198 GLU E CA    1 
ATOM   7131 C C     . GLU C 1 201 ? 9.223   -2.407  -17.426 1.00 24.61 ? 198 GLU E C     1 
ATOM   7132 O O     . GLU C 1 201 ? 8.901   -1.271  -17.776 1.00 24.23 ? 198 GLU E O     1 
ATOM   7133 C CB    . GLU C 1 201 ? 7.987   -3.197  -19.443 1.00 25.43 ? 198 GLU E CB    1 
ATOM   7134 C CG    . GLU C 1 201 ? 7.818   -4.251  -20.517 1.00 26.85 ? 198 GLU E CG    1 
ATOM   7135 C CD    . GLU C 1 201 ? 7.322   -3.680  -21.846 1.00 27.04 ? 198 GLU E CD    1 
ATOM   7136 O OE1   . GLU C 1 201 ? 6.698   -2.591  -21.878 1.00 29.52 ? 198 GLU E OE1   1 
ATOM   7137 O OE2   . GLU C 1 201 ? 7.574   -4.333  -22.880 1.00 31.38 ? 198 GLU E OE2   1 
ATOM   7138 N N     . ALA C 1 202 ? 9.837   -2.671  -16.268 1.00 24.24 ? 199 ALA E N     1 
ATOM   7139 C CA    . ALA C 1 202 ? 10.189  -1.626  -15.332 1.00 24.17 ? 199 ALA E CA    1 
ATOM   7140 C C     . ALA C 1 202 ? 11.018  -0.523  -16.007 1.00 23.90 ? 199 ALA E C     1 
ATOM   7141 O O     . ALA C 1 202 ? 10.851  0.646   -15.684 1.00 23.59 ? 199 ALA E O     1 
ATOM   7142 C CB    . ALA C 1 202 ? 10.937  -2.208  -14.135 1.00 23.92 ? 199 ALA E CB    1 
ATOM   7143 N N     . TYR C 1 203 ? 11.887  -0.892  -16.951 1.00 24.21 ? 200 TYR E N     1 
ATOM   7144 C CA    . TYR C 1 203 ? 12.772  0.075   -17.634 1.00 24.92 ? 200 TYR E CA    1 
ATOM   7145 C C     . TYR C 1 203 ? 12.462  0.282   -19.115 1.00 25.78 ? 200 TYR E C     1 
ATOM   7146 O O     . TYR C 1 203 ? 13.356  0.663   -19.894 1.00 26.67 ? 200 TYR E O     1 
ATOM   7147 C CB    . TYR C 1 203 ? 14.232  -0.354  -17.480 1.00 24.46 ? 200 TYR E CB    1 
ATOM   7148 C CG    . TYR C 1 203 ? 14.561  -0.638  -16.046 1.00 23.48 ? 200 TYR E CG    1 
ATOM   7149 C CD1   . TYR C 1 203 ? 14.859  0.392   -15.165 1.00 23.47 ? 200 TYR E CD1   1 
ATOM   7150 C CD2   . TYR C 1 203 ? 14.516  -1.938  -15.555 1.00 23.96 ? 200 TYR E CD2   1 
ATOM   7151 C CE1   . TYR C 1 203 ? 15.138  0.127   -13.831 1.00 24.87 ? 200 TYR E CE1   1 
ATOM   7152 C CE2   . TYR C 1 203 ? 14.776  -2.213  -14.243 1.00 24.01 ? 200 TYR E CE2   1 
ATOM   7153 C CZ    . TYR C 1 203 ? 15.083  -1.189  -13.381 1.00 24.04 ? 200 TYR E CZ    1 
ATOM   7154 O OH    . TYR C 1 203 ? 15.345  -1.500  -12.083 1.00 24.62 ? 200 TYR E OH    1 
ATOM   7155 N N     . ALA C 1 204 ? 11.210  0.048   -19.505 1.00 26.44 ? 201 ALA E N     1 
ATOM   7156 C CA    . ALA C 1 204 ? 10.786  0.224   -20.898 1.00 26.85 ? 201 ALA E CA    1 
ATOM   7157 C C     . ALA C 1 204 ? 11.057  1.636   -21.392 1.00 27.74 ? 201 ALA E C     1 
ATOM   7158 O O     . ALA C 1 204 ? 11.584  1.822   -22.492 1.00 28.91 ? 201 ALA E O     1 
ATOM   7159 C CB    . ALA C 1 204 ? 9.316   -0.100  -21.043 1.00 27.29 ? 201 ALA E CB    1 
ATOM   7160 N N     . GLU C 1 205 ? 10.717  2.634   -20.582 1.00 28.22 ? 202 GLU E N     1 
ATOM   7161 C CA    . GLU C 1 205 ? 10.877  4.029   -20.985 1.00 28.73 ? 202 GLU E CA    1 
ATOM   7162 C C     . GLU C 1 205 ? 12.303  4.377   -21.391 1.00 29.29 ? 202 GLU E C     1 
ATOM   7163 O O     . GLU C 1 205 ? 12.519  5.349   -22.118 1.00 30.01 ? 202 GLU E O     1 
ATOM   7164 C CB    . GLU C 1 205 ? 10.452  4.983   -19.869 1.00 29.12 ? 202 GLU E CB    1 
ATOM   7165 C CG    . GLU C 1 205 ? 8.932   5.150   -19.685 1.00 30.46 ? 202 GLU E CG    1 
ATOM   7166 C CD    . GLU C 1 205 ? 8.304   4.130   -18.740 1.00 32.99 ? 202 GLU E CD    1 
ATOM   7167 O OE1   . GLU C 1 205 ? 8.960   3.125   -18.348 1.00 34.79 ? 202 GLU E OE1   1 
ATOM   7168 O OE2   . GLU C 1 205 ? 7.124   4.336   -18.391 1.00 34.57 ? 202 GLU E OE2   1 
ATOM   7169 N N     . PHE C 1 206 ? 13.275  3.617   -20.896 1.00 29.68 ? 203 PHE E N     1 
ATOM   7170 C CA    . PHE C 1 206 ? 14.676  3.882   -21.197 1.00 29.88 ? 203 PHE E CA    1 
ATOM   7171 C C     . PHE C 1 206 ? 15.127  3.331   -22.554 1.00 30.38 ? 203 PHE E C     1 
ATOM   7172 O O     . PHE C 1 206 ? 16.247  3.613   -22.988 1.00 30.80 ? 203 PHE E O     1 
ATOM   7173 C CB    . PHE C 1 206 ? 15.563  3.365   -20.050 1.00 29.63 ? 203 PHE E CB    1 
ATOM   7174 C CG    . PHE C 1 206 ? 15.451  4.183   -18.805 1.00 29.21 ? 203 PHE E CG    1 
ATOM   7175 C CD1   . PHE C 1 206 ? 16.071  5.427   -18.725 1.00 28.70 ? 203 PHE E CD1   1 
ATOM   7176 C CD2   . PHE C 1 206 ? 14.694  3.737   -17.721 1.00 29.96 ? 203 PHE E CD2   1 
ATOM   7177 C CE1   . PHE C 1 206 ? 15.957  6.210   -17.579 1.00 29.84 ? 203 PHE E CE1   1 
ATOM   7178 C CE2   . PHE C 1 206 ? 14.572  4.508   -16.565 1.00 30.26 ? 203 PHE E CE2   1 
ATOM   7179 C CZ    . PHE C 1 206 ? 15.205  5.750   -16.489 1.00 29.61 ? 203 PHE E CZ    1 
ATOM   7180 N N     . SER C 1 207 ? 14.263  2.575   -23.235 1.00 31.17 ? 204 SER E N     1 
ATOM   7181 C CA    . SER C 1 207 ? 14.603  1.970   -24.524 1.00 31.73 ? 204 SER E CA    1 
ATOM   7182 C C     . SER C 1 207 ? 13.683  2.475   -25.624 1.00 32.20 ? 204 SER E C     1 
ATOM   7183 O O     . SER C 1 207 ? 12.461  2.543   -25.422 1.00 31.98 ? 204 SER E O     1 
ATOM   7184 C CB    . SER C 1 207 ? 14.495  0.443   -24.460 1.00 32.28 ? 204 SER E CB    1 
ATOM   7185 O OG    . SER C 1 207 ? 14.684  -0.138  -25.743 1.00 32.97 ? 204 SER E OG    1 
ATOM   7186 N N     . PRO C 1 208 ? 14.260  2.817   -26.799 1.00 32.99 ? 205 PRO E N     1 
ATOM   7187 C CA    . PRO C 1 208 ? 13.462  3.232   -27.974 1.00 32.78 ? 205 PRO E CA    1 
ATOM   7188 C C     . PRO C 1 208 ? 12.725  2.076   -28.622 1.00 32.69 ? 205 PRO E C     1 
ATOM   7189 O O     . PRO C 1 208 ? 11.848  2.294   -29.442 1.00 33.26 ? 205 PRO E O     1 
ATOM   7190 C CB    . PRO C 1 208 ? 14.511  3.776   -28.962 1.00 33.00 ? 205 PRO E CB    1 
ATOM   7191 C CG    . PRO C 1 208 ? 15.823  3.781   -28.240 1.00 33.28 ? 205 PRO E CG    1 
ATOM   7192 C CD    . PRO C 1 208 ? 15.711  2.841   -27.084 1.00 33.25 ? 205 PRO E CD    1 
ATOM   7193 N N     . SER C 1 209 ? 13.106  0.854   -28.284 1.00 33.19 ? 206 SER E N     1 
ATOM   7194 C CA    . SER C 1 209 ? 12.428  -0.317  -28.791 1.00 33.61 ? 206 SER E CA    1 
ATOM   7195 C C     . SER C 1 209 ? 10.973  -0.348  -28.312 1.00 33.97 ? 206 SER E C     1 
ATOM   7196 O O     . SER C 1 209 ? 10.635  0.270   -27.299 1.00 34.69 ? 206 SER E O     1 
ATOM   7197 C CB    . SER C 1 209 ? 13.176  -1.571  -28.340 1.00 34.30 ? 206 SER E CB    1 
ATOM   7198 O OG    . SER C 1 209 ? 14.463  -1.634  -28.948 1.00 36.60 ? 206 SER E OG    1 
ATOM   7199 N N     . PRO C 1 210 ? 10.099  -1.053  -29.049 1.00 34.03 ? 207 PRO E N     1 
ATOM   7200 C CA    . PRO C 1 210 ? 8.668   -1.130  -28.708 1.00 33.33 ? 207 PRO E CA    1 
ATOM   7201 C C     . PRO C 1 210 ? 8.318   -1.962  -27.470 1.00 32.69 ? 207 PRO E C     1 
ATOM   7202 O O     . PRO C 1 210 ? 9.005   -2.929  -27.141 1.00 32.53 ? 207 PRO E O     1 
ATOM   7203 C CB    . PRO C 1 210 ? 8.060   -1.795  -29.945 1.00 33.82 ? 207 PRO E CB    1 
ATOM   7204 C CG    . PRO C 1 210 ? 9.182   -2.616  -30.504 1.00 34.31 ? 207 PRO E CG    1 
ATOM   7205 C CD    . PRO C 1 210 ? 10.406  -1.799  -30.286 1.00 34.09 ? 207 PRO E CD    1 
ATOM   7206 N N     . SER C 1 211 ? 7.219   -1.597  -26.814 1.00 32.07 ? 208 SER E N     1 
ATOM   7207 C CA    . SER C 1 211 ? 6.747   -2.339  -25.655 1.00 31.58 ? 208 SER E CA    1 
ATOM   7208 C C     . SER C 1 211 ? 6.068   -3.658  -26.041 1.00 31.16 ? 208 SER E C     1 
ATOM   7209 O O     . SER C 1 211 ? 5.475   -3.791  -27.117 1.00 31.19 ? 208 SER E O     1 
ATOM   7210 C CB    . SER C 1 211 ? 5.766   -1.491  -24.850 1.00 31.42 ? 208 SER E CB    1 
ATOM   7211 O OG    . SER C 1 211 ? 5.055   -2.301  -23.930 1.00 31.31 ? 208 SER E OG    1 
ATOM   7212 N N     . ALA C 1 212 ? 6.112   -4.611  -25.125 1.00 30.83 ? 209 ALA E N     1 
ATOM   7213 C CA    . ALA C 1 212 ? 5.352   -5.840  -25.263 1.00 31.14 ? 209 ALA E CA    1 
ATOM   7214 C C     . ALA C 1 212 ? 3.831   -5.606  -25.234 1.00 31.29 ? 209 ALA E C     1 
ATOM   7215 O O     . ALA C 1 212 ? 3.054   -6.550  -25.433 1.00 31.56 ? 209 ALA E O     1 
ATOM   7216 C CB    . ALA C 1 212 ? 5.759   -6.825  -24.192 1.00 30.75 ? 209 ALA E CB    1 
ATOM   7217 N N     . THR C 1 213 ? 3.399   -4.363  -24.991 1.00 31.50 ? 210 THR E N     1 
ATOM   7218 C CA    . THR C 1 213 ? 1.982   -4.014  -25.112 1.00 31.52 ? 210 THR E CA    1 
ATOM   7219 C C     . THR C 1 213 ? 1.493   -4.258  -26.538 1.00 31.79 ? 210 THR E C     1 
ATOM   7220 O O     . THR C 1 213 ? 0.328   -4.587  -26.751 1.00 31.82 ? 210 THR E O     1 
ATOM   7221 C CB    . THR C 1 213 ? 1.695   -2.538  -24.715 1.00 31.40 ? 210 THR E CB    1 
ATOM   7222 O OG1   . THR C 1 213 ? 2.494   -1.645  -25.503 1.00 31.19 ? 210 THR E OG1   1 
ATOM   7223 C CG2   . THR C 1 213 ? 1.992   -2.324  -23.234 1.00 31.06 ? 210 THR E CG2   1 
ATOM   7224 N N     . THR C 1 214 ? 2.401   -4.102  -27.502 1.00 32.17 ? 211 THR E N     1 
ATOM   7225 C CA    . THR C 1 214 ? 2.114   -4.336  -28.919 1.00 32.43 ? 211 THR E CA    1 
ATOM   7226 C C     . THR C 1 214 ? 1.783   -5.820  -29.208 1.00 33.04 ? 211 THR E C     1 
ATOM   7227 O O     . THR C 1 214 ? 1.148   -6.133  -30.216 1.00 33.82 ? 211 THR E O     1 
ATOM   7228 C CB    . THR C 1 214 ? 3.302   -3.847  -29.807 1.00 32.39 ? 211 THR E CB    1 
ATOM   7229 O OG1   . THR C 1 214 ? 4.521   -4.466  -29.381 1.00 32.42 ? 211 THR E OG1   1 
ATOM   7230 C CG2   . THR C 1 214 ? 3.472   -2.311  -29.720 1.00 31.64 ? 211 THR E CG2   1 
ATOM   7231 N N     . LEU C 1 215 ? 2.207   -6.720  -28.322 1.00 33.31 ? 212 LEU E N     1 
ATOM   7232 C CA    . LEU C 1 215 ? 1.892   -8.144  -28.418 1.00 33.86 ? 212 LEU E CA    1 
ATOM   7233 C C     . LEU C 1 215 ? 0.620   -8.560  -27.663 1.00 34.31 ? 212 LEU E C     1 
ATOM   7234 O O     . LEU C 1 215 ? 0.275   -9.746  -27.655 1.00 34.76 ? 212 LEU E O     1 
ATOM   7235 C CB    . LEU C 1 215 ? 3.046   -8.966  -27.842 1.00 33.86 ? 212 LEU E CB    1 
ATOM   7236 C CG    . LEU C 1 215 ? 4.452   -8.741  -28.410 1.00 34.65 ? 212 LEU E CG    1 
ATOM   7237 C CD1   . LEU C 1 215 ? 5.425   -9.747  -27.772 1.00 33.50 ? 212 LEU E CD1   1 
ATOM   7238 C CD2   . LEU C 1 215 ? 4.448   -8.853  -29.935 1.00 35.75 ? 212 LEU E CD2   1 
ATOM   7239 N N     . LEU C 1 216 ? -0.061  -7.620  -27.007 1.00 34.92 ? 213 LEU E N     1 
ATOM   7240 C CA    . LEU C 1 216 ? -1.222  -7.981  -26.159 1.00 35.56 ? 213 LEU E CA    1 
ATOM   7241 C C     . LEU C 1 216 ? -2.418  -8.495  -26.961 1.00 36.16 ? 213 LEU E C     1 
ATOM   7242 O O     . LEU C 1 216 ? -3.129  -9.403  -26.515 1.00 36.65 ? 213 LEU E O     1 
ATOM   7243 C CB    . LEU C 1 216 ? -1.668  -6.797  -25.295 1.00 35.25 ? 213 LEU E CB    1 
ATOM   7244 C CG    . LEU C 1 216 ? -0.771  -6.473  -24.093 1.00 34.90 ? 213 LEU E CG    1 
ATOM   7245 C CD1   . LEU C 1 216 ? -1.101  -5.088  -23.515 1.00 33.86 ? 213 LEU E CD1   1 
ATOM   7246 C CD2   . LEU C 1 216 ? -0.867  -7.553  -23.044 1.00 33.21 ? 213 LEU E CD2   1 
ATOM   7247 N N     . GLU C 1 217 ? -2.645  -7.903  -28.128 1.00 37.24 ? 214 GLU E N     1 
ATOM   7248 C CA    . GLU C 1 217 ? -3.788  -8.281  -28.976 1.00 37.95 ? 214 GLU E CA    1 
ATOM   7249 C C     . GLU C 1 217 ? -3.673  -9.717  -29.453 1.00 37.92 ? 214 GLU E C     1 
ATOM   7250 O O     . GLU C 1 217 ? -4.672  -10.416 -29.573 1.00 38.08 ? 214 GLU E O     1 
ATOM   7251 C CB    . GLU C 1 217 ? -3.894  -7.353  -30.184 1.00 38.12 ? 214 GLU E CB    1 
ATOM   7252 C CG    . GLU C 1 217 ? -5.268  -7.355  -30.850 1.00 39.32 ? 214 GLU E CG    1 
ATOM   7253 C CD    . GLU C 1 217 ? -5.510  -6.091  -31.671 1.00 40.63 ? 214 GLU E CD    1 
ATOM   7254 O OE1   . GLU C 1 217 ? -5.578  -6.202  -32.919 1.00 44.64 ? 214 GLU E OE1   1 
ATOM   7255 O OE2   . GLU C 1 217 ? -5.616  -4.991  -31.067 1.00 44.09 ? 214 GLU E OE2   1 
ATOM   7256 N N     . LYS C 1 218 ? -2.437  -10.146 -29.703 1.00 38.36 ? 215 LYS E N     1 
ATOM   7257 C CA    . LYS C 1 218 ? -2.146  -11.477 -30.235 1.00 38.26 ? 215 LYS E CA    1 
ATOM   7258 C C     . LYS C 1 218 ? -2.201  -12.600 -29.201 1.00 37.95 ? 215 LYS E C     1 
ATOM   7259 O O     . LYS C 1 218 ? -2.512  -13.737 -29.560 1.00 37.88 ? 215 LYS E O     1 
ATOM   7260 C CB    . LYS C 1 218 ? -0.759  -11.459 -30.893 1.00 38.77 ? 215 LYS E CB    1 
ATOM   7261 C CG    . LYS C 1 218 ? -0.399  -12.719 -31.661 1.00 39.13 ? 215 LYS E CG    1 
ATOM   7262 C CD    . LYS C 1 218 ? 0.755   -12.454 -32.628 1.00 39.73 ? 215 LYS E CD    1 
ATOM   7263 C CE    . LYS C 1 218 ? 1.130   -13.711 -33.422 1.00 40.74 ? 215 LYS E CE    1 
ATOM   7264 N NZ    . LYS C 1 218 ? 2.168   -13.415 -34.474 1.00 41.35 ? 215 LYS E NZ    1 
ATOM   7265 N N     . TYR C 1 219 ? -1.881  -12.303 -27.935 1.00 37.83 ? 216 TYR E N     1 
ATOM   7266 C CA    . TYR C 1 219 ? -1.821  -13.343 -26.882 1.00 37.69 ? 216 TYR E CA    1 
ATOM   7267 C C     . TYR C 1 219 ? -2.636  -13.000 -25.617 1.00 37.52 ? 216 TYR E C     1 
ATOM   7268 O O     . TYR C 1 219 ? -2.151  -13.175 -24.493 1.00 37.58 ? 216 TYR E O     1 
ATOM   7269 C CB    . TYR C 1 219 ? -0.363  -13.635 -26.489 1.00 38.42 ? 216 TYR E CB    1 
ATOM   7270 C CG    . TYR C 1 219 ? 0.523   -14.053 -27.642 1.00 38.73 ? 216 TYR E CG    1 
ATOM   7271 C CD1   . TYR C 1 219 ? 0.665   -15.399 -27.985 1.00 39.11 ? 216 TYR E CD1   1 
ATOM   7272 C CD2   . TYR C 1 219 ? 1.222   -13.104 -28.384 1.00 38.85 ? 216 TYR E CD2   1 
ATOM   7273 C CE1   . TYR C 1 219 ? 1.469   -15.785 -29.041 1.00 39.29 ? 216 TYR E CE1   1 
ATOM   7274 C CE2   . TYR C 1 219 ? 2.035   -13.480 -29.450 1.00 39.27 ? 216 TYR E CE2   1 
ATOM   7275 C CZ    . TYR C 1 219 ? 2.152   -14.820 -29.774 1.00 39.95 ? 216 TYR E CZ    1 
ATOM   7276 O OH    . TYR C 1 219 ? 2.957   -15.201 -30.827 1.00 40.04 ? 216 TYR E OH    1 
ATOM   7277 N N     . PRO C 1 220 ? -3.902  -12.585 -25.795 1.00 36.99 ? 217 PRO E N     1 
ATOM   7278 C CA    . PRO C 1 220 ? -4.761  -12.126 -24.694 1.00 36.42 ? 217 PRO E CA    1 
ATOM   7279 C C     . PRO C 1 220 ? -4.809  -13.047 -23.464 1.00 35.84 ? 217 PRO E C     1 
ATOM   7280 O O     . PRO C 1 220 ? -4.873  -12.555 -22.328 1.00 36.16 ? 217 PRO E O     1 
ATOM   7281 C CB    . PRO C 1 220 ? -6.152  -12.024 -25.351 1.00 36.57 ? 217 PRO E CB    1 
ATOM   7282 C CG    . PRO C 1 220 ? -6.041  -12.764 -26.651 1.00 37.30 ? 217 PRO E CG    1 
ATOM   7283 C CD    . PRO C 1 220 ? -4.627  -12.585 -27.078 1.00 37.09 ? 217 PRO E CD    1 
ATOM   7284 N N     . THR C 1 221 ? -4.757  -14.360 -23.672 1.00 35.02 ? 218 THR E N     1 
ATOM   7285 C CA    . THR C 1 221 ? -4.898  -15.299 -22.557 1.00 34.76 ? 218 THR E CA    1 
ATOM   7286 C C     . THR C 1 221 ? -3.573  -15.637 -21.873 1.00 34.09 ? 218 THR E C     1 
ATOM   7287 O O     . THR C 1 221 ? -3.558  -16.396 -20.898 1.00 34.46 ? 218 THR E O     1 
ATOM   7288 C CB    . THR C 1 221 ? -5.605  -16.626 -22.985 1.00 35.25 ? 218 THR E CB    1 
ATOM   7289 O OG1   . THR C 1 221 ? -4.654  -17.538 -23.565 1.00 35.62 ? 218 THR E OG1   1 
ATOM   7290 C CG2   . THR C 1 221 ? -6.754  -16.338 -23.974 1.00 34.77 ? 218 THR E CG2   1 
ATOM   7291 N N     . LYS C 1 222 ? -2.471  -15.088 -22.381 1.00 33.57 ? 219 LYS E N     1 
ATOM   7292 C CA    . LYS C 1 222 ? -1.137  -15.424 -21.880 1.00 33.52 ? 219 LYS E CA    1 
ATOM   7293 C C     . LYS C 1 222 ? -0.313  -14.247 -21.300 1.00 32.61 ? 219 LYS E C     1 
ATOM   7294 O O     . LYS C 1 222 ? 0.387   -14.421 -20.298 1.00 32.26 ? 219 LYS E O     1 
ATOM   7295 C CB    . LYS C 1 222 ? -0.330  -16.087 -23.001 1.00 34.18 ? 219 LYS E CB    1 
ATOM   7296 C CG    . LYS C 1 222 ? -0.526  -17.602 -23.100 1.00 35.40 ? 219 LYS E CG    1 
ATOM   7297 C CD    . LYS C 1 222 ? 0.197   -18.158 -24.311 1.00 35.34 ? 219 LYS E CD    1 
ATOM   7298 C CE    . LYS C 1 222 ? 0.186   -19.685 -24.316 1.00 37.19 ? 219 LYS E CE    1 
ATOM   7299 N NZ    . LYS C 1 222 ? 1.106   -20.259 -25.370 1.00 37.67 ? 219 LYS E NZ    1 
ATOM   7300 N N     . LEU C 1 223 ? -0.380  -13.085 -21.953 1.00 31.43 ? 220 LEU E N     1 
ATOM   7301 C CA    . LEU C 1 223 ? 0.560   -11.989 -21.706 1.00 30.97 ? 220 LEU E CA    1 
ATOM   7302 C C     . LEU C 1 223 ? -0.002  -10.976 -20.723 1.00 30.22 ? 220 LEU E C     1 
ATOM   7303 O O     . LEU C 1 223 ? -1.161  -10.562 -20.836 1.00 30.33 ? 220 LEU E O     1 
ATOM   7304 C CB    . LEU C 1 223 ? 0.901   -11.269 -23.016 1.00 30.95 ? 220 LEU E CB    1 
ATOM   7305 C CG    . LEU C 1 223 ? 1.992   -10.197 -22.975 1.00 31.83 ? 220 LEU E CG    1 
ATOM   7306 C CD1   . LEU C 1 223 ? 3.320   -10.787 -22.472 1.00 31.88 ? 220 LEU E CD1   1 
ATOM   7307 C CD2   . LEU C 1 223 ? 2.155   -9.532  -24.354 1.00 31.08 ? 220 LEU E CD2   1 
ATOM   7308 N N     . VAL C 1 224 ? 0.837   -10.608 -19.752 1.00 29.62 ? 221 VAL E N     1 
ATOM   7309 C CA    . VAL C 1 224 ? 0.600   -9.478  -18.856 1.00 28.52 ? 221 VAL E CA    1 
ATOM   7310 C C     . VAL C 1 224 ? 1.881   -8.645  -18.874 1.00 27.80 ? 221 VAL E C     1 
ATOM   7311 O O     . VAL C 1 224 ? 2.949   -9.186  -18.662 1.00 27.76 ? 221 VAL E O     1 
ATOM   7312 C CB    . VAL C 1 224 ? 0.339   -9.960  -17.423 1.00 28.54 ? 221 VAL E CB    1 
ATOM   7313 C CG1   . VAL C 1 224 ? 0.282   -8.762  -16.438 1.00 28.96 ? 221 VAL E CG1   1 
ATOM   7314 C CG2   . VAL C 1 224 ? -0.940  -10.778 -17.360 1.00 27.45 ? 221 VAL E CG2   1 
ATOM   7315 N N     . VAL C 1 225 ? 1.767   -7.346  -19.130 1.00 26.86 ? 222 VAL E N     1 
ATOM   7316 C CA    . VAL C 1 225 ? 2.907   -6.448  -19.134 1.00 26.58 ? 222 VAL E CA    1 
ATOM   7317 C C     . VAL C 1 225 ? 2.901   -5.577  -17.864 1.00 26.01 ? 222 VAL E C     1 
ATOM   7318 O O     . VAL C 1 225 ? 2.025   -4.723  -17.682 1.00 26.25 ? 222 VAL E O     1 
ATOM   7319 C CB    . VAL C 1 225 ? 2.917   -5.566  -20.398 1.00 26.88 ? 222 VAL E CB    1 
ATOM   7320 C CG1   . VAL C 1 225 ? 4.138   -4.655  -20.413 1.00 26.95 ? 222 VAL E CG1   1 
ATOM   7321 C CG2   . VAL C 1 225 ? 2.890   -6.443  -21.662 1.00 27.33 ? 222 VAL E CG2   1 
ATOM   7322 N N     . SER C 1 226 ? 3.886   -5.830  -17.001 1.00 25.39 ? 223 SER E N     1 
ATOM   7323 C CA    . SER C 1 226 ? 4.110   -5.122  -15.734 1.00 24.99 ? 223 SER E CA    1 
ATOM   7324 C C     . SER C 1 226 ? 4.915   -3.832  -15.970 1.00 24.51 ? 223 SER E C     1 
ATOM   7325 O O     . SER C 1 226 ? 5.948   -3.848  -16.663 1.00 24.75 ? 223 SER E O     1 
ATOM   7326 C CB    . SER C 1 226 ? 4.828   -6.085  -14.758 1.00 25.30 ? 223 SER E CB    1 
ATOM   7327 O OG    . SER C 1 226 ? 5.412   -5.470  -13.614 1.00 27.18 ? 223 SER E OG    1 
ATOM   7328 N N     . ARG C 1 227 ? 4.437   -2.726  -15.401 1.00 23.49 ? 224 ARG E N     1 
ATOM   7329 C CA    . ARG C 1 227 ? 5.084   -1.416  -15.482 1.00 23.59 ? 224 ARG E CA    1 
ATOM   7330 C C     . ARG C 1 227 ? 5.184   -0.761  -14.084 1.00 23.41 ? 224 ARG E C     1 
ATOM   7331 O O     . ARG C 1 227 ? 4.512   -1.183  -13.138 1.00 23.64 ? 224 ARG E O     1 
ATOM   7332 C CB    . ARG C 1 227 ? 4.280   -0.477  -16.387 1.00 24.11 ? 224 ARG E CB    1 
ATOM   7333 C CG    . ARG C 1 227 ? 3.958   -0.980  -17.804 1.00 25.50 ? 224 ARG E CG    1 
ATOM   7334 C CD    . ARG C 1 227 ? 5.202   -1.047  -18.645 1.00 27.30 ? 224 ARG E CD    1 
ATOM   7335 N NE    . ARG C 1 227 ? 5.633   0.297   -19.056 1.00 27.51 ? 224 ARG E NE    1 
ATOM   7336 C CZ    . ARG C 1 227 ? 5.848   0.683   -20.313 1.00 28.72 ? 224 ARG E CZ    1 
ATOM   7337 N NH1   . ARG C 1 227 ? 5.712   -0.166  -21.332 1.00 28.99 ? 224 ARG E NH1   1 
ATOM   7338 N NH2   . ARG C 1 227 ? 6.215   1.935   -20.551 1.00 28.40 ? 224 ARG E NH2   1 
ATOM   7339 N N     . THR C 1 228 ? 6.002   0.286   -13.970 1.00 22.73 ? 225 THR E N     1 
ATOM   7340 C CA    . THR C 1 228 ? 6.163   1.024   -12.716 1.00 22.72 ? 225 THR E CA    1 
ATOM   7341 C C     . THR C 1 228 ? 6.353   2.532   -12.929 1.00 22.63 ? 225 THR E C     1 
ATOM   7342 O O     . THR C 1 228 ? 6.757   2.979   -14.004 1.00 22.29 ? 225 THR E O     1 
ATOM   7343 C CB    . THR C 1 228 ? 7.367   0.516   -11.891 1.00 22.68 ? 225 THR E CB    1 
ATOM   7344 O OG1   . THR C 1 228 ? 7.416   1.243   -10.658 1.00 22.55 ? 225 THR E OG1   1 
ATOM   7345 C CG2   . THR C 1 228 ? 8.709   0.700   -12.660 1.00 22.64 ? 225 THR E CG2   1 
ATOM   7346 N N     . MET C 1 229 ? 6.061   3.309   -11.894 1.00 22.70 ? 226 MET E N     1 
ATOM   7347 C CA    . MET C 1 229 ? 6.339   4.751   -11.913 1.00 22.76 ? 226 MET E CA    1 
ATOM   7348 C C     . MET C 1 229 ? 7.561   5.105   -11.087 1.00 22.32 ? 226 MET E C     1 
ATOM   7349 O O     . MET C 1 229 ? 7.847   6.278   -10.881 1.00 22.04 ? 226 MET E O     1 
ATOM   7350 C CB    . MET C 1 229 ? 5.136   5.517   -11.389 1.00 22.94 ? 226 MET E CB    1 
ATOM   7351 C CG    . MET C 1 229 ? 3.933   5.439   -12.305 1.00 23.75 ? 226 MET E CG    1 
ATOM   7352 S SD    . MET C 1 229 ? 2.579   6.472   -11.729 1.00 23.27 ? 226 MET E SD    1 
ATOM   7353 C CE    . MET C 1 229 ? 3.239   8.129   -12.024 1.00 21.54 ? 226 MET E CE    1 
ATOM   7354 N N     . SER C 1 230 ? 8.282   4.089   -10.622 1.00 22.33 ? 227 SER E N     1 
ATOM   7355 C CA    . SER C 1 230 ? 9.397   4.280   -9.707  1.00 22.93 ? 227 SER E CA    1 
ATOM   7356 C C     . SER C 1 230 ? 10.744  4.612   -10.369 1.00 23.22 ? 227 SER E C     1 
ATOM   7357 O O     . SER C 1 230 ? 11.669  5.075   -9.678  1.00 23.14 ? 227 SER E O     1 
ATOM   7358 C CB    . SER C 1 230 ? 9.564   3.032   -8.839  1.00 22.88 ? 227 SER E CB    1 
ATOM   7359 O OG    . SER C 1 230 ? 8.382   2.818   -8.066  1.00 24.22 ? 227 SER E OG    1 
HETATM 7360 N N1    . LLP C 1 231 ? 10.910  -4.716  -11.731 1.00 23.75 ? 228 LLP E N1    1 
HETATM 7361 C C2    . LLP C 1 231 ? 12.279  -4.576  -11.805 1.00 24.97 ? 228 LLP E C2    1 
HETATM 7362 C "C2'" . LLP C 1 231 ? 13.035  -5.600  -12.600 1.00 24.73 ? 228 LLP E "C2'" 1 
HETATM 7363 C C3    . LLP C 1 231 ? 12.926  -3.514  -11.155 1.00 25.04 ? 228 LLP E C3    1 
HETATM 7364 O O3    . LLP C 1 231 ? 14.157  -3.391  -11.209 1.00 25.80 ? 228 LLP E O3    1 
HETATM 7365 C C4    . LLP C 1 231 ? 12.170  -2.586  -10.430 1.00 24.65 ? 228 LLP E C4    1 
HETATM 7366 C "C4'" . LLP C 1 231 ? 12.861  -1.442  -9.728  1.00 25.87 ? 228 LLP E "C4'" 1 
HETATM 7367 C C5    . LLP C 1 231 ? 10.783  -2.739  -10.369 1.00 25.65 ? 228 LLP E C5    1 
HETATM 7368 C C6    . LLP C 1 231 ? 10.160  -3.803  -11.022 1.00 25.62 ? 228 LLP E C6    1 
HETATM 7369 C "C5'" . LLP C 1 231 ? 9.921   -1.747  -9.649  1.00 24.96 ? 228 LLP E "C5'" 1 
HETATM 7370 O OP4   . LLP C 1 231 ? 9.498   -1.942  -8.302  1.00 24.97 ? 228 LLP E OP4   1 
HETATM 7371 P P     . LLP C 1 231 ? 8.336   -1.050  -7.664  1.00 25.74 ? 228 LLP E P     1 
HETATM 7372 O OP1   . LLP C 1 231 ? 9.141   0.042   -7.092  1.00 26.10 ? 228 LLP E OP1   1 
HETATM 7373 O OP2   . LLP C 1 231 ? 7.378   -0.641  -8.717  1.00 26.16 ? 228 LLP E OP2   1 
HETATM 7374 O OP3   . LLP C 1 231 ? 7.785   -2.090  -6.780  1.00 26.06 ? 228 LLP E OP3   1 
HETATM 7375 N N     . LLP C 1 231 ? 10.870  4.396   -11.679 1.00 23.44 ? 228 LLP E N     1 
HETATM 7376 C CA    . LLP C 1 231 ? 12.190  4.533   -12.318 1.00 23.86 ? 228 LLP E CA    1 
HETATM 7377 C CB    . LLP C 1 231 ? 12.581  3.219   -13.022 1.00 24.40 ? 228 LLP E CB    1 
HETATM 7378 C CG    . LLP C 1 231 ? 12.486  1.956   -12.126 1.00 24.35 ? 228 LLP E CG    1 
HETATM 7379 C CD    . LLP C 1 231 ? 13.559  1.954   -11.003 1.00 26.59 ? 228 LLP E CD    1 
HETATM 7380 C CE    . LLP C 1 231 ? 13.336  0.881   -9.901  1.00 26.07 ? 228 LLP E CE    1 
HETATM 7381 N NZ    . LLP C 1 231 ? 12.697  -0.340  -10.460 1.00 28.55 ? 228 LLP E NZ    1 
HETATM 7382 C C     . LLP C 1 231 ? 12.242  5.775   -13.232 1.00 23.71 ? 228 LLP E C     1 
HETATM 7383 O O     . LLP C 1 231 ? 12.417  6.885   -12.741 1.00 22.96 ? 228 LLP E O     1 
ATOM   7384 N N     . ALA C 1 232 ? 12.043  5.599   -14.538 1.00 24.10 ? 229 ALA E N     1 
ATOM   7385 C CA    . ALA C 1 232 ? 11.968  6.730   -15.464 1.00 23.73 ? 229 ALA E CA    1 
ATOM   7386 C C     . ALA C 1 232 ? 10.937  7.733   -14.964 1.00 23.30 ? 229 ALA E C     1 
ATOM   7387 O O     . ALA C 1 232 ? 11.150  8.925   -15.042 1.00 22.34 ? 229 ALA E O     1 
ATOM   7388 C CB    . ALA C 1 232 ? 11.613  6.251   -16.854 1.00 23.28 ? 229 ALA E CB    1 
ATOM   7389 N N     . PHE C 1 233 ? 9.837   7.239   -14.388 1.00 23.86 ? 230 PHE E N     1 
ATOM   7390 C CA    . PHE C 1 233 ? 8.790   8.138   -13.894 1.00 24.04 ? 230 PHE E CA    1 
ATOM   7391 C C     . PHE C 1 233 ? 9.152   8.921   -12.624 1.00 24.21 ? 230 PHE E C     1 
ATOM   7392 O O     . PHE C 1 233 ? 8.348   9.722   -12.166 1.00 24.69 ? 230 PHE E O     1 
ATOM   7393 C CB    . PHE C 1 233 ? 7.479   7.387   -13.706 1.00 23.95 ? 230 PHE E CB    1 
ATOM   7394 C CG    . PHE C 1 233 ? 6.381   7.816   -14.644 1.00 24.22 ? 230 PHE E CG    1 
ATOM   7395 C CD1   . PHE C 1 233 ? 5.969   9.141   -14.697 1.00 24.43 ? 230 PHE E CD1   1 
ATOM   7396 C CD2   . PHE C 1 233 ? 5.712   6.890   -15.419 1.00 24.49 ? 230 PHE E CD2   1 
ATOM   7397 C CE1   . PHE C 1 233 ? 4.945   9.541   -15.540 1.00 24.33 ? 230 PHE E CE1   1 
ATOM   7398 C CE2   . PHE C 1 233 ? 4.684   7.285   -16.267 1.00 24.13 ? 230 PHE E CE2   1 
ATOM   7399 C CZ    . PHE C 1 233 ? 4.299   8.622   -16.316 1.00 24.08 ? 230 PHE E CZ    1 
ATOM   7400 N N     . ASP C 1 234 ? 10.327  8.694   -12.030 1.00 24.97 ? 231 ASP E N     1 
ATOM   7401 C CA    . ASP C 1 234 ? 10.844  9.644   -11.030 1.00 24.56 ? 231 ASP E CA    1 
ATOM   7402 C C     . ASP C 1 234 ? 9.887   9.745   -9.799  1.00 24.40 ? 231 ASP E C     1 
ATOM   7403 O O     . ASP C 1 234 ? 9.712   10.832  -9.211  1.00 23.40 ? 231 ASP E O     1 
ATOM   7404 C CB    . ASP C 1 234 ? 10.993  11.009  -11.756 1.00 24.97 ? 231 ASP E CB    1 
ATOM   7405 C CG    . ASP C 1 234 ? 11.781  12.034  -10.990 1.00 26.59 ? 231 ASP E CG    1 
ATOM   7406 O OD1   . ASP C 1 234 ? 12.853  11.714  -10.456 1.00 28.84 ? 231 ASP E OD1   1 
ATOM   7407 O OD2   . ASP C 1 234 ? 11.338  13.209  -10.967 1.00 30.93 ? 231 ASP E OD2   1 
ATOM   7408 N N     . PHE C 1 235 ? 9.292   8.612   -9.410  1.00 24.03 ? 232 PHE E N     1 
ATOM   7409 C CA    . PHE C 1 235 ? 8.226   8.596   -8.397  1.00 23.84 ? 232 PHE E CA    1 
ATOM   7410 C C     . PHE C 1 235 ? 8.264   7.343   -7.504  1.00 23.53 ? 232 PHE E C     1 
ATOM   7411 O O     . PHE C 1 235 ? 7.219   6.870   -7.031  1.00 22.88 ? 232 PHE E O     1 
ATOM   7412 C CB    . PHE C 1 235 ? 6.877   8.680   -9.113  1.00 25.01 ? 232 PHE E CB    1 
ATOM   7413 C CG    . PHE C 1 235 ? 5.794   9.361   -8.315  1.00 26.01 ? 232 PHE E CG    1 
ATOM   7414 C CD1   . PHE C 1 235 ? 5.899   10.701  -7.982  1.00 28.30 ? 232 PHE E CD1   1 
ATOM   7415 C CD2   . PHE C 1 235 ? 4.656   8.671   -7.938  1.00 27.13 ? 232 PHE E CD2   1 
ATOM   7416 C CE1   . PHE C 1 235 ? 4.892   11.331  -7.272  1.00 28.04 ? 232 PHE E CE1   1 
ATOM   7417 C CE2   . PHE C 1 235 ? 3.666   9.289   -7.215  1.00 27.09 ? 232 PHE E CE2   1 
ATOM   7418 C CZ    . PHE C 1 235 ? 3.782   10.615  -6.889  1.00 27.30 ? 232 PHE E CZ    1 
ATOM   7419 N N     . ALA C 1 236 ? 9.465   6.815   -7.268  1.00 23.03 ? 233 ALA E N     1 
ATOM   7420 C CA    . ALA C 1 236 ? 9.668   5.639   -6.401  1.00 22.82 ? 233 ALA E CA    1 
ATOM   7421 C C     . ALA C 1 236 ? 8.977   5.803   -5.046  1.00 22.75 ? 233 ALA E C     1 
ATOM   7422 O O     . ALA C 1 236 ? 8.399   4.843   -4.511  1.00 22.59 ? 233 ALA E O     1 
ATOM   7423 C CB    . ALA C 1 236 ? 11.134  5.378   -6.210  1.00 22.07 ? 233 ALA E CB    1 
ATOM   7424 N N     . GLY C 1 237 ? 9.022   7.032   -4.518  1.00 22.37 ? 234 GLY E N     1 
ATOM   7425 C CA    . GLY C 1 237 ? 8.439   7.358   -3.236  1.00 21.78 ? 234 GLY E CA    1 
ATOM   7426 C C     . GLY C 1 237 ? 6.939   7.242   -3.192  1.00 21.41 ? 234 GLY E C     1 
ATOM   7427 O O     . GLY C 1 237 ? 6.361   7.154   -2.109  1.00 21.61 ? 234 GLY E O     1 
ATOM   7428 N N     . GLY C 1 238 ? 6.304   7.264   -4.366  1.00 22.05 ? 235 GLY E N     1 
ATOM   7429 C CA    . GLY C 1 238 ? 4.843   7.141   -4.493  1.00 21.51 ? 235 GLY E CA    1 
ATOM   7430 C C     . GLY C 1 238 ? 4.303   5.718   -4.524  1.00 21.67 ? 235 GLY E C     1 
ATOM   7431 O O     . GLY C 1 238 ? 3.080   5.513   -4.419  1.00 22.14 ? 235 GLY E O     1 
ATOM   7432 N N     . ARG C 1 239 ? 5.194   4.743   -4.691  1.00 21.38 ? 236 ARG E N     1 
ATOM   7433 C CA    . ARG C 1 239 ? 4.822   3.310   -4.725  1.00 21.18 ? 236 ARG E CA    1 
ATOM   7434 C C     . ARG C 1 239 ? 3.620   3.065   -5.632  1.00 20.97 ? 236 ARG E C     1 
ATOM   7435 O O     . ARG C 1 239 ? 2.514   2.773   -5.152  1.00 21.21 ? 236 ARG E O     1 
ATOM   7436 C CB    . ARG C 1 239 ? 4.508   2.763   -3.335  1.00 21.20 ? 236 ARG E CB    1 
ATOM   7437 C CG    . ARG C 1 239 ? 5.510   3.059   -2.241  1.00 21.69 ? 236 ARG E CG    1 
ATOM   7438 C CD    . ARG C 1 239 ? 6.925   2.645   -2.590  1.00 21.62 ? 236 ARG E CD    1 
ATOM   7439 N NE    . ARG C 1 239 ? 7.039   1.238   -2.931  1.00 21.99 ? 236 ARG E NE    1 
ATOM   7440 C CZ    . ARG C 1 239 ? 7.467   0.772   -4.100  1.00 23.13 ? 236 ARG E CZ    1 
ATOM   7441 N NH1   . ARG C 1 239 ? 7.820   1.603   -5.088  1.00 24.18 ? 236 ARG E NH1   1 
ATOM   7442 N NH2   . ARG C 1 239 ? 7.553   -0.542  -4.274  1.00 23.30 ? 236 ARG E NH2   1 
ATOM   7443 N N     . LEU C 1 240 ? 3.840   3.207   -6.936  1.00 20.73 ? 237 LEU E N     1 
ATOM   7444 C CA    . LEU C 1 240 ? 2.774   3.037   -7.922  1.00 20.99 ? 237 LEU E CA    1 
ATOM   7445 C C     . LEU C 1 240 ? 3.255   2.119   -9.035  1.00 20.96 ? 237 LEU E C     1 
ATOM   7446 O O     . LEU C 1 240 ? 4.010   2.526   -9.930  1.00 20.92 ? 237 LEU E O     1 
ATOM   7447 C CB    . LEU C 1 240 ? 2.316   4.396   -8.477  1.00 20.27 ? 237 LEU E CB    1 
ATOM   7448 C CG    . LEU C 1 240 ? 0.897   4.480   -9.067  1.00 21.25 ? 237 LEU E CG    1 
ATOM   7449 C CD1   . LEU C 1 240 ? 0.635   3.391   -10.098 1.00 22.49 ? 237 LEU E CD1   1 
ATOM   7450 C CD2   . LEU C 1 240 ? -0.153  4.434   -7.950  1.00 21.68 ? 237 LEU E CD2   1 
ATOM   7451 N N     . GLY C 1 241 ? 2.809   0.875   -8.968  1.00 21.11 ? 238 GLY E N     1 
ATOM   7452 C CA    . GLY C 1 241 ? 3.092   -0.111  -10.011 1.00 21.34 ? 238 GLY E CA    1 
ATOM   7453 C C     . GLY C 1 241 ? 1.812   -0.459  -10.730 1.00 21.60 ? 238 GLY E C     1 
ATOM   7454 O O     . GLY C 1 241 ? 0.701   -0.315  -10.177 1.00 21.38 ? 238 GLY E O     1 
ATOM   7455 N N     . TYR C 1 242 ? 1.941   -0.911  -11.970 1.00 22.14 ? 239 TYR E N     1 
ATOM   7456 C CA    . TYR C 1 242 ? 0.756   -1.297  -12.719 1.00 22.67 ? 239 TYR E CA    1 
ATOM   7457 C C     . TYR C 1 242 ? 0.986   -2.349  -13.802 1.00 23.08 ? 239 TYR E C     1 
ATOM   7458 O O     . TYR C 1 242 ? 2.130   -2.629  -14.191 1.00 21.88 ? 239 TYR E O     1 
ATOM   7459 C CB    . TYR C 1 242 ? 0.102   -0.062  -13.305 1.00 23.40 ? 239 TYR E CB    1 
ATOM   7460 C CG    . TYR C 1 242 ? 0.879   0.680   -14.360 1.00 23.43 ? 239 TYR E CG    1 
ATOM   7461 C CD1   . TYR C 1 242 ? 1.860   1.606   -14.015 1.00 23.78 ? 239 TYR E CD1   1 
ATOM   7462 C CD2   . TYR C 1 242 ? 0.581   0.505   -15.705 1.00 23.71 ? 239 TYR E CD2   1 
ATOM   7463 C CE1   . TYR C 1 242 ? 2.552   2.309   -14.982 1.00 24.44 ? 239 TYR E CE1   1 
ATOM   7464 C CE2   . TYR C 1 242 ? 1.258   1.202   -16.681 1.00 24.62 ? 239 TYR E CE2   1 
ATOM   7465 C CZ    . TYR C 1 242 ? 2.239   2.110   -16.317 1.00 24.99 ? 239 TYR E CZ    1 
ATOM   7466 O OH    . TYR C 1 242 ? 2.907   2.798   -17.293 1.00 25.39 ? 239 TYR E OH    1 
ATOM   7467 N N     . PHE C 1 243 ? -0.107  -2.940  -14.275 1.00 23.74 ? 240 PHE E N     1 
ATOM   7468 C CA    . PHE C 1 243 ? -0.024  -3.768  -15.454 1.00 24.61 ? 240 PHE E CA    1 
ATOM   7469 C C     . PHE C 1 243 ? -1.050  -3.408  -16.510 1.00 25.24 ? 240 PHE E C     1 
ATOM   7470 O O     . PHE C 1 243 ? -2.082  -2.780  -16.223 1.00 25.58 ? 240 PHE E O     1 
ATOM   7471 C CB    . PHE C 1 243 ? -0.011  -5.268  -15.111 1.00 25.66 ? 240 PHE E CB    1 
ATOM   7472 C CG    . PHE C 1 243 ? -1.349  -5.850  -14.758 1.00 26.47 ? 240 PHE E CG    1 
ATOM   7473 C CD1   . PHE C 1 243 ? -2.309  -6.089  -15.748 1.00 27.60 ? 240 PHE E CD1   1 
ATOM   7474 C CD2   . PHE C 1 243 ? -1.626  -6.233  -13.456 1.00 26.49 ? 240 PHE E CD2   1 
ATOM   7475 C CE1   . PHE C 1 243 ? -3.535  -6.664  -15.428 1.00 26.37 ? 240 PHE E CE1   1 
ATOM   7476 C CE2   . PHE C 1 243 ? -2.844  -6.808  -13.127 1.00 26.82 ? 240 PHE E CE2   1 
ATOM   7477 C CZ    . PHE C 1 243 ? -3.805  -7.029  -14.120 1.00 26.81 ? 240 PHE E CZ    1 
ATOM   7478 N N     . VAL C 1 244 ? -0.698  -3.779  -17.744 1.00 25.52 ? 241 VAL E N     1 
ATOM   7479 C CA    . VAL C 1 244 ? -1.528  -3.628  -18.922 1.00 25.79 ? 241 VAL E CA    1 
ATOM   7480 C C     . VAL C 1 244 ? -1.786  -5.027  -19.500 1.00 26.33 ? 241 VAL E C     1 
ATOM   7481 O O     . VAL C 1 244 ? -0.841  -5.784  -19.773 1.00 26.44 ? 241 VAL E O     1 
ATOM   7482 C CB    . VAL C 1 244 ? -0.834  -2.770  -19.999 1.00 25.96 ? 241 VAL E CB    1 
ATOM   7483 C CG1   . VAL C 1 244 ? -1.832  -2.376  -21.099 1.00 26.00 ? 241 VAL E CG1   1 
ATOM   7484 C CG2   . VAL C 1 244 ? -0.222  -1.528  -19.392 1.00 25.08 ? 241 VAL E CG2   1 
ATOM   7485 N N     . ALA C 1 245 ? -3.058  -5.380  -19.666 1.00 26.73 ? 242 ALA E N     1 
ATOM   7486 C CA    . ALA C 1 245 ? -3.426  -6.720  -20.123 1.00 27.27 ? 242 ALA E CA    1 
ATOM   7487 C C     . ALA C 1 245 ? -4.856  -6.750  -20.671 1.00 27.78 ? 242 ALA E C     1 
ATOM   7488 O O     . ALA C 1 245 ? -5.532  -5.719  -20.745 1.00 28.35 ? 242 ALA E O     1 
ATOM   7489 C CB    . ALA C 1 245 ? -3.281  -7.713  -18.971 1.00 26.86 ? 242 ALA E CB    1 
ATOM   7490 N N     . ASN C 1 246 ? -5.316  -7.935  -21.055 1.00 28.66 ? 243 ASN E N     1 
ATOM   7491 C CA    . ASN C 1 246 ? -6.716  -8.121  -21.410 1.00 28.95 ? 243 ASN E CA    1 
ATOM   7492 C C     . ASN C 1 246 ? -7.563  -7.863  -20.160 1.00 28.97 ? 243 ASN E C     1 
ATOM   7493 O O     . ASN C 1 246 ? -7.153  -8.243  -19.063 1.00 28.73 ? 243 ASN E O     1 
ATOM   7494 C CB    . ASN C 1 246 ? -6.947  -9.554  -21.929 1.00 29.57 ? 243 ASN E CB    1 
ATOM   7495 C CG    . ASN C 1 246 ? -8.363  -9.784  -22.433 1.00 30.33 ? 243 ASN E CG    1 
ATOM   7496 O OD1   . ASN C 1 246 ? -9.273  -10.082 -21.656 1.00 34.27 ? 243 ASN E OD1   1 
ATOM   7497 N ND2   . ASN C 1 246 ? -8.553  -9.651  -23.745 1.00 32.98 ? 243 ASN E ND2   1 
ATOM   7498 N N     . PRO C 1 247 ? -8.749  -7.243  -20.318 1.00 29.12 ? 244 PRO E N     1 
ATOM   7499 C CA    . PRO C 1 247 ? -9.666  -7.010  -19.179 1.00 29.32 ? 244 PRO E CA    1 
ATOM   7500 C C     . PRO C 1 247 ? -9.949  -8.209  -18.268 1.00 29.57 ? 244 PRO E C     1 
ATOM   7501 O O     . PRO C 1 247 ? -10.295 -8.022  -17.095 1.00 30.14 ? 244 PRO E O     1 
ATOM   7502 C CB    . PRO C 1 247 ? -10.952 -6.548  -19.862 1.00 29.50 ? 244 PRO E CB    1 
ATOM   7503 C CG    . PRO C 1 247 ? -10.483 -5.890  -21.120 1.00 29.39 ? 244 PRO E CG    1 
ATOM   7504 C CD    . PRO C 1 247 ? -9.301  -6.702  -21.572 1.00 29.31 ? 244 PRO E CD    1 
ATOM   7505 N N     . ALA C 1 248 ? -9.811  -9.422  -18.793 1.00 29.64 ? 245 ALA E N     1 
ATOM   7506 C CA    . ALA C 1 248 ? -10.044 -10.646 -18.005 1.00 29.79 ? 245 ALA E CA    1 
ATOM   7507 C C     . ALA C 1 248 ? -9.113  -10.756 -16.800 1.00 29.77 ? 245 ALA E C     1 
ATOM   7508 O O     . ALA C 1 248 ? -9.518  -11.218 -15.739 1.00 29.64 ? 245 ALA E O     1 
ATOM   7509 C CB    . ALA C 1 248 ? -9.894  -11.880 -18.895 1.00 29.68 ? 245 ALA E CB    1 
ATOM   7510 N N     . PHE C 1 249 ? -7.858  -10.353 -16.991 1.00 30.26 ? 246 PHE E N     1 
ATOM   7511 C CA    . PHE C 1 249 ? -6.851  -10.359 -15.918 1.00 30.29 ? 246 PHE E CA    1 
ATOM   7512 C C     . PHE C 1 249 ? -7.169  -9.382  -14.790 1.00 30.10 ? 246 PHE E C     1 
ATOM   7513 O O     . PHE C 1 249 ? -6.839  -9.633  -13.631 1.00 30.33 ? 246 PHE E O     1 
ATOM   7514 C CB    . PHE C 1 249 ? -5.467  -10.021 -16.482 1.00 30.85 ? 246 PHE E CB    1 
ATOM   7515 C CG    . PHE C 1 249 ? -4.768  -11.189 -17.098 1.00 31.00 ? 246 PHE E CG    1 
ATOM   7516 C CD1   . PHE C 1 249 ? -4.132  -12.121 -16.299 1.00 31.69 ? 246 PHE E CD1   1 
ATOM   7517 C CD2   . PHE C 1 249 ? -4.758  -11.363 -18.472 1.00 31.60 ? 246 PHE E CD2   1 
ATOM   7518 C CE1   . PHE C 1 249 ? -3.491  -13.210 -16.863 1.00 32.71 ? 246 PHE E CE1   1 
ATOM   7519 C CE2   . PHE C 1 249 ? -4.114  -12.441 -19.048 1.00 31.84 ? 246 PHE E CE2   1 
ATOM   7520 C CZ    . PHE C 1 249 ? -3.486  -13.370 -18.248 1.00 32.33 ? 246 PHE E CZ    1 
ATOM   7521 N N     . ILE C 1 250 ? -7.782  -8.256  -15.122 1.00 30.25 ? 247 ILE E N     1 
ATOM   7522 C CA    . ILE C 1 250 ? -8.264  -7.358  -14.073 1.00 30.72 ? 247 ILE E CA    1 
ATOM   7523 C C     . ILE C 1 250 ? -9.269  -8.117  -13.209 1.00 30.68 ? 247 ILE E C     1 
ATOM   7524 O O     . ILE C 1 250 ? -9.188  -8.095  -11.982 1.00 30.48 ? 247 ILE E O     1 
ATOM   7525 C CB    . ILE C 1 250 ? -8.906  -6.079  -14.621 1.00 30.41 ? 247 ILE E CB    1 
ATOM   7526 C CG1   . ILE C 1 250 ? -7.842  -5.110  -15.170 1.00 31.59 ? 247 ILE E CG1   1 
ATOM   7527 C CG2   . ILE C 1 250 ? -9.670  -5.376  -13.520 1.00 31.02 ? 247 ILE E CG2   1 
ATOM   7528 C CD1   . ILE C 1 250 ? -6.756  -5.751  -16.075 1.00 30.66 ? 247 ILE E CD1   1 
ATOM   7529 N N     . ASP C 1 251 ? -10.189 -8.834  -13.846 1.00 31.13 ? 248 ASP E N     1 
ATOM   7530 C CA    . ASP C 1 251 ? -11.205 -9.563  -13.086 1.00 31.39 ? 248 ASP E CA    1 
ATOM   7531 C C     . ASP C 1 251 ? -10.561 -10.629 -12.212 1.00 31.11 ? 248 ASP E C     1 
ATOM   7532 O O     . ASP C 1 251 ? -11.041 -10.887 -11.110 1.00 31.16 ? 248 ASP E O     1 
ATOM   7533 C CB    . ASP C 1 251 ? -12.270 -10.163 -14.013 1.00 32.49 ? 248 ASP E CB    1 
ATOM   7534 C CG    . ASP C 1 251 ? -13.034 -9.091  -14.792 1.00 35.78 ? 248 ASP E CG    1 
ATOM   7535 O OD1   . ASP C 1 251 ? -12.850 -7.882  -14.486 1.00 40.73 ? 248 ASP E OD1   1 
ATOM   7536 O OD2   . ASP C 1 251 ? -13.815 -9.441  -15.707 1.00 40.35 ? 248 ASP E OD2   1 
ATOM   7537 N N     . ALA C 1 252 ? -9.452  -11.204 -12.684 1.00 30.43 ? 249 ALA E N     1 
ATOM   7538 C CA    . ALA C 1 252 ? -8.694  -12.193 -11.905 1.00 30.51 ? 249 ALA E CA    1 
ATOM   7539 C C     . ALA C 1 252 ? -8.083  -11.591 -10.639 1.00 30.15 ? 249 ALA E C     1 
ATOM   7540 O O     . ALA C 1 252 ? -8.173  -12.183 -9.564  1.00 29.71 ? 249 ALA E O     1 
ATOM   7541 C CB    . ALA C 1 252 ? -7.587  -12.838 -12.771 1.00 29.92 ? 249 ALA E CB    1 
ATOM   7542 N N     . VAL C 1 253 ? -7.445  -10.427 -10.765 1.00 30.06 ? 250 VAL E N     1 
ATOM   7543 C CA    . VAL C 1 253 ? -6.741  -9.845  -9.615  1.00 30.43 ? 250 VAL E CA    1 
ATOM   7544 C C     . VAL C 1 253 ? -7.708  -9.266  -8.583  1.00 30.71 ? 250 VAL E C     1 
ATOM   7545 O O     . VAL C 1 253 ? -7.398  -9.246  -7.395  1.00 30.66 ? 250 VAL E O     1 
ATOM   7546 C CB    . VAL C 1 253 ? -5.647  -8.819  -10.019 1.00 30.07 ? 250 VAL E CB    1 
ATOM   7547 C CG1   . VAL C 1 253 ? -4.578  -9.517  -10.814 1.00 29.20 ? 250 VAL E CG1   1 
ATOM   7548 C CG2   . VAL C 1 253 ? -6.227  -7.653  -10.801 1.00 29.34 ? 250 VAL E CG2   1 
ATOM   7549 N N     . MET C 1 254 ? -8.892  -8.857  -9.025  1.00 31.05 ? 251 MET E N     1 
ATOM   7550 C CA    . MET C 1 254 ? -9.944  -8.413  -8.096  1.00 32.03 ? 251 MET E CA    1 
ATOM   7551 C C     . MET C 1 254 ? -10.332 -9.462  -7.059  1.00 31.39 ? 251 MET E C     1 
ATOM   7552 O O     . MET C 1 254 ? -10.855 -9.135  -5.994  1.00 31.85 ? 251 MET E O     1 
ATOM   7553 C CB    . MET C 1 254 ? -11.195 -8.007  -8.862  1.00 32.31 ? 251 MET E CB    1 
ATOM   7554 C CG    . MET C 1 254 ? -10.924 -6.949  -9.895  1.00 34.02 ? 251 MET E CG    1 
ATOM   7555 S SD    . MET C 1 254 ? -11.975 -5.530  -9.687  1.00 37.33 ? 251 MET E SD    1 
ATOM   7556 C CE    . MET C 1 254 ? -11.942 -4.797  -11.316 1.00 34.91 ? 251 MET E CE    1 
ATOM   7557 N N     . LEU C 1 255 ? -10.086 -10.721 -7.392  1.00 30.92 ? 252 LEU E N     1 
ATOM   7558 C CA    . LEU C 1 255 ? -10.344 -11.845 -6.506  1.00 30.37 ? 252 LEU E CA    1 
ATOM   7559 C C     . LEU C 1 255 ? -9.315  -11.964 -5.393  1.00 29.84 ? 252 LEU E C     1 
ATOM   7560 O O     . LEU C 1 255 ? -9.631  -12.461 -4.315  1.00 30.40 ? 252 LEU E O     1 
ATOM   7561 C CB    . LEU C 1 255 ? -10.358 -13.135 -7.324  1.00 30.81 ? 252 LEU E CB    1 
ATOM   7562 C CG    . LEU C 1 255 ? -11.452 -13.188 -8.396  1.00 31.68 ? 252 LEU E CG    1 
ATOM   7563 C CD1   . LEU C 1 255 ? -11.100 -14.197 -9.484  1.00 33.03 ? 252 LEU E CD1   1 
ATOM   7564 C CD2   . LEU C 1 255 ? -12.777 -13.531 -7.743  1.00 31.90 ? 252 LEU E CD2   1 
ATOM   7565 N N     . VAL C 1 256 ? -8.090  -11.502 -5.651  1.00 29.08 ? 253 VAL E N     1 
ATOM   7566 C CA    . VAL C 1 256 ? -6.993  -11.597 -4.681  1.00 28.17 ? 253 VAL E CA    1 
ATOM   7567 C C     . VAL C 1 256 ? -6.546  -10.252 -4.045  1.00 27.39 ? 253 VAL E C     1 
ATOM   7568 O O     . VAL C 1 256 ? -5.939  -10.254 -2.982  1.00 26.64 ? 253 VAL E O     1 
ATOM   7569 C CB    . VAL C 1 256 ? -5.779  -12.273 -5.321  1.00 28.01 ? 253 VAL E CB    1 
ATOM   7570 C CG1   . VAL C 1 256 ? -6.080  -13.722 -5.605  1.00 27.79 ? 253 VAL E CG1   1 
ATOM   7571 C CG2   . VAL C 1 256 ? -5.383  -11.561 -6.600  1.00 28.65 ? 253 VAL E CG2   1 
ATOM   7572 N N     . ARG C 1 257 ? -6.829  -9.117  -4.681  1.00 26.83 ? 254 ARG E N     1 
ATOM   7573 C CA    . ARG C 1 257 ? -6.392  -7.815  -4.135  1.00 26.64 ? 254 ARG E CA    1 
ATOM   7574 C C     . ARG C 1 257 ? -7.013  -7.540  -2.763  1.00 26.16 ? 254 ARG E C     1 
ATOM   7575 O O     . ARG C 1 257 ? -8.138  -7.954  -2.473  1.00 25.78 ? 254 ARG E O     1 
ATOM   7576 C CB    . ARG C 1 257 ? -6.695  -6.658  -5.104  1.00 26.87 ? 254 ARG E CB    1 
ATOM   7577 C CG    . ARG C 1 257 ? -8.180  -6.479  -5.476  1.00 27.13 ? 254 ARG E CG    1 
ATOM   7578 C CD    . ARG C 1 257 ? -8.836  -5.316  -4.753  1.00 29.07 ? 254 ARG E CD    1 
ATOM   7579 N NE    . ARG C 1 257 ? -10.295 -5.290  -4.905  1.00 29.11 ? 254 ARG E NE    1 
ATOM   7580 C CZ    . ARG C 1 257 ? -11.138 -5.988  -4.149  1.00 30.79 ? 254 ARG E CZ    1 
ATOM   7581 N NH1   . ARG C 1 257 ? -10.694 -6.839  -3.230  1.00 31.69 ? 254 ARG E NH1   1 
ATOM   7582 N NH2   . ARG C 1 257 ? -12.446 -5.873  -4.340  1.00 32.99 ? 254 ARG E NH2   1 
ATOM   7583 N N     . LEU C 1 258 ? -6.258  -6.877  -1.902  1.00 25.96 ? 255 LEU E N     1 
ATOM   7584 C CA    . LEU C 1 258 ? -6.811  -6.392  -0.651  1.00 26.13 ? 255 LEU E CA    1 
ATOM   7585 C C     . LEU C 1 258 ? -7.731  -5.248  -0.995  1.00 25.66 ? 255 LEU E C     1 
ATOM   7586 O O     . LEU C 1 258 ? -7.331  -4.358  -1.733  1.00 25.50 ? 255 LEU E O     1 
ATOM   7587 C CB    . LEU C 1 258 ? -5.709  -5.870  0.276   1.00 26.84 ? 255 LEU E CB    1 
ATOM   7588 C CG    . LEU C 1 258 ? -4.715  -6.899  0.821   1.00 28.01 ? 255 LEU E CG    1 
ATOM   7589 C CD1   . LEU C 1 258 ? -3.711  -6.226  1.745   1.00 28.99 ? 255 LEU E CD1   1 
ATOM   7590 C CD2   . LEU C 1 258 ? -5.425  -8.012  1.541   1.00 28.47 ? 255 LEU E CD2   1 
ATOM   7591 N N     . PRO C 1 259 ? -8.962  -5.244  -0.457  1.00 25.06 ? 256 PRO E N     1 
ATOM   7592 C CA    . PRO C 1 259 ? -9.826  -4.137  -0.835  1.00 25.01 ? 256 PRO E CA    1 
ATOM   7593 C C     . PRO C 1 259 ? -9.289  -2.813  -0.308  1.00 24.46 ? 256 PRO E C     1 
ATOM   7594 O O     . PRO C 1 259 ? -8.738  -2.750  0.790   1.00 24.75 ? 256 PRO E O     1 
ATOM   7595 C CB    . PRO C 1 259 ? -11.188 -4.492  -0.199  1.00 25.46 ? 256 PRO E CB    1 
ATOM   7596 C CG    . PRO C 1 259 ? -11.076 -5.888  0.270   1.00 24.87 ? 256 PRO E CG    1 
ATOM   7597 C CD    . PRO C 1 259 ? -9.612  -6.157  0.493   1.00 25.53 ? 256 PRO E CD    1 
ATOM   7598 N N     . TYR C 1 260 ? -9.444  -1.766  -1.103  1.00 24.59 ? 257 TYR E N     1 
ATOM   7599 C CA    . TYR C 1 260 ? -8.939  -0.438  -0.769  1.00 24.39 ? 257 TYR E CA    1 
ATOM   7600 C C     . TYR C 1 260 ? -7.425  -0.437  -0.628  1.00 24.13 ? 257 TYR E C     1 
ATOM   7601 O O     . TYR C 1 260 ? -6.870  0.345   0.131   1.00 24.00 ? 257 TYR E O     1 
ATOM   7602 C CB    . TYR C 1 260 ? -9.576  0.074   0.515   1.00 24.41 ? 257 TYR E CB    1 
ATOM   7603 C CG    . TYR C 1 260 ? -11.078 -0.035  0.556   1.00 24.45 ? 257 TYR E CG    1 
ATOM   7604 C CD1   . TYR C 1 260 ? -11.885 0.867   -0.130  1.00 24.14 ? 257 TYR E CD1   1 
ATOM   7605 C CD2   . TYR C 1 260 ? -11.696 -1.031  1.304   1.00 25.15 ? 257 TYR E CD2   1 
ATOM   7606 C CE1   . TYR C 1 260 ? -13.278 0.770   -0.070  1.00 25.56 ? 257 TYR E CE1   1 
ATOM   7607 C CE2   . TYR C 1 260 ? -13.079 -1.144  1.360   1.00 24.14 ? 257 TYR E CE2   1 
ATOM   7608 C CZ    . TYR C 1 260 ? -13.861 -0.247  0.683   1.00 24.97 ? 257 TYR E CZ    1 
ATOM   7609 O OH    . TYR C 1 260 ? -15.230 -0.359  0.779   1.00 27.30 ? 257 TYR E OH    1 
ATOM   7610 N N     . HIS C 1 261 ? -6.758  -1.326  -1.348  1.00 24.25 ? 258 HIS E N     1 
ATOM   7611 C CA    . HIS C 1 261 ? -5.306  -1.443  -1.245  1.00 24.54 ? 258 HIS E CA    1 
ATOM   7612 C C     . HIS C 1 261 ? -4.539  -0.179  -1.636  1.00 24.51 ? 258 HIS E C     1 
ATOM   7613 O O     . HIS C 1 261 ? -3.379  -0.041  -1.274  1.00 25.82 ? 258 HIS E O     1 
ATOM   7614 C CB    . HIS C 1 261 ? -4.795  -2.621  -2.084  1.00 24.56 ? 258 HIS E CB    1 
ATOM   7615 C CG    . HIS C 1 261 ? -4.810  -2.367  -3.555  1.00 24.95 ? 258 HIS E CG    1 
ATOM   7616 N ND1   . HIS C 1 261 ? -5.976  -2.242  -4.278  1.00 24.36 ? 258 HIS E ND1   1 
ATOM   7617 C CD2   . HIS C 1 261 ? -3.795  -2.237  -4.447  1.00 25.77 ? 258 HIS E CD2   1 
ATOM   7618 C CE1   . HIS C 1 261 ? -5.681  -2.029  -5.548  1.00 24.39 ? 258 HIS E CE1   1 
ATOM   7619 N NE2   . HIS C 1 261 ? -4.365  -2.016  -5.677  1.00 24.95 ? 258 HIS E NE2   1 
ATOM   7620 N N     . LEU C 1 262 ? -5.169  0.733   -2.374  1.00 24.57 ? 259 LEU E N     1 
ATOM   7621 C CA    . LEU C 1 262 ? -4.498  1.934   -2.871  1.00 24.46 ? 259 LEU E CA    1 
ATOM   7622 C C     . LEU C 1 262 ? -5.096  3.195   -2.210  1.00 24.06 ? 259 LEU E C     1 
ATOM   7623 O O     . LEU C 1 262 ? -6.292  3.457   -2.322  1.00 24.12 ? 259 LEU E O     1 
ATOM   7624 C CB    . LEU C 1 262 ? -4.644  1.968   -4.398  1.00 25.10 ? 259 LEU E CB    1 
ATOM   7625 C CG    . LEU C 1 262 ? -3.451  2.275   -5.326  1.00 25.84 ? 259 LEU E CG    1 
ATOM   7626 C CD1   . LEU C 1 262 ? -2.111  1.827   -4.805  1.00 25.79 ? 259 LEU E CD1   1 
ATOM   7627 C CD2   . LEU C 1 262 ? -3.721  1.654   -6.720  1.00 24.49 ? 259 LEU E CD2   1 
ATOM   7628 N N     . SER C 1 263 ? -4.281  3.954   -1.497  1.00 23.81 ? 260 SER E N     1 
ATOM   7629 C CA    . SER C 1 263 ? -4.797  5.088   -0.740  1.00 24.23 ? 260 SER E CA    1 
ATOM   7630 C C     . SER C 1 263 ? -5.257  6.234   -1.639  1.00 24.08 ? 260 SER E C     1 
ATOM   7631 O O     . SER C 1 263 ? -4.810  6.374   -2.769  1.00 24.34 ? 260 SER E O     1 
ATOM   7632 C CB    . SER C 1 263 ? -3.766  5.606   0.263   1.00 23.99 ? 260 SER E CB    1 
ATOM   7633 O OG    . SER C 1 263 ? -2.707  6.310   -0.371  1.00 25.02 ? 260 SER E OG    1 
ATOM   7634 N N     . ALA C 1 264 ? -6.156  7.050   -1.103  1.00 24.33 ? 261 ALA E N     1 
ATOM   7635 C CA    . ALA C 1 264 ? -6.603  8.286   -1.749  1.00 24.31 ? 261 ALA E CA    1 
ATOM   7636 C C     . ALA C 1 264 ? -5.428  9.170   -2.185  1.00 24.34 ? 261 ALA E C     1 
ATOM   7637 O O     . ALA C 1 264 ? -5.433  9.719   -3.274  1.00 24.58 ? 261 ALA E O     1 
ATOM   7638 C CB    . ALA C 1 264 ? -7.507  9.046   -0.806  1.00 23.98 ? 261 ALA E CB    1 
ATOM   7639 N N     . LEU C 1 265 ? -4.420  9.298   -1.335  1.00 24.66 ? 262 LEU E N     1 
ATOM   7640 C CA    . LEU C 1 265 ? -3.265  10.138  -1.645  1.00 24.57 ? 262 LEU E CA    1 
ATOM   7641 C C     . LEU C 1 265 ? -2.354  9.524   -2.694  1.00 24.23 ? 262 LEU E C     1 
ATOM   7642 O O     . LEU C 1 265 ? -1.819  10.226  -3.542  1.00 24.10 ? 262 LEU E O     1 
ATOM   7643 C CB    . LEU C 1 265 ? -2.442  10.373  -0.397  1.00 25.40 ? 262 LEU E CB    1 
ATOM   7644 C CG    . LEU C 1 265 ? -2.880  11.491  0.530   1.00 27.58 ? 262 LEU E CG    1 
ATOM   7645 C CD1   . LEU C 1 265 ? -1.850  11.572  1.663   1.00 30.05 ? 262 LEU E CD1   1 
ATOM   7646 C CD2   . LEU C 1 265 ? -2.996  12.828  -0.220  1.00 30.57 ? 262 LEU E CD2   1 
ATOM   7647 N N     . SER C 1 266 ? -2.136  8.220   -2.600  1.00 23.29 ? 263 SER E N     1 
ATOM   7648 C CA    . SER C 1 266 ? -1.378  7.523   -3.611  1.00 23.12 ? 263 SER E CA    1 
ATOM   7649 C C     . SER C 1 266 ? -2.054  7.658   -4.970  1.00 22.75 ? 263 SER E C     1 
ATOM   7650 O O     . SER C 1 266 ? -1.394  7.887   -5.982  1.00 21.60 ? 263 SER E O     1 
ATOM   7651 C CB    . SER C 1 266 ? -1.219  6.037   -3.243  1.00 23.06 ? 263 SER E CB    1 
ATOM   7652 O OG    . SER C 1 266 ? -0.502  5.901   -2.016  1.00 22.39 ? 263 SER E OG    1 
ATOM   7653 N N     . GLN C 1 267 ? -3.370  7.488   -4.995  1.00 22.25 ? 264 GLN E N     1 
ATOM   7654 C CA    . GLN C 1 267 ? -4.114  7.659   -6.229  1.00 22.58 ? 264 GLN E CA    1 
ATOM   7655 C C     . GLN C 1 267 ? -3.994  9.089   -6.763  1.00 22.95 ? 264 GLN E C     1 
ATOM   7656 O O     . GLN C 1 267 ? -3.691  9.279   -7.937  1.00 23.02 ? 264 GLN E O     1 
ATOM   7657 C CB    . GLN C 1 267 ? -5.579  7.311   -6.020  1.00 22.74 ? 264 GLN E CB    1 
ATOM   7658 C CG    . GLN C 1 267 ? -5.810  5.813   -5.755  1.00 21.81 ? 264 GLN E CG    1 
ATOM   7659 C CD    . GLN C 1 267 ? -7.285  5.489   -5.598  1.00 22.36 ? 264 GLN E CD    1 
ATOM   7660 O OE1   . GLN C 1 267 ? -7.680  4.729   -4.707  1.00 22.82 ? 264 GLN E OE1   1 
ATOM   7661 N NE2   . GLN C 1 267 ? -8.106  6.061   -6.467  1.00 20.00 ? 264 GLN E NE2   1 
ATOM   7662 N N     . ALA C 1 268 ? -4.223  10.076  -5.887  1.00 23.05 ? 265 ALA E N     1 
ATOM   7663 C CA    . ALA C 1 268 ? -4.185  11.487  -6.256  1.00 22.72 ? 265 ALA E CA    1 
ATOM   7664 C C     . ALA C 1 268 ? -2.796  11.899  -6.728  1.00 22.96 ? 265 ALA E C     1 
ATOM   7665 O O     . ALA C 1 268 ? -2.654  12.578  -7.748  1.00 23.36 ? 265 ALA E O     1 
ATOM   7666 C CB    . ALA C 1 268 ? -4.597  12.338  -5.096  1.00 22.91 ? 265 ALA E CB    1 
ATOM   7667 N N     . ALA C 1 269 ? -1.780  11.483  -5.984  1.00 22.50 ? 266 ALA E N     1 
ATOM   7668 C CA    . ALA C 1 269 ? -0.401  11.825  -6.292  1.00 22.66 ? 266 ALA E CA    1 
ATOM   7669 C C     . ALA C 1 269 ? 0.091   11.229  -7.619  1.00 22.76 ? 266 ALA E C     1 
ATOM   7670 O O     . ALA C 1 269 ? 0.766   11.915  -8.386  1.00 22.43 ? 266 ALA E O     1 
ATOM   7671 C CB    . ALA C 1 269 ? 0.513   11.409  -5.144  1.00 22.43 ? 266 ALA E CB    1 
ATOM   7672 N N     . ALA C 1 270 ? -0.228  9.956   -7.873  1.00 22.42 ? 267 ALA E N     1 
ATOM   7673 C CA    . ALA C 1 270 ? 0.067   9.341   -9.162  1.00 22.83 ? 267 ALA E CA    1 
ATOM   7674 C C     . ALA C 1 270 ? -0.687  10.053  -10.302 1.00 23.05 ? 267 ALA E C     1 
ATOM   7675 O O     . ALA C 1 270 ? -0.114  10.283  -11.350 1.00 22.05 ? 267 ALA E O     1 
ATOM   7676 C CB    . ALA C 1 270 ? -0.266  7.848   -9.150  1.00 22.57 ? 267 ALA E CB    1 
ATOM   7677 N N     . ILE C 1 271 ? -1.955  10.407  -10.094 1.00 23.11 ? 268 ILE E N     1 
ATOM   7678 C CA    . ILE C 1 271 ? -2.706  11.160  -11.119 1.00 23.58 ? 268 ILE E CA    1 
ATOM   7679 C C     . ILE C 1 271 ? -2.007  12.482  -11.476 1.00 23.88 ? 268 ILE E C     1 
ATOM   7680 O O     . ILE C 1 271 ? -1.922  12.855  -12.657 1.00 23.98 ? 268 ILE E O     1 
ATOM   7681 C CB    . ILE C 1 271 ? -4.141  11.450  -10.657 1.00 23.78 ? 268 ILE E CB    1 
ATOM   7682 C CG1   . ILE C 1 271 ? -4.988  10.172  -10.754 1.00 24.56 ? 268 ILE E CG1   1 
ATOM   7683 C CG2   . ILE C 1 271 ? -4.770  12.568  -11.489 1.00 23.58 ? 268 ILE E CG2   1 
ATOM   7684 C CD1   . ILE C 1 271 ? -6.296  10.225  -9.962  1.00 23.74 ? 268 ILE E CD1   1 
ATOM   7685 N N     . VAL C 1 272 ? -1.488  13.165  -10.453 1.00 24.13 ? 269 VAL E N     1 
ATOM   7686 C CA    . VAL C 1 272 ? -0.739  14.395  -10.645 1.00 24.33 ? 269 VAL E CA    1 
ATOM   7687 C C     . VAL C 1 272 ? 0.540   14.115  -11.446 1.00 24.97 ? 269 VAL E C     1 
ATOM   7688 O O     . VAL C 1 272 ? 0.815   14.785  -12.446 1.00 25.11 ? 269 VAL E O     1 
ATOM   7689 C CB    . VAL C 1 272 ? -0.395  15.042  -9.310  1.00 24.48 ? 269 VAL E CB    1 
ATOM   7690 C CG1   . VAL C 1 272 ? 0.598   16.179  -9.504  1.00 24.95 ? 269 VAL E CG1   1 
ATOM   7691 C CG2   . VAL C 1 272 ? -1.668  15.538  -8.616  1.00 25.10 ? 269 VAL E CG2   1 
ATOM   7692 N N     . ALA C 1 273 ? 1.306   13.113  -11.016 1.00 25.11 ? 270 ALA E N     1 
ATOM   7693 C CA    . ALA C 1 273 ? 2.556   12.738  -11.700 1.00 25.18 ? 270 ALA E CA    1 
ATOM   7694 C C     . ALA C 1 273 ? 2.324   12.543  -13.206 1.00 25.61 ? 270 ALA E C     1 
ATOM   7695 O O     . ALA C 1 273 ? 3.031   13.137  -14.049 1.00 25.39 ? 270 ALA E O     1 
ATOM   7696 C CB    . ALA C 1 273 ? 3.128   11.457  -11.074 1.00 25.43 ? 270 ALA E CB    1 
ATOM   7697 N N     . LEU C 1 274 ? 1.305   11.738  -13.517 1.00 25.52 ? 271 LEU E N     1 
ATOM   7698 C CA    . LEU C 1 274 ? 0.906   11.391  -14.882 1.00 25.69 ? 271 LEU E CA    1 
ATOM   7699 C C     . LEU C 1 274 ? 0.651   12.574  -15.803 1.00 26.42 ? 271 LEU E C     1 
ATOM   7700 O O     . LEU C 1 274 ? 0.998   12.523  -17.001 1.00 26.54 ? 271 LEU E O     1 
ATOM   7701 C CB    . LEU C 1 274 ? -0.338  10.502  -14.853 1.00 25.09 ? 271 LEU E CB    1 
ATOM   7702 C CG    . LEU C 1 274 ? -0.063  9.042   -14.457 1.00 23.84 ? 271 LEU E CG    1 
ATOM   7703 C CD1   . LEU C 1 274 ? -1.292  8.318   -13.941 1.00 20.00 ? 271 LEU E CD1   1 
ATOM   7704 C CD2   . LEU C 1 274 ? 0.539   8.288   -15.623 1.00 21.37 ? 271 LEU E CD2   1 
ATOM   7705 N N     . ARG C 1 275 ? 0.064   13.645  -15.272 1.00 27.21 ? 272 ARG E N     1 
ATOM   7706 C CA    . ARG C 1 275 ? -0.187  14.818  -16.109 1.00 27.95 ? 272 ARG E CA    1 
ATOM   7707 C C     . ARG C 1 275 ? 1.013   15.745  -16.252 1.00 28.21 ? 272 ARG E C     1 
ATOM   7708 O O     . ARG C 1 275 ? 0.945   16.721  -16.990 1.00 28.08 ? 272 ARG E O     1 
ATOM   7709 C CB    . ARG C 1 275 ? -1.440  15.578  -15.677 1.00 28.21 ? 272 ARG E CB    1 
ATOM   7710 C CG    . ARG C 1 275 ? -1.368  16.377  -14.413 1.00 28.68 ? 272 ARG E CG    1 
ATOM   7711 C CD    . ARG C 1 275 ? -2.782  16.939  -14.125 1.00 29.93 ? 272 ARG E CD    1 
ATOM   7712 N NE    . ARG C 1 275 ? -2.973  17.425  -12.750 1.00 30.55 ? 272 ARG E NE    1 
ATOM   7713 C CZ    . ARG C 1 275 ? -3.994  17.088  -11.955 1.00 31.54 ? 272 ARG E CZ    1 
ATOM   7714 N NH1   . ARG C 1 275 ? -4.952  16.254  -12.355 1.00 32.99 ? 272 ARG E NH1   1 
ATOM   7715 N NH2   . ARG C 1 275 ? -4.066  17.598  -10.742 1.00 32.19 ? 272 ARG E NH2   1 
ATOM   7716 N N     . HIS C 1 276 ? 2.111   15.428  -15.575 1.00 28.49 ? 273 HIS E N     1 
ATOM   7717 C CA    . HIS C 1 276 ? 3.371   16.128  -15.779 1.00 28.74 ? 273 HIS E CA    1 
ATOM   7718 C C     . HIS C 1 276 ? 4.399   15.231  -16.458 1.00 28.85 ? 273 HIS E C     1 
ATOM   7719 O O     . HIS C 1 276 ? 5.598   15.472  -16.368 1.00 29.01 ? 273 HIS E O     1 
ATOM   7720 C CB    . HIS C 1 276 ? 3.882   16.636  -14.439 1.00 28.88 ? 273 HIS E CB    1 
ATOM   7721 C CG    . HIS C 1 276 ? 3.133   17.821  -13.939 1.00 29.52 ? 273 HIS E CG    1 
ATOM   7722 N ND1   . HIS C 1 276 ? 1.937   17.715  -13.260 1.00 30.68 ? 273 HIS E ND1   1 
ATOM   7723 C CD2   . HIS C 1 276 ? 3.384   19.144  -14.061 1.00 31.42 ? 273 HIS E CD2   1 
ATOM   7724 C CE1   . HIS C 1 276 ? 1.501   18.925  -12.961 1.00 30.72 ? 273 HIS E CE1   1 
ATOM   7725 N NE2   . HIS C 1 276 ? 2.362   19.809  -13.430 1.00 31.49 ? 273 HIS E NE2   1 
ATOM   7726 N N     . SER C 1 277 ? 3.916   14.219  -17.172 1.00 29.11 ? 274 SER E N     1 
ATOM   7727 C CA    . SER C 1 277 ? 4.770   13.169  -17.695 1.00 29.78 ? 274 SER E CA    1 
ATOM   7728 C C     . SER C 1 277 ? 5.719   13.613  -18.802 1.00 30.28 ? 274 SER E C     1 
ATOM   7729 O O     . SER C 1 277 ? 6.801   13.050  -18.939 1.00 30.09 ? 274 SER E O     1 
ATOM   7730 C CB    . SER C 1 277 ? 3.919   12.019  -18.225 1.00 29.82 ? 274 SER E CB    1 
ATOM   7731 O OG    . SER C 1 277 ? 3.090   12.469  -19.274 1.00 30.14 ? 274 SER E OG    1 
ATOM   7732 N N     . ALA C 1 278 ? 5.299   14.587  -19.611 1.00 31.14 ? 275 ALA E N     1 
ATOM   7733 C CA    . ALA C 1 278 ? 6.093   15.026  -20.756 1.00 31.21 ? 275 ALA E CA    1 
ATOM   7734 C C     . ALA C 1 278 ? 7.369   15.695  -20.274 1.00 31.65 ? 275 ALA E C     1 
ATOM   7735 O O     . ALA C 1 278 ? 8.453   15.402  -20.771 1.00 32.90 ? 275 ALA E O     1 
ATOM   7736 C CB    . ALA C 1 278 ? 5.283   15.969  -21.658 1.00 31.49 ? 275 ALA E CB    1 
ATOM   7737 N N     . ASP C 1 279 ? 7.239   16.573  -19.293 1.00 32.14 ? 276 ASP E N     1 
ATOM   7738 C CA    . ASP C 1 279 ? 8.377   17.218  -18.674 1.00 31.58 ? 276 ASP E CA    1 
ATOM   7739 C C     . ASP C 1 279 ? 9.242   16.215  -17.891 1.00 31.50 ? 276 ASP E C     1 
ATOM   7740 O O     . ASP C 1 279 ? 10.473  16.180  -18.028 1.00 31.72 ? 276 ASP E O     1 
ATOM   7741 C CB    . ASP C 1 279 ? 7.870   18.294  -17.721 1.00 32.41 ? 276 ASP E CB    1 
ATOM   7742 C CG    . ASP C 1 279 ? 8.992   19.065  -17.055 1.00 34.22 ? 276 ASP E CG    1 
ATOM   7743 O OD1   . ASP C 1 279 ? 9.892   19.567  -17.779 1.00 39.28 ? 276 ASP E OD1   1 
ATOM   7744 O OD2   . ASP C 1 279 ? 8.975   19.177  -15.804 1.00 39.61 ? 276 ASP E OD2   1 
ATOM   7745 N N     . THR C 1 280 ? 8.586   15.424  -17.049 1.00 30.43 ? 277 THR E N     1 
ATOM   7746 C CA    . THR C 1 280 ? 9.268   14.487  -16.167 1.00 29.92 ? 277 THR E CA    1 
ATOM   7747 C C     . THR C 1 280 ? 10.098  13.510  -16.977 1.00 29.12 ? 277 THR E C     1 
ATOM   7748 O O     . THR C 1 280 ? 11.275  13.331  -16.716 1.00 28.71 ? 277 THR E O     1 
ATOM   7749 C CB    . THR C 1 280 ? 8.251   13.694  -15.299 1.00 30.05 ? 277 THR E CB    1 
ATOM   7750 O OG1   . THR C 1 280 ? 7.591   14.600  -14.404 1.00 29.71 ? 277 THR E OG1   1 
ATOM   7751 C CG2   . THR C 1 280 ? 8.942   12.570  -14.502 1.00 29.60 ? 277 THR E CG2   1 
ATOM   7752 N N     . LEU C 1 281 ? 9.485   12.906  -17.982 1.00 28.83 ? 278 LEU E N     1 
ATOM   7753 C CA    . LEU C 1 281 ? 10.148  11.866  -18.740 1.00 28.92 ? 278 LEU E CA    1 
ATOM   7754 C C     . LEU C 1 281 ? 11.225  12.381  -19.709 1.00 28.56 ? 278 LEU E C     1 
ATOM   7755 O O     . LEU C 1 281 ? 11.920  11.588  -20.309 1.00 28.68 ? 278 LEU E O     1 
ATOM   7756 C CB    . LEU C 1 281 ? 9.106   11.019  -19.467 1.00 29.04 ? 278 LEU E CB    1 
ATOM   7757 C CG    . LEU C 1 281 ? 8.183   10.237  -18.516 1.00 29.47 ? 278 LEU E CG    1 
ATOM   7758 C CD1   . LEU C 1 281 ? 7.057   9.593   -19.293 1.00 29.64 ? 278 LEU E CD1   1 
ATOM   7759 C CD2   . LEU C 1 281 ? 8.983   9.174   -17.747 1.00 28.79 ? 278 LEU E CD2   1 
ATOM   7760 N N     . GLY C 1 282 ? 11.367  13.692  -19.856 1.00 28.66 ? 279 GLY E N     1 
ATOM   7761 C CA    . GLY C 1 282 ? 12.507  14.259  -20.579 1.00 29.09 ? 279 GLY E CA    1 
ATOM   7762 C C     . GLY C 1 282 ? 13.869  14.075  -19.904 1.00 29.36 ? 279 GLY E C     1 
ATOM   7763 O O     . GLY C 1 282 ? 14.917  14.266  -20.543 1.00 29.56 ? 279 GLY E O     1 
ATOM   7764 N N     . THR C 1 283 ? 13.871  13.723  -18.616 1.00 29.17 ? 280 THR E N     1 
ATOM   7765 C CA    . THR C 1 283 ? 15.109  13.371  -17.924 1.00 29.36 ? 280 THR E CA    1 
ATOM   7766 C C     . THR C 1 283 ? 15.715  12.120  -18.536 1.00 29.05 ? 280 THR E C     1 
ATOM   7767 O O     . THR C 1 283 ? 16.910  11.894  -18.420 1.00 29.19 ? 280 THR E O     1 
ATOM   7768 C CB    . THR C 1 283 ? 14.884  13.115  -16.414 1.00 29.55 ? 280 THR E CB    1 
ATOM   7769 O OG1   . THR C 1 283 ? 13.876  12.106  -16.234 1.00 30.55 ? 280 THR E OG1   1 
ATOM   7770 C CG2   . THR C 1 283 ? 14.486  14.400  -15.695 1.00 29.95 ? 280 THR E CG2   1 
ATOM   7771 N N     . VAL C 1 284 ? 14.888  11.313  -19.195 1.00 29.20 ? 281 VAL E N     1 
ATOM   7772 C CA    . VAL C 1 284 ? 15.347  10.065  -19.796 1.00 29.70 ? 281 VAL E CA    1 
ATOM   7773 C C     . VAL C 1 284 ? 16.394  10.279  -20.889 1.00 30.28 ? 281 VAL E C     1 
ATOM   7774 O O     . VAL C 1 284 ? 17.278  9.432   -21.083 1.00 30.30 ? 281 VAL E O     1 
ATOM   7775 C CB    . VAL C 1 284 ? 14.193  9.294   -20.409 1.00 29.62 ? 281 VAL E CB    1 
ATOM   7776 C CG1   . VAL C 1 284 ? 14.712  8.090   -21.179 1.00 28.96 ? 281 VAL E CG1   1 
ATOM   7777 C CG2   . VAL C 1 284 ? 13.200  8.883   -19.319 1.00 29.77 ? 281 VAL E CG2   1 
ATOM   7778 N N     . GLU C 1 285 ? 16.262  11.389  -21.614 1.00 30.61 ? 282 GLU E N     1 
ATOM   7779 C CA    . GLU C 1 285 ? 17.218  11.767  -22.637 1.00 31.28 ? 282 GLU E CA    1 
ATOM   7780 C C     . GLU C 1 285 ? 18.591  12.020  -22.024 1.00 31.03 ? 282 GLU E C     1 
ATOM   7781 O O     . GLU C 1 285 ? 19.606  11.551  -22.544 1.00 31.85 ? 282 GLU E O     1 
ATOM   7782 C CB    . GLU C 1 285 ? 16.760  13.051  -23.350 1.00 31.68 ? 282 GLU E CB    1 
ATOM   7783 C CG    . GLU C 1 285 ? 15.461  12.915  -24.187 1.00 33.69 ? 282 GLU E CG    1 
ATOM   7784 C CD    . GLU C 1 285 ? 15.236  14.108  -25.129 1.00 34.05 ? 282 GLU E CD    1 
ATOM   7785 O OE1   . GLU C 1 285 ? 14.359  14.018  -26.031 1.00 38.11 ? 282 GLU E OE1   1 
ATOM   7786 O OE2   . GLU C 1 285 ? 15.960  15.129  -24.984 1.00 39.73 ? 282 GLU E OE2   1 
ATOM   7787 N N     . LYS C 1 286 ? 18.607  12.810  -20.951 1.00 30.91 ? 283 LYS E N     1 
ATOM   7788 C CA    . LYS C 1 286 ? 19.829  13.128  -20.210 1.00 30.63 ? 283 LYS E CA    1 
ATOM   7789 C C     . LYS C 1 286 ? 20.457  11.859  -19.610 1.00 29.62 ? 283 LYS E C     1 
ATOM   7790 O O     . LYS C 1 286 ? 21.659  11.630  -19.743 1.00 28.76 ? 283 LYS E O     1 
ATOM   7791 C CB    . LYS C 1 286 ? 19.518  14.125  -19.090 1.00 31.25 ? 283 LYS E CB    1 
ATOM   7792 C CG    . LYS C 1 286 ? 19.169  15.551  -19.566 1.00 32.92 ? 283 LYS E CG    1 
ATOM   7793 C CD    . LYS C 1 286 ? 18.579  16.403  -18.434 1.00 32.33 ? 283 LYS E CD    1 
ATOM   7794 C CE    . LYS C 1 286 ? 18.568  17.907  -18.794 1.00 34.83 ? 283 LYS E CE    1 
ATOM   7795 N NZ    . LYS C 1 286 ? 18.157  18.789  -17.630 1.00 35.84 ? 283 LYS E NZ    1 
ATOM   7796 N N     . LEU C 1 287 ? 19.629  11.047  -18.963 1.00 28.45 ? 284 LEU E N     1 
ATOM   7797 C CA    . LEU C 1 287 ? 20.095  9.824   -18.323 1.00 28.36 ? 284 LEU E CA    1 
ATOM   7798 C C     . LEU C 1 287 ? 20.665  8.830   -19.320 1.00 27.80 ? 284 LEU E C     1 
ATOM   7799 O O     . LEU C 1 287 ? 21.640  8.148   -19.038 1.00 27.41 ? 284 LEU E O     1 
ATOM   7800 C CB    . LEU C 1 287 ? 18.970  9.171   -17.512 1.00 28.27 ? 284 LEU E CB    1 
ATOM   7801 C CG    . LEU C 1 287 ? 18.610  9.902   -16.211 1.00 28.47 ? 284 LEU E CG    1 
ATOM   7802 C CD1   . LEU C 1 287 ? 17.256  9.461   -15.660 1.00 27.95 ? 284 LEU E CD1   1 
ATOM   7803 C CD2   . LEU C 1 287 ? 19.720  9.708   -15.179 1.00 27.91 ? 284 LEU E CD2   1 
ATOM   7804 N N     . SER C 1 288 ? 20.060  8.758   -20.492 1.00 27.84 ? 285 SER E N     1 
ATOM   7805 C CA    . SER C 1 288 ? 20.476  7.797   -21.499 1.00 27.79 ? 285 SER E CA    1 
ATOM   7806 C C     . SER C 1 288 ? 21.857  8.100   -22.097 1.00 27.38 ? 285 SER E C     1 
ATOM   7807 O O     . SER C 1 288 ? 22.598  7.172   -22.405 1.00 27.50 ? 285 SER E O     1 
ATOM   7808 C CB    . SER C 1 288 ? 19.404  7.684   -22.590 1.00 27.98 ? 285 SER E CB    1 
ATOM   7809 O OG    . SER C 1 288 ? 18.213  7.096   -22.056 1.00 28.76 ? 285 SER E OG    1 
ATOM   7810 N N     . VAL C 1 289 ? 22.200  9.380   -22.242 1.00 27.11 ? 286 VAL E N     1 
ATOM   7811 C CA    . VAL C 1 289 ? 23.531  9.779   -22.733 1.00 27.36 ? 286 VAL E CA    1 
ATOM   7812 C C     . VAL C 1 289 ? 24.588  9.564   -21.660 1.00 27.49 ? 286 VAL E C     1 
ATOM   7813 O O     . VAL C 1 289 ? 25.706  9.119   -21.952 1.00 26.71 ? 286 VAL E O     1 
ATOM   7814 C CB    . VAL C 1 289 ? 23.606  11.285  -23.168 1.00 27.20 ? 286 VAL E CB    1 
ATOM   7815 C CG1   . VAL C 1 289 ? 24.996  11.605  -23.762 1.00 26.27 ? 286 VAL E CG1   1 
ATOM   7816 C CG2   . VAL C 1 289 ? 22.541  11.599  -24.183 1.00 27.47 ? 286 VAL E CG2   1 
ATOM   7817 N N     . GLU C 1 290 ? 24.232  9.905   -20.420 1.00 27.43 ? 287 GLU E N     1 
ATOM   7818 C CA    . GLU C 1 290 ? 25.139  9.718   -19.290 1.00 27.56 ? 287 GLU E CA    1 
ATOM   7819 C C     . GLU C 1 290 ? 25.456  8.249   -19.085 1.00 27.40 ? 287 GLU E C     1 
ATOM   7820 O O     . GLU C 1 290 ? 26.584  7.888   -18.749 1.00 27.30 ? 287 GLU E O     1 
ATOM   7821 C CB    . GLU C 1 290 ? 24.555  10.330  -18.024 1.00 27.99 ? 287 GLU E CB    1 
ATOM   7822 C CG    . GLU C 1 290 ? 24.724  11.819  -17.990 1.00 28.69 ? 287 GLU E CG    1 
ATOM   7823 C CD    . GLU C 1 290 ? 26.188  12.187  -17.908 1.00 31.71 ? 287 GLU E CD    1 
ATOM   7824 O OE1   . GLU C 1 290 ? 26.751  12.663  -18.929 1.00 33.85 ? 287 GLU E OE1   1 
ATOM   7825 O OE2   . GLU C 1 290 ? 26.783  11.957  -16.830 1.00 30.86 ? 287 GLU E OE2   1 
ATOM   7826 N N     . ARG C 1 291 ? 24.486  7.384   -19.332 1.00 27.33 ? 288 ARG E N     1 
ATOM   7827 C CA    . ARG C 1 291 ? 24.787  5.965   -19.266 1.00 27.04 ? 288 ARG E CA    1 
ATOM   7828 C C     . ARG C 1 291 ? 25.928  5.650   -20.226 1.00 26.84 ? 288 ARG E C     1 
ATOM   7829 O O     . ARG C 1 291 ? 26.905  4.991   -19.851 1.00 26.56 ? 288 ARG E O     1 
ATOM   7830 C CB    . ARG C 1 291 ? 23.576  5.135   -19.631 1.00 27.05 ? 288 ARG E CB    1 
ATOM   7831 C CG    . ARG C 1 291 ? 23.774  3.624   -19.416 1.00 28.18 ? 288 ARG E CG    1 
ATOM   7832 C CD    . ARG C 1 291 ? 23.448  2.851   -20.649 1.00 31.59 ? 288 ARG E CD    1 
ATOM   7833 N NE    . ARG C 1 291 ? 22.190  3.302   -21.230 1.00 33.57 ? 288 ARG E NE    1 
ATOM   7834 C CZ    . ARG C 1 291 ? 21.885  3.277   -22.526 1.00 35.51 ? 288 ARG E CZ    1 
ATOM   7835 N NH1   . ARG C 1 291 ? 22.754  2.826   -23.425 1.00 37.04 ? 288 ARG E NH1   1 
ATOM   7836 N NH2   . ARG C 1 291 ? 20.691  3.721   -22.922 1.00 34.86 ? 288 ARG E NH2   1 
ATOM   7837 N N     . VAL C 1 292 ? 25.789  6.112   -21.468 1.00 26.78 ? 289 VAL E N     1 
ATOM   7838 C CA    . VAL C 1 292 ? 26.768  5.810   -22.510 1.00 26.98 ? 289 VAL E CA    1 
ATOM   7839 C C     . VAL C 1 292 ? 28.132  6.325   -22.126 1.00 26.65 ? 289 VAL E C     1 
ATOM   7840 O O     . VAL C 1 292 ? 29.134  5.645   -22.319 1.00 26.83 ? 289 VAL E O     1 
ATOM   7841 C CB    . VAL C 1 292 ? 26.378  6.401   -23.883 1.00 27.05 ? 289 VAL E CB    1 
ATOM   7842 C CG1   . VAL C 1 292 ? 27.582  6.392   -24.827 1.00 25.60 ? 289 VAL E CG1   1 
ATOM   7843 C CG2   . VAL C 1 292 ? 25.257  5.620   -24.464 1.00 26.27 ? 289 VAL E CG2   1 
ATOM   7844 N N     . ARG C 1 293 ? 28.161  7.534   -21.590 1.00 26.98 ? 290 ARG E N     1 
ATOM   7845 C CA    . ARG C 1 293 ? 29.399  8.129   -21.112 1.00 27.36 ? 290 ARG E CA    1 
ATOM   7846 C C     . ARG C 1 293 ? 30.031  7.292   -19.977 1.00 27.47 ? 290 ARG E C     1 
ATOM   7847 O O     . ARG C 1 293 ? 31.222  6.950   -20.018 1.00 26.85 ? 290 ARG E O     1 
ATOM   7848 C CB    . ARG C 1 293 ? 29.122  9.550   -20.637 1.00 27.08 ? 290 ARG E CB    1 
ATOM   7849 C CG    . ARG C 1 293 ? 30.338  10.261  -20.127 1.00 28.27 ? 290 ARG E CG    1 
ATOM   7850 C CD    . ARG C 1 293 ? 30.104  11.761  -19.994 1.00 29.17 ? 290 ARG E CD    1 
ATOM   7851 N NE    . ARG C 1 293 ? 29.442  12.149  -18.746 1.00 31.19 ? 290 ARG E NE    1 
ATOM   7852 C CZ    . ARG C 1 293 ? 30.040  12.132  -17.552 1.00 32.65 ? 290 ARG E CZ    1 
ATOM   7853 N NH1   . ARG C 1 293 ? 31.313  11.753  -17.431 1.00 32.04 ? 290 ARG E NH1   1 
ATOM   7854 N NH2   . ARG C 1 293 ? 29.371  12.514  -16.470 1.00 31.88 ? 290 ARG E NH2   1 
ATOM   7855 N N     . VAL C 1 294 ? 29.233  6.959   -18.969 1.00 26.89 ? 291 VAL E N     1 
ATOM   7856 C CA    . VAL C 1 294 ? 29.736  6.162   -17.852 1.00 26.96 ? 291 VAL E CA    1 
ATOM   7857 C C     . VAL C 1 294 ? 30.277  4.800   -18.313 1.00 26.97 ? 291 VAL E C     1 
ATOM   7858 O O     . VAL C 1 294 ? 31.387  4.446   -17.945 1.00 26.39 ? 291 VAL E O     1 
ATOM   7859 C CB    . VAL C 1 294 ? 28.661  5.984   -16.753 1.00 26.79 ? 291 VAL E CB    1 
ATOM   7860 C CG1   . VAL C 1 294 ? 29.016  4.843   -15.846 1.00 25.60 ? 291 VAL E CG1   1 
ATOM   7861 C CG2   . VAL C 1 294 ? 28.497  7.304   -15.980 1.00 26.16 ? 291 VAL E CG2   1 
ATOM   7862 N N     . ALA C 1 295 ? 29.507  4.077   -19.137 1.00 27.30 ? 292 ALA E N     1 
ATOM   7863 C CA    . ALA C 1 295 ? 29.902  2.756   -19.657 1.00 27.97 ? 292 ALA E CA    1 
ATOM   7864 C C     . ALA C 1 295 ? 31.183  2.828   -20.494 1.00 28.86 ? 292 ALA E C     1 
ATOM   7865 O O     . ALA C 1 295 ? 31.994  1.893   -20.486 1.00 28.48 ? 292 ALA E O     1 
ATOM   7866 C CB    . ALA C 1 295 ? 28.797  2.166   -20.501 1.00 27.37 ? 292 ALA E CB    1 
ATOM   7867 N N     . ALA C 1 296 ? 31.336  3.933   -21.228 1.00 29.39 ? 293 ALA E N     1 
ATOM   7868 C CA    . ALA C 1 296 ? 32.498  4.139   -22.094 1.00 30.11 ? 293 ALA E CA    1 
ATOM   7869 C C     . ALA C 1 296 ? 33.748  4.346   -21.250 1.00 30.68 ? 293 ALA E C     1 
ATOM   7870 O O     . ALA C 1 296 ? 34.790  3.726   -21.503 1.00 30.73 ? 293 ALA E O     1 
ATOM   7871 C CB    . ALA C 1 296 ? 32.272  5.344   -23.019 1.00 30.05 ? 293 ALA E CB    1 
ATOM   7872 N N     . ARG C 1 297 ? 33.641  5.218   -20.249 1.00 31.62 ? 294 ARG E N     1 
ATOM   7873 C CA    . ARG C 1 297 ? 34.750  5.488   -19.335 1.00 31.91 ? 294 ARG E CA    1 
ATOM   7874 C C     . ARG C 1 297 ? 35.183  4.263   -18.523 1.00 32.28 ? 294 ARG E C     1 
ATOM   7875 O O     . ARG C 1 297 ? 36.381  4.054   -18.340 1.00 32.80 ? 294 ARG E O     1 
ATOM   7876 C CB    . ARG C 1 297 ? 34.399  6.651   -18.410 1.00 32.72 ? 294 ARG E CB    1 
ATOM   7877 C CG    . ARG C 1 297 ? 35.492  7.077   -17.454 1.00 32.92 ? 294 ARG E CG    1 
ATOM   7878 C CD    . ARG C 1 297 ? 36.834  7.307   -18.109 1.00 35.59 ? 294 ARG E CD    1 
ATOM   7879 N NE    . ARG C 1 297 ? 37.759  7.860   -17.130 1.00 36.44 ? 294 ARG E NE    1 
ATOM   7880 C CZ    . ARG C 1 297 ? 39.048  8.121   -17.343 1.00 39.47 ? 294 ARG E CZ    1 
ATOM   7881 N NH1   . ARG C 1 297 ? 39.605  7.888   -18.528 1.00 40.57 ? 294 ARG E NH1   1 
ATOM   7882 N NH2   . ARG C 1 297 ? 39.784  8.624   -16.356 1.00 39.37 ? 294 ARG E NH2   1 
ATOM   7883 N N     . LEU C 1 298 ? 34.233  3.453   -18.050 1.00 32.36 ? 295 LEU E N     1 
ATOM   7884 C CA    . LEU C 1 298 ? 34.569  2.207   -17.346 1.00 32.53 ? 295 LEU E CA    1 
ATOM   7885 C C     . LEU C 1 298 ? 35.360  1.277   -18.254 1.00 33.03 ? 295 LEU E C     1 
ATOM   7886 O O     . LEU C 1 298 ? 36.328  0.656   -17.821 1.00 32.86 ? 295 LEU E O     1 
ATOM   7887 C CB    . LEU C 1 298 ? 33.317  1.475   -16.846 1.00 32.03 ? 295 LEU E CB    1 
ATOM   7888 C CG    . LEU C 1 298 ? 32.495  2.125   -15.730 1.00 30.82 ? 295 LEU E CG    1 
ATOM   7889 C CD1   . LEU C 1 298 ? 31.230  1.308   -15.472 1.00 30.40 ? 295 LEU E CD1   1 
ATOM   7890 C CD2   . LEU C 1 298 ? 33.319  2.266   -14.459 1.00 29.03 ? 295 LEU E CD2   1 
ATOM   7891 N N     . GLU C 1 299 ? 34.933  1.171   -19.509 1.00 34.12 ? 296 GLU E N     1 
ATOM   7892 C CA    . GLU C 1 299 ? 35.640  0.356   -20.505 1.00 34.95 ? 296 GLU E CA    1 
ATOM   7893 C C     . GLU C 1 299 ? 37.049  0.884   -20.752 1.00 34.94 ? 296 GLU E C     1 
ATOM   7894 O O     . GLU C 1 299 ? 37.982  0.110   -20.823 1.00 35.47 ? 296 GLU E O     1 
ATOM   7895 C CB    . GLU C 1 299 ? 34.851  0.277   -21.820 1.00 35.25 ? 296 GLU E CB    1 
ATOM   7896 C CG    . GLU C 1 299 ? 33.794  -0.836  -21.831 1.00 36.28 ? 296 GLU E CG    1 
ATOM   7897 C CD    . GLU C 1 299 ? 33.103  -0.994  -23.190 1.00 36.89 ? 296 GLU E CD    1 
ATOM   7898 O OE1   . GLU C 1 299 ? 32.934  0.045   -23.879 1.00 40.21 ? 296 GLU E OE1   1 
ATOM   7899 O OE2   . GLU C 1 299 ? 32.738  -2.149  -23.562 1.00 37.41 ? 296 GLU E OE2   1 
ATOM   7900 N N     . GLU C 1 300 ? 37.188  2.202   -20.851 1.00 35.35 ? 297 GLU E N     1 
ATOM   7901 C CA    . GLU C 1 300 ? 38.489  2.854   -21.016 1.00 35.56 ? 297 GLU E CA    1 
ATOM   7902 C C     . GLU C 1 300 ? 39.414  2.609   -19.812 1.00 35.30 ? 297 GLU E C     1 
ATOM   7903 O O     . GLU C 1 300 ? 40.635  2.476   -19.962 1.00 35.33 ? 297 GLU E O     1 
ATOM   7904 C CB    . GLU C 1 300 ? 38.293  4.370   -21.212 1.00 35.71 ? 297 GLU E CB    1 
ATOM   7905 C CG    . GLU C 1 300 ? 39.569  5.121   -21.641 1.00 36.86 ? 297 GLU E CG    1 
ATOM   7906 C CD    . GLU C 1 300 ? 39.388  6.639   -21.765 1.00 38.24 ? 297 GLU E CD    1 
ATOM   7907 O OE1   . GLU C 1 300 ? 38.333  7.173   -21.329 1.00 39.81 ? 297 GLU E OE1   1 
ATOM   7908 O OE2   . GLU C 1 300 ? 40.323  7.303   -22.299 1.00 42.68 ? 297 GLU E OE2   1 
ATOM   7909 N N     . LEU C 1 301 ? 38.821  2.565   -18.622 1.00 34.62 ? 298 LEU E N     1 
ATOM   7910 C CA    . LEU C 1 301 ? 39.550  2.299   -17.380 1.00 34.13 ? 298 LEU E CA    1 
ATOM   7911 C C     . LEU C 1 301 ? 40.070  0.865   -17.301 1.00 33.59 ? 298 LEU E C     1 
ATOM   7912 O O     . LEU C 1 301 ? 41.089  0.609   -16.653 1.00 34.02 ? 298 LEU E O     1 
ATOM   7913 C CB    . LEU C 1 301 ? 38.668  2.613   -16.160 1.00 34.21 ? 298 LEU E CB    1 
ATOM   7914 C CG    . LEU C 1 301 ? 38.870  3.975   -15.469 1.00 34.54 ? 298 LEU E CG    1 
ATOM   7915 C CD1   . LEU C 1 301 ? 39.477  4.980   -16.393 1.00 35.75 ? 298 LEU E CD1   1 
ATOM   7916 C CD2   . LEU C 1 301 ? 37.535  4.502   -14.897 1.00 32.93 ? 298 LEU E CD2   1 
ATOM   7917 N N     . GLY C 1 302 ? 39.379  -0.057  -17.959 1.00 32.77 ? 299 GLY E N     1 
ATOM   7918 C CA    . GLY C 1 302 ? 39.788  -1.448  -17.989 1.00 32.66 ? 299 GLY E CA    1 
ATOM   7919 C C     . GLY C 1 302 ? 38.733  -2.428  -17.511 1.00 32.47 ? 299 GLY E C     1 
ATOM   7920 O O     . GLY C 1 302 ? 38.981  -3.640  -17.501 1.00 32.73 ? 299 GLY E O     1 
ATOM   7921 N N     . TYR C 1 303 ? 37.559  -1.932  -17.114 1.00 32.07 ? 300 TYR E N     1 
ATOM   7922 C CA    . TYR C 1 303 ? 36.490  -2.798  -16.610 1.00 31.79 ? 300 TYR E CA    1 
ATOM   7923 C C     . TYR C 1 303 ? 35.818  -3.596  -17.709 1.00 31.69 ? 300 TYR E C     1 
ATOM   7924 O O     . TYR C 1 303 ? 35.816  -3.204  -18.873 1.00 32.46 ? 300 TYR E O     1 
ATOM   7925 C CB    . TYR C 1 303 ? 35.430  -1.985  -15.873 1.00 31.55 ? 300 TYR E CB    1 
ATOM   7926 C CG    . TYR C 1 303 ? 35.885  -1.430  -14.545 1.00 31.86 ? 300 TYR E CG    1 
ATOM   7927 C CD1   . TYR C 1 303 ? 35.925  -2.236  -13.406 1.00 30.98 ? 300 TYR E CD1   1 
ATOM   7928 C CD2   . TYR C 1 303 ? 36.266  -0.093  -14.422 1.00 30.33 ? 300 TYR E CD2   1 
ATOM   7929 C CE1   . TYR C 1 303 ? 36.346  -1.711  -12.168 1.00 31.30 ? 300 TYR E CE1   1 
ATOM   7930 C CE2   . TYR C 1 303 ? 36.671  0.431   -13.213 1.00 30.60 ? 300 TYR E CE2   1 
ATOM   7931 C CZ    . TYR C 1 303 ? 36.711  -0.375  -12.089 1.00 30.73 ? 300 TYR E CZ    1 
ATOM   7932 O OH    . TYR C 1 303 ? 37.109  0.170   -10.892 1.00 31.56 ? 300 TYR E OH    1 
ATOM   7933 N N     . ALA C 1 304 ? 35.242  -4.723  -17.321 1.00 32.07 ? 301 ALA E N     1 
ATOM   7934 C CA    . ALA C 1 304 ? 34.416  -5.529  -18.200 1.00 31.92 ? 301 ALA E CA    1 
ATOM   7935 C C     . ALA C 1 304 ? 32.988  -5.038  -18.031 1.00 32.26 ? 301 ALA E C     1 
ATOM   7936 O O     . ALA C 1 304 ? 32.398  -5.198  -16.959 1.00 32.89 ? 301 ALA E O     1 
ATOM   7937 C CB    . ALA C 1 304 ? 34.515  -6.987  -17.826 1.00 32.27 ? 301 ALA E CB    1 
ATOM   7938 N N     . VAL C 1 305 ? 32.442  -4.446  -19.095 1.00 31.94 ? 302 VAL E N     1 
ATOM   7939 C CA    . VAL C 1 305 ? 31.153  -3.776  -19.059 1.00 31.66 ? 302 VAL E CA    1 
ATOM   7940 C C     . VAL C 1 305 ? 30.159  -4.498  -19.952 1.00 31.71 ? 302 VAL E C     1 
ATOM   7941 O O     . VAL C 1 305 ? 30.419  -4.717  -21.134 1.00 31.90 ? 302 VAL E O     1 
ATOM   7942 C CB    . VAL C 1 305 ? 31.280  -2.327  -19.553 1.00 31.50 ? 302 VAL E CB    1 
ATOM   7943 C CG1   . VAL C 1 305 ? 29.915  -1.662  -19.618 1.00 30.91 ? 302 VAL E CG1   1 
ATOM   7944 C CG2   . VAL C 1 305 ? 32.225  -1.538  -18.656 1.00 31.43 ? 302 VAL E CG2   1 
ATOM   7945 N N     . VAL C 1 306 ? 29.016  -4.858  -19.379 1.00 31.83 ? 303 VAL E N     1 
ATOM   7946 C CA    . VAL C 1 306 ? 27.920  -5.432  -20.142 1.00 31.73 ? 303 VAL E CA    1 
ATOM   7947 C C     . VAL C 1 306 ? 27.153  -4.275  -20.773 1.00 32.14 ? 303 VAL E C     1 
ATOM   7948 O O     . VAL C 1 306 ? 26.832  -3.297  -20.085 1.00 32.41 ? 303 VAL E O     1 
ATOM   7949 C CB    . VAL C 1 306 ? 26.987  -6.244  -19.249 1.00 31.50 ? 303 VAL E CB    1 
ATOM   7950 C CG1   . VAL C 1 306 ? 25.843  -6.797  -20.053 1.00 31.43 ? 303 VAL E CG1   1 
ATOM   7951 C CG2   . VAL C 1 306 ? 27.756  -7.368  -18.554 1.00 31.78 ? 303 VAL E CG2   1 
ATOM   7952 N N     . PRO C 1 307 ? 26.862  -4.364  -22.089 1.00 32.35 ? 304 PRO E N     1 
ATOM   7953 C CA    . PRO C 1 307 ? 26.158  -3.250  -22.753 1.00 32.00 ? 304 PRO E CA    1 
ATOM   7954 C C     . PRO C 1 307 ? 24.682  -3.167  -22.321 1.00 31.71 ? 304 PRO E C     1 
ATOM   7955 O O     . PRO C 1 307 ? 23.997  -4.186  -22.253 1.00 32.29 ? 304 PRO E O     1 
ATOM   7956 C CB    . PRO C 1 307 ? 26.302  -3.575  -24.244 1.00 32.04 ? 304 PRO E CB    1 
ATOM   7957 C CG    . PRO C 1 307 ? 26.457  -5.058  -24.289 1.00 32.62 ? 304 PRO E CG    1 
ATOM   7958 C CD    . PRO C 1 307 ? 27.167  -5.466  -23.022 1.00 32.33 ? 304 PRO E CD    1 
ATOM   7959 N N     . SER C 1 308 ? 24.221  -1.954  -22.047 1.00 31.13 ? 305 SER E N     1 
ATOM   7960 C CA    . SER C 1 308 ? 22.955  -1.714  -21.353 1.00 31.39 ? 305 SER E CA    1 
ATOM   7961 C C     . SER C 1 308 ? 22.041  -0.831  -22.182 1.00 30.96 ? 305 SER E C     1 
ATOM   7962 O O     . SER C 1 308 ? 22.525  -0.042  -22.983 1.00 30.84 ? 305 SER E O     1 
ATOM   7963 C CB    . SER C 1 308 ? 23.252  -0.985  -20.028 1.00 31.40 ? 305 SER E CB    1 
ATOM   7964 O OG    . SER C 1 308 ? 22.123  -0.287  -19.538 1.00 30.99 ? 305 SER E OG    1 
ATOM   7965 N N     . GLU C 1 309 ? 20.728  -0.926  -21.959 1.00 30.80 ? 306 GLU E N     1 
ATOM   7966 C CA    . GLU C 1 309 ? 19.790  0.014   -22.583 1.00 31.11 ? 306 GLU E CA    1 
ATOM   7967 C C     . GLU C 1 309 ? 18.888  0.690   -21.553 1.00 30.63 ? 306 GLU E C     1 
ATOM   7968 O O     . GLU C 1 309 ? 17.765  1.086   -21.861 1.00 30.11 ? 306 GLU E O     1 
ATOM   7969 C CB    . GLU C 1 309 ? 18.967  -0.697  -23.666 1.00 31.19 ? 306 GLU E CB    1 
ATOM   7970 C CG    . GLU C 1 309 ? 19.826  -1.169  -24.849 1.00 32.95 ? 306 GLU E CG    1 
ATOM   7971 C CD    . GLU C 1 309 ? 19.128  -2.220  -25.680 1.00 33.11 ? 306 GLU E CD    1 
ATOM   7972 O OE1   . GLU C 1 309 ? 18.253  -1.821  -26.496 1.00 35.87 ? 306 GLU E OE1   1 
ATOM   7973 O OE2   . GLU C 1 309 ? 19.443  -3.430  -25.488 1.00 34.58 ? 306 GLU E OE2   1 
ATOM   7974 N N     . SER C 1 310 ? 19.404  0.854   -20.333 1.00 30.09 ? 307 SER E N     1 
ATOM   7975 C CA    . SER C 1 310 ? 18.587  1.297   -19.210 1.00 29.60 ? 307 SER E CA    1 
ATOM   7976 C C     . SER C 1 310 ? 19.327  2.393   -18.453 1.00 28.84 ? 307 SER E C     1 
ATOM   7977 O O     . SER C 1 310 ? 20.306  2.953   -18.976 1.00 29.23 ? 307 SER E O     1 
ATOM   7978 C CB    . SER C 1 310 ? 18.287  0.097   -18.313 1.00 29.93 ? 307 SER E CB    1 
ATOM   7979 O OG    . SER C 1 310 ? 19.486  -0.382  -17.717 1.00 32.07 ? 307 SER E OG    1 
ATOM   7980 N N     . ASN C 1 311 ? 18.894  2.690   -17.228 1.00 27.58 ? 308 ASN E N     1 
ATOM   7981 C CA    . ASN C 1 311 ? 19.580  3.692   -16.407 1.00 27.25 ? 308 ASN E CA    1 
ATOM   7982 C C     . ASN C 1 311 ? 20.598  3.095   -15.425 1.00 26.48 ? 308 ASN E C     1 
ATOM   7983 O O     . ASN C 1 311 ? 20.815  3.634   -14.343 1.00 26.05 ? 308 ASN E O     1 
ATOM   7984 C CB    . ASN C 1 311 ? 18.571  4.560   -15.664 1.00 27.27 ? 308 ASN E CB    1 
ATOM   7985 C CG    . ASN C 1 311 ? 17.729  3.773   -14.685 1.00 28.10 ? 308 ASN E CG    1 
ATOM   7986 O OD1   . ASN C 1 311 ? 17.526  2.561   -14.840 1.00 26.97 ? 308 ASN E OD1   1 
ATOM   7987 N ND2   . ASN C 1 311 ? 17.216  4.467   -13.673 1.00 29.07 ? 308 ASN E ND2   1 
ATOM   7988 N N     . PHE C 1 312 ? 21.231  1.994   -15.817 1.00 25.96 ? 309 PHE E N     1 
ATOM   7989 C CA    . PHE C 1 312 ? 22.282  1.387   -15.005 1.00 25.99 ? 309 PHE E CA    1 
ATOM   7990 C C     . PHE C 1 312 ? 23.281  0.607   -15.843 1.00 25.45 ? 309 PHE E C     1 
ATOM   7991 O O     . PHE C 1 312 ? 23.070  0.350   -17.026 1.00 25.33 ? 309 PHE E O     1 
ATOM   7992 C CB    . PHE C 1 312 ? 21.687  0.491   -13.921 1.00 25.97 ? 309 PHE E CB    1 
ATOM   7993 C CG    . PHE C 1 312 ? 20.679  -0.504  -14.434 1.00 26.17 ? 309 PHE E CG    1 
ATOM   7994 C CD1   . PHE C 1 312 ? 21.083  -1.724  -14.960 1.00 26.97 ? 309 PHE E CD1   1 
ATOM   7995 C CD2   . PHE C 1 312 ? 19.316  -0.229  -14.357 1.00 26.61 ? 309 PHE E CD2   1 
ATOM   7996 C CE1   . PHE C 1 312 ? 20.147  -2.644  -15.411 1.00 25.78 ? 309 PHE E CE1   1 
ATOM   7997 C CE2   . PHE C 1 312 ? 18.376  -1.151  -14.806 1.00 26.28 ? 309 PHE E CE2   1 
ATOM   7998 C CZ    . PHE C 1 312 ? 18.795  -2.353  -15.332 1.00 25.81 ? 309 PHE E CZ    1 
ATOM   7999 N N     . VAL C 1 313 ? 24.381  0.249   -15.212 1.00 25.60 ? 310 VAL E N     1 
ATOM   8000 C CA    . VAL C 1 313 ? 25.465  -0.469  -15.872 1.00 26.11 ? 310 VAL E CA    1 
ATOM   8001 C C     . VAL C 1 313 ? 25.954  -1.583  -14.967 1.00 26.19 ? 310 VAL E C     1 
ATOM   8002 O O     . VAL C 1 313 ? 26.157  -1.374  -13.778 1.00 26.53 ? 310 VAL E O     1 
ATOM   8003 C CB    . VAL C 1 313 ? 26.642  0.456   -16.225 1.00 25.74 ? 310 VAL E CB    1 
ATOM   8004 C CG1   . VAL C 1 313 ? 27.810  -0.364  -16.785 1.00 26.15 ? 310 VAL E CG1   1 
ATOM   8005 C CG2   . VAL C 1 313 ? 26.215  1.494   -17.228 1.00 26.53 ? 310 VAL E CG2   1 
ATOM   8006 N N     . PHE C 1 314 ? 26.125  -2.757  -15.559 1.00 26.81 ? 311 PHE E N     1 
ATOM   8007 C CA    . PHE C 1 314 ? 26.621  -3.957  -14.903 1.00 27.22 ? 311 PHE E CA    1 
ATOM   8008 C C     . PHE C 1 314 ? 28.074  -4.142  -15.352 1.00 27.63 ? 311 PHE E C     1 
ATOM   8009 O O     . PHE C 1 314 ? 28.345  -4.165  -16.550 1.00 27.27 ? 311 PHE E O     1 
ATOM   8010 C CB    . PHE C 1 314 ? 25.769  -5.114  -15.379 1.00 27.79 ? 311 PHE E CB    1 
ATOM   8011 C CG    . PHE C 1 314 ? 25.824  -6.341  -14.520 1.00 28.60 ? 311 PHE E CG    1 
ATOM   8012 C CD1   . PHE C 1 314 ? 25.522  -6.284  -13.167 1.00 28.96 ? 311 PHE E CD1   1 
ATOM   8013 C CD2   . PHE C 1 314 ? 26.086  -7.580  -15.094 1.00 29.34 ? 311 PHE E CD2   1 
ATOM   8014 C CE1   . PHE C 1 314 ? 25.528  -7.429  -12.385 1.00 29.15 ? 311 PHE E CE1   1 
ATOM   8015 C CE2   . PHE C 1 314 ? 26.089  -8.734  -14.320 1.00 29.47 ? 311 PHE E CE2   1 
ATOM   8016 C CZ    . PHE C 1 314 ? 25.805  -8.658  -12.962 1.00 28.97 ? 311 PHE E CZ    1 
ATOM   8017 N N     . PHE C 1 315 ? 28.995  -4.253  -14.393 1.00 27.93 ? 312 PHE E N     1 
ATOM   8018 C CA    . PHE C 1 315 ? 30.417  -4.244  -14.687 1.00 28.58 ? 312 PHE E CA    1 
ATOM   8019 C C     . PHE C 1 315 ? 31.217  -5.051  -13.682 1.00 29.28 ? 312 PHE E C     1 
ATOM   8020 O O     . PHE C 1 315 ? 30.745  -5.322  -12.586 1.00 29.35 ? 312 PHE E O     1 
ATOM   8021 C CB    . PHE C 1 315 ? 30.956  -2.812  -14.758 1.00 28.00 ? 312 PHE E CB    1 
ATOM   8022 C CG    . PHE C 1 315 ? 30.981  -2.086  -13.438 1.00 27.74 ? 312 PHE E CG    1 
ATOM   8023 C CD1   . PHE C 1 315 ? 29.805  -1.622  -12.858 1.00 27.29 ? 312 PHE E CD1   1 
ATOM   8024 C CD2   . PHE C 1 315 ? 32.187  -1.805  -12.806 1.00 28.05 ? 312 PHE E CD2   1 
ATOM   8025 C CE1   . PHE C 1 315 ? 29.829  -0.913  -11.662 1.00 26.99 ? 312 PHE E CE1   1 
ATOM   8026 C CE2   . PHE C 1 315 ? 32.223  -1.102  -11.603 1.00 27.69 ? 312 PHE E CE2   1 
ATOM   8027 C CZ    . PHE C 1 315 ? 31.035  -0.656  -11.030 1.00 27.96 ? 312 PHE E CZ    1 
ATOM   8028 N N     . GLY C 1 316 ? 32.438  -5.416  -14.086 1.00 30.66 ? 313 GLY E N     1 
ATOM   8029 C CA    . GLY C 1 316 ? 33.274  -6.389  -13.374 1.00 31.19 ? 313 GLY E CA    1 
ATOM   8030 C C     . GLY C 1 316 ? 34.696  -6.367  -13.920 1.00 32.56 ? 313 GLY E C     1 
ATOM   8031 O O     . GLY C 1 316 ? 35.063  -5.387  -14.552 1.00 32.45 ? 313 GLY E O     1 
ATOM   8032 N N     . ASP C 1 317 ? 35.516  -7.409  -13.699 1.00 33.96 ? 314 ASP E N     1 
ATOM   8033 C CA    . ASP C 1 317 ? 35.205  -8.601  -12.888 1.00 35.08 ? 314 ASP E CA    1 
ATOM   8034 C C     . ASP C 1 317 ? 36.148  -8.634  -11.686 1.00 35.01 ? 314 ASP E C     1 
ATOM   8035 O O     . ASP C 1 317 ? 37.359  -8.811  -11.842 1.00 34.79 ? 314 ASP E O     1 
ATOM   8036 C CB    . ASP C 1 317 ? 35.400  -9.903  -13.688 1.00 35.97 ? 314 ASP E CB    1 
ATOM   8037 C CG    . ASP C 1 317 ? 34.914  -9.795  -15.124 1.00 40.09 ? 314 ASP E CG    1 
ATOM   8038 O OD1   . ASP C 1 317 ? 34.245  -8.781  -15.442 1.00 45.50 ? 314 ASP E OD1   1 
ATOM   8039 O OD2   . ASP C 1 317 ? 35.197  -10.717 -15.945 1.00 44.70 ? 314 ASP E OD2   1 
ATOM   8040 N N     . PHE C 1 318 ? 35.598  -8.476  -10.485 1.00 34.61 ? 315 PHE E N     1 
ATOM   8041 C CA    . PHE C 1 318 ? 36.416  -8.436  -9.282  1.00 34.56 ? 315 PHE E CA    1 
ATOM   8042 C C     . PHE C 1 318 ? 36.610  -9.856  -8.742  1.00 34.76 ? 315 PHE E C     1 
ATOM   8043 O O     . PHE C 1 318 ? 35.757  -10.712 -8.942  1.00 34.82 ? 315 PHE E O     1 
ATOM   8044 C CB    . PHE C 1 318 ? 35.739  -7.567  -8.226  1.00 33.92 ? 315 PHE E CB    1 
ATOM   8045 C CG    . PHE C 1 318 ? 35.393  -6.171  -8.699  1.00 33.59 ? 315 PHE E CG    1 
ATOM   8046 C CD1   . PHE C 1 318 ? 36.344  -5.161  -8.687  1.00 32.98 ? 315 PHE E CD1   1 
ATOM   8047 C CD2   . PHE C 1 318 ? 34.105  -5.864  -9.127  1.00 32.61 ? 315 PHE E CD2   1 
ATOM   8048 C CE1   . PHE C 1 318 ? 36.020  -3.873  -9.108  1.00 32.87 ? 315 PHE E CE1   1 
ATOM   8049 C CE2   . PHE C 1 318 ? 33.779  -4.580  -9.547  1.00 32.92 ? 315 PHE E CE2   1 
ATOM   8050 C CZ    . PHE C 1 318 ? 34.733  -3.584  -9.536  1.00 32.20 ? 315 PHE E CZ    1 
ATOM   8051 N N     . SER C 1 319 ? 37.726  -10.107 -8.057  1.00 35.29 ? 316 SER E N     1 
ATOM   8052 C CA    . SER C 1 319 ? 37.879  -11.349 -7.270  1.00 35.21 ? 316 SER E CA    1 
ATOM   8053 C C     . SER C 1 319 ? 36.835  -11.374 -6.156  1.00 35.18 ? 316 SER E C     1 
ATOM   8054 O O     . SER C 1 319 ? 36.182  -12.396 -5.934  1.00 35.40 ? 316 SER E O     1 
ATOM   8055 C CB    . SER C 1 319 ? 39.269  -11.453 -6.641  1.00 35.79 ? 316 SER E CB    1 
ATOM   8056 O OG    . SER C 1 319 ? 40.299  -11.343 -7.607  1.00 37.42 ? 316 SER E OG    1 
ATOM   8057 N N     . ASP C 1 320 ? 36.682  -10.244 -5.459  1.00 35.10 ? 317 ASP E N     1 
ATOM   8058 C CA    . ASP C 1 320 ? 35.655  -10.090 -4.428  1.00 34.33 ? 317 ASP E CA    1 
ATOM   8059 C C     . ASP C 1 320 ? 34.907  -8.798  -4.677  1.00 33.55 ? 317 ASP E C     1 
ATOM   8060 O O     . ASP C 1 320 ? 35.395  -7.714  -4.344  1.00 33.46 ? 317 ASP E O     1 
ATOM   8061 C CB    . ASP C 1 320 ? 36.291  -10.080 -3.022  1.00 35.23 ? 317 ASP E CB    1 
ATOM   8062 C CG    . ASP C 1 320 ? 35.247  -9.981  -1.883  1.00 36.43 ? 317 ASP E CG    1 
ATOM   8063 O OD1   . ASP C 1 320 ? 34.020  -10.180 -2.115  1.00 39.24 ? 317 ASP E OD1   1 
ATOM   8064 O OD2   . ASP C 1 320 ? 35.669  -9.715  -0.739  1.00 40.29 ? 317 ASP E OD2   1 
ATOM   8065 N N     . GLN C 1 321 ? 33.713  -8.915  -5.247  1.00 32.88 ? 318 GLN E N     1 
ATOM   8066 C CA    . GLN C 1 321 ? 32.912  -7.737  -5.586  1.00 32.59 ? 318 GLN E CA    1 
ATOM   8067 C C     . GLN C 1 321 ? 32.333  -7.017  -4.374  1.00 31.62 ? 318 GLN E C     1 
ATOM   8068 O O     . GLN C 1 321 ? 32.006  -5.832  -4.468  1.00 30.93 ? 318 GLN E O     1 
ATOM   8069 C CB    . GLN C 1 321 ? 31.794  -8.017  -6.606  1.00 32.71 ? 318 GLN E CB    1 
ATOM   8070 C CG    . GLN C 1 321 ? 31.490  -9.453  -6.920  1.00 34.88 ? 318 GLN E CG    1 
ATOM   8071 C CD    . GLN C 1 321 ? 30.652  -10.158 -5.893  1.00 36.19 ? 318 GLN E CD    1 
ATOM   8072 O OE1   . GLN C 1 321 ? 29.669  -9.618  -5.392  1.00 38.55 ? 318 GLN E OE1   1 
ATOM   8073 N NE2   . GLN C 1 321 ? 31.013  -11.392 -5.603  1.00 37.35 ? 318 GLN E NE2   1 
ATOM   8074 N N     . HIS C 1 322 ? 32.199  -7.706  -3.245  1.00 31.24 ? 319 HIS E N     1 
ATOM   8075 C CA    . HIS C 1 322 ? 31.759  -7.018  -2.024  1.00 30.62 ? 319 HIS E CA    1 
ATOM   8076 C C     . HIS C 1 322 ? 32.850  -6.126  -1.469  1.00 29.38 ? 319 HIS E C     1 
ATOM   8077 O O     . HIS C 1 322 ? 32.591  -5.028  -1.004  1.00 29.44 ? 319 HIS E O     1 
ATOM   8078 C CB    . HIS C 1 322 ? 31.329  -7.980  -0.941  1.00 31.13 ? 319 HIS E CB    1 
ATOM   8079 C CG    . HIS C 1 322 ? 30.617  -7.299  0.181   1.00 32.13 ? 319 HIS E CG    1 
ATOM   8080 N ND1   . HIS C 1 322 ? 31.263  -6.871  1.321   1.00 34.15 ? 319 HIS E ND1   1 
ATOM   8081 C CD2   . HIS C 1 322 ? 29.323  -6.922  0.313   1.00 33.75 ? 319 HIS E CD2   1 
ATOM   8082 C CE1   . HIS C 1 322 ? 30.388  -6.293  2.123   1.00 34.95 ? 319 HIS E CE1   1 
ATOM   8083 N NE2   . HIS C 1 322 ? 29.202  -6.319  1.539   1.00 34.77 ? 319 HIS E NE2   1 
ATOM   8084 N N     . ALA C 1 323 ? 34.075  -6.612  -1.522  1.00 28.80 ? 320 ALA E N     1 
ATOM   8085 C CA    . ALA C 1 323 ? 35.235  -5.807  -1.183  1.00 28.09 ? 320 ALA E CA    1 
ATOM   8086 C C     . ALA C 1 323 ? 35.237  -4.535  -2.048  1.00 27.25 ? 320 ALA E C     1 
ATOM   8087 O O     . ALA C 1 323 ? 35.365  -3.426  -1.533  1.00 27.92 ? 320 ALA E O     1 
ATOM   8088 C CB    . ALA C 1 323 ? 36.513  -6.629  -1.373  1.00 27.94 ? 320 ALA E CB    1 
ATOM   8089 N N     . ALA C 1 324 ? 35.032  -4.698  -3.352  1.00 26.34 ? 321 ALA E N     1 
ATOM   8090 C CA    . ALA C 1 324 ? 34.945  -3.561  -4.289  1.00 25.50 ? 321 ALA E CA    1 
ATOM   8091 C C     . ALA C 1 324 ? 33.782  -2.623  -3.957  1.00 24.79 ? 321 ALA E C     1 
ATOM   8092 O O     . ALA C 1 324 ? 33.930  -1.389  -3.924  1.00 23.40 ? 321 ALA E O     1 
ATOM   8093 C CB    . ALA C 1 324 ? 34.823  -4.071  -5.711  1.00 25.32 ? 321 ALA E CB    1 
ATOM   8094 N N     . TRP C 1 325 ? 32.625  -3.210  -3.691  1.00 23.90 ? 322 TRP E N     1 
ATOM   8095 C CA    . TRP C 1 325 ? 31.485  -2.433  -3.227  1.00 24.04 ? 322 TRP E CA    1 
ATOM   8096 C C     . TRP C 1 325 ? 31.854  -1.539  -2.027  1.00 23.76 ? 322 TRP E C     1 
ATOM   8097 O O     . TRP C 1 325 ? 31.656  -0.316  -2.055  1.00 22.74 ? 322 TRP E O     1 
ATOM   8098 C CB    . TRP C 1 325 ? 30.333  -3.377  -2.903  1.00 24.25 ? 322 TRP E CB    1 
ATOM   8099 C CG    . TRP C 1 325 ? 29.083  -2.702  -2.392  1.00 24.08 ? 322 TRP E CG    1 
ATOM   8100 C CD1   . TRP C 1 325 ? 28.118  -2.116  -3.134  1.00 24.69 ? 322 TRP E CD1   1 
ATOM   8101 C CD2   . TRP C 1 325 ? 28.672  -2.581  -1.028  1.00 24.54 ? 322 TRP E CD2   1 
ATOM   8102 N NE1   . TRP C 1 325 ? 27.125  -1.626  -2.323  1.00 25.00 ? 322 TRP E NE1   1 
ATOM   8103 C CE2   . TRP C 1 325 ? 27.445  -1.889  -1.023  1.00 24.00 ? 322 TRP E CE2   1 
ATOM   8104 C CE3   . TRP C 1 325 ? 29.233  -2.965  0.193   1.00 24.58 ? 322 TRP E CE3   1 
ATOM   8105 C CZ2   . TRP C 1 325 ? 26.762  -1.589  0.149   1.00 24.88 ? 322 TRP E CZ2   1 
ATOM   8106 C CZ3   . TRP C 1 325 ? 28.542  -2.679  1.361   1.00 24.81 ? 322 TRP E CZ3   1 
ATOM   8107 C CH2   . TRP C 1 325 ? 27.326  -1.992  1.331   1.00 24.65 ? 322 TRP E CH2   1 
ATOM   8108 N N     . GLN C 1 326 ? 32.429  -2.136  -0.984  1.00 24.02 ? 323 GLN E N     1 
ATOM   8109 C CA    . GLN C 1 326 ? 32.832  -1.355  0.182   1.00 23.63 ? 323 GLN E CA    1 
ATOM   8110 C C     . GLN C 1 326 ? 33.819  -0.251  -0.173  1.00 23.59 ? 323 GLN E C     1 
ATOM   8111 O O     . GLN C 1 326 ? 33.672  0.868   0.323   1.00 23.81 ? 323 GLN E O     1 
ATOM   8112 C CB    . GLN C 1 326 ? 33.402  -2.237  1.292   1.00 23.88 ? 323 GLN E CB    1 
ATOM   8113 C CG    . GLN C 1 326 ? 33.593  -1.500  2.637   1.00 24.09 ? 323 GLN E CG    1 
ATOM   8114 C CD    . GLN C 1 326 ? 32.299  -0.938  3.216   1.00 26.16 ? 323 GLN E CD    1 
ATOM   8115 O OE1   . GLN C 1 326 ? 31.283  -1.637  3.285   1.00 28.17 ? 323 GLN E OE1   1 
ATOM   8116 N NE2   . GLN C 1 326 ? 32.328  0.333   3.636   1.00 23.28 ? 323 GLN E NE2   1 
ATOM   8117 N N     . ALA C 1 327 ? 34.802  -0.550  -1.023  1.00 23.17 ? 324 ALA E N     1 
ATOM   8118 C CA    . ALA C 1 327 ? 35.734  0.478   -1.509  1.00 23.21 ? 324 ALA E CA    1 
ATOM   8119 C C     . ALA C 1 327 ? 35.021  1.659   -2.146  1.00 23.47 ? 324 ALA E C     1 
ATOM   8120 O O     . ALA C 1 327 ? 35.420  2.801   -1.912  1.00 22.78 ? 324 ALA E O     1 
ATOM   8121 C CB    . ALA C 1 327 ? 36.729  -0.108  -2.501  1.00 23.45 ? 324 ALA E CB    1 
ATOM   8122 N N     . PHE C 1 328 ? 33.994  1.399   -2.971  1.00 23.61 ? 325 PHE E N     1 
ATOM   8123 C CA    . PHE C 1 328 ? 33.221  2.490   -3.551  1.00 24.01 ? 325 PHE E CA    1 
ATOM   8124 C C     . PHE C 1 328 ? 32.560  3.274   -2.430  1.00 24.18 ? 325 PHE E C     1 
ATOM   8125 O O     . PHE C 1 328 ? 32.584  4.508   -2.421  1.00 24.56 ? 325 PHE E O     1 
ATOM   8126 C CB    . PHE C 1 328 ? 32.147  1.993   -4.538  1.00 24.41 ? 325 PHE E CB    1 
ATOM   8127 C CG    . PHE C 1 328 ? 32.665  1.735   -5.922  1.00 24.07 ? 325 PHE E CG    1 
ATOM   8128 C CD1   . PHE C 1 328 ? 32.860  2.789   -6.810  1.00 24.37 ? 325 PHE E CD1   1 
ATOM   8129 C CD2   . PHE C 1 328 ? 32.964  0.447   -6.335  1.00 23.80 ? 325 PHE E CD2   1 
ATOM   8130 C CE1   . PHE C 1 328 ? 33.342  2.564   -8.098  1.00 24.34 ? 325 PHE E CE1   1 
ATOM   8131 C CE2   . PHE C 1 328 ? 33.451  0.204   -7.606  1.00 25.19 ? 325 PHE E CE2   1 
ATOM   8132 C CZ    . PHE C 1 328 ? 33.638  1.274   -8.501  1.00 25.84 ? 325 PHE E CZ    1 
ATOM   8133 N N     . LEU C 1 329 ? 31.960  2.544   -1.492  1.00 24.72 ? 326 LEU E N     1 
ATOM   8134 C CA    . LEU C 1 329 ? 31.212  3.146   -0.391  1.00 25.09 ? 326 LEU E CA    1 
ATOM   8135 C C     . LEU C 1 329 ? 32.134  3.985   0.508   1.00 25.52 ? 326 LEU E C     1 
ATOM   8136 O O     . LEU C 1 329 ? 31.767  5.087   0.901   1.00 25.14 ? 326 LEU E O     1 
ATOM   8137 C CB    . LEU C 1 329 ? 30.476  2.056   0.405   1.00 25.21 ? 326 LEU E CB    1 
ATOM   8138 C CG    . LEU C 1 329 ? 29.434  2.481   1.453   1.00 25.28 ? 326 LEU E CG    1 
ATOM   8139 C CD1   . LEU C 1 329 ? 28.351  3.353   0.849   1.00 24.60 ? 326 LEU E CD1   1 
ATOM   8140 C CD2   . LEU C 1 329 ? 28.821  1.258   2.091   1.00 24.62 ? 326 LEU E CD2   1 
ATOM   8141 N N     . ASP C 1 330 ? 33.339  3.482   0.781   1.00 25.88 ? 327 ASP E N     1 
ATOM   8142 C CA    . ASP C 1 330 ? 34.348  4.231   1.551   1.00 26.51 ? 327 ASP E CA    1 
ATOM   8143 C C     . ASP C 1 330 ? 34.645  5.596   0.929   1.00 27.18 ? 327 ASP E C     1 
ATOM   8144 O O     . ASP C 1 330 ? 34.948  6.577   1.636   1.00 27.63 ? 327 ASP E O     1 
ATOM   8145 C CB    . ASP C 1 330 ? 35.658  3.431   1.682   1.00 26.41 ? 327 ASP E CB    1 
ATOM   8146 C CG    . ASP C 1 330 ? 35.527  2.235   2.622   1.00 26.59 ? 327 ASP E CG    1 
ATOM   8147 O OD1   . ASP C 1 330 ? 34.485  2.130   3.315   1.00 25.79 ? 327 ASP E OD1   1 
ATOM   8148 O OD2   . ASP C 1 330 ? 36.458  1.391   2.662   1.00 25.31 ? 327 ASP E OD2   1 
ATOM   8149 N N     . ARG C 1 331 ? 34.535  5.659   -0.393  1.00 27.32 ? 328 ARG E N     1 
ATOM   8150 C CA    . ARG C 1 331 ? 34.738  6.907   -1.124  1.00 27.15 ? 328 ARG E CA    1 
ATOM   8151 C C     . ARG C 1 331 ? 33.445  7.723   -1.298  1.00 26.88 ? 328 ARG E C     1 
ATOM   8152 O O     . ARG C 1 331 ? 33.422  8.663   -2.066  1.00 27.72 ? 328 ARG E O     1 
ATOM   8153 C CB    . ARG C 1 331 ? 35.380  6.592   -2.471  1.00 27.42 ? 328 ARG E CB    1 
ATOM   8154 C CG    . ARG C 1 331 ? 36.806  6.124   -2.360  1.00 27.81 ? 328 ARG E CG    1 
ATOM   8155 C CD    . ARG C 1 331 ? 37.222  5.268   -3.535  1.00 28.12 ? 328 ARG E CD    1 
ATOM   8156 N NE    . ARG C 1 331 ? 38.625  4.876   -3.419  1.00 29.92 ? 328 ARG E NE    1 
ATOM   8157 C CZ    . ARG C 1 331 ? 39.090  3.909   -2.618  1.00 31.45 ? 328 ARG E CZ    1 
ATOM   8158 N NH1   . ARG C 1 331 ? 38.268  3.203   -1.851  1.00 31.76 ? 328 ARG E NH1   1 
ATOM   8159 N NH2   . ARG C 1 331 ? 40.395  3.641   -2.586  1.00 30.34 ? 328 ARG E NH2   1 
ATOM   8160 N N     . GLY C 1 332 ? 32.385  7.368   -0.579  1.00 26.34 ? 329 GLY E N     1 
ATOM   8161 C CA    . GLY C 1 332 ? 31.131  8.120   -0.594  1.00 25.75 ? 329 GLY E CA    1 
ATOM   8162 C C     . GLY C 1 332 ? 30.169  7.794   -1.726  1.00 25.44 ? 329 GLY E C     1 
ATOM   8163 O O     . GLY C 1 332 ? 29.212  8.533   -1.959  1.00 26.00 ? 329 GLY E O     1 
ATOM   8164 N N     . VAL C 1 333 ? 30.408  6.687   -2.421  1.00 24.93 ? 330 VAL E N     1 
ATOM   8165 C CA    . VAL C 1 333 ? 29.622  6.295   -3.590  1.00 24.06 ? 330 VAL E CA    1 
ATOM   8166 C C     . VAL C 1 333 ? 28.931  4.960   -3.313  1.00 23.76 ? 330 VAL E C     1 
ATOM   8167 O O     . VAL C 1 333 ? 29.590  3.929   -3.144  1.00 22.90 ? 330 VAL E O     1 
ATOM   8168 C CB    . VAL C 1 333 ? 30.536  6.195   -4.845  1.00 24.37 ? 330 VAL E CB    1 
ATOM   8169 C CG1   . VAL C 1 333 ? 29.754  5.715   -6.091  1.00 22.84 ? 330 VAL E CG1   1 
ATOM   8170 C CG2   . VAL C 1 333 ? 31.218  7.556   -5.116  1.00 23.42 ? 330 VAL E CG2   1 
ATOM   8171 N N     . LEU C 1 334 ? 27.600  4.992   -3.252  1.00 23.45 ? 331 LEU E N     1 
ATOM   8172 C CA    . LEU C 1 334 ? 26.803  3.799   -2.953  1.00 23.40 ? 331 LEU E CA    1 
ATOM   8173 C C     . LEU C 1 334 ? 26.226  3.210   -4.242  1.00 23.00 ? 331 LEU E C     1 
ATOM   8174 O O     . LEU C 1 334 ? 25.367  3.816   -4.869  1.00 22.57 ? 331 LEU E O     1 
ATOM   8175 C CB    . LEU C 1 334 ? 25.669  4.148   -1.977  1.00 23.27 ? 331 LEU E CB    1 
ATOM   8176 C CG    . LEU C 1 334 ? 24.744  3.021   -1.494  1.00 23.56 ? 331 LEU E CG    1 
ATOM   8177 C CD1   . LEU C 1 334 ? 25.537  1.845   -0.913  1.00 23.88 ? 331 LEU E CD1   1 
ATOM   8178 C CD2   . LEU C 1 334 ? 23.739  3.567   -0.490  1.00 23.34 ? 331 LEU E CD2   1 
ATOM   8179 N N     . ILE C 1 335 ? 26.730  2.045   -4.641  1.00 23.35 ? 332 ILE E N     1 
ATOM   8180 C CA    . ILE C 1 335 ? 26.190  1.301   -5.786  1.00 23.75 ? 332 ILE E CA    1 
ATOM   8181 C C     . ILE C 1 335 ? 25.600  -0.017  -5.271  1.00 24.06 ? 332 ILE E C     1 
ATOM   8182 O O     . ILE C 1 335 ? 25.273  -0.111  -4.085  1.00 24.35 ? 332 ILE E O     1 
ATOM   8183 C CB    . ILE C 1 335 ? 27.243  1.145   -6.942  1.00 23.64 ? 332 ILE E CB    1 
ATOM   8184 C CG1   . ILE C 1 335 ? 28.355  0.163   -6.600  1.00 23.18 ? 332 ILE E CG1   1 
ATOM   8185 C CG2   . ILE C 1 335 ? 27.835  2.511   -7.318  1.00 22.30 ? 332 ILE E CG2   1 
ATOM   8186 C CD1   . ILE C 1 335 ? 29.561  0.272   -7.549  1.00 23.40 ? 332 ILE E CD1   1 
ATOM   8187 N N     . ARG C 1 336 ? 25.437  -1.019  -6.128  1.00 24.74 ? 333 ARG E N     1 
ATOM   8188 C CA    . ARG C 1 336 ? 24.711  -2.227  -5.748  1.00 25.32 ? 333 ARG E CA    1 
ATOM   8189 C C     . ARG C 1 336 ? 25.503  -3.520  -5.966  1.00 26.06 ? 333 ARG E C     1 
ATOM   8190 O O     . ARG C 1 336 ? 26.005  -3.762  -7.060  1.00 26.30 ? 333 ARG E O     1 
ATOM   8191 C CB    . ARG C 1 336 ? 23.402  -2.298  -6.529  1.00 25.07 ? 333 ARG E CB    1 
ATOM   8192 C CG    . ARG C 1 336 ? 22.493  -3.479  -6.122  1.00 26.21 ? 333 ARG E CG    1 
ATOM   8193 C CD    . ARG C 1 336 ? 21.459  -3.077  -5.070  1.00 29.62 ? 333 ARG E CD    1 
ATOM   8194 N NE    . ARG C 1 336 ? 21.507  -3.944  -3.922  1.00 33.39 ? 333 ARG E NE    1 
ATOM   8195 C CZ    . ARG C 1 336 ? 20.882  -5.113  -3.795  1.00 33.49 ? 333 ARG E CZ    1 
ATOM   8196 N NH1   . ARG C 1 336 ? 20.082  -5.586  -4.736  1.00 35.53 ? 333 ARG E NH1   1 
ATOM   8197 N NH2   . ARG C 1 336 ? 21.055  -5.802  -2.685  1.00 33.22 ? 333 ARG E NH2   1 
ATOM   8198 N N     . ASP C 1 337 ? 25.598  -4.337  -4.914  1.00 27.10 ? 334 ASP E N     1 
ATOM   8199 C CA    . ASP C 1 337 ? 26.132  -5.703  -4.994  1.00 27.77 ? 334 ASP E CA    1 
ATOM   8200 C C     . ASP C 1 337 ? 24.936  -6.615  -5.036  1.00 28.33 ? 334 ASP E C     1 
ATOM   8201 O O     . ASP C 1 337 ? 24.308  -6.874  -4.006  1.00 28.82 ? 334 ASP E O     1 
ATOM   8202 C CB    . ASP C 1 337 ? 27.016  -6.043  -3.780  1.00 27.89 ? 334 ASP E CB    1 
ATOM   8203 C CG    . ASP C 1 337 ? 27.514  -7.504  -3.775  1.00 28.36 ? 334 ASP E CG    1 
ATOM   8204 O OD1   . ASP C 1 337 ? 27.312  -8.251  -4.770  1.00 30.88 ? 334 ASP E OD1   1 
ATOM   8205 O OD2   . ASP C 1 337 ? 28.106  -7.914  -2.754  1.00 29.81 ? 334 ASP E OD2   1 
ATOM   8206 N N     . VAL C 1 338 ? 24.620  -7.083  -6.239  1.00 29.20 ? 335 VAL E N     1 
ATOM   8207 C CA    . VAL C 1 338 ? 23.440  -7.903  -6.491  1.00 29.95 ? 335 VAL E CA    1 
ATOM   8208 C C     . VAL C 1 338 ? 23.727  -9.384  -6.244  1.00 30.70 ? 335 VAL E C     1 
ATOM   8209 O O     . VAL C 1 338 ? 22.912  -10.242 -6.595  1.00 31.79 ? 335 VAL E O     1 
ATOM   8210 C CB    . VAL C 1 338 ? 22.927  -7.718  -7.952  1.00 30.50 ? 335 VAL E CB    1 
ATOM   8211 C CG1   . VAL C 1 338 ? 22.523  -6.263  -8.202  1.00 30.39 ? 335 VAL E CG1   1 
ATOM   8212 C CG2   . VAL C 1 338 ? 23.986  -8.144  -8.967  1.00 30.67 ? 335 VAL E CG2   1 
ATOM   8213 N N     . GLY C 1 339 ? 24.876  -9.696  -5.653  1.00 30.52 ? 336 GLY E N     1 
ATOM   8214 C CA    . GLY C 1 339 ? 25.198  -11.081 -5.320  1.00 30.64 ? 336 GLY E CA    1 
ATOM   8215 C C     . GLY C 1 339 ? 25.684  -11.903 -6.504  1.00 31.05 ? 336 GLY E C     1 
ATOM   8216 O O     . GLY C 1 339 ? 25.674  -13.136 -6.442  1.00 31.56 ? 336 GLY E O     1 
ATOM   8217 N N     . ILE C 1 340 ? 26.133  -11.238 -7.573  1.00 30.82 ? 337 ILE E N     1 
ATOM   8218 C CA    . ILE C 1 340 ? 26.668  -11.932 -8.739  1.00 30.54 ? 337 ILE E CA    1 
ATOM   8219 C C     . ILE C 1 340 ? 28.177  -11.835 -8.748  1.00 30.45 ? 337 ILE E C     1 
ATOM   8220 O O     . ILE C 1 340 ? 28.740  -10.741 -8.885  1.00 30.15 ? 337 ILE E O     1 
ATOM   8221 C CB    . ILE C 1 340 ? 26.147  -11.347 -10.061 1.00 30.79 ? 337 ILE E CB    1 
ATOM   8222 C CG1   . ILE C 1 340 ? 24.618  -11.471 -10.150 1.00 31.16 ? 337 ILE E CG1   1 
ATOM   8223 C CG2   . ILE C 1 340 ? 26.839  -12.021 -11.252 1.00 30.68 ? 337 ILE E CG2   1 
ATOM   8224 C CD1   . ILE C 1 340 ? 24.072  -12.866 -9.839  1.00 34.10 ? 337 ILE E CD1   1 
ATOM   8225 N N     . ALA C 1 341 ? 28.816  -12.998 -8.630  1.00 30.38 ? 338 ALA E N     1 
ATOM   8226 C CA    . ALA C 1 341 ? 30.270  -13.107 -8.596  1.00 29.99 ? 338 ALA E CA    1 
ATOM   8227 C C     . ALA C 1 341 ? 30.909  -12.237 -9.668  1.00 29.68 ? 338 ALA E C     1 
ATOM   8228 O O     . ALA C 1 341 ? 30.514  -12.281 -10.838 1.00 30.46 ? 338 ALA E O     1 
ATOM   8229 C CB    . ALA C 1 341 ? 30.685  -14.560 -8.785  1.00 30.41 ? 338 ALA E CB    1 
ATOM   8230 N N     . GLY C 1 342 ? 31.886  -11.439 -9.257  1.00 28.91 ? 339 GLY E N     1 
ATOM   8231 C CA    . GLY C 1 342 ? 32.637  -10.590 -10.166 1.00 28.40 ? 339 GLY E CA    1 
ATOM   8232 C C     . GLY C 1 342 ? 32.070  -9.213  -10.457 1.00 28.02 ? 339 GLY E C     1 
ATOM   8233 O O     . GLY C 1 342 ? 32.827  -8.310  -10.785 1.00 27.62 ? 339 GLY E O     1 
ATOM   8234 N N     . HIS C 1 343 ? 30.757  -9.026  -10.337 1.00 27.58 ? 340 HIS E N     1 
ATOM   8235 C CA    . HIS C 1 343 ? 30.133  -7.811  -10.881 1.00 27.25 ? 340 HIS E CA    1 
ATOM   8236 C C     . HIS C 1 343 ? 29.390  -6.937  -9.862  1.00 26.57 ? 340 HIS E C     1 
ATOM   8237 O O     . HIS C 1 343 ? 28.942  -7.425  -8.824  1.00 26.26 ? 340 HIS E O     1 
ATOM   8238 C CB    . HIS C 1 343 ? 29.180  -8.190  -12.022 1.00 27.73 ? 340 HIS E CB    1 
ATOM   8239 C CG    . HIS C 1 343 ? 29.863  -8.849  -13.187 1.00 30.36 ? 340 HIS E CG    1 
ATOM   8240 N ND1   . HIS C 1 343 ? 30.284  -10.165 -13.157 1.00 32.88 ? 340 HIS E ND1   1 
ATOM   8241 C CD2   . HIS C 1 343 ? 30.198  -8.378  -14.413 1.00 32.22 ? 340 HIS E CD2   1 
ATOM   8242 C CE1   . HIS C 1 343 ? 30.849  -10.472 -14.311 1.00 32.30 ? 340 HIS E CE1   1 
ATOM   8243 N NE2   . HIS C 1 343 ? 30.813  -9.405  -15.090 1.00 33.34 ? 340 HIS E NE2   1 
ATOM   8244 N N     . LEU C 1 344 ? 29.269  -5.647  -10.195 1.00 25.36 ? 341 LEU E N     1 
ATOM   8245 C CA    . LEU C 1 344 ? 28.450  -4.689  -9.457  1.00 25.22 ? 341 LEU E CA    1 
ATOM   8246 C C     . LEU C 1 344 ? 27.586  -3.897  -10.438 1.00 24.94 ? 341 LEU E C     1 
ATOM   8247 O O     . LEU C 1 344 ? 27.943  -3.752  -11.615 1.00 24.94 ? 341 LEU E O     1 
ATOM   8248 C CB    . LEU C 1 344 ? 29.311  -3.711  -8.662  1.00 25.21 ? 341 LEU E CB    1 
ATOM   8249 C CG    . LEU C 1 344 ? 30.227  -4.320  -7.588  1.00 26.14 ? 341 LEU E CG    1 
ATOM   8250 C CD1   . LEU C 1 344 ? 31.277  -3.300  -7.155  1.00 24.97 ? 341 LEU E CD1   1 
ATOM   8251 C CD2   . LEU C 1 344 ? 29.415  -4.855  -6.394  1.00 24.99 ? 341 LEU E CD2   1 
ATOM   8252 N N     . ARG C 1 345 ? 26.458  -3.387  -9.936  1.00 23.89 ? 342 ARG E N     1 
ATOM   8253 C CA    . ARG C 1 345 ? 25.553  -2.544  -10.709 1.00 23.33 ? 342 ARG E CA    1 
ATOM   8254 C C     . ARG C 1 345 ? 25.524  -1.083  -10.207 1.00 23.00 ? 342 ARG E C     1 
ATOM   8255 O O     . ARG C 1 345 ? 25.278  -0.818  -9.034  1.00 22.45 ? 342 ARG E O     1 
ATOM   8256 C CB    . ARG C 1 345 ? 24.152  -3.137  -10.660 1.00 23.06 ? 342 ARG E CB    1 
ATOM   8257 C CG    . ARG C 1 345 ? 23.165  -2.528  -11.640 1.00 22.66 ? 342 ARG E CG    1 
ATOM   8258 C CD    . ARG C 1 345 ? 21.752  -2.866  -11.247 1.00 22.51 ? 342 ARG E CD    1 
ATOM   8259 N NE    . ARG C 1 345 ? 21.358  -2.167  -10.026 1.00 21.81 ? 342 ARG E NE    1 
ATOM   8260 C CZ    . ARG C 1 345 ? 20.403  -2.565  -9.181  1.00 21.91 ? 342 ARG E CZ    1 
ATOM   8261 N NH1   . ARG C 1 345 ? 19.704  -3.680  -9.387  1.00 20.30 ? 342 ARG E NH1   1 
ATOM   8262 N NH2   . ARG C 1 345 ? 20.174  -1.847  -8.092  1.00 22.02 ? 342 ARG E NH2   1 
ATOM   8263 N N     . THR C 1 346 ? 25.777  -0.144  -11.117 1.00 22.96 ? 343 THR E N     1 
ATOM   8264 C CA    . THR C 1 346 ? 25.718  1.278   -10.810 1.00 22.99 ? 343 THR E CA    1 
ATOM   8265 C C     . THR C 1 346 ? 24.555  1.907   -11.533 1.00 22.63 ? 343 THR E C     1 
ATOM   8266 O O     . THR C 1 346 ? 24.390  1.708   -12.715 1.00 22.91 ? 343 THR E O     1 
ATOM   8267 C CB    . THR C 1 346 ? 27.012  2.024   -11.222 1.00 23.14 ? 343 THR E CB    1 
ATOM   8268 O OG1   . THR C 1 346 ? 26.964  3.372   -10.716 1.00 22.89 ? 343 THR E OG1   1 
ATOM   8269 C CG2   . THR C 1 346 ? 27.159  2.062   -12.731 1.00 23.68 ? 343 THR E CG2   1 
ATOM   8270 N N     . THR C 1 347 ? 23.740  2.654   -10.802 1.00 23.01 ? 344 THR E N     1 
ATOM   8271 C CA    . THR C 1 347 ? 22.727  3.496   -11.375 1.00 22.71 ? 344 THR E CA    1 
ATOM   8272 C C     . THR C 1 347 ? 23.335  4.789   -11.931 1.00 22.91 ? 344 THR E C     1 
ATOM   8273 O O     . THR C 1 347 ? 24.285  5.333   -11.373 1.00 22.91 ? 344 THR E O     1 
ATOM   8274 C CB    . THR C 1 347 ? 21.652  3.848   -10.313 1.00 22.69 ? 344 THR E CB    1 
ATOM   8275 O OG1   . THR C 1 347 ? 21.104  2.638   -9.773  1.00 23.05 ? 344 THR E OG1   1 
ATOM   8276 C CG2   . THR C 1 347 ? 20.536  4.672   -10.921 1.00 22.36 ? 344 THR E CG2   1 
ATOM   8277 N N     . ILE C 1 348 ? 22.756  5.291   -13.017 1.00 22.86 ? 345 ILE E N     1 
ATOM   8278 C CA    . ILE C 1 348 ? 23.231  6.513   -13.655 1.00 23.06 ? 345 ILE E CA    1 
ATOM   8279 C C     . ILE C 1 348 ? 22.545  7.690   -12.954 1.00 23.10 ? 345 ILE E C     1 
ATOM   8280 O O     . ILE C 1 348 ? 21.335  7.725   -12.832 1.00 22.67 ? 345 ILE E O     1 
ATOM   8281 C CB    . ILE C 1 348 ? 22.942  6.490   -15.187 1.00 23.28 ? 345 ILE E CB    1 
ATOM   8282 C CG1   . ILE C 1 348 ? 23.666  5.319   -15.865 1.00 22.76 ? 345 ILE E CG1   1 
ATOM   8283 C CG2   . ILE C 1 348 ? 23.333  7.803   -15.866 1.00 22.67 ? 345 ILE E CG2   1 
ATOM   8284 C CD1   . ILE C 1 348 ? 25.165  5.318   -15.725 1.00 23.39 ? 345 ILE E CD1   1 
ATOM   8285 N N     . GLY C 1 349 ? 23.332  8.620   -12.438 1.00 23.60 ? 346 GLY E N     1 
ATOM   8286 C CA    . GLY C 1 349 ? 22.802  9.750   -11.696 1.00 24.49 ? 346 GLY E CA    1 
ATOM   8287 C C     . GLY C 1 349 ? 22.886  11.022  -12.507 1.00 25.07 ? 346 GLY E C     1 
ATOM   8288 O O     . GLY C 1 349 ? 22.853  10.983  -13.738 1.00 25.03 ? 346 GLY E O     1 
ATOM   8289 N N     . VAL C 1 350 ? 22.954  12.159  -11.814 1.00 26.02 ? 347 VAL E N     1 
ATOM   8290 C CA    . VAL C 1 350 ? 23.258  13.425  -12.463 1.00 26.76 ? 347 VAL E CA    1 
ATOM   8291 C C     . VAL C 1 350 ? 24.783  13.468  -12.753 1.00 27.53 ? 347 VAL E C     1 
ATOM   8292 O O     . VAL C 1 350 ? 25.561  12.834  -12.051 1.00 26.93 ? 347 VAL E O     1 
ATOM   8293 C CB    . VAL C 1 350 ? 22.819  14.632  -11.596 1.00 26.66 ? 347 VAL E CB    1 
ATOM   8294 C CG1   . VAL C 1 350 ? 21.329  14.537  -11.281 1.00 27.69 ? 347 VAL E CG1   1 
ATOM   8295 C CG2   . VAL C 1 350 ? 23.629  14.709  -10.314 1.00 25.88 ? 347 VAL E CG2   1 
ATOM   8296 N N     . PRO C 1 351 ? 25.211  14.220  -13.783 1.00 28.75 ? 348 PRO E N     1 
ATOM   8297 C CA    . PRO C 1 351 ? 26.633  14.212  -14.208 1.00 29.15 ? 348 PRO E CA    1 
ATOM   8298 C C     . PRO C 1 351 ? 27.661  14.263  -13.074 1.00 29.63 ? 348 PRO E C     1 
ATOM   8299 O O     . PRO C 1 351 ? 28.644  13.528  -13.087 1.00 29.82 ? 348 PRO E O     1 
ATOM   8300 C CB    . PRO C 1 351 ? 26.734  15.465  -15.079 1.00 29.18 ? 348 PRO E CB    1 
ATOM   8301 C CG    . PRO C 1 351 ? 25.385  15.589  -15.676 1.00 29.34 ? 348 PRO E CG    1 
ATOM   8302 C CD    . PRO C 1 351 ? 24.402  15.125  -14.622 1.00 28.86 ? 348 PRO E CD    1 
ATOM   8303 N N     . GLU C 1 352 ? 27.428  15.126  -12.101 1.00 30.69 ? 349 GLU E N     1 
ATOM   8304 C CA    . GLU C 1 352 ? 28.356  15.298  -10.988 1.00 30.86 ? 349 GLU E CA    1 
ATOM   8305 C C     . GLU C 1 352 ? 28.456  14.049  -10.098 1.00 30.55 ? 349 GLU E C     1 
ATOM   8306 O O     . GLU C 1 352 ? 29.532  13.761  -9.556  1.00 30.42 ? 349 GLU E O     1 
ATOM   8307 C CB    . GLU C 1 352 ? 27.957  16.531  -10.164 1.00 31.49 ? 349 GLU E CB    1 
ATOM   8308 C CG    . GLU C 1 352 ? 29.122  17.135  -9.396  1.00 33.10 ? 349 GLU E CG    1 
ATOM   8309 C CD    . GLU C 1 352 ? 28.718  18.317  -8.520  1.00 35.27 ? 349 GLU E CD    1 
ATOM   8310 O OE1   . GLU C 1 352 ? 28.248  19.346  -9.080  1.00 42.17 ? 349 GLU E OE1   1 
ATOM   8311 O OE2   . GLU C 1 352 ? 28.906  18.224  -7.276  1.00 40.44 ? 349 GLU E OE2   1 
ATOM   8312 N N     . GLU C 1 353 ? 27.344  13.313  -9.958  1.00 29.80 ? 350 GLU E N     1 
ATOM   8313 C CA    . GLU C 1 353 ? 27.332  12.017  -9.262  1.00 29.28 ? 350 GLU E CA    1 
ATOM   8314 C C     . GLU C 1 353 ? 28.031  10.942  -10.077 1.00 28.71 ? 350 GLU E C     1 
ATOM   8315 O O     . GLU C 1 353 ? 28.732  10.087  -9.531  1.00 28.37 ? 350 GLU E O     1 
ATOM   8316 C CB    . GLU C 1 353 ? 25.898  11.559  -8.971  1.00 29.03 ? 350 GLU E CB    1 
ATOM   8317 C CG    . GLU C 1 353 ? 25.154  12.470  -8.021  1.00 28.72 ? 350 GLU E CG    1 
ATOM   8318 C CD    . GLU C 1 353 ? 23.695  12.090  -7.822  1.00 29.94 ? 350 GLU E CD    1 
ATOM   8319 O OE1   . GLU C 1 353 ? 23.093  11.401  -8.681  1.00 30.82 ? 350 GLU E OE1   1 
ATOM   8320 O OE2   . GLU C 1 353 ? 23.135  12.515  -6.801  1.00 32.07 ? 350 GLU E OE2   1 
ATOM   8321 N N     . ASN C 1 354 ? 27.826  10.982  -11.383 1.00 28.13 ? 351 ASN E N     1 
ATOM   8322 C CA    . ASN C 1 354 ? 28.491  10.060  -12.298 1.00 28.54 ? 351 ASN E CA    1 
ATOM   8323 C C     . ASN C 1 354 ? 30.012  10.295  -12.341 1.00 27.96 ? 351 ASN E C     1 
ATOM   8324 O O     . ASN C 1 354 ? 30.794  9.352   -12.429 1.00 27.36 ? 351 ASN E O     1 
ATOM   8325 C CB    . ASN C 1 354 ? 27.861  10.167  -13.693 1.00 28.46 ? 351 ASN E CB    1 
ATOM   8326 C CG    . ASN C 1 354 ? 26.387  9.770   -13.692 1.00 29.41 ? 351 ASN E CG    1 
ATOM   8327 O OD1   . ASN C 1 354 ? 25.990  8.797   -13.019 1.00 27.86 ? 351 ASN E OD1   1 
ATOM   8328 N ND2   . ASN C 1 354 ? 25.562  10.528  -14.429 1.00 29.85 ? 351 ASN E ND2   1 
ATOM   8329 N N     . ASP C 1 355 ? 30.418  11.550  -12.237 1.00 28.19 ? 352 ASP E N     1 
ATOM   8330 C CA    . ASP C 1 355 ? 31.831  11.891  -12.154 1.00 28.86 ? 352 ASP E CA    1 
ATOM   8331 C C     . ASP C 1 355 ? 32.461  11.327  -10.882 1.00 28.53 ? 352 ASP E C     1 
ATOM   8332 O O     . ASP C 1 355 ? 33.566  10.807  -10.931 1.00 29.02 ? 352 ASP E O     1 
ATOM   8333 C CB    . ASP C 1 355 ? 32.032  13.413  -12.182 1.00 29.82 ? 352 ASP E CB    1 
ATOM   8334 C CG    . ASP C 1 355 ? 31.779  14.027  -13.567 1.00 32.71 ? 352 ASP E CG    1 
ATOM   8335 O OD1   . ASP C 1 355 ? 31.800  13.290  -14.577 1.00 35.17 ? 352 ASP E OD1   1 
ATOM   8336 O OD2   . ASP C 1 355 ? 31.567  15.262  -13.632 1.00 37.69 ? 352 ASP E OD2   1 
ATOM   8337 N N     . ALA C 1 356 ? 31.760  11.438  -9.757  1.00 28.12 ? 353 ALA E N     1 
ATOM   8338 C CA    . ALA C 1 356 ? 32.244  10.914  -8.478  1.00 28.12 ? 353 ALA E CA    1 
ATOM   8339 C C     . ALA C 1 356 ? 32.328  9.395   -8.514  1.00 27.88 ? 353 ALA E C     1 
ATOM   8340 O O     . ALA C 1 356 ? 33.273  8.810   -7.972  1.00 28.22 ? 353 ALA E O     1 
ATOM   8341 C CB    . ALA C 1 356 ? 31.351  11.376  -7.322  1.00 28.28 ? 353 ALA E CB    1 
ATOM   8342 N N     . PHE C 1 357 ? 31.359  8.758   -9.169  1.00 27.43 ? 354 PHE E N     1 
ATOM   8343 C CA    . PHE C 1 357 ? 31.434  7.320   -9.417  1.00 27.66 ? 354 PHE E CA    1 
ATOM   8344 C C     . PHE C 1 357 ? 32.686  6.960   -10.240 1.00 28.06 ? 354 PHE E C     1 
ATOM   8345 O O     . PHE C 1 357 ? 33.454  6.047   -9.890  1.00 28.17 ? 354 PHE E O     1 
ATOM   8346 C CB    . PHE C 1 357 ? 30.173  6.823   -10.136 1.00 27.14 ? 354 PHE E CB    1 
ATOM   8347 C CG    . PHE C 1 357 ? 30.326  5.457   -10.712 1.00 27.28 ? 354 PHE E CG    1 
ATOM   8348 C CD1   . PHE C 1 357 ? 30.363  4.340   -9.874  1.00 27.15 ? 354 PHE E CD1   1 
ATOM   8349 C CD2   . PHE C 1 357 ? 30.486  5.279   -12.077 1.00 26.27 ? 354 PHE E CD2   1 
ATOM   8350 C CE1   . PHE C 1 357 ? 30.539  3.071   -10.396 1.00 26.03 ? 354 PHE E CE1   1 
ATOM   8351 C CE2   . PHE C 1 357 ? 30.670  4.018   -12.604 1.00 26.54 ? 354 PHE E CE2   1 
ATOM   8352 C CZ    . PHE C 1 357 ? 30.695  2.911   -11.766 1.00 27.10 ? 354 PHE E CZ    1 
ATOM   8353 N N     . LEU C 1 358 ? 32.891  7.697   -11.327 1.00 28.42 ? 355 LEU E N     1 
ATOM   8354 C CA    . LEU C 1 358 ? 33.973  7.405   -12.270 1.00 28.64 ? 355 LEU E CA    1 
ATOM   8355 C C     . LEU C 1 358 ? 35.348  7.669   -11.667 1.00 29.01 ? 355 LEU E C     1 
ATOM   8356 O O     . LEU C 1 358 ? 36.261  6.883   -11.873 1.00 29.24 ? 355 LEU E O     1 
ATOM   8357 C CB    . LEU C 1 358 ? 33.788  8.221   -13.551 1.00 28.62 ? 355 LEU E CB    1 
ATOM   8358 C CG    . LEU C 1 358 ? 33.179  7.585   -14.804 1.00 28.58 ? 355 LEU E CG    1 
ATOM   8359 C CD1   . LEU C 1 358 ? 32.465  6.296   -14.571 1.00 28.13 ? 355 LEU E CD1   1 
ATOM   8360 C CD2   . LEU C 1 358 ? 32.260  8.625   -15.480 1.00 29.76 ? 355 LEU E CD2   1 
ATOM   8361 N N     . ASP C 1 359 ? 35.494  8.784   -10.954 1.00 29.42 ? 356 ASP E N     1 
ATOM   8362 C CA    . ASP C 1 359 ? 36.681  9.055   -10.153 1.00 29.82 ? 356 ASP E CA    1 
ATOM   8363 C C     . ASP C 1 359 ? 37.016  7.874   -9.233  1.00 29.75 ? 356 ASP E C     1 
ATOM   8364 O O     . ASP C 1 359 ? 38.153  7.414   -9.187  1.00 29.63 ? 356 ASP E O     1 
ATOM   8365 C CB    . ASP C 1 359 ? 36.449  10.276  -9.265  1.00 30.67 ? 356 ASP E CB    1 
ATOM   8366 C CG    . ASP C 1 359 ? 36.570  11.603  -10.017 1.00 33.46 ? 356 ASP E CG    1 
ATOM   8367 O OD1   . ASP C 1 359 ? 36.573  11.625  -11.278 1.00 39.28 ? 356 ASP E OD1   1 
ATOM   8368 O OD2   . ASP C 1 359 ? 36.649  12.641  -9.327  1.00 37.48 ? 356 ASP E OD2   1 
ATOM   8369 N N     . ALA C 1 360 ? 36.018  7.418   -8.483  1.00 29.58 ? 357 ALA E N     1 
ATOM   8370 C CA    . ALA C 1 360 ? 36.175  6.296   -7.569  1.00 29.71 ? 357 ALA E CA    1 
ATOM   8371 C C     . ALA C 1 360 ? 36.477  4.999   -8.312  1.00 29.33 ? 357 ALA E C     1 
ATOM   8372 O O     . ALA C 1 360 ? 37.242  4.176   -7.831  1.00 29.63 ? 357 ALA E O     1 
ATOM   8373 C CB    . ALA C 1 360 ? 34.918  6.136   -6.709  1.00 29.66 ? 357 ALA E CB    1 
ATOM   8374 N N     . ALA C 1 361 ? 35.872  4.804   -9.480  1.00 29.81 ? 358 ALA E N     1 
ATOM   8375 C CA    . ALA C 1 361 ? 36.109  3.587   -10.258 1.00 30.05 ? 358 ALA E CA    1 
ATOM   8376 C C     . ALA C 1 361 ? 37.557  3.532   -10.754 1.00 30.36 ? 358 ALA E C     1 
ATOM   8377 O O     . ALA C 1 361 ? 38.122  2.447   -10.912 1.00 30.16 ? 358 ALA E O     1 
ATOM   8378 C CB    . ALA C 1 361 ? 35.132  3.490   -11.427 1.00 29.57 ? 358 ALA E CB    1 
ATOM   8379 N N     . ALA C 1 362 ? 38.144  4.702   -11.006 1.00 30.98 ? 359 ALA E N     1 
ATOM   8380 C CA    . ALA C 1 362 ? 39.530  4.790   -11.459 1.00 31.94 ? 359 ALA E CA    1 
ATOM   8381 C C     . ALA C 1 362 ? 40.507  4.407   -10.341 1.00 32.45 ? 359 ALA E C     1 
ATOM   8382 O O     . ALA C 1 362 ? 41.429  3.652   -10.584 1.00 32.71 ? 359 ALA E O     1 
ATOM   8383 C CB    . ALA C 1 362 ? 39.844  6.194   -11.994 1.00 31.99 ? 359 ALA E CB    1 
ATOM   8384 N N     . GLU C 1 363 ? 40.296  4.912   -9.126  1.00 33.40 ? 360 GLU E N     1 
ATOM   8385 C CA    . GLU C 1 363 ? 41.130  4.513   -7.976  1.00 33.92 ? 360 GLU E CA    1 
ATOM   8386 C C     . GLU C 1 363 ? 41.024  3.005   -7.744  1.00 34.07 ? 360 GLU E C     1 
ATOM   8387 O O     . GLU C 1 363 ? 42.036  2.322   -7.618  1.00 34.40 ? 360 GLU E O     1 
ATOM   8388 C CB    . GLU C 1 363 ? 40.733  5.246   -6.687  1.00 34.14 ? 360 GLU E CB    1 
ATOM   8389 C CG    . GLU C 1 363 ? 40.813  6.779   -6.729  1.00 35.18 ? 360 GLU E CG    1 
ATOM   8390 C CD    . GLU C 1 363 ? 40.927  7.436   -5.325  1.00 36.73 ? 360 GLU E CD    1 
ATOM   8391 O OE1   . GLU C 1 363 ? 40.801  6.732   -4.283  1.00 39.76 ? 360 GLU E OE1   1 
ATOM   8392 O OE2   . GLU C 1 363 ? 41.162  8.674   -5.267  1.00 39.26 ? 360 GLU E OE2   1 
ATOM   8393 N N     . ILE C 1 364 ? 39.798  2.488   -7.730  1.00 34.02 ? 361 ILE E N     1 
ATOM   8394 C CA    . ILE C 1 364 ? 39.535  1.112   -7.298  1.00 34.14 ? 361 ILE E CA    1 
ATOM   8395 C C     . ILE C 1 364 ? 40.085  0.042   -8.240  1.00 34.66 ? 361 ILE E C     1 
ATOM   8396 O O     . ILE C 1 364 ? 40.496  -1.040  -7.793  1.00 34.63 ? 361 ILE E O     1 
ATOM   8397 C CB    . ILE C 1 364 ? 38.017  0.890   -7.050  1.00 33.71 ? 361 ILE E CB    1 
ATOM   8398 C CG1   . ILE C 1 364 ? 37.587  1.662   -5.800  1.00 32.99 ? 361 ILE E CG1   1 
ATOM   8399 C CG2   . ILE C 1 364 ? 37.711  -0.580  -6.883  1.00 33.61 ? 361 ILE E CG2   1 
ATOM   8400 C CD1   . ILE C 1 364 ? 36.110  1.892   -5.671  1.00 33.54 ? 361 ILE E CD1   1 
ATOM   8401 N N     . ILE C 1 365 ? 40.102  0.321   -9.538  1.00 35.31 ? 362 ILE E N     1 
ATOM   8402 C CA    . ILE C 1 365 ? 40.638  -0.652  -10.483 1.00 35.73 ? 362 ILE E CA    1 
ATOM   8403 C C     . ILE C 1 365 ? 42.132  -0.902  -10.231 1.00 36.29 ? 362 ILE E C     1 
ATOM   8404 O O     . ILE C 1 365 ? 42.637  -2.000  -10.481 1.00 35.72 ? 362 ILE E O     1 
ATOM   8405 C CB    . ILE C 1 365 ? 40.392  -0.228  -11.953 1.00 36.00 ? 362 ILE E CB    1 
ATOM   8406 C CG1   . ILE C 1 365 ? 40.622  -1.414  -12.883 1.00 35.26 ? 362 ILE E CG1   1 
ATOM   8407 C CG2   . ILE C 1 365 ? 41.269  0.973   -12.354 1.00 34.48 ? 362 ILE E CG2   1 
ATOM   8408 C CD1   . ILE C 1 365 ? 39.952  -1.252  -14.214 1.00 35.76 ? 362 ILE E CD1   1 
ATOM   8409 N N     . LYS C 1 366 ? 42.828  0.110   -9.715  1.00 37.21 ? 363 LYS E N     1 
ATOM   8410 C CA    . LYS C 1 366 ? 44.259  -0.023  -9.407  1.00 38.36 ? 363 LYS E CA    1 
ATOM   8411 C C     . LYS C 1 366 ? 44.532  -0.871  -8.155  1.00 38.79 ? 363 LYS E C     1 
ATOM   8412 O O     . LYS C 1 366 ? 45.671  -1.271  -7.924  1.00 39.02 ? 363 LYS E O     1 
ATOM   8413 C CB    . LYS C 1 366 ? 44.924  1.359   -9.281  1.00 38.54 ? 363 LYS E CB    1 
ATOM   8414 C CG    . LYS C 1 366 ? 44.971  2.154   -10.592 1.00 39.51 ? 363 LYS E CG    1 
ATOM   8415 C CD    . LYS C 1 366 ? 45.702  3.498   -10.432 1.00 40.11 ? 363 LYS E CD    1 
ATOM   8416 C CE    . LYS C 1 366 ? 44.873  4.522   -9.624  1.00 42.64 ? 363 LYS E CE    1 
ATOM   8417 N NZ    . LYS C 1 366 ? 45.697  5.334   -8.648  1.00 42.90 ? 363 LYS E NZ    1 
ATOM   8418 N N     . LEU C 1 367 ? 43.492  -1.142  -7.365  1.00 39.38 ? 364 LEU E N     1 
ATOM   8419 C CA    . LEU C 1 367 ? 43.579  -1.996  -6.180  1.00 39.69 ? 364 LEU E CA    1 
ATOM   8420 C C     . LEU C 1 367 ? 43.440  -3.479  -6.528  1.00 40.42 ? 364 LEU E C     1 
ATOM   8421 O O     . LEU C 1 367 ? 43.784  -4.354  -5.719  1.00 40.78 ? 364 LEU E O     1 
ATOM   8422 C CB    . LEU C 1 367 ? 42.478  -1.638  -5.174  1.00 39.93 ? 364 LEU E CB    1 
ATOM   8423 C CG    . LEU C 1 367 ? 42.302  -0.180  -4.738  1.00 39.95 ? 364 LEU E CG    1 
ATOM   8424 C CD1   . LEU C 1 367 ? 41.182  -0.075  -3.712  1.00 39.30 ? 364 LEU E CD1   1 
ATOM   8425 C CD2   . LEU C 1 367 ? 43.599  0.402   -4.181  1.00 40.84 ? 364 LEU E CD2   1 
ATOM   8426 N N     . ASN C 1 368 ? 42.909  -3.773  -7.710  1.00 40.88 ? 365 ASN E N     1 
ATOM   8427 C CA    . ASN C 1 368 ? 42.770  -5.156  -8.154  1.00 41.12 ? 365 ASN E CA    1 
ATOM   8428 C C     . ASN C 1 368 ? 42.050  -5.994  -7.085  1.00 41.44 ? 365 ASN E C     1 
ATOM   8429 O O     . ASN C 1 368 ? 42.553  -7.025  -6.631  1.00 41.54 ? 365 ASN E O     1 
ATOM   8430 C CB    . ASN C 1 368 ? 44.152  -5.725  -8.516  1.00 41.43 ? 365 ASN E CB    1 
ATOM   8431 C CG    . ASN C 1 368 ? 44.103  -7.169  -8.988  1.00 41.65 ? 365 ASN E CG    1 
ATOM   8432 O OD1   . ASN C 1 368 ? 43.228  -7.568  -9.767  1.00 43.08 ? 365 ASN E OD1   1 
ATOM   8433 N ND2   . ASN C 1 368 ? 45.060  -7.964  -8.520  1.00 43.32 ? 365 ASN E ND2   1 
ATOM   8434 N N     . LEU C 1 369 ? 40.867  -5.519  -6.691  1.00 41.56 ? 366 LEU E N     1 
ATOM   8435 C CA    . LEU C 1 369 ? 40.030  -6.209  -5.712  1.00 41.73 ? 366 LEU E CA    1 
ATOM   8436 C C     . LEU C 1 369 ? 39.294  -7.388  -6.341  1.00 42.26 ? 366 LEU E C     1 
ATOM   8437 O O     . LEU C 1 369 ? 38.666  -8.192  -5.628  1.00 42.86 ? 366 LEU E O     1 
ATOM   8438 C CB    . LEU C 1 369 ? 39.007  -5.247  -5.097  1.00 41.62 ? 366 LEU E CB    1 
ATOM   8439 C CG    . LEU C 1 369 ? 39.563  -3.998  -4.416  1.00 41.31 ? 366 LEU E CG    1 
ATOM   8440 C CD1   . LEU C 1 369 ? 38.423  -3.139  -3.894  1.00 41.60 ? 366 LEU E CD1   1 
ATOM   8441 C CD2   . LEU C 1 369 ? 40.515  -4.372  -3.295  1.00 40.46 ? 366 LEU E CD2   1 
ATOM   8442 O OXT   . LEU C 1 369 ? 39.287  -7.555  -7.570  1.00 42.71 ? 366 LEU E OXT   1 
HETATM 8443 P P     . PO4 D 2 .   ? 43.084  5.512   22.349  1.00 45.80 ? 402 PO4 A P     1 
HETATM 8444 O O1    . PO4 D 2 .   ? 41.650  5.278   22.741  1.00 45.43 ? 402 PO4 A O1    1 
HETATM 8445 O O2    . PO4 D 2 .   ? 43.786  4.179   22.476  1.00 45.15 ? 402 PO4 A O2    1 
HETATM 8446 O O3    . PO4 D 2 .   ? 43.222  5.961   20.926  1.00 45.59 ? 402 PO4 A O3    1 
HETATM 8447 O O4    . PO4 D 2 .   ? 43.657  6.590   23.235  1.00 45.97 ? 402 PO4 A O4    1 
HETATM 8448 P P     . PO4 E 2 .   ? 37.817  9.310   27.214  1.00 44.48 ? 404 PO4 A P     1 
HETATM 8449 O O1    . PO4 E 2 .   ? 37.680  8.132   26.288  1.00 50.00 ? 404 PO4 A O1    1 
HETATM 8450 O O2    . PO4 E 2 .   ? 38.161  8.775   28.565  1.00 51.68 ? 404 PO4 A O2    1 
HETATM 8451 O O3    . PO4 E 2 .   ? 36.527  10.062  27.263  1.00 49.61 ? 404 PO4 A O3    1 
HETATM 8452 O O4    . PO4 E 2 .   ? 38.904  10.237  26.782  1.00 50.28 ? 404 PO4 A O4    1 
HETATM 8453 P P     . PO4 F 2 .   ? 28.707  22.256  16.438  1.00 59.42 ? 405 PO4 A P     1 
HETATM 8454 O O1    . PO4 F 2 .   ? 29.378  21.537  15.264  1.00 54.40 ? 405 PO4 A O1    1 
HETATM 8455 O O2    . PO4 F 2 .   ? 28.497  21.276  17.605  1.00 56.59 ? 405 PO4 A O2    1 
HETATM 8456 O O3    . PO4 F 2 .   ? 27.331  22.751  16.054  1.00 55.02 ? 405 PO4 A O3    1 
HETATM 8457 O O4    . PO4 F 2 .   ? 29.570  23.476  16.835  1.00 54.90 ? 405 PO4 A O4    1 
HETATM 8458 P P     . PO4 G 2 .   ? 73.334  4.171   18.644  1.00 86.18 ? 403 PO4 C P     1 
HETATM 8459 O O1    . PO4 G 2 .   ? 73.002  2.703   18.553  1.00 85.51 ? 403 PO4 C O1    1 
HETATM 8460 O O2    . PO4 G 2 .   ? 74.519  4.343   19.568  1.00 86.46 ? 403 PO4 C O2    1 
HETATM 8461 O O3    . PO4 G 2 .   ? 73.683  4.698   17.268  1.00 86.03 ? 403 PO4 C O3    1 
HETATM 8462 O O4    . PO4 G 2 .   ? 72.161  4.944   19.210  1.00 86.12 ? 403 PO4 C O4    1 
HETATM 8463 P P     . PO4 H 2 .   ? 67.748  -19.473 35.289  1.00 31.98 ? 402 PO4 C P     1 
HETATM 8464 O O1    . PO4 H 2 .   ? 68.281  -19.219 36.673  1.00 30.21 ? 402 PO4 C O1    1 
HETATM 8465 O O2    . PO4 H 2 .   ? 68.593  -18.723 34.289  1.00 31.57 ? 402 PO4 C O2    1 
HETATM 8466 O O3    . PO4 H 2 .   ? 67.716  -20.954 34.955  1.00 32.18 ? 402 PO4 C O3    1 
HETATM 8467 O O4    . PO4 H 2 .   ? 66.311  -18.994 35.272  1.00 31.63 ? 402 PO4 C O4    1 
HETATM 8468 P P     . PO4 I 2 .   ? 56.843  -16.132 52.725  1.00 51.99 ? 404 PO4 C P     1 
HETATM 8469 O O1    . PO4 I 2 .   ? 56.228  -17.043 51.684  1.00 54.67 ? 404 PO4 C O1    1 
HETATM 8470 O O2    . PO4 I 2 .   ? 57.377  -16.974 53.867  1.00 56.98 ? 404 PO4 C O2    1 
HETATM 8471 O O3    . PO4 I 2 .   ? 55.794  -15.184 53.251  1.00 55.67 ? 404 PO4 C O3    1 
HETATM 8472 O O4    . PO4 I 2 .   ? 58.013  -15.348 52.205  1.00 55.81 ? 404 PO4 C O4    1 
HETATM 8473 P P     . PO4 J 2 .   ? 17.387  -4.185  -6.479  1.00 38.15 ? 402 PO4 E P     1 
HETATM 8474 O O1    . PO4 J 2 .   ? 16.063  -3.467  -6.349  1.00 34.97 ? 402 PO4 E O1    1 
HETATM 8475 O O2    . PO4 J 2 .   ? 18.480  -3.225  -6.112  1.00 34.86 ? 402 PO4 E O2    1 
HETATM 8476 O O3    . PO4 J 2 .   ? 17.406  -5.373  -5.542  1.00 36.89 ? 402 PO4 E O3    1 
HETATM 8477 O O4    . PO4 J 2 .   ? 17.533  -4.663  -7.897  1.00 37.03 ? 402 PO4 E O4    1 
HETATM 8478 O O     . HOH K 3 .   ? 43.300  -4.497  4.171   1.00 8.38  ? 406 HOH A O     1 
HETATM 8479 O O     . HOH K 3 .   ? 44.801  -6.775  5.635   1.00 9.82  ? 407 HOH A O     1 
HETATM 8480 O O     . HOH K 3 .   ? 56.625  -14.339 19.465  1.00 16.07 ? 408 HOH A O     1 
HETATM 8481 O O     . HOH K 3 .   ? 45.711  0.756   11.592  1.00 18.90 ? 409 HOH A O     1 
HETATM 8482 O O     . HOH K 3 .   ? 30.974  9.573   26.566  1.00 16.83 ? 410 HOH A O     1 
HETATM 8483 O O     . HOH K 3 .   ? 42.483  -7.021  15.007  1.00 17.27 ? 411 HOH A O     1 
HETATM 8484 O O     . HOH K 3 .   ? 63.466  6.016   9.612   1.00 23.17 ? 412 HOH A O     1 
HETATM 8485 O O     . HOH K 3 .   ? 28.404  -1.649  24.833  1.00 19.11 ? 413 HOH A O     1 
HETATM 8486 O O     . HOH K 3 .   ? 61.397  -5.920  6.472   1.00 24.16 ? 414 HOH A O     1 
HETATM 8487 O O     . HOH K 3 .   ? 36.674  9.751   11.116  1.00 20.36 ? 415 HOH A O     1 
HETATM 8488 O O     . HOH K 3 .   ? 36.281  5.528   20.384  1.00 16.60 ? 416 HOH A O     1 
HETATM 8489 O O     . HOH K 3 .   ? 44.472  -8.725  21.137  1.00 19.32 ? 417 HOH A O     1 
HETATM 8490 O O     . HOH K 3 .   ? 65.350  -2.021  2.161   1.00 28.34 ? 418 HOH A O     1 
HETATM 8491 O O     . HOH K 3 .   ? 59.962  -14.928 25.081  1.00 20.15 ? 419 HOH A O     1 
HETATM 8492 O O     . HOH K 3 .   ? 53.312  -22.901 25.639  1.00 25.11 ? 420 HOH A O     1 
HETATM 8493 O O     . HOH K 3 .   ? 51.657  -13.358 28.394  1.00 25.09 ? 421 HOH A O     1 
HETATM 8494 O O     . HOH K 3 .   ? 44.854  7.306   20.016  1.00 31.94 ? 422 HOH A O     1 
HETATM 8495 O O     . HOH K 3 .   ? 21.405  -0.666  11.322  1.00 28.05 ? 423 HOH A O     1 
HETATM 8496 O O     . HOH K 3 .   ? 52.996  -20.898 8.630   1.00 30.54 ? 424 HOH A O     1 
HETATM 8497 O O     . HOH K 3 .   ? 37.699  -6.271  19.834  1.00 23.79 ? 425 HOH A O     1 
HETATM 8498 O O     . HOH K 3 .   ? 56.732  -17.121 25.610  1.00 18.24 ? 426 HOH A O     1 
HETATM 8499 O O     . HOH K 3 .   ? 31.420  2.862   36.493  1.00 25.67 ? 427 HOH A O     1 
HETATM 8500 O O     . HOH K 3 .   ? 52.956  -21.315 20.271  1.00 22.96 ? 428 HOH A O     1 
HETATM 8501 O O     . HOH K 3 .   ? 30.304  -1.671  21.682  1.00 27.40 ? 429 HOH A O     1 
HETATM 8502 O O     . HOH K 3 .   ? 38.834  -15.802 15.573  1.00 24.35 ? 430 HOH A O     1 
HETATM 8503 O O     . HOH K 3 .   ? 45.372  -9.117  12.703  1.00 20.84 ? 431 HOH A O     1 
HETATM 8504 O O     . HOH K 3 .   ? 22.410  7.477   8.442   1.00 29.28 ? 432 HOH A O     1 
HETATM 8505 O O     . HOH K 3 .   ? 34.053  -1.987  16.358  1.00 18.93 ? 433 HOH A O     1 
HETATM 8506 O O     . HOH K 3 .   ? 28.902  7.986   5.529   1.00 29.55 ? 434 HOH A O     1 
HETATM 8507 O O     . HOH K 3 .   ? 35.507  -3.323  5.196   1.00 33.42 ? 435 HOH A O     1 
HETATM 8508 O O     . HOH K 3 .   ? 52.045  8.776   12.581  1.00 25.44 ? 436 HOH A O     1 
HETATM 8509 O O     . HOH K 3 .   ? 34.415  -14.627 17.183  1.00 29.95 ? 437 HOH A O     1 
HETATM 8510 O O     . HOH K 3 .   ? 28.530  4.573   16.989  1.00 26.22 ? 438 HOH A O     1 
HETATM 8511 O O     . HOH K 3 .   ? 45.602  -21.994 14.656  1.00 26.83 ? 439 HOH A O     1 
HETATM 8512 O O     . HOH K 3 .   ? 66.375  -11.465 3.268   1.00 27.01 ? 440 HOH A O     1 
HETATM 8513 O O     . HOH K 3 .   ? 28.829  23.597  19.699  1.00 28.08 ? 441 HOH A O     1 
HETATM 8514 O O     . HOH K 3 .   ? 38.990  -14.042 17.632  1.00 22.59 ? 442 HOH A O     1 
HETATM 8515 O O     . HOH K 3 .   ? 57.866  15.419  33.342  1.00 35.82 ? 443 HOH A O     1 
HETATM 8516 O O     . HOH K 3 .   ? 34.997  -0.042  22.334  1.00 16.68 ? 444 HOH A O     1 
HETATM 8517 O O     . HOH K 3 .   ? 48.650  -12.092 26.190  1.00 28.63 ? 445 HOH A O     1 
HETATM 8518 O O     . HOH K 3 .   ? 40.786  -32.350 32.877  1.00 42.04 ? 446 HOH A O     1 
HETATM 8519 O O     . HOH K 3 .   ? 55.994  -8.178  0.075   1.00 31.73 ? 447 HOH A O     1 
HETATM 8520 O O     . HOH K 3 .   ? 41.880  -5.107  12.809  1.00 31.64 ? 448 HOH A O     1 
HETATM 8521 O O     . HOH K 3 .   ? 47.408  8.854   0.802   1.00 23.62 ? 449 HOH A O     1 
HETATM 8522 O O     . HOH K 3 .   ? 55.020  -22.960 20.159  1.00 34.86 ? 450 HOH A O     1 
HETATM 8523 O O     . HOH K 3 .   ? 46.768  7.249   7.604   1.00 20.85 ? 451 HOH A O     1 
HETATM 8524 O O     . HOH K 3 .   ? 45.911  -18.666 10.682  1.00 27.65 ? 452 HOH A O     1 
HETATM 8525 O O     . HOH K 3 .   ? 28.193  14.429  34.433  1.00 53.14 ? 453 HOH A O     1 
HETATM 8526 O O     . HOH K 3 .   ? 65.020  -20.387 31.771  1.00 31.43 ? 454 HOH A O     1 
HETATM 8527 O O     . HOH K 3 .   ? 45.884  -5.805  12.312  1.00 23.60 ? 455 HOH A O     1 
HETATM 8528 O O     . HOH K 3 .   ? 52.411  -19.066 6.024   1.00 33.16 ? 456 HOH A O     1 
HETATM 8529 O O     . HOH K 3 .   ? 51.123  9.568   17.411  1.00 33.10 ? 457 HOH A O     1 
HETATM 8530 O O     . HOH K 3 .   ? 46.704  0.713   1.611   1.00 23.48 ? 458 HOH A O     1 
HETATM 8531 O O     . HOH K 3 .   ? 37.954  -4.552  4.753   1.00 36.73 ? 459 HOH A O     1 
HETATM 8532 O O     . HOH K 3 .   ? 59.387  -7.958  25.914  1.00 23.97 ? 460 HOH A O     1 
HETATM 8533 O O     . HOH K 3 .   ? 43.930  19.879  20.371  1.00 33.22 ? 461 HOH A O     1 
HETATM 8534 O O     . HOH K 3 .   ? 36.722  -13.375 19.171  1.00 26.23 ? 462 HOH A O     1 
HETATM 8535 O O     . HOH K 3 .   ? 27.594  -5.231  22.294  1.00 26.01 ? 463 HOH A O     1 
HETATM 8536 O O     . HOH K 3 .   ? 53.499  -24.017 30.155  1.00 26.15 ? 464 HOH A O     1 
HETATM 8537 O O     . HOH K 3 .   ? 52.526  5.127   54.782  1.00 40.20 ? 465 HOH A O     1 
HETATM 8538 O O     . HOH K 3 .   ? 42.099  -13.932 5.771   1.00 33.25 ? 466 HOH A O     1 
HETATM 8539 O O     . HOH K 3 .   ? 20.384  6.329   10.043  1.00 33.30 ? 467 HOH A O     1 
HETATM 8540 O O     . HOH K 3 .   ? 50.136  8.125   11.179  1.00 24.05 ? 468 HOH A O     1 
HETATM 8541 O O     . HOH K 3 .   ? 45.805  18.391  11.970  1.00 33.61 ? 469 HOH A O     1 
HETATM 8542 O O     . HOH K 3 .   ? 24.446  3.151   30.732  1.00 46.09 ? 470 HOH A O     1 
HETATM 8543 O O     . HOH K 3 .   ? 46.280  -15.022 28.004  1.00 36.34 ? 471 HOH A O     1 
HETATM 8544 O O     . HOH K 3 .   ? 16.297  17.023  22.308  1.00 41.92 ? 472 HOH A O     1 
HETATM 8545 O O     . HOH K 3 .   ? 35.828  -0.715  4.629   1.00 31.11 ? 473 HOH A O     1 
HETATM 8546 O O     . HOH K 3 .   ? 37.087  2.281   29.241  1.00 30.74 ? 474 HOH A O     1 
HETATM 8547 O O     . HOH K 3 .   ? 51.901  15.691  7.418   1.00 33.31 ? 475 HOH A O     1 
HETATM 8548 O O     . HOH K 3 .   ? 35.904  -13.576 6.776   1.00 29.75 ? 476 HOH A O     1 
HETATM 8549 O O     . HOH K 3 .   ? 47.147  -7.081  0.832   1.00 33.41 ? 477 HOH A O     1 
HETATM 8550 O O     . HOH K 3 .   ? 55.635  -20.891 9.180   1.00 24.25 ? 478 HOH A O     1 
HETATM 8551 O O     . HOH K 3 .   ? 30.509  -7.408  23.377  1.00 21.79 ? 479 HOH A O     1 
HETATM 8552 O O     . HOH K 3 .   ? 49.660  -2.488  15.273  1.00 26.47 ? 480 HOH A O     1 
HETATM 8553 O O     . HOH K 3 .   ? 39.134  1.956   2.410   1.00 35.03 ? 481 HOH A O     1 
HETATM 8554 O O     . HOH K 3 .   ? 39.134  14.584  21.851  1.00 30.44 ? 482 HOH A O     1 
HETATM 8555 O O     . HOH K 3 .   ? 45.720  -24.691 14.794  1.00 30.14 ? 483 HOH A O     1 
HETATM 8556 O O     . HOH K 3 .   ? 56.756  -26.324 28.399  1.00 35.50 ? 484 HOH A O     1 
HETATM 8557 O O     . HOH K 3 .   ? 38.956  7.757   4.497   1.00 35.34 ? 485 HOH A O     1 
HETATM 8558 O O     . HOH K 3 .   ? 38.249  -19.858 9.688   1.00 31.93 ? 486 HOH A O     1 
HETATM 8559 O O     . HOH K 3 .   ? 17.304  12.081  19.936  1.00 32.27 ? 487 HOH A O     1 
HETATM 8560 O O     . HOH K 3 .   ? 61.708  -23.470 23.380  1.00 26.34 ? 488 HOH A O     1 
HETATM 8561 O O     . HOH K 3 .   ? 64.561  -17.820 22.645  1.00 40.80 ? 489 HOH A O     1 
HETATM 8562 O O     . HOH K 3 .   ? 39.669  -8.101  6.128   1.00 35.39 ? 490 HOH A O     1 
HETATM 8563 O O     . HOH K 3 .   ? 45.183  -21.314 11.935  1.00 27.31 ? 491 HOH A O     1 
HETATM 8564 O O     . HOH K 3 .   ? 64.903  1.871   25.063  1.00 31.65 ? 492 HOH A O     1 
HETATM 8565 O O     . HOH K 3 .   ? 32.787  -1.382  20.675  1.00 30.04 ? 493 HOH A O     1 
HETATM 8566 O O     . HOH K 3 .   ? 51.429  -5.379  27.091  1.00 29.43 ? 494 HOH A O     1 
HETATM 8567 O O     . HOH K 3 .   ? 40.588  3.884   24.936  1.00 45.11 ? 495 HOH A O     1 
HETATM 8568 O O     . HOH K 3 .   ? 52.615  -25.374 13.781  1.00 34.85 ? 496 HOH A O     1 
HETATM 8569 O O     . HOH K 3 .   ? 51.184  18.160  15.687  1.00 42.39 ? 497 HOH A O     1 
HETATM 8570 O O     . HOH K 3 .   ? 46.963  10.125  5.130   1.00 27.50 ? 498 HOH A O     1 
HETATM 8571 O O     . HOH K 3 .   ? 45.204  11.528  18.997  1.00 45.00 ? 499 HOH A O     1 
HETATM 8572 O O     . HOH K 3 .   ? 61.812  -16.027 22.316  1.00 25.40 ? 500 HOH A O     1 
HETATM 8573 O O     . HOH K 3 .   ? 45.486  0.828   24.125  1.00 45.13 ? 501 HOH A O     1 
HETATM 8574 O O     . HOH K 3 .   ? 27.100  18.181  8.853   1.00 34.26 ? 502 HOH A O     1 
HETATM 8575 O O     . HOH K 3 .   ? 36.167  6.529   27.277  1.00 34.52 ? 503 HOH A O     1 
HETATM 8576 O O     . HOH K 3 .   ? 46.625  16.528  4.259   1.00 40.66 ? 504 HOH A O     1 
HETATM 8577 O O     . HOH K 3 .   ? 39.583  11.188  5.889   1.00 43.88 ? 505 HOH A O     1 
HETATM 8578 O O     . HOH K 3 .   ? 66.550  9.938   22.257  1.00 37.27 ? 506 HOH A O     1 
HETATM 8579 O O     . HOH K 3 .   ? 18.570  18.372  23.307  1.00 44.22 ? 507 HOH A O     1 
HETATM 8580 O O     . HOH K 3 .   ? 41.143  20.603  16.778  1.00 29.39 ? 508 HOH A O     1 
HETATM 8581 O O     . HOH K 3 .   ? 30.108  24.530  26.090  1.00 36.52 ? 509 HOH A O     1 
HETATM 8582 O O     . HOH K 3 .   ? 48.213  -25.221 15.516  1.00 38.32 ? 510 HOH A O     1 
HETATM 8583 O O     . HOH K 3 .   ? 55.317  -28.410 29.110  1.00 37.89 ? 511 HOH A O     1 
HETATM 8584 O O     . HOH K 3 .   ? 19.261  1.182   21.052  1.00 33.32 ? 512 HOH A O     1 
HETATM 8585 O O     . HOH K 3 .   ? 53.966  -18.805 2.844   1.00 36.16 ? 513 HOH A O     1 
HETATM 8586 O O     . HOH K 3 .   ? 20.781  7.202   23.573  1.00 27.87 ? 514 HOH A O     1 
HETATM 8587 O O     . HOH K 3 .   ? 29.893  -0.319  38.838  1.00 39.67 ? 515 HOH A O     1 
HETATM 8588 O O     . HOH K 3 .   ? 41.096  -6.117  3.986   1.00 40.47 ? 516 HOH A O     1 
HETATM 8589 O O     . HOH K 3 .   ? 68.657  4.228   12.833  1.00 29.54 ? 517 HOH A O     1 
HETATM 8590 O O     . HOH K 3 .   ? 44.780  -2.398  4.490   1.00 35.26 ? 518 HOH A O     1 
HETATM 8591 O O     . HOH K 3 .   ? 32.496  -12.737 16.852  1.00 34.52 ? 519 HOH A O     1 
HETATM 8592 O O     . HOH K 3 .   ? 50.711  -22.594 24.868  1.00 35.51 ? 520 HOH A O     1 
HETATM 8593 O O     . HOH K 3 .   ? 53.521  -30.452 33.500  1.00 33.17 ? 521 HOH A O     1 
HETATM 8594 O O     . HOH K 3 .   ? 44.590  9.449   19.858  1.00 41.47 ? 522 HOH A O     1 
HETATM 8595 O O     . HOH K 3 .   ? 52.538  8.184   15.151  1.00 31.27 ? 523 HOH A O     1 
HETATM 8596 O O     . HOH K 3 .   ? 18.971  17.413  16.683  1.00 32.36 ? 524 HOH A O     1 
HETATM 8597 O O     . HOH K 3 .   ? 62.431  -17.564 13.316  1.00 35.64 ? 525 HOH A O     1 
HETATM 8598 O O     . HOH K 3 .   ? 66.293  11.380  36.572  1.00 41.13 ? 526 HOH A O     1 
HETATM 8599 O O     . HOH K 3 .   ? 44.289  8.393   28.548  1.00 34.58 ? 527 HOH A O     1 
HETATM 8600 O O     . HOH K 3 .   ? 26.108  -13.451 10.771  1.00 34.81 ? 528 HOH A O     1 
HETATM 8601 O O     . HOH K 3 .   ? 68.165  0.544   4.678   1.00 36.96 ? 529 HOH A O     1 
HETATM 8602 O O     . HOH K 3 .   ? 50.965  12.573  31.382  1.00 40.54 ? 530 HOH A O     1 
HETATM 8603 O O     . HOH K 3 .   ? 48.720  3.087   -3.794  1.00 36.24 ? 531 HOH A O     1 
HETATM 8604 O O     . HOH K 3 .   ? 37.575  12.069  29.547  1.00 43.42 ? 532 HOH A O     1 
HETATM 8605 O O     . HOH K 3 .   ? 51.602  -3.394  -3.378  1.00 36.85 ? 533 HOH A O     1 
HETATM 8606 O O     . HOH L 3 .   ? 59.267  -17.507 54.038  1.00 5.31  ? 405 HOH C O     1 
HETATM 8607 O O     . HOH L 3 .   ? 66.607  -22.471 32.852  1.00 18.28 ? 406 HOH C O     1 
HETATM 8608 O O     . HOH L 3 .   ? 64.192  -15.627 46.191  1.00 19.89 ? 407 HOH C O     1 
HETATM 8609 O O     . HOH L 3 .   ? 71.811  -31.549 32.345  1.00 19.23 ? 408 HOH C O     1 
HETATM 8610 O O     . HOH L 3 .   ? 71.920  -9.413  44.313  1.00 21.15 ? 409 HOH C O     1 
HETATM 8611 O O     . HOH L 3 .   ? 72.115  -25.010 31.548  1.00 19.63 ? 410 HOH C O     1 
HETATM 8612 O O     . HOH L 3 .   ? 38.268  -9.397  28.112  1.00 22.35 ? 411 HOH C O     1 
HETATM 8613 O O     . HOH L 3 .   ? 72.548  -25.205 47.172  1.00 22.54 ? 412 HOH C O     1 
HETATM 8614 O O     . HOH L 3 .   ? 68.029  -26.258 38.075  1.00 24.71 ? 413 HOH C O     1 
HETATM 8615 O O     . HOH L 3 .   ? 69.715  2.279   46.343  1.00 22.82 ? 414 HOH C O     1 
HETATM 8616 O O     . HOH L 3 .   ? 53.894  -17.277 37.035  1.00 20.52 ? 415 HOH C O     1 
HETATM 8617 O O     . HOH L 3 .   ? 62.591  -27.032 36.126  1.00 18.36 ? 416 HOH C O     1 
HETATM 8618 O O     . HOH L 3 .   ? 47.074  -0.298  35.183  1.00 26.61 ? 417 HOH C O     1 
HETATM 8619 O O     . HOH L 3 .   ? 45.553  -5.295  32.106  1.00 22.62 ? 418 HOH C O     1 
HETATM 8620 O O     . HOH L 3 .   ? 49.233  -19.344 30.724  1.00 34.68 ? 419 HOH C O     1 
HETATM 8621 O O     . HOH L 3 .   ? 47.540  -2.329  32.617  1.00 26.14 ? 420 HOH C O     1 
HETATM 8622 O O     . HOH L 3 .   ? 60.618  -31.662 37.398  1.00 25.28 ? 421 HOH C O     1 
HETATM 8623 O O     . HOH L 3 .   ? 55.677  -3.853  57.175  1.00 19.54 ? 422 HOH C O     1 
HETATM 8624 O O     . HOH L 3 .   ? 48.741  -5.037  38.137  1.00 24.87 ? 423 HOH C O     1 
HETATM 8625 O O     . HOH L 3 .   ? 47.150  -22.760 43.301  1.00 24.41 ? 424 HOH C O     1 
HETATM 8626 O O     . HOH L 3 .   ? 54.629  -3.009  31.163  1.00 21.33 ? 425 HOH C O     1 
HETATM 8627 O O     . HOH L 3 .   ? 57.869  0.355   50.211  1.00 23.41 ? 426 HOH C O     1 
HETATM 8628 O O     . HOH L 3 .   ? 48.910  -11.239 29.777  1.00 23.83 ? 427 HOH C O     1 
HETATM 8629 O O     . HOH L 3 .   ? 56.354  -24.095 38.712  1.00 24.17 ? 428 HOH C O     1 
HETATM 8630 O O     . HOH L 3 .   ? 67.756  -24.343 31.256  1.00 20.54 ? 429 HOH C O     1 
HETATM 8631 O O     . HOH L 3 .   ? 50.458  4.962   32.061  1.00 27.89 ? 430 HOH C O     1 
HETATM 8632 O O     . HOH L 3 .   ? 80.159  -14.920 52.675  1.00 30.75 ? 431 HOH C O     1 
HETATM 8633 O O     . HOH L 3 .   ? 70.062  -33.169 53.644  1.00 31.64 ? 432 HOH C O     1 
HETATM 8634 O O     . HOH L 3 .   ? 72.196  -13.533 56.437  1.00 22.52 ? 433 HOH C O     1 
HETATM 8635 O O     . HOH L 3 .   ? 45.173  2.662   34.838  1.00 33.72 ? 434 HOH C O     1 
HETATM 8636 O O     . HOH L 3 .   ? 60.401  -33.707 34.067  1.00 22.69 ? 435 HOH C O     1 
HETATM 8637 O O     . HOH L 3 .   ? 66.334  4.872   42.196  1.00 17.87 ? 436 HOH C O     1 
HETATM 8638 O O     . HOH L 3 .   ? 39.867  -8.821  33.254  1.00 25.77 ? 437 HOH C O     1 
HETATM 8639 O O     . HOH L 3 .   ? 39.891  -11.626 33.586  1.00 20.61 ? 438 HOH C O     1 
HETATM 8640 O O     . HOH L 3 .   ? 70.187  -17.683 37.648  1.00 22.71 ? 439 HOH C O     1 
HETATM 8641 O O     . HOH L 3 .   ? 50.377  6.950   38.916  1.00 24.68 ? 440 HOH C O     1 
HETATM 8642 O O     . HOH L 3 .   ? 48.169  -27.399 41.628  1.00 21.58 ? 441 HOH C O     1 
HETATM 8643 O O     . HOH L 3 .   ? 60.836  -27.754 42.140  1.00 30.61 ? 442 HOH C O     1 
HETATM 8644 O O     . HOH L 3 .   ? 58.189  -19.671 45.359  1.00 20.49 ? 443 HOH C O     1 
HETATM 8645 O O     . HOH L 3 .   ? 48.913  -22.638 41.022  1.00 22.25 ? 444 HOH C O     1 
HETATM 8646 O O     . HOH L 3 .   ? 39.724  -6.700  38.373  1.00 21.48 ? 445 HOH C O     1 
HETATM 8647 O O     . HOH L 3 .   ? 62.078  -27.296 32.083  1.00 23.27 ? 446 HOH C O     1 
HETATM 8648 O O     . HOH L 3 .   ? 71.466  -11.509 45.474  1.00 25.99 ? 447 HOH C O     1 
HETATM 8649 O O     . HOH L 3 .   ? 55.913  -19.064 43.395  1.00 24.07 ? 448 HOH C O     1 
HETATM 8650 O O     . HOH L 3 .   ? 58.787  -35.863 49.514  1.00 32.50 ? 449 HOH C O     1 
HETATM 8651 O O     . HOH L 3 .   ? 57.371  -15.519 45.707  1.00 26.41 ? 450 HOH C O     1 
HETATM 8652 O O     . HOH L 3 .   ? 62.304  -13.269 36.381  1.00 26.77 ? 451 HOH C O     1 
HETATM 8653 O O     . HOH L 3 .   ? 61.697  5.042   54.165  1.00 29.28 ? 452 HOH C O     1 
HETATM 8654 O O     . HOH L 3 .   ? 68.841  -28.799 52.419  1.00 35.26 ? 453 HOH C O     1 
HETATM 8655 O O     . HOH L 3 .   ? 56.552  -3.415  38.481  1.00 27.78 ? 454 HOH C O     1 
HETATM 8656 O O     . HOH L 3 .   ? 60.488  -12.080 42.367  1.00 25.61 ? 455 HOH C O     1 
HETATM 8657 O O     . HOH L 3 .   ? 72.241  -11.149 39.438  1.00 29.49 ? 456 HOH C O     1 
HETATM 8658 O O     . HOH L 3 .   ? 34.871  -27.626 34.827  1.00 30.64 ? 457 HOH C O     1 
HETATM 8659 O O     . HOH L 3 .   ? 79.196  -9.757  49.011  1.00 25.23 ? 458 HOH C O     1 
HETATM 8660 O O     . HOH L 3 .   ? 77.589  -23.487 36.559  1.00 27.29 ? 459 HOH C O     1 
HETATM 8661 O O     . HOH L 3 .   ? 58.106  -10.113 40.743  1.00 28.21 ? 460 HOH C O     1 
HETATM 8662 O O     . HOH L 3 .   ? 82.787  -35.972 37.609  1.00 33.38 ? 461 HOH C O     1 
HETATM 8663 O O     . HOH L 3 .   ? 54.028  -16.128 45.607  1.00 25.35 ? 462 HOH C O     1 
HETATM 8664 O O     . HOH L 3 .   ? 69.829  -26.070 31.360  1.00 23.96 ? 463 HOH C O     1 
HETATM 8665 O O     . HOH L 3 .   ? 58.652  -2.911  59.237  1.00 35.96 ? 464 HOH C O     1 
HETATM 8666 O O     . HOH L 3 .   ? 79.371  -43.322 42.744  1.00 30.68 ? 465 HOH C O     1 
HETATM 8667 O O     . HOH L 3 .   ? 50.604  -13.560 32.216  1.00 21.44 ? 466 HOH C O     1 
HETATM 8668 O O     . HOH L 3 .   ? 73.644  -14.000 51.874  1.00 29.15 ? 467 HOH C O     1 
HETATM 8669 O O     . HOH L 3 .   ? 75.653  -20.219 49.918  1.00 41.87 ? 468 HOH C O     1 
HETATM 8670 O O     . HOH L 3 .   ? 49.456  -3.592  26.504  1.00 24.97 ? 469 HOH C O     1 
HETATM 8671 O O     . HOH L 3 .   ? 72.949  -12.925 32.977  1.00 29.14 ? 470 HOH C O     1 
HETATM 8672 O O     . HOH L 3 .   ? 66.852  -24.529 23.961  1.00 32.12 ? 471 HOH C O     1 
HETATM 8673 O O     . HOH L 3 .   ? 45.639  -27.452 43.929  1.00 33.97 ? 472 HOH C O     1 
HETATM 8674 O O     . HOH L 3 .   ? 65.680  -13.630 58.348  1.00 28.81 ? 473 HOH C O     1 
HETATM 8675 O O     . HOH L 3 .   ? 42.583  -5.242  49.046  1.00 22.38 ? 474 HOH C O     1 
HETATM 8676 O O     . HOH L 3 .   ? 29.979  -17.130 28.963  1.00 33.38 ? 475 HOH C O     1 
HETATM 8677 O O     . HOH L 3 .   ? 60.621  -24.941 30.692  1.00 27.39 ? 476 HOH C O     1 
HETATM 8678 O O     . HOH L 3 .   ? 49.323  -25.181 39.739  1.00 30.22 ? 477 HOH C O     1 
HETATM 8679 O O     . HOH L 3 .   ? 70.639  -14.409 49.575  1.00 22.92 ? 478 HOH C O     1 
HETATM 8680 O O     . HOH L 3 .   ? 67.513  -11.542 60.925  1.00 28.82 ? 479 HOH C O     1 
HETATM 8681 O O     . HOH L 3 .   ? 55.019  -22.243 52.005  1.00 44.72 ? 480 HOH C O     1 
HETATM 8682 O O     . HOH L 3 .   ? 31.485  -9.434  24.829  1.00 29.22 ? 481 HOH C O     1 
HETATM 8683 O O     . HOH L 3 .   ? 63.828  -4.519  28.977  1.00 31.34 ? 482 HOH C O     1 
HETATM 8684 O O     . HOH L 3 .   ? 67.065  -33.062 41.838  1.00 19.92 ? 483 HOH C O     1 
HETATM 8685 O O     . HOH L 3 .   ? 43.260  -22.667 49.332  1.00 29.57 ? 484 HOH C O     1 
HETATM 8686 O O     . HOH L 3 .   ? 55.301  -37.047 45.327  1.00 35.85 ? 485 HOH C O     1 
HETATM 8687 O O     . HOH L 3 .   ? 43.397  -25.620 48.267  1.00 38.46 ? 486 HOH C O     1 
HETATM 8688 O O     . HOH L 3 .   ? 56.947  -5.376  28.644  1.00 23.53 ? 487 HOH C O     1 
HETATM 8689 O O     . HOH L 3 .   ? 44.150  -12.956 54.014  1.00 26.24 ? 488 HOH C O     1 
HETATM 8690 O O     . HOH L 3 .   ? 57.862  -39.884 41.852  1.00 41.46 ? 489 HOH C O     1 
HETATM 8691 O O     . HOH L 3 .   ? 83.820  -33.039 43.735  1.00 28.54 ? 490 HOH C O     1 
HETATM 8692 O O     . HOH L 3 .   ? 61.378  -28.858 37.767  1.00 26.33 ? 491 HOH C O     1 
HETATM 8693 O O     . HOH L 3 .   ? 42.501  -7.859  49.792  1.00 33.93 ? 492 HOH C O     1 
HETATM 8694 O O     . HOH L 3 .   ? 48.400  -16.360 34.771  1.00 30.62 ? 493 HOH C O     1 
HETATM 8695 O O     . HOH L 3 .   ? 76.808  -29.779 25.396  1.00 39.69 ? 494 HOH C O     1 
HETATM 8696 O O     . HOH L 3 .   ? 64.501  -37.624 27.381  1.00 37.41 ? 495 HOH C O     1 
HETATM 8697 O O     . HOH L 3 .   ? 37.383  -8.194  30.471  1.00 30.79 ? 496 HOH C O     1 
HETATM 8698 O O     . HOH L 3 .   ? 63.238  -23.983 30.501  1.00 33.25 ? 497 HOH C O     1 
HETATM 8699 O O     . HOH L 3 .   ? 48.069  2.349   45.200  1.00 37.91 ? 498 HOH C O     1 
HETATM 8700 O O     . HOH L 3 .   ? 63.798  -15.609 32.466  1.00 50.94 ? 499 HOH C O     1 
HETATM 8701 O O     . HOH L 3 .   ? 75.155  -36.879 53.573  1.00 39.63 ? 500 HOH C O     1 
HETATM 8702 O O     . HOH L 3 .   ? 64.187  -14.096 56.262  1.00 37.64 ? 501 HOH C O     1 
HETATM 8703 O O     . HOH L 3 .   ? 79.935  -14.964 40.334  1.00 36.75 ? 502 HOH C O     1 
HETATM 8704 O O     . HOH L 3 .   ? 41.541  -8.775  38.153  1.00 27.46 ? 503 HOH C O     1 
HETATM 8705 O O     . HOH L 3 .   ? 57.238  -33.863 37.052  1.00 24.92 ? 504 HOH C O     1 
HETATM 8706 O O     . HOH L 3 .   ? 41.794  -36.059 41.657  1.00 30.24 ? 505 HOH C O     1 
HETATM 8707 O O     . HOH L 3 .   ? 61.976  -0.702  28.316  1.00 35.86 ? 506 HOH C O     1 
HETATM 8708 O O     . HOH L 3 .   ? 65.413  -12.706 54.028  1.00 32.30 ? 507 HOH C O     1 
HETATM 8709 O O     . HOH L 3 .   ? 63.209  -27.423 29.577  1.00 38.77 ? 508 HOH C O     1 
HETATM 8710 O O     . HOH L 3 .   ? 54.275  -25.344 53.912  1.00 63.00 ? 509 HOH C O     1 
HETATM 8711 O O     . HOH L 3 .   ? 70.272  -20.025 54.421  1.00 33.98 ? 510 HOH C O     1 
HETATM 8712 O O     . HOH L 3 .   ? 42.568  -32.192 42.661  1.00 36.63 ? 511 HOH C O     1 
HETATM 8713 O O     . HOH L 3 .   ? 52.996  3.332   29.445  1.00 32.98 ? 512 HOH C O     1 
HETATM 8714 O O     . HOH L 3 .   ? 37.679  -27.432 41.248  1.00 29.70 ? 513 HOH C O     1 
HETATM 8715 O O     . HOH L 3 .   ? 50.565  -6.007  59.920  1.00 31.45 ? 514 HOH C O     1 
HETATM 8716 O O     . HOH L 3 .   ? 42.250  2.951   27.174  1.00 31.66 ? 515 HOH C O     1 
HETATM 8717 O O     . HOH L 3 .   ? 67.076  3.820   55.582  1.00 41.90 ? 516 HOH C O     1 
HETATM 8718 O O     . HOH L 3 .   ? 86.460  -32.764 41.760  1.00 25.89 ? 517 HOH C O     1 
HETATM 8719 O O     . HOH L 3 .   ? 41.124  -16.208 44.309  1.00 26.29 ? 518 HOH C O     1 
HETATM 8720 O O     . HOH L 3 .   ? 52.837  -6.837  28.623  1.00 35.37 ? 519 HOH C O     1 
HETATM 8721 O O     . HOH L 3 .   ? 65.249  -16.556 60.800  1.00 44.35 ? 520 HOH C O     1 
HETATM 8722 O O     . HOH L 3 .   ? 72.881  -17.455 37.424  1.00 35.60 ? 521 HOH C O     1 
HETATM 8723 O O     . HOH L 3 .   ? 67.088  -11.748 6.879   1.00 37.08 ? 522 HOH C O     1 
HETATM 8724 O O     . HOH L 3 .   ? 70.766  -14.220 20.025  1.00 39.49 ? 523 HOH C O     1 
HETATM 8725 O O     . HOH L 3 .   ? 43.084  -20.005 49.059  1.00 34.38 ? 524 HOH C O     1 
HETATM 8726 O O     . HOH L 3 .   ? 51.843  -32.574 52.088  1.00 46.96 ? 525 HOH C O     1 
HETATM 8727 O O     . HOH L 3 .   ? 75.385  -47.020 48.229  1.00 41.71 ? 526 HOH C O     1 
HETATM 8728 O O     . HOH L 3 .   ? 87.617  -30.319 40.290  1.00 40.36 ? 527 HOH C O     1 
HETATM 8729 O O     . HOH L 3 .   ? 63.829  -19.758 36.638  1.00 41.99 ? 528 HOH C O     1 
HETATM 8730 O O     . HOH L 3 .   ? 68.027  6.877   42.648  1.00 28.33 ? 529 HOH C O     1 
HETATM 8731 O O     . HOH L 3 .   ? 71.164  -9.488  41.461  1.00 35.05 ? 530 HOH C O     1 
HETATM 8732 O O     . HOH L 3 .   ? 44.237  -15.272 47.989  1.00 29.49 ? 531 HOH C O     1 
HETATM 8733 O O     . HOH L 3 .   ? 76.237  3.938   41.398  1.00 34.03 ? 532 HOH C O     1 
HETATM 8734 O O     . HOH L 3 .   ? 38.439  -15.995 43.914  1.00 30.11 ? 533 HOH C O     1 
HETATM 8735 O O     . HOH L 3 .   ? 31.603  -24.935 32.139  1.00 38.60 ? 534 HOH C O     1 
HETATM 8736 O O     . HOH L 3 .   ? 65.294  -7.412  60.942  1.00 40.10 ? 535 HOH C O     1 
HETATM 8737 O O     . HOH L 3 .   ? 38.765  -7.653  48.474  1.00 36.27 ? 536 HOH C O     1 
HETATM 8738 O O     . HOH L 3 .   ? 51.777  6.029   50.646  1.00 24.11 ? 537 HOH C O     1 
HETATM 8739 O O     . HOH M 3 .   ? 10.168  1.456   -24.959 1.00 10.23 ? 403 HOH E O     1 
HETATM 8740 O O     . HOH M 3 .   ? 7.601   2.072   -23.454 1.00 10.18 ? 404 HOH E O     1 
HETATM 8741 O O     . HOH M 3 .   ? 22.750  0.134   -8.951  1.00 22.45 ? 405 HOH E O     1 
HETATM 8742 O O     . HOH M 3 .   ? 12.179  -3.672  -17.344 1.00 19.66 ? 406 HOH E O     1 
HETATM 8743 O O     . HOH M 3 .   ? 12.935  7.406   -9.271  1.00 14.56 ? 407 HOH E O     1 
HETATM 8744 O O     . HOH M 3 .   ? 6.311   4.261   -7.996  1.00 17.50 ? 408 HOH E O     1 
HETATM 8745 O O     . HOH M 3 .   ? 24.122  -3.826  -2.332  1.00 15.79 ? 409 HOH E O     1 
HETATM 8746 O O     . HOH M 3 .   ? 9.157   4.299   -14.174 1.00 21.35 ? 410 HOH E O     1 
HETATM 8747 O O     . HOH M 3 .   ? 18.991  5.207   -2.920  1.00 20.83 ? 411 HOH E O     1 
HETATM 8748 O O     . HOH M 3 .   ? 4.318   8.722   -1.479  1.00 27.39 ? 412 HOH E O     1 
HETATM 8749 O O     . HOH M 3 .   ? 30.986  -4.046  3.939   1.00 29.41 ? 413 HOH E O     1 
HETATM 8750 O O     . HOH M 3 .   ? -10.239 9.183   1.038   1.00 24.87 ? 414 HOH E O     1 
HETATM 8751 O O     . HOH M 3 .   ? 29.038  1.136   -2.963  1.00 23.24 ? 415 HOH E O     1 
HETATM 8752 O O     . HOH M 3 .   ? 24.922  -3.305  -18.157 1.00 22.76 ? 416 HOH E O     1 
HETATM 8753 O O     . HOH M 3 .   ? 18.752  -1.273  -3.876  1.00 23.06 ? 417 HOH E O     1 
HETATM 8754 O O     . HOH M 3 .   ? 27.025  -8.413  -7.497  1.00 33.33 ? 418 HOH E O     1 
HETATM 8755 O O     . HOH M 3 .   ? 38.440  -6.102  -14.420 1.00 30.98 ? 419 HOH E O     1 
HETATM 8756 O O     . HOH M 3 .   ? -8.774  -1.858  -3.874  1.00 20.77 ? 420 HOH E O     1 
HETATM 8757 O O     . HOH M 3 .   ? -6.092  -0.518  -9.449  1.00 26.30 ? 421 HOH E O     1 
HETATM 8758 O O     . HOH M 3 .   ? 5.700   13.009  -13.887 1.00 24.93 ? 422 HOH E O     1 
HETATM 8759 O O     . HOH M 3 .   ? 21.396  9.412   -7.725  1.00 21.04 ? 423 HOH E O     1 
HETATM 8760 O O     . HOH M 3 .   ? 18.615  6.712   -12.821 1.00 24.55 ? 424 HOH E O     1 
HETATM 8761 O O     . HOH M 3 .   ? -3.604  -6.703  -2.596  1.00 26.48 ? 425 HOH E O     1 
HETATM 8762 O O     . HOH M 3 .   ? 5.599   3.470   -16.394 1.00 25.88 ? 426 HOH E O     1 
HETATM 8763 O O     . HOH M 3 .   ? 21.069  -0.727  -2.117  1.00 22.75 ? 427 HOH E O     1 
HETATM 8764 O O     . HOH M 3 .   ? 0.000   -6.363  0.000   0.50 24.69 ? 428 HOH E O     1 
HETATM 8765 O O     . HOH M 3 .   ? 19.350  4.778   -6.813  1.00 23.60 ? 429 HOH E O     1 
HETATM 8766 O O     . HOH M 3 .   ? -8.642  7.035   -9.055  1.00 30.27 ? 430 HOH E O     1 
HETATM 8767 O O     . HOH M 3 .   ? 7.626   -3.765  -13.504 1.00 23.12 ? 431 HOH E O     1 
HETATM 8768 O O     . HOH M 3 .   ? 17.931  -7.188  -8.835  1.00 30.31 ? 432 HOH E O     1 
HETATM 8769 O O     . HOH M 3 .   ? 15.712  2.462   5.612   1.00 24.99 ? 433 HOH E O     1 
HETATM 8770 O O     . HOH M 3 .   ? 21.385  6.324   6.214   1.00 25.98 ? 434 HOH E O     1 
HETATM 8771 O O     . HOH M 3 .   ? 0.961   4.013   -2.986  1.00 29.63 ? 435 HOH E O     1 
HETATM 8772 O O     . HOH M 3 .   ? 7.578   0.740   -16.798 1.00 22.96 ? 436 HOH E O     1 
HETATM 8773 O O     . HOH M 3 .   ? 22.785  10.906  -4.642  1.00 31.46 ? 437 HOH E O     1 
HETATM 8774 O O     . HOH M 3 .   ? 3.579   -20.173 -18.643 1.00 39.02 ? 438 HOH E O     1 
HETATM 8775 O O     . HOH M 3 .   ? 11.626  -3.936  -27.428 1.00 37.86 ? 439 HOH E O     1 
HETATM 8776 O O     . HOH M 3 .   ? 23.604  -1.226  -2.160  1.00 20.00 ? 440 HOH E O     1 
HETATM 8777 O O     . HOH M 3 .   ? 10.958  3.306   -16.112 1.00 34.28 ? 441 HOH E O     1 
HETATM 8778 O O     . HOH M 3 .   ? -8.207  1.587   -3.252  1.00 28.47 ? 442 HOH E O     1 
HETATM 8779 O O     . HOH M 3 .   ? 39.932  -8.711  -12.369 1.00 30.94 ? 443 HOH E O     1 
HETATM 8780 O O     . HOH M 3 .   ? 13.761  5.618   -24.685 1.00 36.72 ? 444 HOH E O     1 
HETATM 8781 O O     . HOH M 3 .   ? 4.471   17.391  -18.952 1.00 44.91 ? 445 HOH E O     1 
HETATM 8782 O O     . HOH M 3 .   ? 13.318  -13.886 -15.837 1.00 38.30 ? 446 HOH E O     1 
HETATM 8783 O O     . HOH M 3 .   ? -7.629  10.301  -4.573  1.00 32.47 ? 447 HOH E O     1 
HETATM 8784 O O     . HOH M 3 .   ? -1.736  -2.550  0.135   1.00 28.72 ? 448 HOH E O     1 
HETATM 8785 O O     . HOH M 3 .   ? -1.680  7.492   1.765   1.00 40.12 ? 449 HOH E O     1 
HETATM 8786 O O     . HOH M 3 .   ? 38.850  -5.212  -11.723 1.00 36.38 ? 450 HOH E O     1 
HETATM 8787 O O     . HOH M 3 .   ? -6.281  -2.549  2.121   1.00 25.47 ? 451 HOH E O     1 
HETATM 8788 O O     . HOH M 3 .   ? 3.874   -2.884  -1.618  1.00 23.20 ? 452 HOH E O     1 
HETATM 8789 O O     . HOH M 3 .   ? -3.719  -10.032 -22.155 1.00 34.04 ? 453 HOH E O     1 
HETATM 8790 O O     . HOH M 3 .   ? 16.113  -1.906  -2.853  1.00 31.33 ? 454 HOH E O     1 
HETATM 8791 O O     . HOH M 3 .   ? -3.296  9.089   -24.797 1.00 26.41 ? 455 HOH E O     1 
HETATM 8792 O O     . HOH M 3 .   ? -10.331 -2.922  -6.075  1.00 33.97 ? 456 HOH E O     1 
HETATM 8793 O O     . HOH M 3 .   ? 34.725  10.140  -5.738  1.00 25.37 ? 457 HOH E O     1 
HETATM 8794 O O     . HOH M 3 .   ? 16.599  4.522   -1.700  1.00 31.47 ? 458 HOH E O     1 
HETATM 8795 O O     . HOH M 3 .   ? -5.777  14.390  -14.682 1.00 32.71 ? 459 HOH E O     1 
HETATM 8796 O O     . HOH M 3 .   ? -3.723  0.094   -31.061 1.00 35.25 ? 460 HOH E O     1 
HETATM 8797 O O     . HOH M 3 .   ? -1.804  -5.053  -28.646 1.00 31.26 ? 461 HOH E O     1 
HETATM 8798 O O     . HOH M 3 .   ? 16.147  -9.124  -21.061 1.00 32.14 ? 462 HOH E O     1 
HETATM 8799 O O     . HOH M 3 .   ? -3.798  -16.129 -25.922 1.00 39.14 ? 463 HOH E O     1 
HETATM 8800 O O     . HOH M 3 .   ? 23.404  -8.400  -21.391 1.00 40.94 ? 464 HOH E O     1 
HETATM 8801 O O     . HOH M 3 .   ? 33.771  -4.296  -21.855 1.00 35.40 ? 465 HOH E O     1 
HETATM 8802 O O     . HOH M 3 .   ? -1.574  2.788   -0.749  1.00 33.86 ? 466 HOH E O     1 
HETATM 8803 O O     . HOH M 3 .   ? 19.773  -0.620  4.984   1.00 28.61 ? 467 HOH E O     1 
HETATM 8804 O O     . HOH M 3 .   ? 8.461   13.055  -10.209 1.00 28.21 ? 468 HOH E O     1 
HETATM 8805 O O     . HOH M 3 .   ? 19.968  7.048   -8.484  1.00 32.70 ? 469 HOH E O     1 
HETATM 8806 O O     . HOH M 3 .   ? 18.057  -11.378 -23.301 1.00 35.55 ? 470 HOH E O     1 
HETATM 8807 O O     . HOH M 3 .   ? 18.736  -18.758 -21.012 1.00 34.49 ? 471 HOH E O     1 
HETATM 8808 O O     . HOH M 3 .   ? 8.952   22.872  -13.250 1.00 33.16 ? 472 HOH E O     1 
HETATM 8809 O O     . HOH M 3 .   ? 9.314   -4.382  -7.358  1.00 41.37 ? 473 HOH E O     1 
HETATM 8810 O O     . HOH M 3 .   ? -9.956  4.578   -19.849 1.00 39.70 ? 474 HOH E O     1 
HETATM 8811 O O     . HOH M 3 .   ? 6.659   11.722  -11.418 1.00 30.75 ? 475 HOH E O     1 
HETATM 8812 O O     . HOH M 3 .   ? 29.407  -0.120  -23.079 1.00 48.59 ? 476 HOH E O     1 
HETATM 8813 O O     . HOH M 3 .   ? 1.208   7.507   -5.618  1.00 26.68 ? 477 HOH E O     1 
HETATM 8814 O O     . HOH M 3 .   ? 26.167  2.166   -23.375 1.00 40.49 ? 478 HOH E O     1 
HETATM 8815 O O     . HOH M 3 .   ? 39.141  0.963   -0.165  1.00 36.71 ? 479 HOH E O     1 
HETATM 8816 O O     . HOH M 3 .   ? -0.414  -19.787 -14.585 1.00 42.89 ? 480 HOH E O     1 
HETATM 8817 O O     . HOH M 3 .   ? 38.208  -5.811  -18.770 1.00 50.02 ? 481 HOH E O     1 
HETATM 8818 O O     . HOH M 3 .   ? 7.613   17.398  -14.306 1.00 35.31 ? 482 HOH E O     1 
HETATM 8819 O O     . HOH M 3 .   ? 0.765   -18.823 -27.764 1.00 43.29 ? 483 HOH E O     1 
HETATM 8820 O O     . HOH M 3 .   ? 40.214  8.897   -9.629  1.00 31.58 ? 484 HOH E O     1 
HETATM 8821 O O     . HOH M 3 .   ? -11.408 6.984   -9.036  1.00 30.65 ? 485 HOH E O     1 
HETATM 8822 O O     . HOH M 3 .   ? -2.030  9.987   -18.595 1.00 32.39 ? 486 HOH E O     1 
HETATM 8823 O O     . HOH M 3 .   ? 21.287  -15.677 -9.985  1.00 32.89 ? 487 HOH E O     1 
HETATM 8824 O O     . HOH M 3 .   ? -14.046 -3.482  -6.197  1.00 43.08 ? 488 HOH E O     1 
HETATM 8825 O O     . HOH M 3 .   ? 7.918   4.477   -27.066 1.00 27.02 ? 489 HOH E O     1 
HETATM 8826 O O     . HOH M 3 .   ? 18.236  4.417   -21.462 1.00 48.01 ? 490 HOH E O     1 
HETATM 8827 O O     . HOH M 3 .   ? 1.035   14.333  -19.575 1.00 36.33 ? 491 HOH E O     1 
HETATM 8828 O O     . HOH M 3 .   ? 27.380  -15.725 -8.842  1.00 32.76 ? 492 HOH E O     1 
HETATM 8829 O O     . HOH M 3 .   ? 10.936  -14.549 0.039   1.00 37.29 ? 493 HOH E O     1 
HETATM 8830 O O     . HOH M 3 .   ? -2.875  12.331  -17.444 1.00 30.36 ? 494 HOH E O     1 
HETATM 8831 O O     . HOH M 3 .   ? 33.950  15.632  -15.374 1.00 33.90 ? 495 HOH E O     1 
HETATM 8832 O O     . HOH M 3 .   ? 8.437   -15.118 -32.913 1.00 35.14 ? 496 HOH E O     1 
HETATM 8833 O O     . HOH M 3 .   ? 10.625  -0.876  -24.868 1.00 33.51 ? 497 HOH E O     1 
HETATM 8834 O O     . HOH M 3 .   ? 22.639  14.700  -19.250 1.00 44.69 ? 498 HOH E O     1 
HETATM 8835 O O     . HOH M 3 .   ? 34.285  9.339   1.344   1.00 41.52 ? 499 HOH E O     1 
HETATM 8836 O O     . HOH M 3 .   ? 37.153  8.764   -5.333  1.00 38.74 ? 500 HOH E O     1 
HETATM 8837 O O     . HOH M 3 .   ? 3.931   -3.732  -12.002 1.00 38.39 ? 501 HOH E O     1 
HETATM 8838 O O     . HOH M 3 .   ? 33.268  8.023   -21.391 1.00 34.28 ? 502 HOH E O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -2  ?   ?   ?   A . n 
A 1 2   SER 2   -1  ?   ?   ?   A . n 
A 1 3   HIS 3   0   ?   ?   ?   A . n 
A 1 4   MET 4   1   ?   ?   ?   A . n 
A 1 5   THR 5   2   ?   ?   ?   A . n 
A 1 6   LYS 6   3   3   LYS ALA A . n 
A 1 7   ILE 7   4   4   ILE ILE A . n 
A 1 8   THR 8   5   5   THR THR A . n 
A 1 9   LEU 9   6   6   LEU LEU A . n 
A 1 10  SER 10  7   7   SER SER A . n 
A 1 11  ASP 11  8   8   ASP ASP A . n 
A 1 12  LEU 12  9   9   LEU LEU A . n 
A 1 13  PRO 13  10  10  PRO PRO A . n 
A 1 14  LEU 14  11  11  LEU LEU A . n 
A 1 15  ARG 15  12  12  ARG ARG A . n 
A 1 16  GLU 16  13  13  GLU GLU A . n 
A 1 17  GLU 17  14  14  GLU GLU A . n 
A 1 18  LEU 18  15  15  LEU LEU A . n 
A 1 19  ARG 19  16  16  ARG ARG A . n 
A 1 20  GLY 20  17  17  GLY GLY A . n 
A 1 21  GLU 21  18  18  GLU GLU A . n 
A 1 22  HIS 22  19  19  HIS HIS A . n 
A 1 23  ALA 23  20  20  ALA ALA A . n 
A 1 24  TYR 24  21  21  TYR TYR A . n 
A 1 25  GLY 25  22  22  GLY GLY A . n 
A 1 26  ALA 26  23  23  ALA ALA A . n 
A 1 27  PRO 27  24  24  PRO PRO A . n 
A 1 28  GLN 28  25  25  GLN GLN A . n 
A 1 29  LEU 29  26  26  LEU LEU A . n 
A 1 30  ASN 30  27  27  ASN ASN A . n 
A 1 31  VAL 31  28  28  VAL VAL A . n 
A 1 32  ASP 32  29  29  ASP ASP A . n 
A 1 33  ILE 33  30  30  ILE ILE A . n 
A 1 34  ARG 34  31  31  ARG ARG A . n 
A 1 35  LEU 35  32  32  LEU LEU A . n 
A 1 36  ASN 36  33  33  ASN ASN A . n 
A 1 37  THR 37  34  34  THR THR A . n 
A 1 38  ASN 38  35  35  ASN ASN A . n 
A 1 39  GLU 39  36  36  GLU GLU A . n 
A 1 40  ASN 40  37  37  ASN ASN A . n 
A 1 41  PRO 41  38  38  PRO PRO A . n 
A 1 42  TYR 42  39  39  TYR TYR A . n 
A 1 43  PRO 43  40  40  PRO PRO A . n 
A 1 44  PRO 44  41  41  PRO PRO A . n 
A 1 45  SER 45  42  42  SER SER A . n 
A 1 46  GLU 46  43  43  GLU GLU A . n 
A 1 47  ALA 47  44  44  ALA ALA A . n 
A 1 48  LEU 48  45  45  LEU LEU A . n 
A 1 49  VAL 49  46  46  VAL VAL A . n 
A 1 50  ALA 50  47  47  ALA ALA A . n 
A 1 51  ASP 51  48  48  ASP ASP A . n 
A 1 52  LEU 52  49  49  LEU LEU A . n 
A 1 53  VAL 53  50  50  VAL VAL A . n 
A 1 54  ALA 54  51  51  ALA ALA A . n 
A 1 55  THR 55  52  52  THR THR A . n 
A 1 56  VAL 56  53  53  VAL VAL A . n 
A 1 57  ASP 57  54  54  ASP ASP A . n 
A 1 58  LYS 58  55  55  LYS LYS A . n 
A 1 59  ILE 59  56  56  ILE ILE A . n 
A 1 60  ALA 60  57  57  ALA ALA A . n 
A 1 61  THR 61  58  58  THR THR A . n 
A 1 62  GLU 62  59  59  GLU GLU A . n 
A 1 63  LEU 63  60  60  LEU LEU A . n 
A 1 64  ASN 64  61  61  ASN ASN A . n 
A 1 65  ARG 65  62  62  ARG ARG A . n 
A 1 66  TYR 66  63  63  TYR TYR A . n 
A 1 67  PRO 67  64  64  PRO PRO A . n 
A 1 68  GLU 68  65  65  GLU GLU A . n 
A 1 69  ARG 69  66  66  ARG ARG A . n 
A 1 70  ASP 70  67  67  ASP ASP A . n 
A 1 71  ALA 71  68  68  ALA ALA A . n 
A 1 72  VAL 72  69  69  VAL VAL A . n 
A 1 73  GLU 73  70  70  GLU GLU A . n 
A 1 74  LEU 74  71  71  LEU LEU A . n 
A 1 75  ARG 75  72  72  ARG ARG A . n 
A 1 76  ASP 76  73  73  ASP ASP A . n 
A 1 77  GLU 77  74  74  GLU GLU A . n 
A 1 78  LEU 78  75  75  LEU LEU A . n 
A 1 79  ALA 79  76  76  ALA ALA A . n 
A 1 80  ALA 80  77  77  ALA ALA A . n 
A 1 81  TYR 81  78  78  TYR TYR A . n 
A 1 82  ILE 82  79  79  ILE ILE A . n 
A 1 83  THR 83  80  80  THR THR A . n 
A 1 84  LYS 84  81  81  LYS LYS A . n 
A 1 85  GLN 85  82  82  GLN GLN A . n 
A 1 86  THR 86  83  83  THR THR A . n 
A 1 87  GLY 87  84  84  GLY GLY A . n 
A 1 88  VAL 88  85  85  VAL VAL A . n 
A 1 89  ALA 89  86  86  ALA ALA A . n 
A 1 90  VAL 90  87  87  VAL VAL A . n 
A 1 91  THR 91  88  88  THR THR A . n 
A 1 92  ARG 92  89  89  ARG ARG A . n 
A 1 93  ASP 93  90  90  ASP ASP A . n 
A 1 94  ASN 94  91  91  ASN ASN A . n 
A 1 95  LEU 95  92  92  LEU LEU A . n 
A 1 96  TRP 96  93  93  TRP TRP A . n 
A 1 97  ALA 97  94  94  ALA ALA A . n 
A 1 98  ALA 98  95  95  ALA ALA A . n 
A 1 99  ASN 99  96  96  ASN ASN A . n 
A 1 100 GLY 100 97  97  GLY GLY A . n 
A 1 101 SER 101 98  98  SER SER A . n 
A 1 102 ASN 102 99  99  ASN ASN A . n 
A 1 103 GLU 103 100 100 GLU GLU A . n 
A 1 104 ILE 104 101 101 ILE ILE A . n 
A 1 105 LEU 105 102 102 LEU LEU A . n 
A 1 106 GLN 106 103 103 GLN GLN A . n 
A 1 107 GLN 107 104 104 GLN GLN A . n 
A 1 108 LEU 108 105 105 LEU LEU A . n 
A 1 109 LEU 109 106 106 LEU LEU A . n 
A 1 110 GLN 110 107 107 GLN GLN A . n 
A 1 111 ALA 111 108 108 ALA ALA A . n 
A 1 112 PHE 112 109 109 PHE PHE A . n 
A 1 113 GLY 113 110 110 GLY GLY A . n 
A 1 114 GLY 114 111 111 GLY GLY A . n 
A 1 115 PRO 115 112 112 PRO PRO A . n 
A 1 116 GLY 116 113 113 GLY GLY A . n 
A 1 117 ARG 117 114 114 ARG ARG A . n 
A 1 118 THR 118 115 115 THR THR A . n 
A 1 119 ALA 119 116 116 ALA ALA A . n 
A 1 120 LEU 120 117 117 LEU LEU A . n 
A 1 121 GLY 121 118 118 GLY GLY A . n 
A 1 122 PHE 122 119 119 PHE PHE A . n 
A 1 123 GLN 123 120 120 GLN GLN A . n 
A 1 124 PRO 124 121 121 PRO PRO A . n 
A 1 125 SER 125 122 122 SER SER A . n 
A 1 126 TYR 126 123 123 TYR TYR A . n 
A 1 127 SER 127 124 124 SER SER A . n 
A 1 128 MET 128 125 125 MET MET A . n 
A 1 129 HIS 129 126 126 HIS HIS A . n 
A 1 130 PRO 130 127 127 PRO PRO A . n 
A 1 131 ILE 131 128 128 ILE ILE A . n 
A 1 132 LEU 132 129 129 LEU LEU A . n 
A 1 133 ALA 133 130 130 ALA ALA A . n 
A 1 134 LYS 134 131 131 LYS LYS A . n 
A 1 135 GLY 135 132 132 GLY GLY A . n 
A 1 136 THR 136 133 133 THR THR A . n 
A 1 137 HIS 137 134 134 HIS HIS A . n 
A 1 138 THR 138 135 135 THR THR A . n 
A 1 139 GLU 139 136 136 GLU GLU A . n 
A 1 140 PHE 140 137 137 PHE PHE A . n 
A 1 141 ILE 141 138 138 ILE ILE A . n 
A 1 142 ALA 142 139 139 ALA ALA A . n 
A 1 143 VAL 143 140 140 VAL VAL A . n 
A 1 144 SER 144 141 141 SER SER A . n 
A 1 145 ARG 145 142 142 ARG ARG A . n 
A 1 146 GLY 146 143 143 GLY GLY A . n 
A 1 147 ALA 147 144 144 ALA ALA A . n 
A 1 148 ASP 148 145 145 ASP ASP A . n 
A 1 149 PHE 149 146 146 PHE PHE A . n 
A 1 150 ARG 150 147 147 ARG ARG A . n 
A 1 151 ILE 151 148 148 ILE ILE A . n 
A 1 152 ASP 152 149 149 ASP ASP A . n 
A 1 153 MET 153 150 150 MET MET A . n 
A 1 154 ASP 154 151 151 ASP ASP A . n 
A 1 155 VAL 155 152 152 VAL VAL A . n 
A 1 156 ALA 156 153 153 ALA ALA A . n 
A 1 157 LEU 157 154 154 LEU LEU A . n 
A 1 158 GLU 158 155 155 GLU GLU A . n 
A 1 159 GLU 159 156 156 GLU GLU A . n 
A 1 160 ILE 160 157 157 ILE ILE A . n 
A 1 161 ARG 161 158 158 ARG ARG A . n 
A 1 162 ALA 162 159 159 ALA ALA A . n 
A 1 163 LYS 163 160 160 LYS LYS A . n 
A 1 164 GLN 164 161 161 GLN GLN A . n 
A 1 165 PRO 165 162 162 PRO PRO A . n 
A 1 166 ASP 166 163 163 ASP ASP A . n 
A 1 167 ILE 167 164 164 ILE ILE A . n 
A 1 168 VAL 168 165 165 VAL VAL A . n 
A 1 169 PHE 169 166 166 PHE PHE A . n 
A 1 170 VAL 170 167 167 VAL VAL A . n 
A 1 171 THR 171 168 168 THR THR A . n 
A 1 172 THR 172 169 169 THR THR A . n 
A 1 173 PRO 173 170 170 PRO PRO A . n 
A 1 174 ASN 174 171 171 ASN ASN A . n 
A 1 175 ASN 175 172 172 ASN ASN A . n 
A 1 176 PRO 176 173 173 PRO PRO A . n 
A 1 177 THR 177 174 174 THR THR A . n 
A 1 178 GLY 178 175 175 GLY GLY A . n 
A 1 179 ASP 179 176 176 ASP ASP A . n 
A 1 180 VAL 180 177 177 VAL VAL A . n 
A 1 181 THR 181 178 178 THR THR A . n 
A 1 182 SER 182 179 179 SER SER A . n 
A 1 183 LEU 183 180 180 LEU LEU A . n 
A 1 184 ASP 184 181 181 ASP ASP A . n 
A 1 185 ASP 185 182 182 ASP ASP A . n 
A 1 186 VAL 186 183 183 VAL VAL A . n 
A 1 187 GLU 187 184 184 GLU GLU A . n 
A 1 188 ARG 188 185 185 ARG ARG A . n 
A 1 189 ILE 189 186 186 ILE ILE A . n 
A 1 190 ILE 190 187 187 ILE ILE A . n 
A 1 191 ASN 191 188 188 ASN ASN A . n 
A 1 192 VAL 192 189 189 VAL VAL A . n 
A 1 193 ALA 193 190 190 ALA ALA A . n 
A 1 194 PRO 194 191 191 PRO PRO A . n 
A 1 195 GLY 195 192 192 GLY GLY A . n 
A 1 196 ILE 196 193 193 ILE ILE A . n 
A 1 197 VAL 197 194 194 VAL VAL A . n 
A 1 198 ILE 198 195 195 ILE ILE A . n 
A 1 199 VAL 199 196 196 VAL VAL A . n 
A 1 200 ASP 200 197 197 ASP ASP A . n 
A 1 201 GLU 201 198 198 GLU GLU A . n 
A 1 202 ALA 202 199 199 ALA ALA A . n 
A 1 203 TYR 203 200 200 TYR TYR A . n 
A 1 204 ALA 204 201 201 ALA ALA A . n 
A 1 205 GLU 205 202 202 GLU GLU A . n 
A 1 206 PHE 206 203 203 PHE PHE A . n 
A 1 207 SER 207 204 204 SER SER A . n 
A 1 208 PRO 208 205 205 PRO PRO A . n 
A 1 209 SER 209 206 206 SER SER A . n 
A 1 210 PRO 210 207 207 PRO PRO A . n 
A 1 211 SER 211 208 208 SER SER A . n 
A 1 212 ALA 212 209 209 ALA ALA A . n 
A 1 213 THR 213 210 210 THR THR A . n 
A 1 214 THR 214 211 211 THR THR A . n 
A 1 215 LEU 215 212 212 LEU LEU A . n 
A 1 216 LEU 216 213 213 LEU LEU A . n 
A 1 217 GLU 217 214 214 GLU GLU A . n 
A 1 218 LYS 218 215 215 LYS LYS A . n 
A 1 219 TYR 219 216 216 TYR TYR A . n 
A 1 220 PRO 220 217 217 PRO PRO A . n 
A 1 221 THR 221 218 218 THR THR A . n 
A 1 222 LYS 222 219 219 LYS LYS A . n 
A 1 223 LEU 223 220 220 LEU LEU A . n 
A 1 224 VAL 224 221 221 VAL VAL A . n 
A 1 225 VAL 225 222 222 VAL VAL A . n 
A 1 226 SER 226 223 223 SER SER A . n 
A 1 227 ARG 227 224 224 ARG ARG A . n 
A 1 228 THR 228 225 225 THR THR A . n 
A 1 229 MET 229 226 226 MET MET A . n 
A 1 230 SER 230 227 227 SER SER A . n 
A 1 231 LLP 231 228 228 LLP LLP A . n 
A 1 232 ALA 232 229 229 ALA ALA A . n 
A 1 233 PHE 233 230 230 PHE PHE A . n 
A 1 234 ASP 234 231 231 ASP ASP A . n 
A 1 235 PHE 235 232 232 PHE PHE A . n 
A 1 236 ALA 236 233 233 ALA ALA A . n 
A 1 237 GLY 237 234 234 GLY GLY A . n 
A 1 238 GLY 238 235 235 GLY GLY A . n 
A 1 239 ARG 239 236 236 ARG ARG A . n 
A 1 240 LEU 240 237 237 LEU LEU A . n 
A 1 241 GLY 241 238 238 GLY GLY A . n 
A 1 242 TYR 242 239 239 TYR TYR A . n 
A 1 243 PHE 243 240 240 PHE PHE A . n 
A 1 244 VAL 244 241 241 VAL VAL A . n 
A 1 245 ALA 245 242 242 ALA ALA A . n 
A 1 246 ASN 246 243 243 ASN ASN A . n 
A 1 247 PRO 247 244 244 PRO PRO A . n 
A 1 248 ALA 248 245 245 ALA ALA A . n 
A 1 249 PHE 249 246 246 PHE PHE A . n 
A 1 250 ILE 250 247 247 ILE ILE A . n 
A 1 251 ASP 251 248 248 ASP ASP A . n 
A 1 252 ALA 252 249 249 ALA ALA A . n 
A 1 253 VAL 253 250 250 VAL VAL A . n 
A 1 254 MET 254 251 251 MET MET A . n 
A 1 255 LEU 255 252 252 LEU LEU A . n 
A 1 256 VAL 256 253 253 VAL VAL A . n 
A 1 257 ARG 257 254 254 ARG ARG A . n 
A 1 258 LEU 258 255 255 LEU LEU A . n 
A 1 259 PRO 259 256 256 PRO PRO A . n 
A 1 260 TYR 260 257 257 TYR TYR A . n 
A 1 261 HIS 261 258 258 HIS HIS A . n 
A 1 262 LEU 262 259 259 LEU LEU A . n 
A 1 263 SER 263 260 260 SER SER A . n 
A 1 264 ALA 264 261 261 ALA ALA A . n 
A 1 265 LEU 265 262 262 LEU LEU A . n 
A 1 266 SER 266 263 263 SER SER A . n 
A 1 267 GLN 267 264 264 GLN GLN A . n 
A 1 268 ALA 268 265 265 ALA ALA A . n 
A 1 269 ALA 269 266 266 ALA ALA A . n 
A 1 270 ALA 270 267 267 ALA ALA A . n 
A 1 271 ILE 271 268 268 ILE ILE A . n 
A 1 272 VAL 272 269 269 VAL VAL A . n 
A 1 273 ALA 273 270 270 ALA ALA A . n 
A 1 274 LEU 274 271 271 LEU LEU A . n 
A 1 275 ARG 275 272 272 ARG ARG A . n 
A 1 276 HIS 276 273 273 HIS HIS A . n 
A 1 277 SER 277 274 274 SER SER A . n 
A 1 278 ALA 278 275 275 ALA ALA A . n 
A 1 279 ASP 279 276 276 ASP ASP A . n 
A 1 280 THR 280 277 277 THR THR A . n 
A 1 281 LEU 281 278 278 LEU LEU A . n 
A 1 282 GLY 282 279 279 GLY GLY A . n 
A 1 283 THR 283 280 280 THR THR A . n 
A 1 284 VAL 284 281 281 VAL VAL A . n 
A 1 285 GLU 285 282 282 GLU GLU A . n 
A 1 286 LYS 286 283 283 LYS LYS A . n 
A 1 287 LEU 287 284 284 LEU LEU A . n 
A 1 288 SER 288 285 285 SER SER A . n 
A 1 289 VAL 289 286 286 VAL VAL A . n 
A 1 290 GLU 290 287 287 GLU GLU A . n 
A 1 291 ARG 291 288 288 ARG ARG A . n 
A 1 292 VAL 292 289 289 VAL VAL A . n 
A 1 293 ARG 293 290 290 ARG ARG A . n 
A 1 294 VAL 294 291 291 VAL VAL A . n 
A 1 295 ALA 295 292 292 ALA ALA A . n 
A 1 296 ALA 296 293 293 ALA ALA A . n 
A 1 297 ARG 297 294 294 ARG ARG A . n 
A 1 298 LEU 298 295 295 LEU LEU A . n 
A 1 299 GLU 299 296 296 GLU GLU A . n 
A 1 300 GLU 300 297 297 GLU GLU A . n 
A 1 301 LEU 301 298 298 LEU LEU A . n 
A 1 302 GLY 302 299 299 GLY GLY A . n 
A 1 303 TYR 303 300 300 TYR TYR A . n 
A 1 304 ALA 304 301 301 ALA ALA A . n 
A 1 305 VAL 305 302 302 VAL VAL A . n 
A 1 306 VAL 306 303 303 VAL VAL A . n 
A 1 307 PRO 307 304 304 PRO PRO A . n 
A 1 308 SER 308 305 305 SER SER A . n 
A 1 309 GLU 309 306 306 GLU GLU A . n 
A 1 310 SER 310 307 307 SER SER A . n 
A 1 311 ASN 311 308 308 ASN ASN A . n 
A 1 312 PHE 312 309 309 PHE PHE A . n 
A 1 313 VAL 313 310 310 VAL VAL A . n 
A 1 314 PHE 314 311 311 PHE PHE A . n 
A 1 315 PHE 315 312 312 PHE PHE A . n 
A 1 316 GLY 316 313 313 GLY GLY A . n 
A 1 317 ASP 317 314 314 ASP ASP A . n 
A 1 318 PHE 318 315 315 PHE PHE A . n 
A 1 319 SER 319 316 316 SER SER A . n 
A 1 320 ASP 320 317 317 ASP ASP A . n 
A 1 321 GLN 321 318 318 GLN GLN A . n 
A 1 322 HIS 322 319 319 HIS HIS A . n 
A 1 323 ALA 323 320 320 ALA ALA A . n 
A 1 324 ALA 324 321 321 ALA ALA A . n 
A 1 325 TRP 325 322 322 TRP TRP A . n 
A 1 326 GLN 326 323 323 GLN GLN A . n 
A 1 327 ALA 327 324 324 ALA ALA A . n 
A 1 328 PHE 328 325 325 PHE PHE A . n 
A 1 329 LEU 329 326 326 LEU LEU A . n 
A 1 330 ASP 330 327 327 ASP ASP A . n 
A 1 331 ARG 331 328 328 ARG ARG A . n 
A 1 332 GLY 332 329 329 GLY GLY A . n 
A 1 333 VAL 333 330 330 VAL VAL A . n 
A 1 334 LEU 334 331 331 LEU LEU A . n 
A 1 335 ILE 335 332 332 ILE ILE A . n 
A 1 336 ARG 336 333 333 ARG ARG A . n 
A 1 337 ASP 337 334 334 ASP ASP A . n 
A 1 338 VAL 338 335 335 VAL VAL A . n 
A 1 339 GLY 339 336 336 GLY GLY A . n 
A 1 340 ILE 340 337 337 ILE ILE A . n 
A 1 341 ALA 341 338 338 ALA ALA A . n 
A 1 342 GLY 342 339 339 GLY GLY A . n 
A 1 343 HIS 343 340 340 HIS HIS A . n 
A 1 344 LEU 344 341 341 LEU LEU A . n 
A 1 345 ARG 345 342 342 ARG ARG A . n 
A 1 346 THR 346 343 343 THR THR A . n 
A 1 347 THR 347 344 344 THR THR A . n 
A 1 348 ILE 348 345 345 ILE ILE A . n 
A 1 349 GLY 349 346 346 GLY GLY A . n 
A 1 350 VAL 350 347 347 VAL VAL A . n 
A 1 351 PRO 351 348 348 PRO PRO A . n 
A 1 352 GLU 352 349 349 GLU GLU A . n 
A 1 353 GLU 353 350 350 GLU GLU A . n 
A 1 354 ASN 354 351 351 ASN ASN A . n 
A 1 355 ASP 355 352 352 ASP ASP A . n 
A 1 356 ALA 356 353 353 ALA ALA A . n 
A 1 357 PHE 357 354 354 PHE PHE A . n 
A 1 358 LEU 358 355 355 LEU LEU A . n 
A 1 359 ASP 359 356 356 ASP ASP A . n 
A 1 360 ALA 360 357 357 ALA ALA A . n 
A 1 361 ALA 361 358 358 ALA ALA A . n 
A 1 362 ALA 362 359 359 ALA ALA A . n 
A 1 363 GLU 363 360 360 GLU GLU A . n 
A 1 364 ILE 364 361 361 ILE ILE A . n 
A 1 365 ILE 365 362 362 ILE ILE A . n 
A 1 366 LYS 366 363 363 LYS LYS A . n 
A 1 367 LEU 367 364 364 LEU LEU A . n 
A 1 368 ASN 368 365 365 ASN ASN A . n 
A 1 369 LEU 369 366 366 LEU LEU A . n 
B 1 1   GLY 1   -2  ?   ?   ?   C . n 
B 1 2   SER 2   -1  ?   ?   ?   C . n 
B 1 3   HIS 3   0   ?   ?   ?   C . n 
B 1 4   MET 4   1   ?   ?   ?   C . n 
B 1 5   THR 5   2   ?   ?   ?   C . n 
B 1 6   LYS 6   3   3   LYS ALA C . n 
B 1 7   ILE 7   4   4   ILE ILE C . n 
B 1 8   THR 8   5   5   THR THR C . n 
B 1 9   LEU 9   6   6   LEU LEU C . n 
B 1 10  SER 10  7   7   SER SER C . n 
B 1 11  ASP 11  8   8   ASP ASP C . n 
B 1 12  LEU 12  9   9   LEU LEU C . n 
B 1 13  PRO 13  10  10  PRO PRO C . n 
B 1 14  LEU 14  11  11  LEU LEU C . n 
B 1 15  ARG 15  12  12  ARG ARG C . n 
B 1 16  GLU 16  13  13  GLU GLU C . n 
B 1 17  GLU 17  14  14  GLU GLU C . n 
B 1 18  LEU 18  15  15  LEU LEU C . n 
B 1 19  ARG 19  16  16  ARG ARG C . n 
B 1 20  GLY 20  17  17  GLY GLY C . n 
B 1 21  GLU 21  18  18  GLU GLU C . n 
B 1 22  HIS 22  19  19  HIS HIS C . n 
B 1 23  ALA 23  20  20  ALA ALA C . n 
B 1 24  TYR 24  21  21  TYR TYR C . n 
B 1 25  GLY 25  22  22  GLY GLY C . n 
B 1 26  ALA 26  23  23  ALA ALA C . n 
B 1 27  PRO 27  24  24  PRO PRO C . n 
B 1 28  GLN 28  25  25  GLN GLN C . n 
B 1 29  LEU 29  26  26  LEU LEU C . n 
B 1 30  ASN 30  27  27  ASN ASN C . n 
B 1 31  VAL 31  28  28  VAL VAL C . n 
B 1 32  ASP 32  29  29  ASP ASP C . n 
B 1 33  ILE 33  30  30  ILE ILE C . n 
B 1 34  ARG 34  31  31  ARG ARG C . n 
B 1 35  LEU 35  32  32  LEU LEU C . n 
B 1 36  ASN 36  33  33  ASN ASN C . n 
B 1 37  THR 37  34  34  THR THR C . n 
B 1 38  ASN 38  35  35  ASN ASN C . n 
B 1 39  GLU 39  36  36  GLU GLU C . n 
B 1 40  ASN 40  37  37  ASN ASN C . n 
B 1 41  PRO 41  38  38  PRO PRO C . n 
B 1 42  TYR 42  39  39  TYR TYR C . n 
B 1 43  PRO 43  40  40  PRO PRO C . n 
B 1 44  PRO 44  41  41  PRO PRO C . n 
B 1 45  SER 45  42  42  SER SER C . n 
B 1 46  GLU 46  43  43  GLU GLU C . n 
B 1 47  ALA 47  44  44  ALA ALA C . n 
B 1 48  LEU 48  45  45  LEU LEU C . n 
B 1 49  VAL 49  46  46  VAL VAL C . n 
B 1 50  ALA 50  47  47  ALA ALA C . n 
B 1 51  ASP 51  48  48  ASP ASP C . n 
B 1 52  LEU 52  49  49  LEU LEU C . n 
B 1 53  VAL 53  50  50  VAL VAL C . n 
B 1 54  ALA 54  51  51  ALA ALA C . n 
B 1 55  THR 55  52  52  THR THR C . n 
B 1 56  VAL 56  53  53  VAL VAL C . n 
B 1 57  ASP 57  54  54  ASP ASP C . n 
B 1 58  LYS 58  55  55  LYS LYS C . n 
B 1 59  ILE 59  56  56  ILE ILE C . n 
B 1 60  ALA 60  57  57  ALA ALA C . n 
B 1 61  THR 61  58  58  THR THR C . n 
B 1 62  GLU 62  59  59  GLU GLU C . n 
B 1 63  LEU 63  60  60  LEU LEU C . n 
B 1 64  ASN 64  61  61  ASN ASN C . n 
B 1 65  ARG 65  62  62  ARG ARG C . n 
B 1 66  TYR 66  63  63  TYR TYR C . n 
B 1 67  PRO 67  64  64  PRO PRO C . n 
B 1 68  GLU 68  65  65  GLU GLU C . n 
B 1 69  ARG 69  66  66  ARG ARG C . n 
B 1 70  ASP 70  67  67  ASP ASP C . n 
B 1 71  ALA 71  68  68  ALA ALA C . n 
B 1 72  VAL 72  69  69  VAL VAL C . n 
B 1 73  GLU 73  70  70  GLU GLU C . n 
B 1 74  LEU 74  71  71  LEU LEU C . n 
B 1 75  ARG 75  72  72  ARG ARG C . n 
B 1 76  ASP 76  73  73  ASP ASP C . n 
B 1 77  GLU 77  74  74  GLU GLU C . n 
B 1 78  LEU 78  75  75  LEU LEU C . n 
B 1 79  ALA 79  76  76  ALA ALA C . n 
B 1 80  ALA 80  77  77  ALA ALA C . n 
B 1 81  TYR 81  78  78  TYR TYR C . n 
B 1 82  ILE 82  79  79  ILE ILE C . n 
B 1 83  THR 83  80  80  THR THR C . n 
B 1 84  LYS 84  81  81  LYS LYS C . n 
B 1 85  GLN 85  82  82  GLN GLN C . n 
B 1 86  THR 86  83  83  THR THR C . n 
B 1 87  GLY 87  84  84  GLY GLY C . n 
B 1 88  VAL 88  85  85  VAL VAL C . n 
B 1 89  ALA 89  86  86  ALA ALA C . n 
B 1 90  VAL 90  87  87  VAL VAL C . n 
B 1 91  THR 91  88  88  THR THR C . n 
B 1 92  ARG 92  89  89  ARG ARG C . n 
B 1 93  ASP 93  90  90  ASP ASP C . n 
B 1 94  ASN 94  91  91  ASN ASN C . n 
B 1 95  LEU 95  92  92  LEU LEU C . n 
B 1 96  TRP 96  93  93  TRP TRP C . n 
B 1 97  ALA 97  94  94  ALA ALA C . n 
B 1 98  ALA 98  95  95  ALA ALA C . n 
B 1 99  ASN 99  96  96  ASN ASN C . n 
B 1 100 GLY 100 97  97  GLY GLY C . n 
B 1 101 SER 101 98  98  SER SER C . n 
B 1 102 ASN 102 99  99  ASN ASN C . n 
B 1 103 GLU 103 100 100 GLU GLU C . n 
B 1 104 ILE 104 101 101 ILE ILE C . n 
B 1 105 LEU 105 102 102 LEU LEU C . n 
B 1 106 GLN 106 103 103 GLN GLN C . n 
B 1 107 GLN 107 104 104 GLN GLN C . n 
B 1 108 LEU 108 105 105 LEU LEU C . n 
B 1 109 LEU 109 106 106 LEU LEU C . n 
B 1 110 GLN 110 107 107 GLN GLN C . n 
B 1 111 ALA 111 108 108 ALA ALA C . n 
B 1 112 PHE 112 109 109 PHE PHE C . n 
B 1 113 GLY 113 110 110 GLY GLY C . n 
B 1 114 GLY 114 111 111 GLY GLY C . n 
B 1 115 PRO 115 112 112 PRO PRO C . n 
B 1 116 GLY 116 113 113 GLY GLY C . n 
B 1 117 ARG 117 114 114 ARG ARG C . n 
B 1 118 THR 118 115 115 THR THR C . n 
B 1 119 ALA 119 116 116 ALA ALA C . n 
B 1 120 LEU 120 117 117 LEU LEU C . n 
B 1 121 GLY 121 118 118 GLY GLY C . n 
B 1 122 PHE 122 119 119 PHE PHE C . n 
B 1 123 GLN 123 120 120 GLN GLN C . n 
B 1 124 PRO 124 121 121 PRO PRO C . n 
B 1 125 SER 125 122 122 SER SER C . n 
B 1 126 TYR 126 123 123 TYR TYR C . n 
B 1 127 SER 127 124 124 SER SER C . n 
B 1 128 MET 128 125 125 MET MET C . n 
B 1 129 HIS 129 126 126 HIS HIS C . n 
B 1 130 PRO 130 127 127 PRO PRO C . n 
B 1 131 ILE 131 128 128 ILE ILE C . n 
B 1 132 LEU 132 129 129 LEU LEU C . n 
B 1 133 ALA 133 130 130 ALA ALA C . n 
B 1 134 LYS 134 131 131 LYS LYS C . n 
B 1 135 GLY 135 132 132 GLY GLY C . n 
B 1 136 THR 136 133 133 THR THR C . n 
B 1 137 HIS 137 134 134 HIS HIS C . n 
B 1 138 THR 138 135 135 THR THR C . n 
B 1 139 GLU 139 136 136 GLU GLU C . n 
B 1 140 PHE 140 137 137 PHE PHE C . n 
B 1 141 ILE 141 138 138 ILE ILE C . n 
B 1 142 ALA 142 139 139 ALA ALA C . n 
B 1 143 VAL 143 140 140 VAL VAL C . n 
B 1 144 SER 144 141 141 SER SER C . n 
B 1 145 ARG 145 142 142 ARG ARG C . n 
B 1 146 GLY 146 143 143 GLY GLY C . n 
B 1 147 ALA 147 144 144 ALA ALA C . n 
B 1 148 ASP 148 145 145 ASP ASP C . n 
B 1 149 PHE 149 146 146 PHE PHE C . n 
B 1 150 ARG 150 147 147 ARG ARG C . n 
B 1 151 ILE 151 148 148 ILE ILE C . n 
B 1 152 ASP 152 149 149 ASP ASP C . n 
B 1 153 MET 153 150 150 MET MET C . n 
B 1 154 ASP 154 151 151 ASP ASP C . n 
B 1 155 VAL 155 152 152 VAL VAL C . n 
B 1 156 ALA 156 153 153 ALA ALA C . n 
B 1 157 LEU 157 154 154 LEU LEU C . n 
B 1 158 GLU 158 155 155 GLU GLU C . n 
B 1 159 GLU 159 156 156 GLU GLU C . n 
B 1 160 ILE 160 157 157 ILE ILE C . n 
B 1 161 ARG 161 158 158 ARG ARG C . n 
B 1 162 ALA 162 159 159 ALA ALA C . n 
B 1 163 LYS 163 160 160 LYS LYS C . n 
B 1 164 GLN 164 161 161 GLN GLN C . n 
B 1 165 PRO 165 162 162 PRO PRO C . n 
B 1 166 ASP 166 163 163 ASP ASP C . n 
B 1 167 ILE 167 164 164 ILE ILE C . n 
B 1 168 VAL 168 165 165 VAL VAL C . n 
B 1 169 PHE 169 166 166 PHE PHE C . n 
B 1 170 VAL 170 167 167 VAL VAL C . n 
B 1 171 THR 171 168 168 THR THR C . n 
B 1 172 THR 172 169 169 THR THR C . n 
B 1 173 PRO 173 170 170 PRO PRO C . n 
B 1 174 ASN 174 171 171 ASN ASN C . n 
B 1 175 ASN 175 172 172 ASN ASN C . n 
B 1 176 PRO 176 173 173 PRO PRO C . n 
B 1 177 THR 177 174 174 THR THR C . n 
B 1 178 GLY 178 175 175 GLY GLY C . n 
B 1 179 ASP 179 176 176 ASP ASP C . n 
B 1 180 VAL 180 177 177 VAL VAL C . n 
B 1 181 THR 181 178 178 THR THR C . n 
B 1 182 SER 182 179 179 SER SER C . n 
B 1 183 LEU 183 180 180 LEU LEU C . n 
B 1 184 ASP 184 181 181 ASP ASP C . n 
B 1 185 ASP 185 182 182 ASP ASP C . n 
B 1 186 VAL 186 183 183 VAL VAL C . n 
B 1 187 GLU 187 184 184 GLU GLU C . n 
B 1 188 ARG 188 185 185 ARG ARG C . n 
B 1 189 ILE 189 186 186 ILE ILE C . n 
B 1 190 ILE 190 187 187 ILE ILE C . n 
B 1 191 ASN 191 188 188 ASN ASN C . n 
B 1 192 VAL 192 189 189 VAL VAL C . n 
B 1 193 ALA 193 190 190 ALA ALA C . n 
B 1 194 PRO 194 191 191 PRO PRO C . n 
B 1 195 GLY 195 192 192 GLY GLY C . n 
B 1 196 ILE 196 193 193 ILE ILE C . n 
B 1 197 VAL 197 194 194 VAL VAL C . n 
B 1 198 ILE 198 195 195 ILE ILE C . n 
B 1 199 VAL 199 196 196 VAL VAL C . n 
B 1 200 ASP 200 197 197 ASP ASP C . n 
B 1 201 GLU 201 198 198 GLU GLU C . n 
B 1 202 ALA 202 199 199 ALA ALA C . n 
B 1 203 TYR 203 200 200 TYR TYR C . n 
B 1 204 ALA 204 201 201 ALA ALA C . n 
B 1 205 GLU 205 202 202 GLU GLU C . n 
B 1 206 PHE 206 203 203 PHE PHE C . n 
B 1 207 SER 207 204 204 SER SER C . n 
B 1 208 PRO 208 205 205 PRO PRO C . n 
B 1 209 SER 209 206 206 SER SER C . n 
B 1 210 PRO 210 207 207 PRO PRO C . n 
B 1 211 SER 211 208 208 SER SER C . n 
B 1 212 ALA 212 209 209 ALA ALA C . n 
B 1 213 THR 213 210 210 THR THR C . n 
B 1 214 THR 214 211 211 THR THR C . n 
B 1 215 LEU 215 212 212 LEU LEU C . n 
B 1 216 LEU 216 213 213 LEU LEU C . n 
B 1 217 GLU 217 214 214 GLU GLU C . n 
B 1 218 LYS 218 215 215 LYS LYS C . n 
B 1 219 TYR 219 216 216 TYR TYR C . n 
B 1 220 PRO 220 217 217 PRO PRO C . n 
B 1 221 THR 221 218 218 THR THR C . n 
B 1 222 LYS 222 219 219 LYS LYS C . n 
B 1 223 LEU 223 220 220 LEU LEU C . n 
B 1 224 VAL 224 221 221 VAL VAL C . n 
B 1 225 VAL 225 222 222 VAL VAL C . n 
B 1 226 SER 226 223 223 SER SER C . n 
B 1 227 ARG 227 224 224 ARG ARG C . n 
B 1 228 THR 228 225 225 THR THR C . n 
B 1 229 MET 229 226 226 MET MET C . n 
B 1 230 SER 230 227 227 SER SER C . n 
B 1 231 LLP 231 228 228 LLP LLP C . n 
B 1 232 ALA 232 229 229 ALA ALA C . n 
B 1 233 PHE 233 230 230 PHE PHE C . n 
B 1 234 ASP 234 231 231 ASP ASP C . n 
B 1 235 PHE 235 232 232 PHE PHE C . n 
B 1 236 ALA 236 233 233 ALA ALA C . n 
B 1 237 GLY 237 234 234 GLY GLY C . n 
B 1 238 GLY 238 235 235 GLY GLY C . n 
B 1 239 ARG 239 236 236 ARG ARG C . n 
B 1 240 LEU 240 237 237 LEU LEU C . n 
B 1 241 GLY 241 238 238 GLY GLY C . n 
B 1 242 TYR 242 239 239 TYR TYR C . n 
B 1 243 PHE 243 240 240 PHE PHE C . n 
B 1 244 VAL 244 241 241 VAL VAL C . n 
B 1 245 ALA 245 242 242 ALA ALA C . n 
B 1 246 ASN 246 243 243 ASN ASN C . n 
B 1 247 PRO 247 244 244 PRO PRO C . n 
B 1 248 ALA 248 245 245 ALA ALA C . n 
B 1 249 PHE 249 246 246 PHE PHE C . n 
B 1 250 ILE 250 247 247 ILE ILE C . n 
B 1 251 ASP 251 248 248 ASP ASP C . n 
B 1 252 ALA 252 249 249 ALA ALA C . n 
B 1 253 VAL 253 250 250 VAL VAL C . n 
B 1 254 MET 254 251 251 MET MET C . n 
B 1 255 LEU 255 252 252 LEU LEU C . n 
B 1 256 VAL 256 253 253 VAL VAL C . n 
B 1 257 ARG 257 254 254 ARG ARG C . n 
B 1 258 LEU 258 255 255 LEU LEU C . n 
B 1 259 PRO 259 256 256 PRO PRO C . n 
B 1 260 TYR 260 257 257 TYR TYR C . n 
B 1 261 HIS 261 258 258 HIS HIS C . n 
B 1 262 LEU 262 259 259 LEU LEU C . n 
B 1 263 SER 263 260 260 SER SER C . n 
B 1 264 ALA 264 261 261 ALA ALA C . n 
B 1 265 LEU 265 262 262 LEU LEU C . n 
B 1 266 SER 266 263 263 SER SER C . n 
B 1 267 GLN 267 264 264 GLN GLN C . n 
B 1 268 ALA 268 265 265 ALA ALA C . n 
B 1 269 ALA 269 266 266 ALA ALA C . n 
B 1 270 ALA 270 267 267 ALA ALA C . n 
B 1 271 ILE 271 268 268 ILE ILE C . n 
B 1 272 VAL 272 269 269 VAL VAL C . n 
B 1 273 ALA 273 270 270 ALA ALA C . n 
B 1 274 LEU 274 271 271 LEU LEU C . n 
B 1 275 ARG 275 272 272 ARG ARG C . n 
B 1 276 HIS 276 273 273 HIS HIS C . n 
B 1 277 SER 277 274 274 SER SER C . n 
B 1 278 ALA 278 275 275 ALA ALA C . n 
B 1 279 ASP 279 276 276 ASP ASP C . n 
B 1 280 THR 280 277 277 THR THR C . n 
B 1 281 LEU 281 278 278 LEU LEU C . n 
B 1 282 GLY 282 279 279 GLY GLY C . n 
B 1 283 THR 283 280 280 THR THR C . n 
B 1 284 VAL 284 281 281 VAL VAL C . n 
B 1 285 GLU 285 282 282 GLU GLU C . n 
B 1 286 LYS 286 283 283 LYS LYS C . n 
B 1 287 LEU 287 284 284 LEU LEU C . n 
B 1 288 SER 288 285 285 SER SER C . n 
B 1 289 VAL 289 286 286 VAL VAL C . n 
B 1 290 GLU 290 287 287 GLU GLU C . n 
B 1 291 ARG 291 288 288 ARG ARG C . n 
B 1 292 VAL 292 289 289 VAL VAL C . n 
B 1 293 ARG 293 290 290 ARG ARG C . n 
B 1 294 VAL 294 291 291 VAL VAL C . n 
B 1 295 ALA 295 292 292 ALA ALA C . n 
B 1 296 ALA 296 293 293 ALA ALA C . n 
B 1 297 ARG 297 294 294 ARG ARG C . n 
B 1 298 LEU 298 295 295 LEU LEU C . n 
B 1 299 GLU 299 296 296 GLU GLU C . n 
B 1 300 GLU 300 297 297 GLU GLU C . n 
B 1 301 LEU 301 298 298 LEU LEU C . n 
B 1 302 GLY 302 299 299 GLY GLY C . n 
B 1 303 TYR 303 300 300 TYR TYR C . n 
B 1 304 ALA 304 301 301 ALA ALA C . n 
B 1 305 VAL 305 302 302 VAL VAL C . n 
B 1 306 VAL 306 303 303 VAL VAL C . n 
B 1 307 PRO 307 304 304 PRO PRO C . n 
B 1 308 SER 308 305 305 SER SER C . n 
B 1 309 GLU 309 306 306 GLU GLU C . n 
B 1 310 SER 310 307 307 SER SER C . n 
B 1 311 ASN 311 308 308 ASN ASN C . n 
B 1 312 PHE 312 309 309 PHE PHE C . n 
B 1 313 VAL 313 310 310 VAL VAL C . n 
B 1 314 PHE 314 311 311 PHE PHE C . n 
B 1 315 PHE 315 312 312 PHE PHE C . n 
B 1 316 GLY 316 313 313 GLY GLY C . n 
B 1 317 ASP 317 314 314 ASP ASP C . n 
B 1 318 PHE 318 315 315 PHE PHE C . n 
B 1 319 SER 319 316 316 SER SER C . n 
B 1 320 ASP 320 317 317 ASP ASP C . n 
B 1 321 GLN 321 318 318 GLN GLN C . n 
B 1 322 HIS 322 319 319 HIS HIS C . n 
B 1 323 ALA 323 320 320 ALA ALA C . n 
B 1 324 ALA 324 321 321 ALA ALA C . n 
B 1 325 TRP 325 322 322 TRP TRP C . n 
B 1 326 GLN 326 323 323 GLN GLN C . n 
B 1 327 ALA 327 324 324 ALA ALA C . n 
B 1 328 PHE 328 325 325 PHE PHE C . n 
B 1 329 LEU 329 326 326 LEU LEU C . n 
B 1 330 ASP 330 327 327 ASP ASP C . n 
B 1 331 ARG 331 328 328 ARG ARG C . n 
B 1 332 GLY 332 329 329 GLY GLY C . n 
B 1 333 VAL 333 330 330 VAL VAL C . n 
B 1 334 LEU 334 331 331 LEU LEU C . n 
B 1 335 ILE 335 332 332 ILE ILE C . n 
B 1 336 ARG 336 333 333 ARG ARG C . n 
B 1 337 ASP 337 334 334 ASP ASP C . n 
B 1 338 VAL 338 335 335 VAL VAL C . n 
B 1 339 GLY 339 336 336 GLY GLY C . n 
B 1 340 ILE 340 337 337 ILE ILE C . n 
B 1 341 ALA 341 338 338 ALA ALA C . n 
B 1 342 GLY 342 339 339 GLY GLY C . n 
B 1 343 HIS 343 340 340 HIS HIS C . n 
B 1 344 LEU 344 341 341 LEU LEU C . n 
B 1 345 ARG 345 342 342 ARG ARG C . n 
B 1 346 THR 346 343 343 THR THR C . n 
B 1 347 THR 347 344 344 THR THR C . n 
B 1 348 ILE 348 345 345 ILE ILE C . n 
B 1 349 GLY 349 346 346 GLY GLY C . n 
B 1 350 VAL 350 347 347 VAL VAL C . n 
B 1 351 PRO 351 348 348 PRO PRO C . n 
B 1 352 GLU 352 349 349 GLU GLU C . n 
B 1 353 GLU 353 350 350 GLU GLU C . n 
B 1 354 ASN 354 351 351 ASN ASN C . n 
B 1 355 ASP 355 352 352 ASP ASP C . n 
B 1 356 ALA 356 353 353 ALA ALA C . n 
B 1 357 PHE 357 354 354 PHE PHE C . n 
B 1 358 LEU 358 355 355 LEU LEU C . n 
B 1 359 ASP 359 356 356 ASP ASP C . n 
B 1 360 ALA 360 357 357 ALA ALA C . n 
B 1 361 ALA 361 358 358 ALA ALA C . n 
B 1 362 ALA 362 359 359 ALA ALA C . n 
B 1 363 GLU 363 360 360 GLU GLU C . n 
B 1 364 ILE 364 361 361 ILE ILE C . n 
B 1 365 ILE 365 362 362 ILE ILE C . n 
B 1 366 LYS 366 363 363 LYS LYS C . n 
B 1 367 LEU 367 364 364 LEU LEU C . n 
B 1 368 ASN 368 365 365 ASN ASN C . n 
B 1 369 LEU 369 366 366 LEU LEU C . n 
C 1 1   GLY 1   -2  ?   ?   ?   E . n 
C 1 2   SER 2   -1  ?   ?   ?   E . n 
C 1 3   HIS 3   0   ?   ?   ?   E . n 
C 1 4   MET 4   1   ?   ?   ?   E . n 
C 1 5   THR 5   2   ?   ?   ?   E . n 
C 1 6   LYS 6   3   3   LYS ALA E . n 
C 1 7   ILE 7   4   4   ILE ILE E . n 
C 1 8   THR 8   5   5   THR THR E . n 
C 1 9   LEU 9   6   6   LEU LEU E . n 
C 1 10  SER 10  7   7   SER SER E . n 
C 1 11  ASP 11  8   8   ASP ASP E . n 
C 1 12  LEU 12  9   9   LEU LEU E . n 
C 1 13  PRO 13  10  10  PRO PRO E . n 
C 1 14  LEU 14  11  11  LEU LEU E . n 
C 1 15  ARG 15  12  12  ARG ARG E . n 
C 1 16  GLU 16  13  13  GLU GLU E . n 
C 1 17  GLU 17  14  14  GLU GLU E . n 
C 1 18  LEU 18  15  15  LEU LEU E . n 
C 1 19  ARG 19  16  16  ARG ARG E . n 
C 1 20  GLY 20  17  17  GLY GLY E . n 
C 1 21  GLU 21  18  18  GLU GLU E . n 
C 1 22  HIS 22  19  19  HIS HIS E . n 
C 1 23  ALA 23  20  20  ALA ALA E . n 
C 1 24  TYR 24  21  21  TYR TYR E . n 
C 1 25  GLY 25  22  22  GLY GLY E . n 
C 1 26  ALA 26  23  23  ALA ALA E . n 
C 1 27  PRO 27  24  24  PRO PRO E . n 
C 1 28  GLN 28  25  25  GLN GLN E . n 
C 1 29  LEU 29  26  26  LEU LEU E . n 
C 1 30  ASN 30  27  27  ASN ASN E . n 
C 1 31  VAL 31  28  28  VAL VAL E . n 
C 1 32  ASP 32  29  29  ASP ASP E . n 
C 1 33  ILE 33  30  30  ILE ILE E . n 
C 1 34  ARG 34  31  31  ARG ARG E . n 
C 1 35  LEU 35  32  32  LEU LEU E . n 
C 1 36  ASN 36  33  33  ASN ASN E . n 
C 1 37  THR 37  34  34  THR THR E . n 
C 1 38  ASN 38  35  35  ASN ASN E . n 
C 1 39  GLU 39  36  36  GLU GLU E . n 
C 1 40  ASN 40  37  37  ASN ASN E . n 
C 1 41  PRO 41  38  38  PRO PRO E . n 
C 1 42  TYR 42  39  39  TYR TYR E . n 
C 1 43  PRO 43  40  40  PRO PRO E . n 
C 1 44  PRO 44  41  41  PRO PRO E . n 
C 1 45  SER 45  42  42  SER SER E . n 
C 1 46  GLU 46  43  43  GLU GLU E . n 
C 1 47  ALA 47  44  44  ALA ALA E . n 
C 1 48  LEU 48  45  45  LEU LEU E . n 
C 1 49  VAL 49  46  46  VAL VAL E . n 
C 1 50  ALA 50  47  47  ALA ALA E . n 
C 1 51  ASP 51  48  48  ASP ASP E . n 
C 1 52  LEU 52  49  49  LEU LEU E . n 
C 1 53  VAL 53  50  50  VAL VAL E . n 
C 1 54  ALA 54  51  51  ALA ALA E . n 
C 1 55  THR 55  52  52  THR THR E . n 
C 1 56  VAL 56  53  53  VAL VAL E . n 
C 1 57  ASP 57  54  54  ASP ASP E . n 
C 1 58  LYS 58  55  55  LYS LYS E . n 
C 1 59  ILE 59  56  56  ILE ILE E . n 
C 1 60  ALA 60  57  57  ALA ALA E . n 
C 1 61  THR 61  58  58  THR THR E . n 
C 1 62  GLU 62  59  59  GLU GLU E . n 
C 1 63  LEU 63  60  60  LEU LEU E . n 
C 1 64  ASN 64  61  61  ASN ASN E . n 
C 1 65  ARG 65  62  62  ARG ARG E . n 
C 1 66  TYR 66  63  63  TYR TYR E . n 
C 1 67  PRO 67  64  64  PRO PRO E . n 
C 1 68  GLU 68  65  65  GLU GLU E . n 
C 1 69  ARG 69  66  66  ARG ARG E . n 
C 1 70  ASP 70  67  67  ASP ASP E . n 
C 1 71  ALA 71  68  68  ALA ALA E . n 
C 1 72  VAL 72  69  69  VAL VAL E . n 
C 1 73  GLU 73  70  70  GLU GLU E . n 
C 1 74  LEU 74  71  71  LEU LEU E . n 
C 1 75  ARG 75  72  72  ARG ARG E . n 
C 1 76  ASP 76  73  73  ASP ASP E . n 
C 1 77  GLU 77  74  74  GLU GLU E . n 
C 1 78  LEU 78  75  75  LEU LEU E . n 
C 1 79  ALA 79  76  76  ALA ALA E . n 
C 1 80  ALA 80  77  77  ALA ALA E . n 
C 1 81  TYR 81  78  78  TYR TYR E . n 
C 1 82  ILE 82  79  79  ILE ILE E . n 
C 1 83  THR 83  80  80  THR THR E . n 
C 1 84  LYS 84  81  81  LYS LYS E . n 
C 1 85  GLN 85  82  82  GLN GLN E . n 
C 1 86  THR 86  83  83  THR THR E . n 
C 1 87  GLY 87  84  84  GLY GLY E . n 
C 1 88  VAL 88  85  85  VAL VAL E . n 
C 1 89  ALA 89  86  86  ALA ALA E . n 
C 1 90  VAL 90  87  87  VAL VAL E . n 
C 1 91  THR 91  88  88  THR THR E . n 
C 1 92  ARG 92  89  89  ARG ARG E . n 
C 1 93  ASP 93  90  90  ASP ASP E . n 
C 1 94  ASN 94  91  91  ASN ASN E . n 
C 1 95  LEU 95  92  92  LEU LEU E . n 
C 1 96  TRP 96  93  93  TRP TRP E . n 
C 1 97  ALA 97  94  94  ALA ALA E . n 
C 1 98  ALA 98  95  95  ALA ALA E . n 
C 1 99  ASN 99  96  96  ASN ASN E . n 
C 1 100 GLY 100 97  97  GLY GLY E . n 
C 1 101 SER 101 98  98  SER SER E . n 
C 1 102 ASN 102 99  99  ASN ASN E . n 
C 1 103 GLU 103 100 100 GLU GLU E . n 
C 1 104 ILE 104 101 101 ILE ILE E . n 
C 1 105 LEU 105 102 102 LEU LEU E . n 
C 1 106 GLN 106 103 103 GLN GLN E . n 
C 1 107 GLN 107 104 104 GLN GLN E . n 
C 1 108 LEU 108 105 105 LEU LEU E . n 
C 1 109 LEU 109 106 106 LEU LEU E . n 
C 1 110 GLN 110 107 107 GLN GLN E . n 
C 1 111 ALA 111 108 108 ALA ALA E . n 
C 1 112 PHE 112 109 109 PHE PHE E . n 
C 1 113 GLY 113 110 110 GLY GLY E . n 
C 1 114 GLY 114 111 111 GLY GLY E . n 
C 1 115 PRO 115 112 112 PRO PRO E . n 
C 1 116 GLY 116 113 113 GLY GLY E . n 
C 1 117 ARG 117 114 114 ARG ARG E . n 
C 1 118 THR 118 115 115 THR THR E . n 
C 1 119 ALA 119 116 116 ALA ALA E . n 
C 1 120 LEU 120 117 117 LEU LEU E . n 
C 1 121 GLY 121 118 118 GLY GLY E . n 
C 1 122 PHE 122 119 119 PHE PHE E . n 
C 1 123 GLN 123 120 120 GLN GLN E . n 
C 1 124 PRO 124 121 121 PRO PRO E . n 
C 1 125 SER 125 122 122 SER SER E . n 
C 1 126 TYR 126 123 123 TYR TYR E . n 
C 1 127 SER 127 124 124 SER SER E . n 
C 1 128 MET 128 125 125 MET MET E . n 
C 1 129 HIS 129 126 126 HIS HIS E . n 
C 1 130 PRO 130 127 127 PRO PRO E . n 
C 1 131 ILE 131 128 128 ILE ILE E . n 
C 1 132 LEU 132 129 129 LEU LEU E . n 
C 1 133 ALA 133 130 130 ALA ALA E . n 
C 1 134 LYS 134 131 131 LYS LYS E . n 
C 1 135 GLY 135 132 132 GLY GLY E . n 
C 1 136 THR 136 133 133 THR THR E . n 
C 1 137 HIS 137 134 134 HIS HIS E . n 
C 1 138 THR 138 135 135 THR THR E . n 
C 1 139 GLU 139 136 136 GLU GLU E . n 
C 1 140 PHE 140 137 137 PHE PHE E . n 
C 1 141 ILE 141 138 138 ILE ILE E . n 
C 1 142 ALA 142 139 139 ALA ALA E . n 
C 1 143 VAL 143 140 140 VAL VAL E . n 
C 1 144 SER 144 141 141 SER SER E . n 
C 1 145 ARG 145 142 142 ARG ARG E . n 
C 1 146 GLY 146 143 143 GLY GLY E . n 
C 1 147 ALA 147 144 144 ALA ALA E . n 
C 1 148 ASP 148 145 145 ASP ASP E . n 
C 1 149 PHE 149 146 146 PHE PHE E . n 
C 1 150 ARG 150 147 147 ARG ARG E . n 
C 1 151 ILE 151 148 148 ILE ILE E . n 
C 1 152 ASP 152 149 149 ASP ASP E . n 
C 1 153 MET 153 150 150 MET MET E . n 
C 1 154 ASP 154 151 151 ASP ASP E . n 
C 1 155 VAL 155 152 152 VAL VAL E . n 
C 1 156 ALA 156 153 153 ALA ALA E . n 
C 1 157 LEU 157 154 154 LEU LEU E . n 
C 1 158 GLU 158 155 155 GLU GLU E . n 
C 1 159 GLU 159 156 156 GLU GLU E . n 
C 1 160 ILE 160 157 157 ILE ILE E . n 
C 1 161 ARG 161 158 158 ARG ARG E . n 
C 1 162 ALA 162 159 159 ALA ALA E . n 
C 1 163 LYS 163 160 160 LYS LYS E . n 
C 1 164 GLN 164 161 161 GLN GLN E . n 
C 1 165 PRO 165 162 162 PRO PRO E . n 
C 1 166 ASP 166 163 163 ASP ASP E . n 
C 1 167 ILE 167 164 164 ILE ILE E . n 
C 1 168 VAL 168 165 165 VAL VAL E . n 
C 1 169 PHE 169 166 166 PHE PHE E . n 
C 1 170 VAL 170 167 167 VAL VAL E . n 
C 1 171 THR 171 168 168 THR THR E . n 
C 1 172 THR 172 169 169 THR THR E . n 
C 1 173 PRO 173 170 170 PRO PRO E . n 
C 1 174 ASN 174 171 171 ASN ASN E . n 
C 1 175 ASN 175 172 172 ASN ASN E . n 
C 1 176 PRO 176 173 173 PRO PRO E . n 
C 1 177 THR 177 174 174 THR THR E . n 
C 1 178 GLY 178 175 175 GLY GLY E . n 
C 1 179 ASP 179 176 176 ASP ASP E . n 
C 1 180 VAL 180 177 177 VAL VAL E . n 
C 1 181 THR 181 178 178 THR THR E . n 
C 1 182 SER 182 179 179 SER SER E . n 
C 1 183 LEU 183 180 180 LEU LEU E . n 
C 1 184 ASP 184 181 181 ASP ASP E . n 
C 1 185 ASP 185 182 182 ASP ASP E . n 
C 1 186 VAL 186 183 183 VAL VAL E . n 
C 1 187 GLU 187 184 184 GLU GLU E . n 
C 1 188 ARG 188 185 185 ARG ARG E . n 
C 1 189 ILE 189 186 186 ILE ILE E . n 
C 1 190 ILE 190 187 187 ILE ILE E . n 
C 1 191 ASN 191 188 188 ASN ASN E . n 
C 1 192 VAL 192 189 189 VAL VAL E . n 
C 1 193 ALA 193 190 190 ALA ALA E . n 
C 1 194 PRO 194 191 191 PRO PRO E . n 
C 1 195 GLY 195 192 192 GLY GLY E . n 
C 1 196 ILE 196 193 193 ILE ILE E . n 
C 1 197 VAL 197 194 194 VAL VAL E . n 
C 1 198 ILE 198 195 195 ILE ILE E . n 
C 1 199 VAL 199 196 196 VAL VAL E . n 
C 1 200 ASP 200 197 197 ASP ASP E . n 
C 1 201 GLU 201 198 198 GLU GLU E . n 
C 1 202 ALA 202 199 199 ALA ALA E . n 
C 1 203 TYR 203 200 200 TYR TYR E . n 
C 1 204 ALA 204 201 201 ALA ALA E . n 
C 1 205 GLU 205 202 202 GLU GLU E . n 
C 1 206 PHE 206 203 203 PHE PHE E . n 
C 1 207 SER 207 204 204 SER SER E . n 
C 1 208 PRO 208 205 205 PRO PRO E . n 
C 1 209 SER 209 206 206 SER SER E . n 
C 1 210 PRO 210 207 207 PRO PRO E . n 
C 1 211 SER 211 208 208 SER SER E . n 
C 1 212 ALA 212 209 209 ALA ALA E . n 
C 1 213 THR 213 210 210 THR THR E . n 
C 1 214 THR 214 211 211 THR THR E . n 
C 1 215 LEU 215 212 212 LEU LEU E . n 
C 1 216 LEU 216 213 213 LEU LEU E . n 
C 1 217 GLU 217 214 214 GLU GLU E . n 
C 1 218 LYS 218 215 215 LYS LYS E . n 
C 1 219 TYR 219 216 216 TYR TYR E . n 
C 1 220 PRO 220 217 217 PRO PRO E . n 
C 1 221 THR 221 218 218 THR THR E . n 
C 1 222 LYS 222 219 219 LYS LYS E . n 
C 1 223 LEU 223 220 220 LEU LEU E . n 
C 1 224 VAL 224 221 221 VAL VAL E . n 
C 1 225 VAL 225 222 222 VAL VAL E . n 
C 1 226 SER 226 223 223 SER SER E . n 
C 1 227 ARG 227 224 224 ARG ARG E . n 
C 1 228 THR 228 225 225 THR THR E . n 
C 1 229 MET 229 226 226 MET MET E . n 
C 1 230 SER 230 227 227 SER SER E . n 
C 1 231 LLP 231 228 228 LLP LLP E . n 
C 1 232 ALA 232 229 229 ALA ALA E . n 
C 1 233 PHE 233 230 230 PHE PHE E . n 
C 1 234 ASP 234 231 231 ASP ASP E . n 
C 1 235 PHE 235 232 232 PHE PHE E . n 
C 1 236 ALA 236 233 233 ALA ALA E . n 
C 1 237 GLY 237 234 234 GLY GLY E . n 
C 1 238 GLY 238 235 235 GLY GLY E . n 
C 1 239 ARG 239 236 236 ARG ARG E . n 
C 1 240 LEU 240 237 237 LEU LEU E . n 
C 1 241 GLY 241 238 238 GLY GLY E . n 
C 1 242 TYR 242 239 239 TYR TYR E . n 
C 1 243 PHE 243 240 240 PHE PHE E . n 
C 1 244 VAL 244 241 241 VAL VAL E . n 
C 1 245 ALA 245 242 242 ALA ALA E . n 
C 1 246 ASN 246 243 243 ASN ASN E . n 
C 1 247 PRO 247 244 244 PRO PRO E . n 
C 1 248 ALA 248 245 245 ALA ALA E . n 
C 1 249 PHE 249 246 246 PHE PHE E . n 
C 1 250 ILE 250 247 247 ILE ILE E . n 
C 1 251 ASP 251 248 248 ASP ASP E . n 
C 1 252 ALA 252 249 249 ALA ALA E . n 
C 1 253 VAL 253 250 250 VAL VAL E . n 
C 1 254 MET 254 251 251 MET MET E . n 
C 1 255 LEU 255 252 252 LEU LEU E . n 
C 1 256 VAL 256 253 253 VAL VAL E . n 
C 1 257 ARG 257 254 254 ARG ARG E . n 
C 1 258 LEU 258 255 255 LEU LEU E . n 
C 1 259 PRO 259 256 256 PRO PRO E . n 
C 1 260 TYR 260 257 257 TYR TYR E . n 
C 1 261 HIS 261 258 258 HIS HIS E . n 
C 1 262 LEU 262 259 259 LEU LEU E . n 
C 1 263 SER 263 260 260 SER SER E . n 
C 1 264 ALA 264 261 261 ALA ALA E . n 
C 1 265 LEU 265 262 262 LEU LEU E . n 
C 1 266 SER 266 263 263 SER SER E . n 
C 1 267 GLN 267 264 264 GLN GLN E . n 
C 1 268 ALA 268 265 265 ALA ALA E . n 
C 1 269 ALA 269 266 266 ALA ALA E . n 
C 1 270 ALA 270 267 267 ALA ALA E . n 
C 1 271 ILE 271 268 268 ILE ILE E . n 
C 1 272 VAL 272 269 269 VAL VAL E . n 
C 1 273 ALA 273 270 270 ALA ALA E . n 
C 1 274 LEU 274 271 271 LEU LEU E . n 
C 1 275 ARG 275 272 272 ARG ARG E . n 
C 1 276 HIS 276 273 273 HIS HIS E . n 
C 1 277 SER 277 274 274 SER SER E . n 
C 1 278 ALA 278 275 275 ALA ALA E . n 
C 1 279 ASP 279 276 276 ASP ASP E . n 
C 1 280 THR 280 277 277 THR THR E . n 
C 1 281 LEU 281 278 278 LEU LEU E . n 
C 1 282 GLY 282 279 279 GLY GLY E . n 
C 1 283 THR 283 280 280 THR THR E . n 
C 1 284 VAL 284 281 281 VAL VAL E . n 
C 1 285 GLU 285 282 282 GLU GLU E . n 
C 1 286 LYS 286 283 283 LYS LYS E . n 
C 1 287 LEU 287 284 284 LEU LEU E . n 
C 1 288 SER 288 285 285 SER SER E . n 
C 1 289 VAL 289 286 286 VAL VAL E . n 
C 1 290 GLU 290 287 287 GLU GLU E . n 
C 1 291 ARG 291 288 288 ARG ARG E . n 
C 1 292 VAL 292 289 289 VAL VAL E . n 
C 1 293 ARG 293 290 290 ARG ARG E . n 
C 1 294 VAL 294 291 291 VAL VAL E . n 
C 1 295 ALA 295 292 292 ALA ALA E . n 
C 1 296 ALA 296 293 293 ALA ALA E . n 
C 1 297 ARG 297 294 294 ARG ARG E . n 
C 1 298 LEU 298 295 295 LEU LEU E . n 
C 1 299 GLU 299 296 296 GLU GLU E . n 
C 1 300 GLU 300 297 297 GLU GLU E . n 
C 1 301 LEU 301 298 298 LEU LEU E . n 
C 1 302 GLY 302 299 299 GLY GLY E . n 
C 1 303 TYR 303 300 300 TYR TYR E . n 
C 1 304 ALA 304 301 301 ALA ALA E . n 
C 1 305 VAL 305 302 302 VAL VAL E . n 
C 1 306 VAL 306 303 303 VAL VAL E . n 
C 1 307 PRO 307 304 304 PRO PRO E . n 
C 1 308 SER 308 305 305 SER SER E . n 
C 1 309 GLU 309 306 306 GLU GLU E . n 
C 1 310 SER 310 307 307 SER SER E . n 
C 1 311 ASN 311 308 308 ASN ASN E . n 
C 1 312 PHE 312 309 309 PHE PHE E . n 
C 1 313 VAL 313 310 310 VAL VAL E . n 
C 1 314 PHE 314 311 311 PHE PHE E . n 
C 1 315 PHE 315 312 312 PHE PHE E . n 
C 1 316 GLY 316 313 313 GLY GLY E . n 
C 1 317 ASP 317 314 314 ASP ASP E . n 
C 1 318 PHE 318 315 315 PHE PHE E . n 
C 1 319 SER 319 316 316 SER SER E . n 
C 1 320 ASP 320 317 317 ASP ASP E . n 
C 1 321 GLN 321 318 318 GLN GLN E . n 
C 1 322 HIS 322 319 319 HIS HIS E . n 
C 1 323 ALA 323 320 320 ALA ALA E . n 
C 1 324 ALA 324 321 321 ALA ALA E . n 
C 1 325 TRP 325 322 322 TRP TRP E . n 
C 1 326 GLN 326 323 323 GLN GLN E . n 
C 1 327 ALA 327 324 324 ALA ALA E . n 
C 1 328 PHE 328 325 325 PHE PHE E . n 
C 1 329 LEU 329 326 326 LEU LEU E . n 
C 1 330 ASP 330 327 327 ASP ASP E . n 
C 1 331 ARG 331 328 328 ARG ARG E . n 
C 1 332 GLY 332 329 329 GLY GLY E . n 
C 1 333 VAL 333 330 330 VAL VAL E . n 
C 1 334 LEU 334 331 331 LEU LEU E . n 
C 1 335 ILE 335 332 332 ILE ILE E . n 
C 1 336 ARG 336 333 333 ARG ARG E . n 
C 1 337 ASP 337 334 334 ASP ASP E . n 
C 1 338 VAL 338 335 335 VAL VAL E . n 
C 1 339 GLY 339 336 336 GLY GLY E . n 
C 1 340 ILE 340 337 337 ILE ILE E . n 
C 1 341 ALA 341 338 338 ALA ALA E . n 
C 1 342 GLY 342 339 339 GLY GLY E . n 
C 1 343 HIS 343 340 340 HIS HIS E . n 
C 1 344 LEU 344 341 341 LEU LEU E . n 
C 1 345 ARG 345 342 342 ARG ARG E . n 
C 1 346 THR 346 343 343 THR THR E . n 
C 1 347 THR 347 344 344 THR THR E . n 
C 1 348 ILE 348 345 345 ILE ILE E . n 
C 1 349 GLY 349 346 346 GLY GLY E . n 
C 1 350 VAL 350 347 347 VAL VAL E . n 
C 1 351 PRO 351 348 348 PRO PRO E . n 
C 1 352 GLU 352 349 349 GLU GLU E . n 
C 1 353 GLU 353 350 350 GLU GLU E . n 
C 1 354 ASN 354 351 351 ASN ASN E . n 
C 1 355 ASP 355 352 352 ASP ASP E . n 
C 1 356 ALA 356 353 353 ALA ALA E . n 
C 1 357 PHE 357 354 354 PHE PHE E . n 
C 1 358 LEU 358 355 355 LEU LEU E . n 
C 1 359 ASP 359 356 356 ASP ASP E . n 
C 1 360 ALA 360 357 357 ALA ALA E . n 
C 1 361 ALA 361 358 358 ALA ALA E . n 
C 1 362 ALA 362 359 359 ALA ALA E . n 
C 1 363 GLU 363 360 360 GLU GLU E . n 
C 1 364 ILE 364 361 361 ILE ILE E . n 
C 1 365 ILE 365 362 362 ILE ILE E . n 
C 1 366 LYS 366 363 363 LYS LYS E . n 
C 1 367 LEU 367 364 364 LEU LEU E . n 
C 1 368 ASN 368 365 365 ASN ASN E . n 
C 1 369 LEU 369 366 366 LEU LEU E . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 2 PO4 1   402 402 PO4 PO4 A . 
E 2 PO4 1   404 404 PO4 PO4 A . 
F 2 PO4 1   405 405 PO4 PO4 A . 
G 2 PO4 1   403 403 PO4 PO4 C . 
H 2 PO4 1   402 402 PO4 PO4 C . 
I 2 PO4 1   404 403 PO4 PO4 C . 
J 2 PO4 1   402 402 PO4 PO4 E . 
K 3 HOH 1   406 2   HOH HOH A . 
K 3 HOH 2   407 6   HOH HOH A . 
K 3 HOH 3   408 8   HOH HOH A . 
K 3 HOH 4   409 9   HOH HOH A . 
K 3 HOH 5   410 10  HOH HOH A . 
K 3 HOH 6   411 12  HOH HOH A . 
K 3 HOH 7   412 15  HOH HOH A . 
K 3 HOH 8   413 19  HOH HOH A . 
K 3 HOH 9   414 20  HOH HOH A . 
K 3 HOH 10  415 26  HOH HOH A . 
K 3 HOH 11  416 27  HOH HOH A . 
K 3 HOH 12  417 32  HOH HOH A . 
K 3 HOH 13  418 39  HOH HOH A . 
K 3 HOH 14  419 40  HOH HOH A . 
K 3 HOH 15  420 44  HOH HOH A . 
K 3 HOH 16  421 52  HOH HOH A . 
K 3 HOH 17  422 55  HOH HOH A . 
K 3 HOH 18  423 56  HOH HOH A . 
K 3 HOH 19  424 60  HOH HOH A . 
K 3 HOH 20  425 62  HOH HOH A . 
K 3 HOH 21  426 64  HOH HOH A . 
K 3 HOH 22  427 65  HOH HOH A . 
K 3 HOH 23  428 74  HOH HOH A . 
K 3 HOH 24  429 79  HOH HOH A . 
K 3 HOH 25  430 83  HOH HOH A . 
K 3 HOH 26  431 84  HOH HOH A . 
K 3 HOH 27  432 89  HOH HOH A . 
K 3 HOH 28  433 100 HOH HOH A . 
K 3 HOH 29  434 103 HOH HOH A . 
K 3 HOH 30  435 109 HOH HOH A . 
K 3 HOH 31  436 111 HOH HOH A . 
K 3 HOH 32  437 112 HOH HOH A . 
K 3 HOH 33  438 113 HOH HOH A . 
K 3 HOH 34  439 114 HOH HOH A . 
K 3 HOH 35  440 119 HOH HOH A . 
K 3 HOH 36  441 120 HOH HOH A . 
K 3 HOH 37  442 122 HOH HOH A . 
K 3 HOH 38  443 123 HOH HOH A . 
K 3 HOH 39  444 126 HOH HOH A . 
K 3 HOH 40  445 127 HOH HOH A . 
K 3 HOH 41  446 128 HOH HOH A . 
K 3 HOH 42  447 131 HOH HOH A . 
K 3 HOH 43  448 134 HOH HOH A . 
K 3 HOH 44  449 135 HOH HOH A . 
K 3 HOH 45  450 139 HOH HOH A . 
K 3 HOH 46  451 140 HOH HOH A . 
K 3 HOH 47  452 144 HOH HOH A . 
K 3 HOH 48  453 145 HOH HOH A . 
K 3 HOH 49  454 159 HOH HOH A . 
K 3 HOH 50  455 160 HOH HOH A . 
K 3 HOH 51  456 161 HOH HOH A . 
K 3 HOH 52  457 163 HOH HOH A . 
K 3 HOH 53  458 165 HOH HOH A . 
K 3 HOH 54  459 169 HOH HOH A . 
K 3 HOH 55  460 172 HOH HOH A . 
K 3 HOH 56  461 173 HOH HOH A . 
K 3 HOH 57  462 175 HOH HOH A . 
K 3 HOH 58  463 176 HOH HOH A . 
K 3 HOH 59  464 177 HOH HOH A . 
K 3 HOH 60  465 178 HOH HOH A . 
K 3 HOH 61  466 181 HOH HOH A . 
K 3 HOH 62  467 183 HOH HOH A . 
K 3 HOH 63  468 187 HOH HOH A . 
K 3 HOH 64  469 191 HOH HOH A . 
K 3 HOH 65  470 193 HOH HOH A . 
K 3 HOH 66  471 195 HOH HOH A . 
K 3 HOH 67  472 201 HOH HOH A . 
K 3 HOH 68  473 202 HOH HOH A . 
K 3 HOH 69  474 205 HOH HOH A . 
K 3 HOH 70  475 206 HOH HOH A . 
K 3 HOH 71  476 209 HOH HOH A . 
K 3 HOH 72  477 211 HOH HOH A . 
K 3 HOH 73  478 213 HOH HOH A . 
K 3 HOH 74  479 221 HOH HOH A . 
K 3 HOH 75  480 224 HOH HOH A . 
K 3 HOH 76  481 227 HOH HOH A . 
K 3 HOH 77  482 229 HOH HOH A . 
K 3 HOH 78  483 233 HOH HOH A . 
K 3 HOH 79  484 235 HOH HOH A . 
K 3 HOH 80  485 236 HOH HOH A . 
K 3 HOH 81  486 239 HOH HOH A . 
K 3 HOH 82  487 256 HOH HOH A . 
K 3 HOH 83  488 257 HOH HOH A . 
K 3 HOH 84  489 260 HOH HOH A . 
K 3 HOH 85  490 262 HOH HOH A . 
K 3 HOH 86  491 263 HOH HOH A . 
K 3 HOH 87  492 268 HOH HOH A . 
K 3 HOH 88  493 269 HOH HOH A . 
K 3 HOH 89  494 271 HOH HOH A . 
K 3 HOH 90  495 279 HOH HOH A . 
K 3 HOH 91  496 280 HOH HOH A . 
K 3 HOH 92  497 286 HOH HOH A . 
K 3 HOH 93  498 290 HOH HOH A . 
K 3 HOH 94  499 291 HOH HOH A . 
K 3 HOH 95  500 294 HOH HOH A . 
K 3 HOH 96  501 296 HOH HOH A . 
K 3 HOH 97  502 298 HOH HOH A . 
K 3 HOH 98  503 304 HOH HOH A . 
K 3 HOH 99  504 308 HOH HOH A . 
K 3 HOH 100 505 317 HOH HOH A . 
K 3 HOH 101 506 321 HOH HOH A . 
K 3 HOH 102 507 327 HOH HOH A . 
K 3 HOH 103 508 329 HOH HOH A . 
K 3 HOH 104 509 330 HOH HOH A . 
K 3 HOH 105 510 338 HOH HOH A . 
K 3 HOH 106 511 340 HOH HOH A . 
K 3 HOH 107 512 343 HOH HOH A . 
K 3 HOH 108 513 344 HOH HOH A . 
K 3 HOH 109 514 348 HOH HOH A . 
K 3 HOH 110 515 349 HOH HOH A . 
K 3 HOH 111 516 351 HOH HOH A . 
K 3 HOH 112 517 352 HOH HOH A . 
K 3 HOH 113 518 354 HOH HOH A . 
K 3 HOH 114 519 355 HOH HOH A . 
K 3 HOH 115 520 362 HOH HOH A . 
K 3 HOH 116 521 363 HOH HOH A . 
K 3 HOH 117 522 365 HOH HOH A . 
K 3 HOH 118 523 367 HOH HOH A . 
K 3 HOH 119 524 370 HOH HOH A . 
K 3 HOH 120 525 372 HOH HOH A . 
K 3 HOH 121 526 373 HOH HOH A . 
K 3 HOH 122 527 376 HOH HOH A . 
K 3 HOH 123 528 381 HOH HOH A . 
K 3 HOH 124 529 384 HOH HOH A . 
K 3 HOH 125 530 388 HOH HOH A . 
K 3 HOH 126 531 390 HOH HOH A . 
K 3 HOH 127 532 397 HOH HOH A . 
K 3 HOH 128 533 398 HOH HOH A . 
L 3 HOH 1   405 3   HOH HOH C . 
L 3 HOH 2   406 11  HOH HOH C . 
L 3 HOH 3   407 14  HOH HOH C . 
L 3 HOH 4   408 17  HOH HOH C . 
L 3 HOH 5   409 21  HOH HOH C . 
L 3 HOH 6   410 23  HOH HOH C . 
L 3 HOH 7   411 24  HOH HOH C . 
L 3 HOH 8   412 30  HOH HOH C . 
L 3 HOH 9   413 34  HOH HOH C . 
L 3 HOH 10  414 36  HOH HOH C . 
L 3 HOH 11  415 37  HOH HOH C . 
L 3 HOH 12  416 38  HOH HOH C . 
L 3 HOH 13  417 42  HOH HOH C . 
L 3 HOH 14  418 43  HOH HOH C . 
L 3 HOH 15  419 45  HOH HOH C . 
L 3 HOH 16  420 46  HOH HOH C . 
L 3 HOH 17  421 50  HOH HOH C . 
L 3 HOH 18  422 51  HOH HOH C . 
L 3 HOH 19  423 53  HOH HOH C . 
L 3 HOH 20  424 58  HOH HOH C . 
L 3 HOH 21  425 59  HOH HOH C . 
L 3 HOH 22  426 61  HOH HOH C . 
L 3 HOH 23  427 63  HOH HOH C . 
L 3 HOH 24  428 67  HOH HOH C . 
L 3 HOH 25  429 69  HOH HOH C . 
L 3 HOH 26  430 71  HOH HOH C . 
L 3 HOH 27  431 72  HOH HOH C . 
L 3 HOH 28  432 73  HOH HOH C . 
L 3 HOH 29  433 75  HOH HOH C . 
L 3 HOH 30  434 76  HOH HOH C . 
L 3 HOH 31  435 77  HOH HOH C . 
L 3 HOH 32  436 78  HOH HOH C . 
L 3 HOH 33  437 80  HOH HOH C . 
L 3 HOH 34  438 82  HOH HOH C . 
L 3 HOH 35  439 85  HOH HOH C . 
L 3 HOH 36  440 86  HOH HOH C . 
L 3 HOH 37  441 88  HOH HOH C . 
L 3 HOH 38  442 90  HOH HOH C . 
L 3 HOH 39  443 91  HOH HOH C . 
L 3 HOH 40  444 93  HOH HOH C . 
L 3 HOH 41  445 94  HOH HOH C . 
L 3 HOH 42  446 95  HOH HOH C . 
L 3 HOH 43  447 96  HOH HOH C . 
L 3 HOH 44  448 99  HOH HOH C . 
L 3 HOH 45  449 102 HOH HOH C . 
L 3 HOH 46  450 104 HOH HOH C . 
L 3 HOH 47  451 105 HOH HOH C . 
L 3 HOH 48  452 107 HOH HOH C . 
L 3 HOH 49  453 108 HOH HOH C . 
L 3 HOH 50  454 116 HOH HOH C . 
L 3 HOH 51  455 121 HOH HOH C . 
L 3 HOH 52  456 129 HOH HOH C . 
L 3 HOH 53  457 132 HOH HOH C . 
L 3 HOH 54  458 133 HOH HOH C . 
L 3 HOH 55  459 136 HOH HOH C . 
L 3 HOH 56  460 138 HOH HOH C . 
L 3 HOH 57  461 141 HOH HOH C . 
L 3 HOH 58  462 148 HOH HOH C . 
L 3 HOH 59  463 150 HOH HOH C . 
L 3 HOH 60  464 152 HOH HOH C . 
L 3 HOH 61  465 153 HOH HOH C . 
L 3 HOH 62  466 154 HOH HOH C . 
L 3 HOH 63  467 156 HOH HOH C . 
L 3 HOH 64  468 162 HOH HOH C . 
L 3 HOH 65  469 164 HOH HOH C . 
L 3 HOH 66  470 166 HOH HOH C . 
L 3 HOH 67  471 167 HOH HOH C . 
L 3 HOH 68  472 168 HOH HOH C . 
L 3 HOH 69  473 170 HOH HOH C . 
L 3 HOH 70  474 171 HOH HOH C . 
L 3 HOH 71  475 179 HOH HOH C . 
L 3 HOH 72  476 180 HOH HOH C . 
L 3 HOH 73  477 185 HOH HOH C . 
L 3 HOH 74  478 186 HOH HOH C . 
L 3 HOH 75  479 189 HOH HOH C . 
L 3 HOH 76  480 190 HOH HOH C . 
L 3 HOH 77  481 192 HOH HOH C . 
L 3 HOH 78  482 196 HOH HOH C . 
L 3 HOH 79  483 197 HOH HOH C . 
L 3 HOH 80  484 198 HOH HOH C . 
L 3 HOH 81  485 199 HOH HOH C . 
L 3 HOH 82  486 203 HOH HOH C . 
L 3 HOH 83  487 204 HOH HOH C . 
L 3 HOH 84  488 207 HOH HOH C . 
L 3 HOH 85  489 208 HOH HOH C . 
L 3 HOH 86  490 210 HOH HOH C . 
L 3 HOH 87  491 216 HOH HOH C . 
L 3 HOH 88  492 218 HOH HOH C . 
L 3 HOH 89  493 220 HOH HOH C . 
L 3 HOH 90  494 222 HOH HOH C . 
L 3 HOH 91  495 223 HOH HOH C . 
L 3 HOH 92  496 228 HOH HOH C . 
L 3 HOH 93  497 232 HOH HOH C . 
L 3 HOH 94  498 237 HOH HOH C . 
L 3 HOH 95  499 242 HOH HOH C . 
L 3 HOH 96  500 247 HOH HOH C . 
L 3 HOH 97  501 248 HOH HOH C . 
L 3 HOH 98  502 249 HOH HOH C . 
L 3 HOH 99  503 252 HOH HOH C . 
L 3 HOH 100 504 259 HOH HOH C . 
L 3 HOH 101 505 265 HOH HOH C . 
L 3 HOH 102 506 270 HOH HOH C . 
L 3 HOH 103 507 278 HOH HOH C . 
L 3 HOH 104 508 283 HOH HOH C . 
L 3 HOH 105 509 285 HOH HOH C . 
L 3 HOH 106 510 287 HOH HOH C . 
L 3 HOH 107 511 289 HOH HOH C . 
L 3 HOH 108 512 300 HOH HOH C . 
L 3 HOH 109 513 302 HOH HOH C . 
L 3 HOH 110 514 305 HOH HOH C . 
L 3 HOH 111 515 309 HOH HOH C . 
L 3 HOH 112 516 311 HOH HOH C . 
L 3 HOH 113 517 313 HOH HOH C . 
L 3 HOH 114 518 315 HOH HOH C . 
L 3 HOH 115 519 331 HOH HOH C . 
L 3 HOH 116 520 332 HOH HOH C . 
L 3 HOH 117 521 333 HOH HOH C . 
L 3 HOH 118 522 334 HOH HOH C . 
L 3 HOH 119 523 335 HOH HOH C . 
L 3 HOH 120 524 337 HOH HOH C . 
L 3 HOH 121 525 341 HOH HOH C . 
L 3 HOH 122 526 345 HOH HOH C . 
L 3 HOH 123 527 353 HOH HOH C . 
L 3 HOH 124 528 356 HOH HOH C . 
L 3 HOH 125 529 358 HOH HOH C . 
L 3 HOH 126 530 361 HOH HOH C . 
L 3 HOH 127 531 374 HOH HOH C . 
L 3 HOH 128 532 375 HOH HOH C . 
L 3 HOH 129 533 377 HOH HOH C . 
L 3 HOH 130 534 379 HOH HOH C . 
L 3 HOH 131 535 380 HOH HOH C . 
L 3 HOH 132 536 385 HOH HOH C . 
L 3 HOH 133 537 386 HOH HOH C . 
M 3 HOH 1   403 1   HOH HOH E . 
M 3 HOH 2   404 5   HOH HOH E . 
M 3 HOH 3   405 13  HOH HOH E . 
M 3 HOH 4   406 16  HOH HOH E . 
M 3 HOH 5   407 18  HOH HOH E . 
M 3 HOH 6   408 25  HOH HOH E . 
M 3 HOH 7   409 28  HOH HOH E . 
M 3 HOH 8   410 29  HOH HOH E . 
M 3 HOH 9   411 31  HOH HOH E . 
M 3 HOH 10  412 33  HOH HOH E . 
M 3 HOH 11  413 41  HOH HOH E . 
M 3 HOH 12  414 47  HOH HOH E . 
M 3 HOH 13  415 48  HOH HOH E . 
M 3 HOH 14  416 54  HOH HOH E . 
M 3 HOH 15  417 57  HOH HOH E . 
M 3 HOH 16  418 66  HOH HOH E . 
M 3 HOH 17  419 68  HOH HOH E . 
M 3 HOH 18  420 70  HOH HOH E . 
M 3 HOH 19  421 81  HOH HOH E . 
M 3 HOH 20  422 87  HOH HOH E . 
M 3 HOH 21  423 92  HOH HOH E . 
M 3 HOH 22  424 97  HOH HOH E . 
M 3 HOH 23  425 98  HOH HOH E . 
M 3 HOH 24  426 101 HOH HOH E . 
M 3 HOH 25  427 106 HOH HOH E . 
M 3 HOH 26  428 110 HOH HOH E . 
M 3 HOH 27  429 115 HOH HOH E . 
M 3 HOH 28  430 117 HOH HOH E . 
M 3 HOH 29  431 118 HOH HOH E . 
M 3 HOH 30  432 124 HOH HOH E . 
M 3 HOH 31  433 125 HOH HOH E . 
M 3 HOH 32  434 137 HOH HOH E . 
M 3 HOH 33  435 142 HOH HOH E . 
M 3 HOH 34  436 143 HOH HOH E . 
M 3 HOH 35  437 147 HOH HOH E . 
M 3 HOH 36  438 149 HOH HOH E . 
M 3 HOH 37  439 151 HOH HOH E . 
M 3 HOH 38  440 155 HOH HOH E . 
M 3 HOH 39  441 157 HOH HOH E . 
M 3 HOH 40  442 158 HOH HOH E . 
M 3 HOH 41  443 174 HOH HOH E . 
M 3 HOH 42  444 182 HOH HOH E . 
M 3 HOH 43  445 184 HOH HOH E . 
M 3 HOH 44  446 200 HOH HOH E . 
M 3 HOH 45  447 212 HOH HOH E . 
M 3 HOH 46  448 214 HOH HOH E . 
M 3 HOH 47  449 215 HOH HOH E . 
M 3 HOH 48  450 217 HOH HOH E . 
M 3 HOH 49  451 225 HOH HOH E . 
M 3 HOH 50  452 226 HOH HOH E . 
M 3 HOH 51  453 230 HOH HOH E . 
M 3 HOH 52  454 231 HOH HOH E . 
M 3 HOH 53  455 234 HOH HOH E . 
M 3 HOH 54  456 238 HOH HOH E . 
M 3 HOH 55  457 240 HOH HOH E . 
M 3 HOH 56  458 241 HOH HOH E . 
M 3 HOH 57  459 245 HOH HOH E . 
M 3 HOH 58  460 246 HOH HOH E . 
M 3 HOH 59  461 250 HOH HOH E . 
M 3 HOH 60  462 251 HOH HOH E . 
M 3 HOH 61  463 253 HOH HOH E . 
M 3 HOH 62  464 255 HOH HOH E . 
M 3 HOH 63  465 258 HOH HOH E . 
M 3 HOH 64  466 264 HOH HOH E . 
M 3 HOH 65  467 266 HOH HOH E . 
M 3 HOH 66  468 267 HOH HOH E . 
M 3 HOH 67  469 274 HOH HOH E . 
M 3 HOH 68  470 276 HOH HOH E . 
M 3 HOH 69  471 277 HOH HOH E . 
M 3 HOH 70  472 282 HOH HOH E . 
M 3 HOH 71  473 288 HOH HOH E . 
M 3 HOH 72  474 292 HOH HOH E . 
M 3 HOH 73  475 293 HOH HOH E . 
M 3 HOH 74  476 297 HOH HOH E . 
M 3 HOH 75  477 299 HOH HOH E . 
M 3 HOH 76  478 301 HOH HOH E . 
M 3 HOH 77  479 303 HOH HOH E . 
M 3 HOH 78  480 306 HOH HOH E . 
M 3 HOH 79  481 312 HOH HOH E . 
M 3 HOH 80  482 314 HOH HOH E . 
M 3 HOH 81  483 316 HOH HOH E . 
M 3 HOH 82  484 318 HOH HOH E . 
M 3 HOH 83  485 319 HOH HOH E . 
M 3 HOH 84  486 322 HOH HOH E . 
M 3 HOH 85  487 323 HOH HOH E . 
M 3 HOH 86  488 324 HOH HOH E . 
M 3 HOH 87  489 326 HOH HOH E . 
M 3 HOH 88  490 328 HOH HOH E . 
M 3 HOH 89  491 336 HOH HOH E . 
M 3 HOH 90  492 339 HOH HOH E . 
M 3 HOH 91  493 346 HOH HOH E . 
M 3 HOH 92  494 350 HOH HOH E . 
M 3 HOH 93  495 359 HOH HOH E . 
M 3 HOH 94  496 368 HOH HOH E . 
M 3 HOH 95  497 371 HOH HOH E . 
M 3 HOH 96  498 383 HOH HOH E . 
M 3 HOH 97  499 391 HOH HOH E . 
M 3 HOH 98  500 392 HOH HOH E . 
M 3 HOH 99  501 393 HOH HOH E . 
M 3 HOH 100 502 400 HOH HOH E . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A LLP 231 A LLP 228 ? LYS ? 
2 B LLP 231 C LLP 228 ? LYS ? 
3 C LLP 231 E LLP 228 ? LYS ? 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B,D,E,F,G,H,I,K,L 
2 1,2 C,J,M               
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 8840  ? 
1 MORE         -82.0 ? 
1 'SSA (A^2)'  25440 ? 
2 'ABSA (A^2)' 7860  ? 
2 MORE         -53.7 ? 
2 'SSA (A^2)'  25640 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z   1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 2_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    E 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     428 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   M 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-07-01 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement        5.2.0019 ? 1 
DNA    'data collection' .        ? 2 
MOSFLM 'data reduction'  .        ? 3 
SCALA  'data scaling'    .        ? 4 
MOLREP phasing           .        ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O2 C PO4 404 ? ? O C HOH 405 ? ? 1.97 
2 1 O  A HOH 422 ? ? O A HOH 522 ? ? 2.16 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE C ARG 66 ? ? CZ C ARG 66 ? ? NH1 C ARG 66 ? ? 123.34 120.30 3.04  0.50 N 
2 1 NE C ARG 66 ? ? CZ C ARG 66 ? ? NH2 C ARG 66 ? ? 116.90 120.30 -3.40 0.50 N 
3 1 NE E ARG 66 ? ? CZ E ARG 66 ? ? NH2 E ARG 66 ? ? 117.00 120.30 -3.30 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PRO A 10  ? ? -79.43  46.28   
2  1 SER A 122 ? ? -135.27 -159.98 
3  1 LLP A 228 ? ? -103.96 -90.25  
4  1 PHE A 232 ? ? -142.02 36.89   
5  1 ASN A 308 ? ? -95.01  32.99   
6  1 ILE A 332 ? ? -112.12 -168.02 
7  1 PRO C 10  ? ? -74.13  43.44   
8  1 TYR C 21  ? ? -39.79  122.32  
9  1 SER C 122 ? ? -140.96 -154.37 
10 1 GLU C 198 ? ? -102.08 45.72   
11 1 LLP C 228 ? ? -110.96 -96.43  
12 1 PHE C 232 ? ? -142.12 33.71   
13 1 ARG C 236 ? ? 44.19   77.93   
14 1 SER C 307 ? ? -124.91 -165.22 
15 1 ILE C 332 ? ? -110.50 -159.15 
16 1 PRO E 10  ? ? -76.74  45.64   
17 1 GLU E 198 ? ? -104.17 45.20   
18 1 LLP E 228 ? ? -109.87 -97.62  
19 1 PHE E 232 ? ? -145.13 31.55   
20 1 ARG E 236 ? ? 46.80   70.31   
21 1 ASN E 308 ? ? -95.73  32.52   
22 1 ILE E 332 ? ? -114.89 -159.30 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 3 ? CG ? A LYS 6 CG 
2  1 Y 1 A LYS 3 ? CD ? A LYS 6 CD 
3  1 Y 1 A LYS 3 ? CE ? A LYS 6 CE 
4  1 Y 1 A LYS 3 ? NZ ? A LYS 6 NZ 
5  1 Y 1 C LYS 3 ? CG ? B LYS 6 CG 
6  1 Y 1 C LYS 3 ? CD ? B LYS 6 CD 
7  1 Y 1 C LYS 3 ? CE ? B LYS 6 CE 
8  1 Y 1 C LYS 3 ? NZ ? B LYS 6 NZ 
9  1 Y 1 E LYS 3 ? CG ? C LYS 6 CG 
10 1 Y 1 E LYS 3 ? CD ? C LYS 6 CD 
11 1 Y 1 E LYS 3 ? CE ? C LYS 6 CE 
12 1 Y 1 E LYS 3 ? NZ ? C LYS 6 NZ 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -2 ? A GLY 1 
2  1 Y 1 A SER -1 ? A SER 2 
3  1 Y 1 A HIS 0  ? A HIS 3 
4  1 Y 1 A MET 1  ? A MET 4 
5  1 Y 1 A THR 2  ? A THR 5 
6  1 Y 1 C GLY -2 ? B GLY 1 
7  1 Y 1 C SER -1 ? B SER 2 
8  1 Y 1 C HIS 0  ? B HIS 3 
9  1 Y 1 C MET 1  ? B MET 4 
10 1 Y 1 C THR 2  ? B THR 5 
11 1 Y 1 E GLY -2 ? C GLY 1 
12 1 Y 1 E SER -1 ? C SER 2 
13 1 Y 1 E HIS 0  ? C HIS 3 
14 1 Y 1 E MET 1  ? C MET 4 
15 1 Y 1 E THR 2  ? C THR 5 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'PHOSPHATE ION' PO4 
3 water           HOH 
#