data_3CR2
# 
_entry.id   3CR2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3CR2         
RCSB  RCSB047110   
WWPDB D_1000047110 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3cr4 . unspecified 
PDB 3cr5 . unspecified 
# 
_pdbx_database_status.entry_id                        3CR2 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2008-04-04 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
_audit_author.name           'Charpentier, T.H.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     'Divalent metal ion complexes of S100B in the absence and presence of pentamidine.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            382 
_citation.page_first                56 
_citation.page_last                 73 
_citation.year                      2008 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18602402 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2008.06.047 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Charpentier, T.H.' 1 
primary 'Wilder, P.T.'      2 
primary 'Liriano, M.A.'     3 
primary 'Varney, K.M.'      4 
primary 'Pozharski, E.'     5 
primary 'MacKerell, A.D.'   6 
primary 'Coop, A.'          7 
primary 'Toth, E.A.'        8 
primary 'Weber, D.J.'       9 
# 
_cell.length_a           34.587 
_cell.length_b           90.476 
_cell.length_c           58.301 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           3CR2 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.entry_id                         3CR2 
_symmetry.Int_Tables_number                20 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Protein S100-B' 10681.974 1  ? ? ? ? 
2 non-polymer syn 'CALCIUM ION'    40.078    2  ? ? ? ? 
3 non-polymer syn 'ZINC ION'       65.409    1  ? ? ? ? 
4 water       nat water            18.015    51 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'S100 calcium-binding protein B, S-100 protein subunit beta, S-100 protein beta chain' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAM
ITTACHEFFEHE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAM
ITTACHEFFEHE
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  SER n 
1 3  GLU n 
1 4  LEU n 
1 5  GLU n 
1 6  LYS n 
1 7  ALA n 
1 8  VAL n 
1 9  VAL n 
1 10 ALA n 
1 11 LEU n 
1 12 ILE n 
1 13 ASP n 
1 14 VAL n 
1 15 PHE n 
1 16 HIS n 
1 17 GLN n 
1 18 TYR n 
1 19 SER n 
1 20 GLY n 
1 21 ARG n 
1 22 GLU n 
1 23 GLY n 
1 24 ASP n 
1 25 LYS n 
1 26 HIS n 
1 27 LYS n 
1 28 LEU n 
1 29 LYS n 
1 30 LYS n 
1 31 SER n 
1 32 GLU n 
1 33 LEU n 
1 34 LYS n 
1 35 GLU n 
1 36 LEU n 
1 37 ILE n 
1 38 ASN n 
1 39 ASN n 
1 40 GLU n 
1 41 LEU n 
1 42 SER n 
1 43 HIS n 
1 44 PHE n 
1 45 LEU n 
1 46 GLU n 
1 47 GLU n 
1 48 ILE n 
1 49 LYS n 
1 50 GLU n 
1 51 GLN n 
1 52 GLU n 
1 53 VAL n 
1 54 VAL n 
1 55 ASP n 
1 56 LYS n 
1 57 VAL n 
1 58 MET n 
1 59 GLU n 
1 60 THR n 
1 61 LEU n 
1 62 ASP n 
1 63 SER n 
1 64 ASP n 
1 65 GLY n 
1 66 ASP n 
1 67 GLY n 
1 68 GLU n 
1 69 CYS n 
1 70 ASP n 
1 71 PHE n 
1 72 GLN n 
1 73 GLU n 
1 74 PHE n 
1 75 MET n 
1 76 ALA n 
1 77 PHE n 
1 78 VAL n 
1 79 ALA n 
1 80 MET n 
1 81 ILE n 
1 82 THR n 
1 83 THR n 
1 84 ALA n 
1 85 CYS n 
1 86 HIS n 
1 87 GLU n 
1 88 PHE n 
1 89 PHE n 
1 90 GLU n 
1 91 HIS n 
1 92 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               Bovine 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 S100B 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Bos taurus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     ? 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'HMS174(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET11b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    S100B_BOVIN 
_struct_ref.pdbx_db_accession          P02638 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAM
ITTACHEFFEHE
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3CR2 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 92 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P02638 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  92 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       0 
_struct_ref_seq.pdbx_auth_seq_align_end       91 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.crystals_number   1 
_exptl.entry_id          3CR2 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.13 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   42.39 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.pdbx_details    
'PEG3350, CaCl2, ZnCl2, Cacodylate buffer, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2007-02-23 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL9-1' 
_diffrn_source.pdbx_wavelength_list        0.98 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL9-1 
# 
_reflns.entry_id                     3CR2 
_reflns.d_resolution_high            1.880 
_reflns.d_resolution_low             45.000 
_reflns.number_obs                   7477 
_reflns.pdbx_Rmerge_I_obs            0.058 
_reflns.pdbx_netI_over_sigmaI        20.300 
_reflns.pdbx_chi_squared             1.261 
_reflns.pdbx_redundancy              6.600 
_reflns.percent_possible_obs         96.800 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
1.88 1.95  ? ? ? 0.359 ? ? 1.157 5.10 ? 732 97.10  1  1 
1.95 2.03  ? ? ? 0.229 ? ? 1.256 6.50 ? 759 99.90  2  1 
2.03 2.12  ? ? ? 0.174 ? ? 1.378 7.00 ? 748 100.00 3  1 
2.12 2.23  ? ? ? 0.127 ? ? 1.333 7.10 ? 759 100.00 4  1 
2.23 2.37  ? ? ? 0.108 ? ? 1.356 7.10 ? 766 100.00 5  1 
2.37 2.55  ? ? ? 0.084 ? ? 1.227 7.10 ? 760 100.00 6  1 
2.55 2.81  ? ? ? 0.076 ? ? 1.285 7.10 ? 774 100.00 7  1 
2.81 3.21  ? ? ? 0.071 ? ? 1.204 7.00 ? 776 99.60  8  1 
3.21 4.05  ? ? ? 0.051 ? ? 1.185 6.40 ? 739 94.30  9  1 
4.05 45.00 ? ? ? 0.043 ? ? 1.142 5.80 ? 664 78.80  10 1 
# 
_refine.entry_id                                 3CR2 
_refine.ls_d_res_high                            1.880 
_refine.ls_d_res_low                             45.220 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    96.450 
_refine.ls_number_reflns_obs                     7464 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.ls_R_factor_obs                          0.221 
_refine.ls_R_factor_R_work                       0.219 
_refine.ls_R_factor_R_free                       0.268 
_refine.ls_percent_reflns_R_free                 4.600 
_refine.ls_number_reflns_R_free                  344 
_refine.B_iso_mean                               49.423 
_refine.aniso_B[1][1]                            1.220 
_refine.aniso_B[2][2]                            -0.710 
_refine.aniso_B[3][3]                            -0.510 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.947 
_refine.correlation_coeff_Fo_to_Fc_free          0.925 
_refine.pdbx_overall_ESU_R                       0.184 
_refine.pdbx_overall_ESU_R_Free                  0.170 
_refine.overall_SU_ML                            0.147 
_refine.overall_SU_B                             11.503 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        714 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         3 
_refine_hist.number_atoms_solvent             51 
_refine_hist.number_atoms_total               768 
_refine_hist.d_res_high                       1.880 
_refine_hist.d_res_low                        45.220 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             725 0.015  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          972 1.543  1.945  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       89  4.829  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       38  33.237 26.316 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       135 16.380 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       1   4.076  15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr               108 0.125  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         542 0.006  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined                359 0.243  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined              513 0.301  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        44  0.266  0.200  ? 'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          6   0.109  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       47  0.215  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     12  0.223  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined 2   0.097  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it                  464 0.873  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it                 714 1.124  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it                  291 2.003  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it                 258 2.725  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       1.882 
_refine_ls_shell.d_res_low                        1.931 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               91.900 
_refine_ls_shell.number_reflns_R_work             502 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.311 
_refine_ls_shell.R_factor_R_free                  0.467 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             20 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                522 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3CR2 
_struct.title                     'X-ray structure of bovine Zn(2+),Ca(2+)-S100B' 
_struct.pdbx_descriptor           'Protein S100-B' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3CR2 
_struct_keywords.text            'EF hand, Alpha helical, Metal-binding, Nucleus, METAL BINDING PROTEIN' 
_struct_keywords.pdbx_keywords   'METAL BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 2  ? GLY A 20 ? SER A 1  GLY A 19 1 ? 19 
HELX_P HELX_P2 2 LYS A 29 ? LEU A 41 ? LYS A 28 LEU A 40 1 ? 13 
HELX_P HELX_P3 3 GLU A 50 ? ASP A 62 ? GLU A 49 ASP A 61 1 ? 13 
HELX_P HELX_P4 4 ASP A 70 ? PHE A 89 ? ASP A 69 PHE A 88 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A SER 19 O   ? ? ? 1_555 B CA  . CA ? ? A SER 18 A CA  92  1_555 ? ? ? ? ? ? ? 2.307 ? 
metalc2  metalc ? ? A GLU 22 O   ? ? ? 1_555 B CA  . CA ? ? A GLU 21 A CA  92  1_555 ? ? ? ? ? ? ? 2.421 ? 
metalc3  metalc ? ? A ASP 24 O   ? ? ? 1_555 B CA  . CA ? ? A ASP 23 A CA  92  1_555 ? ? ? ? ? ? ? 2.585 ? 
metalc4  metalc ? ? A LYS 27 O   ? ? ? 1_555 B CA  . CA ? ? A LYS 26 A CA  92  1_555 ? ? ? ? ? ? ? 2.426 ? 
metalc5  metalc ? ? A GLU 32 OE1 ? ? ? 1_555 B CA  . CA ? ? A GLU 31 A CA  92  1_555 ? ? ? ? ? ? ? 2.439 ? 
metalc6  metalc ? ? A GLU 32 OE2 ? ? ? 1_555 B CA  . CA ? ? A GLU 31 A CA  92  1_555 ? ? ? ? ? ? ? 2.651 ? 
metalc7  metalc ? ? A ASP 62 OD1 ? ? ? 1_555 C CA  . CA ? ? A ASP 61 A CA  93  1_555 ? ? ? ? ? ? ? 2.256 ? 
metalc8  metalc ? ? A ASP 64 OD1 ? ? ? 1_555 C CA  . CA ? ? A ASP 63 A CA  93  1_555 ? ? ? ? ? ? ? 2.565 ? 
metalc9  metalc ? ? A ASP 66 OD1 ? ? ? 1_555 C CA  . CA ? ? A ASP 65 A CA  93  1_555 ? ? ? ? ? ? ? 2.452 ? 
metalc10 metalc ? ? A GLU 68 O   ? ? ? 1_555 C CA  . CA ? ? A GLU 67 A CA  93  1_555 ? ? ? ? ? ? ? 2.345 ? 
metalc11 metalc ? ? A GLU 73 OE1 ? ? ? 1_555 C CA  . CA ? ? A GLU 72 A CA  93  1_555 ? ? ? ? ? ? ? 2.304 ? 
metalc12 metalc ? ? A GLU 73 OE2 ? ? ? 1_555 C CA  . CA ? ? A GLU 72 A CA  93  1_555 ? ? ? ? ? ? ? 2.484 ? 
metalc13 metalc ? ? A HIS 86 NE2 ? ? ? 1_555 D ZN  . ZN ? ? A HIS 85 A ZN  94  1_555 ? ? ? ? ? ? ? 2.038 ? 
metalc14 metalc ? ? A GLU 90 OE2 ? ? ? 1_555 D ZN  . ZN ? ? A GLU 89 A ZN  94  1_555 ? ? ? ? ? ? ? 2.023 ? 
metalc15 metalc ? ? B CA  .  CA  ? ? ? 1_555 E HOH . O  ? ? A CA  92 A HOH 125 1_555 ? ? ? ? ? ? ? 2.308 ? 
metalc16 metalc ? ? C CA  .  CA  ? ? ? 1_555 E HOH . O  ? ? A CA  93 A HOH 107 1_555 ? ? ? ? ? ? ? 2.518 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 92' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 93' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 94' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 SER A 19 ? SER A 18  . ? 1_555 ? 
2  AC1 6 GLU A 22 ? GLU A 21  . ? 1_555 ? 
3  AC1 6 ASP A 24 ? ASP A 23  . ? 1_555 ? 
4  AC1 6 LYS A 27 ? LYS A 26  . ? 1_555 ? 
5  AC1 6 GLU A 32 ? GLU A 31  . ? 1_555 ? 
6  AC1 6 HOH E .  ? HOH A 125 . ? 1_555 ? 
7  AC2 6 ASP A 62 ? ASP A 61  . ? 1_555 ? 
8  AC2 6 ASP A 64 ? ASP A 63  . ? 1_555 ? 
9  AC2 6 ASP A 66 ? ASP A 65  . ? 1_555 ? 
10 AC2 6 GLU A 68 ? GLU A 67  . ? 1_555 ? 
11 AC2 6 GLU A 73 ? GLU A 72  . ? 1_555 ? 
12 AC2 6 HOH E .  ? HOH A 107 . ? 1_555 ? 
13 AC3 4 HIS A 16 ? HIS A 15  . ? 4_555 ? 
14 AC3 4 HIS A 26 ? HIS A 25  . ? 4_555 ? 
15 AC3 4 HIS A 86 ? HIS A 85  . ? 1_555 ? 
16 AC3 4 GLU A 90 ? GLU A 89  . ? 1_555 ? 
# 
_atom_sites.entry_id                    3CR2 
_atom_sites.fract_transf_matrix[1][1]   0.028913 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011053 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.017152 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N  N   . MET A 1 1  ? 7.435   -7.810 6.980   1.00 53.97 ? 0   MET A N   1 
ATOM   2   C  CA  . MET A 1 1  ? 6.052   -7.757 6.451   1.00 55.40 ? 0   MET A CA  1 
ATOM   3   C  C   . MET A 1 1  ? 6.071   -7.698 4.922   1.00 53.43 ? 0   MET A C   1 
ATOM   4   O  O   . MET A 1 1  ? 7.056   -7.216 4.310   1.00 53.49 ? 0   MET A O   1 
ATOM   5   C  CB  . MET A 1 1  ? 5.245   -6.605 7.079   1.00 54.20 ? 0   MET A CB  1 
ATOM   6   C  CG  . MET A 1 1  ? 5.476   -5.245 6.478   1.00 55.15 ? 0   MET A CG  1 
ATOM   7   S  SD  . MET A 1 1  ? 5.509   -3.938 7.717   1.00 61.49 ? 0   MET A SD  1 
ATOM   8   C  CE  . MET A 1 1  ? 3.791   -3.486 7.599   1.00 54.79 ? 0   MET A CE  1 
ATOM   9   N  N   . SER A 1 2  ? 5.003   -8.233 4.342   1.00 51.35 ? 1   SER A N   1 
ATOM   10  C  CA  . SER A 1 2  ? 4.835   -8.371 2.897   1.00 49.97 ? 1   SER A CA  1 
ATOM   11  C  C   . SER A 1 2  ? 4.445   -7.034 2.289   1.00 48.83 ? 1   SER A C   1 
ATOM   12  O  O   . SER A 1 2  ? 4.049   -6.162 2.996   1.00 45.77 ? 1   SER A O   1 
ATOM   13  C  CB  . SER A 1 2  ? 3.709   -9.351 2.610   1.00 49.48 ? 1   SER A CB  1 
ATOM   14  O  OG  . SER A 1 2  ? 2.449   -8.802 3.019   1.00 50.85 ? 1   SER A OG  1 
ATOM   15  N  N   . GLU A 1 3  ? 4.585   -6.903 0.969   1.00 48.71 ? 2   GLU A N   1 
ATOM   16  C  CA  . GLU A 1 3  ? 4.108   -5.748 0.219   1.00 48.84 ? 2   GLU A CA  1 
ATOM   17  C  C   . GLU A 1 3  ? 2.664   -5.354 0.520   1.00 49.70 ? 2   GLU A C   1 
ATOM   18  O  O   . GLU A 1 3  ? 2.338   -4.159 0.533   1.00 48.23 ? 2   GLU A O   1 
ATOM   19  C  CB  . GLU A 1 3  ? 4.212   -6.054 -1.278  1.00 49.55 ? 2   GLU A CB  1 
ATOM   20  C  CG  . GLU A 1 3  ? 5.597   -5.953 -1.805  1.00 51.67 ? 2   GLU A CG  1 
ATOM   21  C  CD  . GLU A 1 3  ? 6.031   -4.512 -2.012  1.00 55.96 ? 2   GLU A CD  1 
ATOM   22  O  OE1 . GLU A 1 3  ? 5.987   -4.035 -3.174  1.00 55.45 ? 2   GLU A OE1 1 
ATOM   23  O  OE2 . GLU A 1 3  ? 6.416   -3.862 -1.018  1.00 56.84 ? 2   GLU A OE2 1 
ATOM   24  N  N   . LEU A 1 4  ? 1.789   -6.354 0.699   1.00 49.12 ? 3   LEU A N   1 
ATOM   25  C  CA  . LEU A 1 4  ? 0.396   -6.059 1.015   1.00 49.28 ? 3   LEU A CA  1 
ATOM   26  C  C   . LEU A 1 4  ? 0.286   -5.477 2.417   1.00 49.31 ? 3   LEU A C   1 
ATOM   27  O  O   . LEU A 1 4  ? -0.415  -4.507 2.615   1.00 48.88 ? 3   LEU A O   1 
ATOM   28  C  CB  . LEU A 1 4  ? -0.452  -7.317 0.958   1.00 48.58 ? 3   LEU A CB  1 
ATOM   29  C  CG  . LEU A 1 4  ? -1.917  -7.305 0.535   1.00 53.44 ? 3   LEU A CG  1 
ATOM   30  C  CD1 . LEU A 1 4  ? -2.633  -8.604 1.070   1.00 47.49 ? 3   LEU A CD1 1 
ATOM   31  C  CD2 . LEU A 1 4  ? -2.768  -5.973 0.576   1.00 50.12 ? 3   LEU A CD2 1 
ATOM   32  N  N   . GLU A 1 5  ? 1.044   -6.014 3.367   1.00 50.41 ? 4   GLU A N   1 
ATOM   33  C  CA  . GLU A 1 5  ? 1.014   -5.451 4.748   1.00 48.58 ? 4   GLU A CA  1 
ATOM   34  C  C   . GLU A 1 5  ? 1.595   -4.045 4.743   1.00 49.26 ? 4   GLU A C   1 
ATOM   35  O  O   . GLU A 1 5  ? 1.052   -3.129 5.370   1.00 48.82 ? 4   GLU A O   1 
ATOM   36  C  CB  . GLU A 1 5  ? 1.720   -6.375 5.783   1.00 49.59 ? 4   GLU A CB  1 
ATOM   37  C  CG  . GLU A 1 5  ? 0.895   -7.651 6.069   1.00 46.40 ? 4   GLU A CG  1 
ATOM   38  C  CD  . GLU A 1 5  ? 1.637   -8.822 6.678   1.00 49.17 ? 4   GLU A CD  1 
ATOM   39  O  OE1 . GLU A 1 5  ? 2.850   -8.981 6.427   1.00 48.80 ? 4   GLU A OE1 1 
ATOM   40  O  OE2 . GLU A 1 5  ? 0.986   -9.622 7.394   1.00 46.87 ? 4   GLU A OE2 1 
ATOM   41  N  N   . LYS A 1 6  ? 2.687   -3.871 4.027   1.00 47.64 ? 5   LYS A N   1 
ATOM   42  C  CA  . LYS A 1 6  ? 3.298   -2.543 3.923   1.00 47.70 ? 5   LYS A CA  1 
ATOM   43  C  C   . LYS A 1 6  ? 2.271   -1.538 3.392   1.00 47.02 ? 5   LYS A C   1 
ATOM   44  O  O   . LYS A 1 6  ? 2.262   -0.389 3.810   1.00 45.54 ? 5   LYS A O   1 
ATOM   45  C  CB  . LYS A 1 6  ? 4.544   -2.584 3.033   1.00 48.15 ? 5   LYS A CB  1 
ATOM   46  C  CG  . LYS A 1 6  ? 5.830   -3.022 3.749   1.00 47.86 ? 5   LYS A CG  1 
ATOM   47  C  CD  . LYS A 1 6  ? 7.023   -3.189 2.797   1.00 48.02 ? 5   LYS A CD  1 
ATOM   48  N  N   . ALA A 1 7  ? 1.441   -1.976 2.436   1.00 47.76 ? 6   ALA A N   1 
ATOM   49  C  CA  . ALA A 1 7  ? 0.447   -1.106 1.804   1.00 47.79 ? 6   ALA A CA  1 
ATOM   50  C  C   . ALA A 1 7  ? -0.644  -0.726 2.789   1.00 49.13 ? 6   ALA A C   1 
ATOM   51  O  O   . ALA A 1 7  ? -1.066  0.451  2.850   1.00 49.54 ? 6   ALA A O   1 
ATOM   52  C  CB  . ALA A 1 7  ? -0.160  -1.773 0.543   1.00 48.56 ? 6   ALA A CB  1 
ATOM   53  N  N   . VAL A 1 8  ? -1.144  -1.714 3.528   1.00 47.79 ? 7   VAL A N   1 
ATOM   54  C  CA  . VAL A 1 8  ? -2.140  -1.472 4.568   1.00 48.93 ? 7   VAL A CA  1 
ATOM   55  C  C   . VAL A 1 8  ? -1.611  -0.425 5.564   1.00 49.72 ? 7   VAL A C   1 
ATOM   56  O  O   . VAL A 1 8  ? -2.327  0.497  5.918   1.00 49.31 ? 7   VAL A O   1 
ATOM   57  C  CB  . VAL A 1 8  ? -2.489  -2.788 5.302   1.00 48.11 ? 7   VAL A CB  1 
ATOM   58  C  CG1 . VAL A 1 8  ? -3.272  -2.539 6.589   1.00 48.95 ? 7   VAL A CG1 1 
ATOM   59  C  CG2 . VAL A 1 8  ? -3.287  -3.681 4.334   1.00 47.76 ? 7   VAL A CG2 1 
ATOM   60  N  N   . VAL A 1 9  ? -0.371  -0.535 5.998   1.00 49.37 ? 8   VAL A N   1 
ATOM   61  C  CA  . VAL A 1 9  ? 0.049   0.426  7.031   1.00 50.27 ? 8   VAL A CA  1 
ATOM   62  C  C   . VAL A 1 9  ? 0.297   1.798  6.419   1.00 50.15 ? 8   VAL A C   1 
ATOM   63  O  O   . VAL A 1 9  ? 0.144   2.824  7.108   1.00 51.52 ? 8   VAL A O   1 
ATOM   64  C  CB  . VAL A 1 9  ? 1.223   -0.033 8.015   1.00 51.72 ? 8   VAL A CB  1 
ATOM   65  C  CG1 . VAL A 1 9  ? 1.286   -1.543 8.194   1.00 51.23 ? 8   VAL A CG1 1 
ATOM   66  C  CG2 . VAL A 1 9  ? 2.579   0.612  7.717   1.00 50.37 ? 8   VAL A CG2 1 
ATOM   67  N  N   . ALA A 1 10 ? 0.687   1.816  5.141   1.00 49.66 ? 9   ALA A N   1 
ATOM   68  C  CA  . ALA A 1 10 ? 0.971   3.094  4.432   1.00 49.13 ? 9   ALA A CA  1 
ATOM   69  C  C   . ALA A 1 10 ? -0.334  3.890  4.309   1.00 48.95 ? 9   ALA A C   1 
ATOM   70  O  O   . ALA A 1 10 ? -0.333  5.111  4.397   1.00 47.26 ? 9   ALA A O   1 
ATOM   71  C  CB  . ALA A 1 10 ? 1.557   2.831  3.063   1.00 49.30 ? 9   ALA A CB  1 
ATOM   72  N  N   . LEU A 1 11 ? -1.436  3.176  4.087   1.00 46.97 ? 10  LEU A N   1 
ATOM   73  C  CA  . LEU A 1 11 ? -2.761  3.801  4.011   1.00 48.64 ? 10  LEU A CA  1 
ATOM   74  C  C   . LEU A 1 11 ? -3.171  4.446  5.326   1.00 49.23 ? 10  LEU A C   1 
ATOM   75  O  O   . LEU A 1 11 ? -3.674  5.598  5.359   1.00 49.02 ? 10  LEU A O   1 
ATOM   76  C  CB  . LEU A 1 11 ? -3.825  2.760  3.636   1.00 49.02 ? 10  LEU A CB  1 
ATOM   77  C  CG  . LEU A 1 11 ? -3.709  2.039  2.295   1.00 47.81 ? 10  LEU A CG  1 
ATOM   78  C  CD1 . LEU A 1 11 ? -4.884  1.083  2.187   1.00 49.08 ? 10  LEU A CD1 1 
ATOM   79  C  CD2 . LEU A 1 11 ? -3.792  3.114  1.200   1.00 48.26 ? 10  LEU A CD2 1 
ATOM   80  N  N   . ILE A 1 12 ? -2.946  3.717  6.420   1.00 49.43 ? 11  ILE A N   1 
ATOM   81  C  CA  . ILE A 1 12 ? -3.144  4.284  7.761   1.00 48.75 ? 11  ILE A CA  1 
ATOM   82  C  C   . ILE A 1 12 ? -2.262  5.522  8.010   1.00 50.02 ? 11  ILE A C   1 
ATOM   83  O  O   . ILE A 1 12 ? -2.731  6.567  8.503   1.00 50.12 ? 11  ILE A O   1 
ATOM   84  C  CB  . ILE A 1 12 ? -2.977  3.183  8.855   1.00 49.22 ? 11  ILE A CB  1 
ATOM   85  C  CG1 . ILE A 1 12 ? -4.056  2.098  8.645   1.00 47.34 ? 11  ILE A CG1 1 
ATOM   86  C  CG2 . ILE A 1 12 ? -3.090  3.770  10.300  1.00 50.32 ? 11  ILE A CG2 1 
ATOM   87  C  CD1 . ILE A 1 12 ? -3.905  0.826  9.475   1.00 49.35 ? 11  ILE A CD1 1 
ATOM   88  N  N   . ASP A 1 13 ? -0.986  5.389  7.687   1.00 49.32 ? 12  ASP A N   1 
ATOM   89  C  CA  . ASP A 1 13 ? 0.007   6.418  7.959   1.00 50.11 ? 12  ASP A CA  1 
ATOM   90  C  C   . ASP A 1 13 ? -0.286  7.711  7.203   1.00 49.32 ? 12  ASP A C   1 
ATOM   91  O  O   . ASP A 1 13 ? -0.290  8.782  7.821   1.00 48.56 ? 12  ASP A O   1 
ATOM   92  C  CB  . ASP A 1 13 ? 1.400   5.889  7.608   1.00 49.70 ? 12  ASP A CB  1 
ATOM   93  C  CG  . ASP A 1 13 ? 2.495   6.826  8.022   1.00 53.49 ? 12  ASP A CG  1 
ATOM   94  O  OD1 . ASP A 1 13 ? 2.836   6.892  9.237   1.00 52.68 ? 12  ASP A OD1 1 
ATOM   95  O  OD2 . ASP A 1 13 ? 3.011   7.521  7.115   1.00 56.52 ? 12  ASP A OD2 1 
ATOM   96  N  N   . VAL A 1 14 ? -0.550  7.631  5.885   1.00 48.56 ? 13  VAL A N   1 
ATOM   97  C  CA  . VAL A 1 14 ? -0.766  8.855  5.111   1.00 49.14 ? 13  VAL A CA  1 
ATOM   98  C  C   . VAL A 1 14 ? -1.997  9.529  5.659   1.00 49.84 ? 13  VAL A C   1 
ATOM   99  O  O   . VAL A 1 14 ? -2.000  10.723 5.839   1.00 50.06 ? 13  VAL A O   1 
ATOM   100 C  CB  . VAL A 1 14 ? -0.840  8.684  3.539   1.00 48.77 ? 13  VAL A CB  1 
ATOM   101 C  CG1 . VAL A 1 14 ? -2.189  8.150  3.093   1.00 48.67 ? 13  VAL A CG1 1 
ATOM   102 C  CG2 . VAL A 1 14 ? -0.540  10.033 2.811   1.00 48.17 ? 13  VAL A CG2 1 
ATOM   103 N  N   . PHE A 1 15 ? -3.038  8.758  5.955   1.00 49.60 ? 14  PHE A N   1 
ATOM   104 C  CA  . PHE A 1 15 ? -4.251  9.369  6.515   1.00 49.67 ? 14  PHE A CA  1 
ATOM   105 C  C   . PHE A 1 15 ? -3.964  10.260 7.747   1.00 49.66 ? 14  PHE A C   1 
ATOM   106 O  O   . PHE A 1 15 ? -4.468  11.374 7.850   1.00 50.39 ? 14  PHE A O   1 
ATOM   107 C  CB  . PHE A 1 15 ? -5.348  8.314  6.785   1.00 47.69 ? 14  PHE A CB  1 
ATOM   108 C  CG  . PHE A 1 15 ? -6.626  8.913  7.359   1.00 48.02 ? 14  PHE A CG  1 
ATOM   109 C  CD1 . PHE A 1 15 ? -7.596  9.472  6.517   1.00 44.44 ? 14  PHE A CD1 1 
ATOM   110 C  CD2 . PHE A 1 15 ? -6.839  8.943  8.746   1.00 48.30 ? 14  PHE A CD2 1 
ATOM   111 C  CE1 . PHE A 1 15 ? -8.771  10.065 7.048   1.00 45.44 ? 14  PHE A CE1 1 
ATOM   112 C  CE2 . PHE A 1 15 ? -7.999  9.540  9.295   1.00 47.16 ? 14  PHE A CE2 1 
ATOM   113 C  CZ  . PHE A 1 15 ? -8.970  10.088 8.436   1.00 46.56 ? 14  PHE A CZ  1 
ATOM   114 N  N   . HIS A 1 16 ? -3.158  9.754  8.675   1.00 50.29 ? 15  HIS A N   1 
ATOM   115 C  CA  . HIS A 1 16 ? -2.914  10.408 9.944   1.00 50.48 ? 15  HIS A CA  1 
ATOM   116 C  C   . HIS A 1 16 ? -1.941  11.569 9.771   1.00 49.97 ? 15  HIS A C   1 
ATOM   117 O  O   . HIS A 1 16 ? -2.032  12.574 10.449  1.00 50.33 ? 15  HIS A O   1 
ATOM   118 C  CB  . HIS A 1 16 ? -2.354  9.377  10.914  1.00 51.19 ? 15  HIS A CB  1 
ATOM   119 C  CG  . HIS A 1 16 ? -3.379  8.456  11.494  1.00 53.05 ? 15  HIS A CG  1 
ATOM   120 N  ND1 . HIS A 1 16 ? -3.182  7.097  11.585  1.00 57.11 ? 15  HIS A ND1 1 
ATOM   121 C  CD2 . HIS A 1 16 ? -4.587  8.698  12.060  1.00 53.77 ? 15  HIS A CD2 1 
ATOM   122 C  CE1 . HIS A 1 16 ? -4.218  6.543  12.194  1.00 57.22 ? 15  HIS A CE1 1 
ATOM   123 N  NE2 . HIS A 1 16 ? -5.093  7.489  12.473  1.00 52.42 ? 15  HIS A NE2 1 
ATOM   124 N  N   . GLN A 1 17 ? -1.020  11.424 8.829   1.00 49.78 ? 16  GLN A N   1 
ATOM   125 C  CA  . GLN A 1 17 ? -0.148  12.522 8.440   1.00 50.13 ? 16  GLN A CA  1 
ATOM   126 C  C   . GLN A 1 17 ? -0.961  13.780 8.122   1.00 49.59 ? 16  GLN A C   1 
ATOM   127 O  O   . GLN A 1 17 ? -0.628  14.861 8.594   1.00 49.18 ? 16  GLN A O   1 
ATOM   128 C  CB  . GLN A 1 17 ? 0.741   12.127 7.256   1.00 49.55 ? 16  GLN A CB  1 
ATOM   129 C  CG  . GLN A 1 17 ? 1.918   11.291 7.670   1.00 52.56 ? 16  GLN A CG  1 
ATOM   130 C  CD  . GLN A 1 17 ? 2.633   10.600 6.506   1.00 56.74 ? 16  GLN A CD  1 
ATOM   131 O  OE1 . GLN A 1 17 ? 2.399   10.898 5.329   1.00 56.30 ? 16  GLN A OE1 1 
ATOM   132 N  NE2 . GLN A 1 17 ? 3.529   9.671  6.845   1.00 57.39 ? 16  GLN A NE2 1 
ATOM   133 N  N   . TYR A 1 18 ? -2.037  13.631 7.347   1.00 48.76 ? 17  TYR A N   1 
ATOM   134 C  CA  . TYR A 1 18 ? -2.821  14.787 6.911   1.00 48.44 ? 17  TYR A CA  1 
ATOM   135 C  C   . TYR A 1 18 ? -3.982  15.155 7.823   1.00 48.89 ? 17  TYR A C   1 
ATOM   136 O  O   . TYR A 1 18 ? -4.205  16.321 8.079   1.00 49.38 ? 17  TYR A O   1 
ATOM   137 C  CB  . TYR A 1 18 ? -3.249  14.652 5.440   1.00 48.51 ? 17  TYR A CB  1 
ATOM   138 C  CG  . TYR A 1 18 ? -2.038  14.806 4.507   1.00 47.98 ? 17  TYR A CG  1 
ATOM   139 C  CD1 . TYR A 1 18 ? -1.219  13.713 4.189   1.00 49.36 ? 17  TYR A CD1 1 
ATOM   140 C  CD2 . TYR A 1 18 ? -1.691  16.055 4.008   1.00 48.13 ? 17  TYR A CD2 1 
ATOM   141 C  CE1 . TYR A 1 18 ? -0.083  13.862 3.359   1.00 49.51 ? 17  TYR A CE1 1 
ATOM   142 C  CE2 . TYR A 1 18 ? -0.583  16.225 3.172   1.00 47.66 ? 17  TYR A CE2 1 
ATOM   143 C  CZ  . TYR A 1 18 ? 0.224   15.139 2.866   1.00 50.36 ? 17  TYR A CZ  1 
ATOM   144 O  OH  . TYR A 1 18 ? 1.325   15.373 2.070   1.00 49.20 ? 17  TYR A OH  1 
ATOM   145 N  N   . SER A 1 19 ? -4.713  14.171 8.318   1.00 48.70 ? 18  SER A N   1 
ATOM   146 C  CA  . SER A 1 19 ? -5.836  14.422 9.210   1.00 48.40 ? 18  SER A CA  1 
ATOM   147 C  C   . SER A 1 19 ? -5.470  15.087 10.568  1.00 49.47 ? 18  SER A C   1 
ATOM   148 O  O   . SER A 1 19 ? -6.298  15.816 11.169  1.00 48.27 ? 18  SER A O   1 
ATOM   149 C  CB  . SER A 1 19 ? -6.603  13.120 9.430   1.00 47.93 ? 18  SER A CB  1 
ATOM   150 O  OG  . SER A 1 19 ? -5.916  12.288 10.353  1.00 49.96 ? 18  SER A OG  1 
ATOM   151 N  N   . GLY A 1 20 ? -4.254  14.833 11.047  1.00 49.47 ? 19  GLY A N   1 
ATOM   152 C  CA  . GLY A 1 20 ? -3.811  15.356 12.333  1.00 50.46 ? 19  GLY A CA  1 
ATOM   153 C  C   . GLY A 1 20 ? -3.194  16.746 12.278  1.00 50.88 ? 19  GLY A C   1 
ATOM   154 O  O   . GLY A 1 20 ? -2.645  17.214 13.277  1.00 50.30 ? 19  GLY A O   1 
ATOM   155 N  N   . ARG A 1 21 ? -3.263  17.391 11.112  1.00 51.00 ? 20  ARG A N   1 
ATOM   156 C  CA  . ARG A 1 21 ? -2.728  18.734 10.932  1.00 51.19 ? 20  ARG A CA  1 
ATOM   157 C  C   . ARG A 1 21 ? -3.560  19.791 11.676  1.00 51.37 ? 20  ARG A C   1 
ATOM   158 O  O   . ARG A 1 21 ? -3.004  20.607 12.409  1.00 51.18 ? 20  ARG A O   1 
ATOM   159 C  CB  . ARG A 1 21 ? -2.605  19.081 9.441   1.00 51.84 ? 20  ARG A CB  1 
ATOM   160 C  CG  . ARG A 1 21 ? -1.458  18.378 8.700   1.00 51.65 ? 20  ARG A CG  1 
ATOM   161 C  CD  . ARG A 1 21 ? -1.362  18.818 7.229   1.00 51.84 ? 20  ARG A CD  1 
ATOM   162 N  NE  . ARG A 1 21 ? -0.103  18.376 6.616   1.00 52.05 ? 20  ARG A NE  1 
ATOM   163 C  CZ  . ARG A 1 21 ? 0.305   18.668 5.378   1.00 50.76 ? 20  ARG A CZ  1 
ATOM   164 N  NH1 . ARG A 1 21 ? -0.448  19.388 4.554   1.00 50.56 ? 20  ARG A NH1 1 
ATOM   165 N  NH2 . ARG A 1 21 ? 1.470   18.228 4.948   1.00 47.96 ? 20  ARG A NH2 1 
ATOM   166 N  N   . GLU A 1 22 ? -4.878  19.781 11.486  1.00 51.49 ? 21  GLU A N   1 
ATOM   167 C  CA  . GLU A 1 22 ? -5.759  20.798 12.095  1.00 52.29 ? 21  GLU A CA  1 
ATOM   168 C  C   . GLU A 1 22 ? -7.093  20.211 12.482  1.00 51.98 ? 21  GLU A C   1 
ATOM   169 O  O   . GLU A 1 22 ? -7.542  19.215 11.910  1.00 52.39 ? 21  GLU A O   1 
ATOM   170 C  CB  . GLU A 1 22 ? -6.051  21.977 11.153  1.00 51.99 ? 21  GLU A CB  1 
ATOM   171 C  CG  . GLU A 1 22 ? -5.117  22.141 9.987   1.00 52.56 ? 21  GLU A CG  1 
ATOM   172 C  CD  . GLU A 1 22 ? -5.356  23.434 9.233   1.00 53.34 ? 21  GLU A CD  1 
ATOM   173 O  OE1 . GLU A 1 22 ? -4.913  24.488 9.740   1.00 53.03 ? 21  GLU A OE1 1 
ATOM   174 N  N   . GLY A 1 23 ? -7.745  20.877 13.428  1.00 52.10 ? 22  GLY A N   1 
ATOM   175 C  CA  . GLY A 1 23 ? -9.054  20.481 13.888  1.00 51.57 ? 22  GLY A CA  1 
ATOM   176 C  C   . GLY A 1 23 ? -9.055  19.034 14.318  1.00 51.15 ? 22  GLY A C   1 
ATOM   177 O  O   . GLY A 1 23 ? -8.119  18.572 14.981  1.00 51.06 ? 22  GLY A O   1 
ATOM   178 N  N   . ASP A 1 24 ? -10.110 18.330 13.922  1.00 50.59 ? 23  ASP A N   1 
ATOM   179 C  CA  . ASP A 1 24 ? -10.297 16.947 14.278  1.00 50.69 ? 23  ASP A CA  1 
ATOM   180 C  C   . ASP A 1 24 ? -9.076  16.167 13.803  1.00 50.73 ? 23  ASP A C   1 
ATOM   181 O  O   . ASP A 1 24 ? -8.864  16.034 12.609  1.00 51.93 ? 23  ASP A O   1 
ATOM   182 C  CB  . ASP A 1 24 ? -11.597 16.426 13.648  1.00 50.05 ? 23  ASP A CB  1 
ATOM   183 C  CG  . ASP A 1 24 ? -11.926 15.002 14.051  1.00 50.09 ? 23  ASP A CG  1 
ATOM   184 O  OD1 . ASP A 1 24 ? -11.004 14.174 14.268  1.00 48.96 ? 23  ASP A OD1 1 
ATOM   185 O  OD2 . ASP A 1 24 ? -13.130 14.698 14.134  1.00 50.80 ? 23  ASP A OD2 1 
ATOM   186 N  N   . LYS A 1 25 ? -8.261  15.692 14.745  1.00 51.01 ? 24  LYS A N   1 
ATOM   187 C  CA  . LYS A 1 25 ? -7.031  14.956 14.436  1.00 50.46 ? 24  LYS A CA  1 
ATOM   188 C  C   . LYS A 1 25 ? -7.311  13.696 13.620  1.00 50.39 ? 24  LYS A C   1 
ATOM   189 O  O   . LYS A 1 25 ? -6.388  13.114 13.049  1.00 50.29 ? 24  LYS A O   1 
ATOM   190 C  CB  . LYS A 1 25 ? -6.280  14.571 15.726  1.00 50.23 ? 24  LYS A CB  1 
ATOM   191 C  CG  . LYS A 1 25 ? -5.461  15.686 16.393  1.00 50.56 ? 24  LYS A CG  1 
ATOM   192 N  N   . HIS A 1 26 ? -8.575  13.264 13.597  1.00 50.59 ? 25  HIS A N   1 
ATOM   193 C  CA  . HIS A 1 26 ? -8.997  12.055 12.862  1.00 50.53 ? 25  HIS A CA  1 
ATOM   194 C  C   . HIS A 1 26 ? -9.891  12.227 11.630  1.00 50.67 ? 25  HIS A C   1 
ATOM   195 O  O   . HIS A 1 26 ? -10.540 11.272 11.206  1.00 51.78 ? 25  HIS A O   1 
ATOM   196 C  CB  . HIS A 1 26 ? -9.726  11.119 13.792  1.00 51.14 ? 25  HIS A CB  1 
ATOM   197 C  CG  . HIS A 1 26 ? -8.914  9.941  14.185  1.00 51.08 ? 25  HIS A CG  1 
ATOM   198 N  ND1 . HIS A 1 26 ? -8.682  9.604  15.499  1.00 53.18 ? 25  HIS A ND1 1 
ATOM   199 C  CD2 . HIS A 1 26 ? -8.252  9.037  13.435  1.00 49.70 ? 25  HIS A CD2 1 
ATOM   200 C  CE1 . HIS A 1 26 ? -7.922  8.525  15.537  1.00 53.01 ? 25  HIS A CE1 1 
ATOM   201 N  NE2 . HIS A 1 26 ? -7.642  8.169  14.297  1.00 50.20 ? 25  HIS A NE2 1 
ATOM   202 N  N   . LYS A 1 27 ? -9.960  13.425 11.067  1.00 49.96 ? 26  LYS A N   1 
ATOM   203 C  CA  . LYS A 1 27 ? -10.727 13.628 9.846   1.00 49.16 ? 26  LYS A CA  1 
ATOM   204 C  C   . LYS A 1 27 ? -9.920  14.592 8.993   1.00 49.50 ? 26  LYS A C   1 
ATOM   205 O  O   . LYS A 1 27 ? -9.212  15.453 9.517   1.00 50.14 ? 26  LYS A O   1 
ATOM   206 C  CB  . LYS A 1 27 ? -12.131 14.215 10.120  1.00 49.42 ? 26  LYS A CB  1 
ATOM   207 C  CG  . LYS A 1 27 ? -13.051 13.375 11.034  1.00 47.06 ? 26  LYS A CG  1 
ATOM   208 C  CD  . LYS A 1 27 ? -14.420 14.001 11.172  1.00 49.45 ? 26  LYS A CD  1 
ATOM   209 N  N   . LEU A 1 28 ? -10.036 14.432 7.681   1.00 48.41 ? 27  LEU A N   1 
ATOM   210 C  CA  . LEU A 1 28 ? -9.393  15.308 6.729   1.00 48.08 ? 27  LEU A CA  1 
ATOM   211 C  C   . LEU A 1 28 ? -10.390 16.431 6.453   1.00 47.99 ? 27  LEU A C   1 
ATOM   212 O  O   . LEU A 1 28 ? -11.484 16.205 5.931   1.00 47.13 ? 27  LEU A O   1 
ATOM   213 C  CB  . LEU A 1 28 ? -9.087  14.544 5.421   1.00 47.88 ? 27  LEU A CB  1 
ATOM   214 C  CG  . LEU A 1 28 ? -8.139  13.339 5.439   1.00 49.59 ? 27  LEU A CG  1 
ATOM   215 C  CD1 . LEU A 1 28 ? -8.268  12.509 4.147   1.00 53.22 ? 27  LEU A CD1 1 
ATOM   216 C  CD2 . LEU A 1 28 ? -6.687  13.801 5.550   1.00 49.37 ? 27  LEU A CD2 1 
ATOM   217 N  N   . LYS A 1 29 ? -10.028 17.645 6.840   1.00 47.87 ? 28  LYS A N   1 
ATOM   218 C  CA  . LYS A 1 29 ? -10.787 18.796 6.392   1.00 48.69 ? 28  LYS A CA  1 
ATOM   219 C  C   . LYS A 1 29 ? -10.288 19.110 4.984   1.00 48.48 ? 28  LYS A C   1 
ATOM   220 O  O   . LYS A 1 29 ? -9.291  18.540 4.528   1.00 47.83 ? 28  LYS A O   1 
ATOM   221 C  CB  . LYS A 1 29 ? -10.613 20.001 7.311   1.00 48.99 ? 28  LYS A CB  1 
ATOM   222 C  CG  . LYS A 1 29 ? -9.174  20.288 7.691   1.00 51.60 ? 28  LYS A CG  1 
ATOM   223 C  CD  . LYS A 1 29 ? -8.893  21.794 7.883   1.00 53.18 ? 28  LYS A CD  1 
ATOM   224 C  CE  . LYS A 1 29 ? -9.867  22.454 8.829   1.00 57.28 ? 28  LYS A CE  1 
ATOM   225 N  NZ  . LYS A 1 29 ? -9.985  21.697 10.116  1.00 59.90 ? 28  LYS A NZ  1 
ATOM   226 N  N   . LYS A 1 30 ? -11.010 19.987 4.303   1.00 48.20 ? 29  LYS A N   1 
ATOM   227 C  CA  . LYS A 1 30 ? -10.714 20.332 2.904   1.00 48.16 ? 29  LYS A CA  1 
ATOM   228 C  C   . LYS A 1 30 ? -9.261  20.651 2.589   1.00 48.10 ? 29  LYS A C   1 
ATOM   229 O  O   . LYS A 1 30 ? -8.736  20.152 1.594   1.00 47.26 ? 29  LYS A O   1 
ATOM   230 C  CB  . LYS A 1 30 ? -11.555 21.518 2.476   1.00 47.09 ? 29  LYS A CB  1 
ATOM   231 C  CG  . LYS A 1 30 ? -12.967 21.195 2.088   1.00 47.30 ? 29  LYS A CG  1 
ATOM   232 C  CD  . LYS A 1 30 ? -13.618 22.563 1.795   1.00 45.95 ? 29  LYS A CD  1 
ATOM   233 C  CE  . LYS A 1 30 ? -15.101 22.509 1.609   1.00 46.54 ? 29  LYS A CE  1 
ATOM   234 N  NZ  . LYS A 1 30 ? -15.565 23.787 0.978   1.00 43.28 ? 29  LYS A NZ  1 
ATOM   235 N  N   . SER A 1 31 ? -8.635  21.526 3.393   1.00 48.69 ? 30  SER A N   1 
ATOM   236 C  CA  . SER A 1 31 ? -7.227  21.867 3.168   1.00 48.54 ? 30  SER A CA  1 
ATOM   237 C  C   . SER A 1 31 ? -6.277  20.663 3.391   1.00 49.29 ? 30  SER A C   1 
ATOM   238 O  O   . SER A 1 31 ? -5.255  20.521 2.685   1.00 49.11 ? 30  SER A O   1 
ATOM   239 C  CB  . SER A 1 31 ? -6.822  23.053 4.021   1.00 48.60 ? 30  SER A CB  1 
ATOM   240 O  OG  . SER A 1 31 ? -6.897  22.660 5.369   1.00 48.18 ? 30  SER A OG  1 
ATOM   241 N  N   . GLU A 1 32 ? -6.598  19.785 4.338   1.00 48.54 ? 31  GLU A N   1 
ATOM   242 C  CA  . GLU A 1 32 ? -5.778  18.568 4.504   1.00 49.38 ? 31  GLU A CA  1 
ATOM   243 C  C   . GLU A 1 32 ? -5.955  17.619 3.323   1.00 49.43 ? 31  GLU A C   1 
ATOM   244 O  O   . GLU A 1 32 ? -4.999  17.056 2.792   1.00 50.54 ? 31  GLU A O   1 
ATOM   245 C  CB  . GLU A 1 32 ? -6.157  17.865 5.799   1.00 48.63 ? 31  GLU A CB  1 
ATOM   246 C  CG  . GLU A 1 32 ? -5.698  18.638 7.029   1.00 49.21 ? 31  GLU A CG  1 
ATOM   247 C  CD  . GLU A 1 32 ? -6.390  18.176 8.276   1.00 48.18 ? 31  GLU A CD  1 
ATOM   248 O  OE1 . GLU A 1 32 ? -7.422  17.477 8.157   1.00 48.64 ? 31  GLU A OE1 1 
ATOM   249 O  OE2 . GLU A 1 32 ? -5.929  18.530 9.386   1.00 47.59 ? 31  GLU A OE2 1 
ATOM   250 N  N   . LEU A 1 33 ? -7.207  17.403 2.939   1.00 50.09 ? 32  LEU A N   1 
ATOM   251 C  CA  . LEU A 1 33 ? -7.548  16.602 1.752   1.00 49.80 ? 32  LEU A CA  1 
ATOM   252 C  C   . LEU A 1 33 ? -6.785  17.066 0.486   1.00 49.42 ? 32  LEU A C   1 
ATOM   253 O  O   . LEU A 1 33 ? -6.168  16.241 -0.224  1.00 48.97 ? 32  LEU A O   1 
ATOM   254 C  CB  . LEU A 1 33 ? -9.062  16.669 1.513   1.00 49.96 ? 32  LEU A CB  1 
ATOM   255 C  CG  . LEU A 1 33 ? -9.810  15.495 0.863   1.00 53.49 ? 32  LEU A CG  1 
ATOM   256 C  CD1 . LEU A 1 33 ? -10.993 15.922 -0.011  1.00 54.41 ? 32  LEU A CD1 1 
ATOM   257 C  CD2 . LEU A 1 33 ? -8.956  14.419 0.177   1.00 51.81 ? 32  LEU A CD2 1 
ATOM   258 N  N   . LYS A 1 34 ? -6.823  18.371 0.214   1.00 49.72 ? 33  LYS A N   1 
ATOM   259 C  CA  . LYS A 1 34 ? -6.122  18.987 -0.925  1.00 49.70 ? 33  LYS A CA  1 
ATOM   260 C  C   . LYS A 1 34 ? -4.602  18.697 -0.970  1.00 49.45 ? 33  LYS A C   1 
ATOM   261 O  O   . LYS A 1 34 ? -4.045  18.312 -2.012  1.00 48.51 ? 33  LYS A O   1 
ATOM   262 C  CB  . LYS A 1 34 ? -6.392  20.516 -0.948  1.00 49.40 ? 33  LYS A CB  1 
ATOM   263 C  CG  . LYS A 1 34 ? -5.574  21.285 -2.007  1.00 49.46 ? 33  LYS A CG  1 
ATOM   264 C  CD  . LYS A 1 34 ? -5.703  22.793 -1.884  1.00 49.63 ? 33  LYS A CD  1 
ATOM   265 C  CE  . LYS A 1 34 ? -4.389  23.491 -2.166  1.00 51.75 ? 33  LYS A CE  1 
ATOM   266 N  NZ  . LYS A 1 34 ? -4.509  24.981 -1.846  1.00 54.75 ? 33  LYS A NZ  1 
ATOM   267 N  N   . GLU A 1 35 ? -3.949  18.858 0.180   1.00 50.20 ? 34  GLU A N   1 
ATOM   268 C  CA  . GLU A 1 35 ? -2.524  18.659 0.302   1.00 49.09 ? 34  GLU A CA  1 
ATOM   269 C  C   . GLU A 1 35 ? -2.208  17.176 0.150   1.00 49.98 ? 34  GLU A C   1 
ATOM   270 O  O   . GLU A 1 35 ? -1.197  16.810 -0.450  1.00 49.37 ? 34  GLU A O   1 
ATOM   271 C  CB  . GLU A 1 35 ? -2.037  19.193 1.661   1.00 49.95 ? 34  GLU A CB  1 
ATOM   272 C  CG  . GLU A 1 35 ? -2.216  20.747 1.925   1.00 51.05 ? 34  GLU A CG  1 
ATOM   273 C  CD  . GLU A 1 35 ? -1.726  21.703 0.814   1.00 52.77 ? 34  GLU A CD  1 
ATOM   274 O  OE1 . GLU A 1 35 ? -1.290  21.248 -0.278  1.00 51.98 ? 34  GLU A OE1 1 
ATOM   275 O  OE2 . GLU A 1 35 ? -1.782  22.961 1.041   1.00 53.71 ? 34  GLU A OE2 1 
ATOM   276 N  N   . LEU A 1 36 ? -3.089  16.309 0.663   1.00 49.24 ? 35  LEU A N   1 
ATOM   277 C  CA  . LEU A 1 36 ? -2.842  14.878 0.560   1.00 49.86 ? 35  LEU A CA  1 
ATOM   278 C  C   . LEU A 1 36 ? -2.797  14.527 -0.935  1.00 49.90 ? 35  LEU A C   1 
ATOM   279 O  O   . LEU A 1 36 ? -1.862  13.860 -1.407  1.00 49.73 ? 35  LEU A O   1 
ATOM   280 C  CB  . LEU A 1 36 ? -3.910  14.060 1.313   1.00 48.05 ? 35  LEU A CB  1 
ATOM   281 C  CG  . LEU A 1 36 ? -3.758  12.525 1.334   1.00 51.25 ? 35  LEU A CG  1 
ATOM   282 C  CD1 . LEU A 1 36 ? -4.390  11.941 2.626   1.00 55.02 ? 35  LEU A CD1 1 
ATOM   283 C  CD2 . LEU A 1 36 ? -4.322  11.773 0.062   1.00 54.49 ? 35  LEU A CD2 1 
ATOM   284 N  N   . ILE A 1 37 ? -3.792  15.031 -1.664  1.00 49.20 ? 36  ILE A N   1 
ATOM   285 C  CA  . ILE A 1 37 ? -3.934  14.783 -3.105  1.00 50.15 ? 36  ILE A CA  1 
ATOM   286 C  C   . ILE A 1 37 ? -2.757  15.386 -3.869  1.00 49.70 ? 36  ILE A C   1 
ATOM   287 O  O   . ILE A 1 37 ? -2.146  14.740 -4.736  1.00 50.47 ? 36  ILE A O   1 
ATOM   288 C  CB  . ILE A 1 37 ? -5.283  15.309 -3.631  1.00 48.80 ? 36  ILE A CB  1 
ATOM   289 C  CG1 . ILE A 1 37 ? -6.432  14.378 -3.194  1.00 51.03 ? 36  ILE A CG1 1 
ATOM   290 C  CG2 . ILE A 1 37 ? -5.307  15.448 -5.158  1.00 49.70 ? 36  ILE A CG2 1 
ATOM   291 C  CD1 . ILE A 1 37 ? -7.803  14.909 -3.627  1.00 50.58 ? 36  ILE A CD1 1 
ATOM   292 N  N   . ASN A 1 38 ? -2.396  16.605 -3.512  1.00 49.94 ? 37  ASN A N   1 
ATOM   293 C  CA  . ASN A 1 38 ? -1.379  17.304 -4.260  1.00 49.35 ? 37  ASN A CA  1 
ATOM   294 C  C   . ASN A 1 38 ? 0.000   16.701 -4.044  1.00 50.36 ? 37  ASN A C   1 
ATOM   295 O  O   . ASN A 1 38 ? 0.848   16.646 -4.966  1.00 49.76 ? 37  ASN A O   1 
ATOM   296 C  CB  . ASN A 1 38 ? -1.420  18.790 -3.899  1.00 49.90 ? 37  ASN A CB  1 
ATOM   297 C  CG  . ASN A 1 38 ? -2.551  19.550 -4.634  1.00 51.03 ? 37  ASN A CG  1 
ATOM   298 O  OD1 . ASN A 1 38 ? -2.748  20.772 -4.452  1.00 52.86 ? 37  ASN A OD1 1 
ATOM   299 N  ND2 . ASN A 1 38 ? -3.269  18.845 -5.457  1.00 47.10 ? 37  ASN A ND2 1 
ATOM   300 N  N   . ASN A 1 39 ? 0.246   16.255 -2.830  1.00 50.73 ? 38  ASN A N   1 
ATOM   301 C  CA  . ASN A 1 39 ? 1.607   15.894 -2.464  1.00 50.71 ? 38  ASN A CA  1 
ATOM   302 C  C   . ASN A 1 39 ? 1.770   14.420 -2.679  1.00 50.62 ? 38  ASN A C   1 
ATOM   303 O  O   . ASN A 1 39 ? 2.863   13.990 -3.028  1.00 50.20 ? 38  ASN A O   1 
ATOM   304 C  CB  . ASN A 1 39 ? 1.891   16.206 -0.999  1.00 51.20 ? 38  ASN A CB  1 
ATOM   305 C  CG  . ASN A 1 39 ? 1.840   17.706 -0.677  1.00 51.59 ? 38  ASN A CG  1 
ATOM   306 O  OD1 . ASN A 1 39 ? 2.018   18.571 -1.538  1.00 49.66 ? 38  ASN A OD1 1 
ATOM   307 N  ND2 . ASN A 1 39 ? 1.586   18.008 0.573   1.00 51.00 ? 38  ASN A ND2 1 
ATOM   308 N  N   . GLU A 1 40 ? 0.680   13.658 -2.491  1.00 49.49 ? 39  GLU A N   1 
ATOM   309 C  CA  . GLU A 1 40 ? 0.754   12.166 -2.407  1.00 48.70 ? 39  GLU A CA  1 
ATOM   310 C  C   . GLU A 1 40 ? 0.123   11.393 -3.552  1.00 48.22 ? 39  GLU A C   1 
ATOM   311 O  O   . GLU A 1 40 ? 0.356   10.158 -3.694  1.00 49.17 ? 39  GLU A O   1 
ATOM   312 C  CB  . GLU A 1 40 ? 0.203   11.653 -1.080  1.00 48.84 ? 39  GLU A CB  1 
ATOM   313 C  CG  . GLU A 1 40 ? 0.606   12.485 0.129   1.00 47.13 ? 39  GLU A CG  1 
ATOM   314 C  CD  . GLU A 1 40 ? 2.118   12.554 0.363   1.00 49.88 ? 39  GLU A CD  1 
ATOM   315 O  OE1 . GLU A 1 40 ? 2.874   11.731 -0.216  1.00 50.86 ? 39  GLU A OE1 1 
ATOM   316 O  OE2 . GLU A 1 40 ? 2.563   13.427 1.158   1.00 45.97 ? 39  GLU A OE2 1 
ATOM   317 N  N   . LEU A 1 41 ? -0.647  12.096 -4.378  1.00 46.67 ? 40  LEU A N   1 
ATOM   318 C  CA  . LEU A 1 41 ? -1.277  11.471 -5.554  1.00 47.57 ? 40  LEU A CA  1 
ATOM   319 C  C   . LEU A 1 41 ? -0.913  12.164 -6.876  1.00 47.71 ? 40  LEU A C   1 
ATOM   320 O  O   . LEU A 1 41 ? -1.689  12.122 -7.846  1.00 48.60 ? 40  LEU A O   1 
ATOM   321 C  CB  . LEU A 1 41 ? -2.783  11.366 -5.345  1.00 47.68 ? 40  LEU A CB  1 
ATOM   322 C  CG  . LEU A 1 41 ? -3.177  10.312 -4.292  1.00 47.14 ? 40  LEU A CG  1 
ATOM   323 C  CD1 . LEU A 1 41 ? -4.584  10.562 -3.801  1.00 47.62 ? 40  LEU A CD1 1 
ATOM   324 C  CD2 . LEU A 1 41 ? -2.980  8.845  -4.784  1.00 50.61 ? 40  LEU A CD2 1 
ATOM   325 N  N   . SER A 1 42 ? 0.294   12.742 -6.937  1.00 46.59 ? 41  SER A N   1 
ATOM   326 C  CA  . SER A 1 42 ? 0.678   13.580 -8.069  1.00 46.40 ? 41  SER A CA  1 
ATOM   327 C  C   . SER A 1 42 ? 0.830   12.788 -9.389  1.00 46.82 ? 41  SER A C   1 
ATOM   328 O  O   . SER A 1 42 ? 0.789   13.382 -10.442 1.00 46.35 ? 41  SER A O   1 
ATOM   329 C  CB  . SER A 1 42 ? 1.989   14.367 -7.782  1.00 45.60 ? 41  SER A CB  1 
ATOM   330 O  OG  . SER A 1 42 ? 3.128   13.498 -7.817  1.00 47.69 ? 41  SER A OG  1 
ATOM   331 N  N   . HIS A 1 43 ? 1.049   11.472 -9.329  1.00 46.72 ? 42  HIS A N   1 
ATOM   332 C  CA  . HIS A 1 43 ? 1.140   10.641 -10.551 1.00 47.86 ? 42  HIS A CA  1 
ATOM   333 C  C   . HIS A 1 43 ? -0.198  10.062 -10.993 1.00 48.38 ? 42  HIS A C   1 
ATOM   334 O  O   . HIS A 1 43 ? -0.318  9.574  -12.134 1.00 50.22 ? 42  HIS A O   1 
ATOM   335 C  CB  . HIS A 1 43 ? 2.185   9.519  -10.369 1.00 47.63 ? 42  HIS A CB  1 
ATOM   336 C  CG  . HIS A 1 43 ? 3.531   10.030 -9.943  1.00 49.18 ? 42  HIS A CG  1 
ATOM   337 N  ND1 . HIS A 1 43 ? 3.917   10.119 -8.624  1.00 48.77 ? 42  HIS A ND1 1 
ATOM   338 C  CD2 . HIS A 1 43 ? 4.573   10.506 -10.668 1.00 50.10 ? 42  HIS A CD2 1 
ATOM   339 C  CE1 . HIS A 1 43 ? 5.142   10.614 -8.554  1.00 48.18 ? 42  HIS A CE1 1 
ATOM   340 N  NE2 . HIS A 1 43 ? 5.553   10.872 -9.777  1.00 50.55 ? 42  HIS A NE2 1 
ATOM   341 N  N   . PHE A 1 44 ? -1.180  10.068 -10.095 1.00 47.81 ? 43  PHE A N   1 
ATOM   342 C  CA  . PHE A 1 44 ? -2.517  9.493  -10.383 1.00 49.70 ? 43  PHE A CA  1 
ATOM   343 C  C   . PHE A 1 44 ? -3.615  10.542 -10.596 1.00 49.23 ? 43  PHE A C   1 
ATOM   344 O  O   . PHE A 1 44 ? -4.581  10.274 -11.310 1.00 51.30 ? 43  PHE A O   1 
ATOM   345 C  CB  . PHE A 1 44 ? -2.971  8.479  -9.301  1.00 48.70 ? 43  PHE A CB  1 
ATOM   346 C  CG  . PHE A 1 44 ? -2.053  7.282  -9.134  1.00 49.99 ? 43  PHE A CG  1 
ATOM   347 C  CD1 . PHE A 1 44 ? -1.154  6.917  -10.121 1.00 51.30 ? 43  PHE A CD1 1 
ATOM   348 C  CD2 . PHE A 1 44 ? -2.151  6.478  -8.016  1.00 50.12 ? 43  PHE A CD2 1 
ATOM   349 C  CE1 . PHE A 1 44 ? -0.340  5.789  -9.974  1.00 50.84 ? 43  PHE A CE1 1 
ATOM   350 C  CE2 . PHE A 1 44 ? -1.342  5.336  -7.886  1.00 51.87 ? 43  PHE A CE2 1 
ATOM   351 C  CZ  . PHE A 1 44 ? -0.444  5.023  -8.854  1.00 48.89 ? 43  PHE A CZ  1 
ATOM   352 N  N   . LEU A 1 45 ? -3.462  11.720 -10.006 1.00 49.54 ? 44  LEU A N   1 
ATOM   353 C  CA  . LEU A 1 45 ? -4.471  12.781 -10.086 1.00 48.62 ? 44  LEU A CA  1 
ATOM   354 C  C   . LEU A 1 45 ? -3.856  14.140 -10.435 1.00 49.41 ? 44  LEU A C   1 
ATOM   355 O  O   . LEU A 1 45 ? -2.762  14.461 -9.954  1.00 48.82 ? 44  LEU A O   1 
ATOM   356 C  CB  . LEU A 1 45 ? -5.202  12.901 -8.735  1.00 49.15 ? 44  LEU A CB  1 
ATOM   357 C  CG  . LEU A 1 45 ? -6.052  11.763 -8.149  1.00 50.57 ? 44  LEU A CG  1 
ATOM   358 C  CD1 . LEU A 1 45 ? -6.786  12.202 -6.889  1.00 47.00 ? 44  LEU A CD1 1 
ATOM   359 C  CD2 . LEU A 1 45 ? -7.025  11.122 -9.162  1.00 52.70 ? 44  LEU A CD2 1 
ATOM   360 N  N   . GLU A 1 46 ? -4.558  14.947 -11.242 1.00 50.11 ? 45  GLU A N   1 
ATOM   361 C  CA  . GLU A 1 46 ? -4.084  16.314 -11.581 1.00 51.20 ? 45  GLU A CA  1 
ATOM   362 C  C   . GLU A 1 46 ? -3.978  17.144 -10.309 1.00 50.45 ? 45  GLU A C   1 
ATOM   363 O  O   . GLU A 1 46 ? -4.813  17.025 -9.399  1.00 50.95 ? 45  GLU A O   1 
ATOM   364 C  CB  . GLU A 1 46 ? -4.993  17.035 -12.614 1.00 50.97 ? 45  GLU A CB  1 
ATOM   365 C  CG  . GLU A 1 46 ? -5.088  16.361 -13.996 1.00 53.40 ? 45  GLU A CG  1 
ATOM   366 C  CD  . GLU A 1 46 ? -5.795  17.211 -15.071 1.00 53.48 ? 45  GLU A CD  1 
ATOM   367 O  OE1 . GLU A 1 46 ? -6.832  17.855 -14.774 1.00 56.74 ? 45  GLU A OE1 1 
ATOM   368 O  OE2 . GLU A 1 46 ? -5.305  17.234 -16.223 1.00 55.74 ? 45  GLU A OE2 1 
ATOM   369 N  N   . GLU A 1 47 ? -2.968  18.001 -10.242 1.00 49.59 ? 46  GLU A N   1 
ATOM   370 C  CA  . GLU A 1 47 ? -2.858  18.919 -9.131  1.00 49.66 ? 46  GLU A CA  1 
ATOM   371 C  C   . GLU A 1 47 ? -4.155  19.708 -8.953  1.00 49.25 ? 46  GLU A C   1 
ATOM   372 O  O   . GLU A 1 47 ? -4.786  20.132 -9.938  1.00 49.39 ? 46  GLU A O   1 
ATOM   373 C  CB  . GLU A 1 47 ? -1.721  19.887 -9.369  1.00 49.82 ? 46  GLU A CB  1 
ATOM   374 C  CG  . GLU A 1 47 ? -1.299  20.591 -8.121  1.00 50.16 ? 46  GLU A CG  1 
ATOM   375 C  CD  . GLU A 1 47 ? -0.203  21.565 -8.386  1.00 51.93 ? 46  GLU A CD  1 
ATOM   376 O  OE1 . GLU A 1 47 ? 0.596   21.313 -9.324  1.00 52.36 ? 46  GLU A OE1 1 
ATOM   377 O  OE2 . GLU A 1 47 ? -0.177  22.609 -7.690  1.00 51.46 ? 46  GLU A OE2 1 
ATOM   378 N  N   . ILE A 1 48 ? -4.555  19.894 -7.699  1.00 48.64 ? 47  ILE A N   1 
ATOM   379 C  CA  . ILE A 1 48 ? -5.729  20.680 -7.379  1.00 49.03 ? 47  ILE A CA  1 
ATOM   380 C  C   . ILE A 1 48 ? -5.363  22.140 -7.121  1.00 49.11 ? 47  ILE A C   1 
ATOM   381 O  O   . ILE A 1 48 ? -4.680  22.445 -6.124  1.00 49.13 ? 47  ILE A O   1 
ATOM   382 C  CB  . ILE A 1 48 ? -6.460  20.125 -6.138  1.00 49.56 ? 47  ILE A CB  1 
ATOM   383 C  CG1 . ILE A 1 48 ? -7.217  18.837 -6.502  1.00 50.95 ? 47  ILE A CG1 1 
ATOM   384 C  CG2 . ILE A 1 48 ? -7.390  21.208 -5.565  1.00 50.05 ? 47  ILE A CG2 1 
ATOM   385 C  CD1 . ILE A 1 48 ? -7.824  18.154 -5.326  1.00 51.46 ? 47  ILE A CD1 1 
ATOM   386 N  N   . LYS A 1 49 ? -5.834  23.045 -7.993  1.00 48.21 ? 48  LYS A N   1 
ATOM   387 C  CA  . LYS A 1 49 ? -5.516  24.476 -7.842  1.00 48.53 ? 48  LYS A CA  1 
ATOM   388 C  C   . LYS A 1 49 ? -6.736  25.394 -7.656  1.00 48.55 ? 48  LYS A C   1 
ATOM   389 O  O   . LYS A 1 49 ? -6.573  26.581 -7.386  1.00 49.49 ? 48  LYS A O   1 
ATOM   390 C  CB  . LYS A 1 49 ? -4.662  25.011 -9.019  1.00 47.60 ? 48  LYS A CB  1 
ATOM   391 C  CG  . LYS A 1 49 ? -3.375  24.225 -9.276  1.00 47.56 ? 48  LYS A CG  1 
ATOM   392 C  CD  . LYS A 1 49 ? -2.804  24.546 -10.642 1.00 49.30 ? 48  LYS A CD  1 
ATOM   393 C  CE  . LYS A 1 49 ? -1.853  23.460 -11.106 1.00 49.11 ? 48  LYS A CE  1 
ATOM   394 N  NZ  . LYS A 1 49 ? -1.092  23.954 -12.288 1.00 53.55 ? 48  LYS A NZ  1 
ATOM   395 N  N   . GLU A 1 50 ? -7.950  24.877 -7.803  1.00 48.91 ? 49  GLU A N   1 
ATOM   396 C  CA  . GLU A 1 50 ? -9.143  25.737 -7.712  1.00 48.13 ? 49  GLU A CA  1 
ATOM   397 C  C   . GLU A 1 50 ? -9.971  25.308 -6.502  1.00 48.52 ? 49  GLU A C   1 
ATOM   398 O  O   . GLU A 1 50 ? -10.144 24.124 -6.274  1.00 46.91 ? 49  GLU A O   1 
ATOM   399 C  CB  . GLU A 1 50 ? -10.035 25.617 -8.970  1.00 48.41 ? 49  GLU A CB  1 
ATOM   400 C  CG  . GLU A 1 50 ? -9.550  26.270 -10.252 1.00 48.25 ? 49  GLU A CG  1 
ATOM   401 N  N   . GLN A 1 51 ? -10.545 26.273 -5.787  1.00 48.01 ? 50  GLN A N   1 
ATOM   402 C  CA  . GLN A 1 51 ? -11.363 25.984 -4.615  1.00 48.61 ? 50  GLN A CA  1 
ATOM   403 C  C   . GLN A 1 51 ? -12.507 25.065 -4.999  1.00 48.73 ? 50  GLN A C   1 
ATOM   404 O  O   . GLN A 1 51 ? -12.885 24.204 -4.222  1.00 48.06 ? 50  GLN A O   1 
ATOM   405 C  CB  . GLN A 1 51 ? -11.936 27.282 -4.022  1.00 48.80 ? 50  GLN A CB  1 
ATOM   406 C  CG  . GLN A 1 51 ? -12.721 27.107 -2.711  1.00 51.61 ? 50  GLN A CG  1 
ATOM   407 C  CD  . GLN A 1 51 ? -11.863 26.577 -1.556  1.00 53.42 ? 50  GLN A CD  1 
ATOM   408 O  OE1 . GLN A 1 51 ? -10.825 27.149 -1.209  1.00 54.28 ? 50  GLN A OE1 1 
ATOM   409 N  NE2 . GLN A 1 51 ? -12.312 25.497 -0.944  1.00 53.14 ? 50  GLN A NE2 1 
ATOM   410 N  N   . GLU A 1 52 ? -13.053 25.279 -6.201  1.00 48.64 ? 51  GLU A N   1 
ATOM   411 C  CA  . GLU A 1 52 ? -14.203 24.532 -6.724  1.00 49.34 ? 51  GLU A CA  1 
ATOM   412 C  C   . GLU A 1 52 ? -13.950 23.064 -6.759  1.00 48.27 ? 51  GLU A C   1 
ATOM   413 O  O   . GLU A 1 52 ? -14.857 22.240 -6.563  1.00 47.80 ? 51  GLU A O   1 
ATOM   414 C  CB  . GLU A 1 52 ? -14.511 24.993 -8.149  1.00 49.74 ? 51  GLU A CB  1 
ATOM   415 C  CG  . GLU A 1 52 ? -15.869 24.536 -8.689  1.00 51.86 ? 51  GLU A CG  1 
ATOM   416 C  CD  . GLU A 1 52 ? -16.198 25.164 -10.029 1.00 51.33 ? 51  GLU A CD  1 
ATOM   417 O  OE1 . GLU A 1 52 ? -15.590 26.206 -10.351 1.00 55.11 ? 51  GLU A OE1 1 
ATOM   418 O  OE2 . GLU A 1 52 ? -17.068 24.635 -10.763 1.00 54.17 ? 51  GLU A OE2 1 
ATOM   419 N  N   . VAL A 1 53 ? -12.712 22.729 -7.079  1.00 48.09 ? 52  VAL A N   1 
ATOM   420 C  CA  . VAL A 1 53 ? -12.316 21.320 -7.195  1.00 48.12 ? 52  VAL A CA  1 
ATOM   421 C  C   . VAL A 1 53 ? -12.136 20.712 -5.808  1.00 48.26 ? 52  VAL A C   1 
ATOM   422 O  O   . VAL A 1 53 ? -12.645 19.636 -5.544  1.00 48.23 ? 52  VAL A O   1 
ATOM   423 C  CB  . VAL A 1 53 ? -11.078 21.180 -8.084  1.00 48.18 ? 52  VAL A CB  1 
ATOM   424 C  CG1 . VAL A 1 53 ? -10.577 19.720 -8.077  1.00 47.42 ? 52  VAL A CG1 1 
ATOM   425 C  CG2 . VAL A 1 53 ? -11.388 21.723 -9.517  1.00 45.80 ? 52  VAL A CG2 1 
ATOM   426 N  N   . VAL A 1 54 ? -11.472 21.435 -4.900  1.00 49.63 ? 53  VAL A N   1 
ATOM   427 C  CA  . VAL A 1 54 ? -11.431 21.047 -3.472  1.00 50.35 ? 53  VAL A CA  1 
ATOM   428 C  C   . VAL A 1 54 ? -12.864 20.736 -2.955  1.00 50.25 ? 53  VAL A C   1 
ATOM   429 O  O   . VAL A 1 54 ? -13.134 19.670 -2.455  1.00 49.52 ? 53  VAL A O   1 
ATOM   430 C  CB  . VAL A 1 54 ? -10.815 22.163 -2.612  1.00 50.85 ? 53  VAL A CB  1 
ATOM   431 C  CG1 . VAL A 1 54 ? -10.880 21.825 -1.128  1.00 51.24 ? 53  VAL A CG1 1 
ATOM   432 C  CG2 . VAL A 1 54 ? -9.377  22.510 -3.042  1.00 53.81 ? 53  VAL A CG2 1 
ATOM   433 N  N   . ASP A 1 55 ? -13.778 21.703 -3.097  1.00 49.19 ? 54  ASP A N   1 
ATOM   434 C  CA  . ASP A 1 55 ? -15.151 21.536 -2.682  1.00 48.07 ? 54  ASP A CA  1 
ATOM   435 C  C   . ASP A 1 55 ? -15.804 20.316 -3.313  1.00 47.97 ? 54  ASP A C   1 
ATOM   436 O  O   . ASP A 1 55 ? -16.421 19.500 -2.640  1.00 47.90 ? 54  ASP A O   1 
ATOM   437 C  CB  . ASP A 1 55 ? -15.960 22.779 -3.084  1.00 47.63 ? 54  ASP A CB  1 
ATOM   438 C  CG  . ASP A 1 55 ? -15.486 24.028 -2.385  1.00 48.29 ? 54  ASP A CG  1 
ATOM   439 O  OD1 . ASP A 1 55 ? -14.597 23.901 -1.519  1.00 48.89 ? 54  ASP A OD1 1 
ATOM   440 O  OD2 . ASP A 1 55 ? -15.984 25.119 -2.709  1.00 42.97 ? 54  ASP A OD2 1 
ATOM   441 N  N   . LYS A 1 56 ? -15.681 20.205 -4.625  1.00 48.29 ? 55  LYS A N   1 
ATOM   442 C  CA  . LYS A 1 56 ? -16.298 19.095 -5.326  1.00 47.86 ? 55  LYS A CA  1 
ATOM   443 C  C   . LYS A 1 56 ? -15.763 17.713 -4.892  1.00 48.79 ? 55  LYS A C   1 
ATOM   444 O  O   . LYS A 1 56 ? -16.564 16.799 -4.689  1.00 47.26 ? 55  LYS A O   1 
ATOM   445 C  CB  . LYS A 1 56 ? -16.132 19.276 -6.832  1.00 48.91 ? 55  LYS A CB  1 
ATOM   446 C  CG  . LYS A 1 56 ? -16.795 18.164 -7.673  1.00 48.88 ? 55  LYS A CG  1 
ATOM   447 C  CD  . LYS A 1 56 ? -18.320 18.289 -7.564  1.00 52.19 ? 55  LYS A CD  1 
ATOM   448 N  N   . VAL A 1 57 ? -14.429 17.553 -4.794  1.00 48.64 ? 56  VAL A N   1 
ATOM   449 C  CA  . VAL A 1 57 ? -13.836 16.261 -4.386  1.00 49.76 ? 56  VAL A CA  1 
ATOM   450 C  C   . VAL A 1 57 ? -14.332 15.876 -2.997  1.00 48.83 ? 56  VAL A C   1 
ATOM   451 O  O   . VAL A 1 57 ? -14.639 14.719 -2.769  1.00 48.64 ? 56  VAL A O   1 
ATOM   452 C  CB  . VAL A 1 57 ? -12.258 16.243 -4.458  1.00 50.14 ? 56  VAL A CB  1 
ATOM   453 C  CG1 . VAL A 1 57 ? -11.668 14.910 -3.955  1.00 51.70 ? 56  VAL A CG1 1 
ATOM   454 C  CG2 . VAL A 1 57 ? -11.788 16.479 -5.884  1.00 51.69 ? 56  VAL A CG2 1 
ATOM   455 N  N   . MET A 1 58 ? -14.398 16.846 -2.065  1.00 49.07 ? 57  MET A N   1 
ATOM   456 C  CA  . MET A 1 58 ? -14.943 16.591 -0.734  1.00 48.41 ? 57  MET A CA  1 
ATOM   457 C  C   . MET A 1 58 ? -16.413 16.223 -0.809  1.00 49.06 ? 57  MET A C   1 
ATOM   458 O  O   . MET A 1 58 ? -16.867 15.261 -0.162  1.00 48.56 ? 57  MET A O   1 
ATOM   459 C  CB  . MET A 1 58 ? -14.768 17.803 0.187   1.00 48.46 ? 57  MET A CB  1 
ATOM   460 C  CG  . MET A 1 58 ? -15.349 17.594 1.627   1.00 48.05 ? 57  MET A CG  1 
ATOM   461 S  SD  . MET A 1 58 ? -14.367 16.385 2.555   1.00 49.68 ? 57  MET A SD  1 
ATOM   462 C  CE  . MET A 1 58 ? -12.897 17.330 3.010   1.00 48.16 ? 57  MET A CE  1 
ATOM   463 N  N   . GLU A 1 59 ? -17.158 16.973 -1.611  1.00 49.48 ? 58  GLU A N   1 
ATOM   464 C  CA  . GLU A 1 59 ? -18.587 16.702 -1.766  1.00 50.98 ? 58  GLU A CA  1 
ATOM   465 C  C   . GLU A 1 59 ? -18.763 15.231 -2.143  1.00 50.34 ? 58  GLU A C   1 
ATOM   466 O  O   . GLU A 1 59 ? -19.606 14.553 -1.599  1.00 49.38 ? 58  GLU A O   1 
ATOM   467 C  CB  . GLU A 1 59 ? -19.199 17.653 -2.807  1.00 51.12 ? 58  GLU A CB  1 
ATOM   468 C  CG  . GLU A 1 59 ? -20.733 17.816 -2.715  1.00 53.64 ? 58  GLU A CG  1 
ATOM   469 C  CD  . GLU A 1 59 ? -21.323 18.581 -3.900  1.00 52.31 ? 58  GLU A CD  1 
ATOM   470 O  OE1 . GLU A 1 59 ? -20.573 19.217 -4.672  1.00 53.87 ? 58  GLU A OE1 1 
ATOM   471 O  OE2 . GLU A 1 59 ? -22.550 18.536 -4.070  1.00 55.67 ? 58  GLU A OE2 1 
ATOM   472 N  N   . THR A 1 60 ? -17.897 14.752 -3.032  1.00 50.96 ? 59  THR A N   1 
ATOM   473 C  CA  . THR A 1 60 ? -17.930 13.372 -3.577  1.00 51.18 ? 59  THR A CA  1 
ATOM   474 C  C   . THR A 1 60 ? -17.540 12.284 -2.559  1.00 51.11 ? 59  THR A C   1 
ATOM   475 O  O   . THR A 1 60 ? -18.185 11.228 -2.523  1.00 50.26 ? 59  THR A O   1 
ATOM   476 C  CB  . THR A 1 60 ? -17.038 13.287 -4.855  1.00 51.17 ? 59  THR A CB  1 
ATOM   477 O  OG1 . THR A 1 60 ? -17.509 14.258 -5.808  1.00 51.53 ? 59  THR A OG1 1 
ATOM   478 C  CG2 . THR A 1 60 ? -17.060 11.904 -5.480  1.00 51.62 ? 59  THR A CG2 1 
ATOM   479 N  N   . LEU A 1 61 ? -16.518 12.550 -1.723  1.00 50.60 ? 60  LEU A N   1 
ATOM   480 C  CA  . LEU A 1 61 ? -16.000 11.578 -0.730  1.00 50.73 ? 60  LEU A CA  1 
ATOM   481 C  C   . LEU A 1 61 ? -16.782 11.586 0.576   1.00 49.99 ? 60  LEU A C   1 
ATOM   482 O  O   . LEU A 1 61 ? -16.836 10.586 1.293   1.00 49.35 ? 60  LEU A O   1 
ATOM   483 C  CB  . LEU A 1 61 ? -14.519 11.874 -0.392  1.00 51.47 ? 60  LEU A CB  1 
ATOM   484 C  CG  . LEU A 1 61 ? -13.530 12.080 -1.519  1.00 54.76 ? 60  LEU A CG  1 
ATOM   485 C  CD1 . LEU A 1 61 ? -12.099 12.286 -0.956  1.00 55.99 ? 60  LEU A CD1 1 
ATOM   486 C  CD2 . LEU A 1 61 ? -13.602 10.934 -2.535  1.00 58.39 ? 60  LEU A CD2 1 
ATOM   487 N  N   . ASP A 1 62 ? -17.394 12.727 0.881   1.00 48.44 ? 61  ASP A N   1 
ATOM   488 C  CA  . ASP A 1 62 ? -18.114 12.914 2.121   1.00 49.47 ? 61  ASP A CA  1 
ATOM   489 C  C   . ASP A 1 62 ? -19.500 12.221 2.075   1.00 49.74 ? 61  ASP A C   1 
ATOM   490 O  O   . ASP A 1 62 ? -20.509 12.842 1.738   1.00 49.36 ? 61  ASP A O   1 
ATOM   491 C  CB  . ASP A 1 62 ? -18.261 14.425 2.391   1.00 49.99 ? 61  ASP A CB  1 
ATOM   492 C  CG  . ASP A 1 62 ? -18.859 14.737 3.756   1.00 51.15 ? 61  ASP A CG  1 
ATOM   493 O  OD1 . ASP A 1 62 ? -18.788 13.909 4.701   1.00 52.88 ? 61  ASP A OD1 1 
ATOM   494 O  OD2 . ASP A 1 62 ? -19.388 15.835 3.876   1.00 50.71 ? 61  ASP A OD2 1 
ATOM   495 N  N   . SER A 1 63 ? -19.537 10.945 2.438   1.00 50.23 ? 62  SER A N   1 
ATOM   496 C  CA  . SER A 1 63 ? -20.779 10.151 2.458   1.00 50.67 ? 62  SER A CA  1 
ATOM   497 C  C   . SER A 1 63 ? -21.726 10.492 3.583   1.00 51.11 ? 62  SER A C   1 
ATOM   498 O  O   . SER A 1 63 ? -22.955 10.331 3.444   1.00 51.34 ? 62  SER A O   1 
ATOM   499 C  CB  . SER A 1 63 ? -20.458 8.651  2.570   1.00 50.57 ? 62  SER A CB  1 
ATOM   500 O  OG  . SER A 1 63 ? -19.746 8.218  1.435   1.00 51.84 ? 62  SER A OG  1 
ATOM   501 N  N   . ASP A 1 64 ? -21.188 10.897 4.725   1.00 51.61 ? 63  ASP A N   1 
ATOM   502 C  CA  . ASP A 1 64 ? -22.075 11.138 5.860   1.00 52.64 ? 63  ASP A CA  1 
ATOM   503 C  C   . ASP A 1 64 ? -22.417 12.624 6.009   1.00 52.62 ? 63  ASP A C   1 
ATOM   504 O  O   . ASP A 1 64 ? -23.149 13.038 6.928   1.00 53.60 ? 63  ASP A O   1 
ATOM   505 C  CB  . ASP A 1 64 ? -21.571 10.464 7.154   1.00 52.61 ? 63  ASP A CB  1 
ATOM   506 C  CG  . ASP A 1 64 ? -20.279 11.058 7.681   1.00 53.68 ? 63  ASP A CG  1 
ATOM   507 O  OD1 . ASP A 1 64 ? -19.907 12.203 7.311   1.00 55.31 ? 63  ASP A OD1 1 
ATOM   508 O  OD2 . ASP A 1 64 ? -19.622 10.366 8.487   1.00 54.78 ? 63  ASP A OD2 1 
ATOM   509 N  N   . GLY A 1 65 ? -21.919 13.414 5.059   1.00 52.27 ? 64  GLY A N   1 
ATOM   510 C  CA  . GLY A 1 65 ? -22.333 14.807 4.909   1.00 51.35 ? 64  GLY A CA  1 
ATOM   511 C  C   . GLY A 1 65 ? -21.869 15.730 6.024   1.00 51.44 ? 64  GLY A C   1 
ATOM   512 O  O   . GLY A 1 65 ? -22.512 16.828 6.250   1.00 51.05 ? 64  GLY A O   1 
ATOM   513 N  N   . ASP A 1 66 ? -20.752 15.313 6.715   1.00 51.34 ? 65  ASP A N   1 
ATOM   514 C  CA  . ASP A 1 66 ? -20.232 16.180 7.792   1.00 51.94 ? 65  ASP A CA  1 
ATOM   515 C  C   . ASP A 1 66 ? -19.174 17.216 7.342   1.00 51.33 ? 65  ASP A C   1 
ATOM   516 O  O   . ASP A 1 66 ? -18.555 17.876 8.172   1.00 52.10 ? 65  ASP A O   1 
ATOM   517 C  CB  . ASP A 1 66 ? -19.736 15.355 8.989   1.00 51.95 ? 65  ASP A CB  1 
ATOM   518 C  CG  . ASP A 1 66 ? -18.394 14.682 8.743   1.00 53.75 ? 65  ASP A CG  1 
ATOM   519 O  OD1 . ASP A 1 66 ? -17.846 14.706 7.604   1.00 52.30 ? 65  ASP A OD1 1 
ATOM   520 O  OD2 . ASP A 1 66 ? -17.879 14.078 9.714   1.00 55.11 ? 65  ASP A OD2 1 
ATOM   521 N  N   . GLY A 1 67 ? -18.978 17.385 6.020   1.00 50.95 ? 66  GLY A N   1 
ATOM   522 C  CA  . GLY A 1 67 ? -17.975 18.336 5.536   1.00 50.14 ? 66  GLY A CA  1 
ATOM   523 C  C   . GLY A 1 67 ? -16.514 17.912 5.676   1.00 49.92 ? 66  GLY A C   1 
ATOM   524 O  O   . GLY A 1 67 ? -15.615 18.662 5.283   1.00 49.59 ? 66  GLY A O   1 
ATOM   525 N  N   . GLU A 1 68 ? -16.257 16.743 6.264   1.00 50.25 ? 67  GLU A N   1 
ATOM   526 C  CA  . GLU A 1 68 ? -14.890 16.207 6.331   1.00 50.44 ? 67  GLU A CA  1 
ATOM   527 C  C   . GLU A 1 68 ? -14.866 14.780 5.815   1.00 50.25 ? 67  GLU A C   1 
ATOM   528 O  O   . GLU A 1 68 ? -15.922 14.169 5.605   1.00 50.41 ? 67  GLU A O   1 
ATOM   529 C  CB  . GLU A 1 68 ? -14.318 16.270 7.763   1.00 50.96 ? 67  GLU A CB  1 
ATOM   530 C  CG  . GLU A 1 68 ? -14.490 17.640 8.455   1.00 51.40 ? 67  GLU A CG  1 
ATOM   531 C  CD  . GLU A 1 68 ? -13.361 18.008 9.422   1.00 52.36 ? 67  GLU A CD  1 
ATOM   532 O  OE1 . GLU A 1 68 ? -12.348 17.292 9.537   1.00 52.05 ? 67  GLU A OE1 1 
ATOM   533 O  OE2 . GLU A 1 68 ? -13.476 19.060 10.065  1.00 53.79 ? 67  GLU A OE2 1 
ATOM   534 N  N   . CYS A 1 69 ? -13.661 14.268 5.582   1.00 49.82 ? 68  CYS A N   1 
ATOM   535 C  CA  . CYS A 1 69 ? -13.452 12.887 5.173   1.00 49.21 ? 68  CYS A CA  1 
ATOM   536 C  C   . CYS A 1 69 ? -12.783 12.113 6.310   1.00 48.98 ? 68  CYS A C   1 
ATOM   537 O  O   . CYS A 1 69 ? -11.632 12.393 6.677   1.00 48.48 ? 68  CYS A O   1 
ATOM   538 C  CB  . CYS A 1 69 ? -12.604 12.840 3.888   1.00 49.39 ? 68  CYS A CB  1 
ATOM   539 S  SG  . CYS A 1 69 ? -12.095 11.204 3.358   1.00 49.91 ? 68  CYS A SG  1 
ATOM   540 N  N   . ASP A 1 70 ? -13.501 11.131 6.847   1.00 47.91 ? 69  ASP A N   1 
ATOM   541 C  CA  . ASP A 1 70 ? -13.004 10.323 7.953   1.00 48.41 ? 69  ASP A CA  1 
ATOM   542 C  C   . ASP A 1 70 ? -12.343 9.079  7.384   1.00 48.36 ? 69  ASP A C   1 
ATOM   543 O  O   . ASP A 1 70 ? -12.207 8.932  6.155   1.00 47.94 ? 69  ASP A O   1 
ATOM   544 C  CB  . ASP A 1 70 ? -14.130 9.959  8.947   1.00 48.61 ? 69  ASP A CB  1 
ATOM   545 C  CG  . ASP A 1 70 ? -15.244 9.149  8.306   1.00 50.24 ? 69  ASP A CG  1 
ATOM   546 O  OD1 . ASP A 1 70 ? -15.003 8.525  7.249   1.00 53.47 ? 69  ASP A OD1 1 
ATOM   547 O  OD2 . ASP A 1 70 ? -16.372 9.135  8.846   1.00 51.57 ? 69  ASP A OD2 1 
ATOM   548 N  N   . PHE A 1 71 ? -11.941 8.171  8.257   1.00 49.01 ? 70  PHE A N   1 
ATOM   549 C  CA  . PHE A 1 71 ? -11.148 7.051  7.810   1.00 49.07 ? 70  PHE A CA  1 
ATOM   550 C  C   . PHE A 1 71 ? -11.912 6.144  6.828   1.00 49.92 ? 70  PHE A C   1 
ATOM   551 O  O   . PHE A 1 71 ? -11.359 5.676  5.831   1.00 50.00 ? 70  PHE A O   1 
ATOM   552 C  CB  . PHE A 1 71 ? -10.583 6.259  8.992   1.00 49.97 ? 70  PHE A CB  1 
ATOM   553 C  CG  . PHE A 1 71 ? -9.601  5.245  8.572   1.00 49.20 ? 70  PHE A CG  1 
ATOM   554 C  CD1 . PHE A 1 71 ? -8.301  5.624  8.254   1.00 50.75 ? 70  PHE A CD1 1 
ATOM   555 C  CD2 . PHE A 1 71 ? -9.988  3.912  8.399   1.00 50.71 ? 70  PHE A CD2 1 
ATOM   556 C  CE1 . PHE A 1 71 ? -7.374  4.691  7.803   1.00 51.12 ? 70  PHE A CE1 1 
ATOM   557 C  CE2 . PHE A 1 71 ? -9.080  2.966  7.941   1.00 49.69 ? 70  PHE A CE2 1 
ATOM   558 C  CZ  . PHE A 1 71 ? -7.764  3.354  7.642   1.00 51.50 ? 70  PHE A CZ  1 
ATOM   559 N  N   . GLN A 1 72 ? -13.191 5.913  7.107   1.00 50.53 ? 71  GLN A N   1 
ATOM   560 C  CA  . GLN A 1 72 ? -14.017 5.032  6.288   1.00 50.84 ? 71  GLN A CA  1 
ATOM   561 C  C   . GLN A 1 72 ? -14.178 5.623  4.901   1.00 50.14 ? 71  GLN A C   1 
ATOM   562 O  O   . GLN A 1 72 ? -14.060 4.929  3.897   1.00 49.68 ? 71  GLN A O   1 
ATOM   563 C  CB  . GLN A 1 72 ? -15.383 4.805  6.957   1.00 51.34 ? 71  GLN A CB  1 
ATOM   564 C  CG  . GLN A 1 72 ? -16.387 4.016  6.129   1.00 52.49 ? 71  GLN A CG  1 
ATOM   565 C  CD  . GLN A 1 72 ? -17.772 4.019  6.745   1.00 52.48 ? 71  GLN A CD  1 
ATOM   566 O  OE1 . GLN A 1 72 ? -17.968 3.660  7.909   1.00 52.12 ? 71  GLN A OE1 1 
ATOM   567 N  NE2 . GLN A 1 72 ? -18.747 4.453  5.964   1.00 57.80 ? 71  GLN A NE2 1 
ATOM   568 N  N   . GLU A 1 73 ? -14.429 6.926  4.857   1.00 50.54 ? 72  GLU A N   1 
ATOM   569 C  CA  . GLU A 1 73 ? -14.574 7.655  3.616   1.00 49.86 ? 72  GLU A CA  1 
ATOM   570 C  C   . GLU A 1 73 ? -13.263 7.707  2.857   1.00 50.07 ? 72  GLU A C   1 
ATOM   571 O  O   . GLU A 1 73 ? -13.250 7.675  1.618   1.00 51.60 ? 72  GLU A O   1 
ATOM   572 C  CB  . GLU A 1 73 ? -15.135 9.058  3.892   1.00 48.74 ? 72  GLU A CB  1 
ATOM   573 C  CG  . GLU A 1 73 ? -16.590 8.995  4.456   1.00 46.73 ? 72  GLU A CG  1 
ATOM   574 C  CD  . GLU A 1 73 ? -17.047 10.332 4.982   1.00 46.62 ? 72  GLU A CD  1 
ATOM   575 O  OE1 . GLU A 1 73 ? -16.180 11.160 5.311   1.00 47.71 ? 72  GLU A OE1 1 
ATOM   576 O  OE2 . GLU A 1 73 ? -18.270 10.584 5.069   1.00 47.25 ? 72  GLU A OE2 1 
ATOM   577 N  N   . PHE A 1 74 ? -12.151 7.810  3.578   1.00 49.15 ? 73  PHE A N   1 
ATOM   578 C  CA  . PHE A 1 74 ? -10.859 7.801  2.923   1.00 49.20 ? 73  PHE A CA  1 
ATOM   579 C  C   . PHE A 1 74 ? -10.578 6.445  2.230   1.00 49.60 ? 73  PHE A C   1 
ATOM   580 O  O   . PHE A 1 74 ? -10.032 6.386  1.100   1.00 49.71 ? 73  PHE A O   1 
ATOM   581 C  CB  . PHE A 1 74 ? -9.744  8.126  3.926   1.00 48.67 ? 73  PHE A CB  1 
ATOM   582 C  CG  . PHE A 1 74 ? -8.386  8.118  3.303   1.00 48.12 ? 73  PHE A CG  1 
ATOM   583 C  CD1 . PHE A 1 74 ? -8.034  9.099  2.366   1.00 48.25 ? 73  PHE A CD1 1 
ATOM   584 C  CD2 . PHE A 1 74 ? -7.460  7.121  3.619   1.00 46.83 ? 73  PHE A CD2 1 
ATOM   585 C  CE1 . PHE A 1 74 ? -6.743  9.089  1.784   1.00 47.11 ? 73  PHE A CE1 1 
ATOM   586 C  CE2 . PHE A 1 74 ? -6.183  7.098  3.031   1.00 49.40 ? 73  PHE A CE2 1 
ATOM   587 C  CZ  . PHE A 1 74 ? -5.833  8.079  2.112   1.00 48.85 ? 73  PHE A CZ  1 
ATOM   588 N  N   . MET A 1 75 ? -10.929 5.354  2.921   1.00 49.72 ? 74  MET A N   1 
ATOM   589 C  CA  . MET A 1 75 ? -10.785 3.987  2.376   1.00 49.27 ? 74  MET A CA  1 
ATOM   590 C  C   . MET A 1 75 ? -11.591 3.851  1.085   1.00 48.85 ? 74  MET A C   1 
ATOM   591 O  O   . MET A 1 75 ? -11.090 3.295  0.109   1.00 48.97 ? 74  MET A O   1 
ATOM   592 C  CB  . MET A 1 75 ? -11.236 2.929  3.383   1.00 49.81 ? 74  MET A CB  1 
ATOM   593 C  CG  . MET A 1 75 ? -10.309 2.664  4.513   1.00 49.47 ? 74  MET A CG  1 
ATOM   594 S  SD  . MET A 1 75 ? -8.614  2.309  4.041   1.00 54.71 ? 74  MET A SD  1 
ATOM   595 C  CE  . MET A 1 75 ? -8.739  0.849  3.019   1.00 54.19 ? 74  MET A CE  1 
ATOM   596 N  N   . ALA A 1 76 ? -12.809 4.401  1.060   1.00 49.12 ? 75  ALA A N   1 
ATOM   597 C  CA  . ALA A 1 76 ? -13.625 4.457  -0.167  1.00 49.13 ? 75  ALA A CA  1 
ATOM   598 C  C   . ALA A 1 76 ? -12.894 5.202  -1.317  1.00 49.24 ? 75  ALA A C   1 
ATOM   599 O  O   . ALA A 1 76 ? -12.958 4.788  -2.461  1.00 50.02 ? 75  ALA A O   1 
ATOM   600 C  CB  . ALA A 1 76 ? -15.010 5.119  0.118   1.00 49.71 ? 75  ALA A CB  1 
ATOM   601 N  N   . PHE A 1 77 ? -12.245 6.328  -1.010  1.00 50.19 ? 76  PHE A N   1 
ATOM   602 C  CA  . PHE A 1 77 ? -11.432 7.095  -1.949  1.00 50.61 ? 76  PHE A CA  1 
ATOM   603 C  C   . PHE A 1 77 ? -10.274 6.283  -2.486  1.00 50.53 ? 76  PHE A C   1 
ATOM   604 O  O   . PHE A 1 77 ? -10.039 6.244  -3.691  1.00 52.04 ? 76  PHE A O   1 
ATOM   605 C  CB  . PHE A 1 77 ? -10.921 8.373  -1.253  1.00 50.49 ? 76  PHE A CB  1 
ATOM   606 C  CG  . PHE A 1 77 ? -10.132 9.311  -2.133  1.00 51.37 ? 76  PHE A CG  1 
ATOM   607 C  CD1 . PHE A 1 77 ? -10.565 9.668  -3.404  1.00 50.26 ? 76  PHE A CD1 1 
ATOM   608 C  CD2 . PHE A 1 77 ? -8.966  9.870  -1.654  1.00 48.10 ? 76  PHE A CD2 1 
ATOM   609 C  CE1 . PHE A 1 77 ? -9.828  10.543 -4.191  1.00 52.95 ? 76  PHE A CE1 1 
ATOM   610 C  CE2 . PHE A 1 77 ? -8.227  10.743 -2.435  1.00 47.88 ? 76  PHE A CE2 1 
ATOM   611 C  CZ  . PHE A 1 77 ? -8.666  11.081 -3.706  1.00 50.74 ? 76  PHE A CZ  1 
ATOM   612 N  N   . VAL A 1 78 ? -9.539  5.629  -1.597  1.00 49.59 ? 77  VAL A N   1 
ATOM   613 C  CA  . VAL A 1 78 ? -8.428  4.758  -2.028  1.00 48.96 ? 77  VAL A CA  1 
ATOM   614 C  C   . VAL A 1 78 ? -8.943  3.662  -2.982  1.00 49.14 ? 77  VAL A C   1 
ATOM   615 O  O   . VAL A 1 78 ? -8.304  3.380  -4.005  1.00 50.16 ? 77  VAL A O   1 
ATOM   616 C  CB  . VAL A 1 78 ? -7.702  4.153  -0.820  1.00 47.73 ? 77  VAL A CB  1 
ATOM   617 C  CG1 . VAL A 1 78 ? -6.642  3.094  -1.261  1.00 47.70 ? 77  VAL A CG1 1 
ATOM   618 C  CG2 . VAL A 1 78 ? -6.999  5.279  -0.051  1.00 48.13 ? 77  VAL A CG2 1 
ATOM   619 N  N   . ALA A 1 79 ? -10.097 3.044  -2.664  1.00 49.11 ? 78  ALA A N   1 
ATOM   620 C  CA  . ALA A 1 79 ? -10.650 2.027  -3.551  1.00 48.43 ? 78  ALA A CA  1 
ATOM   621 C  C   . ALA A 1 79 ? -10.998 2.581  -4.954  1.00 49.17 ? 78  ALA A C   1 
ATOM   622 O  O   . ALA A 1 79 ? -10.717 1.943  -5.962  1.00 48.45 ? 78  ALA A O   1 
ATOM   623 C  CB  . ALA A 1 79 ? -11.861 1.357  -2.925  1.00 49.48 ? 78  ALA A CB  1 
ATOM   624 N  N   . MET A 1 80 ? -11.569 3.774  -4.992  1.00 48.17 ? 79  MET A N   1 
ATOM   625 C  CA  . MET A 1 80 ? -11.857 4.461  -6.257  1.00 50.74 ? 79  MET A CA  1 
ATOM   626 C  C   . MET A 1 80 ? -10.577 4.655  -7.084  1.00 49.17 ? 79  MET A C   1 
ATOM   627 O  O   . MET A 1 80 ? -10.523 4.356  -8.269  1.00 47.05 ? 79  MET A O   1 
ATOM   628 C  CB  . MET A 1 80 ? -12.442 5.833  -5.952  1.00 50.14 ? 79  MET A CB  1 
ATOM   629 C  CG  . MET A 1 80 ? -13.920 5.931  -5.690  1.00 53.98 ? 79  MET A CG  1 
ATOM   630 S  SD  . MET A 1 80 ? -14.257 7.586  -4.981  1.00 56.76 ? 79  MET A SD  1 
ATOM   631 C  CE  . MET A 1 80 ? -15.668 8.126  -5.939  1.00 53.93 ? 79  MET A CE  1 
ATOM   632 N  N   . ILE A 1 81 ? -9.526  5.147  -6.436  1.00 49.13 ? 80  ILE A N   1 
ATOM   633 C  CA  . ILE A 1 81 ? -8.281  5.504  -7.126  1.00 50.87 ? 80  ILE A CA  1 
ATOM   634 C  C   . ILE A 1 81 ? -7.634  4.216  -7.610  1.00 50.43 ? 80  ILE A C   1 
ATOM   635 O  O   . ILE A 1 81 ? -7.144  4.134  -8.742  1.00 50.29 ? 80  ILE A O   1 
ATOM   636 C  CB  . ILE A 1 81 ? -7.315  6.210  -6.159  1.00 50.90 ? 80  ILE A CB  1 
ATOM   637 C  CG1 . ILE A 1 81 ? -7.911  7.535  -5.722  1.00 54.20 ? 80  ILE A CG1 1 
ATOM   638 C  CG2 . ILE A 1 81 ? -5.964  6.538  -6.836  1.00 51.59 ? 80  ILE A CG2 1 
ATOM   639 C  CD1 . ILE A 1 81 ? -7.355  8.003  -4.401  1.00 59.27 ? 80  ILE A CD1 1 
ATOM   640 N  N   . THR A 1 82 ? -7.610  3.232  -6.721  1.00 48.11 ? 81  THR A N   1 
ATOM   641 C  CA  . THR A 1 82 ? -7.098  1.932  -7.065  1.00 48.26 ? 81  THR A CA  1 
ATOM   642 C  C   . THR A 1 82 ? -7.844  1.293  -8.265  1.00 47.70 ? 81  THR A C   1 
ATOM   643 O  O   . THR A 1 82 ? -7.189  0.806  -9.184  1.00 46.42 ? 81  THR A O   1 
ATOM   644 C  CB  . THR A 1 82 ? -7.104  1.003  -5.838  1.00 47.89 ? 81  THR A CB  1 
ATOM   645 O  OG1 . THR A 1 82 ? -6.376  1.667  -4.784  1.00 43.54 ? 81  THR A OG1 1 
ATOM   646 C  CG2 . THR A 1 82 ? -6.401  -0.318 -6.169  1.00 48.20 ? 81  THR A CG2 1 
ATOM   647 N  N   . THR A 1 83 ? -9.179  1.292  -8.234  1.00 48.10 ? 82  THR A N   1 
ATOM   648 C  CA  . THR A 1 83 ? -10.012 0.757  -9.344  1.00 48.69 ? 82  THR A CA  1 
ATOM   649 C  C   . THR A 1 83 ? -9.710  1.496  -10.679 1.00 48.90 ? 82  THR A C   1 
ATOM   650 O  O   . THR A 1 83 ? -9.592  0.854  -11.722 1.00 50.11 ? 82  THR A O   1 
ATOM   651 C  CB  . THR A 1 83 ? -11.504 0.852  -9.023  1.00 47.93 ? 82  THR A CB  1 
ATOM   652 O  OG1 . THR A 1 83 ? -11.772 0.163  -7.800  1.00 48.53 ? 82  THR A OG1 1 
ATOM   653 C  CG2 . THR A 1 83 ? -12.360 0.212  -10.121 1.00 49.49 ? 82  THR A CG2 1 
ATOM   654 N  N   . ALA A 1 84 ? -9.613  2.824  -10.634 1.00 48.83 ? 83  ALA A N   1 
ATOM   655 C  CA  . ALA A 1 84 ? -9.213  3.626  -11.802 1.00 49.67 ? 83  ALA A CA  1 
ATOM   656 C  C   . ALA A 1 84 ? -7.826  3.271  -12.339 1.00 50.65 ? 83  ALA A C   1 
ATOM   657 O  O   . ALA A 1 84 ? -7.633  3.207  -13.554 1.00 51.68 ? 83  ALA A O   1 
ATOM   658 C  CB  . ALA A 1 84 ? -9.311  5.107  -11.505 1.00 49.55 ? 83  ALA A CB  1 
ATOM   659 N  N   . CYS A 1 85 ? -6.845  3.110  -11.450 1.00 51.63 ? 84  CYS A N   1 
ATOM   660 C  CA  . CYS A 1 85 ? -5.497  2.718  -11.846 1.00 51.86 ? 84  CYS A CA  1 
ATOM   661 C  C   . CYS A 1 85 ? -5.508  1.315  -12.476 1.00 51.46 ? 84  CYS A C   1 
ATOM   662 O  O   . CYS A 1 85 ? -4.859  1.068  -13.506 1.00 50.58 ? 84  CYS A O   1 
ATOM   663 C  CB  . CYS A 1 85 ? -4.575  2.735  -10.643 1.00 52.69 ? 84  CYS A CB  1 
ATOM   664 S  SG  . CYS A 1 85 ? -2.904  2.293  -11.089 1.00 54.26 ? 84  CYS A SG  1 
ATOM   665 N  N   . HIS A 1 86 ? -6.270  0.410  -11.862 1.00 50.71 ? 85  HIS A N   1 
ATOM   666 C  CA  . HIS A 1 86 ? -6.406  -0.937 -12.367 1.00 50.47 ? 85  HIS A CA  1 
ATOM   667 C  C   . HIS A 1 86 ? -6.926  -0.976 -13.803 1.00 50.28 ? 85  HIS A C   1 
ATOM   668 O  O   . HIS A 1 86 ? -6.353  -1.656 -14.668 1.00 50.42 ? 85  HIS A O   1 
ATOM   669 C  CB  . HIS A 1 86 ? -7.347  -1.751 -11.464 1.00 50.41 ? 85  HIS A CB  1 
ATOM   670 C  CG  . HIS A 1 86 ? -7.577  -3.149 -11.949 1.00 49.89 ? 85  HIS A CG  1 
ATOM   671 N  ND1 . HIS A 1 86 ? -8.827  -3.728 -12.004 1.00 49.15 ? 85  HIS A ND1 1 
ATOM   672 C  CD2 . HIS A 1 86 ? -6.709  -4.082 -12.404 1.00 49.81 ? 85  HIS A CD2 1 
ATOM   673 C  CE1 . HIS A 1 86 ? -8.719  -4.958 -12.471 1.00 50.44 ? 85  HIS A CE1 1 
ATOM   674 N  NE2 . HIS A 1 86 ? -7.445  -5.194 -12.730 1.00 50.93 ? 85  HIS A NE2 1 
ATOM   675 N  N   . GLU A 1 87 ? -8.017  -0.264 -14.042 1.00 49.41 ? 86  GLU A N   1 
ATOM   676 C  CA  . GLU A 1 87 ? -8.688  -0.320 -15.337 1.00 50.33 ? 86  GLU A CA  1 
ATOM   677 C  C   . GLU A 1 87 ? -7.874  0.391  -16.428 1.00 50.21 ? 86  GLU A C   1 
ATOM   678 O  O   . GLU A 1 87 ? -7.943  0.026  -17.610 1.00 49.84 ? 86  GLU A O   1 
ATOM   679 C  CB  . GLU A 1 87 ? -10.084 0.289  -15.229 1.00 50.20 ? 86  GLU A CB  1 
ATOM   680 C  CG  . GLU A 1 87 ? -11.093 -0.590 -14.491 1.00 52.49 ? 86  GLU A CG  1 
ATOM   681 C  CD  . GLU A 1 87 ? -12.491 -0.010 -14.562 1.00 54.57 ? 86  GLU A CD  1 
ATOM   682 O  OE1 . GLU A 1 87 ? -12.918 0.334  -15.682 1.00 55.67 ? 86  GLU A OE1 1 
ATOM   683 O  OE2 . GLU A 1 87 ? -13.161 0.104  -13.512 1.00 55.81 ? 86  GLU A OE2 1 
ATOM   684 N  N   . PHE A 1 88 ? -7.086  1.385  -16.012 1.00 50.12 ? 87  PHE A N   1 
ATOM   685 C  CA  . PHE A 1 88 ? -6.247  2.161  -16.934 1.00 50.35 ? 87  PHE A CA  1 
ATOM   686 C  C   . PHE A 1 88 ? -5.222  1.282  -17.680 1.00 51.35 ? 87  PHE A C   1 
ATOM   687 O  O   . PHE A 1 88 ? -4.879  1.554  -18.832 1.00 51.40 ? 87  PHE A O   1 
ATOM   688 C  CB  . PHE A 1 88 ? -5.542  3.315  -16.182 1.00 49.56 ? 87  PHE A CB  1 
ATOM   689 C  CG  . PHE A 1 88 ? -4.972  4.397  -17.106 1.00 49.42 ? 87  PHE A CG  1 
ATOM   690 C  CD1 . PHE A 1 88 ? -5.728  5.522  -17.444 1.00 47.12 ? 87  PHE A CD1 1 
ATOM   691 C  CD2 . PHE A 1 88 ? -3.695  4.264  -17.648 1.00 48.21 ? 87  PHE A CD2 1 
ATOM   692 C  CE1 . PHE A 1 88 ? -5.212  6.502  -18.303 1.00 48.86 ? 87  PHE A CE1 1 
ATOM   693 C  CE2 . PHE A 1 88 ? -3.166  5.235  -18.518 1.00 49.06 ? 87  PHE A CE2 1 
ATOM   694 C  CZ  . PHE A 1 88 ? -3.925  6.355  -18.841 1.00 49.24 ? 87  PHE A CZ  1 
ATOM   695 N  N   . PHE A 1 89 ? -4.763  0.205  -17.044 1.00 52.34 ? 88  PHE A N   1 
ATOM   696 C  CA  . PHE A 1 89 ? -3.566  -0.485 -17.523 1.00 53.21 ? 88  PHE A CA  1 
ATOM   697 C  C   . PHE A 1 89 ? -3.813  -1.839 -18.120 1.00 53.82 ? 88  PHE A C   1 
ATOM   698 O  O   . PHE A 1 89 ? -2.888  -2.641 -18.273 1.00 53.89 ? 88  PHE A O   1 
ATOM   699 C  CB  . PHE A 1 89 ? -2.497  -0.515 -16.432 1.00 53.74 ? 88  PHE A CB  1 
ATOM   700 C  CG  . PHE A 1 89 ? -1.820  0.798  -16.269 1.00 54.00 ? 88  PHE A CG  1 
ATOM   701 C  CD1 . PHE A 1 89 ? -0.740  1.131  -17.075 1.00 54.26 ? 88  PHE A CD1 1 
ATOM   702 C  CD2 . PHE A 1 89 ? -2.309  1.740  -15.373 1.00 54.97 ? 88  PHE A CD2 1 
ATOM   703 C  CE1 . PHE A 1 89 ? -0.127  2.364  -16.962 1.00 53.63 ? 88  PHE A CE1 1 
ATOM   704 C  CE2 . PHE A 1 89 ? -1.695  2.982  -15.260 1.00 54.06 ? 88  PHE A CE2 1 
ATOM   705 C  CZ  . PHE A 1 89 ? -0.604  3.288  -16.069 1.00 53.96 ? 88  PHE A CZ  1 
ATOM   706 N  N   . GLU A 1 90 ? -5.073  -2.060 -18.486 1.00 54.61 ? 89  GLU A N   1 
ATOM   707 C  CA  . GLU A 1 90 ? -5.517  -3.237 -19.211 1.00 54.29 ? 89  GLU A CA  1 
ATOM   708 C  C   . GLU A 1 90 ? -6.441  -2.785 -20.339 1.00 54.59 ? 89  GLU A C   1 
ATOM   709 O  O   . GLU A 1 90 ? -6.864  -1.594 -20.354 1.00 53.92 ? 89  GLU A O   1 
ATOM   710 C  CB  . GLU A 1 90 ? -6.240  -4.194 -18.254 1.00 54.56 ? 89  GLU A CB  1 
ATOM   711 C  CG  . GLU A 1 90 ? -5.308  -4.848 -17.222 1.00 53.48 ? 89  GLU A CG  1 
ATOM   712 C  CD  . GLU A 1 90 ? -6.022  -5.482 -16.036 1.00 54.66 ? 89  GLU A CD  1 
ATOM   713 O  OE1 . GLU A 1 90 ? -7.271  -5.427 -15.953 1.00 55.56 ? 89  GLU A OE1 1 
ATOM   714 O  OE2 . GLU A 1 90 ? -5.323  -6.058 -15.174 1.00 50.81 ? 89  GLU A OE2 1 
HETATM 715 CA CA  . CA  B 2 .  ? -7.966  17.274 10.526  1.00 46.71 ? 92  CA  A CA  1 
HETATM 716 CA CA  . CA  C 2 .  ? -17.640 12.695 6.217   1.00 47.00 ? 93  CA  A CA  1 
HETATM 717 ZN ZN  . ZN  D 3 .  ? -6.497  -6.733 -13.671 1.00 50.11 ? 94  ZN  A ZN  1 
HETATM 718 O  O   . HOH E 4 .  ? -12.941 4.437  -9.698  1.00 47.03 ? 95  HOH A O   1 
HETATM 719 O  O   . HOH E 4 .  ? 2.739   12.041 -5.571  1.00 43.51 ? 96  HOH A O   1 
HETATM 720 O  O   . HOH E 4 .  ? -0.062  17.943 14.565  0.50 40.86 ? 97  HOH A O   1 
HETATM 721 O  O   . HOH E 4 .  ? -15.724 8.329  0.240   1.00 46.89 ? 98  HOH A O   1 
HETATM 722 O  O   . HOH E 4 .  ? -8.706  4.219  -15.547 1.00 54.70 ? 99  HOH A O   1 
HETATM 723 O  O   . HOH E 4 .  ? 2.205   9.075  0.654   1.00 48.28 ? 100 HOH A O   1 
HETATM 724 O  O   . HOH E 4 .  ? 0.081   17.253 -7.586  1.00 43.56 ? 101 HOH A O   1 
HETATM 725 O  O   . HOH E 4 .  ? -11.859 8.886  11.280  1.00 42.62 ? 102 HOH A O   1 
HETATM 726 O  O   . HOH E 4 .  ? -0.528  21.184 -12.371 1.00 61.91 ? 103 HOH A O   1 
HETATM 727 O  O   . HOH E 4 .  ? -7.615  22.440 -9.719  1.00 47.61 ? 104 HOH A O   1 
HETATM 728 O  O   . HOH E 4 .  ? -13.609 20.799 5.427   1.00 48.33 ? 105 HOH A O   1 
HETATM 729 O  O   . HOH E 4 .  ? -7.042  28.991 -8.000  1.00 50.88 ? 106 HOH A O   1 
HETATM 730 O  O   . HOH E 4 .  ? -16.832 12.224 8.555   1.00 48.25 ? 107 HOH A O   1 
HETATM 731 O  O   . HOH E 4 .  ? -17.452 24.924 -13.380 1.00 49.99 ? 108 HOH A O   1 
HETATM 732 O  O   . HOH E 4 .  ? -14.767 2.476  3.336   1.00 49.65 ? 109 HOH A O   1 
HETATM 733 O  O   . HOH E 4 .  ? 8.590   -3.139 -0.678  1.00 57.89 ? 110 HOH A O   1 
HETATM 734 O  O   . HOH E 4 .  ? -10.554 23.171 11.800  1.00 57.99 ? 111 HOH A O   1 
HETATM 735 O  O   . HOH E 4 .  ? -9.869  29.309 -6.275  1.00 54.44 ? 112 HOH A O   1 
HETATM 736 O  O   . HOH E 4 .  ? -17.791 0.289  5.196   1.00 56.05 ? 113 HOH A O   1 
HETATM 737 O  O   . HOH E 4 .  ? 2.562   16.136 6.262   1.00 48.45 ? 114 HOH A O   1 
HETATM 738 O  O   . HOH E 4 .  ? -7.531  16.234 -9.263  1.00 52.56 ? 115 HOH A O   1 
HETATM 739 O  O   . HOH E 4 .  ? -14.985 3.457  -3.339  1.00 38.56 ? 116 HOH A O   1 
HETATM 740 O  O   . HOH E 4 .  ? -0.805  9.771  -14.786 0.50 37.42 ? 117 HOH A O   1 
HETATM 741 O  O   . HOH E 4 .  ? -2.540  12.590 -14.000 1.00 56.78 ? 118 HOH A O   1 
HETATM 742 O  O   . HOH E 4 .  ? -7.677  14.009 -11.946 1.00 53.58 ? 119 HOH A O   1 
HETATM 743 O  O   . HOH E 4 .  ? -9.823  30.662 -3.654  1.00 52.76 ? 120 HOH A O   1 
HETATM 744 O  O   . HOH E 4 .  ? -9.916  23.529 4.946   1.00 45.86 ? 121 HOH A O   1 
HETATM 745 O  O   . HOH E 4 .  ? -2.143  15.802 -7.468  1.00 47.58 ? 122 HOH A O   1 
HETATM 746 O  O   . HOH E 4 .  ? -9.199  15.344 17.550  1.00 48.11 ? 123 HOH A O   1 
HETATM 747 O  O   . HOH E 4 .  ? -14.244 6.279  10.066  1.00 47.02 ? 124 HOH A O   1 
HETATM 748 O  O   . HOH E 4 .  ? -9.896  18.533 10.391  1.00 48.32 ? 125 HOH A O   1 
HETATM 749 O  O   . HOH E 4 .  ? -11.194 19.903 12.043  1.00 53.23 ? 126 HOH A O   1 
HETATM 750 O  O   . HOH E 4 .  ? -14.226 1.595  -5.743  1.00 44.16 ? 127 HOH A O   1 
HETATM 751 O  O   . HOH E 4 .  ? -13.876 -1.038 -5.897  1.00 55.34 ? 128 HOH A O   1 
HETATM 752 O  O   . HOH E 4 .  ? -19.432 21.207 -3.939  1.00 47.10 ? 129 HOH A O   1 
HETATM 753 O  O   . HOH E 4 .  ? -20.491 17.284 1.867   1.00 66.82 ? 130 HOH A O   1 
HETATM 754 O  O   . HOH E 4 .  ? -3.484  -7.174 -17.060 1.00 68.73 ? 131 HOH A O   1 
HETATM 755 O  O   . HOH E 4 .  ? -17.641 6.765  0.729   1.00 45.10 ? 132 HOH A O   1 
HETATM 756 O  O   . HOH E 4 .  ? -17.460 20.514 -0.266  1.00 38.16 ? 133 HOH A O   1 
HETATM 757 O  O   . HOH E 4 .  ? -18.707 8.024  7.788   1.00 53.81 ? 134 HOH A O   1 
HETATM 758 O  O   . HOH E 4 .  ? 3.465   -5.495 -4.711  1.00 48.51 ? 135 HOH A O   1 
HETATM 759 O  O   . HOH E 4 .  ? -12.918 3.286  -12.740 1.00 48.44 ? 136 HOH A O   1 
HETATM 760 O  O   . HOH E 4 .  ? -18.610 4.753  -1.209  1.00 57.14 ? 137 HOH A O   1 
HETATM 761 O  O   . HOH E 4 .  ? 0.010   7.054  -14.608 0.50 38.76 ? 138 HOH A O   1 
HETATM 762 O  O   . HOH E 4 .  ? -2.083  6.329  -15.302 1.00 62.05 ? 139 HOH A O   1 
HETATM 763 O  O   . HOH E 4 .  ? -10.456 18.755 17.474  1.00 49.30 ? 140 HOH A O   1 
HETATM 764 O  O   . HOH E 4 .  ? 1.808   4.345  9.500   1.00 80.32 ? 141 HOH A O   1 
HETATM 765 O  O   . HOH E 4 .  ? 4.268   1.117  4.778   1.00 45.50 ? 142 HOH A O   1 
HETATM 766 O  O   . HOH E 4 .  ? 1.712   -1.454 -16.699 1.00 44.06 ? 143 HOH A O   1 
HETATM 767 O  O   . HOH E 4 .  ? -14.145 12.681 -4.262  1.00 67.56 ? 144 HOH A O   1 
HETATM 768 O  O   . HOH E 4 .  ? -6.706  15.655 -10.793 1.00 76.56 ? 145 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  0  0  MET MET A . n 
A 1 2  SER 2  1  1  SER SER A . n 
A 1 3  GLU 3  2  2  GLU GLU A . n 
A 1 4  LEU 4  3  3  LEU LEU A . n 
A 1 5  GLU 5  4  4  GLU GLU A . n 
A 1 6  LYS 6  5  5  LYS LYS A . n 
A 1 7  ALA 7  6  6  ALA ALA A . n 
A 1 8  VAL 8  7  7  VAL VAL A . n 
A 1 9  VAL 9  8  8  VAL VAL A . n 
A 1 10 ALA 10 9  9  ALA ALA A . n 
A 1 11 LEU 11 10 10 LEU LEU A . n 
A 1 12 ILE 12 11 11 ILE ILE A . n 
A 1 13 ASP 13 12 12 ASP ASP A . n 
A 1 14 VAL 14 13 13 VAL VAL A . n 
A 1 15 PHE 15 14 14 PHE PHE A . n 
A 1 16 HIS 16 15 15 HIS HIS A . n 
A 1 17 GLN 17 16 16 GLN GLN A . n 
A 1 18 TYR 18 17 17 TYR TYR A . n 
A 1 19 SER 19 18 18 SER SER A . n 
A 1 20 GLY 20 19 19 GLY GLY A . n 
A 1 21 ARG 21 20 20 ARG ARG A . n 
A 1 22 GLU 22 21 21 GLU GLU A . n 
A 1 23 GLY 23 22 22 GLY GLY A . n 
A 1 24 ASP 24 23 23 ASP ASP A . n 
A 1 25 LYS 25 24 24 LYS LYS A . n 
A 1 26 HIS 26 25 25 HIS HIS A . n 
A 1 27 LYS 27 26 26 LYS LYS A . n 
A 1 28 LEU 28 27 27 LEU LEU A . n 
A 1 29 LYS 29 28 28 LYS LYS A . n 
A 1 30 LYS 30 29 29 LYS LYS A . n 
A 1 31 SER 31 30 30 SER SER A . n 
A 1 32 GLU 32 31 31 GLU GLU A . n 
A 1 33 LEU 33 32 32 LEU LEU A . n 
A 1 34 LYS 34 33 33 LYS LYS A . n 
A 1 35 GLU 35 34 34 GLU GLU A . n 
A 1 36 LEU 36 35 35 LEU LEU A . n 
A 1 37 ILE 37 36 36 ILE ILE A . n 
A 1 38 ASN 38 37 37 ASN ASN A . n 
A 1 39 ASN 39 38 38 ASN ASN A . n 
A 1 40 GLU 40 39 39 GLU GLU A . n 
A 1 41 LEU 41 40 40 LEU LEU A . n 
A 1 42 SER 42 41 41 SER SER A . n 
A 1 43 HIS 43 42 42 HIS HIS A . n 
A 1 44 PHE 44 43 43 PHE PHE A . n 
A 1 45 LEU 45 44 44 LEU LEU A . n 
A 1 46 GLU 46 45 45 GLU GLU A . n 
A 1 47 GLU 47 46 46 GLU GLU A . n 
A 1 48 ILE 48 47 47 ILE ILE A . n 
A 1 49 LYS 49 48 48 LYS LYS A . n 
A 1 50 GLU 50 49 49 GLU GLU A . n 
A 1 51 GLN 51 50 50 GLN GLN A . n 
A 1 52 GLU 52 51 51 GLU GLU A . n 
A 1 53 VAL 53 52 52 VAL VAL A . n 
A 1 54 VAL 54 53 53 VAL VAL A . n 
A 1 55 ASP 55 54 54 ASP ASP A . n 
A 1 56 LYS 56 55 55 LYS LYS A . n 
A 1 57 VAL 57 56 56 VAL VAL A . n 
A 1 58 MET 58 57 57 MET MET A . n 
A 1 59 GLU 59 58 58 GLU GLU A . n 
A 1 60 THR 60 59 59 THR THR A . n 
A 1 61 LEU 61 60 60 LEU LEU A . n 
A 1 62 ASP 62 61 61 ASP ASP A . n 
A 1 63 SER 63 62 62 SER SER A . n 
A 1 64 ASP 64 63 63 ASP ASP A . n 
A 1 65 GLY 65 64 64 GLY GLY A . n 
A 1 66 ASP 66 65 65 ASP ASP A . n 
A 1 67 GLY 67 66 66 GLY GLY A . n 
A 1 68 GLU 68 67 67 GLU GLU A . n 
A 1 69 CYS 69 68 68 CYS CYS A . n 
A 1 70 ASP 70 69 69 ASP ASP A . n 
A 1 71 PHE 71 70 70 PHE PHE A . n 
A 1 72 GLN 72 71 71 GLN GLN A . n 
A 1 73 GLU 73 72 72 GLU GLU A . n 
A 1 74 PHE 74 73 73 PHE PHE A . n 
A 1 75 MET 75 74 74 MET MET A . n 
A 1 76 ALA 76 75 75 ALA ALA A . n 
A 1 77 PHE 77 76 76 PHE PHE A . n 
A 1 78 VAL 78 77 77 VAL VAL A . n 
A 1 79 ALA 79 78 78 ALA ALA A . n 
A 1 80 MET 80 79 79 MET MET A . n 
A 1 81 ILE 81 80 80 ILE ILE A . n 
A 1 82 THR 82 81 81 THR THR A . n 
A 1 83 THR 83 82 82 THR THR A . n 
A 1 84 ALA 84 83 83 ALA ALA A . n 
A 1 85 CYS 85 84 84 CYS CYS A . n 
A 1 86 HIS 86 85 85 HIS HIS A . n 
A 1 87 GLU 87 86 86 GLU GLU A . n 
A 1 88 PHE 88 87 87 PHE PHE A . n 
A 1 89 PHE 89 88 88 PHE PHE A . n 
A 1 90 GLU 90 89 89 GLU GLU A . n 
A 1 91 HIS 91 90 ?  ?   ?   A . n 
A 1 92 GLU 92 91 ?  ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CA  1  92  91 CA  CA  A . 
C 2 CA  1  93  92 CA  CA  A . 
D 3 ZN  1  94  93 ZN  ZN  A . 
E 4 HOH 1  95  1  HOH HOH A . 
E 4 HOH 2  96  2  HOH HOH A . 
E 4 HOH 3  97  3  HOH HOH A . 
E 4 HOH 4  98  4  HOH HOH A . 
E 4 HOH 5  99  5  HOH HOH A . 
E 4 HOH 6  100 6  HOH HOH A . 
E 4 HOH 7  101 7  HOH HOH A . 
E 4 HOH 8  102 8  HOH HOH A . 
E 4 HOH 9  103 9  HOH HOH A . 
E 4 HOH 10 104 10 HOH HOH A . 
E 4 HOH 11 105 11 HOH HOH A . 
E 4 HOH 12 106 12 HOH HOH A . 
E 4 HOH 13 107 13 HOH HOH A . 
E 4 HOH 14 108 14 HOH HOH A . 
E 4 HOH 15 109 15 HOH HOH A . 
E 4 HOH 16 110 16 HOH HOH A . 
E 4 HOH 17 111 17 HOH HOH A . 
E 4 HOH 18 112 18 HOH HOH A . 
E 4 HOH 19 113 19 HOH HOH A . 
E 4 HOH 20 114 20 HOH HOH A . 
E 4 HOH 21 115 21 HOH HOH A . 
E 4 HOH 22 116 22 HOH HOH A . 
E 4 HOH 23 117 23 HOH HOH A . 
E 4 HOH 24 118 24 HOH HOH A . 
E 4 HOH 25 119 25 HOH HOH A . 
E 4 HOH 26 120 26 HOH HOH A . 
E 4 HOH 27 121 27 HOH HOH A . 
E 4 HOH 28 122 28 HOH HOH A . 
E 4 HOH 29 123 29 HOH HOH A . 
E 4 HOH 30 124 30 HOH HOH A . 
E 4 HOH 31 125 31 HOH HOH A . 
E 4 HOH 32 126 32 HOH HOH A . 
E 4 HOH 33 127 33 HOH HOH A . 
E 4 HOH 34 128 34 HOH HOH A . 
E 4 HOH 35 129 35 HOH HOH A . 
E 4 HOH 36 130 36 HOH HOH A . 
E 4 HOH 37 131 37 HOH HOH A . 
E 4 HOH 38 132 38 HOH HOH A . 
E 4 HOH 39 133 39 HOH HOH A . 
E 4 HOH 40 134 40 HOH HOH A . 
E 4 HOH 41 135 41 HOH HOH A . 
E 4 HOH 42 136 42 HOH HOH A . 
E 4 HOH 43 137 43 HOH HOH A . 
E 4 HOH 44 138 44 HOH HOH A . 
E 4 HOH 45 139 45 HOH HOH A . 
E 4 HOH 46 140 46 HOH HOH A . 
E 4 HOH 47 141 47 HOH HOH A . 
E 4 HOH 48 142 48 HOH HOH A . 
E 4 HOH 49 143 49 HOH HOH A . 
E 4 HOH 50 144 50 HOH HOH A . 
E 4 HOH 51 145 51 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3260   ? 
1 MORE         -159.9 ? 
1 'SSA (A^2)'  9550   ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z   1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 97  ? E HOH . 
2 1 A HOH 138 ? E HOH . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? A SER 19 ? A SER 18 ? 1_555 CA ? B CA . ? A CA 92 ? 1_555 O   ? A GLU 22 ? A GLU 21  ? 1_555 102.8 ? 
2  O   ? A SER 19 ? A SER 18 ? 1_555 CA ? B CA . ? A CA 92 ? 1_555 O   ? A ASP 24 ? A ASP 23  ? 1_555 73.9  ? 
3  O   ? A GLU 22 ? A GLU 21 ? 1_555 CA ? B CA . ? A CA 92 ? 1_555 O   ? A ASP 24 ? A ASP 23  ? 1_555 89.1  ? 
4  O   ? A SER 19 ? A SER 18 ? 1_555 CA ? B CA . ? A CA 92 ? 1_555 O   ? A LYS 27 ? A LYS 26  ? 1_555 90.7  ? 
5  O   ? A GLU 22 ? A GLU 21 ? 1_555 CA ? B CA . ? A CA 92 ? 1_555 O   ? A LYS 27 ? A LYS 26  ? 1_555 158.3 ? 
6  O   ? A ASP 24 ? A ASP 23 ? 1_555 CA ? B CA . ? A CA 92 ? 1_555 O   ? A LYS 27 ? A LYS 26  ? 1_555 78.3  ? 
7  O   ? A SER 19 ? A SER 18 ? 1_555 CA ? B CA . ? A CA 92 ? 1_555 OE1 ? A GLU 32 ? A GLU 31  ? 1_555 99.3  ? 
8  O   ? A GLU 22 ? A GLU 21 ? 1_555 CA ? B CA . ? A CA 92 ? 1_555 OE1 ? A GLU 32 ? A GLU 31  ? 1_555 116.7 ? 
9  O   ? A ASP 24 ? A ASP 23 ? 1_555 CA ? B CA . ? A CA 92 ? 1_555 OE1 ? A GLU 32 ? A GLU 31  ? 1_555 154.2 ? 
10 O   ? A LYS 27 ? A LYS 26 ? 1_555 CA ? B CA . ? A CA 92 ? 1_555 OE1 ? A GLU 32 ? A GLU 31  ? 1_555 76.9  ? 
11 O   ? A SER 19 ? A SER 18 ? 1_555 CA ? B CA . ? A CA 92 ? 1_555 OE2 ? A GLU 32 ? A GLU 31  ? 1_555 82.2  ? 
12 O   ? A GLU 22 ? A GLU 21 ? 1_555 CA ? B CA . ? A CA 92 ? 1_555 OE2 ? A GLU 32 ? A GLU 31  ? 1_555 74.4  ? 
13 O   ? A ASP 24 ? A ASP 23 ? 1_555 CA ? B CA . ? A CA 92 ? 1_555 OE2 ? A GLU 32 ? A GLU 31  ? 1_555 147.2 ? 
14 O   ? A LYS 27 ? A LYS 26 ? 1_555 CA ? B CA . ? A CA 92 ? 1_555 OE2 ? A GLU 32 ? A GLU 31  ? 1_555 124.8 ? 
15 OE1 ? A GLU 32 ? A GLU 31 ? 1_555 CA ? B CA . ? A CA 92 ? 1_555 OE2 ? A GLU 32 ? A GLU 31  ? 1_555 51.1  ? 
16 O   ? A SER 19 ? A SER 18 ? 1_555 CA ? B CA . ? A CA 92 ? 1_555 O   ? E HOH .  ? A HOH 125 ? 1_555 164.9 ? 
17 O   ? A GLU 22 ? A GLU 21 ? 1_555 CA ? B CA . ? A CA 92 ? 1_555 O   ? E HOH .  ? A HOH 125 ? 1_555 75.1  ? 
18 O   ? A ASP 24 ? A ASP 23 ? 1_555 CA ? B CA . ? A CA 92 ? 1_555 O   ? E HOH .  ? A HOH 125 ? 1_555 91.0  ? 
19 O   ? A LYS 27 ? A LYS 26 ? 1_555 CA ? B CA . ? A CA 92 ? 1_555 O   ? E HOH .  ? A HOH 125 ? 1_555 87.5  ? 
20 OE1 ? A GLU 32 ? A GLU 31 ? 1_555 CA ? B CA . ? A CA 92 ? 1_555 O   ? E HOH .  ? A HOH 125 ? 1_555 94.8  ? 
21 OE2 ? A GLU 32 ? A GLU 31 ? 1_555 CA ? B CA . ? A CA 92 ? 1_555 O   ? E HOH .  ? A HOH 125 ? 1_555 111.0 ? 
22 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? C CA . ? A CA 93 ? 1_555 OD1 ? A ASP 64 ? A ASP 63  ? 1_555 86.6  ? 
23 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? C CA . ? A CA 93 ? 1_555 OD1 ? A ASP 66 ? A ASP 65  ? 1_555 84.0  ? 
24 OD1 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? C CA . ? A CA 93 ? 1_555 OD1 ? A ASP 66 ? A ASP 65  ? 1_555 80.9  ? 
25 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? C CA . ? A CA 93 ? 1_555 O   ? A GLU 68 ? A GLU 67  ? 1_555 81.9  ? 
26 OD1 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? C CA . ? A CA 93 ? 1_555 O   ? A GLU 68 ? A GLU 67  ? 1_555 151.6 ? 
27 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 CA ? C CA . ? A CA 93 ? 1_555 O   ? A GLU 68 ? A GLU 67  ? 1_555 72.2  ? 
28 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? C CA . ? A CA 93 ? 1_555 OE1 ? A GLU 73 ? A GLU 72  ? 1_555 114.6 ? 
29 OD1 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? C CA . ? A CA 93 ? 1_555 OE1 ? A GLU 73 ? A GLU 72  ? 1_555 126.9 ? 
30 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 CA ? C CA . ? A CA 93 ? 1_555 OE1 ? A GLU 73 ? A GLU 72  ? 1_555 145.3 ? 
31 O   ? A GLU 68 ? A GLU 67 ? 1_555 CA ? C CA . ? A CA 93 ? 1_555 OE1 ? A GLU 73 ? A GLU 72  ? 1_555 81.5  ? 
32 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? C CA . ? A CA 93 ? 1_555 OE2 ? A GLU 73 ? A GLU 72  ? 1_555 91.0  ? 
33 OD1 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? C CA . ? A CA 93 ? 1_555 OE2 ? A GLU 73 ? A GLU 72  ? 1_555 79.0  ? 
34 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 CA ? C CA . ? A CA 93 ? 1_555 OE2 ? A GLU 73 ? A GLU 72  ? 1_555 159.6 ? 
35 O   ? A GLU 68 ? A GLU 67 ? 1_555 CA ? C CA . ? A CA 93 ? 1_555 OE2 ? A GLU 73 ? A GLU 72  ? 1_555 126.8 ? 
36 OE1 ? A GLU 73 ? A GLU 72 ? 1_555 CA ? C CA . ? A CA 93 ? 1_555 OE2 ? A GLU 73 ? A GLU 72  ? 1_555 54.0  ? 
37 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? C CA . ? A CA 93 ? 1_555 O   ? E HOH .  ? A HOH 107 ? 1_555 152.6 ? 
38 OD1 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? C CA . ? A CA 93 ? 1_555 O   ? E HOH .  ? A HOH 107 ? 1_555 81.5  ? 
39 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 CA ? C CA . ? A CA 93 ? 1_555 O   ? E HOH .  ? A HOH 107 ? 1_555 69.8  ? 
40 O   ? A GLU 68 ? A GLU 67 ? 1_555 CA ? C CA . ? A CA 93 ? 1_555 O   ? E HOH .  ? A HOH 107 ? 1_555 97.2  ? 
41 OE1 ? A GLU 73 ? A GLU 72 ? 1_555 CA ? C CA . ? A CA 93 ? 1_555 O   ? E HOH .  ? A HOH 107 ? 1_555 92.1  ? 
42 OE2 ? A GLU 73 ? A GLU 72 ? 1_555 CA ? C CA . ? A CA 93 ? 1_555 O   ? E HOH .  ? A HOH 107 ? 1_555 110.6 ? 
43 NE2 ? A HIS 86 ? A HIS 85 ? 1_555 ZN ? D ZN . ? A ZN 94 ? 1_555 OE2 ? A GLU 90 ? A GLU 89  ? 1_555 111.2 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-06-24 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-10-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
3 3 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 3.1509   -5.8189 3.1449   -0.2329 -0.0527 -0.0746 -0.0159 -0.0301 -0.0409 15.0468 52.7404 13.7128 11.6844 -13.0121 
0.2606  -0.3804 0.4717  -0.0914 -0.0239 -0.3752 -2.2804 0.5331  -0.5370 2.0453  'X-RAY DIFFRACTION' 
2 ? refined -1.8090  5.6734  6.6826   -0.0581 -0.0375 -0.2273 -0.0262 -0.0246 -0.0514 3.5770  34.9755 5.1481  -1.0311 1.8703   
9.2608  -0.2090 0.3145  -0.1055 -0.2817 0.1995  -0.4317 0.8121  -0.4441 0.3891  'X-RAY DIFFRACTION' 
3 ? refined -5.3851  16.6111 4.6417   -0.0536 -0.1218 -0.1102 0.0103  0.0222  -0.0485 7.5902  7.7362  7.9819  -0.8487 -2.3012  
0.9065  -0.3049 0.4098  -0.1050 -0.7590 0.4696  0.0461  0.9541  -0.5184 0.2948  'X-RAY DIFFRACTION' 
4 ? refined -10.6505 17.1056 -5.1190  -0.1275 -0.1962 -0.0608 -0.0097 -0.0166 -0.0219 9.1480  8.2051  3.5526  -3.9348 -1.4316  
0.3983  0.1982  -0.1093 -0.0889 0.2462  -0.0285 0.5266  -0.5166 -0.4401 -0.1813 'X-RAY DIFFRACTION' 
5 ? refined -12.9284 8.8094  3.8166   -0.1725 -0.1265 0.0419  0.0566  0.1179  0.1318  3.8631  17.1273 11.0173 -1.2678 0.5862   
6.3054  -0.1979 0.8953  -0.6974 -0.6567 -0.0062 1.2871  1.0775  -0.0764 0.0205  'X-RAY DIFFRACTION' 
6 ? refined -7.3541  1.5892  -12.1918 0.2161  0.0572  -0.1213 -0.3017 -0.0797 0.0541  2.2893  24.4172 25.9487 -5.5031 -5.1887  
19.0854 0.0162  0.9153  -0.9315 0.4189  -0.0092 0.2062  -2.8105 -1.2677 0.6666  'X-RAY DIFFRACTION' 
7 ? refined -8.5365  11.7914 -1.9453  -0.1023 -0.1429 0.0419  -0.0580 0.0559  0.0336  2.9819  4.7105  3.5695  -1.4467 0.3536   
-0.2262 -0.0433 0.2236  -0.1804 -0.0118 -0.2394 0.4525  -0.1396 -0.1366 -0.0077 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A A 5   ? 0  A 1  A 6  'X-RAY DIFFRACTION' ? 
2 2 A A 16  ? 6  A 7  A 17 'X-RAY DIFFRACTION' ? 
3 3 A A 40  ? 17 A 18 A 41 'X-RAY DIFFRACTION' ? 
4 4 A A 63  ? 41 A 42 A 64 'X-RAY DIFFRACTION' ? 
5 5 A A 78  ? 64 A 65 A 79 'X-RAY DIFFRACTION' ? 
6 6 A A 93  ? 79 A 80 C 1  'X-RAY DIFFRACTION' ? 
7 7 A A 145 ? 95 E 1  E 51 'X-RAY DIFFRACTION' ? 
# 
_pdbx_phasing_MR.entry_id                     3CR2 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                'Phaser MODE: MR_AUTO' 
_pdbx_phasing_MR.R_factor                     ? 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          2.500 
_pdbx_phasing_MR.d_res_low_rotation           22.730 
_pdbx_phasing_MR.d_res_high_translation       2.500 
_pdbx_phasing_MR.d_res_low_translation        22.730 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
_phasing.method   MR 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
DENZO       .     ?                    package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu       'data reduction'  
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 1 
SCALEPACK   .     ?                    package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu       'data scaling'    
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 2 
PHASER      .     ?                    other   'R. J. Read'         cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/      ?          ? 3 
REFMAC      .     ?                    program 'Murshudov, G.N.'    ccp4@dl.ac.uk               refinement        
http://www.ccp4.ac.uk/main.html                  Fortran_77 ? 4 
PDB_EXTRACT 3.005 'September 10, 2007' package PDB                  sw-help@rcsb.rutgers.edu    'data extraction' 
http://pdb.rutgers.edu/software/                 C++        ? 5 
Blu-Ice     .     ?                    ?       ?                    ?                           'data collection' ? ?          ? 6 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    115 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    145 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             1.83 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 5  ? CE  ? A LYS 6  CE  
2  1 Y 1 A LYS 5  ? NZ  ? A LYS 6  NZ  
3  1 Y 1 A GLU 21 ? OE2 ? A GLU 22 OE2 
4  1 Y 1 A LYS 24 ? CD  ? A LYS 25 CD  
5  1 Y 1 A LYS 24 ? CE  ? A LYS 25 CE  
6  1 Y 1 A LYS 24 ? NZ  ? A LYS 25 NZ  
7  1 Y 1 A LYS 26 ? CE  ? A LYS 27 CE  
8  1 Y 1 A LYS 26 ? NZ  ? A LYS 27 NZ  
9  1 Y 1 A GLU 49 ? CD  ? A GLU 50 CD  
10 1 Y 1 A GLU 49 ? OE1 ? A GLU 50 OE1 
11 1 Y 1 A GLU 49 ? OE2 ? A GLU 50 OE2 
12 1 Y 1 A LYS 55 ? CE  ? A LYS 56 CE  
13 1 Y 1 A LYS 55 ? NZ  ? A LYS 56 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A HIS 90 ? A HIS 91 
2 1 Y 1 A GLU 91 ? A GLU 92 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CALCIUM ION' CA  
3 'ZINC ION'    ZN  
4 water         HOH 
#