data_3CR4
# 
_entry.id   3CR4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3CR4         
RCSB  RCSB047112   
WWPDB D_1000047112 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3CR2 . unspecified 
PDB 3CR5 . unspecified 
# 
_pdbx_database_status.entry_id                        3CR4 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2008-04-04 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
_audit_author.name           'Charpentier, T.H.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     'Divalent metal ion complexes of S100B in the absence and presence of pentamidine.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            382 
_citation.page_first                56 
_citation.page_last                 73 
_citation.year                      2008 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18602402 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2008.06.047 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Charpentier, T.H.' 1 
primary 'Wilder, P.T.'      2 
primary 'Liriano, M.A.'     3 
primary 'Varney, K.M.'      4 
primary 'Pozharski, E.'     5 
primary 'MacKerell, A.D.'   6 
primary 'Coop, A.'          7 
primary 'Toth, E.A.'        8 
primary 'Weber, D.J.'       9 
# 
_cell.entry_id           3CR4 
_cell.length_a           63.587 
_cell.length_b           63.587 
_cell.length_c           48.248 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3CR4 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Protein S100-B'                   10681.974 1  ? ? ? ? 
2 non-polymer syn '1,5-BIS(4-AMIDINOPHENOXY)PENTANE' 340.419   2  ? ? ? ? 
3 non-polymer syn 'CALCIUM ION'                      40.078    2  ? ? ? ? 
4 water       nat water                              18.015    35 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'S100 calcium-binding protein B, S-100 protein subunit beta, S-100 protein beta chain' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAM
ITTACHEFFEHE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAM
ITTACHEFFEHE
;
_entity_poly.pdbx_strand_id                 X 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  SER n 
1 3  GLU n 
1 4  LEU n 
1 5  GLU n 
1 6  LYS n 
1 7  ALA n 
1 8  VAL n 
1 9  VAL n 
1 10 ALA n 
1 11 LEU n 
1 12 ILE n 
1 13 ASP n 
1 14 VAL n 
1 15 PHE n 
1 16 HIS n 
1 17 GLN n 
1 18 TYR n 
1 19 SER n 
1 20 GLY n 
1 21 ARG n 
1 22 GLU n 
1 23 GLY n 
1 24 ASP n 
1 25 LYS n 
1 26 HIS n 
1 27 LYS n 
1 28 LEU n 
1 29 LYS n 
1 30 LYS n 
1 31 SER n 
1 32 GLU n 
1 33 LEU n 
1 34 LYS n 
1 35 GLU n 
1 36 LEU n 
1 37 ILE n 
1 38 ASN n 
1 39 ASN n 
1 40 GLU n 
1 41 LEU n 
1 42 SER n 
1 43 HIS n 
1 44 PHE n 
1 45 LEU n 
1 46 GLU n 
1 47 GLU n 
1 48 ILE n 
1 49 LYS n 
1 50 GLU n 
1 51 GLN n 
1 52 GLU n 
1 53 VAL n 
1 54 VAL n 
1 55 ASP n 
1 56 LYS n 
1 57 VAL n 
1 58 MET n 
1 59 GLU n 
1 60 THR n 
1 61 LEU n 
1 62 ASP n 
1 63 SER n 
1 64 ASP n 
1 65 GLY n 
1 66 ASP n 
1 67 GLY n 
1 68 GLU n 
1 69 CYS n 
1 70 ASP n 
1 71 PHE n 
1 72 GLN n 
1 73 GLU n 
1 74 PHE n 
1 75 MET n 
1 76 ALA n 
1 77 PHE n 
1 78 VAL n 
1 79 ALA n 
1 80 MET n 
1 81 ILE n 
1 82 THR n 
1 83 THR n 
1 84 ALA n 
1 85 CYS n 
1 86 HIS n 
1 87 GLU n 
1 88 PHE n 
1 89 PHE n 
1 90 GLU n 
1 91 HIS n 
1 92 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               Bovine 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 S100B 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Bos taurus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     ? 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'HMS174(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET11b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    S100B_BOVIN 
_struct_ref.pdbx_db_accession          P02638 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAM
ITTACHEFFEHE
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3CR4 
_struct_ref_seq.pdbx_strand_id                X 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 92 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P02638 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  92 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       0 
_struct_ref_seq.pdbx_auth_seq_align_end       91 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                            ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                           ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                         ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                    ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'                      ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE                           ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                          ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                    ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                            ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                          ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                              ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                         ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                            ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                             ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                         ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                      ? 'C9 H11 N O2'    165.189 
PNT non-polymer         . '1,5-BIS(4-AMIDINOPHENOXY)PENTANE' ? 'C19 H24 N4 O2'  340.419 
SER 'L-peptide linking' y SERINE                             ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                          ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE                           ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                             ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3CR4 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.28 
_exptl_crystal.density_percent_sol   46.12 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.1 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'PEG3350, CaCl2, Penamidine, Cacodylate buffer, pH 7.1, VAPOR DIFFUSION, SITTING DROP, temperature 298K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV++' 
_diffrn_detector.pdbx_collection_date   2005-08-05 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU MICROMAX-007' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     3CR4 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            2.150 
_reflns.number_obs                   5795 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100.000 
_reflns.pdbx_Rmerge_I_obs            0.081 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        9.600 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              12.000 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.percent_possible_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.15 2.23  100.00 0.666 ? ? 12.10 ? ? ? ? ? ? 1  1 
2.23 2.32  100.00 0.502 ? ? 12.10 ? ? ? ? ? ? 2  1 
2.32 2.42  100.00 0.375 ? ? 12.20 ? ? ? ? ? ? 3  1 
2.42 2.55  100.00 0.281 ? ? 12.10 ? ? ? ? ? ? 4  1 
2.55 2.71  100.00 0.227 ? ? 12.30 ? ? ? ? ? ? 5  1 
2.71 2.92  100.00 0.142 ? ? 12.20 ? ? ? ? ? ? 6  1 
2.92 3.21  100.00 0.106 ? ? 12.20 ? ? ? ? ? ? 7  1 
3.21 3.68  100.00 0.064 ? ? 12.20 ? ? ? ? ? ? 8  1 
3.68 4.63  100.00 0.046 ? ? 11.90 ? ? ? ? ? ? 9  1 
4.63 50.00 99.70  0.031 ? ? 11.00 ? ? ? ? ? ? 10 1 
# 
_refine.entry_id                                 3CR4 
_refine.ls_number_reflns_obs                     5502 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             44.95 
_refine.ls_d_res_high                            2.15 
_refine.ls_percent_reflns_obs                    99.98 
_refine.ls_R_factor_obs                          0.21086 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.20858 
_refine.ls_R_factor_R_free                       0.26596 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.6 
_refine.ls_number_reflns_R_free                  263 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.950 
_refine.correlation_coeff_Fo_to_Fc_free          0.891 
_refine.B_iso_mean                               35.872 
_refine.aniso_B[1][1]                            -0.32 
_refine.aniso_B[2][2]                            -0.32 
_refine.aniso_B[3][3]                            0.64 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.274 
_refine.pdbx_overall_ESU_R_Free                  0.223 
_refine.overall_SU_ML                            0.152 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             13.390 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        727 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         52 
_refine_hist.number_atoms_solvent             35 
_refine_hist.number_atoms_total               814 
_refine_hist.d_res_high                       2.15 
_refine_hist.d_res_low                        44.95 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.008  0.021  ? 790  'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.135  2.019  ? 1053 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       4.409  5.000  ? 89   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       35.177 26.500 ? 40   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       16.115 15.000 ? 145  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       8.486  15.000 ? 1    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.091  0.200  ? 108  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.003  0.020  ? 598  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.213  0.200  ? 365  'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.302  0.200  ? 534  'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.117  0.200  ? 39   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          0.097  0.200  ? 9    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.162  0.200  ? 52   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.144  0.200  ? 9    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.458  1.500  ? 460  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.713  2.000  ? 714  'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.082  3.000  ? 368  'X-RAY DIFFRACTION' ? 
r_scangle_it                 1.671  4.500  ? 339  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.147 
_refine_ls_shell.d_res_low                        2.203 
_refine_ls_shell.number_reflns_R_work             390 
_refine_ls_shell.R_factor_R_work                  0.252 
_refine_ls_shell.percent_reflns_obs               99.76 
_refine_ls_shell.R_factor_R_free                  0.267 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             27 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3CR4 
_struct.title                     'X-ray structure of bovine Pnt,Ca(2+)-S100B' 
_struct.pdbx_descriptor           'Protein S100-B' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3CR4 
_struct_keywords.text            'EF hand, Alpha helical, Metal-binding, Nucleus, METAL BINDING PROTEIN' 
_struct_keywords.pdbx_keywords   'METAL BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 2  ? GLY A 20 ? SER X 1  GLY X 19 1 ? 19 
HELX_P HELX_P2 2 LYS A 29 ? LEU A 41 ? LYS X 28 LEU X 40 1 ? 13 
HELX_P HELX_P3 3 GLU A 50 ? ASP A 62 ? GLU X 49 ASP X 61 1 ? 13 
HELX_P HELX_P4 4 ASP A 70 ? GLU A 87 ? ASP X 69 GLU X 86 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A SER 19 O   ? ? ? 1_555 D CA  . CA ? ? X SER 18  X CA  103 1_555 ? ? ? ? ? ? ? 2.286 ? 
metalc2  metalc ? ? A GLU 22 O   ? ? ? 1_555 D CA  . CA ? ? X GLU 21  X CA  103 1_555 ? ? ? ? ? ? ? 2.400 ? 
metalc3  metalc ? ? A ASP 24 O   ? ? ? 1_555 D CA  . CA ? ? X ASP 23  X CA  103 1_555 ? ? ? ? ? ? ? 2.377 ? 
metalc4  metalc ? ? A LYS 27 O   ? ? ? 1_555 D CA  . CA ? ? X LYS 26  X CA  103 1_555 ? ? ? ? ? ? ? 2.394 ? 
metalc5  metalc ? ? A GLU 32 OE1 ? ? ? 1_555 D CA  . CA ? ? X GLU 31  X CA  103 1_555 ? ? ? ? ? ? ? 2.494 ? 
metalc6  metalc ? ? A GLU 32 OE2 ? ? ? 1_555 D CA  . CA ? ? X GLU 31  X CA  103 1_555 ? ? ? ? ? ? ? 2.554 ? 
metalc7  metalc ? ? A ASP 62 OD1 ? ? ? 1_555 E CA  . CA ? ? X ASP 61  X CA  104 1_555 ? ? ? ? ? ? ? 2.303 ? 
metalc8  metalc ? ? A ASP 64 OD1 ? ? ? 1_555 E CA  . CA ? ? X ASP 63  X CA  104 1_555 ? ? ? ? ? ? ? 2.306 ? 
metalc9  metalc ? ? A ASP 66 OD1 ? ? ? 1_555 E CA  . CA ? ? X ASP 65  X CA  104 1_555 ? ? ? ? ? ? ? 2.298 ? 
metalc10 metalc ? ? A GLU 68 O   ? ? ? 1_555 E CA  . CA ? ? X GLU 67  X CA  104 1_555 ? ? ? ? ? ? ? 2.344 ? 
metalc11 metalc ? ? A GLU 73 OE1 ? ? ? 1_555 E CA  . CA ? ? X GLU 72  X CA  104 1_555 ? ? ? ? ? ? ? 2.540 ? 
metalc12 metalc ? ? A GLU 73 OE2 ? ? ? 1_555 E CA  . CA ? ? X GLU 72  X CA  104 1_555 ? ? ? ? ? ? ? 2.569 ? 
metalc13 metalc ? ? D CA  .  CA  ? ? ? 1_555 F HOH . O  ? ? X CA  103 X HOH 105 1_555 ? ? ? ? ? ? ? 2.292 ? 
metalc14 metalc ? ? E CA  .  CA  ? ? ? 1_555 F HOH . O  ? ? X CA  104 X HOH 112 1_555 ? ? ? ? ? ? ? 2.485 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE PNT X 101' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE PNT X 102' 
AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA X 103'  
AC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA X 104'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7 MET A 1  ? MET X 0   . ? 2_555 ? 
2  AC1 7 ILE A 12 ? ILE X 11  . ? 2_555 ? 
3  AC1 7 ASP A 13 ? ASP X 12  . ? 2_555 ? 
4  AC1 7 HIS A 16 ? HIS X 15  . ? 2_555 ? 
5  AC1 7 CYS A 85 ? CYS X 84  . ? 7_556 ? 
6  AC1 7 HIS A 86 ? HIS X 85  . ? 1_555 ? 
7  AC1 7 PHE A 88 ? PHE X 87  . ? 1_555 ? 
8  AC2 4 MET A 1  ? MET X 0   . ? 8_555 ? 
9  AC2 4 HIS A 43 ? HIS X 42  . ? 7_556 ? 
10 AC2 4 PHE A 44 ? PHE X 43  . ? 1_555 ? 
11 AC2 4 PHE A 89 ? PHE X 88  . ? 1_555 ? 
12 AC3 6 SER A 19 ? SER X 18  . ? 1_555 ? 
13 AC3 6 GLU A 22 ? GLU X 21  . ? 1_555 ? 
14 AC3 6 ASP A 24 ? ASP X 23  . ? 1_555 ? 
15 AC3 6 LYS A 27 ? LYS X 26  . ? 1_555 ? 
16 AC3 6 GLU A 32 ? GLU X 31  . ? 1_555 ? 
17 AC3 6 HOH F .  ? HOH X 105 . ? 1_555 ? 
18 AC4 6 ASP A 62 ? ASP X 61  . ? 1_555 ? 
19 AC4 6 ASP A 64 ? ASP X 63  . ? 1_555 ? 
20 AC4 6 ASP A 66 ? ASP X 65  . ? 1_555 ? 
21 AC4 6 GLU A 68 ? GLU X 67  . ? 1_555 ? 
22 AC4 6 GLU A 73 ? GLU X 72  . ? 1_555 ? 
23 AC4 6 HOH F .  ? HOH X 112 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3CR4 
_atom_sites.fract_transf_matrix[1][1]   0.015726 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015726 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.020726 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N  N     . MET A 1 1  ? -10.732 -2.831  6.626   1.00 37.72 ? 0   MET X N     1 
ATOM   2   C  CA    . MET A 1 1  ? -9.520  -3.545  7.151   1.00 37.47 ? 0   MET X CA    1 
ATOM   3   C  C     . MET A 1 1  ? -9.378  -3.397  8.672   1.00 36.43 ? 0   MET X C     1 
ATOM   4   O  O     . MET A 1 1  ? -9.820  -2.398  9.254   1.00 36.83 ? 0   MET X O     1 
ATOM   5   C  CB    . MET A 1 1  ? -8.255  -3.062  6.438   1.00 37.53 ? 0   MET X CB    1 
ATOM   6   C  CG    . MET A 1 1  ? -8.098  -3.593  5.012   1.00 38.17 ? 0   MET X CG    1 
ATOM   7   S  SD    . MET A 1 1  ? -6.772  -2.799  4.066   1.00 39.43 ? 0   MET X SD    1 
ATOM   8   C  CE    . MET A 1 1  ? -5.312  -3.369  4.909   1.00 39.22 ? 0   MET X CE    1 
ATOM   9   N  N     . SER A 1 2  ? -8.781  -4.408  9.303   1.00 34.90 ? 1   SER X N     1 
ATOM   10  C  CA    . SER A 1 2  ? -8.534  -4.405  10.742  1.00 33.61 ? 1   SER X CA    1 
ATOM   11  C  C     . SER A 1 2  ? -7.332  -3.514  11.061  1.00 33.25 ? 1   SER X C     1 
ATOM   12  O  O     . SER A 1 2  ? -6.610  -3.095  10.152  1.00 32.47 ? 1   SER X O     1 
ATOM   13  C  CB    . SER A 1 2  ? -8.277  -5.833  11.249  1.00 33.46 ? 1   SER X CB    1 
ATOM   14  O  OG    . SER A 1 2  ? -6.962  -6.262  10.924  1.00 31.51 ? 1   SER X OG    1 
ATOM   15  N  N     . GLU A 1 3  ? -7.119  -3.235  12.350  1.00 32.77 ? 2   GLU X N     1 
ATOM   16  C  CA    . GLU A 1 3  ? -5.937  -2.488  12.792  1.00 32.54 ? 2   GLU X CA    1 
ATOM   17  C  C     . GLU A 1 3  ? -4.649  -3.230  12.438  1.00 31.85 ? 2   GLU X C     1 
ATOM   18  O  O     . GLU A 1 3  ? -3.700  -2.613  11.963  1.00 31.94 ? 2   GLU X O     1 
ATOM   19  C  CB    . GLU A 1 3  ? -5.996  -2.169  14.290  1.00 32.54 ? 2   GLU X CB    1 
ATOM   20  C  CG    . GLU A 1 3  ? -7.122  -1.201  14.693  1.00 34.47 ? 2   GLU X CG    1 
ATOM   21  C  CD    . GLU A 1 3  ? -7.012  0.161   14.012  1.00 36.54 ? 2   GLU X CD    1 
ATOM   22  O  OE1   . GLU A 1 3  ? -5.960  0.824   14.156  1.00 37.80 ? 2   GLU X OE1   1 
ATOM   23  O  OE2   . GLU A 1 3  ? -7.981  0.568   13.333  1.00 37.43 ? 2   GLU X OE2   1 
ATOM   24  N  N     . LEU A 1 4  ? -4.626  -4.548  12.659  1.00 31.26 ? 3   LEU X N     1 
ATOM   25  C  CA    . LEU A 1 4  ? -3.504  -5.394  12.242  1.00 30.78 ? 3   LEU X CA    1 
ATOM   26  C  C     . LEU A 1 4  ? -3.240  -5.258  10.742  1.00 30.52 ? 3   LEU X C     1 
ATOM   27  O  O     . LEU A 1 4  ? -2.106  -5.025  10.320  1.00 30.63 ? 3   LEU X O     1 
ATOM   28  C  CB    . LEU A 1 4  ? -3.764  -6.870  12.576  1.00 30.41 ? 3   LEU X CB    1 
ATOM   29  C  CG    . LEU A 1 4  ? -2.579  -7.798  12.920  1.00 31.26 ? 3   LEU X CG    1 
ATOM   30  C  CD1   . LEU A 1 4  ? -2.933  -9.264  12.676  1.00 28.63 ? 3   LEU X CD1   1 
ATOM   31  C  CD2   . LEU A 1 4  ? -1.247  -7.453  12.255  1.00 29.26 ? 3   LEU X CD2   1 
ATOM   32  N  N     . GLU A 1 5  ? -4.284  -5.403  9.937   1.00 30.40 ? 4   GLU X N     1 
ATOM   33  C  CA    . GLU A 1 5  ? -4.140  -5.285  8.483   1.00 30.77 ? 4   GLU X CA    1 
ATOM   34  C  C     . GLU A 1 5  ? -3.634  -3.903  8.038   1.00 31.03 ? 4   GLU X C     1 
ATOM   35  O  O     . GLU A 1 5  ? -2.799  -3.804  7.134   1.00 31.39 ? 4   GLU X O     1 
ATOM   36  C  CB    . GLU A 1 5  ? -5.436  -5.680  7.774   1.00 30.46 ? 4   GLU X CB    1 
ATOM   37  C  CG    . GLU A 1 5  ? -5.660  -7.181  7.771   1.00 30.42 ? 4   GLU X CG    1 
ATOM   38  C  CD    . GLU A 1 5  ? -7.056  -7.600  7.378   1.00 30.15 ? 4   GLU X CD    1 
ATOM   39  O  OE1   . GLU A 1 5  ? -8.015  -6.823  7.558   1.00 30.63 ? 4   GLU X OE1   1 
ATOM   40  O  OE2   . GLU A 1 5  ? -7.202  -8.739  6.892   1.00 32.25 ? 4   GLU X OE2   1 
ATOM   41  N  N     . LYS A 1 6  ? -4.115  -2.846  8.690   1.00 31.13 ? 5   LYS X N     1 
ATOM   42  C  CA    . LYS A 1 6  ? -3.640  -1.486  8.417   1.00 31.30 ? 5   LYS X CA    1 
ATOM   43  C  C     . LYS A 1 6  ? -2.186  -1.309  8.855   1.00 31.26 ? 5   LYS X C     1 
ATOM   44  O  O     . LYS A 1 6  ? -1.420  -0.605  8.195   1.00 31.01 ? 5   LYS X O     1 
ATOM   45  C  CB    . LYS A 1 6  ? -4.513  -0.434  9.108   1.00 30.84 ? 5   LYS X CB    1 
ATOM   46  C  CG    . LYS A 1 6  ? -5.952  -0.367  8.635   1.00 31.98 ? 5   LYS X CG    1 
ATOM   47  C  CD    . LYS A 1 6  ? -6.696  0.756   9.364   1.00 32.33 ? 5   LYS X CD    1 
ATOM   48  C  CE    . LYS A 1 6  ? -8.016  0.263   9.952   1.00 35.97 ? 5   LYS X CE    1 
ATOM   49  N  NZ    . LYS A 1 6  ? -8.703  1.294   10.806  1.00 36.70 ? 5   LYS X NZ    1 
ATOM   50  N  N     . ALA A 1 7  ? -1.815  -1.947  9.967   1.00 31.12 ? 6   ALA X N     1 
ATOM   51  C  CA    . ALA A 1 7  ? -0.447  -1.868  10.490  1.00 31.23 ? 6   ALA X CA    1 
ATOM   52  C  C     . ALA A 1 7  ? 0.549   -2.521  9.534   1.00 31.56 ? 6   ALA X C     1 
ATOM   53  O  O     . ALA A 1 7  ? 1.653   -1.996  9.318   1.00 31.46 ? 6   ALA X O     1 
ATOM   54  C  CB    . ALA A 1 7  ? -0.356  -2.497  11.878  1.00 31.03 ? 6   ALA X CB    1 
ATOM   55  N  N     . VAL A 1 8  ? 0.156   -3.662  8.970   1.00 31.62 ? 7   VAL X N     1 
ATOM   56  C  CA    . VAL A 1 8  ? 0.951   -4.346  7.950   1.00 31.72 ? 7   VAL X CA    1 
ATOM   57  C  C     . VAL A 1 8  ? 1.254   -3.429  6.758   1.00 32.07 ? 7   VAL X C     1 
ATOM   58  O  O     . VAL A 1 8  ? 2.412   -3.315  6.347   1.00 32.42 ? 7   VAL X O     1 
ATOM   59  C  CB    . VAL A 1 8  ? 0.269   -5.662  7.474   1.00 31.73 ? 7   VAL X CB    1 
ATOM   60  C  CG1   . VAL A 1 8  ? 0.926   -6.201  6.219   1.00 31.43 ? 7   VAL X CG1   1 
ATOM   61  C  CG2   . VAL A 1 8  ? 0.304   -6.718  8.579   1.00 31.52 ? 7   VAL X CG2   1 
ATOM   62  N  N     . VAL A 1 9  ? 0.233   -2.777  6.197   1.00 32.18 ? 8   VAL X N     1 
ATOM   63  C  CA    . VAL A 1 9  ? 0.470   -1.901  5.044   1.00 32.27 ? 8   VAL X CA    1 
ATOM   64  C  C     . VAL A 1 9  ? 1.319   -0.680  5.429   1.00 32.18 ? 8   VAL X C     1 
ATOM   65  O  O     . VAL A 1 9  ? 2.165   -0.237  4.647   1.00 31.46 ? 8   VAL X O     1 
ATOM   66  C  CB    . VAL A 1 9  ? -0.833  -1.475  4.281   1.00 32.70 ? 8   VAL X CB    1 
ATOM   67  C  CG1   . VAL A 1 9  ? -1.736  -2.675  3.999   1.00 32.04 ? 8   VAL X CG1   1 
ATOM   68  C  CG2   . VAL A 1 9  ? -1.584  -0.426  5.041   1.00 33.78 ? 8   VAL X CG2   1 
ATOM   69  N  N     . ALA A 1 10 ? 1.093   -0.151  6.633   1.00 31.84 ? 9   ALA X N     1 
ATOM   70  C  CA    . ALA A 1 10 ? 1.885   0.963   7.143   1.00 31.99 ? 9   ALA X CA    1 
ATOM   71  C  C     . ALA A 1 10 ? 3.379   0.631   7.177   1.00 32.01 ? 9   ALA X C     1 
ATOM   72  O  O     . ALA A 1 10 ? 4.208   1.499   6.926   1.00 31.59 ? 9   ALA X O     1 
ATOM   73  C  CB    . ALA A 1 10 ? 1.401   1.387   8.513   1.00 31.85 ? 9   ALA X CB    1 
ATOM   74  N  N     . LEU A 1 11 ? 3.712   -0.623  7.482   1.00 32.47 ? 10  LEU X N     1 
ATOM   75  C  CA    . LEU A 1 11 ? 5.112   -1.066  7.522   1.00 32.67 ? 10  LEU X CA    1 
ATOM   76  C  C     . LEU A 1 11 ? 5.734   -1.056  6.129   1.00 33.12 ? 10  LEU X C     1 
ATOM   77  O  O     . LEU A 1 11 ? 6.904   -0.683  5.962   1.00 33.05 ? 10  LEU X O     1 
ATOM   78  C  CB    . LEU A 1 11 ? 5.232   -2.463  8.127   1.00 32.60 ? 10  LEU X CB    1 
ATOM   79  C  CG    . LEU A 1 11 ? 4.800   -2.701  9.584   1.00 32.82 ? 10  LEU X CG    1 
ATOM   80  C  CD1   . LEU A 1 11 ? 5.101   -4.128  9.979   1.00 31.33 ? 10  LEU X CD1   1 
ATOM   81  C  CD2   . LEU A 1 11 ? 5.444   -1.715  10.561  1.00 31.44 ? 10  LEU X CD2   1 
ATOM   82  N  N     . ILE A 1 12 ? 4.942   -1.472  5.141   1.00 33.47 ? 11  ILE X N     1 
ATOM   83  C  CA    . ILE A 1 12 ? 5.343   -1.452  3.733   1.00 34.16 ? 11  ILE X CA    1 
ATOM   84  C  C     . ILE A 1 12 ? 5.401   -0.024  3.209   1.00 34.33 ? 11  ILE X C     1 
ATOM   85  O  O     . ILE A 1 12 ? 6.319   0.323   2.466   1.00 34.46 ? 11  ILE X O     1 
ATOM   86  C  CB    . ILE A 1 12 ? 4.397   -2.308  2.845   1.00 34.14 ? 11  ILE X CB    1 
ATOM   87  C  CG1   . ILE A 1 12 ? 4.202   -3.695  3.460   1.00 34.16 ? 11  ILE X CG1   1 
ATOM   88  C  CG2   . ILE A 1 12 ? 4.970   -2.469  1.440   1.00 34.87 ? 11  ILE X CG2   1 
ATOM   89  C  CD1   . ILE A 1 12 ? 3.009   -4.458  2.915   1.00 34.28 ? 11  ILE X CD1   1 
ATOM   90  N  N     . ASP A 1 13 ? 4.433   0.803   3.602   1.00 34.71 ? 12  ASP X N     1 
ATOM   91  C  CA    . ASP A 1 13 ? 4.398   2.201   3.175   1.00 35.32 ? 12  ASP X CA    1 
ATOM   92  C  C     . ASP A 1 13 ? 5.669   2.924   3.588   1.00 35.16 ? 12  ASP X C     1 
ATOM   93  O  O     . ASP A 1 13 ? 6.328   3.513   2.749   1.00 35.15 ? 12  ASP X O     1 
ATOM   94  C  CB    . ASP A 1 13 ? 3.165   2.945   3.715   1.00 35.76 ? 12  ASP X CB    1 
ATOM   95  C  CG    . ASP A 1 13 ? 1.860   2.462   3.081   1.00 37.99 ? 12  ASP X CG    1 
ATOM   96  O  OD1   . ASP A 1 13 ? 1.904   1.584   2.191   1.00 39.99 ? 12  ASP X OD1   1 
ATOM   97  O  OD2   . ASP A 1 13 ? 0.781   2.954   3.478   1.00 39.01 ? 12  ASP X OD2   1 
ATOM   98  N  N     . VAL A 1 14 ? 6.026   2.848   4.868   1.00 34.85 ? 13  VAL X N     1 
ATOM   99  C  CA    . VAL A 1 14 ? 7.177   3.593   5.385   1.00 34.98 ? 13  VAL X CA    1 
ATOM   100 C  C     . VAL A 1 14 ? 8.522   3.151   4.766   1.00 35.11 ? 13  VAL X C     1 
ATOM   101 O  O     . VAL A 1 14 ? 9.402   3.981   4.512   1.00 35.10 ? 13  VAL X O     1 
ATOM   102 C  CB    . VAL A 1 14 ? 7.214   3.587   6.943   1.00 34.77 ? 13  VAL X CB    1 
ATOM   103 C  CG1   . VAL A 1 14 ? 7.741   2.266   7.483   1.00 33.35 ? 13  VAL X CG1   1 
ATOM   104 C  CG2   . VAL A 1 14 ? 8.022   4.765   7.463   1.00 34.56 ? 13  VAL X CG2   1 
ATOM   105 N  N     . PHE A 1 15 ? 8.674   1.851   4.522   1.00 35.49 ? 14  PHE X N     1 
ATOM   106 C  CA    . PHE A 1 15 ? 9.894   1.338   3.892   1.00 35.80 ? 14  PHE X CA    1 
ATOM   107 C  C     . PHE A 1 15 ? 10.114  2.037   2.558   1.00 36.42 ? 14  PHE X C     1 
ATOM   108 O  O     . PHE A 1 15 ? 11.197  2.560   2.299   1.00 37.08 ? 14  PHE X O     1 
ATOM   109 C  CB    . PHE A 1 15 ? 9.834   -0.181  3.711   1.00 35.04 ? 14  PHE X CB    1 
ATOM   110 C  CG    . PHE A 1 15 ? 11.041  -0.760  3.024   1.00 34.29 ? 14  PHE X CG    1 
ATOM   111 C  CD1   . PHE A 1 15 ? 12.206  -1.032  3.741   1.00 32.94 ? 14  PHE X CD1   1 
ATOM   112 C  CD2   . PHE A 1 15 ? 11.015  -1.045  1.667   1.00 32.51 ? 14  PHE X CD2   1 
ATOM   113 C  CE1   . PHE A 1 15 ? 13.326  -1.568  3.116   1.00 32.47 ? 14  PHE X CE1   1 
ATOM   114 C  CE2   . PHE A 1 15 ? 12.134  -1.588  1.033   1.00 33.68 ? 14  PHE X CE2   1 
ATOM   115 C  CZ    . PHE A 1 15 ? 13.291  -1.852  1.767   1.00 33.24 ? 14  PHE X CZ    1 
ATOM   116 N  N     . HIS A 1 16 ? 9.073   2.068   1.734   1.00 37.30 ? 15  HIS X N     1 
ATOM   117 C  CA    . HIS A 1 16 ? 9.140   2.691   0.407   1.00 37.99 ? 15  HIS X CA    1 
ATOM   118 C  C     . HIS A 1 16 ? 9.151   4.217   0.365   1.00 37.90 ? 15  HIS X C     1 
ATOM   119 O  O     . HIS A 1 16 ? 9.695   4.781   -0.589  1.00 38.31 ? 15  HIS X O     1 
ATOM   120 C  CB    . HIS A 1 16 ? 8.071   2.115   -0.515  1.00 38.12 ? 15  HIS X CB    1 
ATOM   121 C  CG    . HIS A 1 16 ? 8.311   0.681   -0.854  1.00 40.19 ? 15  HIS X CG    1 
ATOM   122 N  ND1   . HIS A 1 16 ? 7.798   -0.355  -0.103  1.00 42.16 ? 15  HIS X ND1   1 
ATOM   123 C  CD2   . HIS A 1 16 ? 9.061   0.108   -1.826  1.00 41.42 ? 15  HIS X CD2   1 
ATOM   124 C  CE1   . HIS A 1 16 ? 8.194   -1.506  -0.617  1.00 42.43 ? 15  HIS X CE1   1 
ATOM   125 N  NE2   . HIS A 1 16 ? 8.965   -1.253  -1.661  1.00 42.68 ? 15  HIS X NE2   1 
ATOM   126 N  N     . GLN A 1 17 ? 8.595   4.893   1.377   1.00 37.62 ? 16  GLN X N     1 
ATOM   127 C  CA    . GLN A 1 17 ? 8.739   6.360   1.449   1.00 37.69 ? 16  GLN X CA    1 
ATOM   128 C  C     . GLN A 1 17 ? 10.215  6.724   1.503   1.00 36.65 ? 16  GLN X C     1 
ATOM   129 O  O     . GLN A 1 17 ? 10.597  7.810   1.081   1.00 36.72 ? 16  GLN X O     1 
ATOM   130 C  CB    . GLN A 1 17 ? 8.059   7.022   2.669   1.00 38.09 ? 16  GLN X CB    1 
ATOM   131 C  CG    . GLN A 1 17 ? 6.927   6.278   3.376   1.00 41.50 ? 16  GLN X CG    1 
ATOM   132 C  CD    . GLN A 1 17 ? 5.554   6.462   2.740   1.00 44.53 ? 16  GLN X CD    1 
ATOM   133 O  OE1   . GLN A 1 17 ? 4.554   6.657   3.444   1.00 44.86 ? 16  GLN X OE1   1 
ATOM   134 N  NE2   . GLN A 1 17 ? 5.492   6.377   1.413   1.00 44.84 ? 16  GLN X NE2   1 
ATOM   135 N  N     . TYR A 1 18 ? 11.030  5.818   2.045   1.00 35.99 ? 17  TYR X N     1 
ATOM   136 C  CA    . TYR A 1 18 ? 12.457  6.079   2.248   1.00 34.94 ? 17  TYR X CA    1 
ATOM   137 C  C     . TYR A 1 18 ? 13.366  5.341   1.286   1.00 34.54 ? 17  TYR X C     1 
ATOM   138 O  O     . TYR A 1 18 ? 14.372  5.895   0.863   1.00 34.13 ? 17  TYR X O     1 
ATOM   139 C  CB    . TYR A 1 18 ? 12.854  5.876   3.721   1.00 34.25 ? 17  TYR X CB    1 
ATOM   140 C  CG    . TYR A 1 18 ? 12.267  6.975   4.582   1.00 34.11 ? 17  TYR X CG    1 
ATOM   141 C  CD1   . TYR A 1 18 ? 10.988  6.852   5.126   1.00 33.89 ? 17  TYR X CD1   1 
ATOM   142 C  CD2   . TYR A 1 18 ? 12.959  8.162   4.798   1.00 33.32 ? 17  TYR X CD2   1 
ATOM   143 C  CE1   . TYR A 1 18 ? 10.425  7.871   5.880   1.00 33.15 ? 17  TYR X CE1   1 
ATOM   144 C  CE2   . TYR A 1 18 ? 12.401  9.188   5.558   1.00 33.39 ? 17  TYR X CE2   1 
ATOM   145 C  CZ    . TYR A 1 18 ? 11.136  9.028   6.093   1.00 32.83 ? 17  TYR X CZ    1 
ATOM   146 O  OH    . TYR A 1 18 ? 10.578  10.029  6.836   1.00 33.09 ? 17  TYR X OH    1 
ATOM   147 N  N     . SER A 1 19 ? 12.987  4.123   0.902   1.00 34.56 ? 18  SER X N     1 
ATOM   148 C  CA    . SER A 1 19 ? 13.846  3.274   0.057   1.00 34.59 ? 18  SER X CA    1 
ATOM   149 C  C     . SER A 1 19 ? 14.001  3.785   -1.372  1.00 34.77 ? 18  SER X C     1 
ATOM   150 O  O     . SER A 1 19 ? 15.067  3.626   -1.972  1.00 35.04 ? 18  SER X O     1 
ATOM   151 C  CB    . SER A 1 19 ? 13.367  1.815   0.050   1.00 34.23 ? 18  SER X CB    1 
ATOM   152 O  OG    . SER A 1 19 ? 12.240  1.642   -0.790  1.00 33.62 ? 18  SER X OG    1 
ATOM   153 N  N     . GLY A 1 20 ? 12.944  4.394   -1.901  1.00 35.16 ? 19  GLY X N     1 
ATOM   154 C  CA    . GLY A 1 20 ? 12.911  4.881   -3.283  1.00 35.59 ? 19  GLY X CA    1 
ATOM   155 C  C     . GLY A 1 20 ? 13.570  6.228   -3.520  1.00 35.95 ? 19  GLY X C     1 
ATOM   156 O  O     . GLY A 1 20 ? 13.650  6.689   -4.657  1.00 36.26 ? 19  GLY X O     1 
ATOM   157 N  N     . ARG A 1 21 ? 14.053  6.862   -2.454  1.00 36.14 ? 20  ARG X N     1 
ATOM   158 C  CA    . ARG A 1 21 ? 14.618  8.210   -2.551  1.00 36.47 ? 20  ARG X CA    1 
ATOM   159 C  C     . ARG A 1 21 ? 15.949  8.243   -3.293  1.00 36.08 ? 20  ARG X C     1 
ATOM   160 O  O     . ARG A 1 21 ? 16.205  9.172   -4.049  1.00 36.22 ? 20  ARG X O     1 
ATOM   161 C  CB    . ARG A 1 21 ? 14.788  8.834   -1.163  1.00 36.40 ? 20  ARG X CB    1 
ATOM   162 C  CG    . ARG A 1 21 ? 13.485  9.169   -0.470  1.00 37.35 ? 20  ARG X CG    1 
ATOM   163 C  CD    . ARG A 1 21 ? 13.708  9.884   0.855   1.00 37.79 ? 20  ARG X CD    1 
ATOM   164 N  NE    . ARG A 1 21 ? 12.434  10.219  1.499   1.00 39.83 ? 20  ARG X NE    1 
ATOM   165 C  CZ    . ARG A 1 21 ? 12.314  10.984  2.580   1.00 41.26 ? 20  ARG X CZ    1 
ATOM   166 N  NH1   . ARG A 1 21 ? 13.395  11.505  3.161   1.00 42.67 ? 20  ARG X NH1   1 
ATOM   167 N  NH2   . ARG A 1 21 ? 11.114  11.226  3.088   1.00 40.87 ? 20  ARG X NH2   1 
ATOM   168 N  N     . GLU A 1 22 ? 16.788  7.233   -3.063  1.00 35.67 ? 21  GLU X N     1 
ATOM   169 C  CA    . GLU A 1 22 ? 18.137  7.183   -3.622  1.00 35.37 ? 21  GLU X CA    1 
ATOM   170 C  C     . GLU A 1 22 ? 18.467  5.796   -4.154  1.00 35.17 ? 21  GLU X C     1 
ATOM   171 O  O     . GLU A 1 22 ? 18.001  4.785   -3.616  1.00 34.99 ? 21  GLU X O     1 
ATOM   172 C  CB    . GLU A 1 22 ? 19.166  7.548   -2.553  1.00 35.17 ? 21  GLU X CB    1 
ATOM   173 C  CG    . GLU A 1 22 ? 18.995  8.927   -1.933  1.00 35.47 ? 21  GLU X CG    1 
ATOM   174 C  CD    . GLU A 1 22 ? 20.022  9.190   -0.853  1.00 35.74 ? 21  GLU X CD    1 
ATOM   175 O  OE1   . GLU A 1 22 ? 21.172  9.537   -1.194  1.00 36.18 ? 21  GLU X OE1   1 
ATOM   176 O  OE2   . GLU A 1 22 ? 19.683  9.031   0.337   1.00 35.80 ? 21  GLU X OE2   1 
ATOM   177 N  N     . GLY A 1 23 ? 19.276  5.761   -5.211  1.00 35.01 ? 22  GLY X N     1 
ATOM   178 C  CA    . GLY A 1 23 ? 19.829  4.520   -5.754  1.00 34.93 ? 22  GLY X CA    1 
ATOM   179 C  C     . GLY A 1 23 ? 18.831  3.393   -5.939  1.00 34.84 ? 22  GLY X C     1 
ATOM   180 O  O     . GLY A 1 23 ? 17.774  3.579   -6.556  1.00 34.73 ? 22  GLY X O     1 
ATOM   181 N  N     . ASP A 1 24 ? 19.174  2.223   -5.399  1.00 34.62 ? 23  ASP X N     1 
ATOM   182 C  CA    . ASP A 1 24 ? 18.319  1.046   -5.469  1.00 34.59 ? 23  ASP X CA    1 
ATOM   183 C  C     . ASP A 1 24 ? 16.986  1.377   -4.808  1.00 34.77 ? 23  ASP X C     1 
ATOM   184 O  O     . ASP A 1 24 ? 16.942  1.700   -3.621  1.00 35.08 ? 23  ASP X O     1 
ATOM   185 C  CB    . ASP A 1 24 ? 18.998  -0.144  -4.776  1.00 34.46 ? 23  ASP X CB    1 
ATOM   186 C  CG    . ASP A 1 24 ? 18.197  -1.433  -4.894  1.00 34.29 ? 23  ASP X CG    1 
ATOM   187 O  OD1   . ASP A 1 24 ? 16.961  -1.381  -5.008  1.00 34.59 ? 23  ASP X OD1   1 
ATOM   188 O  OD2   . ASP A 1 24 ? 18.807  -2.515  -4.865  1.00 35.20 ? 23  ASP X OD2   1 
ATOM   189 N  N     . LYS A 1 25 ? 15.907  1.310   -5.581  1.00 34.73 ? 24  LYS X N     1 
ATOM   190 C  CA    . LYS A 1 25 ? 14.587  1.725   -5.105  1.00 35.03 ? 24  LYS X CA    1 
ATOM   191 C  C     . LYS A 1 25 ? 14.010  0.788   -4.041  1.00 34.91 ? 24  LYS X C     1 
ATOM   192 O  O     . LYS A 1 25 ? 13.100  1.174   -3.302  1.00 35.17 ? 24  LYS X O     1 
ATOM   193 C  CB    . LYS A 1 25 ? 13.605  1.850   -6.278  1.00 35.14 ? 24  LYS X CB    1 
ATOM   194 C  CG    . LYS A 1 25 ? 13.954  2.948   -7.289  1.00 36.52 ? 24  LYS X CG    1 
ATOM   195 C  CD    . LYS A 1 25 ? 13.129  4.217   -7.066  1.00 38.29 ? 24  LYS X CD    1 
ATOM   196 C  CE    . LYS A 1 25 ? 13.629  5.378   -7.918  1.00 38.77 ? 24  LYS X CE    1 
ATOM   197 N  NZ    . LYS A 1 25 ? 13.435  5.127   -9.374  1.00 39.95 ? 24  LYS X NZ    1 
ATOM   198 N  N     . HIS A 1 26 ? 14.549  -0.428  -3.957  1.00 34.80 ? 25  HIS X N     1 
ATOM   199 C  CA    . HIS A 1 26 ? 14.011  -1.461  -3.055  1.00 34.94 ? 25  HIS X CA    1 
ATOM   200 C  C     . HIS A 1 26 ? 14.862  -1.721  -1.802  1.00 34.26 ? 25  HIS X C     1 
ATOM   201 O  O     . HIS A 1 26 ? 14.620  -2.677  -1.050  1.00 34.73 ? 25  HIS X O     1 
ATOM   202 C  CB    . HIS A 1 26 ? 13.768  -2.756  -3.841  1.00 35.35 ? 25  HIS X CB    1 
ATOM   203 C  CG    . HIS A 1 26 ? 12.982  -2.550  -5.098  1.00 36.07 ? 25  HIS X CG    1 
ATOM   204 N  ND1   . HIS A 1 26 ? 11.636  -2.255  -5.093  1.00 37.46 ? 25  HIS X ND1   1 
ATOM   205 C  CD2   . HIS A 1 26 ? 13.356  -2.577  -6.398  1.00 37.60 ? 25  HIS X CD2   1 
ATOM   206 C  CE1   . HIS A 1 26 ? 11.212  -2.114  -6.336  1.00 37.55 ? 25  HIS X CE1   1 
ATOM   207 N  NE2   . HIS A 1 26 ? 12.235  -2.307  -7.147  1.00 37.72 ? 25  HIS X NE2   1 
ATOM   208 N  N     . LYS A 1 27 ? 15.849  -0.863  -1.570  1.00 33.33 ? 26  LYS X N     1 
ATOM   209 C  CA    . LYS A 1 27 ? 16.692  -0.974  -0.389  1.00 32.65 ? 26  LYS X CA    1 
ATOM   210 C  C     . LYS A 1 27 ? 16.931  0.381   0.245   1.00 32.18 ? 26  LYS X C     1 
ATOM   211 O  O     . LYS A 1 27 ? 16.913  1.404   -0.441  1.00 31.66 ? 26  LYS X O     1 
ATOM   212 C  CB    . LYS A 1 27 ? 18.040  -1.612  -0.738  1.00 32.70 ? 26  LYS X CB    1 
ATOM   213 C  CG    . LYS A 1 27 ? 17.955  -3.020  -1.271  1.00 33.21 ? 26  LYS X CG    1 
ATOM   214 C  CD    . LYS A 1 27 ? 19.300  -3.485  -1.762  1.00 34.69 ? 26  LYS X CD    1 
ATOM   215 C  CE    . LYS A 1 27 ? 19.155  -4.746  -2.585  1.00 34.96 ? 26  LYS X CE    1 
ATOM   216 N  NZ    . LYS A 1 27 ? 20.472  -5.412  -2.715  1.00 36.68 ? 26  LYS X NZ    1 
ATOM   217 N  N     . LEU A 1 28 ? 17.149  0.374   1.561   1.00 32.19 ? 27  LEU X N     1 
ATOM   218 C  CA    . LEU A 1 28 ? 17.538  1.566   2.301   1.00 31.99 ? 27  LEU X CA    1 
ATOM   219 C  C     . LEU A 1 28 ? 19.046  1.559   2.441   1.00 32.23 ? 27  LEU X C     1 
ATOM   220 O  O     . LEU A 1 28 ? 19.597  0.698   3.127   1.00 32.39 ? 27  LEU X O     1 
ATOM   221 C  CB    . LEU A 1 28 ? 16.920  1.577   3.707   1.00 31.78 ? 27  LEU X CB    1 
ATOM   222 C  CG    . LEU A 1 28 ? 15.414  1.430   3.930   1.00 31.38 ? 27  LEU X CG    1 
ATOM   223 C  CD1   . LEU A 1 28 ? 15.144  0.963   5.355   1.00 30.24 ? 27  LEU X CD1   1 
ATOM   224 C  CD2   . LEU A 1 28 ? 14.691  2.732   3.652   1.00 30.97 ? 27  LEU X CD2   1 
ATOM   225 N  N     . LYS A 1 29 ? 19.718  2.489   1.772   1.00 32.40 ? 28  LYS X N     1 
ATOM   226 C  CA    . LYS A 1 29 ? 21.125  2.737   2.061   1.00 32.83 ? 28  LYS X CA    1 
ATOM   227 C  C     . LYS A 1 29 ? 21.208  3.536   3.358   1.00 32.79 ? 28  LYS X C     1 
ATOM   228 O  O     . LYS A 1 29 ? 20.196  4.032   3.841   1.00 32.87 ? 28  LYS X O     1 
ATOM   229 C  CB    . LYS A 1 29 ? 21.836  3.473   0.910   1.00 32.89 ? 28  LYS X CB    1 
ATOM   230 C  CG    . LYS A 1 29 ? 21.054  4.623   0.292   1.00 33.75 ? 28  LYS X CG    1 
ATOM   231 C  CD    . LYS A 1 29 ? 21.900  5.866   0.119   1.00 34.85 ? 28  LYS X CD    1 
ATOM   232 C  CE    . LYS A 1 29 ? 22.948  5.736   -0.970  1.00 34.63 ? 28  LYS X CE    1 
ATOM   233 N  NZ    . LYS A 1 29 ? 23.715  7.007   -1.054  1.00 34.82 ? 28  LYS X NZ    1 
ATOM   234 N  N     . LYS A 1 30 ? 22.410  3.662   3.908   1.00 32.88 ? 29  LYS X N     1 
ATOM   235 C  CA    . LYS A 1 30 ? 22.620  4.308   5.202   1.00 33.30 ? 29  LYS X CA    1 
ATOM   236 C  C     . LYS A 1 30 ? 21.932  5.664   5.324   1.00 33.12 ? 29  LYS X C     1 
ATOM   237 O  O     . LYS A 1 30 ? 21.227  5.907   6.302   1.00 33.04 ? 29  LYS X O     1 
ATOM   238 C  CB    . LYS A 1 30 ? 24.120  4.417   5.528   1.00 32.96 ? 29  LYS X CB    1 
ATOM   239 C  CG    . LYS A 1 30 ? 24.735  3.123   6.051   1.00 33.33 ? 29  LYS X CG    1 
ATOM   240 C  CD    . LYS A 1 30 ? 26.258  3.210   6.172   1.00 34.57 ? 29  LYS X CD    1 
ATOM   241 C  CE    . LYS A 1 30 ? 26.970  2.479   5.025   1.00 37.55 ? 29  LYS X CE    1 
ATOM   242 N  NZ    . LYS A 1 30 ? 26.833  0.973   5.130   1.00 39.43 ? 29  LYS X NZ    1 
ATOM   243 N  N     . SER A 1 31 ? 22.110  6.532   4.328   1.00 33.42 ? 30  SER X N     1 
ATOM   244 C  CA    . SER A 1 31 ? 21.479  7.862   4.362   1.00 33.68 ? 30  SER X CA    1 
ATOM   245 C  C     . SER A 1 31 ? 19.950  7.819   4.412   1.00 33.30 ? 30  SER X C     1 
ATOM   246 O  O     . SER A 1 31 ? 19.339  8.633   5.101   1.00 33.79 ? 30  SER X O     1 
ATOM   247 C  CB    . SER A 1 31 ? 21.990  8.788   3.238   1.00 33.95 ? 30  SER X CB    1 
ATOM   248 O  OG    . SER A 1 31 ? 21.622  8.324   1.953   1.00 35.20 ? 30  SER X OG    1 
ATOM   249 N  N     . GLU A 1 32 ? 19.332  6.864   3.717   1.00 32.68 ? 31  GLU X N     1 
ATOM   250 C  CA    . GLU A 1 32 ? 17.871  6.684   3.793   1.00 32.34 ? 31  GLU X CA    1 
ATOM   251 C  C     . GLU A 1 32 ? 17.405  6.137   5.158   1.00 32.45 ? 31  GLU X C     1 
ATOM   252 O  O     . GLU A 1 32 ? 16.388  6.569   5.696   1.00 32.73 ? 31  GLU X O     1 
ATOM   253 C  CB    . GLU A 1 32 ? 17.388  5.760   2.677   1.00 32.21 ? 31  GLU X CB    1 
ATOM   254 C  CG    . GLU A 1 32 ? 17.470  6.342   1.273   1.00 31.52 ? 31  GLU X CG    1 
ATOM   255 C  CD    . GLU A 1 32 ? 17.333  5.283   0.192   1.00 32.04 ? 31  GLU X CD    1 
ATOM   256 O  OE1   . GLU A 1 32 ? 17.649  4.107   0.448   1.00 32.83 ? 31  GLU X OE1   1 
ATOM   257 O  OE2   . GLU A 1 32 ? 16.928  5.613   -0.939  1.00 32.31 ? 31  GLU X OE2   1 
ATOM   258 N  N     . LEU A 1 33 ? 18.162  5.188   5.699   1.00 32.20 ? 32  LEU X N     1 
ATOM   259 C  CA    . LEU A 1 33 ? 17.905  4.578   7.010   1.00 32.36 ? 32  LEU X CA    1 
ATOM   260 C  C     . LEU A 1 33 ? 17.983  5.608   8.150   1.00 32.01 ? 32  LEU X C     1 
ATOM   261 O  O     . LEU A 1 33 ? 17.142  5.598   9.051   1.00 32.06 ? 32  LEU X O     1 
ATOM   262 C  CB    . LEU A 1 33 ? 18.925  3.469   7.266   1.00 31.85 ? 32  LEU X CB    1 
ATOM   263 C  CG    . LEU A 1 33 ? 18.593  2.142   7.974   1.00 33.29 ? 32  LEU X CG    1 
ATOM   264 C  CD1   . LEU A 1 33 ? 19.815  1.716   8.799   1.00 31.27 ? 32  LEU X CD1   1 
ATOM   265 C  CD2   . LEU A 1 33 ? 17.300  2.121   8.830   1.00 31.30 ? 32  LEU X CD2   1 
ATOM   266 N  N     . LYS A 1 34 ? 19.008  6.463   8.114   1.00 31.45 ? 33  LYS X N     1 
ATOM   267 C  CA    . LYS A 1 34 ? 19.134  7.595   9.040   1.00 31.28 ? 33  LYS X CA    1 
ATOM   268 C  C     . LYS A 1 34 ? 17.899  8.487   8.990   1.00 31.50 ? 33  LYS X C     1 
ATOM   269 O  O     . LYS A 1 34 ? 17.378  8.895   10.033  1.00 31.51 ? 33  LYS X O     1 
ATOM   270 C  CB    . LYS A 1 34 ? 20.384  8.433   8.714   1.00 31.25 ? 33  LYS X CB    1 
ATOM   271 C  CG    . LYS A 1 34 ? 20.547  9.708   9.551   1.00 30.56 ? 33  LYS X CG    1 
ATOM   272 C  CD    . LYS A 1 34 ? 21.898  10.374  9.291   1.00 30.79 ? 33  LYS X CD    1 
ATOM   273 C  CE    . LYS A 1 34 ? 21.986  11.747  9.929   1.00 29.86 ? 33  LYS X CE    1 
ATOM   274 N  NZ    . LYS A 1 34 ? 23.271  12.419  9.577   1.00 30.13 ? 33  LYS X NZ    1 
ATOM   275 N  N     . GLU A 1 35 ? 17.447  8.789   7.773   1.00 31.36 ? 34  GLU X N     1 
ATOM   276 C  CA    . GLU A 1 35 ? 16.295  9.657   7.564   1.00 31.64 ? 34  GLU X CA    1 
ATOM   277 C  C     . GLU A 1 35 ? 15.034  9.056   8.149   1.00 31.27 ? 34  GLU X C     1 
ATOM   278 O  O     . GLU A 1 35 ? 14.270  9.745   8.826   1.00 31.18 ? 34  GLU X O     1 
ATOM   279 C  CB    . GLU A 1 35 ? 16.097  9.949   6.072   1.00 31.88 ? 34  GLU X CB    1 
ATOM   280 C  CG    . GLU A 1 35 ? 17.077  10.959  5.523   1.00 33.64 ? 34  GLU X CG    1 
ATOM   281 C  CD    . GLU A 1 35 ? 17.072  12.244  6.327   1.00 36.39 ? 34  GLU X CD    1 
ATOM   282 O  OE1   . GLU A 1 35 ? 16.081  13.003  6.216   1.00 38.38 ? 34  GLU X OE1   1 
ATOM   283 O  OE2   . GLU A 1 35 ? 18.045  12.483  7.079   1.00 37.39 ? 34  GLU X OE2   1 
ATOM   284 N  N     . LEU A 1 36 ? 14.832  7.767   7.881   1.00 30.95 ? 35  LEU X N     1 
ATOM   285 C  CA    . LEU A 1 36 ? 13.682  7.023   8.388   1.00 30.75 ? 35  LEU X CA    1 
ATOM   286 C  C     . LEU A 1 36 ? 13.666  7.029   9.910   1.00 30.47 ? 35  LEU X C     1 
ATOM   287 O  O     . LEU A 1 36 ? 12.647  7.330   10.510  1.00 30.50 ? 35  LEU X O     1 
ATOM   288 C  CB    . LEU A 1 36 ? 13.708  5.586   7.854   1.00 30.38 ? 35  LEU X CB    1 
ATOM   289 C  CG    . LEU A 1 36 ? 12.520  4.647   8.084   1.00 30.50 ? 35  LEU X CG    1 
ATOM   290 C  CD1   . LEU A 1 36 ? 12.420  3.654   6.937   1.00 28.77 ? 35  LEU X CD1   1 
ATOM   291 C  CD2   . LEU A 1 36 ? 12.612  3.905   9.431   1.00 30.30 ? 35  LEU X CD2   1 
ATOM   292 N  N     . ILE A 1 37 ? 14.803  6.700   10.523  1.00 30.31 ? 36  ILE X N     1 
ATOM   293 C  CA    . ILE A 1 37 ? 14.918  6.649   11.977  1.00 30.01 ? 36  ILE X CA    1 
ATOM   294 C  C     . ILE A 1 37 ? 14.628  8.008   12.607  1.00 30.04 ? 36  ILE X C     1 
ATOM   295 O  O     . ILE A 1 37 ? 13.790  8.104   13.507  1.00 29.95 ? 36  ILE X O     1 
ATOM   296 C  CB    . ILE A 1 37 ? 16.297  6.076   12.433  1.00 30.06 ? 36  ILE X CB    1 
ATOM   297 C  CG1   . ILE A 1 37 ? 16.362  4.574   12.124  1.00 30.26 ? 36  ILE X CG1   1 
ATOM   298 C  CG2   . ILE A 1 37 ? 16.539  6.323   13.931  1.00 29.98 ? 36  ILE X CG2   1 
ATOM   299 C  CD1   . ILE A 1 37 ? 17.745  3.953   12.208  1.00 29.94 ? 36  ILE X CD1   1 
ATOM   300 N  N     . ASN A 1 38 ? 15.299  9.056   12.120  1.00 29.95 ? 37  ASN X N     1 
ATOM   301 C  CA    . ASN A 1 38 ? 15.125  10.407  12.665  1.00 30.19 ? 37  ASN X CA    1 
ATOM   302 C  C     . ASN A 1 38 ? 13.714  10.986  12.492  1.00 30.31 ? 37  ASN X C     1 
ATOM   303 O  O     . ASN A 1 38 ? 13.234  11.719  13.359  1.00 30.22 ? 37  ASN X O     1 
ATOM   304 C  CB    . ASN A 1 38 ? 16.167  11.372  12.087  1.00 30.10 ? 37  ASN X CB    1 
ATOM   305 C  CG    . ASN A 1 38 ? 17.578  11.068  12.567  1.00 30.24 ? 37  ASN X CG    1 
ATOM   306 O  OD1   . ASN A 1 38 ? 18.542  11.700  12.132  1.00 31.20 ? 37  ASN X OD1   1 
ATOM   307 N  ND2   . ASN A 1 38 ? 17.707  10.098  13.457  1.00 28.63 ? 37  ASN X ND2   1 
ATOM   308 N  N     . ASN A 1 39 ? 13.055  10.640  11.387  1.00 30.46 ? 38  ASN X N     1 
ATOM   309 C  CA    . ASN A 1 39 ? 11.735  11.186  11.073  1.00 30.93 ? 38  ASN X CA    1 
ATOM   310 C  C     . ASN A 1 39 ? 10.542  10.320  11.490  1.00 30.93 ? 38  ASN X C     1 
ATOM   311 O  O     . ASN A 1 39 ? 9.460   10.853  11.765  1.00 31.17 ? 38  ASN X O     1 
ATOM   312 C  CB    . ASN A 1 39 ? 11.644  11.512  9.586   1.00 30.94 ? 38  ASN X CB    1 
ATOM   313 C  CG    . ASN A 1 39 ? 12.570  12.645  9.183   1.00 31.88 ? 38  ASN X CG    1 
ATOM   314 O  OD1   . ASN A 1 39 ? 12.360  13.794  9.560   1.00 33.44 ? 38  ASN X OD1   1 
ATOM   315 N  ND2   . ASN A 1 39 ? 13.600  12.324  8.413   1.00 32.70 ? 38  ASN X ND2   1 
ATOM   316 N  N     . GLU A 1 40 ? 10.733  9.002   11.533  1.00 30.59 ? 39  GLU X N     1 
ATOM   317 C  CA    . GLU A 1 40 ? 9.626   8.054   11.788  1.00 30.73 ? 39  GLU X CA    1 
ATOM   318 C  C     . GLU A 1 40 ? 9.743   7.287   13.112  1.00 30.75 ? 39  GLU X C     1 
ATOM   319 O  O     . GLU A 1 40 ? 8.792   6.628   13.549  1.00 30.40 ? 39  GLU X O     1 
ATOM   320 C  CB    . GLU A 1 40 ? 9.469   7.064   10.615  1.00 30.64 ? 39  GLU X CB    1 
ATOM   321 C  CG    . GLU A 1 40 ? 9.480   7.719   9.213   1.00 31.35 ? 39  GLU X CG    1 
ATOM   322 C  CD    . GLU A 1 40 ? 8.360   8.738   8.997   1.00 31.82 ? 39  GLU X CD    1 
ATOM   323 O  OE1   . GLU A 1 40 ? 7.283   8.608   9.610   1.00 33.03 ? 39  GLU X OE1   1 
ATOM   324 O  OE2   . GLU A 1 40 ? 8.548   9.674   8.197   1.00 33.99 ? 39  GLU X OE2   1 
ATOM   325 N  N     . LEU A 1 41 ? 10.907  7.375   13.748  1.00 31.25 ? 40  LEU X N     1 
ATOM   326 C  CA    . LEU A 1 41 ? 11.125  6.712   15.036  1.00 31.50 ? 40  LEU X CA    1 
ATOM   327 C  C     . LEU A 1 41 ? 11.700  7.648   16.098  1.00 31.95 ? 40  LEU X C     1 
ATOM   328 O  O     . LEU A 1 41 ? 12.477  7.217   16.957  1.00 32.26 ? 40  LEU X O     1 
ATOM   329 C  CB    . LEU A 1 41 ? 12.027  5.490   14.859  1.00 31.38 ? 40  LEU X CB    1 
ATOM   330 C  CG    . LEU A 1 41 ? 11.466  4.315   14.066  1.00 31.37 ? 40  LEU X CG    1 
ATOM   331 C  CD1   . LEU A 1 41 ? 12.609  3.405   13.662  1.00 31.89 ? 40  LEU X CD1   1 
ATOM   332 C  CD2   . LEU A 1 41 ? 10.404  3.557   14.872  1.00 30.06 ? 40  LEU X CD2   1 
ATOM   333 N  N     . SER A 1 42 ? 11.294  8.917   16.044  1.00 32.41 ? 41  SER X N     1 
ATOM   334 C  CA    . SER A 1 42 ? 11.812  9.966   16.931  1.00 32.90 ? 41  SER X CA    1 
ATOM   335 C  C     . SER A 1 42 ? 11.376  9.829   18.393  1.00 33.23 ? 41  SER X C     1 
ATOM   336 O  O     . SER A 1 42 ? 12.008  10.409  19.292  1.00 33.44 ? 41  SER X O     1 
ATOM   337 C  CB    . SER A 1 42 ? 11.417  11.349  16.408  1.00 33.00 ? 41  SER X CB    1 
ATOM   338 O  OG    . SER A 1 42 ? 10.012  11.460  16.299  1.00 33.36 ? 41  SER X OG    1 
ATOM   339 N  N     . HIS A 1 43 ? 10.302  9.074   18.628  1.00 33.61 ? 42  HIS X N     1 
ATOM   340 C  CA    . HIS A 1 43 ? 9.813   8.832   19.990  1.00 33.97 ? 42  HIS X CA    1 
ATOM   341 C  C     . HIS A 1 43 ? 10.340  7.527   20.570  1.00 34.25 ? 42  HIS X C     1 
ATOM   342 O  O     . HIS A 1 43 ? 10.412  7.371   21.786  1.00 34.62 ? 42  HIS X O     1 
ATOM   343 C  CB    . HIS A 1 43 ? 8.282   8.870   20.044  1.00 33.91 ? 42  HIS X CB    1 
ATOM   344 C  CG    . HIS A 1 43 ? 7.697   10.146  19.528  1.00 33.90 ? 42  HIS X CG    1 
ATOM   345 N  ND1   . HIS A 1 43 ? 6.946   10.206  18.374  1.00 35.00 ? 42  HIS X ND1   1 
ATOM   346 C  CD2   . HIS A 1 43 ? 7.779   11.417  19.991  1.00 33.62 ? 42  HIS X CD2   1 
ATOM   347 C  CE1   . HIS A 1 43 ? 6.576   11.456  18.157  1.00 34.20 ? 42  HIS X CE1   1 
ATOM   348 N  NE2   . HIS A 1 43 ? 7.070   12.211  19.122  1.00 33.73 ? 42  HIS X NE2   1 
ATOM   349 N  N     . PHE A 1 44 ? 10.710  6.599   19.694  1.00 34.56 ? 43  PHE X N     1 
ATOM   350 C  CA    . PHE A 1 44 ? 11.184  5.287   20.117  1.00 35.09 ? 43  PHE X CA    1 
ATOM   351 C  C     . PHE A 1 44 ? 12.704  5.205   20.136  1.00 35.53 ? 43  PHE X C     1 
ATOM   352 O  O     . PHE A 1 44 ? 13.277  4.407   20.882  1.00 36.24 ? 43  PHE X O     1 
ATOM   353 C  CB    . PHE A 1 44 ? 10.636  4.174   19.208  1.00 34.70 ? 43  PHE X CB    1 
ATOM   354 C  CG    . PHE A 1 44 ? 9.144   3.934   19.331  1.00 34.41 ? 43  PHE X CG    1 
ATOM   355 C  CD1   . PHE A 1 44 ? 8.375   4.589   20.292  1.00 33.37 ? 43  PHE X CD1   1 
ATOM   356 C  CD2   . PHE A 1 44 ? 8.518   3.011   18.495  1.00 34.54 ? 43  PHE X CD2   1 
ATOM   357 C  CE1   . PHE A 1 44 ? 7.012   4.355   20.398  1.00 32.73 ? 43  PHE X CE1   1 
ATOM   358 C  CE2   . PHE A 1 44 ? 7.160   2.768   18.600  1.00 33.66 ? 43  PHE X CE2   1 
ATOM   359 C  CZ    . PHE A 1 44 ? 6.405   3.444   19.555  1.00 33.06 ? 43  PHE X CZ    1 
ATOM   360 N  N     . LEU A 1 45 ? 13.353  6.015   19.307  1.00 35.71 ? 44  LEU X N     1 
ATOM   361 C  CA    . LEU A 1 45 ? 14.806  5.970   19.168  1.00 35.95 ? 44  LEU X CA    1 
ATOM   362 C  C     . LEU A 1 45 ? 15.457  7.347   19.261  1.00 36.13 ? 44  LEU X C     1 
ATOM   363 O  O     . LEU A 1 45 ? 14.908  8.349   18.791  1.00 36.30 ? 44  LEU X O     1 
ATOM   364 C  CB    . LEU A 1 45 ? 15.205  5.288   17.854  1.00 35.77 ? 44  LEU X CB    1 
ATOM   365 C  CG    . LEU A 1 45 ? 15.035  3.767   17.748  1.00 36.01 ? 44  LEU X CG    1 
ATOM   366 C  CD1   . LEU A 1 45 ? 15.331  3.291   16.334  1.00 35.09 ? 44  LEU X CD1   1 
ATOM   367 C  CD2   . LEU A 1 45 ? 15.923  3.038   18.765  1.00 36.51 ? 44  LEU X CD2   1 
ATOM   368 N  N     . GLU A 1 46 ? 16.640  7.375   19.867  1.00 36.23 ? 45  GLU X N     1 
ATOM   369 C  CA    . GLU A 1 46 ? 17.433  8.585   19.980  1.00 36.41 ? 45  GLU X CA    1 
ATOM   370 C  C     . GLU A 1 46 ? 17.836  9.029   18.583  1.00 36.29 ? 45  GLU X C     1 
ATOM   371 O  O     . GLU A 1 46 ? 18.212  8.195   17.754  1.00 36.14 ? 45  GLU X O     1 
ATOM   372 C  CB    . GLU A 1 46 ? 18.687  8.303   20.817  1.00 36.66 ? 45  GLU X CB    1 
ATOM   373 C  CG    . GLU A 1 46 ? 19.272  9.523   21.537  1.00 37.65 ? 45  GLU X CG    1 
ATOM   374 C  CD    . GLU A 1 46 ? 18.682  9.737   22.925  1.00 38.59 ? 45  GLU X CD    1 
ATOM   375 O  OE1   . GLU A 1 46 ? 19.443  10.145  23.828  1.00 39.46 ? 45  GLU X OE1   1 
ATOM   376 O  OE2   . GLU A 1 46 ? 17.468  9.499   23.122  1.00 38.52 ? 45  GLU X OE2   1 
ATOM   377 N  N     . GLU A 1 47 ? 17.757  10.333  18.323  1.00 36.16 ? 46  GLU X N     1 
ATOM   378 C  CA    . GLU A 1 47 ? 18.135  10.882  17.020  1.00 36.22 ? 46  GLU X CA    1 
ATOM   379 C  C     . GLU A 1 47 ? 19.578  10.517  16.652  1.00 36.29 ? 46  GLU X C     1 
ATOM   380 O  O     . GLU A 1 47 ? 20.478  10.594  17.487  1.00 36.18 ? 46  GLU X O     1 
ATOM   381 C  CB    . GLU A 1 47 ? 17.951  12.401  17.006  1.00 36.13 ? 46  GLU X CB    1 
ATOM   382 C  CG    . GLU A 1 47 ? 17.983  13.013  15.608  1.00 36.29 ? 46  GLU X CG    1 
ATOM   383 C  CD    . GLU A 1 47 ? 18.063  14.527  15.626  1.00 36.25 ? 46  GLU X CD    1 
ATOM   384 O  OE1   . GLU A 1 47 ? 17.538  15.137  16.580  1.00 36.84 ? 46  GLU X OE1   1 
ATOM   385 O  OE2   . GLU A 1 47 ? 18.647  15.107  14.683  1.00 35.38 ? 46  GLU X OE2   1 
ATOM   386 N  N     . ILE A 1 48 ? 19.789  10.096  15.409  1.00 36.51 ? 47  ILE X N     1 
ATOM   387 C  CA    . ILE A 1 48 ? 21.134  9.795   14.932  1.00 36.71 ? 47  ILE X CA    1 
ATOM   388 C  C     . ILE A 1 48 ? 21.754  11.050  14.337  1.00 36.97 ? 47  ILE X C     1 
ATOM   389 O  O     . ILE A 1 48 ? 21.247  11.587  13.350  1.00 36.82 ? 47  ILE X O     1 
ATOM   390 C  CB    . ILE A 1 48 ? 21.146  8.682   13.872  1.00 36.59 ? 47  ILE X CB    1 
ATOM   391 C  CG1   . ILE A 1 48 ? 20.497  7.408   14.413  1.00 36.27 ? 47  ILE X CG1   1 
ATOM   392 C  CG2   . ILE A 1 48 ? 22.575  8.404   13.415  1.00 36.59 ? 47  ILE X CG2   1 
ATOM   393 C  CD1   . ILE A 1 48 ? 20.274  6.365   13.357  1.00 35.57 ? 47  ILE X CD1   1 
ATOM   394 N  N     . LYS A 1 49 ? 22.847  11.508  14.942  1.00 37.42 ? 48  LYS X N     1 
ATOM   395 C  CA    . LYS A 1 49 ? 23.544  12.697  14.469  1.00 37.95 ? 48  LYS X CA    1 
ATOM   396 C  C     . LYS A 1 49 ? 24.931  12.386  13.904  1.00 38.38 ? 48  LYS X C     1 
ATOM   397 O  O     . LYS A 1 49 ? 25.457  13.153  13.095  1.00 38.49 ? 48  LYS X O     1 
ATOM   398 C  CB    . LYS A 1 49 ? 23.614  13.766  15.568  1.00 38.00 ? 48  LYS X CB    1 
ATOM   399 C  CG    . LYS A 1 49 ? 22.261  14.404  15.888  1.00 38.25 ? 48  LYS X CG    1 
ATOM   400 C  CD    . LYS A 1 49 ? 22.413  15.772  16.529  1.00 38.90 ? 48  LYS X CD    1 
ATOM   401 C  CE    . LYS A 1 49 ? 21.145  16.615  16.360  1.00 39.57 ? 48  LYS X CE    1 
ATOM   402 N  NZ    . LYS A 1 49 ? 21.398  18.076  16.576  1.00 38.99 ? 48  LYS X NZ    1 
ATOM   403 N  N     . GLU A 1 50 ? 25.504  11.255  14.314  1.00 38.90 ? 49  GLU X N     1 
ATOM   404 C  CA    . GLU A 1 50 ? 26.854  10.854  13.898  1.00 39.39 ? 49  GLU X CA    1 
ATOM   405 C  C     . GLU A 1 50 ? 26.825  9.736   12.851  1.00 39.65 ? 49  GLU X C     1 
ATOM   406 O  O     . GLU A 1 50 ? 26.022  8.799   12.956  1.00 39.66 ? 49  GLU X O     1 
ATOM   407 C  CB    . GLU A 1 50 ? 27.667  10.393  15.110  1.00 39.33 ? 49  GLU X CB    1 
ATOM   408 C  CG    . GLU A 1 50 ? 27.730  11.392  16.262  1.00 39.68 ? 49  GLU X CG    1 
ATOM   409 C  CD    . GLU A 1 50 ? 28.716  10.976  17.348  1.00 39.88 ? 49  GLU X CD    1 
ATOM   410 O  OE1   . GLU A 1 50 ? 28.641  9.817   17.821  1.00 40.42 ? 49  GLU X OE1   1 
ATOM   411 O  OE2   . GLU A 1 50 ? 29.564  11.812  17.736  1.00 40.17 ? 49  GLU X OE2   1 
ATOM   412 N  N     . GLN A 1 51 ? 27.710  9.830   11.855  1.00 39.93 ? 50  GLN X N     1 
ATOM   413 C  CA    . GLN A 1 51 ? 27.809  8.813   10.793  1.00 40.23 ? 50  GLN X CA    1 
ATOM   414 C  C     . GLN A 1 51 ? 28.159  7.436   11.359  1.00 40.12 ? 50  GLN X C     1 
ATOM   415 O  O     . GLN A 1 51 ? 27.673  6.414   10.878  1.00 40.22 ? 50  GLN X O     1 
ATOM   416 C  CB    . GLN A 1 51 ? 28.832  9.228   9.725   1.00 40.45 ? 50  GLN X CB    1 
ATOM   417 C  CG    . GLN A 1 51 ? 28.892  8.311   8.492   1.00 41.22 ? 50  GLN X CG    1 
ATOM   418 C  CD    . GLN A 1 51 ? 27.572  8.241   7.731   1.00 42.81 ? 50  GLN X CD    1 
ATOM   419 O  OE1   . GLN A 1 51 ? 26.857  9.237   7.605   1.00 44.06 ? 50  GLN X OE1   1 
ATOM   420 N  NE2   . GLN A 1 51 ? 27.245  7.055   7.217   1.00 43.04 ? 50  GLN X NE2   1 
ATOM   421 N  N     . GLU A 1 52 ? 29.002  7.435   12.386  1.00 40.08 ? 51  GLU X N     1 
ATOM   422 C  CA    . GLU A 1 52 ? 29.355  6.243   13.147  1.00 40.01 ? 51  GLU X CA    1 
ATOM   423 C  C     . GLU A 1 52 ? 28.115  5.473   13.629  1.00 39.59 ? 51  GLU X C     1 
ATOM   424 O  O     . GLU A 1 52 ? 28.075  4.243   13.552  1.00 39.65 ? 51  GLU X O     1 
ATOM   425 C  CB    . GLU A 1 52 ? 30.218  6.665   14.338  1.00 40.14 ? 51  GLU X CB    1 
ATOM   426 C  CG    . GLU A 1 52 ? 31.009  5.555   15.009  1.00 40.68 ? 51  GLU X CG    1 
ATOM   427 C  CD    . GLU A 1 52 ? 31.803  6.058   16.208  1.00 40.81 ? 51  GLU X CD    1 
ATOM   428 O  OE1   . GLU A 1 52 ? 31.369  7.048   16.840  1.00 41.92 ? 51  GLU X OE1   1 
ATOM   429 O  OE2   . GLU A 1 52 ? 32.859  5.467   16.522  1.00 41.31 ? 51  GLU X OE2   1 
ATOM   430 N  N     . VAL A 1 53 ? 27.108  6.201   14.109  1.00 38.96 ? 52  VAL X N     1 
ATOM   431 C  CA    . VAL A 1 53 ? 25.892  5.589   14.648  1.00 38.41 ? 52  VAL X CA    1 
ATOM   432 C  C     . VAL A 1 53 ? 25.039  4.952   13.538  1.00 38.10 ? 52  VAL X C     1 
ATOM   433 O  O     . VAL A 1 53 ? 24.480  3.871   13.729  1.00 37.87 ? 52  VAL X O     1 
ATOM   434 C  CB    . VAL A 1 53 ? 25.073  6.596   15.511  1.00 38.36 ? 52  VAL X CB    1 
ATOM   435 C  CG1   . VAL A 1 53 ? 23.766  5.978   16.010  1.00 38.34 ? 52  VAL X CG1   1 
ATOM   436 C  CG2   . VAL A 1 53 ? 25.900  7.078   16.692  1.00 38.31 ? 52  VAL X CG2   1 
ATOM   437 N  N     . VAL A 1 54 ? 24.959  5.613   12.384  1.00 37.63 ? 53  VAL X N     1 
ATOM   438 C  CA    . VAL A 1 54 ? 24.282  5.049   11.214  1.00 37.35 ? 53  VAL X CA    1 
ATOM   439 C  C     . VAL A 1 54 ? 24.976  3.765   10.786  1.00 36.75 ? 53  VAL X C     1 
ATOM   440 O  O     . VAL A 1 54 ? 24.315  2.776   10.482  1.00 36.89 ? 53  VAL X O     1 
ATOM   441 C  CB    . VAL A 1 54 ? 24.300  5.988   9.981   1.00 37.34 ? 53  VAL X CB    1 
ATOM   442 C  CG1   . VAL A 1 54 ? 23.168  5.621   9.047   1.00 38.43 ? 53  VAL X CG1   1 
ATOM   443 C  CG2   . VAL A 1 54 ? 24.222  7.457   10.380  1.00 37.78 ? 53  VAL X CG2   1 
ATOM   444 N  N     . ASP A 1 55 ? 26.309  3.801   10.746  1.00 36.26 ? 54  ASP X N     1 
ATOM   445 C  CA    . ASP A 1 55 ? 27.113  2.642   10.365  1.00 35.83 ? 54  ASP X CA    1 
ATOM   446 C  C     . ASP A 1 55 ? 26.831  1.441   11.255  1.00 35.31 ? 54  ASP X C     1 
ATOM   447 O  O     . ASP A 1 55 ? 26.602  0.341   10.754  1.00 35.21 ? 54  ASP X O     1 
ATOM   448 C  CB    . ASP A 1 55 ? 28.611  2.966   10.409  1.00 36.13 ? 54  ASP X CB    1 
ATOM   449 C  CG    . ASP A 1 55 ? 28.996  4.099   9.481   1.00 36.56 ? 54  ASP X CG    1 
ATOM   450 O  OD1   . ASP A 1 55 ? 28.264  4.368   8.504   1.00 38.43 ? 54  ASP X OD1   1 
ATOM   451 O  OD2   . ASP A 1 55 ? 30.040  4.727   9.731   1.00 36.57 ? 54  ASP X OD2   1 
ATOM   452 N  N     . LYS A 1 56 ? 26.837  1.661   12.570  1.00 34.81 ? 55  LYS X N     1 
ATOM   453 C  CA    . LYS A 1 56 ? 26.618  0.585   13.537  1.00 34.55 ? 55  LYS X CA    1 
ATOM   454 C  C     . LYS A 1 56 ? 25.201  0.011   13.474  1.00 34.29 ? 55  LYS X C     1 
ATOM   455 O  O     . LYS A 1 56 ? 25.017  -1.195  13.636  1.00 34.28 ? 55  LYS X O     1 
ATOM   456 C  CB    . LYS A 1 56 ? 26.964  1.038   14.955  1.00 34.50 ? 55  LYS X CB    1 
ATOM   457 C  CG    . LYS A 1 56 ? 28.453  1.246   15.161  1.00 35.61 ? 55  LYS X CG    1 
ATOM   458 C  CD    . LYS A 1 56 ? 28.809  1.556   16.611  1.00 36.72 ? 55  LYS X CD    1 
ATOM   459 C  CE    . LYS A 1 56 ? 30.158  2.249   16.681  1.00 37.04 ? 55  LYS X CE    1 
ATOM   460 N  NZ    . LYS A 1 56 ? 30.675  2.365   18.076  1.00 38.94 ? 55  LYS X NZ    1 
ATOM   461 N  N     . VAL A 1 57 ? 24.207  0.869   13.237  1.00 33.77 ? 56  VAL X N     1 
ATOM   462 C  CA    . VAL A 1 57 ? 22.832  0.399   13.055  1.00 33.20 ? 56  VAL X CA    1 
ATOM   463 C  C     . VAL A 1 57 ? 22.740  -0.413  11.762  1.00 33.17 ? 56  VAL X C     1 
ATOM   464 O  O     . VAL A 1 57 ? 22.154  -1.497  11.757  1.00 33.06 ? 56  VAL X O     1 
ATOM   465 C  CB    . VAL A 1 57 ? 21.774  1.541   13.095  1.00 33.31 ? 56  VAL X CB    1 
ATOM   466 C  CG1   . VAL A 1 57 ? 20.349  0.972   12.987  1.00 32.95 ? 56  VAL X CG1   1 
ATOM   467 C  CG2   . VAL A 1 57 ? 21.900  2.350   14.378  1.00 32.60 ? 56  VAL X CG2   1 
ATOM   468 N  N     . MET A 1 58 ? 23.356  0.086   10.688  1.00 32.97 ? 57  MET X N     1 
ATOM   469 C  CA    . MET A 1 58 ? 23.352  -0.635  9.420   1.00 33.19 ? 57  MET X CA    1 
ATOM   470 C  C     . MET A 1 58 ? 24.120  -1.958  9.488   1.00 33.61 ? 57  MET X C     1 
ATOM   471 O  O     . MET A 1 58 ? 23.696  -2.932  8.872   1.00 34.07 ? 57  MET X O     1 
ATOM   472 C  CB    . MET A 1 58 ? 23.847  0.239   8.258   1.00 33.38 ? 57  MET X CB    1 
ATOM   473 C  CG    . MET A 1 58 ? 23.815  -0.441  6.874   1.00 32.62 ? 57  MET X CG    1 
ATOM   474 S  SD    . MET A 1 58 ? 22.172  -0.953  6.292   1.00 34.07 ? 57  MET X SD    1 
ATOM   475 C  CE    . MET A 1 58 ? 21.613  0.579   5.542   1.00 30.55 ? 57  MET X CE    1 
ATOM   476 N  N     . GLU A 1 59 ? 25.225  -2.001  10.240  1.00 33.66 ? 58  GLU X N     1 
ATOM   477 C  CA    . GLU A 1 59 ? 25.994  -3.237  10.418  1.00 33.92 ? 58  GLU X CA    1 
ATOM   478 C  C     . GLU A 1 59 ? 25.135  -4.304  11.089  1.00 33.84 ? 58  GLU X C     1 
ATOM   479 O  O     . GLU A 1 59 ? 25.266  -5.494  10.789  1.00 33.42 ? 58  GLU X O     1 
ATOM   480 C  CB    . GLU A 1 59 ? 27.266  -2.993  11.253  1.00 33.96 ? 58  GLU X CB    1 
ATOM   481 C  CG    . GLU A 1 59 ? 28.320  -4.140  11.228  1.00 35.07 ? 58  GLU X CG    1 
ATOM   482 C  CD    . GLU A 1 59 ? 28.105  -5.255  12.279  1.00 36.23 ? 58  GLU X CD    1 
ATOM   483 O  OE1   . GLU A 1 59 ? 27.245  -5.126  13.183  1.00 37.33 ? 58  GLU X OE1   1 
ATOM   484 O  OE2   . GLU A 1 59 ? 28.822  -6.277  12.206  1.00 35.82 ? 58  GLU X OE2   1 
ATOM   485 N  N     . THR A 1 60 ? 24.279  -3.871  12.013  1.00 33.87 ? 59  THR X N     1 
ATOM   486 C  CA    . THR A 1 60 ? 23.420  -4.791  12.743  1.00 34.37 ? 59  THR X CA    1 
ATOM   487 C  C     . THR A 1 60 ? 22.368  -5.363  11.802  1.00 34.15 ? 59  THR X C     1 
ATOM   488 O  O     . THR A 1 60 ? 22.116  -6.566  11.819  1.00 34.14 ? 59  THR X O     1 
ATOM   489 C  CB    . THR A 1 60 ? 22.758  -4.124  13.974  1.00 34.43 ? 59  THR X CB    1 
ATOM   490 O  OG1   . THR A 1 60 ? 23.775  -3.691  14.884  1.00 34.97 ? 59  THR X OG1   1 
ATOM   491 C  CG2   . THR A 1 60 ? 21.845  -5.113  14.707  1.00 35.12 ? 59  THR X CG2   1 
ATOM   492 N  N     . LEU A 1 61 ? 21.802  -4.503  10.959  1.00 34.18 ? 60  LEU X N     1 
ATOM   493 C  CA    . LEU A 1 61 ? 20.650  -4.861  10.124  1.00 34.40 ? 60  LEU X CA    1 
ATOM   494 C  C     . LEU A 1 61 ? 21.017  -5.618  8.862   1.00 34.61 ? 60  LEU X C     1 
ATOM   495 O  O     . LEU A 1 61 ? 20.212  -6.383  8.340   1.00 34.85 ? 60  LEU X O     1 
ATOM   496 C  CB    . LEU A 1 61 ? 19.871  -3.609  9.731   1.00 34.11 ? 60  LEU X CB    1 
ATOM   497 C  CG    . LEU A 1 61 ? 19.260  -2.786  10.862  1.00 34.57 ? 60  LEU X CG    1 
ATOM   498 C  CD1   . LEU A 1 61 ? 18.346  -1.730  10.298  1.00 33.24 ? 60  LEU X CD1   1 
ATOM   499 C  CD2   . LEU A 1 61 ? 18.511  -3.670  11.851  1.00 35.68 ? 60  LEU X CD2   1 
ATOM   500 N  N     . ASP A 1 62 ? 22.231  -5.387  8.375   1.00 34.94 ? 61  ASP X N     1 
ATOM   501 C  CA    . ASP A 1 62 ? 22.675  -5.904  7.087   1.00 35.24 ? 61  ASP X CA    1 
ATOM   502 C  C     . ASP A 1 62 ? 23.160  -7.348  7.225   1.00 35.56 ? 61  ASP X C     1 
ATOM   503 O  O     . ASP A 1 62 ? 24.306  -7.584  7.575   1.00 36.03 ? 61  ASP X O     1 
ATOM   504 C  CB    . ASP A 1 62 ? 23.773  -4.989  6.524   1.00 35.16 ? 61  ASP X CB    1 
ATOM   505 C  CG    . ASP A 1 62 ? 24.243  -5.398  5.143   1.00 34.41 ? 61  ASP X CG    1 
ATOM   506 O  OD1   . ASP A 1 62 ? 23.474  -6.048  4.405   1.00 32.55 ? 61  ASP X OD1   1 
ATOM   507 O  OD2   . ASP A 1 62 ? 25.394  -5.056  4.796   1.00 34.38 ? 61  ASP X OD2   1 
ATOM   508 N  N     . SER A 1 63 ? 22.278  -8.308  6.957   1.00 35.60 ? 62  SER X N     1 
ATOM   509 C  CA    . SER A 1 63 ? 22.624  -9.718  7.088   1.00 35.45 ? 62  SER X CA    1 
ATOM   510 C  C     . SER A 1 63 ? 23.264  -10.341 5.837   1.00 35.52 ? 62  SER X C     1 
ATOM   511 O  O     . SER A 1 63 ? 23.806  -11.438 5.910   1.00 35.51 ? 62  SER X O     1 
ATOM   512 C  CB    . SER A 1 63 ? 21.400  -10.530 7.511   1.00 35.56 ? 62  SER X CB    1 
ATOM   513 O  OG    . SER A 1 63 ? 20.831  -10.023 8.710   1.00 36.08 ? 62  SER X OG    1 
ATOM   514 N  N     . ASP A 1 64 ? 23.202  -9.661  4.693   1.00 35.47 ? 63  ASP X N     1 
ATOM   515 C  CA    . ASP A 1 64 ? 23.797  -10.215 3.470   1.00 35.24 ? 63  ASP X CA    1 
ATOM   516 C  C     . ASP A 1 64 ? 25.007  -9.417  2.971   1.00 35.35 ? 63  ASP X C     1 
ATOM   517 O  O     . ASP A 1 64 ? 25.530  -9.670  1.883   1.00 35.27 ? 63  ASP X O     1 
ATOM   518 C  CB    . ASP A 1 64 ? 22.742  -10.424 2.369   1.00 35.11 ? 63  ASP X CB    1 
ATOM   519 C  CG    . ASP A 1 64 ? 22.201  -9.113  1.803   1.00 34.95 ? 63  ASP X CG    1 
ATOM   520 O  OD1   . ASP A 1 64 ? 22.555  -8.033  2.326   1.00 34.04 ? 63  ASP X OD1   1 
ATOM   521 O  OD2   . ASP A 1 64 ? 21.407  -9.167  0.838   1.00 33.98 ? 63  ASP X OD2   1 
ATOM   522 N  N     . GLY A 1 65 ? 25.442  -8.451  3.777   1.00 35.36 ? 64  GLY X N     1 
ATOM   523 C  CA    . GLY A 1 65 ? 26.728  -7.789  3.569   1.00 35.50 ? 64  GLY X CA    1 
ATOM   524 C  C     . GLY A 1 65 ? 26.812  -6.837  2.394   1.00 35.49 ? 64  GLY X C     1 
ATOM   525 O  O     . GLY A 1 65 ? 27.914  -6.496  1.957   1.00 35.53 ? 64  GLY X O     1 
ATOM   526 N  N     . ASP A 1 66 ? 25.662  -6.401  1.879   1.00 35.54 ? 65  ASP X N     1 
ATOM   527 C  CA    . ASP A 1 66 ? 25.659  -5.476  0.740   1.00 35.55 ? 65  ASP X CA    1 
ATOM   528 C  C     . ASP A 1 66 ? 25.680  -4.005  1.154   1.00 35.23 ? 65  ASP X C     1 
ATOM   529 O  O     . ASP A 1 66 ? 25.647  -3.109  0.305   1.00 35.53 ? 65  ASP X O     1 
ATOM   530 C  CB    . ASP A 1 66 ? 24.534  -5.796  -0.266  1.00 35.45 ? 65  ASP X CB    1 
ATOM   531 C  CG    . ASP A 1 66 ? 23.149  -5.456  0.248   1.00 36.52 ? 65  ASP X CG    1 
ATOM   532 O  OD1   . ASP A 1 66 ? 22.986  -5.190  1.457   1.00 38.57 ? 65  ASP X OD1   1 
ATOM   533 O  OD2   . ASP A 1 66 ? 22.199  -5.474  -0.565  1.00 36.25 ? 65  ASP X OD2   1 
ATOM   534 N  N     . GLY A 1 67 ? 25.749  -3.764  2.459   1.00 34.83 ? 66  GLY X N     1 
ATOM   535 C  CA    . GLY A 1 67 ? 25.834  -2.408  2.989   1.00 34.59 ? 66  GLY X CA    1 
ATOM   536 C  C     . GLY A 1 67 ? 24.517  -1.650  2.956   1.00 34.26 ? 66  GLY X C     1 
ATOM   537 O  O     . GLY A 1 67 ? 24.479  -0.457  3.249   1.00 34.51 ? 66  GLY X O     1 
ATOM   538 N  N     . GLU A 1 68 ? 23.440  -2.345  2.596   1.00 33.96 ? 67  GLU X N     1 
ATOM   539 C  CA    . GLU A 1 68 ? 22.102  -1.759  2.540   1.00 33.72 ? 67  GLU X CA    1 
ATOM   540 C  C     . GLU A 1 68 ? 21.090  -2.620  3.288   1.00 33.60 ? 67  GLU X C     1 
ATOM   541 O  O     . GLU A 1 68 ? 21.339  -3.791  3.555   1.00 33.51 ? 67  GLU X O     1 
ATOM   542 C  CB    . GLU A 1 68 ? 21.647  -1.562  1.087   1.00 33.50 ? 67  GLU X CB    1 
ATOM   543 C  CG    . GLU A 1 68 ? 22.588  -0.684  0.248   1.00 33.43 ? 67  GLU X CG    1 
ATOM   544 C  CD    . GLU A 1 68 ? 21.871  0.137   -0.806  1.00 32.35 ? 67  GLU X CD    1 
ATOM   545 O  OE1   . GLU A 1 68 ? 20.625  0.225   -0.775  1.00 30.88 ? 67  GLU X OE1   1 
ATOM   546 O  OE2   . GLU A 1 68 ? 22.566  0.713   -1.665  1.00 33.41 ? 67  GLU X OE2   1 
ATOM   547 N  N     . CYS A 1 69 ? 19.946  -2.028  3.612   1.00 33.77 ? 68  CYS X N     1 
ATOM   548 C  CA    . CYS A 1 69 ? 18.875  -2.719  4.307   1.00 33.95 ? 68  CYS X CA    1 
ATOM   549 C  C     . CYS A 1 69 ? 17.732  -2.985  3.328   1.00 34.16 ? 68  CYS X C     1 
ATOM   550 O  O     . CYS A 1 69 ? 17.060  -2.050  2.891   1.00 34.36 ? 68  CYS X O     1 
ATOM   551 C  CB    . CYS A 1 69 ? 18.390  -1.882  5.498   1.00 33.79 ? 68  CYS X CB    1 
ATOM   552 S  SG    . CYS A 1 69 ? 17.037  -2.635  6.436   1.00 33.88 ? 68  CYS X SG    1 
ATOM   553 N  N     . ASP A 1 70 ? 17.541  -4.252  2.959   1.00 34.36 ? 69  ASP X N     1 
ATOM   554 C  CA    . ASP A 1 70 ? 16.416  -4.643  2.093   1.00 34.26 ? 69  ASP X CA    1 
ATOM   555 C  C     . ASP A 1 70 ? 15.128  -4.877  2.905   1.00 34.39 ? 69  ASP X C     1 
ATOM   556 O  O     . ASP A 1 70 ? 15.090  -4.609  4.110   1.00 34.50 ? 69  ASP X O     1 
ATOM   557 C  CB    . ASP A 1 70 ? 16.782  -5.827  1.160   1.00 34.23 ? 69  ASP X CB    1 
ATOM   558 C  CG    . ASP A 1 70 ? 16.963  -7.162  1.896   1.00 34.11 ? 69  ASP X CG    1 
ATOM   559 O  OD1   . ASP A 1 70 ? 16.591  -7.289  3.077   1.00 33.83 ? 69  ASP X OD1   1 
ATOM   560 O  OD2   . ASP A 1 70 ? 17.480  -8.107  1.270   1.00 34.44 ? 69  ASP X OD2   1 
ATOM   561 N  N     . PHE A 1 71 ? 14.065  -5.352  2.259   1.00 34.33 ? 70  PHE X N     1 
ATOM   562 C  CA    . PHE A 1 71 ? 12.785  -5.436  2.956   1.00 34.17 ? 70  PHE X CA    1 
ATOM   563 C  C     . PHE A 1 71 ? 12.772  -6.442  4.111   1.00 34.03 ? 70  PHE X C     1 
ATOM   564 O  O     . PHE A 1 71 ? 12.241  -6.159  5.179   1.00 33.15 ? 70  PHE X O     1 
ATOM   565 C  CB    . PHE A 1 71 ? 11.628  -5.707  1.991   1.00 34.37 ? 70  PHE X CB    1 
ATOM   566 C  CG    . PHE A 1 71 ? 10.281  -5.598  2.638   1.00 34.94 ? 70  PHE X CG    1 
ATOM   567 C  CD1   . PHE A 1 71 ? 9.758   -4.356  2.974   1.00 35.43 ? 70  PHE X CD1   1 
ATOM   568 C  CD2   . PHE A 1 71 ? 9.541   -6.738  2.932   1.00 34.98 ? 70  PHE X CD2   1 
ATOM   569 C  CE1   . PHE A 1 71 ? 8.513   -4.253  3.570   1.00 36.35 ? 70  PHE X CE1   1 
ATOM   570 C  CE2   . PHE A 1 71 ? 8.301   -6.638  3.536   1.00 35.91 ? 70  PHE X CE2   1 
ATOM   571 C  CZ    . PHE A 1 71 ? 7.785   -5.397  3.850   1.00 35.48 ? 70  PHE X CZ    1 
ATOM   572 N  N     . GLN A 1 72 ? 13.345  -7.618  3.904   1.00 34.24 ? 71  GLN X N     1 
ATOM   573 C  CA    . GLN A 1 72 ? 13.339  -8.597  4.977   1.00 34.95 ? 71  GLN X CA    1 
ATOM   574 C  C     . GLN A 1 72 ? 14.249  -8.175  6.139   1.00 34.37 ? 71  GLN X C     1 
ATOM   575 O  O     . GLN A 1 72 ? 13.930  -8.422  7.298   1.00 34.27 ? 71  GLN X O     1 
ATOM   576 C  CB    . GLN A 1 72 ? 13.620  -10.013 4.463   1.00 35.34 ? 71  GLN X CB    1 
ATOM   577 C  CG    . GLN A 1 72 ? 15.053  -10.433 4.429   1.00 38.67 ? 71  GLN X CG    1 
ATOM   578 C  CD    . GLN A 1 72 ? 15.215  -11.894 4.785   1.00 42.25 ? 71  GLN X CD    1 
ATOM   579 O  OE1   . GLN A 1 72 ? 15.875  -12.650 4.075   1.00 42.28 ? 71  GLN X OE1   1 
ATOM   580 N  NE2   . GLN A 1 72 ? 14.590  -12.306 5.891   1.00 44.71 ? 71  GLN X NE2   1 
ATOM   581 N  N     . GLU A 1 73 ? 15.345  -7.493  5.821   1.00 34.08 ? 72  GLU X N     1 
ATOM   582 C  CA    . GLU A 1 73 ? 16.207  -6.895  6.836   1.00 33.76 ? 72  GLU X CA    1 
ATOM   583 C  C     . GLU A 1 73 ? 15.484  -5.775  7.571   1.00 33.81 ? 72  GLU X C     1 
ATOM   584 O  O     . GLU A 1 73 ? 15.671  -5.587  8.775   1.00 33.59 ? 72  GLU X O     1 
ATOM   585 C  CB    . GLU A 1 73 ? 17.499  -6.384  6.217   1.00 33.45 ? 72  GLU X CB    1 
ATOM   586 C  CG    . GLU A 1 73 ? 18.452  -7.499  5.812   1.00 33.66 ? 72  GLU X CG    1 
ATOM   587 C  CD    . GLU A 1 73 ? 19.518  -7.027  4.855   1.00 33.32 ? 72  GLU X CD    1 
ATOM   588 O  OE1   . GLU A 1 73 ? 19.366  -5.934  4.267   1.00 31.82 ? 72  GLU X OE1   1 
ATOM   589 O  OE2   . GLU A 1 73 ? 20.518  -7.751  4.678   1.00 34.43 ? 72  GLU X OE2   1 
ATOM   590 N  N     . PHE A 1 74 ? 14.644  -5.044  6.848   1.00 33.73 ? 73  PHE X N     1 
ATOM   591 C  CA    . PHE A 1 74 ? 13.796  -4.029  7.475   1.00 34.28 ? 73  PHE X CA    1 
ATOM   592 C  C     . PHE A 1 74 ? 12.768  -4.649  8.427   1.00 34.32 ? 73  PHE X C     1 
ATOM   593 O  O     . PHE A 1 74 ? 12.500  -4.100  9.490   1.00 34.75 ? 73  PHE X O     1 
ATOM   594 C  CB    . PHE A 1 74 ? 13.088  -3.156  6.436   1.00 33.76 ? 73  PHE X CB    1 
ATOM   595 C  CG    . PHE A 1 74 ? 12.212  -2.108  7.043   1.00 33.81 ? 73  PHE X CG    1 
ATOM   596 C  CD1   . PHE A 1 74 ? 12.768  -1.046  7.751   1.00 33.19 ? 73  PHE X CD1   1 
ATOM   597 C  CD2   . PHE A 1 74 ? 10.829  -2.187  6.925   1.00 33.84 ? 73  PHE X CD2   1 
ATOM   598 C  CE1   . PHE A 1 74 ? 11.973  -0.086  8.332   1.00 32.32 ? 73  PHE X CE1   1 
ATOM   599 C  CE2   . PHE A 1 74 ? 10.019  -1.220  7.493   1.00 33.62 ? 73  PHE X CE2   1 
ATOM   600 C  CZ    . PHE A 1 74 ? 10.598  -0.161  8.196   1.00 33.83 ? 73  PHE X CZ    1 
ATOM   601 N  N     . MET A 1 75 ? 12.202  -5.784  8.033   1.00 34.61 ? 74  MET X N     1 
ATOM   602 C  CA    . MET A 1 75 ? 11.258  -6.514  8.872   1.00 35.11 ? 74  MET X CA    1 
ATOM   603 C  C     . MET A 1 75 ? 11.906  -6.995  10.170  1.00 34.60 ? 74  MET X C     1 
ATOM   604 O  O     . MET A 1 75 ? 11.267  -6.984  11.217  1.00 34.70 ? 74  MET X O     1 
ATOM   605 C  CB    . MET A 1 75 ? 10.658  -7.704  8.112   1.00 35.48 ? 74  MET X CB    1 
ATOM   606 C  CG    . MET A 1 75 ? 9.526   -7.356  7.125   1.00 38.24 ? 74  MET X CG    1 
ATOM   607 S  SD    . MET A 1 75 ? 8.232   -6.215  7.717   1.00 44.60 ? 74  MET X SD    1 
ATOM   608 C  CE    . MET A 1 75 ? 7.551   -7.096  9.119   1.00 44.18 ? 74  MET X CE    1 
ATOM   609 N  N     . ALA A 1 76 ? 13.166  -7.427  10.105  1.00 33.97 ? 75  ALA X N     1 
ATOM   610 C  CA    . ALA A 1 76 ? 13.897  -7.792  11.324  1.00 33.59 ? 75  ALA X CA    1 
ATOM   611 C  C     . ALA A 1 76 ? 14.092  -6.563  12.222  1.00 33.24 ? 75  ALA X C     1 
ATOM   612 O  O     . ALA A 1 76 ? 13.888  -6.642  13.434  1.00 33.78 ? 75  ALA X O     1 
ATOM   613 C  CB    . ALA A 1 76 ? 15.228  -8.466  10.996  1.00 33.12 ? 75  ALA X CB    1 
ATOM   614 N  N     . PHE A 1 77 ? 14.455  -5.431  11.619  1.00 32.95 ? 76  PHE X N     1 
ATOM   615 C  CA    . PHE A 1 77 ? 14.527  -4.139  12.315  1.00 32.31 ? 76  PHE X CA    1 
ATOM   616 C  C     . PHE A 1 77 ? 13.224  -3.809  13.046  1.00 32.11 ? 76  PHE X C     1 
ATOM   617 O  O     . PHE A 1 77 ? 13.244  -3.481  14.242  1.00 32.12 ? 76  PHE X O     1 
ATOM   618 C  CB    . PHE A 1 77 ? 14.895  -3.029  11.326  1.00 32.52 ? 76  PHE X CB    1 
ATOM   619 C  CG    . PHE A 1 77 ? 15.124  -1.678  11.960  1.00 32.90 ? 76  PHE X CG    1 
ATOM   620 C  CD1   . PHE A 1 77 ? 15.904  -1.539  13.108  1.00 33.69 ? 76  PHE X CD1   1 
ATOM   621 C  CD2   . PHE A 1 77 ? 14.591  -0.535  11.381  1.00 33.95 ? 76  PHE X CD2   1 
ATOM   622 C  CE1   . PHE A 1 77 ? 16.125  -0.287  13.677  1.00 33.06 ? 76  PHE X CE1   1 
ATOM   623 C  CE2   . PHE A 1 77 ? 14.809  0.725   11.942  1.00 32.69 ? 76  PHE X CE2   1 
ATOM   624 C  CZ    . PHE A 1 77 ? 15.576  0.842   13.091  1.00 33.31 ? 76  PHE X CZ    1 
ATOM   625 N  N     . VAL A 1 78 ? 12.096  -3.918  12.341  1.00 31.58 ? 77  VAL X N     1 
ATOM   626 C  CA    . VAL A 1 78 ? 10.772  -3.716  12.952  1.00 31.50 ? 77  VAL X CA    1 
ATOM   627 C  C     . VAL A 1 78 ? 10.522  -4.678  14.128  1.00 31.76 ? 77  VAL X C     1 
ATOM   628 O  O     . VAL A 1 78 ? 10.008  -4.267  15.169  1.00 31.09 ? 77  VAL X O     1 
ATOM   629 C  CB    . VAL A 1 78 ? 9.638   -3.796  11.904  1.00 31.78 ? 77  VAL X CB    1 
ATOM   630 C  CG1   . VAL A 1 78 ? 8.259   -3.800  12.577  1.00 31.37 ? 77  VAL X CG1   1 
ATOM   631 C  CG2   . VAL A 1 78 ? 9.752   -2.639  10.919  1.00 30.93 ? 77  VAL X CG2   1 
ATOM   632 N  N     . ALA A 1 79 ? 10.911  -5.946  13.968  1.00 32.36 ? 78  ALA X N     1 
ATOM   633 C  CA    . ALA A 1 79 ? 10.814  -6.931  15.054  1.00 33.00 ? 78  ALA X CA    1 
ATOM   634 C  C     . ALA A 1 79 ? 11.625  -6.525  16.303  1.00 33.61 ? 78  ALA X C     1 
ATOM   635 O  O     . ALA A 1 79 ? 11.145  -6.686  17.424  1.00 33.68 ? 78  ALA X O     1 
ATOM   636 C  CB    . ALA A 1 79 ? 11.230  -8.325  14.559  1.00 32.86 ? 78  ALA X CB    1 
ATOM   637 N  N     . MET A 1 80 ? 12.842  -6.009  16.099  1.00 34.67 ? 79  MET X N     1 
ATOM   638 C  CA    . MET A 1 80 ? 13.690  -5.459  17.184  1.00 36.09 ? 79  MET X CA    1 
ATOM   639 C  C     . MET A 1 80 ? 12.988  -4.303  17.914  1.00 34.79 ? 79  MET X C     1 
ATOM   640 O  O     . MET A 1 80 ? 12.943  -4.268  19.141  1.00 34.65 ? 79  MET X O     1 
ATOM   641 C  CB    . MET A 1 80 ? 15.026  -4.915  16.641  1.00 36.13 ? 79  MET X CB    1 
ATOM   642 C  CG    . MET A 1 80 ? 16.061  -5.923  16.153  1.00 37.77 ? 79  MET X CG    1 
ATOM   643 S  SD    . MET A 1 80 ? 17.350  -5.074  15.163  1.00 40.69 ? 79  MET X SD    1 
ATOM   644 C  CE    . MET A 1 80 ? 18.111  -6.470  14.319  1.00 39.73 ? 79  MET X CE    1 
ATOM   645 N  N     . ILE A 1 81 ? 12.468  -3.356  17.141  1.00 34.04 ? 80  ILE X N     1 
ATOM   646 C  CA    . ILE A 1 81 ? 11.772  -2.185  17.672  1.00 33.35 ? 80  ILE X CA    1 
ATOM   647 C  C     . ILE A 1 81 ? 10.514  -2.576  18.447  1.00 33.06 ? 80  ILE X C     1 
ATOM   648 O  O     . ILE A 1 81 ? 10.321  -2.130  19.585  1.00 32.82 ? 80  ILE X O     1 
ATOM   649 C  CB    . ILE A 1 81 ? 11.395  -1.193  16.549  1.00 33.46 ? 80  ILE X CB    1 
ATOM   650 C  CG1   . ILE A 1 81 ? 12.651  -0.638  15.877  1.00 33.11 ? 80  ILE X CG1   1 
ATOM   651 C  CG2   . ILE A 1 81 ? 10.532  -0.047  17.087  1.00 33.80 ? 80  ILE X CG2   1 
ATOM   652 C  CD1   . ILE A 1 81 ? 12.365  -0.076  14.507  1.00 34.77 ? 80  ILE X CD1   1 
ATOM   653 N  N     . THR A 1 82 ? 9.665   -3.396  17.827  1.00 32.20 ? 81  THR X N     1 
ATOM   654 C  CA    . THR A 1 82 ? 8.432   -3.860  18.458  1.00 32.29 ? 81  THR X CA    1 
ATOM   655 C  C     . THR A 1 82 ? 8.721   -4.627  19.747  1.00 32.34 ? 81  THR X C     1 
ATOM   656 O  O     . THR A 1 82 ? 8.094   -4.372  20.766  1.00 32.32 ? 81  THR X O     1 
ATOM   657 C  CB    . THR A 1 82 ? 7.560   -4.695  17.480  1.00 32.16 ? 81  THR X CB    1 
ATOM   658 O  OG1   . THR A 1 82 ? 7.344   -3.936  16.285  1.00 31.14 ? 81  THR X OG1   1 
ATOM   659 C  CG2   . THR A 1 82 ? 6.199   -5.039  18.095  1.00 31.38 ? 81  THR X CG2   1 
ATOM   660 N  N     . THR A 1 83 ? 9.684   -5.545  19.704  1.00 32.78 ? 82  THR X N     1 
ATOM   661 C  CA    . THR A 1 83 ? 10.084  -6.280  20.895  1.00 33.02 ? 82  THR X CA    1 
ATOM   662 C  C     . THR A 1 83 ? 10.512  -5.330  22.023  1.00 33.41 ? 82  THR X C     1 
ATOM   663 O  O     . THR A 1 83 ? 10.134  -5.534  23.173  1.00 33.24 ? 82  THR X O     1 
ATOM   664 C  CB    . THR A 1 83 ? 11.190  -7.321  20.592  1.00 33.26 ? 82  THR X CB    1 
ATOM   665 O  OG1   . THR A 1 83 ? 10.686  -8.305  19.676  1.00 33.24 ? 82  THR X OG1   1 
ATOM   666 C  CG2   . THR A 1 83 ? 11.652  -8.032  21.873  1.00 33.11 ? 82  THR X CG2   1 
ATOM   667 N  N     . ALA A 1 84 ? 11.279  -4.295  21.683  1.00 33.66 ? 83  ALA X N     1 
ATOM   668 C  CA    . ALA A 1 84 ? 11.730  -3.306  22.659  1.00 34.34 ? 83  ALA X CA    1 
ATOM   669 C  C     . ALA A 1 84 ? 10.568  -2.498  23.258  1.00 34.78 ? 83  ALA X C     1 
ATOM   670 O  O     . ALA A 1 84 ? 10.530  -2.274  24.466  1.00 34.58 ? 83  ALA X O     1 
ATOM   671 C  CB    . ALA A 1 84 ? 12.785  -2.384  22.048  1.00 34.20 ? 83  ALA X CB    1 
ATOM   672 N  N     . CYS A 1 85 ? 9.629   -2.080  22.409  1.00 35.74 ? 84  CYS X N     1 
ATOM   673 C  CA    . CYS A 1 85 ? 8.411   -1.398  22.856  1.00 36.04 ? 84  CYS X CA    1 
ATOM   674 C  C     . CYS A 1 85 ? 7.627   -2.304  23.799  1.00 36.28 ? 84  CYS X C     1 
ATOM   675 O  O     . CYS A 1 85 ? 7.199   -1.873  24.872  1.00 36.04 ? 84  CYS X O     1 
ATOM   676 C  CB    . CYS A 1 85 ? 7.544   -1.000  21.655  1.00 36.06 ? 84  CYS X CB    1 
ATOM   677 S  SG    . CYS A 1 85 ? 6.069   0.025   22.030  1.00 37.22 ? 84  CYS X SG    1 
ATOM   678 N  N     . HIS A 1 86 ? 7.470   -3.562  23.390  1.00 36.43 ? 85  HIS X N     1 
ATOM   679 C  CA    . HIS A 1 86 ? 6.758   -4.576  24.160  1.00 36.96 ? 85  HIS X CA    1 
ATOM   680 C  C     . HIS A 1 86 ? 7.368   -4.729  25.555  1.00 37.56 ? 85  HIS X C     1 
ATOM   681 O  O     . HIS A 1 86 ? 6.648   -4.928  26.539  1.00 37.54 ? 85  HIS X O     1 
ATOM   682 C  CB    . HIS A 1 86 ? 6.780   -5.905  23.394  1.00 36.61 ? 85  HIS X CB    1 
ATOM   683 C  CG    . HIS A 1 86 ? 6.093   -7.035  24.093  1.00 36.27 ? 85  HIS X CG    1 
ATOM   684 N  ND1   . HIS A 1 86 ? 6.752   -8.189  24.464  1.00 36.07 ? 85  HIS X ND1   1 
ATOM   685 C  CD2   . HIS A 1 86 ? 4.805   -7.198  24.475  1.00 35.83 ? 85  HIS X CD2   1 
ATOM   686 C  CE1   . HIS A 1 86 ? 5.901   -9.011  25.050  1.00 35.42 ? 85  HIS X CE1   1 
ATOM   687 N  NE2   . HIS A 1 86 ? 4.713   -8.433  25.070  1.00 36.12 ? 85  HIS X NE2   1 
ATOM   688 N  N     . GLU A 1 87 ? 8.690   -4.606  25.628  1.00 38.24 ? 86  GLU X N     1 
ATOM   689 C  CA    . GLU A 1 87 ? 9.423   -4.731  26.886  1.00 39.53 ? 86  GLU X CA    1 
ATOM   690 C  C     . GLU A 1 87 ? 9.513   -3.409  27.655  1.00 39.74 ? 86  GLU X C     1 
ATOM   691 O  O     . GLU A 1 87 ? 10.262  -3.297  28.629  1.00 39.60 ? 86  GLU X O     1 
ATOM   692 C  CB    . GLU A 1 87 ? 10.815  -5.309  26.616  1.00 39.35 ? 86  GLU X CB    1 
ATOM   693 C  CG    . GLU A 1 87 ? 10.802  -6.797  26.241  1.00 40.32 ? 86  GLU X CG    1 
ATOM   694 C  CD    . GLU A 1 87 ? 12.154  -7.309  25.754  1.00 40.57 ? 86  GLU X CD    1 
ATOM   695 O  OE1   . GLU A 1 87 ? 12.344  -8.545  25.728  1.00 41.64 ? 86  GLU X OE1   1 
ATOM   696 O  OE2   . GLU A 1 87 ? 13.021  -6.479  25.386  1.00 42.37 ? 86  GLU X OE2   1 
ATOM   697 N  N     . PHE A 1 88 ? 8.731   -2.422  27.210  1.00 40.57 ? 87  PHE X N     1 
ATOM   698 C  CA    . PHE A 1 88 ? 8.689   -1.067  27.792  1.00 41.31 ? 87  PHE X CA    1 
ATOM   699 C  C     . PHE A 1 88 ? 10.034  -0.340  27.703  1.00 41.78 ? 87  PHE X C     1 
ATOM   700 O  O     . PHE A 1 88 ? 10.345  0.526   28.525  1.00 41.68 ? 87  PHE X O     1 
ATOM   701 C  CB    . PHE A 1 88 ? 8.168   -1.095  29.236  1.00 41.44 ? 87  PHE X CB    1 
ATOM   702 C  CG    . PHE A 1 88 ? 6.785   -1.671  29.373  1.00 41.94 ? 87  PHE X CG    1 
ATOM   703 C  CD1   . PHE A 1 88 ? 6.605   -2.990  29.794  1.00 42.81 ? 87  PHE X CD1   1 
ATOM   704 C  CD2   . PHE A 1 88 ? 5.660   -0.896  29.090  1.00 41.89 ? 87  PHE X CD2   1 
ATOM   705 C  CE1   . PHE A 1 88 ? 5.322   -3.532  29.928  1.00 43.22 ? 87  PHE X CE1   1 
ATOM   706 C  CE2   . PHE A 1 88 ? 4.375   -1.427  29.221  1.00 42.31 ? 87  PHE X CE2   1 
ATOM   707 C  CZ    . PHE A 1 88 ? 4.203   -2.746  29.639  1.00 42.64 ? 87  PHE X CZ    1 
ATOM   708 N  N     . PHE A 1 89 ? 10.811  -0.704  26.681  1.00 42.54 ? 88  PHE X N     1 
ATOM   709 C  CA    . PHE A 1 89 ? 12.165  -0.177  26.439  1.00 43.38 ? 88  PHE X CA    1 
ATOM   710 C  C     . PHE A 1 89 ? 13.142  -0.433  27.594  1.00 43.73 ? 88  PHE X C     1 
ATOM   711 O  O     . PHE A 1 89 ? 13.776  0.497   28.100  1.00 43.97 ? 88  PHE X O     1 
ATOM   712 C  CB    . PHE A 1 89 ? 12.132  1.307   26.062  1.00 43.36 ? 88  PHE X CB    1 
ATOM   713 C  CG    . PHE A 1 89 ? 11.290  1.613   24.857  1.00 43.28 ? 88  PHE X CG    1 
ATOM   714 C  CD1   . PHE A 1 89 ? 9.925   1.877   24.991  1.00 43.46 ? 88  PHE X CD1   1 
ATOM   715 C  CD2   . PHE A 1 89 ? 11.860  1.652   23.592  1.00 43.22 ? 88  PHE X CD2   1 
ATOM   716 C  CE1   . PHE A 1 89 ? 9.141   2.167   23.882  1.00 43.07 ? 88  PHE X CE1   1 
ATOM   717 C  CE2   . PHE A 1 89 ? 11.088  1.948   22.479  1.00 42.92 ? 88  PHE X CE2   1 
ATOM   718 C  CZ    . PHE A 1 89 ? 9.724   2.206   22.626  1.00 43.09 ? 88  PHE X CZ    1 
ATOM   719 N  N     . GLU A 1 90 ? 13.241  -1.707  27.983  1.00 44.27 ? 89  GLU X N     1 
ATOM   720 C  CA    . GLU A 1 90 ? 14.173  -2.233  29.009  1.00 44.47 ? 89  GLU X CA    1 
ATOM   721 C  C     . GLU A 1 90 ? 14.262  -1.444  30.304  1.00 44.42 ? 89  GLU X C     1 
ATOM   722 O  O     . GLU A 1 90 ? 14.047  -1.999  31.377  1.00 44.73 ? 89  GLU X O     1 
ATOM   723 C  CB    . GLU A 1 90 ? 15.575  -2.534  28.427  1.00 44.61 ? 89  GLU X CB    1 
ATOM   724 C  CG    . GLU A 1 90 ? 16.387  -1.323  27.948  1.00 45.13 ? 89  GLU X CG    1 
ATOM   725 C  CD    . GLU A 1 90 ? 17.222  -1.610  26.704  1.00 45.54 ? 89  GLU X CD    1 
ATOM   726 O  OE1   . GLU A 1 90 ? 17.807  -2.711  26.604  1.00 45.51 ? 89  GLU X OE1   1 
ATOM   727 O  OE2   . GLU A 1 90 ? 17.299  -0.722  25.826  1.00 44.99 ? 89  GLU X OE2   1 
HETATM 728 C  C1    . PNT B 2 .  ? -0.678  2.685   23.737  0.50 45.59 ? 101 PNT X C1    1 
HETATM 729 C  C2    . PNT B 2 .  ? -1.628  2.848   22.727  0.50 45.41 ? 101 PNT X C2    1 
HETATM 730 C  C3    . PNT B 2 .  ? -2.665  1.922   22.585  0.50 45.63 ? 101 PNT X C3    1 
HETATM 731 C  C4    . PNT B 2 .  ? -2.764  0.827   23.451  0.50 45.70 ? 101 PNT X C4    1 
HETATM 732 C  C5    . PNT B 2 .  ? -1.812  0.674   24.458  0.50 45.73 ? 101 PNT X C5    1 
HETATM 733 C  C6    . PNT B 2 .  ? -0.776  1.595   24.603  0.50 45.57 ? 101 PNT X C6    1 
HETATM 734 C  C7    . PNT B 2 .  ? 1.644   3.150   24.299  0.50 45.07 ? 101 PNT X C7    1 
HETATM 735 C  C8    . PNT B 2 .  ? 2.733   4.185   24.016  0.50 44.23 ? 101 PNT X C8    1 
HETATM 736 C  C9    . PNT B 2 .  ? -3.887  -0.174  23.311  0.50 45.61 ? 101 PNT X C9    1 
HETATM 737 C  C10   . PNT B 2 .  ? 4.084   3.512   23.773  0.50 43.26 ? 101 PNT X C10   1 
HETATM 738 C  "C1'" . PNT B 2 .  ? 3.650   -0.424  25.058  0.50 40.56 ? 101 PNT X "C1'" 1 
HETATM 739 C  "C2'" . PNT B 2 .  ? 4.600   -1.279  25.607  0.50 40.10 ? 101 PNT X "C2'" 1 
HETATM 740 C  "C3'" . PNT B 2 .  ? 4.240   -2.549  26.045  0.50 39.98 ? 101 PNT X "C3'" 1 
HETATM 741 C  "C4'" . PNT B 2 .  ? 2.919   -2.978  25.948  0.50 40.28 ? 101 PNT X "C4'" 1 
HETATM 742 C  "C5'" . PNT B 2 .  ? 1.960   -2.125  25.396  0.50 40.14 ? 101 PNT X "C5'" 1 
HETATM 743 C  "C6'" . PNT B 2 .  ? 2.325   -0.853  24.951  0.50 40.31 ? 101 PNT X "C6'" 1 
HETATM 744 C  "C7'" . PNT B 2 .  ? 5.064   1.608   25.170  0.50 41.92 ? 101 PNT X "C7'" 1 
HETATM 745 C  "C8'" . PNT B 2 .  ? 4.766   3.106   25.079  0.50 42.61 ? 101 PNT X "C8'" 1 
HETATM 746 C  "C9'" . PNT B 2 .  ? 2.549   -4.354  26.433  0.50 40.31 ? 101 PNT X "C9'" 1 
HETATM 747 O  O1    . PNT B 2 .  ? 0.348   3.593   23.878  0.50 45.77 ? 101 PNT X O1    1 
HETATM 748 O  "O1'" . PNT B 2 .  ? 3.999   0.830   24.611  0.50 41.20 ? 101 PNT X "O1'" 1 
HETATM 749 N  N1    . PNT B 2 .  ? -3.874  -1.260  23.953  0.50 44.78 ? 101 PNT X N1    1 
HETATM 750 N  N2    . PNT B 2 .  ? -4.910  0.070   22.491  0.50 45.85 ? 101 PNT X N2    1 
HETATM 751 N  "N1'" . PNT B 2 .  ? 3.402   -5.281  26.416  0.50 39.70 ? 101 PNT X "N1'" 1 
HETATM 752 N  "N2'" . PNT B 2 .  ? 1.323   -4.609  26.890  0.50 40.00 ? 101 PNT X "N2'" 1 
HETATM 753 C  C1    . PNT C 2 .  ? 5.649   10.362  22.796  0.50 53.14 ? 102 PNT X C1    1 
HETATM 754 C  C2    . PNT C 2 .  ? 6.050   11.571  23.365  0.50 53.21 ? 102 PNT X C2    1 
HETATM 755 C  C3    . PNT C 2 .  ? 5.680   12.782  22.779  0.50 53.30 ? 102 PNT X C3    1 
HETATM 756 C  C4    . PNT C 2 .  ? 4.906   12.792  21.617  0.50 53.19 ? 102 PNT X C4    1 
HETATM 757 C  C5    . PNT C 2 .  ? 4.504   11.583  21.041  0.50 53.25 ? 102 PNT X C5    1 
HETATM 758 C  C6    . PNT C 2 .  ? 4.877   10.371  21.628  0.50 53.10 ? 102 PNT X C6    1 
HETATM 759 C  C7    . PNT C 2 .  ? 5.416   7.932   23.138  0.50 52.94 ? 102 PNT X C7    1 
HETATM 760 C  C8    . PNT C 2 .  ? 5.876   6.917   24.178  0.50 52.80 ? 102 PNT X C8    1 
HETATM 761 C  C9    . PNT C 2 .  ? 4.517   14.107  20.998  0.50 53.18 ? 102 PNT X C9    1 
HETATM 762 C  C10   . PNT C 2 .  ? 7.274   6.399   23.862  0.50 52.73 ? 102 PNT X C10   1 
HETATM 763 C  "C1'" . PNT C 2 .  ? 11.550  5.029   25.592  0.50 53.27 ? 102 PNT X "C1'" 1 
HETATM 764 C  "C2'" . PNT C 2 .  ? 12.110  5.055   24.310  0.50 53.40 ? 102 PNT X "C2'" 1 
HETATM 765 C  "C3'" . PNT C 2 .  ? 13.477  4.834   24.134  0.50 53.44 ? 102 PNT X "C3'" 1 
HETATM 766 C  "C4'" . PNT C 2 .  ? 14.290  4.584   25.240  0.50 53.34 ? 102 PNT X "C4'" 1 
HETATM 767 C  "C5'" . PNT C 2 .  ? 13.738  4.555   26.522  0.50 53.39 ? 102 PNT X "C5'" 1 
HETATM 768 C  "C6'" . PNT C 2 .  ? 12.369  4.776   26.696  0.50 53.35 ? 102 PNT X "C6'" 1 
HETATM 769 C  "C7'" . PNT C 2 .  ? 9.479   6.227   25.045  0.50 52.89 ? 102 PNT X "C7'" 1 
HETATM 770 C  "C8'" . PNT C 2 .  ? 7.986   5.928   25.123  0.50 52.75 ? 102 PNT X "C8'" 1 
HETATM 771 C  "C9'" . PNT C 2 .  ? 15.757  4.346   25.045  0.50 53.22 ? 102 PNT X "C9'" 1 
HETATM 772 O  O1    . PNT C 2 .  ? 6.037   9.191   23.402  0.50 53.09 ? 102 PNT X O1    1 
HETATM 773 O  "O1'" . PNT C 2 .  ? 10.203  5.240   25.782  0.50 53.02 ? 102 PNT X "O1'" 1 
HETATM 774 N  N1    . PNT C 2 .  ? 4.800   14.350  19.795  0.50 53.17 ? 102 PNT X N1    1 
HETATM 775 N  N2    . PNT C 2 .  ? 3.877   15.027  21.721  0.50 53.19 ? 102 PNT X N2    1 
HETATM 776 N  "N1'" . PNT C 2 .  ? 16.587  5.246   25.344  0.50 53.25 ? 102 PNT X "N1'" 1 
HETATM 777 N  "N2'" . PNT C 2 .  ? 16.179  3.181   24.555  0.50 52.92 ? 102 PNT X "N2'" 1 
HETATM 778 CA CA    . CA  D 3 .  ? 17.324  3.272   -1.880  1.00 31.72 ? 103 CA  X CA    1 
HETATM 779 CA CA    . CA  E 3 .  ? 21.600  -6.069  3.066   1.00 35.58 ? 104 CA  X CA    1 
HETATM 780 O  O     . HOH F 4 .  ? 19.490  2.534   -1.757  1.00 27.04 ? 105 HOH X O     1 
HETATM 781 O  O     . HOH F 4 .  ? 13.643  -3.172  25.802  1.00 36.12 ? 106 HOH X O     1 
HETATM 782 O  O     . HOH F 4 .  ? 24.402  6.232   2.356   1.00 26.24 ? 107 HOH X O     1 
HETATM 783 O  O     . HOH F 4 .  ? 13.743  -5.169  -0.650  1.00 34.44 ? 108 HOH X O     1 
HETATM 784 O  O     . HOH F 4 .  ? 19.339  -10.291 4.034   1.00 35.98 ? 109 HOH X O     1 
HETATM 785 O  O     . HOH F 4 .  ? 24.499  1.996   2.525   1.00 32.58 ? 110 HOH X O     1 
HETATM 786 O  O     . HOH F 4 .  ? 3.435   4.059   7.287   1.00 38.95 ? 111 HOH X O     1 
HETATM 787 O  O     . HOH F 4 .  ? 20.163  -6.009  1.039   1.00 33.11 ? 112 HOH X O     1 
HETATM 788 O  O     . HOH F 4 .  ? -9.497  -3.901  14.175  1.00 24.48 ? 113 HOH X O     1 
HETATM 789 O  O     . HOH F 4 .  ? 16.006  0.259   -8.155  1.00 33.73 ? 114 HOH X O     1 
HETATM 790 O  O     . HOH F 4 .  ? 4.633   6.301   6.877   1.00 30.09 ? 115 HOH X O     1 
HETATM 791 O  O     . HOH F 4 .  ? 14.980  9.219   16.031  1.00 28.01 ? 116 HOH X O     1 
HETATM 792 O  O     . HOH F 4 .  ? 14.637  -5.773  20.715  1.00 35.56 ? 117 HOH X O     1 
HETATM 793 O  O     . HOH F 4 .  ? 26.055  -8.882  6.705   1.00 36.42 ? 118 HOH X O     1 
HETATM 794 O  O     . HOH F 4 .  ? 17.364  10.035  1.381   1.00 34.60 ? 119 HOH X O     1 
HETATM 795 O  O     . HOH F 4 .  ? 28.311  -0.100  8.796   1.00 41.15 ? 120 HOH X O     1 
HETATM 796 O  O     . HOH F 4 .  ? 14.843  -9.184  14.670  1.00 43.91 ? 121 HOH X O     1 
HETATM 797 O  O     . HOH F 4 .  ? -6.568  -5.857  14.324  1.00 30.84 ? 122 HOH X O     1 
HETATM 798 O  O     . HOH F 4 .  ? 26.785  -0.576  0.012   1.00 35.24 ? 123 HOH X O     1 
HETATM 799 O  O     . HOH F 4 .  ? 0.971   4.078   6.081   1.00 36.62 ? 124 HOH X O     1 
HETATM 800 O  O     . HOH F 4 .  ? 9.389   0.403   20.699  1.00 44.36 ? 125 HOH X O     1 
HETATM 801 O  O     . HOH F 4 .  ? 24.370  8.707   5.941   1.00 34.25 ? 126 HOH X O     1 
HETATM 802 O  O     . HOH F 4 .  ? 8.453   9.950   14.935  1.00 37.65 ? 127 HOH X O     1 
HETATM 803 O  O     . HOH F 4 .  ? 13.883  -8.813  0.908   1.00 45.05 ? 128 HOH X O     1 
HETATM 804 O  O     . HOH F 4 .  ? 15.717  -6.253  -2.516  1.00 41.80 ? 129 HOH X O     1 
HETATM 805 O  O     . HOH F 4 .  ? 10.962  5.970   -10.771 1.00 40.75 ? 130 HOH X O     1 
HETATM 806 O  O     . HOH F 4 .  ? 29.252  4.857   5.807   1.00 57.08 ? 131 HOH X O     1 
HETATM 807 O  O     . HOH F 4 .  ? 26.779  -2.961  14.758  1.00 31.30 ? 132 HOH X O     1 
HETATM 808 O  O     . HOH F 4 .  ? 21.465  2.269   -3.583  1.00 27.99 ? 133 HOH X O     1 
HETATM 809 O  O     . HOH F 4 .  ? 29.721  -9.530  4.643   1.00 33.78 ? 134 HOH X O     1 
HETATM 810 O  O     . HOH F 4 .  ? 10.335  -10.841 20.087  1.00 35.18 ? 135 HOH X O     1 
HETATM 811 O  O     . HOH F 4 .  ? 15.321  -6.074  29.367  1.00 30.60 ? 136 HOH X O     1 
HETATM 812 O  O     . HOH F 4 .  ? -3.232  0.067   12.740  1.00 32.82 ? 137 HOH X O     1 
HETATM 813 O  O     . HOH F 4 .  ? 18.188  -9.459  9.025   1.00 36.57 ? 138 HOH X O     1 
HETATM 814 O  O     . HOH F 4 .  ? 18.059  -7.032  9.854   1.00 41.35 ? 139 HOH X O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  0  0  MET MET X . n 
A 1 2  SER 2  1  1  SER SER X . n 
A 1 3  GLU 3  2  2  GLU GLU X . n 
A 1 4  LEU 4  3  3  LEU LEU X . n 
A 1 5  GLU 5  4  4  GLU GLU X . n 
A 1 6  LYS 6  5  5  LYS LYS X . n 
A 1 7  ALA 7  6  6  ALA ALA X . n 
A 1 8  VAL 8  7  7  VAL VAL X . n 
A 1 9  VAL 9  8  8  VAL VAL X . n 
A 1 10 ALA 10 9  9  ALA ALA X . n 
A 1 11 LEU 11 10 10 LEU LEU X . n 
A 1 12 ILE 12 11 11 ILE ILE X . n 
A 1 13 ASP 13 12 12 ASP ASP X . n 
A 1 14 VAL 14 13 13 VAL VAL X . n 
A 1 15 PHE 15 14 14 PHE PHE X . n 
A 1 16 HIS 16 15 15 HIS HIS X . n 
A 1 17 GLN 17 16 16 GLN GLN X . n 
A 1 18 TYR 18 17 17 TYR TYR X . n 
A 1 19 SER 19 18 18 SER SER X . n 
A 1 20 GLY 20 19 19 GLY GLY X . n 
A 1 21 ARG 21 20 20 ARG ARG X . n 
A 1 22 GLU 22 21 21 GLU GLU X . n 
A 1 23 GLY 23 22 22 GLY GLY X . n 
A 1 24 ASP 24 23 23 ASP ASP X . n 
A 1 25 LYS 25 24 24 LYS LYS X . n 
A 1 26 HIS 26 25 25 HIS HIS X . n 
A 1 27 LYS 27 26 26 LYS LYS X . n 
A 1 28 LEU 28 27 27 LEU LEU X . n 
A 1 29 LYS 29 28 28 LYS LYS X . n 
A 1 30 LYS 30 29 29 LYS LYS X . n 
A 1 31 SER 31 30 30 SER SER X . n 
A 1 32 GLU 32 31 31 GLU GLU X . n 
A 1 33 LEU 33 32 32 LEU LEU X . n 
A 1 34 LYS 34 33 33 LYS LYS X . n 
A 1 35 GLU 35 34 34 GLU GLU X . n 
A 1 36 LEU 36 35 35 LEU LEU X . n 
A 1 37 ILE 37 36 36 ILE ILE X . n 
A 1 38 ASN 38 37 37 ASN ASN X . n 
A 1 39 ASN 39 38 38 ASN ASN X . n 
A 1 40 GLU 40 39 39 GLU GLU X . n 
A 1 41 LEU 41 40 40 LEU LEU X . n 
A 1 42 SER 42 41 41 SER SER X . n 
A 1 43 HIS 43 42 42 HIS HIS X . n 
A 1 44 PHE 44 43 43 PHE PHE X . n 
A 1 45 LEU 45 44 44 LEU LEU X . n 
A 1 46 GLU 46 45 45 GLU GLU X . n 
A 1 47 GLU 47 46 46 GLU GLU X . n 
A 1 48 ILE 48 47 47 ILE ILE X . n 
A 1 49 LYS 49 48 48 LYS LYS X . n 
A 1 50 GLU 50 49 49 GLU GLU X . n 
A 1 51 GLN 51 50 50 GLN GLN X . n 
A 1 52 GLU 52 51 51 GLU GLU X . n 
A 1 53 VAL 53 52 52 VAL VAL X . n 
A 1 54 VAL 54 53 53 VAL VAL X . n 
A 1 55 ASP 55 54 54 ASP ASP X . n 
A 1 56 LYS 56 55 55 LYS LYS X . n 
A 1 57 VAL 57 56 56 VAL VAL X . n 
A 1 58 MET 58 57 57 MET MET X . n 
A 1 59 GLU 59 58 58 GLU GLU X . n 
A 1 60 THR 60 59 59 THR THR X . n 
A 1 61 LEU 61 60 60 LEU LEU X . n 
A 1 62 ASP 62 61 61 ASP ASP X . n 
A 1 63 SER 63 62 62 SER SER X . n 
A 1 64 ASP 64 63 63 ASP ASP X . n 
A 1 65 GLY 65 64 64 GLY GLY X . n 
A 1 66 ASP 66 65 65 ASP ASP X . n 
A 1 67 GLY 67 66 66 GLY GLY X . n 
A 1 68 GLU 68 67 67 GLU GLU X . n 
A 1 69 CYS 69 68 68 CYS CYS X . n 
A 1 70 ASP 70 69 69 ASP ASP X . n 
A 1 71 PHE 71 70 70 PHE PHE X . n 
A 1 72 GLN 72 71 71 GLN GLN X . n 
A 1 73 GLU 73 72 72 GLU GLU X . n 
A 1 74 PHE 74 73 73 PHE PHE X . n 
A 1 75 MET 75 74 74 MET MET X . n 
A 1 76 ALA 76 75 75 ALA ALA X . n 
A 1 77 PHE 77 76 76 PHE PHE X . n 
A 1 78 VAL 78 77 77 VAL VAL X . n 
A 1 79 ALA 79 78 78 ALA ALA X . n 
A 1 80 MET 80 79 79 MET MET X . n 
A 1 81 ILE 81 80 80 ILE ILE X . n 
A 1 82 THR 82 81 81 THR THR X . n 
A 1 83 THR 83 82 82 THR THR X . n 
A 1 84 ALA 84 83 83 ALA ALA X . n 
A 1 85 CYS 85 84 84 CYS CYS X . n 
A 1 86 HIS 86 85 85 HIS HIS X . n 
A 1 87 GLU 87 86 86 GLU GLU X . n 
A 1 88 PHE 88 87 87 PHE PHE X . n 
A 1 89 PHE 89 88 88 PHE PHE X . n 
A 1 90 GLU 90 89 89 GLU GLU X . n 
A 1 91 HIS 91 90 ?  ?   ?   X . n 
A 1 92 GLU 92 91 ?  ?   ?   X . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 PNT 1  101 101 PNT PNT X . 
C 2 PNT 1  102 101 PNT PNT X . 
D 3 CA  1  103 90  CA  CA  X . 
E 3 CA  1  104 91  CA  CA  X . 
F 4 HOH 1  105 1   HOH HOH X . 
F 4 HOH 2  106 2   HOH HOH X . 
F 4 HOH 3  107 3   HOH HOH X . 
F 4 HOH 4  108 4   HOH HOH X . 
F 4 HOH 5  109 5   HOH HOH X . 
F 4 HOH 6  110 6   HOH HOH X . 
F 4 HOH 7  111 7   HOH HOH X . 
F 4 HOH 8  112 8   HOH HOH X . 
F 4 HOH 9  113 9   HOH HOH X . 
F 4 HOH 10 114 10  HOH HOH X . 
F 4 HOH 11 115 11  HOH HOH X . 
F 4 HOH 12 116 12  HOH HOH X . 
F 4 HOH 13 117 13  HOH HOH X . 
F 4 HOH 14 118 14  HOH HOH X . 
F 4 HOH 15 119 15  HOH HOH X . 
F 4 HOH 16 120 16  HOH HOH X . 
F 4 HOH 17 121 17  HOH HOH X . 
F 4 HOH 18 122 18  HOH HOH X . 
F 4 HOH 19 123 19  HOH HOH X . 
F 4 HOH 20 124 20  HOH HOH X . 
F 4 HOH 21 125 21  HOH HOH X . 
F 4 HOH 22 126 22  HOH HOH X . 
F 4 HOH 23 127 23  HOH HOH X . 
F 4 HOH 24 128 24  HOH HOH X . 
F 4 HOH 25 129 25  HOH HOH X . 
F 4 HOH 26 130 26  HOH HOH X . 
F 4 HOH 27 131 27  HOH HOH X . 
F 4 HOH 28 132 28  HOH HOH X . 
F 4 HOH 29 133 29  HOH HOH X . 
F 4 HOH 30 134 30  HOH HOH X . 
F 4 HOH 31 135 31  HOH HOH X . 
F 4 HOH 32 136 32  HOH HOH X . 
F 4 HOH 33 137 33  HOH HOH X . 
F 4 HOH 34 138 34  HOH HOH X . 
F 4 HOH 35 139 35  HOH HOH X . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4190  ? 
1 MORE         -63.9 ? 
1 'SSA (A^2)'  10880 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z        1.0000000000 0.0000000000  0.0000000000 0.0000000000 0.0000000000  1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 8_555 -y,-x,-z+1/2 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 24.1240000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? A SER 19 ? X SER 18 ? 1_555 CA ? D CA . ? X CA 103 ? 1_555 O   ? A GLU 22 ? X GLU 21  ? 1_555 98.7  ? 
2  O   ? A SER 19 ? X SER 18 ? 1_555 CA ? D CA . ? X CA 103 ? 1_555 O   ? A ASP 24 ? X ASP 23  ? 1_555 85.1  ? 
3  O   ? A GLU 22 ? X GLU 21 ? 1_555 CA ? D CA . ? X CA 103 ? 1_555 O   ? A ASP 24 ? X ASP 23  ? 1_555 86.1  ? 
4  O   ? A SER 19 ? X SER 18 ? 1_555 CA ? D CA . ? X CA 103 ? 1_555 O   ? A LYS 27 ? X LYS 26  ? 1_555 88.6  ? 
5  O   ? A GLU 22 ? X GLU 21 ? 1_555 CA ? D CA . ? X CA 103 ? 1_555 O   ? A LYS 27 ? X LYS 26  ? 1_555 167.2 ? 
6  O   ? A ASP 24 ? X ASP 23 ? 1_555 CA ? D CA . ? X CA 103 ? 1_555 O   ? A LYS 27 ? X LYS 26  ? 1_555 84.1  ? 
7  O   ? A SER 19 ? X SER 18 ? 1_555 CA ? D CA . ? X CA 103 ? 1_555 OE1 ? A GLU 32 ? X GLU 31  ? 1_555 96.6  ? 
8  O   ? A GLU 22 ? X GLU 21 ? 1_555 CA ? D CA . ? X CA 103 ? 1_555 OE1 ? A GLU 32 ? X GLU 31  ? 1_555 115.3 ? 
9  O   ? A ASP 24 ? X ASP 23 ? 1_555 CA ? D CA . ? X CA 103 ? 1_555 OE1 ? A GLU 32 ? X GLU 31  ? 1_555 157.8 ? 
10 O   ? A LYS 27 ? X LYS 26 ? 1_555 CA ? D CA . ? X CA 103 ? 1_555 OE1 ? A GLU 32 ? X GLU 31  ? 1_555 73.9  ? 
11 O   ? A SER 19 ? X SER 18 ? 1_555 CA ? D CA . ? X CA 103 ? 1_555 OE2 ? A GLU 32 ? X GLU 31  ? 1_555 73.7  ? 
12 O   ? A GLU 22 ? X GLU 21 ? 1_555 CA ? D CA . ? X CA 103 ? 1_555 OE2 ? A GLU 32 ? X GLU 31  ? 1_555 74.5  ? 
13 O   ? A ASP 24 ? X ASP 23 ? 1_555 CA ? D CA . ? X CA 103 ? 1_555 OE2 ? A GLU 32 ? X GLU 31  ? 1_555 148.4 ? 
14 O   ? A LYS 27 ? X LYS 26 ? 1_555 CA ? D CA . ? X CA 103 ? 1_555 OE2 ? A GLU 32 ? X GLU 31  ? 1_555 117.9 ? 
15 OE1 ? A GLU 32 ? X GLU 31 ? 1_555 CA ? D CA . ? X CA 103 ? 1_555 OE2 ? A GLU 32 ? X GLU 31  ? 1_555 50.9  ? 
16 O   ? A SER 19 ? X SER 18 ? 1_555 CA ? D CA . ? X CA 103 ? 1_555 O   ? F HOH .  ? X HOH 105 ? 1_555 170.1 ? 
17 O   ? A GLU 22 ? X GLU 21 ? 1_555 CA ? D CA . ? X CA 103 ? 1_555 O   ? F HOH .  ? X HOH 105 ? 1_555 88.6  ? 
18 O   ? A ASP 24 ? X ASP 23 ? 1_555 CA ? D CA . ? X CA 103 ? 1_555 O   ? F HOH .  ? X HOH 105 ? 1_555 88.8  ? 
19 O   ? A LYS 27 ? X LYS 26 ? 1_555 CA ? D CA . ? X CA 103 ? 1_555 O   ? F HOH .  ? X HOH 105 ? 1_555 83.0  ? 
20 OE1 ? A GLU 32 ? X GLU 31 ? 1_555 CA ? D CA . ? X CA 103 ? 1_555 O   ? F HOH .  ? X HOH 105 ? 1_555 86.2  ? 
21 OE2 ? A GLU 32 ? X GLU 31 ? 1_555 CA ? D CA . ? X CA 103 ? 1_555 O   ? F HOH .  ? X HOH 105 ? 1_555 115.0 ? 
22 OD1 ? A ASP 62 ? X ASP 61 ? 1_555 CA ? E CA . ? X CA 104 ? 1_555 OD1 ? A ASP 64 ? X ASP 63  ? 1_555 81.8  ? 
23 OD1 ? A ASP 62 ? X ASP 61 ? 1_555 CA ? E CA . ? X CA 104 ? 1_555 OD1 ? A ASP 66 ? X ASP 65  ? 1_555 85.0  ? 
24 OD1 ? A ASP 64 ? X ASP 63 ? 1_555 CA ? E CA . ? X CA 104 ? 1_555 OD1 ? A ASP 66 ? X ASP 65  ? 1_555 81.4  ? 
25 OD1 ? A ASP 62 ? X ASP 61 ? 1_555 CA ? E CA . ? X CA 104 ? 1_555 O   ? A GLU 68 ? X GLU 67  ? 1_555 87.7  ? 
26 OD1 ? A ASP 64 ? X ASP 63 ? 1_555 CA ? E CA . ? X CA 104 ? 1_555 O   ? A GLU 68 ? X GLU 67  ? 1_555 160.2 ? 
27 OD1 ? A ASP 66 ? X ASP 65 ? 1_555 CA ? E CA . ? X CA 104 ? 1_555 O   ? A GLU 68 ? X GLU 67  ? 1_555 80.9  ? 
28 OD1 ? A ASP 62 ? X ASP 61 ? 1_555 CA ? E CA . ? X CA 104 ? 1_555 OE1 ? A GLU 73 ? X GLU 72  ? 1_555 116.1 ? 
29 OD1 ? A ASP 64 ? X ASP 63 ? 1_555 CA ? E CA . ? X CA 104 ? 1_555 OE1 ? A GLU 73 ? X GLU 72  ? 1_555 124.1 ? 
30 OD1 ? A ASP 66 ? X ASP 65 ? 1_555 CA ? E CA . ? X CA 104 ? 1_555 OE1 ? A GLU 73 ? X GLU 72  ? 1_555 147.3 ? 
31 O   ? A GLU 68 ? X GLU 67 ? 1_555 CA ? E CA . ? X CA 104 ? 1_555 OE1 ? A GLU 73 ? X GLU 72  ? 1_555 75.6  ? 
32 OD1 ? A ASP 62 ? X ASP 61 ? 1_555 CA ? E CA . ? X CA 104 ? 1_555 OE2 ? A GLU 73 ? X GLU 72  ? 1_555 89.1  ? 
33 OD1 ? A ASP 64 ? X ASP 63 ? 1_555 CA ? E CA . ? X CA 104 ? 1_555 OE2 ? A GLU 73 ? X GLU 72  ? 1_555 79.5  ? 
34 OD1 ? A ASP 66 ? X ASP 65 ? 1_555 CA ? E CA . ? X CA 104 ? 1_555 OE2 ? A GLU 73 ? X GLU 72  ? 1_555 160.7 ? 
35 O   ? A GLU 68 ? X GLU 67 ? 1_555 CA ? E CA . ? X CA 104 ? 1_555 OE2 ? A GLU 73 ? X GLU 72  ? 1_555 117.3 ? 
36 OE1 ? A GLU 73 ? X GLU 72 ? 1_555 CA ? E CA . ? X CA 104 ? 1_555 OE2 ? A GLU 73 ? X GLU 72  ? 1_555 50.8  ? 
37 OD1 ? A ASP 62 ? X ASP 61 ? 1_555 CA ? E CA . ? X CA 104 ? 1_555 O   ? F HOH .  ? X HOH 112 ? 1_555 160.8 ? 
38 OD1 ? A ASP 64 ? X ASP 63 ? 1_555 CA ? E CA . ? X CA 104 ? 1_555 O   ? F HOH .  ? X HOH 112 ? 1_555 89.9  ? 
39 OD1 ? A ASP 66 ? X ASP 65 ? 1_555 CA ? E CA . ? X CA 104 ? 1_555 O   ? F HOH .  ? X HOH 112 ? 1_555 76.6  ? 
40 O   ? A GLU 68 ? X GLU 67 ? 1_555 CA ? E CA . ? X CA 104 ? 1_555 O   ? F HOH .  ? X HOH 112 ? 1_555 94.7  ? 
41 OE1 ? A GLU 73 ? X GLU 72 ? 1_555 CA ? E CA . ? X CA 104 ? 1_555 O   ? F HOH .  ? X HOH 112 ? 1_555 82.9  ? 
42 OE2 ? A GLU 73 ? X GLU 72 ? 1_555 CA ? E CA . ? X CA 104 ? 1_555 O   ? F HOH .  ? X HOH 112 ? 1_555 106.5 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-08-05 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-10-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
3 3 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         13.8196 
_pdbx_refine_tls.origin_y         1.0811 
_pdbx_refine_tls.origin_z         9.9934 
_pdbx_refine_tls.T[1][1]          -0.0758 
_pdbx_refine_tls.T[2][2]          -0.1203 
_pdbx_refine_tls.T[3][3]          -0.0789 
_pdbx_refine_tls.T[1][2]          0.0231 
_pdbx_refine_tls.T[1][3]          -0.0427 
_pdbx_refine_tls.T[2][3]          0.0641 
_pdbx_refine_tls.L[1][1]          4.7768 
_pdbx_refine_tls.L[2][2]          3.3515 
_pdbx_refine_tls.L[3][3]          2.7285 
_pdbx_refine_tls.L[1][2]          0.3722 
_pdbx_refine_tls.L[1][3]          -1.6573 
_pdbx_refine_tls.L[2][3]          -0.6051 
_pdbx_refine_tls.S[1][1]          0.0054 
_pdbx_refine_tls.S[1][2]          -0.0311 
_pdbx_refine_tls.S[1][3]          0.2702 
_pdbx_refine_tls.S[2][1]          0.3327 
_pdbx_refine_tls.S[2][2]          -0.1041 
_pdbx_refine_tls.S[2][3]          -0.3580 
_pdbx_refine_tls.S[3][1]          -0.2390 
_pdbx_refine_tls.S[3][2]          0.1208 
_pdbx_refine_tls.S[3][3]          0.0987 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 X 0   A 1 X 89  A 90 ? 'X-RAY DIFFRACTION' ? 
2 1 X 101 B . X 101 B .  ? 'X-RAY DIFFRACTION' ? 
3 1 X 105 F . X 139 F .  ? 'X-RAY DIFFRACTION' ? 
4 1 X 102 C . X 102 C .  ? 'X-RAY DIFFRACTION' ? 
# 
_pdbx_phasing_MR.entry_id                     3CR4 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                ? 
_pdbx_phasing_MR.R_factor                     ? 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          2.530 
_pdbx_phasing_MR.d_res_low_rotation           38.440 
_pdbx_phasing_MR.d_res_high_translation       2.530 
_pdbx_phasing_MR.d_res_low_translation        38.440 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
_phasing.method   MR 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
DENZO        .     ?                    package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu    'data reduction'  
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 1 
SCALEPACK    .     ?                    package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu    'data scaling'    
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 2 
MOLREP       .     ?                    other   'A. Vagin'           alexei@ysbl.york.ac.uk   phasing           
http://www.ccp4.ac.uk/dist/html/molrep.html      Fortran_77 ? 3 
REFMAC       .     ?                    program 'Murshudov, G.N.'    ccp4@dl.ac.uk            refinement        
http://www.ccp4.ac.uk/main.html                  Fortran_77 ? 4 
PDB_EXTRACT  3.005 'September 10, 2007' package PDB                  sw-help@rcsb.rutgers.edu 'data extraction' 
http://pdb.rutgers.edu/software/                 C++        ? 5 
CrystalClear .     ?                    ?       ?                    ?                        'data collection' ? ?          ? 6 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 X HIS 90 ? A HIS 91 
2 1 Y 1 X GLU 91 ? A GLU 92 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '1,5-BIS(4-AMIDINOPHENOXY)PENTANE' PNT 
3 'CALCIUM ION'                      CA  
4 water                              HOH 
#