data_3CRX
# 
_entry.id   3CRX 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   3CRX         pdb_00003crx 10.2210/pdb3crx/pdb 
RCSB  PD0104       ?            ?                   
WWPDB D_1000178924 ?            ?                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3CRX 
_pdbx_database_status.recvd_initial_deposition_date   1998-06-19 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    NDB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gopaul, D.N.'   1 
'Guo, F.'        2 
'Vanduyne, G.D.' 3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structure of the Holliday junction intermediate in Cre-loxP site-specific recombination.' 'EMBO J.' 17  4175 4187 1998 
EMJODG UK 0261-4189 0897 ? 9670032 10.1093/emboj/17.14.4175 
1       'Structure of Cre Recombinase Complexed with DNA in a Site-Specific Recombination Synapse' Nature    389 40   46   1997 
NATUAS UK 0028-0836 0006 ? ?       ?                        
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Gopaul, D.N.'    1 ? 
primary 'Guo, F.'         2 ? 
primary 'Van Duyne, G.D.' 3 ? 
1       'Guo, F.'         4 ? 
1       'Gopaul, D.N.'    5 ? 
1       'Van Duyne, G.D.' 6 ? 
# 
_cell.entry_id           3CRX 
_cell.length_a           106.300 
_cell.length_b           122.700 
_cell.length_c           179.500 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         3CRX 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     orthorhombic 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn 'DNA 35-MER'      10758.980 1   ? ?     ? ? 
2 polymer syn 'DNA 35-MER'      10718.956 1   ? ?     ? ? 
3 polymer syn 'DNA 35-MER'      10758.980 1   ? ?     ? ? 
4 polymer syn 'DNA 35-MER'      10799.004 1   ? ?     ? ? 
5 polymer man 'CRE RECOMBINASE' 38567.152 2   ? R173K ? ? 
6 water   nat water             18.015    236 ? ?     ? ? 
# 
_entity_name_com.entity_id   5 
_entity_name_com.name        'CRE-HJ1, RGBPP1 RECOMBINASE' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no 
;(DT)(DA)(DT)(DA)(DA)(DG)(DT)(DT)(DC)(DG)(DT)(DA)(DT)(DA)(DG)(DC)(DA)(DT)(DA)(DC)
(DA)(DT)(DT)(DA)(DT)(DA)(DC)(DG)(DA)(DA)(DT)(DT)(DT)(DA)(DT)
;
TATAAGTTCGTATAGCATACATTATACGAATTTAT C   ? 
2 polydeoxyribonucleotide no no 
;(DT)(DA)(DT)(DA)(DA)(DT)(DT)(DT)(DC)(DG)(DT)(DA)(DT)(DA)(DT)(DA)(DC)(DA)(DA)(DT)
(DG)(DC)(DT)(DA)(DT)(DA)(DC)(DG)(DA)(DA)(DC)(DT)(DT)(DA)(DT)
;
TATAATTTCGTATATACAATGCTATACGAACTTAT D   ? 
3 polydeoxyribonucleotide no no 
;(DT)(DA)(DT)(DA)(DA)(DC)(DT)(DT)(DC)(DG)(DT)(DA)(DT)(DA)(DC)(DG)(DT)(DA)(DT)(DG)
(DT)(DA)(DT)(DA)(DT)(DA)(DC)(DG)(DA)(DA)(DA)(DT)(DT)(DA)(DT)
;
TATAACTTCGTATACGTATGTATATACGAAATTAT E   ? 
4 polydeoxyribonucleotide no no 
;(DT)(DA)(DT)(DA)(DA)(DA)(DT)(DT)(DC)(DG)(DT)(DA)(DT)(DA)(DA)(DT)(DG)(DT)(DT)(DA)
(DC)(DG)(DT)(DA)(DT)(DA)(DC)(DG)(DA)(DA)(DG)(DT)(DT)(DA)(DT)
;
TATAAATTCGTATAATGTTACGTATACGAAGTTAT F   ? 
5 'polypeptide(L)'        no no 
;MSNLLTVHQNLPALPVDATSDEVRKNLMDMFRDRQAFSEHTWKMLLSVCRSWAAWCKLNNRKWFPAEPEDVRDYLLYLQA
RGLAVKTIQQHLGQLNMLHRRSGLPRPSDSNAVSLVMRRIRKENVDAGERAKQALAFERTDFDQVRSLMENSDRCQDIRN
LAFLGIAYNTLLKIAEIARIRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALSLGVTKLVERWISVSGVADDPNNYLFC
RVRKNGVAAPSATSQLSTRALEGIFEATHRLIYGAKDDSGQRYLAWSGHSARVGAARDMARAGVSIPEIMQAGGWTNVNI
VMNYIRNLDSETGAMVRLLEDGD
;
;MSNLLTVHQNLPALPVDATSDEVRKNLMDMFRDRQAFSEHTWKMLLSVCRSWAAWCKLNNRKWFPAEPEDVRDYLLYLQA
RGLAVKTIQQHLGQLNMLHRRSGLPRPSDSNAVSLVMRRIRKENVDAGERAKQALAFERTDFDQVRSLMENSDRCQDIRN
LAFLGIAYNTLLKIAEIARIRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALSLGVTKLVERWISVSGVADDPNNYLFC
RVRKNGVAAPSATSQLSTRALEGIFEATHRLIYGAKDDSGQRYLAWSGHSARVGAARDMARAGVSIPEIMQAGGWTNVNI
VMNYIRNLDSETGAMVRLLEDGD
;
A,B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DT  n 
1 2   DA  n 
1 3   DT  n 
1 4   DA  n 
1 5   DA  n 
1 6   DG  n 
1 7   DT  n 
1 8   DT  n 
1 9   DC  n 
1 10  DG  n 
1 11  DT  n 
1 12  DA  n 
1 13  DT  n 
1 14  DA  n 
1 15  DG  n 
1 16  DC  n 
1 17  DA  n 
1 18  DT  n 
1 19  DA  n 
1 20  DC  n 
1 21  DA  n 
1 22  DT  n 
1 23  DT  n 
1 24  DA  n 
1 25  DT  n 
1 26  DA  n 
1 27  DC  n 
1 28  DG  n 
1 29  DA  n 
1 30  DA  n 
1 31  DT  n 
1 32  DT  n 
1 33  DT  n 
1 34  DA  n 
1 35  DT  n 
2 1   DT  n 
2 2   DA  n 
2 3   DT  n 
2 4   DA  n 
2 5   DA  n 
2 6   DT  n 
2 7   DT  n 
2 8   DT  n 
2 9   DC  n 
2 10  DG  n 
2 11  DT  n 
2 12  DA  n 
2 13  DT  n 
2 14  DA  n 
2 15  DT  n 
2 16  DA  n 
2 17  DC  n 
2 18  DA  n 
2 19  DA  n 
2 20  DT  n 
2 21  DG  n 
2 22  DC  n 
2 23  DT  n 
2 24  DA  n 
2 25  DT  n 
2 26  DA  n 
2 27  DC  n 
2 28  DG  n 
2 29  DA  n 
2 30  DA  n 
2 31  DC  n 
2 32  DT  n 
2 33  DT  n 
2 34  DA  n 
2 35  DT  n 
3 1   DT  n 
3 2   DA  n 
3 3   DT  n 
3 4   DA  n 
3 5   DA  n 
3 6   DC  n 
3 7   DT  n 
3 8   DT  n 
3 9   DC  n 
3 10  DG  n 
3 11  DT  n 
3 12  DA  n 
3 13  DT  n 
3 14  DA  n 
3 15  DC  n 
3 16  DG  n 
3 17  DT  n 
3 18  DA  n 
3 19  DT  n 
3 20  DG  n 
3 21  DT  n 
3 22  DA  n 
3 23  DT  n 
3 24  DA  n 
3 25  DT  n 
3 26  DA  n 
3 27  DC  n 
3 28  DG  n 
3 29  DA  n 
3 30  DA  n 
3 31  DA  n 
3 32  DT  n 
3 33  DT  n 
3 34  DA  n 
3 35  DT  n 
4 1   DT  n 
4 2   DA  n 
4 3   DT  n 
4 4   DA  n 
4 5   DA  n 
4 6   DA  n 
4 7   DT  n 
4 8   DT  n 
4 9   DC  n 
4 10  DG  n 
4 11  DT  n 
4 12  DA  n 
4 13  DT  n 
4 14  DA  n 
4 15  DA  n 
4 16  DT  n 
4 17  DG  n 
4 18  DT  n 
4 19  DT  n 
4 20  DA  n 
4 21  DC  n 
4 22  DG  n 
4 23  DT  n 
4 24  DA  n 
4 25  DT  n 
4 26  DA  n 
4 27  DC  n 
4 28  DG  n 
4 29  DA  n 
4 30  DA  n 
4 31  DG  n 
4 32  DT  n 
4 33  DT  n 
4 34  DA  n 
4 35  DT  n 
5 1   MET n 
5 2   SER n 
5 3   ASN n 
5 4   LEU n 
5 5   LEU n 
5 6   THR n 
5 7   VAL n 
5 8   HIS n 
5 9   GLN n 
5 10  ASN n 
5 11  LEU n 
5 12  PRO n 
5 13  ALA n 
5 14  LEU n 
5 15  PRO n 
5 16  VAL n 
5 17  ASP n 
5 18  ALA n 
5 19  THR n 
5 20  SER n 
5 21  ASP n 
5 22  GLU n 
5 23  VAL n 
5 24  ARG n 
5 25  LYS n 
5 26  ASN n 
5 27  LEU n 
5 28  MET n 
5 29  ASP n 
5 30  MET n 
5 31  PHE n 
5 32  ARG n 
5 33  ASP n 
5 34  ARG n 
5 35  GLN n 
5 36  ALA n 
5 37  PHE n 
5 38  SER n 
5 39  GLU n 
5 40  HIS n 
5 41  THR n 
5 42  TRP n 
5 43  LYS n 
5 44  MET n 
5 45  LEU n 
5 46  LEU n 
5 47  SER n 
5 48  VAL n 
5 49  CYS n 
5 50  ARG n 
5 51  SER n 
5 52  TRP n 
5 53  ALA n 
5 54  ALA n 
5 55  TRP n 
5 56  CYS n 
5 57  LYS n 
5 58  LEU n 
5 59  ASN n 
5 60  ASN n 
5 61  ARG n 
5 62  LYS n 
5 63  TRP n 
5 64  PHE n 
5 65  PRO n 
5 66  ALA n 
5 67  GLU n 
5 68  PRO n 
5 69  GLU n 
5 70  ASP n 
5 71  VAL n 
5 72  ARG n 
5 73  ASP n 
5 74  TYR n 
5 75  LEU n 
5 76  LEU n 
5 77  TYR n 
5 78  LEU n 
5 79  GLN n 
5 80  ALA n 
5 81  ARG n 
5 82  GLY n 
5 83  LEU n 
5 84  ALA n 
5 85  VAL n 
5 86  LYS n 
5 87  THR n 
5 88  ILE n 
5 89  GLN n 
5 90  GLN n 
5 91  HIS n 
5 92  LEU n 
5 93  GLY n 
5 94  GLN n 
5 95  LEU n 
5 96  ASN n 
5 97  MET n 
5 98  LEU n 
5 99  HIS n 
5 100 ARG n 
5 101 ARG n 
5 102 SER n 
5 103 GLY n 
5 104 LEU n 
5 105 PRO n 
5 106 ARG n 
5 107 PRO n 
5 108 SER n 
5 109 ASP n 
5 110 SER n 
5 111 ASN n 
5 112 ALA n 
5 113 VAL n 
5 114 SER n 
5 115 LEU n 
5 116 VAL n 
5 117 MET n 
5 118 ARG n 
5 119 ARG n 
5 120 ILE n 
5 121 ARG n 
5 122 LYS n 
5 123 GLU n 
5 124 ASN n 
5 125 VAL n 
5 126 ASP n 
5 127 ALA n 
5 128 GLY n 
5 129 GLU n 
5 130 ARG n 
5 131 ALA n 
5 132 LYS n 
5 133 GLN n 
5 134 ALA n 
5 135 LEU n 
5 136 ALA n 
5 137 PHE n 
5 138 GLU n 
5 139 ARG n 
5 140 THR n 
5 141 ASP n 
5 142 PHE n 
5 143 ASP n 
5 144 GLN n 
5 145 VAL n 
5 146 ARG n 
5 147 SER n 
5 148 LEU n 
5 149 MET n 
5 150 GLU n 
5 151 ASN n 
5 152 SER n 
5 153 ASP n 
5 154 ARG n 
5 155 CYS n 
5 156 GLN n 
5 157 ASP n 
5 158 ILE n 
5 159 ARG n 
5 160 ASN n 
5 161 LEU n 
5 162 ALA n 
5 163 PHE n 
5 164 LEU n 
5 165 GLY n 
5 166 ILE n 
5 167 ALA n 
5 168 TYR n 
5 169 ASN n 
5 170 THR n 
5 171 LEU n 
5 172 LEU n 
5 173 LYS n 
5 174 ILE n 
5 175 ALA n 
5 176 GLU n 
5 177 ILE n 
5 178 ALA n 
5 179 ARG n 
5 180 ILE n 
5 181 ARG n 
5 182 VAL n 
5 183 LYS n 
5 184 ASP n 
5 185 ILE n 
5 186 SER n 
5 187 ARG n 
5 188 THR n 
5 189 ASP n 
5 190 GLY n 
5 191 GLY n 
5 192 ARG n 
5 193 MET n 
5 194 LEU n 
5 195 ILE n 
5 196 HIS n 
5 197 ILE n 
5 198 GLY n 
5 199 ARG n 
5 200 THR n 
5 201 LYS n 
5 202 THR n 
5 203 LEU n 
5 204 VAL n 
5 205 SER n 
5 206 THR n 
5 207 ALA n 
5 208 GLY n 
5 209 VAL n 
5 210 GLU n 
5 211 LYS n 
5 212 ALA n 
5 213 LEU n 
5 214 SER n 
5 215 LEU n 
5 216 GLY n 
5 217 VAL n 
5 218 THR n 
5 219 LYS n 
5 220 LEU n 
5 221 VAL n 
5 222 GLU n 
5 223 ARG n 
5 224 TRP n 
5 225 ILE n 
5 226 SER n 
5 227 VAL n 
5 228 SER n 
5 229 GLY n 
5 230 VAL n 
5 231 ALA n 
5 232 ASP n 
5 233 ASP n 
5 234 PRO n 
5 235 ASN n 
5 236 ASN n 
5 237 TYR n 
5 238 LEU n 
5 239 PHE n 
5 240 CYS n 
5 241 ARG n 
5 242 VAL n 
5 243 ARG n 
5 244 LYS n 
5 245 ASN n 
5 246 GLY n 
5 247 VAL n 
5 248 ALA n 
5 249 ALA n 
5 250 PRO n 
5 251 SER n 
5 252 ALA n 
5 253 THR n 
5 254 SER n 
5 255 GLN n 
5 256 LEU n 
5 257 SER n 
5 258 THR n 
5 259 ARG n 
5 260 ALA n 
5 261 LEU n 
5 262 GLU n 
5 263 GLY n 
5 264 ILE n 
5 265 PHE n 
5 266 GLU n 
5 267 ALA n 
5 268 THR n 
5 269 HIS n 
5 270 ARG n 
5 271 LEU n 
5 272 ILE n 
5 273 TYR n 
5 274 GLY n 
5 275 ALA n 
5 276 LYS n 
5 277 ASP n 
5 278 ASP n 
5 279 SER n 
5 280 GLY n 
5 281 GLN n 
5 282 ARG n 
5 283 TYR n 
5 284 LEU n 
5 285 ALA n 
5 286 TRP n 
5 287 SER n 
5 288 GLY n 
5 289 HIS n 
5 290 SER n 
5 291 ALA n 
5 292 ARG n 
5 293 VAL n 
5 294 GLY n 
5 295 ALA n 
5 296 ALA n 
5 297 ARG n 
5 298 ASP n 
5 299 MET n 
5 300 ALA n 
5 301 ARG n 
5 302 ALA n 
5 303 GLY n 
5 304 VAL n 
5 305 SER n 
5 306 ILE n 
5 307 PRO n 
5 308 GLU n 
5 309 ILE n 
5 310 MET n 
5 311 GLN n 
5 312 ALA n 
5 313 GLY n 
5 314 GLY n 
5 315 TRP n 
5 316 THR n 
5 317 ASN n 
5 318 VAL n 
5 319 ASN n 
5 320 ILE n 
5 321 VAL n 
5 322 MET n 
5 323 ASN n 
5 324 TYR n 
5 325 ILE n 
5 326 ARG n 
5 327 ASN n 
5 328 LEU n 
5 329 ASP n 
5 330 SER n 
5 331 GLU n 
5 332 THR n 
5 333 GLY n 
5 334 ALA n 
5 335 MET n 
5 336 VAL n 
5 337 ARG n 
5 338 LEU n 
5 339 LEU n 
5 340 GLU n 
5 341 ASP n 
5 342 GLY n 
5 343 ASP n 
# 
_entity_src_gen.entity_id                          5 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     'P1-like viruses' 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Enterobacteria phage P1' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10678 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 25404-B1 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET21A 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP RECR_BPP1 5 ? ? P06956 ? 
2 PDB 3CRX      1 ? ? 3CRX   ? 
3 PDB 3CRX      2 ? ? 3CRX   ? 
4 PDB 3CRX      3 ? ? 3CRX   ? 
5 PDB 3CRX      4 ? ? 3CRX   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3CRX A 1 ? 343 ? P06956 1 ? 343 ? 1 343 
2 1 3CRX B 1 ? 343 ? P06956 1 ? 343 ? 1 343 
3 2 3CRX C 1 ? 35  ? 3CRX   1 ? 35  ? 1 35  
4 3 3CRX D 1 ? 35  ? 3CRX   1 ? 35  ? 1 35  
5 4 3CRX E 1 ? 35  ? 3CRX   1 ? 35  ? 1 35  
6 5 3CRX F 1 ? 35  ? 3CRX   1 ? 35  ? 1 35  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3CRX LYS A 173 ? UNP P06956 ARG 173 'engineered mutation' 173 1 
2 3CRX LYS B 173 ? UNP P06956 ARG 173 'engineered mutation' 173 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          3CRX 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.41 
_exptl_crystal.density_percent_sol   50 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.0 
_exptl_crystal_grow.pdbx_details    '50MM ACETATE PH 5.0, 26% MPD, 80MM MGCL2' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1997-05-15 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    SI 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.90 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             0.90 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     3CRX 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             48.0 
_reflns.d_resolution_high            2.7 
_reflns.number_obs                   38807 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.0 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.0720000 
_reflns.pdbx_netI_over_sigmaI        20 
_reflns.B_iso_Wilson_estimate        65.5 
_reflns.pdbx_redundancy              4.7 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.70 
_reflns_shell.d_res_low              2.78 
_reflns_shell.percent_possible_all   93.2 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.3290000 
_reflns_shell.meanI_over_sigI_obs    5 
_reflns_shell.pdbx_redundancy        4.4 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3CRX 
_refine.ls_number_reflns_obs                     36470 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               1000000 
_refine.pdbx_data_cutoff_low_absF                0.001 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             27.3 
_refine.ls_d_res_high                            2.5 
_refine.ls_percent_reflns_obs                    94.4 
_refine.ls_R_factor_obs                          0.1980000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1980000 
_refine.ls_R_factor_R_free                       0.2680000 
_refine.ls_R_factor_R_free_error                 0.017 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1940 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               58.2 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1CRX 
_refine.pdbx_method_to_determine_struct          'DIFFERENCE FOURIER' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4873 
_refine_hist.pdbx_number_atoms_nucleic_acid   1405 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             361 
_refine_hist.number_atoms_total               6639 
_refine_hist.d_res_high                       2.5 
_refine_hist.d_res_low                        27.3 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.007 ?   ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.3   ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      23.1  ?   ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      0.95  ?   ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             4.4   1.5 ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            6.5   2.0 ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             6.6   2.0 ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            9.0   2.5 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       2.5 
_refine_ls_shell.d_res_low                        2.61 
_refine_ls_shell.number_reflns_R_work             3426 
_refine_ls_shell.R_factor_R_work                  0.3440000 
_refine_ls_shell.percent_reflns_obs               74.9 
_refine_ls_shell.R_factor_R_free                  0.3890000 
_refine_ls_shell.R_factor_R_free_error            0.017 
_refine_ls_shell.percent_reflns_R_free            5.0 
_refine_ls_shell.number_reflns_R_free             188 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
2 DNA-RNA_REP.PARAM DNA-RNA.TOP  'X-RAY DIFFRACTION' 
3 PARAM19.SOL       ?            'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3CRX 
_struct.title                     'CRE RECOMBINASE/DNA COMPLEX INTERMEDIATE I' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3CRX 
_struct_keywords.pdbx_keywords   'HYDROLASE, LIGASE/DNA' 
_struct_keywords.text            
'CRE RECOMBINASE, HOLLIDAY JUNCTION, RECOMBINATION, RECOMBINASE-DNA COMPLEX, HYDROLASE, LIGASE-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 6 ? 
H N N 6 ? 
I N N 6 ? 
J N N 6 ? 
K N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER E 20  ? ARG E 32  ? SER A 20  ARG A 32  1 ? 13 
HELX_P HELX_P2  2  ARG E 34  ? ALA E 36  ? ARG A 34  ALA A 36  5 ? 3  
HELX_P HELX_P3  3  GLU E 39  ? ASN E 59  ? GLU A 39  ASN A 59  1 ? 21 
HELX_P HELX_P4  4  PRO E 68  ? ALA E 80  ? PRO A 68  ALA A 80  1 ? 13 
HELX_P HELX_P5  5  VAL E 85  ? SER E 102 ? VAL A 85  SER A 102 1 ? 18 
HELX_P HELX_P6  6  PRO E 107 ? ASP E 109 ? PRO A 107 ASP A 109 5 ? 3  
HELX_P HELX_P7  7  ASN E 111 ? ASP E 126 ? ASN A 111 ASP A 126 1 ? 16 
HELX_P HELX_P8  8  ARG E 139 ? LEU E 148 ? ARG A 139 LEU A 148 1 ? 10 
HELX_P HELX_P9  9  CYS E 155 ? THR E 170 ? CYS A 155 THR A 170 1 ? 16 
HELX_P HELX_P10 10 ILE E 174 ? ARG E 179 ? ILE A 174 ARG A 179 1 ? 6  
HELX_P HELX_P11 11 LEU E 215 ? SER E 228 ? LEU A 215 SER A 228 1 ? 14 
HELX_P HELX_P12 12 VAL E 230 ? ASP E 232 ? VAL A 230 ASP A 232 5 ? 3  
HELX_P HELX_P13 13 THR E 258 ? TYR E 273 ? THR A 258 TYR A 273 1 ? 16 
HELX_P HELX_P14 14 SER E 290 ? ARG E 301 ? SER A 290 ARG A 301 1 ? 12 
HELX_P HELX_P15 15 ILE E 306 ? ALA E 312 ? ILE A 306 ALA A 312 1 ? 7  
HELX_P HELX_P16 16 VAL E 318 ? TYR E 324 ? VAL A 318 TYR A 324 1 ? 7  
HELX_P HELX_P17 17 ALA E 334 ? LEU E 339 ? ALA A 334 LEU A 339 1 ? 6  
HELX_P HELX_P18 18 GLU F 22  ? ARG F 32  ? GLU B 22  ARG B 32  1 ? 11 
HELX_P HELX_P19 19 ARG F 34  ? ALA F 36  ? ARG B 34  ALA B 36  5 ? 3  
HELX_P HELX_P20 20 GLU F 39  ? ASN F 59  ? GLU B 39  ASN B 59  1 ? 21 
HELX_P HELX_P21 21 PRO F 68  ? ARG F 81  ? PRO B 68  ARG B 81  1 ? 14 
HELX_P HELX_P22 22 VAL F 85  ? ARG F 100 ? VAL B 85  ARG B 100 1 ? 16 
HELX_P HELX_P23 23 PRO F 107 ? ASP F 109 ? PRO B 107 ASP B 109 5 ? 3  
HELX_P HELX_P24 24 ASN F 111 ? ASP F 126 ? ASN B 111 ASP B 126 1 ? 16 
HELX_P HELX_P25 25 ARG F 139 ? MET F 149 ? ARG B 139 MET B 149 1 ? 11 
HELX_P HELX_P26 26 CYS F 155 ? THR F 170 ? CYS B 155 THR B 170 1 ? 16 
HELX_P HELX_P27 27 ILE F 174 ? ILE F 177 ? ILE B 174 ILE B 177 1 ? 4  
HELX_P HELX_P28 28 VAL F 182 ? ASP F 184 ? VAL B 182 ASP B 184 5 ? 3  
HELX_P HELX_P29 29 LEU F 215 ? SER F 228 ? LEU B 215 SER B 228 1 ? 14 
HELX_P HELX_P30 30 VAL F 230 ? ASP F 232 ? VAL B 230 ASP B 232 5 ? 3  
HELX_P HELX_P31 31 THR F 258 ? TYR F 273 ? THR B 258 TYR B 273 1 ? 16 
HELX_P HELX_P32 32 SER F 290 ? ALA F 302 ? SER B 290 ALA B 302 1 ? 13 
HELX_P HELX_P33 33 ILE F 306 ? GLY F 313 ? ILE B 306 GLY B 313 1 ? 8  
HELX_P HELX_P34 34 ASN F 319 ? ILE F 325 ? ASN B 319 ILE B 325 1 ? 7  
HELX_P HELX_P35 35 ALA F 334 ? LEU F 339 ? ALA B 334 LEU B 339 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
hydrog1   hydrog ? ? A DA 2  N1 ? ? ? 1_555 B DT 35 N3 ? ? C DA 2  D DT 35 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog2   hydrog ? ? A DA 2  N6 ? ? ? 1_555 B DT 35 O4 ? ? C DA 2  D DT 35 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog3   hydrog ? ? A DT 3  N3 ? ? ? 1_555 B DA 34 N1 ? ? C DT 3  D DA 34 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog4   hydrog ? ? A DT 3  O4 ? ? ? 1_555 B DA 34 N6 ? ? C DT 3  D DA 34 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog5   hydrog ? ? A DA 4  N1 ? ? ? 1_555 B DT 33 N3 ? ? C DA 4  D DT 33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog6   hydrog ? ? A DA 4  N6 ? ? ? 1_555 B DT 33 O4 ? ? C DA 4  D DT 33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog7   hydrog ? ? A DA 5  N1 ? ? ? 1_555 B DT 32 N3 ? ? C DA 5  D DT 32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog8   hydrog ? ? A DA 5  N6 ? ? ? 1_555 B DT 32 O4 ? ? C DA 5  D DT 32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog9   hydrog ? ? A DG 6  N1 ? ? ? 1_555 B DC 31 N3 ? ? C DG 6  D DC 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog10  hydrog ? ? A DG 6  N2 ? ? ? 1_555 B DC 31 O2 ? ? C DG 6  D DC 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog11  hydrog ? ? A DG 6  O6 ? ? ? 1_555 B DC 31 N4 ? ? C DG 6  D DC 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog12  hydrog ? ? A DT 7  N3 ? ? ? 1_555 B DA 30 N1 ? ? C DT 7  D DA 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog13  hydrog ? ? A DT 7  O4 ? ? ? 1_555 B DA 30 N6 ? ? C DT 7  D DA 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog14  hydrog ? ? A DT 8  N3 ? ? ? 1_555 B DA 29 N1 ? ? C DT 8  D DA 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog15  hydrog ? ? A DT 8  O4 ? ? ? 1_555 B DA 29 N6 ? ? C DT 8  D DA 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog16  hydrog ? ? A DC 9  N3 ? ? ? 1_555 B DG 28 N1 ? ? C DC 9  D DG 28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog17  hydrog ? ? A DC 9  N4 ? ? ? 1_555 B DG 28 O6 ? ? C DC 9  D DG 28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog18  hydrog ? ? A DC 9  O2 ? ? ? 1_555 B DG 28 N2 ? ? C DC 9  D DG 28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog19  hydrog ? ? A DG 10 N1 ? ? ? 1_555 B DC 27 N3 ? ? C DG 10 D DC 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog20  hydrog ? ? A DG 10 N2 ? ? ? 1_555 B DC 27 O2 ? ? C DG 10 D DC 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog21  hydrog ? ? A DG 10 O6 ? ? ? 1_555 B DC 27 N4 ? ? C DG 10 D DC 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog22  hydrog ? ? A DT 11 N3 ? ? ? 1_555 B DA 26 N1 ? ? C DT 11 D DA 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog23  hydrog ? ? A DT 11 O4 ? ? ? 1_555 B DA 26 N6 ? ? C DT 11 D DA 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog24  hydrog ? ? A DA 12 N1 ? ? ? 1_555 B DT 25 N3 ? ? C DA 12 D DT 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog25  hydrog ? ? A DA 12 N6 ? ? ? 1_555 B DT 25 O4 ? ? C DA 12 D DT 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog26  hydrog ? ? A DT 13 N3 ? ? ? 1_555 B DA 24 N1 ? ? C DT 13 D DA 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog27  hydrog ? ? A DT 13 O4 ? ? ? 1_555 B DA 24 N6 ? ? C DT 13 D DA 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog28  hydrog ? ? A DA 14 N1 ? ? ? 1_555 B DT 23 N3 ? ? C DA 14 D DT 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog29  hydrog ? ? A DA 14 N6 ? ? ? 1_555 B DT 23 O4 ? ? C DA 14 D DT 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog30  hydrog ? ? A DG 15 N1 ? ? ? 1_555 B DC 22 N3 ? ? C DG 15 D DC 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog31  hydrog ? ? A DG 15 N2 ? ? ? 1_555 B DC 22 O2 ? ? C DG 15 D DC 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog32  hydrog ? ? A DG 15 O6 ? ? ? 1_555 B DC 22 N4 ? ? C DG 15 D DC 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog33  hydrog ? ? A DC 16 N3 ? ? ? 1_555 B DG 21 N1 ? ? C DC 16 D DG 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog34  hydrog ? ? A DC 16 N4 ? ? ? 1_555 B DG 21 O6 ? ? C DC 16 D DG 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog35  hydrog ? ? A DC 16 O2 ? ? ? 1_555 B DG 21 N2 ? ? C DC 16 D DG 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog36  hydrog ? ? A DA 17 N1 ? ? ? 1_555 B DT 20 N3 ? ? C DA 17 D DT 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog37  hydrog ? ? A DA 17 N6 ? ? ? 1_555 B DT 20 O4 ? ? C DA 17 D DT 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog38  hydrog ? ? A DT 18 N3 ? ? ? 1_555 B DA 19 N1 ? ? C DT 18 D DA 19 1_555 ? ? ? ? ? ? 'DT-DA PAIR' ? ? ? 
hydrog39  hydrog ? ? A DA 19 N1 ? ? ? 1_555 D DT 18 N3 ? ? C DA 19 F DT 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog40  hydrog ? ? A DA 19 N6 ? ? ? 1_555 D DT 18 O4 ? ? C DA 19 F DT 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog41  hydrog ? ? A DC 20 O2 ? ? ? 1_555 D DG 17 N2 ? ? C DC 20 F DG 17 1_555 ? ? ? ? ? ? 'DC-DG PAIR' ? ? ? 
hydrog42  hydrog ? ? A DA 21 N1 ? ? ? 1_555 D DT 16 N3 ? ? C DA 21 F DT 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog43  hydrog ? ? A DA 21 N6 ? ? ? 1_555 D DT 16 O4 ? ? C DA 21 F DT 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog44  hydrog ? ? A DT 23 N3 ? ? ? 1_555 D DA 14 N1 ? ? C DT 23 F DA 14 1_555 ? ? ? ? ? ? 'DT-DA PAIR' ? ? ? 
hydrog45  hydrog ? ? A DA 24 N1 ? ? ? 1_555 D DT 13 N3 ? ? C DA 24 F DT 13 1_555 ? ? ? ? ? ? 'DA-DT PAIR' ? ? ? 
hydrog46  hydrog ? ? A DT 25 N3 ? ? ? 1_555 D DA 12 N1 ? ? C DT 25 F DA 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog47  hydrog ? ? A DT 25 O4 ? ? ? 1_555 D DA 12 N6 ? ? C DT 25 F DA 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog48  hydrog ? ? A DA 26 N1 ? ? ? 1_555 D DT 11 N3 ? ? C DA 26 F DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog49  hydrog ? ? A DA 26 N6 ? ? ? 1_555 D DT 11 O4 ? ? C DA 26 F DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog50  hydrog ? ? A DC 27 N3 ? ? ? 1_555 D DG 10 N1 ? ? C DC 27 F DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog51  hydrog ? ? A DC 27 N4 ? ? ? 1_555 D DG 10 O6 ? ? C DC 27 F DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog52  hydrog ? ? A DC 27 O2 ? ? ? 1_555 D DG 10 N2 ? ? C DC 27 F DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog53  hydrog ? ? A DG 28 N1 ? ? ? 1_555 D DC 9  N3 ? ? C DG 28 F DC 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog54  hydrog ? ? A DG 28 N2 ? ? ? 1_555 D DC 9  O2 ? ? C DG 28 F DC 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog55  hydrog ? ? A DG 28 O6 ? ? ? 1_555 D DC 9  N4 ? ? C DG 28 F DC 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog56  hydrog ? ? A DA 29 N1 ? ? ? 1_555 D DT 8  N3 ? ? C DA 29 F DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog57  hydrog ? ? A DA 29 N6 ? ? ? 1_555 D DT 8  O4 ? ? C DA 29 F DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog58  hydrog ? ? A DA 30 N1 ? ? ? 1_555 D DT 7  N3 ? ? C DA 30 F DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog59  hydrog ? ? A DA 30 N6 ? ? ? 1_555 D DT 7  O4 ? ? C DA 30 F DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog60  hydrog ? ? A DT 31 N3 ? ? ? 1_555 D DA 6  N1 ? ? C DT 31 F DA 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog61  hydrog ? ? A DT 31 O4 ? ? ? 1_555 D DA 6  N6 ? ? C DT 31 F DA 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog62  hydrog ? ? A DT 32 N3 ? ? ? 1_555 D DA 5  N1 ? ? C DT 32 F DA 5  1_555 ? ? ? ? ? ? 'DT-DA PAIR' ? ? ? 
hydrog63  hydrog ? ? A DT 33 N3 ? ? ? 1_555 D DA 4  N1 ? ? C DT 33 F DA 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog64  hydrog ? ? A DT 33 O4 ? ? ? 1_555 D DA 4  N6 ? ? C DT 33 F DA 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog65  hydrog ? ? A DA 34 N1 ? ? ? 1_555 D DT 3  N3 ? ? C DA 34 F DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog66  hydrog ? ? A DA 34 N6 ? ? ? 1_555 D DT 3  O4 ? ? C DA 34 F DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog67  hydrog ? ? A DT 35 N3 ? ? ? 1_555 D DA 2  N1 ? ? C DT 35 F DA 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog68  hydrog ? ? A DT 35 O4 ? ? ? 1_555 D DA 2  N6 ? ? C DT 35 F DA 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog69  hydrog ? ? B DA 2  N1 ? ? ? 1_555 C DT 35 N3 ? ? D DA 2  E DT 35 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog70  hydrog ? ? B DA 2  N6 ? ? ? 1_555 C DT 35 O4 ? ? D DA 2  E DT 35 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog71  hydrog ? ? B DT 3  N3 ? ? ? 1_555 C DA 34 N1 ? ? D DT 3  E DA 34 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog72  hydrog ? ? B DT 3  O4 ? ? ? 1_555 C DA 34 N6 ? ? D DT 3  E DA 34 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog73  hydrog ? ? B DA 4  N1 ? ? ? 1_555 C DT 33 N3 ? ? D DA 4  E DT 33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog74  hydrog ? ? B DA 4  N6 ? ? ? 1_555 C DT 33 O4 ? ? D DA 4  E DT 33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog75  hydrog ? ? B DA 5  N1 ? ? ? 1_555 C DT 32 N3 ? ? D DA 5  E DT 32 1_555 ? ? ? ? ? ? 'DA-DT PAIR' ? ? ? 
hydrog76  hydrog ? ? B DT 6  N3 ? ? ? 1_555 C DA 31 N1 ? ? D DT 6  E DA 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog77  hydrog ? ? B DT 6  O4 ? ? ? 1_555 C DA 31 N6 ? ? D DT 6  E DA 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog78  hydrog ? ? B DT 7  N3 ? ? ? 1_555 C DA 30 N1 ? ? D DT 7  E DA 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog79  hydrog ? ? B DT 7  O4 ? ? ? 1_555 C DA 30 N6 ? ? D DT 7  E DA 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog80  hydrog ? ? B DT 8  N3 ? ? ? 1_555 C DA 29 N1 ? ? D DT 8  E DA 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog81  hydrog ? ? B DT 8  O4 ? ? ? 1_555 C DA 29 N6 ? ? D DT 8  E DA 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog82  hydrog ? ? B DC 9  N3 ? ? ? 1_555 C DG 28 N1 ? ? D DC 9  E DG 28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog83  hydrog ? ? B DC 9  N4 ? ? ? 1_555 C DG 28 O6 ? ? D DC 9  E DG 28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog84  hydrog ? ? B DC 9  O2 ? ? ? 1_555 C DG 28 N2 ? ? D DC 9  E DG 28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog85  hydrog ? ? B DG 10 N1 ? ? ? 1_555 C DC 27 N3 ? ? D DG 10 E DC 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog86  hydrog ? ? B DG 10 N2 ? ? ? 1_555 C DC 27 O2 ? ? D DG 10 E DC 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog87  hydrog ? ? B DG 10 O6 ? ? ? 1_555 C DC 27 N4 ? ? D DG 10 E DC 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog88  hydrog ? ? B DT 11 N3 ? ? ? 1_555 C DA 26 N1 ? ? D DT 11 E DA 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog89  hydrog ? ? B DT 11 O4 ? ? ? 1_555 C DA 26 N6 ? ? D DT 11 E DA 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog90  hydrog ? ? B DA 12 N1 ? ? ? 1_555 C DT 25 N3 ? ? D DA 12 E DT 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog91  hydrog ? ? B DA 12 N6 ? ? ? 1_555 C DT 25 O4 ? ? D DA 12 E DT 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog92  hydrog ? ? B DT 13 N3 ? ? ? 1_555 C DA 24 N1 ? ? D DT 13 E DA 24 1_555 ? ? ? ? ? ? 'DT-DA PAIR' ? ? ? 
hydrog93  hydrog ? ? B DA 14 N1 ? ? ? 1_555 C DT 23 N3 ? ? D DA 14 E DT 23 1_555 ? ? ? ? ? ? 'DA-DT PAIR' ? ? ? 
hydrog94  hydrog ? ? B DA 16 N1 ? ? ? 1_555 C DT 21 N3 ? ? D DA 16 E DT 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog95  hydrog ? ? B DA 16 N6 ? ? ? 1_555 C DT 21 O4 ? ? D DA 16 E DT 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog96  hydrog ? ? B DC 17 O2 ? ? ? 1_555 C DG 20 N2 ? ? D DC 17 E DG 20 1_555 ? ? ? ? ? ? 'DC-DG PAIR' ? ? ? 
hydrog97  hydrog ? ? B DA 18 N1 ? ? ? 1_555 C DT 19 N3 ? ? D DA 18 E DT 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog98  hydrog ? ? B DA 18 N6 ? ? ? 1_555 C DT 19 O4 ? ? D DA 18 E DT 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog99  hydrog ? ? C DA 2  N1 ? ? ? 1_555 D DT 35 N3 ? ? E DA 2  F DT 35 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog100 hydrog ? ? C DA 2  N6 ? ? ? 1_555 D DT 35 O4 ? ? E DA 2  F DT 35 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog101 hydrog ? ? C DT 3  N3 ? ? ? 1_555 D DA 34 N1 ? ? E DT 3  F DA 34 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog102 hydrog ? ? C DT 3  O4 ? ? ? 1_555 D DA 34 N6 ? ? E DT 3  F DA 34 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog103 hydrog ? ? C DA 4  N1 ? ? ? 1_555 D DT 33 N3 ? ? E DA 4  F DT 33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog104 hydrog ? ? C DA 4  N6 ? ? ? 1_555 D DT 33 O4 ? ? E DA 4  F DT 33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog105 hydrog ? ? C DA 5  N1 ? ? ? 1_555 D DT 32 N3 ? ? E DA 5  F DT 32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog106 hydrog ? ? C DA 5  N6 ? ? ? 1_555 D DT 32 O4 ? ? E DA 5  F DT 32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog107 hydrog ? ? C DC 6  N3 ? ? ? 1_555 D DG 31 N1 ? ? E DC 6  F DG 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog108 hydrog ? ? C DC 6  N4 ? ? ? 1_555 D DG 31 O6 ? ? E DC 6  F DG 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog109 hydrog ? ? C DC 6  O2 ? ? ? 1_555 D DG 31 N2 ? ? E DC 6  F DG 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog110 hydrog ? ? C DT 7  N3 ? ? ? 1_555 D DA 30 N1 ? ? E DT 7  F DA 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog111 hydrog ? ? C DT 7  O4 ? ? ? 1_555 D DA 30 N6 ? ? E DT 7  F DA 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog112 hydrog ? ? C DT 8  N3 ? ? ? 1_555 D DA 29 N1 ? ? E DT 8  F DA 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog113 hydrog ? ? C DT 8  O4 ? ? ? 1_555 D DA 29 N6 ? ? E DT 8  F DA 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog114 hydrog ? ? C DC 9  N3 ? ? ? 1_555 D DG 28 N1 ? ? E DC 9  F DG 28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog115 hydrog ? ? C DC 9  N4 ? ? ? 1_555 D DG 28 O6 ? ? E DC 9  F DG 28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog116 hydrog ? ? C DC 9  O2 ? ? ? 1_555 D DG 28 N2 ? ? E DC 9  F DG 28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog117 hydrog ? ? C DG 10 N1 ? ? ? 1_555 D DC 27 N3 ? ? E DG 10 F DC 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog118 hydrog ? ? C DG 10 N2 ? ? ? 1_555 D DC 27 O2 ? ? E DG 10 F DC 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog119 hydrog ? ? C DG 10 O6 ? ? ? 1_555 D DC 27 N4 ? ? E DG 10 F DC 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog120 hydrog ? ? C DT 11 N3 ? ? ? 1_555 D DA 26 N1 ? ? E DT 11 F DA 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog121 hydrog ? ? C DT 11 O4 ? ? ? 1_555 D DA 26 N6 ? ? E DT 11 F DA 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog122 hydrog ? ? C DA 12 N1 ? ? ? 1_555 D DT 25 N3 ? ? E DA 12 F DT 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog123 hydrog ? ? C DA 12 N6 ? ? ? 1_555 D DT 25 O4 ? ? E DA 12 F DT 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog124 hydrog ? ? C DT 13 N3 ? ? ? 1_555 D DA 24 N1 ? ? E DT 13 F DA 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog125 hydrog ? ? C DT 13 O4 ? ? ? 1_555 D DA 24 N6 ? ? E DT 13 F DA 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog126 hydrog ? ? C DA 14 N1 ? ? ? 1_555 D DT 23 N3 ? ? E DA 14 F DT 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog127 hydrog ? ? C DA 14 N6 ? ? ? 1_555 D DT 23 O4 ? ? E DA 14 F DT 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog128 hydrog ? ? C DC 15 N3 ? ? ? 1_555 D DG 22 N1 ? ? E DC 15 F DG 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog129 hydrog ? ? C DC 15 N4 ? ? ? 1_555 D DG 22 O6 ? ? E DC 15 F DG 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog130 hydrog ? ? C DC 15 O2 ? ? ? 1_555 D DG 22 N2 ? ? E DC 15 F DG 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog131 hydrog ? ? C DG 16 N1 ? ? ? 1_555 D DC 21 N3 ? ? E DG 16 F DC 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog132 hydrog ? ? C DG 16 N2 ? ? ? 1_555 D DC 21 O2 ? ? E DG 16 F DC 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog133 hydrog ? ? C DG 16 O6 ? ? ? 1_555 D DC 21 N4 ? ? E DG 16 F DC 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog134 hydrog ? ? C DT 17 N3 ? ? ? 1_555 D DA 20 N1 ? ? E DT 17 F DA 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog135 hydrog ? ? C DT 17 O4 ? ? ? 1_555 D DA 20 N6 ? ? E DT 17 F DA 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog136 hydrog ? ? C DA 18 N1 ? ? ? 1_555 D DT 19 N3 ? ? E DA 18 F DT 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog137 hydrog ? ? C DA 18 N6 ? ? ? 1_555 D DT 19 O4 ? ? E DA 18 F DT 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PHE 64 E . ? PHE 64 A PRO 65 E ? PRO 65 A 1 0.00  
2 PHE 64 F . ? PHE 64 B PRO 65 F ? PRO 65 B 1 -0.11 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE E 185 ? ARG E 187 ? ILE A 185 ARG A 187 
A 2 MET E 193 ? ILE E 195 ? MET A 193 ILE A 195 
B 1 ILE F 185 ? ARG F 187 ? ILE B 185 ARG B 187 
B 2 MET F 193 ? HIS F 196 ? MET B 193 HIS B 196 
B 3 GLU F 210 ? ALA F 212 ? GLU B 210 ALA B 212 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O SER E 186 ? O SER A 186 N LEU E 194 ? N LEU A 194 
B 1 2 O SER F 186 ? O SER B 186 N LEU F 194 ? N LEU B 194 
B 2 3 O ILE F 195 ? O ILE B 195 N LYS F 211 ? N LYS B 211 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
CIC Unknown ? ? ? ? 5 'RECOMBINASE ACTIVE SITE.' 
CIB Unknown ? ? ? ? 5 'RECOMBINASE ACTIVE SITE.' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  CIC 5 LYS E 173 ? LYS A 173 . ? 1_555 ? 
2  CIC 5 HIS E 289 ? HIS A 289 . ? 1_555 ? 
3  CIC 5 ARG E 292 ? ARG A 292 . ? 1_555 ? 
4  CIC 5 TRP E 315 ? TRP A 315 . ? 1_555 ? 
5  CIC 5 TYR E 324 ? TYR A 324 . ? 1_555 ? 
6  CIB 5 LYS F 173 ? LYS B 173 . ? 1_555 ? 
7  CIB 5 HIS F 289 ? HIS B 289 . ? 1_555 ? 
8  CIB 5 ARG F 292 ? ARG B 292 . ? 1_555 ? 
9  CIB 5 TRP F 315 ? TRP B 315 . ? 1_555 ? 
10 CIB 5 TYR F 324 ? TYR B 324 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3CRX 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3CRX 
_atom_sites.fract_transf_matrix[1][1]   0.009407 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008150 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005571 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DT  A 1 1   ? 73.955  3.971   54.594  0.50 100.00 ? 1   DT  C "O5'" 1 
ATOM   2    C "C5'" . DT  A 1 1   ? 72.669  4.485   54.953  0.50 100.00 ? 1   DT  C "C5'" 1 
ATOM   3    C "C4'" . DT  A 1 1   ? 72.760  5.381   56.166  0.50 70.48  ? 1   DT  C "C4'" 1 
ATOM   4    O "O4'" . DT  A 1 1   ? 73.555  6.552   55.855  0.50 100.00 ? 1   DT  C "O4'" 1 
ATOM   5    C "C3'" . DT  A 1 1   ? 71.425  5.915   56.690  0.50 100.00 ? 1   DT  C "C3'" 1 
ATOM   6    O "O3'" . DT  A 1 1   ? 71.536  6.080   58.103  0.50 100.00 ? 1   DT  C "O3'" 1 
ATOM   7    C "C2'" . DT  A 1 1   ? 71.356  7.297   56.071  0.50 100.00 ? 1   DT  C "C2'" 1 
ATOM   8    C "C1'" . DT  A 1 1   ? 72.810  7.711   56.192  0.50 100.00 ? 1   DT  C "C1'" 1 
ATOM   9    N N1    . DT  A 1 1   ? 73.252  8.815   55.322  0.50 70.48  ? 1   DT  C N1    1 
ATOM   10   C C2    . DT  A 1 1   ? 74.574  9.188   55.390  0.50 70.48  ? 1   DT  C C2    1 
ATOM   11   O O2    . DT  A 1 1   ? 75.387  8.630   56.109  0.50 70.48  ? 1   DT  C O2    1 
ATOM   12   N N3    . DT  A 1 1   ? 74.914  10.241  54.580  0.50 70.48  ? 1   DT  C N3    1 
ATOM   13   C C4    . DT  A 1 1   ? 74.082  10.939  53.726  0.50 70.48  ? 1   DT  C C4    1 
ATOM   14   O O4    . DT  A 1 1   ? 74.530  11.871  53.064  0.50 70.48  ? 1   DT  C O4    1 
ATOM   15   C C5    . DT  A 1 1   ? 72.709  10.487  53.697  0.50 70.48  ? 1   DT  C C5    1 
ATOM   16   C C7    . DT  A 1 1   ? 71.735  11.180  52.796  0.50 70.48  ? 1   DT  C C7    1 
ATOM   17   C C6    . DT  A 1 1   ? 72.368  9.460   54.484  0.50 70.48  ? 1   DT  C C6    1 
ATOM   18   P P     . DA  A 1 2   ? 70.448  5.425   59.084  0.50 100.00 ? 2   DA  C P     1 
ATOM   19   O OP1   . DA  A 1 2   ? 70.333  3.980   58.761  0.50 100.00 ? 2   DA  C OP1   1 
ATOM   20   O OP2   . DA  A 1 2   ? 69.235  6.283   59.069  0.50 100.00 ? 2   DA  C OP2   1 
ATOM   21   O "O5'" . DA  A 1 2   ? 71.157  5.565   60.502  0.50 100.00 ? 2   DA  C "O5'" 1 
ATOM   22   C "C5'" . DA  A 1 2   ? 72.494  5.104   60.672  0.50 100.00 ? 2   DA  C "C5'" 1 
ATOM   23   C "C4'" . DA  A 1 2   ? 73.450  6.268   60.802  0.50 51.49  ? 2   DA  C "C4'" 1 
ATOM   24   O "O4'" . DA  A 1 2   ? 73.292  7.188   59.689  0.50 100.00 ? 2   DA  C "O4'" 1 
ATOM   25   C "C3'" . DA  A 1 2   ? 73.302  7.117   62.066  0.50 100.00 ? 2   DA  C "C3'" 1 
ATOM   26   O "O3'" . DA  A 1 2   ? 74.604  7.451   62.553  0.50 100.00 ? 2   DA  C "O3'" 1 
ATOM   27   C "C2'" . DA  A 1 2   ? 72.597  8.367   61.575  0.50 100.00 ? 2   DA  C "C2'" 1 
ATOM   28   C "C1'" . DA  A 1 2   ? 73.185  8.514   60.189  0.50 100.00 ? 2   DA  C "C1'" 1 
ATOM   29   N N9    . DA  A 1 2   ? 72.370  9.299   59.262  0.50 51.49  ? 2   DA  C N9    1 
ATOM   30   C C8    . DA  A 1 2   ? 71.046  9.129   58.940  0.50 51.49  ? 2   DA  C C8    1 
ATOM   31   N N7    . DA  A 1 2   ? 70.595  10.010  58.078  0.50 51.49  ? 2   DA  C N7    1 
ATOM   32   C C5    . DA  A 1 2   ? 71.696  10.813  57.814  0.50 51.49  ? 2   DA  C C5    1 
ATOM   33   C C6    . DA  A 1 2   ? 71.875  11.933  56.977  0.50 51.49  ? 2   DA  C C6    1 
ATOM   34   N N6    . DA  A 1 2   ? 70.906  12.462  56.225  0.50 51.49  ? 2   DA  C N6    1 
ATOM   35   N N1    . DA  A 1 2   ? 73.100  12.500  56.942  0.50 51.49  ? 2   DA  C N1    1 
ATOM   36   C C2    . DA  A 1 2   ? 74.070  11.974  57.698  0.50 51.49  ? 2   DA  C C2    1 
ATOM   37   N N3    . DA  A 1 2   ? 74.026  10.930  58.524  0.50 51.49  ? 2   DA  C N3    1 
ATOM   38   C C4    . DA  A 1 2   ? 72.796  10.386  58.536  0.50 51.49  ? 2   DA  C C4    1 
ATOM   39   P P     . DT  A 1 3   ? 74.761  8.499   63.758  0.50 79.13  ? 3   DT  C P     1 
ATOM   40   O OP1   . DT  A 1 3   ? 76.037  8.206   64.460  0.50 79.13  ? 3   DT  C OP1   1 
ATOM   41   O OP2   . DT  A 1 3   ? 73.485  8.494   64.519  0.50 79.13  ? 3   DT  C OP2   1 
ATOM   42   O "O5'" . DT  A 1 3   ? 74.904  9.903   63.020  0.50 79.13  ? 3   DT  C "O5'" 1 
ATOM   43   C "C5'" . DT  A 1 3   ? 76.113  10.247  62.346  0.50 79.13  ? 3   DT  C "C5'" 1 
ATOM   44   C "C4'" . DT  A 1 3   ? 76.271  11.749  62.277  0.50 33.89  ? 3   DT  C "C4'" 1 
ATOM   45   O "O4'" . DT  A 1 3   ? 75.402  12.306  61.261  0.50 79.13  ? 3   DT  C "O4'" 1 
ATOM   46   C "C3'" . DT  A 1 3   ? 75.944  12.492  63.574  0.50 79.13  ? 3   DT  C "C3'" 1 
ATOM   47   O "O3'" . DT  A 1 3   ? 76.879  13.553  63.776  0.50 79.13  ? 3   DT  C "O3'" 1 
ATOM   48   C "C2'" . DT  A 1 3   ? 74.571  13.078  63.298  0.50 79.13  ? 3   DT  C "C2'" 1 
ATOM   49   C "C1'" . DT  A 1 3   ? 74.669  13.384  61.816  0.50 79.13  ? 3   DT  C "C1'" 1 
ATOM   50   N N1    . DT  A 1 3   ? 73.384  13.486  61.098  0.50 33.89  ? 3   DT  C N1    1 
ATOM   51   C C2    . DT  A 1 3   ? 73.321  14.340  60.019  0.50 33.89  ? 3   DT  C C2    1 
ATOM   52   O O2    . DT  A 1 3   ? 74.274  14.997  59.632  0.50 33.89  ? 3   DT  C O2    1 
ATOM   53   N N3    . DT  A 1 3   ? 72.096  14.397  59.405  0.50 33.89  ? 3   DT  C N3    1 
ATOM   54   C C4    . DT  A 1 3   ? 70.954  13.704  59.754  0.50 33.89  ? 3   DT  C C4    1 
ATOM   55   O O4    . DT  A 1 3   ? 69.921  13.863  59.110  0.50 33.89  ? 3   DT  C O4    1 
ATOM   56   C C5    . DT  A 1 3   ? 71.092  12.823  60.890  0.50 33.89  ? 3   DT  C C5    1 
ATOM   57   C C7    . DT  A 1 3   ? 69.907  12.028  61.339  0.50 33.89  ? 3   DT  C C7    1 
ATOM   58   C C6    . DT  A 1 3   ? 72.284  12.758  61.497  0.50 33.89  ? 3   DT  C C6    1 
ATOM   59   P P     . DA  A 1 4   ? 77.364  13.917  65.264  0.50 33.53  ? 4   DA  C P     1 
ATOM   60   O OP1   . DA  A 1 4   ? 78.382  12.920  65.681  0.50 33.53  ? 4   DA  C OP1   1 
ATOM   61   O OP2   . DA  A 1 4   ? 76.152  14.124  66.096  0.50 33.53  ? 4   DA  C OP2   1 
ATOM   62   O "O5'" . DA  A 1 4   ? 78.088  15.322  65.081  0.50 33.53  ? 4   DA  C "O5'" 1 
ATOM   63   C "C5'" . DA  A 1 4   ? 79.086  15.494  64.080  0.50 33.53  ? 4   DA  C "C5'" 1 
ATOM   64   C "C4'" . DA  A 1 4   ? 78.845  16.774  63.317  0.50 36.52  ? 4   DA  C "C4'" 1 
ATOM   65   O "O4'" . DA  A 1 4   ? 77.561  16.697  62.652  0.50 33.53  ? 4   DA  C "O4'" 1 
ATOM   66   C "C3'" . DA  A 1 4   ? 78.798  18.034  64.179  0.50 33.53  ? 4   DA  C "C3'" 1 
ATOM   67   O "O3'" . DA  A 1 4   ? 79.414  19.117  63.481  0.50 33.53  ? 4   DA  C "O3'" 1 
ATOM   68   C "C2'" . DA  A 1 4   ? 77.313  18.289  64.354  0.50 33.53  ? 4   DA  C "C2'" 1 
ATOM   69   C "C1'" . DA  A 1 4   ? 76.745  17.792  63.039  0.50 33.53  ? 4   DA  C "C1'" 1 
ATOM   70   N N9    . DA  A 1 4   ? 75.365  17.314  63.122  0.50 36.52  ? 4   DA  C N9    1 
ATOM   71   C C8    . DA  A 1 4   ? 74.819  16.467  64.056  0.50 36.52  ? 4   DA  C C8    1 
ATOM   72   N N7    . DA  A 1 4   ? 73.546  16.219  63.864  0.50 36.52  ? 4   DA  C N7    1 
ATOM   73   C C5    . DA  A 1 4   ? 73.231  16.952  62.728  0.50 36.52  ? 4   DA  C C5    1 
ATOM   74   C C6    . DA  A 1 4   ? 72.034  17.111  62.005  0.50 36.52  ? 4   DA  C C6    1 
ATOM   75   N N6    . DA  A 1 4   ? 70.884  16.518  62.335  0.50 36.52  ? 4   DA  C N6    1 
ATOM   76   N N1    . DA  A 1 4   ? 72.060  17.914  60.919  0.50 36.52  ? 4   DA  C N1    1 
ATOM   77   C C2    . DA  A 1 4   ? 73.214  18.510  60.589  0.50 36.52  ? 4   DA  C C2    1 
ATOM   78   N N3    . DA  A 1 4   ? 74.402  18.438  61.187  0.50 36.52  ? 4   DA  C N3    1 
ATOM   79   C C4    . DA  A 1 4   ? 74.342  17.633  62.262  0.50 36.52  ? 4   DA  C C4    1 
ATOM   80   P P     . DA  A 1 5   ? 79.663  20.510  64.236  0.50 28.37  ? 5   DA  C P     1 
ATOM   81   O OP1   . DA  A 1 5   ? 80.752  21.235  63.532  0.50 28.37  ? 5   DA  C OP1   1 
ATOM   82   O OP2   . DA  A 1 5   ? 79.794  20.213  65.685  0.50 28.37  ? 5   DA  C OP2   1 
ATOM   83   O "O5'" . DA  A 1 5   ? 78.304  21.304  64.003  0.50 28.37  ? 5   DA  C "O5'" 1 
ATOM   84   C "C5'" . DA  A 1 5   ? 78.012  21.873  62.731  0.50 28.37  ? 5   DA  C "C5'" 1 
ATOM   85   C "C4'" . DA  A 1 5   ? 76.750  22.699  62.803  0.50 21.54  ? 5   DA  C "C4'" 1 
ATOM   86   O "O4'" . DA  A 1 5   ? 75.592  21.834  62.903  0.50 28.37  ? 5   DA  C "O4'" 1 
ATOM   87   C "C3'" . DA  A 1 5   ? 76.679  23.647  64.002  0.50 28.37  ? 5   DA  C "C3'" 1 
ATOM   88   O "O3'" . DA  A 1 5   ? 76.110  24.897  63.602  0.50 28.37  ? 5   DA  C "O3'" 1 
ATOM   89   C "C2'" . DA  A 1 5   ? 75.743  22.925  64.955  0.50 28.37  ? 5   DA  C "C2'" 1 
ATOM   90   C "C1'" . DA  A 1 5   ? 74.785  22.268  63.982  0.50 28.37  ? 5   DA  C "C1'" 1 
ATOM   91   N N9    . DA  A 1 5   ? 74.050  21.114  64.501  0.50 21.54  ? 5   DA  C N9    1 
ATOM   92   C C8    . DA  A 1 5   ? 74.417  20.240  65.494  0.50 21.54  ? 5   DA  C C8    1 
ATOM   93   N N7    . DA  A 1 5   ? 73.518  19.320  65.747  0.50 21.54  ? 5   DA  C N7    1 
ATOM   94   C C5    . DA  A 1 5   ? 72.491  19.602  64.856  0.50 21.54  ? 5   DA  C C5    1 
ATOM   95   C C6    . DA  A 1 5   ? 71.246  18.993  64.622  0.50 21.54  ? 5   DA  C C6    1 
ATOM   96   N N6    . DA  A 1 5   ? 70.802  17.931  65.298  0.50 21.54  ? 5   DA  C N6    1 
ATOM   97   N N1    . DA  A 1 5   ? 70.460  19.519  63.659  0.50 21.54  ? 5   DA  C N1    1 
ATOM   98   C C2    . DA  A 1 5   ? 70.903  20.586  62.983  0.50 21.54  ? 5   DA  C C2    1 
ATOM   99   N N3    . DA  A 1 5   ? 72.051  21.249  63.113  0.50 21.54  ? 5   DA  C N3    1 
ATOM   100  C C4    . DA  A 1 5   ? 72.809  20.700  64.078  0.50 21.54  ? 5   DA  C C4    1 
ATOM   101  P P     . DG  A 1 6   ? 76.401  26.219  64.468  0.50 33.03  ? 6   DG  C P     1 
ATOM   102  O OP1   . DG  A 1 6   ? 76.715  27.332  63.538  0.50 33.03  ? 6   DG  C OP1   1 
ATOM   103  O OP2   . DG  A 1 6   ? 77.372  25.849  65.529  0.50 33.03  ? 6   DG  C OP2   1 
ATOM   104  O "O5'" . DG  A 1 6   ? 75.001  26.531  65.156  0.50 33.03  ? 6   DG  C "O5'" 1 
ATOM   105  C "C5'" . DG  A 1 6   ? 74.008  25.519  65.247  0.50 33.03  ? 6   DG  C "C5'" 1 
ATOM   106  C "C4'" . DG  A 1 6   ? 72.908  25.779  64.248  0.50 24.14  ? 6   DG  C "C4'" 1 
ATOM   107  O "O4'" . DG  A 1 6   ? 72.201  24.543  64.003  0.50 33.03  ? 6   DG  C "O4'" 1 
ATOM   108  C "C3'" . DG  A 1 6   ? 71.862  26.784  64.717  0.50 33.03  ? 6   DG  C "C3'" 1 
ATOM   109  O "O3'" . DG  A 1 6   ? 71.370  27.564  63.628  0.50 33.03  ? 6   DG  C "O3'" 1 
ATOM   110  C "C2'" . DG  A 1 6   ? 70.767  25.907  65.288  0.50 33.03  ? 6   DG  C "C2'" 1 
ATOM   111  C "C1'" . DG  A 1 6   ? 70.867  24.623  64.477  0.50 33.03  ? 6   DG  C "C1'" 1 
ATOM   112  N N9    . DG  A 1 6   ? 70.635  23.442  65.298  0.50 24.14  ? 6   DG  C N9    1 
ATOM   113  C C8    . DG  A 1 6   ? 71.490  22.919  66.236  0.50 24.14  ? 6   DG  C C8    1 
ATOM   114  N N7    . DG  A 1 6   ? 71.013  21.860  66.829  0.50 24.14  ? 6   DG  C N7    1 
ATOM   115  C C5    . DG  A 1 6   ? 69.769  21.670  66.244  0.50 24.14  ? 6   DG  C C5    1 
ATOM   116  C C6    . DG  A 1 6   ? 68.787  20.677  66.480  0.50 24.14  ? 6   DG  C C6    1 
ATOM   117  O O6    . DG  A 1 6   ? 68.819  19.736  67.282  0.50 24.14  ? 6   DG  C O6    1 
ATOM   118  N N1    . DG  A 1 6   ? 67.674  20.854  65.664  0.50 24.14  ? 6   DG  C N1    1 
ATOM   119  C C2    . DG  A 1 6   ? 67.526  21.860  64.741  0.50 24.14  ? 6   DG  C C2    1 
ATOM   120  N N2    . DG  A 1 6   ? 66.379  21.865  64.050  0.50 24.14  ? 6   DG  C N2    1 
ATOM   121  N N3    . DG  A 1 6   ? 68.434  22.793  64.513  0.50 24.14  ? 6   DG  C N3    1 
ATOM   122  C C4    . DG  A 1 6   ? 69.523  22.638  65.294  0.50 24.14  ? 6   DG  C C4    1 
ATOM   123  P P     . DT  A 1 7   ? 70.356  28.774  63.920  0.50 28.64  ? 7   DT  C P     1 
ATOM   124  O OP1   . DT  A 1 7   ? 70.402  29.720  62.777  0.50 28.64  ? 7   DT  C OP1   1 
ATOM   125  O OP2   . DT  A 1 7   ? 70.630  29.265  65.293  0.50 28.64  ? 7   DT  C OP2   1 
ATOM   126  O "O5'" . DT  A 1 7   ? 68.929  28.072  63.932  0.50 28.64  ? 7   DT  C "O5'" 1 
ATOM   127  C "C5'" . DT  A 1 7   ? 68.349  27.593  62.726  0.50 28.64  ? 7   DT  C "C5'" 1 
ATOM   128  C "C4'" . DT  A 1 7   ? 66.905  27.220  62.959  0.50 28.72  ? 7   DT  C "C4'" 1 
ATOM   129  O "O4'" . DT  A 1 7   ? 66.837  26.032  63.782  0.50 28.64  ? 7   DT  C "O4'" 1 
ATOM   130  C "C3'" . DT  A 1 7   ? 66.087  28.287  63.686  0.50 28.64  ? 7   DT  C "C3'" 1 
ATOM   131  O "O3'" . DT  A 1 7   ? 64.774  28.345  63.128  0.50 28.64  ? 7   DT  C "O3'" 1 
ATOM   132  C "C2'" . DT  A 1 7   ? 66.045  27.784  65.118  0.50 28.64  ? 7   DT  C "C2'" 1 
ATOM   133  C "C1'" . DT  A 1 7   ? 66.036  26.279  64.928  0.50 28.64  ? 7   DT  C "C1'" 1 
ATOM   134  N N1    . DT  A 1 7   ? 66.605  25.505  66.049  0.50 28.72  ? 7   DT  C N1    1 
ATOM   135  C C2    . DT  A 1 7   ? 65.923  24.387  66.473  0.50 28.72  ? 7   DT  C C2    1 
ATOM   136  O O2    . DT  A 1 7   ? 64.868  24.023  65.981  0.50 28.72  ? 7   DT  C O2    1 
ATOM   137  N N3    . DT  A 1 7   ? 66.525  23.706  67.501  0.50 28.72  ? 7   DT  C N3    1 
ATOM   138  C C4    . DT  A 1 7   ? 67.707  24.029  68.139  0.50 28.72  ? 7   DT  C C4    1 
ATOM   139  O O4    . DT  A 1 7   ? 68.129  23.315  69.046  0.50 28.72  ? 7   DT  C O4    1 
ATOM   140  C C5    . DT  A 1 7   ? 68.360  25.224  67.656  0.50 28.72  ? 7   DT  C C5    1 
ATOM   141  C C7    . DT  A 1 7   ? 69.636  25.663  68.301  0.50 28.72  ? 7   DT  C C7    1 
ATOM   142  C C6    . DT  A 1 7   ? 67.784  25.892  66.647  0.50 28.72  ? 7   DT  C C6    1 
ATOM   143  P P     . DT  A 1 8   ? 63.679  29.326  63.770  0.50 38.85  ? 8   DT  C P     1 
ATOM   144  O OP1   . DT  A 1 8   ? 62.778  29.779  62.680  0.50 38.85  ? 8   DT  C OP1   1 
ATOM   145  O OP2   . DT  A 1 8   ? 64.392  30.330  64.600  0.50 38.85  ? 8   DT  C OP2   1 
ATOM   146  O "O5'" . DT  A 1 8   ? 62.854  28.365  64.733  0.50 38.85  ? 8   DT  C "O5'" 1 
ATOM   147  C "C5'" . DT  A 1 8   ? 62.175  27.232  64.203  0.50 38.85  ? 8   DT  C "C5'" 1 
ATOM   148  C "C4'" . DT  A 1 8   ? 61.256  26.637  65.242  0.50 24.27  ? 8   DT  C "C4'" 1 
ATOM   149  O "O4'" . DT  A 1 8   ? 62.017  25.878  66.212  0.50 38.85  ? 8   DT  C "O4'" 1 
ATOM   150  C "C3'" . DT  A 1 8   ? 60.444  27.660  66.036  0.50 38.85  ? 8   DT  C "C3'" 1 
ATOM   151  O "O3'" . DT  A 1 8   ? 59.107  27.186  66.206  0.50 38.85  ? 8   DT  C "O3'" 1 
ATOM   152  C "C2'" . DT  A 1 8   ? 61.174  27.733  67.366  0.50 38.85  ? 8   DT  C "C2'" 1 
ATOM   153  C "C1'" . DT  A 1 8   ? 61.707  26.320  67.523  0.50 38.85  ? 8   DT  C "C1'" 1 
ATOM   154  N N1    . DT  A 1 8   ? 62.931  26.202  68.339  0.50 24.27  ? 8   DT  C N1    1 
ATOM   155  C C2    . DT  A 1 8   ? 63.033  25.137  69.207  0.50 24.27  ? 8   DT  C C2    1 
ATOM   156  O O2    . DT  A 1 8   ? 62.160  24.294  69.337  0.50 24.27  ? 8   DT  C O2    1 
ATOM   157  N N3    . DT  A 1 8   ? 64.203  25.094  69.923  0.50 24.27  ? 8   DT  C N3    1 
ATOM   158  C C4    . DT  A 1 8   ? 65.256  25.987  69.861  0.50 24.27  ? 8   DT  C C4    1 
ATOM   159  O O4    . DT  A 1 8   ? 66.248  25.814  70.564  0.50 24.27  ? 8   DT  C O4    1 
ATOM   160  C C5    . DT  A 1 8   ? 65.080  27.081  68.934  0.50 24.27  ? 8   DT  C C5    1 
ATOM   161  C C7    . DT  A 1 8   ? 66.166  28.101  68.803  0.50 24.27  ? 8   DT  C C7    1 
ATOM   162  C C6    . DT  A 1 8   ? 63.942  27.133  68.229  0.50 24.27  ? 8   DT  C C6    1 
ATOM   163  P P     . DC  A 1 9   ? 58.062  28.035  67.082  0.50 44.83  ? 9   DC  C P     1 
ATOM   164  O OP1   . DC  A 1 9   ? 56.706  27.818  66.519  0.50 44.83  ? 9   DC  C OP1   1 
ATOM   165  O OP2   . DC  A 1 9   ? 58.590  29.417  67.219  0.50 44.83  ? 9   DC  C OP2   1 
ATOM   166  O "O5'" . DC  A 1 9   ? 58.134  27.324  68.503  0.50 44.83  ? 9   DC  C "O5'" 1 
ATOM   167  C "C5'" . DC  A 1 9   ? 58.535  25.960  68.606  0.50 44.83  ? 9   DC  C "C5'" 1 
ATOM   168  C "C4'" . DC  A 1 9   ? 58.237  25.428  69.986  0.50 23.83  ? 9   DC  C "C4'" 1 
ATOM   169  O "O4'" . DC  A 1 9   ? 59.484  25.173  70.678  0.50 44.83  ? 9   DC  C "O4'" 1 
ATOM   170  C "C3'" . DC  A 1 9   ? 57.446  26.385  70.875  0.50 44.83  ? 9   DC  C "C3'" 1 
ATOM   171  O "O3'" . DC  A 1 9   ? 56.524  25.649  71.679  0.50 44.83  ? 9   DC  C "O3'" 1 
ATOM   172  C "C2'" . DC  A 1 9   ? 58.515  27.029  71.738  0.50 44.83  ? 9   DC  C "C2'" 1 
ATOM   173  C "C1'" . DC  A 1 9   ? 59.532  25.911  71.889  0.50 44.83  ? 9   DC  C "C1'" 1 
ATOM   174  N N1    . DC  A 1 9   ? 60.920  26.368  72.082  0.50 23.83  ? 9   DC  C N1    1 
ATOM   175  C C2    . DC  A 1 9   ? 61.761  25.628  72.918  0.50 23.83  ? 9   DC  C C2    1 
ATOM   176  O O2    . DC  A 1 9   ? 61.318  24.606  73.463  0.50 23.83  ? 9   DC  C O2    1 
ATOM   177  N N3    . DC  A 1 9   ? 63.034  26.045  73.111  0.50 23.83  ? 9   DC  C N3    1 
ATOM   178  C C4    . DC  A 1 9   ? 63.472  27.150  72.505  0.50 23.83  ? 9   DC  C C4    1 
ATOM   179  N N4    . DC  A 1 9   ? 64.734  27.527  72.725  0.50 23.83  ? 9   DC  C N4    1 
ATOM   180  C C5    . DC  A 1 9   ? 62.638  27.919  71.644  0.50 23.83  ? 9   DC  C C5    1 
ATOM   181  C C6    . DC  A 1 9   ? 61.381  27.495  71.462  0.50 23.83  ? 9   DC  C C6    1 
ATOM   182  P P     . DG  A 1 10  ? 55.270  26.399  72.340  0.50 45.82  ? 10  DG  C P     1 
ATOM   183  O OP1   . DG  A 1 10  ? 54.036  25.662  71.970  0.50 45.82  ? 10  DG  C OP1   1 
ATOM   184  O OP2   . DG  A 1 10  ? 55.386  27.843  72.015  0.50 45.82  ? 10  DG  C OP2   1 
ATOM   185  O "O5'" . DG  A 1 10  ? 55.516  26.218  73.901  0.50 45.82  ? 10  DG  C "O5'" 1 
ATOM   186  C "C5'" . DG  A 1 10  ? 55.579  24.916  74.479  0.50 45.82  ? 10  DG  C "C5'" 1 
ATOM   187  C "C4'" . DG  A 1 10  ? 56.122  24.997  75.886  0.50 27.17  ? 10  DG  C "C4'" 1 
ATOM   188  O "O4'" . DG  A 1 10  ? 57.546  25.267  75.855  0.50 45.82  ? 10  DG  C "O4'" 1 
ATOM   189  C "C3'" . DG  A 1 10  ? 55.493  26.108  76.730  0.50 45.82  ? 10  DG  C "C3'" 1 
ATOM   190  O "O3'" . DG  A 1 10  ? 55.284  25.657  78.067  0.50 45.82  ? 10  DG  C "O3'" 1 
ATOM   191  C "C2'" . DG  A 1 10  ? 56.550  27.195  76.719  0.50 45.82  ? 10  DG  C "C2'" 1 
ATOM   192  C "C1'" . DG  A 1 10  ? 57.831  26.384  76.680  0.50 45.82  ? 10  DG  C "C1'" 1 
ATOM   193  N N9    . DG  A 1 10  ? 58.970  27.098  76.112  0.50 27.17  ? 10  DG  C N9    1 
ATOM   194  C C8    . DG  A 1 10  ? 58.934  28.089  75.159  0.50 27.17  ? 10  DG  C C8    1 
ATOM   195  N N7    . DG  A 1 10  ? 60.112  28.579  74.882  0.50 27.17  ? 10  DG  C N7    1 
ATOM   196  C C5    . DG  A 1 10  ? 60.982  27.862  75.693  0.50 27.17  ? 10  DG  C C5    1 
ATOM   197  C C6    . DG  A 1 10  ? 62.390  27.958  75.839  0.50 27.17  ? 10  DG  C C6    1 
ATOM   198  O O6    . DG  A 1 10  ? 63.173  28.724  75.269  0.50 27.17  ? 10  DG  C O6    1 
ATOM   199  N N1    . DG  A 1 10  ? 62.871  27.039  76.764  0.50 27.17  ? 10  DG  C N1    1 
ATOM   200  C C2    . DG  A 1 10  ? 62.098  26.147  77.464  0.50 27.17  ? 10  DG  C C2    1 
ATOM   201  N N2    . DG  A 1 10  ? 62.751  25.342  78.308  0.50 27.17  ? 10  DG  C N2    1 
ATOM   202  N N3    . DG  A 1 10  ? 60.784  26.051  77.343  0.50 27.17  ? 10  DG  C N3    1 
ATOM   203  C C4    . DG  A 1 10  ? 60.294  26.935  76.447  0.50 27.17  ? 10  DG  C C4    1 
ATOM   204  P P     . DT  A 1 11  ? 54.398  26.539  79.075  0.50 29.53  ? 11  DT  C P     1 
ATOM   205  O OP1   . DT  A 1 11  ? 53.032  25.961  79.142  0.50 29.53  ? 11  DT  C OP1   1 
ATOM   206  O OP2   . DT  A 1 11  ? 54.572  27.968  78.710  0.50 29.53  ? 11  DT  C OP2   1 
ATOM   207  O "O5'" . DT  A 1 11  ? 55.114  26.302  80.474  0.50 29.53  ? 11  DT  C "O5'" 1 
ATOM   208  C "C5'" . DT  A 1 11  ? 55.650  25.025  80.798  0.50 29.53  ? 11  DT  C "C5'" 1 
ATOM   209  C "C4'" . DT  A 1 11  ? 56.919  25.176  81.602  0.50 23.92  ? 11  DT  C "C4'" 1 
ATOM   210  O "O4'" . DT  A 1 11  ? 57.973  25.734  80.779  0.50 29.53  ? 11  DT  C "O4'" 1 
ATOM   211  C "C3'" . DT  A 1 11  ? 56.797  26.093  82.818  0.50 29.53  ? 11  DT  C "C3'" 1 
ATOM   212  O "O3'" . DT  A 1 11  ? 57.498  25.522  83.922  0.50 29.53  ? 11  DT  C "O3'" 1 
ATOM   213  C "C2'" . DT  A 1 11  ? 57.482  27.371  82.369  0.50 29.53  ? 11  DT  C "C2'" 1 
ATOM   214  C "C1'" . DT  A 1 11  ? 58.561  26.837  81.450  0.50 29.53  ? 11  DT  C "C1'" 1 
ATOM   215  N N1    . DT  A 1 11  ? 59.036  27.796  80.436  0.50 23.92  ? 11  DT  C N1    1 
ATOM   216  C C2    . DT  A 1 11  ? 60.395  27.918  80.253  0.50 23.92  ? 11  DT  C C2    1 
ATOM   217  O O2    . DT  A 1 11  ? 61.212  27.258  80.874  0.50 23.92  ? 11  DT  C O2    1 
ATOM   218  N N3    . DT  A 1 11  ? 60.765  28.847  79.313  0.50 23.92  ? 11  DT  C N3    1 
ATOM   219  C C4    . DT  A 1 11  ? 59.931  29.644  78.555  0.50 23.92  ? 11  DT  C C4    1 
ATOM   220  O O4    . DT  A 1 11  ? 60.410  30.443  77.756  0.50 23.92  ? 11  DT  C O4    1 
ATOM   221  C C5    . DT  A 1 11  ? 58.519  29.455  78.786  0.50 23.92  ? 11  DT  C C5    1 
ATOM   222  C C7    . DT  A 1 11  ? 57.541  30.268  78.001  0.50 23.92  ? 11  DT  C C7    1 
ATOM   223  C C6    . DT  A 1 11  ? 58.147  28.551  79.702  0.50 23.92  ? 11  DT  C C6    1 
ATOM   224  P P     . DA  A 1 12  ? 57.465  26.253  85.347  0.50 26.97  ? 12  DA  C P     1 
ATOM   225  O OP1   . DA  A 1 12  ? 57.325  25.207  86.386  0.50 26.97  ? 12  DA  C OP1   1 
ATOM   226  O OP2   . DA  A 1 12  ? 56.472  27.356  85.275  0.50 26.97  ? 12  DA  C OP2   1 
ATOM   227  O "O5'" . DA  A 1 12  ? 58.919  26.889  85.465  0.50 26.97  ? 12  DA  C "O5'" 1 
ATOM   228  C "C5'" . DA  A 1 12  ? 60.073  26.054  85.474  0.50 26.97  ? 12  DA  C "C5'" 1 
ATOM   229  C "C4'" . DA  A 1 12  ? 61.314  26.876  85.726  0.50 13.43  ? 12  DA  C "C4'" 1 
ATOM   230  O "O4'" . DA  A 1 12  ? 61.652  27.647  84.546  0.50 26.97  ? 12  DA  C "O4'" 1 
ATOM   231  C "C3'" . DA  A 1 12  ? 61.189  27.882  86.871  0.50 26.97  ? 12  DA  C "C3'" 1 
ATOM   232  O "O3'" . DA  A 1 12  ? 62.391  27.896  87.646  0.50 26.97  ? 12  DA  C "O3'" 1 
ATOM   233  C "C2'" . DA  A 1 12  ? 60.999  29.207  86.156  0.50 26.97  ? 12  DA  C "C2'" 1 
ATOM   234  C "C1'" . DA  A 1 12  ? 61.828  29.007  84.903  0.50 26.97  ? 12  DA  C "C1'" 1 
ATOM   235  N N9    . DA  A 1 12  ? 61.424  29.833  83.766  0.50 13.43  ? 12  DA  C N9    1 
ATOM   236  C C8    . DA  A 1 12  ? 60.165  30.008  83.247  0.50 13.43  ? 12  DA  C C8    1 
ATOM   237  N N7    . DA  A 1 12  ? 60.123  30.836  82.231  0.50 13.43  ? 12  DA  C N7    1 
ATOM   238  C C5    . DA  A 1 12  ? 61.444  31.230  82.066  0.50 13.43  ? 12  DA  C C5    1 
ATOM   239  C C6    . DA  A 1 12  ? 62.067  32.106  81.159  0.50 13.43  ? 12  DA  C C6    1 
ATOM   240  N N6    . DA  A 1 12  ? 61.413  32.780  80.210  0.50 13.43  ? 12  DA  C N6    1 
ATOM   241  N N1    . DA  A 1 12  ? 63.403  32.272  81.263  0.50 13.43  ? 12  DA  C N1    1 
ATOM   242  C C2    . DA  A 1 12  ? 64.058  31.605  82.219  0.50 13.43  ? 12  DA  C C2    1 
ATOM   243  N N3    . DA  A 1 12  ? 63.586  30.759  83.132  0.50 13.43  ? 12  DA  C N3    1 
ATOM   244  C C4    . DA  A 1 12  ? 62.257  30.614  83.001  0.50 13.43  ? 12  DA  C C4    1 
ATOM   245  P P     . DT  A 1 13  ? 62.534  28.920  88.874  0.50 27.80  ? 13  DT  C P     1 
ATOM   246  O OP1   . DT  A 1 13  ? 63.448  28.319  89.878  0.50 27.80  ? 13  DT  C OP1   1 
ATOM   247  O OP2   . DT  A 1 13  ? 61.164  29.321  89.278  0.50 27.80  ? 13  DT  C OP2   1 
ATOM   248  O "O5'" . DT  A 1 13  ? 63.267  30.174  88.220  0.50 27.80  ? 13  DT  C "O5'" 1 
ATOM   249  C "C5'" . DT  A 1 13  ? 64.527  30.009  87.576  0.50 27.80  ? 13  DT  C "C5'" 1 
ATOM   250  C "C4'" . DT  A 1 13  ? 65.093  31.344  87.150  0.50 26.91  ? 13  DT  C "C4'" 1 
ATOM   251  O "O4'" . DT  A 1 13  ? 64.411  31.860  85.981  0.50 27.80  ? 13  DT  C "O4'" 1 
ATOM   252  C "C3'" . DT  A 1 13  ? 65.052  32.462  88.195  0.50 27.80  ? 13  DT  C "C3'" 1 
ATOM   253  O "O3'" . DT  A 1 13  ? 66.285  33.177  88.135  0.50 27.80  ? 13  DT  C "O3'" 1 
ATOM   254  C "C2'" . DT  A 1 13  ? 63.942  33.365  87.686  0.50 27.80  ? 13  DT  C "C2'" 1 
ATOM   255  C "C1'" . DT  A 1 13  ? 64.150  33.235  86.192  0.50 27.80  ? 13  DT  C "C1'" 1 
ATOM   256  N N1    . DT  A 1 13  ? 63.023  33.636  85.329  0.50 26.91  ? 13  DT  C N1    1 
ATOM   257  C C2    . DT  A 1 13  ? 63.311  34.457  84.261  0.50 26.91  ? 13  DT  C C2    1 
ATOM   258  O O2    . DT  A 1 13  ? 64.438  34.854  84.010  0.50 26.91  ? 13  DT  C O2    1 
ATOM   259  N N3    . DT  A 1 13  ? 62.227  34.799  83.492  0.50 26.91  ? 13  DT  C N3    1 
ATOM   260  C C4    . DT  A 1 13  ? 60.916  34.412  83.680  0.50 26.91  ? 13  DT  C C4    1 
ATOM   261  O O4    . DT  A 1 13  ? 60.047  34.800  82.904  0.50 26.91  ? 13  DT  C O4    1 
ATOM   262  C C5    . DT  A 1 13  ? 60.685  33.550  84.818  0.50 26.91  ? 13  DT  C C5    1 
ATOM   263  C C7    . DT  A 1 13  ? 59.293  33.078  85.098  0.50 26.91  ? 13  DT  C C7    1 
ATOM   264  C C6    . DT  A 1 13  ? 61.736  33.209  85.577  0.50 26.91  ? 13  DT  C C6    1 
ATOM   265  P P     . DA  A 1 14  ? 66.717  34.134  89.346  0.50 22.56  ? 14  DA  C P     1 
ATOM   266  O OP1   . DA  A 1 14  ? 67.491  33.328  90.322  0.50 22.56  ? 14  DA  C OP1   1 
ATOM   267  O OP2   . DA  A 1 14  ? 65.510  34.873  89.795  0.50 22.56  ? 14  DA  C OP2   1 
ATOM   268  O "O5'" . DA  A 1 14  ? 67.708  35.165  88.647  0.50 22.56  ? 14  DA  C "O5'" 1 
ATOM   269  C "C5'" . DA  A 1 14  ? 68.704  34.701  87.739  0.50 22.56  ? 14  DA  C "C5'" 1 
ATOM   270  C "C4'" . DA  A 1 14  ? 68.957  35.724  86.657  0.50 15.88  ? 14  DA  C "C4'" 1 
ATOM   271  O "O4'" . DA  A 1 14  ? 67.779  35.878  85.828  0.50 22.56  ? 14  DA  C "O4'" 1 
ATOM   272  C "C3'" . DA  A 1 14  ? 69.312  37.126  87.149  0.50 22.56  ? 14  DA  C "C3'" 1 
ATOM   273  O "O3'" . DA  A 1 14  ? 70.329  37.674  86.311  0.50 22.56  ? 14  DA  C "O3'" 1 
ATOM   274  C "C2'" . DA  A 1 14  ? 68.017  37.899  86.979  0.50 22.56  ? 14  DA  C "C2'" 1 
ATOM   275  C "C1'" . DA  A 1 14  ? 67.422  37.250  85.745  0.50 22.56  ? 14  DA  C "C1'" 1 
ATOM   276  N N9    . DA  A 1 14  ? 65.964  37.329  85.662  0.50 15.88  ? 14  DA  C N9    1 
ATOM   277  C C8    . DA  A 1 14  ? 65.043  36.687  86.450  0.50 15.88  ? 14  DA  C C8    1 
ATOM   278  N N7    . DA  A 1 14  ? 63.799  36.955  86.137  0.50 15.88  ? 14  DA  C N7    1 
ATOM   279  C C5    . DA  A 1 14  ? 63.907  37.835  85.069  0.50 15.88  ? 14  DA  C C5    1 
ATOM   280  C C6    . DA  A 1 14  ? 62.942  38.493  84.284  0.50 15.88  ? 14  DA  C C6    1 
ATOM   281  N N6    . DA  A 1 14  ? 61.626  38.362  84.465  0.50 15.88  ? 14  DA  C N6    1 
ATOM   282  N N1    . DA  A 1 14  ? 63.381  39.302  83.294  0.50 15.88  ? 14  DA  C N1    1 
ATOM   283  C C2    . DA  A 1 14  ? 64.702  39.434  83.117  0.50 15.88  ? 14  DA  C C2    1 
ATOM   284  N N3    . DA  A 1 14  ? 65.706  38.872  83.790  0.50 15.88  ? 14  DA  C N3    1 
ATOM   285  C C4    . DA  A 1 14  ? 65.235  38.074  84.765  0.50 15.88  ? 14  DA  C C4    1 
ATOM   286  P P     . DG  A 1 15  ? 70.965  39.103  86.659  0.50 27.51  ? 15  DG  C P     1 
ATOM   287  O OP1   . DG  A 1 15  ? 72.428  39.029  86.415  0.50 27.51  ? 15  DG  C OP1   1 
ATOM   288  O OP2   . DG  A 1 15  ? 70.460  39.514  87.995  0.50 27.51  ? 15  DG  C OP2   1 
ATOM   289  O "O5'" . DG  A 1 15  ? 70.328  40.063  85.563  0.50 27.51  ? 15  DG  C "O5'" 1 
ATOM   290  C "C5'" . DG  A 1 15  ? 70.414  39.735  84.179  0.50 27.51  ? 15  DG  C "C5'" 1 
ATOM   291  C "C4'" . DG  A 1 15  ? 69.834  40.849  83.341  0.50 15.06  ? 15  DG  C "C4'" 1 
ATOM   292  O "O4'" . DG  A 1 15  ? 68.391  40.858  83.455  0.50 27.51  ? 15  DG  C "O4'" 1 
ATOM   293  C "C3'" . DG  A 1 15  ? 70.297  42.247  83.741  0.50 27.51  ? 15  DG  C "C3'" 1 
ATOM   294  O "O3'" . DG  A 1 15  ? 70.483  43.036  82.563  0.50 27.51  ? 15  DG  C "O3'" 1 
ATOM   295  C "C2'" . DG  A 1 15  ? 69.143  42.768  84.579  0.50 27.51  ? 15  DG  C "C2'" 1 
ATOM   296  C "C1'" . DG  A 1 15  ? 67.947  42.131  83.897  0.50 27.51  ? 15  DG  C "C1'" 1 
ATOM   297  N N9    . DG  A 1 15  ? 66.788  41.917  84.757  0.50 15.06  ? 15  DG  C N9    1 
ATOM   298  C C8    . DG  A 1 15  ? 66.776  41.371  86.018  0.50 15.06  ? 15  DG  C C8    1 
ATOM   299  N N7    . DG  A 1 15  ? 65.577  41.284  86.527  0.50 15.06  ? 15  DG  C N7    1 
ATOM   300  C C5    . DG  A 1 15  ? 64.748  41.809  85.545  0.50 15.06  ? 15  DG  C C5    1 
ATOM   301  C C6    . DG  A 1 15  ? 63.338  41.972  85.521  0.50 15.06  ? 15  DG  C C6    1 
ATOM   302  O O6    . DG  A 1 15  ? 62.512  41.670  86.387  0.50 15.06  ? 15  DG  C O6    1 
ATOM   303  N N1    . DG  A 1 15  ? 62.911  42.550  84.333  0.50 15.06  ? 15  DG  C N1    1 
ATOM   304  C C2    . DG  A 1 15  ? 63.732  42.922  83.298  0.50 15.06  ? 15  DG  C C2    1 
ATOM   305  N N2    . DG  A 1 15  ? 63.130  43.471  82.238  0.50 15.06  ? 15  DG  C N2    1 
ATOM   306  N N3    . DG  A 1 15  ? 65.044  42.771  83.304  0.50 15.06  ? 15  DG  C N3    1 
ATOM   307  C C4    . DG  A 1 15  ? 65.482  42.213  84.451  0.50 15.06  ? 15  DG  C C4    1 
ATOM   308  P P     . DC  A 1 16  ? 71.301  44.414  82.644  0.50 53.55  ? 16  DC  C P     1 
ATOM   309  O OP1   . DC  A 1 16  ? 72.335  44.412  81.580  0.50 53.55  ? 16  DC  C OP1   1 
ATOM   310  O OP2   . DC  A 1 16  ? 71.699  44.621  84.059  0.50 53.55  ? 16  DC  C OP2   1 
ATOM   311  O "O5'" . DC  A 1 16  ? 70.202  45.500  82.277  0.50 53.55  ? 16  DC  C "O5'" 1 
ATOM   312  C "C5'" . DC  A 1 16  ? 68.831  45.251  82.557  0.50 53.55  ? 16  DC  C "C5'" 1 
ATOM   313  C "C4'" . DC  A 1 16  ? 67.991  46.432  82.144  0.50 22.95  ? 16  DC  C "C4'" 1 
ATOM   314  O "O4'" . DC  A 1 16  ? 66.622  46.176  82.530  0.50 53.55  ? 16  DC  C "O4'" 1 
ATOM   315  C "C3'" . DC  A 1 16  ? 68.382  47.740  82.827  0.50 53.55  ? 16  DC  C "C3'" 1 
ATOM   316  O "O3'" . DC  A 1 16  ? 68.132  48.827  81.935  0.50 53.55  ? 16  DC  C "O3'" 1 
ATOM   317  C "C2'" . DC  A 1 16  ? 67.453  47.792  84.024  0.50 53.55  ? 16  DC  C "C2'" 1 
ATOM   318  C "C1'" . DC  A 1 16  ? 66.195  47.128  83.489  0.50 53.55  ? 16  DC  C "C1'" 1 
ATOM   319  N N1    . DC  A 1 16  ? 65.436  46.401  84.515  0.50 22.95  ? 16  DC  C N1    1 
ATOM   320  C C2    . DC  A 1 16  ? 64.056  46.309  84.378  0.50 22.95  ? 16  DC  C C2    1 
ATOM   321  O O2    . DC  A 1 16  ? 63.520  46.819  83.386  0.50 22.95  ? 16  DC  C O2    1 
ATOM   322  N N3    . DC  A 1 16  ? 63.340  45.662  85.328  0.50 22.95  ? 16  DC  C N3    1 
ATOM   323  C C4    . DC  A 1 16  ? 63.963  45.117  86.377  0.50 22.95  ? 16  DC  C C4    1 
ATOM   324  N N4    . DC  A 1 16  ? 63.219  44.500  87.299  0.50 22.95  ? 16  DC  C N4    1 
ATOM   325  C C5    . DC  A 1 16  ? 65.377  45.184  86.530  0.50 22.95  ? 16  DC  C C5    1 
ATOM   326  C C6    . DC  A 1 16  ? 66.069  45.831  85.584  0.50 22.95  ? 16  DC  C C6    1 
ATOM   327  P P     . DA  A 1 17  ? 68.784  50.263  82.223  0.50 54.26  ? 17  DA  C P     1 
ATOM   328  O OP1   . DA  A 1 17  ? 69.961  50.430  81.341  0.50 54.26  ? 17  DA  C OP1   1 
ATOM   329  O OP2   . DA  A 1 17  ? 68.946  50.403  83.692  0.50 54.26  ? 17  DA  C OP2   1 
ATOM   330  O "O5'" . DA  A 1 17  ? 67.647  51.267  81.743  0.50 54.26  ? 17  DA  C "O5'" 1 
ATOM   331  C "C5'" . DA  A 1 17  ? 66.924  51.026  80.535  0.50 54.26  ? 17  DA  C "C5'" 1 
ATOM   332  C "C4'" . DA  A 1 17  ? 65.516  51.565  80.648  0.50 34.53  ? 17  DA  C "C4'" 1 
ATOM   333  O "O4'" . DA  A 1 17  ? 64.747  50.774  81.588  0.50 54.26  ? 17  DA  C "O4'" 1 
ATOM   334  C "C3'" . DA  A 1 17  ? 65.440  53.009  81.147  0.50 54.26  ? 17  DA  C "C3'" 1 
ATOM   335  O "O3'" . DA  A 1 17  ? 64.413  53.727  80.453  0.50 54.26  ? 17  DA  C "O3'" 1 
ATOM   336  C "C2'" . DA  A 1 17  ? 65.089  52.855  82.614  0.50 54.26  ? 17  DA  C "C2'" 1 
ATOM   337  C "C1'" . DA  A 1 17  ? 64.216  51.613  82.603  0.50 54.26  ? 17  DA  C "C1'" 1 
ATOM   338  N N9    . DA  A 1 17  ? 64.207  50.854  83.853  0.50 34.53  ? 17  DA  C N9    1 
ATOM   339  C C8    . DA  A 1 17  ? 65.287  50.406  84.565  0.50 34.53  ? 17  DA  C C8    1 
ATOM   340  N N7    . DA  A 1 17  ? 64.967  49.750  85.654  0.50 34.53  ? 17  DA  C N7    1 
ATOM   341  C C5    . DA  A 1 17  ? 63.580  49.766  85.660  0.50 34.53  ? 17  DA  C C5    1 
ATOM   342  C C6    . DA  A 1 17  ? 62.627  49.238  86.555  0.50 34.53  ? 17  DA  C C6    1 
ATOM   343  N N6    . DA  A 1 17  ? 62.940  48.561  87.666  0.50 34.53  ? 17  DA  C N6    1 
ATOM   344  N N1    . DA  A 1 17  ? 61.323  49.436  86.266  0.50 34.53  ? 17  DA  C N1    1 
ATOM   345  C C2    . DA  A 1 17  ? 61.005  50.115  85.155  0.50 34.53  ? 17  DA  C C2    1 
ATOM   346  N N3    . DA  A 1 17  ? 61.805  50.656  84.240  0.50 34.53  ? 17  DA  C N3    1 
ATOM   347  C C4    . DA  A 1 17  ? 63.096  50.445  84.554  0.50 34.53  ? 17  DA  C C4    1 
ATOM   348  P P     . DT  A 1 18  ? 64.414  55.336  80.485  0.50 99.65  ? 18  DT  C P     1 
ATOM   349  O OP1   . DT  A 1 18  ? 64.115  55.852  79.127  0.50 99.65  ? 18  DT  C OP1   1 
ATOM   350  O OP2   . DT  A 1 18  ? 65.653  55.769  81.175  0.50 99.65  ? 18  DT  C OP2   1 
ATOM   351  O "O5'" . DT  A 1 18  ? 63.195  55.705  81.440  0.50 99.65  ? 18  DT  C "O5'" 1 
ATOM   352  C "C5'" . DT  A 1 18  ? 61.862  55.342  81.094  0.50 99.65  ? 18  DT  C "C5'" 1 
ATOM   353  C "C4'" . DT  A 1 18  ? 60.935  55.540  82.273  0.50 95.58  ? 18  DT  C "C4'" 1 
ATOM   354  O "O4'" . DT  A 1 18  ? 61.225  54.566  83.304  0.50 99.65  ? 18  DT  C "O4'" 1 
ATOM   355  C "C3'" . DT  A 1 18  ? 60.999  56.912  82.953  0.50 99.65  ? 18  DT  C "C3'" 1 
ATOM   356  O "O3'" . DT  A 1 18  ? 59.678  57.340  83.315  0.50 99.65  ? 18  DT  C "O3'" 1 
ATOM   357  C "C2'" . DT  A 1 18  ? 61.807  56.638  84.208  0.50 99.65  ? 18  DT  C "C2'" 1 
ATOM   358  C "C1'" . DT  A 1 18  ? 61.350  55.232  84.547  0.50 99.65  ? 18  DT  C "C1'" 1 
ATOM   359  N N1    . DT  A 1 18  ? 62.249  54.439  85.408  0.50 95.58  ? 18  DT  C N1    1 
ATOM   360  C C2    . DT  A 1 18  ? 61.684  53.734  86.448  0.50 95.58  ? 18  DT  C C2    1 
ATOM   361  O O2    . DT  A 1 18  ? 60.487  53.736  86.681  0.50 95.58  ? 18  DT  C O2    1 
ATOM   362  N N3    . DT  A 1 18  ? 62.579  53.023  87.210  0.50 95.58  ? 18  DT  C N3    1 
ATOM   363  C C4    . DT  A 1 18  ? 63.948  52.953  87.044  0.50 95.58  ? 18  DT  C C4    1 
ATOM   364  O O4    . DT  A 1 18  ? 64.623  52.273  87.813  0.50 95.58  ? 18  DT  C O4    1 
ATOM   365  C C5    . DT  A 1 18  ? 64.473  53.722  85.938  0.50 95.58  ? 18  DT  C C5    1 
ATOM   366  C C7    . DT  A 1 18  ? 65.951  53.724  85.695  0.50 95.58  ? 18  DT  C C7    1 
ATOM   367  C C6    . DT  A 1 18  ? 63.608  54.410  85.181  0.50 95.58  ? 18  DT  C C6    1 
ATOM   368  P P     . DA  A 1 19  ? 59.409  58.884  83.696  0.50 95.81  ? 19  DA  C P     1 
ATOM   369  O OP1   . DA  A 1 19  ? 60.027  59.147  85.016  0.50 95.81  ? 19  DA  C OP1   1 
ATOM   370  O OP2   . DA  A 1 19  ? 57.964  59.166  83.497  0.50 95.81  ? 19  DA  C OP2   1 
ATOM   371  O "O5'" . DA  A 1 19  ? 60.210  59.712  82.595  0.50 95.81  ? 19  DA  C "O5'" 1 
ATOM   372  C "C5'" . DA  A 1 19  ? 59.929  59.545  81.205  0.50 95.81  ? 19  DA  C "C5'" 1 
ATOM   373  C "C4'" . DA  A 1 19  ? 59.114  60.712  80.702  0.50 49.69  ? 19  DA  C "C4'" 1 
ATOM   374  O "O4'" . DA  A 1 19  ? 59.865  61.934  80.902  0.50 95.81  ? 19  DA  C "O4'" 1 
ATOM   375  C "C3'" . DA  A 1 19  ? 58.751  60.675  79.216  0.50 95.81  ? 19  DA  C "C3'" 1 
ATOM   376  O "O3'" . DA  A 1 19  ? 57.431  61.201  79.033  0.50 95.81  ? 19  DA  C "O3'" 1 
ATOM   377  C "C2'" . DA  A 1 19  ? 59.768  61.609  78.586  0.50 95.81  ? 19  DA  C "C2'" 1 
ATOM   378  C "C1'" . DA  A 1 19  ? 59.968  62.646  79.677  0.50 95.81  ? 19  DA  C "C1'" 1 
ATOM   379  N N9    . DA  A 1 19  ? 61.285  63.286  79.645  0.50 49.69  ? 19  DA  C N9    1 
ATOM   380  C C8    . DA  A 1 19  ? 62.488  62.684  79.374  0.50 49.69  ? 19  DA  C C8    1 
ATOM   381  N N7    . DA  A 1 19  ? 63.512  63.502  79.413  0.50 49.69  ? 19  DA  C N7    1 
ATOM   382  C C5    . DA  A 1 19  ? 62.948  64.728  79.732  0.50 49.69  ? 19  DA  C C5    1 
ATOM   383  C C6    . DA  A 1 19  ? 63.507  66.005  79.921  0.50 49.69  ? 19  DA  C C6    1 
ATOM   384  N N6    . DA  A 1 19  ? 64.814  66.266  79.814  0.50 49.69  ? 19  DA  C N6    1 
ATOM   385  N N1    . DA  A 1 19  ? 62.668  67.019  80.228  0.50 49.69  ? 19  DA  C N1    1 
ATOM   386  C C2    . DA  A 1 19  ? 61.357  66.755  80.337  0.50 49.69  ? 19  DA  C C2    1 
ATOM   387  N N3    . DA  A 1 19  ? 60.712  65.597  80.183  0.50 49.69  ? 19  DA  C N3    1 
ATOM   388  C C4    . DA  A 1 19  ? 61.574  64.612  79.878  0.50 49.69  ? 19  DA  C C4    1 
ATOM   389  P P     . DC  A 1 20  ? 56.604  60.850  77.698  0.50 99.38  ? 20  DC  C P     1 
ATOM   390  O OP1   . DC  A 1 20  ? 55.461  59.975  78.064  0.50 99.38  ? 20  DC  C OP1   1 
ATOM   391  O OP2   . DC  A 1 20  ? 57.551  60.407  76.644  0.50 99.38  ? 20  DC  C OP2   1 
ATOM   392  O "O5'" . DC  A 1 20  ? 56.018  62.257  77.243  0.50 99.38  ? 20  DC  C "O5'" 1 
ATOM   393  C "C5'" . DC  A 1 20  ? 55.445  63.147  78.194  0.50 99.38  ? 20  DC  C "C5'" 1 
ATOM   394  C "C4'" . DC  A 1 20  ? 55.476  64.562  77.668  0.50 74.37  ? 20  DC  C "C4'" 1 
ATOM   395  O "O4'" . DC  A 1 20  ? 56.820  65.093  77.771  0.50 99.38  ? 20  DC  C "O4'" 1 
ATOM   396  C "C3'" . DC  A 1 20  ? 55.072  64.706  76.200  0.50 99.38  ? 20  DC  C "C3'" 1 
ATOM   397  O "O3'" . DC  A 1 20  ? 54.227  65.850  76.048  0.50 99.38  ? 20  DC  C "O3'" 1 
ATOM   398  C "C2'" . DC  A 1 20  ? 56.397  64.882  75.479  0.50 99.38  ? 20  DC  C "C2'" 1 
ATOM   399  C "C1'" . DC  A 1 20  ? 57.249  65.591  76.514  0.50 99.38  ? 20  DC  C "C1'" 1 
ATOM   400  N N1    . DC  A 1 20  ? 58.695  65.325  76.395  0.50 74.37  ? 20  DC  C N1    1 
ATOM   401  C C2    . DC  A 1 20  ? 59.597  66.312  76.806  0.50 74.37  ? 20  DC  C C2    1 
ATOM   402  O O2    . DC  A 1 20  ? 59.156  67.374  77.270  0.50 74.37  ? 20  DC  C O2    1 
ATOM   403  N N3    . DC  A 1 20  ? 60.927  66.082  76.688  0.50 74.37  ? 20  DC  C N3    1 
ATOM   404  C C4    . DC  A 1 20  ? 61.363  64.924  76.184  0.50 74.37  ? 20  DC  C C4    1 
ATOM   405  N N4    . DC  A 1 20  ? 62.682  64.744  76.076  0.50 74.37  ? 20  DC  C N4    1 
ATOM   406  C C5    . DC  A 1 20  ? 60.464  63.899  75.767  0.50 74.37  ? 20  DC  C C5    1 
ATOM   407  C C6    . DC  A 1 20  ? 59.151  64.140  75.890  0.50 74.37  ? 20  DC  C C6    1 
ATOM   408  P P     . DA  A 1 21  ? 53.921  66.441  74.584  0.50 62.09  ? 21  DA  C P     1 
ATOM   409  O OP1   . DA  A 1 21  ? 52.469  66.743  74.499  0.50 62.09  ? 21  DA  C OP1   1 
ATOM   410  O OP2   . DA  A 1 21  ? 54.545  65.560  73.567  0.50 62.09  ? 21  DA  C OP2   1 
ATOM   411  O "O5'" . DA  A 1 21  ? 54.711  67.821  74.604  0.50 62.09  ? 21  DA  C "O5'" 1 
ATOM   412  C "C5'" . DA  A 1 21  ? 54.797  68.572  75.812  0.50 62.09  ? 21  DA  C "C5'" 1 
ATOM   413  C "C4'" . DA  A 1 21  ? 55.731  69.746  75.642  0.50 10.08  ? 21  DA  C "C4'" 1 
ATOM   414  O "O4'" . DA  A 1 21  ? 57.106  69.300  75.559  0.50 62.09  ? 21  DA  C "O4'" 1 
ATOM   415  C "C3'" . DA  A 1 21  ? 55.484  70.594  74.396  0.50 62.09  ? 21  DA  C "C3'" 1 
ATOM   416  O "O3'" . DA  A 1 21  ? 55.655  71.969  74.732  0.50 62.09  ? 21  DA  C "O3'" 1 
ATOM   417  C "C2'" . DA  A 1 21  ? 56.586  70.151  73.450  0.50 62.09  ? 21  DA  C "C2'" 1 
ATOM   418  C "C1'" . DA  A 1 21  ? 57.717  69.887  74.424  0.50 62.09  ? 21  DA  C "C1'" 1 
ATOM   419  N N9    . DA  A 1 21  ? 58.778  68.991  73.965  0.50 10.08  ? 21  DA  C N9    1 
ATOM   420  C C8    . DA  A 1 21  ? 58.668  67.773  73.342  0.50 10.08  ? 21  DA  C C8    1 
ATOM   421  N N7    . DA  A 1 21  ? 59.824  67.215  73.065  0.50 10.08  ? 21  DA  C N7    1 
ATOM   422  C C5    . DA  A 1 21  ? 60.757  68.129  73.537  0.50 10.08  ? 21  DA  C C5    1 
ATOM   423  C C6    . DA  A 1 21  ? 62.166  68.128  73.549  0.50 10.08  ? 21  DA  C C6    1 
ATOM   424  N N6    . DA  A 1 21  ? 62.912  67.138  73.052  0.50 10.08  ? 21  DA  C N6    1 
ATOM   425  N N1    . DA  A 1 21  ? 62.789  69.194  74.098  0.50 10.08  ? 21  DA  C N1    1 
ATOM   426  C C2    . DA  A 1 21  ? 62.044  70.186  74.596  0.50 10.08  ? 21  DA  C C2    1 
ATOM   427  N N3    . DA  A 1 21  ? 60.719  70.303  74.643  0.50 10.08  ? 21  DA  C N3    1 
ATOM   428  C C4    . DA  A 1 21  ? 60.128  69.227  74.091  0.50 10.08  ? 21  DA  C C4    1 
ATOM   429  P P     . DT  A 1 22  ? 54.979  73.102  73.823  0.50 28.57  ? 22  DT  C P     1 
ATOM   430  O OP1   . DT  A 1 22  ? 53.924  73.768  74.628  0.50 28.57  ? 22  DT  C OP1   1 
ATOM   431  O OP2   . DT  A 1 22  ? 54.629  72.493  72.512  0.50 28.57  ? 22  DT  C OP2   1 
ATOM   432  O "O5'" . DT  A 1 22  ? 56.167  74.134  73.601  0.50 28.57  ? 22  DT  C "O5'" 1 
ATOM   433  C "C5'" . DT  A 1 22  ? 56.899  74.629  74.715  0.50 28.57  ? 22  DT  C "C5'" 1 
ATOM   434  C "C4'" . DT  A 1 22  ? 58.265  75.101  74.279  0.50 26.43  ? 22  DT  C "C4'" 1 
ATOM   435  O "O4'" . DT  A 1 22  ? 59.094  73.973  73.904  0.50 28.57  ? 22  DT  C "O4'" 1 
ATOM   436  C "C3'" . DT  A 1 22  ? 58.268  76.046  73.078  0.50 28.57  ? 22  DT  C "C3'" 1 
ATOM   437  O "O3'" . DT  A 1 22  ? 59.212  77.093  73.306  0.50 28.57  ? 22  DT  C "O3'" 1 
ATOM   438  C "C2'" . DT  A 1 22  ? 58.723  75.160  71.931  0.50 28.57  ? 22  DT  C "C2'" 1 
ATOM   439  C "C1'" . DT  A 1 22  ? 59.678  74.219  72.636  0.50 28.57  ? 22  DT  C "C1'" 1 
ATOM   440  N N1    . DT  A 1 22  ? 59.898  72.920  71.971  0.50 26.43  ? 22  DT  C N1    1 
ATOM   441  C C2    . DT  A 1 22  ? 61.191  72.453  71.898  0.50 26.43  ? 22  DT  C C2    1 
ATOM   442  O O2    . DT  A 1 22  ? 62.148  73.066  72.344  0.50 26.43  ? 22  DT  C O2    1 
ATOM   443  N N3    . DT  A 1 22  ? 61.327  71.236  71.278  0.50 26.43  ? 22  DT  C N3    1 
ATOM   444  C C4    . DT  A 1 22  ? 60.323  70.461  70.732  0.50 26.43  ? 22  DT  C C4    1 
ATOM   445  O O4    . DT  A 1 22  ? 60.599  69.387  70.204  0.50 26.43  ? 22  DT  C O4    1 
ATOM   446  C C5    . DT  A 1 22  ? 58.992  71.014  70.838  0.50 26.43  ? 22  DT  C C5    1 
ATOM   447  C C7    . DT  A 1 22  ? 57.841  70.245  70.270  0.50 26.43  ? 22  DT  C C7    1 
ATOM   448  C C6    . DT  A 1 22  ? 58.848  72.200  71.445  0.50 26.43  ? 22  DT  C C6    1 
ATOM   449  P P     . DT  A 1 23  ? 59.545  78.129  72.133  0.50 27.43  ? 23  DT  C P     1 
ATOM   450  O OP1   . DT  A 1 23  ? 59.846  79.449  72.744  0.50 27.43  ? 23  DT  C OP1   1 
ATOM   451  O OP2   . DT  A 1 23  ? 58.463  78.014  71.126  0.50 27.43  ? 23  DT  C OP2   1 
ATOM   452  O "O5'" . DT  A 1 23  ? 60.886  77.550  71.504  0.50 27.43  ? 23  DT  C "O5'" 1 
ATOM   453  C "C5'" . DT  A 1 23  ? 62.046  77.384  72.313  0.50 27.43  ? 23  DT  C "C5'" 1 
ATOM   454  C "C4'" . DT  A 1 23  ? 63.241  77.040  71.456  0.50 19.48  ? 23  DT  C "C4'" 1 
ATOM   455  O "O4'" . DT  A 1 23  ? 63.159  75.669  70.992  0.50 27.43  ? 23  DT  C "O4'" 1 
ATOM   456  C "C3'" . DT  A 1 23  ? 63.403  77.904  70.204  0.50 27.43  ? 23  DT  C "C3'" 1 
ATOM   457  O "O3'" . DT  A 1 23  ? 64.784  78.219  70.025  0.50 27.43  ? 23  DT  C "O3'" 1 
ATOM   458  C "C2'" . DT  A 1 23  ? 62.930  76.992  69.086  0.50 27.43  ? 23  DT  C "C2'" 1 
ATOM   459  C "C1'" . DT  A 1 23  ? 63.382  75.637  69.593  0.50 27.43  ? 23  DT  C "C1'" 1 
ATOM   460  N N1    . DT  A 1 23  ? 62.662  74.475  69.036  0.50 19.48  ? 23  DT  C N1    1 
ATOM   461  C C2    . DT  A 1 23  ? 63.391  73.336  68.781  0.50 19.48  ? 23  DT  C C2    1 
ATOM   462  O O2    . DT  A 1 23  ? 64.586  73.249  69.003  0.50 19.48  ? 23  DT  C O2    1 
ATOM   463  N N3    . DT  A 1 23  ? 62.667  72.298  68.252  0.50 19.48  ? 23  DT  C N3    1 
ATOM   464  C C4    . DT  A 1 23  ? 61.316  72.283  67.964  0.50 19.48  ? 23  DT  C C4    1 
ATOM   465  O O4    . DT  A 1 23  ? 60.803  71.271  67.488  0.50 19.48  ? 23  DT  C O4    1 
ATOM   466  C C5    . DT  A 1 23  ? 60.611  73.511  68.260  0.50 19.48  ? 23  DT  C C5    1 
ATOM   467  C C7    . DT  A 1 23  ? 59.143  73.589  67.980  0.50 19.48  ? 23  DT  C C7    1 
ATOM   468  C C6    . DT  A 1 23  ? 61.309  74.531  68.776  0.50 19.48  ? 23  DT  C C6    1 
ATOM   469  P P     . DA  A 1 24  ? 65.238  79.157  68.805  0.50 55.73  ? 24  DA  C P     1 
ATOM   470  O OP1   . DA  A 1 24  ? 65.948  80.335  69.365  0.50 55.73  ? 24  DA  C OP1   1 
ATOM   471  O OP2   . DA  A 1 24  ? 64.068  79.359  67.912  0.50 55.73  ? 24  DA  C OP2   1 
ATOM   472  O "O5'" . DA  A 1 24  ? 66.302  78.255  68.042  0.50 55.73  ? 24  DA  C "O5'" 1 
ATOM   473  C "C5'" . DA  A 1 24  ? 67.373  77.642  68.755  0.50 55.73  ? 24  DA  C "C5'" 1 
ATOM   474  C "C4'" . DA  A 1 24  ? 68.110  76.678  67.856  0.50 22.37  ? 24  DA  C "C4'" 1 
ATOM   475  O "O4'" . DA  A 1 24  ? 67.276  75.520  67.602  0.50 55.73  ? 24  DA  C "O4'" 1 
ATOM   476  C "C3'" . DA  A 1 24  ? 68.460  77.265  66.489  0.50 55.73  ? 24  DA  C "C3'" 1 
ATOM   477  O "O3'" . DA  A 1 24  ? 69.761  76.846  66.078  0.50 55.73  ? 24  DA  C "O3'" 1 
ATOM   478  C "C2'" . DA  A 1 24  ? 67.396  76.688  65.574  0.50 55.73  ? 24  DA  C "C2'" 1 
ATOM   479  C "C1'" . DA  A 1 24  ? 67.099  75.341  66.206  0.50 55.73  ? 24  DA  C "C1'" 1 
ATOM   480  N N9    . DA  A 1 24  ? 65.728  74.887  65.977  0.50 22.37  ? 24  DA  C N9    1 
ATOM   481  C C8    . DA  A 1 24  ? 64.569  75.592  66.186  0.50 22.37  ? 24  DA  C C8    1 
ATOM   482  N N7    . DA  A 1 24  ? 63.484  74.941  65.843  0.50 22.37  ? 24  DA  C N7    1 
ATOM   483  C C5    . DA  A 1 24  ? 63.959  73.720  65.386  0.50 22.37  ? 24  DA  C C5    1 
ATOM   484  C C6    . DA  A 1 24  ? 63.308  72.585  64.871  0.50 22.37  ? 24  DA  C C6    1 
ATOM   485  N N6    . DA  A 1 24  ? 61.985  72.497  64.715  0.50 22.37  ? 24  DA  C N6    1 
ATOM   486  N N1    . DA  A 1 24  ? 64.073  71.531  64.512  0.50 22.37  ? 24  DA  C N1    1 
ATOM   487  C C2    . DA  A 1 24  ? 65.400  71.623  64.663  0.50 22.37  ? 24  DA  C C2    1 
ATOM   488  N N3    . DA  A 1 24  ? 66.129  72.636  65.130  0.50 22.37  ? 24  DA  C N3    1 
ATOM   489  C C4    . DA  A 1 24  ? 65.339  73.667  65.477  0.50 22.37  ? 24  DA  C C4    1 
ATOM   490  P P     . DT  A 1 25  ? 70.383  77.407  64.707  0.50 39.46  ? 25  DT  C P     1 
ATOM   491  O OP1   . DT  A 1 25  ? 71.673  78.077  65.016  0.50 39.46  ? 25  DT  C OP1   1 
ATOM   492  O OP2   . DT  A 1 25  ? 69.323  78.155  63.984  0.50 39.46  ? 25  DT  C OP2   1 
ATOM   493  O "O5'" . DT  A 1 25  ? 70.695  76.077  63.893  0.50 39.46  ? 25  DT  C "O5'" 1 
ATOM   494  C "C5'" . DT  A 1 25  ? 71.223  74.937  64.562  0.50 39.46  ? 25  DT  C "C5'" 1 
ATOM   495  C "C4'" . DT  A 1 25  ? 71.016  73.695  63.730  0.50 19.72  ? 25  DT  C "C4'" 1 
ATOM   496  O "O4'" . DT  A 1 25  ? 69.609  73.356  63.674  0.50 39.46  ? 25  DT  C "O4'" 1 
ATOM   497  C "C3'" . DT  A 1 25  ? 71.485  73.814  62.281  0.50 39.46  ? 25  DT  C "C3'" 1 
ATOM   498  O "O3'" . DT  A 1 25  ? 72.114  72.593  61.892  0.50 39.46  ? 25  DT  C "O3'" 1 
ATOM   499  C "C2'" . DT  A 1 25  ? 70.191  74.008  61.510  0.50 39.46  ? 25  DT  C "C2'" 1 
ATOM   500  C "C1'" . DT  A 1 25  ? 69.229  73.165  62.322  0.50 39.46  ? 25  DT  C "C1'" 1 
ATOM   501  N N1    . DT  A 1 25  ? 67.803  73.521  62.185  0.50 19.72  ? 25  DT  C N1    1 
ATOM   502  C C2    . DT  A 1 25  ? 66.962  72.569  61.656  0.50 19.72  ? 25  DT  C C2    1 
ATOM   503  O O2    . DT  A 1 25  ? 67.348  71.470  61.296  0.50 19.72  ? 25  DT  C O2    1 
ATOM   504  N N3    . DT  A 1 25  ? 65.647  72.954  61.559  0.50 19.72  ? 25  DT  C N3    1 
ATOM   505  C C4    . DT  A 1 25  ? 65.104  74.169  61.929  0.50 19.72  ? 25  DT  C C4    1 
ATOM   506  O O4    . DT  A 1 25  ? 63.900  74.369  61.788  0.50 19.72  ? 25  DT  C O4    1 
ATOM   507  C C5    . DT  A 1 25  ? 66.044  75.126  62.470  0.50 19.72  ? 25  DT  C C5    1 
ATOM   508  C C7    . DT  A 1 25  ? 65.545  76.473  62.887  0.50 19.72  ? 25  DT  C C7    1 
ATOM   509  C C6    . DT  A 1 25  ? 67.330  74.758  62.573  0.50 19.72  ? 25  DT  C C6    1 
ATOM   510  P P     . DA  A 1 26  ? 72.893  72.502  60.493  0.50 40.67  ? 26  DA  C P     1 
ATOM   511  O OP1   . DA  A 1 26  ? 74.316  72.180  60.764  0.50 40.67  ? 26  DA  C OP1   1 
ATOM   512  O OP2   . DA  A 1 26  ? 72.552  73.712  59.703  0.50 40.67  ? 26  DA  C OP2   1 
ATOM   513  O "O5'" . DA  A 1 26  ? 72.214  71.247  59.792  0.50 40.67  ? 26  DA  C "O5'" 1 
ATOM   514  C "C5'" . DA  A 1 26  ? 70.799  71.124  59.774  0.50 40.67  ? 26  DA  C "C5'" 1 
ATOM   515  C "C4'" . DA  A 1 26  ? 70.379  70.010  58.846  0.50 21.84  ? 26  DA  C "C4'" 1 
ATOM   516  O "O4'" . DA  A 1 26  ? 68.937  70.031  58.763  0.50 40.67  ? 26  DA  C "O4'" 1 
ATOM   517  C "C3'" . DA  A 1 26  ? 70.871  70.188  57.416  0.50 40.67  ? 26  DA  C "C3'" 1 
ATOM   518  O "O3'" . DA  A 1 26  ? 71.036  68.904  56.803  0.50 40.67  ? 26  DA  C "O3'" 1 
ATOM   519  C "C2'" . DA  A 1 26  ? 69.766  71.003  56.769  0.50 40.67  ? 26  DA  C "C2'" 1 
ATOM   520  C "C1'" . DA  A 1 26  ? 68.511  70.563  57.514  0.50 40.67  ? 26  DA  C "C1'" 1 
ATOM   521  N N9    . DA  A 1 26  ? 67.586  71.658  57.807  0.50 21.84  ? 26  DA  C N9    1 
ATOM   522  C C8    . DA  A 1 26  ? 67.861  72.810  58.502  0.50 21.84  ? 26  DA  C C8    1 
ATOM   523  N N7    . DA  A 1 26  ? 66.828  73.604  58.640  0.50 21.84  ? 26  DA  C N7    1 
ATOM   524  C C5    . DA  A 1 26  ? 65.803  72.934  57.987  0.50 21.84  ? 26  DA  C C5    1 
ATOM   525  C C6    . DA  A 1 26  ? 64.450  73.249  57.779  0.50 21.84  ? 26  DA  C C6    1 
ATOM   526  N N6    . DA  A 1 26  ? 63.870  74.361  58.234  0.50 21.84  ? 26  DA  C N6    1 
ATOM   527  N N1    . DA  A 1 26  ? 63.702  72.370  57.080  0.50 21.84  ? 26  DA  C N1    1 
ATOM   528  C C2    . DA  A 1 26  ? 64.282  71.252  56.629  0.50 21.84  ? 26  DA  C C2    1 
ATOM   529  N N3    . DA  A 1 26  ? 65.541  70.842  56.762  0.50 21.84  ? 26  DA  C N3    1 
ATOM   530  C C4    . DA  A 1 26  ? 66.259  71.738  57.460  0.50 21.84  ? 26  DA  C C4    1 
ATOM   531  P P     . DC  A 1 27  ? 71.849  68.774  55.424  0.50 39.46  ? 27  DC  C P     1 
ATOM   532  O OP1   . DC  A 1 27  ? 72.244  67.354  55.252  0.50 39.46  ? 27  DC  C OP1   1 
ATOM   533  O OP2   . DC  A 1 27  ? 72.891  69.832  55.410  0.50 39.46  ? 27  DC  C OP2   1 
ATOM   534  O "O5'" . DC  A 1 27  ? 70.762  69.131  54.317  0.50 39.46  ? 27  DC  C "O5'" 1 
ATOM   535  C "C5'" . DC  A 1 27  ? 69.417  68.673  54.446  0.50 39.46  ? 27  DC  C "C5'" 1 
ATOM   536  C "C4'" . DC  A 1 27  ? 68.568  69.206  53.316  0.50 30.50  ? 27  DC  C "C4'" 1 
ATOM   537  O "O4'" . DC  A 1 27  ? 67.660  70.215  53.823  0.50 39.46  ? 27  DC  C "O4'" 1 
ATOM   538  C "C3'" . DC  A 1 27  ? 69.347  69.868  52.179  0.50 39.46  ? 27  DC  C "C3'" 1 
ATOM   539  O "O3'" . DC  A 1 27  ? 68.713  69.567  50.934  0.50 39.46  ? 27  DC  C "O3'" 1 
ATOM   540  C "C2'" . DC  A 1 27  ? 69.196  71.349  52.474  0.50 39.46  ? 27  DC  C "C2'" 1 
ATOM   541  C "C1'" . DC  A 1 27  ? 67.794  71.399  53.054  0.50 39.46  ? 27  DC  C "C1'" 1 
ATOM   542  N N1    . DC  A 1 27  ? 67.516  72.549  53.930  0.50 30.50  ? 27  DC  C N1    1 
ATOM   543  C C2    . DC  A 1 27  ? 66.184  72.923  54.145  0.50 30.50  ? 27  DC  C C2    1 
ATOM   544  O O2    . DC  A 1 27  ? 65.281  72.253  53.620  0.50 30.50  ? 27  DC  C O2    1 
ATOM   545  N N3    . DC  A 1 27  ? 65.916  73.999  54.919  0.50 30.50  ? 27  DC  C N3    1 
ATOM   546  C C4    . DC  A 1 27  ? 66.916  74.690  55.470  0.50 30.50  ? 27  DC  C C4    1 
ATOM   547  N N4    . DC  A 1 27  ? 66.605  75.751  56.216  0.50 30.50  ? 27  DC  C N4    1 
ATOM   548  C C5    . DC  A 1 27  ? 68.280  74.322  55.280  0.50 30.50  ? 27  DC  C C5    1 
ATOM   549  C C6    . DC  A 1 27  ? 68.531  73.256  54.512  0.50 30.50  ? 27  DC  C C6    1 
ATOM   550  P P     . DG  A 1 28  ? 69.592  69.070  49.686  0.50 63.07  ? 28  DG  C P     1 
ATOM   551  O OP1   . DG  A 1 28  ? 70.157  67.735  50.009  0.50 63.07  ? 28  DG  C OP1   1 
ATOM   552  O OP2   . DG  A 1 28  ? 70.501  70.178  49.294  0.50 63.07  ? 28  DG  C OP2   1 
ATOM   553  O "O5'" . DG  A 1 28  ? 68.510  68.885  48.535  0.50 63.07  ? 28  DG  C "O5'" 1 
ATOM   554  C "C5'" . DG  A 1 28  ? 67.436  67.962  48.693  0.50 63.07  ? 28  DG  C "C5'" 1 
ATOM   555  C "C4'" . DG  A 1 28  ? 66.132  68.595  48.267  0.50 24.71  ? 28  DG  C "C4'" 1 
ATOM   556  O "O4'" . DG  A 1 28  ? 65.748  69.628  49.207  0.50 63.07  ? 28  DG  C "O4'" 1 
ATOM   557  C "C3'" . DG  A 1 28  ? 66.161  69.260  46.891  0.50 63.07  ? 28  DG  C "C3'" 1 
ATOM   558  O "O3'" . DG  A 1 28  ? 64.942  68.988  46.196  0.50 63.07  ? 28  DG  C "O3'" 1 
ATOM   559  C "C2'" . DG  A 1 28  ? 66.280  70.739  47.216  0.50 63.07  ? 28  DG  C "C2'" 1 
ATOM   560  C "C1'" . DG  A 1 28  ? 65.510  70.848  48.519  0.50 63.07  ? 28  DG  C "C1'" 1 
ATOM   561  N N9    . DG  A 1 28  ? 65.944  71.944  49.383  0.50 24.71  ? 28  DG  C N9    1 
ATOM   562  C C8    . DG  A 1 28  ? 67.236  72.276  49.714  0.50 24.71  ? 28  DG  C C8    1 
ATOM   563  N N7    . DG  A 1 28  ? 67.313  73.311  50.505  0.50 24.71  ? 28  DG  C N7    1 
ATOM   564  C C5    . DG  A 1 28  ? 65.993  73.689  50.711  0.50 24.71  ? 28  DG  C C5    1 
ATOM   565  C C6    . DG  A 1 28  ? 65.449  74.749  51.483  0.50 24.71  ? 28  DG  C C6    1 
ATOM   566  O O6    . DG  A 1 28  ? 66.045  75.594  52.161  0.50 24.71  ? 28  DG  C O6    1 
ATOM   567  N N1    . DG  A 1 28  ? 64.061  74.774  51.413  0.50 24.71  ? 28  DG  C N1    1 
ATOM   568  C C2    . DG  A 1 28  ? 63.292  73.893  50.694  0.50 24.71  ? 28  DG  C C2    1 
ATOM   569  N N2    . DG  A 1 28  ? 61.967  74.090  50.746  0.50 24.71  ? 28  DG  C N2    1 
ATOM   570  N N3    . DG  A 1 28  ? 63.784  72.897  49.974  0.50 24.71  ? 28  DG  C N3    1 
ATOM   571  C C4    . DG  A 1 28  ? 65.133  72.855  50.026  0.50 24.71  ? 28  DG  C C4    1 
ATOM   572  P P     . DA  A 1 29  ? 64.605  69.776  44.839  0.50 63.68  ? 29  DA  C P     1 
ATOM   573  O OP1   . DA  A 1 29  ? 63.651  68.957  44.050  0.50 63.68  ? 29  DA  C OP1   1 
ATOM   574  O OP2   . DA  A 1 29  ? 65.891  70.200  44.229  0.50 63.68  ? 29  DA  C OP2   1 
ATOM   575  O "O5'" . DA  A 1 29  ? 63.840  71.073  45.352  0.50 63.68  ? 29  DA  C "O5'" 1 
ATOM   576  C "C5'" . DA  A 1 29  ? 62.571  70.956  45.988  0.50 63.68  ? 29  DA  C "C5'" 1 
ATOM   577  C "C4'" . DA  A 1 29  ? 61.866  72.291  45.990  0.50 26.92  ? 29  DA  C "C4'" 1 
ATOM   578  O "O4'" . DA  A 1 29  ? 62.446  73.159  46.994  0.50 63.68  ? 29  DA  C "O4'" 1 
ATOM   579  C "C3'" . DA  A 1 29  ? 61.968  73.045  44.665  0.50 63.68  ? 29  DA  C "C3'" 1 
ATOM   580  O "O3'" . DA  A 1 29  ? 60.735  73.704  44.386  0.50 63.68  ? 29  DA  C "O3'" 1 
ATOM   581  C "C2'" . DA  A 1 29  ? 63.051  74.073  44.933  0.50 63.68  ? 29  DA  C "C2'" 1 
ATOM   582  C "C1'" . DA  A 1 29  ? 62.807  74.391  46.395  0.50 63.68  ? 29  DA  C "C1'" 1 
ATOM   583  N N9    . DA  A 1 29  ? 63.961  74.929  47.114  0.50 26.92  ? 29  DA  C N9    1 
ATOM   584  C C8    . DA  A 1 29  ? 65.279  74.548  47.032  0.50 26.92  ? 29  DA  C C8    1 
ATOM   585  N N7    . DA  A 1 29  ? 66.081  75.255  47.793  0.50 26.92  ? 29  DA  C N7    1 
ATOM   586  C C5    . DA  A 1 29  ? 65.233  76.158  48.422  0.50 26.92  ? 29  DA  C C5    1 
ATOM   587  C C6    . DA  A 1 29  ? 65.466  77.187  49.352  0.50 26.92  ? 29  DA  C C6    1 
ATOM   588  N N6    . DA  A 1 29  ? 66.673  77.499  49.826  0.50 26.92  ? 29  DA  C N6    1 
ATOM   589  N N1    . DA  A 1 29  ? 64.400  77.897  49.783  0.50 26.92  ? 29  DA  C N1    1 
ATOM   590  C C2    . DA  A 1 29  ? 63.189  77.586  49.305  0.50 26.92  ? 29  DA  C C2    1 
ATOM   591  N N3    . DA  A 1 29  ? 62.843  76.646  48.429  0.50 26.92  ? 29  DA  C N3    1 
ATOM   592  C C4    . DA  A 1 29  ? 63.925  75.960  48.020  0.50 26.92  ? 29  DA  C C4    1 
ATOM   593  P P     . DA  A 1 30  ? 60.409  74.181  42.890  0.50 68.49  ? 30  DA  C P     1 
ATOM   594  O OP1   . DA  A 1 30  ? 59.524  73.171  42.255  0.50 68.49  ? 30  DA  C OP1   1 
ATOM   595  O OP2   . DA  A 1 30  ? 61.695  74.544  42.241  0.50 68.49  ? 30  DA  C OP2   1 
ATOM   596  O "O5'" . DA  A 1 30  ? 59.574  75.516  43.110  0.50 68.49  ? 30  DA  C "O5'" 1 
ATOM   597  C "C5'" . DA  A 1 30  ? 58.537  75.568  44.084  0.50 68.49  ? 30  DA  C "C5'" 1 
ATOM   598  C "C4'" . DA  A 1 30  ? 58.379  76.979  44.597  0.50 26.24  ? 30  DA  C "C4'" 1 
ATOM   599  O "O4'" . DA  A 1 30  ? 59.506  77.327  45.440  0.50 68.49  ? 30  DA  C "O4'" 1 
ATOM   600  C "C3'" . DA  A 1 30  ? 58.332  78.034  43.493  0.50 68.49  ? 30  DA  C "C3'" 1 
ATOM   601  O "O3'" . DA  A 1 30  ? 57.355  79.027  43.803  0.50 68.49  ? 30  DA  C "O3'" 1 
ATOM   602  C "C2'" . DA  A 1 30  ? 59.730  78.626  43.508  0.50 68.49  ? 30  DA  C "C2'" 1 
ATOM   603  C "C1'" . DA  A 1 30  ? 60.107  78.525  44.973  0.50 68.49  ? 30  DA  C "C1'" 1 
ATOM   604  N N9    . DA  A 1 30  ? 61.547  78.434  45.215  0.50 26.24  ? 30  DA  C N9    1 
ATOM   605  C C8    . DA  A 1 30  ? 62.445  77.562  44.649  0.50 26.24  ? 30  DA  C C8    1 
ATOM   606  N N7    . DA  A 1 30  ? 63.680  77.736  45.054  0.50 26.24  ? 30  DA  C N7    1 
ATOM   607  C C5    . DA  A 1 30  ? 63.591  78.791  45.951  0.50 26.24  ? 30  DA  C C5    1 
ATOM   608  C C6    . DA  A 1 30  ? 64.557  79.457  46.729  0.50 26.24  ? 30  DA  C C6    1 
ATOM   609  N N6    . DA  A 1 30  ? 65.856  79.149  46.724  0.50 26.24  ? 30  DA  C N6    1 
ATOM   610  N N1    . DA  A 1 30  ? 64.137  80.465  47.523  0.50 26.24  ? 30  DA  C N1    1 
ATOM   611  C C2    . DA  A 1 30  ? 62.834  80.776  47.529  0.50 26.24  ? 30  DA  C C2    1 
ATOM   612  N N3    . DA  A 1 30  ? 61.833  80.226  46.843  0.50 26.24  ? 30  DA  C N3    1 
ATOM   613  C C4    . DA  A 1 30  ? 62.283  79.228  46.063  0.50 26.24  ? 30  DA  C C4    1 
ATOM   614  P P     . DT  A 1 31  ? 57.310  80.387  42.954  0.50 62.83  ? 31  DT  C P     1 
ATOM   615  O OP1   . DT  A 1 31  ? 55.909  80.876  42.927  0.50 62.83  ? 31  DT  C OP1   1 
ATOM   616  O OP2   . DT  A 1 31  ? 58.032  80.154  41.677  0.50 62.83  ? 31  DT  C OP2   1 
ATOM   617  O "O5'" . DT  A 1 31  ? 58.171  81.389  43.839  0.50 62.83  ? 31  DT  C "O5'" 1 
ATOM   618  C "C5'" . DT  A 1 31  ? 57.756  81.718  45.161  0.50 62.83  ? 31  DT  C "C5'" 1 
ATOM   619  C "C4'" . DT  A 1 31  ? 58.368  83.032  45.582  0.50 30.39  ? 31  DT  C "C4'" 1 
ATOM   620  O "O4'" . DT  A 1 31  ? 59.774  82.845  45.868  0.50 62.83  ? 31  DT  C "O4'" 1 
ATOM   621  C "C3'" . DT  A 1 31  ? 58.292  84.118  44.511  0.50 62.83  ? 31  DT  C "C3'" 1 
ATOM   622  O "O3'" . DT  A 1 31  ? 58.019  85.381  45.118  0.50 62.83  ? 31  DT  C "O3'" 1 
ATOM   623  C "C2'" . DT  A 1 31  ? 59.674  84.092  43.885  0.50 62.83  ? 31  DT  C "C2'" 1 
ATOM   624  C "C1'" . DT  A 1 31  ? 60.556  83.709  45.059  0.50 62.83  ? 31  DT  C "C1'" 1 
ATOM   625  N N1    . DT  A 1 31  ? 61.787  82.991  44.691  0.50 30.39  ? 31  DT  C N1    1 
ATOM   626  C C2    . DT  A 1 31  ? 62.977  83.437  45.220  0.50 30.39  ? 31  DT  C C2    1 
ATOM   627  O O2    . DT  A 1 31  ? 63.055  84.399  45.968  0.50 30.39  ? 31  DT  C O2    1 
ATOM   628  N N3    . DT  A 1 31  ? 64.079  82.712  44.840  0.50 30.39  ? 31  DT  C N3    1 
ATOM   629  C C4    . DT  A 1 31  ? 64.108  81.613  44.003  0.50 30.39  ? 31  DT  C C4    1 
ATOM   630  O O4    . DT  A 1 31  ? 65.175  81.057  43.758  0.50 30.39  ? 31  DT  C O4    1 
ATOM   631  C C5    . DT  A 1 31  ? 62.825  81.206  43.477  0.50 30.39  ? 31  DT  C C5    1 
ATOM   632  C C7    . DT  A 1 31  ? 62.761  80.035  42.549  0.50 30.39  ? 31  DT  C C7    1 
ATOM   633  C C6    . DT  A 1 31  ? 61.743  81.905  43.845  0.50 30.39  ? 31  DT  C C6    1 
ATOM   634  P P     . DT  A 1 32  ? 58.325  86.731  44.309  0.50 59.66  ? 32  DT  C P     1 
ATOM   635  O OP1   . DT  A 1 32  ? 57.508  87.823  44.897  0.50 59.66  ? 32  DT  C OP1   1 
ATOM   636  O OP2   . DT  A 1 32  ? 58.213  86.426  42.859  0.50 59.66  ? 32  DT  C OP2   1 
ATOM   637  O "O5'" . DT  A 1 32  ? 59.852  87.012  44.650  0.50 59.66  ? 32  DT  C "O5'" 1 
ATOM   638  C "C5'" . DT  A 1 32  ? 60.263  87.178  46.003  0.50 59.66  ? 32  DT  C "C5'" 1 
ATOM   639  C "C4'" . DT  A 1 32  ? 61.508  88.028  46.070  0.50 28.58  ? 32  DT  C "C4'" 1 
ATOM   640  O "O4'" . DT  A 1 32  ? 62.672  87.244  45.716  0.50 59.66  ? 32  DT  C "O4'" 1 
ATOM   641  C "C3'" . DT  A 1 32  ? 61.497  89.230  45.128  0.50 59.66  ? 32  DT  C "C3'" 1 
ATOM   642  O "O3'" . DT  A 1 32  ? 62.047  90.369  45.789  0.50 59.66  ? 32  DT  C "O3'" 1 
ATOM   643  C "C2'" . DT  A 1 32  ? 62.388  88.787  43.979  0.50 59.66  ? 32  DT  C "C2'" 1 
ATOM   644  C "C1'" . DT  A 1 32  ? 63.392  87.889  44.679  0.50 59.66  ? 32  DT  C "C1'" 1 
ATOM   645  N N1    . DT  A 1 32  ? 63.993  86.841  43.833  0.50 28.58  ? 32  DT  C N1    1 
ATOM   646  C C2    . DT  A 1 32  ? 65.354  86.643  43.916  0.50 28.58  ? 32  DT  C C2    1 
ATOM   647  O O2    . DT  A 1 32  ? 66.081  87.308  44.636  0.50 28.58  ? 32  DT  C O2    1 
ATOM   648  N N3    . DT  A 1 32  ? 65.837  85.634  43.120  0.50 28.58  ? 32  DT  C N3    1 
ATOM   649  C C4    . DT  A 1 32  ? 65.113  84.828  42.264  0.50 28.58  ? 32  DT  C C4    1 
ATOM   650  O O4    . DT  A 1 32  ? 65.684  83.956  41.616  0.50 28.58  ? 32  DT  C O4    1 
ATOM   651  C C5    . DT  A 1 32  ? 63.694  85.100  42.215  0.50 28.58  ? 32  DT  C C5    1 
ATOM   652  C C7    . DT  A 1 32  ? 62.831  84.284  41.306  0.50 28.58  ? 32  DT  C C7    1 
ATOM   653  C C6    . DT  A 1 32  ? 63.212  86.078  42.993  0.50 28.58  ? 32  DT  C C6    1 
ATOM   654  P P     . DT  A 1 33  ? 61.997  91.804  45.075  0.50 44.15  ? 33  DT  C P     1 
ATOM   655  O OP1   . DT  A 1 33  ? 61.581  92.811  46.083  0.50 44.15  ? 33  DT  C OP1   1 
ATOM   656  O OP2   . DT  A 1 33  ? 61.221  91.662  43.816  0.50 44.15  ? 33  DT  C OP2   1 
ATOM   657  O "O5'" . DT  A 1 33  ? 63.519  92.068  44.698  0.50 44.15  ? 33  DT  C "O5'" 1 
ATOM   658  C "C5'" . DT  A 1 33  ? 64.520  92.078  45.711  0.50 44.15  ? 33  DT  C "C5'" 1 
ATOM   659  C "C4'" . DT  A 1 33  ? 65.886  92.275  45.097  0.50 31.19  ? 33  DT  C "C4'" 1 
ATOM   660  O "O4'" . DT  A 1 33  ? 66.347  91.056  44.464  0.50 44.15  ? 33  DT  C "O4'" 1 
ATOM   661  C "C3'" . DT  A 1 33  ? 65.948  93.362  44.025  0.50 44.15  ? 33  DT  C "C3'" 1 
ATOM   662  O "O3'" . DT  A 1 33  ? 67.155  94.106  44.170  0.50 44.15  ? 33  DT  C "O3'" 1 
ATOM   663  C "C2'" . DT  A 1 33  ? 65.991  92.571  42.730  0.50 44.15  ? 33  DT  C "C2'" 1 
ATOM   664  C "C1'" . DT  A 1 33  ? 66.787  91.351  43.151  0.50 44.15  ? 33  DT  C "C1'" 1 
ATOM   665  N N1    . DT  A 1 33  ? 66.597  90.149  42.317  0.50 31.19  ? 33  DT  C N1    1 
ATOM   666  C C2    . DT  A 1 33  ? 67.646  89.265  42.219  0.50 31.19  ? 33  DT  C C2    1 
ATOM   667  O O2    . DT  A 1 33  ? 68.707  89.426  42.797  0.50 31.19  ? 33  DT  C O2    1 
ATOM   668  N N3    . DT  A 1 33  ? 67.408  88.179  41.414  0.50 31.19  ? 33  DT  C N3    1 
ATOM   669  C C4    . DT  A 1 33  ? 66.251  87.895  40.718  0.50 31.19  ? 33  DT  C C4    1 
ATOM   670  O O4    . DT  A 1 33  ? 66.184  86.879  40.032  0.50 31.19  ? 33  DT  C O4    1 
ATOM   671  C C5    . DT  A 1 33  ? 65.188  88.862  40.870  0.50 31.19  ? 33  DT  C C5    1 
ATOM   672  C C7    . DT  A 1 33  ? 63.895  88.636  40.152  0.50 31.19  ? 33  DT  C C7    1 
ATOM   673  C C6    . DT  A 1 33  ? 65.409  89.925  41.653  0.50 31.19  ? 33  DT  C C6    1 
ATOM   674  P P     . DA  A 1 34  ? 67.298  95.537  43.461  0.50 57.15  ? 34  DA  C P     1 
ATOM   675  O OP1   . DA  A 1 34  ? 67.039  96.593  44.472  0.50 57.15  ? 34  DA  C OP1   1 
ATOM   676  O OP2   . DA  A 1 34  ? 66.497  95.506  42.211  0.50 57.15  ? 34  DA  C OP2   1 
ATOM   677  O "O5'" . DA  A 1 34  ? 68.837  95.581  43.066  0.50 57.15  ? 34  DA  C "O5'" 1 
ATOM   678  C "C5'" . DA  A 1 34  ? 69.810  94.957  43.899  0.50 57.15  ? 34  DA  C "C5'" 1 
ATOM   679  C "C4'" . DA  A 1 34  ? 70.820  94.213  43.059  0.50 14.55  ? 34  DA  C "C4'" 1 
ATOM   680  O "O4'" . DA  A 1 34  ? 70.207  93.067  42.417  0.50 57.15  ? 34  DA  C "O4'" 1 
ATOM   681  C "C3'" . DA  A 1 34  ? 71.447  95.039  41.935  0.50 57.15  ? 34  DA  C "C3'" 1 
ATOM   682  O "O3'" . DA  A 1 34  ? 72.824  94.690  41.817  0.50 57.15  ? 34  DA  C "O3'" 1 
ATOM   683  C "C2'" . DA  A 1 34  ? 70.704  94.563  40.701  0.50 57.15  ? 34  DA  C "C2'" 1 
ATOM   684  C "C1'" . DA  A 1 34  ? 70.504  93.098  41.031  0.50 57.15  ? 34  DA  C "C1'" 1 
ATOM   685  N N9    . DA  A 1 34  ? 69.416  92.439  40.311  0.50 14.55  ? 34  DA  C N9    1 
ATOM   686  C C8    . DA  A 1 34  ? 68.129  92.878  40.124  0.50 14.55  ? 34  DA  C C8    1 
ATOM   687  N N7    . DA  A 1 34  ? 67.388  92.055  39.420  0.50 14.55  ? 34  DA  C N7    1 
ATOM   688  C C5    . DA  A 1 34  ? 68.243  91.003  39.125  0.50 14.55  ? 34  DA  C C5    1 
ATOM   689  C C6    . DA  A 1 34  ? 68.063  89.807  38.405  0.50 14.55  ? 34  DA  C C6    1 
ATOM   690  N N6    . DA  A 1 34  ? 66.910  89.456  37.827  0.50 14.55  ? 34  DA  C N6    1 
ATOM   691  N N1    . DA  A 1 34  ? 69.120  88.972  38.298  0.50 14.55  ? 34  DA  C N1    1 
ATOM   692  C C2    . DA  A 1 34  ? 70.274  89.324  38.880  0.50 14.55  ? 34  DA  C C2    1 
ATOM   693  N N3    . DA  A 1 34  ? 70.567  90.418  39.581  0.50 14.55  ? 34  DA  C N3    1 
ATOM   694  C C4    . DA  A 1 34  ? 69.495  91.226  39.668  0.50 14.55  ? 34  DA  C C4    1 
ATOM   695  P P     . DT  A 1 35  ? 73.880  95.779  41.302  0.50 63.86  ? 35  DT  C P     1 
ATOM   696  O OP1   . DT  A 1 35  ? 74.377  96.536  42.479  0.50 63.86  ? 35  DT  C OP1   1 
ATOM   697  O OP2   . DT  A 1 35  ? 73.256  96.510  40.169  0.50 63.86  ? 35  DT  C OP2   1 
ATOM   698  O "O5'" . DT  A 1 35  ? 75.071  94.885  40.740  0.50 63.86  ? 35  DT  C "O5'" 1 
ATOM   699  C "C5'" . DT  A 1 35  ? 75.376  94.849  39.347  0.50 63.86  ? 35  DT  C "C5'" 1 
ATOM   700  C "C4'" . DT  A 1 35  ? 75.559  93.420  38.895  0.50 31.73  ? 35  DT  C "C4'" 1 
ATOM   701  O "O4'" . DT  A 1 35  ? 74.258  92.782  38.790  0.50 63.86  ? 35  DT  C "O4'" 1 
ATOM   702  C "C3'" . DT  A 1 35  ? 76.203  93.271  37.515  0.50 63.86  ? 35  DT  C "C3'" 1 
ATOM   703  O "O3'" . DT  A 1 35  ? 76.921  92.036  37.467  0.50 63.86  ? 35  DT  C "O3'" 1 
ATOM   704  C "C2'" . DT  A 1 35  ? 75.008  93.103  36.596  0.50 63.86  ? 35  DT  C "C2'" 1 
ATOM   705  C "C1'" . DT  A 1 35  ? 74.077  92.285  37.469  0.50 63.86  ? 35  DT  C "C1'" 1 
ATOM   706  N N1    . DT  A 1 35  ? 72.650  92.401  37.110  0.50 31.73  ? 35  DT  C N1    1 
ATOM   707  C C2    . DT  A 1 35  ? 72.039  91.295  36.559  0.50 31.73  ? 35  DT  C C2    1 
ATOM   708  O O2    . DT  A 1 35  ? 72.616  90.234  36.381  0.50 31.73  ? 35  DT  C O2    1 
ATOM   709  N N3    . DT  A 1 35  ? 70.720  91.475  36.222  0.50 31.73  ? 35  DT  C N3    1 
ATOM   710  C C4    . DT  A 1 35  ? 69.968  92.622  36.381  0.50 31.73  ? 35  DT  C C4    1 
ATOM   711  O O4    . DT  A 1 35  ? 68.792  92.636  36.025  0.50 31.73  ? 35  DT  C O4    1 
ATOM   712  C C5    . DT  A 1 35  ? 70.667  93.742  36.976  0.50 31.73  ? 35  DT  C C5    1 
ATOM   713  C C7    . DT  A 1 35  ? 69.929  95.024  37.192  0.50 31.73  ? 35  DT  C C7    1 
ATOM   714  C C6    . DT  A 1 35  ? 71.955  93.576  37.308  0.50 31.73  ? 35  DT  C C6    1 
ATOM   715  P P     . DA  B 2 2   ? 65.304  38.791  149.518 0.50 99.11  ? 2   DA  D P     1 
ATOM   716  O OP1   . DA  B 2 2   ? 65.517  37.743  150.549 0.50 99.11  ? 2   DA  D OP1   1 
ATOM   717  O OP2   . DA  B 2 2   ? 64.538  38.465  148.287 0.50 99.11  ? 2   DA  D OP2   1 
ATOM   718  O "O5'" . DA  B 2 2   ? 66.729  39.355  149.080 0.50 99.11  ? 2   DA  D "O5'" 1 
ATOM   719  C "C5'" . DA  B 2 2   ? 67.790  39.490  150.026 0.50 99.11  ? 2   DA  D "C5'" 1 
ATOM   720  C "C4'" . DA  B 2 2   ? 69.130  39.389  149.332 0.50 28.95  ? 2   DA  D "C4'" 1 
ATOM   721  O "O4'" . DA  B 2 2   ? 69.323  38.044  148.829 0.50 99.11  ? 2   DA  D "O4'" 1 
ATOM   722  C "C3'" . DA  B 2 2   ? 69.307  40.318  148.130 0.50 99.11  ? 2   DA  D "C3'" 1 
ATOM   723  O "O3'" . DA  B 2 2   ? 70.645  40.823  148.098 0.50 99.11  ? 2   DA  D "O3'" 1 
ATOM   724  C "C2'" . DA  B 2 2   ? 69.059  39.407  146.943 0.50 99.11  ? 2   DA  D "C2'" 1 
ATOM   725  C "C1'" . DA  B 2 2   ? 69.605  38.081  147.438 0.50 99.11  ? 2   DA  D "C1'" 1 
ATOM   726  N N9    . DA  B 2 2   ? 68.988  36.906  146.823 0.50 28.95  ? 2   DA  D N9    1 
ATOM   727  C C8    . DA  B 2 2   ? 67.650  36.628  146.689 0.50 28.95  ? 2   DA  D C8    1 
ATOM   728  N N7    . DA  B 2 2   ? 67.404  35.487  146.090 0.50 28.95  ? 2   DA  D N7    1 
ATOM   729  C C5    . DA  B 2 2   ? 68.666  34.979  145.810 0.50 28.95  ? 2   DA  D C5    1 
ATOM   730  C C6    . DA  B 2 2   ? 69.090  33.796  145.184 0.50 28.95  ? 2   DA  D C6    1 
ATOM   731  N N6    . DA  B 2 2   ? 68.256  32.869  144.709 0.50 28.95  ? 2   DA  D N6    1 
ATOM   732  N N1    . DA  B 2 2   ? 70.420  33.592  145.062 0.50 28.95  ? 2   DA  D N1    1 
ATOM   733  C C2    . DA  B 2 2   ? 71.257  34.521  145.542 0.50 28.95  ? 2   DA  D C2    1 
ATOM   734  N N3    . DA  B 2 2   ? 70.979  35.671  146.151 0.50 28.95  ? 2   DA  D N3    1 
ATOM   735  C C4    . DA  B 2 2   ? 69.650  35.844  146.255 0.50 28.95  ? 2   DA  D C4    1 
ATOM   736  P P     . DT  B 2 3   ? 71.067  41.886  146.970 0.50 52.87  ? 3   DT  D P     1 
ATOM   737  O OP1   . DT  B 2 3   ? 72.196  42.700  147.493 0.50 52.87  ? 3   DT  D OP1   1 
ATOM   738  O OP2   . DT  B 2 3   ? 69.831  42.561  146.497 0.50 52.87  ? 3   DT  D OP2   1 
ATOM   739  O "O5'" . DT  B 2 3   ? 71.621  40.978  145.786 0.50 52.87  ? 3   DT  D "O5'" 1 
ATOM   740  C "C5'" . DT  B 2 3   ? 72.910  40.378  145.874 0.50 52.87  ? 3   DT  D "C5'" 1 
ATOM   741  C "C4'" . DT  B 2 3   ? 73.310  39.796  144.539 0.50 23.47  ? 3   DT  D "C4'" 1 
ATOM   742  O "O4'" . DT  B 2 3   ? 72.527  38.613  144.251 0.50 52.87  ? 3   DT  D "O4'" 1 
ATOM   743  C "C3'" . DT  B 2 3   ? 73.118  40.733  143.345 0.50 52.87  ? 3   DT  D "C3'" 1 
ATOM   744  O "O3'" . DT  B 2 3   ? 74.182  40.528  142.415 0.50 52.87  ? 3   DT  D "O3'" 1 
ATOM   745  C "C2'" . DT  B 2 3   ? 71.825  40.233  142.729 0.50 52.87  ? 3   DT  D "C2'" 1 
ATOM   746  C "C1'" . DT  B 2 3   ? 71.959  38.741  142.960 0.50 52.87  ? 3   DT  D "C1'" 1 
ATOM   747  N N1    . DT  B 2 3   ? 70.705  37.970  142.930 0.50 23.47  ? 3   DT  D N1    1 
ATOM   748  C C2    . DT  B 2 3   ? 70.763  36.682  142.451 0.50 23.47  ? 3   DT  D C2    1 
ATOM   749  O O2    . DT  B 2 3   ? 71.800  36.158  142.079 0.50 23.47  ? 3   DT  D O2    1 
ATOM   750  N N3    . DT  B 2 3   ? 69.559  36.025  142.425 0.50 23.47  ? 3   DT  D N3    1 
ATOM   751  C C4    . DT  B 2 3   ? 68.333  36.515  142.828 0.50 23.47  ? 3   DT  D C4    1 
ATOM   752  O O4    . DT  B 2 3   ? 67.334  35.805  142.740 0.50 23.47  ? 3   DT  D O4    1 
ATOM   753  C C5    . DT  B 2 3   ? 68.346  37.870  143.334 0.50 23.47  ? 3   DT  D C5    1 
ATOM   754  C C7    . DT  B 2 3   ? 67.065  38.483  143.804 0.50 23.47  ? 3   DT  D C7    1 
ATOM   755  C C6    . DT  B 2 3   ? 69.517  38.521  143.358 0.50 23.47  ? 3   DT  D C6    1 
ATOM   756  P P     . DA  B 2 4   ? 74.927  41.789  141.762 0.50 42.51  ? 4   DA  D P     1 
ATOM   757  O OP1   . DA  B 2 4   ? 75.750  42.441  142.812 0.50 42.51  ? 4   DA  D OP1   1 
ATOM   758  O OP2   . DA  B 2 4   ? 73.911  42.583  141.026 0.50 42.51  ? 4   DA  D OP2   1 
ATOM   759  O "O5'" . DA  B 2 4   ? 75.908  41.119  140.704 0.50 42.51  ? 4   DA  D "O5'" 1 
ATOM   760  C "C5'" . DA  B 2 4   ? 76.827  40.110  141.110 0.50 42.51  ? 4   DA  D "C5'" 1 
ATOM   761  C "C4'" . DA  B 2 4   ? 76.780  38.940  140.155 0.50 21.25  ? 4   DA  D "C4'" 1 
ATOM   762  O "O4'" . DA  B 2 4   ? 75.491  38.286  140.238 0.50 42.51  ? 4   DA  D "O4'" 1 
ATOM   763  C "C3'" . DA  B 2 4   ? 76.977  39.298  138.682 0.50 42.51  ? 4   DA  D "C3'" 1 
ATOM   764  O "O3'" . DA  B 2 4   ? 77.767  38.289  138.047 0.50 42.51  ? 4   DA  D "O3'" 1 
ATOM   765  C "C2'" . DA  B 2 4   ? 75.564  39.298  138.126 0.50 42.51  ? 4   DA  D "C2'" 1 
ATOM   766  C "C1'" . DA  B 2 4   ? 74.897  38.212  138.949 0.50 42.51  ? 4   DA  D "C1'" 1 
ATOM   767  N N9    . DA  B 2 4   ? 73.451  38.370  139.114 0.50 21.25  ? 4   DA  D N9    1 
ATOM   768  C C8    . DA  B 2 4   ? 72.774  39.461  139.603 0.50 21.25  ? 4   DA  D C8    1 
ATOM   769  N N7    . DA  B 2 4   ? 71.474  39.295  139.660 0.50 21.25  ? 4   DA  D N7    1 
ATOM   770  C C5    . DA  B 2 4   ? 71.280  38.010  139.170 0.50 21.25  ? 4   DA  D C5    1 
ATOM   771  C C6    . DA  B 2 4   ? 70.121  37.233  138.982 0.50 21.25  ? 4   DA  D C6    1 
ATOM   772  N N6    . DA  B 2 4   ? 68.891  37.651  139.285 0.50 21.25  ? 4   DA  D N6    1 
ATOM   773  N N1    . DA  B 2 4   ? 70.273  35.994  138.468 0.50 21.25  ? 4   DA  D N1    1 
ATOM   774  C C2    . DA  B 2 4   ? 71.509  35.571  138.172 0.50 21.25  ? 4   DA  D C2    1 
ATOM   775  N N3    . DA  B 2 4   ? 72.673  36.204  138.310 0.50 21.25  ? 4   DA  D N3    1 
ATOM   776  C C4    . DA  B 2 4   ? 72.488  37.433  138.821 0.50 21.25  ? 4   DA  D C4    1 
ATOM   777  P P     . DA  B 2 5   ? 78.252  38.495  136.532 0.50 31.82  ? 5   DA  D P     1 
ATOM   778  O OP1   . DA  B 2 5   ? 79.383  37.568  136.275 0.50 31.82  ? 5   DA  D OP1   1 
ATOM   779  O OP2   . DA  B 2 5   ? 78.431  39.952  136.309 0.50 31.82  ? 5   DA  D OP2   1 
ATOM   780  O "O5'" . DA  B 2 5   ? 77.004  38.001  135.676 0.50 31.82  ? 5   DA  D "O5'" 1 
ATOM   781  C "C5'" . DA  B 2 5   ? 76.781  36.612  135.460 0.50 31.82  ? 5   DA  D "C5'" 1 
ATOM   782  C "C4'" . DA  B 2 5   ? 75.774  36.411  134.353 0.50 21.44  ? 5   DA  D "C4'" 1 
ATOM   783  O "O4'" . DA  B 2 5   ? 74.435  36.681  134.839 0.50 31.82  ? 5   DA  D "O4'" 1 
ATOM   784  C "C3'" . DA  B 2 5   ? 75.980  37.322  133.141 0.50 31.82  ? 5   DA  D "C3'" 1 
ATOM   785  O "O3'" . DA  B 2 5   ? 75.730  36.598  131.931 0.50 31.82  ? 5   DA  D "O3'" 1 
ATOM   786  C "C2'" . DA  B 2 5   ? 74.929  38.399  133.342 0.50 31.82  ? 5   DA  D "C2'" 1 
ATOM   787  C "C1'" . DA  B 2 5   ? 73.801  37.601  133.968 0.50 31.82  ? 5   DA  D "C1'" 1 
ATOM   788  N N9    . DA  B 2 5   ? 72.834  38.375  134.746 0.50 21.44  ? 5   DA  D N9    1 
ATOM   789  C C8    . DA  B 2 5   ? 72.979  39.632  135.282 0.50 21.44  ? 5   DA  D C8    1 
ATOM   790  N N7    . DA  B 2 5   ? 71.911  40.067  135.905 0.50 21.44  ? 5   DA  D N7    1 
ATOM   791  C C5    . DA  B 2 5   ? 71.003  39.025  135.777 0.50 21.44  ? 5   DA  D C5    1 
ATOM   792  C C6    . DA  B 2 5   ? 69.676  38.867  136.216 0.50 21.44  ? 5   DA  D C6    1 
ATOM   793  N N6    . DA  B 2 5   ? 69.004  39.799  136.897 0.50 21.44  ? 5   DA  D N6    1 
ATOM   794  N N1    . DA  B 2 5   ? 69.052  37.703  135.924 0.50 21.44  ? 5   DA  D N1    1 
ATOM   795  C C2    . DA  B 2 5   ? 69.724  36.772  135.235 0.50 21.44  ? 5   DA  D C2    1 
ATOM   796  N N3    . DA  B 2 5   ? 70.970  36.807  134.764 0.50 21.44  ? 5   DA  D N3    1 
ATOM   797  C C4    . DA  B 2 5   ? 71.561  37.974  135.072 0.50 21.44  ? 5   DA  D C4    1 
ATOM   798  P P     . DT  B 2 6   ? 76.218  37.203  130.523 0.50 42.11  ? 6   DT  D P     1 
ATOM   799  O OP1   . DT  B 2 6   ? 76.856  36.116  129.738 0.50 42.11  ? 6   DT  D OP1   1 
ATOM   800  O OP2   . DT  B 2 6   ? 76.978  38.446  130.810 0.50 42.11  ? 6   DT  D OP2   1 
ATOM   801  O "O5'" . DT  B 2 6   ? 74.858  37.607  129.804 0.50 42.11  ? 6   DT  D "O5'" 1 
ATOM   802  C "C5'" . DT  B 2 6   ? 73.716  37.941  130.579 0.50 42.11  ? 6   DT  D "C5'" 1 
ATOM   803  C "C4'" . DT  B 2 6   ? 72.592  36.974  130.298 0.50 23.61  ? 6   DT  D "C4'" 1 
ATOM   804  O "O4'" . DT  B 2 6   ? 71.620  37.081  131.362 0.50 42.11  ? 6   DT  D "O4'" 1 
ATOM   805  C "C3'" . DT  B 2 6   ? 71.843  37.267  129.004 0.50 42.11  ? 6   DT  D "C3'" 1 
ATOM   806  O "O3'" . DT  B 2 6   ? 71.405  36.065  128.366 0.50 42.11  ? 6   DT  D "O3'" 1 
ATOM   807  C "C2'" . DT  B 2 6   ? 70.668  38.109  129.460 0.50 42.11  ? 6   DT  D "C2'" 1 
ATOM   808  C "C1'" . DT  B 2 6   ? 70.412  37.654  130.891 0.50 42.11  ? 6   DT  D "C1'" 1 
ATOM   809  N N1    . DT  B 2 6   ? 70.084  38.776  131.788 0.50 23.61  ? 6   DT  D N1    1 
ATOM   810  C C2    . DT  B 2 6   ? 68.896  38.748  132.477 0.50 23.61  ? 6   DT  D C2    1 
ATOM   811  O O2    . DT  B 2 6   ? 68.105  37.822  132.401 0.50 23.61  ? 6   DT  D O2    1 
ATOM   812  N N3    . DT  B 2 6   ? 68.667  39.850  133.267 0.50 23.61  ? 6   DT  D N3    1 
ATOM   813  C C4    . DT  B 2 6   ? 69.496  40.946  133.433 0.50 23.61  ? 6   DT  D C4    1 
ATOM   814  O O4    . DT  B 2 6   ? 69.156  41.865  134.174 0.50 23.61  ? 6   DT  D O4    1 
ATOM   815  C C5    . DT  B 2 6   ? 70.733  40.899  132.688 0.50 23.61  ? 6   DT  D C5    1 
ATOM   816  C C7    . DT  B 2 6   ? 71.700  42.034  132.811 0.50 23.61  ? 6   DT  D C7    1 
ATOM   817  C C6    . DT  B 2 6   ? 70.961  39.831  131.914 0.50 23.61  ? 6   DT  D C6    1 
ATOM   818  P P     . DT  B 2 7   ? 70.654  36.151  126.947 0.50 32.89  ? 7   DT  D P     1 
ATOM   819  O OP1   . DT  B 2 7   ? 70.883  34.882  126.210 0.50 32.89  ? 7   DT  D OP1   1 
ATOM   820  O OP2   . DT  B 2 7   ? 71.033  37.444  126.321 0.50 32.89  ? 7   DT  D OP2   1 
ATOM   821  O "O5'" . DT  B 2 7   ? 69.116  36.227  127.345 0.50 32.89  ? 7   DT  D "O5'" 1 
ATOM   822  C "C5'" . DT  B 2 7   ? 68.503  35.156  128.055 0.50 32.89  ? 7   DT  D "C5'" 1 
ATOM   823  C "C4'" . DT  B 2 7   ? 67.027  35.422  128.223 0.50 19.69  ? 7   DT  D "C4'" 1 
ATOM   824  O "O4'" . DT  B 2 7   ? 66.829  36.500  129.170 0.50 32.89  ? 7   DT  D "O4'" 1 
ATOM   825  C "C3'" . DT  B 2 7   ? 66.325  35.852  126.937 0.50 32.89  ? 7   DT  D "C3'" 1 
ATOM   826  O "O3'" . DT  B 2 7   ? 65.028  35.259  126.871 0.50 32.89  ? 7   DT  D "O3'" 1 
ATOM   827  C "C2'" . DT  B 2 7   ? 66.219  37.359  127.081 0.50 32.89  ? 7   DT  D "C2'" 1 
ATOM   828  C "C1'" . DT  B 2 7   ? 66.048  37.526  128.579 0.50 32.89  ? 7   DT  D "C1'" 1 
ATOM   829  N N1    . DT  B 2 7   ? 66.515  38.818  129.120 0.50 19.69  ? 7   DT  D N1    1 
ATOM   830  C C2    . DT  B 2 7   ? 65.684  39.495  129.986 0.50 19.69  ? 7   DT  D C2    1 
ATOM   831  O O2    . DT  B 2 7   ? 64.580  39.085  130.306 0.50 19.69  ? 7   DT  D O2    1 
ATOM   832  N N3    . DT  B 2 7   ? 66.196  40.677  130.465 0.50 19.69  ? 7   DT  D N3    1 
ATOM   833  C C4    . DT  B 2 7   ? 67.425  41.238  130.166 0.50 19.69  ? 7   DT  D C4    1 
ATOM   834  O O4    . DT  B 2 7   ? 67.754  42.304  130.681 0.50 19.69  ? 7   DT  D O4    1 
ATOM   835  C C5    . DT  B 2 7   ? 68.236  40.483  129.241 0.50 19.69  ? 7   DT  D C5    1 
ATOM   836  C C7    . DT  B 2 7   ? 69.574  41.023  128.846 0.50 19.69  ? 7   DT  D C7    1 
ATOM   837  C C6    . DT  B 2 7   ? 67.749  39.326  128.772 0.50 19.69  ? 7   DT  D C6    1 
ATOM   838  P P     . DT  B 2 8   ? 64.105  35.514  125.584 0.50 45.15  ? 8   DT  D P     1 
ATOM   839  O OP1   . DT  B 2 8   ? 63.391  34.255  125.261 0.50 45.15  ? 8   DT  D OP1   1 
ATOM   840  O OP2   . DT  B 2 8   ? 64.946  36.168  124.550 0.50 45.15  ? 8   DT  D OP2   1 
ATOM   841  O "O5'" . DT  B 2 8   ? 63.039  36.572  126.109 0.50 45.15  ? 8   DT  D "O5'" 1 
ATOM   842  C "C5'" . DT  B 2 8   ? 62.213  36.266  127.226 0.50 45.15  ? 8   DT  D "C5'" 1 
ATOM   843  C "C4'" . DT  B 2 8   ? 61.312  37.433  127.547 0.50 25.50  ? 8   DT  D "C4'" 1 
ATOM   844  O "O4'" . DT  B 2 8   ? 62.096  38.528  128.081 0.50 45.15  ? 8   DT  D "O4'" 1 
ATOM   845  C "C3'" . DT  B 2 8   ? 60.549  37.999  126.349 0.50 45.15  ? 8   DT  D "C3'" 1 
ATOM   846  O "O3'" . DT  B 2 8   ? 59.219  38.340  126.746 0.50 45.15  ? 8   DT  D "O3'" 1 
ATOM   847  C "C2'" . DT  B 2 8   ? 61.338  39.244  125.985 0.50 45.15  ? 8   DT  D "C2'" 1 
ATOM   848  C "C1'" . DT  B 2 8   ? 61.841  39.710  127.339 0.50 45.15  ? 8   DT  D "C1'" 1 
ATOM   849  N N1    . DT  B 2 8   ? 63.088  40.502  127.306 0.50 25.50  ? 8   DT  D N1    1 
ATOM   850  C C2    . DT  B 2 8   ? 63.146  41.645  128.070 0.50 25.50  ? 8   DT  D C2    1 
ATOM   851  O O2    . DT  B 2 8   ? 62.216  42.037  128.754 0.50 25.50  ? 8   DT  D O2    1 
ATOM   852  N N3    . DT  B 2 8   ? 64.340  42.320  128.002 0.50 25.50  ? 8   DT  D N3    1 
ATOM   853  C C4    . DT  B 2 8   ? 65.453  41.973  127.263 0.50 25.50  ? 8   DT  D C4    1 
ATOM   854  O O4    . DT  B 2 8   ? 66.461  42.674  127.306 0.50 25.50  ? 8   DT  D O4    1 
ATOM   855  C C5    . DT  B 2 8   ? 65.320  40.770  126.477 0.50 25.50  ? 8   DT  D C5    1 
ATOM   856  C C7    . DT  B 2 8   ? 66.473  40.324  125.635 0.50 25.50  ? 8   DT  D C7    1 
ATOM   857  C C6    . DT  B 2 8   ? 64.160  40.102  126.538 0.50 25.50  ? 8   DT  D C6    1 
ATOM   858  P P     . DC  B 2 9   ? 58.149  38.801  125.641 0.50 43.16  ? 9   DC  D P     1 
ATOM   859  O OP1   . DC  B 2 9   ? 56.936  37.956  125.782 0.50 43.16  ? 9   DC  D OP1   1 
ATOM   860  O OP2   . DC  B 2 9   ? 58.846  38.873  124.331 0.50 43.16  ? 9   DC  D OP2   1 
ATOM   861  O "O5'" . DC  B 2 9   ? 57.784  40.281  126.097 0.50 43.16  ? 9   DC  D "O5'" 1 
ATOM   862  C "C5'" . DC  B 2 9   ? 58.488  40.895  127.173 0.50 43.16  ? 9   DC  D "C5'" 1 
ATOM   863  C "C4'" . DC  B 2 9   ? 57.947  42.281  127.429 0.50 9.30   ? 9   DC  D "C4'" 1 
ATOM   864  O "O4'" . DC  B 2 9   ? 59.051  43.162  127.738 0.50 43.16  ? 9   DC  D "O4'" 1 
ATOM   865  C "C3'" . DC  B 2 9   ? 57.227  42.907  126.239 0.50 43.16  ? 9   DC  D "C3'" 1 
ATOM   866  O "O3'" . DC  B 2 9   ? 56.127  43.695  126.698 0.50 43.16  ? 9   DC  D "O3'" 1 
ATOM   867  C "C2'" . DC  B 2 9   ? 58.295  43.769  125.592 0.50 43.16  ? 9   DC  D "C2'" 1 
ATOM   868  C "C1'" . DC  B 2 9   ? 59.154  44.198  126.771 0.50 43.16  ? 9   DC  D "C1'" 1 
ATOM   869  N N1    . DC  B 2 9   ? 60.580  44.355  126.447 0.50 9.30   ? 9   DC  D N1    1 
ATOM   870  C C2    . DC  B 2 9   ? 61.269  45.465  126.946 0.50 9.30   ? 9   DC  D C2    1 
ATOM   871  O O2    . DC  B 2 9   ? 60.656  46.290  127.641 0.50 9.30   ? 9   DC  D O2    1 
ATOM   872  N N3    . DC  B 2 9   ? 62.583  45.610  126.659 0.50 9.30   ? 9   DC  D N3    1 
ATOM   873  C C4    . DC  B 2 9   ? 63.208  44.700  125.908 0.50 9.30   ? 9   DC  D C4    1 
ATOM   874  N N4    . DC  B 2 9   ? 64.505  44.881  125.657 0.50 9.30   ? 9   DC  D N4    1 
ATOM   875  C C5    . DC  B 2 9   ? 62.528  43.564  125.383 0.50 9.30   ? 9   DC  D C5    1 
ATOM   876  C C6    . DC  B 2 9   ? 61.229  43.431  125.674 0.50 9.30   ? 9   DC  D C6    1 
ATOM   877  P P     . DG  B 2 10  ? 55.188  44.446  125.635 0.50 43.45  ? 10  DG  D P     1 
ATOM   878  O OP1   . DG  B 2 10  ? 53.784  44.386  126.115 0.50 43.45  ? 10  DG  D OP1   1 
ATOM   879  O OP2   . DG  B 2 10  ? 55.527  43.926  124.286 0.50 43.45  ? 10  DG  D OP2   1 
ATOM   880  O "O5'" . DG  B 2 10  ? 55.678  45.955  125.728 0.50 43.45  ? 10  DG  D "O5'" 1 
ATOM   881  C "C5'" . DG  B 2 10  ? 55.609  46.660  126.962 0.50 43.45  ? 10  DG  D "C5'" 1 
ATOM   882  C "C4'" . DG  B 2 10  ? 56.069  48.085  126.772 0.50 16.72  ? 10  DG  D "C4'" 1 
ATOM   883  O "O4'" . DG  B 2 10  ? 57.507  48.122  126.607 0.50 43.45  ? 10  DG  D "O4'" 1 
ATOM   884  C "C3'" . DG  B 2 10  ? 55.478  48.766  125.539 0.50 43.45  ? 10  DG  D "C3'" 1 
ATOM   885  O "O3'" . DG  B 2 10  ? 55.135  50.115  125.849 0.50 43.45  ? 10  DG  D "O3'" 1 
ATOM   886  C "C2'" . DG  B 2 10  ? 56.607  48.709  124.525 0.50 43.45  ? 10  DG  D "C2'" 1 
ATOM   887  C "C1'" . DG  B 2 10  ? 57.844  48.792  125.403 0.50 43.45  ? 10  DG  D "C1'" 1 
ATOM   888  N N9    . DG  B 2 10  ? 59.027  48.142  124.848 0.50 16.72  ? 10  DG  D N9    1 
ATOM   889  C C8    . DG  B 2 10  ? 59.063  46.997  124.087 0.50 16.72  ? 10  DG  D C8    1 
ATOM   890  N N7    . DG  B 2 10  ? 60.273  46.652  123.736 0.50 16.72  ? 10  DG  D N7    1 
ATOM   891  C C5    . DG  B 2 10  ? 61.087  47.628  124.297 0.50 16.72  ? 10  DG  D C5    1 
ATOM   892  C C6    . DG  B 2 10  ? 62.496  47.783  124.255 0.50 16.72  ? 10  DG  D C6    1 
ATOM   893  O O6    . DG  B 2 10  ? 63.333  47.069  123.693 0.50 16.72  ? 10  DG  D O6    1 
ATOM   894  N N1    . DG  B 2 10  ? 62.908  48.908  124.960 0.50 16.72  ? 10  DG  D N1    1 
ATOM   895  C C2    . DG  B 2 10  ? 62.074  49.775  125.620 0.50 16.72  ? 10  DG  D C2    1 
ATOM   896  N N2    . DG  B 2 10  ? 62.670  50.804  126.243 0.50 16.72  ? 10  DG  D N2    1 
ATOM   897  N N3    . DG  B 2 10  ? 60.756  49.645  125.665 0.50 16.72  ? 10  DG  D N3    1 
ATOM   898  C C4    . DG  B 2 10  ? 60.334  48.555  124.987 0.50 16.72  ? 10  DG  D C4    1 
ATOM   899  P P     . DT  B 2 11  ? 54.430  51.028  124.736 0.50 29.96  ? 11  DT  D P     1 
ATOM   900  O OP1   . DT  B 2 11  ? 53.507  51.967  125.420 0.50 29.96  ? 11  DT  D OP1   1 
ATOM   901  O OP2   . DT  B 2 11  ? 53.910  50.127  123.678 0.50 29.96  ? 11  DT  D OP2   1 
ATOM   902  O "O5'" . DT  B 2 11  ? 55.647  51.859  124.136 0.50 29.96  ? 11  DT  D "O5'" 1 
ATOM   903  C "C5'" . DT  B 2 11  ? 56.474  52.639  124.993 0.50 29.96  ? 11  DT  D "C5'" 1 
ATOM   904  C "C4'" . DT  B 2 11  ? 57.610  53.258  124.212 0.50 25.48  ? 11  DT  D "C4'" 1 
ATOM   905  O "O4'" . DT  B 2 11  ? 58.614  52.267  123.883 0.50 29.96  ? 11  DT  D "O4'" 1 
ATOM   906  C "C3'" . DT  B 2 11  ? 57.210  53.913  122.889 0.50 29.96  ? 11  DT  D "C3'" 1 
ATOM   907  O "O3'" . DT  B 2 11  ? 57.961  55.112  122.725 0.50 29.96  ? 11  DT  D "O3'" 1 
ATOM   908  C "C2'" . DT  B 2 11  ? 57.677  52.908  121.853 0.50 29.96  ? 11  DT  D "C2'" 1 
ATOM   909  C "C1'" . DT  B 2 11  ? 58.942  52.400  122.513 0.50 29.96  ? 11  DT  D "C1'" 1 
ATOM   910  N N1    . DT  B 2 11  ? 59.451  51.106  122.027 0.50 25.48  ? 11  DT  D N1    1 
ATOM   911  C C2    . DT  B 2 11  ? 60.812  50.905  122.070 0.50 25.48  ? 11  DT  D C2    1 
ATOM   912  O O2    . DT  B 2 11  ? 61.593  51.735  122.507 0.50 25.48  ? 11  DT  D O2    1 
ATOM   913  N N3    . DT  B 2 11  ? 61.227  49.693  121.581 0.50 25.48  ? 11  DT  D N3    1 
ATOM   914  C C4    . DT  B 2 11  ? 60.435  48.686  121.068 0.50 25.48  ? 11  DT  D C4    1 
ATOM   915  O O4    . DT  B 2 11  ? 60.953  47.651  120.657 0.50 25.48  ? 11  DT  D O4    1 
ATOM   916  C C5    . DT  B 2 11  ? 59.015  48.960  121.062 0.50 25.48  ? 11  DT  D C5    1 
ATOM   917  C C7    . DT  B 2 11  ? 58.078  47.923  120.529 0.50 25.48  ? 11  DT  D C7    1 
ATOM   918  C C6    . DT  B 2 11  ? 58.600  50.140  121.538 0.50 25.48  ? 11  DT  D C6    1 
ATOM   919  P P     . DA  B 2 12  ? 57.330  56.345  121.922 0.50 29.15  ? 12  DA  D P     1 
ATOM   920  O OP1   . DA  B 2 12  ? 56.226  56.914  122.736 0.50 29.15  ? 12  DA  D OP1   1 
ATOM   921  O OP2   . DA  B 2 12  ? 57.065  55.896  120.532 0.50 29.15  ? 12  DA  D OP2   1 
ATOM   922  O "O5'" . DA  B 2 12  ? 58.526  57.391  121.893 0.50 29.15  ? 12  DA  D "O5'" 1 
ATOM   923  C "C5'" . DA  B 2 12  ? 59.246  57.695  123.085 0.50 29.15  ? 12  DA  D "C5'" 1 
ATOM   924  C "C4'" . DA  B 2 12  ? 60.730  57.723  122.805 0.50 16.55  ? 12  DA  D "C4'" 1 
ATOM   925  O "O4'" . DA  B 2 12  ? 61.207  56.379  122.548 0.50 29.15  ? 12  DA  D "O4'" 1 
ATOM   926  C "C3'" . DA  B 2 12  ? 61.116  58.552  121.580 0.50 29.15  ? 12  DA  D "C3'" 1 
ATOM   927  O "O3'" . DA  B 2 12  ? 62.310  59.291  121.831 0.50 29.15  ? 12  DA  D "O3'" 1 
ATOM   928  C "C2'" . DA  B 2 12  ? 61.367  57.507  120.509 0.50 29.15  ? 12  DA  D "C2'" 1 
ATOM   929  C "C1'" . DA  B 2 12  ? 61.917  56.352  121.321 0.50 29.15  ? 12  DA  D "C1'" 1 
ATOM   930  N N9    . DA  B 2 12  ? 61.714  55.041  120.705 0.50 16.55  ? 12  DA  D N9    1 
ATOM   931  C C8    . DA  B 2 12  ? 60.529  54.410  120.422 0.50 16.55  ? 12  DA  D C8    1 
ATOM   932  N N7    . DA  B 2 12  ? 60.677  53.239  119.848 0.50 16.55  ? 12  DA  D N7    1 
ATOM   933  C C5    . DA  B 2 12  ? 62.053  53.089  119.748 0.50 16.55  ? 12  DA  D C5    1 
ATOM   934  C C6    . DA  B 2 12  ? 62.859  52.059  119.227 0.50 16.55  ? 12  DA  D C6    1 
ATOM   935  N N6    . DA  B 2 12  ? 62.374  50.939  118.686 0.50 16.55  ? 12  DA  D N6    1 
ATOM   936  N N1    . DA  B 2 12  ? 64.200  52.222  119.281 0.50 16.55  ? 12  DA  D N1    1 
ATOM   937  C C2    . DA  B 2 12  ? 64.686  53.345  119.825 0.50 16.55  ? 12  DA  D C2    1 
ATOM   938  N N3    . DA  B 2 12  ? 64.032  54.381  120.348 0.50 16.55  ? 12  DA  D N3    1 
ATOM   939  C C4    . DA  B 2 12  ? 62.704  54.189  120.277 0.50 16.55  ? 12  DA  D C4    1 
ATOM   940  P P     . DT  B 2 13  ? 62.845  60.324  120.728 0.50 35.33  ? 13  DT  D P     1 
ATOM   941  O OP1   . DT  B 2 13  ? 63.767  61.282  121.391 0.50 35.33  ? 13  DT  D OP1   1 
ATOM   942  O OP2   . DT  B 2 13  ? 61.660  60.835  119.995 0.50 35.33  ? 13  DT  D OP2   1 
ATOM   943  O "O5'" . DT  B 2 13  ? 63.687  59.408  119.735 0.50 35.33  ? 13  DT  D "O5'" 1 
ATOM   944  C "C5'" . DT  B 2 13  ? 64.908  58.816  120.166 0.50 35.33  ? 13  DT  D "C5'" 1 
ATOM   945  C "C4'" . DT  B 2 13  ? 65.607  58.141  119.010 0.50 38.24  ? 13  DT  D "C4'" 1 
ATOM   946  O "O4'" . DT  B 2 13  ? 64.955  56.895  118.661 0.50 35.33  ? 13  DT  D "O4'" 1 
ATOM   947  C "C3'" . DT  B 2 13  ? 65.681  58.957  117.718 0.50 35.33  ? 13  DT  D "C3'" 1 
ATOM   948  O "O3'" . DT  B 2 13  ? 66.966  58.769  117.129 0.50 35.33  ? 13  DT  D "O3'" 1 
ATOM   949  C "C2'" . DT  B 2 13  ? 64.634  58.301  116.835 0.50 35.33  ? 13  DT  D "C2'" 1 
ATOM   950  C "C1'" . DT  B 2 13  ? 64.784  56.853  117.256 0.50 35.33  ? 13  DT  D "C1'" 1 
ATOM   951  N N1    . DT  B 2 13  ? 63.649  55.961  116.951 0.50 38.24  ? 13  DT  D N1    1 
ATOM   952  C C2    . DT  B 2 13  ? 63.945  54.708  116.461 0.50 38.24  ? 13  DT  D C2    1 
ATOM   953  O O2    . DT  B 2 13  ? 65.086  54.318  116.280 0.50 38.24  ? 13  DT  D O2    1 
ATOM   954  N N3    . DT  B 2 13  ? 62.852  53.925  116.192 0.50 38.24  ? 13  DT  D N3    1 
ATOM   955  C C4    . DT  B 2 13  ? 61.523  54.259  116.360 0.50 38.24  ? 13  DT  D C4    1 
ATOM   956  O O4    . DT  B 2 13  ? 60.648  53.447  116.074 0.50 38.24  ? 13  DT  D O4    1 
ATOM   957  C C5    . DT  B 2 13  ? 61.284  55.587  116.880 0.50 38.24  ? 13  DT  D C5    1 
ATOM   958  C C7    . DT  B 2 13  ? 59.874  56.037  117.096 0.50 38.24  ? 13  DT  D C7    1 
ATOM   959  C C6    . DT  B 2 13  ? 62.345  56.361  117.147 0.50 38.24  ? 13  DT  D C6    1 
ATOM   960  P P     . DA  B 2 14  ? 67.521  59.832  116.066 0.50 37.41  ? 14  DA  D P     1 
ATOM   961  O OP1   . DA  B 2 14  ? 68.117  60.972  116.807 0.50 37.41  ? 14  DA  D OP1   1 
ATOM   962  O OP2   . DA  B 2 14  ? 66.442  60.083  115.079 0.50 37.41  ? 14  DA  D OP2   1 
ATOM   963  O "O5'" . DA  B 2 14  ? 68.691  59.033  115.343 0.50 37.41  ? 14  DA  D "O5'" 1 
ATOM   964  C "C5'" . DA  B 2 14  ? 69.566  58.197  116.096 0.50 37.41  ? 14  DA  D "C5'" 1 
ATOM   965  C "C4'" . DA  B 2 14  ? 69.958  56.983  115.286 0.50 27.06  ? 14  DA  D "C4'" 1 
ATOM   966  O "O4'" . DA  B 2 14  ? 68.822  56.098  115.136 0.50 37.41  ? 14  DA  D "O4'" 1 
ATOM   967  C "C3'" . DA  B 2 14  ? 70.432  57.306  113.872 0.50 37.41  ? 14  DA  D "C3'" 1 
ATOM   968  O "O3'" . DA  B 2 14  ? 71.534  56.471  113.522 0.50 37.41  ? 14  DA  D "O3'" 1 
ATOM   969  C "C2'" . DA  B 2 14  ? 69.223  56.996  113.008 0.50 37.41  ? 14  DA  D "C2'" 1 
ATOM   970  C "C1'" . DA  B 2 14  ? 68.564  55.855  113.760 0.50 37.41  ? 14  DA  D "C1'" 1 
ATOM   971  N N9    . DA  B 2 14  ? 67.113  55.776  113.586 0.50 27.06  ? 14  DA  D N9    1 
ATOM   972  C C8    . DA  B 2 14  ? 66.181  56.733  113.900 0.50 27.06  ? 14  DA  D C8    1 
ATOM   973  N N7    . DA  B 2 14  ? 64.946  56.375  113.642 0.50 27.06  ? 14  DA  D N7    1 
ATOM   974  C C5    . DA  B 2 14  ? 65.073  55.096  113.120 0.50 27.06  ? 14  DA  D C5    1 
ATOM   975  C C6    . DA  B 2 14  ? 64.124  54.166  112.655 0.50 27.06  ? 14  DA  D C6    1 
ATOM   976  N N6    . DA  B 2 14  ? 62.808  54.393  112.640 0.50 27.06  ? 14  DA  D N6    1 
ATOM   977  N N1    . DA  B 2 14  ? 64.581  52.978  112.199 0.50 27.06  ? 14  DA  D N1    1 
ATOM   978  C C2    . DA  B 2 14  ? 65.900  52.751  112.215 0.50 27.06  ? 14  DA  D C2    1 
ATOM   979  N N3    . DA  B 2 14  ? 66.889  53.544  112.628 0.50 27.06  ? 14  DA  D N3    1 
ATOM   980  C C4    . DA  B 2 14  ? 66.403  54.715  113.076 0.50 27.06  ? 14  DA  D C4    1 
ATOM   981  P P     . DT  B 2 15  ? 72.219  56.630  112.081 0.50 55.91  ? 15  DT  D P     1 
ATOM   982  O OP1   . DT  B 2 15  ? 73.684  56.449  112.233 0.50 55.91  ? 15  DT  D OP1   1 
ATOM   983  O OP2   . DT  B 2 15  ? 71.692  57.876  111.466 0.50 55.91  ? 15  DT  D OP2   1 
ATOM   984  O "O5'" . DT  B 2 15  ? 71.642  55.389  111.274 0.50 55.91  ? 15  DT  D "O5'" 1 
ATOM   985  C "C5'" . DT  B 2 15  ? 71.835  54.063  111.756 0.50 55.91  ? 15  DT  D "C5'" 1 
ATOM   986  C "C4'" . DT  B 2 15  ? 71.441  53.064  110.696 0.50 59.02  ? 15  DT  D "C4'" 1 
ATOM   987  O "O4'" . DT  B 2 15  ? 69.997  53.010  110.593 0.50 55.91  ? 15  DT  D "O4'" 1 
ATOM   988  C "C3'" . DT  B 2 15  ? 71.958  53.403  109.299 0.50 55.91  ? 15  DT  D "C3'" 1 
ATOM   989  O "O3'" . DT  B 2 15  ? 72.404  52.213  108.643 0.50 55.91  ? 15  DT  D "O3'" 1 
ATOM   990  C "C2'" . DT  B 2 15  ? 70.751  54.018  108.612 0.50 55.91  ? 15  DT  D "C2'" 1 
ATOM   991  C "C1'" . DT  B 2 15  ? 69.588  53.293  109.262 0.50 55.91  ? 15  DT  D "C1'" 1 
ATOM   992  N N1    . DT  B 2 15  ? 68.338  54.074  109.326 0.50 59.02  ? 15  DT  D N1    1 
ATOM   993  C C2    . DT  B 2 15  ? 67.160  53.455  108.965 0.50 59.02  ? 15  DT  D C2    1 
ATOM   994  O O2    . DT  B 2 15  ? 67.103  52.295  108.591 0.50 59.02  ? 15  DT  D O2    1 
ATOM   995  N N3    . DT  B 2 15  ? 66.045  54.249  109.061 0.50 59.02  ? 15  DT  D N3    1 
ATOM   996  C C4    . DT  B 2 15  ? 65.991  55.569  109.468 0.50 59.02  ? 15  DT  D C4    1 
ATOM   997  O O4    . DT  B 2 15  ? 64.912  56.155  109.506 0.50 59.02  ? 15  DT  D O4    1 
ATOM   998  C C5    . DT  B 2 15  ? 67.262  56.154  109.824 0.50 59.02  ? 15  DT  D C5    1 
ATOM   999  C C7    . DT  B 2 15  ? 67.302  57.584  110.267 0.50 59.02  ? 15  DT  D C7    1 
ATOM   1000 C C6    . DT  B 2 15  ? 68.355  55.390  109.740 0.50 59.02  ? 15  DT  D C6    1 
ATOM   1001 P P     . DA  B 2 16  ? 72.532  52.177  107.044 0.50 49.91  ? 16  DA  D P     1 
ATOM   1002 O OP1   . DA  B 2 16  ? 73.673  51.294  106.707 0.50 49.91  ? 16  DA  D OP1   1 
ATOM   1003 O OP2   . DA  B 2 16  ? 72.503  53.567  106.522 0.50 49.91  ? 16  DA  D OP2   1 
ATOM   1004 O "O5'" . DA  B 2 16  ? 71.189  51.444  106.613 0.50 49.91  ? 16  DA  D "O5'" 1 
ATOM   1005 C "C5'" . DA  B 2 16  ? 70.731  50.315  107.347 0.50 49.91  ? 16  DA  D "C5'" 1 
ATOM   1006 C "C4'" . DA  B 2 16  ? 69.622  49.621  106.595 0.50 14.86  ? 16  DA  D "C4'" 1 
ATOM   1007 O "O4'" . DA  B 2 16  ? 68.398  50.383  106.705 0.50 49.91  ? 16  DA  D "O4'" 1 
ATOM   1008 C "C3'" . DA  B 2 16  ? 69.891  49.451  105.103 0.50 49.91  ? 16  DA  D "C3'" 1 
ATOM   1009 O "O3'" . DA  B 2 16  ? 69.417  48.174  104.677 0.50 49.91  ? 16  DA  D "O3'" 1 
ATOM   1010 C "C2'" . DA  B 2 16  ? 69.099  50.584  104.474 0.50 49.91  ? 16  DA  D "C2'" 1 
ATOM   1011 C "C1'" . DA  B 2 16  ? 67.915  50.730  105.416 0.50 49.91  ? 16  DA  D "C1'" 1 
ATOM   1012 N N9    . DA  B 2 16  ? 67.362  52.080  105.504 0.50 14.86  ? 16  DA  D N9    1 
ATOM   1013 C C8    . DA  B 2 16  ? 68.035  53.255  105.734 0.50 14.86  ? 16  DA  D C8    1 
ATOM   1014 N N7    . DA  B 2 16  ? 67.257  54.308  105.788 0.50 14.86  ? 16  DA  D N7    1 
ATOM   1015 C C5    . DA  B 2 16  ? 65.984  53.795  105.573 0.50 14.86  ? 16  DA  D C5    1 
ATOM   1016 C C6    . DA  B 2 16  ? 64.714  54.399  105.518 0.50 14.86  ? 16  DA  D C6    1 
ATOM   1017 N N6    . DA  B 2 16  ? 64.509  55.707  105.683 0.50 14.86  ? 16  DA  D N6    1 
ATOM   1018 N N1    . DA  B 2 16  ? 63.648  53.602  105.285 0.50 14.86  ? 16  DA  D N1    1 
ATOM   1019 C C2    . DA  B 2 16  ? 63.855  52.289  105.120 0.50 14.86  ? 16  DA  D C2    1 
ATOM   1020 N N3    . DA  B 2 16  ? 64.997  51.606  105.153 0.50 14.86  ? 16  DA  D N3    1 
ATOM   1021 C C4    . DA  B 2 16  ? 66.036  52.426  105.387 0.50 14.86  ? 16  DA  D C4    1 
ATOM   1022 P P     . DC  B 2 17  ? 69.701  47.686  103.177 0.50 97.03  ? 17  DC  D P     1 
ATOM   1023 O OP1   . DC  B 2 17  ? 69.991  46.234  103.215 0.50 97.03  ? 17  DC  D OP1   1 
ATOM   1024 O OP2   . DC  B 2 17  ? 70.685  48.615  102.564 0.50 97.03  ? 17  DC  D OP2   1 
ATOM   1025 O "O5'" . DC  B 2 17  ? 68.294  47.899  102.469 0.50 97.03  ? 17  DC  D "O5'" 1 
ATOM   1026 C "C5'" . DC  B 2 17  ? 67.090  47.518  103.132 0.50 97.03  ? 17  DC  D "C5'" 1 
ATOM   1027 C "C4'" . DC  B 2 17  ? 65.891  47.896  102.295 0.50 76.25  ? 17  DC  D "C4'" 1 
ATOM   1028 O "O4'" . DC  B 2 17  ? 65.510  49.270  102.558 0.50 97.03  ? 17  DC  D "O4'" 1 
ATOM   1029 C "C3'" . DC  B 2 17  ? 66.147  47.810  100.791 0.50 97.03  ? 17  DC  D "C3'" 1 
ATOM   1030 O "O3'" . DC  B 2 17  ? 64.987  47.319  100.124 0.50 97.03  ? 17  DC  D "O3'" 1 
ATOM   1031 C "C2'" . DC  B 2 17  ? 66.398  49.253  100.396 0.50 97.03  ? 17  DC  D "C2'" 1 
ATOM   1032 C "C1'" . DC  B 2 17  ? 65.463  49.990  101.336 0.50 97.03  ? 17  DC  D "C1'" 1 
ATOM   1033 N N1    . DC  B 2 17  ? 65.813  51.394  101.611 0.50 76.25  ? 17  DC  D N1    1 
ATOM   1034 C C2    . DC  B 2 17  ? 64.777  52.312  101.800 0.50 76.25  ? 17  DC  D C2    1 
ATOM   1035 O O2    . DC  B 2 17  ? 63.605  51.913  101.737 0.50 76.25  ? 17  DC  D O2    1 
ATOM   1036 N N3    . DC  B 2 17  ? 65.077  53.608  102.043 0.50 76.25  ? 17  DC  D N3    1 
ATOM   1037 C C4    . DC  B 2 17  ? 66.352  53.998  102.103 0.50 76.25  ? 17  DC  D C4    1 
ATOM   1038 N N4    . DC  B 2 17  ? 66.597  55.287  102.337 0.50 76.25  ? 17  DC  D N4    1 
ATOM   1039 C C5    . DC  B 2 17  ? 67.429  53.082  101.921 0.50 76.25  ? 17  DC  D C5    1 
ATOM   1040 C C6    . DC  B 2 17  ? 67.117  51.800  101.680 0.50 76.25  ? 17  DC  D C6    1 
ATOM   1041 P P     . DA  B 2 18  ? 65.147  46.443  98.788  0.50 61.16  ? 18  DA  D P     1 
ATOM   1042 O OP1   . DA  B 2 18  ? 65.255  45.014  99.175  0.50 61.16  ? 18  DA  D OP1   1 
ATOM   1043 O OP2   . DA  B 2 18  ? 66.209  47.061  97.952  0.50 61.16  ? 18  DA  D OP2   1 
ATOM   1044 O "O5'" . DA  B 2 18  ? 63.746  46.658  98.069  0.50 61.16  ? 18  DA  D "O5'" 1 
ATOM   1045 C "C5'" . DA  B 2 18  ? 62.545  46.667  98.834  0.50 61.16  ? 18  DA  D "C5'" 1 
ATOM   1046 C "C4'" . DA  B 2 18  ? 61.624  47.762  98.351  0.50 20.97  ? 18  DA  D "C4'" 1 
ATOM   1047 O "O4'" . DA  B 2 18  ? 62.101  49.065  98.765  0.50 61.16  ? 18  DA  D "O4'" 1 
ATOM   1048 C "C3'" . DA  B 2 18  ? 61.473  47.825  96.832  0.50 61.16  ? 18  DA  D "C3'" 1 
ATOM   1049 O "O3'" . DA  B 2 18  ? 60.106  48.062  96.507  0.50 61.16  ? 18  DA  D "O3'" 1 
ATOM   1050 C "C2'" . DA  B 2 18  ? 62.321  49.023  96.442  0.50 61.16  ? 18  DA  D "C2'" 1 
ATOM   1051 C "C1'" . DA  B 2 18  ? 62.140  49.930  97.643  0.50 61.16  ? 18  DA  D "C1'" 1 
ATOM   1052 N N9    . DA  B 2 18  ? 63.205  50.908  97.860  0.50 20.97  ? 18  DA  D N9    1 
ATOM   1053 C C8    . DA  B 2 18  ? 64.564  50.708  97.879  0.50 20.97  ? 18  DA  D C8    1 
ATOM   1054 N N7    . DA  B 2 18  ? 65.255  51.798  98.117  0.50 20.97  ? 18  DA  D N7    1 
ATOM   1055 C C5    . DA  B 2 18  ? 64.286  52.782  98.261  0.50 20.97  ? 18  DA  D C5    1 
ATOM   1056 C C6    . DA  B 2 18  ? 64.366  54.161  98.531  0.50 20.97  ? 18  DA  D C6    1 
ATOM   1057 N N6    . DA  B 2 18  ? 65.515  54.817  98.714  0.50 20.97  ? 18  DA  D N6    1 
ATOM   1058 N N1    . DA  B 2 18  ? 63.209  54.853  98.608  0.50 20.97  ? 18  DA  D N1    1 
ATOM   1059 C C2    . DA  B 2 18  ? 62.056  54.197  98.428  0.50 20.97  ? 18  DA  D C2    1 
ATOM   1060 N N3    . DA  B 2 18  ? 61.851  52.908  98.172  0.50 20.97  ? 18  DA  D N3    1 
ATOM   1061 C C4    . DA  B 2 18  ? 63.020  52.248  98.100  0.50 20.97  ? 18  DA  D C4    1 
ATOM   1062 P P     . DA  B 2 19  ? 59.107  46.817  96.358  0.50 77.73  ? 19  DA  D P     1 
ATOM   1063 O OP1   . DA  B 2 19  ? 58.769  46.326  97.720  0.50 77.73  ? 19  DA  D OP1   1 
ATOM   1064 O OP2   . DA  B 2 19  ? 59.695  45.883  95.366  0.50 77.73  ? 19  DA  D OP2   1 
ATOM   1065 O "O5'" . DA  B 2 19  ? 57.804  47.468  95.723  0.50 77.73  ? 19  DA  D "O5'" 1 
ATOM   1066 C "C5'" . DA  B 2 19  ? 57.226  48.639  96.289  0.50 77.73  ? 19  DA  D "C5'" 1 
ATOM   1067 C "C4'" . DA  B 2 19  ? 56.571  49.458  95.205  0.50 47.09  ? 19  DA  D "C4'" 1 
ATOM   1068 O "O4'" . DA  B 2 19  ? 57.579  50.152  94.431  0.50 77.73  ? 19  DA  D "O4'" 1 
ATOM   1069 C "C3'" . DA  B 2 19  ? 55.787  48.603  94.212  0.50 77.73  ? 19  DA  D "C3'" 1 
ATOM   1070 O "O3'" . DA  B 2 19  ? 54.570  49.246  93.845  0.50 77.73  ? 19  DA  D "O3'" 1 
ATOM   1071 C "C2'" . DA  B 2 19  ? 56.722  48.486  93.022  0.50 77.73  ? 19  DA  D "C2'" 1 
ATOM   1072 C "C1'" . DA  B 2 19  ? 57.476  49.803  93.059  0.50 77.73  ? 19  DA  D "C1'" 1 
ATOM   1073 N N9    . DA  B 2 19  ? 58.838  49.696  92.537  0.50 47.09  ? 19  DA  D N9    1 
ATOM   1074 C C8    . DA  B 2 19  ? 59.860  48.939  93.054  0.50 47.09  ? 19  DA  D C8    1 
ATOM   1075 N N7    . DA  B 2 19  ? 60.982  49.038  92.385  0.50 47.09  ? 19  DA  D N7    1 
ATOM   1076 C C5    . DA  B 2 19  ? 60.680  49.917  91.356  0.50 47.09  ? 19  DA  D C5    1 
ATOM   1077 C C6    . DA  B 2 19  ? 61.450  50.434  90.301  0.50 47.09  ? 19  DA  D C6    1 
ATOM   1078 N N6    . DA  B 2 19  ? 62.734  50.128  90.104  0.50 47.09  ? 19  DA  D N6    1 
ATOM   1079 N N1    . DA  B 2 19  ? 60.848  51.288  89.445  0.50 47.09  ? 19  DA  D N1    1 
ATOM   1080 C C2    . DA  B 2 19  ? 59.560  51.596  89.648  0.50 47.09  ? 19  DA  D C2    1 
ATOM   1081 N N3    . DA  B 2 19  ? 58.733  51.177  90.603  0.50 47.09  ? 19  DA  D N3    1 
ATOM   1082 C C4    . DA  B 2 19  ? 59.361  50.329  91.435  0.50 47.09  ? 19  DA  D C4    1 
ATOM   1083 P P     . DT  B 2 20  ? 53.481  48.436  92.991  0.50 98.47  ? 20  DT  D P     1 
ATOM   1084 O OP1   . DT  B 2 20  ? 52.135  48.982  93.305  0.50 98.47  ? 20  DT  D OP1   1 
ATOM   1085 O OP2   . DT  B 2 20  ? 53.750  46.988  93.184  0.50 98.47  ? 20  DT  D OP2   1 
ATOM   1086 O "O5'" . DT  B 2 20  ? 53.844  48.813  91.489  0.50 98.47  ? 20  DT  D "O5'" 1 
ATOM   1087 C "C5'" . DT  B 2 20  ? 53.659  50.141  91.015  0.50 98.47  ? 20  DT  D "C5'" 1 
ATOM   1088 C "C4'" . DT  B 2 20  ? 53.823  50.186  89.515  0.50 24.63  ? 20  DT  D "C4'" 1 
ATOM   1089 O "O4'" . DT  B 2 20  ? 55.224  50.100  89.158  0.50 98.47  ? 20  DT  D "O4'" 1 
ATOM   1090 C "C3'" . DT  B 2 20  ? 53.122  49.052  88.770  0.50 98.47  ? 20  DT  D "C3'" 1 
ATOM   1091 O "O3'" . DT  B 2 20  ? 52.523  49.562  87.580  0.50 98.47  ? 20  DT  D "O3'" 1 
ATOM   1092 C "C2'" . DT  B 2 20  ? 54.255  48.098  88.433  0.50 98.47  ? 20  DT  D "C2'" 1 
ATOM   1093 C "C1'" . DT  B 2 20  ? 55.416  49.053  88.222  0.50 98.47  ? 20  DT  D "C1'" 1 
ATOM   1094 N N1    . DT  B 2 20  ? 56.757  48.482  88.452  0.50 24.63  ? 20  DT  D N1    1 
ATOM   1095 C C2    . DT  B 2 20  ? 57.792  48.947  87.672  0.50 24.63  ? 20  DT  D C2    1 
ATOM   1096 O O2    . DT  B 2 20  ? 57.643  49.791  86.801  0.50 24.63  ? 20  DT  D O2    1 
ATOM   1097 N N3    . DT  B 2 20  ? 59.015  48.387  87.950  0.50 24.63  ? 20  DT  D N3    1 
ATOM   1098 C C4    . DT  B 2 20  ? 59.297  47.430  88.904  0.50 24.63  ? 20  DT  D C4    1 
ATOM   1099 O O4    . DT  B 2 20  ? 60.448  47.028  89.045  0.50 24.63  ? 20  DT  D O4    1 
ATOM   1100 C C5    . DT  B 2 20  ? 58.164  46.978  89.677  0.50 24.63  ? 20  DT  D C5    1 
ATOM   1101 C C7    . DT  B 2 20  ? 58.373  45.933  90.726  0.50 24.63  ? 20  DT  D C7    1 
ATOM   1102 C C6    . DT  B 2 20  ? 56.966  47.521  89.417  0.50 24.63  ? 20  DT  D C6    1 
ATOM   1103 P P     . DG  B 2 21  ? 51.721  48.572  86.609  0.50 30.42  ? 21  DG  D P     1 
ATOM   1104 O OP1   . DG  B 2 21  ? 50.542  49.303  86.080  0.50 30.42  ? 21  DG  D OP1   1 
ATOM   1105 O OP2   . DG  B 2 21  ? 51.529  47.287  87.329  0.50 30.42  ? 21  DG  D OP2   1 
ATOM   1106 O "O5'" . DG  B 2 21  ? 52.742  48.333  85.413  0.50 30.42  ? 21  DG  D "O5'" 1 
ATOM   1107 C "C5'" . DG  B 2 21  ? 53.305  49.439  84.712  0.50 30.42  ? 21  DG  D "C5'" 1 
ATOM   1108 C "C4'" . DG  B 2 21  ? 54.215  48.948  83.613  0.50 40.54  ? 21  DG  D "C4'" 1 
ATOM   1109 O "O4'" . DG  B 2 21  ? 55.458  48.472  84.184  0.50 30.42  ? 21  DG  D "O4'" 1 
ATOM   1110 C "C3'" . DG  B 2 21  ? 53.643  47.780  82.808  0.50 30.42  ? 21  DG  D "C3'" 1 
ATOM   1111 O "O3'" . DG  B 2 21  ? 53.997  47.917  81.428  0.50 30.42  ? 21  DG  D "O3'" 1 
ATOM   1112 C "C2'" . DG  B 2 21  ? 54.337  46.574  83.414  0.50 30.42  ? 21  DG  D "C2'" 1 
ATOM   1113 C "C1'" . DG  B 2 21  ? 55.700  47.148  83.741  0.50 30.42  ? 21  DG  D "C1'" 1 
ATOM   1114 N N9    . DG  B 2 21  ? 56.440  46.447  84.785  0.50 40.54  ? 21  DG  D N9    1 
ATOM   1115 C C8    . DG  B 2 21  ? 55.932  45.745  85.852  0.50 40.54  ? 21  DG  D C8    1 
ATOM   1116 N N7    . DG  B 2 21  ? 56.860  45.219  86.605  0.50 40.54  ? 21  DG  D N7    1 
ATOM   1117 C C5    . DG  B 2 21  ? 58.050  45.600  85.999  0.50 40.54  ? 21  DG  D C5    1 
ATOM   1118 C C6    . DG  B 2 21  ? 59.397  45.326  86.357  0.50 40.54  ? 21  DG  D C6    1 
ATOM   1119 O O6    . DG  B 2 21  ? 59.824  44.666  87.311  0.50 40.54  ? 21  DG  D O6    1 
ATOM   1120 N N1    . DG  B 2 21  ? 60.290  45.912  85.466  0.50 40.54  ? 21  DG  D N1    1 
ATOM   1121 C C2    . DG  B 2 21  ? 59.933  46.660  84.370  0.50 40.54  ? 21  DG  D C2    1 
ATOM   1122 N N2    . DG  B 2 21  ? 60.935  47.143  83.630  0.50 40.54  ? 21  DG  D N2    1 
ATOM   1123 N N3    . DG  B 2 21  ? 58.686  46.915  84.025  0.50 40.54  ? 21  DG  D N3    1 
ATOM   1124 C C4    . DG  B 2 21  ? 57.804  46.360  84.877  0.50 40.54  ? 21  DG  D C4    1 
ATOM   1125 P P     . DC  B 2 22  ? 52.990  47.392  80.291  0.50 31.69  ? 22  DC  D P     1 
ATOM   1126 O OP1   . DC  B 2 22  ? 52.945  48.415  79.215  0.50 31.69  ? 22  DC  D OP1   1 
ATOM   1127 O OP2   . DC  B 2 22  ? 51.732  46.969  80.957  0.50 31.69  ? 22  DC  D OP2   1 
ATOM   1128 O "O5'" . DC  B 2 22  ? 53.706  46.093  79.714  0.50 31.69  ? 22  DC  D "O5'" 1 
ATOM   1129 C "C5'" . DC  B 2 22  ? 54.723  45.433  80.459  0.50 31.69  ? 22  DC  D "C5'" 1 
ATOM   1130 C "C4'" . DC  B 2 22  ? 56.081  45.903  79.998  0.50 8.54   ? 22  DC  D "C4'" 1 
ATOM   1131 O "O4'" . DC  B 2 22  ? 57.024  45.792  81.090  0.50 31.69  ? 22  DC  D "O4'" 1 
ATOM   1132 C "C3'" . DC  B 2 22  ? 56.676  45.108  78.836  0.50 31.69  ? 22  DC  D "C3'" 1 
ATOM   1133 O "O3'" . DC  B 2 22  ? 57.367  45.987  77.944  0.50 31.69  ? 22  DC  D "O3'" 1 
ATOM   1134 C "C2'" . DC  B 2 22  ? 57.646  44.164  79.520  0.50 31.69  ? 22  DC  D "C2'" 1 
ATOM   1135 C "C1'" . DC  B 2 22  ? 58.124  44.988  80.703  0.50 31.69  ? 22  DC  D "C1'" 1 
ATOM   1136 N N1    . DC  B 2 22  ? 58.552  44.209  81.871  0.50 8.54   ? 22  DC  D N1    1 
ATOM   1137 C C2    . DC  B 2 22  ? 59.918  44.023  82.085  0.50 8.54   ? 22  DC  D C2    1 
ATOM   1138 O O2    . DC  B 2 22  ? 60.722  44.537  81.292  0.50 8.54   ? 22  DC  D O2    1 
ATOM   1139 N N3    . DC  B 2 22  ? 60.329  43.294  83.147  0.50 8.54   ? 22  DC  D N3    1 
ATOM   1140 C C4    . DC  B 2 22  ? 59.429  42.765  83.978  0.50 8.54   ? 22  DC  D C4    1 
ATOM   1141 N N4    . DC  B 2 22  ? 59.874  42.043  85.008  0.50 8.54   ? 22  DC  D N4    1 
ATOM   1142 C C5    . DC  B 2 22  ? 58.031  42.950  83.790  0.50 8.54   ? 22  DC  D C5    1 
ATOM   1143 C C6    . DC  B 2 22  ? 57.639  43.671  82.733  0.50 8.54   ? 22  DC  D C6    1 
ATOM   1144 P P     . DT  B 2 23  ? 57.821  45.458  76.496  0.50 19.79  ? 23  DT  D P     1 
ATOM   1145 O OP1   . DT  B 2 23  ? 57.999  46.637  75.611  0.50 19.79  ? 23  DT  D OP1   1 
ATOM   1146 O OP2   . DT  B 2 23  ? 56.899  44.368  76.090  0.50 19.79  ? 23  DT  D OP2   1 
ATOM   1147 O "O5'" . DT  B 2 23  ? 59.253  44.821  76.764  0.50 19.79  ? 23  DT  D "O5'" 1 
ATOM   1148 C "C5'" . DT  B 2 23  ? 60.376  45.657  77.020  0.50 19.79  ? 23  DT  D "C5'" 1 
ATOM   1149 C "C4'" . DT  B 2 23  ? 61.625  44.823  77.180  0.50 19.46  ? 23  DT  D "C4'" 1 
ATOM   1150 O "O4'" . DT  B 2 23  ? 61.613  44.133  78.454  0.50 19.79  ? 23  DT  D "O4'" 1 
ATOM   1151 C "C3'" . DT  B 2 23  ? 61.816  43.745  76.113  0.50 19.79  ? 23  DT  D "C3'" 1 
ATOM   1152 O "O3'" . DT  B 2 23  ? 63.190  43.691  75.732  0.50 19.79  ? 23  DT  D "O3'" 1 
ATOM   1153 C "C2'" . DT  B 2 23  ? 61.432  42.467  76.837  0.50 19.79  ? 23  DT  D "C2'" 1 
ATOM   1154 C "C1'" . DT  B 2 23  ? 61.921  42.767  78.239  0.50 19.79  ? 23  DT  D "C1'" 1 
ATOM   1155 N N1    . DT  B 2 23  ? 61.299  41.975  79.317  0.50 19.46  ? 23  DT  D N1    1 
ATOM   1156 C C2    . DT  B 2 23  ? 62.118  41.511  80.322  0.50 19.46  ? 23  DT  D C2    1 
ATOM   1157 O O2    . DT  B 2 23  ? 63.319  41.726  80.356  0.50 19.46  ? 23  DT  D O2    1 
ATOM   1158 N N3    . DT  B 2 23  ? 61.481  40.777  81.289  0.50 19.46  ? 23  DT  D N3    1 
ATOM   1159 C C4    . DT  B 2 23  ? 60.137  40.466  81.350  0.50 19.46  ? 23  DT  D C4    1 
ATOM   1160 O O4    . DT  B 2 23  ? 59.709  39.788  82.280  0.50 19.46  ? 23  DT  D O4    1 
ATOM   1161 C C5    . DT  B 2 23  ? 59.334  40.988  80.267  0.50 19.46  ? 23  DT  D C5    1 
ATOM   1162 C C7    . DT  B 2 23  ? 57.865  40.707  80.253  0.50 19.46  ? 23  DT  D C7    1 
ATOM   1163 C C6    . DT  B 2 23  ? 59.947  41.708  79.317  0.50 19.46  ? 23  DT  D C6    1 
ATOM   1164 P P     . DA  B 2 24  ? 63.642  42.752  74.512  0.50 24.36  ? 24  DA  D P     1 
ATOM   1165 O OP1   . DA  B 2 24  ? 64.311  43.602  73.495  0.50 24.36  ? 24  DA  D OP1   1 
ATOM   1166 O OP2   . DA  B 2 24  ? 62.480  41.914  74.120  0.50 24.36  ? 24  DA  D OP2   1 
ATOM   1167 O "O5'" . DA  B 2 24  ? 64.735  41.808  75.175  0.50 24.36  ? 24  DA  D "O5'" 1 
ATOM   1168 C "C5'" . DA  B 2 24  ? 65.806  42.365  75.928  0.50 24.36  ? 24  DA  D "C5'" 1 
ATOM   1169 C "C4'" . DA  B 2 24  ? 66.520  41.281  76.699  0.50 22.42  ? 24  DA  D "C4'" 1 
ATOM   1170 O "O4'" . DA  B 2 24  ? 65.678  40.813  77.782  0.50 24.36  ? 24  DA  D "O4'" 1 
ATOM   1171 C "C3'" . DA  B 2 24  ? 66.867  40.047  75.863  0.50 24.36  ? 24  DA  D "C3'" 1 
ATOM   1172 O "O3'" . DA  B 2 24  ? 68.159  39.552  76.215  0.50 24.36  ? 24  DA  D "O3'" 1 
ATOM   1173 C "C2'" . DA  B 2 24  ? 65.812  39.041  76.276  0.50 24.36  ? 24  DA  D "C2'" 1 
ATOM   1174 C "C1'" . DA  B 2 24  ? 65.600  39.400  77.731  0.50 24.36  ? 24  DA  D "C1'" 1 
ATOM   1175 N N9    . DA  B 2 24  ? 64.301  38.986  78.260  0.50 22.42  ? 24  DA  D N9    1 
ATOM   1176 C C8    . DA  B 2 24  ? 63.051  39.277  77.775  0.50 22.42  ? 24  DA  D C8    1 
ATOM   1177 N N7    . DA  B 2 24  ? 62.079  38.702  78.443  0.50 22.42  ? 24  DA  D N7    1 
ATOM   1178 C C5    . DA  B 2 24  ? 62.734  37.995  79.442  0.50 22.42  ? 24  DA  D C5    1 
ATOM   1179 C C6    . DA  B 2 24  ? 62.268  37.166  80.477  0.50 22.42  ? 24  DA  D C6    1 
ATOM   1180 N N6    . DA  B 2 24  ? 60.980  36.889  80.681  0.50 22.42  ? 24  DA  D N6    1 
ATOM   1181 N N1    . DA  B 2 24  ? 63.185  36.619  81.305  0.50 22.42  ? 24  DA  D N1    1 
ATOM   1182 C C2    . DA  B 2 24  ? 64.478  36.889  81.095  0.50 22.42  ? 24  DA  D C2    1 
ATOM   1183 N N3    . DA  B 2 24  ? 65.039  37.646  80.156  0.50 22.42  ? 24  DA  D N3    1 
ATOM   1184 C C4    . DA  B 2 24  ? 64.102  38.175  79.351  0.50 22.42  ? 24  DA  D C4    1 
ATOM   1185 P P     . DT  B 2 25  ? 68.815  38.357  75.362  0.50 18.42  ? 25  DT  D P     1 
ATOM   1186 O OP1   . DT  B 2 25  ? 70.013  38.895  74.674  0.50 18.42  ? 25  DT  D OP1   1 
ATOM   1187 O OP2   . DT  B 2 25  ? 67.744  37.703  74.567  0.50 18.42  ? 25  DT  D OP2   1 
ATOM   1188 O "O5'" . DT  B 2 25  ? 69.302  37.342  76.486  0.50 18.42  ? 25  DT  D "O5'" 1 
ATOM   1189 C "C5'" . DT  B 2 25  ? 69.972  37.830  77.643  0.50 18.42  ? 25  DT  D "C5'" 1 
ATOM   1190 C "C4'" . DT  B 2 25  ? 69.869  36.837  78.776  0.50 19.94  ? 25  DT  D "C4'" 1 
ATOM   1191 O "O4'" . DT  B 2 25  ? 68.480  36.630  79.129  0.50 18.42  ? 25  DT  D "O4'" 1 
ATOM   1192 C "C3'" . DT  B 2 25  ? 70.442  35.449  78.491  0.50 18.42  ? 25  DT  D "C3'" 1 
ATOM   1193 O "O3'" . DT  B 2 25  ? 71.110  34.984  79.665  0.50 18.42  ? 25  DT  D "O3'" 1 
ATOM   1194 C "C2'" . DT  B 2 25  ? 69.208  34.606  78.228  0.50 18.42  ? 25  DT  D "C2'" 1 
ATOM   1195 C "C1'" . DT  B 2 25  ? 68.212  35.239  79.176  0.50 18.42  ? 25  DT  D "C1'" 1 
ATOM   1196 N N1    . DT  B 2 25  ? 66.792  35.028  78.835  0.50 19.94  ? 25  DT  D N1    1 
ATOM   1197 C C2    . DT  B 2 25  ? 66.042  34.244  79.680  0.50 19.94  ? 25  DT  D C2    1 
ATOM   1198 O O2    . DT  B 2 25  ? 66.500  33.717  80.680  0.50 19.94  ? 25  DT  D O2    1 
ATOM   1199 N N3    . DT  B 2 25  ? 64.730  34.095  79.311  0.50 19.94  ? 25  DT  D N3    1 
ATOM   1200 C C4    . DT  B 2 25  ? 64.107  34.636  78.204  0.50 19.94  ? 25  DT  D C4    1 
ATOM   1201 O O4    . DT  B 2 25  ? 62.916  34.414  78.004  0.50 19.94  ? 25  DT  D O4    1 
ATOM   1202 C C5    . DT  B 2 25  ? 64.953  35.444  77.356  0.50 19.94  ? 25  DT  D C5    1 
ATOM   1203 C C7    . DT  B 2 25  ? 64.366  36.065  76.128  0.50 19.94  ? 25  DT  D C7    1 
ATOM   1204 C C6    . DT  B 2 25  ? 66.237  35.600  77.710  0.50 19.94  ? 25  DT  D C6    1 
ATOM   1205 P P     . DA  B 2 26  ? 71.851  33.563  79.653  0.50 24.02  ? 26  DA  D P     1 
ATOM   1206 O OP1   . DA  B 2 26  ? 73.021  33.661  80.561  0.50 24.02  ? 26  DA  D OP1   1 
ATOM   1207 O OP2   . DA  B 2 26  ? 72.049  33.154  78.241  0.50 24.02  ? 26  DA  D OP2   1 
ATOM   1208 O "O5'" . DA  B 2 26  ? 70.789  32.584  80.315  0.50 24.02  ? 26  DA  D "O5'" 1 
ATOM   1209 C "C5'" . DA  B 2 26  ? 70.674  32.500  81.730  0.50 24.02  ? 26  DA  D "C5'" 1 
ATOM   1210 C "C4'" . DA  B 2 26  ? 70.181  31.130  82.127  0.50 17.64  ? 26  DA  D "C4'" 1 
ATOM   1211 O "O4'" . DA  B 2 26  ? 68.784  30.997  81.781  0.50 24.02  ? 26  DA  D "O4'" 1 
ATOM   1212 C "C3'" . DA  B 2 26  ? 70.901  29.981  81.428  0.50 24.02  ? 26  DA  D "C3'" 1 
ATOM   1213 O "O3'" . DA  B 2 26  ? 71.051  28.889  82.335  0.50 24.02  ? 26  DA  D "O3'" 1 
ATOM   1214 C "C2'" . DA  B 2 26  ? 69.964  29.622  80.289  0.50 24.02  ? 26  DA  D "C2'" 1 
ATOM   1215 C "C1'" . DA  B 2 26  ? 68.598  29.915  80.884  0.50 24.02  ? 26  DA  D "C1'" 1 
ATOM   1216 N N9    . DA  B 2 26  ? 67.583  30.323  79.915  0.50 17.64  ? 26  DA  D N9    1 
ATOM   1217 C C8    . DA  B 2 26  ? 67.702  31.237  78.897  0.50 17.64  ? 26  DA  D C8    1 
ATOM   1218 N N7    . DA  B 2 26  ? 66.598  31.411  78.211  0.50 17.64  ? 26  DA  D N7    1 
ATOM   1219 C C5    . DA  B 2 26  ? 65.692  30.549  78.813  0.50 17.64  ? 26  DA  D C5    1 
ATOM   1220 C C6    . DA  B 2 26  ? 64.339  30.265  78.555  0.50 17.64  ? 26  DA  D C6    1 
ATOM   1221 N N6    . DA  B 2 26  ? 63.629  30.846  77.586  0.50 17.64  ? 26  DA  D N6    1 
ATOM   1222 N N1    . DA  B 2 26  ? 63.729  29.351  79.340  0.50 17.64  ? 26  DA  D N1    1 
ATOM   1223 C C2    . DA  B 2 26  ? 64.438  28.769  80.316  0.50 17.64  ? 26  DA  D C2    1 
ATOM   1224 N N3    . DA  B 2 26  ? 65.710  28.954  80.658  0.50 17.64  ? 26  DA  D N3    1 
ATOM   1225 C C4    . DA  B 2 26  ? 66.288  29.867  79.859  0.50 17.64  ? 26  DA  D C4    1 
ATOM   1226 P P     . DC  B 2 27  ? 71.982  27.648  81.934  0.50 24.02  ? 27  DC  D P     1 
ATOM   1227 O OP1   . DC  B 2 27  ? 72.540  27.057  83.176  0.50 24.02  ? 27  DC  D OP1   1 
ATOM   1228 O OP2   . DC  B 2 27  ? 72.899  28.117  80.866  0.50 24.02  ? 27  DC  D OP2   1 
ATOM   1229 O "O5'" . DC  B 2 27  ? 70.956  26.605  81.307  0.50 24.02  ? 27  DC  D "O5'" 1 
ATOM   1230 C "C5'" . DC  B 2 27  ? 69.758  26.267  82.001  0.50 24.02  ? 27  DC  D "C5'" 1 
ATOM   1231 C "C4'" . DC  B 2 27  ? 69.011  25.181  81.263  0.50 25.76  ? 27  DC  D "C4'" 1 
ATOM   1232 O "O4'" . DC  B 2 27  ? 67.988  25.776  80.429  0.50 24.02  ? 27  DC  D "O4'" 1 
ATOM   1233 C "C3'" . DC  B 2 27  ? 69.866  24.323  80.330  0.50 24.02  ? 27  DC  D "C3'" 1 
ATOM   1234 O "O3'" . DC  B 2 27  ? 69.375  22.982  80.350  0.50 24.02  ? 27  DC  D "O3'" 1 
ATOM   1235 C "C2'" . DC  B 2 27  ? 69.596  24.927  78.965  0.50 24.02  ? 27  DC  D "C2'" 1 
ATOM   1236 C "C1'" . DC  B 2 27  ? 68.136  25.310  79.099  0.50 24.02  ? 27  DC  D "C1'" 1 
ATOM   1237 N N1    . DC  B 2 27  ? 67.668  26.366  78.190  0.50 25.76  ? 27  DC  D N1    1 
ATOM   1238 C C2    . DC  B 2 27  ? 66.306  26.433  77.896  0.50 25.76  ? 27  DC  D C2    1 
ATOM   1239 O O2    . DC  B 2 27  ? 65.539  25.617  78.425  0.50 25.76  ? 27  DC  D O2    1 
ATOM   1240 N N3    . DC  B 2 27  ? 65.859  27.384  77.045  0.50 25.76  ? 27  DC  D N3    1 
ATOM   1241 C C4    . DC  B 2 27  ? 66.717  28.245  76.501  0.50 25.76  ? 27  DC  D C4    1 
ATOM   1242 N N4    . DC  B 2 27  ? 66.233  29.162  75.662  0.50 25.76  ? 27  DC  D N4    1 
ATOM   1243 C C5    . DC  B 2 27  ? 68.112  28.205  76.791  0.50 25.76  ? 27  DC  D C5    1 
ATOM   1244 C C6    . DC  B 2 27  ? 68.540  27.259  77.635  0.50 25.76  ? 27  DC  D C6    1 
ATOM   1245 P P     . DG  B 2 28  ? 70.397  21.752  80.215  0.50 35.70  ? 28  DG  D P     1 
ATOM   1246 O OP1   . DG  B 2 28  ? 71.167  21.651  81.482  0.50 35.70  ? 28  DG  D OP1   1 
ATOM   1247 O OP2   . DG  B 2 28  ? 71.117  21.889  78.924  0.50 35.70  ? 28  DG  D OP2   1 
ATOM   1248 O "O5'" . DG  B 2 28  ? 69.430  20.495  80.116  0.50 35.70  ? 28  DG  D "O5'" 1 
ATOM   1249 C "C5'" . DG  B 2 28  ? 68.417  20.287  81.095  0.50 35.70  ? 28  DG  D "C5'" 1 
ATOM   1250 C "C4'" . DG  B 2 28  ? 67.120  19.891  80.430  0.50 19.90  ? 28  DG  D "C4'" 1 
ATOM   1251 O "O4'" . DG  B 2 28  ? 66.597  21.004  79.663  0.50 35.70  ? 28  DG  D "O4'" 1 
ATOM   1252 C "C3'" . DG  B 2 28  ? 67.238  18.723  79.453  0.50 35.70  ? 28  DG  D "C3'" 1 
ATOM   1253 O "O3'" . DG  B 2 28  ? 66.101  17.867  79.586  0.50 35.70  ? 28  DG  D "O3'" 1 
ATOM   1254 C "C2'" . DG  B 2 28  ? 67.251  19.398  78.093  0.50 35.70  ? 28  DG  D "C2'" 1 
ATOM   1255 C "C1'" . DG  B 2 28  ? 66.357  20.601  78.323  0.50 35.70  ? 28  DG  D "C1'" 1 
ATOM   1256 N N9    . DG  B 2 28  ? 66.638  21.741  77.453  0.50 19.90  ? 28  DG  D N9    1 
ATOM   1257 C C8    . DG  B 2 28  ? 67.863  22.307  77.199  0.50 19.90  ? 28  DG  D C8    1 
ATOM   1258 N N7    . DG  B 2 28  ? 67.799  23.318  76.376  0.50 19.90  ? 28  DG  D N7    1 
ATOM   1259 C C5    . DG  B 2 28  ? 66.450  23.426  76.066  0.50 19.90  ? 28  DG  D C5    1 
ATOM   1260 C C6    . DG  B 2 28  ? 65.770  24.340  75.217  0.50 19.90  ? 28  DG  D C6    1 
ATOM   1261 O O6    . DG  B 2 28  ? 66.241  25.266  74.545  0.50 19.90  ? 28  DG  D O6    1 
ATOM   1262 N N1    . DG  B 2 28  ? 64.402  24.094  75.190  0.50 19.90  ? 28  DG  D N1    1 
ATOM   1263 C C2    . DG  B 2 28  ? 63.767  23.098  75.888  0.50 19.90  ? 28  DG  D C2    1 
ATOM   1264 N N2    . DG  B 2 28  ? 62.438  23.026  75.729  0.50 19.90  ? 28  DG  D N2    1 
ATOM   1265 N N3    . DG  B 2 28  ? 64.388  22.238  76.681  0.50 19.90  ? 28  DG  D N3    1 
ATOM   1266 C C4    . DG  B 2 28  ? 65.718  22.460  76.723  0.50 19.90  ? 28  DG  D C4    1 
ATOM   1267 P P     . DA  B 2 29  ? 65.967  16.571  78.649  0.50 56.34  ? 29  DA  D P     1 
ATOM   1268 O OP1   . DA  B 2 29  ? 65.249  15.514  79.405  0.50 56.34  ? 29  DA  D OP1   1 
ATOM   1269 O OP2   . DA  B 2 29  ? 67.309  16.284  78.079  0.50 56.34  ? 29  DA  D OP2   1 
ATOM   1270 O "O5'" . DA  B 2 29  ? 65.023  17.070  77.472  0.50 56.34  ? 29  DA  D "O5'" 1 
ATOM   1271 C "C5'" . DA  B 2 29  ? 63.668  17.421  77.731  0.50 56.34  ? 29  DA  D "C5'" 1 
ATOM   1272 C "C4'" . DA  B 2 29  ? 62.927  17.612  76.430  0.50 28.81  ? 29  DA  D "C4'" 1 
ATOM   1273 O "O4'" . DA  B 2 29  ? 63.320  18.861  75.810  0.50 56.34  ? 29  DA  D "O4'" 1 
ATOM   1274 C "C3'" . DA  B 2 29  ? 63.212  16.519  75.399  0.50 56.34  ? 29  DA  D "C3'" 1 
ATOM   1275 O "O3'" . DA  B 2 29  ? 62.018  16.199  74.688  0.50 56.34  ? 29  DA  D "O3'" 1 
ATOM   1276 C "C2'" . DA  B 2 29  ? 64.211  17.176  74.463  0.50 56.34  ? 29  DA  D "C2'" 1 
ATOM   1277 C "C1'" . DA  B 2 29  ? 63.731  18.614  74.476  0.50 56.34  ? 29  DA  D "C1'" 1 
ATOM   1278 N N9    . DA  B 2 29  ? 64.741  19.610  74.114  0.50 28.81  ? 29  DA  D N9    1 
ATOM   1279 C C8    . DA  B 2 29  ? 66.075  19.638  74.441  0.50 28.81  ? 29  DA  D C8    1 
ATOM   1280 N N7    . DA  B 2 29  ? 66.719  20.668  73.944  0.50 28.81  ? 29  DA  D N7    1 
ATOM   1281 C C5    . DA  B 2 29  ? 65.743  21.367  73.247  0.50 28.81  ? 29  DA  D C5    1 
ATOM   1282 C C6    . DA  B 2 29  ? 65.783  22.554  72.493  0.50 28.81  ? 29  DA  D C6    1 
ATOM   1283 N N6    . DA  B 2 29  ? 66.888  23.279  72.308  0.50 28.81  ? 29  DA  D N6    1 
ATOM   1284 N N1    . DA  B 2 29  ? 64.631  22.977  71.927  0.50 28.81  ? 29  DA  D N1    1 
ATOM   1285 C C2    . DA  B 2 29  ? 63.522  22.251  72.112  0.50 28.81  ? 29  DA  D C2    1 
ATOM   1286 N N3    . DA  B 2 29  ? 63.358  21.122  72.796  0.50 28.81  ? 29  DA  D N3    1 
ATOM   1287 C C4    . DA  B 2 29  ? 64.520  20.728  73.345  0.50 28.81  ? 29  DA  D C4    1 
ATOM   1288 P P     . DA  B 2 30  ? 61.947  14.852  73.820  0.50 75.75  ? 30  DA  D P     1 
ATOM   1289 O OP1   . DA  B 2 30  ? 61.057  13.893  74.522  0.50 75.75  ? 30  DA  D OP1   1 
ATOM   1290 O OP2   . DA  B 2 30  ? 63.337  14.453  73.482  0.50 75.75  ? 30  DA  D OP2   1 
ATOM   1291 O "O5'" . DA  B 2 30  ? 61.225  15.325  72.483  0.50 75.75  ? 30  DA  D "O5'" 1 
ATOM   1292 C "C5'" . DA  B 2 30  ? 60.051  16.129  72.545  0.50 75.75  ? 30  DA  D "C5'" 1 
ATOM   1293 C "C4'" . DA  B 2 30  ? 59.929  16.975  71.300  0.50 27.77  ? 30  DA  D "C4'" 1 
ATOM   1294 O "O4'" . DA  B 2 30  ? 60.962  17.991  71.284  0.50 75.75  ? 30  DA  D "O4'" 1 
ATOM   1295 C "C3'" . DA  B 2 30  ? 60.075  16.200  69.989  0.50 75.75  ? 30  DA  D "C3'" 1 
ATOM   1296 O "O3'" . DA  B 2 30  ? 59.136  16.690  69.031  0.50 75.75  ? 30  DA  D "O3'" 1 
ATOM   1297 C "C2'" . DA  B 2 30  ? 61.487  16.527  69.544  0.50 75.75  ? 30  DA  D "C2'" 1 
ATOM   1298 C "C1'" . DA  B 2 30  ? 61.645  17.949  70.043  0.50 75.75  ? 30  DA  D "C1'" 1 
ATOM   1299 N N9    . DA  B 2 30  ? 63.030  18.360  70.266  0.50 27.77  ? 30  DA  D N9    1 
ATOM   1300 C C8    . DA  B 2 30  ? 63.991  17.735  71.022  0.50 27.77  ? 30  DA  D C8    1 
ATOM   1301 N N7    . DA  B 2 30  ? 65.155  18.341  71.003  0.50 27.77  ? 30  DA  D N7    1 
ATOM   1302 C C5    . DA  B 2 30  ? 64.944  19.442  70.186  0.50 27.77  ? 30  DA  D C5    1 
ATOM   1303 C C6    . DA  B 2 30  ? 65.791  20.482  69.760  0.50 27.77  ? 30  DA  D C6    1 
ATOM   1304 N N6    . DA  B 2 30  ? 67.077  20.582  70.108  0.50 27.77  ? 30  DA  D N6    1 
ATOM   1305 N N1    . DA  B 2 30  ? 65.266  21.427  68.949  0.50 27.77  ? 30  DA  D N1    1 
ATOM   1306 C C2    . DA  B 2 30  ? 63.979  21.323  68.594  0.50 27.77  ? 30  DA  D C2    1 
ATOM   1307 N N3    . DA  B 2 30  ? 63.085  20.394  68.924  0.50 27.77  ? 30  DA  D N3    1 
ATOM   1308 C C4    . DA  B 2 30  ? 63.638  19.471  69.732  0.50 27.77  ? 30  DA  D C4    1 
ATOM   1309 P P     . DC  B 2 31  ? 58.934  15.909  67.643  0.50 72.91  ? 31  DC  D P     1 
ATOM   1310 O OP1   . DC  B 2 31  ? 57.484  15.642  67.468  0.50 72.91  ? 31  DC  D OP1   1 
ATOM   1311 O OP2   . DC  B 2 31  ? 59.896  14.778  67.613  0.50 72.91  ? 31  DC  D OP2   1 
ATOM   1312 O "O5'" . DC  B 2 31  ? 59.386  16.977  66.552  0.50 72.91  ? 31  DC  D "O5'" 1 
ATOM   1313 C "C5'" . DC  B 2 31  ? 58.779  18.266  66.504  0.50 72.91  ? 31  DC  D "C5'" 1 
ATOM   1314 C "C4'" . DC  B 2 31  ? 59.471  19.133  65.479  0.50 24.75  ? 31  DC  D "C4'" 1 
ATOM   1315 O "O4'" . DC  B 2 31  ? 60.781  19.512  65.973  0.50 72.91  ? 31  DC  D "O4'" 1 
ATOM   1316 C "C3'" . DC  B 2 31  ? 59.710  18.453  64.131  0.50 72.91  ? 31  DC  D "C3'" 1 
ATOM   1317 O "O3'" . DC  B 2 31  ? 59.526  19.394  63.069  0.50 72.91  ? 31  DC  D "O3'" 1 
ATOM   1318 C "C2'" . DC  B 2 31  ? 61.162  18.022  64.210  0.50 72.91  ? 31  DC  D "C2'" 1 
ATOM   1319 C "C1'" . DC  B 2 31  ? 61.771  19.143  65.027  0.50 72.91  ? 31  DC  D "C1'" 1 
ATOM   1320 N N1    . DC  B 2 31  ? 62.996  18.785  65.752  0.50 24.75  ? 31  DC  D N1    1 
ATOM   1321 C C2    . DC  B 2 31  ? 64.087  19.652  65.684  0.50 24.75  ? 31  DC  D C2    1 
ATOM   1322 O O2    . DC  B 2 31  ? 63.973  20.706  65.039  0.50 24.75  ? 31  DC  D O2    1 
ATOM   1323 N N3    . DC  B 2 31  ? 65.232  19.325  66.321  0.50 24.75  ? 31  DC  D N3    1 
ATOM   1324 C C4    . DC  B 2 31  ? 65.309  18.185  67.009  0.50 24.75  ? 31  DC  D C4    1 
ATOM   1325 N N4    . DC  B 2 31  ? 66.462  17.900  67.613  0.50 24.75  ? 31  DC  D N4    1 
ATOM   1326 C C5    . DC  B 2 31  ? 64.206  17.288  67.107  0.50 24.75  ? 31  DC  D C5    1 
ATOM   1327 C C6    . DC  B 2 31  ? 63.079  17.624  66.469  0.50 24.75  ? 31  DC  D C6    1 
ATOM   1328 P P     . DT  B 2 32  ? 60.108  19.070  61.607  0.50 64.68  ? 32  DT  D P     1 
ATOM   1329 O OP1   . DT  B 2 32  ? 59.227  19.719  60.604  0.50 64.68  ? 32  DT  D OP1   1 
ATOM   1330 O OP2   . DT  B 2 32  ? 60.361  17.609  61.525  0.50 64.68  ? 32  DT  D OP2   1 
ATOM   1331 O "O5'" . DT  B 2 32  ? 61.511  19.822  61.591  0.50 64.68  ? 32  DT  D "O5'" 1 
ATOM   1332 C "C5'" . DT  B 2 32  ? 61.569  21.242  61.698  0.50 64.68  ? 32  DT  D "C5'" 1 
ATOM   1333 C "C4'" . DT  B 2 32  ? 62.716  21.783  60.878  0.50 44.14  ? 32  DT  D "C4'" 1 
ATOM   1334 O "O4'" . DT  B 2 32  ? 63.972  21.517  61.546  0.50 64.68  ? 32  DT  D "O4'" 1 
ATOM   1335 C "C3'" . DT  B 2 32  ? 62.840  21.173  59.481  0.50 64.68  ? 32  DT  D "C3'" 1 
ATOM   1336 O "O3'" . DT  B 2 32  ? 63.203  22.184  58.538  0.50 64.68  ? 32  DT  D "O3'" 1 
ATOM   1337 C "C2'" . DT  B 2 32  ? 63.961  20.162  59.638  0.50 64.68  ? 32  DT  D "C2'" 1 
ATOM   1338 C "C1'" . DT  B 2 32  ? 64.851  20.834  60.666  0.50 64.68  ? 32  DT  D "C1'" 1 
ATOM   1339 N N1    . DT  B 2 32  ? 65.670  19.913  61.474  0.50 44.14  ? 32  DT  D N1    1 
ATOM   1340 C C2    . DT  B 2 32  ? 67.019  20.167  61.574  0.50 44.14  ? 32  DT  D C2    1 
ATOM   1341 O O2    . DT  B 2 32  ? 67.563  21.110  61.022  0.50 44.14  ? 32  DT  D O2    1 
ATOM   1342 N N3    . DT  B 2 32  ? 67.714  19.272  62.348  0.50 44.14  ? 32  DT  D N3    1 
ATOM   1343 C C4    . DT  B 2 32  ? 67.205  18.176  63.018  0.50 44.14  ? 32  DT  D C4    1 
ATOM   1344 O O4    . DT  B 2 32  ? 67.954  17.463  63.678  0.50 44.14  ? 32  DT  D O4    1 
ATOM   1345 C C5    . DT  B 2 32  ? 65.782  17.968  62.868  0.50 44.14  ? 32  DT  D C5    1 
ATOM   1346 C C7    . DT  B 2 32  ? 65.141  16.804  63.556  0.50 44.14  ? 32  DT  D C7    1 
ATOM   1347 C C6    . DT  B 2 32  ? 65.095  18.835  62.113  0.50 44.14  ? 32  DT  D C6    1 
ATOM   1348 P P     . DT  B 2 33  ? 63.479  21.782  57.009  0.50 62.95  ? 33  DT  D P     1 
ATOM   1349 O OP1   . DT  B 2 33  ? 63.138  22.949  56.155  0.50 62.95  ? 33  DT  D OP1   1 
ATOM   1350 O OP2   . DT  B 2 33  ? 62.821  20.474  56.763  0.50 62.95  ? 33  DT  D OP2   1 
ATOM   1351 O "O5'" . DT  B 2 33  ? 65.056  21.565  56.961  0.50 62.95  ? 33  DT  D "O5'" 1 
ATOM   1352 C "C5'" . DT  B 2 33  ? 65.945  22.669  57.115  0.50 62.95  ? 33  DT  D "C5'" 1 
ATOM   1353 C "C4'" . DT  B 2 33  ? 67.343  22.283  56.692  0.50 30.58  ? 33  DT  D "C4'" 1 
ATOM   1354 O "O4'" . DT  B 2 33  ? 67.952  21.424  57.687  0.50 62.95  ? 33  DT  D "O4'" 1 
ATOM   1355 C "C3'" . DT  B 2 33  ? 67.420  21.521  55.368  0.50 62.95  ? 33  DT  D "C3'" 1 
ATOM   1356 O "O3'" . DT  B 2 33  ? 68.563  21.953  54.628  0.50 62.95  ? 33  DT  D "O3'" 1 
ATOM   1357 C "C2'" . DT  B 2 33  ? 67.615  20.082  55.808  0.50 62.95  ? 33  DT  D "C2'" 1 
ATOM   1358 C "C1'" . DT  B 2 33  ? 68.459  20.263  57.055  0.50 62.95  ? 33  DT  D "C1'" 1 
ATOM   1359 N N1    . DT  B 2 33  ? 68.408  19.153  58.026  0.50 30.58  ? 33  DT  D N1    1 
ATOM   1360 C C2    . DT  B 2 33  ? 69.522  18.937  58.806  0.50 30.58  ? 33  DT  D C2    1 
ATOM   1361 O O2    . DT  B 2 33  ? 70.526  19.628  58.738  0.50 30.58  ? 33  DT  D O2    1 
ATOM   1362 N N3    . DT  B 2 33  ? 69.418  17.877  59.673  0.50 30.58  ? 33  DT  D N3    1 
ATOM   1363 C C4    . DT  B 2 33  ? 68.337  17.035  59.836  0.50 30.58  ? 33  DT  D C4    1 
ATOM   1364 O O4    . DT  B 2 33  ? 68.394  16.120  60.652  0.50 30.58  ? 33  DT  D O4    1 
ATOM   1365 C C5    . DT  B 2 33  ? 67.197  17.326  58.993  0.50 30.58  ? 33  DT  D C5    1 
ATOM   1366 C C7    . DT  B 2 33  ? 65.976  16.470  59.106  0.50 30.58  ? 33  DT  D C7    1 
ATOM   1367 C C6    . DT  B 2 33  ? 67.289  18.357  58.143  0.50 30.58  ? 33  DT  D C6    1 
ATOM   1368 P P     . DA  B 2 34  ? 68.468  22.099  53.033  0.50 38.67  ? 34  DA  D P     1 
ATOM   1369 O OP1   . DA  B 2 34  ? 67.745  23.359  52.721  0.50 38.67  ? 34  DA  D OP1   1 
ATOM   1370 O OP2   . DA  B 2 34  ? 67.962  20.810  52.496  0.50 38.67  ? 34  DA  D OP2   1 
ATOM   1371 O "O5'" . DA  B 2 34  ? 69.987  22.267  52.585  0.50 38.67  ? 34  DA  D "O5'" 1 
ATOM   1372 C "C5'" . DA  B 2 34  ? 70.822  23.246  53.198  0.50 38.67  ? 34  DA  D "C5'" 1 
ATOM   1373 C "C4'" . DA  B 2 34  ? 72.159  22.641  53.555  0.50 28.31  ? 34  DA  D "C4'" 1 
ATOM   1374 O "O4'" . DA  B 2 34  ? 71.964  21.609  54.553  0.50 38.67  ? 34  DA  D "O4'" 1 
ATOM   1375 C "C3'" . DA  B 2 34  ? 72.888  21.967  52.392  0.50 38.67  ? 34  DA  D "C3'" 1 
ATOM   1376 O "O3'" . DA  B 2 34  ? 74.297  22.173  52.515  0.50 38.67  ? 34  DA  D "O3'" 1 
ATOM   1377 C "C2'" . DA  B 2 34  ? 72.558  20.498  52.578  0.50 38.67  ? 34  DA  D "C2'" 1 
ATOM   1378 C "C1'" . DA  B 2 34  ? 72.491  20.376  54.088  0.50 38.67  ? 34  DA  D "C1'" 1 
ATOM   1379 N N9    . DA  B 2 34  ? 71.614  19.305  54.562  0.50 28.31  ? 34  DA  D N9    1 
ATOM   1380 C C8    . DA  B 2 34  ? 70.368  18.966  54.095  0.50 28.31  ? 34  DA  D C8    1 
ATOM   1381 N N7    . DA  B 2 34  ? 69.830  17.946  54.716  0.50 28.31  ? 34  DA  D N7    1 
ATOM   1382 C C5    . DA  B 2 34  ? 70.784  17.588  55.658  0.50 28.31  ? 34  DA  D C5    1 
ATOM   1383 C C6    . DA  B 2 34  ? 70.820  16.574  56.630  0.50 28.31  ? 34  DA  D C6    1 
ATOM   1384 N N6    . DA  B 2 34  ? 69.832  15.695  56.820  0.50 28.31  ? 34  DA  D N6    1 
ATOM   1385 N N1    . DA  B 2 34  ? 71.919  16.490  57.409  0.50 28.31  ? 34  DA  D N1    1 
ATOM   1386 C C2    . DA  B 2 34  ? 72.911  17.368  57.215  0.50 28.31  ? 34  DA  D C2    1 
ATOM   1387 N N3    . DA  B 2 34  ? 72.996  18.361  56.334  0.50 28.31  ? 34  DA  D N3    1 
ATOM   1388 C C4    . DA  B 2 34  ? 71.887  18.419  55.576  0.50 28.31  ? 34  DA  D C4    1 
ATOM   1389 P P     . DT  B 2 35  ? 75.272  21.744  51.314  0.50 44.79  ? 35  DT  D P     1 
ATOM   1390 O OP1   . DT  B 2 35  ? 76.668  21.997  51.748  0.50 44.79  ? 35  DT  D OP1   1 
ATOM   1391 O OP2   . DT  B 2 35  ? 74.764  22.379  50.072  0.50 44.79  ? 35  DT  D OP2   1 
ATOM   1392 O "O5'" . DT  B 2 35  ? 75.067  20.169  51.203  0.50 44.79  ? 35  DT  D "O5'" 1 
ATOM   1393 C "C5'" . DT  B 2 35  ? 76.155  19.275  51.424  0.50 44.79  ? 35  DT  D "C5'" 1 
ATOM   1394 C "C4'" . DT  B 2 35  ? 76.353  19.058  52.905  0.50 41.05  ? 35  DT  D "C4'" 1 
ATOM   1395 O "O4'" . DT  B 2 35  ? 75.121  18.569  53.489  0.50 44.79  ? 35  DT  D "O4'" 1 
ATOM   1396 C "C3'" . DT  B 2 35  ? 77.420  18.023  53.263  0.50 44.79  ? 35  DT  D "C3'" 1 
ATOM   1397 O "O3'" . DT  B 2 35  ? 77.954  18.316  54.557  0.50 44.79  ? 35  DT  D "O3'" 1 
ATOM   1398 C "C2'" . DT  B 2 35  ? 76.607  16.756  53.435  0.50 44.79  ? 35  DT  D "C2'" 1 
ATOM   1399 C "C1'" . DT  B 2 35  ? 75.346  17.298  54.082  0.50 44.79  ? 35  DT  D "C1'" 1 
ATOM   1400 N N1    . DT  B 2 35  ? 74.144  16.472  53.870  0.50 41.05  ? 35  DT  D N1    1 
ATOM   1401 C C2    . DT  B 2 35  ? 73.981  15.358  54.660  0.50 41.05  ? 35  DT  D C2    1 
ATOM   1402 O O2    . DT  B 2 35  ? 74.786  15.027  55.517  0.50 41.05  ? 35  DT  D O2    1 
ATOM   1403 N N3    . DT  B 2 35  ? 72.838  14.640  54.411  0.50 41.05  ? 35  DT  D N3    1 
ATOM   1404 C C4    . DT  B 2 35  ? 71.864  14.921  53.473  0.50 41.05  ? 35  DT  D C4    1 
ATOM   1405 O O4    . DT  B 2 35  ? 70.888  14.183  53.368  0.50 41.05  ? 35  DT  D O4    1 
ATOM   1406 C C5    . DT  B 2 35  ? 72.100  16.106  52.677  0.50 41.05  ? 35  DT  D C5    1 
ATOM   1407 C C7    . DT  B 2 35  ? 71.099  16.490  51.633  0.50 41.05  ? 35  DT  D C7    1 
ATOM   1408 C C6    . DT  B 2 35  ? 73.214  16.812  52.913  0.50 41.05  ? 35  DT  D C6    1 
ATOM   1409 O "O5'" . DT  C 3 1   ? 73.963  118.729 124.900 0.50 100.00 ? 1   DT  E "O5'" 1 
ATOM   1410 C "C5'" . DT  C 3 1   ? 72.676  118.215 124.541 0.50 100.00 ? 1   DT  E "C5'" 1 
ATOM   1411 C "C4'" . DT  C 3 1   ? 72.768  117.318 123.327 0.50 69.40  ? 1   DT  E "C4'" 1 
ATOM   1412 O "O4'" . DT  C 3 1   ? 73.562  116.148 123.639 0.50 100.00 ? 1   DT  E "O4'" 1 
ATOM   1413 C "C3'" . DT  C 3 1   ? 71.432  116.785 122.804 0.50 100.00 ? 1   DT  E "C3'" 1 
ATOM   1414 O "O3'" . DT  C 3 1   ? 71.543  116.621 121.391 0.50 100.00 ? 1   DT  E "O3'" 1 
ATOM   1415 C "C2'" . DT  C 3 1   ? 71.364  115.403 123.423 0.50 100.00 ? 1   DT  E "C2'" 1 
ATOM   1416 C "C1'" . DT  C 3 1   ? 72.817  114.989 123.303 0.50 100.00 ? 1   DT  E "C1'" 1 
ATOM   1417 N N1    . DT  C 3 1   ? 73.258  113.884 124.174 0.50 69.40  ? 1   DT  E N1    1 
ATOM   1418 C C2    . DT  C 3 1   ? 74.581  113.512 124.107 0.50 69.40  ? 1   DT  E C2    1 
ATOM   1419 O O2    . DT  C 3 1   ? 75.394  114.069 123.387 0.50 69.40  ? 1   DT  E O2    1 
ATOM   1420 N N3    . DT  C 3 1   ? 74.921  112.458 124.917 0.50 69.40  ? 1   DT  E N3    1 
ATOM   1421 C C4    . DT  C 3 1   ? 74.089  111.760 125.771 0.50 69.40  ? 1   DT  E C4    1 
ATOM   1422 O O4    . DT  C 3 1   ? 74.537  110.828 126.433 0.50 69.40  ? 1   DT  E O4    1 
ATOM   1423 C C5    . DT  C 3 1   ? 72.715  112.212 125.800 0.50 69.40  ? 1   DT  E C5    1 
ATOM   1424 C C7    . DT  C 3 1   ? 71.741  111.520 126.700 0.50 69.40  ? 1   DT  E C7    1 
ATOM   1425 C C6    . DT  C 3 1   ? 72.374  113.240 125.012 0.50 69.40  ? 1   DT  E C6    1 
ATOM   1426 P P     . DA  C 3 2   ? 70.455  117.275 120.410 0.50 100.00 ? 2   DA  E P     1 
ATOM   1427 O OP1   . DA  C 3 2   ? 70.341  118.721 120.734 0.50 100.00 ? 2   DA  E OP1   1 
ATOM   1428 O OP2   . DA  C 3 2   ? 69.243  116.418 120.426 0.50 100.00 ? 2   DA  E OP2   1 
ATOM   1429 O "O5'" . DA  C 3 2   ? 71.163  117.135 118.992 0.50 100.00 ? 2   DA  E "O5'" 1 
ATOM   1430 C "C5'" . DA  C 3 2   ? 72.501  117.596 118.823 0.50 100.00 ? 2   DA  E "C5'" 1 
ATOM   1431 C "C4'" . DA  C 3 2   ? 73.457  116.431 118.692 0.50 50.95  ? 2   DA  E "C4'" 1 
ATOM   1432 O "O4'" . DA  C 3 2   ? 73.299  115.512 119.806 0.50 100.00 ? 2   DA  E "O4'" 1 
ATOM   1433 C "C3'" . DA  C 3 2   ? 73.308  115.583 117.428 0.50 100.00 ? 2   DA  E "C3'" 1 
ATOM   1434 O "O3'" . DA  C 3 2   ? 74.611  115.248 116.940 0.50 100.00 ? 2   DA  E "O3'" 1 
ATOM   1435 C "C2'" . DA  C 3 2   ? 72.603  114.333 117.920 0.50 100.00 ? 2   DA  E "C2'" 1 
ATOM   1436 C "C1'" . DA  C 3 2   ? 73.192  114.186 119.306 0.50 100.00 ? 2   DA  E "C1'" 1 
ATOM   1437 N N9    . DA  C 3 2   ? 72.376  113.400 120.234 0.50 50.95  ? 2   DA  E N9    1 
ATOM   1438 C C8    . DA  C 3 2   ? 71.053  113.570 120.557 0.50 50.95  ? 2   DA  E C8    1 
ATOM   1439 N N7    . DA  C 3 2   ? 70.601  112.689 121.419 0.50 50.95  ? 2   DA  E N7    1 
ATOM   1440 C C5    . DA  C 3 2   ? 71.702  111.886 121.683 0.50 50.95  ? 2   DA  E C5    1 
ATOM   1441 C C6    . DA  C 3 2   ? 71.881  110.767 122.519 0.50 50.95  ? 2   DA  E C6    1 
ATOM   1442 N N6    . DA  C 3 2   ? 70.912  110.239 123.271 0.50 50.95  ? 2   DA  E N6    1 
ATOM   1443 N N1    . DA  C 3 2   ? 73.106  110.200 122.555 0.50 50.95  ? 2   DA  E N1    1 
ATOM   1444 C C2    . DA  C 3 2   ? 74.077  110.725 121.798 0.50 50.95  ? 2   DA  E C2    1 
ATOM   1445 N N3    . DA  C 3 2   ? 74.032  111.770 120.972 0.50 50.95  ? 2   DA  E N3    1 
ATOM   1446 C C4    . DA  C 3 2   ? 72.802  112.313 120.961 0.50 50.95  ? 2   DA  E C4    1 
ATOM   1447 P P     . DT  C 3 3   ? 74.767  114.201 115.736 0.50 79.15  ? 3   DT  E P     1 
ATOM   1448 O OP1   . DT  C 3 3   ? 76.044  114.493 115.033 0.50 79.15  ? 3   DT  E OP1   1 
ATOM   1449 O OP2   . DT  C 3 3   ? 73.491  114.205 114.976 0.50 79.15  ? 3   DT  E OP2   1 
ATOM   1450 O "O5'" . DT  C 3 3   ? 74.910  112.796 116.474 0.50 79.15  ? 3   DT  E "O5'" 1 
ATOM   1451 C "C5'" . DT  C 3 3   ? 76.119  112.452 117.148 0.50 79.15  ? 3   DT  E "C5'" 1 
ATOM   1452 C "C4'" . DT  C 3 3   ? 76.277  110.950 117.217 0.50 34.02  ? 3   DT  E "C4'" 1 
ATOM   1453 O "O4'" . DT  C 3 3   ? 75.408  110.393 118.233 0.50 79.15  ? 3   DT  E "O4'" 1 
ATOM   1454 C "C3'" . DT  C 3 3   ? 75.949  110.207 115.920 0.50 79.15  ? 3   DT  E "C3'" 1 
ATOM   1455 O "O3'" . DT  C 3 3   ? 76.885  109.147 115.718 0.50 79.15  ? 3   DT  E "O3'" 1 
ATOM   1456 C "C2'" . DT  C 3 3   ? 74.576  109.621 116.196 0.50 79.15  ? 3   DT  E "C2'" 1 
ATOM   1457 C "C1'" . DT  C 3 3   ? 74.675  109.315 117.679 0.50 79.15  ? 3   DT  E "C1'" 1 
ATOM   1458 N N1    . DT  C 3 3   ? 73.390  109.213 118.398 0.50 34.02  ? 3   DT  E N1    1 
ATOM   1459 C C2    . DT  C 3 3   ? 73.327  108.360 119.478 0.50 34.02  ? 3   DT  E C2    1 
ATOM   1460 O O2    . DT  C 3 3   ? 74.279  107.702 119.865 0.50 34.02  ? 3   DT  E O2    1 
ATOM   1461 N N3    . DT  C 3 3   ? 72.101  108.303 120.091 0.50 34.02  ? 3   DT  E N3    1 
ATOM   1462 C C4    . DT  C 3 3   ? 70.960  108.996 119.743 0.50 34.02  ? 3   DT  E C4    1 
ATOM   1463 O O4    . DT  C 3 3   ? 69.927  108.837 120.386 0.50 34.02  ? 3   DT  E O4    1 
ATOM   1464 C C5    . DT  C 3 3   ? 71.098  109.877 118.606 0.50 34.02  ? 3   DT  E C5    1 
ATOM   1465 C C7    . DT  C 3 3   ? 69.913  110.672 118.158 0.50 34.02  ? 3   DT  E C7    1 
ATOM   1466 C C6    . DT  C 3 3   ? 72.290  109.942 118.000 0.50 34.02  ? 3   DT  E C6    1 
ATOM   1467 P P     . DA  C 3 4   ? 77.369  108.781 114.231 0.50 33.13  ? 4   DA  E P     1 
ATOM   1468 O OP1   . DA  C 3 4   ? 78.388  109.778 113.813 0.50 33.13  ? 4   DA  E OP1   1 
ATOM   1469 O OP2   . DA  C 3 4   ? 76.158  108.575 113.398 0.50 33.13  ? 4   DA  E OP2   1 
ATOM   1470 O "O5'" . DA  C 3 4   ? 78.093  107.377 114.413 0.50 33.13  ? 4   DA  E "O5'" 1 
ATOM   1471 C "C5'" . DA  C 3 4   ? 79.091  107.205 115.414 0.50 33.13  ? 4   DA  E "C5'" 1 
ATOM   1472 C "C4'" . DA  C 3 4   ? 78.851  105.925 116.178 0.50 35.38  ? 4   DA  E "C4'" 1 
ATOM   1473 O "O4'" . DA  C 3 4   ? 77.566  106.002 116.842 0.50 33.13  ? 4   DA  E "O4'" 1 
ATOM   1474 C "C3'" . DA  C 3 4   ? 78.803  104.665 115.314 0.50 33.13  ? 4   DA  E "C3'" 1 
ATOM   1475 O "O3'" . DA  C 3 4   ? 79.419  103.582 116.013 0.50 33.13  ? 4   DA  E "O3'" 1 
ATOM   1476 C "C2'" . DA  C 3 4   ? 77.318  104.411 115.140 0.50 33.13  ? 4   DA  E "C2'" 1 
ATOM   1477 C "C1'" . DA  C 3 4   ? 76.750  104.907 116.455 0.50 33.13  ? 4   DA  E "C1'" 1 
ATOM   1478 N N9    . DA  C 3 4   ? 75.370  105.385 116.374 0.50 35.38  ? 4   DA  E N9    1 
ATOM   1479 C C8    . DA  C 3 4   ? 74.824  106.232 115.441 0.50 35.38  ? 4   DA  E C8    1 
ATOM   1480 N N7    . DA  C 3 4   ? 73.551  106.480 115.632 0.50 35.38  ? 4   DA  E N7    1 
ATOM   1481 C C5    . DA  C 3 4   ? 73.236  105.747 116.769 0.50 35.38  ? 4   DA  E C5    1 
ATOM   1482 C C6    . DA  C 3 4   ? 72.040  105.588 117.491 0.50 35.38  ? 4   DA  E C6    1 
ATOM   1483 N N6    . DA  C 3 4   ? 70.889  106.182 117.162 0.50 35.38  ? 4   DA  E N6    1 
ATOM   1484 N N1    . DA  C 3 4   ? 72.065  104.786 118.578 0.50 35.38  ? 4   DA  E N1    1 
ATOM   1485 C C2    . DA  C 3 4   ? 73.218  104.189 118.908 0.50 35.38  ? 4   DA  E C2    1 
ATOM   1486 N N3    . DA  C 3 4   ? 74.406  104.262 118.310 0.50 35.38  ? 4   DA  E N3    1 
ATOM   1487 C C4    . DA  C 3 4   ? 74.347  105.066 117.235 0.50 35.38  ? 4   DA  E C4    1 
ATOM   1488 P P     . DA  C 3 5   ? 79.667  102.189 115.258 0.50 28.11  ? 5   DA  E P     1 
ATOM   1489 O OP1   . DA  C 3 5   ? 80.756  101.463 115.962 0.50 28.11  ? 5   DA  E OP1   1 
ATOM   1490 O OP2   . DA  C 3 5   ? 79.799  102.485 113.809 0.50 28.11  ? 5   DA  E OP2   1 
ATOM   1491 O "O5'" . DA  C 3 5   ? 78.308  101.395 115.491 0.50 28.11  ? 5   DA  E "O5'" 1 
ATOM   1492 C "C5'" . DA  C 3 5   ? 78.016  100.826 116.764 0.50 28.11  ? 5   DA  E "C5'" 1 
ATOM   1493 C "C4'" . DA  C 3 5   ? 76.754  100.000 116.691 0.50 23.51  ? 5   DA  E "C4'" 1 
ATOM   1494 O "O4'" . DA  C 3 5   ? 75.597  100.865 116.591 0.50 28.11  ? 5   DA  E "O4'" 1 
ATOM   1495 C "C3'" . DA  C 3 5   ? 76.682  99.053  115.492 0.50 28.11  ? 5   DA  E "C3'" 1 
ATOM   1496 O "O3'" . DA  C 3 5   ? 76.114  97.802  115.893 0.50 28.11  ? 5   DA  E "O3'" 1 
ATOM   1497 C "C2'" . DA  C 3 5   ? 75.747  99.774  114.540 0.50 28.11  ? 5   DA  E "C2'" 1 
ATOM   1498 C "C1'" . DA  C 3 5   ? 74.789  100.432 115.513 0.50 28.11  ? 5   DA  E "C1'" 1 
ATOM   1499 N N9    . DA  C 3 5   ? 74.054  101.585 114.996 0.50 23.51  ? 5   DA  E N9    1 
ATOM   1500 C C8    . DA  C 3 5   ? 74.422  102.459 114.003 0.50 23.51  ? 5   DA  E C8    1 
ATOM   1501 N N7    . DA  C 3 5   ? 73.522  103.380 113.749 0.50 23.51  ? 5   DA  E N7    1 
ATOM   1502 C C5    . DA  C 3 5   ? 72.496  103.098 114.641 0.50 23.51  ? 5   DA  E C5    1 
ATOM   1503 C C6    . DA  C 3 5   ? 71.251  103.707 114.875 0.50 23.51  ? 5   DA  E C6    1 
ATOM   1504 N N6    . DA  C 3 5   ? 70.807  104.769 114.198 0.50 23.51  ? 5   DA  E N6    1 
ATOM   1505 N N1    . DA  C 3 5   ? 70.464  103.180 115.838 0.50 23.51  ? 5   DA  E N1    1 
ATOM   1506 C C2    . DA  C 3 5   ? 70.908  102.114 116.514 0.50 23.51  ? 5   DA  E C2    1 
ATOM   1507 N N3    . DA  C 3 5   ? 72.055  101.451 116.384 0.50 23.51  ? 5   DA  E N3    1 
ATOM   1508 C C4    . DA  C 3 5   ? 72.813  101.999 115.419 0.50 23.51  ? 5   DA  E C4    1 
ATOM   1509 P P     . DC  C 3 6   ? 76.405  96.481  115.026 0.50 33.96  ? 6   DC  E P     1 
ATOM   1510 O OP1   . DC  C 3 6   ? 76.718  95.367  115.956 0.50 33.96  ? 6   DC  E OP1   1 
ATOM   1511 O OP2   . DC  C 3 6   ? 77.376  96.849  113.965 0.50 33.96  ? 6   DC  E OP2   1 
ATOM   1512 O "O5'" . DC  C 3 6   ? 75.004  96.169  114.340 0.50 33.96  ? 6   DC  E "O5'" 1 
ATOM   1513 C "C5'" . DC  C 3 6   ? 74.009  97.179  114.245 0.50 33.96  ? 6   DC  E "C5'" 1 
ATOM   1514 C "C4'" . DC  C 3 6   ? 72.912  96.920  115.249 0.50 30.40  ? 6   DC  E "C4'" 1 
ATOM   1515 O "O4'" . DC  C 3 6   ? 72.205  98.157  115.490 0.50 33.96  ? 6   DC  E "O4'" 1 
ATOM   1516 C "C3'" . DC  C 3 6   ? 71.864  95.917  114.777 0.50 33.96  ? 6   DC  E "C3'" 1 
ATOM   1517 O "O3'" . DC  C 3 6   ? 71.372  95.137  115.866 0.50 33.96  ? 6   DC  E "O3'" 1 
ATOM   1518 C "C2'" . DC  C 3 6   ? 70.770  96.795  114.206 0.50 33.96  ? 6   DC  E "C2'" 1 
ATOM   1519 C "C1'" . DC  C 3 6   ? 70.870  98.074  115.024 0.50 33.96  ? 6   DC  E "C1'" 1 
ATOM   1520 N N1    . DC  C 3 6   ? 70.609  99.281  114.237 0.50 30.40  ? 6   DC  E N1    1 
ATOM   1521 C C2    . DC  C 3 6   ? 69.416  99.973  114.438 0.50 30.40  ? 6   DC  E C2    1 
ATOM   1522 O O2    . DC  C 3 6   ? 68.628  99.569  115.308 0.50 30.40  ? 6   DC  E O2    1 
ATOM   1523 N N3    . DC  C 3 6   ? 69.153  101.063 113.685 0.50 30.40  ? 6   DC  E N3    1 
ATOM   1524 C C4    . DC  C 3 6   ? 70.031  101.464 112.763 0.50 30.40  ? 6   DC  E C4    1 
ATOM   1525 N N4    . DC  C 3 6   ? 69.722  102.528 112.025 0.50 30.40  ? 6   DC  E N4    1 
ATOM   1526 C C5    . DC  C 3 6   ? 71.265  100.787 112.556 0.50 30.40  ? 6   DC  E C5    1 
ATOM   1527 C C6    . DC  C 3 6   ? 71.512  99.713  113.307 0.50 30.40  ? 6   DC  E C6    1 
ATOM   1528 P P     . DT  C 3 7   ? 70.359  93.927  115.575 0.50 28.43  ? 7   DT  E P     1 
ATOM   1529 O OP1   . DT  C 3 7   ? 70.405  92.980  116.718 0.50 28.43  ? 7   DT  E OP1   1 
ATOM   1530 O OP2   . DT  C 3 7   ? 70.633  93.435  114.202 0.50 28.43  ? 7   DT  E OP2   1 
ATOM   1531 O "O5'" . DT  C 3 7   ? 68.932  94.629  115.563 0.50 28.43  ? 7   DT  E "O5'" 1 
ATOM   1532 C "C5'" . DT  C 3 7   ? 68.352  95.107  116.769 0.50 28.43  ? 7   DT  E "C5'" 1 
ATOM   1533 C "C4'" . DT  C 3 7   ? 66.908  95.480  116.537 0.50 28.08  ? 7   DT  E "C4'" 1 
ATOM   1534 O "O4'" . DT  C 3 7   ? 66.840  96.669  115.714 0.50 28.43  ? 7   DT  E "O4'" 1 
ATOM   1535 C "C3'" . DT  C 3 7   ? 66.090  94.414  115.810 0.50 28.43  ? 7   DT  E "C3'" 1 
ATOM   1536 O "O3'" . DT  C 3 7   ? 64.777  94.357  116.367 0.50 28.43  ? 7   DT  E "O3'" 1 
ATOM   1537 C "C2'" . DT  C 3 7   ? 66.048  94.916  114.378 0.50 28.43  ? 7   DT  E "C2'" 1 
ATOM   1538 C "C1'" . DT  C 3 7   ? 66.040  96.422  114.568 0.50 28.43  ? 7   DT  E "C1'" 1 
ATOM   1539 N N1    . DT  C 3 7   ? 66.607  97.195  113.447 0.50 28.08  ? 7   DT  E N1    1 
ATOM   1540 C C2    . DT  C 3 7   ? 65.927  98.314  113.025 0.50 28.08  ? 7   DT  E C2    1 
ATOM   1541 O O2    . DT  C 3 7   ? 64.872  98.678  113.517 0.50 28.08  ? 7   DT  E O2    1 
ATOM   1542 N N3    . DT  C 3 7   ? 66.529  98.994  111.997 0.50 28.08  ? 7   DT  E N3    1 
ATOM   1543 C C4    . DT  C 3 7   ? 67.711  98.671  111.358 0.50 28.08  ? 7   DT  E C4    1 
ATOM   1544 O O4    . DT  C 3 7   ? 68.133  99.385  110.451 0.50 28.08  ? 7   DT  E O4    1 
ATOM   1545 C C5    . DT  C 3 7   ? 68.363  97.476  111.841 0.50 28.08  ? 7   DT  E C5    1 
ATOM   1546 C C7    . DT  C 3 7   ? 69.639  97.036  111.197 0.50 28.08  ? 7   DT  E C7    1 
ATOM   1547 C C6    . DT  C 3 7   ? 67.787  96.808  112.850 0.50 28.08  ? 7   DT  E C6    1 
ATOM   1548 P P     . DT  C 3 8   ? 63.682  93.376  115.726 0.50 38.52  ? 8   DT  E P     1 
ATOM   1549 O OP1   . DT  C 3 8   ? 62.781  92.922  116.816 0.50 38.52  ? 8   DT  E OP1   1 
ATOM   1550 O OP2   . DT  C 3 8   ? 64.395  92.371  114.896 0.50 38.52  ? 8   DT  E OP2   1 
ATOM   1551 O "O5'" . DT  C 3 8   ? 62.857  94.336  114.762 0.50 38.52  ? 8   DT  E "O5'" 1 
ATOM   1552 C "C5'" . DT  C 3 8   ? 62.178  95.469  115.292 0.50 38.52  ? 8   DT  E "C5'" 1 
ATOM   1553 C "C4'" . DT  C 3 8   ? 61.258  96.065  114.253 0.50 23.80  ? 8   DT  E "C4'" 1 
ATOM   1554 O "O4'" . DT  C 3 8   ? 62.020  96.823  113.284 0.50 38.52  ? 8   DT  E "O4'" 1 
ATOM   1555 C "C3'" . DT  C 3 8   ? 60.447  95.041  113.459 0.50 38.52  ? 8   DT  E "C3'" 1 
ATOM   1556 O "O3'" . DT  C 3 8   ? 59.109  95.517  113.290 0.50 38.52  ? 8   DT  E "O3'" 1 
ATOM   1557 C "C2'" . DT  C 3 8   ? 61.177  94.969  112.129 0.50 38.52  ? 8   DT  E "C2'" 1 
ATOM   1558 C "C1'" . DT  C 3 8   ? 61.710  96.382  111.973 0.50 38.52  ? 8   DT  E "C1'" 1 
ATOM   1559 N N1    . DT  C 3 8   ? 62.934  96.499  111.158 0.50 23.80  ? 8   DT  E N1    1 
ATOM   1560 C C2    . DT  C 3 8   ? 63.036  97.563  110.291 0.50 23.80  ? 8   DT  E C2    1 
ATOM   1561 O O2    . DT  C 3 8   ? 62.163  98.406  110.161 0.50 23.80  ? 8   DT  E O2    1 
ATOM   1562 N N3    . DT  C 3 8   ? 64.206  97.607  109.575 0.50 23.80  ? 8   DT  E N3    1 
ATOM   1563 C C4    . DT  C 3 8   ? 65.259  96.713  109.637 0.50 23.80  ? 8   DT  E C4    1 
ATOM   1564 O O4    . DT  C 3 8   ? 66.251  96.886  108.933 0.50 23.80  ? 8   DT  E O4    1 
ATOM   1565 C C5    . DT  C 3 8   ? 65.083  95.619  110.564 0.50 23.80  ? 8   DT  E C5    1 
ATOM   1566 C C7    . DT  C 3 8   ? 66.169  94.599  110.694 0.50 23.80  ? 8   DT  E C7    1 
ATOM   1567 C C6    . DT  C 3 8   ? 63.945  95.568  111.269 0.50 23.80  ? 8   DT  E C6    1 
ATOM   1568 P P     . DC  C 3 9   ? 58.066  94.668  112.415 0.50 45.04  ? 9   DC  E P     1 
ATOM   1569 O OP1   . DC  C 3 9   ? 56.709  94.884  112.977 0.50 45.04  ? 9   DC  E OP1   1 
ATOM   1570 O OP2   . DC  C 3 9   ? 58.593  93.285  112.277 0.50 45.04  ? 9   DC  E OP2   1 
ATOM   1571 O "O5'" . DC  C 3 9   ? 58.137  95.378  110.993 0.50 45.04  ? 9   DC  E "O5'" 1 
ATOM   1572 C "C5'" . DC  C 3 9   ? 58.539  96.742  110.891 0.50 45.04  ? 9   DC  E "C5'" 1 
ATOM   1573 C "C4'" . DC  C 3 9   ? 58.240  97.274  109.510 0.50 19.26  ? 9   DC  E "C4'" 1 
ATOM   1574 O "O4'" . DC  C 3 9   ? 59.487  97.529  108.818 0.50 45.04  ? 9   DC  E "O4'" 1 
ATOM   1575 C "C3'" . DC  C 3 9   ? 57.449  96.316  108.621 0.50 45.04  ? 9   DC  E "C3'" 1 
ATOM   1576 O "O3'" . DC  C 3 9   ? 56.527  97.053  107.817 0.50 45.04  ? 9   DC  E "O3'" 1 
ATOM   1577 C "C2'" . DC  C 3 9   ? 58.518  95.673  107.758 0.50 45.04  ? 9   DC  E "C2'" 1 
ATOM   1578 C "C1'" . DC  C 3 9   ? 59.535  96.791  107.607 0.50 45.04  ? 9   DC  E "C1'" 1 
ATOM   1579 N N1    . DC  C 3 9   ? 60.923  96.334  107.415 0.50 19.26  ? 9   DC  E N1    1 
ATOM   1580 C C2    . DC  C 3 9   ? 61.764  97.072  106.579 0.50 19.26  ? 9   DC  E C2    1 
ATOM   1581 O O2    . DC  C 3 9   ? 61.321  98.095  106.035 0.50 19.26  ? 9   DC  E O2    1 
ATOM   1582 N N3    . DC  C 3 9   ? 63.037  96.655  106.387 0.50 19.26  ? 9   DC  E N3    1 
ATOM   1583 C C4    . DC  C 3 9   ? 63.475  95.551  106.993 0.50 19.26  ? 9   DC  E C4    1 
ATOM   1584 N N4    . DC  C 3 9   ? 64.736  95.174  106.772 0.50 19.26  ? 9   DC  E N4    1 
ATOM   1585 C C5    . DC  C 3 9   ? 62.641  94.781  107.854 0.50 19.26  ? 9   DC  E C5    1 
ATOM   1586 C C6    . DC  C 3 9   ? 61.383  95.206  108.036 0.50 19.26  ? 9   DC  E C6    1 
ATOM   1587 P P     . DG  C 3 10  ? 55.272  96.303  107.156 0.50 44.89  ? 10  DG  E P     1 
ATOM   1588 O OP1   . DG  C 3 10  ? 54.039  97.041  107.526 0.50 44.89  ? 10  DG  E OP1   1 
ATOM   1589 O OP2   . DG  C 3 10  ? 55.389  94.859  107.481 0.50 44.89  ? 10  DG  E OP2   1 
ATOM   1590 O "O5'" . DG  C 3 10  ? 55.518  96.485  105.595 0.50 44.89  ? 10  DG  E "O5'" 1 
ATOM   1591 C "C5'" . DG  C 3 10  ? 55.582  97.786  105.017 0.50 44.89  ? 10  DG  E "C5'" 1 
ATOM   1592 C "C4'" . DG  C 3 10  ? 56.125  97.705  103.610 0.50 13.43  ? 10  DG  E "C4'" 1 
ATOM   1593 O "O4'" . DG  C 3 10  ? 57.549  97.435  103.641 0.50 44.89  ? 10  DG  E "O4'" 1 
ATOM   1594 C "C3'" . DG  C 3 10  ? 55.496  96.595  102.767 0.50 44.89  ? 10  DG  E "C3'" 1 
ATOM   1595 O "O3'" . DG  C 3 10  ? 55.286  97.045  101.429 0.50 44.89  ? 10  DG  E "O3'" 1 
ATOM   1596 C "C2'" . DG  C 3 10  ? 56.553  95.507  102.777 0.50 44.89  ? 10  DG  E "C2'" 1 
ATOM   1597 C "C1'" . DG  C 3 10  ? 57.835  96.318  102.817 0.50 44.89  ? 10  DG  E "C1'" 1 
ATOM   1598 N N9    . DG  C 3 10  ? 58.972  95.603  103.386 0.50 13.43  ? 10  DG  E N9    1 
ATOM   1599 C C8    . DG  C 3 10  ? 58.936  94.612  104.340 0.50 13.43  ? 10  DG  E C8    1 
ATOM   1600 N N7    . DG  C 3 10  ? 60.114  94.122  104.616 0.50 13.43  ? 10  DG  E N7    1 
ATOM   1601 C C5    . DG  C 3 10  ? 60.984  94.839  103.804 0.50 13.43  ? 10  DG  E C5    1 
ATOM   1602 C C6    . DG  C 3 10  ? 62.391  94.743  103.659 0.50 13.43  ? 10  DG  E C6    1 
ATOM   1603 O O6    . DG  C 3 10  ? 63.175  93.976  104.230 0.50 13.43  ? 10  DG  E O6    1 
ATOM   1604 N N1    . DG  C 3 10  ? 62.874  95.661  102.733 0.50 13.43  ? 10  DG  E N1    1 
ATOM   1605 C C2    . DG  C 3 10  ? 62.100  96.553  102.034 0.50 13.43  ? 10  DG  E C2    1 
ATOM   1606 N N2    . DG  C 3 10  ? 62.753  97.359  101.189 0.50 13.43  ? 10  DG  E N2    1 
ATOM   1607 N N3    . DG  C 3 10  ? 60.786  96.650  102.155 0.50 13.43  ? 10  DG  E N3    1 
ATOM   1608 C C4    . DG  C 3 10  ? 60.297  95.767  103.051 0.50 13.43  ? 10  DG  E C4    1 
ATOM   1609 P P     . DT  C 3 11  ? 54.400  96.163  100.421 0.50 29.34  ? 11  DT  E P     1 
ATOM   1610 O OP1   . DT  C 3 11  ? 53.034  96.742  100.354 0.50 29.34  ? 11  DT  E OP1   1 
ATOM   1611 O OP2   . DT  C 3 11  ? 54.574  94.734  100.786 0.50 29.34  ? 11  DT  E OP2   1 
ATOM   1612 O "O5'" . DT  C 3 11  ? 55.117  96.400  99.022  0.50 29.34  ? 11  DT  E "O5'" 1 
ATOM   1613 C "C5'" . DT  C 3 11  ? 55.653  97.677  98.698  0.50 29.34  ? 11  DT  E "C5'" 1 
ATOM   1614 C "C4'" . DT  C 3 11  ? 56.921  97.526  97.894  0.50 23.59  ? 11  DT  E "C4'" 1 
ATOM   1615 O "O4'" . DT  C 3 11  ? 57.976  96.967  98.717  0.50 29.34  ? 11  DT  E "O4'" 1 
ATOM   1616 C "C3'" . DT  C 3 11  ? 56.799  96.608  96.678  0.50 29.34  ? 11  DT  E "C3'" 1 
ATOM   1617 O "O3'" . DT  C 3 11  ? 57.500  97.179  95.574  0.50 29.34  ? 11  DT  E "O3'" 1 
ATOM   1618 C "C2'" . DT  C 3 11  ? 57.484  95.331  97.127  0.50 29.34  ? 11  DT  E "C2'" 1 
ATOM   1619 C "C1'" . DT  C 3 11  ? 58.563  95.865  98.046  0.50 29.34  ? 11  DT  E "C1'" 1 
ATOM   1620 N N1    . DT  C 3 11  ? 59.038  94.905  99.062  0.50 23.59  ? 11  DT  E N1    1 
ATOM   1621 C C2    . DT  C 3 11  ? 60.397  94.783  99.244  0.50 23.59  ? 11  DT  E C2    1 
ATOM   1622 O O2    . DT  C 3 11  ? 61.214  95.443  98.624  0.50 23.59  ? 11  DT  E O2    1 
ATOM   1623 N N3    . DT  C 3 11  ? 60.766  93.854  100.185 0.50 23.59  ? 11  DT  E N3    1 
ATOM   1624 C C4    . DT  C 3 11  ? 59.933  93.057  100.943 0.50 23.59  ? 11  DT  E C4    1 
ATOM   1625 O O4    . DT  C 3 11  ? 60.412  92.258  101.743 0.50 23.59  ? 11  DT  E O4    1 
ATOM   1626 C C5    . DT  C 3 11  ? 58.521  93.247  100.712 0.50 23.59  ? 11  DT  E C5    1 
ATOM   1627 C C7    . DT  C 3 11  ? 57.542  92.433  101.498 0.50 23.59  ? 11  DT  E C7    1 
ATOM   1628 C C6    . DT  C 3 11  ? 58.148  94.151  99.796  0.50 23.59  ? 11  DT  E C6    1 
ATOM   1629 P P     . DA  C 3 12  ? 57.467  96.448  94.149  0.50 29.17  ? 12  DA  E P     1 
ATOM   1630 O OP1   . DA  C 3 12  ? 57.327  97.495  93.109  0.50 29.17  ? 12  DA  E OP1   1 
ATOM   1631 O OP2   . DA  C 3 12  ? 56.473  95.345  94.220  0.50 29.17  ? 12  DA  E OP2   1 
ATOM   1632 O "O5'" . DA  C 3 12  ? 58.921  95.812  94.031  0.50 29.17  ? 12  DA  E "O5'" 1 
ATOM   1633 C "C5'" . DA  C 3 12  ? 60.075  96.647  94.021  0.50 29.17  ? 12  DA  E "C5'" 1 
ATOM   1634 C "C4'" . DA  C 3 12  ? 61.316  95.824  93.769  0.50 13.65  ? 12  DA  E "C4'" 1 
ATOM   1635 O "O4'" . DA  C 3 12  ? 61.654  95.054  94.950  0.50 29.17  ? 12  DA  E "O4'" 1 
ATOM   1636 C "C3'" . DA  C 3 12  ? 61.190  94.819  92.624  0.50 29.17  ? 12  DA  E "C3'" 1 
ATOM   1637 O "O3'" . DA  C 3 12  ? 62.392  94.805  91.849  0.50 29.17  ? 12  DA  E "O3'" 1 
ATOM   1638 C "C2'" . DA  C 3 12  ? 61.001  93.494  93.339  0.50 29.17  ? 12  DA  E "C2'" 1 
ATOM   1639 C "C1'" . DA  C 3 12  ? 61.830  93.694  94.593  0.50 29.17  ? 12  DA  E "C1'" 1 
ATOM   1640 N N9    . DA  C 3 12  ? 61.425  92.868  95.731  0.50 13.65  ? 12  DA  E N9    1 
ATOM   1641 C C8    . DA  C 3 12  ? 60.166  92.693  96.251  0.50 13.65  ? 12  DA  E C8    1 
ATOM   1642 N N7    . DA  C 3 12  ? 60.124  91.865  97.267  0.50 13.65  ? 12  DA  E N7    1 
ATOM   1643 C C5    . DA  C 3 12  ? 61.445  91.471  97.432  0.50 13.65  ? 12  DA  E C5    1 
ATOM   1644 C C6    . DA  C 3 12  ? 62.068  90.595  98.339  0.50 13.65  ? 12  DA  E C6    1 
ATOM   1645 N N6    . DA  C 3 12  ? 61.414  89.921  99.288  0.50 13.65  ? 12  DA  E N6    1 
ATOM   1646 N N1    . DA  C 3 12  ? 63.403  90.428  98.234  0.50 13.65  ? 12  DA  E N1    1 
ATOM   1647 C C2    . DA  C 3 12  ? 64.059  91.095  97.279  0.50 13.65  ? 12  DA  E C2    1 
ATOM   1648 N N3    . DA  C 3 12  ? 63.587  91.941  96.366  0.50 13.65  ? 12  DA  E N3    1 
ATOM   1649 C C4    . DA  C 3 12  ? 62.258  92.086  96.497  0.50 13.65  ? 12  DA  E C4    1 
ATOM   1650 P P     . DT  C 3 13  ? 62.536  93.781  90.622  0.50 27.23  ? 13  DT  E P     1 
ATOM   1651 O OP1   . DT  C 3 13  ? 63.449  94.381  89.618  0.50 27.23  ? 13  DT  E OP1   1 
ATOM   1652 O OP2   . DT  C 3 13  ? 61.165  93.380  90.218  0.50 27.23  ? 13  DT  E OP2   1 
ATOM   1653 O "O5'" . DT  C 3 13  ? 63.268  92.526  91.275  0.50 27.23  ? 13  DT  E "O5'" 1 
ATOM   1654 C "C5'" . DT  C 3 13  ? 64.528  92.691  91.919  0.50 27.23  ? 13  DT  E "C5'" 1 
ATOM   1655 C "C4'" . DT  C 3 13  ? 65.094  91.357  92.345  0.50 25.99  ? 13  DT  E "C4'" 1 
ATOM   1656 O "O4'" . DT  C 3 13  ? 64.412  90.841  93.515  0.50 27.23  ? 13  DT  E "O4'" 1 
ATOM   1657 C "C3'" . DT  C 3 13  ? 65.053  90.239  91.301  0.50 27.23  ? 13  DT  E "C3'" 1 
ATOM   1658 O "O3'" . DT  C 3 13  ? 66.286  89.523  91.361  0.50 27.23  ? 13  DT  E "O3'" 1 
ATOM   1659 C "C2'" . DT  C 3 13  ? 63.943  89.336  91.810  0.50 27.23  ? 13  DT  E "C2'" 1 
ATOM   1660 C "C1'" . DT  C 3 13  ? 64.150  89.465  93.304  0.50 27.23  ? 13  DT  E "C1'" 1 
ATOM   1661 N N1    . DT  C 3 13  ? 63.024  89.064  94.169  0.50 25.99  ? 13  DT  E N1    1 
ATOM   1662 C C2    . DT  C 3 13  ? 63.312  88.243  95.237  0.50 25.99  ? 13  DT  E C2    1 
ATOM   1663 O O2    . DT  C 3 13  ? 64.438  87.846  95.488  0.50 25.99  ? 13  DT  E O2    1 
ATOM   1664 N N3    . DT  C 3 13  ? 62.228  87.901  96.006  0.50 25.99  ? 13  DT  E N3    1 
ATOM   1665 C C4    . DT  C 3 13  ? 60.917  88.289  95.819  0.50 25.99  ? 13  DT  E C4    1 
ATOM   1666 O O4    . DT  C 3 13  ? 60.048  87.900  96.594  0.50 25.99  ? 13  DT  E O4    1 
ATOM   1667 C C5    . DT  C 3 13  ? 60.685  89.151  94.680  0.50 25.99  ? 13  DT  E C5    1 
ATOM   1668 C C7    . DT  C 3 13  ? 59.294  89.623  94.401  0.50 25.99  ? 13  DT  E C7    1 
ATOM   1669 C C6    . DT  C 3 13  ? 61.737  89.491  93.921  0.50 25.99  ? 13  DT  E C6    1 
ATOM   1670 P P     . DA  C 3 14  ? 66.717  88.565  90.150  0.50 23.05  ? 14  DA  E P     1 
ATOM   1671 O OP1   . DA  C 3 14  ? 67.492  89.371  89.173  0.50 23.05  ? 14  DA  E OP1   1 
ATOM   1672 O OP2   . DA  C 3 14  ? 65.510  87.828  89.701  0.50 23.05  ? 14  DA  E OP2   1 
ATOM   1673 O "O5'" . DA  C 3 14  ? 67.708  87.534  90.849  0.50 23.05  ? 14  DA  E "O5'" 1 
ATOM   1674 C "C5'" . DA  C 3 14  ? 68.704  87.999  91.756  0.50 23.05  ? 14  DA  E "C5'" 1 
ATOM   1675 C "C4'" . DA  C 3 14  ? 68.957  86.975  92.838  0.50 16.27  ? 14  DA  E "C4'" 1 
ATOM   1676 O "O4'" . DA  C 3 14  ? 67.779  86.822  93.667  0.50 23.05  ? 14  DA  E "O4'" 1 
ATOM   1677 C "C3'" . DA  C 3 14  ? 69.312  85.573  92.346  0.50 23.05  ? 14  DA  E "C3'" 1 
ATOM   1678 O "O3'" . DA  C 3 14  ? 70.329  85.026  93.185  0.50 23.05  ? 14  DA  E "O3'" 1 
ATOM   1679 C "C2'" . DA  C 3 14  ? 68.016  84.801  92.516  0.50 23.05  ? 14  DA  E "C2'" 1 
ATOM   1680 C "C1'" . DA  C 3 14  ? 67.422  85.451  93.751  0.50 23.05  ? 14  DA  E "C1'" 1 
ATOM   1681 N N9    . DA  C 3 14  ? 65.964  85.371  93.836  0.50 16.27  ? 14  DA  E N9    1 
ATOM   1682 C C8    . DA  C 3 14  ? 65.043  86.013  93.047  0.50 16.27  ? 14  DA  E C8    1 
ATOM   1683 N N7    . DA  C 3 14  ? 63.799  85.745  93.361  0.50 16.27  ? 14  DA  E N7    1 
ATOM   1684 C C5    . DA  C 3 14  ? 63.907  84.865  94.428  0.50 16.27  ? 14  DA  E C5    1 
ATOM   1685 C C6    . DA  C 3 14  ? 62.942  84.207  95.214  0.50 16.27  ? 14  DA  E C6    1 
ATOM   1686 N N6    . DA  C 3 14  ? 61.626  84.339  95.033  0.50 16.27  ? 14  DA  E N6    1 
ATOM   1687 N N1    . DA  C 3 14  ? 63.381  83.399  96.204  0.50 16.27  ? 14  DA  E N1    1 
ATOM   1688 C C2    . DA  C 3 14  ? 64.702  83.265  96.381  0.50 16.27  ? 14  DA  E C2    1 
ATOM   1689 N N3    . DA  C 3 14  ? 65.705  83.828  95.707  0.50 16.27  ? 14  DA  E N3    1 
ATOM   1690 C C4    . DA  C 3 14  ? 65.235  84.626  94.733  0.50 16.27  ? 14  DA  E C4    1 
ATOM   1691 P P     . DC  C 3 15  ? 70.965  83.596  92.836  0.50 36.22  ? 15  DC  E P     1 
ATOM   1692 O OP1   . DC  C 3 15  ? 72.427  83.670  93.079  0.50 36.22  ? 15  DC  E OP1   1 
ATOM   1693 O OP2   . DC  C 3 15  ? 70.460  83.186  91.501  0.50 36.22  ? 15  DC  E OP2   1 
ATOM   1694 O "O5'" . DC  C 3 15  ? 70.329  82.635  93.933  0.50 36.22  ? 15  DC  E "O5'" 1 
ATOM   1695 C "C5'" . DC  C 3 15  ? 70.412  82.965  95.316  0.50 36.22  ? 15  DC  E "C5'" 1 
ATOM   1696 C "C4'" . DC  C 3 15  ? 69.834  81.851  96.156  0.50 64.33  ? 15  DC  E "C4'" 1 
ATOM   1697 O "O4'" . DC  C 3 15  ? 68.390  81.843  96.040  0.50 36.22  ? 15  DC  E "O4'" 1 
ATOM   1698 C "C3'" . DC  C 3 15  ? 70.296  80.452  95.754  0.50 36.22  ? 15  DC  E "C3'" 1 
ATOM   1699 O "O3'" . DC  C 3 15  ? 70.483  79.664  96.933  0.50 36.22  ? 15  DC  E "O3'" 1 
ATOM   1700 C "C2'" . DC  C 3 15  ? 69.141  79.931  94.916  0.50 36.22  ? 15  DC  E "C2'" 1 
ATOM   1701 C "C1'" . DC  C 3 15  ? 67.948  80.569  95.601  0.50 36.22  ? 15  DC  E "C1'" 1 
ATOM   1702 N N1    . DC  C 3 15  ? 66.766  80.769  94.748  0.50 64.33  ? 15  DC  E N1    1 
ATOM   1703 C C2    . DC  C 3 15  ? 65.536  80.273  95.185  0.50 64.33  ? 15  DC  E C2    1 
ATOM   1704 O O2    . DC  C 3 15  ? 65.485  79.674  96.268  0.50 64.33  ? 15  DC  E O2    1 
ATOM   1705 N N3    . DC  C 3 15  ? 64.437  80.458  94.419  0.50 64.33  ? 15  DC  E N3    1 
ATOM   1706 C C4    . DC  C 3 15  ? 64.536  81.106  93.258  0.50 64.33  ? 15  DC  E C4    1 
ATOM   1707 N N4    . DC  C 3 15  ? 63.424  81.266  92.536  0.50 64.33  ? 15  DC  E N4    1 
ATOM   1708 C C5    . DC  C 3 15  ? 65.779  81.619  92.784  0.50 64.33  ? 15  DC  E C5    1 
ATOM   1709 C C6    . DC  C 3 15  ? 66.859  81.430  93.555  0.50 64.33  ? 15  DC  E C6    1 
ATOM   1710 P P     . DG  C 3 16  ? 71.299  78.285  96.851  0.50 52.61  ? 16  DG  E P     1 
ATOM   1711 O OP1   . DG  C 3 16  ? 72.334  78.288  97.915  0.50 52.61  ? 16  DG  E OP1   1 
ATOM   1712 O OP2   . DG  C 3 16  ? 71.698  78.078  95.436  0.50 52.61  ? 16  DG  E OP2   1 
ATOM   1713 O "O5'" . DG  C 3 16  ? 70.201  77.200  97.220  0.50 52.61  ? 16  DG  E "O5'" 1 
ATOM   1714 C "C5'" . DG  C 3 16  ? 68.830  77.448  96.936  0.50 52.61  ? 16  DG  E "C5'" 1 
ATOM   1715 C "C4'" . DG  C 3 16  ? 67.990  76.268  97.352  0.50 49.26  ? 16  DG  E "C4'" 1 
ATOM   1716 O "O4'" . DG  C 3 16  ? 66.620  76.526  96.965  0.50 52.61  ? 16  DG  E "O4'" 1 
ATOM   1717 C "C3'" . DG  C 3 16  ? 68.380  74.960  96.668  0.50 52.61  ? 16  DG  E "C3'" 1 
ATOM   1718 O "O3'" . DG  C 3 16  ? 68.130  73.874  97.561  0.50 52.61  ? 16  DG  E "O3'" 1 
ATOM   1719 C "C2'" . DG  C 3 16  ? 67.451  74.910  95.470  0.50 52.61  ? 16  DG  E "C2'" 1 
ATOM   1720 C "C1'" . DG  C 3 16  ? 66.194  75.567  96.011  0.50 52.61  ? 16  DG  E "C1'" 1 
ATOM   1721 N N9    . DG  C 3 16  ? 65.376  76.258  95.021  0.50 49.26  ? 16  DG  E N9    1 
ATOM   1722 C C8    . DG  C 3 16  ? 65.807  77.045  93.981  0.50 49.26  ? 16  DG  E C8    1 
ATOM   1723 N N7    . DG  C 3 16  ? 64.825  77.534  93.269  0.50 49.26  ? 16  DG  E N7    1 
ATOM   1724 C C5    . DG  C 3 16  ? 63.681  77.036  93.876  0.50 49.26  ? 16  DG  E C5    1 
ATOM   1725 C C6    . DG  C 3 16  ? 62.308  77.223  93.552  0.50 49.26  ? 16  DG  E C6    1 
ATOM   1726 O O6    . DG  C 3 16  ? 61.813  77.890  92.634  0.50 49.26  ? 16  DG  E O6    1 
ATOM   1727 N N1    . DG  C 3 16  ? 61.477  76.536  94.433  0.50 49.26  ? 16  DG  E N1    1 
ATOM   1728 C C2    . DG  C 3 16  ? 61.910  75.771  95.490  0.50 49.26  ? 16  DG  E C2    1 
ATOM   1729 N N2    . DG  C 3 16  ? 60.957  75.196  96.237  0.50 49.26  ? 16  DG  E N2    1 
ATOM   1730 N N3    . DG  C 3 16  ? 63.182  75.587  95.798  0.50 49.26  ? 16  DG  E N3    1 
ATOM   1731 C C4    . DG  C 3 16  ? 64.004  76.244  94.957  0.50 49.26  ? 16  DG  E C4    1 
ATOM   1732 P P     . DT  C 3 17  ? 68.781  72.437  97.272  0.50 79.71  ? 17  DT  E P     1 
ATOM   1733 O OP1   . DT  C 3 17  ? 69.959  72.270  98.155  0.50 79.71  ? 17  DT  E OP1   1 
ATOM   1734 O OP2   . DT  C 3 17  ? 68.944  72.297  95.804  0.50 79.71  ? 17  DT  E OP2   1 
ATOM   1735 O "O5'" . DT  C 3 17  ? 67.645  71.432  97.753  0.50 79.71  ? 17  DT  E "O5'" 1 
ATOM   1736 C "C5'" . DT  C 3 17  ? 66.923  71.674  98.961  0.50 79.71  ? 17  DT  E "C5'" 1 
ATOM   1737 C "C4'" . DT  C 3 17  ? 65.515  71.136  98.848  0.50 39.60  ? 17  DT  E "C4'" 1 
ATOM   1738 O "O4'" . DT  C 3 17  ? 64.746  71.926  97.909  0.50 79.71  ? 17  DT  E "O4'" 1 
ATOM   1739 C "C3'" . DT  C 3 17  ? 65.437  69.692  98.350  0.50 79.71  ? 17  DT  E "C3'" 1 
ATOM   1740 O "O3'" . DT  C 3 17  ? 64.410  68.973  99.042  0.50 79.71  ? 17  DT  E "O3'" 1 
ATOM   1741 C "C2'" . DT  C 3 17  ? 65.086  69.846  96.883  0.50 79.71  ? 17  DT  E "C2'" 1 
ATOM   1742 C "C1'" . DT  C 3 17  ? 64.217  71.093  96.890  0.50 79.71  ? 17  DT  E "C1'" 1 
ATOM   1743 N N1    . DT  C 3 17  ? 64.239  71.854  95.620  0.50 39.60  ? 17  DT  E N1    1 
ATOM   1744 C C2    . DT  C 3 17  ? 63.074  72.466  95.217  0.50 39.60  ? 17  DT  E C2    1 
ATOM   1745 O O2    . DT  C 3 17  ? 62.043  72.413  95.862  0.50 39.60  ? 17  DT  E O2    1 
ATOM   1746 N N3    . DT  C 3 17  ? 63.161  73.147  94.024  0.50 39.60  ? 17  DT  E N3    1 
ATOM   1747 C C4    . DT  C 3 17  ? 64.272  73.279  93.219  0.50 39.60  ? 17  DT  E C4    1 
ATOM   1748 O O4    . DT  C 3 17  ? 64.201  73.931  92.178  0.50 39.60  ? 17  DT  E O4    1 
ATOM   1749 C C5    . DT  C 3 17  ? 65.461  72.618  93.703  0.50 39.60  ? 17  DT  E C5    1 
ATOM   1750 C C7    . DT  C 3 17  ? 66.715  72.715  92.895  0.50 39.60  ? 17  DT  E C7    1 
ATOM   1751 C C6    . DT  C 3 17  ? 65.388  71.946  94.863  0.50 39.60  ? 17  DT  E C6    1 
ATOM   1752 P P     . DA  C 3 18  ? 64.412  67.365  99.012  0.50 90.53  ? 18  DA  E P     1 
ATOM   1753 O OP1   . DA  C 3 18  ? 64.112  66.849  100.369 0.50 90.53  ? 18  DA  E OP1   1 
ATOM   1754 O OP2   . DA  C 3 18  ? 65.650  66.931  98.321  0.50 90.53  ? 18  DA  E OP2   1 
ATOM   1755 O "O5'" . DA  C 3 18  ? 63.192  66.996  98.057  0.50 90.53  ? 18  DA  E "O5'" 1 
ATOM   1756 C "C5'" . DA  C 3 18  ? 61.860  67.360  98.402  0.50 90.53  ? 18  DA  E "C5'" 1 
ATOM   1757 C "C4'" . DA  C 3 18  ? 60.932  67.161  97.225  0.50 31.17  ? 18  DA  E "C4'" 1 
ATOM   1758 O "O4'" . DA  C 3 18  ? 61.222  68.135  96.193  0.50 90.53  ? 18  DA  E "O4'" 1 
ATOM   1759 C "C3'" . DA  C 3 18  ? 60.995  65.788  96.544  0.50 90.53  ? 18  DA  E "C3'" 1 
ATOM   1760 O "O3'" . DA  C 3 18  ? 59.675  65.361  96.182  0.50 90.53  ? 18  DA  E "O3'" 1 
ATOM   1761 C "C2'" . DA  C 3 18  ? 61.801  66.061  95.289  0.50 90.53  ? 18  DA  E "C2'" 1 
ATOM   1762 C "C1'" . DA  C 3 18  ? 61.352  67.469  94.949  0.50 90.53  ? 18  DA  E "C1'" 1 
ATOM   1763 N N9    . DA  C 3 18  ? 62.303  68.217  94.133  0.50 31.17  ? 18  DA  E N9    1 
ATOM   1764 C C8    . DA  C 3 18  ? 63.670  68.255  94.252  0.50 31.17  ? 18  DA  E C8    1 
ATOM   1765 N N7    . DA  C 3 18  ? 64.257  69.012  93.359  0.50 31.17  ? 18  DA  E N7    1 
ATOM   1766 C C5    . DA  C 3 18  ? 63.205  69.508  92.600  0.50 31.17  ? 18  DA  E C5    1 
ATOM   1767 C C6    . DA  C 3 18  ? 63.161  70.368  91.486  0.50 31.17  ? 18  DA  E C6    1 
ATOM   1768 N N6    . DA  C 3 18  ? 64.243  70.908  90.916  0.50 31.17  ? 18  DA  E N6    1 
ATOM   1769 N N1    . DA  C 3 18  ? 61.948  70.660  90.970  0.50 31.17  ? 18  DA  E N1    1 
ATOM   1770 C C2    . DA  C 3 18  ? 60.862  70.122  91.538  0.50 31.17  ? 18  DA  E C2    1 
ATOM   1771 N N3    . DA  C 3 18  ? 60.775  69.302  92.581  0.50 31.17  ? 18  DA  E N3    1 
ATOM   1772 C C4    . DA  C 3 18  ? 61.997  69.031  93.070  0.50 31.17  ? 18  DA  E C4    1 
ATOM   1773 P P     . DT  C 3 19  ? 59.406  63.818  95.801  0.50 96.33  ? 19  DT  E P     1 
ATOM   1774 O OP1   . DT  C 3 19  ? 60.023  63.554  94.481  0.50 96.33  ? 19  DT  E OP1   1 
ATOM   1775 O OP2   . DT  C 3 19  ? 57.960  63.535  96.000  0.50 96.33  ? 19  DT  E OP2   1 
ATOM   1776 O "O5'" . DT  C 3 19  ? 60.207  62.989  96.902  0.50 96.33  ? 19  DT  E "O5'" 1 
ATOM   1777 C "C5'" . DT  C 3 19  ? 59.926  63.157  98.291  0.50 96.33  ? 19  DT  E "C5'" 1 
ATOM   1778 C "C4'" . DT  C 3 19  ? 59.111  61.989  98.795  0.50 18.09  ? 19  DT  E "C4'" 1 
ATOM   1779 O "O4'" . DT  C 3 19  ? 59.864  60.767  98.595  0.50 96.33  ? 19  DT  E "O4'" 1 
ATOM   1780 C "C3'" . DT  C 3 19  ? 58.748  62.027  100.281 0.50 96.33  ? 19  DT  E "C3'" 1 
ATOM   1781 O "O3'" . DT  C 3 19  ? 57.428  61.501  100.464 0.50 96.33  ? 19  DT  E "O3'" 1 
ATOM   1782 C "C2'" . DT  C 3 19  ? 59.765  61.094  100.912 0.50 96.33  ? 19  DT  E "C2'" 1 
ATOM   1783 C "C1'" . DT  C 3 19  ? 59.957  60.056  99.821  0.50 96.33  ? 19  DT  E "C1'" 1 
ATOM   1784 N N1    . DT  C 3 19  ? 61.251  59.342  99.850  0.50 18.09  ? 19  DT  E N1    1 
ATOM   1785 C C2    . DT  C 3 19  ? 61.247  57.990  99.588  0.50 18.09  ? 19  DT  E C2    1 
ATOM   1786 O O2    . DT  C 3 19  ? 60.229  57.365  99.342  0.50 18.09  ? 19  DT  E O2    1 
ATOM   1787 N N3    . DT  C 3 19  ? 62.486  57.394  99.628  0.50 18.09  ? 19  DT  E N3    1 
ATOM   1788 C C4    . DT  C 3 19  ? 63.696  57.999  99.902  0.50 18.09  ? 19  DT  E C4    1 
ATOM   1789 O O4    . DT  C 3 19  ? 64.729  57.334  99.899  0.50 18.09  ? 19  DT  E O4    1 
ATOM   1790 C C5    . DT  C 3 19  ? 63.625  59.417  100.177 0.50 18.09  ? 19  DT  E C5    1 
ATOM   1791 C C7    . DT  C 3 19  ? 64.885  60.155  100.504 0.50 18.09  ? 19  DT  E C7    1 
ATOM   1792 C C6    . DT  C 3 19  ? 62.424  60.010  100.131 0.50 18.09  ? 19  DT  E C6    1 
ATOM   1793 P P     . DG  C 3 20  ? 56.601  61.853  101.799 0.50 60.80  ? 20  DG  E P     1 
ATOM   1794 O OP1   . DG  C 3 20  ? 55.458  62.727  101.433 0.50 60.80  ? 20  DG  E OP1   1 
ATOM   1795 O OP2   . DG  C 3 20  ? 57.548  62.295  102.853 0.50 60.80  ? 20  DG  E OP2   1 
ATOM   1796 O "O5'" . DG  C 3 20  ? 56.016  60.445  102.253 0.50 60.80  ? 20  DG  E "O5'" 1 
ATOM   1797 C "C5'" . DG  C 3 20  ? 55.438  59.555  101.304 0.50 60.80  ? 20  DG  E "C5'" 1 
ATOM   1798 C "C4'" . DG  C 3 20  ? 55.474  58.140  101.830 0.50 14.98  ? 20  DG  E "C4'" 1 
ATOM   1799 O "O4'" . DG  C 3 20  ? 56.820  57.611  101.727 0.50 60.80  ? 20  DG  E "O4'" 1 
ATOM   1800 C "C3'" . DG  C 3 20  ? 55.068  57.996  103.297 0.50 60.80  ? 20  DG  E "C3'" 1 
ATOM   1801 O "O3'" . DG  C 3 20  ? 54.223  56.851  103.449 0.50 60.80  ? 20  DG  E "O3'" 1 
ATOM   1802 C "C2'" . DG  C 3 20  ? 56.392  57.821  104.018 0.50 60.80  ? 20  DG  E "C2'" 1 
ATOM   1803 C "C1'" . DG  C 3 20  ? 57.243  57.110  102.986 0.50 60.80  ? 20  DG  E "C1'" 1 
ATOM   1804 N N9    . DG  C 3 20  ? 58.675  57.363  103.126 0.50 14.98  ? 20  DG  E N9    1 
ATOM   1805 C C8    . DG  C 3 20  ? 59.272  58.518  103.574 0.50 14.98  ? 20  DG  E C8    1 
ATOM   1806 N N7    . DG  C 3 20  ? 60.575  58.439  103.614 0.50 14.98  ? 20  DG  E N7    1 
ATOM   1807 C C5    . DG  C 3 20  ? 60.857  57.159  103.160 0.50 14.98  ? 20  DG  E C5    1 
ATOM   1808 C C6    . DG  C 3 20  ? 62.105  56.499  102.983 0.50 14.98  ? 20  DG  E C6    1 
ATOM   1809 O O6    . DG  C 3 20  ? 63.245  56.931  103.200 0.50 14.98  ? 20  DG  E O6    1 
ATOM   1810 N N1    . DG  C 3 20  ? 61.935  55.207  102.499 0.50 14.98  ? 20  DG  E N1    1 
ATOM   1811 C C2    . DG  C 3 20  ? 60.724  54.624  102.218 0.50 14.98  ? 20  DG  E C2    1 
ATOM   1812 N N2    . DG  C 3 20  ? 60.768  53.370  101.748 0.50 14.98  ? 20  DG  E N2    1 
ATOM   1813 N N3    . DG  C 3 20  ? 59.556  55.225  102.380 0.50 14.98  ? 20  DG  E N3    1 
ATOM   1814 C C4    . DG  C 3 20  ? 59.697  56.481  102.851 0.50 14.98  ? 20  DG  E C4    1 
ATOM   1815 P P     . DT  C 3 21  ? 53.917  56.261  104.914 0.50 63.66  ? 21  DT  E P     1 
ATOM   1816 O OP1   . DT  C 3 21  ? 52.465  55.959  104.998 0.50 63.66  ? 21  DT  E OP1   1 
ATOM   1817 O OP2   . DT  C 3 21  ? 54.541  57.143  105.930 0.50 63.66  ? 21  DT  E OP2   1 
ATOM   1818 O "O5'" . DT  C 3 21  ? 54.706  54.881  104.894 0.50 63.66  ? 21  DT  E "O5'" 1 
ATOM   1819 C "C5'" . DT  C 3 21  ? 54.792  54.131  103.686 0.50 63.66  ? 21  DT  E "C5'" 1 
ATOM   1820 C "C4'" . DT  C 3 21  ? 55.726  52.957  103.855 0.50 34.70  ? 21  DT  E "C4'" 1 
ATOM   1821 O "O4'" . DT  C 3 21  ? 57.101  53.402  103.938 0.50 63.66  ? 21  DT  E "O4'" 1 
ATOM   1822 C "C3'" . DT  C 3 21  ? 55.478  52.108  105.101 0.50 63.66  ? 21  DT  E "C3'" 1 
ATOM   1823 O "O3'" . DT  C 3 21  ? 55.651  50.734  104.766 0.50 63.66  ? 21  DT  E "O3'" 1 
ATOM   1824 C "C2'" . DT  C 3 21  ? 56.580  52.549  106.046 0.50 63.66  ? 21  DT  E "C2'" 1 
ATOM   1825 C "C1'" . DT  C 3 21  ? 57.713  52.818  105.077 0.50 63.66  ? 21  DT  E "C1'" 1 
ATOM   1826 N N1    . DT  C 3 21  ? 58.739  53.752  105.578 0.50 34.70  ? 21  DT  E N1    1 
ATOM   1827 C C2    . DT  C 3 21  ? 60.060  53.376  105.478 0.50 34.70  ? 21  DT  E C2    1 
ATOM   1828 O O2    . DT  C 3 21  ? 60.417  52.314  104.994 0.50 34.70  ? 21  DT  E O2    1 
ATOM   1829 N N3    . DT  C 3 21  ? 60.956  54.294  105.969 0.50 34.70  ? 21  DT  E N3    1 
ATOM   1830 C C4    . DT  C 3 21  ? 60.668  55.519  106.540 0.50 34.70  ? 21  DT  E C4    1 
ATOM   1831 O O4    . DT  C 3 21  ? 61.580  56.237  106.942 0.50 34.70  ? 21  DT  E O4    1 
ATOM   1832 C C5    . DT  C 3 21  ? 59.263  55.849  106.614 0.50 34.70  ? 21  DT  E C5    1 
ATOM   1833 C C7    . DT  C 3 21  ? 58.857  57.155  107.222 0.50 34.70  ? 21  DT  E C7    1 
ATOM   1834 C C6    . DT  C 3 21  ? 58.380  54.963  106.132 0.50 34.70  ? 21  DT  E C6    1 
ATOM   1835 P P     . DA  C 3 22  ? 54.974  49.600  105.675 0.50 28.83  ? 22  DA  E P     1 
ATOM   1836 O OP1   . DA  C 3 22  ? 53.919  48.934  104.870 0.50 28.83  ? 22  DA  E OP1   1 
ATOM   1837 O OP2   . DA  C 3 22  ? 54.624  50.210  106.985 0.50 28.83  ? 22  DA  E OP2   1 
ATOM   1838 O "O5'" . DA  C 3 22  ? 56.162  48.568  105.896 0.50 28.83  ? 22  DA  E "O5'" 1 
ATOM   1839 C "C5'" . DA  C 3 22  ? 56.894  48.074  104.782 0.50 28.83  ? 22  DA  E "C5'" 1 
ATOM   1840 C "C4'" . DA  C 3 22  ? 58.260  47.601  105.218 0.50 6.64   ? 22  DA  E "C4'" 1 
ATOM   1841 O "O4'" . DA  C 3 22  ? 59.088  48.728  105.592 0.50 28.83  ? 22  DA  E "O4'" 1 
ATOM   1842 C "C3'" . DA  C 3 22  ? 58.262  46.656  106.419 0.50 28.83  ? 22  DA  E "C3'" 1 
ATOM   1843 O "O3'" . DA  C 3 22  ? 59.206  45.609  106.191 0.50 28.83  ? 22  DA  E "O3'" 1 
ATOM   1844 C "C2'" . DA  C 3 22  ? 58.718  47.542  107.566 0.50 28.83  ? 22  DA  E "C2'" 1 
ATOM   1845 C "C1'" . DA  C 3 22  ? 59.672  48.484  106.861 0.50 28.83  ? 22  DA  E "C1'" 1 
ATOM   1846 N N9    . DA  C 3 22  ? 59.880  49.774  107.518 0.50 6.64   ? 22  DA  E N9    1 
ATOM   1847 C C8    . DA  C 3 22  ? 58.944  50.621  108.059 0.50 6.64   ? 22  DA  E C8    1 
ATOM   1848 N N7    . DA  C 3 22  ? 59.455  51.717  108.569 0.50 6.64   ? 22  DA  E N7    1 
ATOM   1849 C C5    . DA  C 3 22  ? 60.818  51.582  108.350 0.50 6.64   ? 22  DA  E C5    1 
ATOM   1850 C C6    . DA  C 3 22  ? 61.914  52.411  108.655 0.50 6.64   ? 22  DA  E C6    1 
ATOM   1851 N N6    . DA  C 3 22  ? 61.806  53.591  109.269 0.50 6.64   ? 22  DA  E N6    1 
ATOM   1852 N N1    . DA  C 3 22  ? 63.145  51.979  108.301 0.50 6.64   ? 22  DA  E N1    1 
ATOM   1853 C C2    . DA  C 3 22  ? 63.257  50.797  107.685 0.50 6.64   ? 22  DA  E C2    1 
ATOM   1854 N N3    . DA  C 3 22  ? 62.305  49.931  107.345 0.50 6.64   ? 22  DA  E N3    1 
ATOM   1855 C C4    . DA  C 3 22  ? 61.095  50.388  107.710 0.50 6.64   ? 22  DA  E C4    1 
ATOM   1856 P P     . DT  C 3 23  ? 59.540  44.572  107.364 0.50 27.29  ? 23  DT  E P     1 
ATOM   1857 O OP1   . DT  C 3 23  ? 59.840  43.253  106.753 0.50 27.29  ? 23  DT  E OP1   1 
ATOM   1858 O OP2   . DT  C 3 23  ? 58.457  44.688  108.372 0.50 27.29  ? 23  DT  E OP2   1 
ATOM   1859 O "O5'" . DT  C 3 23  ? 60.881  45.151  107.993 0.50 27.29  ? 23  DT  E "O5'" 1 
ATOM   1860 C "C5'" . DT  C 3 23  ? 62.040  45.317  107.185 0.50 27.29  ? 23  DT  E "C5'" 1 
ATOM   1861 C "C4'" . DT  C 3 23  ? 63.235  45.661  108.042 0.50 19.36  ? 23  DT  E "C4'" 1 
ATOM   1862 O "O4'" . DT  C 3 23  ? 63.154  47.032  108.505 0.50 27.29  ? 23  DT  E "O4'" 1 
ATOM   1863 C "C3'" . DT  C 3 23  ? 63.398  44.797  109.293 0.50 27.29  ? 23  DT  E "C3'" 1 
ATOM   1864 O "O3'" . DT  C 3 23  ? 64.778  44.481  109.472 0.50 27.29  ? 23  DT  E "O3'" 1 
ATOM   1865 C "C2'" . DT  C 3 23  ? 62.925  45.710  110.411 0.50 27.29  ? 23  DT  E "C2'" 1 
ATOM   1866 C "C1'" . DT  C 3 23  ? 63.377  47.065  109.904 0.50 27.29  ? 23  DT  E "C1'" 1 
ATOM   1867 N N1    . DT  C 3 23  ? 62.656  48.226  110.462 0.50 19.36  ? 23  DT  E N1    1 
ATOM   1868 C C2    . DT  C 3 23  ? 63.386  49.364  110.719 0.50 19.36  ? 23  DT  E C2    1 
ATOM   1869 O O2    . DT  C 3 23  ? 64.581  49.452  110.496 0.50 19.36  ? 23  DT  E O2    1 
ATOM   1870 N N3    . DT  C 3 23  ? 62.662  50.404  111.247 0.50 19.36  ? 23  DT  E N3    1 
ATOM   1871 C C4    . DT  C 3 23  ? 61.311  50.418  111.536 0.50 19.36  ? 23  DT  E C4    1 
ATOM   1872 O O4    . DT  C 3 23  ? 60.798  51.431  112.011 0.50 19.36  ? 23  DT  E O4    1 
ATOM   1873 C C5    . DT  C 3 23  ? 60.606  49.191  111.240 0.50 19.36  ? 23  DT  E C5    1 
ATOM   1874 C C7    . DT  C 3 23  ? 59.138  49.113  111.519 0.50 19.36  ? 23  DT  E C7    1 
ATOM   1875 C C6    . DT  C 3 23  ? 61.305  48.170  110.724 0.50 19.36  ? 23  DT  E C6    1 
ATOM   1876 P P     . DA  C 3 24  ? 65.232  43.544  110.692 0.50 55.12  ? 24  DA  E P     1 
ATOM   1877 O OP1   . DA  C 3 24  ? 65.941  42.366  110.132 0.50 55.12  ? 24  DA  E OP1   1 
ATOM   1878 O OP2   . DA  C 3 24  ? 64.062  43.342  111.585 0.50 55.12  ? 24  DA  E OP2   1 
ATOM   1879 O "O5'" . DA  C 3 24  ? 66.296  44.445  111.455 0.50 55.12  ? 24  DA  E "O5'" 1 
ATOM   1880 C "C5'" . DA  C 3 24  ? 67.368  45.059  110.742 0.50 55.12  ? 24  DA  E "C5'" 1 
ATOM   1881 C "C4'" . DA  C 3 24  ? 68.105  46.023  111.640 0.50 22.63  ? 24  DA  E "C4'" 1 
ATOM   1882 O "O4'" . DA  C 3 24  ? 67.271  47.181  111.895 0.50 55.12  ? 24  DA  E "O4'" 1 
ATOM   1883 C "C3'" . DA  C 3 24  ? 68.454  45.436  113.007 0.50 55.12  ? 24  DA  E "C3'" 1 
ATOM   1884 O "O3'" . DA  C 3 24  ? 69.756  45.855  113.418 0.50 55.12  ? 24  DA  E "O3'" 1 
ATOM   1885 C "C2'" . DA  C 3 24  ? 67.390  46.012  113.923 0.50 55.12  ? 24  DA  E "C2'" 1 
ATOM   1886 C "C1'" . DA  C 3 24  ? 67.094  47.360  113.291 0.50 55.12  ? 24  DA  E "C1'" 1 
ATOM   1887 N N9    . DA  C 3 24  ? 65.723  47.813  113.522 0.50 22.63  ? 24  DA  E N9    1 
ATOM   1888 C C8    . DA  C 3 24  ? 64.564  47.108  113.313 0.50 22.63  ? 24  DA  E C8    1 
ATOM   1889 N N7    . DA  C 3 24  ? 63.479  47.759  113.657 0.50 22.63  ? 24  DA  E N7    1 
ATOM   1890 C C5    . DA  C 3 24  ? 63.954  48.981  114.113 0.50 22.63  ? 24  DA  E C5    1 
ATOM   1891 C C6    . DA  C 3 24  ? 63.303  50.116  114.629 0.50 22.63  ? 24  DA  E C6    1 
ATOM   1892 N N6    . DA  C 3 24  ? 61.980  50.205  114.784 0.50 22.63  ? 24  DA  E N6    1 
ATOM   1893 N N1    . DA  C 3 24  ? 64.068  51.170  114.987 0.50 22.63  ? 24  DA  E N1    1 
ATOM   1894 C C2    . DA  C 3 24  ? 65.396  51.078  114.837 0.50 22.63  ? 24  DA  E C2    1 
ATOM   1895 N N3    . DA  C 3 24  ? 66.124  50.064  114.369 0.50 22.63  ? 24  DA  E N3    1 
ATOM   1896 C C4    . DA  C 3 24  ? 65.334  49.033  114.022 0.50 22.63  ? 24  DA  E C4    1 
ATOM   1897 P P     . DT  C 3 25  ? 70.378  45.293  114.790 0.50 40.91  ? 25  DT  E P     1 
ATOM   1898 O OP1   . DT  C 3 25  ? 71.667  44.623  114.480 0.50 40.91  ? 25  DT  E OP1   1 
ATOM   1899 O OP2   . DT  C 3 25  ? 69.317  44.545  115.512 0.50 40.91  ? 25  DT  E OP2   1 
ATOM   1900 O "O5'" . DT  C 3 25  ? 70.690  46.623  115.604 0.50 40.91  ? 25  DT  E "O5'" 1 
ATOM   1901 C "C5'" . DT  C 3 25  ? 71.218  47.763  114.934 0.50 40.91  ? 25  DT  E "C5'" 1 
ATOM   1902 C "C4'" . DT  C 3 25  ? 71.012  49.005  115.766 0.50 20.09  ? 25  DT  E "C4'" 1 
ATOM   1903 O "O4'" . DT  C 3 25  ? 69.604  49.345  115.823 0.50 40.91  ? 25  DT  E "O4'" 1 
ATOM   1904 C "C3'" . DT  C 3 25  ? 71.481  48.886  117.216 0.50 40.91  ? 25  DT  E "C3'" 1 
ATOM   1905 O "O3'" . DT  C 3 25  ? 72.110  50.108  117.604 0.50 40.91  ? 25  DT  E "O3'" 1 
ATOM   1906 C "C2'" . DT  C 3 25  ? 70.187  48.692  117.987 0.50 40.91  ? 25  DT  E "C2'" 1 
ATOM   1907 C "C1'" . DT  C 3 25  ? 69.225  49.535  117.175 0.50 40.91  ? 25  DT  E "C1'" 1 
ATOM   1908 N N1    . DT  C 3 25  ? 67.799  49.179  117.313 0.50 20.09  ? 25  DT  E N1    1 
ATOM   1909 C C2    . DT  C 3 25  ? 66.958  50.131  117.843 0.50 20.09  ? 25  DT  E C2    1 
ATOM   1910 O O2    . DT  C 3 25  ? 67.344  51.230  118.203 0.50 20.09  ? 25  DT  E O2    1 
ATOM   1911 N N3    . DT  C 3 25  ? 65.643  49.747  117.940 0.50 20.09  ? 25  DT  E N3    1 
ATOM   1912 C C4    . DT  C 3 25  ? 65.099  48.531  117.571 0.50 20.09  ? 25  DT  E C4    1 
ATOM   1913 O O4    . DT  C 3 25  ? 63.895  48.332  117.712 0.50 20.09  ? 25  DT  E O4    1 
ATOM   1914 C C5    . DT  C 3 25  ? 66.039  47.575  117.029 0.50 20.09  ? 25  DT  E C5    1 
ATOM   1915 C C7    . DT  C 3 25  ? 65.540  46.228  116.612 0.50 20.09  ? 25  DT  E C7    1 
ATOM   1916 C C6    . DT  C 3 25  ? 67.325  47.943  116.927 0.50 20.09  ? 25  DT  E C6    1 
ATOM   1917 P P     . DA  C 3 26  ? 72.889  50.198  119.003 0.50 38.56  ? 26  DA  E P     1 
ATOM   1918 O OP1   . DA  C 3 26  ? 74.312  50.520  118.732 0.50 38.56  ? 26  DA  E OP1   1 
ATOM   1919 O OP2   . DA  C 3 26  ? 72.548  48.987  119.794 0.50 38.56  ? 26  DA  E OP2   1 
ATOM   1920 O "O5'" . DA  C 3 26  ? 72.211  51.453  119.704 0.50 38.56  ? 26  DA  E "O5'" 1 
ATOM   1921 C "C5'" . DA  C 3 26  ? 70.795  51.576  119.722 0.50 38.56  ? 26  DA  E "C5'" 1 
ATOM   1922 C "C4'" . DA  C 3 26  ? 70.375  52.689  120.650 0.50 22.61  ? 26  DA  E "C4'" 1 
ATOM   1923 O "O4'" . DA  C 3 26  ? 68.933  52.669  120.734 0.50 38.56  ? 26  DA  E "O4'" 1 
ATOM   1924 C "C3'" . DA  C 3 26  ? 70.868  52.513  122.081 0.50 38.56  ? 26  DA  E "C3'" 1 
ATOM   1925 O "O3'" . DA  C 3 26  ? 71.033  53.797  122.693 0.50 38.56  ? 26  DA  E "O3'" 1 
ATOM   1926 C "C2'" . DA  C 3 26  ? 69.763  51.697  122.728 0.50 38.56  ? 26  DA  E "C2'" 1 
ATOM   1927 C "C1'" . DA  C 3 26  ? 68.508  52.138  121.983 0.50 38.56  ? 26  DA  E "C1'" 1 
ATOM   1928 N N9    . DA  C 3 26  ? 67.582  51.042  121.692 0.50 22.61  ? 26  DA  E N9    1 
ATOM   1929 C C8    . DA  C 3 26  ? 67.857  49.890  120.997 0.50 22.61  ? 26  DA  E C8    1 
ATOM   1930 N N7    . DA  C 3 26  ? 66.823  49.096  120.859 0.50 22.61  ? 26  DA  E N7    1 
ATOM   1931 C C5    . DA  C 3 26  ? 65.799  49.767  121.512 0.50 22.61  ? 26  DA  E C5    1 
ATOM   1932 C C6    . DA  C 3 26  ? 64.446  49.452  121.721 0.50 22.61  ? 26  DA  E C6    1 
ATOM   1933 N N6    . DA  C 3 26  ? 63.866  48.340  121.265 0.50 22.61  ? 26  DA  E N6    1 
ATOM   1934 N N1    . DA  C 3 26  ? 63.697  50.331  122.419 0.50 22.61  ? 26  DA  E N1    1 
ATOM   1935 C C2    . DA  C 3 26  ? 64.279  51.449  122.870 0.50 22.61  ? 26  DA  E C2    1 
ATOM   1936 N N3    . DA  C 3 26  ? 65.537  51.859  122.737 0.50 22.61  ? 26  DA  E N3    1 
ATOM   1937 C C4    . DA  C 3 26  ? 66.255  50.963  122.038 0.50 22.61  ? 26  DA  E C4    1 
ATOM   1938 P P     . DC  C 3 27  ? 71.846  53.927  124.073 0.50 39.26  ? 27  DC  E P     1 
ATOM   1939 O OP1   . DC  C 3 27  ? 72.242  55.346  124.244 0.50 39.26  ? 27  DC  E OP1   1 
ATOM   1940 O OP2   . DC  C 3 27  ? 72.887  52.868  124.086 0.50 39.26  ? 27  DC  E OP2   1 
ATOM   1941 O "O5'" . DC  C 3 27  ? 70.759  53.569  125.180 0.50 39.26  ? 27  DC  E "O5'" 1 
ATOM   1942 C "C5'" . DC  C 3 27  ? 69.414  54.028  125.050 0.50 39.26  ? 27  DC  E "C5'" 1 
ATOM   1943 C "C4'" . DC  C 3 27  ? 68.565  53.495  126.180 0.50 29.96  ? 27  DC  E "C4'" 1 
ATOM   1944 O "O4'" . DC  C 3 27  ? 67.657  52.485  125.673 0.50 39.26  ? 27  DC  E "O4'" 1 
ATOM   1945 C "C3'" . DC  C 3 27  ? 69.343  52.832  127.318 0.50 39.26  ? 27  DC  E "C3'" 1 
ATOM   1946 O "O3'" . DC  C 3 27  ? 68.710  53.134  128.562 0.50 39.26  ? 27  DC  E "O3'" 1 
ATOM   1947 C "C2'" . DC  C 3 27  ? 69.192  51.352  127.023 0.50 39.26  ? 27  DC  E "C2'" 1 
ATOM   1948 C "C1'" . DC  C 3 27  ? 67.791  51.303  126.443 0.50 39.26  ? 27  DC  E "C1'" 1 
ATOM   1949 N N1    . DC  C 3 27  ? 67.512  50.151  125.569 0.50 29.96  ? 27  DC  E N1    1 
ATOM   1950 C C2    . DC  C 3 27  ? 66.180  49.779  125.355 0.50 29.96  ? 27  DC  E C2    1 
ATOM   1951 O O2    . DC  C 3 27  ? 65.277  50.448  125.880 0.50 29.96  ? 27  DC  E O2    1 
ATOM   1952 N N3    . DC  C 3 27  ? 65.912  48.702  124.580 0.50 29.96  ? 27  DC  E N3    1 
ATOM   1953 C C4    . DC  C 3 27  ? 66.911  48.011  124.029 0.50 29.96  ? 27  DC  E C4    1 
ATOM   1954 N N4    . DC  C 3 27  ? 66.601  46.949  123.283 0.50 29.96  ? 27  DC  E N4    1 
ATOM   1955 C C5    . DC  C 3 27  ? 68.275  48.378  124.219 0.50 29.96  ? 27  DC  E C5    1 
ATOM   1956 C C6    . DC  C 3 27  ? 68.528  49.445  124.987 0.50 29.96  ? 27  DC  E C6    1 
ATOM   1957 P P     . DG  C 3 28  ? 69.590  53.630  129.811 0.50 64.25  ? 28  DG  E P     1 
ATOM   1958 O OP1   . DG  C 3 28  ? 70.154  54.966  129.487 0.50 64.25  ? 28  DG  E OP1   1 
ATOM   1959 O OP2   . DG  C 3 28  ? 70.499  52.523  130.202 0.50 64.25  ? 28  DG  E OP2   1 
ATOM   1960 O "O5'" . DG  C 3 28  ? 68.508  53.816  130.962 0.50 64.25  ? 28  DG  E "O5'" 1 
ATOM   1961 C "C5'" . DG  C 3 28  ? 67.434  54.739  130.803 0.50 64.25  ? 28  DG  E "C5'" 1 
ATOM   1962 C "C4'" . DG  C 3 28  ? 66.130  54.107  131.230 0.50 24.98  ? 28  DG  E "C4'" 1 
ATOM   1963 O "O4'" . DG  C 3 28  ? 65.745  53.073  130.289 0.50 64.25  ? 28  DG  E "O4'" 1 
ATOM   1964 C "C3'" . DG  C 3 28  ? 66.158  53.441  132.605 0.50 64.25  ? 28  DG  E "C3'" 1 
ATOM   1965 O "O3'" . DG  C 3 28  ? 64.939  53.714  133.301 0.50 64.25  ? 28  DG  E "O3'" 1 
ATOM   1966 C "C2'" . DG  C 3 28  ? 66.278  51.963  132.281 0.50 64.25  ? 28  DG  E "C2'" 1 
ATOM   1967 C "C1'" . DG  C 3 28  ? 65.508  51.854  130.978 0.50 64.25  ? 28  DG  E "C1'" 1 
ATOM   1968 N N9    . DG  C 3 28  ? 65.939  50.757  130.116 0.50 24.98  ? 28  DG  E N9    1 
ATOM   1969 C C8    . DG  C 3 28  ? 67.232  50.426  129.785 0.50 24.98  ? 28  DG  E C8    1 
ATOM   1970 N N7    . DG  C 3 28  ? 67.309  49.389  128.994 0.50 24.98  ? 28  DG  E N7    1 
ATOM   1971 C C5    . DG  C 3 28  ? 65.989  49.012  128.788 0.50 24.98  ? 28  DG  E C5    1 
ATOM   1972 C C6    . DG  C 3 28  ? 65.445  47.951  128.016 0.50 24.98  ? 28  DG  E C6    1 
ATOM   1973 O O6    . DG  C 3 28  ? 66.041  47.107  127.338 0.50 24.98  ? 28  DG  E O6    1 
ATOM   1974 N N1    . DG  C 3 28  ? 64.057  47.928  128.086 0.50 24.98  ? 28  DG  E N1    1 
ATOM   1975 C C2    . DG  C 3 28  ? 63.288  48.808  128.805 0.50 24.98  ? 28  DG  E C2    1 
ATOM   1976 N N2    . DG  C 3 28  ? 61.963  48.612  128.753 0.50 24.98  ? 28  DG  E N2    1 
ATOM   1977 N N3    . DG  C 3 28  ? 63.781  49.805  129.525 0.50 24.98  ? 28  DG  E N3    1 
ATOM   1978 C C4    . DG  C 3 28  ? 65.130  49.846  129.473 0.50 24.98  ? 28  DG  E C4    1 
ATOM   1979 P P     . DA  C 3 29  ? 64.603  52.925  134.657 0.50 63.90  ? 29  DA  E P     1 
ATOM   1980 O OP1   . DA  C 3 29  ? 63.649  53.745  135.447 0.50 63.90  ? 29  DA  E OP1   1 
ATOM   1981 O OP2   . DA  C 3 29  ? 65.888  52.502  135.267 0.50 63.90  ? 29  DA  E OP2   1 
ATOM   1982 O "O5'" . DA  C 3 29  ? 63.837  51.629  134.145 0.50 63.90  ? 29  DA  E "O5'" 1 
ATOM   1983 C "C5'" . DA  C 3 29  ? 62.568  51.745  133.509 0.50 63.90  ? 29  DA  E "C5'" 1 
ATOM   1984 C "C4'" . DA  C 3 29  ? 61.863  50.411  133.507 0.50 29.44  ? 29  DA  E "C4'" 1 
ATOM   1985 O "O4'" . DA  C 3 29  ? 62.442  49.543  132.503 0.50 63.90  ? 29  DA  E "O4'" 1 
ATOM   1986 C "C3'" . DA  C 3 29  ? 61.965  49.658  134.832 0.50 63.90  ? 29  DA  E "C3'" 1 
ATOM   1987 O "O3'" . DA  C 3 29  ? 60.732  48.998  135.111 0.50 63.90  ? 29  DA  E "O3'" 1 
ATOM   1988 C "C2'" . DA  C 3 29  ? 63.048  48.629  134.564 0.50 63.90  ? 29  DA  E "C2'" 1 
ATOM   1989 C "C1'" . DA  C 3 29  ? 62.803  48.311  133.102 0.50 63.90  ? 29  DA  E "C1'" 1 
ATOM   1990 N N9    . DA  C 3 29  ? 63.957  47.773  132.385 0.50 29.44  ? 29  DA  E N9    1 
ATOM   1991 C C8    . DA  C 3 29  ? 65.276  48.153  132.467 0.50 29.44  ? 29  DA  E C8    1 
ATOM   1992 N N7    . DA  C 3 29  ? 66.078  47.446  131.706 0.50 29.44  ? 29  DA  E N7    1 
ATOM   1993 C C5    . DA  C 3 29  ? 65.229  46.543  131.077 0.50 29.44  ? 29  DA  E C5    1 
ATOM   1994 C C6    . DA  C 3 29  ? 65.461  45.514  130.147 0.50 29.44  ? 29  DA  E C6    1 
ATOM   1995 N N6    . DA  C 3 29  ? 66.668  45.202  129.673 0.50 29.44  ? 29  DA  E N6    1 
ATOM   1996 N N1    . DA  C 3 29  ? 64.395  44.805  129.717 0.50 29.44  ? 29  DA  E N1    1 
ATOM   1997 C C2    . DA  C 3 29  ? 63.184  45.115  130.194 0.50 29.44  ? 29  DA  E C2    1 
ATOM   1998 N N3    . DA  C 3 29  ? 62.840  46.056  131.070 0.50 29.44  ? 29  DA  E N3    1 
ATOM   1999 C C4    . DA  C 3 29  ? 63.921  46.741  131.479 0.50 29.44  ? 29  DA  E C4    1 
ATOM   2000 P P     . DA  C 3 30  ? 60.406  48.521  136.607 0.50 68.66  ? 30  DA  E P     1 
ATOM   2001 O OP1   . DA  C 3 30  ? 59.521  49.531  137.242 0.50 68.66  ? 30  DA  E OP1   1 
ATOM   2002 O OP2   . DA  C 3 30  ? 61.691  48.158  137.257 0.50 68.66  ? 30  DA  E OP2   1 
ATOM   2003 O "O5'" . DA  C 3 30  ? 59.570  47.187  136.388 0.50 68.66  ? 30  DA  E "O5'" 1 
ATOM   2004 C "C5'" . DA  C 3 30  ? 58.533  47.135  135.413 0.50 68.66  ? 30  DA  E "C5'" 1 
ATOM   2005 C "C4'" . DA  C 3 30  ? 58.376  45.724  134.900 0.50 31.30  ? 30  DA  E "C4'" 1 
ATOM   2006 O "O4'" . DA  C 3 30  ? 59.502  45.375  134.057 0.50 68.66  ? 30  DA  E "O4'" 1 
ATOM   2007 C "C3'" . DA  C 3 30  ? 58.328  44.669  136.005 0.50 68.66  ? 30  DA  E "C3'" 1 
ATOM   2008 O "O3'" . DA  C 3 30  ? 57.351  43.676  135.695 0.50 68.66  ? 30  DA  E "O3'" 1 
ATOM   2009 C "C2'" . DA  C 3 30  ? 59.726  44.076  135.989 0.50 68.66  ? 30  DA  E "C2'" 1 
ATOM   2010 C "C1'" . DA  C 3 30  ? 60.102  44.177  134.525 0.50 68.66  ? 30  DA  E "C1'" 1 
ATOM   2011 N N9    . DA  C 3 30  ? 61.543  44.268  134.284 0.50 31.30  ? 30  DA  E N9    1 
ATOM   2012 C C8    . DA  C 3 30  ? 62.441  45.140  134.851 0.50 31.30  ? 30  DA  E C8    1 
ATOM   2013 N N7    . DA  C 3 30  ? 63.676  44.966  134.446 0.50 31.30  ? 30  DA  E N7    1 
ATOM   2014 C C5    . DA  C 3 30  ? 63.587  43.911  133.549 0.50 31.30  ? 30  DA  E C5    1 
ATOM   2015 C C6    . DA  C 3 30  ? 64.553  43.244  132.770 0.50 31.30  ? 30  DA  E C6    1 
ATOM   2016 N N6    . DA  C 3 30  ? 65.852  43.552  132.775 0.50 31.30  ? 30  DA  E N6    1 
ATOM   2017 N N1    . DA  C 3 30  ? 64.132  42.236  131.976 0.50 31.30  ? 30  DA  E N1    1 
ATOM   2018 C C2    . DA  C 3 30  ? 62.829  41.926  131.971 0.50 31.30  ? 30  DA  E C2    1 
ATOM   2019 N N3    . DA  C 3 30  ? 61.828  42.476  132.657 0.50 31.30  ? 30  DA  E N3    1 
ATOM   2020 C C4    . DA  C 3 30  ? 62.278  43.473  133.436 0.50 31.30  ? 30  DA  E C4    1 
ATOM   2021 P P     . DA  C 3 31  ? 57.306  42.316  136.544 0.50 73.08  ? 31  DA  E P     1 
ATOM   2022 O OP1   . DA  C 3 31  ? 55.904  41.827  136.571 0.50 73.08  ? 31  DA  E OP1   1 
ATOM   2023 O OP2   . DA  C 3 31  ? 58.028  42.548  137.821 0.50 73.08  ? 31  DA  E OP2   1 
ATOM   2024 O "O5'" . DA  C 3 31  ? 58.166  41.314  135.659 0.50 73.08  ? 31  DA  E "O5'" 1 
ATOM   2025 C "C5'" . DA  C 3 31  ? 57.751  40.985  134.337 0.50 73.08  ? 31  DA  E "C5'" 1 
ATOM   2026 C "C4'" . DA  C 3 31  ? 58.362  39.671  133.915 0.50 37.85  ? 31  DA  E "C4'" 1 
ATOM   2027 O "O4'" . DA  C 3 31  ? 59.768  39.856  133.628 0.50 73.08  ? 31  DA  E "O4'" 1 
ATOM   2028 C "C3'" . DA  C 3 31  ? 58.287  38.585  134.986 0.50 73.08  ? 31  DA  E "C3'" 1 
ATOM   2029 O "O3'" . DA  C 3 31  ? 58.014  37.321  134.380 0.50 73.08  ? 31  DA  E "O3'" 1 
ATOM   2030 C "C2'" . DA  C 3 31  ? 59.669  38.611  135.612 0.50 73.08  ? 31  DA  E "C2'" 1 
ATOM   2031 C "C1'" . DA  C 3 31  ? 60.552  38.995  134.439 0.50 73.08  ? 31  DA  E "C1'" 1 
ATOM   2032 N N9    . DA  C 3 31  ? 61.760  39.729  134.814 0.50 37.85  ? 31  DA  E N9    1 
ATOM   2033 C C8    . DA  C 3 31  ? 61.855  40.827  135.634 0.50 37.85  ? 31  DA  E C8    1 
ATOM   2034 N N7    . DA  C 3 31  ? 63.077  41.279  135.771 0.50 37.85  ? 31  DA  E N7    1 
ATOM   2035 C C5    . DA  C 3 31  ? 63.840  40.418  134.993 0.50 37.85  ? 31  DA  E C5    1 
ATOM   2036 C C6    . DA  C 3 31  ? 65.218  40.362  134.718 0.50 37.85  ? 31  DA  E C6    1 
ATOM   2037 N N6    . DA  C 3 31  ? 66.109  41.224  135.214 0.50 37.85  ? 31  DA  E N6    1 
ATOM   2038 N N1    . DA  C 3 31  ? 65.655  39.378  133.902 0.50 37.85  ? 31  DA  E N1    1 
ATOM   2039 C C2    . DA  C 3 31  ? 64.760  38.516  133.402 0.50 37.85  ? 31  DA  E C2    1 
ATOM   2040 N N3    . DA  C 3 31  ? 63.443  38.465  133.587 0.50 37.85  ? 31  DA  E N3    1 
ATOM   2041 C C4    . DA  C 3 31  ? 63.041  39.457  134.402 0.50 37.85  ? 31  DA  E C4    1 
ATOM   2042 P P     . DT  C 3 32  ? 58.320  35.972  135.189 0.50 60.82  ? 32  DT  E P     1 
ATOM   2043 O OP1   . DT  C 3 32  ? 57.502  34.880  134.602 0.50 60.82  ? 32  DT  E OP1   1 
ATOM   2044 O OP2   . DT  C 3 32  ? 58.208  36.277  136.638 0.50 60.82  ? 32  DT  E OP2   1 
ATOM   2045 O "O5'" . DT  C 3 32  ? 59.847  35.690  134.847 0.50 60.82  ? 32  DT  E "O5'" 1 
ATOM   2046 C "C5'" . DT  C 3 32  ? 60.258  35.525  133.494 0.50 60.82  ? 32  DT  E "C5'" 1 
ATOM   2047 C "C4'" . DT  C 3 32  ? 61.503  34.675  133.428 0.50 29.31  ? 32  DT  E "C4'" 1 
ATOM   2048 O "O4'" . DT  C 3 32  ? 62.667  35.459  133.782 0.50 60.82  ? 32  DT  E "O4'" 1 
ATOM   2049 C "C3'" . DT  C 3 32  ? 61.491  33.472  134.370 0.50 60.82  ? 32  DT  E "C3'" 1 
ATOM   2050 O "O3'" . DT  C 3 32  ? 62.041  32.333  133.708 0.50 60.82  ? 32  DT  E "O3'" 1 
ATOM   2051 C "C2'" . DT  C 3 32  ? 62.382  33.915  135.518 0.50 60.82  ? 32  DT  E "C2'" 1 
ATOM   2052 C "C1'" . DT  C 3 32  ? 63.387  34.813  134.819 0.50 60.82  ? 32  DT  E "C1'" 1 
ATOM   2053 N N1    . DT  C 3 32  ? 63.988  35.861  135.666 0.50 29.31  ? 32  DT  E N1    1 
ATOM   2054 C C2    . DT  C 3 32  ? 65.349  36.057  135.584 0.50 29.31  ? 32  DT  E C2    1 
ATOM   2055 O O2    . DT  C 3 32  ? 66.075  35.393  134.864 0.50 29.31  ? 32  DT  E O2    1 
ATOM   2056 N N3    . DT  C 3 32  ? 65.832  37.067  136.380 0.50 29.31  ? 32  DT  E N3    1 
ATOM   2057 C C4    . DT  C 3 32  ? 65.108  37.873  137.236 0.50 29.31  ? 32  DT  E C4    1 
ATOM   2058 O O4    . DT  C 3 32  ? 65.679  38.745  137.883 0.50 29.31  ? 32  DT  E O4    1 
ATOM   2059 C C5    . DT  C 3 32  ? 63.689  37.602  137.284 0.50 29.31  ? 32  DT  E C5    1 
ATOM   2060 C C7    . DT  C 3 32  ? 62.826  38.418  138.194 0.50 29.31  ? 32  DT  E C7    1 
ATOM   2061 C C6    . DT  C 3 32  ? 63.206  36.624  136.507 0.50 29.31  ? 32  DT  E C6    1 
ATOM   2062 P P     . DT  C 3 33  ? 61.990  30.898  134.423 0.50 44.59  ? 33  DT  E P     1 
ATOM   2063 O OP1   . DT  C 3 33  ? 61.575  29.890  133.415 0.50 44.59  ? 33  DT  E OP1   1 
ATOM   2064 O OP2   . DT  C 3 33  ? 61.215  31.041  135.681 0.50 44.59  ? 33  DT  E OP2   1 
ATOM   2065 O "O5'" . DT  C 3 33  ? 63.513  30.634  134.800 0.50 44.59  ? 33  DT  E "O5'" 1 
ATOM   2066 C "C5'" . DT  C 3 33  ? 64.514  30.623  133.786 0.50 44.59  ? 33  DT  E "C5'" 1 
ATOM   2067 C "C4'" . DT  C 3 33  ? 65.880  30.426  134.400 0.50 33.42  ? 33  DT  E "C4'" 1 
ATOM   2068 O "O4'" . DT  C 3 33  ? 66.340  31.646  135.033 0.50 44.59  ? 33  DT  E "O4'" 1 
ATOM   2069 C "C3'" . DT  C 3 33  ? 65.941  29.339  135.473 0.50 44.59  ? 33  DT  E "C3'" 1 
ATOM   2070 O "O3'" . DT  C 3 33  ? 67.148  28.595  135.328 0.50 44.59  ? 33  DT  E "O3'" 1 
ATOM   2071 C "C2'" . DT  C 3 33  ? 65.984  30.130  136.767 0.50 44.59  ? 33  DT  E "C2'" 1 
ATOM   2072 C "C1'" . DT  C 3 33  ? 66.781  31.350  136.347 0.50 44.59  ? 33  DT  E "C1'" 1 
ATOM   2073 N N1    . DT  C 3 33  ? 66.590  32.552  137.182 0.50 33.42  ? 33  DT  E N1    1 
ATOM   2074 C C2    . DT  C 3 33  ? 67.641  33.436  137.281 0.50 33.42  ? 33  DT  E C2    1 
ATOM   2075 O O2    . DT  C 3 33  ? 68.701  33.275  136.702 0.50 33.42  ? 33  DT  E O2    1 
ATOM   2076 N N3    . DT  C 3 33  ? 67.402  34.522  138.085 0.50 33.42  ? 33  DT  E N3    1 
ATOM   2077 C C4    . DT  C 3 33  ? 66.245  34.806  138.782 0.50 33.42  ? 33  DT  E C4    1 
ATOM   2078 O O4    . DT  C 3 33  ? 66.179  35.822  139.468 0.50 33.42  ? 33  DT  E O4    1 
ATOM   2079 C C5    . DT  C 3 33  ? 65.182  33.840  138.630 0.50 33.42  ? 33  DT  E C5    1 
ATOM   2080 C C7    . DT  C 3 33  ? 63.889  34.066  139.348 0.50 33.42  ? 33  DT  E C7    1 
ATOM   2081 C C6    . DT  C 3 33  ? 65.404  32.776  137.847 0.50 33.42  ? 33  DT  E C6    1 
ATOM   2082 P P     . DA  C 3 34  ? 67.291  27.164  136.037 0.50 56.81  ? 34  DA  E P     1 
ATOM   2083 O OP1   . DA  C 3 34  ? 67.032  26.108  135.025 0.50 56.81  ? 34  DA  E OP1   1 
ATOM   2084 O OP2   . DA  C 3 34  ? 66.490  27.196  137.287 0.50 56.81  ? 34  DA  E OP2   1 
ATOM   2085 O "O5'" . DA  C 3 34  ? 68.831  27.120  136.431 0.50 56.81  ? 34  DA  E "O5'" 1 
ATOM   2086 C "C5'" . DA  C 3 34  ? 69.802  27.744  135.598 0.50 56.81  ? 34  DA  E "C5'" 1 
ATOM   2087 C "C4'" . DA  C 3 34  ? 70.814  28.488  136.438 0.50 22.64  ? 34  DA  E "C4'" 1 
ATOM   2088 O "O4'" . DA  C 3 34  ? 70.200  29.635  137.080 0.50 56.81  ? 34  DA  E "O4'" 1 
ATOM   2089 C "C3'" . DA  C 3 34  ? 71.440  27.662  137.562 0.50 56.81  ? 34  DA  E "C3'" 1 
ATOM   2090 O "O3'" . DA  C 3 34  ? 72.818  28.010  137.680 0.50 56.81  ? 34  DA  E "O3'" 1 
ATOM   2091 C "C2'" . DA  C 3 34  ? 70.697  28.138  138.796 0.50 56.81  ? 34  DA  E "C2'" 1 
ATOM   2092 C "C1'" . DA  C 3 34  ? 70.498  29.603  138.466 0.50 56.81  ? 34  DA  E "C1'" 1 
ATOM   2093 N N9    . DA  C 3 34  ? 69.410  30.262  139.188 0.50 22.64  ? 34  DA  E N9    1 
ATOM   2094 C C8    . DA  C 3 34  ? 68.123  29.824  139.376 0.50 22.64  ? 34  DA  E C8    1 
ATOM   2095 N N7    . DA  C 3 34  ? 67.381  30.646  140.079 0.50 22.64  ? 34  DA  E N7    1 
ATOM   2096 C C5    . DA  C 3 34  ? 68.238  31.698  140.375 0.50 22.64  ? 34  DA  E C5    1 
ATOM   2097 C C6    . DA  C 3 34  ? 68.057  32.894  141.094 0.50 22.64  ? 34  DA  E C6    1 
ATOM   2098 N N6    . DA  C 3 34  ? 66.905  33.246  141.673 0.50 22.64  ? 34  DA  E N6    1 
ATOM   2099 N N1    . DA  C 3 34  ? 69.115  33.729  141.200 0.50 22.64  ? 34  DA  E N1    1 
ATOM   2100 C C2    . DA  C 3 34  ? 70.269  33.376  140.620 0.50 22.64  ? 34  DA  E C2    1 
ATOM   2101 N N3    . DA  C 3 34  ? 70.561  32.282  139.918 0.50 22.64  ? 34  DA  E N3    1 
ATOM   2102 C C4    . DA  C 3 34  ? 69.489  31.475  139.831 0.50 22.64  ? 34  DA  E C4    1 
ATOM   2103 P P     . DT  C 3 35  ? 73.873  26.921  138.195 0.50 58.33  ? 35  DT  E P     1 
ATOM   2104 O OP1   . DT  C 3 35  ? 74.370  26.164  137.018 0.50 58.33  ? 35  DT  E OP1   1 
ATOM   2105 O OP2   . DT  C 3 35  ? 73.249  26.191  139.328 0.50 58.33  ? 35  DT  E OP2   1 
ATOM   2106 O "O5'" . DT  C 3 35  ? 75.064  27.815  138.757 0.50 58.33  ? 35  DT  E "O5'" 1 
ATOM   2107 C "C5'" . DT  C 3 35  ? 75.370  27.851  140.149 0.50 58.33  ? 35  DT  E "C5'" 1 
ATOM   2108 C "C4'" . DT  C 3 35  ? 75.553  29.281  140.603 0.50 29.38  ? 35  DT  E "C4'" 1 
ATOM   2109 O "O4'" . DT  C 3 35  ? 74.252  29.919  140.707 0.50 58.33  ? 35  DT  E "O4'" 1 
ATOM   2110 C "C3'" . DT  C 3 35  ? 76.196  29.429  141.982 0.50 58.33  ? 35  DT  E "C3'" 1 
ATOM   2111 O "O3'" . DT  C 3 35  ? 76.915  30.663  142.030 0.50 58.33  ? 35  DT  E "O3'" 1 
ATOM   2112 C "C2'" . DT  C 3 35  ? 75.002  29.597  142.900 0.50 58.33  ? 35  DT  E "C2'" 1 
ATOM   2113 C "C1'" . DT  C 3 35  ? 74.071  30.415  142.028 0.50 58.33  ? 35  DT  E "C1'" 1 
ATOM   2114 N N1    . DT  C 3 35  ? 72.643  30.300  142.388 0.50 29.38  ? 35  DT  E N1    1 
ATOM   2115 C C2    . DT  C 3 35  ? 72.033  31.405  142.941 0.50 29.38  ? 35  DT  E C2    1 
ATOM   2116 O O2    . DT  C 3 35  ? 72.611  32.466  143.119 0.50 29.38  ? 35  DT  E O2    1 
ATOM   2117 N N3    . DT  C 3 35  ? 70.715  31.225  143.278 0.50 29.38  ? 35  DT  E N3    1 
ATOM   2118 C C4    . DT  C 3 35  ? 69.961  30.079  143.119 0.50 29.38  ? 35  DT  E C4    1 
ATOM   2119 O O4    . DT  C 3 35  ? 68.786  30.064  143.475 0.50 29.38  ? 35  DT  E O4    1 
ATOM   2120 C C5    . DT  C 3 35  ? 70.661  28.959  142.524 0.50 29.38  ? 35  DT  E C5    1 
ATOM   2121 C C7    . DT  C 3 35  ? 69.922  27.677  142.307 0.50 29.38  ? 35  DT  E C7    1 
ATOM   2122 C C6    . DT  C 3 35  ? 71.950  29.125  142.192 0.50 29.38  ? 35  DT  E C6    1 
ATOM   2123 P P     . DA  D 4 2   ? 65.299  83.908  29.978  0.50 99.11  ? 2   DA  F P     1 
ATOM   2124 O OP1   . DA  D 4 2   ? 65.513  84.956  28.947  0.50 99.11  ? 2   DA  F OP1   1 
ATOM   2125 O OP2   . DA  D 4 2   ? 64.534  84.233  31.209  0.50 99.11  ? 2   DA  F OP2   1 
ATOM   2126 O "O5'" . DA  D 4 2   ? 66.724  83.343  30.416  0.50 99.11  ? 2   DA  F "O5'" 1 
ATOM   2127 C "C5'" . DA  D 4 2   ? 67.785  83.208  29.469  0.50 99.11  ? 2   DA  F "C5'" 1 
ATOM   2128 C "C4'" . DA  D 4 2   ? 69.125  83.308  30.163  0.50 30.63  ? 2   DA  F "C4'" 1 
ATOM   2129 O "O4'" . DA  D 4 2   ? 69.318  84.653  30.666  0.50 99.11  ? 2   DA  F "O4'" 1 
ATOM   2130 C "C3'" . DA  D 4 2   ? 69.303  82.380  31.365  0.50 99.11  ? 2   DA  F "C3'" 1 
ATOM   2131 O "O3'" . DA  D 4 2   ? 70.640  81.874  31.397  0.50 99.11  ? 2   DA  F "O3'" 1 
ATOM   2132 C "C2'" . DA  D 4 2   ? 69.055  83.291  32.553  0.50 99.11  ? 2   DA  F "C2'" 1 
ATOM   2133 C "C1'" . DA  D 4 2   ? 69.601  84.616  32.057  0.50 99.11  ? 2   DA  F "C1'" 1 
ATOM   2134 N N9    . DA  D 4 2   ? 68.984  85.791  32.674  0.50 30.63  ? 2   DA  F N9    1 
ATOM   2135 C C8    . DA  D 4 2   ? 67.646  86.069  32.809  0.50 30.63  ? 2   DA  F C8    1 
ATOM   2136 N N7    . DA  D 4 2   ? 67.400  87.210  33.408  0.50 30.63  ? 2   DA  F N7    1 
ATOM   2137 C C5    . DA  D 4 2   ? 68.662  87.717  33.687  0.50 30.63  ? 2   DA  F C5    1 
ATOM   2138 C C6    . DA  D 4 2   ? 69.087  88.901  34.313  0.50 30.63  ? 2   DA  F C6    1 
ATOM   2139 N N6    . DA  D 4 2   ? 68.252  89.828  34.789  0.50 30.63  ? 2   DA  F N6    1 
ATOM   2140 N N1    . DA  D 4 2   ? 70.417  89.105  34.435  0.50 30.63  ? 2   DA  F N1    1 
ATOM   2141 C C2    . DA  D 4 2   ? 71.253  88.176  33.955  0.50 30.63  ? 2   DA  F C2    1 
ATOM   2142 N N3    . DA  D 4 2   ? 70.975  87.025  33.347  0.50 30.63  ? 2   DA  F N3    1 
ATOM   2143 C C4    . DA  D 4 2   ? 69.646  86.853  33.242  0.50 30.63  ? 2   DA  F C4    1 
ATOM   2144 P P     . DT  D 4 3   ? 71.062  80.811  32.525  0.50 53.29  ? 3   DT  F P     1 
ATOM   2145 O OP1   . DT  D 4 3   ? 72.191  79.997  32.002  0.50 53.29  ? 3   DT  F OP1   1 
ATOM   2146 O OP2   . DT  D 4 3   ? 69.826  80.137  32.999  0.50 53.29  ? 3   DT  F OP2   1 
ATOM   2147 O "O5'" . DT  D 4 3   ? 71.616  81.719  33.710  0.50 53.29  ? 3   DT  F "O5'" 1 
ATOM   2148 C "C5'" . DT  D 4 3   ? 72.905  82.319  33.621  0.50 53.29  ? 3   DT  F "C5'" 1 
ATOM   2149 C "C4'" . DT  D 4 3   ? 73.306  82.901  34.956  0.50 24.71  ? 3   DT  F "C4'" 1 
ATOM   2150 O "O4'" . DT  D 4 3   ? 72.523  84.085  35.245  0.50 53.29  ? 3   DT  F "O4'" 1 
ATOM   2151 C "C3'" . DT  D 4 3   ? 73.113  81.964  36.150  0.50 53.29  ? 3   DT  F "C3'" 1 
ATOM   2152 O "O3'" . DT  D 4 3   ? 74.177  82.169  37.080  0.50 53.29  ? 3   DT  F "O3'" 1 
ATOM   2153 C "C2'" . DT  D 4 3   ? 71.821  82.464  36.767  0.50 53.29  ? 3   DT  F "C2'" 1 
ATOM   2154 C "C1'" . DT  D 4 3   ? 71.955  83.956  36.535  0.50 53.29  ? 3   DT  F "C1'" 1 
ATOM   2155 N N1    . DT  D 4 3   ? 70.700  84.727  36.567  0.50 24.71  ? 3   DT  F N1    1 
ATOM   2156 C C2    . DT  D 4 3   ? 70.759  86.015  37.046  0.50 24.71  ? 3   DT  F C2    1 
ATOM   2157 O O2    . DT  D 4 3   ? 71.796  86.539  37.418  0.50 24.71  ? 3   DT  F O2    1 
ATOM   2158 N N3    . DT  D 4 3   ? 69.556  86.672  37.073  0.50 24.71  ? 3   DT  F N3    1 
ATOM   2159 C C4    . DT  D 4 3   ? 68.329  86.182  36.669  0.50 24.71  ? 3   DT  F C4    1 
ATOM   2160 O O4    . DT  D 4 3   ? 67.330  86.892  36.758  0.50 24.71  ? 3   DT  F O4    1 
ATOM   2161 C C5    . DT  D 4 3   ? 68.342  84.827  36.164  0.50 24.71  ? 3   DT  F C5    1 
ATOM   2162 C C7    . DT  D 4 3   ? 67.061  84.214  35.694  0.50 24.71  ? 3   DT  F C7    1 
ATOM   2163 C C6    . DT  D 4 3   ? 69.512  84.176  36.139  0.50 24.71  ? 3   DT  F C6    1 
ATOM   2164 P P     . DA  D 4 4   ? 74.923  80.908  37.733  0.50 43.49  ? 4   DA  F P     1 
ATOM   2165 O OP1   . DA  D 4 4   ? 75.745  80.255  36.683  0.50 43.49  ? 4   DA  F OP1   1 
ATOM   2166 O OP2   . DA  D 4 4   ? 73.907  80.114  38.469  0.50 43.49  ? 4   DA  F OP2   1 
ATOM   2167 O "O5'" . DA  D 4 4   ? 75.903  81.578  38.791  0.50 43.49  ? 4   DA  F "O5'" 1 
ATOM   2168 C "C5'" . DA  D 4 4   ? 76.823  82.587  38.385  0.50 43.49  ? 4   DA  F "C5'" 1 
ATOM   2169 C "C4'" . DA  D 4 4   ? 76.776  83.757  39.340  0.50 20.63  ? 4   DA  F "C4'" 1 
ATOM   2170 O "O4'" . DA  D 4 4   ? 75.487  84.411  39.257  0.50 43.49  ? 4   DA  F "O4'" 1 
ATOM   2171 C "C3'" . DA  D 4 4   ? 76.973  83.399  40.813  0.50 43.49  ? 4   DA  F "C3'" 1 
ATOM   2172 O "O3'" . DA  D 4 4   ? 77.763  84.408  41.448  0.50 43.49  ? 4   DA  F "O3'" 1 
ATOM   2173 C "C2'" . DA  D 4 4   ? 75.560  83.399  41.369  0.50 43.49  ? 4   DA  F "C2'" 1 
ATOM   2174 C "C1'" . DA  D 4 4   ? 74.893  84.485  40.547  0.50 43.49  ? 4   DA  F "C1'" 1 
ATOM   2175 N N9    . DA  D 4 4   ? 73.447  84.326  40.382  0.50 20.63  ? 4   DA  F N9    1 
ATOM   2176 C C8    . DA  D 4 4   ? 72.769  83.236  39.894  0.50 20.63  ? 4   DA  F C8    1 
ATOM   2177 N N7    . DA  D 4 4   ? 71.469  83.402  39.838  0.50 20.63  ? 4   DA  F N7    1 
ATOM   2178 C C5    . DA  D 4 4   ? 71.276  84.687  40.327  0.50 20.63  ? 4   DA  F C5    1 
ATOM   2179 C C6    . DA  D 4 4   ? 70.118  85.464  40.516  0.50 20.63  ? 4   DA  F C6    1 
ATOM   2180 N N6    . DA  D 4 4   ? 68.887  85.046  40.212  0.50 20.63  ? 4   DA  F N6    1 
ATOM   2181 N N1    . DA  D 4 4   ? 70.270  86.703  41.030  0.50 20.63  ? 4   DA  F N1    1 
ATOM   2182 C C2    . DA  D 4 4   ? 71.505  87.125  41.326  0.50 20.63  ? 4   DA  F C2    1 
ATOM   2183 N N3    . DA  D 4 4   ? 72.670  86.493  41.188  0.50 20.63  ? 4   DA  F N3    1 
ATOM   2184 C C4    . DA  D 4 4   ? 72.484  85.264  40.677  0.50 20.63  ? 4   DA  F C4    1 
ATOM   2185 P P     . DA  D 4 5   ? 78.248  84.202  42.963  0.50 31.20  ? 5   DA  F P     1 
ATOM   2186 O OP1   . DA  D 4 5   ? 79.379  85.128  43.220  0.50 31.20  ? 5   DA  F OP1   1 
ATOM   2187 O OP2   . DA  D 4 5   ? 78.427  82.745  43.186  0.50 31.20  ? 5   DA  F OP2   1 
ATOM   2188 O "O5'" . DA  D 4 5   ? 77.001  84.695  43.819  0.50 31.20  ? 5   DA  F "O5'" 1 
ATOM   2189 C "C5'" . DA  D 4 5   ? 76.778  86.085  44.035  0.50 31.20  ? 5   DA  F "C5'" 1 
ATOM   2190 C "C4'" . DA  D 4 5   ? 75.771  86.286  45.142  0.50 18.92  ? 5   DA  F "C4'" 1 
ATOM   2191 O "O4'" . DA  D 4 5   ? 74.432  86.016  44.656  0.50 31.20  ? 5   DA  F "O4'" 1 
ATOM   2192 C "C3'" . DA  D 4 5   ? 75.976  85.375  46.353  0.50 31.20  ? 5   DA  F "C3'" 1 
ATOM   2193 O "O3'" . DA  D 4 5   ? 75.727  86.099  47.564  0.50 31.20  ? 5   DA  F "O3'" 1 
ATOM   2194 C "C2'" . DA  D 4 5   ? 74.926  84.298  46.153  0.50 31.20  ? 5   DA  F "C2'" 1 
ATOM   2195 C "C1'" . DA  D 4 5   ? 73.799  85.097  45.528  0.50 31.20  ? 5   DA  F "C1'" 1 
ATOM   2196 N N9    . DA  D 4 5   ? 72.831  84.321  44.751  0.50 18.92  ? 5   DA  F N9    1 
ATOM   2197 C C8    . DA  D 4 5   ? 72.975  83.065  44.216  0.50 18.92  ? 5   DA  F C8    1 
ATOM   2198 N N7    . DA  D 4 5   ? 71.907  82.630  43.592  0.50 18.92  ? 5   DA  F N7    1 
ATOM   2199 C C5    . DA  D 4 5   ? 70.999  83.672  43.720  0.50 18.92  ? 5   DA  F C5    1 
ATOM   2200 C C6    . DA  D 4 5   ? 69.671  83.831  43.282  0.50 18.92  ? 5   DA  F C6    1 
ATOM   2201 N N6    . DA  D 4 5   ? 69.001  82.899  42.601  0.50 18.92  ? 5   DA  F N6    1 
ATOM   2202 N N1    . DA  D 4 5   ? 69.048  84.994  43.573  0.50 18.92  ? 5   DA  F N1    1 
ATOM   2203 C C2    . DA  D 4 5   ? 69.720  85.925  44.262  0.50 18.92  ? 5   DA  F C2    1 
ATOM   2204 N N3    . DA  D 4 5   ? 70.966  85.891  44.733  0.50 18.92  ? 5   DA  F N3    1 
ATOM   2205 C C4    . DA  D 4 5   ? 71.557  84.723  44.426  0.50 18.92  ? 5   DA  F C4    1 
ATOM   2206 P P     . DA  D 4 6   ? 76.215  85.494  48.972  0.50 40.11  ? 6   DA  F P     1 
ATOM   2207 O OP1   . DA  D 4 6   ? 76.853  86.581  49.756  0.50 40.11  ? 6   DA  F OP1   1 
ATOM   2208 O OP2   . DA  D 4 6   ? 76.975  84.251  48.685  0.50 40.11  ? 6   DA  F OP2   1 
ATOM   2209 O "O5'" . DA  D 4 6   ? 74.855  85.091  49.691  0.50 40.11  ? 6   DA  F "O5'" 1 
ATOM   2210 C "C5'" . DA  D 4 6   ? 73.713  84.757  48.916  0.50 40.11  ? 6   DA  F "C5'" 1 
ATOM   2211 C "C4'" . DA  D 4 6   ? 72.588  85.724  49.197  0.50 5.00   ? 6   DA  F "C4'" 1 
ATOM   2212 O "O4'" . DA  D 4 6   ? 71.617  85.617  48.133  0.50 40.11  ? 6   DA  F "O4'" 1 
ATOM   2213 C "C3'" . DA  D 4 6   ? 71.839  85.431  50.491  0.50 40.11  ? 6   DA  F "C3'" 1 
ATOM   2214 O "O3'" . DA  D 4 6   ? 71.402  86.633  51.129  0.50 40.11  ? 6   DA  F "O3'" 1 
ATOM   2215 C "C2'" . DA  D 4 6   ? 70.664  84.589  50.035  0.50 40.11  ? 6   DA  F "C2'" 1 
ATOM   2216 C "C1'" . DA  D 4 6   ? 70.408  85.044  48.604  0.50 40.11  ? 6   DA  F "C1'" 1 
ATOM   2217 N N9    . DA  D 4 6   ? 70.086  83.929  47.714  0.50 5.00   ? 6   DA  F N9    1 
ATOM   2218 C C8    . DA  D 4 6   ? 70.907  82.878  47.388  0.50 5.00   ? 6   DA  F C8    1 
ATOM   2219 N N7    . DA  D 4 6   ? 70.354  82.006  46.582  0.50 5.00   ? 6   DA  F N7    1 
ATOM   2220 C C5    . DA  D 4 6   ? 69.084  82.519  46.357  0.50 5.00   ? 6   DA  F C5    1 
ATOM   2221 C C6    . DA  D 4 6   ? 68.004  82.059  45.584  0.50 5.00   ? 6   DA  F C6    1 
ATOM   2222 N N6    . DA  D 4 6   ? 68.034  80.933  44.867  0.50 5.00   ? 6   DA  F N6    1 
ATOM   2223 N N1    . DA  D 4 6   ? 66.879  82.804  45.573  0.50 5.00   ? 6   DA  F N1    1 
ATOM   2224 C C2    . DA  D 4 6   ? 66.852  83.935  46.291  0.50 5.00   ? 6   DA  F C2    1 
ATOM   2225 N N3    . DA  D 4 6   ? 67.803  84.473  47.053  0.50 5.00   ? 6   DA  F N3    1 
ATOM   2226 C C4    . DA  D 4 6   ? 68.907  83.706  47.045  0.50 5.00   ? 6   DA  F C4    1 
ATOM   2227 P P     . DT  D 4 7   ? 70.652  86.547  52.548  0.50 32.52  ? 7   DT  F P     1 
ATOM   2228 O OP1   . DT  D 4 7   ? 70.880  87.816  53.284  0.50 32.52  ? 7   DT  F OP1   1 
ATOM   2229 O OP2   . DT  D 4 7   ? 71.030  85.255  53.175  0.50 32.52  ? 7   DT  F OP2   1 
ATOM   2230 O "O5'" . DT  D 4 7   ? 69.114  86.472  52.150  0.50 32.52  ? 7   DT  F "O5'" 1 
ATOM   2231 C "C5'" . DT  D 4 7   ? 68.500  87.542  51.441  0.50 32.52  ? 7   DT  F "C5'" 1 
ATOM   2232 C "C4'" . DT  D 4 7   ? 67.025  87.276  51.272  0.50 19.92  ? 7   DT  F "C4'" 1 
ATOM   2233 O "O4'" . DT  D 4 7   ? 66.825  86.199  50.326  0.50 32.52  ? 7   DT  F "O4'" 1 
ATOM   2234 C "C3'" . DT  D 4 7   ? 66.322  86.847  52.558  0.50 32.52  ? 7   DT  F "C3'" 1 
ATOM   2235 O "O3'" . DT  D 4 7   ? 65.025  87.440  52.624  0.50 32.52  ? 7   DT  F "O3'" 1 
ATOM   2236 C "C2'" . DT  D 4 7   ? 66.216  85.340  52.414  0.50 32.52  ? 7   DT  F "C2'" 1 
ATOM   2237 C "C1'" . DT  D 4 7   ? 66.045  85.172  50.917  0.50 32.52  ? 7   DT  F "C1'" 1 
ATOM   2238 N N1    . DT  D 4 7   ? 66.512  83.880  50.377  0.50 19.92  ? 7   DT  F N1    1 
ATOM   2239 C C2    . DT  D 4 7   ? 65.681  83.203  49.512  0.50 19.92  ? 7   DT  F C2    1 
ATOM   2240 O O2    . DT  D 4 7   ? 64.577  83.613  49.192  0.50 19.92  ? 7   DT  F O2    1 
ATOM   2241 N N3    . DT  D 4 7   ? 66.193  82.021  49.033  0.50 19.92  ? 7   DT  F N3    1 
ATOM   2242 C C4    . DT  D 4 7   ? 67.420  81.460  49.332  0.50 19.92  ? 7   DT  F C4    1 
ATOM   2243 O O4    . DT  D 4 7   ? 67.750  80.393  48.817  0.50 19.92  ? 7   DT  F O4    1 
ATOM   2244 C C5    . DT  D 4 7   ? 68.232  82.215  50.257  0.50 19.92  ? 7   DT  F C5    1 
ATOM   2245 C C7    . DT  D 4 7   ? 69.570  81.674  50.651  0.50 19.92  ? 7   DT  F C7    1 
ATOM   2246 C C6    . DT  D 4 7   ? 67.745  83.372  50.726  0.50 19.92  ? 7   DT  F C6    1 
ATOM   2247 P P     . DT  D 4 8   ? 64.102  87.185  53.911  0.50 44.90  ? 8   DT  F P     1 
ATOM   2248 O OP1   . DT  D 4 8   ? 63.389  88.445  54.235  0.50 44.90  ? 8   DT  F OP1   1 
ATOM   2249 O OP2   . DT  D 4 8   ? 64.943  86.531  54.945  0.50 44.90  ? 8   DT  F OP2   1 
ATOM   2250 O "O5'" . DT  D 4 8   ? 63.036  86.128  53.387  0.50 44.90  ? 8   DT  F "O5'" 1 
ATOM   2251 C "C5'" . DT  D 4 8   ? 62.211  86.434  52.269  0.50 44.90  ? 8   DT  F "C5'" 1 
ATOM   2252 C "C4'" . DT  D 4 8   ? 61.309  85.266  51.948  0.50 25.82  ? 8   DT  F "C4'" 1 
ATOM   2253 O "O4'" . DT  D 4 8   ? 62.093  84.172  51.416  0.50 44.90  ? 8   DT  F "O4'" 1 
ATOM   2254 C "C3'" . DT  D 4 8   ? 60.546  84.701  53.147  0.50 44.90  ? 8   DT  F "C3'" 1 
ATOM   2255 O "O3'" . DT  D 4 8   ? 59.216  84.360  52.750  0.50 44.90  ? 8   DT  F "O3'" 1 
ATOM   2256 C "C2'" . DT  D 4 8   ? 61.335  83.456  53.511  0.50 44.90  ? 8   DT  F "C2'" 1 
ATOM   2257 C "C1'" . DT  D 4 8   ? 61.838  82.989  52.157  0.50 44.90  ? 8   DT  F "C1'" 1 
ATOM   2258 N N1    . DT  D 4 8   ? 63.084  82.197  52.191  0.50 25.82  ? 8   DT  F N1    1 
ATOM   2259 C C2    . DT  D 4 8   ? 63.142  81.052  51.428  0.50 25.82  ? 8   DT  F C2    1 
ATOM   2260 O O2    . DT  D 4 8   ? 62.212  80.661  50.744  0.50 25.82  ? 8   DT  F O2    1 
ATOM   2261 N N3    . DT  D 4 8   ? 64.337  80.379  51.495  0.50 25.82  ? 8   DT  F N3    1 
ATOM   2262 C C4    . DT  D 4 8   ? 65.450  80.725  52.236  0.50 25.82  ? 8   DT  F C4    1 
ATOM   2263 O O4    . DT  D 4 8   ? 66.457  80.024  52.192  0.50 25.82  ? 8   DT  F O4    1 
ATOM   2264 C C5    . DT  D 4 8   ? 65.317  81.929  53.021  0.50 25.82  ? 8   DT  F C5    1 
ATOM   2265 C C7    . DT  D 4 8   ? 66.470  82.374  53.863  0.50 25.82  ? 8   DT  F C7    1 
ATOM   2266 C C6    . DT  D 4 8   ? 64.156  82.596  52.960  0.50 25.82  ? 8   DT  F C6    1 
ATOM   2267 P P     . DC  D 4 9   ? 58.146  83.899  53.855  0.50 45.61  ? 9   DC  F P     1 
ATOM   2268 O OP1   . DC  D 4 9   ? 56.934  84.744  53.714  0.50 45.61  ? 9   DC  F OP1   1 
ATOM   2269 O OP2   . DC  D 4 9   ? 58.843  83.827  55.165  0.50 45.61  ? 9   DC  F OP2   1 
ATOM   2270 O "O5'" . DC  D 4 9   ? 57.780  82.420  53.400  0.50 45.61  ? 9   DC  F "O5'" 1 
ATOM   2271 C "C5'" . DC  D 4 9   ? 58.484  81.805  52.324  0.50 45.61  ? 9   DC  F "C5'" 1 
ATOM   2272 C "C4'" . DC  D 4 9   ? 57.943  80.420  52.068  0.50 9.51   ? 9   DC  F "C4'" 1 
ATOM   2273 O "O4'" . DC  D 4 9   ? 59.048  79.538  51.759  0.50 45.61  ? 9   DC  F "O4'" 1 
ATOM   2274 C "C3'" . DC  D 4 9   ? 57.223  79.793  53.258  0.50 45.61  ? 9   DC  F "C3'" 1 
ATOM   2275 O "O3'" . DC  D 4 9   ? 56.123  79.006  52.799  0.50 45.61  ? 9   DC  F "O3'" 1 
ATOM   2276 C "C2'" . DC  D 4 9   ? 58.291  78.931  53.905  0.50 45.61  ? 9   DC  F "C2'" 1 
ATOM   2277 C "C1'" . DC  D 4 9   ? 59.150  78.503  52.725  0.50 45.61  ? 9   DC  F "C1'" 1 
ATOM   2278 N N1    . DC  D 4 9   ? 60.576  78.344  53.051  0.50 9.51   ? 9   DC  F N1    1 
ATOM   2279 C C2    . DC  D 4 9   ? 61.265  77.234  52.553  0.50 9.51   ? 9   DC  F C2    1 
ATOM   2280 O O2    . DC  D 4 9   ? 60.652  76.410  51.857  0.50 9.51   ? 9   DC  F O2    1 
ATOM   2281 N N3    . DC  D 4 9   ? 62.579  77.088  52.839  0.50 9.51   ? 9   DC  F N3    1 
ATOM   2282 C C4    . DC  D 4 9   ? 63.203  77.998  53.590  0.50 9.51   ? 9   DC  F C4    1 
ATOM   2283 N N4    . DC  D 4 9   ? 64.501  77.817  53.842  0.50 9.51   ? 9   DC  F N4    1 
ATOM   2284 C C5    . DC  D 4 9   ? 62.524  79.135  54.115  0.50 9.51   ? 9   DC  F C5    1 
ATOM   2285 C C6    . DC  D 4 9   ? 61.224  79.267  53.824  0.50 9.51   ? 9   DC  F C6    1 
ATOM   2286 P P     . DG  D 4 10  ? 55.184  78.255  53.861  0.50 43.90  ? 10  DG  F P     1 
ATOM   2287 O OP1   . DG  D 4 10  ? 53.780  78.315  53.381  0.50 43.90  ? 10  DG  F OP1   1 
ATOM   2288 O OP2   . DG  D 4 10  ? 55.523  78.775  55.210  0.50 43.90  ? 10  DG  F OP2   1 
ATOM   2289 O "O5'" . DG  D 4 10  ? 55.674  76.745  53.769  0.50 43.90  ? 10  DG  F "O5'" 1 
ATOM   2290 C "C5'" . DG  D 4 10  ? 55.604  76.040  52.535  0.50 43.90  ? 10  DG  F "C5'" 1 
ATOM   2291 C "C4'" . DG  D 4 10  ? 56.064  74.616  52.725  0.50 16.66  ? 10  DG  F "C4'" 1 
ATOM   2292 O "O4'" . DG  D 4 10  ? 57.502  74.578  52.890  0.50 43.90  ? 10  DG  F "O4'" 1 
ATOM   2293 C "C3'" . DG  D 4 10  ? 55.473  73.934  53.957  0.50 43.90  ? 10  DG  F "C3'" 1 
ATOM   2294 O "O3'" . DG  D 4 10  ? 55.129  72.585  53.648  0.50 43.90  ? 10  DG  F "O3'" 1 
ATOM   2295 C "C2'" . DG  D 4 10  ? 56.602  73.992  54.972  0.50 43.90  ? 10  DG  F "C2'" 1 
ATOM   2296 C "C1'" . DG  D 4 10  ? 57.839  73.908  54.094  0.50 43.90  ? 10  DG  F "C1'" 1 
ATOM   2297 N N9    . DG  D 4 10  ? 59.023  74.558  54.651  0.50 16.66  ? 10  DG  F N9    1 
ATOM   2298 C C8    . DG  D 4 10  ? 59.059  75.702  55.412  0.50 16.66  ? 10  DG  F C8    1 
ATOM   2299 N N7    . DG  D 4 10  ? 60.268  76.047  55.763  0.50 16.66  ? 10  DG  F N7    1 
ATOM   2300 C C5    . DG  D 4 10  ? 61.082  75.071  55.202  0.50 16.66  ? 10  DG  F C5    1 
ATOM   2301 C C6    . DG  D 4 10  ? 62.492  74.916  55.243  0.50 16.66  ? 10  DG  F C6    1 
ATOM   2302 O O6    . DG  D 4 10  ? 63.329  75.629  55.806  0.50 16.66  ? 10  DG  F O6    1 
ATOM   2303 N N1    . DG  D 4 10  ? 62.904  73.791  54.538  0.50 16.66  ? 10  DG  F N1    1 
ATOM   2304 C C2    . DG  D 4 10  ? 62.069  72.924  53.879  0.50 16.66  ? 10  DG  F C2    1 
ATOM   2305 N N2    . DG  D 4 10  ? 62.665  71.895  53.255  0.50 16.66  ? 10  DG  F N2    1 
ATOM   2306 N N3    . DG  D 4 10  ? 60.751  73.055  53.834  0.50 16.66  ? 10  DG  F N3    1 
ATOM   2307 C C4    . DG  D 4 10  ? 60.329  74.144  54.511  0.50 16.66  ? 10  DG  F C4    1 
ATOM   2308 P P     . DT  D 4 11  ? 54.425  71.672  54.761  0.50 29.29  ? 11  DT  F P     1 
ATOM   2309 O OP1   . DT  D 4 11  ? 53.502  70.734  54.076  0.50 29.29  ? 11  DT  F OP1   1 
ATOM   2310 O OP2   . DT  D 4 11  ? 53.905  72.574  55.819  0.50 29.29  ? 11  DT  F OP2   1 
ATOM   2311 O "O5'" . DT  D 4 11  ? 55.642  70.842  55.361  0.50 29.29  ? 11  DT  F "O5'" 1 
ATOM   2312 C "C5'" . DT  D 4 11  ? 56.469  70.061  54.504  0.50 29.29  ? 11  DT  F "C5'" 1 
ATOM   2313 C "C4'" . DT  D 4 11  ? 57.604  69.443  55.284  0.50 25.72  ? 11  DT  F "C4'" 1 
ATOM   2314 O "O4'" . DT  D 4 11  ? 58.608  70.434  55.613  0.50 29.29  ? 11  DT  F "O4'" 1 
ATOM   2315 C "C3'" . DT  D 4 11  ? 57.205  68.787  56.608  0.50 29.29  ? 11  DT  F "C3'" 1 
ATOM   2316 O "O3'" . DT  D 4 11  ? 57.956  67.589  56.772  0.50 29.29  ? 11  DT  F "O3'" 1 
ATOM   2317 C "C2'" . DT  D 4 11  ? 57.672  69.792  57.644  0.50 29.29  ? 11  DT  F "C2'" 1 
ATOM   2318 C "C1'" . DT  D 4 11  ? 58.937  70.300  56.984  0.50 29.29  ? 11  DT  F "C1'" 1 
ATOM   2319 N N1    . DT  D 4 11  ? 59.446  71.593  57.471  0.50 25.72  ? 11  DT  F N1    1 
ATOM   2320 C C2    . DT  D 4 11  ? 60.807  71.794  57.429  0.50 25.72  ? 11  DT  F C2    1 
ATOM   2321 O O2    . DT  D 4 11  ? 61.588  70.964  56.992  0.50 25.72  ? 11  DT  F O2    1 
ATOM   2322 N N3    . DT  D 4 11  ? 61.222  73.006  57.917  0.50 25.72  ? 11  DT  F N3    1 
ATOM   2323 C C4    . DT  D 4 11  ? 60.431  74.014  58.431  0.50 25.72  ? 11  DT  F C4    1 
ATOM   2324 O O4    . DT  D 4 11  ? 60.949  75.048  58.842  0.50 25.72  ? 11  DT  F O4    1 
ATOM   2325 C C5    . DT  D 4 11  ? 59.010  73.740  58.437  0.50 25.72  ? 11  DT  F C5    1 
ATOM   2326 C C7    . DT  D 4 11  ? 58.073  74.777  58.970  0.50 25.72  ? 11  DT  F C7    1 
ATOM   2327 C C6    . DT  D 4 11  ? 58.595  72.559  57.961  0.50 25.72  ? 11  DT  F C6    1 
ATOM   2328 P P     . DA  D 4 12  ? 57.325  66.356  57.575  0.50 29.89  ? 12  DA  F P     1 
ATOM   2329 O OP1   . DA  D 4 12  ? 56.221  65.787  56.761  0.50 29.89  ? 12  DA  F OP1   1 
ATOM   2330 O OP2   . DA  D 4 12  ? 57.059  66.805  58.964  0.50 29.89  ? 12  DA  F OP2   1 
ATOM   2331 O "O5'" . DA  D 4 12  ? 58.521  65.310  57.604  0.50 29.89  ? 12  DA  F "O5'" 1 
ATOM   2332 C "C5'" . DA  D 4 12  ? 59.240  65.005  56.412  0.50 29.89  ? 12  DA  F "C5'" 1 
ATOM   2333 C "C4'" . DA  D 4 12  ? 60.723  64.977  56.691  0.50 17.29  ? 12  DA  F "C4'" 1 
ATOM   2334 O "O4'" . DA  D 4 12  ? 61.201  66.321  56.948  0.50 29.89  ? 12  DA  F "O4'" 1 
ATOM   2335 C "C3'" . DA  D 4 12  ? 61.110  64.148  57.916  0.50 29.89  ? 12  DA  F "C3'" 1 
ATOM   2336 O "O3'" . DA  D 4 12  ? 62.304  63.408  57.665  0.50 29.89  ? 12  DA  F "O3'" 1 
ATOM   2337 C "C2'" . DA  D 4 12  ? 61.361  65.193  58.987  0.50 29.89  ? 12  DA  F "C2'" 1 
ATOM   2338 C "C1'" . DA  D 4 12  ? 61.911  66.348  58.176  0.50 29.89  ? 12  DA  F "C1'" 1 
ATOM   2339 N N9    . DA  D 4 12  ? 61.709  67.658  58.793  0.50 17.29  ? 12  DA  F N9    1 
ATOM   2340 C C8    . DA  D 4 12  ? 60.524  68.290  59.077  0.50 17.29  ? 12  DA  F C8    1 
ATOM   2341 N N7    . DA  D 4 12  ? 60.672  69.460  59.651  0.50 17.29  ? 12  DA  F N7    1 
ATOM   2342 C C5    . DA  D 4 12  ? 62.048  69.611  59.750  0.50 17.29  ? 12  DA  F C5    1 
ATOM   2343 C C6    . DA  D 4 12  ? 62.854  70.640  60.271  0.50 17.29  ? 12  DA  F C6    1 
ATOM   2344 N N6    . DA  D 4 12  ? 62.369  71.761  60.812  0.50 17.29  ? 12  DA  F N6    1 
ATOM   2345 N N1    . DA  D 4 12  ? 64.194  70.476  60.217  0.50 17.29  ? 12  DA  F N1    1 
ATOM   2346 C C2    . DA  D 4 12  ? 64.681  69.353  59.673  0.50 17.29  ? 12  DA  F C2    1 
ATOM   2347 N N3    . DA  D 4 12  ? 64.027  68.317  59.151  0.50 17.29  ? 12  DA  F N3    1 
ATOM   2348 C C4    . DA  D 4 12  ? 62.698  68.510  59.222  0.50 17.29  ? 12  DA  F C4    1 
ATOM   2349 P P     . DT  D 4 13  ? 62.839  62.375  58.768  0.50 35.35  ? 13  DT  F P     1 
ATOM   2350 O OP1   . DT  D 4 13  ? 63.761  61.417  58.105  0.50 35.35  ? 13  DT  F OP1   1 
ATOM   2351 O OP2   . DT  D 4 13  ? 61.653  61.865  59.503  0.50 35.35  ? 13  DT  F OP2   1 
ATOM   2352 O "O5'" . DT  D 4 13  ? 63.681  63.291  59.761  0.50 35.35  ? 13  DT  F "O5'" 1 
ATOM   2353 C "C5'" . DT  D 4 13  ? 64.902  63.884  59.330  0.50 35.35  ? 13  DT  F "C5'" 1 
ATOM   2354 C "C4'" . DT  D 4 13  ? 65.601  64.558  60.487  0.50 38.12  ? 13  DT  F "C4'" 1 
ATOM   2355 O "O4'" . DT  D 4 13  ? 64.949  65.804  60.835  0.50 35.35  ? 13  DT  F "O4'" 1 
ATOM   2356 C "C3'" . DT  D 4 13  ? 65.675  63.743  61.778  0.50 35.35  ? 13  DT  F "C3'" 1 
ATOM   2357 O "O3'" . DT  D 4 13  ? 66.960  63.931  62.367  0.50 35.35  ? 13  DT  F "O3'" 1 
ATOM   2358 C "C2'" . DT  D 4 13  ? 64.628  64.399  62.661  0.50 35.35  ? 13  DT  F "C2'" 1 
ATOM   2359 C "C1'" . DT  D 4 13  ? 64.778  65.847  62.241  0.50 35.35  ? 13  DT  F "C1'" 1 
ATOM   2360 N N1    . DT  D 4 13  ? 63.644  66.739  62.547  0.50 38.12  ? 13  DT  F N1    1 
ATOM   2361 C C2    . DT  D 4 13  ? 63.940  67.990  63.037  0.50 38.12  ? 13  DT  F C2    1 
ATOM   2362 O O2    . DT  D 4 13  ? 65.081  68.380  63.219  0.50 38.12  ? 13  DT  F O2    1 
ATOM   2363 N N3    . DT  D 4 13  ? 62.847  68.774  63.307  0.50 38.12  ? 13  DT  F N3    1 
ATOM   2364 C C4    . DT  D 4 13  ? 61.518  68.441  63.139  0.50 38.12  ? 13  DT  F C4    1 
ATOM   2365 O O4    . DT  D 4 13  ? 60.643  69.253  63.425  0.50 38.12  ? 13  DT  F O4    1 
ATOM   2366 C C5    . DT  D 4 13  ? 61.278  67.112  62.619  0.50 38.12  ? 13  DT  F C5    1 
ATOM   2367 C C7    . DT  D 4 13  ? 59.868  66.662  62.403  0.50 38.12  ? 13  DT  F C7    1 
ATOM   2368 C C6    . DT  D 4 13  ? 62.340  66.337  62.352  0.50 38.12  ? 13  DT  F C6    1 
ATOM   2369 P P     . DA  D 4 14  ? 67.516  62.867  63.430  0.50 37.26  ? 14  DA  F P     1 
ATOM   2370 O OP1   . DA  D 4 14  ? 68.111  61.727  62.689  0.50 37.26  ? 14  DA  F OP1   1 
ATOM   2371 O OP2   . DA  D 4 14  ? 66.436  62.616  64.417  0.50 37.26  ? 14  DA  F OP2   1 
ATOM   2372 O "O5'" . DA  D 4 14  ? 68.685  63.666  64.153  0.50 37.26  ? 14  DA  F "O5'" 1 
ATOM   2373 C "C5'" . DA  D 4 14  ? 69.561  64.502  63.400  0.50 37.26  ? 14  DA  F "C5'" 1 
ATOM   2374 C "C4'" . DA  D 4 14  ? 69.952  65.715  64.210  0.50 7.88   ? 14  DA  F "C4'" 1 
ATOM   2375 O "O4'" . DA  D 4 14  ? 68.816  66.601  64.360  0.50 37.26  ? 14  DA  F "O4'" 1 
ATOM   2376 C "C3'" . DA  D 4 14  ? 70.427  65.392  65.624  0.50 37.26  ? 14  DA  F "C3'" 1 
ATOM   2377 O "O3'" . DA  D 4 14  ? 71.529  66.227  65.974  0.50 37.26  ? 14  DA  F "O3'" 1 
ATOM   2378 C "C2'" . DA  D 4 14  ? 69.217  65.703  66.488  0.50 37.26  ? 14  DA  F "C2'" 1 
ATOM   2379 C "C1'" . DA  D 4 14  ? 68.559  66.844  65.736  0.50 37.26  ? 14  DA  F "C1'" 1 
ATOM   2380 N N9    . DA  D 4 14  ? 67.108  66.922  65.913  0.50 7.88   ? 14  DA  F N9    1 
ATOM   2381 C C8    . DA  D 4 14  ? 66.175  65.966  65.599  0.50 7.88   ? 14  DA  F C8    1 
ATOM   2382 N N7    . DA  D 4 14  ? 64.941  66.324  65.857  0.50 7.88   ? 14  DA  F N7    1 
ATOM   2383 C C5    . DA  D 4 14  ? 65.067  67.603  66.378  0.50 7.88   ? 14  DA  F C5    1 
ATOM   2384 C C6    . DA  D 4 14  ? 64.119  68.533  66.844  0.50 7.88   ? 14  DA  F C6    1 
ATOM   2385 N N6    . DA  D 4 14  ? 62.803  68.307  66.858  0.50 7.88   ? 14  DA  F N6    1 
ATOM   2386 N N1    . DA  D 4 14  ? 64.576  69.721  67.299  0.50 7.88   ? 14  DA  F N1    1 
ATOM   2387 C C2    . DA  D 4 14  ? 65.896  69.948  67.283  0.50 7.88   ? 14  DA  F C2    1 
ATOM   2388 N N3    . DA  D 4 14  ? 66.884  69.155  66.870  0.50 7.88   ? 14  DA  F N3    1 
ATOM   2389 C C4    . DA  D 4 14  ? 66.398  67.984  66.423  0.50 7.88   ? 14  DA  F C4    1 
ATOM   2390 P P     . DA  D 4 15  ? 72.214  66.068  67.414  0.50 52.53  ? 15  DA  F P     1 
ATOM   2391 O OP1   . DA  D 4 15  ? 73.680  66.250  67.262  0.50 52.53  ? 15  DA  F OP1   1 
ATOM   2392 O OP2   . DA  D 4 15  ? 71.686  64.823  68.030  0.50 52.53  ? 15  DA  F OP2   1 
ATOM   2393 O "O5'" . DA  D 4 15  ? 71.638  67.309  68.222  0.50 52.53  ? 15  DA  F "O5'" 1 
ATOM   2394 C "C5'" . DA  D 4 15  ? 71.831  68.635  67.740  0.50 52.53  ? 15  DA  F "C5'" 1 
ATOM   2395 C "C4'" . DA  D 4 15  ? 71.437  69.635  68.800  0.50 16.63  ? 15  DA  F "C4'" 1 
ATOM   2396 O "O4'" . DA  D 4 15  ? 69.994  69.692  68.904  0.50 52.53  ? 15  DA  F "O4'" 1 
ATOM   2397 C "C3'" . DA  D 4 15  ? 71.954  69.295  70.197  0.50 52.53  ? 15  DA  F "C3'" 1 
ATOM   2398 O "O3'" . DA  D 4 15  ? 72.400  70.485  70.852  0.50 52.53  ? 15  DA  F "O3'" 1 
ATOM   2399 C "C2'" . DA  D 4 15  ? 70.746  68.680  70.883  0.50 52.53  ? 15  DA  F "C2'" 1 
ATOM   2400 C "C1'" . DA  D 4 15  ? 69.579  69.401  70.230  0.50 52.53  ? 15  DA  F "C1'" 1 
ATOM   2401 N N9    . DA  D 4 15  ? 68.357  68.598  70.139  0.50 16.63  ? 15  DA  F N9    1 
ATOM   2402 C C8    . DA  D 4 15  ? 68.252  67.265  69.823  0.50 16.63  ? 15  DA  F C8    1 
ATOM   2403 N N7    . DA  D 4 15  ? 67.018  66.825  69.790  0.50 16.63  ? 15  DA  F N7    1 
ATOM   2404 C C5    . DA  D 4 15  ? 66.258  67.941  70.110  0.50 16.63  ? 15  DA  F C5    1 
ATOM   2405 C C6    . DA  D 4 15  ? 64.870  68.138  70.234  0.50 16.63  ? 15  DA  F C6    1 
ATOM   2406 N N6    . DA  D 4 15  ? 63.964  67.178  70.034  0.50 16.63  ? 15  DA  F N6    1 
ATOM   2407 N N1    . DA  D 4 15  ? 64.439  69.373  70.569  0.50 16.63  ? 15  DA  F N1    1 
ATOM   2408 C C2    . DA  D 4 15  ? 65.347  70.338  70.761  0.50 16.63  ? 15  DA  F C2    1 
ATOM   2409 N N3    . DA  D 4 15  ? 66.673  70.278  70.670  0.50 16.63  ? 15  DA  F N3    1 
ATOM   2410 C C4    . DA  D 4 15  ? 67.070  69.038  70.336  0.50 16.63  ? 15  DA  F C4    1 
ATOM   2411 P P     . DT  D 4 16  ? 72.528  70.521  72.452  0.50 100.00 ? 16  DT  F P     1 
ATOM   2412 O OP1   . DT  D 4 16  ? 73.669  71.404  72.789  0.50 100.00 ? 16  DT  F OP1   1 
ATOM   2413 O OP2   . DT  D 4 16  ? 72.499  69.132  72.973  0.50 100.00 ? 16  DT  F OP2   1 
ATOM   2414 O "O5'" . DT  D 4 16  ? 71.186  71.254  72.883  0.50 100.00 ? 16  DT  F "O5'" 1 
ATOM   2415 C "C5'" . DT  D 4 16  ? 70.728  72.384  72.149  0.50 100.00 ? 16  DT  F "C5'" 1 
ATOM   2416 C "C4'" . DT  D 4 16  ? 69.619  73.079  72.900  0.50 48.42  ? 16  DT  F "C4'" 1 
ATOM   2417 O "O4'" . DT  D 4 16  ? 68.395  72.317  72.790  0.50 100.00 ? 16  DT  F "O4'" 1 
ATOM   2418 C "C3'" . DT  D 4 16  ? 69.887  73.248  74.392  0.50 100.00 ? 16  DT  F "C3'" 1 
ATOM   2419 O "O3'" . DT  D 4 16  ? 69.414  74.524  74.819  0.50 100.00 ? 16  DT  F "O3'" 1 
ATOM   2420 C "C2'" . DT  D 4 16  ? 69.095  72.115  75.021  0.50 100.00 ? 16  DT  F "C2'" 1 
ATOM   2421 C "C1'" . DT  D 4 16  ? 67.911  71.969  74.075  0.50 100.00 ? 16  DT  F "C1'" 1 
ATOM   2422 N N1    . DT  D 4 16  ? 67.355  70.609  73.981  0.50 48.42  ? 16  DT  F N1    1 
ATOM   2423 C C2    . DT  D 4 16  ? 65.999  70.447  74.154  0.50 48.42  ? 16  DT  F C2    1 
ATOM   2424 O O2    . DT  D 4 16  ? 65.242  71.373  74.409  0.50 48.42  ? 16  DT  F O2    1 
ATOM   2425 N N3    . DT  D 4 16  ? 65.559  69.156  74.021  0.50 48.42  ? 16  DT  F N3    1 
ATOM   2426 C C4    . DT  D 4 16  ? 66.320  68.038  73.739  0.50 48.42  ? 16  DT  F C4    1 
ATOM   2427 O O4    . DT  D 4 16  ? 65.778  66.940  73.631  0.50 48.42  ? 16  DT  F O4    1 
ATOM   2428 C C5    . DT  D 4 16  ? 67.735  68.279  73.580  0.50 48.42  ? 16  DT  F C5    1 
ATOM   2429 C C7    . DT  D 4 16  ? 68.639  67.128  73.266  0.50 48.42  ? 16  DT  F C7    1 
ATOM   2430 C C6    . DT  D 4 16  ? 68.176  69.534  73.713  0.50 48.42  ? 16  DT  F C6    1 
ATOM   2431 P P     . DG  D 4 17  ? 69.697  75.013  76.319  0.50 68.99  ? 17  DG  F P     1 
ATOM   2432 O OP1   . DG  D 4 17  ? 69.988  76.465  76.281  0.50 68.99  ? 17  DG  F OP1   1 
ATOM   2433 O OP2   . DG  D 4 17  ? 70.682  74.084  76.932  0.50 68.99  ? 17  DG  F OP2   1 
ATOM   2434 O "O5'" . DG  D 4 17  ? 68.291  74.797  77.025  0.50 68.99  ? 17  DG  F "O5'" 1 
ATOM   2435 C "C5'" . DG  D 4 17  ? 67.087  75.186  76.366  0.50 68.99  ? 17  DG  F "C5'" 1 
ATOM   2436 C "C4'" . DG  D 4 17  ? 65.889  74.801  77.200  0.50 25.70  ? 17  DG  F "C4'" 1 
ATOM   2437 O "O4'" . DG  D 4 17  ? 65.507  73.429  76.938  0.50 68.99  ? 17  DG  F "O4'" 1 
ATOM   2438 C "C3'" . DG  D 4 17  ? 66.143  74.892  78.705  0.50 68.99  ? 17  DG  F "C3'" 1 
ATOM   2439 O "O3'" . DG  D 4 17  ? 64.983  75.382  79.372  0.50 68.99  ? 17  DG  F "O3'" 1 
ATOM   2440 C "C2'" . DG  D 4 17  ? 66.394  73.449  79.100  0.50 68.99  ? 17  DG  F "C2'" 1 
ATOM   2441 C "C1'" . DG  D 4 17  ? 65.464  72.707  78.159  0.50 68.99  ? 17  DG  F "C1'" 1 
ATOM   2442 N N9    . DG  D 4 17  ? 65.861  71.331  77.887  0.50 25.70  ? 17  DG  F N9    1 
ATOM   2443 C C8    . DG  D 4 17  ? 67.142  70.843  77.755  0.50 25.70  ? 17  DG  F C8    1 
ATOM   2444 N N7    . DG  D 4 17  ? 67.181  69.560  77.523  0.50 25.70  ? 17  DG  F N7    1 
ATOM   2445 C C5    . DG  D 4 17  ? 65.846  69.174  77.496  0.50 25.70  ? 17  DG  F C5    1 
ATOM   2446 C C6    . DG  D 4 17  ? 65.264  67.899  77.284  0.50 25.70  ? 17  DG  F C6    1 
ATOM   2447 O O6    . DG  D 4 17  ? 65.827  66.820  77.070  0.50 25.70  ? 17  DG  F O6    1 
ATOM   2448 N N1    . DG  D 4 17  ? 63.875  67.956  77.338  0.50 25.70  ? 17  DG  F N1    1 
ATOM   2449 C C2    . DG  D 4 17  ? 63.142  69.093  77.568  0.50 25.70  ? 17  DG  F C2    1 
ATOM   2450 N N2    . DG  D 4 17  ? 61.811  68.943  77.584  0.50 25.70  ? 17  DG  F N2    1 
ATOM   2451 N N3    . DG  D 4 17  ? 63.673  70.288  77.766  0.50 25.70  ? 17  DG  F N3    1 
ATOM   2452 C C4    . DG  D 4 17  ? 65.022  70.256  77.718  0.50 25.70  ? 17  DG  F C4    1 
ATOM   2453 P P     . DT  D 4 18  ? 65.144  76.257  80.708  0.50 80.78  ? 18  DT  F P     1 
ATOM   2454 O OP1   . DT  D 4 18  ? 65.253  77.686  80.321  0.50 80.78  ? 18  DT  F OP1   1 
ATOM   2455 O OP2   . DT  D 4 18  ? 66.206  75.638  81.544  0.50 80.78  ? 18  DT  F OP2   1 
ATOM   2456 O "O5'" . DT  D 4 18  ? 63.743  76.042  81.427  0.50 80.78  ? 18  DT  F "O5'" 1 
ATOM   2457 C "C5'" . DT  D 4 18  ? 62.542  76.033  80.662  0.50 80.78  ? 18  DT  F "C5'" 1 
ATOM   2458 C "C4'" . DT  D 4 18  ? 61.622  74.939  81.145  0.50 99.72  ? 18  DT  F "C4'" 1 
ATOM   2459 O "O4'" . DT  D 4 18  ? 62.098  73.635  80.731  0.50 80.78  ? 18  DT  F "O4'" 1 
ATOM   2460 C "C3'" . DT  D 4 18  ? 61.470  74.876  82.664  0.50 80.78  ? 18  DT  F "C3'" 1 
ATOM   2461 O "O3'" . DT  D 4 18  ? 60.104  74.639  82.990  0.50 80.78  ? 18  DT  F "O3'" 1 
ATOM   2462 C "C2'" . DT  D 4 18  ? 62.317  73.678  83.054  0.50 80.78  ? 18  DT  F "C2'" 1 
ATOM   2463 C "C1'" . DT  D 4 18  ? 62.140  72.770  81.854  0.50 80.78  ? 18  DT  F "C1'" 1 
ATOM   2464 N N1    . DT  D 4 18  ? 63.234  71.804  81.644  0.50 99.72  ? 18  DT  F N1    1 
ATOM   2465 C C2    . DT  D 4 18  ? 62.897  70.520  81.280  0.50 99.72  ? 18  DT  F C2    1 
ATOM   2466 O O2    . DT  D 4 18  ? 61.744  70.151  81.128  0.50 99.72  ? 18  DT  F O2    1 
ATOM   2467 N N3    . DT  D 4 18  ? 63.967  69.677  81.099  0.50 99.72  ? 18  DT  F N3    1 
ATOM   2468 C C4    . DT  D 4 18  ? 65.307  69.985  81.246  0.50 99.72  ? 18  DT  F C4    1 
ATOM   2469 O O4    . DT  D 4 18  ? 66.158  69.122  81.049  0.50 99.72  ? 18  DT  F O4    1 
ATOM   2470 C C5    . DT  D 4 18  ? 65.586  71.347  81.636  0.50 99.72  ? 18  DT  F C5    1 
ATOM   2471 C C7    . DT  D 4 18  ? 67.009  71.768  81.832  0.50 99.72  ? 18  DT  F C7    1 
ATOM   2472 C C6    . DT  D 4 18  ? 64.550  72.178  81.810  0.50 99.72  ? 18  DT  F C6    1 
ATOM   2473 P P     . DT  D 4 19  ? 59.104  75.884  83.138  0.50 84.29  ? 19  DT  F P     1 
ATOM   2474 O OP1   . DT  D 4 19  ? 58.767  76.376  81.777  0.50 84.29  ? 19  DT  F OP1   1 
ATOM   2475 O OP2   . DT  D 4 19  ? 59.693  76.818  84.130  0.50 84.29  ? 19  DT  F OP2   1 
ATOM   2476 O "O5'" . DT  D 4 19  ? 57.802  75.234  83.773  0.50 84.29  ? 19  DT  F "O5'" 1 
ATOM   2477 C "C5'" . DT  D 4 19  ? 57.224  74.063  83.207  0.50 84.29  ? 19  DT  F "C5'" 1 
ATOM   2478 C "C4'" . DT  D 4 19  ? 56.570  73.243  84.293  0.50 49.39  ? 19  DT  F "C4'" 1 
ATOM   2479 O "O4'" . DT  D 4 19  ? 57.582  72.551  85.065  0.50 84.29  ? 19  DT  F "O4'" 1 
ATOM   2480 C "C3'" . DT  D 4 19  ? 55.785  74.099  85.285  0.50 84.29  ? 19  DT  F "C3'" 1 
ATOM   2481 O "O3'" . DT  D 4 19  ? 54.568  73.456  85.652  0.50 84.29  ? 19  DT  F "O3'" 1 
ATOM   2482 C "C2'" . DT  D 4 19  ? 56.722  74.217  86.474  0.50 84.29  ? 19  DT  F "C2'" 1 
ATOM   2483 C "C1'" . DT  D 4 19  ? 57.463  72.894  86.437  0.50 84.29  ? 19  DT  F "C1'" 1 
ATOM   2484 N N1    . DT  D 4 19  ? 58.812  72.906  87.037  0.50 49.39  ? 19  DT  F N1    1 
ATOM   2485 C C2    . DT  D 4 19  ? 58.994  72.204  88.207  0.50 49.39  ? 19  DT  F C2    1 
ATOM   2486 O O2    . DT  D 4 19  ? 58.101  71.579  88.754  0.50 49.39  ? 19  DT  F O2    1 
ATOM   2487 N N3    . DT  D 4 19  ? 60.268  72.259  88.717  0.50 49.39  ? 19  DT  F N3    1 
ATOM   2488 C C4    . DT  D 4 19  ? 61.352  72.928  88.184  0.50 49.39  ? 19  DT  F C4    1 
ATOM   2489 O O4    . DT  D 4 19  ? 62.437  72.886  88.756  0.50 49.39  ? 19  DT  F O4    1 
ATOM   2490 C C5    . DT  D 4 19  ? 61.092  73.642  86.954  0.50 49.39  ? 19  DT  F C5    1 
ATOM   2491 C C7    . DT  D 4 19  ? 62.210  74.395  86.305  0.50 49.39  ? 19  DT  F C7    1 
ATOM   2492 C C6    . DT  D 4 19  ? 59.850  73.596  86.449  0.50 49.39  ? 19  DT  F C6    1 
ATOM   2493 P P     . DA  D 4 20  ? 53.479  74.266  86.505  0.50 43.98  ? 20  DA  F P     1 
ATOM   2494 O OP1   . DA  D 4 20  ? 52.133  73.720  86.193  0.50 43.98  ? 20  DA  F OP1   1 
ATOM   2495 O OP2   . DA  D 4 20  ? 53.748  75.713  86.312  0.50 43.98  ? 20  DA  F OP2   1 
ATOM   2496 O "O5'" . DA  D 4 20  ? 53.842  73.889  88.008  0.50 43.98  ? 20  DA  F "O5'" 1 
ATOM   2497 C "C5'" . DA  D 4 20  ? 53.656  72.561  88.482  0.50 43.98  ? 20  DA  F "C5'" 1 
ATOM   2498 C "C4'" . DA  D 4 20  ? 53.821  72.516  89.982  0.50 11.46  ? 20  DA  F "C4'" 1 
ATOM   2499 O "O4'" . DA  D 4 20  ? 55.222  72.603  90.338  0.50 43.98  ? 20  DA  F "O4'" 1 
ATOM   2500 C "C3'" . DA  D 4 20  ? 53.120  73.651  90.727  0.50 43.98  ? 20  DA  F "C3'" 1 
ATOM   2501 O "O3'" . DA  D 4 20  ? 52.521  73.141  91.917  0.50 43.98  ? 20  DA  F "O3'" 1 
ATOM   2502 C "C2'" . DA  D 4 20  ? 54.253  74.604  91.064  0.50 43.98  ? 20  DA  F "C2'" 1 
ATOM   2503 C "C1'" . DA  D 4 20  ? 55.414  73.650  91.275  0.50 43.98  ? 20  DA  F "C1'" 1 
ATOM   2504 N N9    . DA  D 4 20  ? 56.741  74.219  91.041  0.50 11.46  ? 20  DA  F N9    1 
ATOM   2505 C C8    . DA  D 4 20  ? 57.113  75.177  90.131  0.50 11.46  ? 20  DA  F C8    1 
ATOM   2506 N N7    . DA  D 4 20  ? 58.393  75.466  90.160  0.50 11.46  ? 20  DA  F N7    1 
ATOM   2507 C C5    . DA  D 4 20  ? 58.897  74.644  91.158  0.50 11.46  ? 20  DA  F C5    1 
ATOM   2508 C C6    . DA  D 4 20  ? 60.192  74.468  91.676  0.50 11.46  ? 20  DA  F C6    1 
ATOM   2509 N N6    . DA  D 4 20  ? 61.264  75.131  91.237  0.50 11.46  ? 20  DA  F N6    1 
ATOM   2510 N N1    . DA  D 4 20  ? 60.352  73.572  92.673  0.50 11.46  ? 20  DA  F N1    1 
ATOM   2511 C C2    . DA  D 4 20  ? 59.280  72.899  93.110  0.50 11.46  ? 20  DA  F C2    1 
ATOM   2512 N N3    . DA  D 4 20  ? 58.016  72.973  92.702  0.50 11.46  ? 20  DA  F N3    1 
ATOM   2513 C C4    . DA  D 4 20  ? 57.890  73.875  91.713  0.50 11.46  ? 20  DA  F C4    1 
ATOM   2514 P P     . DC  D 4 21  ? 51.718  74.131  92.888  0.50 28.98  ? 21  DC  F P     1 
ATOM   2515 O OP1   . DC  D 4 21  ? 50.540  73.400  93.417  0.50 28.98  ? 21  DC  F OP1   1 
ATOM   2516 O OP2   . DC  D 4 21  ? 51.527  75.416  92.168  0.50 28.98  ? 21  DC  F OP2   1 
ATOM   2517 O "O5'" . DC  D 4 21  ? 52.739  74.369  94.085  0.50 28.98  ? 21  DC  F "O5'" 1 
ATOM   2518 C "C5'" . DC  D 4 21  ? 53.305  73.263  94.783  0.50 28.98  ? 21  DC  F "C5'" 1 
ATOM   2519 C "C4'" . DC  D 4 21  ? 54.213  73.754  95.885  0.50 18.96  ? 21  DC  F "C4'" 1 
ATOM   2520 O "O4'" . DC  D 4 21  ? 55.456  74.230  95.312  0.50 28.98  ? 21  DC  F "O4'" 1 
ATOM   2521 C "C3'" . DC  D 4 21  ? 53.642  74.923  96.689  0.50 28.98  ? 21  DC  F "C3'" 1 
ATOM   2522 O "O3'" . DC  D 4 21  ? 53.996  74.786  98.069  0.50 28.98  ? 21  DC  F "O3'" 1 
ATOM   2523 C "C2'" . DC  D 4 21  ? 54.336  76.129  96.082  0.50 28.98  ? 21  DC  F "C2'" 1 
ATOM   2524 C "C1'" . DC  D 4 21  ? 55.700  75.553  95.756  0.50 28.98  ? 21  DC  F "C1'" 1 
ATOM   2525 N N1    . DC  D 4 21  ? 56.471  76.256  94.716  0.50 18.96  ? 21  DC  F N1    1 
ATOM   2526 C C2    . DC  D 4 21  ? 57.826  75.950  94.572  0.50 18.96  ? 21  DC  F C2    1 
ATOM   2527 O O2    . DC  D 4 21  ? 58.324  75.082  95.304  0.50 18.96  ? 21  DC  F O2    1 
ATOM   2528 N N3    . DC  D 4 21  ? 58.560  76.604  93.641  0.50 18.96  ? 21  DC  F N3    1 
ATOM   2529 C C4    . DC  D 4 21  ? 57.985  77.528  92.870  0.50 18.96  ? 21  DC  F C4    1 
ATOM   2530 N N4    . DC  D 4 21  ? 58.749  78.154  91.972  0.50 18.96  ? 21  DC  F N4    1 
ATOM   2531 C C5    . DC  D 4 21  ? 56.601  77.853  92.985  0.50 18.96  ? 21  DC  F C5    1 
ATOM   2532 C C6    . DC  D 4 21  ? 55.887  77.196  93.912  0.50 18.96  ? 21  DC  F C6    1 
ATOM   2533 P P     . DG  D 4 22  ? 52.989  75.311  99.206  0.50 37.50  ? 22  DG  F P     1 
ATOM   2534 O OP1   . DG  D 4 22  ? 52.943  74.288  100.281 0.50 37.50  ? 22  DG  F OP1   1 
ATOM   2535 O OP2   . DG  D 4 22  ? 51.730  75.733  98.541  0.50 37.50  ? 22  DG  F OP2   1 
ATOM   2536 O "O5'" . DG  D 4 22  ? 53.705  76.611  99.783  0.50 37.50  ? 22  DG  F "O5'" 1 
ATOM   2537 C "C5'" . DG  D 4 22  ? 54.721  77.266  99.034  0.50 37.50  ? 22  DG  F "C5'" 1 
ATOM   2538 C "C4'" . DG  D 4 22  ? 56.081  76.801  99.498  0.50 31.13  ? 22  DG  F "C4'" 1 
ATOM   2539 O "O4'" . DG  D 4 22  ? 57.024  76.908  98.409  0.50 37.50  ? 22  DG  F "O4'" 1 
ATOM   2540 C "C3'" . DG  D 4 22  ? 56.674  77.593  100.661 0.50 37.50  ? 22  DG  F "C3'" 1 
ATOM   2541 O "O3'" . DG  D 4 22  ? 57.366  76.715  101.553 0.50 37.50  ? 22  DG  F "O3'" 1 
ATOM   2542 C "C2'" . DG  D 4 22  ? 57.646  78.536  99.977  0.50 37.50  ? 22  DG  F "C2'" 1 
ATOM   2543 C "C1'" . DG  D 4 22  ? 58.120  77.720  98.786  0.50 37.50  ? 22  DG  F "C1'" 1 
ATOM   2544 N N9    . DG  D 4 22  ? 58.468  78.537  97.628  0.50 31.13  ? 22  DG  F N9    1 
ATOM   2545 C C8    . DG  D 4 22  ? 57.598  79.220  96.812  0.50 31.13  ? 22  DG  F C8    1 
ATOM   2546 N N7    . DG  D 4 22  ? 58.197  79.874  95.855  0.50 31.13  ? 22  DG  F N7    1 
ATOM   2547 C C5    . DG  D 4 22  ? 59.546  79.605  96.049  0.50 31.13  ? 22  DG  F C5    1 
ATOM   2548 C C6    . DG  D 4 22  ? 60.681  80.043  95.324  0.50 31.13  ? 22  DG  F C6    1 
ATOM   2549 O O6    . DG  D 4 22  ? 60.727  80.783  94.336  0.50 31.13  ? 22  DG  F O6    1 
ATOM   2550 N N1    . DG  D 4 22  ? 61.858  79.532  95.860  0.50 31.13  ? 22  DG  F N1    1 
ATOM   2551 C C2    . DG  D 4 22  ? 61.932  78.706  96.954  0.50 31.13  ? 22  DG  F C2    1 
ATOM   2552 N N2    . DG  D 4 22  ? 63.162  78.313  97.316  0.50 31.13  ? 22  DG  F N2    1 
ATOM   2553 N N3    . DG  D 4 22  ? 60.881  78.293  97.641  0.50 31.13  ? 22  DG  F N3    1 
ATOM   2554 C C4    . DG  D 4 22  ? 59.727  78.778  97.137  0.50 31.13  ? 22  DG  F C4    1 
ATOM   2555 P P     . DT  D 4 23  ? 57.821  77.244  103.001 0.50 20.06  ? 23  DT  F P     1 
ATOM   2556 O OP1   . DT  D 4 23  ? 57.998  76.065  103.885 0.50 20.06  ? 23  DT  F OP1   1 
ATOM   2557 O OP2   . DT  D 4 23  ? 56.899  78.334  103.407 0.50 20.06  ? 23  DT  F OP2   1 
ATOM   2558 O "O5'" . DT  D 4 23  ? 59.253  77.881  102.732 0.50 20.06  ? 23  DT  F "O5'" 1 
ATOM   2559 C "C5'" . DT  D 4 23  ? 60.375  77.045  102.476 0.50 20.06  ? 23  DT  F "C5'" 1 
ATOM   2560 C "C4'" . DT  D 4 23  ? 61.624  77.878  102.316 0.50 19.07  ? 23  DT  F "C4'" 1 
ATOM   2561 O "O4'" . DT  D 4 23  ? 61.612  78.568  101.043 0.50 20.06  ? 23  DT  F "O4'" 1 
ATOM   2562 C "C3'" . DT  D 4 23  ? 61.815  78.956  103.383 0.50 20.06  ? 23  DT  F "C3'" 1 
ATOM   2563 O "O3'" . DT  D 4 23  ? 63.189  79.010  103.764 0.50 20.06  ? 23  DT  F "O3'" 1 
ATOM   2564 C "C2'" . DT  D 4 23  ? 61.432  80.234  102.659 0.50 20.06  ? 23  DT  F "C2'" 1 
ATOM   2565 C "C1'" . DT  D 4 23  ? 61.921  79.934  101.257 0.50 20.06  ? 23  DT  F "C1'" 1 
ATOM   2566 N N1    . DT  D 4 23  ? 61.298  80.725  100.181 0.50 19.07  ? 23  DT  F N1    1 
ATOM   2567 C C2    . DT  D 4 23  ? 62.118  81.190  99.176  0.50 19.07  ? 23  DT  F C2    1 
ATOM   2568 O O2    . DT  D 4 23  ? 63.318  80.974  99.142  0.50 19.07  ? 23  DT  F O2    1 
ATOM   2569 N N3    . DT  D 4 23  ? 61.480  81.923  98.209  0.50 19.07  ? 23  DT  F N3    1 
ATOM   2570 C C4    . DT  D 4 23  ? 60.137  82.235  98.148  0.50 19.07  ? 23  DT  F C4    1 
ATOM   2571 O O4    . DT  D 4 23  ? 59.709  82.913  97.218  0.50 19.07  ? 23  DT  F O4    1 
ATOM   2572 C C5    . DT  D 4 23  ? 59.333  81.712  99.231  0.50 19.07  ? 23  DT  F C5    1 
ATOM   2573 C C7    . DT  D 4 23  ? 57.864  81.994  99.246  0.50 19.07  ? 23  DT  F C7    1 
ATOM   2574 C C6    . DT  D 4 23  ? 59.947  80.994  100.181 0.50 19.07  ? 23  DT  F C6    1 
ATOM   2575 P P     . DA  D 4 24  ? 63.641  79.949  104.984 0.50 23.54  ? 24  DA  F P     1 
ATOM   2576 O OP1   . DA  D 4 24  ? 64.311  79.099  106.001 0.50 23.54  ? 24  DA  F OP1   1 
ATOM   2577 O OP2   . DA  D 4 24  ? 62.481  80.787  105.376 0.50 23.54  ? 24  DA  F OP2   1 
ATOM   2578 O "O5'" . DA  D 4 24  ? 64.735  80.893  104.321 0.50 23.54  ? 24  DA  F "O5'" 1 
ATOM   2579 C "C5'" . DA  D 4 24  ? 65.806  80.335  103.567 0.50 23.54  ? 24  DA  F "C5'" 1 
ATOM   2580 C "C4'" . DA  D 4 24  ? 66.521  81.419  102.797 0.50 19.00  ? 24  DA  F "C4'" 1 
ATOM   2581 O "O4'" . DA  D 4 24  ? 65.678  81.887  101.714 0.50 23.54  ? 24  DA  F "O4'" 1 
ATOM   2582 C "C3'" . DA  D 4 24  ? 66.867  82.654  103.632 0.50 23.54  ? 24  DA  F "C3'" 1 
ATOM   2583 O "O3'" . DA  D 4 24  ? 68.160  83.149  103.280 0.50 23.54  ? 24  DA  F "O3'" 1 
ATOM   2584 C "C2'" . DA  D 4 24  ? 65.812  83.660  103.220 0.50 23.54  ? 24  DA  F "C2'" 1 
ATOM   2585 C "C1'" . DA  D 4 24  ? 65.600  83.300  101.765 0.50 23.54  ? 24  DA  F "C1'" 1 
ATOM   2586 N N9    . DA  D 4 24  ? 64.302  83.715  101.239 0.50 19.00  ? 24  DA  F N9    1 
ATOM   2587 C C8    . DA  D 4 24  ? 63.051  83.424  101.723 0.50 19.00  ? 24  DA  F C8    1 
ATOM   2588 N N7    . DA  D 4 24  ? 62.080  83.999  101.055 0.50 19.00  ? 24  DA  F N7    1 
ATOM   2589 C C5    . DA  D 4 24  ? 62.734  84.705  100.056 0.50 19.00  ? 24  DA  F C5    1 
ATOM   2590 C C6    . DA  D 4 24  ? 62.268  85.535  99.021  0.50 19.00  ? 24  DA  F C6    1 
ATOM   2591 N N6    . DA  D 4 24  ? 60.980  85.812  98.818  0.50 19.00  ? 24  DA  F N6    1 
ATOM   2592 N N1    . DA  D 4 24  ? 63.185  86.082  98.193  0.50 19.00  ? 24  DA  F N1    1 
ATOM   2593 C C2    . DA  D 4 24  ? 64.478  85.812  98.403  0.50 19.00  ? 24  DA  F C2    1 
ATOM   2594 N N3    . DA  D 4 24  ? 65.039  85.054  99.342  0.50 19.00  ? 24  DA  F N3    1 
ATOM   2595 C C4    . DA  D 4 24  ? 64.102  84.525  100.147 0.50 19.00  ? 24  DA  F C4    1 
ATOM   2596 P P     . DT  D 4 25  ? 68.815  84.343  104.133 0.50 18.71  ? 25  DT  F P     1 
ATOM   2597 O OP1   . DT  D 4 25  ? 70.013  83.805  104.822 0.50 18.71  ? 25  DT  F OP1   1 
ATOM   2598 O OP2   . DT  D 4 25  ? 67.745  84.997  104.929 0.50 18.71  ? 25  DT  F OP2   1 
ATOM   2599 O "O5'" . DT  D 4 25  ? 69.303  85.358  103.009 0.50 18.71  ? 25  DT  F "O5'" 1 
ATOM   2600 C "C5'" . DT  D 4 25  ? 69.972  84.870  101.852 0.50 18.71  ? 25  DT  F "C5'" 1 
ATOM   2601 C "C4'" . DT  D 4 25  ? 69.869  85.863  100.719 0.50 19.89  ? 25  DT  F "C4'" 1 
ATOM   2602 O "O4'" . DT  D 4 25  ? 68.481  86.070  100.366 0.50 18.71  ? 25  DT  F "O4'" 1 
ATOM   2603 C "C3'" . DT  D 4 25  ? 70.442  87.251  101.004 0.50 18.71  ? 25  DT  F "C3'" 1 
ATOM   2604 O "O3'" . DT  D 4 25  ? 71.111  87.715  99.830  0.50 18.71  ? 25  DT  F "O3'" 1 
ATOM   2605 C "C2'" . DT  D 4 25  ? 69.209  88.093  101.268 0.50 18.71  ? 25  DT  F "C2'" 1 
ATOM   2606 C "C1'" . DT  D 4 25  ? 68.212  87.462  100.319 0.50 18.71  ? 25  DT  F "C1'" 1 
ATOM   2607 N N1    . DT  D 4 25  ? 66.793  87.671  100.663 0.50 19.89  ? 25  DT  F N1    1 
ATOM   2608 C C2    . DT  D 4 25  ? 66.043  88.456  99.817  0.50 19.89  ? 25  DT  F C2    1 
ATOM   2609 O O2    . DT  D 4 25  ? 66.501  88.982  98.817  0.50 19.89  ? 25  DT  F O2    1 
ATOM   2610 N N3    . DT  D 4 25  ? 64.730  88.605  100.187 0.50 19.89  ? 25  DT  F N3    1 
ATOM   2611 C C4    . DT  D 4 25  ? 64.108  88.064  101.294 0.50 19.89  ? 25  DT  F C4    1 
ATOM   2612 O O4    . DT  D 4 25  ? 62.917  88.287  101.495 0.50 19.89  ? 25  DT  F O4    1 
ATOM   2613 C C5    . DT  D 4 25  ? 64.955  87.256  102.142 0.50 19.89  ? 25  DT  F C5    1 
ATOM   2614 C C7    . DT  D 4 25  ? 64.367  86.635  103.370 0.50 19.89  ? 25  DT  F C7    1 
ATOM   2615 C C6    . DT  D 4 25  ? 66.238  87.100  101.788 0.50 19.89  ? 25  DT  F C6    1 
ATOM   2616 P P     . DA  D 4 26  ? 71.852  89.137  99.842  0.50 24.06  ? 26  DA  F P     1 
ATOM   2617 O OP1   . DA  D 4 26  ? 73.022  89.038  98.934  0.50 24.06  ? 26  DA  F OP1   1 
ATOM   2618 O OP2   . DA  D 4 26  ? 72.050  89.545  101.254 0.50 24.06  ? 26  DA  F OP2   1 
ATOM   2619 O "O5'" . DA  D 4 26  ? 70.790  90.116  99.180  0.50 24.06  ? 26  DA  F "O5'" 1 
ATOM   2620 C "C5'" . DA  D 4 26  ? 70.676  90.199  97.766  0.50 24.06  ? 26  DA  F "C5'" 1 
ATOM   2621 C "C4'" . DA  D 4 26  ? 70.181  91.569  97.367  0.50 18.83  ? 26  DA  F "C4'" 1 
ATOM   2622 O "O4'" . DA  D 4 26  ? 68.785  91.702  97.714  0.50 24.06  ? 26  DA  F "O4'" 1 
ATOM   2623 C "C3'" . DA  D 4 26  ? 70.902  92.719  98.067  0.50 24.06  ? 26  DA  F "C3'" 1 
ATOM   2624 O "O3'" . DA  D 4 26  ? 71.053  93.810  97.160  0.50 24.06  ? 26  DA  F "O3'" 1 
ATOM   2625 C "C2'" . DA  D 4 26  ? 69.965  93.078  99.206  0.50 24.06  ? 26  DA  F "C2'" 1 
ATOM   2626 C "C1'" . DA  D 4 26  ? 68.599  92.785  98.611  0.50 24.06  ? 26  DA  F "C1'" 1 
ATOM   2627 N N9    . DA  D 4 26  ? 67.584  92.377  99.582  0.50 18.83  ? 26  DA  F N9    1 
ATOM   2628 C C8    . DA  D 4 26  ? 67.704  91.463  100.600 0.50 18.83  ? 26  DA  F C8    1 
ATOM   2629 N N7    . DA  D 4 26  ? 66.599  91.288  101.286 0.50 18.83  ? 26  DA  F N7    1 
ATOM   2630 C C5    . DA  D 4 26  ? 65.693  92.151  100.684 0.50 18.83  ? 26  DA  F C5    1 
ATOM   2631 C C6    . DA  D 4 26  ? 64.340  92.435  100.943 0.50 18.83  ? 26  DA  F C6    1 
ATOM   2632 N N6    . DA  D 4 26  ? 63.631  91.854  101.912 0.50 18.83  ? 26  DA  F N6    1 
ATOM   2633 N N1    . DA  D 4 26  ? 63.731  93.350  100.157 0.50 18.83  ? 26  DA  F N1    1 
ATOM   2634 C C2    . DA  D 4 26  ? 64.439  93.931  99.181  0.50 18.83  ? 26  DA  F C2    1 
ATOM   2635 N N3    . DA  D 4 26  ? 65.712  93.746  98.839  0.50 18.83  ? 26  DA  F N3    1 
ATOM   2636 C C4    . DA  D 4 26  ? 66.289  92.833  99.639  0.50 18.83  ? 26  DA  F C4    1 
ATOM   2637 P P     . DC  D 4 27  ? 71.984  95.052  97.561  0.50 23.22  ? 27  DC  F P     1 
ATOM   2638 O OP1   . DC  D 4 27  ? 72.542  95.642  96.319  0.50 23.22  ? 27  DC  F OP1   1 
ATOM   2639 O OP2   . DC  D 4 27  ? 72.901  94.583  98.629  0.50 23.22  ? 27  DC  F OP2   1 
ATOM   2640 O "O5'" . DC  D 4 27  ? 70.958  96.094  98.188  0.50 23.22  ? 27  DC  F "O5'" 1 
ATOM   2641 C "C5'" . DC  D 4 27  ? 69.760  96.433  97.494  0.50 23.22  ? 27  DC  F "C5'" 1 
ATOM   2642 C "C4'" . DC  D 4 27  ? 69.013  97.519  98.232  0.50 25.90  ? 27  DC  F "C4'" 1 
ATOM   2643 O "O4'" . DC  D 4 27  ? 67.991  96.923  99.066  0.50 23.22  ? 27  DC  F "O4'" 1 
ATOM   2644 C "C3'" . DC  D 4 27  ? 69.868  98.377  99.165  0.50 23.22  ? 27  DC  F "C3'" 1 
ATOM   2645 O "O3'" . DC  D 4 27  ? 69.378  99.718  99.145  0.50 23.22  ? 27  DC  F "O3'" 1 
ATOM   2646 C "C2'" . DC  D 4 27  ? 69.598  97.772  100.530 0.50 23.22  ? 27  DC  F "C2'" 1 
ATOM   2647 C "C1'" . DC  D 4 27  ? 68.138  97.390  100.396 0.50 23.22  ? 27  DC  F "C1'" 1 
ATOM   2648 N N1    . DC  D 4 27  ? 67.671  96.334  101.307 0.50 25.90  ? 27  DC  F N1    1 
ATOM   2649 C C2    . DC  D 4 27  ? 66.308  96.266  101.602 0.50 25.90  ? 27  DC  F C2    1 
ATOM   2650 O O2    . DC  D 4 27  ? 65.542  97.083  101.072 0.50 25.90  ? 27  DC  F O2    1 
ATOM   2651 N N3    . DC  D 4 27  ? 65.861  95.317  102.452 0.50 25.90  ? 27  DC  F N3    1 
ATOM   2652 C C4    . DC  D 4 27  ? 66.720  94.455  102.996 0.50 25.90  ? 27  DC  F C4    1 
ATOM   2653 N N4    . DC  D 4 27  ? 66.235  93.538  103.836 0.50 25.90  ? 27  DC  F N4    1 
ATOM   2654 C C5    . DC  D 4 27  ? 68.114  94.495  102.706 0.50 25.90  ? 27  DC  F C5    1 
ATOM   2655 C C6    . DC  D 4 27  ? 68.542  95.441  101.863 0.50 25.90  ? 27  DC  F C6    1 
ATOM   2656 P P     . DG  D 4 28  ? 70.400  100.947 99.279  0.50 36.43  ? 28  DG  F P     1 
ATOM   2657 O OP1   . DG  D 4 28  ? 71.170  101.048 98.013  0.50 36.43  ? 28  DG  F OP1   1 
ATOM   2658 O OP2   . DG  D 4 28  ? 71.120  100.811 100.571 0.50 36.43  ? 28  DG  F OP2   1 
ATOM   2659 O "O5'" . DG  D 4 28  ? 69.433  102.205 99.379  0.50 36.43  ? 28  DG  F "O5'" 1 
ATOM   2660 C "C5'" . DG  D 4 28  ? 68.421  102.413 98.400  0.50 36.43  ? 28  DG  F "C5'" 1 
ATOM   2661 C "C4'" . DG  D 4 28  ? 67.123  102.809 99.065  0.50 21.12  ? 28  DG  F "C4'" 1 
ATOM   2662 O "O4'" . DG  D 4 28  ? 66.600  101.696 99.832  0.50 36.43  ? 28  DG  F "O4'" 1 
ATOM   2663 C "C3'" . DG  D 4 28  ? 67.241  103.978 100.042 0.50 36.43  ? 28  DG  F "C3'" 1 
ATOM   2664 O "O3'" . DG  D 4 28  ? 66.104  104.834 99.909  0.50 36.43  ? 28  DG  F "O3'" 1 
ATOM   2665 C "C2'" . DG  D 4 28  ? 67.255  103.302 101.402 0.50 36.43  ? 28  DG  F "C2'" 1 
ATOM   2666 C "C1'" . DG  D 4 28  ? 66.361  102.099 101.172 0.50 36.43  ? 28  DG  F "C1'" 1 
ATOM   2667 N N9    . DG  D 4 28  ? 66.641  100.959 102.043 0.50 21.12  ? 28  DG  F N9    1 
ATOM   2668 C C8    . DG  D 4 28  ? 67.866  100.393 102.298 0.50 21.12  ? 28  DG  F C8    1 
ATOM   2669 N N7    . DG  D 4 28  ? 67.802  99.381  103.122 0.50 21.12  ? 28  DG  F N7    1 
ATOM   2670 C C5    . DG  D 4 28  ? 66.453  99.274  103.431 0.50 21.12  ? 28  DG  F C5    1 
ATOM   2671 C C6    . DG  D 4 28  ? 65.773  98.360  104.280 0.50 21.12  ? 28  DG  F C6    1 
ATOM   2672 O O6    . DG  D 4 28  ? 66.244  97.434  104.952 0.50 21.12  ? 28  DG  F O6    1 
ATOM   2673 N N1    . DG  D 4 28  ? 64.405  98.607  104.307 0.50 21.12  ? 28  DG  F N1    1 
ATOM   2674 C C2    . DG  D 4 28  ? 63.770  99.602  103.610 0.50 21.12  ? 28  DG  F C2    1 
ATOM   2675 N N2    . DG  D 4 28  ? 62.441  99.675  103.769 0.50 21.12  ? 28  DG  F N2    1 
ATOM   2676 N N3    . DG  D 4 28  ? 64.390  100.462 102.816 0.50 21.12  ? 28  DG  F N3    1 
ATOM   2677 C C4    . DG  D 4 28  ? 65.721  100.240 102.774 0.50 21.12  ? 28  DG  F C4    1 
ATOM   2678 P P     . DA  D 4 29  ? 65.971  106.130 100.846 0.50 56.22  ? 29  DA  F P     1 
ATOM   2679 O OP1   . DA  D 4 29  ? 65.254  107.186 100.090 0.50 56.22  ? 29  DA  F OP1   1 
ATOM   2680 O OP2   . DA  D 4 29  ? 67.312  106.416 101.416 0.50 56.22  ? 29  DA  F OP2   1 
ATOM   2681 O "O5'" . DA  D 4 29  ? 65.026  105.630 102.023 0.50 56.22  ? 29  DA  F "O5'" 1 
ATOM   2682 C "C5'" . DA  D 4 29  ? 63.672  105.280 101.764 0.50 56.22  ? 29  DA  F "C5'" 1 
ATOM   2683 C "C4'" . DA  D 4 29  ? 62.931  105.089 103.065 0.50 27.19  ? 29  DA  F "C4'" 1 
ATOM   2684 O "O4'" . DA  D 4 29  ? 63.324  103.839 103.685 0.50 56.22  ? 29  DA  F "O4'" 1 
ATOM   2685 C "C3'" . DA  D 4 29  ? 63.217  106.182 104.096 0.50 56.22  ? 29  DA  F "C3'" 1 
ATOM   2686 O "O3'" . DA  D 4 29  ? 62.023  106.503 104.807 0.50 56.22  ? 29  DA  F "O3'" 1 
ATOM   2687 C "C2'" . DA  D 4 29  ? 64.215  105.524 105.032 0.50 56.22  ? 29  DA  F "C2'" 1 
ATOM   2688 C "C1'" . DA  D 4 29  ? 63.735  104.087 105.019 0.50 56.22  ? 29  DA  F "C1'" 1 
ATOM   2689 N N9    . DA  D 4 29  ? 64.744  103.091 105.383 0.50 27.19  ? 29  DA  F N9    1 
ATOM   2690 C C8    . DA  D 4 29  ? 66.079  103.062 105.056 0.50 27.19  ? 29  DA  F C8    1 
ATOM   2691 N N7    . DA  D 4 29  ? 66.722  102.032 105.552 0.50 27.19  ? 29  DA  F N7    1 
ATOM   2692 C C5    . DA  D 4 29  ? 65.746  101.333 106.251 0.50 27.19  ? 29  DA  F C5    1 
ATOM   2693 C C6    . DA  D 4 29  ? 65.787  100.147 107.005 0.50 27.19  ? 29  DA  F C6    1 
ATOM   2694 N N6    . DA  D 4 29  ? 66.891  99.421  107.190 0.50 27.19  ? 29  DA  F N6    1 
ATOM   2695 N N1    . DA  D 4 29  ? 64.635  99.723  107.570 0.50 27.19  ? 29  DA  F N1    1 
ATOM   2696 C C2    . DA  D 4 29  ? 63.525  100.449 107.385 0.50 27.19  ? 29  DA  F C2    1 
ATOM   2697 N N3    . DA  D 4 29  ? 63.362  101.579 106.701 0.50 27.19  ? 29  DA  F N3    1 
ATOM   2698 C C4    . DA  D 4 29  ? 64.524  101.973 106.152 0.50 27.19  ? 29  DA  F C4    1 
ATOM   2699 P P     . DA  D 4 30  ? 61.952  107.849 105.676 0.50 73.79  ? 30  DA  F P     1 
ATOM   2700 O OP1   . DA  D 4 30  ? 61.062  108.808 104.973 0.50 73.79  ? 30  DA  F OP1   1 
ATOM   2701 O OP2   . DA  D 4 30  ? 63.342  108.248 106.013 0.50 73.79  ? 30  DA  F OP2   1 
ATOM   2702 O "O5'" . DA  D 4 30  ? 61.230  107.376 107.012 0.50 73.79  ? 30  DA  F "O5'" 1 
ATOM   2703 C "C5'" . DA  D 4 30  ? 60.056  106.572 106.950 0.50 73.79  ? 30  DA  F "C5'" 1 
ATOM   2704 C "C4'" . DA  D 4 30  ? 59.934  105.727 108.196 0.50 26.68  ? 30  DA  F "C4'" 1 
ATOM   2705 O "O4'" . DA  D 4 30  ? 60.967  104.711 108.211 0.50 73.79  ? 30  DA  F "O4'" 1 
ATOM   2706 C "C3'" . DA  D 4 30  ? 60.079  106.502 109.506 0.50 73.79  ? 30  DA  F "C3'" 1 
ATOM   2707 O "O3'" . DA  D 4 30  ? 59.141  106.012 110.465 0.50 73.79  ? 30  DA  F "O3'" 1 
ATOM   2708 C "C2'" . DA  D 4 30  ? 61.492  106.175 109.951 0.50 73.79  ? 30  DA  F "C2'" 1 
ATOM   2709 C "C1'" . DA  D 4 30  ? 61.649  104.753 109.453 0.50 73.79  ? 30  DA  F "C1'" 1 
ATOM   2710 N N9    . DA  D 4 30  ? 63.034  104.340 109.230 0.50 26.68  ? 30  DA  F N9    1 
ATOM   2711 C C8    . DA  D 4 30  ? 63.996  104.966 108.476 0.50 26.68  ? 30  DA  F C8    1 
ATOM   2712 N N7    . DA  D 4 30  ? 65.159  104.360 108.494 0.50 26.68  ? 30  DA  F N7    1 
ATOM   2713 C C5    . DA  D 4 30  ? 64.948  103.258 109.311 0.50 26.68  ? 30  DA  F C5    1 
ATOM   2714 C C6    . DA  D 4 30  ? 65.795  102.218 109.738 0.50 26.68  ? 30  DA  F C6    1 
ATOM   2715 N N6    . DA  D 4 30  ? 67.080  102.118 109.390 0.50 26.68  ? 30  DA  F N6    1 
ATOM   2716 N N1    . DA  D 4 30  ? 65.269  101.274 110.548 0.50 26.68  ? 30  DA  F N1    1 
ATOM   2717 C C2    . DA  D 4 30  ? 63.983  101.378 110.904 0.50 26.68  ? 30  DA  F C2    1 
ATOM   2718 N N3    . DA  D 4 30  ? 63.089  102.307 110.573 0.50 26.68  ? 30  DA  F N3    1 
ATOM   2719 C C4    . DA  D 4 30  ? 63.642  103.229 109.766 0.50 26.68  ? 30  DA  F C4    1 
ATOM   2720 P P     . DG  D 4 31  ? 58.939  106.793 111.852 0.50 63.66  ? 31  DG  F P     1 
ATOM   2721 O OP1   . DG  D 4 31  ? 57.489  107.059 112.028 0.50 63.66  ? 31  DG  F OP1   1 
ATOM   2722 O OP2   . DG  D 4 31  ? 59.901  107.924 111.883 0.50 63.66  ? 31  DG  F OP2   1 
ATOM   2723 O "O5'" . DG  D 4 31  ? 59.392  105.725 112.943 0.50 63.66  ? 31  DG  F "O5'" 1 
ATOM   2724 C "C5'" . DG  D 4 31  ? 58.782  104.437 112.993 0.50 63.66  ? 31  DG  F "C5'" 1 
ATOM   2725 C "C4'" . DG  D 4 31  ? 59.476  103.569 114.016 0.50 34.98  ? 31  DG  F "C4'" 1 
ATOM   2726 O "O4'" . DG  D 4 31  ? 60.784  103.188 113.524 0.50 63.66  ? 31  DG  F "O4'" 1 
ATOM   2727 C "C3'" . DG  D 4 31  ? 59.714  104.248 115.366 0.50 63.66  ? 31  DG  F "C3'" 1 
ATOM   2728 O "O3'" . DG  D 4 31  ? 59.530  103.307 116.427 0.50 63.66  ? 31  DG  F "O3'" 1 
ATOM   2729 C "C2'" . DG  D 4 31  ? 61.165  104.678 115.287 0.50 63.66  ? 31  DG  F "C2'" 1 
ATOM   2730 C "C1'" . DG  D 4 31  ? 61.779  103.564 114.463 0.50 63.66  ? 31  DG  F "C1'" 1 
ATOM   2731 N N9    . DG  D 4 31  ? 62.955  103.994 113.717 0.50 34.98  ? 31  DG  F N9    1 
ATOM   2732 C C8    . DG  D 4 31  ? 63.061  105.095 112.900 0.50 34.98  ? 31  DG  F C8    1 
ATOM   2733 N N7    . DG  D 4 31  ? 64.250  105.235 112.381 0.50 34.98  ? 31  DG  F N7    1 
ATOM   2734 C C5    . DG  D 4 31  ? 64.971  104.160 112.883 0.50 34.98  ? 31  DG  F C5    1 
ATOM   2735 C C6    . DG  D 4 31  ? 66.323  103.783 112.676 0.50 34.98  ? 31  DG  F C6    1 
ATOM   2736 O O6    . DG  D 4 31  ? 67.185  104.345 111.989 0.50 34.98  ? 31  DG  F O6    1 
ATOM   2737 N N1    . DG  D 4 31  ? 66.640  102.621 113.371 0.50 34.98  ? 31  DG  F N1    1 
ATOM   2738 C C2    . DG  D 4 31  ? 65.771  101.916 114.166 0.50 34.98  ? 31  DG  F C2    1 
ATOM   2739 N N2    . DG  D 4 31  ? 66.263  100.819 114.752 0.50 34.98  ? 31  DG  F N2    1 
ATOM   2740 N N3    . DG  D 4 31  ? 64.512  102.260 114.372 0.50 34.98  ? 31  DG  F N3    1 
ATOM   2741 C C4    . DG  D 4 31  ? 64.183  103.383 113.703 0.50 34.98  ? 31  DG  F C4    1 
ATOM   2742 P P     . DT  D 4 32  ? 60.113  103.631 117.888 0.50 62.65  ? 32  DT  F P     1 
ATOM   2743 O OP1   . DT  D 4 32  ? 59.231  102.982 118.892 0.50 62.65  ? 32  DT  F OP1   1 
ATOM   2744 O OP2   . DT  D 4 32  ? 60.366  105.093 117.970 0.50 62.65  ? 32  DT  F OP2   1 
ATOM   2745 O "O5'" . DT  D 4 32  ? 61.516  102.879 117.904 0.50 62.65  ? 32  DT  F "O5'" 1 
ATOM   2746 C "C5'" . DT  D 4 32  ? 61.573  101.459 117.797 0.50 62.65  ? 32  DT  F "C5'" 1 
ATOM   2747 C "C4'" . DT  D 4 32  ? 62.721  100.919 118.617 0.50 42.84  ? 32  DT  F "C4'" 1 
ATOM   2748 O "O4'" . DT  D 4 32  ? 63.977  101.184 117.949 0.50 62.65  ? 32  DT  F "O4'" 1 
ATOM   2749 C "C3'" . DT  D 4 32  ? 62.845  101.528 120.014 0.50 62.65  ? 32  DT  F "C3'" 1 
ATOM   2750 O "O3'" . DT  D 4 32  ? 63.207  100.517 120.957 0.50 62.65  ? 32  DT  F "O3'" 1 
ATOM   2751 C "C2'" . DT  D 4 32  ? 63.966  102.540 119.858 0.50 62.65  ? 32  DT  F "C2'" 1 
ATOM   2752 C "C1'" . DT  D 4 32  ? 64.855  101.867 118.829 0.50 62.65  ? 32  DT  F "C1'" 1 
ATOM   2753 N N1    . DT  D 4 32  ? 65.674  102.787 118.022 0.50 42.84  ? 32  DT  F N1    1 
ATOM   2754 C C2    . DT  D 4 32  ? 67.024  102.534 117.924 0.50 42.84  ? 32  DT  F C2    1 
ATOM   2755 O O2    . DT  D 4 32  ? 67.567  101.590 118.476 0.50 42.84  ? 32  DT  F O2    1 
ATOM   2756 N N3    . DT  D 4 32  ? 67.718  103.429 117.149 0.50 42.84  ? 32  DT  F N3    1 
ATOM   2757 C C4    . DT  D 4 32  ? 67.210  104.525 116.480 0.50 42.84  ? 32  DT  F C4    1 
ATOM   2758 O O4    . DT  D 4 32  ? 67.959  105.237 115.819 0.50 42.84  ? 32  DT  F O4    1 
ATOM   2759 C C5    . DT  D 4 32  ? 65.787  104.732 116.630 0.50 42.84  ? 32  DT  F C5    1 
ATOM   2760 C C7    . DT  D 4 32  ? 65.146  105.896 115.941 0.50 42.84  ? 32  DT  F C7    1 
ATOM   2761 C C6    . DT  D 4 32  ? 65.100  103.865 117.385 0.50 42.84  ? 32  DT  F C6    1 
ATOM   2762 P P     . DT  D 4 33  ? 63.484  100.920 122.486 0.50 62.03  ? 33  DT  F P     1 
ATOM   2763 O OP1   . DT  D 4 33  ? 63.142  99.752  123.340 0.50 62.03  ? 33  DT  F OP1   1 
ATOM   2764 O OP2   . DT  D 4 33  ? 62.825  102.228 122.732 0.50 62.03  ? 33  DT  F OP2   1 
ATOM   2765 O "O5'" . DT  D 4 33  ? 65.061  101.137 122.535 0.50 62.03  ? 33  DT  F "O5'" 1 
ATOM   2766 C "C5'" . DT  D 4 33  ? 65.950  100.032 122.380 0.50 62.03  ? 33  DT  F "C5'" 1 
ATOM   2767 C "C4'" . DT  D 4 33  ? 67.348  100.418 122.803 0.50 30.03  ? 33  DT  F "C4'" 1 
ATOM   2768 O "O4'" . DT  D 4 33  ? 67.957  101.276 121.808 0.50 62.03  ? 33  DT  F "O4'" 1 
ATOM   2769 C "C3'" . DT  D 4 33  ? 67.425  101.180 124.127 0.50 62.03  ? 33  DT  F "C3'" 1 
ATOM   2770 O "O3'" . DT  D 4 33  ? 68.568  100.747 124.867 0.50 62.03  ? 33  DT  F "O3'" 1 
ATOM   2771 C "C2'" . DT  D 4 33  ? 67.620  102.619 123.687 0.50 62.03  ? 33  DT  F "C2'" 1 
ATOM   2772 C "C1'" . DT  D 4 33  ? 68.464  102.438 122.440 0.50 62.03  ? 33  DT  F "C1'" 1 
ATOM   2773 N N1    . DT  D 4 33  ? 68.413  103.548 121.470 0.50 30.03  ? 33  DT  F N1    1 
ATOM   2774 C C2    . DT  D 4 33  ? 69.527  103.764 120.691 0.50 30.03  ? 33  DT  F C2    1 
ATOM   2775 O O2    . DT  D 4 33  ? 70.531  103.072 120.759 0.50 30.03  ? 33  DT  F O2    1 
ATOM   2776 N N3    . DT  D 4 33  ? 69.423  104.823 119.824 0.50 30.03  ? 33  DT  F N3    1 
ATOM   2777 C C4    . DT  D 4 33  ? 68.342  105.665 119.661 0.50 30.03  ? 33  DT  F C4    1 
ATOM   2778 O O4    . DT  D 4 33  ? 68.399  106.581 118.845 0.50 30.03  ? 33  DT  F O4    1 
ATOM   2779 C C5    . DT  D 4 33  ? 67.203  105.375 120.503 0.50 30.03  ? 33  DT  F C5    1 
ATOM   2780 C C7    . DT  D 4 33  ? 65.981  106.230 120.391 0.50 30.03  ? 33  DT  F C7    1 
ATOM   2781 C C6    . DT  D 4 33  ? 67.294  104.344 121.354 0.50 30.03  ? 33  DT  F C6    1 
ATOM   2782 P P     . DA  D 4 34  ? 68.473  100.602 126.462 0.50 37.87  ? 34  DA  F P     1 
ATOM   2783 O OP1   . DA  D 4 34  ? 67.750  99.342  126.774 0.50 37.87  ? 34  DA  F OP1   1 
ATOM   2784 O OP2   . DA  D 4 34  ? 67.967  101.892 126.999 0.50 37.87  ? 34  DA  F OP2   1 
ATOM   2785 O "O5'" . DA  D 4 34  ? 69.992  100.434 126.909 0.50 37.87  ? 34  DA  F "O5'" 1 
ATOM   2786 C "C5'" . DA  D 4 34  ? 70.827  99.455  126.297 0.50 37.87  ? 34  DA  F "C5'" 1 
ATOM   2787 C "C4'" . DA  D 4 34  ? 72.164  100.059 125.939 0.50 27.26  ? 34  DA  F "C4'" 1 
ATOM   2788 O "O4'" . DA  D 4 34  ? 71.969  101.091 124.942 0.50 37.87  ? 34  DA  F "O4'" 1 
ATOM   2789 C "C3'" . DA  D 4 34  ? 72.893  100.733 127.102 0.50 37.87  ? 34  DA  F "C3'" 1 
ATOM   2790 O "O3'" . DA  D 4 34  ? 74.302  100.526 126.979 0.50 37.87  ? 34  DA  F "O3'" 1 
ATOM   2791 C "C2'" . DA  D 4 34  ? 72.563  102.201 126.917 0.50 37.87  ? 34  DA  F "C2'" 1 
ATOM   2792 C "C1'" . DA  D 4 34  ? 72.496  102.324 125.407 0.50 37.87  ? 34  DA  F "C1'" 1 
ATOM   2793 N N9    . DA  D 4 34  ? 71.619  103.395 124.935 0.50 27.26  ? 34  DA  F N9    1 
ATOM   2794 C C8    . DA  D 4 34  ? 70.373  103.734 125.403 0.50 27.26  ? 34  DA  F C8    1 
ATOM   2795 N N7    . DA  D 4 34  ? 69.835  104.754 124.781 0.50 27.26  ? 34  DA  F N7    1 
ATOM   2796 C C5    . DA  D 4 34  ? 70.789  105.112 123.839 0.50 27.26  ? 34  DA  F C5    1 
ATOM   2797 C C6    . DA  D 4 34  ? 70.825  106.127 122.867 0.50 27.26  ? 34  DA  F C6    1 
ATOM   2798 N N6    . DA  D 4 34  ? 69.838  107.005 122.677 0.50 27.26  ? 34  DA  F N6    1 
ATOM   2799 N N1    . DA  D 4 34  ? 71.925  106.210 122.088 0.50 27.26  ? 34  DA  F N1    1 
ATOM   2800 C C2    . DA  D 4 34  ? 72.916  105.332 122.282 0.50 27.26  ? 34  DA  F C2    1 
ATOM   2801 N N3    . DA  D 4 34  ? 73.001  104.339 123.163 0.50 27.26  ? 34  DA  F N3    1 
ATOM   2802 C C4    . DA  D 4 34  ? 71.892  104.281 123.920 0.50 27.26  ? 34  DA  F C4    1 
ATOM   2803 P P     . DT  D 4 35  ? 75.278  100.956 128.180 0.50 44.65  ? 35  DT  F P     1 
ATOM   2804 O OP1   . DT  D 4 35  ? 76.673  100.702 127.747 0.50 44.65  ? 35  DT  F OP1   1 
ATOM   2805 O OP2   . DT  D 4 35  ? 74.768  100.321 129.423 0.50 44.65  ? 35  DT  F OP2   1 
ATOM   2806 O "O5'" . DT  D 4 35  ? 75.072  102.531 128.291 0.50 44.65  ? 35  DT  F "O5'" 1 
ATOM   2807 C "C5'" . DT  D 4 35  ? 76.160  103.424 128.071 0.50 44.65  ? 35  DT  F "C5'" 1 
ATOM   2808 C "C4'" . DT  D 4 35  ? 76.359  103.642 126.588 0.50 40.74  ? 35  DT  F "C4'" 1 
ATOM   2809 O "O4'" . DT  D 4 35  ? 75.127  104.130 126.006 0.50 44.65  ? 35  DT  F "O4'" 1 
ATOM   2810 C "C3'" . DT  D 4 35  ? 77.426  104.676 126.231 0.50 44.65  ? 35  DT  F "C3'" 1 
ATOM   2811 O "O3'" . DT  D 4 35  ? 77.960  104.383 124.937 0.50 44.65  ? 35  DT  F "O3'" 1 
ATOM   2812 C "C2'" . DT  D 4 35  ? 76.613  105.944 126.059 0.50 44.65  ? 35  DT  F "C2'" 1 
ATOM   2813 C "C1'" . DT  D 4 35  ? 75.351  105.402 125.413 0.50 44.65  ? 35  DT  F "C1'" 1 
ATOM   2814 N N1    . DT  D 4 35  ? 74.149  106.227 125.626 0.50 40.74  ? 35  DT  F N1    1 
ATOM   2815 C C2    . DT  D 4 35  ? 73.988  107.341 124.836 0.50 40.74  ? 35  DT  F C2    1 
ATOM   2816 O O2    . DT  D 4 35  ? 74.791  107.673 123.980 0.50 40.74  ? 35  DT  F O2    1 
ATOM   2817 N N3    . DT  D 4 35  ? 72.844  108.059 125.085 0.50 40.74  ? 35  DT  F N3    1 
ATOM   2818 C C4    . DT  D 4 35  ? 71.870  107.779 126.023 0.50 40.74  ? 35  DT  F C4    1 
ATOM   2819 O O4    . DT  D 4 35  ? 70.894  108.517 126.129 0.50 40.74  ? 35  DT  F O4    1 
ATOM   2820 C C5    . DT  D 4 35  ? 72.106  106.595 126.819 0.50 40.74  ? 35  DT  F C5    1 
ATOM   2821 C C7    . DT  D 4 35  ? 71.105  106.210 127.864 0.50 40.74  ? 35  DT  F C7    1 
ATOM   2822 C C6    . DT  D 4 35  ? 73.219  105.888 126.584 0.50 40.74  ? 35  DT  F C6    1 
ATOM   2823 N N     . THR E 5 19  ? 30.798  49.454  104.081 1.00 80.42  ? 19  THR A N     1 
ATOM   2824 C CA    . THR E 5 19  ? 32.164  48.949  104.013 1.00 80.42  ? 19  THR A CA    1 
ATOM   2825 C C     . THR E 5 19  ? 32.599  48.318  105.334 1.00 80.42  ? 19  THR A C     1 
ATOM   2826 O O     . THR E 5 19  ? 33.727  47.844  105.457 1.00 80.42  ? 19  THR A O     1 
ATOM   2827 C CB    . THR E 5 19  ? 33.165  50.075  103.649 1.00 100.00 ? 19  THR A CB    1 
ATOM   2828 O OG1   . THR E 5 19  ? 33.290  50.987  104.747 1.00 100.00 ? 19  THR A OG1   1 
ATOM   2829 C CG2   . THR E 5 19  ? 32.692  50.836  102.418 1.00 100.00 ? 19  THR A CG2   1 
ATOM   2830 N N     . SER E 5 20  ? 31.704  48.315  106.318 1.00 49.41  ? 20  SER A N     1 
ATOM   2831 C CA    . SER E 5 20  ? 32.005  47.734  107.622 1.00 49.41  ? 20  SER A CA    1 
ATOM   2832 C C     . SER E 5 20  ? 32.474  46.295  107.447 1.00 49.41  ? 20  SER A C     1 
ATOM   2833 O O     . SER E 5 20  ? 33.253  45.782  108.248 1.00 49.41  ? 20  SER A O     1 
ATOM   2834 C CB    . SER E 5 20  ? 30.767  47.771  108.521 1.00 97.16  ? 20  SER A CB    1 
ATOM   2835 O OG    . SER E 5 20  ? 29.577  47.690  107.756 1.00 97.16  ? 20  SER A OG    1 
ATOM   2836 N N     . ASP E 5 21  ? 31.990  45.651  106.390 1.00 38.63  ? 21  ASP A N     1 
ATOM   2837 C CA    . ASP E 5 21  ? 32.362  44.275  106.092 1.00 38.63  ? 21  ASP A CA    1 
ATOM   2838 C C     . ASP E 5 21  ? 33.668  44.264  105.307 1.00 38.63  ? 21  ASP A C     1 
ATOM   2839 O O     . ASP E 5 21  ? 34.449  43.315  105.392 1.00 38.63  ? 21  ASP A O     1 
ATOM   2840 C CB    . ASP E 5 21  ? 31.262  43.593  105.278 1.00 91.53  ? 21  ASP A CB    1 
ATOM   2841 C CG    . ASP E 5 21  ? 29.963  43.456  106.051 1.00 91.53  ? 21  ASP A CG    1 
ATOM   2842 O OD1   . ASP E 5 21  ? 30.012  43.081  107.242 1.00 91.53  ? 21  ASP A OD1   1 
ATOM   2843 O OD2   . ASP E 5 21  ? 28.892  43.725  105.466 1.00 91.53  ? 21  ASP A OD2   1 
ATOM   2844 N N     . GLU E 5 22  ? 33.899  45.327  104.543 1.00 56.46  ? 22  GLU A N     1 
ATOM   2845 C CA    . GLU E 5 22  ? 35.114  45.440  103.752 1.00 56.46  ? 22  GLU A CA    1 
ATOM   2846 C C     . GLU E 5 22  ? 36.313  45.671  104.668 1.00 56.46  ? 22  GLU A C     1 
ATOM   2847 O O     . GLU E 5 22  ? 37.392  45.129  104.436 1.00 56.46  ? 22  GLU A O     1 
ATOM   2848 C CB    . GLU E 5 22  ? 34.984  46.586  102.748 1.00 55.44  ? 22  GLU A CB    1 
ATOM   2849 C CG    . GLU E 5 22  ? 34.506  46.139  101.374 1.00 55.44  ? 22  GLU A CG    1 
ATOM   2850 C CD    . GLU E 5 22  ? 33.786  47.238  100.616 1.00 55.44  ? 22  GLU A CD    1 
ATOM   2851 O OE1   . GLU E 5 22  ? 33.159  48.097  101.268 1.00 55.44  ? 22  GLU A OE1   1 
ATOM   2852 O OE2   . GLU E 5 22  ? 33.846  47.242  99.368  1.00 55.44  ? 22  GLU A OE2   1 
ATOM   2853 N N     . VAL E 5 23  ? 36.121  46.478  105.708 1.00 36.41  ? 23  VAL A N     1 
ATOM   2854 C CA    . VAL E 5 23  ? 37.193  46.749  106.658 1.00 36.41  ? 23  VAL A CA    1 
ATOM   2855 C C     . VAL E 5 23  ? 37.438  45.470  107.438 1.00 36.41  ? 23  VAL A C     1 
ATOM   2856 O O     . VAL E 5 23  ? 38.578  45.131  107.755 1.00 36.41  ? 23  VAL A O     1 
ATOM   2857 C CB    . VAL E 5 23  ? 36.813  47.869  107.656 1.00 22.71  ? 23  VAL A CB    1 
ATOM   2858 C CG1   . VAL E 5 23  ? 37.790  47.879  108.828 1.00 22.71  ? 23  VAL A CG1   1 
ATOM   2859 C CG2   . VAL E 5 23  ? 36.819  49.219  106.956 1.00 22.71  ? 23  VAL A CG2   1 
ATOM   2860 N N     . ARG E 5 24  ? 36.355  44.760  107.744 1.00 30.77  ? 24  ARG A N     1 
ATOM   2861 C CA    . ARG E 5 24  ? 36.450  43.509  108.483 1.00 30.77  ? 24  ARG A CA    1 
ATOM   2862 C C     . ARG E 5 24  ? 37.323  42.543  107.698 1.00 30.77  ? 24  ARG A C     1 
ATOM   2863 O O     . ARG E 5 24  ? 38.246  41.941  108.241 1.00 30.77  ? 24  ARG A O     1 
ATOM   2864 C CB    . ARG E 5 24  ? 35.060  42.903  108.686 1.00 97.68  ? 24  ARG A CB    1 
ATOM   2865 C CG    . ARG E 5 24  ? 34.565  42.955  110.124 1.00 97.68  ? 24  ARG A CG    1 
ATOM   2866 C CD    . ARG E 5 24  ? 33.729  41.732  110.471 1.00 97.68  ? 24  ARG A CD    1 
ATOM   2867 N NE    . ARG E 5 24  ? 34.550  40.645  110.998 1.00 97.68  ? 24  ARG A NE    1 
ATOM   2868 C CZ    . ARG E 5 24  ? 35.223  40.706  112.142 1.00 97.68  ? 24  ARG A CZ    1 
ATOM   2869 N NH1   . ARG E 5 24  ? 35.175  41.804  112.886 1.00 97.68  ? 24  ARG A NH1   1 
ATOM   2870 N NH2   . ARG E 5 24  ? 35.947  39.669  112.544 1.00 97.68  ? 24  ARG A NH2   1 
ATOM   2871 N N     . LYS E 5 25  ? 37.028  42.406  106.412 1.00 17.96  ? 25  LYS A N     1 
ATOM   2872 C CA    . LYS E 5 25  ? 37.787  41.518  105.546 1.00 17.96  ? 25  LYS A CA    1 
ATOM   2873 C C     . LYS E 5 25  ? 39.240  41.970  105.467 1.00 17.96  ? 25  LYS A C     1 
ATOM   2874 O O     . LYS E 5 25  ? 40.159  41.161  105.590 1.00 17.96  ? 25  LYS A O     1 
ATOM   2875 C CB    . LYS E 5 25  ? 37.169  41.499  104.144 1.00 17.80  ? 25  LYS A CB    1 
ATOM   2876 C CG    . LYS E 5 25  ? 38.104  41.014  103.049 1.00 17.80  ? 25  LYS A CG    1 
ATOM   2877 C CD    . LYS E 5 25  ? 38.239  39.499  103.060 1.00 17.80  ? 25  LYS A CD    1 
ATOM   2878 C CE    . LYS E 5 25  ? 38.516  38.959  101.660 1.00 17.80  ? 25  LYS A CE    1 
ATOM   2879 N NZ    . LYS E 5 25  ? 39.850  39.380  101.143 1.00 17.80  ? 25  LYS A NZ    1 
ATOM   2880 N N     . ASN E 5 26  ? 39.439  43.267  105.266 1.00 30.83  ? 26  ASN A N     1 
ATOM   2881 C CA    . ASN E 5 26  ? 40.777  43.834  105.159 1.00 30.83  ? 26  ASN A CA    1 
ATOM   2882 C C     . ASN E 5 26  ? 41.645  43.529  106.372 1.00 30.83  ? 26  ASN A C     1 
ATOM   2883 O O     . ASN E 5 26  ? 42.812  43.168  106.233 1.00 30.83  ? 26  ASN A O     1 
ATOM   2884 C CB    . ASN E 5 26  ? 40.683  45.341  104.956 1.00 18.61  ? 26  ASN A CB    1 
ATOM   2885 C CG    . ASN E 5 26  ? 40.292  45.706  103.542 1.00 18.61  ? 26  ASN A CG    1 
ATOM   2886 O OD1   . ASN E 5 26  ? 40.595  44.977  102.595 1.00 18.61  ? 26  ASN A OD1   1 
ATOM   2887 N ND2   . ASN E 5 26  ? 39.610  46.836  103.388 1.00 18.61  ? 26  ASN A ND2   1 
ATOM   2888 N N     . LEU E 5 27  ? 41.075  43.676  107.562 1.00 18.27  ? 27  LEU A N     1 
ATOM   2889 C CA    . LEU E 5 27  ? 41.809  43.399  108.786 1.00 18.27  ? 27  LEU A CA    1 
ATOM   2890 C C     . LEU E 5 27  ? 42.076  41.902  108.868 1.00 18.27  ? 27  LEU A C     1 
ATOM   2891 O O     . LEU E 5 27  ? 43.072  41.470  109.446 1.00 18.27  ? 27  LEU A O     1 
ATOM   2892 C CB    . LEU E 5 27  ? 41.004  43.853  110.003 1.00 20.70  ? 27  LEU A CB    1 
ATOM   2893 C CG    . LEU E 5 27  ? 40.858  45.362  110.215 1.00 20.70  ? 27  LEU A CG    1 
ATOM   2894 C CD1   . LEU E 5 27  ? 40.143  45.611  111.526 1.00 20.70  ? 27  LEU A CD1   1 
ATOM   2895 C CD2   . LEU E 5 27  ? 42.226  46.028  110.221 1.00 20.70  ? 27  LEU A CD2   1 
ATOM   2896 N N     . MET E 5 28  ? 41.177  41.111  108.293 1.00 21.92  ? 28  MET A N     1 
ATOM   2897 C CA    . MET E 5 28  ? 41.336  39.662  108.288 1.00 21.92  ? 28  MET A CA    1 
ATOM   2898 C C     . MET E 5 28  ? 42.453  39.318  107.309 1.00 21.92  ? 28  MET A C     1 
ATOM   2899 O O     . MET E 5 28  ? 43.140  38.308  107.458 1.00 21.92  ? 28  MET A O     1 
ATOM   2900 C CB    . MET E 5 28  ? 40.034  38.984  107.851 1.00 27.57  ? 28  MET A CB    1 
ATOM   2901 C CG    . MET E 5 28  ? 39.271  38.315  108.984 1.00 27.57  ? 28  MET A CG    1 
ATOM   2902 S SD    . MET E 5 28  ? 37.515  38.076  108.619 1.00 27.57  ? 28  MET A SD    1 
ATOM   2903 C CE    . MET E 5 28  ? 36.968  37.227  110.094 1.00 27.57  ? 28  MET A CE    1 
ATOM   2904 N N     . ASP E 5 29  ? 42.620  40.179  106.308 1.00 23.29  ? 29  ASP A N     1 
ATOM   2905 C CA    . ASP E 5 29  ? 43.648  40.011  105.286 1.00 23.29  ? 29  ASP A CA    1 
ATOM   2906 C C     . ASP E 5 29  ? 45.017  40.285  105.897 1.00 23.29  ? 29  ASP A C     1 
ATOM   2907 O O     . ASP E 5 29  ? 45.963  39.519  105.709 1.00 23.29  ? 29  ASP A O     1 
ATOM   2908 C CB    . ASP E 5 29  ? 43.414  40.997  104.137 1.00 41.98  ? 29  ASP A CB    1 
ATOM   2909 C CG    . ASP E 5 29  ? 42.591  40.406  103.010 1.00 41.98  ? 29  ASP A CG    1 
ATOM   2910 O OD1   . ASP E 5 29  ? 42.358  39.179  103.013 1.00 41.98  ? 29  ASP A OD1   1 
ATOM   2911 O OD2   . ASP E 5 29  ? 42.176  41.175  102.117 1.00 41.98  ? 29  ASP A OD2   1 
ATOM   2912 N N     . MET E 5 30  ? 45.109  41.392  106.629 1.00 34.76  ? 30  MET A N     1 
ATOM   2913 C CA    . MET E 5 30  ? 46.350  41.801  107.269 1.00 34.76  ? 30  MET A CA    1 
ATOM   2914 C C     . MET E 5 30  ? 46.848  40.759  108.259 1.00 34.76  ? 30  MET A C     1 
ATOM   2915 O O     . MET E 5 30  ? 48.028  40.414  108.265 1.00 34.76  ? 30  MET A O     1 
ATOM   2916 C CB    . MET E 5 30  ? 46.155  43.140  107.982 1.00 62.00  ? 30  MET A CB    1 
ATOM   2917 C CG    . MET E 5 30  ? 46.331  44.345  107.074 1.00 62.00  ? 30  MET A CG    1 
ATOM   2918 S SD    . MET E 5 30  ? 45.288  45.739  107.531 1.00 62.00  ? 30  MET A SD    1 
ATOM   2919 C CE    . MET E 5 30  ? 45.691  45.900  109.278 1.00 62.00  ? 30  MET A CE    1 
ATOM   2920 N N     . PHE E 5 31  ? 45.951  40.258  109.098 1.00 22.50  ? 31  PHE A N     1 
ATOM   2921 C CA    . PHE E 5 31  ? 46.336  39.256  110.076 1.00 22.50  ? 31  PHE A CA    1 
ATOM   2922 C C     . PHE E 5 31  ? 46.646  37.916  109.417 1.00 22.50  ? 31  PHE A C     1 
ATOM   2923 O O     . PHE E 5 31  ? 47.572  37.219  109.830 1.00 22.50  ? 31  PHE A O     1 
ATOM   2924 C CB    . PHE E 5 31  ? 45.236  39.067  111.118 1.00 39.16  ? 31  PHE A CB    1 
ATOM   2925 C CG    . PHE E 5 31  ? 45.649  38.198  112.268 1.00 39.16  ? 31  PHE A CG    1 
ATOM   2926 C CD1   . PHE E 5 31  ? 45.653  36.813  112.142 1.00 39.16  ? 31  PHE A CD1   1 
ATOM   2927 C CD2   . PHE E 5 31  ? 46.060  38.763  113.469 1.00 39.16  ? 31  PHE A CD2   1 
ATOM   2928 C CE1   . PHE E 5 31  ? 46.062  36.001  113.196 1.00 39.16  ? 31  PHE A CE1   1 
ATOM   2929 C CE2   . PHE E 5 31  ? 46.470  37.961  114.530 1.00 39.16  ? 31  PHE A CE2   1 
ATOM   2930 C CZ    . PHE E 5 31  ? 46.471  36.576  114.393 1.00 39.16  ? 31  PHE A CZ    1 
ATOM   2931 N N     . ARG E 5 32  ? 45.875  37.555  108.396 1.00 24.67  ? 32  ARG A N     1 
ATOM   2932 C CA    . ARG E 5 32  ? 46.093  36.290  107.706 1.00 24.67  ? 32  ARG A CA    1 
ATOM   2933 C C     . ARG E 5 32  ? 47.514  36.211  107.175 1.00 24.67  ? 32  ARG A C     1 
ATOM   2934 O O     . ARG E 5 32  ? 48.174  35.182  107.302 1.00 24.67  ? 32  ARG A O     1 
ATOM   2935 C CB    . ARG E 5 32  ? 45.113  36.126  106.544 1.00 18.14  ? 32  ARG A CB    1 
ATOM   2936 C CG    . ARG E 5 32  ? 45.460  34.970  105.616 1.00 18.14  ? 32  ARG A CG    1 
ATOM   2937 C CD    . ARG E 5 32  ? 44.338  34.682  104.642 1.00 18.14  ? 32  ARG A CD    1 
ATOM   2938 N NE    . ARG E 5 32  ? 44.219  35.722  103.627 1.00 18.14  ? 32  ARG A NE    1 
ATOM   2939 C CZ    . ARG E 5 32  ? 43.312  35.721  102.656 1.00 18.14  ? 32  ARG A CZ    1 
ATOM   2940 N NH1   . ARG E 5 32  ? 42.434  34.730  102.562 1.00 18.14  ? 32  ARG A NH1   1 
ATOM   2941 N NH2   . ARG E 5 32  ? 43.286  36.713  101.774 1.00 18.14  ? 32  ARG A NH2   1 
ATOM   2942 N N     . ASP E 5 33  ? 47.980  37.301  106.577 1.00 22.27  ? 33  ASP A N     1 
ATOM   2943 C CA    . ASP E 5 33  ? 49.326  37.336  106.022 1.00 22.27  ? 33  ASP A CA    1 
ATOM   2944 C C     . ASP E 5 33  ? 50.235  38.248  106.831 1.00 22.27  ? 33  ASP A C     1 
ATOM   2945 O O     . ASP E 5 33  ? 50.991  39.042  106.270 1.00 22.27  ? 33  ASP A O     1 
ATOM   2946 C CB    . ASP E 5 33  ? 49.283  37.809  104.570 1.00 16.49  ? 33  ASP A CB    1 
ATOM   2947 C CG    . ASP E 5 33  ? 49.067  36.670  103.594 1.00 16.49  ? 33  ASP A CG    1 
ATOM   2948 O OD1   . ASP E 5 33  ? 49.506  35.538  103.894 1.00 16.49  ? 33  ASP A OD1   1 
ATOM   2949 O OD2   . ASP E 5 33  ? 48.460  36.908  102.526 1.00 16.49  ? 33  ASP A OD2   1 
ATOM   2950 N N     . ARG E 5 34  ? 50.157  38.129  108.152 1.00 20.69  ? 34  ARG A N     1 
ATOM   2951 C CA    . ARG E 5 34  ? 50.975  38.944  109.036 1.00 20.69  ? 34  ARG A CA    1 
ATOM   2952 C C     . ARG E 5 34  ? 52.453  38.643  108.817 1.00 20.69  ? 34  ARG A C     1 
ATOM   2953 O O     . ARG E 5 34  ? 53.305  39.503  109.031 1.00 20.69  ? 34  ARG A O     1 
ATOM   2954 C CB    . ARG E 5 34  ? 50.599  38.679  110.495 1.00 35.45  ? 34  ARG A CB    1 
ATOM   2955 C CG    . ARG E 5 34  ? 50.751  37.232  110.917 1.00 35.45  ? 34  ARG A CG    1 
ATOM   2956 C CD    . ARG E 5 34  ? 49.955  36.938  112.177 1.00 35.45  ? 34  ARG A CD    1 
ATOM   2957 N NE    . ARG E 5 34  ? 50.003  35.521  112.517 1.00 35.45  ? 34  ARG A NE    1 
ATOM   2958 C CZ    . ARG E 5 34  ? 49.281  34.585  111.910 1.00 35.45  ? 34  ARG A CZ    1 
ATOM   2959 N NH1   . ARG E 5 34  ? 48.451  34.912  110.928 1.00 35.45  ? 34  ARG A NH1   1 
ATOM   2960 N NH2   . ARG E 5 34  ? 49.394  33.316  112.278 1.00 35.45  ? 34  ARG A NH2   1 
ATOM   2961 N N     . GLN E 5 35  ? 52.753  37.422  108.380 1.00 27.65  ? 35  GLN A N     1 
ATOM   2962 C CA    . GLN E 5 35  ? 54.136  37.017  108.134 1.00 27.65  ? 35  GLN A CA    1 
ATOM   2963 C C     . GLN E 5 35  ? 54.751  37.843  107.010 1.00 27.65  ? 35  GLN A C     1 
ATOM   2964 O O     . GLN E 5 35  ? 55.929  37.692  106.682 1.00 27.65  ? 35  GLN A O     1 
ATOM   2965 C CB    . GLN E 5 35  ? 54.203  35.530  107.776 1.00 68.52  ? 35  GLN A CB    1 
ATOM   2966 C CG    . GLN E 5 35  ? 54.202  34.602  108.983 1.00 68.52  ? 35  GLN A CG    1 
ATOM   2967 C CD    . GLN E 5 35  ? 55.048  33.360  108.770 1.00 68.52  ? 35  GLN A CD    1 
ATOM   2968 O OE1   . GLN E 5 35  ? 54.546  32.238  108.829 1.00 68.52  ? 35  GLN A OE1   1 
ATOM   2969 N NE2   . GLN E 5 35  ? 56.338  33.556  108.524 1.00 68.52  ? 35  GLN A NE2   1 
ATOM   2970 N N     . ALA E 5 36  ? 53.942  38.718  106.422 1.00 19.02  ? 36  ALA A N     1 
ATOM   2971 C CA    . ALA E 5 36  ? 54.396  39.579  105.342 1.00 19.02  ? 36  ALA A CA    1 
ATOM   2972 C C     . ALA E 5 36  ? 55.283  40.680  105.901 1.00 19.02  ? 36  ALA A C     1 
ATOM   2973 O O     . ALA E 5 36  ? 55.957  41.386  105.155 1.00 19.02  ? 36  ALA A O     1 
ATOM   2974 C CB    . ALA E 5 36  ? 53.202  40.186  104.629 1.00 16.80  ? 36  ALA A CB    1 
ATOM   2975 N N     . PHE E 5 37  ? 55.279  40.817  107.223 1.00 26.57  ? 37  PHE A N     1 
ATOM   2976 C CA    . PHE E 5 37  ? 56.075  41.836  107.894 1.00 26.57  ? 37  PHE A CA    1 
ATOM   2977 C C     . PHE E 5 37  ? 56.854  41.236  109.058 1.00 26.57  ? 37  PHE A C     1 
ATOM   2978 O O     . PHE E 5 37  ? 56.468  40.207  109.612 1.00 26.57  ? 37  PHE A O     1 
ATOM   2979 C CB    . PHE E 5 37  ? 55.170  42.956  108.413 1.00 29.17  ? 37  PHE A CB    1 
ATOM   2980 C CG    . PHE E 5 37  ? 54.447  43.708  107.330 1.00 29.17  ? 37  PHE A CG    1 
ATOM   2981 C CD1   . PHE E 5 37  ? 55.129  44.608  106.518 1.00 29.17  ? 37  PHE A CD1   1 
ATOM   2982 C CD2   . PHE E 5 37  ? 53.085  43.519  107.122 1.00 29.17  ? 37  PHE A CD2   1 
ATOM   2983 C CE1   . PHE E 5 37  ? 54.465  45.310  105.516 1.00 29.17  ? 37  PHE A CE1   1 
ATOM   2984 C CE2   . PHE E 5 37  ? 52.410  44.216  106.122 1.00 29.17  ? 37  PHE A CE2   1 
ATOM   2985 C CZ    . PHE E 5 37  ? 53.101  45.113  105.317 1.00 29.17  ? 37  PHE A CZ    1 
ATOM   2986 N N     . SER E 5 38  ? 57.951  41.890  109.426 1.00 35.76  ? 38  SER A N     1 
ATOM   2987 C CA    . SER E 5 38  ? 58.787  41.430  110.529 1.00 35.76  ? 38  SER A CA    1 
ATOM   2988 C C     . SER E 5 38  ? 58.011  41.482  111.840 1.00 35.76  ? 38  SER A C     1 
ATOM   2989 O O     . SER E 5 38  ? 57.160  42.351  112.028 1.00 35.76  ? 38  SER A O     1 
ATOM   2990 C CB    . SER E 5 38  ? 60.039  42.303  110.640 1.00 43.18  ? 38  SER A CB    1 
ATOM   2991 O OG    . SER E 5 38  ? 61.152  41.677  110.027 1.00 43.18  ? 38  SER A OG    1 
ATOM   2992 N N     . GLU E 5 39  ? 58.306  40.550  112.741 1.00 26.09  ? 39  GLU A N     1 
ATOM   2993 C CA    . GLU E 5 39  ? 57.633  40.504  114.032 1.00 26.09  ? 39  GLU A CA    1 
ATOM   2994 C C     . GLU E 5 39  ? 57.876  41.795  114.800 1.00 26.09  ? 39  GLU A C     1 
ATOM   2995 O O     . GLU E 5 39  ? 57.003  42.266  115.527 1.00 26.09  ? 39  GLU A O     1 
ATOM   2996 C CB    . GLU E 5 39  ? 58.127  39.311  114.859 1.00 100.00 ? 39  GLU A CB    1 
ATOM   2997 C CG    . GLU E 5 39  ? 57.017  38.557  115.590 1.00 100.00 ? 39  GLU A CG    1 
ATOM   2998 C CD    . GLU E 5 39  ? 57.446  38.035  116.953 1.00 100.00 ? 39  GLU A CD    1 
ATOM   2999 O OE1   . GLU E 5 39  ? 58.602  38.286  117.354 1.00 100.00 ? 39  GLU A OE1   1 
ATOM   3000 O OE2   . GLU E 5 39  ? 56.625  37.373  117.624 1.00 100.00 ? 39  GLU A OE2   1 
ATOM   3001 N N     . HIS E 5 40  ? 59.062  42.373  114.634 1.00 26.90  ? 40  HIS A N     1 
ATOM   3002 C CA    . HIS E 5 40  ? 59.387  43.611  115.328 1.00 26.90  ? 40  HIS A CA    1 
ATOM   3003 C C     . HIS E 5 40  ? 58.631  44.776  114.712 1.00 26.90  ? 40  HIS A C     1 
ATOM   3004 O O     . HIS E 5 40  ? 58.285  45.736  115.395 1.00 26.90  ? 40  HIS A O     1 
ATOM   3005 C CB    . HIS E 5 40  ? 60.891  43.886  115.276 1.00 77.08  ? 40  HIS A CB    1 
ATOM   3006 C CG    . HIS E 5 40  ? 61.387  44.701  116.430 1.00 77.08  ? 40  HIS A CG    1 
ATOM   3007 N ND1   . HIS E 5 40  ? 62.329  44.235  117.322 1.00 77.08  ? 40  HIS A ND1   1 
ATOM   3008 C CD2   . HIS E 5 40  ? 61.053  45.943  116.852 1.00 77.08  ? 40  HIS A CD2   1 
ATOM   3009 C CE1   . HIS E 5 40  ? 62.554  45.154  118.243 1.00 77.08  ? 40  HIS A CE1   1 
ATOM   3010 N NE2   . HIS E 5 40  ? 61.792  46.200  117.982 1.00 77.08  ? 40  HIS A NE2   1 
ATOM   3011 N N     . THR E 5 41  ? 58.384  44.689  113.412 1.00 15.20  ? 41  THR A N     1 
ATOM   3012 C CA    . THR E 5 41  ? 57.650  45.726  112.708 1.00 15.20  ? 41  THR A CA    1 
ATOM   3013 C C     . THR E 5 41  ? 56.237  45.811  113.274 1.00 15.20  ? 41  THR A C     1 
ATOM   3014 O O     . THR E 5 41  ? 55.680  46.902  113.431 1.00 15.20  ? 41  THR A O     1 
ATOM   3015 C CB    . THR E 5 41  ? 57.557  45.410  111.214 1.00 31.27  ? 41  THR A CB    1 
ATOM   3016 O OG1   . THR E 5 41  ? 58.872  45.184  110.694 1.00 31.27  ? 41  THR A OG1   1 
ATOM   3017 C CG2   . THR E 5 41  ? 56.902  46.562  110.467 1.00 31.27  ? 41  THR A CG2   1 
ATOM   3018 N N     . TRP E 5 42  ? 55.669  44.646  113.581 1.00 29.74  ? 42  TRP A N     1 
ATOM   3019 C CA    . TRP E 5 42  ? 54.323  44.555  114.139 1.00 29.74  ? 42  TRP A CA    1 
ATOM   3020 C C     . TRP E 5 42  ? 54.294  45.133  115.548 1.00 29.74  ? 42  TRP A C     1 
ATOM   3021 O O     . TRP E 5 42  ? 53.338  45.804  115.931 1.00 29.74  ? 42  TRP A O     1 
ATOM   3022 C CB    . TRP E 5 42  ? 53.867  43.095  114.179 1.00 42.07  ? 42  TRP A CB    1 
ATOM   3023 C CG    . TRP E 5 42  ? 53.243  42.623  112.907 1.00 42.07  ? 42  TRP A CG    1 
ATOM   3024 C CD1   . TRP E 5 42  ? 53.782  41.752  112.007 1.00 42.07  ? 42  TRP A CD1   1 
ATOM   3025 C CD2   . TRP E 5 42  ? 51.957  42.989  112.393 1.00 42.07  ? 42  TRP A CD2   1 
ATOM   3026 N NE1   . TRP E 5 42  ? 52.912  41.552  110.965 1.00 42.07  ? 42  TRP A NE1   1 
ATOM   3027 C CE2   . TRP E 5 42  ? 51.783  42.298  111.175 1.00 42.07  ? 42  TRP A CE2   1 
ATOM   3028 C CE3   . TRP E 5 42  ? 50.934  43.832  112.844 1.00 42.07  ? 42  TRP A CE3   1 
ATOM   3029 C CZ2   . TRP E 5 42  ? 50.626  42.425  110.399 1.00 42.07  ? 42  TRP A CZ2   1 
ATOM   3030 C CZ3   . TRP E 5 42  ? 49.782  43.958  112.071 1.00 42.07  ? 42  TRP A CZ3   1 
ATOM   3031 C CH2   . TRP E 5 42  ? 49.639  43.256  110.862 1.00 42.07  ? 42  TRP A CH2   1 
ATOM   3032 N N     . LYS E 5 43  ? 55.343  44.856  116.316 1.00 27.56  ? 43  LYS A N     1 
ATOM   3033 C CA    . LYS E 5 43  ? 55.455  45.359  117.682 1.00 27.56  ? 43  LYS A CA    1 
ATOM   3034 C C     . LYS E 5 43  ? 55.347  46.878  117.656 1.00 27.56  ? 43  LYS A C     1 
ATOM   3035 O O     . LYS E 5 43  ? 54.683  47.485  118.496 1.00 27.56  ? 43  LYS A O     1 
ATOM   3036 C CB    . LYS E 5 43  ? 56.799  44.951  118.286 1.00 69.61  ? 43  LYS A CB    1 
ATOM   3037 C CG    . LYS E 5 43  ? 56.705  43.847  119.321 1.00 69.61  ? 43  LYS A CG    1 
ATOM   3038 C CD    . LYS E 5 43  ? 56.519  42.496  118.661 1.00 69.61  ? 43  LYS A CD    1 
ATOM   3039 C CE    . LYS E 5 43  ? 55.738  41.552  119.557 1.00 69.61  ? 43  LYS A CE    1 
ATOM   3040 N NZ    . LYS E 5 43  ? 56.408  40.227  119.676 1.00 69.61  ? 43  LYS A NZ    1 
ATOM   3041 N N     . MET E 5 44  ? 56.008  47.485  116.678 1.00 26.01  ? 44  MET A N     1 
ATOM   3042 C CA    . MET E 5 44  ? 55.987  48.931  116.525 1.00 26.01  ? 44  MET A CA    1 
ATOM   3043 C C     . MET E 5 44  ? 54.551  49.399  116.308 1.00 26.01  ? 44  MET A C     1 
ATOM   3044 O O     . MET E 5 44  ? 54.077  50.301  116.996 1.00 26.01  ? 44  MET A O     1 
ATOM   3045 C CB    . MET E 5 44  ? 56.853  49.345  115.333 1.00 30.95  ? 44  MET A CB    1 
ATOM   3046 C CG    . MET E 5 44  ? 58.192  49.989  115.690 1.00 30.95  ? 44  MET A CG    1 
ATOM   3047 S SD    . MET E 5 44  ? 58.682  49.839  117.421 1.00 30.95  ? 44  MET A SD    1 
ATOM   3048 C CE    . MET E 5 44  ? 58.001  51.347  118.101 1.00 30.95  ? 44  MET A CE    1 
ATOM   3049 N N     . LEU E 5 45  ? 53.860  48.777  115.354 1.00 23.36  ? 45  LEU A N     1 
ATOM   3050 C CA    . LEU E 5 45  ? 52.477  49.139  115.052 1.00 23.36  ? 45  LEU A CA    1 
ATOM   3051 C C     . LEU E 5 45  ? 51.575  48.991  116.270 1.00 23.36  ? 45  LEU A C     1 
ATOM   3052 O O     . LEU E 5 45  ? 50.677  49.803  116.492 1.00 23.36  ? 45  LEU A O     1 
ATOM   3053 C CB    . LEU E 5 45  ? 51.924  48.269  113.924 1.00 13.16  ? 45  LEU A CB    1 
ATOM   3054 C CG    . LEU E 5 45  ? 50.409  48.396  113.738 1.00 13.16  ? 45  LEU A CG    1 
ATOM   3055 C CD1   . LEU E 5 45  ? 50.102  49.686  113.003 1.00 13.16  ? 45  LEU A CD1   1 
ATOM   3056 C CD2   . LEU E 5 45  ? 49.869  47.203  112.973 1.00 13.16  ? 45  LEU A CD2   1 
ATOM   3057 N N     . LEU E 5 46  ? 51.815  47.942  117.049 1.00 26.18  ? 46  LEU A N     1 
ATOM   3058 C CA    . LEU E 5 46  ? 51.030  47.678  118.244 1.00 26.18  ? 46  LEU A CA    1 
ATOM   3059 C C     . LEU E 5 46  ? 51.285  48.767  119.272 1.00 26.18  ? 46  LEU A C     1 
ATOM   3060 O O     . LEU E 5 46  ? 50.373  49.204  119.974 1.00 26.18  ? 46  LEU A O     1 
ATOM   3061 C CB    . LEU E 5 46  ? 51.405  46.314  118.829 1.00 57.86  ? 46  LEU A CB    1 
ATOM   3062 C CG    . LEU E 5 46  ? 50.421  45.163  118.595 1.00 57.86  ? 46  LEU A CG    1 
ATOM   3063 C CD1   . LEU E 5 46  ? 50.086  45.055  117.114 1.00 57.86  ? 46  LEU A CD1   1 
ATOM   3064 C CD2   . LEU E 5 46  ? 51.032  43.864  119.100 1.00 57.86  ? 46  LEU A CD2   1 
ATOM   3065 N N     . SER E 5 47  ? 52.535  49.204  119.355 1.00 31.35  ? 47  SER A N     1 
ATOM   3066 C CA    . SER E 5 47  ? 52.914  50.245  120.296 1.00 31.35  ? 47  SER A CA    1 
ATOM   3067 C C     . SER E 5 47  ? 52.186  51.548  119.982 1.00 31.35  ? 47  SER A C     1 
ATOM   3068 O O     . SER E 5 47  ? 51.732  52.248  120.881 1.00 31.35  ? 47  SER A O     1 
ATOM   3069 C CB    . SER E 5 47  ? 54.424  50.470  120.246 1.00 30.78  ? 47  SER A CB    1 
ATOM   3070 O OG    . SER E 5 47  ? 54.891  51.013  121.464 1.00 30.78  ? 47  SER A OG    1 
ATOM   3071 N N     . VAL E 5 48  ? 52.078  51.871  118.700 1.00 23.00  ? 48  VAL A N     1 
ATOM   3072 C CA    . VAL E 5 48  ? 51.401  53.091  118.282 1.00 23.00  ? 48  VAL A CA    1 
ATOM   3073 C C     . VAL E 5 48  ? 49.913  52.991  118.588 1.00 23.00  ? 48  VAL A C     1 
ATOM   3074 O O     . VAL E 5 48  ? 49.342  53.870  119.230 1.00 23.00  ? 48  VAL A O     1 
ATOM   3075 C CB    . VAL E 5 48  ? 51.570  53.340  116.770 1.00 42.25  ? 48  VAL A CB    1 
ATOM   3076 C CG1   . VAL E 5 48  ? 50.975  54.690  116.396 1.00 42.25  ? 48  VAL A CG1   1 
ATOM   3077 C CG2   . VAL E 5 48  ? 53.043  53.276  116.393 1.00 42.25  ? 48  VAL A CG2   1 
ATOM   3078 N N     . CYS E 5 49  ? 49.291  51.915  118.117 1.00 17.80  ? 49  CYS A N     1 
ATOM   3079 C CA    . CYS E 5 49  ? 47.868  51.696  118.334 1.00 17.80  ? 49  CYS A CA    1 
ATOM   3080 C C     . CYS E 5 49  ? 47.549  51.736  119.818 1.00 17.80  ? 49  CYS A C     1 
ATOM   3081 O O     . CYS E 5 49  ? 46.452  52.124  120.214 1.00 17.80  ? 49  CYS A O     1 
ATOM   3082 C CB    . CYS E 5 49  ? 47.450  50.348  117.750 1.00 40.61  ? 49  CYS A CB    1 
ATOM   3083 S SG    . CYS E 5 49  ? 47.663  50.235  115.962 1.00 40.61  ? 49  CYS A SG    1 
ATOM   3084 N N     . ARG E 5 50  ? 48.516  51.337  120.635 1.00 32.70  ? 50  ARG A N     1 
ATOM   3085 C CA    . ARG E 5 50  ? 48.340  51.335  122.080 1.00 32.70  ? 50  ARG A CA    1 
ATOM   3086 C C     . ARG E 5 50  ? 48.321  52.761  122.615 1.00 32.70  ? 50  ARG A C     1 
ATOM   3087 O O     . ARG E 5 50  ? 47.412  53.145  123.347 1.00 32.70  ? 50  ARG A O     1 
ATOM   3088 C CB    . ARG E 5 50  ? 49.472  50.551  122.749 1.00 49.34  ? 50  ARG A CB    1 
ATOM   3089 C CG    . ARG E 5 50  ? 49.069  49.170  123.237 1.00 49.34  ? 50  ARG A CG    1 
ATOM   3090 C CD    . ARG E 5 50  ? 50.213  48.497  123.972 1.00 49.34  ? 50  ARG A CD    1 
ATOM   3091 N NE    . ARG E 5 50  ? 50.577  47.220  123.366 1.00 49.34  ? 50  ARG A NE    1 
ATOM   3092 C CZ    . ARG E 5 50  ? 51.795  46.925  122.924 1.00 49.34  ? 50  ARG A CZ    1 
ATOM   3093 N NH1   . ARG E 5 50  ? 52.771  47.816  123.020 1.00 49.34  ? 50  ARG A NH1   1 
ATOM   3094 N NH2   . ARG E 5 50  ? 52.041  45.736  122.391 1.00 49.34  ? 50  ARG A NH2   1 
ATOM   3095 N N     . SER E 5 51  ? 49.327  53.543  122.237 1.00 44.57  ? 51  SER A N     1 
ATOM   3096 C CA    . SER E 5 51  ? 49.434  54.926  122.682 1.00 44.57  ? 51  SER A CA    1 
ATOM   3097 C C     . SER E 5 51  ? 48.307  55.789  122.125 1.00 44.57  ? 51  SER A C     1 
ATOM   3098 O O     . SER E 5 51  ? 47.774  56.657  122.815 1.00 44.57  ? 51  SER A O     1 
ATOM   3099 C CB    . SER E 5 51  ? 50.786  55.508  122.261 1.00 49.79  ? 51  SER A CB    1 
ATOM   3100 O OG    . SER E 5 51  ? 50.620  56.577  121.350 1.00 49.79  ? 51  SER A OG    1 
ATOM   3101 N N     . TRP E 5 52  ? 47.949  55.543  120.871 1.00 35.39  ? 52  TRP A N     1 
ATOM   3102 C CA    . TRP E 5 52  ? 46.888  56.293  120.217 1.00 35.39  ? 52  TRP A CA    1 
ATOM   3103 C C     . TRP E 5 52  ? 45.539  56.016  120.876 1.00 35.39  ? 52  TRP A C     1 
ATOM   3104 O O     . TRP E 5 52  ? 44.853  56.937  121.319 1.00 35.39  ? 52  TRP A O     1 
ATOM   3105 C CB    . TRP E 5 52  ? 46.833  55.924  118.734 1.00 23.44  ? 52  TRP A CB    1 
ATOM   3106 C CG    . TRP E 5 52  ? 45.546  56.290  118.045 1.00 23.44  ? 52  TRP A CG    1 
ATOM   3107 C CD1   . TRP E 5 52  ? 44.659  55.432  117.456 1.00 23.44  ? 52  TRP A CD1   1 
ATOM   3108 C CD2   . TRP E 5 52  ? 45.021  57.608  117.842 1.00 23.44  ? 52  TRP A CD2   1 
ATOM   3109 N NE1   . TRP E 5 52  ? 43.620  56.133  116.898 1.00 23.44  ? 52  TRP A NE1   1 
ATOM   3110 C CE2   . TRP E 5 52  ? 43.815  57.471  117.119 1.00 23.44  ? 52  TRP A CE2   1 
ATOM   3111 C CE3   . TRP E 5 52  ? 45.453  58.891  118.199 1.00 23.44  ? 52  TRP A CE3   1 
ATOM   3112 C CZ2   . TRP E 5 52  ? 43.036  58.569  116.746 1.00 23.44  ? 52  TRP A CZ2   1 
ATOM   3113 C CZ3   . TRP E 5 52  ? 44.677  59.982  117.828 1.00 23.44  ? 52  TRP A CZ3   1 
ATOM   3114 C CH2   . TRP E 5 52  ? 43.482  59.812  117.109 1.00 23.44  ? 52  TRP A CH2   1 
ATOM   3115 N N     . ALA E 5 53  ? 45.163  54.744  120.937 1.00 35.17  ? 53  ALA A N     1 
ATOM   3116 C CA    . ALA E 5 53  ? 43.893  54.354  121.538 1.00 35.17  ? 53  ALA A CA    1 
ATOM   3117 C C     . ALA E 5 53  ? 43.771  54.890  122.956 1.00 35.17  ? 53  ALA A C     1 
ATOM   3118 O O     . ALA E 5 53  ? 42.723  55.400  123.346 1.00 35.17  ? 53  ALA A O     1 
ATOM   3119 C CB    . ALA E 5 53  ? 43.761  52.842  121.543 1.00 35.31  ? 53  ALA A CB    1 
ATOM   3120 N N     . ALA E 5 54  ? 44.851  54.776  123.722 1.00 35.07  ? 54  ALA A N     1 
ATOM   3121 C CA    . ALA E 5 54  ? 44.867  55.247  125.101 1.00 35.07  ? 54  ALA A CA    1 
ATOM   3122 C C     . ALA E 5 54  ? 44.548  56.736  125.167 1.00 35.07  ? 54  ALA A C     1 
ATOM   3123 O O     . ALA E 5 54  ? 43.687  57.163  125.938 1.00 35.07  ? 54  ALA A O     1 
ATOM   3124 C CB    . ALA E 5 54  ? 46.228  54.976  125.726 1.00 31.61  ? 54  ALA A CB    1 
ATOM   3125 N N     . TRP E 5 55  ? 45.250  57.521  124.354 1.00 29.51  ? 55  TRP A N     1 
ATOM   3126 C CA    . TRP E 5 55  ? 45.046  58.965  124.309 1.00 29.51  ? 55  TRP A CA    1 
ATOM   3127 C C     . TRP E 5 55  ? 43.588  59.257  123.999 1.00 29.51  ? 55  TRP A C     1 
ATOM   3128 O O     . TRP E 5 55  ? 42.990  60.166  124.573 1.00 29.51  ? 55  TRP A O     1 
ATOM   3129 C CB    . TRP E 5 55  ? 45.934  59.594  123.231 1.00 22.65  ? 55  TRP A CB    1 
ATOM   3130 C CG    . TRP E 5 55  ? 45.732  61.079  123.051 1.00 22.65  ? 55  TRP A CG    1 
ATOM   3131 C CD1   . TRP E 5 55  ? 46.385  62.081  123.714 1.00 22.65  ? 55  TRP A CD1   1 
ATOM   3132 C CD2   . TRP E 5 55  ? 44.815  61.723  122.154 1.00 22.65  ? 55  TRP A CD2   1 
ATOM   3133 N NE1   . TRP E 5 55  ? 45.931  63.305  123.286 1.00 22.65  ? 55  TRP A NE1   1 
ATOM   3134 C CE2   . TRP E 5 55  ? 44.968  63.117  122.330 1.00 22.65  ? 55  TRP A CE2   1 
ATOM   3135 C CE3   . TRP E 5 55  ? 43.879  61.258  121.219 1.00 22.65  ? 55  TRP A CE3   1 
ATOM   3136 C CZ2   . TRP E 5 55  ? 44.219  64.051  121.606 1.00 22.65  ? 55  TRP A CZ2   1 
ATOM   3137 C CZ3   . TRP E 5 55  ? 43.134  62.190  120.499 1.00 22.65  ? 55  TRP A CZ3   1 
ATOM   3138 C CH2   . TRP E 5 55  ? 43.311  63.570  120.699 1.00 22.65  ? 55  TRP A CH2   1 
ATOM   3139 N N     . CYS E 5 56  ? 43.023  58.475  123.086 1.00 37.07  ? 56  CYS A N     1 
ATOM   3140 C CA    . CYS E 5 56  ? 41.635  58.642  122.688 1.00 37.07  ? 56  CYS A CA    1 
ATOM   3141 C C     . CYS E 5 56  ? 40.704  58.391  123.864 1.00 37.07  ? 56  CYS A C     1 
ATOM   3142 O O     . CYS E 5 56  ? 39.782  59.165  124.109 1.00 37.07  ? 56  CYS A O     1 
ATOM   3143 C CB    . CYS E 5 56  ? 41.295  57.682  121.550 1.00 26.94  ? 56  CYS A CB    1 
ATOM   3144 S SG    . CYS E 5 56  ? 41.874  58.235  119.936 1.00 26.94  ? 56  CYS A SG    1 
ATOM   3145 N N     . LYS E 5 57  ? 40.955  57.308  124.591 1.00 38.16  ? 57  LYS A N     1 
ATOM   3146 C CA    . LYS E 5 57  ? 40.136  56.956  125.744 1.00 38.16  ? 57  LYS A CA    1 
ATOM   3147 C C     . LYS E 5 57  ? 40.194  58.056  126.793 1.00 38.16  ? 57  LYS A C     1 
ATOM   3148 O O     . LYS E 5 57  ? 39.192  58.371  127.435 1.00 38.16  ? 57  LYS A O     1 
ATOM   3149 C CB    . LYS E 5 57  ? 40.627  55.641  126.354 1.00 72.71  ? 57  LYS A CB    1 
ATOM   3150 C CG    . LYS E 5 57  ? 39.646  54.995  127.318 1.00 72.71  ? 57  LYS A CG    1 
ATOM   3151 C CD    . LYS E 5 57  ? 39.588  53.488  127.116 1.00 72.71  ? 57  LYS A CD    1 
ATOM   3152 C CE    . LYS E 5 57  ? 39.118  52.778  128.376 1.00 72.71  ? 57  LYS A CE    1 
ATOM   3153 N NZ    . LYS E 5 57  ? 40.237  52.515  129.325 1.00 72.71  ? 57  LYS A NZ    1 
ATOM   3154 N N     . LEU E 5 58  ? 41.376  58.641  126.956 1.00 49.09  ? 58  LEU A N     1 
ATOM   3155 C CA    . LEU E 5 58  ? 41.586  59.699  127.935 1.00 49.09  ? 58  LEU A CA    1 
ATOM   3156 C C     . LEU E 5 58  ? 40.983  61.031  127.506 1.00 49.09  ? 58  LEU A C     1 
ATOM   3157 O O     . LEU E 5 58  ? 40.682  61.880  128.347 1.00 49.09  ? 58  LEU A O     1 
ATOM   3158 C CB    . LEU E 5 58  ? 43.083  59.876  128.187 1.00 56.84  ? 58  LEU A CB    1 
ATOM   3159 C CG    . LEU E 5 58  ? 43.484  60.803  129.336 1.00 56.84  ? 58  LEU A CG    1 
ATOM   3160 C CD1   . LEU E 5 58  ? 44.149  59.998  130.443 1.00 56.84  ? 58  LEU A CD1   1 
ATOM   3161 C CD2   . LEU E 5 58  ? 44.428  61.872  128.816 1.00 56.84  ? 58  LEU A CD2   1 
ATOM   3162 N N     . ASN E 5 59  ? 40.807  61.209  126.200 1.00 50.42  ? 59  ASN A N     1 
ATOM   3163 C CA    . ASN E 5 59  ? 40.254  62.451  125.670 1.00 50.42  ? 59  ASN A CA    1 
ATOM   3164 C C     . ASN E 5 59  ? 38.870  62.294  125.052 1.00 50.42  ? 59  ASN A C     1 
ATOM   3165 O O     . ASN E 5 59  ? 38.279  63.268  124.590 1.00 50.42  ? 59  ASN A O     1 
ATOM   3166 C CB    . ASN E 5 59  ? 41.211  63.042  124.635 1.00 31.73  ? 59  ASN A CB    1 
ATOM   3167 C CG    . ASN E 5 59  ? 42.343  63.821  125.270 1.00 31.73  ? 59  ASN A CG    1 
ATOM   3168 O OD1   . ASN E 5 59  ? 42.296  65.049  125.358 1.00 31.73  ? 59  ASN A OD1   1 
ATOM   3169 N ND2   . ASN E 5 59  ? 43.369  63.110  125.720 1.00 31.73  ? 59  ASN A ND2   1 
ATOM   3170 N N     . ASN E 5 60  ? 38.356  61.071  125.046 1.00 53.48  ? 60  ASN A N     1 
ATOM   3171 C CA    . ASN E 5 60  ? 37.038  60.801  124.481 1.00 53.48  ? 60  ASN A CA    1 
ATOM   3172 C C     . ASN E 5 60  ? 36.991  61.079  122.981 1.00 53.48  ? 60  ASN A C     1 
ATOM   3173 O O     . ASN E 5 60  ? 36.344  62.029  122.540 1.00 53.48  ? 60  ASN A O     1 
ATOM   3174 C CB    . ASN E 5 60  ? 35.978  61.651  125.185 1.00 100.00 ? 60  ASN A CB    1 
ATOM   3175 C CG    . ASN E 5 60  ? 35.471  61.009  126.457 1.00 100.00 ? 60  ASN A CG    1 
ATOM   3176 O OD1   . ASN E 5 60  ? 34.942  59.898  126.437 1.00 100.00 ? 60  ASN A OD1   1 
ATOM   3177 N ND2   . ASN E 5 60  ? 35.628  61.707  127.576 1.00 100.00 ? 60  ASN A ND2   1 
ATOM   3178 N N     . ARG E 5 61  ? 37.678  60.251  122.200 1.00 44.23  ? 61  ARG A N     1 
ATOM   3179 C CA    . ARG E 5 61  ? 37.698  60.412  120.750 1.00 44.23  ? 61  ARG A CA    1 
ATOM   3180 C C     . ARG E 5 61  ? 37.753  59.051  120.072 1.00 44.23  ? 61  ARG A C     1 
ATOM   3181 O O     . ARG E 5 61  ? 38.535  58.189  120.468 1.00 44.23  ? 61  ARG A O     1 
ATOM   3182 C CB    . ARG E 5 61  ? 38.909  61.244  120.320 1.00 30.92  ? 61  ARG A CB    1 
ATOM   3183 C CG    . ARG E 5 61  ? 39.532  62.076  121.427 1.00 30.92  ? 61  ARG A CG    1 
ATOM   3184 C CD    . ARG E 5 61  ? 38.853  63.431  121.552 1.00 30.92  ? 61  ARG A CD    1 
ATOM   3185 N NE    . ARG E 5 61  ? 39.479  64.431  120.694 1.00 30.92  ? 61  ARG A NE    1 
ATOM   3186 C CZ    . ARG E 5 61  ? 40.086  65.527  121.140 1.00 30.92  ? 61  ARG A CZ    1 
ATOM   3187 N NH1   . ARG E 5 61  ? 40.154  65.773  122.443 1.00 30.92  ? 61  ARG A NH1   1 
ATOM   3188 N NH2   . ARG E 5 61  ? 40.636  66.373  120.282 1.00 30.92  ? 61  ARG A NH2   1 
ATOM   3189 N N     . LYS E 5 62  ? 36.917  58.860  119.055 1.00 45.11  ? 62  LYS A N     1 
ATOM   3190 C CA    . LYS E 5 62  ? 36.886  57.603  118.315 1.00 45.11  ? 62  LYS A CA    1 
ATOM   3191 C C     . LYS E 5 62  ? 38.319  57.231  117.949 1.00 45.11  ? 62  LYS A C     1 
ATOM   3192 O O     . LYS E 5 62  ? 39.050  58.047  117.390 1.00 45.11  ? 62  LYS A O     1 
ATOM   3193 C CB    . LYS E 5 62  ? 36.052  57.767  117.043 1.00 64.37  ? 62  LYS A CB    1 
ATOM   3194 C CG    . LYS E 5 62  ? 35.176  56.570  116.707 1.00 64.37  ? 62  LYS A CG    1 
ATOM   3195 C CD    . LYS E 5 62  ? 33.714  56.969  116.577 1.00 64.37  ? 62  LYS A CD    1 
ATOM   3196 C CE    . LYS E 5 62  ? 33.517  58.040  115.514 1.00 64.37  ? 62  LYS A CE    1 
ATOM   3197 N NZ    . LYS E 5 62  ? 34.157  57.671  114.223 1.00 64.37  ? 62  LYS A NZ    1 
ATOM   3198 N N     . TRP E 5 63  ? 38.723  56.004  118.264 1.00 38.28  ? 63  TRP A N     1 
ATOM   3199 C CA    . TRP E 5 63  ? 40.084  55.575  117.970 1.00 38.28  ? 63  TRP A CA    1 
ATOM   3200 C C     . TRP E 5 63  ? 40.246  55.044  116.547 1.00 38.28  ? 63  TRP A C     1 
ATOM   3201 O O     . TRP E 5 63  ? 41.254  55.304  115.893 1.00 38.28  ? 63  TRP A O     1 
ATOM   3202 C CB    . TRP E 5 63  ? 40.548  54.544  119.018 1.00 53.59  ? 63  TRP A CB    1 
ATOM   3203 C CG    . TRP E 5 63  ? 40.405  53.097  118.642 1.00 53.59  ? 63  TRP A CG    1 
ATOM   3204 C CD1   . TRP E 5 63  ? 39.305  52.308  118.817 1.00 53.59  ? 63  TRP A CD1   1 
ATOM   3205 C CD2   . TRP E 5 63  ? 41.414  52.257  118.064 1.00 53.59  ? 63  TRP A CD2   1 
ATOM   3206 N NE1   . TRP E 5 63  ? 39.567  51.029  118.384 1.00 53.59  ? 63  TRP A NE1   1 
ATOM   3207 C CE2   . TRP E 5 63  ? 40.852  50.970  117.915 1.00 53.59  ? 63  TRP A CE2   1 
ATOM   3208 C CE3   . TRP E 5 63  ? 42.737  52.467  117.654 1.00 53.59  ? 63  TRP A CE3   1 
ATOM   3209 C CZ2   . TRP E 5 63  ? 41.569  49.895  117.376 1.00 53.59  ? 63  TRP A CZ2   1 
ATOM   3210 C CZ3   . TRP E 5 63  ? 43.453  51.396  117.116 1.00 53.59  ? 63  TRP A CZ3   1 
ATOM   3211 C CH2   . TRP E 5 63  ? 42.863  50.127  116.982 1.00 53.59  ? 63  TRP A CH2   1 
ATOM   3212 N N     . PHE E 5 64  ? 39.250  54.316  116.060 1.00 49.25  ? 64  PHE A N     1 
ATOM   3213 C CA    . PHE E 5 64  ? 39.312  53.779  114.708 1.00 49.25  ? 64  PHE A CA    1 
ATOM   3214 C C     . PHE E 5 64  ? 37.923  53.720  114.093 1.00 49.25  ? 64  PHE A C     1 
ATOM   3215 O O     . PHE E 5 64  ? 37.022  53.091  114.643 1.00 49.25  ? 64  PHE A O     1 
ATOM   3216 C CB    . PHE E 5 64  ? 39.926  52.380  114.718 1.00 35.75  ? 64  PHE A CB    1 
ATOM   3217 C CG    . PHE E 5 64  ? 40.177  51.820  113.345 1.00 35.75  ? 64  PHE A CG    1 
ATOM   3218 C CD1   . PHE E 5 64  ? 41.334  52.148  112.646 1.00 35.75  ? 64  PHE A CD1   1 
ATOM   3219 C CD2   . PHE E 5 64  ? 39.265  50.953  112.756 1.00 35.75  ? 64  PHE A CD2   1 
ATOM   3220 C CE1   . PHE E 5 64  ? 41.579  51.620  111.380 1.00 35.75  ? 64  PHE A CE1   1 
ATOM   3221 C CE2   . PHE E 5 64  ? 39.501  50.420  111.491 1.00 35.75  ? 64  PHE A CE2   1 
ATOM   3222 C CZ    . PHE E 5 64  ? 40.662  50.754  110.803 1.00 35.75  ? 64  PHE A CZ    1 
ATOM   3223 N N     . PRO E 5 65  ? 37.729  54.381  112.940 1.00 32.21  ? 65  PRO A N     1 
ATOM   3224 C CA    . PRO E 5 65  ? 38.746  55.157  112.222 1.00 32.21  ? 65  PRO A CA    1 
ATOM   3225 C C     . PRO E 5 65  ? 39.060  56.491  112.891 1.00 32.21  ? 65  PRO A C     1 
ATOM   3226 O O     . PRO E 5 65  ? 38.231  57.047  113.612 1.00 32.21  ? 65  PRO A O     1 
ATOM   3227 C CB    . PRO E 5 65  ? 38.143  55.341  110.835 1.00 16.87  ? 65  PRO A CB    1 
ATOM   3228 C CG    . PRO E 5 65  ? 36.680  55.301  111.066 1.00 16.87  ? 65  PRO A CG    1 
ATOM   3229 C CD    . PRO E 5 65  ? 36.436  54.387  112.237 1.00 16.87  ? 65  PRO A CD    1 
ATOM   3230 N N     . ALA E 5 66  ? 40.260  57.001  112.635 1.00 41.73  ? 66  ALA A N     1 
ATOM   3231 C CA    . ALA E 5 66  ? 40.707  58.259  113.216 1.00 41.73  ? 66  ALA A CA    1 
ATOM   3232 C C     . ALA E 5 66  ? 40.220  59.483  112.449 1.00 41.73  ? 66  ALA A C     1 
ATOM   3233 O O     . ALA E 5 66  ? 40.188  59.494  111.220 1.00 41.73  ? 66  ALA A O     1 
ATOM   3234 C CB    . ALA E 5 66  ? 42.226  58.274  113.302 1.00 37.05  ? 66  ALA A CB    1 
ATOM   3235 N N     . GLU E 5 67  ? 39.846  60.515  113.197 1.00 25.69  ? 67  GLU A N     1 
ATOM   3236 C CA    . GLU E 5 67  ? 39.369  61.759  112.618 1.00 25.69  ? 67  GLU A CA    1 
ATOM   3237 C C     . GLU E 5 67  ? 40.570  62.674  112.447 1.00 25.69  ? 67  GLU A C     1 
ATOM   3238 O O     . GLU E 5 67  ? 41.468  62.689  113.287 1.00 25.69  ? 67  GLU A O     1 
ATOM   3239 C CB    . GLU E 5 67  ? 38.356  62.420  113.549 1.00 83.79  ? 67  GLU A CB    1 
ATOM   3240 C CG    . GLU E 5 67  ? 37.266  61.491  114.029 1.00 83.79  ? 67  GLU A CG    1 
ATOM   3241 C CD    . GLU E 5 67  ? 36.086  61.470  113.089 1.00 83.79  ? 67  GLU A CD    1 
ATOM   3242 O OE1   . GLU E 5 67  ? 36.293  61.191  111.890 1.00 83.79  ? 67  GLU A OE1   1 
ATOM   3243 O OE2   . GLU E 5 67  ? 34.954  61.735  113.548 1.00 83.79  ? 67  GLU A OE2   1 
ATOM   3244 N N     . PRO E 5 68  ? 40.605  63.448  111.353 1.00 35.23  ? 68  PRO A N     1 
ATOM   3245 C CA    . PRO E 5 68  ? 41.724  64.363  111.105 1.00 35.23  ? 68  PRO A CA    1 
ATOM   3246 C C     . PRO E 5 68  ? 42.040  65.257  112.305 1.00 35.23  ? 68  PRO A C     1 
ATOM   3247 O O     . PRO E 5 68  ? 43.164  65.268  112.805 1.00 35.23  ? 68  PRO A O     1 
ATOM   3248 C CB    . PRO E 5 68  ? 41.267  65.166  109.891 1.00 49.23  ? 68  PRO A CB    1 
ATOM   3249 C CG    . PRO E 5 68  ? 40.307  64.262  109.190 1.00 49.23  ? 68  PRO A CG    1 
ATOM   3250 C CD    . PRO E 5 68  ? 39.601  63.501  110.276 1.00 49.23  ? 68  PRO A CD    1 
ATOM   3251 N N     . GLU E 5 69  ? 41.041  66.003  112.763 1.00 39.23  ? 69  GLU A N     1 
ATOM   3252 C CA    . GLU E 5 69  ? 41.221  66.894  113.901 1.00 39.23  ? 69  GLU A CA    1 
ATOM   3253 C C     . GLU E 5 69  ? 41.768  66.117  115.097 1.00 39.23  ? 69  GLU A C     1 
ATOM   3254 O O     . GLU E 5 69  ? 42.604  66.617  115.849 1.00 39.23  ? 69  GLU A O     1 
ATOM   3255 C CB    . GLU E 5 69  ? 39.887  67.550  114.265 1.00 49.95  ? 69  GLU A CB    1 
ATOM   3256 C CG    . GLU E 5 69  ? 39.973  69.049  114.529 1.00 49.95  ? 69  GLU A CG    1 
ATOM   3257 C CD    . GLU E 5 69  ? 40.450  69.833  113.322 1.00 49.95  ? 69  GLU A CD    1 
ATOM   3258 O OE1   . GLU E 5 69  ? 40.243  69.365  112.181 1.00 49.95  ? 69  GLU A OE1   1 
ATOM   3259 O OE2   . GLU E 5 69  ? 41.032  70.921  113.516 1.00 49.95  ? 69  GLU A OE2   1 
ATOM   3260 N N     . ASP E 5 70  ? 41.289  64.889  115.265 1.00 30.94  ? 70  ASP A N     1 
ATOM   3261 C CA    . ASP E 5 70  ? 41.732  64.037  116.359 1.00 30.94  ? 70  ASP A CA    1 
ATOM   3262 C C     . ASP E 5 70  ? 43.226  63.768  116.242 1.00 30.94  ? 70  ASP A C     1 
ATOM   3263 O O     . ASP E 5 70  ? 43.990  64.027  117.171 1.00 30.94  ? 70  ASP A O     1 
ATOM   3264 C CB    . ASP E 5 70  ? 40.969  62.711  116.336 1.00 52.06  ? 70  ASP A CB    1 
ATOM   3265 C CG    . ASP E 5 70  ? 39.601  62.812  116.982 1.00 52.06  ? 70  ASP A CG    1 
ATOM   3266 O OD1   . ASP E 5 70  ? 39.196  63.931  117.368 1.00 52.06  ? 70  ASP A OD1   1 
ATOM   3267 O OD2   . ASP E 5 70  ? 38.929  61.767  117.104 1.00 52.06  ? 70  ASP A OD2   1 
ATOM   3268 N N     . VAL E 5 71  ? 43.639  63.248  115.091 1.00 22.96  ? 71  VAL A N     1 
ATOM   3269 C CA    . VAL E 5 71  ? 45.045  62.946  114.853 1.00 22.96  ? 71  VAL A CA    1 
ATOM   3270 C C     . VAL E 5 71  ? 45.886  64.216  114.952 1.00 22.96  ? 71  VAL A C     1 
ATOM   3271 O O     . VAL E 5 71  ? 47.064  64.162  115.301 1.00 22.96  ? 71  VAL A O     1 
ATOM   3272 C CB    . VAL E 5 71  ? 45.254  62.303  113.458 1.00 13.01  ? 71  VAL A CB    1 
ATOM   3273 C CG1   . VAL E 5 71  ? 46.731  62.009  113.227 1.00 13.01  ? 71  VAL A CG1   1 
ATOM   3274 C CG2   . VAL E 5 71  ? 44.446  61.021  113.352 1.00 13.01  ? 71  VAL A CG2   1 
ATOM   3275 N N     . ARG E 5 72  ? 45.279  65.358  114.651 1.00 16.55  ? 72  ARG A N     1 
ATOM   3276 C CA    . ARG E 5 72  ? 45.995  66.623  114.722 1.00 16.55  ? 72  ARG A CA    1 
ATOM   3277 C C     . ARG E 5 72  ? 46.311  66.924  116.182 1.00 16.55  ? 72  ARG A C     1 
ATOM   3278 O O     . ARG E 5 72  ? 47.439  67.279  116.526 1.00 16.55  ? 72  ARG A O     1 
ATOM   3279 C CB    . ARG E 5 72  ? 45.148  67.750  114.136 1.00 23.01  ? 72  ARG A CB    1 
ATOM   3280 C CG    . ARG E 5 72  ? 45.556  69.131  114.615 1.00 23.01  ? 72  ARG A CG    1 
ATOM   3281 C CD    . ARG E 5 72  ? 45.252  70.188  113.575 1.00 23.01  ? 72  ARG A CD    1 
ATOM   3282 N NE    . ARG E 5 72  ? 46.055  71.394  113.755 1.00 23.01  ? 72  ARG A NE    1 
ATOM   3283 C CZ    . ARG E 5 72  ? 45.999  72.177  114.828 1.00 23.01  ? 72  ARG A CZ    1 
ATOM   3284 N NH1   . ARG E 5 72  ? 45.176  71.884  115.825 1.00 23.01  ? 72  ARG A NH1   1 
ATOM   3285 N NH2   . ARG E 5 72  ? 46.756  73.262  114.898 1.00 23.01  ? 72  ARG A NH2   1 
ATOM   3286 N N     . ASP E 5 73  ? 45.303  66.778  117.038 1.00 22.51  ? 73  ASP A N     1 
ATOM   3287 C CA    . ASP E 5 73  ? 45.468  67.025  118.463 1.00 22.51  ? 73  ASP A CA    1 
ATOM   3288 C C     . ASP E 5 73  ? 46.489  66.055  119.045 1.00 22.51  ? 73  ASP A C     1 
ATOM   3289 O O     . ASP E 5 73  ? 47.340  66.443  119.847 1.00 22.51  ? 73  ASP A O     1 
ATOM   3290 C CB    . ASP E 5 73  ? 44.129  66.862  119.181 1.00 45.14  ? 73  ASP A CB    1 
ATOM   3291 C CG    . ASP E 5 73  ? 43.253  68.087  119.050 1.00 45.14  ? 73  ASP A CG    1 
ATOM   3292 O OD1   . ASP E 5 73  ? 43.561  68.943  118.195 1.00 45.14  ? 73  ASP A OD1   1 
ATOM   3293 O OD2   . ASP E 5 73  ? 42.261  68.199  119.798 1.00 45.14  ? 73  ASP A OD2   1 
ATOM   3294 N N     . TYR E 5 74  ? 46.397  64.796  118.627 1.00 27.37  ? 74  TYR A N     1 
ATOM   3295 C CA    . TYR E 5 74  ? 47.310  63.755  119.090 1.00 27.37  ? 74  TYR A CA    1 
ATOM   3296 C C     . TYR E 5 74  ? 48.749  64.089  118.713 1.00 27.37  ? 74  TYR A C     1 
ATOM   3297 O O     . TYR E 5 74  ? 49.656  63.990  119.538 1.00 27.37  ? 74  TYR A O     1 
ATOM   3298 C CB    . TYR E 5 74  ? 46.918  62.409  118.479 1.00 35.83  ? 74  TYR A CB    1 
ATOM   3299 C CG    . TYR E 5 74  ? 47.908  61.291  118.735 1.00 35.83  ? 74  TYR A CG    1 
ATOM   3300 C CD1   . TYR E 5 74  ? 48.192  60.865  120.032 1.00 35.83  ? 74  TYR A CD1   1 
ATOM   3301 C CD2   . TYR E 5 74  ? 48.549  60.648  117.677 1.00 35.83  ? 74  TYR A CD2   1 
ATOM   3302 C CE1   . TYR E 5 74  ? 49.092  59.824  120.270 1.00 35.83  ? 74  TYR A CE1   1 
ATOM   3303 C CE2   . TYR E 5 74  ? 49.448  59.608  117.902 1.00 35.83  ? 74  TYR A CE2   1 
ATOM   3304 C CZ    . TYR E 5 74  ? 49.715  59.201  119.199 1.00 35.83  ? 74  TYR A CZ    1 
ATOM   3305 O OH    . TYR E 5 74  ? 50.602  58.173  119.419 1.00 35.83  ? 74  TYR A OH    1 
ATOM   3306 N N     . LEU E 5 75  ? 48.955  64.482  117.462 1.00 24.23  ? 75  LEU A N     1 
ATOM   3307 C CA    . LEU E 5 75  ? 50.288  64.827  116.994 1.00 24.23  ? 75  LEU A CA    1 
ATOM   3308 C C     . LEU E 5 75  ? 50.815  65.990  117.817 1.00 24.23  ? 75  LEU A C     1 
ATOM   3309 O O     . LEU E 5 75  ? 51.951  65.962  118.292 1.00 24.23  ? 75  LEU A O     1 
ATOM   3310 C CB    . LEU E 5 75  ? 50.250  65.208  115.512 1.00 10.98  ? 75  LEU A CB    1 
ATOM   3311 C CG    . LEU E 5 75  ? 49.929  64.072  114.540 1.00 10.98  ? 75  LEU A CG    1 
ATOM   3312 C CD1   . LEU E 5 75  ? 50.116  64.554  113.115 1.00 10.98  ? 75  LEU A CD1   1 
ATOM   3313 C CD2   . LEU E 5 75  ? 50.827  62.881  114.826 1.00 10.98  ? 75  LEU A CD2   1 
ATOM   3314 N N     . LEU E 5 76  ? 49.980  67.010  117.989 1.00 31.83  ? 76  LEU A N     1 
ATOM   3315 C CA    . LEU E 5 76  ? 50.362  68.183  118.762 1.00 31.83  ? 76  LEU A CA    1 
ATOM   3316 C C     . LEU E 5 76  ? 50.679  67.777  120.196 1.00 31.83  ? 76  LEU A C     1 
ATOM   3317 O O     . LEU E 5 76  ? 51.412  68.467  120.899 1.00 31.83  ? 76  LEU A O     1 
ATOM   3318 C CB    . LEU E 5 76  ? 49.232  69.212  118.751 1.00 24.65  ? 76  LEU A CB    1 
ATOM   3319 C CG    . LEU E 5 76  ? 49.225  70.181  117.570 1.00 24.65  ? 76  LEU A CG    1 
ATOM   3320 C CD1   . LEU E 5 76  ? 47.839  70.790  117.414 1.00 24.65  ? 76  LEU A CD1   1 
ATOM   3321 C CD2   . LEU E 5 76  ? 50.269  71.266  117.792 1.00 24.65  ? 76  LEU A CD2   1 
ATOM   3322 N N     . TYR E 5 77  ? 50.121  66.649  120.619 1.00 29.69  ? 77  TYR A N     1 
ATOM   3323 C CA    . TYR E 5 77  ? 50.343  66.137  121.966 1.00 29.69  ? 77  TYR A CA    1 
ATOM   3324 C C     . TYR E 5 77  ? 51.723  65.499  122.061 1.00 29.69  ? 77  TYR A C     1 
ATOM   3325 O O     . TYR E 5 77  ? 52.481  65.777  122.989 1.00 29.69  ? 77  TYR A O     1 
ATOM   3326 C CB    . TYR E 5 77  ? 49.261  65.109  122.309 1.00 40.66  ? 77  TYR A CB    1 
ATOM   3327 C CG    . TYR E 5 77  ? 49.641  64.126  123.391 1.00 40.66  ? 77  TYR A CG    1 
ATOM   3328 C CD1   . TYR E 5 77  ? 49.744  64.528  124.721 1.00 40.66  ? 77  TYR A CD1   1 
ATOM   3329 C CD2   . TYR E 5 77  ? 49.874  62.786  123.089 1.00 40.66  ? 77  TYR A CD2   1 
ATOM   3330 C CE1   . TYR E 5 77  ? 50.066  63.620  125.725 1.00 40.66  ? 77  TYR A CE1   1 
ATOM   3331 C CE2   . TYR E 5 77  ? 50.196  61.869  124.086 1.00 40.66  ? 77  TYR A CE2   1 
ATOM   3332 C CZ    . TYR E 5 77  ? 50.291  62.293  125.401 1.00 40.66  ? 77  TYR A CZ    1 
ATOM   3333 O OH    . TYR E 5 77  ? 50.602  61.390  126.392 1.00 40.66  ? 77  TYR A OH    1 
ATOM   3334 N N     . LEU E 5 78  ? 52.046  64.646  121.096 1.00 23.73  ? 78  LEU A N     1 
ATOM   3335 C CA    . LEU E 5 78  ? 53.338  63.975  121.077 1.00 23.73  ? 78  LEU A CA    1 
ATOM   3336 C C     . LEU E 5 78  ? 54.458  65.005  121.091 1.00 23.73  ? 78  LEU A C     1 
ATOM   3337 O O     . LEU E 5 78  ? 55.493  64.803  121.730 1.00 23.73  ? 78  LEU A O     1 
ATOM   3338 C CB    . LEU E 5 78  ? 53.468  63.105  119.827 1.00 5.65   ? 78  LEU A CB    1 
ATOM   3339 C CG    . LEU E 5 78  ? 52.549  61.894  119.668 1.00 5.65   ? 78  LEU A CG    1 
ATOM   3340 C CD1   . LEU E 5 78  ? 53.071  61.028  118.534 1.00 5.65   ? 78  LEU A CD1   1 
ATOM   3341 C CD2   . LEU E 5 78  ? 52.489  61.100  120.962 1.00 5.65   ? 78  LEU A CD2   1 
ATOM   3342 N N     . GLN E 5 79  ? 54.252  66.108  120.377 1.00 35.50  ? 79  GLN A N     1 
ATOM   3343 C CA    . GLN E 5 79  ? 55.257  67.161  120.317 1.00 35.50  ? 79  GLN A CA    1 
ATOM   3344 C C     . GLN E 5 79  ? 55.549  67.669  121.721 1.00 35.50  ? 79  GLN A C     1 
ATOM   3345 O O     . GLN E 5 79  ? 56.707  67.849  122.098 1.00 35.50  ? 79  GLN A O     1 
ATOM   3346 C CB    . GLN E 5 79  ? 54.771  68.322  119.447 1.00 19.73  ? 79  GLN A CB    1 
ATOM   3347 C CG    . GLN E 5 79  ? 55.763  69.472  119.358 1.00 19.73  ? 79  GLN A CG    1 
ATOM   3348 C CD    . GLN E 5 79  ? 55.178  70.698  118.688 1.00 19.73  ? 79  GLN A CD    1 
ATOM   3349 O OE1   . GLN E 5 79  ? 54.066  71.123  119.005 1.00 19.73  ? 79  GLN A OE1   1 
ATOM   3350 N NE2   . GLN E 5 79  ? 55.926  71.274  117.754 1.00 19.73  ? 79  GLN A NE2   1 
ATOM   3351 N N     . ALA E 5 80  ? 54.488  67.900  122.487 1.00 39.91  ? 80  ALA A N     1 
ATOM   3352 C CA    . ALA E 5 80  ? 54.622  68.381  123.854 1.00 39.91  ? 80  ALA A CA    1 
ATOM   3353 C C     . ALA E 5 80  ? 55.354  67.337  124.683 1.00 39.91  ? 80  ALA A C     1 
ATOM   3354 O O     . ALA E 5 80  ? 56.191  67.673  125.519 1.00 39.91  ? 80  ALA A O     1 
ATOM   3355 C CB    . ALA E 5 80  ? 53.254  68.656  124.448 1.00 15.75  ? 80  ALA A CB    1 
ATOM   3356 N N     . ARG E 5 81  ? 55.039  66.067  124.444 1.00 32.25  ? 81  ARG A N     1 
ATOM   3357 C CA    . ARG E 5 81  ? 55.685  64.978  125.164 1.00 32.25  ? 81  ARG A CA    1 
ATOM   3358 C C     . ARG E 5 81  ? 57.192  65.068  124.942 1.00 32.25  ? 81  ARG A C     1 
ATOM   3359 O O     . ARG E 5 81  ? 57.971  64.389  125.609 1.00 32.25  ? 81  ARG A O     1 
ATOM   3360 C CB    . ARG E 5 81  ? 55.160  63.627  124.670 1.00 60.26  ? 81  ARG A CB    1 
ATOM   3361 C CG    . ARG E 5 81  ? 54.763  62.671  125.788 1.00 60.26  ? 81  ARG A CG    1 
ATOM   3362 C CD    . ARG E 5 81  ? 54.421  61.284  125.249 1.00 60.26  ? 81  ARG A CD    1 
ATOM   3363 N NE    . ARG E 5 81  ? 55.449  60.292  125.562 1.00 60.26  ? 81  ARG A NE    1 
ATOM   3364 C CZ    . ARG E 5 81  ? 55.687  59.207  124.830 1.00 60.26  ? 81  ARG A CZ    1 
ATOM   3365 N NH1   . ARG E 5 81  ? 54.969  58.971  123.742 1.00 60.26  ? 81  ARG A NH1   1 
ATOM   3366 N NH2   . ARG E 5 81  ? 56.643  58.357  125.185 1.00 60.26  ? 81  ARG A NH2   1 
ATOM   3367 N N     . GLY E 5 82  ? 57.595  65.911  123.994 1.00 28.72  ? 82  GLY A N     1 
ATOM   3368 C CA    . GLY E 5 82  ? 59.008  66.095  123.714 1.00 28.72  ? 82  GLY A CA    1 
ATOM   3369 C C     . GLY E 5 82  ? 59.598  65.084  122.754 1.00 28.72  ? 82  GLY A C     1 
ATOM   3370 O O     . GLY E 5 82  ? 60.816  64.937  122.674 1.00 28.72  ? 82  GLY A O     1 
ATOM   3371 N N     . LEU E 5 83  ? 58.741  64.386  122.020 1.00 36.32  ? 83  LEU A N     1 
ATOM   3372 C CA    . LEU E 5 83  ? 59.202  63.384  121.067 1.00 36.32  ? 83  LEU A CA    1 
ATOM   3373 C C     . LEU E 5 83  ? 59.753  64.037  119.801 1.00 36.32  ? 83  LEU A C     1 
ATOM   3374 O O     . LEU E 5 83  ? 59.184  65.003  119.294 1.00 36.32  ? 83  LEU A O     1 
ATOM   3375 C CB    . LEU E 5 83  ? 58.051  62.442  120.705 1.00 29.92  ? 83  LEU A CB    1 
ATOM   3376 C CG    . LEU E 5 83  ? 57.979  61.115  121.465 1.00 29.92  ? 83  LEU A CG    1 
ATOM   3377 C CD1   . LEU E 5 83  ? 57.984  61.372  122.959 1.00 29.92  ? 83  LEU A CD1   1 
ATOM   3378 C CD2   . LEU E 5 83  ? 56.724  60.363  121.062 1.00 29.92  ? 83  LEU A CD2   1 
ATOM   3379 N N     . ALA E 5 84  ? 60.863  63.507  119.297 1.00 23.25  ? 84  ALA A N     1 
ATOM   3380 C CA    . ALA E 5 84  ? 61.487  64.034  118.087 1.00 23.25  ? 84  ALA A CA    1 
ATOM   3381 C C     . ALA E 5 84  ? 60.552  63.903  116.886 1.00 23.25  ? 84  ALA A C     1 
ATOM   3382 O O     . ALA E 5 84  ? 59.554  63.184  116.942 1.00 23.25  ? 84  ALA A O     1 
ATOM   3383 C CB    . ALA E 5 84  ? 62.786  63.298  117.815 1.00 13.94  ? 84  ALA A CB    1 
ATOM   3384 N N     . VAL E 5 85  ? 60.877  64.592  115.798 1.00 30.08  ? 85  VAL A N     1 
ATOM   3385 C CA    . VAL E 5 85  ? 60.047  64.546  114.601 1.00 30.08  ? 85  VAL A CA    1 
ATOM   3386 C C     . VAL E 5 85  ? 59.987  63.146  114.013 1.00 30.08  ? 85  VAL A C     1 
ATOM   3387 O O     . VAL E 5 85  ? 58.920  62.664  113.641 1.00 30.08  ? 85  VAL A O     1 
ATOM   3388 C CB    . VAL E 5 85  ? 60.569  65.503  113.517 1.00 24.50  ? 85  VAL A CB    1 
ATOM   3389 C CG1   . VAL E 5 85  ? 59.574  65.574  112.372 1.00 24.50  ? 85  VAL A CG1   1 
ATOM   3390 C CG2   . VAL E 5 85  ? 60.799  66.883  114.108 1.00 24.50  ? 85  VAL A CG2   1 
ATOM   3391 N N     . LYS E 5 86  ? 61.143  62.502  113.926 1.00 41.43  ? 86  LYS A N     1 
ATOM   3392 C CA    . LYS E 5 86  ? 61.236  61.153  113.381 1.00 41.43  ? 86  LYS A CA    1 
ATOM   3393 C C     . LYS E 5 86  ? 60.232  60.213  114.036 1.00 41.43  ? 86  LYS A C     1 
ATOM   3394 O O     . LYS E 5 86  ? 59.637  59.368  113.370 1.00 41.43  ? 86  LYS A O     1 
ATOM   3395 C CB    . LYS E 5 86  ? 62.649  60.607  113.584 1.00 100.00 ? 86  LYS A CB    1 
ATOM   3396 C CG    . LYS E 5 86  ? 62.918  59.290  112.876 1.00 100.00 ? 86  LYS A CG    1 
ATOM   3397 C CD    . LYS E 5 86  ? 64.056  59.413  111.868 1.00 100.00 ? 86  LYS A CD    1 
ATOM   3398 C CE    . LYS E 5 86  ? 65.112  60.421  112.315 1.00 100.00 ? 86  LYS A CE    1 
ATOM   3399 N NZ    . LYS E 5 86  ? 66.497  59.897  112.167 1.00 100.00 ? 86  LYS A NZ    1 
ATOM   3400 N N     . THR E 5 87  ? 60.051  60.365  115.345 1.00 34.24  ? 87  THR A N     1 
ATOM   3401 C CA    . THR E 5 87  ? 59.125  59.524  116.093 1.00 34.24  ? 87  THR A CA    1 
ATOM   3402 C C     . THR E 5 87  ? 57.675  59.891  115.800 1.00 34.24  ? 87  THR A C     1 
ATOM   3403 O O     . THR E 5 87  ? 56.842  59.016  115.562 1.00 34.24  ? 87  THR A O     1 
ATOM   3404 C CB    . THR E 5 87  ? 59.371  59.644  117.609 1.00 15.97  ? 87  THR A CB    1 
ATOM   3405 O OG1   . THR E 5 87  ? 60.677  59.141  117.919 1.00 15.97  ? 87  THR A OG1   1 
ATOM   3406 C CG2   . THR E 5 87  ? 58.326  58.855  118.387 1.00 15.97  ? 87  THR A CG2   1 
ATOM   3407 N N     . ILE E 5 88  ? 57.379  61.186  115.821 1.00 20.99  ? 88  ILE A N     1 
ATOM   3408 C CA    . ILE E 5 88  ? 56.028  61.662  115.557 1.00 20.99  ? 88  ILE A CA    1 
ATOM   3409 C C     . ILE E 5 88  ? 55.591  61.248  114.158 1.00 20.99  ? 88  ILE A C     1 
ATOM   3410 O O     . ILE E 5 88  ? 54.424  60.929  113.926 1.00 20.99  ? 88  ILE A O     1 
ATOM   3411 C CB    . ILE E 5 88  ? 55.944  63.196  115.670 1.00 14.71  ? 88  ILE A CB    1 
ATOM   3412 C CG1   . ILE E 5 88  ? 56.484  63.649  117.028 1.00 14.71  ? 88  ILE A CG1   1 
ATOM   3413 C CG2   . ILE E 5 88  ? 54.503  63.648  115.500 1.00 14.71  ? 88  ILE A CG2   1 
ATOM   3414 C CD1   . ILE E 5 88  ? 56.544  65.155  117.195 1.00 14.71  ? 88  ILE A CD1   1 
ATOM   3415 N N     . GLN E 5 89  ? 56.535  61.254  113.224 1.00 26.79  ? 89  GLN A N     1 
ATOM   3416 C CA    . GLN E 5 89  ? 56.240  60.871  111.854 1.00 26.79  ? 89  GLN A CA    1 
ATOM   3417 C C     . GLN E 5 89  ? 55.906  59.387  111.819 1.00 26.79  ? 89  GLN A C     1 
ATOM   3418 O O     . GLN E 5 89  ? 54.959  58.970  111.156 1.00 26.79  ? 89  GLN A O     1 
ATOM   3419 C CB    . GLN E 5 89  ? 57.439  61.163  110.952 1.00 59.47  ? 89  GLN A CB    1 
ATOM   3420 C CG    . GLN E 5 89  ? 57.375  62.517  110.266 1.00 59.47  ? 89  GLN A CG    1 
ATOM   3421 C CD    . GLN E 5 89  ? 58.730  62.993  109.777 1.00 59.47  ? 89  GLN A CD    1 
ATOM   3422 O OE1   . GLN E 5 89  ? 58.939  64.187  109.560 1.00 59.47  ? 89  GLN A OE1   1 
ATOM   3423 N NE2   . GLN E 5 89  ? 59.657  62.058  109.599 1.00 59.47  ? 89  GLN A NE2   1 
ATOM   3424 N N     . GLN E 5 90  ? 56.692  58.594  112.539 1.00 23.50  ? 90  GLN A N     1 
ATOM   3425 C CA    . GLN E 5 90  ? 56.481  57.155  112.600 1.00 23.50  ? 90  GLN A CA    1 
ATOM   3426 C C     . GLN E 5 90  ? 55.082  56.865  113.127 1.00 23.50  ? 90  GLN A C     1 
ATOM   3427 O O     . GLN E 5 90  ? 54.366  56.029  112.582 1.00 23.50  ? 90  GLN A O     1 
ATOM   3428 C CB    . GLN E 5 90  ? 57.534  56.506  113.505 1.00 75.69  ? 90  GLN A CB    1 
ATOM   3429 C CG    . GLN E 5 90  ? 56.982  55.491  114.499 1.00 75.69  ? 90  GLN A CG    1 
ATOM   3430 C CD    . GLN E 5 90  ? 57.205  54.058  114.055 1.00 75.69  ? 90  GLN A CD    1 
ATOM   3431 O OE1   . GLN E 5 90  ? 56.450  53.158  114.425 1.00 75.69  ? 90  GLN A OE1   1 
ATOM   3432 N NE2   . GLN E 5 90  ? 58.246  53.838  113.260 1.00 75.69  ? 90  GLN A NE2   1 
ATOM   3433 N N     . HIS E 5 91  ? 54.695  57.561  114.190 1.00 26.28  ? 91  HIS A N     1 
ATOM   3434 C CA    . HIS E 5 91  ? 53.372  57.368  114.769 1.00 26.28  ? 91  HIS A CA    1 
ATOM   3435 C C     . HIS E 5 91  ? 52.310  57.600  113.701 1.00 26.28  ? 91  HIS A C     1 
ATOM   3436 O O     . HIS E 5 91  ? 51.391  56.796  113.538 1.00 26.28  ? 91  HIS A O     1 
ATOM   3437 C CB    . HIS E 5 91  ? 53.150  58.340  115.927 1.00 31.63  ? 91  HIS A CB    1 
ATOM   3438 C CG    . HIS E 5 91  ? 53.705  57.863  117.231 1.00 31.63  ? 91  HIS A CG    1 
ATOM   3439 N ND1   . HIS E 5 91  ? 52.906  57.435  118.269 1.00 31.63  ? 91  HIS A ND1   1 
ATOM   3440 C CD2   . HIS E 5 91  ? 54.981  57.762  117.673 1.00 31.63  ? 91  HIS A CD2   1 
ATOM   3441 C CE1   . HIS E 5 91  ? 53.664  57.091  119.295 1.00 31.63  ? 91  HIS A CE1   1 
ATOM   3442 N NE2   . HIS E 5 91  ? 54.928  57.281  118.959 1.00 31.63  ? 91  HIS A NE2   1 
ATOM   3443 N N     . LEU E 5 92  ? 52.445  58.703  112.972 1.00 24.61  ? 92  LEU A N     1 
ATOM   3444 C CA    . LEU E 5 92  ? 51.493  59.039  111.923 1.00 24.61  ? 92  LEU A CA    1 
ATOM   3445 C C     . LEU E 5 92  ? 51.534  57.986  110.828 1.00 24.61  ? 92  LEU A C     1 
ATOM   3446 O O     . LEU E 5 92  ? 50.496  57.535  110.349 1.00 24.61  ? 92  LEU A O     1 
ATOM   3447 C CB    . LEU E 5 92  ? 51.825  60.408  111.326 1.00 18.99  ? 92  LEU A CB    1 
ATOM   3448 C CG    . LEU E 5 92  ? 50.647  61.318  110.960 1.00 18.99  ? 92  LEU A CG    1 
ATOM   3449 C CD1   . LEU E 5 92  ? 51.079  62.257  109.842 1.00 18.99  ? 92  LEU A CD1   1 
ATOM   3450 C CD2   . LEU E 5 92  ? 49.437  60.490  110.534 1.00 18.99  ? 92  LEU A CD2   1 
ATOM   3451 N N     . GLY E 5 93  ? 52.747  57.601  110.448 1.00 20.39  ? 93  GLY A N     1 
ATOM   3452 C CA    . GLY E 5 93  ? 52.931  56.611  109.406 1.00 20.39  ? 93  GLY A CA    1 
ATOM   3453 C C     . GLY E 5 93  ? 52.173  55.330  109.676 1.00 20.39  ? 93  GLY A C     1 
ATOM   3454 O O     . GLY E 5 93  ? 51.443  54.848  108.813 1.00 20.39  ? 93  GLY A O     1 
ATOM   3455 N N     . GLN E 5 94  ? 52.340  54.774  110.871 1.00 24.32  ? 94  GLN A N     1 
ATOM   3456 C CA    . GLN E 5 94  ? 51.656  53.538  111.230 1.00 24.32  ? 94  GLN A CA    1 
ATOM   3457 C C     . GLN E 5 94  ? 50.149  53.728  111.133 1.00 24.32  ? 94  GLN A C     1 
ATOM   3458 O O     . GLN E 5 94  ? 49.430  52.837  110.682 1.00 24.32  ? 94  GLN A O     1 
ATOM   3459 C CB    . GLN E 5 94  ? 52.038  53.114  112.649 1.00 31.70  ? 94  GLN A CB    1 
ATOM   3460 C CG    . GLN E 5 94  ? 53.522  52.846  112.835 1.00 31.70  ? 94  GLN A CG    1 
ATOM   3461 C CD    . GLN E 5 94  ? 53.941  51.489  112.308 1.00 31.70  ? 94  GLN A CD    1 
ATOM   3462 O OE1   . GLN E 5 94  ? 53.101  50.629  112.041 1.00 31.70  ? 94  GLN A OE1   1 
ATOM   3463 N NE2   . GLN E 5 94  ? 55.245  51.289  112.155 1.00 31.70  ? 94  GLN A NE2   1 
ATOM   3464 N N     . LEU E 5 95  ? 49.681  54.899  111.555 1.00 29.26  ? 95  LEU A N     1 
ATOM   3465 C CA    . LEU E 5 95  ? 48.260  55.221  111.514 1.00 29.26  ? 95  LEU A CA    1 
ATOM   3466 C C     . LEU E 5 95  ? 47.782  55.286  110.065 1.00 29.26  ? 95  LEU A C     1 
ATOM   3467 O O     . LEU E 5 95  ? 46.702  54.798  109.732 1.00 29.26  ? 95  LEU A O     1 
ATOM   3468 C CB    . LEU E 5 95  ? 48.009  56.565  112.204 1.00 29.06  ? 95  LEU A CB    1 
ATOM   3469 C CG    . LEU E 5 95  ? 47.281  56.581  113.555 1.00 29.06  ? 95  LEU A CG    1 
ATOM   3470 C CD1   . LEU E 5 95  ? 47.275  55.195  114.177 1.00 29.06  ? 95  LEU A CD1   1 
ATOM   3471 C CD2   . LEU E 5 95  ? 47.966  57.574  114.483 1.00 29.06  ? 95  LEU A CD2   1 
ATOM   3472 N N     . ASN E 5 96  ? 48.600  55.886  109.207 1.00 22.67  ? 96  ASN A N     1 
ATOM   3473 C CA    . ASN E 5 96  ? 48.275  56.020  107.794 1.00 22.67  ? 96  ASN A CA    1 
ATOM   3474 C C     . ASN E 5 96  ? 48.056  54.660  107.148 1.00 22.67  ? 96  ASN A C     1 
ATOM   3475 O O     . ASN E 5 96  ? 46.993  54.394  106.595 1.00 22.67  ? 96  ASN A O     1 
ATOM   3476 C CB    . ASN E 5 96  ? 49.401  56.749  107.062 1.00 26.34  ? 96  ASN A CB    1 
ATOM   3477 C CG    . ASN E 5 96  ? 49.331  58.252  107.234 1.00 26.34  ? 96  ASN A CG    1 
ATOM   3478 O OD1   . ASN E 5 96  ? 48.253  58.822  107.388 1.00 26.34  ? 96  ASN A OD1   1 
ATOM   3479 N ND2   . ASN E 5 96  ? 50.486  58.901  107.212 1.00 26.34  ? 96  ASN A ND2   1 
ATOM   3480 N N     . MET E 5 97  ? 49.069  53.802  107.220 1.00 32.59  ? 97  MET A N     1 
ATOM   3481 C CA    . MET E 5 97  ? 48.988  52.466  106.637 1.00 32.59  ? 97  MET A CA    1 
ATOM   3482 C C     . MET E 5 97  ? 47.819  51.680  107.214 1.00 32.59  ? 97  MET A C     1 
ATOM   3483 O O     . MET E 5 97  ? 47.113  50.982  106.490 1.00 32.59  ? 97  MET A O     1 
ATOM   3484 C CB    . MET E 5 97  ? 50.287  51.699  106.888 1.00 45.86  ? 97  MET A CB    1 
ATOM   3485 C CG    . MET E 5 97  ? 51.357  51.926  105.834 1.00 45.86  ? 97  MET A CG    1 
ATOM   3486 S SD    . MET E 5 97  ? 50.849  51.390  104.195 1.00 45.86  ? 97  MET A SD    1 
ATOM   3487 C CE    . MET E 5 97  ? 52.319  51.786  103.240 1.00 45.86  ? 97  MET A CE    1 
ATOM   3488 N N     . LEU E 5 98  ? 47.624  51.791  108.523 1.00 31.49  ? 98  LEU A N     1 
ATOM   3489 C CA    . LEU E 5 98  ? 46.535  51.095  109.188 1.00 31.49  ? 98  LEU A CA    1 
ATOM   3490 C C     . LEU E 5 98  ? 45.211  51.390  108.488 1.00 31.49  ? 98  LEU A C     1 
ATOM   3491 O O     . LEU E 5 98  ? 44.381  50.501  108.309 1.00 31.49  ? 98  LEU A O     1 
ATOM   3492 C CB    . LEU E 5 98  ? 46.451  51.534  110.650 1.00 20.19  ? 98  LEU A CB    1 
ATOM   3493 C CG    . LEU E 5 98  ? 45.894  50.556  111.689 1.00 20.19  ? 98  LEU A CG    1 
ATOM   3494 C CD1   . LEU E 5 98  ? 44.856  51.281  112.523 1.00 20.19  ? 98  LEU A CD1   1 
ATOM   3495 C CD2   . LEU E 5 98  ? 45.286  49.328  111.023 1.00 20.19  ? 98  LEU A CD2   1 
ATOM   3496 N N     . HIS E 5 99  ? 45.021  52.644  108.094 1.00 26.14  ? 99  HIS A N     1 
ATOM   3497 C CA    . HIS E 5 99  ? 43.799  53.056  107.419 1.00 26.14  ? 99  HIS A CA    1 
ATOM   3498 C C     . HIS E 5 99  ? 43.805  52.706  105.941 1.00 26.14  ? 99  HIS A C     1 
ATOM   3499 O O     . HIS E 5 99  ? 42.807  52.219  105.410 1.00 26.14  ? 99  HIS A O     1 
ATOM   3500 C CB    . HIS E 5 99  ? 43.592  54.557  107.592 1.00 32.02  ? 99  HIS A CB    1 
ATOM   3501 C CG    . HIS E 5 99  ? 43.153  54.940  108.967 1.00 32.02  ? 99  HIS A CG    1 
ATOM   3502 N ND1   . HIS E 5 99  ? 43.867  54.658  110.110 1.00 32.02  ? 99  HIS A ND1   1 
ATOM   3503 C CD2   . HIS E 5 99  ? 42.026  55.569  109.383 1.00 32.02  ? 99  HIS A CD2   1 
ATOM   3504 C CE1   . HIS E 5 99  ? 43.169  55.112  111.158 1.00 32.02  ? 99  HIS A CE1   1 
ATOM   3505 N NE2   . HIS E 5 99  ? 42.042  55.673  110.768 1.00 32.02  ? 99  HIS A NE2   1 
ATOM   3506 N N     . ARG E 5 100 ? 44.927  52.958  105.276 1.00 25.07  ? 100 ARG A N     1 
ATOM   3507 C CA    . ARG E 5 100 ? 45.051  52.659  103.858 1.00 25.07  ? 100 ARG A CA    1 
ATOM   3508 C C     . ARG E 5 100 ? 44.744  51.184  103.620 1.00 25.07  ? 100 ARG A C     1 
ATOM   3509 O O     . ARG E 5 100 ? 43.901  50.839  102.791 1.00 25.07  ? 100 ARG A O     1 
ATOM   3510 C CB    . ARG E 5 100 ? 46.465  52.979  103.370 1.00 76.07  ? 100 ARG A CB    1 
ATOM   3511 C CG    . ARG E 5 100 ? 46.747  52.510  101.954 1.00 76.07  ? 100 ARG A CG    1 
ATOM   3512 C CD    . ARG E 5 100 ? 48.177  52.815  101.542 1.00 76.07  ? 100 ARG A CD    1 
ATOM   3513 N NE    . ARG E 5 100 ? 48.274  54.068  100.798 1.00 76.07  ? 100 ARG A NE    1 
ATOM   3514 C CZ    . ARG E 5 100 ? 48.991  55.118  101.190 1.00 76.07  ? 100 ARG A CZ    1 
ATOM   3515 N NH1   . ARG E 5 100 ? 49.679  55.069  102.325 1.00 76.07  ? 100 ARG A NH1   1 
ATOM   3516 N NH2   . ARG E 5 100 ? 49.016  56.221  100.451 1.00 76.07  ? 100 ARG A NH2   1 
ATOM   3517 N N     . ARG E 5 101 ? 45.433  50.319  104.358 1.00 50.32  ? 101 ARG A N     1 
ATOM   3518 C CA    . ARG E 5 101 ? 45.236  48.880  104.232 1.00 50.32  ? 101 ARG A CA    1 
ATOM   3519 C C     . ARG E 5 101 ? 43.891  48.452  104.803 1.00 50.32  ? 101 ARG A C     1 
ATOM   3520 O O     . ARG E 5 101 ? 43.493  47.296  104.675 1.00 50.32  ? 101 ARG A O     1 
ATOM   3521 C CB    . ARG E 5 101 ? 46.368  48.126  104.936 1.00 56.36  ? 101 ARG A CB    1 
ATOM   3522 C CG    . ARG E 5 101 ? 47.403  47.557  103.977 1.00 56.36  ? 101 ARG A CG    1 
ATOM   3523 C CD    . ARG E 5 101 ? 48.443  46.718  104.698 1.00 56.36  ? 101 ARG A CD    1 
ATOM   3524 N NE    . ARG E 5 101 ? 49.796  47.229  104.488 1.00 56.36  ? 101 ARG A NE    1 
ATOM   3525 C CZ    . ARG E 5 101 ? 50.476  47.106  103.351 1.00 56.36  ? 101 ARG A CZ    1 
ATOM   3526 N NH1   . ARG E 5 101 ? 49.931  46.486  102.310 1.00 56.36  ? 101 ARG A NH1   1 
ATOM   3527 N NH2   . ARG E 5 101 ? 51.702  47.604  103.255 1.00 56.36  ? 101 ARG A NH2   1 
ATOM   3528 N N     . SER E 5 102 ? 43.192  49.385  105.437 1.00 30.85  ? 102 SER A N     1 
ATOM   3529 C CA    . SER E 5 102 ? 41.884  49.095  106.007 1.00 30.85  ? 102 SER A CA    1 
ATOM   3530 C C     . SER E 5 102 ? 40.812  49.520  105.011 1.00 30.85  ? 102 SER A C     1 
ATOM   3531 O O     . SER E 5 102 ? 39.634  49.212  105.180 1.00 30.85  ? 102 SER A O     1 
ATOM   3532 C CB    . SER E 5 102 ? 41.694  49.852  107.322 1.00 32.79  ? 102 SER A CB    1 
ATOM   3533 O OG    . SER E 5 102 ? 41.972  49.019  108.434 1.00 32.79  ? 102 SER A OG    1 
ATOM   3534 N N     . GLY E 5 103 ? 41.235  50.227  103.967 1.00 26.49  ? 103 GLY A N     1 
ATOM   3535 C CA    . GLY E 5 103 ? 40.299  50.689  102.961 1.00 26.49  ? 103 GLY A CA    1 
ATOM   3536 C C     . GLY E 5 103 ? 39.695  52.023  103.350 1.00 26.49  ? 103 GLY A C     1 
ATOM   3537 O O     . GLY E 5 103 ? 38.904  52.603  102.604 1.00 26.49  ? 103 GLY A O     1 
ATOM   3538 N N     . LEU E 5 104 ? 40.075  52.507  104.528 1.00 26.76  ? 104 LEU A N     1 
ATOM   3539 C CA    . LEU E 5 104 ? 39.586  53.782  105.039 1.00 26.76  ? 104 LEU A CA    1 
ATOM   3540 C C     . LEU E 5 104 ? 40.545  54.912  104.669 1.00 26.76  ? 104 LEU A C     1 
ATOM   3541 O O     . LEU E 5 104 ? 41.674  54.666  104.242 1.00 26.76  ? 104 LEU A O     1 
ATOM   3542 C CB    . LEU E 5 104 ? 39.442  53.711  106.559 1.00 22.57  ? 104 LEU A CB    1 
ATOM   3543 C CG    . LEU E 5 104 ? 38.489  52.660  107.133 1.00 22.57  ? 104 LEU A CG    1 
ATOM   3544 C CD1   . LEU E 5 104 ? 38.904  52.319  108.553 1.00 22.57  ? 104 LEU A CD1   1 
ATOM   3545 C CD2   . LEU E 5 104 ? 37.069  53.191  107.114 1.00 22.57  ? 104 LEU A CD2   1 
ATOM   3546 N N     . PRO E 5 105 ? 40.103  56.172  104.822 1.00 56.53  ? 105 PRO A N     1 
ATOM   3547 C CA    . PRO E 5 105 ? 40.962  57.314  104.492 1.00 56.53  ? 105 PRO A CA    1 
ATOM   3548 C C     . PRO E 5 105 ? 42.090  57.496  105.506 1.00 56.53  ? 105 PRO A C     1 
ATOM   3549 O O     . PRO E 5 105 ? 41.883  57.349  106.713 1.00 56.53  ? 105 PRO A O     1 
ATOM   3550 C CB    . PRO E 5 105 ? 40.002  58.509  104.484 1.00 69.77  ? 105 PRO A CB    1 
ATOM   3551 C CG    . PRO E 5 105 ? 38.616  57.926  104.614 1.00 69.77  ? 105 PRO A CG    1 
ATOM   3552 C CD    . PRO E 5 105 ? 38.780  56.609  105.294 1.00 69.77  ? 105 PRO A CD    1 
ATOM   3553 N N     . ARG E 5 106 ? 43.281  57.813  105.008 1.00 28.38  ? 106 ARG A N     1 
ATOM   3554 C CA    . ARG E 5 106 ? 44.440  58.010  105.868 1.00 28.38  ? 106 ARG A CA    1 
ATOM   3555 C C     . ARG E 5 106 ? 44.441  59.407  106.464 1.00 28.38  ? 106 ARG A C     1 
ATOM   3556 O O     . ARG E 5 106 ? 44.144  60.381  105.779 1.00 28.38  ? 106 ARG A O     1 
ATOM   3557 C CB    . ARG E 5 106 ? 45.731  57.808  105.078 1.00 35.36  ? 106 ARG A CB    1 
ATOM   3558 C CG    . ARG E 5 106 ? 45.696  56.645  104.107 1.00 35.36  ? 106 ARG A CG    1 
ATOM   3559 C CD    . ARG E 5 106 ? 46.997  56.560  103.332 1.00 35.36  ? 106 ARG A CD    1 
ATOM   3560 N NE    . ARG E 5 106 ? 47.482  57.883  102.949 1.00 35.36  ? 106 ARG A NE    1 
ATOM   3561 C CZ    . ARG E 5 106 ? 48.722  58.311  103.155 1.00 35.36  ? 106 ARG A CZ    1 
ATOM   3562 N NH1   . ARG E 5 106 ? 49.607  57.519  103.742 1.00 35.36  ? 106 ARG A NH1   1 
ATOM   3563 N NH2   . ARG E 5 106 ? 49.079  59.530  102.776 1.00 35.36  ? 106 ARG A NH2   1 
ATOM   3564 N N     . PRO E 5 107 ? 44.780  59.523  107.754 1.00 26.17  ? 107 PRO A N     1 
ATOM   3565 C CA    . PRO E 5 107 ? 44.813  60.828  108.422 1.00 26.17  ? 107 PRO A CA    1 
ATOM   3566 C C     . PRO E 5 107 ? 45.711  61.840  107.709 1.00 26.17  ? 107 PRO A C     1 
ATOM   3567 O O     . PRO E 5 107 ? 45.429  63.035  107.699 1.00 26.17  ? 107 PRO A O     1 
ATOM   3568 C CB    . PRO E 5 107 ? 45.317  60.502  109.828 1.00 36.05  ? 107 PRO A CB    1 
ATOM   3569 C CG    . PRO E 5 107 ? 45.001  59.050  110.022 1.00 36.05  ? 107 PRO A CG    1 
ATOM   3570 C CD    . PRO E 5 107 ? 45.148  58.427  108.667 1.00 36.05  ? 107 PRO A CD    1 
ATOM   3571 N N     . SER E 5 108 ? 46.795  61.357  107.114 1.00 37.90  ? 108 SER A N     1 
ATOM   3572 C CA    . SER E 5 108 ? 47.724  62.232  106.408 1.00 37.90  ? 108 SER A CA    1 
ATOM   3573 C C     . SER E 5 108 ? 47.103  62.784  105.131 1.00 37.90  ? 108 SER A C     1 
ATOM   3574 O O     . SER E 5 108 ? 47.683  63.645  104.466 1.00 37.90  ? 108 SER A O     1 
ATOM   3575 C CB    . SER E 5 108 ? 49.004  61.471  106.073 1.00 34.67  ? 108 SER A CB    1 
ATOM   3576 O OG    . SER E 5 108 ? 49.880  61.457  107.184 1.00 34.67  ? 108 SER A OG    1 
ATOM   3577 N N     . ASP E 5 109 ? 45.920  62.280  104.791 1.00 43.80  ? 109 ASP A N     1 
ATOM   3578 C CA    . ASP E 5 109 ? 45.215  62.722  103.593 1.00 43.80  ? 109 ASP A CA    1 
ATOM   3579 C C     . ASP E 5 109 ? 44.392  63.981  103.854 1.00 43.80  ? 109 ASP A C     1 
ATOM   3580 O O     . ASP E 5 109 ? 43.831  64.565  102.928 1.00 43.80  ? 109 ASP A O     1 
ATOM   3581 C CB    . ASP E 5 109 ? 44.293  61.612  103.075 1.00 66.37  ? 109 ASP A CB    1 
ATOM   3582 C CG    . ASP E 5 109 ? 45.058  60.439  102.488 1.00 66.37  ? 109 ASP A CG    1 
ATOM   3583 O OD1   . ASP E 5 109 ? 46.159  60.656  101.937 1.00 66.37  ? 109 ASP A OD1   1 
ATOM   3584 O OD2   . ASP E 5 109 ? 44.553  59.297  102.577 1.00 66.37  ? 109 ASP A OD2   1 
ATOM   3585 N N     . SER E 5 110 ? 44.314  64.395  105.115 1.00 25.45  ? 110 SER A N     1 
ATOM   3586 C CA    . SER E 5 110 ? 43.558  65.591  105.460 1.00 25.45  ? 110 SER A CA    1 
ATOM   3587 C C     . SER E 5 110 ? 44.486  66.786  105.559 1.00 25.45  ? 110 SER A C     1 
ATOM   3588 O O     . SER E 5 110 ? 45.631  66.662  105.985 1.00 25.45  ? 110 SER A O     1 
ATOM   3589 C CB    . SER E 5 110 ? 42.827  65.410  106.790 1.00 35.60  ? 110 SER A CB    1 
ATOM   3590 O OG    . SER E 5 110 ? 43.305  64.277  107.486 1.00 35.60  ? 110 SER A OG    1 
ATOM   3591 N N     . ASN E 5 111 ? 43.981  67.945  105.160 1.00 26.50  ? 111 ASN A N     1 
ATOM   3592 C CA    . ASN E 5 111 ? 44.751  69.178  105.206 1.00 26.50  ? 111 ASN A CA    1 
ATOM   3593 C C     . ASN E 5 111 ? 45.172  69.504  106.639 1.00 26.50  ? 111 ASN A C     1 
ATOM   3594 O O     . ASN E 5 111 ? 46.273  69.997  106.875 1.00 26.50  ? 111 ASN A O     1 
ATOM   3595 C CB    . ASN E 5 111 ? 43.914  70.322  104.637 1.00 37.84  ? 111 ASN A CB    1 
ATOM   3596 C CG    . ASN E 5 111 ? 44.729  71.562  104.372 1.00 37.84  ? 111 ASN A CG    1 
ATOM   3597 O OD1   . ASN E 5 111 ? 45.880  71.482  103.944 1.00 37.84  ? 111 ASN A OD1   1 
ATOM   3598 N ND2   . ASN E 5 111 ? 44.136  72.723  104.624 1.00 37.84  ? 111 ASN A ND2   1 
ATOM   3599 N N     . ALA E 5 112 ? 44.290  69.226  107.593 1.00 28.39  ? 112 ALA A N     1 
ATOM   3600 C CA    . ALA E 5 112 ? 44.574  69.491  108.999 1.00 28.39  ? 112 ALA A CA    1 
ATOM   3601 C C     . ALA E 5 112 ? 45.851  68.797  109.478 1.00 28.39  ? 112 ALA A C     1 
ATOM   3602 O O     . ALA E 5 112 ? 46.738  69.438  110.043 1.00 28.39  ? 112 ALA A O     1 
ATOM   3603 C CB    . ALA E 5 112 ? 43.392  69.055  109.856 1.00 58.45  ? 112 ALA A CB    1 
ATOM   3604 N N     . VAL E 5 113 ? 45.935  67.488  109.254 1.00 24.96  ? 113 VAL A N     1 
ATOM   3605 C CA    . VAL E 5 113 ? 47.094  66.706  109.674 1.00 24.96  ? 113 VAL A CA    1 
ATOM   3606 C C     . VAL E 5 113 ? 48.341  67.056  108.873 1.00 24.96  ? 113 VAL A C     1 
ATOM   3607 O O     . VAL E 5 113 ? 49.441  67.131  109.424 1.00 24.96  ? 113 VAL A O     1 
ATOM   3608 C CB    . VAL E 5 113 ? 46.832  65.195  109.526 1.00 18.98  ? 113 VAL A CB    1 
ATOM   3609 C CG1   . VAL E 5 113 ? 48.065  64.407  109.942 1.00 18.98  ? 113 VAL A CG1   1 
ATOM   3610 C CG2   . VAL E 5 113 ? 45.637  64.794  110.367 1.00 18.98  ? 113 VAL A CG2   1 
ATOM   3611 N N     . SER E 5 114 ? 48.169  67.258  107.570 1.00 33.38  ? 114 SER A N     1 
ATOM   3612 C CA    . SER E 5 114 ? 49.289  67.603  106.702 1.00 33.38  ? 114 SER A CA    1 
ATOM   3613 C C     . SER E 5 114 ? 49.914  68.908  107.168 1.00 33.38  ? 114 SER A C     1 
ATOM   3614 O O     . SER E 5 114 ? 51.134  69.052  107.193 1.00 33.38  ? 114 SER A O     1 
ATOM   3615 C CB    . SER E 5 114 ? 48.813  67.749  105.257 1.00 30.15  ? 114 SER A CB    1 
ATOM   3616 O OG    . SER E 5 114 ? 48.204  66.555  104.801 1.00 30.15  ? 114 SER A OG    1 
ATOM   3617 N N     . LEU E 5 115 ? 49.066  69.858  107.540 1.00 27.92  ? 115 LEU A N     1 
ATOM   3618 C CA    . LEU E 5 115 ? 49.528  71.155  108.004 1.00 27.92  ? 115 LEU A CA    1 
ATOM   3619 C C     . LEU E 5 115 ? 50.211  71.061  109.365 1.00 27.92  ? 115 LEU A C     1 
ATOM   3620 O O     . LEU E 5 115 ? 51.235  71.703  109.596 1.00 27.92  ? 115 LEU A O     1 
ATOM   3621 C CB    . LEU E 5 115 ? 48.350  72.129  108.082 1.00 12.88  ? 115 LEU A CB    1 
ATOM   3622 C CG    . LEU E 5 115 ? 47.941  72.797  106.765 1.00 12.88  ? 115 LEU A CG    1 
ATOM   3623 C CD1   . LEU E 5 115 ? 46.739  73.699  107.007 1.00 12.88  ? 115 LEU A CD1   1 
ATOM   3624 C CD2   . LEU E 5 115 ? 49.106  73.600  106.200 1.00 12.88  ? 115 LEU A CD2   1 
ATOM   3625 N N     . VAL E 5 116 ? 49.650  70.259  110.264 1.00 19.41  ? 116 VAL A N     1 
ATOM   3626 C CA    . VAL E 5 116 ? 50.223  70.115  111.595 1.00 19.41  ? 116 VAL A CA    1 
ATOM   3627 C C     . VAL E 5 116 ? 51.585  69.434  111.580 1.00 19.41  ? 116 VAL A C     1 
ATOM   3628 O O     . VAL E 5 116 ? 52.472  69.802  112.345 1.00 19.41  ? 116 VAL A O     1 
ATOM   3629 C CB    . VAL E 5 116 ? 49.276  69.341  112.536 1.00 22.04  ? 116 VAL A CB    1 
ATOM   3630 C CG1   . VAL E 5 116 ? 49.489  67.842  112.398 1.00 22.04  ? 116 VAL A CG1   1 
ATOM   3631 C CG2   . VAL E 5 116 ? 49.512  69.785  113.969 1.00 22.04  ? 116 VAL A CG2   1 
ATOM   3632 N N     . MET E 5 117 ? 51.750  68.442  110.713 1.00 13.18  ? 117 MET A N     1 
ATOM   3633 C CA    . MET E 5 117 ? 53.019  67.732  110.612 1.00 13.18  ? 117 MET A CA    1 
ATOM   3634 C C     . MET E 5 117 ? 54.104  68.689  110.122 1.00 13.18  ? 117 MET A C     1 
ATOM   3635 O O     . MET E 5 117 ? 55.238  68.658  110.604 1.00 13.18  ? 117 MET A O     1 
ATOM   3636 C CB    . MET E 5 117 ? 52.891  66.553  109.646 1.00 28.57  ? 117 MET A CB    1 
ATOM   3637 C CG    . MET E 5 117 ? 53.926  65.463  109.864 1.00 28.57  ? 117 MET A CG    1 
ATOM   3638 S SD    . MET E 5 117 ? 53.896  64.797  111.540 1.00 28.57  ? 117 MET A SD    1 
ATOM   3639 C CE    . MET E 5 117 ? 55.598  65.020  112.022 1.00 28.57  ? 117 MET A CE    1 
ATOM   3640 N N     . ARG E 5 118 ? 53.749  69.541  109.164 1.00 27.40  ? 118 ARG A N     1 
ATOM   3641 C CA    . ARG E 5 118 ? 54.693  70.509  108.618 1.00 27.40  ? 118 ARG A CA    1 
ATOM   3642 C C     . ARG E 5 118 ? 55.069  71.532  109.681 1.00 27.40  ? 118 ARG A C     1 
ATOM   3643 O O     . ARG E 5 118 ? 56.218  71.969  109.751 1.00 27.40  ? 118 ARG A O     1 
ATOM   3644 C CB    . ARG E 5 118 ? 54.088  71.229  107.410 1.00 29.64  ? 118 ARG A CB    1 
ATOM   3645 C CG    . ARG E 5 118 ? 55.120  71.932  106.541 1.00 29.64  ? 118 ARG A CG    1 
ATOM   3646 C CD    . ARG E 5 118 ? 54.630  72.087  105.116 1.00 29.64  ? 118 ARG A CD    1 
ATOM   3647 N NE    . ARG E 5 118 ? 54.907  73.420  104.588 1.00 29.64  ? 118 ARG A NE    1 
ATOM   3648 C CZ    . ARG E 5 118 ? 54.721  73.772  103.319 1.00 29.64  ? 118 ARG A CZ    1 
ATOM   3649 N NH1   . ARG E 5 118 ? 54.258  72.891  102.443 1.00 29.64  ? 118 ARG A NH1   1 
ATOM   3650 N NH2   . ARG E 5 118 ? 54.996  75.007  102.925 1.00 29.64  ? 118 ARG A NH2   1 
ATOM   3651 N N     . ARG E 5 119 ? 54.096  71.916  110.503 1.00 27.15  ? 119 ARG A N     1 
ATOM   3652 C CA    . ARG E 5 119 ? 54.332  72.883  111.567 1.00 27.15  ? 119 ARG A CA    1 
ATOM   3653 C C     . ARG E 5 119 ? 55.277  72.306  112.615 1.00 27.15  ? 119 ARG A C     1 
ATOM   3654 O O     . ARG E 5 119 ? 56.204  72.977  113.065 1.00 27.15  ? 119 ARG A O     1 
ATOM   3655 C CB    . ARG E 5 119 ? 53.014  73.275  112.232 1.00 30.37  ? 119 ARG A CB    1 
ATOM   3656 C CG    . ARG E 5 119 ? 53.187  74.155  113.456 1.00 30.37  ? 119 ARG A CG    1 
ATOM   3657 C CD    . ARG E 5 119 ? 51.855  74.679  113.949 1.00 30.37  ? 119 ARG A CD    1 
ATOM   3658 N NE    . ARG E 5 119 ? 51.728  74.559  115.397 1.00 30.37  ? 119 ARG A NE    1 
ATOM   3659 C CZ    . ARG E 5 119 ? 50.595  74.751  116.065 1.00 30.37  ? 119 ARG A CZ    1 
ATOM   3660 N NH1   . ARG E 5 119 ? 49.487  75.075  115.412 1.00 30.37  ? 119 ARG A NH1   1 
ATOM   3661 N NH2   . ARG E 5 119 ? 50.571  74.624  117.385 1.00 30.37  ? 119 ARG A NH2   1 
ATOM   3662 N N     . ILE E 5 120 ? 55.035  71.059  113.003 1.00 25.78  ? 120 ILE A N     1 
ATOM   3663 C CA    . ILE E 5 120 ? 55.868  70.393  113.997 1.00 25.78  ? 120 ILE A CA    1 
ATOM   3664 C C     . ILE E 5 120 ? 57.305  70.230  113.501 1.00 25.78  ? 120 ILE A C     1 
ATOM   3665 O O     . ILE E 5 120 ? 58.248  70.608  114.192 1.00 25.78  ? 120 ILE A O     1 
ATOM   3666 C CB    . ILE E 5 120 ? 55.303  69.001  114.359 1.00 13.82  ? 120 ILE A CB    1 
ATOM   3667 C CG1   . ILE E 5 120 ? 54.004  69.153  115.153 1.00 13.82  ? 120 ILE A CG1   1 
ATOM   3668 C CG2   . ILE E 5 120 ? 56.324  68.216  115.175 1.00 13.82  ? 120 ILE A CG2   1 
ATOM   3669 C CD1   . ILE E 5 120 ? 53.202  67.866  115.263 1.00 13.82  ? 120 ILE A CD1   1 
ATOM   3670 N N     . ARG E 5 121 ? 57.472  69.673  112.304 1.00 24.57  ? 121 ARG A N     1 
ATOM   3671 C CA    . ARG E 5 121 ? 58.804  69.470  111.748 1.00 24.57  ? 121 ARG A CA    1 
ATOM   3672 C C     . ARG E 5 121 ? 59.590  70.772  111.654 1.00 24.57  ? 121 ARG A C     1 
ATOM   3673 O O     . ARG E 5 121 ? 60.777  70.812  111.971 1.00 24.57  ? 121 ARG A O     1 
ATOM   3674 C CB    . ARG E 5 121 ? 58.721  68.832  110.362 1.00 79.75  ? 121 ARG A CB    1 
ATOM   3675 C CG    . ARG E 5 121 ? 60.079  68.426  109.809 1.00 79.75  ? 121 ARG A CG    1 
ATOM   3676 C CD    . ARG E 5 121 ? 60.069  68.345  108.295 1.00 79.75  ? 121 ARG A CD    1 
ATOM   3677 N NE    . ARG E 5 121 ? 59.654  69.602  107.679 1.00 79.75  ? 121 ARG A NE    1 
ATOM   3678 C CZ    . ARG E 5 121 ? 58.612  69.722  106.860 1.00 79.75  ? 121 ARG A CZ    1 
ATOM   3679 N NH1   . ARG E 5 121 ? 57.880  68.657  106.560 1.00 79.75  ? 121 ARG A NH1   1 
ATOM   3680 N NH2   . ARG E 5 121 ? 58.303  70.903  106.341 1.00 79.75  ? 121 ARG A NH2   1 
ATOM   3681 N N     . LYS E 5 122 ? 58.927  71.835  111.211 1.00 30.31  ? 122 LYS A N     1 
ATOM   3682 C CA    . LYS E 5 122 ? 59.572  73.135  111.077 1.00 30.31  ? 122 LYS A CA    1 
ATOM   3683 C C     . LYS E 5 122 ? 59.947  73.696  112.445 1.00 30.31  ? 122 LYS A C     1 
ATOM   3684 O O     . LYS E 5 122 ? 61.094  74.072  112.679 1.00 30.31  ? 122 LYS A O     1 
ATOM   3685 C CB    . LYS E 5 122 ? 58.641  74.112  110.356 1.00 89.01  ? 122 LYS A CB    1 
ATOM   3686 C CG    . LYS E 5 122 ? 59.079  75.567  110.440 1.00 89.01  ? 122 LYS A CG    1 
ATOM   3687 C CD    . LYS E 5 122 ? 58.373  76.420  109.397 1.00 89.01  ? 122 LYS A CD    1 
ATOM   3688 C CE    . LYS E 5 122 ? 57.372  77.366  110.045 1.00 89.01  ? 122 LYS A CE    1 
ATOM   3689 N NZ    . LYS E 5 122 ? 58.025  78.293  111.010 1.00 89.01  ? 122 LYS A NZ    1 
ATOM   3690 N N     . GLU E 5 123 ? 58.971  73.752  113.345 1.00 30.75  ? 123 GLU A N     1 
ATOM   3691 C CA    . GLU E 5 123 ? 59.195  74.270  114.688 1.00 30.75  ? 123 GLU A CA    1 
ATOM   3692 C C     . GLU E 5 123 ? 60.349  73.550  115.378 1.00 30.75  ? 123 GLU A C     1 
ATOM   3693 O O     . GLU E 5 123 ? 61.374  74.155  115.682 1.00 30.75  ? 123 GLU A O     1 
ATOM   3694 C CB    . GLU E 5 123 ? 57.928  74.115  115.533 1.00 27.96  ? 123 GLU A CB    1 
ATOM   3695 C CG    . GLU E 5 123 ? 56.795  75.042  115.137 1.00 27.96  ? 123 GLU A CG    1 
ATOM   3696 C CD    . GLU E 5 123 ? 55.584  74.897  116.037 1.00 27.96  ? 123 GLU A CD    1 
ATOM   3697 O OE1   . GLU E 5 123 ? 55.581  73.985  116.892 1.00 27.96  ? 123 GLU A OE1   1 
ATOM   3698 O OE2   . GLU E 5 123 ? 54.634  75.697  115.888 1.00 27.96  ? 123 GLU A OE2   1 
ATOM   3699 N N     . ASN E 5 124 ? 60.171  72.255  115.619 1.00 35.73  ? 124 ASN A N     1 
ATOM   3700 C CA    . ASN E 5 124 ? 61.181  71.437  116.283 1.00 35.73  ? 124 ASN A CA    1 
ATOM   3701 C C     . ASN E 5 124 ? 62.575  71.627  115.701 1.00 35.73  ? 124 ASN A C     1 
ATOM   3702 O O     . ASN E 5 124 ? 63.557  71.686  116.438 1.00 35.73  ? 124 ASN A O     1 
ATOM   3703 C CB    . ASN E 5 124 ? 60.792  69.958  116.205 1.00 28.09  ? 124 ASN A CB    1 
ATOM   3704 C CG    . ASN E 5 124 ? 59.785  69.562  117.271 1.00 28.09  ? 124 ASN A CG    1 
ATOM   3705 O OD1   . ASN E 5 124 ? 58.769  70.234  117.463 1.00 28.09  ? 124 ASN A OD1   1 
ATOM   3706 N ND2   . ASN E 5 124 ? 60.063  68.465  117.972 1.00 28.09  ? 124 ASN A ND2   1 
ATOM   3707 N N     . VAL E 5 125 ? 62.661  71.718  114.379 1.00 42.89  ? 125 VAL A N     1 
ATOM   3708 C CA    . VAL E 5 125 ? 63.949  71.903  113.720 1.00 42.89  ? 125 VAL A CA    1 
ATOM   3709 C C     . VAL E 5 125 ? 64.544  73.264  114.085 1.00 42.89  ? 125 VAL A C     1 
ATOM   3710 O O     . VAL E 5 125 ? 65.750  73.389  114.294 1.00 42.89  ? 125 VAL A O     1 
ATOM   3711 C CB    . VAL E 5 125 ? 63.805  71.795  112.179 1.00 53.93  ? 125 VAL A CB    1 
ATOM   3712 C CG1   . VAL E 5 125 ? 65.033  72.367  111.489 1.00 53.93  ? 125 VAL A CG1   1 
ATOM   3713 C CG2   . VAL E 5 125 ? 63.612  70.339  111.781 1.00 53.93  ? 125 VAL A CG2   1 
ATOM   3714 N N     . ASP E 5 126 ? 63.690  74.278  114.168 1.00 50.86  ? 126 ASP A N     1 
ATOM   3715 C CA    . ASP E 5 126 ? 64.136  75.624  114.507 1.00 50.86  ? 126 ASP A CA    1 
ATOM   3716 C C     . ASP E 5 126 ? 64.423  75.748  116.001 1.00 50.86  ? 126 ASP A C     1 
ATOM   3717 O O     . ASP E 5 126 ? 65.225  76.581  116.421 1.00 50.86  ? 126 ASP A O     1 
ATOM   3718 C CB    . ASP E 5 126 ? 63.076  76.651  114.099 1.00 99.97  ? 126 ASP A CB    1 
ATOM   3719 C CG    . ASP E 5 126 ? 63.398  77.332  112.780 1.00 99.97  ? 126 ASP A CG    1 
ATOM   3720 O OD1   . ASP E 5 126 ? 64.413  78.058  112.714 1.00 99.97  ? 126 ASP A OD1   1 
ATOM   3721 O OD2   . ASP E 5 126 ? 62.635  77.139  111.809 1.00 99.97  ? 126 ASP A OD2   1 
ATOM   3722 N N     . ALA E 5 127 ? 63.767  74.912  116.798 1.00 46.51  ? 127 ALA A N     1 
ATOM   3723 C CA    . ALA E 5 127 ? 63.949  74.933  118.244 1.00 46.51  ? 127 ALA A CA    1 
ATOM   3724 C C     . ALA E 5 127 ? 65.276  74.294  118.629 1.00 46.51  ? 127 ALA A C     1 
ATOM   3725 O O     . ALA E 5 127 ? 65.631  74.237  119.805 1.00 46.51  ? 127 ALA A O     1 
ATOM   3726 C CB    . ALA E 5 127 ? 62.800  74.201  118.927 1.00 22.30  ? 127 ALA A CB    1 
ATOM   3727 N N     . GLY E 5 128 ? 66.005  73.813  117.627 1.00 65.68  ? 128 GLY A N     1 
ATOM   3728 C CA    . GLY E 5 128 ? 67.288  73.186  117.883 1.00 65.68  ? 128 GLY A CA    1 
ATOM   3729 C C     . GLY E 5 128 ? 67.172  71.705  118.185 1.00 65.68  ? 128 GLY A C     1 
ATOM   3730 O O     . GLY E 5 128 ? 67.531  71.255  119.272 1.00 65.68  ? 128 GLY A O     1 
ATOM   3731 N N     . GLU E 5 129 ? 66.667  70.945  117.219 1.00 48.29  ? 129 GLU A N     1 
ATOM   3732 C CA    . GLU E 5 129 ? 66.506  69.508  117.385 1.00 48.29  ? 129 GLU A CA    1 
ATOM   3733 C C     . GLU E 5 129 ? 67.657  68.768  116.717 1.00 48.29  ? 129 GLU A C     1 
ATOM   3734 O O     . GLU E 5 129 ? 67.698  68.640  115.496 1.00 48.29  ? 129 GLU A O     1 
ATOM   3735 C CB    . GLU E 5 129 ? 65.175  69.053  116.777 1.00 58.92  ? 129 GLU A CB    1 
ATOM   3736 C CG    . GLU E 5 129 ? 65.048  67.544  116.587 1.00 58.92  ? 129 GLU A CG    1 
ATOM   3737 C CD    . GLU E 5 129 ? 63.699  67.008  117.033 1.00 58.92  ? 129 GLU A CD    1 
ATOM   3738 O OE1   . GLU E 5 129 ? 63.201  67.453  118.090 1.00 58.92  ? 129 GLU A OE1   1 
ATOM   3739 O OE2   . GLU E 5 129 ? 63.137  66.142  116.329 1.00 58.92  ? 129 GLU A OE2   1 
ATOM   3740 N N     . ARG E 5 130 ? 68.594  68.287  117.526 1.00 60.50  ? 130 ARG A N     1 
ATOM   3741 C CA    . ARG E 5 130 ? 69.743  67.556  117.008 1.00 60.50  ? 130 ARG A CA    1 
ATOM   3742 C C     . ARG E 5 130 ? 69.467  66.058  117.018 1.00 60.50  ? 130 ARG A C     1 
ATOM   3743 O O     . ARG E 5 130 ? 68.791  65.548  117.914 1.00 60.50  ? 130 ARG A O     1 
ATOM   3744 C CB    . ARG E 5 130 ? 70.985  67.859  117.851 1.00 81.98  ? 130 ARG A CB    1 
ATOM   3745 C CG    . ARG E 5 130 ? 71.822  69.019  117.333 1.00 81.98  ? 130 ARG A CG    1 
ATOM   3746 C CD    . ARG E 5 130 ? 72.665  69.628  118.441 1.00 81.98  ? 130 ARG A CD    1 
ATOM   3747 N NE    . ARG E 5 130 ? 74.096  69.528  118.165 1.00 81.98  ? 130 ARG A NE    1 
ATOM   3748 C CZ    . ARG E 5 130 ? 74.987  70.457  118.500 1.00 81.98  ? 130 ARG A CZ    1 
ATOM   3749 N NH1   . ARG E 5 130 ? 74.593  71.558  119.125 1.00 81.98  ? 130 ARG A NH1   1 
ATOM   3750 N NH2   . ARG E 5 130 ? 76.272  70.287  118.212 1.00 81.98  ? 130 ARG A NH2   1 
ATOM   3751 N N     . ALA E 5 131 ? 69.986  65.355  116.016 1.00 57.18  ? 131 ALA A N     1 
ATOM   3752 C CA    . ALA E 5 131 ? 69.803  63.913  115.923 1.00 57.18  ? 131 ALA A CA    1 
ATOM   3753 C C     . ALA E 5 131 ? 70.488  63.237  117.109 1.00 57.18  ? 131 ALA A C     1 
ATOM   3754 O O     . ALA E 5 131 ? 70.880  63.901  118.067 1.00 57.18  ? 131 ALA A O     1 
ATOM   3755 C CB    . ALA E 5 131 ? 70.385  63.398  114.614 1.00 65.59  ? 131 ALA A CB    1 
ATOM   3756 N N     . LYS E 5 132 ? 70.632  61.917  117.046 1.00 43.32  ? 132 LYS A N     1 
ATOM   3757 C CA    . LYS E 5 132 ? 71.271  61.179  118.131 1.00 43.32  ? 132 LYS A CA    1 
ATOM   3758 C C     . LYS E 5 132 ? 72.594  60.567  117.688 1.00 43.32  ? 132 LYS A C     1 
ATOM   3759 O O     . LYS E 5 132 ? 72.621  59.609  116.914 1.00 43.32  ? 132 LYS A O     1 
ATOM   3760 C CB    . LYS E 5 132 ? 70.341  60.079  118.648 1.00 100.00 ? 132 LYS A CB    1 
ATOM   3761 C CG    . LYS E 5 132 ? 69.651  60.412  119.962 1.00 100.00 ? 132 LYS A CG    1 
ATOM   3762 C CD    . LYS E 5 132 ? 68.187  60.773  119.751 1.00 100.00 ? 132 LYS A CD    1 
ATOM   3763 C CE    . LYS E 5 132 ? 67.926  62.238  120.077 1.00 100.00 ? 132 LYS A CE    1 
ATOM   3764 N NZ    . LYS E 5 132 ? 67.072  62.910  119.056 1.00 100.00 ? 132 LYS A NZ    1 
ATOM   3765 N N     . GLN E 5 133 ? 73.688  61.135  118.185 1.00 76.09  ? 133 GLN A N     1 
ATOM   3766 C CA    . GLN E 5 133 ? 75.025  60.660  117.854 1.00 76.09  ? 133 GLN A CA    1 
ATOM   3767 C C     . GLN E 5 133 ? 75.418  59.501  118.762 1.00 76.09  ? 133 GLN A C     1 
ATOM   3768 O O     . GLN E 5 133 ? 74.967  59.414  119.904 1.00 76.09  ? 133 GLN A O     1 
ATOM   3769 C CB    . GLN E 5 133 ? 76.036  61.800  118.000 1.00 100.00 ? 133 GLN A CB    1 
ATOM   3770 C CG    . GLN E 5 133 ? 76.334  62.192  119.443 1.00 100.00 ? 133 GLN A CG    1 
ATOM   3771 C CD    . GLN E 5 133 ? 75.397  63.267  119.977 1.00 100.00 ? 133 GLN A CD    1 
ATOM   3772 O OE1   . GLN E 5 133 ? 75.496  63.670  121.137 1.00 100.00 ? 133 GLN A OE1   1 
ATOM   3773 N NE2   . GLN E 5 133 ? 74.485  63.736  119.132 1.00 100.00 ? 133 GLN A NE2   1 
ATOM   3774 N N     . ALA E 5 134 ? 76.265  58.615  118.250 1.00 56.28  ? 134 ALA A N     1 
ATOM   3775 C CA    . ALA E 5 134 ? 76.714  57.454  119.008 1.00 56.28  ? 134 ALA A CA    1 
ATOM   3776 C C     . ALA E 5 134 ? 78.166  57.608  119.429 1.00 56.28  ? 134 ALA A C     1 
ATOM   3777 O O     . ALA E 5 134 ? 78.975  58.179  118.699 1.00 56.28  ? 134 ALA A O     1 
ATOM   3778 C CB    . ALA E 5 134 ? 76.554  56.201  118.172 1.00 10.69  ? 134 ALA A CB    1 
ATOM   3779 N N     . LEU E 5 135 ? 78.495  57.096  120.611 1.00 52.02  ? 135 LEU A N     1 
ATOM   3780 C CA    . LEU E 5 135 ? 79.860  57.177  121.109 1.00 52.02  ? 135 LEU A CA    1 
ATOM   3781 C C     . LEU E 5 135 ? 80.746  56.242  120.299 1.00 52.02  ? 135 LEU A C     1 
ATOM   3782 O O     . LEU E 5 135 ? 80.331  55.143  119.934 1.00 52.02  ? 135 LEU A O     1 
ATOM   3783 C CB    . LEU E 5 135 ? 79.915  56.801  122.590 1.00 31.63  ? 135 LEU A CB    1 
ATOM   3784 C CG    . LEU E 5 135 ? 81.167  57.265  123.343 1.00 31.63  ? 135 LEU A CG    1 
ATOM   3785 C CD1   . LEU E 5 135 ? 81.595  58.644  122.855 1.00 31.63  ? 135 LEU A CD1   1 
ATOM   3786 C CD2   . LEU E 5 135 ? 80.878  57.292  124.835 1.00 31.63  ? 135 LEU A CD2   1 
ATOM   3787 N N     . ALA E 5 136 ? 81.970  56.678  120.026 1.00 38.91  ? 136 ALA A N     1 
ATOM   3788 C CA    . ALA E 5 136 ? 82.897  55.881  119.236 1.00 38.91  ? 136 ALA A CA    1 
ATOM   3789 C C     . ALA E 5 136 ? 83.818  54.980  120.054 1.00 38.91  ? 136 ALA A C     1 
ATOM   3790 O O     . ALA E 5 136 ? 84.321  55.372  121.108 1.00 38.91  ? 136 ALA A O     1 
ATOM   3791 C CB    . ALA E 5 136 ? 83.728  56.795  118.355 1.00 13.89  ? 136 ALA A CB    1 
ATOM   3792 N N     . PHE E 5 137 ? 84.022  53.766  119.552 1.00 25.31  ? 137 PHE A N     1 
ATOM   3793 C CA    . PHE E 5 137 ? 84.899  52.788  120.184 1.00 25.31  ? 137 PHE A CA    1 
ATOM   3794 C C     . PHE E 5 137 ? 86.038  52.570  119.195 1.00 25.31  ? 137 PHE A C     1 
ATOM   3795 O O     . PHE E 5 137 ? 85.937  51.744  118.290 1.00 25.31  ? 137 PHE A O     1 
ATOM   3796 C CB    . PHE E 5 137 ? 84.153  51.471  120.432 1.00 24.25  ? 137 PHE A CB    1 
ATOM   3797 C CG    . PHE E 5 137 ? 84.945  50.467  121.225 1.00 24.25  ? 137 PHE A CG    1 
ATOM   3798 C CD1   . PHE E 5 137 ? 84.968  50.523  122.616 1.00 24.25  ? 137 PHE A CD1   1 
ATOM   3799 C CD2   . PHE E 5 137 ? 85.688  49.482  120.582 1.00 24.25  ? 137 PHE A CD2   1 
ATOM   3800 C CE1   . PHE E 5 137 ? 85.724  49.616  123.355 1.00 24.25  ? 137 PHE A CE1   1 
ATOM   3801 C CE2   . PHE E 5 137 ? 86.448  48.570  121.312 1.00 24.25  ? 137 PHE A CE2   1 
ATOM   3802 C CZ    . PHE E 5 137 ? 86.466  48.637  122.702 1.00 24.25  ? 137 PHE A CZ    1 
ATOM   3803 N N     . GLU E 5 138 ? 87.115  53.329  119.364 1.00 28.28  ? 138 GLU A N     1 
ATOM   3804 C CA    . GLU E 5 138 ? 88.263  53.245  118.472 1.00 28.28  ? 138 GLU A CA    1 
ATOM   3805 C C     . GLU E 5 138 ? 89.416  52.447  119.067 1.00 28.28  ? 138 GLU A C     1 
ATOM   3806 O O     . GLU E 5 138 ? 89.342  51.983  120.202 1.00 28.28  ? 138 GLU A O     1 
ATOM   3807 C CB    . GLU E 5 138 ? 88.742  54.653  118.113 1.00 42.77  ? 138 GLU A CB    1 
ATOM   3808 C CG    . GLU E 5 138 ? 87.706  55.491  117.376 1.00 42.77  ? 138 GLU A CG    1 
ATOM   3809 C CD    . GLU E 5 138 ? 87.686  56.940  117.837 1.00 42.77  ? 138 GLU A CD    1 
ATOM   3810 O OE1   . GLU E 5 138 ? 88.072  57.209  118.997 1.00 42.77  ? 138 GLU A OE1   1 
ATOM   3811 O OE2   . GLU E 5 138 ? 87.281  57.810  117.036 1.00 42.77  ? 138 GLU A OE2   1 
ATOM   3812 N N     . ARG E 5 139 ? 90.484  52.300  118.288 1.00 49.21  ? 139 ARG A N     1 
ATOM   3813 C CA    . ARG E 5 139 ? 91.659  51.549  118.712 1.00 49.21  ? 139 ARG A CA    1 
ATOM   3814 C C     . ARG E 5 139 ? 92.206  52.023  120.053 1.00 49.21  ? 139 ARG A C     1 
ATOM   3815 O O     . ARG E 5 139 ? 92.739  51.228  120.824 1.00 49.21  ? 139 ARG A O     1 
ATOM   3816 C CB    . ARG E 5 139 ? 92.755  51.645  117.649 1.00 78.35  ? 139 ARG A CB    1 
ATOM   3817 C CG    . ARG E 5 139 ? 94.090  51.051  118.076 1.00 78.35  ? 139 ARG A CG    1 
ATOM   3818 C CD    . ARG E 5 139 ? 94.280  49.644  117.533 1.00 78.35  ? 139 ARG A CD    1 
ATOM   3819 N NE    . ARG E 5 139 ? 95.627  49.441  117.007 1.00 78.35  ? 139 ARG A NE    1 
ATOM   3820 C CZ    . ARG E 5 139 ? 95.980  49.679  115.748 1.00 78.35  ? 139 ARG A CZ    1 
ATOM   3821 N NH1   . ARG E 5 139 ? 95.085  50.128  114.879 1.00 78.35  ? 139 ARG A NH1   1 
ATOM   3822 N NH2   . ARG E 5 139 ? 97.232  49.471  115.357 1.00 78.35  ? 139 ARG A NH2   1 
ATOM   3823 N N     . THR E 5 140 ? 92.077  53.316  120.330 1.00 39.61  ? 140 THR A N     1 
ATOM   3824 C CA    . THR E 5 140 ? 92.565  53.874  121.588 1.00 39.61  ? 140 THR A CA    1 
ATOM   3825 C C     . THR E 5 140 ? 91.767  53.320  122.764 1.00 39.61  ? 140 THR A C     1 
ATOM   3826 O O     . THR E 5 140 ? 92.302  53.129  123.853 1.00 39.61  ? 140 THR A O     1 
ATOM   3827 C CB    . THR E 5 140 ? 92.459  55.409  121.598 1.00 52.15  ? 140 THR A CB    1 
ATOM   3828 O OG1   . THR E 5 140 ? 91.079  55.794  121.629 1.00 52.15  ? 140 THR A OG1   1 
ATOM   3829 C CG2   . THR E 5 140 ? 93.114  55.991  120.357 1.00 52.15  ? 140 THR A CG2   1 
ATOM   3830 N N     . ASP E 5 141 ? 90.484  53.067  122.530 1.00 37.90  ? 141 ASP A N     1 
ATOM   3831 C CA    . ASP E 5 141 ? 89.598  52.527  123.551 1.00 37.90  ? 141 ASP A CA    1 
ATOM   3832 C C     . ASP E 5 141 ? 89.746  51.014  123.622 1.00 37.90  ? 141 ASP A C     1 
ATOM   3833 O O     . ASP E 5 141 ? 89.712  50.424  124.700 1.00 37.90  ? 141 ASP A O     1 
ATOM   3834 C CB    . ASP E 5 141 ? 88.146  52.875  123.224 1.00 52.41  ? 141 ASP A CB    1 
ATOM   3835 C CG    . ASP E 5 141 ? 87.899  54.365  123.202 1.00 52.41  ? 141 ASP A CG    1 
ATOM   3836 O OD1   . ASP E 5 141 ? 88.135  55.016  124.242 1.00 52.41  ? 141 ASP A OD1   1 
ATOM   3837 O OD2   . ASP E 5 141 ? 87.471  54.883  122.148 1.00 52.41  ? 141 ASP A OD2   1 
ATOM   3838 N N     . PHE E 5 142 ? 89.906  50.395  122.459 1.00 49.80  ? 142 PHE A N     1 
ATOM   3839 C CA    . PHE E 5 142 ? 90.062  48.952  122.366 1.00 49.80  ? 142 PHE A CA    1 
ATOM   3840 C C     . PHE E 5 142 ? 91.423  48.518  122.909 1.00 49.80  ? 142 PHE A C     1 
ATOM   3841 O O     . PHE E 5 142 ? 91.573  47.407  123.417 1.00 49.80  ? 142 PHE A O     1 
ATOM   3842 C CB    . PHE E 5 142 ? 89.912  48.509  120.906 1.00 45.96  ? 142 PHE A CB    1 
ATOM   3843 C CG    . PHE E 5 142 ? 90.228  47.060  120.672 1.00 45.96  ? 142 PHE A CG    1 
ATOM   3844 C CD1   . PHE E 5 142 ? 89.606  46.067  121.422 1.00 45.96  ? 142 PHE A CD1   1 
ATOM   3845 C CD2   . PHE E 5 142 ? 91.151  46.686  119.703 1.00 45.96  ? 142 PHE A CD2   1 
ATOM   3846 C CE1   . PHE E 5 142 ? 89.897  44.724  121.209 1.00 45.96  ? 142 PHE A CE1   1 
ATOM   3847 C CE2   . PHE E 5 142 ? 91.449  45.345  119.482 1.00 45.96  ? 142 PHE A CE2   1 
ATOM   3848 C CZ    . PHE E 5 142 ? 90.821  44.362  120.238 1.00 45.96  ? 142 PHE A CZ    1 
ATOM   3849 N N     . ASP E 5 143 ? 92.409  49.403  122.807 1.00 37.36  ? 143 ASP A N     1 
ATOM   3850 C CA    . ASP E 5 143 ? 93.753  49.100  123.286 1.00 37.36  ? 143 ASP A CA    1 
ATOM   3851 C C     . ASP E 5 143 ? 93.858  49.322  124.787 1.00 37.36  ? 143 ASP A C     1 
ATOM   3852 O O     . ASP E 5 143 ? 94.611  48.633  125.475 1.00 37.36  ? 143 ASP A O     1 
ATOM   3853 C CB    . ASP E 5 143 ? 94.781  49.967  122.559 1.00 59.38  ? 143 ASP A CB    1 
ATOM   3854 C CG    . ASP E 5 143 ? 95.310  49.309  121.299 1.00 59.38  ? 143 ASP A CG    1 
ATOM   3855 O OD1   . ASP E 5 143 ? 95.315  48.061  121.235 1.00 59.38  ? 143 ASP A OD1   1 
ATOM   3856 O OD2   . ASP E 5 143 ? 95.721  50.039  120.373 1.00 59.38  ? 143 ASP A OD2   1 
ATOM   3857 N N     . GLN E 5 144 ? 93.102  50.294  125.291 1.00 36.36  ? 144 GLN A N     1 
ATOM   3858 C CA    . GLN E 5 144 ? 93.099  50.597  126.714 1.00 36.36  ? 144 GLN A CA    1 
ATOM   3859 C C     . GLN E 5 144 ? 92.407  49.442  127.417 1.00 36.36  ? 144 GLN A C     1 
ATOM   3860 O O     . GLN E 5 144 ? 92.825  49.005  128.489 1.00 36.36  ? 144 GLN A O     1 
ATOM   3861 C CB    . GLN E 5 144 ? 92.341  51.898  126.980 1.00 70.00  ? 144 GLN A CB    1 
ATOM   3862 C CG    . GLN E 5 144 ? 92.282  52.291  128.447 1.00 70.00  ? 144 GLN A CG    1 
ATOM   3863 C CD    . GLN E 5 144 ? 91.301  53.417  128.716 1.00 70.00  ? 144 GLN A CD    1 
ATOM   3864 O OE1   . GLN E 5 144 ? 91.313  54.019  129.791 1.00 70.00  ? 144 GLN A OE1   1 
ATOM   3865 N NE2   . GLN E 5 144 ? 90.443  53.708  127.741 1.00 70.00  ? 144 GLN A NE2   1 
ATOM   3866 N N     . VAL E 5 145 ? 91.342  48.949  126.794 1.00 37.11  ? 145 VAL A N     1 
ATOM   3867 C CA    . VAL E 5 145 ? 90.583  47.834  127.338 1.00 37.11  ? 145 VAL A CA    1 
ATOM   3868 C C     . VAL E 5 145 ? 91.430  46.575  127.202 1.00 37.11  ? 145 VAL A C     1 
ATOM   3869 O O     . VAL E 5 145 ? 91.550  45.785  128.140 1.00 37.11  ? 145 VAL A O     1 
ATOM   3870 C CB    . VAL E 5 145 ? 89.251  47.646  126.570 1.00 48.19  ? 145 VAL A CB    1 
ATOM   3871 C CG1   . VAL E 5 145 ? 88.796  46.193  126.638 1.00 48.19  ? 145 VAL A CG1   1 
ATOM   3872 C CG2   . VAL E 5 145 ? 88.189  48.558  127.156 1.00 48.19  ? 145 VAL A CG2   1 
ATOM   3873 N N     . ARG E 5 146 ? 92.025  46.407  126.025 1.00 44.94  ? 146 ARG A N     1 
ATOM   3874 C CA    . ARG E 5 146 ? 92.868  45.254  125.738 1.00 44.94  ? 146 ARG A CA    1 
ATOM   3875 C C     . ARG E 5 146 ? 93.995  45.129  126.755 1.00 44.94  ? 146 ARG A C     1 
ATOM   3876 O O     . ARG E 5 146 ? 94.709  44.133  126.776 1.00 44.94  ? 146 ARG A O     1 
ATOM   3877 C CB    . ARG E 5 146 ? 93.460  45.371  124.331 1.00 91.25  ? 146 ARG A CB    1 
ATOM   3878 C CG    . ARG E 5 146 ? 93.451  44.073  123.539 1.00 91.25  ? 146 ARG A CG    1 
ATOM   3879 C CD    . ARG E 5 146 ? 94.215  44.221  122.232 1.00 91.25  ? 146 ARG A CD    1 
ATOM   3880 N NE    . ARG E 5 146 ? 95.543  44.793  122.436 1.00 91.25  ? 146 ARG A NE    1 
ATOM   3881 C CZ    . ARG E 5 146 ? 96.674  44.102  122.338 1.00 91.25  ? 146 ARG A CZ    1 
ATOM   3882 N NH1   . ARG E 5 146 ? 96.642  42.811  122.039 1.00 91.25  ? 146 ARG A NH1   1 
ATOM   3883 N NH2   . ARG E 5 146 ? 97.840  44.703  122.539 1.00 91.25  ? 146 ARG A NH2   1 
ATOM   3884 N N     . SER E 5 147 ? 94.156  46.148  127.590 1.00 52.63  ? 147 SER A N     1 
ATOM   3885 C CA    . SER E 5 147 ? 95.197  46.137  128.608 1.00 52.63  ? 147 SER A CA    1 
ATOM   3886 C C     . SER E 5 147 ? 94.601  45.758  129.954 1.00 52.63  ? 147 SER A C     1 
ATOM   3887 O O     . SER E 5 147 ? 95.197  45.002  130.721 1.00 52.63  ? 147 SER A O     1 
ATOM   3888 C CB    . SER E 5 147 ? 95.852  47.517  128.707 1.00 69.82  ? 147 SER A CB    1 
ATOM   3889 O OG    . SER E 5 147 ? 96.310  47.957  127.441 1.00 69.82  ? 147 SER A OG    1 
ATOM   3890 N N     . LEU E 5 148 ? 93.412  46.284  130.228 1.00 67.76  ? 148 LEU A N     1 
ATOM   3891 C CA    . LEU E 5 148 ? 92.726  46.023  131.485 1.00 67.76  ? 148 LEU A CA    1 
ATOM   3892 C C     . LEU E 5 148 ? 92.210  44.591  131.616 1.00 67.76  ? 148 LEU A C     1 
ATOM   3893 O O     . LEU E 5 148 ? 92.556  43.886  132.564 1.00 67.76  ? 148 LEU A O     1 
ATOM   3894 C CB    . LEU E 5 148 ? 91.559  46.999  131.653 1.00 72.34  ? 148 LEU A CB    1 
ATOM   3895 C CG    . LEU E 5 148 ? 91.921  48.458  131.944 1.00 72.34  ? 148 LEU A CG    1 
ATOM   3896 C CD1   . LEU E 5 148 ? 91.285  49.359  130.902 1.00 72.34  ? 148 LEU A CD1   1 
ATOM   3897 C CD2   . LEU E 5 148 ? 91.443  48.841  133.334 1.00 72.34  ? 148 LEU A CD2   1 
ATOM   3898 N N     . MET E 5 149 ? 91.389  44.163  130.663 1.00 79.60  ? 149 MET A N     1 
ATOM   3899 C CA    . MET E 5 149 ? 90.811  42.823  130.707 1.00 79.60  ? 149 MET A CA    1 
ATOM   3900 C C     . MET E 5 149 ? 91.499  41.795  129.815 1.00 79.60  ? 149 MET A C     1 
ATOM   3901 O O     . MET E 5 149 ? 90.846  40.894  129.293 1.00 79.60  ? 149 MET A O     1 
ATOM   3902 C CB    . MET E 5 149 ? 89.326  42.881  130.335 1.00 100.00 ? 149 MET A CB    1 
ATOM   3903 C CG    . MET E 5 149 ? 88.506  43.885  131.127 1.00 100.00 ? 149 MET A CG    1 
ATOM   3904 S SD    . MET E 5 149 ? 86.751  43.834  130.686 1.00 100.00 ? 149 MET A SD    1 
ATOM   3905 C CE    . MET E 5 149 ? 86.825  44.244  128.939 1.00 100.00 ? 149 MET A CE    1 
ATOM   3906 N N     . GLU E 5 150 ? 92.810  41.914  129.640 1.00 63.22  ? 150 GLU A N     1 
ATOM   3907 C CA    . GLU E 5 150 ? 93.532  40.964  128.801 1.00 63.22  ? 150 GLU A CA    1 
ATOM   3908 C C     . GLU E 5 150 ? 94.194  39.891  129.649 1.00 63.22  ? 150 GLU A C     1 
ATOM   3909 O O     . GLU E 5 150 ? 94.417  38.771  129.189 1.00 63.22  ? 150 GLU A O     1 
ATOM   3910 C CB    . GLU E 5 150 ? 94.599  41.682  127.985 1.00 80.99  ? 150 GLU A CB    1 
ATOM   3911 C CG    . GLU E 5 150 ? 95.684  42.321  128.833 1.00 80.99  ? 150 GLU A CG    1 
ATOM   3912 C CD    . GLU E 5 150 ? 96.985  42.483  128.080 1.00 80.99  ? 150 GLU A CD    1 
ATOM   3913 O OE1   . GLU E 5 150 ? 97.013  42.165  126.873 1.00 80.99  ? 150 GLU A OE1   1 
ATOM   3914 O OE2   . GLU E 5 150 ? 97.977  42.929  128.694 1.00 80.99  ? 150 GLU A OE2   1 
ATOM   3915 N N     . ASN E 5 151 ? 94.503  40.244  130.892 1.00 71.39  ? 151 ASN A N     1 
ATOM   3916 C CA    . ASN E 5 151 ? 95.155  39.320  131.807 1.00 71.39  ? 151 ASN A CA    1 
ATOM   3917 C C     . ASN E 5 151 ? 94.178  38.604  132.732 1.00 71.39  ? 151 ASN A C     1 
ATOM   3918 O O     . ASN E 5 151 ? 94.518  37.588  133.334 1.00 71.39  ? 151 ASN A O     1 
ATOM   3919 C CB    . ASN E 5 151 ? 96.197  40.067  132.642 1.00 99.63  ? 151 ASN A CB    1 
ATOM   3920 C CG    . ASN E 5 151 ? 97.366  40.553  131.810 1.00 99.63  ? 151 ASN A CG    1 
ATOM   3921 O OD1   . ASN E 5 151 ? 98.067  39.759  131.182 1.00 99.63  ? 151 ASN A OD1   1 
ATOM   3922 N ND2   . ASN E 5 151 ? 97.581  41.863  131.798 1.00 99.63  ? 151 ASN A ND2   1 
ATOM   3923 N N     . SER E 5 152 ? 92.964  39.131  132.844 1.00 56.89  ? 152 SER A N     1 
ATOM   3924 C CA    . SER E 5 152 ? 91.963  38.524  133.711 1.00 56.89  ? 152 SER A CA    1 
ATOM   3925 C C     . SER E 5 152 ? 91.652  37.097  133.281 1.00 56.89  ? 152 SER A C     1 
ATOM   3926 O O     . SER E 5 152 ? 91.524  36.806  132.090 1.00 56.89  ? 152 SER A O     1 
ATOM   3927 C CB    . SER E 5 152 ? 90.677  39.350  133.709 1.00 52.18  ? 152 SER A CB    1 
ATOM   3928 O OG    . SER E 5 152 ? 89.765  38.862  134.678 1.00 52.18  ? 152 SER A OG    1 
ATOM   3929 N N     . ASP E 5 153 ? 91.535  36.211  134.263 1.00 59.12  ? 153 ASP A N     1 
ATOM   3930 C CA    . ASP E 5 153 ? 91.238  34.810  134.005 1.00 59.12  ? 153 ASP A CA    1 
ATOM   3931 C C     . ASP E 5 153 ? 89.735  34.576  133.979 1.00 59.12  ? 153 ASP A C     1 
ATOM   3932 O O     . ASP E 5 153 ? 89.275  33.476  133.677 1.00 59.12  ? 153 ASP A O     1 
ATOM   3933 C CB    . ASP E 5 153 ? 91.872  33.935  135.087 1.00 99.93  ? 153 ASP A CB    1 
ATOM   3934 C CG    . ASP E 5 153 ? 92.710  32.816  134.512 1.00 99.93  ? 153 ASP A CG    1 
ATOM   3935 O OD1   . ASP E 5 153 ? 92.141  31.755  134.176 1.00 99.93  ? 153 ASP A OD1   1 
ATOM   3936 O OD2   . ASP E 5 153 ? 93.940  32.999  134.395 1.00 99.93  ? 153 ASP A OD2   1 
ATOM   3937 N N     . ARG E 5 154 ? 88.974  35.618  134.295 1.00 32.09  ? 154 ARG A N     1 
ATOM   3938 C CA    . ARG E 5 154 ? 87.521  35.523  134.318 1.00 32.09  ? 154 ARG A CA    1 
ATOM   3939 C C     . ARG E 5 154 ? 86.948  35.238  132.935 1.00 32.09  ? 154 ARG A C     1 
ATOM   3940 O O     . ARG E 5 154 ? 87.238  35.949  131.972 1.00 32.09  ? 154 ARG A O     1 
ATOM   3941 C CB    . ARG E 5 154 ? 86.925  36.817  134.871 1.00 57.64  ? 154 ARG A CB    1 
ATOM   3942 C CG    . ARG E 5 154 ? 87.557  37.270  136.175 1.00 57.64  ? 154 ARG A CG    1 
ATOM   3943 C CD    . ARG E 5 154 ? 86.973  38.589  136.638 1.00 57.64  ? 154 ARG A CD    1 
ATOM   3944 N NE    . ARG E 5 154 ? 85.514  38.573  136.630 1.00 57.64  ? 154 ARG A NE    1 
ATOM   3945 C CZ    . ARG E 5 154 ? 84.760  39.622  136.318 1.00 57.64  ? 154 ARG A CZ    1 
ATOM   3946 N NH1   . ARG E 5 154 ? 85.327  40.775  135.986 1.00 57.64  ? 154 ARG A NH1   1 
ATOM   3947 N NH2   . ARG E 5 154 ? 83.437  39.520  136.340 1.00 57.64  ? 154 ARG A NH2   1 
ATOM   3948 N N     . CYS E 5 155 ? 86.134  34.191  132.847 1.00 27.85  ? 155 CYS A N     1 
ATOM   3949 C CA    . CYS E 5 155 ? 85.508  33.802  131.588 1.00 27.85  ? 155 CYS A CA    1 
ATOM   3950 C C     . CYS E 5 155 ? 84.771  34.982  130.968 1.00 27.85  ? 155 CYS A C     1 
ATOM   3951 O O     . CYS E 5 155 ? 84.844  35.210  129.761 1.00 27.85  ? 155 CYS A O     1 
ATOM   3952 C CB    . CYS E 5 155 ? 84.526  32.655  131.827 1.00 48.27  ? 155 CYS A CB    1 
ATOM   3953 S SG    . CYS E 5 155 ? 84.112  31.708  130.351 1.00 48.27  ? 155 CYS A SG    1 
ATOM   3954 N N     . GLN E 5 156 ? 84.055  35.724  131.803 1.00 35.14  ? 156 GLN A N     1 
ATOM   3955 C CA    . GLN E 5 156 ? 83.311  36.884  131.343 1.00 35.14  ? 156 GLN A CA    1 
ATOM   3956 C C     . GLN E 5 156 ? 84.245  37.823  130.588 1.00 35.14  ? 156 GLN A C     1 
ATOM   3957 O O     . GLN E 5 156 ? 83.973  38.204  129.451 1.00 35.14  ? 156 GLN A O     1 
ATOM   3958 C CB    . GLN E 5 156 ? 82.694  37.616  132.536 1.00 82.19  ? 156 GLN A CB    1 
ATOM   3959 C CG    . GLN E 5 156 ? 82.133  38.984  132.203 1.00 82.19  ? 156 GLN A CG    1 
ATOM   3960 C CD    . GLN E 5 156 ? 80.671  39.117  132.576 1.00 82.19  ? 156 GLN A CD    1 
ATOM   3961 O OE1   . GLN E 5 156 ? 79.823  38.370  132.086 1.00 82.19  ? 156 GLN A OE1   1 
ATOM   3962 N NE2   . GLN E 5 156 ? 80.369  40.071  133.449 1.00 82.19  ? 156 GLN A NE2   1 
ATOM   3963 N N     . ASP E 5 157 ? 85.351  38.186  131.229 1.00 55.79  ? 157 ASP A N     1 
ATOM   3964 C CA    . ASP E 5 157 ? 86.332  39.084  130.631 1.00 55.79  ? 157 ASP A CA    1 
ATOM   3965 C C     . ASP E 5 157 ? 86.906  38.537  129.323 1.00 55.79  ? 157 ASP A C     1 
ATOM   3966 O O     . ASP E 5 157 ? 87.109  39.284  128.365 1.00 55.79  ? 157 ASP A O     1 
ATOM   3967 C CB    . ASP E 5 157 ? 87.469  39.348  131.622 1.00 85.66  ? 157 ASP A CB    1 
ATOM   3968 C CG    . ASP E 5 157 ? 87.002  40.088  132.863 1.00 85.66  ? 157 ASP A CG    1 
ATOM   3969 O OD1   . ASP E 5 157 ? 85.793  40.034  133.170 1.00 85.66  ? 157 ASP A OD1   1 
ATOM   3970 O OD2   . ASP E 5 157 ? 87.845  40.726  133.531 1.00 85.66  ? 157 ASP A OD2   1 
ATOM   3971 N N     . ILE E 5 158 ? 87.167  37.235  129.286 1.00 42.20  ? 158 ILE A N     1 
ATOM   3972 C CA    . ILE E 5 158 ? 87.720  36.606  128.093 1.00 42.20  ? 158 ILE A CA    1 
ATOM   3973 C C     . ILE E 5 158 ? 86.751  36.699  126.913 1.00 42.20  ? 158 ILE A C     1 
ATOM   3974 O O     . ILE E 5 158 ? 87.170  36.896  125.773 1.00 42.20  ? 158 ILE A O     1 
ATOM   3975 C CB    . ILE E 5 158 ? 88.068  35.121  128.363 1.00 37.79  ? 158 ILE A CB    1 
ATOM   3976 C CG1   . ILE E 5 158 ? 89.299  35.038  129.272 1.00 37.79  ? 158 ILE A CG1   1 
ATOM   3977 C CG2   . ILE E 5 158 ? 88.336  34.395  127.056 1.00 37.79  ? 158 ILE A CG2   1 
ATOM   3978 C CD1   . ILE E 5 158 ? 89.468  33.703  129.968 1.00 37.79  ? 158 ILE A CD1   1 
ATOM   3979 N N     . ARG E 5 159 ? 85.458  36.572  127.194 1.00 33.56  ? 159 ARG A N     1 
ATOM   3980 C CA    . ARG E 5 159 ? 84.436  36.641  126.152 1.00 33.56  ? 159 ARG A CA    1 
ATOM   3981 C C     . ARG E 5 159 ? 84.215  38.071  125.685 1.00 33.56  ? 159 ARG A C     1 
ATOM   3982 O O     . ARG E 5 159 ? 84.191  38.343  124.486 1.00 33.56  ? 159 ARG A O     1 
ATOM   3983 C CB    . ARG E 5 159 ? 83.115  36.071  126.671 1.00 28.48  ? 159 ARG A CB    1 
ATOM   3984 C CG    . ARG E 5 159 ? 81.897  36.412  125.822 1.00 28.48  ? 159 ARG A CG    1 
ATOM   3985 C CD    . ARG E 5 159 ? 80.727  35.516  126.202 1.00 28.48  ? 159 ARG A CD    1 
ATOM   3986 N NE    . ARG E 5 159 ? 79.590  36.215  126.809 1.00 28.48  ? 159 ARG A NE    1 
ATOM   3987 C CZ    . ARG E 5 159 ? 79.671  37.315  127.552 1.00 28.48  ? 159 ARG A CZ    1 
ATOM   3988 N NH1   . ARG E 5 159 ? 80.843  37.884  127.795 1.00 28.48  ? 159 ARG A NH1   1 
ATOM   3989 N NH2   . ARG E 5 159 ? 78.568  37.850  128.059 1.00 28.48  ? 159 ARG A NH2   1 
ATOM   3990 N N     . ASN E 5 160 ? 84.043  38.978  126.642 1.00 26.60  ? 160 ASN A N     1 
ATOM   3991 C CA    . ASN E 5 160 ? 83.817  40.388  126.341 1.00 26.60  ? 160 ASN A CA    1 
ATOM   3992 C C     . ASN E 5 160 ? 84.882  40.938  125.401 1.00 26.60  ? 160 ASN A C     1 
ATOM   3993 O O     . ASN E 5 160 ? 84.566  41.650  124.451 1.00 26.60  ? 160 ASN A O     1 
ATOM   3994 C CB    . ASN E 5 160 ? 83.810  41.210  127.631 1.00 39.51  ? 160 ASN A CB    1 
ATOM   3995 C CG    . ASN E 5 160 ? 82.539  41.021  128.437 1.00 39.51  ? 160 ASN A CG    1 
ATOM   3996 O OD1   . ASN E 5 160 ? 81.576  40.412  127.972 1.00 39.51  ? 160 ASN A OD1   1 
ATOM   3997 N ND2   . ASN E 5 160 ? 82.532  41.548  129.656 1.00 39.51  ? 160 ASN A ND2   1 
ATOM   3998 N N     . LEU E 5 161 ? 86.142  40.609  125.674 1.00 52.97  ? 161 LEU A N     1 
ATOM   3999 C CA    . LEU E 5 161 ? 87.254  41.073  124.847 1.00 52.97  ? 161 LEU A CA    1 
ATOM   4000 C C     . LEU E 5 161 ? 87.152  40.489  123.440 1.00 52.97  ? 161 LEU A C     1 
ATOM   4001 O O     . LEU E 5 161 ? 87.361  41.187  122.448 1.00 52.97  ? 161 LEU A O     1 
ATOM   4002 C CB    . LEU E 5 161 ? 88.591  40.666  125.476 1.00 30.32  ? 161 LEU A CB    1 
ATOM   4003 C CG    . LEU E 5 161 ? 89.577  41.776  125.862 1.00 30.32  ? 161 LEU A CG    1 
ATOM   4004 C CD1   . LEU E 5 161 ? 90.913  41.150  126.241 1.00 30.32  ? 161 LEU A CD1   1 
ATOM   4005 C CD2   . LEU E 5 161 ? 89.756  42.752  124.708 1.00 30.32  ? 161 LEU A CD2   1 
ATOM   4006 N N     . ALA E 5 162 ? 86.828  39.203  123.364 1.00 44.80  ? 162 ALA A N     1 
ATOM   4007 C CA    . ALA E 5 162 ? 86.695  38.531  122.080 1.00 44.80  ? 162 ALA A CA    1 
ATOM   4008 C C     . ALA E 5 162 ? 85.622  39.237  121.268 1.00 44.80  ? 162 ALA A C     1 
ATOM   4009 O O     . ALA E 5 162 ? 85.808  39.530  120.088 1.00 44.80  ? 162 ALA A O     1 
ATOM   4010 C CB    . ALA E 5 162 ? 86.318  37.070  122.290 1.00 36.37  ? 162 ALA A CB    1 
ATOM   4011 N N     . PHE E 5 163 ? 84.497  39.510  121.914 1.00 33.87  ? 163 PHE A N     1 
ATOM   4012 C CA    . PHE E 5 163 ? 83.391  40.184  121.258 1.00 33.87  ? 163 PHE A CA    1 
ATOM   4013 C C     . PHE E 5 163 ? 83.823  41.575  120.819 1.00 33.87  ? 163 PHE A C     1 
ATOM   4014 O O     . PHE E 5 163 ? 83.552  41.990  119.695 1.00 33.87  ? 163 PHE A O     1 
ATOM   4015 C CB    . PHE E 5 163 ? 82.202  40.282  122.213 1.00 21.97  ? 163 PHE A CB    1 
ATOM   4016 C CG    . PHE E 5 163 ? 81.208  41.334  121.835 1.00 21.97  ? 163 PHE A CG    1 
ATOM   4017 C CD1   . PHE E 5 163 ? 80.286  41.103  120.824 1.00 21.97  ? 163 PHE A CD1   1 
ATOM   4018 C CD2   . PHE E 5 163 ? 81.189  42.556  122.494 1.00 21.97  ? 163 PHE A CD2   1 
ATOM   4019 C CE1   . PHE E 5 163 ? 79.356  42.074  120.472 1.00 21.97  ? 163 PHE A CE1   1 
ATOM   4020 C CE2   . PHE E 5 163 ? 80.263  43.535  122.151 1.00 21.97  ? 163 PHE A CE2   1 
ATOM   4021 C CZ    . PHE E 5 163 ? 79.343  43.294  121.137 1.00 21.97  ? 163 PHE A CZ    1 
ATOM   4022 N N     . LEU E 5 164 ? 84.501  42.291  121.707 1.00 53.78  ? 164 LEU A N     1 
ATOM   4023 C CA    . LEU E 5 164 ? 84.961  43.637  121.396 1.00 53.78  ? 164 LEU A CA    1 
ATOM   4024 C C     . LEU E 5 164 ? 85.957  43.598  120.248 1.00 53.78  ? 164 LEU A C     1 
ATOM   4025 O O     . LEU E 5 164 ? 86.186  44.601  119.574 1.00 53.78  ? 164 LEU A O     1 
ATOM   4026 C CB    . LEU E 5 164 ? 85.604  44.277  122.626 1.00 26.40  ? 164 LEU A CB    1 
ATOM   4027 C CG    . LEU E 5 164 ? 84.618  44.779  123.685 1.00 26.40  ? 164 LEU A CG    1 
ATOM   4028 C CD1   . LEU E 5 164 ? 85.371  45.485  124.800 1.00 26.40  ? 164 LEU A CD1   1 
ATOM   4029 C CD2   . LEU E 5 164 ? 83.609  45.718  123.041 1.00 26.40  ? 164 LEU A CD2   1 
ATOM   4030 N N     . GLY E 5 165 ? 86.542  42.427  120.027 1.00 50.37  ? 165 GLY A N     1 
ATOM   4031 C CA    . GLY E 5 165 ? 87.500  42.278  118.949 1.00 50.37  ? 165 GLY A CA    1 
ATOM   4032 C C     . GLY E 5 165 ? 86.789  42.104  117.623 1.00 50.37  ? 165 GLY A C     1 
ATOM   4033 O O     . GLY E 5 165 ? 86.973  42.898  116.703 1.00 50.37  ? 165 GLY A O     1 
ATOM   4034 N N     . ILE E 5 166 ? 85.967  41.063  117.531 1.00 49.18  ? 166 ILE A N     1 
ATOM   4035 C CA    . ILE E 5 166 ? 85.218  40.786  116.314 1.00 49.18  ? 166 ILE A CA    1 
ATOM   4036 C C     . ILE E 5 166 ? 84.530  42.059  115.840 1.00 49.18  ? 166 ILE A C     1 
ATOM   4037 O O     . ILE E 5 166 ? 84.688  42.472  114.694 1.00 49.18  ? 166 ILE A O     1 
ATOM   4038 C CB    . ILE E 5 166 ? 84.152  39.691  116.556 1.00 30.60  ? 166 ILE A CB    1 
ATOM   4039 C CG1   . ILE E 5 166 ? 84.756  38.315  116.281 1.00 30.60  ? 166 ILE A CG1   1 
ATOM   4040 C CG2   . ILE E 5 166 ? 82.935  39.918  115.662 1.00 30.60  ? 166 ILE A CG2   1 
ATOM   4041 C CD1   . ILE E 5 166 ? 85.549  37.765  117.434 1.00 30.60  ? 166 ILE A CD1   1 
ATOM   4042 N N     . ALA E 5 167 ? 83.772  42.679  116.736 1.00 51.31  ? 167 ALA A N     1 
ATOM   4043 C CA    . ALA E 5 167 ? 83.056  43.903  116.413 1.00 51.31  ? 167 ALA A CA    1 
ATOM   4044 C C     . ALA E 5 167 ? 83.957  44.934  115.737 1.00 51.31  ? 167 ALA A C     1 
ATOM   4045 O O     . ALA E 5 167 ? 83.859  45.160  114.533 1.00 51.31  ? 167 ALA A O     1 
ATOM   4046 C CB    . ALA E 5 167 ? 82.442  44.493  117.677 1.00 23.58  ? 167 ALA A CB    1 
ATOM   4047 N N     . TYR E 5 168 ? 84.835  45.555  116.516 1.00 41.36  ? 168 TYR A N     1 
ATOM   4048 C CA    . TYR E 5 168 ? 85.737  46.572  115.992 1.00 41.36  ? 168 TYR A CA    1 
ATOM   4049 C C     . TYR E 5 168 ? 86.463  46.159  114.715 1.00 41.36  ? 168 TYR A C     1 
ATOM   4050 O O     . TYR E 5 168 ? 86.549  46.933  113.760 1.00 41.36  ? 168 TYR A O     1 
ATOM   4051 C CB    . TYR E 5 168 ? 86.776  46.955  117.049 1.00 26.04  ? 168 TYR A CB    1 
ATOM   4052 C CG    . TYR E 5 168 ? 87.783  47.958  116.541 1.00 26.04  ? 168 TYR A CG    1 
ATOM   4053 C CD1   . TYR E 5 168 ? 87.456  49.310  116.443 1.00 26.04  ? 168 TYR A CD1   1 
ATOM   4054 C CD2   . TYR E 5 168 ? 89.045  47.553  116.109 1.00 26.04  ? 168 TYR A CD2   1 
ATOM   4055 C CE1   . TYR E 5 168 ? 88.356  50.236  115.920 1.00 26.04  ? 168 TYR A CE1   1 
ATOM   4056 C CE2   . TYR E 5 168 ? 89.955  48.470  115.584 1.00 26.04  ? 168 TYR A CE2   1 
ATOM   4057 C CZ    . TYR E 5 168 ? 89.603  49.811  115.491 1.00 26.04  ? 168 TYR A CZ    1 
ATOM   4058 O OH    . TYR E 5 168 ? 90.488  50.720  114.955 1.00 26.04  ? 168 TYR A OH    1 
ATOM   4059 N N     . ASN E 5 169 ? 86.981  44.938  114.703 1.00 60.53  ? 169 ASN A N     1 
ATOM   4060 C CA    . ASN E 5 169 ? 87.728  44.430  113.558 1.00 60.53  ? 169 ASN A CA    1 
ATOM   4061 C C     . ASN E 5 169 ? 86.876  44.029  112.354 1.00 60.53  ? 169 ASN A C     1 
ATOM   4062 O O     . ASN E 5 169 ? 87.389  43.935  111.239 1.00 60.53  ? 169 ASN A O     1 
ATOM   4063 C CB    . ASN E 5 169 ? 88.589  43.243  114.003 1.00 81.32  ? 169 ASN A CB    1 
ATOM   4064 C CG    . ASN E 5 169 ? 89.073  42.400  112.842 1.00 81.32  ? 169 ASN A CG    1 
ATOM   4065 O OD1   . ASN E 5 169 ? 88.357  41.523  112.357 1.00 81.32  ? 169 ASN A OD1   1 
ATOM   4066 N ND2   . ASN E 5 169 ? 90.295  42.657  112.392 1.00 81.32  ? 169 ASN A ND2   1 
ATOM   4067 N N     . THR E 5 170 ? 85.582  43.806  112.563 1.00 34.68  ? 170 THR A N     1 
ATOM   4068 C CA    . THR E 5 170 ? 84.716  43.396  111.462 1.00 34.68  ? 170 THR A CA    1 
ATOM   4069 C C     . THR E 5 170 ? 83.563  44.339  111.145 1.00 34.68  ? 170 THR A C     1 
ATOM   4070 O O     . THR E 5 170 ? 82.776  44.067  110.239 1.00 34.68  ? 170 THR A O     1 
ATOM   4071 C CB    . THR E 5 170 ? 84.121  41.993  111.709 1.00 36.82  ? 170 THR A CB    1 
ATOM   4072 O OG1   . THR E 5 170 ? 83.064  42.084  112.673 1.00 36.82  ? 170 THR A OG1   1 
ATOM   4073 C CG2   . THR E 5 170 ? 85.195  41.039  112.208 1.00 36.82  ? 170 THR A CG2   1 
ATOM   4074 N N     . LEU E 5 171 ? 83.450  45.439  111.881 1.00 27.14  ? 171 LEU A N     1 
ATOM   4075 C CA    . LEU E 5 171 ? 82.372  46.394  111.634 1.00 27.14  ? 171 LEU A CA    1 
ATOM   4076 C C     . LEU E 5 171 ? 81.021  45.683  111.573 1.00 27.14  ? 171 LEU A C     1 
ATOM   4077 O O     . LEU E 5 171 ? 80.021  46.277  111.174 1.00 27.14  ? 171 LEU A O     1 
ATOM   4078 C CB    . LEU E 5 171 ? 82.595  47.117  110.301 1.00 32.25  ? 171 LEU A CB    1 
ATOM   4079 C CG    . LEU E 5 171 ? 83.575  48.288  110.164 1.00 32.25  ? 171 LEU A CG    1 
ATOM   4080 C CD1   . LEU E 5 171 ? 83.108  49.452  111.016 1.00 32.25  ? 171 LEU A CD1   1 
ATOM   4081 C CD2   . LEU E 5 171 ? 84.969  47.843  110.557 1.00 32.25  ? 171 LEU A CD2   1 
ATOM   4082 N N     . LEU E 5 172 ? 80.994  44.412  111.962 1.00 28.21  ? 172 LEU A N     1 
ATOM   4083 C CA    . LEU E 5 172 ? 79.765  43.627  111.929 1.00 28.21  ? 172 LEU A CA    1 
ATOM   4084 C C     . LEU E 5 172 ? 78.674  44.218  112.817 1.00 28.21  ? 172 LEU A C     1 
ATOM   4085 O O     . LEU E 5 172 ? 78.964  44.912  113.791 1.00 28.21  ? 172 LEU A O     1 
ATOM   4086 C CB    . LEU E 5 172 ? 80.057  42.192  112.368 1.00 21.02  ? 172 LEU A CB    1 
ATOM   4087 C CG    . LEU E 5 172 ? 80.443  41.186  111.283 1.00 21.02  ? 172 LEU A CG    1 
ATOM   4088 C CD1   . LEU E 5 172 ? 81.069  39.955  111.927 1.00 21.02  ? 172 LEU A CD1   1 
ATOM   4089 C CD2   . LEU E 5 172 ? 79.206  40.800  110.483 1.00 21.02  ? 172 LEU A CD2   1 
ATOM   4090 N N     . LYS E 5 173 ? 77.419  43.949  112.474 1.00 38.40  ? 173 LYS A N     1 
ATOM   4091 C CA    . LYS E 5 173 ? 76.293  44.440  113.261 1.00 38.40  ? 173 LYS A CA    1 
ATOM   4092 C C     . LYS E 5 173 ? 76.154  43.518  114.466 1.00 38.40  ? 173 LYS A C     1 
ATOM   4093 O O     . LYS E 5 173 ? 76.715  42.423  114.473 1.00 38.40  ? 173 LYS A O     1 
ATOM   4094 C CB    . LYS E 5 173 ? 75.004  44.405  112.435 1.00 45.72  ? 173 LYS A CB    1 
ATOM   4095 C CG    . LYS E 5 173 ? 74.769  45.640  111.582 1.00 45.72  ? 173 LYS A CG    1 
ATOM   4096 C CD    . LYS E 5 173 ? 73.362  46.185  111.785 1.00 45.72  ? 173 LYS A CD    1 
ATOM   4097 C CE    . LYS E 5 173 ? 72.857  46.903  110.542 1.00 45.72  ? 173 LYS A CE    1 
ATOM   4098 N NZ    . LYS E 5 173 ? 71.985  48.063  110.880 1.00 45.72  ? 173 LYS A NZ    1 
ATOM   4099 N N     . ILE E 5 174 ? 75.411  43.950  115.482 1.00 50.81  ? 174 ILE A N     1 
ATOM   4100 C CA    . ILE E 5 174 ? 75.242  43.126  116.676 1.00 50.81  ? 174 ILE A CA    1 
ATOM   4101 C C     . ILE E 5 174 ? 74.504  41.826  116.364 1.00 50.81  ? 174 ILE A C     1 
ATOM   4102 O O     . ILE E 5 174 ? 75.073  40.740  116.482 1.00 50.81  ? 174 ILE A O     1 
ATOM   4103 C CB    . ILE E 5 174 ? 74.483  43.884  117.802 1.00 39.80  ? 174 ILE A CB    1 
ATOM   4104 C CG1   . ILE E 5 174 ? 73.406  44.792  117.208 1.00 39.80  ? 174 ILE A CG1   1 
ATOM   4105 C CG2   . ILE E 5 174 ? 75.466  44.705  118.625 1.00 39.80  ? 174 ILE A CG2   1 
ATOM   4106 C CD1   . ILE E 5 174 ? 72.523  45.450  118.254 1.00 39.80  ? 174 ILE A CD1   1 
ATOM   4107 N N     . ALA E 5 175 ? 73.244  41.941  115.957 1.00 30.85  ? 175 ALA A N     1 
ATOM   4108 C CA    . ALA E 5 175 ? 72.429  40.776  115.630 1.00 30.85  ? 175 ALA A CA    1 
ATOM   4109 C C     . ALA E 5 175 ? 73.197  39.785  114.756 1.00 30.85  ? 175 ALA A C     1 
ATOM   4110 O O     . ALA E 5 175 ? 72.956  38.577  114.808 1.00 30.85  ? 175 ALA A O     1 
ATOM   4111 C CB    . ALA E 5 175 ? 71.153  41.216  114.927 1.00 15.02  ? 175 ALA A CB    1 
ATOM   4112 N N     . GLU E 5 176 ? 74.124  40.302  113.957 1.00 36.75  ? 176 GLU A N     1 
ATOM   4113 C CA    . GLU E 5 176 ? 74.932  39.466  113.079 1.00 36.75  ? 176 GLU A CA    1 
ATOM   4114 C C     . GLU E 5 176 ? 75.953  38.669  113.880 1.00 36.75  ? 176 GLU A C     1 
ATOM   4115 O O     . GLU E 5 176 ? 76.159  37.482  113.632 1.00 36.75  ? 176 GLU A O     1 
ATOM   4116 C CB    . GLU E 5 176 ? 75.660  40.328  112.049 1.00 82.36  ? 176 GLU A CB    1 
ATOM   4117 C CG    . GLU E 5 176 ? 74.872  40.569  110.780 1.00 82.36  ? 176 GLU A CG    1 
ATOM   4118 C CD    . GLU E 5 176 ? 74.813  42.033  110.411 1.00 82.36  ? 176 GLU A CD    1 
ATOM   4119 O OE1   . GLU E 5 176 ? 75.888  42.650  110.259 1.00 82.36  ? 176 GLU A OE1   1 
ATOM   4120 O OE2   . GLU E 5 176 ? 73.693  42.568  110.277 1.00 82.36  ? 176 GLU A OE2   1 
ATOM   4121 N N     . ILE E 5 177 ? 76.600  39.327  114.836 1.00 48.13  ? 177 ILE A N     1 
ATOM   4122 C CA    . ILE E 5 177 ? 77.594  38.659  115.664 1.00 48.13  ? 177 ILE A CA    1 
ATOM   4123 C C     . ILE E 5 177 ? 76.906  37.654  116.582 1.00 48.13  ? 177 ILE A C     1 
ATOM   4124 O O     . ILE E 5 177 ? 77.515  36.679  117.022 1.00 48.13  ? 177 ILE A O     1 
ATOM   4125 C CB    . ILE E 5 177 ? 78.385  39.672  116.526 1.00 34.83  ? 177 ILE A CB    1 
ATOM   4126 C CG1   . ILE E 5 177 ? 78.836  40.856  115.666 1.00 34.83  ? 177 ILE A CG1   1 
ATOM   4127 C CG2   . ILE E 5 177 ? 79.599  38.989  117.147 1.00 34.83  ? 177 ILE A CG2   1 
ATOM   4128 C CD1   . ILE E 5 177 ? 79.492  41.977  116.447 1.00 34.83  ? 177 ILE A CD1   1 
ATOM   4129 N N     . ALA E 5 178 ? 75.628  37.895  116.855 1.00 45.44  ? 178 ALA A N     1 
ATOM   4130 C CA    . ALA E 5 178 ? 74.856  37.020  117.725 1.00 45.44  ? 178 ALA A CA    1 
ATOM   4131 C C     . ALA E 5 178 ? 74.485  35.708  117.040 1.00 45.44  ? 178 ALA A C     1 
ATOM   4132 O O     . ALA E 5 178 ? 74.436  34.662  117.681 1.00 45.44  ? 178 ALA A O     1 
ATOM   4133 C CB    . ALA E 5 178 ? 73.594  37.738  118.196 1.00 25.05  ? 178 ALA A CB    1 
ATOM   4134 N N     . ARG E 5 179 ? 74.222  35.762  115.739 1.00 70.11  ? 179 ARG A N     1 
ATOM   4135 C CA    . ARG E 5 179 ? 73.846  34.561  115.004 1.00 70.11  ? 179 ARG A CA    1 
ATOM   4136 C C     . ARG E 5 179 ? 75.054  33.718  114.607 1.00 70.11  ? 179 ARG A C     1 
ATOM   4137 O O     . ARG E 5 179 ? 74.910  32.552  114.239 1.00 70.11  ? 179 ARG A O     1 
ATOM   4138 C CB    . ARG E 5 179 ? 73.034  34.931  113.755 1.00 45.02  ? 179 ARG A CB    1 
ATOM   4139 C CG    . ARG E 5 179 ? 73.582  36.113  112.971 1.00 45.02  ? 179 ARG A CG    1 
ATOM   4140 C CD    . ARG E 5 179 ? 72.776  36.365  111.701 1.00 45.02  ? 179 ARG A CD    1 
ATOM   4141 N NE    . ARG E 5 179 ? 71.874  37.504  111.844 1.00 45.02  ? 179 ARG A NE    1 
ATOM   4142 C CZ    . ARG E 5 179 ? 71.857  38.552  111.027 1.00 45.02  ? 179 ARG A CZ    1 
ATOM   4143 N NH1   . ARG E 5 179 ? 72.697  38.611  110.002 1.00 45.02  ? 179 ARG A NH1   1 
ATOM   4144 N NH2   . ARG E 5 179 ? 71.003  39.544  111.239 1.00 45.02  ? 179 ARG A NH2   1 
ATOM   4145 N N     . ILE E 5 180 ? 76.243  34.306  114.689 1.00 54.87  ? 180 ILE A N     1 
ATOM   4146 C CA    . ILE E 5 180 ? 77.467  33.595  114.334 1.00 54.87  ? 180 ILE A CA    1 
ATOM   4147 C C     . ILE E 5 180 ? 77.571  32.264  115.073 1.00 54.87  ? 180 ILE A C     1 
ATOM   4148 O O     . ILE E 5 180 ? 77.254  32.173  116.261 1.00 54.87  ? 180 ILE A O     1 
ATOM   4149 C CB    . ILE E 5 180 ? 78.725  34.431  114.669 1.00 36.69  ? 180 ILE A CB    1 
ATOM   4150 C CG1   . ILE E 5 180 ? 78.742  35.713  113.838 1.00 36.69  ? 180 ILE A CG1   1 
ATOM   4151 C CG2   . ILE E 5 180 ? 79.982  33.617  114.395 1.00 36.69  ? 180 ILE A CG2   1 
ATOM   4152 C CD1   . ILE E 5 180 ? 79.871  36.657  114.199 1.00 36.69  ? 180 ILE A CD1   1 
ATOM   4153 N N     . ARG E 5 181 ? 78.008  31.233  114.357 1.00 56.18  ? 181 ARG A N     1 
ATOM   4154 C CA    . ARG E 5 181 ? 78.178  29.905  114.933 1.00 56.18  ? 181 ARG A CA    1 
ATOM   4155 C C     . ARG E 5 181 ? 79.643  29.507  114.774 1.00 56.18  ? 181 ARG A C     1 
ATOM   4156 O O     . ARG E 5 181 ? 80.349  30.050  113.924 1.00 56.18  ? 181 ARG A O     1 
ATOM   4157 C CB    . ARG E 5 181 ? 77.270  28.898  114.224 1.00 37.98  ? 181 ARG A CB    1 
ATOM   4158 C CG    . ARG E 5 181 ? 75.849  29.400  114.015 1.00 37.98  ? 181 ARG A CG    1 
ATOM   4159 C CD    . ARG E 5 181 ? 74.959  28.329  113.407 1.00 37.98  ? 181 ARG A CD    1 
ATOM   4160 N NE    . ARG E 5 181 ? 74.053  27.749  114.395 1.00 37.98  ? 181 ARG A NE    1 
ATOM   4161 C CZ    . ARG E 5 181 ? 72.771  28.081  114.518 1.00 37.98  ? 181 ARG A CZ    1 
ATOM   4162 N NH1   . ARG E 5 181 ? 72.239  28.991  113.713 1.00 37.98  ? 181 ARG A NH1   1 
ATOM   4163 N NH2   . ARG E 5 181 ? 72.020  27.502  115.445 1.00 37.98  ? 181 ARG A NH2   1 
ATOM   4164 N N     . VAL E 5 182 ? 80.096  28.562  115.591 1.00 58.31  ? 182 VAL A N     1 
ATOM   4165 C CA    . VAL E 5 182 ? 81.484  28.115  115.546 1.00 58.31  ? 182 VAL A CA    1 
ATOM   4166 C C     . VAL E 5 182 ? 81.924  27.686  114.150 1.00 58.31  ? 182 VAL A C     1 
ATOM   4167 O O     . VAL E 5 182 ? 82.997  28.070  113.683 1.00 58.31  ? 182 VAL A O     1 
ATOM   4168 C CB    . VAL E 5 182 ? 81.718  26.945  116.519 1.00 52.17  ? 182 VAL A CB    1 
ATOM   4169 C CG1   . VAL E 5 182 ? 83.170  26.500  116.456 1.00 52.17  ? 182 VAL A CG1   1 
ATOM   4170 C CG2   . VAL E 5 182 ? 81.353  27.367  117.932 1.00 52.17  ? 182 VAL A CG2   1 
ATOM   4171 N N     . LYS E 5 183 ? 81.093  26.888  113.488 1.00 92.89  ? 183 LYS A N     1 
ATOM   4172 C CA    . LYS E 5 183 ? 81.401  26.409  112.146 1.00 92.89  ? 183 LYS A CA    1 
ATOM   4173 C C     . LYS E 5 183 ? 81.493  27.565  111.156 1.00 92.89  ? 183 LYS A C     1 
ATOM   4174 O O     . LYS E 5 183 ? 82.282  27.524  110.212 1.00 92.89  ? 183 LYS A O     1 
ATOM   4175 C CB    . LYS E 5 183 ? 80.330  25.421  111.681 1.00 72.80  ? 183 LYS A CB    1 
ATOM   4176 C CG    . LYS E 5 183 ? 78.943  26.027  111.564 1.00 72.80  ? 183 LYS A CG    1 
ATOM   4177 C CD    . LYS E 5 183 ? 78.159  25.390  110.432 1.00 72.80  ? 183 LYS A CD    1 
ATOM   4178 C CE    . LYS E 5 183 ? 76.801  24.903  110.908 1.00 72.80  ? 183 LYS A CE    1 
ATOM   4179 N NZ    . LYS E 5 183 ? 75.734  25.918  110.673 1.00 72.80  ? 183 LYS A NZ    1 
ATOM   4180 N N     . ASP E 5 184 ? 80.685  28.598  111.379 1.00 71.11  ? 184 ASP A N     1 
ATOM   4181 C CA    . ASP E 5 184 ? 80.674  29.769  110.507 1.00 71.11  ? 184 ASP A CA    1 
ATOM   4182 C C     . ASP E 5 184 ? 82.045  30.431  110.483 1.00 71.11  ? 184 ASP A C     1 
ATOM   4183 O O     . ASP E 5 184 ? 82.290  31.356  109.708 1.00 71.11  ? 184 ASP A O     1 
ATOM   4184 C CB    . ASP E 5 184 ? 79.629  30.776  110.991 1.00 80.57  ? 184 ASP A CB    1 
ATOM   4185 C CG    . ASP E 5 184 ? 78.293  30.612  110.292 1.00 80.57  ? 184 ASP A CG    1 
ATOM   4186 O OD1   . ASP E 5 184 ? 78.256  30.716  109.048 1.00 80.57  ? 184 ASP A OD1   1 
ATOM   4187 O OD2   . ASP E 5 184 ? 77.280  30.380  110.987 1.00 80.57  ? 184 ASP A OD2   1 
ATOM   4188 N N     . ILE E 5 185 ? 82.934  29.947  111.341 1.00 60.69  ? 185 ILE A N     1 
ATOM   4189 C CA    . ILE E 5 185 ? 84.280  30.485  111.433 1.00 60.69  ? 185 ILE A CA    1 
ATOM   4190 C C     . ILE E 5 185 ? 85.302  29.459  110.936 1.00 60.69  ? 185 ILE A C     1 
ATOM   4191 O O     . ILE E 5 185 ? 85.409  28.350  111.471 1.00 60.69  ? 185 ILE A O     1 
ATOM   4192 C CB    . ILE E 5 185 ? 84.626  30.848  112.892 1.00 100.00 ? 185 ILE A CB    1 
ATOM   4193 C CG1   . ILE E 5 185 ? 83.790  32.015  113.421 1.00 100.00 ? 185 ILE A CG1   1 
ATOM   4194 C CG2   . ILE E 5 185 ? 86.089  31.259  113.067 1.00 100.00 ? 185 ILE A CG2   1 
ATOM   4195 C CD1   . ILE E 5 185 ? 82.786  31.594  114.496 1.00 100.00 ? 185 ILE A CD1   1 
ATOM   4196 N N     . SER E 5 186 ? 86.033  29.863  109.913 1.00 99.87  ? 186 SER A N     1 
ATOM   4197 C CA    . SER E 5 186 ? 87.083  29.026  109.309 1.00 99.87  ? 186 SER A CA    1 
ATOM   4198 C C     . SER E 5 186 ? 88.449  29.648  109.614 1.00 99.87  ? 186 SER A C     1 
ATOM   4199 O O     . SER E 5 186 ? 88.541  30.714  110.234 1.00 99.87  ? 186 SER A O     1 
ATOM   4200 C CB    . SER E 5 186 ? 86.860  28.928  107.798 1.00 70.53  ? 186 SER A CB    1 
ATOM   4201 O OG    . SER E 5 186 ? 88.105  28.877  107.121 1.00 70.53  ? 186 SER A OG    1 
ATOM   4202 N N     . ARG E 5 187 ? 89.487  28.970  109.171 1.00 100.00 ? 187 ARG A N     1 
ATOM   4203 C CA    . ARG E 5 187 ? 90.876  29.415  109.390 1.00 100.00 ? 187 ARG A CA    1 
ATOM   4204 C C     . ARG E 5 187 ? 91.635  29.436  108.053 1.00 100.00 ? 187 ARG A C     1 
ATOM   4205 O O     . ARG E 5 187 ? 91.581  28.475  107.275 1.00 100.00 ? 187 ARG A O     1 
ATOM   4206 C CB    . ARG E 5 187 ? 91.584  28.424  110.324 1.00 100.00 ? 187 ARG A CB    1 
ATOM   4207 C CG    . ARG E 5 187 ? 91.360  28.674  111.824 1.00 100.00 ? 187 ARG A CG    1 
ATOM   4208 C CD    . ARG E 5 187 ? 89.916  28.500  112.287 1.00 100.00 ? 187 ARG A CD    1 
ATOM   4209 N NE    . ARG E 5 187 ? 89.288  27.205  111.980 1.00 100.00 ? 187 ARG A NE    1 
ATOM   4210 C CZ    . ARG E 5 187 ? 88.577  26.527  112.883 1.00 100.00 ? 187 ARG A CZ    1 
ATOM   4211 N NH1   . ARG E 5 187 ? 88.545  26.922  114.167 1.00 100.00 ? 187 ARG A NH1   1 
ATOM   4212 N NH2   . ARG E 5 187 ? 87.794  25.495  112.586 1.00 100.00 ? 187 ARG A NH2   1 
ATOM   4213 N N     . THR E 5 188 ? 92.340  30.532  107.805 1.00 100.00 ? 188 THR A N     1 
ATOM   4214 C CA    . THR E 5 188 ? 93.135  30.693  106.567 1.00 100.00 ? 188 THR A CA    1 
ATOM   4215 C C     . THR E 5 188 ? 93.921  32.011  106.595 1.00 100.00 ? 188 THR A C     1 
ATOM   4216 O O     . THR E 5 188 ? 93.859  32.773  107.567 1.00 100.00 ? 188 THR A O     1 
ATOM   4217 C CB    . THR E 5 188 ? 92.212  30.693  105.344 1.00 100.00 ? 188 THR A CB    1 
ATOM   4218 O OG1   . THR E 5 188 ? 92.984  30.645  104.152 1.00 100.00 ? 188 THR A OG1   1 
ATOM   4219 C CG2   . THR E 5 188 ? 91.324  31.936  105.267 1.00 100.00 ? 188 THR A CG2   1 
ATOM   4220 N N     . ASP E 5 189 ? 94.647  32.232  105.514 1.00 100.00 ? 189 ASP A N     1 
ATOM   4221 C CA    . ASP E 5 189 ? 95.467  33.442  105.326 1.00 100.00 ? 189 ASP A CA    1 
ATOM   4222 C C     . ASP E 5 189 ? 96.483  33.614  106.464 1.00 100.00 ? 189 ASP A C     1 
ATOM   4223 O O     . ASP E 5 189 ? 96.722  34.729  106.948 1.00 100.00 ? 189 ASP A O     1 
ATOM   4224 C CB    . ASP E 5 189 ? 94.577  34.685  105.294 1.00 100.00 ? 189 ASP A CB    1 
ATOM   4225 C CG    . ASP E 5 189 ? 94.592  35.382  103.936 1.00 100.00 ? 189 ASP A CG    1 
ATOM   4226 O OD1   . ASP E 5 189 ? 94.055  34.807  102.915 1.00 100.00 ? 189 ASP A OD1   1 
ATOM   4227 O OD2   . ASP E 5 189 ? 95.144  36.539  103.812 1.00 100.00 ? 189 ASP A OD2   1 
ATOM   4228 N N     . GLY E 5 190 ? 97.069  32.504  106.871 1.00 100.00 ? 190 GLY A N     1 
ATOM   4229 C CA    . GLY E 5 190 ? 98.092  32.499  107.933 1.00 100.00 ? 190 GLY A CA    1 
ATOM   4230 C C     . GLY E 5 190 ? 97.481  32.094  109.275 1.00 100.00 ? 190 GLY A C     1 
ATOM   4231 O O     . GLY E 5 190 ? 96.510  31.332  109.336 1.00 100.00 ? 190 GLY A O     1 
ATOM   4232 N N     . GLY E 5 191 ? 98.072  32.620  110.328 1.00 100.00 ? 191 GLY A N     1 
ATOM   4233 C CA    . GLY E 5 191 ? 97.634  32.329  111.696 1.00 100.00 ? 191 GLY A CA    1 
ATOM   4234 C C     . GLY E 5 191 ? 96.418  33.161  112.055 1.00 100.00 ? 191 GLY A C     1 
ATOM   4235 O O     . GLY E 5 191 ? 96.053  33.270  113.227 1.00 100.00 ? 191 GLY A O     1 
ATOM   4236 N N     . ARG E 5 192 ? 95.794  33.755  111.041 1.00 95.12  ? 192 ARG A N     1 
ATOM   4237 C CA    . ARG E 5 192 ? 94.610  34.582  111.235 1.00 95.12  ? 192 ARG A CA    1 
ATOM   4238 C C     . ARG E 5 192 ? 93.347  33.728  111.203 1.00 95.12  ? 192 ARG A C     1 
ATOM   4239 O O     . ARG E 5 192 ? 93.417  32.509  111.044 1.00 95.12  ? 192 ARG A O     1 
ATOM   4240 C CB    . ARG E 5 192 ? 94.534  35.658  110.149 1.00 93.79  ? 192 ARG A CB    1 
ATOM   4241 C CG    . ARG E 5 192 ? 94.891  37.054  110.635 1.00 93.79  ? 192 ARG A CG    1 
ATOM   4242 C CD    . ARG E 5 192 ? 95.500  37.892  109.522 1.00 93.79  ? 192 ARG A CD    1 
ATOM   4243 N NE    . ARG E 5 192 ? 96.860  38.312  109.846 1.00 93.79  ? 192 ARG A NE    1 
ATOM   4244 C CZ    . ARG E 5 192 ? 97.952  37.771  109.318 1.00 93.79  ? 192 ARG A CZ    1 
ATOM   4245 N NH1   . ARG E 5 192 ? 97.846  36.785  108.437 1.00 93.79  ? 192 ARG A NH1   1 
ATOM   4246 N NH2   . ARG E 5 192 ? 99.150  38.213  109.672 1.00 93.79  ? 192 ARG A NH2   1 
ATOM   4247 N N     . MET E 5 193 ? 92.194  34.374  111.350 1.00 52.47  ? 193 MET A N     1 
ATOM   4248 C CA    . MET E 5 193 ? 90.918  33.670  111.348 1.00 52.47  ? 193 MET A CA    1 
ATOM   4249 C C     . MET E 5 193 ? 89.978  34.193  110.268 1.00 52.47  ? 193 MET A C     1 
ATOM   4250 O O     . MET E 5 193 ? 90.176  35.280  109.729 1.00 52.47  ? 193 MET A O     1 
ATOM   4251 C CB    . MET E 5 193 ? 90.246  33.805  112.717 1.00 99.98  ? 193 MET A CB    1 
ATOM   4252 C CG    . MET E 5 193 ? 90.385  32.582  113.609 1.00 99.98  ? 193 MET A CG    1 
ATOM   4253 S SD    . MET E 5 193 ? 89.536  32.778  115.190 1.00 99.98  ? 193 MET A SD    1 
ATOM   4254 C CE    . MET E 5 193 ? 88.665  31.221  115.304 1.00 99.98  ? 193 MET A CE    1 
ATOM   4255 N N     . LEU E 5 194 ? 88.950  33.408  109.964 1.00 57.48  ? 194 LEU A N     1 
ATOM   4256 C CA    . LEU E 5 194 ? 87.970  33.780  108.952 1.00 57.48  ? 194 LEU A CA    1 
ATOM   4257 C C     . LEU E 5 194 ? 86.557  33.529  109.461 1.00 57.48  ? 194 LEU A C     1 
ATOM   4258 O O     . LEU E 5 194 ? 86.305  32.557  110.171 1.00 57.48  ? 194 LEU A O     1 
ATOM   4259 C CB    . LEU E 5 194 ? 88.198  32.972  107.671 1.00 100.00 ? 194 LEU A CB    1 
ATOM   4260 C CG    . LEU E 5 194 ? 87.100  33.007  106.601 1.00 100.00 ? 194 LEU A CG    1 
ATOM   4261 C CD1   . LEU E 5 194 ? 87.725  32.744  105.242 1.00 100.00 ? 194 LEU A CD1   1 
ATOM   4262 C CD2   . LEU E 5 194 ? 86.022  31.966  106.898 1.00 100.00 ? 194 LEU A CD2   1 
ATOM   4263 N N     . ILE E 5 195 ? 85.637  34.412  109.094 1.00 63.30  ? 195 ILE A N     1 
ATOM   4264 C CA    . ILE E 5 195 ? 84.250  34.270  109.505 1.00 63.30  ? 195 ILE A CA    1 
ATOM   4265 C C     . ILE E 5 195 ? 83.332  34.821  108.419 1.00 63.30  ? 195 ILE A C     1 
ATOM   4266 O O     . ILE E 5 195 ? 83.527  35.932  107.923 1.00 63.30  ? 195 ILE A O     1 
ATOM   4267 C CB    . ILE E 5 195 ? 83.979  34.993  110.866 1.00 65.68  ? 195 ILE A CB    1 
ATOM   4268 C CG1   . ILE E 5 195 ? 82.970  36.128  110.684 1.00 65.68  ? 195 ILE A CG1   1 
ATOM   4269 C CG2   . ILE E 5 195 ? 85.278  35.534  111.446 1.00 65.68  ? 195 ILE A CG2   1 
ATOM   4270 C CD1   . ILE E 5 195 ? 81.589  35.798  111.192 1.00 65.68  ? 195 ILE A CD1   1 
ATOM   4271 N N     . HIS E 5 196 ? 82.338  34.028  108.040 1.00 49.17  ? 196 HIS A N     1 
ATOM   4272 C CA    . HIS E 5 196 ? 81.396  34.444  107.016 1.00 49.17  ? 196 HIS A CA    1 
ATOM   4273 C C     . HIS E 5 196 ? 79.973  34.360  107.562 1.00 49.17  ? 196 HIS A C     1 
ATOM   4274 O O     . HIS E 5 196 ? 79.566  33.335  108.114 1.00 49.17  ? 196 HIS A O     1 
ATOM   4275 C CB    . HIS E 5 196 ? 81.578  33.576  105.761 1.00 100.00 ? 196 HIS A CB    1 
ATOM   4276 C CG    . HIS E 5 196 ? 80.588  32.461  105.629 1.00 100.00 ? 196 HIS A CG    1 
ATOM   4277 N ND1   . HIS E 5 196 ? 80.880  31.159  105.975 1.00 100.00 ? 196 HIS A ND1   1 
ATOM   4278 C CD2   . HIS E 5 196 ? 79.316  32.451  105.164 1.00 100.00 ? 196 HIS A CD2   1 
ATOM   4279 C CE1   . HIS E 5 196 ? 79.831  30.395  105.728 1.00 100.00 ? 196 HIS A CE1   1 
ATOM   4280 N NE2   . HIS E 5 196 ? 78.869  31.153  105.235 1.00 100.00 ? 196 HIS A NE2   1 
ATOM   4281 N N     . ILE E 5 197 ? 79.229  35.454  107.418 1.00 73.57  ? 197 ILE A N     1 
ATOM   4282 C CA    . ILE E 5 197 ? 77.855  35.531  107.913 1.00 73.57  ? 197 ILE A CA    1 
ATOM   4283 C C     . ILE E 5 197 ? 76.842  35.783  106.799 1.00 73.57  ? 197 ILE A C     1 
ATOM   4284 O O     . ILE E 5 197 ? 77.098  35.485  105.636 1.00 73.57  ? 197 ILE A O     1 
ATOM   4285 C CB    . ILE E 5 197 ? 77.701  36.663  108.961 1.00 100.00 ? 197 ILE A CB    1 
ATOM   4286 C CG1   . ILE E 5 197 ? 79.076  37.205  109.359 1.00 100.00 ? 197 ILE A CG1   1 
ATOM   4287 C CG2   . ILE E 5 197 ? 76.956  36.148  110.182 1.00 100.00 ? 197 ILE A CG2   1 
ATOM   4288 C CD1   . ILE E 5 197 ? 79.637  38.225  108.390 1.00 100.00 ? 197 ILE A CD1   1 
ATOM   4289 N N     . GLY E 5 198 ? 75.686  36.328  107.172 1.00 101.62 ? 198 GLY A N     1 
ATOM   4290 C CA    . GLY E 5 198 ? 74.650  36.625  106.199 1.00 101.62 ? 198 GLY A CA    1 
ATOM   4291 C C     . GLY E 5 198 ? 74.819  38.018  105.626 1.00 101.62 ? 198 GLY A C     1 
ATOM   4292 O O     . GLY E 5 198 ? 75.222  38.177  104.475 1.00 101.62 ? 198 GLY A O     1 
ATOM   4293 N N     . ARG E 5 199 ? 74.511  39.029  106.433 1.00 101.62 ? 199 ARG A N     1 
ATOM   4294 C CA    . ARG E 5 199 ? 74.645  40.419  106.003 1.00 101.62 ? 199 ARG A CA    1 
ATOM   4295 C C     . ARG E 5 199 ? 73.959  40.688  104.654 1.00 101.62 ? 199 ARG A C     1 
ATOM   4296 O O     . ARG E 5 199 ? 74.605  40.638  103.608 1.00 101.62 ? 199 ARG A O     1 
ATOM   4297 C CB    . ARG E 5 199 ? 76.136  40.775  105.918 1.00 101.62 ? 199 ARG A CB    1 
ATOM   4298 C CG    . ARG E 5 199 ? 76.446  42.252  105.721 1.00 101.62 ? 199 ARG A CG    1 
ATOM   4299 C CD    . ARG E 5 199 ? 77.949  42.470  105.571 1.00 101.62 ? 199 ARG A CD    1 
ATOM   4300 N NE    . ARG E 5 199 ? 78.436  43.612  106.342 1.00 101.62 ? 199 ARG A NE    1 
ATOM   4301 C CZ    . ARG E 5 199 ? 78.250  43.770  107.649 1.00 101.62 ? 199 ARG A CZ    1 
ATOM   4302 N NH1   . ARG E 5 199 ? 77.584  42.859  108.344 1.00 101.62 ? 199 ARG A NH1   1 
ATOM   4303 N NH2   . ARG E 5 199 ? 78.731  44.843  108.264 1.00 101.62 ? 199 ARG A NH2   1 
ATOM   4304 N N     . THR E 5 200 ? 72.654  40.973  104.718 1.00 101.62 ? 200 THR A N     1 
ATOM   4305 C CA    . THR E 5 200 ? 71.754  41.267  103.577 1.00 101.62 ? 200 THR A CA    1 
ATOM   4306 C C     . THR E 5 200 ? 70.738  40.131  103.454 1.00 101.62 ? 200 THR A C     1 
ATOM   4307 O O     . THR E 5 200 ? 70.942  39.069  104.044 1.00 101.62 ? 200 THR A O     1 
ATOM   4308 C CB    . THR E 5 200 ? 72.478  41.378  102.201 1.00 101.62 ? 200 THR A CB    1 
ATOM   4309 O OG1   . THR E 5 200 ? 73.137  40.138  101.900 1.00 101.62 ? 200 THR A OG1   1 
ATOM   4310 C CG2   . THR E 5 200 ? 73.467  42.544  102.185 1.00 101.62 ? 200 THR A CG2   1 
ATOM   4311 N N     . LYS E 5 201 ? 69.655  40.354  102.701 1.00 101.62 ? 201 LYS A N     1 
ATOM   4312 C CA    . LYS E 5 201 ? 68.629  39.320  102.497 1.00 101.62 ? 201 LYS A CA    1 
ATOM   4313 C C     . LYS E 5 201 ? 67.259  39.721  101.921 1.00 101.62 ? 201 LYS A C     1 
ATOM   4314 O O     . LYS E 5 201 ? 66.306  39.959  102.668 1.00 101.62 ? 201 LYS A O     1 
ATOM   4315 C CB    . LYS E 5 201 ? 68.394  38.543  103.800 1.00 90.22  ? 201 LYS A CB    1 
ATOM   4316 C CG    . LYS E 5 201 ? 68.695  37.042  103.699 1.00 90.22  ? 201 LYS A CG    1 
ATOM   4317 C CD    . LYS E 5 201 ? 69.903  36.743  102.804 1.00 90.22  ? 201 LYS A CD    1 
ATOM   4318 C CE    . LYS E 5 201 ? 69.611  35.624  101.810 1.00 90.22  ? 201 LYS A CE    1 
ATOM   4319 N NZ    . LYS E 5 201 ? 68.227  35.674  101.255 1.00 90.22  ? 201 LYS A NZ    1 
ATOM   4320 N N     . THR E 5 202 ? 67.178  39.793  100.592 1.00 101.62 ? 202 THR A N     1 
ATOM   4321 C CA    . THR E 5 202 ? 65.943  40.092  99.852  1.00 101.62 ? 202 THR A CA    1 
ATOM   4322 C C     . THR E 5 202 ? 66.230  39.811  98.372  1.00 101.62 ? 202 THR A C     1 
ATOM   4323 O O     . THR E 5 202 ? 66.113  40.684  97.516  1.00 101.62 ? 202 THR A O     1 
ATOM   4324 C CB    . THR E 5 202 ? 65.440  41.574  100.033 1.00 101.62 ? 202 THR A CB    1 
ATOM   4325 O OG1   . THR E 5 202 ? 65.504  42.271  98.785  1.00 101.62 ? 202 THR A OG1   1 
ATOM   4326 C CG2   . THR E 5 202 ? 66.267  42.322  101.060 1.00 101.62 ? 202 THR A CG2   1 
ATOM   4327 N N     . LEU E 5 203 ? 66.606  38.570  98.082  1.00 101.62 ? 203 LEU A N     1 
ATOM   4328 C CA    . LEU E 5 203 ? 66.947  38.152  96.725  1.00 101.62 ? 203 LEU A CA    1 
ATOM   4329 C C     . LEU E 5 203 ? 68.287  38.786  96.374  1.00 101.62 ? 203 LEU A C     1 
ATOM   4330 O O     . LEU E 5 203 ? 69.309  38.104  96.326  1.00 101.62 ? 203 LEU A O     1 
ATOM   4331 C CB    . LEU E 5 203 ? 65.869  38.591  95.727  1.00 101.62 ? 203 LEU A CB    1 
ATOM   4332 C CG    . LEU E 5 203 ? 64.855  37.516  95.317  1.00 101.62 ? 203 LEU A CG    1 
ATOM   4333 C CD1   . LEU E 5 203 ? 65.589  36.287  94.797  1.00 101.62 ? 203 LEU A CD1   1 
ATOM   4334 C CD2   . LEU E 5 203 ? 63.983  37.148  96.509  1.00 101.62 ? 203 LEU A CD2   1 
ATOM   4335 N N     . VAL E 5 204 ? 68.281  40.093  96.132  1.00 101.62 ? 204 VAL A N     1 
ATOM   4336 C CA    . VAL E 5 204 ? 69.512  40.803  95.819  1.00 101.62 ? 204 VAL A CA    1 
ATOM   4337 C C     . VAL E 5 204 ? 70.280  40.977  97.132  1.00 101.62 ? 204 VAL A C     1 
ATOM   4338 O O     . VAL E 5 204 ? 69.804  41.630  98.069  1.00 101.62 ? 204 VAL A O     1 
ATOM   4339 C CB    . VAL E 5 204 ? 69.230  42.199  95.222  1.00 101.62 ? 204 VAL A CB    1 
ATOM   4340 C CG1   . VAL E 5 204 ? 70.443  43.128  95.294  1.00 101.62 ? 204 VAL A CG1   1 
ATOM   4341 C CG2   . VAL E 5 204 ? 68.825  42.139  93.748  1.00 101.62 ? 204 VAL A CG2   1 
ATOM   4342 N N     . SER E 5 205 ? 71.445  40.374  97.180  1.00 101.62 ? 205 SER A N     1 
ATOM   4343 C CA    . SER E 5 205 ? 72.306  40.417  98.372  1.00 101.62 ? 205 SER A CA    1 
ATOM   4344 C C     . SER E 5 205 ? 73.537  39.559  98.122  1.00 101.62 ? 205 SER A C     1 
ATOM   4345 O O     . SER E 5 205 ? 73.690  38.955  97.056  1.00 101.62 ? 205 SER A O     1 
ATOM   4346 C CB    . SER E 5 205 ? 71.538  39.875  99.584  1.00 101.62 ? 205 SER A CB    1 
ATOM   4347 O OG    . SER E 5 205 ? 71.711  38.468  99.680  1.00 101.62 ? 205 SER A OG    1 
ATOM   4348 N N     . THR E 5 206 ? 74.407  39.515  99.106  1.00 101.62 ? 206 THR A N     1 
ATOM   4349 C CA    . THR E 5 206 ? 75.633  38.717  99.001  1.00 101.62 ? 206 THR A CA    1 
ATOM   4350 C C     . THR E 5 206 ? 75.585  37.567  99.995  1.00 101.62 ? 206 THR A C     1 
ATOM   4351 O O     . THR E 5 206 ? 76.095  37.679  101.125 1.00 101.62 ? 206 THR A O     1 
ATOM   4352 C CB    . THR E 5 206 ? 76.862  39.584  99.281  1.00 101.62 ? 206 THR A CB    1 
ATOM   4353 O OG1   . THR E 5 206 ? 77.964  38.762  99.640  1.00 101.62 ? 206 THR A OG1   1 
ATOM   4354 C CG2   . THR E 5 206 ? 76.643  40.585  100.414 1.00 101.62 ? 206 THR A CG2   1 
ATOM   4355 N N     . ALA E 5 207 ? 74.966  36.486  99.543  1.00 100.00 ? 207 ALA A N     1 
ATOM   4356 C CA    . ALA E 5 207 ? 74.831  35.294  100.368 1.00 100.00 ? 207 ALA A CA    1 
ATOM   4357 C C     . ALA E 5 207 ? 75.595  35.574  101.627 1.00 100.00 ? 207 ALA A C     1 
ATOM   4358 O O     . ALA E 5 207 ? 75.035  35.619  102.727 1.00 100.00 ? 207 ALA A O     1 
ATOM   4359 C CB    . ALA E 5 207 ? 75.417  34.077  99.649  1.00 100.00 ? 207 ALA A CB    1 
ATOM   4360 N N     . GLY E 5 208 ? 76.863  35.808  101.424 1.00 100.00 ? 208 GLY A N     1 
ATOM   4361 C CA    . GLY E 5 208 ? 77.709  36.088  102.546 1.00 100.00 ? 208 GLY A CA    1 
ATOM   4362 C C     . GLY E 5 208 ? 79.057  36.604  102.143 1.00 100.00 ? 208 GLY A C     1 
ATOM   4363 O O     . GLY E 5 208 ? 79.532  36.400  101.021 1.00 100.00 ? 208 GLY A O     1 
ATOM   4364 N N     . VAL E 5 209 ? 79.632  37.223  103.117 1.00 78.93  ? 209 VAL A N     1 
ATOM   4365 C CA    . VAL E 5 209 ? 80.932  37.792  102.974 1.00 78.93  ? 209 VAL A CA    1 
ATOM   4366 C C     . VAL E 5 209 ? 81.917  36.980  103.770 1.00 78.93  ? 209 VAL A C     1 
ATOM   4367 O O     . VAL E 5 209 ? 81.723  35.775  104.005 1.00 78.93  ? 209 VAL A O     1 
ATOM   4368 C CB    . VAL E 5 209 ? 80.887  39.229  103.440 1.00 86.40  ? 209 VAL A CB    1 
ATOM   4369 C CG1   . VAL E 5 209 ? 79.898  40.070  102.628 1.00 86.40  ? 209 VAL A CG1   1 
ATOM   4370 C CG2   . VAL E 5 209 ? 80.466  39.366  104.900 1.00 86.40  ? 209 VAL A CG2   1 
ATOM   4371 N N     . GLU E 5 210 ? 82.969  37.646  104.179 1.00 83.14  ? 210 GLU A N     1 
ATOM   4372 C CA    . GLU E 5 210 ? 83.991  36.945  104.911 1.00 83.14  ? 210 GLU A CA    1 
ATOM   4373 C C     . GLU E 5 210 ? 84.945  37.824  105.698 1.00 83.14  ? 210 GLU A C     1 
ATOM   4374 O O     . GLU E 5 210 ? 86.119  37.939  105.351 1.00 83.14  ? 210 GLU A O     1 
ATOM   4375 C CB    . GLU E 5 210 ? 84.841  36.109  103.959 1.00 99.81  ? 210 GLU A CB    1 
ATOM   4376 C CG    . GLU E 5 210 ? 85.007  34.668  104.437 1.00 99.81  ? 210 GLU A CG    1 
ATOM   4377 C CD    . GLU E 5 210 ? 84.675  33.640  103.359 1.00 99.81  ? 210 GLU A CD    1 
ATOM   4378 O OE1   . GLU E 5 210 ? 83.490  33.595  102.855 1.00 99.81  ? 210 GLU A OE1   1 
ATOM   4379 O OE2   . GLU E 5 210 ? 85.583  32.820  102.958 1.00 99.81  ? 210 GLU A OE2   1 
ATOM   4380 N N     . LYS E 5 211 ? 84.448  38.439  106.762 1.00 52.55  ? 211 LYS A N     1 
ATOM   4381 C CA    . LYS E 5 211 ? 85.299  39.282  107.588 1.00 52.55  ? 211 LYS A CA    1 
ATOM   4382 C C     . LYS E 5 211 ? 86.396  38.395  108.168 1.00 52.55  ? 211 LYS A C     1 
ATOM   4383 O O     . LYS E 5 211 ? 86.127  37.277  108.612 1.00 52.55  ? 211 LYS A O     1 
ATOM   4384 C CB    . LYS E 5 211 ? 84.481  39.923  108.714 1.00 73.52  ? 211 LYS A CB    1 
ATOM   4385 C CG    . LYS E 5 211 ? 83.328  40.806  108.234 1.00 73.52  ? 211 LYS A CG    1 
ATOM   4386 C CD    . LYS E 5 211 ? 83.729  41.678  107.045 1.00 73.52  ? 211 LYS A CD    1 
ATOM   4387 C CE    . LYS E 5 211 ? 83.581  43.170  107.342 1.00 73.52  ? 211 LYS A CE    1 
ATOM   4388 N NZ    . LYS E 5 211 ? 84.607  43.982  106.615 1.00 73.52  ? 211 LYS A NZ    1 
ATOM   4389 N N     . ALA E 5 212 ? 87.632  38.888  108.155 1.00 65.76  ? 212 ALA A N     1 
ATOM   4390 C CA    . ALA E 5 212 ? 88.762  38.122  108.673 1.00 65.76  ? 212 ALA A CA    1 
ATOM   4391 C C     . ALA E 5 212 ? 89.468  38.841  109.819 1.00 65.76  ? 212 ALA A C     1 
ATOM   4392 O O     . ALA E 5 212 ? 90.008  39.934  109.643 1.00 65.76  ? 212 ALA A O     1 
ATOM   4393 C CB    . ALA E 5 212 ? 89.749  37.836  107.554 1.00 98.42  ? 212 ALA A CB    1 
ATOM   4394 N N     . LEU E 5 213 ? 89.471  38.213  110.990 1.00 46.23  ? 213 LEU A N     1 
ATOM   4395 C CA    . LEU E 5 213 ? 90.109  38.791  112.164 1.00 46.23  ? 213 LEU A CA    1 
ATOM   4396 C C     . LEU E 5 213 ? 91.619  38.857  111.978 1.00 46.23  ? 213 LEU A C     1 
ATOM   4397 O O     . LEU E 5 213 ? 92.207  38.017  111.302 1.00 46.23  ? 213 LEU A O     1 
ATOM   4398 C CB    . LEU E 5 213 ? 89.780  37.958  113.406 1.00 44.98  ? 213 LEU A CB    1 
ATOM   4399 C CG    . LEU E 5 213 ? 88.413  37.269  113.414 1.00 44.98  ? 213 LEU A CG    1 
ATOM   4400 C CD1   . LEU E 5 213 ? 88.287  36.392  114.646 1.00 44.98  ? 213 LEU A CD1   1 
ATOM   4401 C CD2   . LEU E 5 213 ? 87.311  38.316  113.385 1.00 44.98  ? 213 LEU A CD2   1 
ATOM   4402 N N     . SER E 5 214 ? 92.239  39.864  112.578 1.00 56.02  ? 214 SER A N     1 
ATOM   4403 C CA    . SER E 5 214 ? 93.681  40.033  112.484 1.00 56.02  ? 214 SER A CA    1 
ATOM   4404 C C     . SER E 5 214 ? 94.380  38.995  113.355 1.00 56.02  ? 214 SER A C     1 
ATOM   4405 O O     . SER E 5 214 ? 93.743  38.079  113.878 1.00 56.02  ? 214 SER A O     1 
ATOM   4406 C CB    . SER E 5 214 ? 94.072  41.437  112.947 1.00 43.32  ? 214 SER A CB    1 
ATOM   4407 O OG    . SER E 5 214 ? 93.048  42.003  113.747 1.00 43.32  ? 214 SER A OG    1 
ATOM   4408 N N     . LEU E 5 215 ? 95.692  39.140  113.503 1.00 52.68  ? 215 LEU A N     1 
ATOM   4409 C CA    . LEU E 5 215 ? 96.474  38.224  114.320 1.00 52.68  ? 215 LEU A CA    1 
ATOM   4410 C C     . LEU E 5 215 ? 96.203  38.531  115.785 1.00 52.68  ? 215 LEU A C     1 
ATOM   4411 O O     . LEU E 5 215 ? 96.092  37.627  116.613 1.00 52.68  ? 215 LEU A O     1 
ATOM   4412 C CB    . LEU E 5 215 ? 97.965  38.401  114.030 1.00 99.90  ? 215 LEU A CB    1 
ATOM   4413 C CG    . LEU E 5 215 ? 98.581  37.512  112.949 1.00 99.90  ? 215 LEU A CG    1 
ATOM   4414 C CD1   . LEU E 5 215 ? 100.047 37.878  112.767 1.00 99.90  ? 215 LEU A CD1   1 
ATOM   4415 C CD2   . LEU E 5 215 ? 98.437  36.050  113.341 1.00 99.90  ? 215 LEU A CD2   1 
ATOM   4416 N N     . GLY E 5 216 ? 96.096  39.820  116.090 1.00 100.00 ? 216 GLY A N     1 
ATOM   4417 C CA    . GLY E 5 216 ? 95.842  40.249  117.452 1.00 100.00 ? 216 GLY A CA    1 
ATOM   4418 C C     . GLY E 5 216 ? 94.366  40.404  117.768 1.00 100.00 ? 216 GLY A C     1 
ATOM   4419 O O     . GLY E 5 216 ? 93.938  41.440  118.276 1.00 100.00 ? 216 GLY A O     1 
ATOM   4420 N N     . VAL E 5 217 ? 93.590  39.372  117.457 1.00 45.66  ? 217 VAL A N     1 
ATOM   4421 C CA    . VAL E 5 217 ? 92.154  39.359  117.715 1.00 45.66  ? 217 VAL A CA    1 
ATOM   4422 C C     . VAL E 5 217 ? 91.731  37.903  117.683 1.00 45.66  ? 217 VAL A C     1 
ATOM   4423 O O     . VAL E 5 217 ? 90.833  37.483  118.413 1.00 45.66  ? 217 VAL A O     1 
ATOM   4424 C CB    . VAL E 5 217 ? 91.358  40.117  116.633 1.00 13.50  ? 217 VAL A CB    1 
ATOM   4425 C CG1   . VAL E 5 217 ? 89.891  39.697  116.680 1.00 13.50  ? 217 VAL A CG1   1 
ATOM   4426 C CG2   . VAL E 5 217 ? 91.475  41.614  116.849 1.00 13.50  ? 217 VAL A CG2   1 
ATOM   4427 N N     . THR E 5 218 ? 92.390  37.139  116.817 1.00 72.11  ? 218 THR A N     1 
ATOM   4428 C CA    . THR E 5 218 ? 92.111  35.718  116.677 1.00 72.11  ? 218 THR A CA    1 
ATOM   4429 C C     . THR E 5 218 ? 92.556  35.012  117.950 1.00 72.11  ? 218 THR A C     1 
ATOM   4430 O O     . THR E 5 218 ? 91.919  34.058  118.398 1.00 72.11  ? 218 THR A O     1 
ATOM   4431 C CB    . THR E 5 218 ? 92.872  35.116  115.481 1.00 57.03  ? 218 THR A CB    1 
ATOM   4432 O OG1   . THR E 5 218 ? 92.867  33.688  115.580 1.00 57.03  ? 218 THR A OG1   1 
ATOM   4433 C CG2   . THR E 5 218 ? 94.310  35.612  115.461 1.00 57.03  ? 218 THR A CG2   1 
ATOM   4434 N N     . LYS E 5 219 ? 93.654  35.495  118.529 1.00 68.53  ? 219 LYS A N     1 
ATOM   4435 C CA    . LYS E 5 219 ? 94.195  34.924  119.756 1.00 68.53  ? 219 LYS A CA    1 
ATOM   4436 C C     . LYS E 5 219 ? 93.290  35.255  120.940 1.00 68.53  ? 219 LYS A C     1 
ATOM   4437 O O     . LYS E 5 219 ? 93.408  34.657  122.010 1.00 68.53  ? 219 LYS A O     1 
ATOM   4438 C CB    . LYS E 5 219 ? 95.610  35.455  120.010 1.00 95.42  ? 219 LYS A CB    1 
ATOM   4439 C CG    . LYS E 5 219 ? 95.684  36.639  120.963 1.00 95.42  ? 219 LYS A CG    1 
ATOM   4440 C CD    . LYS E 5 219 ? 96.540  36.322  122.181 1.00 95.42  ? 219 LYS A CD    1 
ATOM   4441 C CE    . LYS E 5 219 ? 95.754  36.506  123.470 1.00 95.42  ? 219 LYS A CE    1 
ATOM   4442 N NZ    . LYS E 5 219 ? 96.591  36.257  124.674 1.00 95.42  ? 219 LYS A NZ    1 
ATOM   4443 N N     . LEU E 5 220 ? 92.394  36.217  120.743 1.00 42.58  ? 220 LEU A N     1 
ATOM   4444 C CA    . LEU E 5 220 ? 91.459  36.618  121.786 1.00 42.58  ? 220 LEU A CA    1 
ATOM   4445 C C     . LEU E 5 220 ? 90.188  35.794  121.639 1.00 42.58  ? 220 LEU A C     1 
ATOM   4446 O O     . LEU E 5 220 ? 89.519  35.484  122.625 1.00 42.58  ? 220 LEU A O     1 
ATOM   4447 C CB    . LEU E 5 220 ? 91.119  38.105  121.662 1.00 29.78  ? 220 LEU A CB    1 
ATOM   4448 C CG    . LEU E 5 220 ? 92.198  39.126  122.031 1.00 29.78  ? 220 LEU A CG    1 
ATOM   4449 C CD1   . LEU E 5 220 ? 91.601  40.523  121.974 1.00 29.78  ? 220 LEU A CD1   1 
ATOM   4450 C CD2   . LEU E 5 220 ? 92.745  38.834  123.418 1.00 29.78  ? 220 LEU A CD2   1 
ATOM   4451 N N     . VAL E 5 221 ? 89.862  35.442  120.399 1.00 45.87  ? 221 VAL A N     1 
ATOM   4452 C CA    . VAL E 5 221 ? 88.672  34.649  120.115 1.00 45.87  ? 221 VAL A CA    1 
ATOM   4453 C C     . VAL E 5 221 ? 88.918  33.174  120.403 1.00 45.87  ? 221 VAL A C     1 
ATOM   4454 O O     . VAL E 5 221 ? 87.981  32.414  120.647 1.00 45.87  ? 221 VAL A O     1 
ATOM   4455 C CB    . VAL E 5 221 ? 88.238  34.795  118.644 1.00 33.80  ? 221 VAL A CB    1 
ATOM   4456 C CG1   . VAL E 5 221 ? 86.833  34.245  118.459 1.00 33.80  ? 221 VAL A CG1   1 
ATOM   4457 C CG2   . VAL E 5 221 ? 88.293  36.253  118.234 1.00 33.80  ? 221 VAL A CG2   1 
ATOM   4458 N N     . GLU E 5 222 ? 90.184  32.772  120.369 1.00 70.38  ? 222 GLU A N     1 
ATOM   4459 C CA    . GLU E 5 222 ? 90.549  31.386  120.639 1.00 70.38  ? 222 GLU A CA    1 
ATOM   4460 C C     . GLU E 5 222 ? 90.619  31.162  122.144 1.00 70.38  ? 222 GLU A C     1 
ATOM   4461 O O     . GLU E 5 222 ? 90.253  30.099  122.642 1.00 70.38  ? 222 GLU A O     1 
ATOM   4462 C CB    . GLU E 5 222 ? 91.899  31.060  119.996 1.00 99.92  ? 222 GLU A CB    1 
ATOM   4463 C CG    . GLU E 5 222 ? 91.872  31.076  118.477 1.00 99.92  ? 222 GLU A CG    1 
ATOM   4464 C CD    . GLU E 5 222 ? 93.075  30.390  117.863 1.00 99.92  ? 222 GLU A CD    1 
ATOM   4465 O OE1   . GLU E 5 222 ? 94.207  30.883  118.056 1.00 99.92  ? 222 GLU A OE1   1 
ATOM   4466 O OE2   . GLU E 5 222 ? 92.889  29.356  117.186 1.00 99.92  ? 222 GLU A OE2   1 
ATOM   4467 N N     . ARG E 5 223 ? 91.092  32.175  122.863 1.00 59.16  ? 223 ARG A N     1 
ATOM   4468 C CA    . ARG E 5 223 ? 91.195  32.096  124.314 1.00 59.16  ? 223 ARG A CA    1 
ATOM   4469 C C     . ARG E 5 223 ? 89.796  32.037  124.915 1.00 59.16  ? 223 ARG A C     1 
ATOM   4470 O O     . ARG E 5 223 ? 89.627  31.719  126.092 1.00 59.16  ? 223 ARG A O     1 
ATOM   4471 C CB    . ARG E 5 223 ? 91.942  33.315  124.861 1.00 74.50  ? 223 ARG A CB    1 
ATOM   4472 C CG    . ARG E 5 223 ? 92.558  33.102  126.236 1.00 74.50  ? 223 ARG A CG    1 
ATOM   4473 C CD    . ARG E 5 223 ? 92.323  34.303  127.140 1.00 74.50  ? 223 ARG A CD    1 
ATOM   4474 N NE    . ARG E 5 223 ? 93.530  34.692  127.863 1.00 74.50  ? 223 ARG A NE    1 
ATOM   4475 C CZ    . ARG E 5 223 ? 93.583  34.900  129.176 1.00 74.50  ? 223 ARG A CZ    1 
ATOM   4476 N NH1   . ARG E 5 223 ? 92.495  34.758  129.923 1.00 74.50  ? 223 ARG A NH1   1 
ATOM   4477 N NH2   . ARG E 5 223 ? 94.727  35.253  129.742 1.00 74.50  ? 223 ARG A NH2   1 
ATOM   4478 N N     . TRP E 5 224 ? 88.795  32.351  124.097 1.00 59.74  ? 224 TRP A N     1 
ATOM   4479 C CA    . TRP E 5 224 ? 87.407  32.329  124.538 1.00 59.74  ? 224 TRP A CA    1 
ATOM   4480 C C     . TRP E 5 224 ? 86.772  30.976  124.232 1.00 59.74  ? 224 TRP A C     1 
ATOM   4481 O O     . TRP E 5 224 ? 86.077  30.406  125.070 1.00 59.74  ? 224 TRP A O     1 
ATOM   4482 C CB    . TRP E 5 224 ? 86.610  33.439  123.845 1.00 37.55  ? 224 TRP A CB    1 
ATOM   4483 C CG    . TRP E 5 224 ? 85.157  33.107  123.660 1.00 37.55  ? 224 TRP A CG    1 
ATOM   4484 C CD1   . TRP E 5 224 ? 84.506  32.904  122.475 1.00 37.55  ? 224 TRP A CD1   1 
ATOM   4485 C CD2   . TRP E 5 224 ? 84.180  32.917  124.691 1.00 37.55  ? 224 TRP A CD2   1 
ATOM   4486 N NE1   . TRP E 5 224 ? 83.187  32.599  122.707 1.00 37.55  ? 224 TRP A NE1   1 
ATOM   4487 C CE2   . TRP E 5 224 ? 82.957  32.600  124.056 1.00 37.55  ? 224 TRP A CE2   1 
ATOM   4488 C CE3   . TRP E 5 224 ? 84.217  32.984  126.091 1.00 37.55  ? 224 TRP A CE3   1 
ATOM   4489 C CZ2   . TRP E 5 224 ? 81.782  32.350  124.773 1.00 37.55  ? 224 TRP A CZ2   1 
ATOM   4490 C CZ3   . TRP E 5 224 ? 83.047  32.734  126.804 1.00 37.55  ? 224 TRP A CZ3   1 
ATOM   4491 C CH2   . TRP E 5 224 ? 81.847  32.422  126.142 1.00 37.55  ? 224 TRP A CH2   1 
ATOM   4492 N N     . ILE E 5 225 ? 87.015  30.471  123.027 1.00 49.64  ? 225 ILE A N     1 
ATOM   4493 C CA    . ILE E 5 225 ? 86.464  29.189  122.607 1.00 49.64  ? 225 ILE A CA    1 
ATOM   4494 C C     . ILE E 5 225 ? 87.059  28.030  123.399 1.00 49.64  ? 225 ILE A C     1 
ATOM   4495 O O     . ILE E 5 225 ? 86.416  26.996  123.577 1.00 49.64  ? 225 ILE A O     1 
ATOM   4496 C CB    . ILE E 5 225 ? 86.720  28.943  121.108 1.00 60.29  ? 225 ILE A CB    1 
ATOM   4497 C CG1   . ILE E 5 225 ? 86.022  30.023  120.281 1.00 60.29  ? 225 ILE A CG1   1 
ATOM   4498 C CG2   . ILE E 5 225 ? 86.208  27.570  120.707 1.00 60.29  ? 225 ILE A CG2   1 
ATOM   4499 C CD1   . ILE E 5 225 ? 86.578  30.180  118.881 1.00 60.29  ? 225 ILE A CD1   1 
ATOM   4500 N N     . SER E 5 226 ? 88.289  28.207  123.870 1.00 74.33  ? 226 SER A N     1 
ATOM   4501 C CA    . SER E 5 226 ? 88.971  27.174  124.641 1.00 74.33  ? 226 SER A CA    1 
ATOM   4502 C C     . SER E 5 226 ? 88.462  27.125  126.077 1.00 74.33  ? 226 SER A C     1 
ATOM   4503 O O     . SER E 5 226 ? 88.388  26.057  126.683 1.00 74.33  ? 226 SER A O     1 
ATOM   4504 C CB    . SER E 5 226 ? 90.482  27.425  124.641 1.00 70.46  ? 226 SER A CB    1 
ATOM   4505 O OG    . SER E 5 226 ? 90.879  28.175  125.777 1.00 70.46  ? 226 SER A OG    1 
ATOM   4506 N N     . VAL E 5 227 ? 88.116  28.289  126.618 1.00 50.58  ? 227 VAL A N     1 
ATOM   4507 C CA    . VAL E 5 227 ? 87.616  28.380  127.984 1.00 50.58  ? 227 VAL A CA    1 
ATOM   4508 C C     . VAL E 5 227 ? 86.097  28.263  128.029 1.00 50.58  ? 227 VAL A C     1 
ATOM   4509 O O     . VAL E 5 227 ? 85.520  27.940  129.065 1.00 50.58  ? 227 VAL A O     1 
ATOM   4510 C CB    . VAL E 5 227 ? 88.031  29.713  128.638 1.00 68.92  ? 227 VAL A CB    1 
ATOM   4511 C CG1   . VAL E 5 227 ? 87.621  29.726  130.101 1.00 68.92  ? 227 VAL A CG1   1 
ATOM   4512 C CG2   . VAL E 5 227 ? 89.533  29.903  128.511 1.00 68.92  ? 227 VAL A CG2   1 
ATOM   4513 N N     . SER E 5 228 ? 85.452  28.527  126.899 1.00 44.05  ? 228 SER A N     1 
ATOM   4514 C CA    . SER E 5 228 ? 83.999  28.445  126.815 1.00 44.05  ? 228 SER A CA    1 
ATOM   4515 C C     . SER E 5 228 ? 83.582  27.048  126.374 1.00 44.05  ? 228 SER A C     1 
ATOM   4516 O O     . SER E 5 228 ? 82.583  26.507  126.851 1.00 44.05  ? 228 SER A O     1 
ATOM   4517 C CB    . SER E 5 228 ? 83.466  29.475  125.818 1.00 69.31  ? 228 SER A CB    1 
ATOM   4518 O OG    . SER E 5 228 ? 83.937  29.208  124.508 1.00 69.31  ? 228 SER A OG    1 
ATOM   4519 N N     . GLY E 5 229 ? 84.356  26.473  125.459 1.00 68.71  ? 229 GLY A N     1 
ATOM   4520 C CA    . GLY E 5 229 ? 84.064  25.141  124.960 1.00 68.71  ? 229 GLY A CA    1 
ATOM   4521 C C     . GLY E 5 229 ? 83.035  25.113  123.846 1.00 68.71  ? 229 GLY A C     1 
ATOM   4522 O O     . GLY E 5 229 ? 82.445  24.067  123.567 1.00 68.71  ? 229 GLY A O     1 
ATOM   4523 N N     . VAL E 5 230 ? 82.813  26.256  123.205 1.00 50.47  ? 230 VAL A N     1 
ATOM   4524 C CA    . VAL E 5 230 ? 81.842  26.337  122.117 1.00 50.47  ? 230 VAL A CA    1 
ATOM   4525 C C     . VAL E 5 230 ? 82.228  25.413  120.967 1.00 50.47  ? 230 VAL A C     1 
ATOM   4526 O O     . VAL E 5 230 ? 81.437  25.178  120.052 1.00 50.47  ? 230 VAL A O     1 
ATOM   4527 C CB    . VAL E 5 230 ? 81.722  27.779  121.566 1.00 60.39  ? 230 VAL A CB    1 
ATOM   4528 C CG1   . VAL E 5 230 ? 80.611  28.520  122.288 1.00 60.39  ? 230 VAL A CG1   1 
ATOM   4529 C CG2   . VAL E 5 230 ? 83.043  28.514  121.722 1.00 60.39  ? 230 VAL A CG2   1 
ATOM   4530 N N     . ALA E 5 231 ? 83.448  24.889  121.023 1.00 97.64  ? 231 ALA A N     1 
ATOM   4531 C CA    . ALA E 5 231 ? 83.958  23.997  119.989 1.00 97.64  ? 231 ALA A CA    1 
ATOM   4532 C C     . ALA E 5 231 ? 83.406  22.580  120.111 1.00 97.64  ? 231 ALA A C     1 
ATOM   4533 O O     . ALA E 5 231 ? 83.653  21.735  119.251 1.00 97.64  ? 231 ALA A O     1 
ATOM   4534 C CB    . ALA E 5 231 ? 85.480  23.968  120.039 1.00 77.90  ? 231 ALA A CB    1 
ATOM   4535 N N     . ASP E 5 232 ? 82.658  22.320  121.177 1.00 74.77  ? 232 ASP A N     1 
ATOM   4536 C CA    . ASP E 5 232 ? 82.082  20.999  121.393 1.00 74.77  ? 232 ASP A CA    1 
ATOM   4537 C C     . ASP E 5 232 ? 80.854  20.768  120.518 1.00 74.77  ? 232 ASP A C     1 
ATOM   4538 O O     . ASP E 5 232 ? 80.058  19.865  120.777 1.00 74.77  ? 232 ASP A O     1 
ATOM   4539 C CB    . ASP E 5 232 ? 81.710  20.830  122.866 1.00 79.92  ? 232 ASP A CB    1 
ATOM   4540 C CG    . ASP E 5 232 ? 82.914  20.911  123.780 1.00 79.92  ? 232 ASP A CG    1 
ATOM   4541 O OD1   . ASP E 5 232 ? 84.051  20.849  123.269 1.00 79.92  ? 232 ASP A OD1   1 
ATOM   4542 O OD2   . ASP E 5 232 ? 82.725  21.037  125.009 1.00 79.92  ? 232 ASP A OD2   1 
ATOM   4543 N N     . ASP E 5 233 ? 80.711  21.589  119.481 1.00 83.78  ? 233 ASP A N     1 
ATOM   4544 C CA    . ASP E 5 233 ? 79.588  21.489  118.554 1.00 83.78  ? 233 ASP A CA    1 
ATOM   4545 C C     . ASP E 5 233 ? 79.634  22.659  117.576 1.00 83.78  ? 233 ASP A C     1 
ATOM   4546 O O     . ASP E 5 233 ? 79.317  23.792  117.936 1.00 83.78  ? 233 ASP A O     1 
ATOM   4547 C CB    . ASP E 5 233 ? 78.258  21.511  119.317 1.00 79.64  ? 233 ASP A CB    1 
ATOM   4548 C CG    . ASP E 5 233 ? 77.070  21.147  118.440 1.00 79.64  ? 233 ASP A CG    1 
ATOM   4549 O OD1   . ASP E 5 233 ? 77.040  21.567  117.264 1.00 79.64  ? 233 ASP A OD1   1 
ATOM   4550 O OD2   . ASP E 5 233 ? 76.162  20.441  118.929 1.00 79.64  ? 233 ASP A OD2   1 
ATOM   4551 N N     . PRO E 5 234 ? 80.042  22.400  116.323 1.00 98.19  ? 234 PRO A N     1 
ATOM   4552 C CA    . PRO E 5 234 ? 80.125  23.448  115.299 1.00 98.19  ? 234 PRO A CA    1 
ATOM   4553 C C     . PRO E 5 234 ? 78.843  24.270  115.163 1.00 98.19  ? 234 PRO A C     1 
ATOM   4554 O O     . PRO E 5 234 ? 78.871  25.409  114.695 1.00 98.19  ? 234 PRO A O     1 
ATOM   4555 C CB    . PRO E 5 234 ? 80.454  22.677  114.022 1.00 100.00 ? 234 PRO A CB    1 
ATOM   4556 C CG    . PRO E 5 234 ? 81.138  21.440  114.502 1.00 100.00 ? 234 PRO A CG    1 
ATOM   4557 C CD    . PRO E 5 234 ? 80.472  21.089  115.803 1.00 100.00 ? 234 PRO A CD    1 
ATOM   4558 N N     . ASN E 5 235 ? 77.721  23.686  115.572 1.00 63.80  ? 235 ASN A N     1 
ATOM   4559 C CA    . ASN E 5 235 ? 76.433  24.367  115.498 1.00 63.80  ? 235 ASN A CA    1 
ATOM   4560 C C     . ASN E 5 235 ? 76.331  25.453  116.564 1.00 63.80  ? 235 ASN A C     1 
ATOM   4561 O O     . ASN E 5 235 ? 75.738  26.507  116.336 1.00 63.80  ? 235 ASN A O     1 
ATOM   4562 C CB    . ASN E 5 235 ? 75.295  23.361  115.682 1.00 100.00 ? 235 ASN A CB    1 
ATOM   4563 C CG    . ASN E 5 235 ? 74.357  23.319  114.492 1.00 100.00 ? 235 ASN A CG    1 
ATOM   4564 O OD1   . ASN E 5 235 ? 73.217  22.866  114.601 1.00 100.00 ? 235 ASN A OD1   1 
ATOM   4565 N ND2   . ASN E 5 235 ? 74.834  23.793  113.346 1.00 100.00 ? 235 ASN A ND2   1 
ATOM   4566 N N     . ASN E 5 236 ? 76.915  25.181  117.728 1.00 70.54  ? 236 ASN A N     1 
ATOM   4567 C CA    . ASN E 5 236 ? 76.908  26.117  118.849 1.00 70.54  ? 236 ASN A CA    1 
ATOM   4568 C C     . ASN E 5 236 ? 77.388  27.502  118.434 1.00 70.54  ? 236 ASN A C     1 
ATOM   4569 O O     . ASN E 5 236 ? 78.415  27.641  117.771 1.00 70.54  ? 236 ASN A O     1 
ATOM   4570 C CB    . ASN E 5 236 ? 77.802  25.595  119.977 1.00 81.04  ? 236 ASN A CB    1 
ATOM   4571 C CG    . ASN E 5 236 ? 77.064  24.683  120.934 1.00 81.04  ? 236 ASN A CG    1 
ATOM   4572 O OD1   . ASN E 5 236 ? 75.834  24.667  120.975 1.00 81.04  ? 236 ASN A OD1   1 
ATOM   4573 N ND2   . ASN E 5 236 ? 77.815  23.914  121.714 1.00 81.04  ? 236 ASN A ND2   1 
ATOM   4574 N N     . TYR E 5 237 ? 76.643  28.527  118.830 1.00 32.52  ? 237 TYR A N     1 
ATOM   4575 C CA    . TYR E 5 237 ? 77.009  29.894  118.500 1.00 32.52  ? 237 TYR A CA    1 
ATOM   4576 C C     . TYR E 5 237 ? 78.349  30.223  119.144 1.00 32.52  ? 237 TYR A C     1 
ATOM   4577 O O     . TYR E 5 237 ? 78.676  29.710  120.214 1.00 32.52  ? 237 TYR A O     1 
ATOM   4578 C CB    . TYR E 5 237 ? 75.946  30.866  119.008 1.00 52.54  ? 237 TYR A CB    1 
ATOM   4579 C CG    . TYR E 5 237 ? 74.598  30.709  118.344 1.00 52.54  ? 237 TYR A CG    1 
ATOM   4580 C CD1   . TYR E 5 237 ? 74.427  30.995  116.991 1.00 52.54  ? 237 TYR A CD1   1 
ATOM   4581 C CD2   . TYR E 5 237 ? 73.488  30.291  119.075 1.00 52.54  ? 237 TYR A CD2   1 
ATOM   4582 C CE1   . TYR E 5 237 ? 73.178  30.872  116.381 1.00 52.54  ? 237 TYR A CE1   1 
ATOM   4583 C CE2   . TYR E 5 237 ? 72.237  30.164  118.477 1.00 52.54  ? 237 TYR A CE2   1 
ATOM   4584 C CZ    . TYR E 5 237 ? 72.089  30.457  117.131 1.00 52.54  ? 237 TYR A CZ    1 
ATOM   4585 O OH    . TYR E 5 237 ? 70.850  30.344  116.542 1.00 52.54  ? 237 TYR A OH    1 
ATOM   4586 N N     . LEU E 5 238 ? 79.121  31.078  118.485 1.00 37.20  ? 238 LEU A N     1 
ATOM   4587 C CA    . LEU E 5 238 ? 80.425  31.473  118.995 1.00 37.20  ? 238 LEU A CA    1 
ATOM   4588 C C     . LEU E 5 238 ? 80.311  32.034  120.408 1.00 37.20  ? 238 LEU A C     1 
ATOM   4589 O O     . LEU E 5 238 ? 81.037  31.616  121.311 1.00 37.20  ? 238 LEU A O     1 
ATOM   4590 C CB    . LEU E 5 238 ? 81.045  32.526  118.078 1.00 27.31  ? 238 LEU A CB    1 
ATOM   4591 C CG    . LEU E 5 238 ? 82.569  32.575  117.953 1.00 27.31  ? 238 LEU A CG    1 
ATOM   4592 C CD1   . LEU E 5 238 ? 82.990  34.016  117.722 1.00 27.31  ? 238 LEU A CD1   1 
ATOM   4593 C CD2   . LEU E 5 238 ? 83.236  32.016  119.201 1.00 27.31  ? 238 LEU A CD2   1 
ATOM   4594 N N     . PHE E 5 239 ? 79.395  32.980  120.590 1.00 51.99  ? 239 PHE A N     1 
ATOM   4595 C CA    . PHE E 5 239 ? 79.180  33.613  121.885 1.00 51.99  ? 239 PHE A CA    1 
ATOM   4596 C C     . PHE E 5 239 ? 77.950  33.040  122.571 1.00 51.99  ? 239 PHE A C     1 
ATOM   4597 O O     . PHE E 5 239 ? 76.893  32.886  121.957 1.00 51.99  ? 239 PHE A O     1 
ATOM   4598 C CB    . PHE E 5 239 ? 79.019  35.126  121.716 1.00 40.22  ? 239 PHE A CB    1 
ATOM   4599 C CG    . PHE E 5 239 ? 80.231  35.801  121.139 1.00 40.22  ? 239 PHE A CG    1 
ATOM   4600 C CD1   . PHE E 5 239 ? 81.377  35.975  121.909 1.00 40.22  ? 239 PHE A CD1   1 
ATOM   4601 C CD2   . PHE E 5 239 ? 80.236  36.243  119.820 1.00 40.22  ? 239 PHE A CD2   1 
ATOM   4602 C CE1   . PHE E 5 239 ? 82.513  36.576  121.373 1.00 40.22  ? 239 PHE A CE1   1 
ATOM   4603 C CE2   . PHE E 5 239 ? 81.367  36.845  119.274 1.00 40.22  ? 239 PHE A CE2   1 
ATOM   4604 C CZ    . PHE E 5 239 ? 82.508  37.011  120.053 1.00 40.22  ? 239 PHE A CZ    1 
ATOM   4605 N N     . CYS E 5 240 ? 78.094  32.729  123.853 1.00 55.01  ? 240 CYS A N     1 
ATOM   4606 C CA    . CYS E 5 240 ? 76.999  32.167  124.625 1.00 55.01  ? 240 CYS A CA    1 
ATOM   4607 C C     . CYS E 5 240 ? 76.856  32.900  125.949 1.00 55.01  ? 240 CYS A C     1 
ATOM   4608 O O     . CYS E 5 240 ? 77.362  34.010  126.117 1.00 55.01  ? 240 CYS A O     1 
ATOM   4609 C CB    . CYS E 5 240 ? 77.254  30.682  124.885 1.00 48.25  ? 240 CYS A CB    1 
ATOM   4610 S SG    . CYS E 5 240 ? 78.902  30.333  125.545 1.00 48.25  ? 240 CYS A SG    1 
ATOM   4611 N N     . ARG E 5 241 ? 76.167  32.265  126.889 1.00 53.43  ? 241 ARG A N     1 
ATOM   4612 C CA    . ARG E 5 241 ? 75.947  32.846  128.202 1.00 53.43  ? 241 ARG A CA    1 
ATOM   4613 C C     . ARG E 5 241 ? 77.088  32.514  129.156 1.00 53.43  ? 241 ARG A C     1 
ATOM   4614 O O     . ARG E 5 241 ? 77.845  31.569  128.934 1.00 53.43  ? 241 ARG A O     1 
ATOM   4615 C CB    . ARG E 5 241 ? 74.629  32.331  128.776 1.00 47.11  ? 241 ARG A CB    1 
ATOM   4616 C CG    . ARG E 5 241 ? 73.549  33.384  128.888 1.00 47.11  ? 241 ARG A CG    1 
ATOM   4617 C CD    . ARG E 5 241 ? 72.939  33.375  130.274 1.00 47.11  ? 241 ARG A CD    1 
ATOM   4618 N NE    . ARG E 5 241 ? 71.614  32.767  130.283 1.00 47.11  ? 241 ARG A NE    1 
ATOM   4619 C CZ    . ARG E 5 241 ? 70.619  33.170  131.065 1.00 47.11  ? 241 ARG A CZ    1 
ATOM   4620 N NH1   . ARG E 5 241 ? 70.801  34.182  131.903 1.00 47.11  ? 241 ARG A NH1   1 
ATOM   4621 N NH2   . ARG E 5 241 ? 69.440  32.567  131.003 1.00 47.11  ? 241 ARG A NH2   1 
ATOM   4622 N N     . VAL E 5 242 ? 77.204  33.305  130.217 1.00 51.35  ? 242 VAL A N     1 
ATOM   4623 C CA    . VAL E 5 242 ? 78.239  33.110  131.223 1.00 51.35  ? 242 VAL A CA    1 
ATOM   4624 C C     . VAL E 5 242 ? 77.686  33.548  132.577 1.00 51.35  ? 242 VAL A C     1 
ATOM   4625 O O     . VAL E 5 242 ? 77.721  34.732  132.914 1.00 51.35  ? 242 VAL A O     1 
ATOM   4626 C CB    . VAL E 5 242 ? 79.500  33.938  130.892 1.00 37.55  ? 242 VAL A CB    1 
ATOM   4627 C CG1   . VAL E 5 242 ? 80.513  33.831  132.021 1.00 37.55  ? 242 VAL A CG1   1 
ATOM   4628 C CG2   . VAL E 5 242 ? 80.113  33.446  129.590 1.00 37.55  ? 242 VAL A CG2   1 
ATOM   4629 N N     . ARG E 5 243 ? 77.176  32.587  133.344 1.00 50.51  ? 243 ARG A N     1 
ATOM   4630 C CA    . ARG E 5 243 ? 76.597  32.858  134.660 1.00 50.51  ? 243 ARG A CA    1 
ATOM   4631 C C     . ARG E 5 243 ? 77.600  33.405  135.676 1.00 50.51  ? 243 ARG A C     1 
ATOM   4632 O O     . ARG E 5 243 ? 78.795  33.506  135.397 1.00 50.51  ? 243 ARG A O     1 
ATOM   4633 C CB    . ARG E 5 243 ? 75.946  31.588  135.212 1.00 37.17  ? 243 ARG A CB    1 
ATOM   4634 C CG    . ARG E 5 243 ? 74.555  31.320  134.660 1.00 37.17  ? 243 ARG A CG    1 
ATOM   4635 C CD    . ARG E 5 243 ? 74.369  29.852  134.330 1.00 37.17  ? 243 ARG A CD    1 
ATOM   4636 N NE    . ARG E 5 243 ? 73.440  29.645  133.222 1.00 37.17  ? 243 ARG A NE    1 
ATOM   4637 C CZ    . ARG E 5 243 ? 72.159  30.000  133.245 1.00 37.17  ? 243 ARG A CZ    1 
ATOM   4638 N NH1   . ARG E 5 243 ? 71.647  30.584  134.321 1.00 37.17  ? 243 ARG A NH1   1 
ATOM   4639 N NH2   . ARG E 5 243 ? 71.388  29.768  132.191 1.00 37.17  ? 243 ARG A NH2   1 
ATOM   4640 N N     . LYS E 5 244 ? 77.098  33.757  136.858 1.00 41.45  ? 244 LYS A N     1 
ATOM   4641 C CA    . LYS E 5 244 ? 77.932  34.310  137.922 1.00 41.45  ? 244 LYS A CA    1 
ATOM   4642 C C     . LYS E 5 244 ? 79.023  33.355  138.391 1.00 41.45  ? 244 LYS A C     1 
ATOM   4643 O O     . LYS E 5 244 ? 80.064  33.789  138.886 1.00 41.45  ? 244 LYS A O     1 
ATOM   4644 C CB    . LYS E 5 244 ? 77.066  34.724  139.118 1.00 30.17  ? 244 LYS A CB    1 
ATOM   4645 C CG    . LYS E 5 244 ? 75.847  33.847  139.350 1.00 30.17  ? 244 LYS A CG    1 
ATOM   4646 C CD    . LYS E 5 244 ? 75.453  33.816  140.824 1.00 30.17  ? 244 LYS A CD    1 
ATOM   4647 C CE    . LYS E 5 244 ? 74.649  35.048  141.219 1.00 30.17  ? 244 LYS A CE    1 
ATOM   4648 N NZ    . LYS E 5 244 ? 74.298  35.056  142.669 1.00 30.17  ? 244 LYS A NZ    1 
ATOM   4649 N N     . ASN E 5 245 ? 78.780  32.056  138.243 1.00 62.37  ? 245 ASN A N     1 
ATOM   4650 C CA    . ASN E 5 245 ? 79.753  31.051  138.651 1.00 62.37  ? 245 ASN A CA    1 
ATOM   4651 C C     . ASN E 5 245 ? 80.992  31.094  137.763 1.00 62.37  ? 245 ASN A C     1 
ATOM   4652 O O     . ASN E 5 245 ? 82.055  30.597  138.139 1.00 62.37  ? 245 ASN A O     1 
ATOM   4653 C CB    . ASN E 5 245 ? 79.128  29.649  138.609 1.00 41.98  ? 245 ASN A CB    1 
ATOM   4654 C CG    . ASN E 5 245 ? 78.536  29.300  137.249 1.00 41.98  ? 245 ASN A CG    1 
ATOM   4655 O OD1   . ASN E 5 245 ? 78.181  28.147  137.000 1.00 41.98  ? 245 ASN A OD1   1 
ATOM   4656 N ND2   . ASN E 5 245 ? 78.424  30.287  136.368 1.00 41.98  ? 245 ASN A ND2   1 
ATOM   4657 N N     . GLY E 5 246 ? 80.854  31.700  136.588 1.00 62.39  ? 246 GLY A N     1 
ATOM   4658 C CA    . GLY E 5 246 ? 81.972  31.794  135.668 1.00 62.39  ? 246 GLY A CA    1 
ATOM   4659 C C     . GLY E 5 246 ? 81.970  30.681  134.638 1.00 62.39  ? 246 GLY A C     1 
ATOM   4660 O O     . GLY E 5 246 ? 82.946  30.498  133.912 1.00 62.39  ? 246 GLY A O     1 
ATOM   4661 N N     . VAL E 5 247 ? 80.870  29.937  134.570 1.00 39.46  ? 247 VAL A N     1 
ATOM   4662 C CA    . VAL E 5 247 ? 80.753  28.838  133.621 1.00 39.46  ? 247 VAL A CA    1 
ATOM   4663 C C     . VAL E 5 247 ? 79.924  29.245  132.407 1.00 39.46  ? 247 VAL A C     1 
ATOM   4664 O O     . VAL E 5 247 ? 78.811  29.753  132.546 1.00 39.46  ? 247 VAL A O     1 
ATOM   4665 C CB    . VAL E 5 247 ? 80.108  27.596  134.286 1.00 27.49  ? 247 VAL A CB    1 
ATOM   4666 C CG1   . VAL E 5 247 ? 79.816  26.526  133.244 1.00 27.49  ? 247 VAL A CG1   1 
ATOM   4667 C CG2   . VAL E 5 247 ? 81.036  27.044  135.350 1.00 27.49  ? 247 VAL A CG2   1 
ATOM   4668 N N     . ALA E 5 248 ? 80.477  29.019  131.219 1.00 83.11  ? 248 ALA A N     1 
ATOM   4669 C CA    . ALA E 5 248 ? 79.798  29.359  129.975 1.00 83.11  ? 248 ALA A CA    1 
ATOM   4670 C C     . ALA E 5 248 ? 78.678  28.367  129.687 1.00 83.11  ? 248 ALA A C     1 
ATOM   4671 O O     . ALA E 5 248 ? 78.670  27.258  130.220 1.00 83.11  ? 248 ALA A O     1 
ATOM   4672 C CB    . ALA E 5 248 ? 80.794  29.369  128.825 1.00 88.09  ? 248 ALA A CB    1 
ATOM   4673 N N     . ALA E 5 249 ? 77.737  28.767  128.837 1.00 40.79  ? 249 ALA A N     1 
ATOM   4674 C CA    . ALA E 5 249 ? 76.614  27.909  128.487 1.00 40.79  ? 249 ALA A CA    1 
ATOM   4675 C C     . ALA E 5 249 ? 76.463  27.779  126.976 1.00 40.79  ? 249 ALA A C     1 
ATOM   4676 O O     . ALA E 5 249 ? 75.505  28.290  126.397 1.00 40.79  ? 249 ALA A O     1 
ATOM   4677 C CB    . ALA E 5 249 ? 75.332  28.463  129.091 1.00 36.44  ? 249 ALA A CB    1 
ATOM   4678 N N     . PRO E 5 250 ? 77.411  27.088  126.319 1.00 41.10  ? 250 PRO A N     1 
ATOM   4679 C CA    . PRO E 5 250 ? 77.367  26.900  124.864 1.00 41.10  ? 250 PRO A CA    1 
ATOM   4680 C C     . PRO E 5 250 ? 75.997  26.419  124.395 1.00 41.10  ? 250 PRO A C     1 
ATOM   4681 O O     . PRO E 5 250 ? 75.428  25.496  124.974 1.00 41.10  ? 250 PRO A O     1 
ATOM   4682 C CB    . PRO E 5 250 ? 78.455  25.861  124.602 1.00 27.79  ? 250 PRO A CB    1 
ATOM   4683 C CG    . PRO E 5 250 ? 79.411  26.028  125.733 1.00 27.79  ? 250 PRO A CG    1 
ATOM   4684 C CD    . PRO E 5 250 ? 78.589  26.440  126.924 1.00 27.79  ? 250 PRO A CD    1 
ATOM   4685 N N     . SER E 5 251 ? 75.468  27.047  123.350 1.00 52.64  ? 251 SER A N     1 
ATOM   4686 C CA    . SER E 5 251 ? 74.162  26.664  122.830 1.00 52.64  ? 251 SER A CA    1 
ATOM   4687 C C     . SER E 5 251 ? 74.046  26.889  121.331 1.00 52.64  ? 251 SER A C     1 
ATOM   4688 O O     . SER E 5 251 ? 74.417  27.944  120.817 1.00 52.64  ? 251 SER A O     1 
ATOM   4689 C CB    . SER E 5 251 ? 73.056  27.443  123.541 1.00 40.70  ? 251 SER A CB    1 
ATOM   4690 O OG    . SER E 5 251 ? 71.801  27.204  122.927 1.00 40.70  ? 251 SER A OG    1 
ATOM   4691 N N     . ALA E 5 252 ? 73.519  25.886  120.637 1.00 61.09  ? 252 ALA A N     1 
ATOM   4692 C CA    . ALA E 5 252 ? 73.343  25.960  119.196 1.00 61.09  ? 252 ALA A CA    1 
ATOM   4693 C C     . ALA E 5 252 ? 71.872  26.184  118.884 1.00 61.09  ? 252 ALA A C     1 
ATOM   4694 O O     . ALA E 5 252 ? 71.465  26.176  117.724 1.00 61.09  ? 252 ALA A O     1 
ATOM   4695 C CB    . ALA E 5 252 ? 73.824  24.673  118.548 1.00 32.57  ? 252 ALA A CB    1 
ATOM   4696 N N     . THR E 5 253 ? 71.079  26.388  119.930 1.00 46.99  ? 253 THR A N     1 
ATOM   4697 C CA    . THR E 5 253 ? 69.648  26.608  119.769 1.00 46.99  ? 253 THR A CA    1 
ATOM   4698 C C     . THR E 5 253 ? 69.264  28.037  120.124 1.00 46.99  ? 253 THR A C     1 
ATOM   4699 O O     . THR E 5 253 ? 68.359  28.613  119.521 1.00 46.99  ? 253 THR A O     1 
ATOM   4700 C CB    . THR E 5 253 ? 68.832  25.649  120.657 1.00 83.20  ? 253 THR A CB    1 
ATOM   4701 O OG1   . THR E 5 253 ? 67.679  26.332  121.164 1.00 83.20  ? 253 THR A OG1   1 
ATOM   4702 C CG2   . THR E 5 253 ? 69.678  25.152  121.823 1.00 83.20  ? 253 THR A CG2   1 
ATOM   4703 N N     . SER E 5 254 ? 69.952  28.606  121.108 1.00 78.69  ? 254 SER A N     1 
ATOM   4704 C CA    . SER E 5 254 ? 69.672  29.971  121.533 1.00 78.69  ? 254 SER A CA    1 
ATOM   4705 C C     . SER E 5 254 ? 70.918  30.844  121.460 1.00 78.69  ? 254 SER A C     1 
ATOM   4706 O O     . SER E 5 254 ? 72.007  30.428  121.858 1.00 78.69  ? 254 SER A O     1 
ATOM   4707 C CB    . SER E 5 254 ? 69.121  29.981  122.959 1.00 73.63  ? 254 SER A CB    1 
ATOM   4708 O OG    . SER E 5 254 ? 68.713  31.287  123.328 1.00 73.63  ? 254 SER A OG    1 
ATOM   4709 N N     . GLN E 5 255 ? 70.747  32.060  120.950 1.00 60.76  ? 255 GLN A N     1 
ATOM   4710 C CA    . GLN E 5 255 ? 71.853  32.997  120.816 1.00 60.76  ? 255 GLN A CA    1 
ATOM   4711 C C     . GLN E 5 255 ? 71.767  34.104  121.856 1.00 60.76  ? 255 GLN A C     1 
ATOM   4712 O O     . GLN E 5 255 ? 70.713  34.331  122.451 1.00 60.76  ? 255 GLN A O     1 
ATOM   4713 C CB    . GLN E 5 255 ? 71.848  33.612  119.415 1.00 60.73  ? 255 GLN A CB    1 
ATOM   4714 C CG    . GLN E 5 255 ? 70.465  33.999  118.917 1.00 60.73  ? 255 GLN A CG    1 
ATOM   4715 C CD    . GLN E 5 255 ? 70.446  34.306  117.434 1.00 60.73  ? 255 GLN A CD    1 
ATOM   4716 O OE1   . GLN E 5 255 ? 71.183  35.168  116.959 1.00 60.73  ? 255 GLN A OE1   1 
ATOM   4717 N NE2   . GLN E 5 255 ? 69.601  33.599  116.693 1.00 60.73  ? 255 GLN A NE2   1 
ATOM   4718 N N     . LEU E 5 256 ? 72.885  34.788  122.071 1.00 49.58  ? 256 LEU A N     1 
ATOM   4719 C CA    . LEU E 5 256 ? 72.940  35.883  123.030 1.00 49.58  ? 256 LEU A CA    1 
ATOM   4720 C C     . LEU E 5 256 ? 72.074  37.024  122.517 1.00 49.58  ? 256 LEU A C     1 
ATOM   4721 O O     . LEU E 5 256 ? 72.213  37.448  121.371 1.00 49.58  ? 256 LEU A O     1 
ATOM   4722 C CB    . LEU E 5 256 ? 74.381  36.371  123.193 1.00 24.08  ? 256 LEU A CB    1 
ATOM   4723 C CG    . LEU E 5 256 ? 75.073  36.090  124.528 1.00 24.08  ? 256 LEU A CG    1 
ATOM   4724 C CD1   . LEU E 5 256 ? 76.474  36.682  124.506 1.00 24.08  ? 256 LEU A CD1   1 
ATOM   4725 C CD2   . LEU E 5 256 ? 74.258  36.682  125.669 1.00 24.08  ? 256 LEU A CD2   1 
ATOM   4726 N N     . SER E 5 257 ? 71.179  37.518  123.363 1.00 42.38  ? 257 SER A N     1 
ATOM   4727 C CA    . SER E 5 257 ? 70.303  38.614  122.976 1.00 42.38  ? 257 SER A CA    1 
ATOM   4728 C C     . SER E 5 257 ? 71.138  39.835  122.618 1.00 42.38  ? 257 SER A C     1 
ATOM   4729 O O     . SER E 5 257 ? 72.174  40.088  123.233 1.00 42.38  ? 257 SER A O     1 
ATOM   4730 C CB    . SER E 5 257 ? 69.354  38.961  124.125 1.00 28.34  ? 257 SER A CB    1 
ATOM   4731 O OG    . SER E 5 257 ? 70.055  39.586  125.187 1.00 28.34  ? 257 SER A OG    1 
ATOM   4732 N N     . THR E 5 258 ? 70.691  40.585  121.614 1.00 37.48  ? 258 THR A N     1 
ATOM   4733 C CA    . THR E 5 258 ? 71.401  41.784  121.188 1.00 37.48  ? 258 THR A CA    1 
ATOM   4734 C C     . THR E 5 258 ? 71.553  42.705  122.383 1.00 37.48  ? 258 THR A C     1 
ATOM   4735 O O     . THR E 5 258 ? 72.578  43.366  122.542 1.00 37.48  ? 258 THR A O     1 
ATOM   4736 C CB    . THR E 5 258 ? 70.634  42.540  120.095 1.00 27.98  ? 258 THR A CB    1 
ATOM   4737 O OG1   . THR E 5 258 ? 69.254  42.643  120.464 1.00 27.98  ? 258 THR A OG1   1 
ATOM   4738 C CG2   . THR E 5 258 ? 70.753  41.817  118.765 1.00 27.98  ? 258 THR A CG2   1 
ATOM   4739 N N     . ARG E 5 259 ? 70.524  42.743  123.222 1.00 39.37  ? 259 ARG A N     1 
ATOM   4740 C CA    . ARG E 5 259 ? 70.552  43.578  124.413 1.00 39.37  ? 259 ARG A CA    1 
ATOM   4741 C C     . ARG E 5 259 ? 71.796  43.249  125.233 1.00 39.37  ? 259 ARG A C     1 
ATOM   4742 O O     . ARG E 5 259 ? 72.521  44.147  125.662 1.00 39.37  ? 259 ARG A O     1 
ATOM   4743 C CB    . ARG E 5 259 ? 69.298  43.342  125.257 1.00 29.65  ? 259 ARG A CB    1 
ATOM   4744 C CG    . ARG E 5 259 ? 69.243  44.167  126.528 1.00 29.65  ? 259 ARG A CG    1 
ATOM   4745 C CD    . ARG E 5 259 ? 68.333  45.373  126.373 1.00 29.65  ? 259 ARG A CD    1 
ATOM   4746 N NE    . ARG E 5 259 ? 68.711  46.470  127.260 1.00 29.65  ? 259 ARG A NE    1 
ATOM   4747 C CZ    . ARG E 5 259 ? 69.890  47.085  127.227 1.00 29.65  ? 259 ARG A CZ    1 
ATOM   4748 N NH1   . ARG E 5 259 ? 70.813  46.713  126.348 1.00 29.65  ? 259 ARG A NH1   1 
ATOM   4749 N NH2   . ARG E 5 259 ? 70.143  48.083  128.066 1.00 29.65  ? 259 ARG A NH2   1 
ATOM   4750 N N     . ALA E 5 260 ? 72.045  41.956  125.433 1.00 40.19  ? 260 ALA A N     1 
ATOM   4751 C CA    . ALA E 5 260 ? 73.200  41.506  126.199 1.00 40.19  ? 260 ALA A CA    1 
ATOM   4752 C C     . ALA E 5 260 ? 74.489  42.050  125.597 1.00 40.19  ? 260 ALA A C     1 
ATOM   4753 O O     . ALA E 5 260 ? 75.329  42.604  126.304 1.00 40.19  ? 260 ALA A O     1 
ATOM   4754 C CB    . ALA E 5 260 ? 73.242  39.987  126.233 1.00 9.58   ? 260 ALA A CB    1 
ATOM   4755 N N     . LEU E 5 261 ? 74.639  41.888  124.286 1.00 31.34  ? 261 LEU A N     1 
ATOM   4756 C CA    . LEU E 5 261 ? 75.826  42.368  123.591 1.00 31.34  ? 261 LEU A CA    1 
ATOM   4757 C C     . LEU E 5 261 ? 75.969  43.874  123.763 1.00 31.34  ? 261 LEU A C     1 
ATOM   4758 O O     . LEU E 5 261 ? 77.078  44.386  123.909 1.00 31.34  ? 261 LEU A O     1 
ATOM   4759 C CB    . LEU E 5 261 ? 75.744  42.013  122.107 1.00 22.44  ? 261 LEU A CB    1 
ATOM   4760 C CG    . LEU E 5 261 ? 75.693  40.510  121.824 1.00 22.44  ? 261 LEU A CG    1 
ATOM   4761 C CD1   . LEU E 5 261 ? 75.167  40.267  120.422 1.00 22.44  ? 261 LEU A CD1   1 
ATOM   4762 C CD2   . LEU E 5 261 ? 77.081  39.916  121.993 1.00 22.44  ? 261 LEU A CD2   1 
ATOM   4763 N N     . GLU E 5 262 ? 74.843  44.580  123.748 1.00 26.04  ? 262 GLU A N     1 
ATOM   4764 C CA    . GLU E 5 262 ? 74.855  46.027  123.918 1.00 26.04  ? 262 GLU A CA    1 
ATOM   4765 C C     . GLU E 5 262 ? 75.386  46.320  125.310 1.00 26.04  ? 262 GLU A C     1 
ATOM   4766 O O     . GLU E 5 262 ? 76.191  47.231  125.507 1.00 26.04  ? 262 GLU A O     1 
ATOM   4767 C CB    . GLU E 5 262 ? 73.442  46.599  123.787 1.00 37.50  ? 262 GLU A CB    1 
ATOM   4768 C CG    . GLU E 5 262 ? 72.840  46.462  122.403 1.00 37.50  ? 262 GLU A CG    1 
ATOM   4769 C CD    . GLU E 5 262 ? 71.410  46.953  122.342 1.00 37.50  ? 262 GLU A CD    1 
ATOM   4770 O OE1   . GLU E 5 262 ? 70.605  46.554  123.209 1.00 37.50  ? 262 GLU A OE1   1 
ATOM   4771 O OE2   . GLU E 5 262 ? 71.090  47.738  121.426 1.00 37.50  ? 262 GLU A OE2   1 
ATOM   4772 N N     . GLY E 5 263 ? 74.926  45.524  126.270 1.00 33.90  ? 263 GLY A N     1 
ATOM   4773 C CA    . GLY E 5 263 ? 75.350  45.691  127.646 1.00 33.90  ? 263 GLY A CA    1 
ATOM   4774 C C     . GLY E 5 263 ? 76.846  45.532  127.814 1.00 33.90  ? 263 GLY A C     1 
ATOM   4775 O O     . GLY E 5 263 ? 77.449  46.177  128.671 1.00 33.90  ? 263 GLY A O     1 
ATOM   4776 N N     . ILE E 5 264 ? 77.448  44.669  127.001 1.00 32.64  ? 264 ILE A N     1 
ATOM   4777 C CA    . ILE E 5 264 ? 78.884  44.442  127.069 1.00 32.64  ? 264 ILE A CA    1 
ATOM   4778 C C     . ILE E 5 264 ? 79.591  45.752  126.742 1.00 32.64  ? 264 ILE A C     1 
ATOM   4779 O O     . ILE E 5 264 ? 80.687  46.021  127.235 1.00 32.64  ? 264 ILE A O     1 
ATOM   4780 C CB    . ILE E 5 264 ? 79.328  43.347  126.067 1.00 19.30  ? 264 ILE A CB    1 
ATOM   4781 C CG1   . ILE E 5 264 ? 78.843  41.975  126.550 1.00 19.30  ? 264 ILE A CG1   1 
ATOM   4782 C CG2   . ILE E 5 264 ? 80.846  43.340  125.929 1.00 19.30  ? 264 ILE A CG2   1 
ATOM   4783 C CD1   . ILE E 5 264 ? 79.018  40.860  125.538 1.00 19.30  ? 264 ILE A CD1   1 
ATOM   4784 N N     . PHE E 5 265 ? 78.948  46.570  125.915 1.00 40.57  ? 265 PHE A N     1 
ATOM   4785 C CA    . PHE E 5 265 ? 79.504  47.857  125.523 1.00 40.57  ? 265 PHE A CA    1 
ATOM   4786 C C     . PHE E 5 265 ? 79.379  48.865  126.662 1.00 40.57  ? 265 PHE A C     1 
ATOM   4787 O O     . PHE E 5 265 ? 80.347  49.538  127.018 1.00 40.57  ? 265 PHE A O     1 
ATOM   4788 C CB    . PHE E 5 265 ? 78.776  48.389  124.289 1.00 25.52  ? 265 PHE A CB    1 
ATOM   4789 C CG    . PHE E 5 265 ? 79.484  48.104  122.996 1.00 25.52  ? 265 PHE A CG    1 
ATOM   4790 C CD1   . PHE E 5 265 ? 80.644  48.788  122.659 1.00 25.52  ? 265 PHE A CD1   1 
ATOM   4791 C CD2   . PHE E 5 265 ? 78.981  47.161  122.109 1.00 25.52  ? 265 PHE A CD2   1 
ATOM   4792 C CE1   . PHE E 5 265 ? 81.295  48.538  121.457 1.00 25.52  ? 265 PHE A CE1   1 
ATOM   4793 C CE2   . PHE E 5 265 ? 79.623  46.904  120.905 1.00 25.52  ? 265 PHE A CE2   1 
ATOM   4794 C CZ    . PHE E 5 265 ? 80.783  47.595  120.578 1.00 25.52  ? 265 PHE A CZ    1 
ATOM   4795 N N     . GLU E 5 266 ? 78.181  48.965  127.226 1.00 46.19  ? 266 GLU A N     1 
ATOM   4796 C CA    . GLU E 5 266 ? 77.927  49.891  128.324 1.00 46.19  ? 266 GLU A CA    1 
ATOM   4797 C C     . GLU E 5 266 ? 78.784  49.552  129.540 1.00 46.19  ? 266 GLU A C     1 
ATOM   4798 O O     . GLU E 5 266 ? 79.380  50.436  130.152 1.00 46.19  ? 266 GLU A O     1 
ATOM   4799 C CB    . GLU E 5 266 ? 76.447  49.856  128.710 1.00 97.13  ? 266 GLU A CB    1 
ATOM   4800 C CG    . GLU E 5 266 ? 75.497  49.837  127.522 1.00 97.13  ? 266 GLU A CG    1 
ATOM   4801 C CD    . GLU E 5 266 ? 74.039  49.812  127.939 1.00 97.13  ? 266 GLU A CD    1 
ATOM   4802 O OE1   . GLU E 5 266 ? 73.493  50.887  128.267 1.00 97.13  ? 266 GLU A OE1   1 
ATOM   4803 O OE2   . GLU E 5 266 ? 73.436  48.717  127.937 1.00 97.13  ? 266 GLU A OE2   1 
ATOM   4804 N N     . ALA E 5 267 ? 78.838  48.267  129.880 1.00 28.64  ? 267 ALA A N     1 
ATOM   4805 C CA    . ALA E 5 267 ? 79.617  47.793  131.021 1.00 28.64  ? 267 ALA A CA    1 
ATOM   4806 C C     . ALA E 5 267 ? 81.101  48.085  130.856 1.00 28.64  ? 267 ALA A C     1 
ATOM   4807 O O     . ALA E 5 267 ? 81.746  48.579  131.780 1.00 28.64  ? 267 ALA A O     1 
ATOM   4808 C CB    . ALA E 5 267 ? 79.402  46.304  131.211 1.00 13.48  ? 267 ALA A CB    1 
ATOM   4809 N N     . THR E 5 268 ? 81.643  47.768  129.683 1.00 22.90  ? 268 THR A N     1 
ATOM   4810 C CA    . THR E 5 268 ? 83.054  48.017  129.410 1.00 22.90  ? 268 THR A CA    1 
ATOM   4811 C C     . THR E 5 268 ? 83.311  49.500  129.612 1.00 22.90  ? 268 THR A C     1 
ATOM   4812 O O     . THR E 5 268 ? 84.280  49.897  130.254 1.00 22.90  ? 268 THR A O     1 
ATOM   4813 C CB    . THR E 5 268 ? 83.429  47.647  127.960 1.00 19.44  ? 268 THR A CB    1 
ATOM   4814 O OG1   . THR E 5 268 ? 83.334  46.228  127.787 1.00 19.44  ? 268 THR A OG1   1 
ATOM   4815 C CG2   . THR E 5 268 ? 84.848  48.092  127.646 1.00 19.44  ? 268 THR A CG2   1 
ATOM   4816 N N     . HIS E 5 269 ? 82.425  50.318  129.062 1.00 46.95  ? 269 HIS A N     1 
ATOM   4817 C CA    . HIS E 5 269 ? 82.551  51.758  129.187 1.00 46.95  ? 269 HIS A CA    1 
ATOM   4818 C C     . HIS E 5 269 ? 82.442  52.159  130.659 1.00 46.95  ? 269 HIS A C     1 
ATOM   4819 O O     . HIS E 5 269 ? 83.048  53.139  131.088 1.00 46.95  ? 269 HIS A O     1 
ATOM   4820 C CB    . HIS E 5 269 ? 81.466  52.452  128.358 1.00 43.47  ? 269 HIS A CB    1 
ATOM   4821 C CG    . HIS E 5 269 ? 81.538  53.945  128.401 1.00 43.47  ? 269 HIS A CG    1 
ATOM   4822 N ND1   . HIS E 5 269 ? 81.014  54.677  129.440 1.00 43.47  ? 269 HIS A ND1   1 
ATOM   4823 C CD2   . HIS E 5 269 ? 82.075  54.845  127.542 1.00 43.47  ? 269 HIS A CD2   1 
ATOM   4824 C CE1   . HIS E 5 269 ? 81.224  55.963  129.225 1.00 43.47  ? 269 HIS A CE1   1 
ATOM   4825 N NE2   . HIS E 5 269 ? 81.866  56.092  128.080 1.00 43.47  ? 269 HIS A NE2   1 
ATOM   4826 N N     . ARG E 5 270 ? 81.675  51.392  131.429 1.00 47.43  ? 270 ARG A N     1 
ATOM   4827 C CA    . ARG E 5 270 ? 81.505  51.669  132.853 1.00 47.43  ? 270 ARG A CA    1 
ATOM   4828 C C     . ARG E 5 270 ? 82.784  51.340  133.617 1.00 47.43  ? 270 ARG A C     1 
ATOM   4829 O O     . ARG E 5 270 ? 83.226  52.109  134.469 1.00 47.43  ? 270 ARG A O     1 
ATOM   4830 C CB    . ARG E 5 270 ? 80.344  50.850  133.422 1.00 96.97  ? 270 ARG A CB    1 
ATOM   4831 C CG    . ARG E 5 270 ? 79.561  51.562  134.514 1.00 96.97  ? 270 ARG A CG    1 
ATOM   4832 C CD    . ARG E 5 270 ? 78.351  50.755  134.961 1.00 96.97  ? 270 ARG A CD    1 
ATOM   4833 N NE    . ARG E 5 270 ? 77.607  50.192  133.836 1.00 96.97  ? 270 ARG A NE    1 
ATOM   4834 C CZ    . ARG E 5 270 ? 76.956  50.914  132.927 1.00 96.97  ? 270 ARG A CZ    1 
ATOM   4835 N NH1   . ARG E 5 270 ? 76.953  52.237  133.002 1.00 96.97  ? 270 ARG A NH1   1 
ATOM   4836 N NH2   . ARG E 5 270 ? 76.306  50.312  131.939 1.00 96.97  ? 270 ARG A NH2   1 
ATOM   4837 N N     . LEU E 5 271 ? 83.378  50.194  133.304 1.00 42.17  ? 271 LEU A N     1 
ATOM   4838 C CA    . LEU E 5 271 ? 84.603  49.769  133.960 1.00 42.17  ? 271 LEU A CA    1 
ATOM   4839 C C     . LEU E 5 271 ? 85.696  50.816  133.809 1.00 42.17  ? 271 LEU A C     1 
ATOM   4840 O O     . LEU E 5 271 ? 86.693  50.785  134.528 1.00 42.17  ? 271 LEU A O     1 
ATOM   4841 C CB    . LEU E 5 271 ? 85.087  48.443  133.365 1.00 40.27  ? 271 LEU A CB    1 
ATOM   4842 C CG    . LEU E 5 271 ? 86.598  48.188  133.325 1.00 40.27  ? 271 LEU A CG    1 
ATOM   4843 C CD1   . LEU E 5 271 ? 86.967  47.175  134.396 1.00 40.27  ? 271 LEU A CD1   1 
ATOM   4844 C CD2   . LEU E 5 271 ? 87.013  47.687  131.948 1.00 40.27  ? 271 LEU A CD2   1 
ATOM   4845 N N     . ILE E 5 272 ? 85.507  51.753  132.884 1.00 39.42  ? 272 ILE A N     1 
ATOM   4846 C CA    . ILE E 5 272 ? 86.515  52.779  132.642 1.00 39.42  ? 272 ILE A CA    1 
ATOM   4847 C C     . ILE E 5 272 ? 86.132  54.226  132.973 1.00 39.42  ? 272 ILE A C     1 
ATOM   4848 O O     . ILE E 5 272 ? 86.818  54.878  133.761 1.00 39.42  ? 272 ILE A O     1 
ATOM   4849 C CB    . ILE E 5 272 ? 87.001  52.726  131.169 1.00 34.98  ? 272 ILE A CB    1 
ATOM   4850 C CG1   . ILE E 5 272 ? 87.411  51.296  130.805 1.00 34.98  ? 272 ILE A CG1   1 
ATOM   4851 C CG2   . ILE E 5 272 ? 88.179  53.668  130.973 1.00 34.98  ? 272 ILE A CG2   1 
ATOM   4852 C CD1   . ILE E 5 272 ? 87.903  51.141  129.382 1.00 34.98  ? 272 ILE A CD1   1 
ATOM   4853 N N     . TYR E 5 273 ? 85.053  54.731  132.379 1.00 71.46  ? 273 TYR A N     1 
ATOM   4854 C CA    . TYR E 5 273 ? 84.647  56.119  132.613 1.00 71.46  ? 273 TYR A CA    1 
ATOM   4855 C C     . TYR E 5 273 ? 83.543  56.321  133.647 1.00 71.46  ? 273 TYR A C     1 
ATOM   4856 O O     . TYR E 5 273 ? 82.611  57.097  133.432 1.00 71.46  ? 273 TYR A O     1 
ATOM   4857 C CB    . TYR E 5 273 ? 84.226  56.771  131.291 1.00 53.82  ? 273 TYR A CB    1 
ATOM   4858 C CG    . TYR E 5 273 ? 85.260  56.649  130.194 1.00 53.82  ? 273 TYR A CG    1 
ATOM   4859 C CD1   . TYR E 5 273 ? 86.254  57.615  130.035 1.00 53.82  ? 273 TYR A CD1   1 
ATOM   4860 C CD2   . TYR E 5 273 ? 85.255  55.558  129.326 1.00 53.82  ? 273 TYR A CD2   1 
ATOM   4861 C CE1   . TYR E 5 273 ? 87.220  57.494  129.036 1.00 53.82  ? 273 TYR A CE1   1 
ATOM   4862 C CE2   . TYR E 5 273 ? 86.216  55.428  128.326 1.00 53.82  ? 273 TYR A CE2   1 
ATOM   4863 C CZ    . TYR E 5 273 ? 87.195  56.397  128.187 1.00 53.82  ? 273 TYR A CZ    1 
ATOM   4864 O OH    . TYR E 5 273 ? 88.149  56.262  127.205 1.00 53.82  ? 273 TYR A OH    1 
ATOM   4865 N N     . GLY E 5 274 ? 83.654  55.632  134.775 1.00 48.35  ? 274 GLY A N     1 
ATOM   4866 C CA    . GLY E 5 274 ? 82.655  55.774  135.815 1.00 48.35  ? 274 GLY A CA    1 
ATOM   4867 C C     . GLY E 5 274 ? 81.356  55.065  135.498 1.00 48.35  ? 274 GLY A C     1 
ATOM   4868 O O     . GLY E 5 274 ? 81.361  53.930  135.028 1.00 48.35  ? 274 GLY A O     1 
ATOM   4869 N N     . ALA E 5 275 ? 80.236  55.733  135.752 1.00 61.17  ? 275 ALA A N     1 
ATOM   4870 C CA    . ALA E 5 275 ? 78.935  55.135  135.497 1.00 61.17  ? 275 ALA A CA    1 
ATOM   4871 C C     . ALA E 5 275 ? 77.910  56.149  135.011 1.00 61.17  ? 275 ALA A C     1 
ATOM   4872 O O     . ALA E 5 275 ? 77.383  56.939  135.793 1.00 61.17  ? 275 ALA A O     1 
ATOM   4873 C CB    . ALA E 5 275 ? 78.428  54.447  136.756 1.00 27.67  ? 275 ALA A CB    1 
ATOM   4874 N N     . LYS E 5 276 ? 77.638  56.111  133.710 1.00 100.00 ? 276 LYS A N     1 
ATOM   4875 C CA    . LYS E 5 276 ? 76.667  56.994  133.073 1.00 100.00 ? 276 LYS A CA    1 
ATOM   4876 C C     . LYS E 5 276 ? 76.578  58.381  133.698 1.00 100.00 ? 276 LYS A C     1 
ATOM   4877 O O     . LYS E 5 276 ? 77.559  58.907  134.225 1.00 100.00 ? 276 LYS A O     1 
ATOM   4878 C CB    . LYS E 5 276 ? 75.284  56.336  133.095 1.00 100.00 ? 276 LYS A CB    1 
ATOM   4879 C CG    . LYS E 5 276 ? 74.447  56.607  131.855 1.00 100.00 ? 276 LYS A CG    1 
ATOM   4880 C CD    . LYS E 5 276 ? 73.410  55.517  131.639 1.00 100.00 ? 276 LYS A CD    1 
ATOM   4881 C CE    . LYS E 5 276 ? 73.591  54.832  130.291 1.00 100.00 ? 276 LYS A CE    1 
ATOM   4882 N NZ    . LYS E 5 276 ? 73.955  55.794  129.210 1.00 100.00 ? 276 LYS A NZ    1 
ATOM   4883 N N     . ASP E 5 277 ? 75.389  58.971  133.617 1.00 73.53  ? 277 ASP A N     1 
ATOM   4884 C CA    . ASP E 5 277 ? 75.136  60.290  134.174 1.00 73.53  ? 277 ASP A CA    1 
ATOM   4885 C C     . ASP E 5 277 ? 73.658  60.385  134.570 1.00 73.53  ? 277 ASP A C     1 
ATOM   4886 O O     . ASP E 5 277 ? 72.827  59.578  134.136 1.00 73.53  ? 277 ASP A O     1 
ATOM   4887 C CB    . ASP E 5 277 ? 75.467  61.376  133.150 1.00 100.00 ? 277 ASP A CB    1 
ATOM   4888 C CG    . ASP E 5 277 ? 75.938  62.670  133.799 1.00 100.00 ? 277 ASP A CG    1 
ATOM   4889 O OD1   . ASP E 5 277 ? 75.184  63.266  134.655 1.00 100.00 ? 277 ASP A OD1   1 
ATOM   4890 O OD2   . ASP E 5 277 ? 77.087  63.159  133.488 1.00 100.00 ? 277 ASP A OD2   1 
ATOM   4891 N N     . ASP E 5 278 ? 73.366  61.377  135.386 1.00 99.87  ? 278 ASP A N     1 
ATOM   4892 C CA    . ASP E 5 278 ? 72.007  61.604  135.911 1.00 99.87  ? 278 ASP A CA    1 
ATOM   4893 C C     . ASP E 5 278 ? 70.993  61.807  134.772 1.00 99.87  ? 278 ASP A C     1 
ATOM   4894 O O     . ASP E 5 278 ? 70.101  60.979  134.552 1.00 99.87  ? 278 ASP A O     1 
ATOM   4895 C CB    . ASP E 5 278 ? 72.014  62.812  136.840 1.00 100.00 ? 278 ASP A CB    1 
ATOM   4896 C CG    . ASP E 5 278 ? 73.340  62.978  137.585 1.00 100.00 ? 278 ASP A CG    1 
ATOM   4897 O OD1   . ASP E 5 278 ? 73.926  61.948  138.095 1.00 100.00 ? 278 ASP A OD1   1 
ATOM   4898 O OD2   . ASP E 5 278 ? 73.874  64.146  137.700 1.00 100.00 ? 278 ASP A OD2   1 
ATOM   4899 N N     . SER E 5 279 ? 71.136  62.911  134.066 1.00 100.00 ? 279 SER A N     1 
ATOM   4900 C CA    . SER E 5 279 ? 70.244  63.246  132.937 1.00 100.00 ? 279 SER A CA    1 
ATOM   4901 C C     . SER E 5 279 ? 70.195  62.070  131.928 1.00 100.00 ? 279 SER A C     1 
ATOM   4902 O O     . SER E 5 279 ? 71.232  61.613  131.428 1.00 100.00 ? 279 SER A O     1 
ATOM   4903 C CB    . SER E 5 279 ? 70.777  64.481  132.203 1.00 89.35  ? 279 SER A CB    1 
ATOM   4904 O OG    . SER E 5 279 ? 71.914  64.131  131.428 1.00 89.35  ? 279 SER A OG    1 
ATOM   4905 N N     . GLY E 5 280 ? 68.978  61.597  131.652 1.00 84.11  ? 280 GLY A N     1 
ATOM   4906 C CA    . GLY E 5 280 ? 68.734  60.505  130.669 1.00 84.11  ? 280 GLY A CA    1 
ATOM   4907 C C     . GLY E 5 280 ? 68.739  61.123  129.271 1.00 84.11  ? 280 GLY A C     1 
ATOM   4908 O O     . GLY E 5 280 ? 67.716  61.150  128.573 1.00 84.11  ? 280 GLY A O     1 
ATOM   4909 N N     . GLN E 5 281 ? 69.916  61.581  128.938 1.00 100.00 ? 281 GLN A N     1 
ATOM   4910 C CA    . GLN E 5 281 ? 70.182  62.368  127.738 1.00 100.00 ? 281 GLN A CA    1 
ATOM   4911 C C     . GLN E 5 281 ? 70.516  61.504  126.520 1.00 100.00 ? 281 GLN A C     1 
ATOM   4912 O O     . GLN E 5 281 ? 70.704  62.004  125.403 1.00 100.00 ? 281 GLN A O     1 
ATOM   4913 C CB    . GLN E 5 281 ? 71.310  63.288  128.088 1.00 100.00 ? 281 GLN A CB    1 
ATOM   4914 C CG    . GLN E 5 281 ? 71.659  64.239  126.985 1.00 100.00 ? 281 GLN A CG    1 
ATOM   4915 C CD    . GLN E 5 281 ? 73.096  64.066  126.560 1.00 100.00 ? 281 GLN A CD    1 
ATOM   4916 O OE1   . GLN E 5 281 ? 73.959  63.860  127.410 1.00 100.00 ? 281 GLN A OE1   1 
ATOM   4917 N NE2   . GLN E 5 281 ? 73.405  64.129  125.287 1.00 100.00 ? 281 GLN A NE2   1 
ATOM   4918 N N     . ARG E 5 282 ? 70.613  60.259  126.773 1.00 97.63  ? 282 ARG A N     1 
ATOM   4919 C CA    . ARG E 5 282 ? 70.728  59.264  125.742 1.00 97.63  ? 282 ARG A CA    1 
ATOM   4920 C C     . ARG E 5 282 ? 71.983  59.180  124.872 1.00 97.63  ? 282 ARG A C     1 
ATOM   4921 O O     . ARG E 5 282 ? 71.987  59.305  123.671 1.00 97.63  ? 282 ARG A O     1 
ATOM   4922 C CB    . ARG E 5 282 ? 69.655  59.403  124.689 1.00 99.15  ? 282 ARG A CB    1 
ATOM   4923 C CG    . ARG E 5 282 ? 69.152  58.033  124.265 1.00 99.15  ? 282 ARG A CG    1 
ATOM   4924 C CD    . ARG E 5 282 ? 69.589  57.624  122.865 1.00 99.15  ? 282 ARG A CD    1 
ATOM   4925 N NE    . ARG E 5 282 ? 68.445  57.512  121.971 1.00 99.15  ? 282 ARG A NE    1 
ATOM   4926 C CZ    . ARG E 5 282 ? 67.376  56.759  122.241 1.00 99.15  ? 282 ARG A CZ    1 
ATOM   4927 N NH1   . ARG E 5 282 ? 67.312  56.032  123.365 1.00 99.15  ? 282 ARG A NH1   1 
ATOM   4928 N NH2   . ARG E 5 282 ? 66.308  56.668  121.442 1.00 99.15  ? 282 ARG A NH2   1 
ATOM   4929 N N     . TYR E 5 283 ? 73.115  58.963  125.368 1.00 58.20  ? 283 TYR A N     1 
ATOM   4930 C CA    . TYR E 5 283 ? 74.126  58.353  124.403 1.00 58.20  ? 283 TYR A CA    1 
ATOM   4931 C C     . TYR E 5 283 ? 75.449  58.583  125.003 1.00 58.20  ? 283 TYR A C     1 
ATOM   4932 O O     . TYR E 5 283 ? 76.341  59.114  124.361 1.00 58.20  ? 283 TYR A O     1 
ATOM   4933 C CB    . TYR E 5 283 ? 74.089  58.810  122.876 1.00 71.56  ? 283 TYR A CB    1 
ATOM   4934 C CG    . TYR E 5 283 ? 73.496  57.814  121.743 1.00 71.56  ? 283 TYR A CG    1 
ATOM   4935 C CD1   . TYR E 5 283 ? 74.147  56.620  121.255 1.00 71.56  ? 283 TYR A CD1   1 
ATOM   4936 C CD2   . TYR E 5 283 ? 72.267  58.127  121.127 1.00 71.56  ? 283 TYR A CD2   1 
ATOM   4937 C CE1   . TYR E 5 283 ? 73.591  55.834  120.219 1.00 71.56  ? 283 TYR A CE1   1 
ATOM   4938 C CE2   . TYR E 5 283 ? 71.715  57.335  120.096 1.00 71.56  ? 283 TYR A CE2   1 
ATOM   4939 C CZ    . TYR E 5 283 ? 72.376  56.195  119.638 1.00 71.56  ? 283 TYR A CZ    1 
ATOM   4940 O OH    . TYR E 5 283 ? 71.828  55.452  118.628 1.00 71.56  ? 283 TYR A OH    1 
ATOM   4941 N N     . LEU E 5 284 ? 75.484  58.165  126.241 1.00 56.61  ? 284 LEU A N     1 
ATOM   4942 C CA    . LEU E 5 284 ? 76.616  58.437  127.109 1.00 56.61  ? 284 LEU A CA    1 
ATOM   4943 C C     . LEU E 5 284 ? 77.712  57.379  127.031 1.00 56.61  ? 284 LEU A C     1 
ATOM   4944 O O     . LEU E 5 284 ? 78.906  57.707  127.004 1.00 56.61  ? 284 LEU A O     1 
ATOM   4945 C CB    . LEU E 5 284 ? 76.126  58.541  128.544 1.00 86.14  ? 284 LEU A CB    1 
ATOM   4946 C CG    . LEU E 5 284 ? 77.262  58.756  129.531 1.00 86.14  ? 284 LEU A CG    1 
ATOM   4947 C CD1   . LEU E 5 284 ? 76.871  59.648  130.707 1.00 86.14  ? 284 LEU A CD1   1 
ATOM   4948 C CD2   . LEU E 5 284 ? 77.760  57.447  130.141 1.00 86.14  ? 284 LEU A CD2   1 
ATOM   4949 N N     . ALA E 5 285 ? 77.306  56.134  127.018 1.00 35.56  ? 285 ALA A N     1 
ATOM   4950 C CA    . ALA E 5 285 ? 78.255  55.014  126.950 1.00 35.56  ? 285 ALA A CA    1 
ATOM   4951 C C     . ALA E 5 285 ? 78.308  54.482  125.525 1.00 35.56  ? 285 ALA A C     1 
ATOM   4952 O O     . ALA E 5 285 ? 77.759  55.093  124.612 1.00 35.56  ? 285 ALA A O     1 
ATOM   4953 C CB    . ALA E 5 285 ? 77.808  53.894  127.892 1.00 15.76  ? 285 ALA A CB    1 
ATOM   4954 N N     . TRP E 5 286 ? 78.967  53.345  125.336 1.00 31.96  ? 286 TRP A N     1 
ATOM   4955 C CA    . TRP E 5 286 ? 79.063  52.744  124.013 1.00 31.96  ? 286 TRP A CA    1 
ATOM   4956 C C     . TRP E 5 286 ? 77.814  51.915  123.762 1.00 31.96  ? 286 TRP A C     1 
ATOM   4957 O O     . TRP E 5 286 ? 77.128  51.518  124.704 1.00 31.96  ? 286 TRP A O     1 
ATOM   4958 C CB    . TRP E 5 286 ? 80.298  51.852  123.923 1.00 25.52  ? 286 TRP A CB    1 
ATOM   4959 C CG    . TRP E 5 286 ? 81.576  52.608  124.021 1.00 25.52  ? 286 TRP A CG    1 
ATOM   4960 C CD1   . TRP E 5 286 ? 81.885  53.780  123.391 1.00 25.52  ? 286 TRP A CD1   1 
ATOM   4961 C CD2   . TRP E 5 286 ? 82.720  52.260  124.809 1.00 25.52  ? 286 TRP A CD2   1 
ATOM   4962 N NE1   . TRP E 5 286 ? 83.151  54.183  123.740 1.00 25.52  ? 286 TRP A NE1   1 
ATOM   4963 C CE2   . TRP E 5 286 ? 83.687  53.270  124.610 1.00 25.52  ? 286 TRP A CE2   1 
ATOM   4964 C CE3   . TRP E 5 286 ? 83.022  51.193  125.667 1.00 25.52  ? 286 TRP A CE3   1 
ATOM   4965 C CZ2   . TRP E 5 286 ? 84.936  53.244  125.235 1.00 25.52  ? 286 TRP A CZ2   1 
ATOM   4966 C CZ3   . TRP E 5 286 ? 84.264  51.168  126.289 1.00 25.52  ? 286 TRP A CZ3   1 
ATOM   4967 C CH2   . TRP E 5 286 ? 85.206  52.189  126.069 1.00 25.52  ? 286 TRP A CH2   1 
ATOM   4968 N N     . SER E 5 287 ? 77.521  51.654  122.492 1.00 41.74  ? 287 SER A N     1 
ATOM   4969 C CA    . SER E 5 287 ? 76.344  50.874  122.131 1.00 41.74  ? 287 SER A CA    1 
ATOM   4970 C C     . SER E 5 287 ? 76.672  49.796  121.109 1.00 41.74  ? 287 SER A C     1 
ATOM   4971 O O     . SER E 5 287 ? 77.837  49.562  120.786 1.00 41.74  ? 287 SER A O     1 
ATOM   4972 C CB    . SER E 5 287 ? 75.257  51.794  121.574 1.00 47.96  ? 287 SER A CB    1 
ATOM   4973 O OG    . SER E 5 287 ? 75.756  53.104  121.368 1.00 47.96  ? 287 SER A OG    1 
ATOM   4974 N N     . GLY E 5 288 ? 75.628  49.150  120.600 1.00 31.97  ? 288 GLY A N     1 
ATOM   4975 C CA    . GLY E 5 288 ? 75.801  48.090  119.625 1.00 31.97  ? 288 GLY A CA    1 
ATOM   4976 C C     . GLY E 5 288 ? 76.634  48.446  118.409 1.00 31.97  ? 288 GLY A C     1 
ATOM   4977 O O     . GLY E 5 288 ? 77.322  47.586  117.863 1.00 31.97  ? 288 GLY A O     1 
ATOM   4978 N N     . HIS E 5 289 ? 76.581  49.702  117.976 1.00 37.02  ? 289 HIS A N     1 
ATOM   4979 C CA    . HIS E 5 289 ? 77.345  50.118  116.805 1.00 37.02  ? 289 HIS A CA    1 
ATOM   4980 C C     . HIS E 5 289 ? 78.482  51.068  117.151 1.00 37.02  ? 289 HIS A C     1 
ATOM   4981 O O     . HIS E 5 289 ? 78.968  51.806  116.294 1.00 37.02  ? 289 HIS A O     1 
ATOM   4982 C CB    . HIS E 5 289 ? 76.427  50.775  115.772 1.00 69.11  ? 289 HIS A CB    1 
ATOM   4983 C CG    . HIS E 5 289 ? 75.759  52.022  116.259 1.00 69.11  ? 289 HIS A CG    1 
ATOM   4984 N ND1   . HIS E 5 289 ? 75.655  52.337  117.596 1.00 69.11  ? 289 HIS A ND1   1 
ATOM   4985 C CD2   . HIS E 5 289 ? 75.142  53.022  115.588 1.00 69.11  ? 289 HIS A CD2   1 
ATOM   4986 C CE1   . HIS E 5 289 ? 75.000  53.477  117.728 1.00 69.11  ? 289 HIS A CE1   1 
ATOM   4987 N NE2   . HIS E 5 289 ? 74.678  53.913  116.524 1.00 69.11  ? 289 HIS A NE2   1 
ATOM   4988 N N     . SER E 5 290 ? 78.907  51.043  118.409 1.00 31.77  ? 290 SER A N     1 
ATOM   4989 C CA    . SER E 5 290 ? 79.991  51.903  118.859 1.00 31.77  ? 290 SER A CA    1 
ATOM   4990 C C     . SER E 5 290 ? 81.306  51.450  118.239 1.00 31.77  ? 290 SER A C     1 
ATOM   4991 O O     . SER E 5 290 ? 82.268  52.211  118.177 1.00 31.77  ? 290 SER A O     1 
ATOM   4992 C CB    . SER E 5 290 ? 80.097  51.866  120.383 1.00 40.84  ? 290 SER A CB    1 
ATOM   4993 O OG    . SER E 5 290 ? 79.448  52.986  120.958 1.00 40.84  ? 290 SER A OG    1 
ATOM   4994 N N     . ALA E 5 291 ? 81.336  50.205  117.772 1.00 37.94  ? 291 ALA A N     1 
ATOM   4995 C CA    . ALA E 5 291 ? 82.536  49.649  117.153 1.00 37.94  ? 291 ALA A CA    1 
ATOM   4996 C C     . ALA E 5 291 ? 82.575  49.961  115.660 1.00 37.94  ? 291 ALA A C     1 
ATOM   4997 O O     . ALA E 5 291 ? 83.648  50.055  115.063 1.00 37.94  ? 291 ALA A O     1 
ATOM   4998 C CB    . ALA E 5 291 ? 82.584  48.142  117.375 1.00 67.18  ? 291 ALA A CB    1 
ATOM   4999 N N     . ARG E 5 292 ? 81.396  50.118  115.064 1.00 34.56  ? 292 ARG A N     1 
ATOM   5000 C CA    . ARG E 5 292 ? 81.284  50.432  113.644 1.00 34.56  ? 292 ARG A CA    1 
ATOM   5001 C C     . ARG E 5 292 ? 81.725  51.868  113.400 1.00 34.56  ? 292 ARG A C     1 
ATOM   5002 O O     . ARG E 5 292 ? 82.603  52.130  112.579 1.00 34.56  ? 292 ARG A O     1 
ATOM   5003 C CB    . ARG E 5 292 ? 79.841  50.267  113.178 1.00 35.29  ? 292 ARG A CB    1 
ATOM   5004 C CG    . ARG E 5 292 ? 79.329  48.848  113.232 1.00 35.29  ? 292 ARG A CG    1 
ATOM   5005 C CD    . ARG E 5 292 ? 77.999  48.745  112.516 1.00 35.29  ? 292 ARG A CD    1 
ATOM   5006 N NE    . ARG E 5 292 ? 78.170  48.362  111.120 1.00 35.29  ? 292 ARG A NE    1 
ATOM   5007 C CZ    . ARG E 5 292 ? 77.288  48.617  110.161 1.00 35.29  ? 292 ARG A CZ    1 
ATOM   5008 N NH1   . ARG E 5 292 ? 76.162  49.258  110.439 1.00 35.29  ? 292 ARG A NH1   1 
ATOM   5009 N NH2   . ARG E 5 292 ? 77.526  48.214  108.923 1.00 35.29  ? 292 ARG A NH2   1 
ATOM   5010 N N     . VAL E 5 293 ? 81.095  52.793  114.117 1.00 40.60  ? 293 VAL A N     1 
ATOM   5011 C CA    . VAL E 5 293 ? 81.411  54.212  114.010 1.00 40.60  ? 293 VAL A CA    1 
ATOM   5012 C C     . VAL E 5 293 ? 82.901  54.419  114.269 1.00 40.60  ? 293 VAL A C     1 
ATOM   5013 O O     . VAL E 5 293 ? 83.574  55.154  113.548 1.00 40.60  ? 293 VAL A O     1 
ATOM   5014 C CB    . VAL E 5 293 ? 80.611  55.037  115.046 1.00 40.23  ? 293 VAL A CB    1 
ATOM   5015 C CG1   . VAL E 5 293 ? 80.899  56.520  114.874 1.00 40.23  ? 293 VAL A CG1   1 
ATOM   5016 C CG2   . VAL E 5 293 ? 79.123  54.758  114.893 1.00 40.23  ? 293 VAL A CG2   1 
ATOM   5017 N N     . GLY E 5 294 ? 83.404  53.754  115.305 1.00 43.32  ? 294 GLY A N     1 
ATOM   5018 C CA    . GLY E 5 294 ? 84.806  53.866  115.659 1.00 43.32  ? 294 GLY A CA    1 
ATOM   5019 C C     . GLY E 5 294 ? 85.735  53.361  114.577 1.00 43.32  ? 294 GLY A C     1 
ATOM   5020 O O     . GLY E 5 294 ? 86.619  54.088  114.128 1.00 43.32  ? 294 GLY A O     1 
ATOM   5021 N N     . ALA E 5 295 ? 85.540  52.113  114.160 1.00 33.60  ? 295 ALA A N     1 
ATOM   5022 C CA    . ALA E 5 295 ? 86.373  51.509  113.124 1.00 33.60  ? 295 ALA A CA    1 
ATOM   5023 C C     . ALA E 5 295 ? 86.428  52.396  111.886 1.00 33.60  ? 295 ALA A C     1 
ATOM   5024 O O     . ALA E 5 295 ? 87.500  52.632  111.329 1.00 33.60  ? 295 ALA A O     1 
ATOM   5025 C CB    . ALA E 5 295 ? 85.835  50.134  112.757 1.00 13.18  ? 295 ALA A CB    1 
ATOM   5026 N N     . ALA E 5 296 ? 85.267  52.886  111.462 1.00 38.43  ? 296 ALA A N     1 
ATOM   5027 C CA    . ALA E 5 296 ? 85.182  53.755  110.294 1.00 38.43  ? 296 ALA A CA    1 
ATOM   5028 C C     . ALA E 5 296 ? 86.099  54.959  110.469 1.00 38.43  ? 296 ALA A C     1 
ATOM   5029 O O     . ALA E 5 296 ? 86.962  55.215  109.633 1.00 38.43  ? 296 ALA A O     1 
ATOM   5030 C CB    . ALA E 5 296 ? 83.746  54.216  110.090 1.00 18.85  ? 296 ALA A CB    1 
ATOM   5031 N N     . ARG E 5 297 ? 85.905  55.694  111.562 1.00 43.07  ? 297 ARG A N     1 
ATOM   5032 C CA    . ARG E 5 297 ? 86.716  56.872  111.854 1.00 43.07  ? 297 ARG A CA    1 
ATOM   5033 C C     . ARG E 5 297 ? 88.197  56.527  111.815 1.00 43.07  ? 297 ARG A C     1 
ATOM   5034 O O     . ARG E 5 297 ? 88.997  57.258  111.234 1.00 43.07  ? 297 ARG A O     1 
ATOM   5035 C CB    . ARG E 5 297 ? 86.375  57.427  113.237 1.00 41.04  ? 297 ARG A CB    1 
ATOM   5036 C CG    . ARG E 5 297 ? 84.967  57.963  113.372 1.00 41.04  ? 297 ARG A CG    1 
ATOM   5037 C CD    . ARG E 5 297 ? 84.743  58.521  114.764 1.00 41.04  ? 297 ARG A CD    1 
ATOM   5038 N NE    . ARG E 5 297 ? 85.617  59.658  115.033 1.00 41.04  ? 297 ARG A NE    1 
ATOM   5039 C CZ    . ARG E 5 297 ? 85.183  60.851  115.420 1.00 41.04  ? 297 ARG A CZ    1 
ATOM   5040 N NH1   . ARG E 5 297 ? 83.883  61.061  115.585 1.00 41.04  ? 297 ARG A NH1   1 
ATOM   5041 N NH2   . ARG E 5 297 ? 86.045  61.836  115.639 1.00 41.04  ? 297 ARG A NH2   1 
ATOM   5042 N N     . ASP E 5 298 ? 88.554  55.414  112.447 1.00 46.32  ? 298 ASP A N     1 
ATOM   5043 C CA    . ASP E 5 298 ? 89.941  54.970  112.487 1.00 46.32  ? 298 ASP A CA    1 
ATOM   5044 C C     . ASP E 5 298 ? 90.453  54.713  111.077 1.00 46.32  ? 298 ASP A C     1 
ATOM   5045 O O     . ASP E 5 298 ? 91.622  54.950  110.780 1.00 46.32  ? 298 ASP A O     1 
ATOM   5046 C CB    . ASP E 5 298 ? 90.064  53.695  113.323 1.00 56.36  ? 298 ASP A CB    1 
ATOM   5047 C CG    . ASP E 5 298 ? 90.176  53.981  114.807 1.00 56.36  ? 298 ASP A CG    1 
ATOM   5048 O OD1   . ASP E 5 298 ? 90.807  54.994  115.177 1.00 56.36  ? 298 ASP A OD1   1 
ATOM   5049 O OD2   . ASP E 5 298 ? 89.632  53.190  115.605 1.00 56.36  ? 298 ASP A OD2   1 
ATOM   5050 N N     . MET E 5 299 ? 89.570  54.225  110.212 1.00 57.90  ? 299 MET A N     1 
ATOM   5051 C CA    . MET E 5 299 ? 89.939  53.948  108.830 1.00 57.90  ? 299 MET A CA    1 
ATOM   5052 C C     . MET E 5 299 ? 90.114  55.270  108.091 1.00 57.90  ? 299 MET A C     1 
ATOM   5053 O O     . MET E 5 299 ? 91.023  55.428  107.277 1.00 57.90  ? 299 MET A O     1 
ATOM   5054 C CB    . MET E 5 299 ? 88.858  53.106  108.149 1.00 56.60  ? 299 MET A CB    1 
ATOM   5055 C CG    . MET E 5 299 ? 88.964  51.619  108.444 1.00 56.60  ? 299 MET A CG    1 
ATOM   5056 S SD    . MET E 5 299 ? 87.797  50.612  107.506 1.00 56.60  ? 299 MET A SD    1 
ATOM   5057 C CE    . MET E 5 299 ? 86.339  50.683  108.565 1.00 56.60  ? 299 MET A CE    1 
ATOM   5058 N N     . ALA E 5 300 ? 89.241  56.223  108.393 1.00 63.12  ? 300 ALA A N     1 
ATOM   5059 C CA    . ALA E 5 300 ? 89.300  57.530  107.761 1.00 63.12  ? 300 ALA A CA    1 
ATOM   5060 C C     . ALA E 5 300 ? 90.565  58.253  108.205 1.00 63.12  ? 300 ALA A C     1 
ATOM   5061 O O     . ALA E 5 300 ? 91.221  58.925  107.409 1.00 63.12  ? 300 ALA A O     1 
ATOM   5062 C CB    . ALA E 5 300 ? 88.070  58.343  108.135 1.00 36.79  ? 300 ALA A CB    1 
ATOM   5063 N N     . ARG E 5 301 ? 90.907  58.099  109.480 1.00 56.61  ? 301 ARG A N     1 
ATOM   5064 C CA    . ARG E 5 301 ? 92.090  58.737  110.041 1.00 56.61  ? 301 ARG A CA    1 
ATOM   5065 C C     . ARG E 5 301 ? 93.336  58.311  109.278 1.00 56.61  ? 301 ARG A C     1 
ATOM   5066 O O     . ARG E 5 301 ? 94.101  59.149  108.797 1.00 56.61  ? 301 ARG A O     1 
ATOM   5067 C CB    . ARG E 5 301 ? 92.236  58.366  111.517 1.00 48.89  ? 301 ARG A CB    1 
ATOM   5068 C CG    . ARG E 5 301 ? 91.809  59.464  112.472 1.00 48.89  ? 301 ARG A CG    1 
ATOM   5069 C CD    . ARG E 5 301 ? 91.847  58.993  113.914 1.00 48.89  ? 301 ARG A CD    1 
ATOM   5070 N NE    . ARG E 5 301 ? 90.748  59.557  114.692 1.00 48.89  ? 301 ARG A NE    1 
ATOM   5071 C CZ    . ARG E 5 301 ? 89.747  58.842  115.194 1.00 48.89  ? 301 ARG A CZ    1 
ATOM   5072 N NH1   . ARG E 5 301 ? 89.705  57.531  115.002 1.00 48.89  ? 301 ARG A NH1   1 
ATOM   5073 N NH2   . ARG E 5 301 ? 88.783  59.438  115.882 1.00 48.89  ? 301 ARG A NH2   1 
ATOM   5074 N N     . ALA E 5 302 ? 93.530  57.002  109.164 1.00 72.38  ? 302 ALA A N     1 
ATOM   5075 C CA    . ALA E 5 302 ? 94.680  56.459  108.456 1.00 72.38  ? 302 ALA A CA    1 
ATOM   5076 C C     . ALA E 5 302 ? 94.560  56.743  106.966 1.00 72.38  ? 302 ALA A C     1 
ATOM   5077 O O     . ALA E 5 302 ? 95.365  56.263  106.167 1.00 72.38  ? 302 ALA A O     1 
ATOM   5078 C CB    . ALA E 5 302 ? 94.779  54.958  108.694 1.00 63.03  ? 302 ALA A CB    1 
ATOM   5079 N N     . GLY E 5 303 ? 93.548  57.521  106.597 1.00 92.24  ? 303 GLY A N     1 
ATOM   5080 C CA    . GLY E 5 303 ? 93.344  57.856  105.201 1.00 92.24  ? 303 GLY A CA    1 
ATOM   5081 C C     . GLY E 5 303 ? 92.942  56.647  104.384 1.00 92.24  ? 303 GLY A C     1 
ATOM   5082 O O     . GLY E 5 303 ? 93.795  55.895  103.909 1.00 92.24  ? 303 GLY A O     1 
ATOM   5083 N N     . VAL E 5 304 ? 91.638  56.454  104.225 1.00 61.60  ? 304 VAL A N     1 
ATOM   5084 C CA    . VAL E 5 304 ? 91.124  55.331  103.454 1.00 61.60  ? 304 VAL A CA    1 
ATOM   5085 C C     . VAL E 5 304 ? 89.909  55.778  102.648 1.00 61.60  ? 304 VAL A C     1 
ATOM   5086 O O     . VAL E 5 304 ? 88.979  56.383  103.185 1.00 61.60  ? 304 VAL A O     1 
ATOM   5087 C CB    . VAL E 5 304 ? 90.726  54.151  104.374 1.00 41.16  ? 304 VAL A CB    1 
ATOM   5088 C CG1   . VAL E 5 304 ? 89.969  53.098  103.580 1.00 41.16  ? 304 VAL A CG1   1 
ATOM   5089 C CG2   . VAL E 5 304 ? 91.970  53.538  104.996 1.00 41.16  ? 304 VAL A CG2   1 
ATOM   5090 N N     . SER E 5 305 ? 89.931  55.481  101.353 1.00 80.80  ? 305 SER A N     1 
ATOM   5091 C CA    . SER E 5 305 ? 88.841  55.851  100.462 1.00 80.80  ? 305 SER A CA    1 
ATOM   5092 C C     . SER E 5 305 ? 87.494  55.567  101.108 1.00 80.80  ? 305 SER A C     1 
ATOM   5093 O O     . SER E 5 305 ? 87.244  54.452  101.567 1.00 80.80  ? 305 SER A O     1 
ATOM   5094 C CB    . SER E 5 305 ? 88.948  55.074  99.148  1.00 56.97  ? 305 SER A CB    1 
ATOM   5095 O OG    . SER E 5 305 ? 87.893  54.135  99.024  1.00 56.97  ? 305 SER A OG    1 
ATOM   5096 N N     . ILE E 5 306 ? 86.634  56.582  101.152 1.00 65.21  ? 306 ILE A N     1 
ATOM   5097 C CA    . ILE E 5 306 ? 85.308  56.428  101.735 1.00 65.21  ? 306 ILE A CA    1 
ATOM   5098 C C     . ILE E 5 306 ? 84.652  55.151  101.223 1.00 65.21  ? 306 ILE A C     1 
ATOM   5099 O O     . ILE E 5 306 ? 84.089  54.382  102.001 1.00 65.21  ? 306 ILE A O     1 
ATOM   5100 C CB    . ILE E 5 306 ? 84.398  57.623  101.390 1.00 54.17  ? 306 ILE A CB    1 
ATOM   5101 C CG1   . ILE E 5 306 ? 85.021  58.918  101.911 1.00 54.17  ? 306 ILE A CG1   1 
ATOM   5102 C CG2   . ILE E 5 306 ? 83.023  57.425  102.005 1.00 54.17  ? 306 ILE A CG2   1 
ATOM   5103 C CD1   . ILE E 5 306 ? 85.341  58.895  103.391 1.00 54.17  ? 306 ILE A CD1   1 
ATOM   5104 N N     . PRO E 5 307 ? 84.710  54.909  99.900  1.00 48.15  ? 307 PRO A N     1 
ATOM   5105 C CA    . PRO E 5 307 ? 84.098  53.691  99.360  1.00 48.15  ? 307 PRO A CA    1 
ATOM   5106 C C     . PRO E 5 307 ? 84.651  52.452  100.054 1.00 48.15  ? 307 PRO A C     1 
ATOM   5107 O O     . PRO E 5 307 ? 83.916  51.513  100.354 1.00 48.15  ? 307 PRO A O     1 
ATOM   5108 C CB    . PRO E 5 307 ? 84.465  53.728  97.877  1.00 94.20  ? 307 PRO A CB    1 
ATOM   5109 C CG    . PRO E 5 307 ? 84.721  55.165  97.587  1.00 94.20  ? 307 PRO A CG    1 
ATOM   5110 C CD    . PRO E 5 307 ? 85.318  55.732  98.839  1.00 94.20  ? 307 PRO A CD    1 
ATOM   5111 N N     . GLU E 5 308 ? 85.955  52.463  100.307 1.00 54.87  ? 308 GLU A N     1 
ATOM   5112 C CA    . GLU E 5 308 ? 86.614  51.348  100.973 1.00 54.87  ? 308 GLU A CA    1 
ATOM   5113 C C     . GLU E 5 308 ? 86.009  51.148  102.359 1.00 54.87  ? 308 GLU A C     1 
ATOM   5114 O O     . GLU E 5 308 ? 85.833  50.017  102.815 1.00 54.87  ? 308 GLU A O     1 
ATOM   5115 C CB    . GLU E 5 308 ? 88.113  51.622  101.099 1.00 99.89  ? 308 GLU A CB    1 
ATOM   5116 C CG    . GLU E 5 308 ? 88.887  51.445  99.805  1.00 99.89  ? 308 GLU A CG    1 
ATOM   5117 C CD    . GLU E 5 308 ? 89.188  49.990  99.503  1.00 99.89  ? 308 GLU A CD    1 
ATOM   5118 O OE1   . GLU E 5 308 ? 90.074  49.416  100.172 1.00 99.89  ? 308 GLU A OE1   1 
ATOM   5119 O OE2   . GLU E 5 308 ? 88.540  49.421  98.597  1.00 99.89  ? 308 GLU A OE2   1 
ATOM   5120 N N     . ILE E 5 309 ? 85.694  52.258  103.020 1.00 67.98  ? 309 ILE A N     1 
ATOM   5121 C CA    . ILE E 5 309 ? 85.105  52.230  104.353 1.00 67.98  ? 309 ILE A CA    1 
ATOM   5122 C C     . ILE E 5 309 ? 83.654  51.776  104.245 1.00 67.98  ? 309 ILE A C     1 
ATOM   5123 O O     . ILE E 5 309 ? 83.102  51.184  105.172 1.00 67.98  ? 309 ILE A O     1 
ATOM   5124 C CB    . ILE E 5 309 ? 85.168  53.629  105.010 1.00 43.40  ? 309 ILE A CB    1 
ATOM   5125 C CG1   . ILE E 5 309 ? 86.611  53.936  105.421 1.00 43.40  ? 309 ILE A CG1   1 
ATOM   5126 C CG2   . ILE E 5 309 ? 84.247  53.693  106.220 1.00 43.40  ? 309 ILE A CG2   1 
ATOM   5127 C CD1   . ILE E 5 309 ? 86.846  55.374  105.829 1.00 43.40  ? 309 ILE A CD1   1 
ATOM   5128 N N     . MET E 5 310 ? 83.045  52.057  103.100 1.00 52.98  ? 310 MET A N     1 
ATOM   5129 C CA    . MET E 5 310 ? 81.666  51.669  102.852 1.00 52.98  ? 310 MET A CA    1 
ATOM   5130 C C     . MET E 5 310 ? 81.577  50.149  102.912 1.00 52.98  ? 310 MET A C     1 
ATOM   5131 O O     . MET E 5 310 ? 80.732  49.592  103.608 1.00 52.98  ? 310 MET A O     1 
ATOM   5132 C CB    . MET E 5 310 ? 81.227  52.157  101.470 1.00 65.37  ? 310 MET A CB    1 
ATOM   5133 C CG    . MET E 5 310 ? 79.777  52.593  101.391 1.00 65.37  ? 310 MET A CG    1 
ATOM   5134 S SD    . MET E 5 310 ? 79.589  54.341  100.990 1.00 65.37  ? 310 MET A SD    1 
ATOM   5135 C CE    . MET E 5 310 ? 80.646  55.093  102.231 1.00 65.37  ? 310 MET A CE    1 
ATOM   5136 N N     . GLN E 5 311 ? 82.471  49.487  102.187 1.00 67.03  ? 311 GLN A N     1 
ATOM   5137 C CA    . GLN E 5 311 ? 82.496  48.031  102.141 1.00 67.03  ? 311 GLN A CA    1 
ATOM   5138 C C     . GLN E 5 311 ? 82.723  47.411  103.514 1.00 67.03  ? 311 GLN A C     1 
ATOM   5139 O O     . GLN E 5 311 ? 81.888  46.651  104.002 1.00 67.03  ? 311 GLN A O     1 
ATOM   5140 C CB    . GLN E 5 311 ? 83.589  47.552  101.183 1.00 100.00 ? 311 GLN A CB    1 
ATOM   5141 C CG    . GLN E 5 311 ? 83.583  46.050  100.935 1.00 100.00 ? 311 GLN A CG    1 
ATOM   5142 C CD    . GLN E 5 311 ? 84.884  45.384  101.349 1.00 100.00 ? 311 GLN A CD    1 
ATOM   5143 O OE1   . GLN E 5 311 ? 84.886  44.415  102.111 1.00 100.00 ? 311 GLN A OE1   1 
ATOM   5144 N NE2   . GLN E 5 311 ? 85.999  45.903  100.849 1.00 100.00 ? 311 GLN A NE2   1 
ATOM   5145 N N     . ALA E 5 312 ? 83.860  47.734  104.125 1.00 87.40  ? 312 ALA A N     1 
ATOM   5146 C CA    . ALA E 5 312 ? 84.217  47.212  105.441 1.00 87.40  ? 312 ALA A CA    1 
ATOM   5147 C C     . ALA E 5 312 ? 83.008  47.038  106.355 1.00 87.40  ? 312 ALA A C     1 
ATOM   5148 O O     . ALA E 5 312 ? 82.883  46.030  107.050 1.00 87.40  ? 312 ALA A O     1 
ATOM   5149 C CB    . ALA E 5 312 ? 85.238  48.128  106.102 1.00 100.00 ? 312 ALA A CB    1 
ATOM   5150 N N     . GLY E 5 313 ? 82.117  48.023  106.349 1.00 47.92  ? 313 GLY A N     1 
ATOM   5151 C CA    . GLY E 5 313 ? 80.938  47.947  107.190 1.00 47.92  ? 313 GLY A CA    1 
ATOM   5152 C C     . GLY E 5 313 ? 79.644  47.817  106.411 1.00 47.92  ? 313 GLY A C     1 
ATOM   5153 O O     . GLY E 5 313 ? 78.672  48.507  106.706 1.00 47.92  ? 313 GLY A O     1 
ATOM   5154 N N     . GLY E 5 314 ? 79.630  46.933  105.418 1.00 43.39  ? 314 GLY A N     1 
ATOM   5155 C CA    . GLY E 5 314 ? 78.436  46.723  104.615 1.00 43.39  ? 314 GLY A CA    1 
ATOM   5156 C C     . GLY E 5 314 ? 77.611  47.967  104.336 1.00 43.39  ? 314 GLY A C     1 
ATOM   5157 O O     . GLY E 5 314 ? 76.400  47.883  104.138 1.00 43.39  ? 314 GLY A O     1 
ATOM   5158 N N     . TRP E 5 315 ? 78.264  49.123  104.321 1.00 60.66  ? 315 TRP A N     1 
ATOM   5159 C CA    . TRP E 5 315 ? 77.590  50.387  104.062 1.00 60.66  ? 315 TRP A CA    1 
ATOM   5160 C C     . TRP E 5 315 ? 77.355  50.610  102.574 1.00 60.66  ? 315 TRP A C     1 
ATOM   5161 O O     . TRP E 5 315 ? 78.067  50.068  101.729 1.00 60.66  ? 315 TRP A O     1 
ATOM   5162 C CB    . TRP E 5 315 ? 78.416  51.546  104.618 1.00 60.34  ? 315 TRP A CB    1 
ATOM   5163 C CG    . TRP E 5 315 ? 78.146  51.836  106.054 1.00 60.34  ? 315 TRP A CG    1 
ATOM   5164 C CD1   . TRP E 5 315 ? 76.962  52.240  106.602 1.00 60.34  ? 315 TRP A CD1   1 
ATOM   5165 C CD2   . TRP E 5 315 ? 79.081  51.748  107.135 1.00 60.34  ? 315 TRP A CD2   1 
ATOM   5166 N NE1   . TRP E 5 315 ? 77.103  52.409  107.957 1.00 60.34  ? 315 TRP A NE1   1 
ATOM   5167 C CE2   . TRP E 5 315 ? 78.393  52.115  108.313 1.00 60.34  ? 315 TRP A CE2   1 
ATOM   5168 C CE3   . TRP E 5 315 ? 80.435  51.395  107.223 1.00 60.34  ? 315 TRP A CE3   1 
ATOM   5169 C CZ2   . TRP E 5 315 ? 79.013  52.138  109.565 1.00 60.34  ? 315 TRP A CZ2   1 
ATOM   5170 C CZ3   . TRP E 5 315 ? 81.052  51.419  108.468 1.00 60.34  ? 315 TRP A CZ3   1 
ATOM   5171 C CH2   . TRP E 5 315 ? 80.339  51.788  109.624 1.00 60.34  ? 315 TRP A CH2   1 
ATOM   5172 N N     . THR E 5 316 ? 76.348  51.417  102.263 1.00 97.59  ? 316 THR A N     1 
ATOM   5173 C CA    . THR E 5 316 ? 76.011  51.733  100.884 1.00 97.59  ? 316 THR A CA    1 
ATOM   5174 C C     . THR E 5 316 ? 75.449  53.148  100.848 1.00 97.59  ? 316 THR A C     1 
ATOM   5175 O O     . THR E 5 316 ? 75.020  53.638  99.803  1.00 97.59  ? 316 THR A O     1 
ATOM   5176 C CB    . THR E 5 316 ? 74.965  50.751  100.326 1.00 100.00 ? 316 THR A CB    1 
ATOM   5177 O OG1   . THR E 5 316 ? 74.390  50.002  101.403 1.00 100.00 ? 316 THR A OG1   1 
ATOM   5178 C CG2   . THR E 5 316 ? 75.614  49.787  99.337  1.00 100.00 ? 316 THR A CG2   1 
ATOM   5179 N N     . ASN E 5 317 ? 75.461  53.796  102.008 1.00 99.15  ? 317 ASN A N     1 
ATOM   5180 C CA    . ASN E 5 317 ? 74.968  55.158  102.142 1.00 99.15  ? 317 ASN A CA    1 
ATOM   5181 C C     . ASN E 5 317 ? 76.110  56.057  102.596 1.00 99.15  ? 317 ASN A C     1 
ATOM   5182 O O     . ASN E 5 317 ? 76.266  56.327  103.788 1.00 99.15  ? 317 ASN A O     1 
ATOM   5183 C CB    . ASN E 5 317 ? 73.831  55.210  103.162 1.00 100.00 ? 317 ASN A CB    1 
ATOM   5184 C CG    . ASN E 5 317 ? 72.487  55.480  102.520 1.00 100.00 ? 317 ASN A CG    1 
ATOM   5185 O OD1   . ASN E 5 317 ? 72.088  54.795  101.576 1.00 100.00 ? 317 ASN A OD1   1 
ATOM   5186 N ND2   . ASN E 5 317 ? 71.780  56.484  103.027 1.00 100.00 ? 317 ASN A ND2   1 
ATOM   5187 N N     . VAL E 5 318 ? 76.909  56.510  101.634 1.00 77.18  ? 318 VAL A N     1 
ATOM   5188 C CA    . VAL E 5 318 ? 78.047  57.378  101.910 1.00 77.18  ? 318 VAL A CA    1 
ATOM   5189 C C     . VAL E 5 318 ? 77.722  58.389  103.003 1.00 77.18  ? 318 VAL A C     1 
ATOM   5190 O O     . VAL E 5 318 ? 78.545  58.660  103.878 1.00 77.18  ? 318 VAL A O     1 
ATOM   5191 C CB    . VAL E 5 318 ? 78.474  58.148  100.645 1.00 53.77  ? 318 VAL A CB    1 
ATOM   5192 C CG1   . VAL E 5 318 ? 79.170  57.210  99.677  1.00 53.77  ? 318 VAL A CG1   1 
ATOM   5193 C CG2   . VAL E 5 318 ? 77.257  58.781  99.988  1.00 53.77  ? 318 VAL A CG2   1 
ATOM   5194 N N     . ASN E 5 319 ? 76.513  58.938  102.945 1.00 71.18  ? 319 ASN A N     1 
ATOM   5195 C CA    . ASN E 5 319 ? 76.065  59.921  103.921 1.00 71.18  ? 319 ASN A CA    1 
ATOM   5196 C C     . ASN E 5 319 ? 76.277  59.436  105.352 1.00 71.18  ? 319 ASN A C     1 
ATOM   5197 O O     . ASN E 5 319 ? 76.981  60.078  106.133 1.00 71.18  ? 319 ASN A O     1 
ATOM   5198 C CB    . ASN E 5 319 ? 74.585  60.238  103.698 1.00 77.94  ? 319 ASN A CB    1 
ATOM   5199 C CG    . ASN E 5 319 ? 73.754  58.993  103.449 1.00 77.94  ? 319 ASN A CG    1 
ATOM   5200 O OD1   . ASN E 5 319 ? 73.921  58.312  102.435 1.00 77.94  ? 319 ASN A OD1   1 
ATOM   5201 N ND2   . ASN E 5 319 ? 72.852  58.688  104.377 1.00 77.94  ? 319 ASN A ND2   1 
ATOM   5202 N N     . ILE E 5 320 ? 75.670  58.302  105.688 1.00 54.80  ? 320 ILE A N     1 
ATOM   5203 C CA    . ILE E 5 320 ? 75.790  57.738  107.029 1.00 54.80  ? 320 ILE A CA    1 
ATOM   5204 C C     . ILE E 5 320 ? 77.251  57.637  107.463 1.00 54.80  ? 320 ILE A C     1 
ATOM   5205 O O     . ILE E 5 320 ? 77.620  58.053  108.569 1.00 54.80  ? 320 ILE A O     1 
ATOM   5206 C CB    . ILE E 5 320 ? 75.142  56.339  107.106 1.00 52.89  ? 320 ILE A CB    1 
ATOM   5207 C CG1   . ILE E 5 320 ? 73.631  56.374  106.864 1.00 52.89  ? 320 ILE A CG1   1 
ATOM   5208 C CG2   . ILE E 5 320 ? 75.341  55.670  108.467 1.00 52.89  ? 320 ILE A CG2   1 
ATOM   5209 C CD1   . ILE E 5 320 ? 72.867  57.130  107.953 1.00 52.89  ? 320 ILE A CD1   1 
ATOM   5210 N N     . VAL E 5 321 ? 78.067  57.084  106.592 1.00 47.01  ? 321 VAL A N     1 
ATOM   5211 C CA    . VAL E 5 321 ? 79.496  56.918  106.885 1.00 47.01  ? 321 VAL A CA    1 
ATOM   5212 C C     . VAL E 5 321 ? 80.160  58.278  107.076 1.00 47.01  ? 321 VAL A C     1 
ATOM   5213 O O     . VAL E 5 321 ? 81.154  58.409  107.800 1.00 47.01  ? 321 VAL A O     1 
ATOM   5214 C CB    . VAL E 5 321 ? 80.206  56.194  105.748 1.00 39.71  ? 321 VAL A CB    1 
ATOM   5215 C CG1   . VAL E 5 321 ? 81.661  55.857  106.088 1.00 39.71  ? 321 VAL A CG1   1 
ATOM   5216 C CG2   . VAL E 5 321 ? 79.538  54.870  105.383 1.00 39.71  ? 321 VAL A CG2   1 
ATOM   5217 N N     . MET E 5 322 ? 79.594  59.268  106.421 1.00 62.12  ? 322 MET A N     1 
ATOM   5218 C CA    . MET E 5 322 ? 80.116  60.635  106.482 1.00 62.12  ? 322 MET A CA    1 
ATOM   5219 C C     . MET E 5 322 ? 79.615  61.344  107.742 1.00 62.12  ? 322 MET A C     1 
ATOM   5220 O O     . MET E 5 322 ? 80.006  62.480  108.036 1.00 62.12  ? 322 MET A O     1 
ATOM   5221 C CB    . MET E 5 322 ? 79.674  61.417  105.250 1.00 90.79  ? 322 MET A CB    1 
ATOM   5222 C CG    . MET E 5 322 ? 80.759  61.478  104.175 1.00 90.79  ? 322 MET A CG    1 
ATOM   5223 S SD    . MET E 5 322 ? 81.475  63.096  104.015 1.00 90.79  ? 322 MET A SD    1 
ATOM   5224 C CE    . MET E 5 322 ? 80.181  64.284  103.747 1.00 90.79  ? 322 MET A CE    1 
ATOM   5225 N N     . ASN E 5 323 ? 78.759  60.654  108.470 1.00 37.77  ? 323 ASN A N     1 
ATOM   5226 C CA    . ASN E 5 323 ? 78.176  61.199  109.703 1.00 37.77  ? 323 ASN A CA    1 
ATOM   5227 C C     . ASN E 5 323 ? 79.035  60.835  110.915 1.00 37.77  ? 323 ASN A C     1 
ATOM   5228 O O     . ASN E 5 323 ? 78.952  61.471  111.973 1.00 37.77  ? 323 ASN A O     1 
ATOM   5229 C CB    . ASN E 5 323 ? 76.766  60.655  109.907 1.00 93.84  ? 323 ASN A CB    1 
ATOM   5230 C CG    . ASN E 5 323 ? 75.690  61.651  109.476 1.00 93.84  ? 323 ASN A CG    1 
ATOM   5231 O OD1   . ASN E 5 323 ? 75.614  61.999  108.298 1.00 93.84  ? 323 ASN A OD1   1 
ATOM   5232 N ND2   . ASN E 5 323 ? 74.850  62.137  110.368 1.00 93.84  ? 323 ASN A ND2   1 
ATOM   5233 N N     . TYR E 5 324 ? 79.851  59.816  110.737 1.00 41.40  ? 324 TYR A N     1 
ATOM   5234 C CA    . TYR E 5 324 ? 80.737  59.337  111.805 1.00 41.40  ? 324 TYR A CA    1 
ATOM   5235 C C     . TYR E 5 324 ? 82.120  59.967  111.682 1.00 41.40  ? 324 TYR A C     1 
ATOM   5236 O O     . TYR E 5 324 ? 82.778  60.245  112.684 1.00 41.40  ? 324 TYR A O     1 
ATOM   5237 C CB    . TYR E 5 324 ? 80.897  57.815  111.731 1.00 36.94  ? 324 TYR A CB    1 
ATOM   5238 C CG    . TYR E 5 324 ? 79.568  57.051  111.698 1.00 36.94  ? 324 TYR A CG    1 
ATOM   5239 C CD1   . TYR E 5 324 ? 78.417  57.600  112.280 1.00 36.94  ? 324 TYR A CD1   1 
ATOM   5240 C CD2   . TYR E 5 324 ? 79.504  55.795  111.083 1.00 36.94  ? 324 TYR A CD2   1 
ATOM   5241 C CE1   . TYR E 5 324 ? 77.206  56.891  112.244 1.00 36.94  ? 324 TYR A CE1   1 
ATOM   5242 C CE2   . TYR E 5 324 ? 78.296  55.088  111.047 1.00 36.94  ? 324 TYR A CE2   1 
ATOM   5243 C CZ    . TYR E 5 324 ? 77.147  55.635  111.627 1.00 36.94  ? 324 TYR A CZ    1 
ATOM   5244 O OH    . TYR E 5 324 ? 75.973  54.948  111.592 1.00 36.94  ? 324 TYR A OH    1 
ATOM   5245 N N     . ILE E 5 325 ? 82.549  60.202  110.447 1.00 44.99  ? 325 ILE A N     1 
ATOM   5246 C CA    . ILE E 5 325 ? 83.869  60.766  110.193 1.00 44.99  ? 325 ILE A CA    1 
ATOM   5247 C C     . ILE E 5 325 ? 83.882  62.236  109.774 1.00 44.99  ? 325 ILE A C     1 
ATOM   5248 O O     . ILE E 5 325 ? 84.937  62.791  109.434 1.00 44.99  ? 325 ILE A O     1 
ATOM   5249 C CB    . ILE E 5 325 ? 84.588  59.969  109.091 1.00 42.56  ? 325 ILE A CB    1 
ATOM   5250 C CG1   . ILE E 5 325 ? 83.844  60.080  107.758 1.00 42.56  ? 325 ILE A CG1   1 
ATOM   5251 C CG2   . ILE E 5 325 ? 84.700  58.479  109.419 1.00 42.56  ? 325 ILE A CG2   1 
ATOM   5252 C CD1   . ILE E 5 325 ? 84.576  59.426  106.594 1.00 42.56  ? 325 ILE A CD1   1 
ATOM   5253 N N     . ARG E 5 326 ? 82.744  62.881  109.810 1.00 62.64  ? 326 ARG A N     1 
ATOM   5254 C CA    . ARG E 5 326 ? 82.673  64.289  109.396 1.00 62.64  ? 326 ARG A CA    1 
ATOM   5255 C C     . ARG E 5 326 ? 83.570  65.187  110.276 1.00 62.64  ? 326 ARG A C     1 
ATOM   5256 O O     . ARG E 5 326 ? 84.400  65.955  109.772 1.00 62.64  ? 326 ARG A O     1 
ATOM   5257 C CB    . ARG E 5 326 ? 81.239  64.811  109.455 1.00 84.64  ? 326 ARG A CB    1 
ATOM   5258 C CG    . ARG E 5 326 ? 80.486  64.389  110.716 1.00 84.64  ? 326 ARG A CG    1 
ATOM   5259 C CD    . ARG E 5 326 ? 78.986  64.677  110.628 1.00 84.64  ? 326 ARG A CD    1 
ATOM   5260 N NE    . ARG E 5 326 ? 78.513  65.593  111.675 1.00 84.64  ? 326 ARG A NE    1 
ATOM   5261 C CZ    . ARG E 5 326 ? 77.297  66.153  111.686 1.00 84.64  ? 326 ARG A CZ    1 
ATOM   5262 N NH1   . ARG E 5 326 ? 76.415  65.907  110.708 1.00 84.64  ? 326 ARG A NH1   1 
ATOM   5263 N NH2   . ARG E 5 326 ? 76.863  66.982  112.646 1.00 84.64  ? 326 ARG A NH2   1 
ATOM   5264 N N     . ASN E 5 327 ? 83.387  65.075  111.581 1.00 56.60  ? 327 ASN A N     1 
ATOM   5265 C CA    . ASN E 5 327 ? 84.135  65.882  112.577 1.00 56.60  ? 327 ASN A CA    1 
ATOM   5266 C C     . ASN E 5 327 ? 85.591  65.344  112.751 1.00 56.60  ? 327 ASN A C     1 
ATOM   5267 O O     . ASN E 5 327 ? 86.282  65.688  113.723 1.00 56.60  ? 327 ASN A O     1 
ATOM   5268 C CB    . ASN E 5 327 ? 83.482  65.739  113.952 1.00 56.13  ? 327 ASN A CB    1 
ATOM   5269 C CG    . ASN E 5 327 ? 84.084  64.600  114.778 1.00 56.13  ? 327 ASN A CG    1 
ATOM   5270 O OD1   . ASN E 5 327 ? 83.765  63.436  114.544 1.00 56.13  ? 327 ASN A OD1   1 
ATOM   5271 N ND2   . ASN E 5 327 ? 84.947  64.868  115.741 1.00 56.13  ? 327 ASN A ND2   1 
ATOM   5272 N N     . LEU E 5 328 ? 86.011  64.532  111.779 1.00 67.57  ? 328 LEU A N     1 
ATOM   5273 C CA    . LEU E 5 328 ? 87.288  63.738  111.806 1.00 67.57  ? 328 LEU A CA    1 
ATOM   5274 C C     . LEU E 5 328 ? 88.616  64.460  111.419 1.00 67.57  ? 328 LEU A C     1 
ATOM   5275 O O     . LEU E 5 328 ? 89.675  63.843  111.286 1.00 67.57  ? 328 LEU A O     1 
ATOM   5276 C CB    . LEU E 5 328 ? 87.197  62.601  110.799 1.00 60.46  ? 328 LEU A CB    1 
ATOM   5277 C CG    . LEU E 5 328 ? 87.689  61.278  111.363 1.00 60.46  ? 328 LEU A CG    1 
ATOM   5278 C CD1   . LEU E 5 328 ? 89.181  61.049  111.126 1.00 60.46  ? 328 LEU A CD1   1 
ATOM   5279 C CD2   . LEU E 5 328 ? 87.482  61.165  112.873 1.00 60.46  ? 328 LEU A CD2   1 
ATOM   5280 N N     . ASP E 5 329 ? 88.594  65.727  111.244 1.00 42.92  ? 329 ASP A N     1 
ATOM   5281 C CA    . ASP E 5 329 ? 89.783  66.532  110.854 1.00 42.92  ? 329 ASP A CA    1 
ATOM   5282 C C     . ASP E 5 329 ? 90.631  66.007  109.692 1.00 42.92  ? 329 ASP A C     1 
ATOM   5283 O O     . ASP E 5 329 ? 91.867  65.978  109.736 1.00 42.92  ? 329 ASP A O     1 
ATOM   5284 C CB    . ASP E 5 329 ? 90.836  66.729  111.920 1.00 69.13  ? 329 ASP A CB    1 
ATOM   5285 C CG    . ASP E 5 329 ? 91.650  67.958  111.523 1.00 69.13  ? 329 ASP A CG    1 
ATOM   5286 O OD1   . ASP E 5 329 ? 91.457  68.498  110.356 1.00 69.13  ? 329 ASP A OD1   1 
ATOM   5287 O OD2   . ASP E 5 329 ? 92.488  68.476  112.338 1.00 69.13  ? 329 ASP A OD2   1 
ATOM   5288 N N     . SER E 5 330 ? 89.982  65.659  108.645 1.00 59.50  ? 330 SER A N     1 
ATOM   5289 C CA    . SER E 5 330 ? 90.689  65.233  107.456 1.00 59.50  ? 330 SER A CA    1 
ATOM   5290 C C     . SER E 5 330 ? 89.701  65.277  106.362 1.00 59.50  ? 330 SER A C     1 
ATOM   5291 O O     . SER E 5 330 ? 90.083  65.405  105.187 1.00 59.50  ? 330 SER A O     1 
ATOM   5292 C CB    . SER E 5 330 ? 91.263  63.846  107.680 1.00 76.80  ? 330 SER A CB    1 
ATOM   5293 O OG    . SER E 5 330 ? 92.677  63.931  107.766 1.00 76.80  ? 330 SER A OG    1 
ATOM   5294 N N     . GLU E 5 331 ? 88.531  65.169  106.897 1.00 40.84  ? 331 GLU A N     1 
ATOM   5295 C CA    . GLU E 5 331 ? 87.293  65.261  106.200 1.00 40.84  ? 331 GLU A CA    1 
ATOM   5296 C C     . GLU E 5 331 ? 86.766  66.656  106.467 1.00 40.84  ? 331 GLU A C     1 
ATOM   5297 O O     . GLU E 5 331 ? 85.555  66.861  106.604 1.00 40.84  ? 331 GLU A O     1 
ATOM   5298 C CB    . GLU E 5 331 ? 86.313  64.231  106.769 1.00 78.82  ? 331 GLU A CB    1 
ATOM   5299 C CG    . GLU E 5 331 ? 86.617  62.805  106.325 1.00 78.82  ? 331 GLU A CG    1 
ATOM   5300 C CD    . GLU E 5 331 ? 86.568  62.650  104.809 1.00 78.82  ? 331 GLU A CD    1 
ATOM   5301 O OE1   . GLU E 5 331 ? 85.699  63.312  104.124 1.00 78.82  ? 331 GLU A OE1   1 
ATOM   5302 O OE2   . GLU E 5 331 ? 87.397  61.861  104.218 1.00 78.82  ? 331 GLU A OE2   1 
ATOM   5303 N N     . THR E 5 332 ? 87.725  67.562  106.548 1.00 63.53  ? 332 THR A N     1 
ATOM   5304 C CA    . THR E 5 332 ? 87.465  68.975  106.828 1.00 63.53  ? 332 THR A CA    1 
ATOM   5305 C C     . THR E 5 332 ? 86.816  69.664  105.632 1.00 63.53  ? 332 THR A C     1 
ATOM   5306 O O     . THR E 5 332 ? 85.856  70.419  105.791 1.00 63.53  ? 332 THR A O     1 
ATOM   5307 C CB    . THR E 5 332 ? 88.766  69.711  107.155 1.00 35.24  ? 332 THR A CB    1 
ATOM   5308 O OG1   . THR E 5 332 ? 89.868  69.037  106.571 1.00 35.24  ? 332 THR A OG1   1 
ATOM   5309 C CG2   . THR E 5 332 ? 89.033  69.813  108.659 1.00 35.24  ? 332 THR A CG2   1 
ATOM   5310 N N     . GLY E 5 333 ? 87.342  69.409  104.438 1.00 30.89  ? 333 GLY A N     1 
ATOM   5311 C CA    . GLY E 5 333 ? 86.769  70.011  103.247 1.00 30.89  ? 333 GLY A CA    1 
ATOM   5312 C C     . GLY E 5 333 ? 87.741  70.737  102.339 1.00 30.89  ? 333 GLY A C     1 
ATOM   5313 O O     . GLY E 5 333 ? 88.916  70.907  102.665 1.00 30.89  ? 333 GLY A O     1 
ATOM   5314 N N     . ALA E 5 334 ? 87.234  71.173  101.191 1.00 36.23  ? 334 ALA A N     1 
ATOM   5315 C CA    . ALA E 5 334 ? 88.039  71.887  100.212 1.00 36.23  ? 334 ALA A CA    1 
ATOM   5316 C C     . ALA E 5 334 ? 88.412  73.277  100.714 1.00 36.23  ? 334 ALA A C     1 
ATOM   5317 O O     . ALA E 5 334 ? 89.588  73.637  100.745 1.00 36.23  ? 334 ALA A O     1 
ATOM   5318 C CB    . ALA E 5 334 ? 87.278  71.995  98.896  1.00 11.21  ? 334 ALA A CB    1 
ATOM   5319 N N     . MET E 5 335 ? 87.407  74.052  101.110 1.00 28.57  ? 335 MET A N     1 
ATOM   5320 C CA    . MET E 5 335 ? 87.631  75.405  101.602 1.00 28.57  ? 335 MET A CA    1 
ATOM   5321 C C     . MET E 5 335 ? 88.814  75.490  102.561 1.00 28.57  ? 335 MET A C     1 
ATOM   5322 O O     . MET E 5 335 ? 89.657  76.378  102.435 1.00 28.57  ? 335 MET A O     1 
ATOM   5323 C CB    . MET E 5 335 ? 86.369  75.927  102.290 1.00 40.26  ? 335 MET A CB    1 
ATOM   5324 C CG    . MET E 5 335 ? 85.410  76.644  101.353 1.00 40.26  ? 335 MET A CG    1 
ATOM   5325 S SD    . MET E 5 335 ? 86.195  77.196  99.819  1.00 40.26  ? 335 MET A SD    1 
ATOM   5326 C CE    . MET E 5 335 ? 86.800  78.805  100.304 1.00 40.26  ? 335 MET A CE    1 
ATOM   5327 N N     . VAL E 5 336 ? 88.873  74.565  103.514 1.00 34.23  ? 336 VAL A N     1 
ATOM   5328 C CA    . VAL E 5 336 ? 89.957  74.544  104.491 1.00 34.23  ? 336 VAL A CA    1 
ATOM   5329 C C     . VAL E 5 336 ? 91.308  74.319  103.821 1.00 34.23  ? 336 VAL A C     1 
ATOM   5330 O O     . VAL E 5 336 ? 92.288  74.989  104.144 1.00 34.23  ? 336 VAL A O     1 
ATOM   5331 C CB    . VAL E 5 336 ? 89.741  73.436  105.550 1.00 19.10  ? 336 VAL A CB    1 
ATOM   5332 C CG1   . VAL E 5 336 ? 91.030  73.186  106.317 1.00 19.10  ? 336 VAL A CG1   1 
ATOM   5333 C CG2   . VAL E 5 336 ? 88.629  73.840  106.509 1.00 19.10  ? 336 VAL A CG2   1 
ATOM   5334 N N     . ARG E 5 337 ? 91.360  73.371  102.891 1.00 34.14  ? 337 ARG A N     1 
ATOM   5335 C CA    . ARG E 5 337 ? 92.603  73.076  102.188 1.00 34.14  ? 337 ARG A CA    1 
ATOM   5336 C C     . ARG E 5 337 ? 93.023  74.286  101.368 1.00 34.14  ? 337 ARG A C     1 
ATOM   5337 O O     . ARG E 5 337 ? 94.203  74.637  101.313 1.00 34.14  ? 337 ARG A O     1 
ATOM   5338 C CB    . ARG E 5 337 ? 92.418  71.862  101.276 1.00 58.64  ? 337 ARG A CB    1 
ATOM   5339 C CG    . ARG E 5 337 ? 91.835  70.646  101.981 1.00 58.64  ? 337 ARG A CG    1 
ATOM   5340 C CD    . ARG E 5 337 ? 91.806  69.426  101.070 1.00 58.64  ? 337 ARG A CD    1 
ATOM   5341 N NE    . ARG E 5 337 ? 91.954  69.786  99.663  1.00 58.64  ? 337 ARG A NE    1 
ATOM   5342 C CZ    . ARG E 5 337 ? 91.092  69.447  98.709  1.00 58.64  ? 337 ARG A CZ    1 
ATOM   5343 N NH1   . ARG E 5 337 ? 90.011  68.738  99.009  1.00 58.64  ? 337 ARG A NH1   1 
ATOM   5344 N NH2   . ARG E 5 337 ? 91.308  69.823  97.456  1.00 58.64  ? 337 ARG A NH2   1 
ATOM   5345 N N     . LEU E 5 338 ? 92.045  74.923  100.736 1.00 24.60  ? 338 LEU A N     1 
ATOM   5346 C CA    . LEU E 5 338 ? 92.289  76.104  99.921  1.00 24.60  ? 338 LEU A CA    1 
ATOM   5347 C C     . LEU E 5 338 ? 92.883  77.213  100.780 1.00 24.60  ? 338 LEU A C     1 
ATOM   5348 O O     . LEU E 5 338 ? 93.940  77.761  100.468 1.00 24.60  ? 338 LEU A O     1 
ATOM   5349 C CB    . LEU E 5 338 ? 90.976  76.587  99.303  1.00 34.77  ? 338 LEU A CB    1 
ATOM   5350 C CG    . LEU E 5 338 ? 90.853  76.634  97.777  1.00 34.77  ? 338 LEU A CG    1 
ATOM   5351 C CD1   . LEU E 5 338 ? 91.522  75.420  97.154  1.00 34.77  ? 338 LEU A CD1   1 
ATOM   5352 C CD2   . LEU E 5 338 ? 89.379  76.687  97.395  1.00 34.77  ? 338 LEU A CD2   1 
ATOM   5353 N N     . LEU E 5 339 ? 92.194  77.531  101.871 1.00 28.80  ? 339 LEU A N     1 
ATOM   5354 C CA    . LEU E 5 339 ? 92.628  78.577  102.792 1.00 28.80  ? 339 LEU A CA    1 
ATOM   5355 C C     . LEU E 5 339 ? 93.973  78.281  103.455 1.00 28.80  ? 339 LEU A C     1 
ATOM   5356 O O     . LEU E 5 339 ? 94.791  79.181  103.640 1.00 28.80  ? 339 LEU A O     1 
ATOM   5357 C CB    . LEU E 5 339 ? 91.563  78.794  103.872 1.00 19.81  ? 339 LEU A CB    1 
ATOM   5358 C CG    . LEU E 5 339 ? 90.340  79.612  103.456 1.00 19.81  ? 339 LEU A CG    1 
ATOM   5359 C CD1   . LEU E 5 339 ? 89.167  79.261  104.356 1.00 19.81  ? 339 LEU A CD1   1 
ATOM   5360 C CD2   . LEU E 5 339 ? 90.662  81.098  103.541 1.00 19.81  ? 339 LEU A CD2   1 
ATOM   5361 N N     . GLU E 5 340 ? 94.197  77.023  103.815 1.00 37.84  ? 340 GLU A N     1 
ATOM   5362 C CA    . GLU E 5 340 ? 95.445  76.630  104.457 1.00 37.84  ? 340 GLU A CA    1 
ATOM   5363 C C     . GLU E 5 340 ? 96.508  76.362  103.396 1.00 37.84  ? 340 GLU A C     1 
ATOM   5364 O O     . GLU E 5 340 ? 97.213  75.355  103.443 1.00 37.84  ? 340 GLU A O     1 
ATOM   5365 C CB    . GLU E 5 340 ? 95.226  75.379  105.316 1.00 37.30  ? 340 GLU A CB    1 
ATOM   5366 C CG    . GLU E 5 340 ? 94.166  75.547  106.400 1.00 37.30  ? 340 GLU A CG    1 
ATOM   5367 C CD    . GLU E 5 340 ? 94.404  74.659  107.613 1.00 37.30  ? 340 GLU A CD    1 
ATOM   5368 O OE1   . GLU E 5 340 ? 95.247  73.741  107.528 1.00 37.30  ? 340 GLU A OE1   1 
ATOM   5369 O OE2   . GLU E 5 340 ? 93.744  74.881  108.651 1.00 37.30  ? 340 GLU A OE2   1 
ATOM   5370 N N     . ASP E 5 341 ? 96.614  77.279  102.440 1.00 68.77  ? 341 ASP A N     1 
ATOM   5371 C CA    . ASP E 5 341 ? 97.573  77.157  101.350 1.00 68.77  ? 341 ASP A CA    1 
ATOM   5372 C C     . ASP E 5 341 ? 97.232  75.972  100.460 1.00 68.77  ? 341 ASP A C     1 
ATOM   5373 O O     . ASP E 5 341 ? 96.589  76.132  99.424  1.00 68.77  ? 341 ASP A O     1 
ATOM   5374 C CB    . ASP E 5 341 ? 98.991  76.996  101.899 1.00 82.15  ? 341 ASP A CB    1 
ATOM   5375 C CG    . ASP E 5 341 ? 100.018 77.750  101.082 1.00 82.15  ? 341 ASP A CG    1 
ATOM   5376 O OD1   . ASP E 5 341 ? 99.615  78.488  100.158 1.00 82.15  ? 341 ASP A OD1   1 
ATOM   5377 O OD2   . ASP E 5 341 ? 101.226 77.607  101.363 1.00 82.15  ? 341 ASP A OD2   1 
ATOM   5378 N N     . THR F 5 19  ? 31.272  48.223  82.500  1.00 99.72  ? 19  THR B N     1 
ATOM   5379 C CA    . THR F 5 19  ? 32.349  47.652  81.700  1.00 99.72  ? 19  THR B CA    1 
ATOM   5380 C C     . THR F 5 19  ? 32.204  46.309  81.190  1.00 99.72  ? 19  THR B C     1 
ATOM   5381 O O     . THR F 5 19  ? 33.046  45.457  81.336  1.00 99.72  ? 19  THR B O     1 
ATOM   5382 C CB    . THR F 5 19  ? 33.694  47.708  82.461  1.00 100.00 ? 19  THR B CB    1 
ATOM   5383 O OG1   . THR F 5 19  ? 33.666  48.754  83.421  1.00 100.00 ? 19  THR B OG1   1 
ATOM   5384 C CG2   . THR F 5 19  ? 34.890  47.963  81.542  1.00 100.00 ? 19  THR B CG2   1 
ATOM   5385 N N     . SER F 5 20  ? 31.229  45.955  80.464  1.00 38.82  ? 20  SER B N     1 
ATOM   5386 C CA    . SER F 5 20  ? 31.395  44.536  80.188  1.00 38.82  ? 20  SER B CA    1 
ATOM   5387 C C     . SER F 5 20  ? 31.817  44.295  78.778  1.00 38.82  ? 20  SER B C     1 
ATOM   5388 O O     . SER F 5 20  ? 32.514  43.352  78.439  1.00 38.82  ? 20  SER B O     1 
ATOM   5389 C CB    . SER F 5 20  ? 30.198  43.735  80.606  1.00 99.80  ? 20  SER B CB    1 
ATOM   5390 O OG    . SER F 5 20  ? 29.040  44.473  80.386  1.00 99.80  ? 20  SER B OG    1 
ATOM   5391 N N     . ASP F 5 21  ? 31.426  45.103  77.865  1.00 62.51  ? 21  ASP B N     1 
ATOM   5392 C CA    . ASP F 5 21  ? 32.004  44.878  76.541  1.00 62.51  ? 21  ASP B CA    1 
ATOM   5393 C C     . ASP F 5 21  ? 33.189  45.843  76.300  1.00 62.51  ? 21  ASP B C     1 
ATOM   5394 O O     . ASP F 5 21  ? 34.228  45.563  75.731  1.00 62.51  ? 21  ASP B O     1 
ATOM   5395 C CB    . ASP F 5 21  ? 30.943  44.922  75.555  1.00 99.93  ? 21  ASP B CB    1 
ATOM   5396 C CG    . ASP F 5 21  ? 30.554  43.509  75.267  1.00 99.93  ? 21  ASP B CG    1 
ATOM   5397 O OD1   . ASP F 5 21  ? 29.655  42.934  75.978  1.00 99.93  ? 21  ASP B OD1   1 
ATOM   5398 O OD2   . ASP F 5 21  ? 31.161  42.902  74.321  1.00 99.93  ? 21  ASP B OD2   1 
ATOM   5399 N N     . GLU F 5 22  ? 33.136  47.068  76.647  1.00 67.09  ? 22  GLU B N     1 
ATOM   5400 C CA    . GLU F 5 22  ? 34.456  47.806  76.647  1.00 67.09  ? 22  GLU B CA    1 
ATOM   5401 C C     . GLU F 5 22  ? 35.773  46.876  76.860  1.00 67.09  ? 22  GLU B C     1 
ATOM   5402 O O     . GLU F 5 22  ? 36.853  47.117  76.276  1.00 67.09  ? 22  GLU B O     1 
ATOM   5403 C CB    . GLU F 5 22  ? 34.510  48.711  77.872  1.00 98.86  ? 22  GLU B CB    1 
ATOM   5404 C CG    . GLU F 5 22  ? 34.174  50.151  77.549  1.00 98.86  ? 22  GLU B CG    1 
ATOM   5405 C CD    . GLU F 5 22  ? 35.360  51.097  77.715  1.00 98.86  ? 22  GLU B CD    1 
ATOM   5406 O OE1   . GLU F 5 22  ? 36.430  50.925  77.016  1.00 98.86  ? 22  GLU B OE1   1 
ATOM   5407 O OE2   . GLU F 5 22  ? 35.284  52.073  78.553  1.00 98.86  ? 22  GLU B OE2   1 
ATOM   5408 N N     . VAL F 5 23  ? 35.727  45.828  77.738  1.00 39.49  ? 23  VAL B N     1 
ATOM   5409 C CA    . VAL F 5 23  ? 36.915  44.920  78.022  1.00 39.49  ? 23  VAL B CA    1 
ATOM   5410 C C     . VAL F 5 23  ? 37.347  44.177  76.748  1.00 39.49  ? 23  VAL B C     1 
ATOM   5411 O O     . VAL F 5 23  ? 38.544  44.054  76.442  1.00 39.49  ? 23  VAL B O     1 
ATOM   5412 C CB    . VAL F 5 23  ? 36.585  43.846  79.085  1.00 25.44  ? 23  VAL B CB    1 
ATOM   5413 C CG1   . VAL F 5 23  ? 37.353  42.528  78.885  1.00 25.44  ? 23  VAL B CG1   1 
ATOM   5414 C CG2   . VAL F 5 23  ? 36.918  44.284  80.516  1.00 25.44  ? 23  VAL B CG2   1 
ATOM   5415 N N     . ARG F 5 24  ? 36.345  43.701  76.037  1.00 30.37  ? 24  ARG B N     1 
ATOM   5416 C CA    . ARG F 5 24  ? 36.539  42.980  74.774  1.00 30.37  ? 24  ARG B CA    1 
ATOM   5417 C C     . ARG F 5 24  ? 37.259  43.877  73.774  1.00 30.37  ? 24  ARG B C     1 
ATOM   5418 O O     . ARG F 5 24  ? 38.193  43.444  73.099  1.00 30.37  ? 24  ARG B O     1 
ATOM   5419 C CB    . ARG F 5 24  ? 35.183  42.575  74.189  1.00 99.99  ? 24  ARG B CB    1 
ATOM   5420 C CG    . ARG F 5 24  ? 34.848  41.098  74.405  1.00 99.99  ? 24  ARG B CG    1 
ATOM   5421 C CD    . ARG F 5 24  ? 34.898  40.684  75.874  1.00 99.99  ? 24  ARG B CD    1 
ATOM   5422 N NE    . ARG F 5 24  ? 35.811  39.563  76.112  1.00 99.99  ? 24  ARG B NE    1 
ATOM   5423 C CZ    . ARG F 5 24  ? 35.653  38.659  77.081  1.00 99.99  ? 24  ARG B CZ    1 
ATOM   5424 N NH1   . ARG F 5 24  ? 34.616  38.730  77.925  1.00 99.99  ? 24  ARG B NH1   1 
ATOM   5425 N NH2   . ARG F 5 24  ? 36.493  37.637  77.285  1.00 99.99  ? 24  ARG B NH2   1 
ATOM   5426 N N     . LYS F 5 25  ? 36.819  45.128  73.678  1.00 35.60  ? 25  LYS B N     1 
ATOM   5427 C CA    . LYS F 5 25  ? 37.438  46.076  72.759  1.00 35.60  ? 25  LYS B CA    1 
ATOM   5428 C C     . LYS F 5 25  ? 38.873  46.357  73.180  1.00 35.60  ? 25  LYS B C     1 
ATOM   5429 O O     . LYS F 5 25  ? 39.777  46.401  72.347  1.00 35.60  ? 25  LYS B O     1 
ATOM   5430 C CB    . LYS F 5 25  ? 36.653  47.389  72.731  1.00 39.42  ? 25  LYS B CB    1 
ATOM   5431 C CG    . LYS F 5 25  ? 37.207  48.411  71.750  1.00 39.42  ? 25  LYS B CG    1 
ATOM   5432 C CD    . LYS F 5 25  ? 36.935  49.832  72.212  1.00 39.42  ? 25  LYS B CD    1 
ATOM   5433 C CE    . LYS F 5 25  ? 37.724  50.836  71.387  1.00 39.42  ? 25  LYS B CE    1 
ATOM   5434 N NZ    . LYS F 5 25  ? 38.206  51.984  72.209  1.00 39.42  ? 25  LYS B NZ    1 
ATOM   5435 N N     . ASN F 5 26  ? 39.073  46.549  74.479  1.00 32.87  ? 26  ASN B N     1 
ATOM   5436 C CA    . ASN F 5 26  ? 40.399  46.824  75.007  1.00 32.87  ? 26  ASN B CA    1 
ATOM   5437 C C     . ASN F 5 26  ? 41.334  45.681  74.657  1.00 32.87  ? 26  ASN B C     1 
ATOM   5438 O O     . ASN F 5 26  ? 42.453  45.897  74.203  1.00 32.87  ? 26  ASN B O     1 
ATOM   5439 C CB    . ASN F 5 26  ? 40.339  46.996  76.522  1.00 30.30  ? 26  ASN B CB    1 
ATOM   5440 C CG    . ASN F 5 26  ? 39.886  48.378  76.926  1.00 30.30  ? 26  ASN B CG    1 
ATOM   5441 O OD1   . ASN F 5 26  ? 38.906  48.898  76.400  1.00 30.30  ? 26  ASN B OD1   1 
ATOM   5442 N ND2   . ASN F 5 26  ? 40.601  48.985  77.864  1.00 30.30  ? 26  ASN B ND2   1 
ATOM   5443 N N     . LEU F 5 27  ? 40.865  44.459  74.866  1.00 26.67  ? 27  LEU B N     1 
ATOM   5444 C CA    . LEU F 5 27  ? 41.670  43.286  74.565  1.00 26.67  ? 27  LEU B CA    1 
ATOM   5445 C C     . LEU F 5 27  ? 41.913  43.227  73.061  1.00 26.67  ? 27  LEU B C     1 
ATOM   5446 O O     . LEU F 5 27  ? 42.941  42.725  72.602  1.00 26.67  ? 27  LEU B O     1 
ATOM   5447 C CB    . LEU F 5 27  ? 40.951  42.017  75.035  1.00 29.52  ? 27  LEU B CB    1 
ATOM   5448 C CG    . LEU F 5 27  ? 41.514  41.225  76.226  1.00 29.52  ? 27  LEU B CG    1 
ATOM   5449 C CD1   . LEU F 5 27  ? 42.510  42.056  77.025  1.00 29.52  ? 27  LEU B CD1   1 
ATOM   5450 C CD2   . LEU F 5 27  ? 40.359  40.781  77.115  1.00 29.52  ? 27  LEU B CD2   1 
ATOM   5451 N N     . MET F 5 28  ? 40.962  43.760  72.300  1.00 33.22  ? 28  MET B N     1 
ATOM   5452 C CA    . MET F 5 28  ? 41.058  43.769  70.847  1.00 33.22  ? 28  MET B CA    1 
ATOM   5453 C C     . MET F 5 28  ? 42.071  44.793  70.352  1.00 33.22  ? 28  MET B C     1 
ATOM   5454 O O     . MET F 5 28  ? 42.778  44.549  69.376  1.00 33.22  ? 28  MET B O     1 
ATOM   5455 C CB    . MET F 5 28  ? 39.686  44.057  70.235  1.00 99.17  ? 28  MET B CB    1 
ATOM   5456 C CG    . MET F 5 28  ? 38.980  42.819  69.705  1.00 99.17  ? 28  MET B CG    1 
ATOM   5457 S SD    . MET F 5 28  ? 40.123  41.665  68.916  1.00 99.17  ? 28  MET B SD    1 
ATOM   5458 C CE    . MET F 5 28  ? 40.376  40.462  70.234  1.00 99.17  ? 28  MET B CE    1 
ATOM   5459 N N     . ASP F 5 29  ? 42.140  45.936  71.028  1.00 38.66  ? 29  ASP B N     1 
ATOM   5460 C CA    . ASP F 5 29  ? 43.075  46.997  70.661  1.00 38.66  ? 29  ASP B CA    1 
ATOM   5461 C C     . ASP F 5 29  ? 44.507  46.617  71.023  1.00 38.66  ? 29  ASP B C     1 
ATOM   5462 O O     . ASP F 5 29  ? 45.457  47.043  70.366  1.00 38.66  ? 29  ASP B O     1 
ATOM   5463 C CB    . ASP F 5 29  ? 42.701  48.297  71.372  1.00 47.29  ? 29  ASP B CB    1 
ATOM   5464 C CG    . ASP F 5 29  ? 41.526  48.994  70.726  1.00 47.29  ? 29  ASP B CG    1 
ATOM   5465 O OD1   . ASP F 5 29  ? 41.074  48.535  69.653  1.00 47.29  ? 29  ASP B OD1   1 
ATOM   5466 O OD2   . ASP F 5 29  ? 41.056  50.002  71.294  1.00 47.29  ? 29  ASP B OD2   1 
ATOM   5467 N N     . MET F 5 30  ? 44.651  45.821  72.078  1.00 43.66  ? 30  MET B N     1 
ATOM   5468 C CA    . MET F 5 30  ? 45.960  45.370  72.532  1.00 43.66  ? 30  MET B CA    1 
ATOM   5469 C C     . MET F 5 30  ? 46.524  44.375  71.531  1.00 43.66  ? 30  MET B C     1 
ATOM   5470 O O     . MET F 5 30  ? 47.718  44.383  71.235  1.00 43.66  ? 30  MET B O     1 
ATOM   5471 C CB    . MET F 5 30  ? 45.845  44.706  73.904  1.00 35.06  ? 30  MET B CB    1 
ATOM   5472 C CG    . MET F 5 30  ? 47.023  44.974  74.820  1.00 35.06  ? 30  MET B CG    1 
ATOM   5473 S SD    . MET F 5 30  ? 47.495  43.543  75.818  1.00 35.06  ? 30  MET B SD    1 
ATOM   5474 C CE    . MET F 5 30  ? 45.893  42.808  76.173  1.00 35.06  ? 30  MET B CE    1 
ATOM   5475 N N     . PHE F 5 31  ? 45.656  43.513  71.013  1.00 22.18  ? 31  PHE B N     1 
ATOM   5476 C CA    . PHE F 5 31  ? 46.077  42.517  70.041  1.00 22.18  ? 31  PHE B CA    1 
ATOM   5477 C C     . PHE F 5 31  ? 46.366  43.162  68.691  1.00 22.18  ? 31  PHE B C     1 
ATOM   5478 O O     . PHE F 5 31  ? 47.321  42.789  68.014  1.00 22.18  ? 31  PHE B O     1 
ATOM   5479 C CB    . PHE F 5 31  ? 45.004  41.441  69.877  1.00 76.65  ? 31  PHE B CB    1 
ATOM   5480 C CG    . PHE F 5 31  ? 45.412  40.320  68.968  1.00 76.65  ? 31  PHE B CG    1 
ATOM   5481 C CD1   . PHE F 5 31  ? 46.371  39.396  69.370  1.00 76.65  ? 31  PHE B CD1   1 
ATOM   5482 C CD2   . PHE F 5 31  ? 44.848  40.191  67.704  1.00 76.65  ? 31  PHE B CD2   1 
ATOM   5483 C CE1   . PHE F 5 31  ? 46.765  38.360  68.524  1.00 76.65  ? 31  PHE B CE1   1 
ATOM   5484 C CE2   . PHE F 5 31  ? 45.234  39.160  66.851  1.00 76.65  ? 31  PHE B CE2   1 
ATOM   5485 C CZ    . PHE F 5 31  ? 46.194  38.243  67.262  1.00 76.65  ? 31  PHE B CZ    1 
ATOM   5486 N N     . ARG F 5 32  ? 45.543  44.129  68.298  1.00 17.20  ? 32  ARG B N     1 
ATOM   5487 C CA    . ARG F 5 32  ? 45.747  44.805  67.023  1.00 17.20  ? 32  ARG B CA    1 
ATOM   5488 C C     . ARG F 5 32  ? 47.143  45.409  66.978  1.00 17.20  ? 32  ARG B C     1 
ATOM   5489 O O     . ARG F 5 32  ? 47.905  45.166  66.044  1.00 17.20  ? 32  ARG B O     1 
ATOM   5490 C CB    . ARG F 5 32  ? 44.709  45.908  66.823  1.00 32.26  ? 32  ARG B CB    1 
ATOM   5491 C CG    . ARG F 5 32  ? 44.605  46.383  65.380  1.00 32.26  ? 32  ARG B CG    1 
ATOM   5492 C CD    . ARG F 5 32  ? 43.956  47.752  65.273  1.00 32.26  ? 32  ARG B CD    1 
ATOM   5493 N NE    . ARG F 5 32  ? 44.134  48.536  66.489  1.00 32.26  ? 32  ARG B NE    1 
ATOM   5494 C CZ    . ARG F 5 32  ? 43.304  49.494  66.886  1.00 32.26  ? 32  ARG B CZ    1 
ATOM   5495 N NH1   . ARG F 5 32  ? 42.232  49.790  66.161  1.00 32.26  ? 32  ARG B NH1   1 
ATOM   5496 N NH2   . ARG F 5 32  ? 43.546  50.150  68.012  1.00 32.26  ? 32  ARG B NH2   1 
ATOM   5497 N N     . ASP F 5 33  ? 47.476  46.199  67.992  1.00 23.68  ? 33  ASP B N     1 
ATOM   5498 C CA    . ASP F 5 33  ? 48.788  46.824  68.062  1.00 23.68  ? 33  ASP B CA    1 
ATOM   5499 C C     . ASP F 5 33  ? 49.717  45.998  68.950  1.00 23.68  ? 33  ASP B C     1 
ATOM   5500 O O     . ASP F 5 33  ? 50.497  46.540  69.731  1.00 23.68  ? 33  ASP B O     1 
ATOM   5501 C CB    . ASP F 5 33  ? 48.662  48.249  68.606  1.00 34.86  ? 33  ASP B CB    1 
ATOM   5502 C CG    . ASP F 5 33  ? 48.012  49.195  67.612  1.00 34.86  ? 33  ASP B CG    1 
ATOM   5503 O OD1   . ASP F 5 33  ? 48.361  49.127  66.414  1.00 34.86  ? 33  ASP B OD1   1 
ATOM   5504 O OD2   . ASP F 5 33  ? 47.150  50.001  68.027  1.00 34.86  ? 33  ASP B OD2   1 
ATOM   5505 N N     . ARG F 5 34  ? 49.629  44.678  68.816  1.00 30.40  ? 34  ARG B N     1 
ATOM   5506 C CA    . ARG F 5 34  ? 50.453  43.766  69.600  1.00 30.40  ? 34  ARG B CA    1 
ATOM   5507 C C     . ARG F 5 34  ? 51.941  43.964  69.334  1.00 30.40  ? 34  ARG B C     1 
ATOM   5508 O O     . ARG F 5 34  ? 52.782  43.539  70.123  1.00 30.40  ? 34  ARG B O     1 
ATOM   5509 C CB    . ARG F 5 34  ? 50.069  42.318  69.295  1.00 51.66  ? 34  ARG B CB    1 
ATOM   5510 C CG    . ARG F 5 34  ? 50.327  41.897  67.862  1.00 51.66  ? 34  ARG B CG    1 
ATOM   5511 C CD    . ARG F 5 34  ? 49.469  40.704  67.476  1.00 51.66  ? 34  ARG B CD    1 
ATOM   5512 N NE    . ARG F 5 34  ? 49.592  40.380  66.057  1.00 51.66  ? 34  ARG B NE    1 
ATOM   5513 C CZ    . ARG F 5 34  ? 48.668  40.663  65.145  1.00 51.66  ? 34  ARG B CZ    1 
ATOM   5514 N NH1   . ARG F 5 34  ? 47.549  41.279  65.498  1.00 51.66  ? 34  ARG B NH1   1 
ATOM   5515 N NH2   . ARG F 5 34  ? 48.865  40.332  63.876  1.00 51.66  ? 34  ARG B NH2   1 
ATOM   5516 N N     . GLN F 5 35  ? 52.265  44.609  68.220  1.00 22.35  ? 35  GLN B N     1 
ATOM   5517 C CA    . GLN F 5 35  ? 53.660  44.854  67.875  1.00 22.35  ? 35  GLN B CA    1 
ATOM   5518 C C     . GLN F 5 35  ? 54.254  45.887  68.826  1.00 22.35  ? 35  GLN B C     1 
ATOM   5519 O O     . GLN F 5 35  ? 55.448  46.182  68.774  1.00 22.35  ? 35  GLN B O     1 
ATOM   5520 C CB    . GLN F 5 35  ? 53.772  45.349  66.431  1.00 76.11  ? 35  GLN B CB    1 
ATOM   5521 C CG    . GLN F 5 35  ? 53.999  44.241  65.413  1.00 76.11  ? 35  GLN B CG    1 
ATOM   5522 C CD    . GLN F 5 35  ? 55.192  43.367  65.756  1.00 76.11  ? 35  GLN B CD    1 
ATOM   5523 O OE1   . GLN F 5 35  ? 56.304  43.603  65.283  1.00 76.11  ? 35  GLN B OE1   1 
ATOM   5524 N NE2   . GLN F 5 35  ? 54.966  42.350  66.583  1.00 76.11  ? 35  GLN B NE2   1 
ATOM   5525 N N     . ALA F 5 36  ? 53.409  46.429  69.697  1.00 22.24  ? 36  ALA B N     1 
ATOM   5526 C CA    . ALA F 5 36  ? 53.835  47.432  70.663  1.00 22.24  ? 36  ALA B CA    1 
ATOM   5527 C C     . ALA F 5 36  ? 54.641  46.794  71.785  1.00 22.24  ? 36  ALA B C     1 
ATOM   5528 O O     . ALA F 5 36  ? 55.422  47.463  72.462  1.00 22.24  ? 36  ALA B O     1 
ATOM   5529 C CB    . ALA F 5 36  ? 52.618  48.147  71.236  1.00 14.69  ? 36  ALA B CB    1 
ATOM   5530 N N     . PHE F 5 37  ? 54.442  45.495  71.977  1.00 28.50  ? 37  PHE B N     1 
ATOM   5531 C CA    . PHE F 5 37  ? 55.144  44.759  73.019  1.00 28.50  ? 37  PHE B CA    1 
ATOM   5532 C C     . PHE F 5 37  ? 56.120  43.758  72.407  1.00 28.50  ? 37  PHE B C     1 
ATOM   5533 O O     . PHE F 5 37  ? 55.935  43.306  71.276  1.00 28.50  ? 37  PHE B O     1 
ATOM   5534 C CB    . PHE F 5 37  ? 54.141  44.020  73.908  1.00 17.99  ? 37  PHE B CB    1 
ATOM   5535 C CG    . PHE F 5 37  ? 53.068  44.905  74.483  1.00 17.99  ? 37  PHE B CG    1 
ATOM   5536 C CD1   . PHE F 5 37  ? 53.289  45.614  75.661  1.00 17.99  ? 37  PHE B CD1   1 
ATOM   5537 C CD2   . PHE F 5 37  ? 51.836  45.025  73.851  1.00 17.99  ? 37  PHE B CD2   1 
ATOM   5538 C CE1   . PHE F 5 37  ? 52.297  46.430  76.199  1.00 17.99  ? 37  PHE B CE1   1 
ATOM   5539 C CE2   . PHE F 5 37  ? 50.840  45.838  74.380  1.00 17.99  ? 37  PHE B CE2   1 
ATOM   5540 C CZ    . PHE F 5 37  ? 51.071  46.542  75.557  1.00 17.99  ? 37  PHE B CZ    1 
ATOM   5541 N N     . SER F 5 38  ? 57.159  43.415  73.160  1.00 21.68  ? 38  SER B N     1 
ATOM   5542 C CA    . SER F 5 38  ? 58.159  42.467  72.690  1.00 21.68  ? 38  SER B CA    1 
ATOM   5543 C C     . SER F 5 38  ? 57.550  41.076  72.542  1.00 21.68  ? 38  SER B C     1 
ATOM   5544 O O     . SER F 5 38  ? 56.569  40.741  73.205  1.00 21.68  ? 38  SER B O     1 
ATOM   5545 C CB    . SER F 5 38  ? 59.334  42.416  73.673  1.00 32.71  ? 38  SER B CB    1 
ATOM   5546 O OG    . SER F 5 38  ? 59.811  41.091  73.844  1.00 32.71  ? 38  SER B OG    1 
ATOM   5547 N N     . GLU F 5 39  ? 58.133  40.271  71.663  1.00 25.20  ? 39  GLU B N     1 
ATOM   5548 C CA    . GLU F 5 39  ? 57.648  38.916  71.443  1.00 25.20  ? 39  GLU B CA    1 
ATOM   5549 C C     . GLU F 5 39  ? 57.739  38.114  72.741  1.00 25.20  ? 39  GLU B C     1 
ATOM   5550 O O     . GLU F 5 39  ? 56.914  37.242  73.004  1.00 25.20  ? 39  GLU B O     1 
ATOM   5551 C CB    . GLU F 5 39  ? 58.482  38.234  70.354  1.00 100.00 ? 39  GLU B CB    1 
ATOM   5552 C CG    . GLU F 5 39  ? 59.971  38.183  70.667  1.00 100.00 ? 39  GLU B CG    1 
ATOM   5553 C CD    . GLU F 5 39  ? 60.834  38.125  69.422  1.00 100.00 ? 39  GLU B CD    1 
ATOM   5554 O OE1   . GLU F 5 39  ? 60.607  37.229  68.581  1.00 100.00 ? 39  GLU B OE1   1 
ATOM   5555 O OE2   . GLU F 5 39  ? 61.740  38.977  69.286  1.00 100.00 ? 39  GLU B OE2   1 
ATOM   5556 N N     . HIS F 5 40  ? 58.746  38.425  73.551  1.00 28.26  ? 40  HIS B N     1 
ATOM   5557 C CA    . HIS F 5 40  ? 58.967  37.730  74.813  1.00 28.26  ? 40  HIS B CA    1 
ATOM   5558 C C     . HIS F 5 40  ? 57.914  38.064  75.858  1.00 28.26  ? 40  HIS B C     1 
ATOM   5559 O O     . HIS F 5 40  ? 57.593  37.243  76.721  1.00 28.26  ? 40  HIS B O     1 
ATOM   5560 C CB    . HIS F 5 40  ? 60.353  38.071  75.357  1.00 23.71  ? 40  HIS B CB    1 
ATOM   5561 C CG    . HIS F 5 40  ? 61.471  37.642  74.460  1.00 23.71  ? 40  HIS B CG    1 
ATOM   5562 N ND1   . HIS F 5 40  ? 62.453  38.507  74.029  1.00 23.71  ? 40  HIS B ND1   1 
ATOM   5563 C CD2   . HIS F 5 40  ? 61.764  36.437  73.915  1.00 23.71  ? 40  HIS B CD2   1 
ATOM   5564 C CE1   . HIS F 5 40  ? 63.304  37.856  73.257  1.00 23.71  ? 40  HIS B CE1   1 
ATOM   5565 N NE2   . HIS F 5 40  ? 62.908  36.598  73.172  1.00 23.71  ? 40  HIS B NE2   1 
ATOM   5566 N N     . THR F 5 41  ? 57.384  39.278  75.787  1.00 24.62  ? 41  THR B N     1 
ATOM   5567 C CA    . THR F 5 41  ? 56.358  39.700  76.725  1.00 24.62  ? 41  THR B CA    1 
ATOM   5568 C C     . THR F 5 41  ? 55.119  38.859  76.456  1.00 24.62  ? 41  THR B C     1 
ATOM   5569 O O     . THR F 5 41  ? 54.507  38.320  77.378  1.00 24.62  ? 41  THR B O     1 
ATOM   5570 C CB    . THR F 5 41  ? 56.014  41.187  76.540  1.00 20.78  ? 41  THR B CB    1 
ATOM   5571 O OG1   . THR F 5 41  ? 57.064  41.990  77.093  1.00 20.78  ? 41  THR B OG1   1 
ATOM   5572 C CG2   . THR F 5 41  ? 54.708  41.526  77.238  1.00 20.78  ? 41  THR B CG2   1 
ATOM   5573 N N     . TRP F 5 42  ? 54.770  38.739  75.178  1.00 25.20  ? 42  TRP B N     1 
ATOM   5574 C CA    . TRP F 5 42  ? 53.608  37.964  74.766  1.00 25.20  ? 42  TRP B CA    1 
ATOM   5575 C C     . TRP F 5 42  ? 53.827  36.489  75.070  1.00 25.20  ? 42  TRP B C     1 
ATOM   5576 O O     . TRP F 5 42  ? 52.909  35.784  75.492  1.00 25.20  ? 42  TRP B O     1 
ATOM   5577 C CB    . TRP F 5 42  ? 53.358  38.144  73.269  1.00 34.17  ? 42  TRP B CB    1 
ATOM   5578 C CG    . TRP F 5 42  ? 52.548  39.355  72.940  1.00 34.17  ? 42  TRP B CG    1 
ATOM   5579 C CD1   . TRP F 5 42  ? 53.003  40.521  72.396  1.00 34.17  ? 42  TRP B CD1   1 
ATOM   5580 C CD2   . TRP F 5 42  ? 51.140  39.526  73.138  1.00 34.17  ? 42  TRP B CD2   1 
ATOM   5581 N NE1   . TRP F 5 42  ? 51.965  41.408  72.244  1.00 34.17  ? 42  TRP B NE1   1 
ATOM   5582 C CE2   . TRP F 5 42  ? 50.809  40.824  72.691  1.00 34.17  ? 42  TRP B CE2   1 
ATOM   5583 C CE3   . TRP F 5 42  ? 50.124  38.708  73.649  1.00 34.17  ? 42  TRP B CE3   1 
ATOM   5584 C CZ2   . TRP F 5 42  ? 49.504  41.326  72.741  1.00 34.17  ? 42  TRP B CZ2   1 
ATOM   5585 C CZ3   . TRP F 5 42  ? 48.825  39.209  73.698  1.00 34.17  ? 42  TRP B CZ3   1 
ATOM   5586 C CH2   . TRP F 5 42  ? 48.529  40.506  73.246  1.00 34.17  ? 42  TRP B CH2   1 
ATOM   5587 N N     . LYS F 5 43  ? 55.053  36.029  74.852  1.00 17.28  ? 43  LYS B N     1 
ATOM   5588 C CA    . LYS F 5 43  ? 55.394  34.639  75.100  1.00 17.28  ? 43  LYS B CA    1 
ATOM   5589 C C     . LYS F 5 43  ? 55.160  34.305  76.568  1.00 17.28  ? 43  LYS B C     1 
ATOM   5590 O O     . LYS F 5 43  ? 54.621  33.248  76.898  1.00 17.28  ? 43  LYS B O     1 
ATOM   5591 C CB    . LYS F 5 43  ? 56.857  34.388  74.724  1.00 41.89  ? 43  LYS B CB    1 
ATOM   5592 C CG    . LYS F 5 43  ? 57.479  33.161  75.372  1.00 41.89  ? 43  LYS B CG    1 
ATOM   5593 C CD    . LYS F 5 43  ? 58.961  33.059  75.042  1.00 41.89  ? 43  LYS B CD    1 
ATOM   5594 C CE    . LYS F 5 43  ? 59.826  33.288  76.271  1.00 41.89  ? 43  LYS B CE    1 
ATOM   5595 N NZ    . LYS F 5 43  ? 60.532  34.598  76.220  1.00 41.89  ? 43  LYS B NZ    1 
ATOM   5596 N N     . MET F 5 44  ? 55.568  35.215  77.445  1.00 19.50  ? 44  MET B N     1 
ATOM   5597 C CA    . MET F 5 44  ? 55.404  35.022  78.879  1.00 19.50  ? 44  MET B CA    1 
ATOM   5598 C C     . MET F 5 44  ? 53.943  35.174  79.278  1.00 19.50  ? 44  MET B C     1 
ATOM   5599 O O     . MET F 5 44  ? 53.438  34.443  80.134  1.00 19.50  ? 44  MET B O     1 
ATOM   5600 C CB    . MET F 5 44  ? 56.257  36.036  79.641  1.00 24.48  ? 44  MET B CB    1 
ATOM   5601 C CG    . MET F 5 44  ? 57.608  35.502  80.093  1.00 24.48  ? 44  MET B CG    1 
ATOM   5602 S SD    . MET F 5 44  ? 57.727  33.700  80.013  1.00 24.48  ? 44  MET B SD    1 
ATOM   5603 C CE    . MET F 5 44  ? 57.646  33.270  81.756  1.00 24.48  ? 44  MET B CE    1 
ATOM   5604 N N     . LEU F 5 45  ? 53.271  36.132  78.649  1.00 26.02  ? 45  LEU B N     1 
ATOM   5605 C CA    . LEU F 5 45  ? 51.867  36.393  78.924  1.00 26.02  ? 45  LEU B CA    1 
ATOM   5606 C C     . LEU F 5 45  ? 51.049  35.122  78.756  1.00 26.02  ? 45  LEU B C     1 
ATOM   5607 O O     . LEU F 5 45  ? 50.441  34.634  79.707  1.00 26.02  ? 45  LEU B O     1 
ATOM   5608 C CB    . LEU F 5 45  ? 51.339  37.466  77.973  1.00 14.13  ? 45  LEU B CB    1 
ATOM   5609 C CG    . LEU F 5 45  ? 50.175  38.333  78.460  1.00 14.13  ? 45  LEU B CG    1 
ATOM   5610 C CD1   . LEU F 5 45  ? 49.434  38.905  77.261  1.00 14.13  ? 45  LEU B CD1   1 
ATOM   5611 C CD2   . LEU F 5 45  ? 49.231  37.513  79.323  1.00 14.13  ? 45  LEU B CD2   1 
ATOM   5612 N N     . LEU F 5 46  ? 51.038  34.593  77.538  1.00 26.38  ? 46  LEU B N     1 
ATOM   5613 C CA    . LEU F 5 46  ? 50.291  33.378  77.234  1.00 26.38  ? 46  LEU B CA    1 
ATOM   5614 C C     . LEU F 5 46  ? 50.765  32.199  78.080  1.00 26.38  ? 46  LEU B C     1 
ATOM   5615 O O     . LEU F 5 46  ? 49.987  31.298  78.392  1.00 26.38  ? 46  LEU B O     1 
ATOM   5616 C CB    . LEU F 5 46  ? 50.423  33.037  75.748  1.00 25.96  ? 46  LEU B CB    1 
ATOM   5617 C CG    . LEU F 5 46  ? 50.388  34.226  74.784  1.00 25.96  ? 46  LEU B CG    1 
ATOM   5618 C CD1   . LEU F 5 46  ? 50.994  33.823  73.451  1.00 25.96  ? 46  LEU B CD1   1 
ATOM   5619 C CD2   . LEU F 5 46  ? 48.956  34.693  74.604  1.00 25.96  ? 46  LEU B CD2   1 
ATOM   5620 N N     . SER F 5 47  ? 52.042  32.204  78.450  1.00 16.33  ? 47  SER B N     1 
ATOM   5621 C CA    . SER F 5 47  ? 52.588  31.127  79.263  1.00 16.33  ? 47  SER B CA    1 
ATOM   5622 C C     . SER F 5 47  ? 51.982  31.181  80.656  1.00 16.33  ? 47  SER B C     1 
ATOM   5623 O O     . SER F 5 47  ? 51.450  30.188  81.155  1.00 16.33  ? 47  SER B O     1 
ATOM   5624 C CB    . SER F 5 47  ? 54.108  31.244  79.359  1.00 18.74  ? 47  SER B CB    1 
ATOM   5625 O OG    . SER F 5 47  ? 54.644  30.154  80.088  1.00 18.74  ? 47  SER B OG    1 
ATOM   5626 N N     . VAL F 5 48  ? 52.058  32.346  81.286  1.00 21.97  ? 48  VAL B N     1 
ATOM   5627 C CA    . VAL F 5 48  ? 51.497  32.509  82.616  1.00 21.97  ? 48  VAL B CA    1 
ATOM   5628 C C     . VAL F 5 48  ? 50.006  32.176  82.594  1.00 21.97  ? 48  VAL B C     1 
ATOM   5629 O O     . VAL F 5 48  ? 49.508  31.485  83.478  1.00 21.97  ? 48  VAL B O     1 
ATOM   5630 C CB    . VAL F 5 48  ? 51.682  33.949  83.129  1.00 8.35   ? 48  VAL B CB    1 
ATOM   5631 C CG1   . VAL F 5 48  ? 51.098  34.078  84.526  1.00 8.35   ? 48  VAL B CG1   1 
ATOM   5632 C CG2   . VAL F 5 48  ? 53.155  34.313  83.130  1.00 8.35   ? 48  VAL B CG2   1 
ATOM   5633 N N     . CYS F 5 49  ? 49.298  32.665  81.580  1.00 21.75  ? 49  CYS B N     1 
ATOM   5634 C CA    . CYS F 5 49  ? 47.864  32.412  81.459  1.00 21.75  ? 49  CYS B CA    1 
ATOM   5635 C C     . CYS F 5 49  ? 47.547  30.923  81.365  1.00 21.75  ? 49  CYS B C     1 
ATOM   5636 O O     . CYS F 5 49  ? 46.477  30.481  81.781  1.00 21.75  ? 49  CYS B O     1 
ATOM   5637 C CB    . CYS F 5 49  ? 47.308  33.125  80.228  1.00 33.24  ? 49  CYS B CB    1 
ATOM   5638 S SG    . CYS F 5 49  ? 47.360  34.912  80.354  1.00 33.24  ? 49  CYS B SG    1 
ATOM   5639 N N     . ARG F 5 50  ? 48.479  30.156  80.809  1.00 24.40  ? 50  ARG B N     1 
ATOM   5640 C CA    . ARG F 5 50  ? 48.301  28.717  80.666  1.00 24.40  ? 50  ARG B CA    1 
ATOM   5641 C C     . ARG F 5 50  ? 48.358  28.061  82.040  1.00 24.40  ? 50  ARG B C     1 
ATOM   5642 O O     . ARG F 5 50  ? 47.494  27.264  82.394  1.00 24.40  ? 50  ARG B O     1 
ATOM   5643 C CB    . ARG F 5 50  ? 49.399  28.133  79.778  1.00 31.61  ? 50  ARG B CB    1 
ATOM   5644 C CG    . ARG F 5 50  ? 49.049  28.070  78.304  1.00 31.61  ? 50  ARG B CG    1 
ATOM   5645 C CD    . ARG F 5 50  ? 50.228  27.565  77.487  1.00 31.61  ? 50  ARG B CD    1 
ATOM   5646 N NE    . ARG F 5 50  ? 50.621  28.510  76.441  1.00 31.61  ? 50  ARG B NE    1 
ATOM   5647 C CZ    . ARG F 5 50  ? 51.878  28.856  76.182  1.00 31.61  ? 50  ARG B CZ    1 
ATOM   5648 N NH1   . ARG F 5 50  ? 52.864  28.334  76.894  1.00 31.61  ? 50  ARG B NH1   1 
ATOM   5649 N NH2   . ARG F 5 50  ? 52.152  29.724  75.214  1.00 31.61  ? 50  ARG B NH2   1 
ATOM   5650 N N     . SER F 5 51  ? 49.386  28.404  82.809  1.00 29.62  ? 51  SER B N     1 
ATOM   5651 C CA    . SER F 5 51  ? 49.565  27.854  84.147  1.00 29.62  ? 51  SER B CA    1 
ATOM   5652 C C     . SER F 5 51  ? 48.460  28.307  85.091  1.00 29.62  ? 51  SER B C     1 
ATOM   5653 O O     . SER F 5 51  ? 47.935  27.512  85.872  1.00 29.62  ? 51  SER B O     1 
ATOM   5654 C CB    . SER F 5 51  ? 50.919  28.280  84.715  1.00 34.65  ? 51  SER B CB    1 
ATOM   5655 O OG    . SER F 5 51  ? 51.623  29.087  83.789  1.00 34.65  ? 51  SER B OG    1 
ATOM   5656 N N     . TRP F 5 52  ? 48.112  29.587  85.019  1.00 26.48  ? 52  TRP B N     1 
ATOM   5657 C CA    . TRP F 5 52  ? 47.071  30.136  85.875  1.00 26.48  ? 52  TRP B CA    1 
ATOM   5658 C C     . TRP F 5 52  ? 45.734  29.495  85.534  1.00 26.48  ? 52  TRP B C     1 
ATOM   5659 O O     . TRP F 5 52  ? 45.006  29.061  86.422  1.00 26.48  ? 52  TRP B O     1 
ATOM   5660 C CB    . TRP F 5 52  ? 46.998  31.655  85.707  1.00 14.80  ? 52  TRP B CB    1 
ATOM   5661 C CG    . TRP F 5 52  ? 45.645  32.253  85.966  1.00 14.80  ? 52  TRP B CG    1 
ATOM   5662 C CD1   . TRP F 5 52  ? 44.805  32.795  85.040  1.00 14.80  ? 52  TRP B CD1   1 
ATOM   5663 C CD2   . TRP F 5 52  ? 44.989  32.397  87.235  1.00 14.80  ? 52  TRP B CD2   1 
ATOM   5664 N NE1   . TRP F 5 52  ? 43.671  33.268  85.647  1.00 14.80  ? 52  TRP B NE1   1 
ATOM   5665 C CE2   . TRP F 5 52  ? 43.754  33.037  86.994  1.00 14.80  ? 52  TRP B CE2   1 
ATOM   5666 C CE3   . TRP F 5 52  ? 45.325  32.046  88.550  1.00 14.80  ? 52  TRP B CE3   1 
ATOM   5667 C CZ2   . TRP F 5 52  ? 42.851  33.338  88.020  1.00 14.80  ? 52  TRP B CZ2   1 
ATOM   5668 C CZ3   . TRP F 5 52  ? 44.424  32.346  89.573  1.00 14.80  ? 52  TRP B CZ3   1 
ATOM   5669 C CH2   . TRP F 5 52  ? 43.203  32.985  89.299  1.00 14.80  ? 52  TRP B CH2   1 
ATOM   5670 N N     . ALA F 5 53  ? 45.415  29.432  84.245  1.00 26.78  ? 53  ALA B N     1 
ATOM   5671 C CA    . ALA F 5 53  ? 44.163  28.824  83.805  1.00 26.78  ? 53  ALA B CA    1 
ATOM   5672 C C     . ALA F 5 53  ? 44.138  27.342  84.175  1.00 26.78  ? 53  ALA B C     1 
ATOM   5673 O O     . ALA F 5 53  ? 43.089  26.797  84.509  1.00 26.78  ? 53  ALA B O     1 
ATOM   5674 C CB    . ALA F 5 53  ? 44.000  28.990  82.306  1.00 5.00   ? 53  ALA B CB    1 
ATOM   5675 N N     . ALA F 5 54  ? 45.294  26.692  84.113  1.00 22.93  ? 54  ALA B N     1 
ATOM   5676 C CA    . ALA F 5 54  ? 45.394  25.276  84.452  1.00 22.93  ? 54  ALA B CA    1 
ATOM   5677 C C     . ALA F 5 54  ? 45.016  25.065  85.912  1.00 22.93  ? 54  ALA B C     1 
ATOM   5678 O O     . ALA F 5 54  ? 44.215  24.189  86.236  1.00 22.93  ? 54  ALA B O     1 
ATOM   5679 C CB    . ALA F 5 54  ? 46.807  24.781  84.204  1.00 22.24  ? 54  ALA B CB    1 
ATOM   5680 N N     . TRP F 5 55  ? 45.598  25.876  86.791  1.00 32.45  ? 55  TRP B N     1 
ATOM   5681 C CA    . TRP F 5 55  ? 45.321  25.795  88.221  1.00 32.45  ? 55  TRP B CA    1 
ATOM   5682 C C     . TRP F 5 55  ? 43.840  26.064  88.481  1.00 32.45  ? 55  TRP B C     1 
ATOM   5683 O O     . TRP F 5 55  ? 43.220  25.415  89.315  1.00 32.45  ? 55  TRP B O     1 
ATOM   5684 C CB    . TRP F 5 55  ? 46.174  26.816  88.978  1.00 23.37  ? 55  TRP B CB    1 
ATOM   5685 C CG    . TRP F 5 55  ? 45.874  26.893  90.449  1.00 23.37  ? 55  TRP B CG    1 
ATOM   5686 C CD1   . TRP F 5 55  ? 46.470  26.175  91.447  1.00 23.37  ? 55  TRP B CD1   1 
ATOM   5687 C CD2   . TRP F 5 55  ? 44.895  27.724  91.084  1.00 23.37  ? 55  TRP B CD2   1 
ATOM   5688 N NE1   . TRP F 5 55  ? 45.922  26.507  92.662  1.00 23.37  ? 55  TRP B NE1   1 
ATOM   5689 C CE2   . TRP F 5 55  ? 44.952  27.455  92.469  1.00 23.37  ? 55  TRP B CE2   1 
ATOM   5690 C CE3   . TRP F 5 55  ? 43.974  28.669  90.617  1.00 23.37  ? 55  TRP B CE3   1 
ATOM   5691 C CZ2   . TRP F 5 55  ? 44.123  28.098  93.394  1.00 23.37  ? 55  TRP B CZ2   1 
ATOM   5692 C CZ3   . TRP F 5 55  ? 43.147  29.310  91.538  1.00 23.37  ? 55  TRP B CZ3   1 
ATOM   5693 C CH2   . TRP F 5 55  ? 43.229  29.019  92.911  1.00 23.37  ? 55  TRP B CH2   1 
ATOM   5694 N N     . CYS F 5 56  ? 43.282  27.027  87.756  1.00 24.82  ? 56  CYS B N     1 
ATOM   5695 C CA    . CYS F 5 56  ? 41.869  27.367  87.899  1.00 24.82  ? 56  CYS B CA    1 
ATOM   5696 C C     . CYS F 5 56  ? 40.996  26.173  87.524  1.00 24.82  ? 56  CYS B C     1 
ATOM   5697 O O     . CYS F 5 56  ? 40.035  25.846  88.223  1.00 24.82  ? 56  CYS B O     1 
ATOM   5698 C CB    . CYS F 5 56  ? 41.524  28.544  86.992  1.00 20.85  ? 56  CYS B CB    1 
ATOM   5699 S SG    . CYS F 5 56  ? 41.886  30.156  87.724  1.00 20.85  ? 56  CYS B SG    1 
ATOM   5700 N N     . LYS F 5 57  ? 41.356  25.508  86.435  1.00 25.62  ? 57  LYS B N     1 
ATOM   5701 C CA    . LYS F 5 57  ? 40.599  24.354  85.978  1.00 25.62  ? 57  LYS B CA    1 
ATOM   5702 C C     . LYS F 5 57  ? 40.617  23.259  87.058  1.00 25.62  ? 57  LYS B C     1 
ATOM   5703 O O     . LYS F 5 57  ? 39.569  22.713  87.415  1.00 25.62  ? 57  LYS B O     1 
ATOM   5704 C CB    . LYS F 5 57  ? 41.202  23.816  84.688  1.00 61.82  ? 57  LYS B CB    1 
ATOM   5705 C CG    . LYS F 5 57  ? 40.307  22.855  83.956  1.00 61.82  ? 57  LYS B CG    1 
ATOM   5706 C CD    . LYS F 5 57  ? 41.047  22.209  82.801  1.00 61.82  ? 57  LYS B CD    1 
ATOM   5707 C CE    . LYS F 5 57  ? 40.563  22.724  81.454  1.00 61.82  ? 57  LYS B CE    1 
ATOM   5708 N NZ    . LYS F 5 57  ? 41.347  22.134  80.333  1.00 61.82  ? 57  LYS B NZ    1 
ATOM   5709 N N     . LEU F 5 58  ? 41.800  22.934  87.574  1.00 26.95  ? 58  LEU B N     1 
ATOM   5710 C CA    . LEU F 5 58  ? 41.941  21.907  88.598  1.00 26.95  ? 58  LEU B CA    1 
ATOM   5711 C C     . LEU F 5 58  ? 41.199  22.250  89.881  1.00 26.95  ? 58  LEU B C     1 
ATOM   5712 O O     . LEU F 5 58  ? 41.024  21.391  90.734  1.00 26.95  ? 58  LEU B O     1 
ATOM   5713 C CB    . LEU F 5 58  ? 43.423  21.661  88.900  1.00 36.26  ? 58  LEU B CB    1 
ATOM   5714 C CG    . LEU F 5 58  ? 43.787  20.909  90.180  1.00 36.26  ? 58  LEU B CG    1 
ATOM   5715 C CD1   . LEU F 5 58  ? 43.275  19.504  90.135  1.00 36.26  ? 58  LEU B CD1   1 
ATOM   5716 C CD2   . LEU F 5 58  ? 45.285  20.914  90.309  1.00 36.26  ? 58  LEU B CD2   1 
ATOM   5717 N N     . ASN F 5 59  ? 40.726  23.488  90.002  1.00 39.34  ? 59  ASN B N     1 
ATOM   5718 C CA    . ASN F 5 59  ? 40.002  23.903  91.203  1.00 39.34  ? 59  ASN B CA    1 
ATOM   5719 C C     . ASN F 5 59  ? 38.622  24.485  90.892  1.00 39.34  ? 59  ASN B C     1 
ATOM   5720 O O     . ASN F 5 59  ? 37.991  25.113  91.748  1.00 39.34  ? 59  ASN B O     1 
ATOM   5721 C CB    . ASN F 5 59  ? 40.827  24.923  91.980  1.00 27.88  ? 59  ASN B CB    1 
ATOM   5722 C CG    . ASN F 5 59  ? 42.098  24.326  92.540  1.00 27.88  ? 59  ASN B CG    1 
ATOM   5723 O OD1   . ASN F 5 59  ? 42.113  23.821  93.662  1.00 27.88  ? 59  ASN B OD1   1 
ATOM   5724 N ND2   . ASN F 5 59  ? 43.172  24.370  91.760  1.00 27.88  ? 59  ASN B ND2   1 
ATOM   5725 N N     . ASN F 5 60  ? 38.159  24.266  89.664  1.00 30.43  ? 60  ASN B N     1 
ATOM   5726 C CA    . ASN F 5 60  ? 36.857  24.761  89.223  1.00 30.43  ? 60  ASN B CA    1 
ATOM   5727 C C     . ASN F 5 60  ? 36.645  26.229  89.606  1.00 30.43  ? 60  ASN B C     1 
ATOM   5728 O O     . ASN F 5 60  ? 35.778  26.559  90.423  1.00 30.43  ? 60  ASN B O     1 
ATOM   5729 C CB    . ASN F 5 60  ? 35.732  23.926  89.840  1.00 67.85  ? 60  ASN B CB    1 
ATOM   5730 C CG    . ASN F 5 60  ? 34.361  24.230  89.242  1.00 67.85  ? 60  ASN B CG    1 
ATOM   5731 O OD1   . ASN F 5 60  ? 34.277  24.695  88.107  1.00 67.85  ? 60  ASN B OD1   1 
ATOM   5732 N ND2   . ASN F 5 60  ? 33.273  23.990  89.947  1.00 67.85  ? 60  ASN B ND2   1 
ATOM   5733 N N     . ARG F 5 61  ? 37.438  27.086  88.989  1.00 33.08  ? 61  ARG B N     1 
ATOM   5734 C CA    . ARG F 5 61  ? 37.362  28.538  89.226  1.00 33.08  ? 61  ARG B CA    1 
ATOM   5735 C C     . ARG F 5 61  ? 37.399  29.295  87.899  1.00 33.08  ? 61  ARG B C     1 
ATOM   5736 O O     . ARG F 5 61  ? 37.838  28.765  86.871  1.00 33.08  ? 61  ARG B O     1 
ATOM   5737 C CB    . ARG F 5 61  ? 38.557  29.008  90.061  1.00 28.92  ? 61  ARG B CB    1 
ATOM   5738 C CG    . ARG F 5 61  ? 38.917  28.055  91.200  1.00 28.92  ? 61  ARG B CG    1 
ATOM   5739 C CD    . ARG F 5 61  ? 38.826  28.718  92.573  1.00 28.92  ? 61  ARG B CD    1 
ATOM   5740 N NE    . ARG F 5 61  ? 37.560  28.431  93.251  1.00 28.92  ? 61  ARG B NE    1 
ATOM   5741 C CZ    . ARG F 5 61  ? 36.835  29.339  93.908  1.00 28.92  ? 61  ARG B CZ    1 
ATOM   5742 N NH1   . ARG F 5 61  ? 37.236  30.614  93.991  1.00 28.92  ? 61  ARG B NH1   1 
ATOM   5743 N NH2   . ARG F 5 61  ? 35.679  29.059  94.522  1.00 28.92  ? 61  ARG B NH2   1 
ATOM   5744 N N     . LYS F 5 62  ? 36.925  30.526  87.951  1.00 38.72  ? 62  LYS B N     1 
ATOM   5745 C CA    . LYS F 5 62  ? 36.947  31.416  86.784  1.00 38.72  ? 62  LYS B CA    1 
ATOM   5746 C C     . LYS F 5 62  ? 38.394  31.803  86.529  1.00 38.72  ? 62  LYS B C     1 
ATOM   5747 O O     . LYS F 5 62  ? 39.134  32.147  87.455  1.00 38.72  ? 62  LYS B O     1 
ATOM   5748 C CB    . LYS F 5 62  ? 36.138  32.678  87.073  1.00 100.00 ? 62  LYS B CB    1 
ATOM   5749 C CG    . LYS F 5 62  ? 34.989  32.894  86.096  1.00 100.00 ? 62  LYS B CG    1 
ATOM   5750 C CD    . LYS F 5 62  ? 33.643  33.037  86.799  1.00 100.00 ? 62  LYS B CD    1 
ATOM   5751 C CE    . LYS F 5 62  ? 32.484  33.236  85.826  1.00 100.00 ? 62  LYS B CE    1 
ATOM   5752 N NZ    . LYS F 5 62  ? 32.634  32.456  84.589  1.00 100.00 ? 62  LYS B NZ    1 
ATOM   5753 N N     . TRP F 5 63  ? 38.811  31.745  85.286  1.00 37.30  ? 63  TRP B N     1 
ATOM   5754 C CA    . TRP F 5 63  ? 40.201  32.076  84.973  1.00 37.30  ? 63  TRP B CA    1 
ATOM   5755 C C     . TRP F 5 63  ? 40.332  33.567  84.652  1.00 37.30  ? 63  TRP B C     1 
ATOM   5756 O O     . TRP F 5 63  ? 41.377  34.172  84.882  1.00 37.30  ? 63  TRP B O     1 
ATOM   5757 C CB    . TRP F 5 63  ? 40.729  31.171  83.850  1.00 54.66  ? 63  TRP B CB    1 
ATOM   5758 C CG    . TRP F 5 63  ? 40.656  31.764  82.443  1.00 54.66  ? 63  TRP B CG    1 
ATOM   5759 C CD1   . TRP F 5 63  ? 39.668  31.596  81.559  1.00 54.66  ? 63  TRP B CD1   1 
ATOM   5760 C CD2   . TRP F 5 63  ? 41.649  32.584  81.845  1.00 54.66  ? 63  TRP B CD2   1 
ATOM   5761 N NE1   . TRP F 5 63  ? 40.037  32.305  80.376  1.00 54.66  ? 63  TRP B NE1   1 
ATOM   5762 C CE2   . TRP F 5 63  ? 41.204  32.875  80.562  1.00 54.66  ? 63  TRP B CE2   1 
ATOM   5763 C CE3   . TRP F 5 63  ? 42.880  33.099  82.274  1.00 54.66  ? 63  TRP B CE3   1 
ATOM   5764 C CZ2   . TRP F 5 63  ? 41.934  33.657  79.658  1.00 54.66  ? 63  TRP B CZ2   1 
ATOM   5765 C CZ3   . TRP F 5 63  ? 43.606  33.891  81.358  1.00 54.66  ? 63  TRP B CZ3   1 
ATOM   5766 C CH2   . TRP F 5 63  ? 43.153  34.155  80.111  1.00 54.66  ? 63  TRP B CH2   1 
ATOM   5767 N N     . PHE F 5 64  ? 39.261  34.163  84.141  1.00 35.50  ? 64  PHE B N     1 
ATOM   5768 C CA    . PHE F 5 64  ? 39.265  35.589  83.833  1.00 35.50  ? 64  PHE B CA    1 
ATOM   5769 C C     . PHE F 5 64  ? 37.851  36.157  83.841  1.00 35.50  ? 64  PHE B C     1 
ATOM   5770 O O     . PHE F 5 64  ? 36.952  35.614  83.203  1.00 35.50  ? 64  PHE B O     1 
ATOM   5771 C CB    . PHE F 5 64  ? 39.908  35.856  82.471  1.00 28.79  ? 64  PHE B CB    1 
ATOM   5772 C CG    . PHE F 5 64  ? 39.994  37.317  82.121  1.00 28.79  ? 64  PHE B CG    1 
ATOM   5773 C CD1   . PHE F 5 64  ? 41.090  38.078  82.514  1.00 28.79  ? 64  PHE B CD1   1 
ATOM   5774 C CD2   . PHE F 5 64  ? 38.976  37.936  81.405  1.00 28.79  ? 64  PHE B CD2   1 
ATOM   5775 C CE1   . PHE F 5 64  ? 41.171  39.434  82.199  1.00 28.79  ? 64  PHE B CE1   1 
ATOM   5776 C CE2   . PHE F 5 64  ? 39.048  39.290  81.086  1.00 28.79  ? 64  PHE B CE2   1 
ATOM   5777 C CZ    . PHE F 5 64  ? 40.147  40.040  81.484  1.00 28.79  ? 64  PHE B CZ    1 
ATOM   5778 N N     . PRO F 5 65  ? 37.635  37.259  84.574  1.00 26.86  ? 65  PRO B N     1 
ATOM   5779 C CA    . PRO F 5 65  ? 38.650  37.958  85.369  1.00 26.86  ? 65  PRO B CA    1 
ATOM   5780 C C     . PRO F 5 65  ? 39.045  37.136  86.586  1.00 26.86  ? 65  PRO B C     1 
ATOM   5781 O O     . PRO F 5 65  ? 38.235  36.375  87.119  1.00 26.86  ? 65  PRO B O     1 
ATOM   5782 C CB    . PRO F 5 65  ? 37.969  39.271  85.764  1.00 15.68  ? 65  PRO B CB    1 
ATOM   5783 C CG    . PRO F 5 65  ? 36.716  39.341  84.945  1.00 15.68  ? 65  PRO B CG    1 
ATOM   5784 C CD    . PRO F 5 65  ? 36.331  37.927  84.665  1.00 15.68  ? 65  PRO B CD    1 
ATOM   5785 N N     . ALA F 5 66  ? 40.291  37.291  87.019  1.00 22.43  ? 66  ALA B N     1 
ATOM   5786 C CA    . ALA F 5 66  ? 40.797  36.555  88.169  1.00 22.43  ? 66  ALA B CA    1 
ATOM   5787 C C     . ALA F 5 66  ? 40.259  37.108  89.485  1.00 22.43  ? 66  ALA B C     1 
ATOM   5788 O O     . ALA F 5 66  ? 39.920  38.287  89.586  1.00 22.43  ? 66  ALA B O     1 
ATOM   5789 C CB    . ALA F 5 66  ? 42.319  36.594  88.174  1.00 9.52   ? 66  ALA B CB    1 
ATOM   5790 N N     . GLU F 5 67  ? 40.175  36.240  90.488  1.00 22.62  ? 67  GLU B N     1 
ATOM   5791 C CA    . GLU F 5 67  ? 39.701  36.633  91.811  1.00 22.62  ? 67  GLU B CA    1 
ATOM   5792 C C     . GLU F 5 67  ? 40.914  36.770  92.731  1.00 22.62  ? 67  GLU B C     1 
ATOM   5793 O O     . GLU F 5 67  ? 41.704  35.836  92.866  1.00 22.62  ? 67  GLU B O     1 
ATOM   5794 C CB    . GLU F 5 67  ? 38.747  35.573  92.369  1.00 50.14  ? 67  GLU B CB    1 
ATOM   5795 C CG    . GLU F 5 67  ? 37.306  35.735  91.918  1.00 50.14  ? 67  GLU B CG    1 
ATOM   5796 C CD    . GLU F 5 67  ? 36.768  37.124  92.192  1.00 50.14  ? 67  GLU B CD    1 
ATOM   5797 O OE1   . GLU F 5 67  ? 37.191  37.736  93.196  1.00 50.14  ? 67  GLU B OE1   1 
ATOM   5798 O OE2   . GLU F 5 67  ? 35.925  37.603  91.403  1.00 50.14  ? 67  GLU B OE2   1 
ATOM   5799 N N     . PRO F 5 68  ? 41.078  37.937  93.377  1.00 29.14  ? 68  PRO B N     1 
ATOM   5800 C CA    . PRO F 5 68  ? 42.222  38.142  94.274  1.00 29.14  ? 68  PRO B CA    1 
ATOM   5801 C C     . PRO F 5 68  ? 42.497  36.968  95.212  1.00 29.14  ? 68  PRO B C     1 
ATOM   5802 O O     . PRO F 5 68  ? 43.647  36.556  95.373  1.00 29.14  ? 68  PRO B O     1 
ATOM   5803 C CB    . PRO F 5 68  ? 41.857  39.416  95.029  1.00 22.73  ? 68  PRO B CB    1 
ATOM   5804 C CG    . PRO F 5 68  ? 41.011  40.172  94.070  1.00 22.73  ? 68  PRO B CG    1 
ATOM   5805 C CD    . PRO F 5 68  ? 40.214  39.130  93.316  1.00 22.73  ? 68  PRO B CD    1 
ATOM   5806 N N     . GLU F 5 69  ? 41.447  36.430  95.827  1.00 25.01  ? 69  GLU B N     1 
ATOM   5807 C CA    . GLU F 5 69  ? 41.600  35.301  96.739  1.00 25.01  ? 69  GLU B CA    1 
ATOM   5808 C C     . GLU F 5 69  ? 42.136  34.098  95.973  1.00 25.01  ? 69  GLU B C     1 
ATOM   5809 O O     . GLU F 5 69  ? 42.938  33.319  96.491  1.00 25.01  ? 69  GLU B O     1 
ATOM   5810 C CB    . GLU F 5 69  ? 40.254  34.947  97.377  1.00 28.60  ? 69  GLU B CB    1 
ATOM   5811 C CG    . GLU F 5 69  ? 39.789  35.931  98.435  1.00 28.60  ? 69  GLU B CG    1 
ATOM   5812 C CD    . GLU F 5 69  ? 40.725  35.996  99.625  1.00 28.60  ? 69  GLU B CD    1 
ATOM   5813 O OE1   . GLU F 5 69  ? 41.223  34.932  100.052 1.00 28.60  ? 69  GLU B OE1   1 
ATOM   5814 O OE2   . GLU F 5 69  ? 40.961  37.112  100.134 1.00 28.60  ? 69  GLU B OE2   1 
ATOM   5815 N N     . ASP F 5 70  ? 41.683  33.956  94.734  1.00 25.37  ? 70  ASP B N     1 
ATOM   5816 C CA    . ASP F 5 70  ? 42.113  32.858  93.887  1.00 25.37  ? 70  ASP B CA    1 
ATOM   5817 C C     . ASP F 5 70  ? 43.568  33.036  93.471  1.00 25.37  ? 70  ASP B C     1 
ATOM   5818 O O     . ASP F 5 70  ? 44.337  32.072  93.449  1.00 25.37  ? 70  ASP B O     1 
ATOM   5819 C CB    . ASP F 5 70  ? 41.218  32.775  92.652  1.00 28.41  ? 70  ASP B CB    1 
ATOM   5820 C CG    . ASP F 5 70  ? 39.860  32.187  92.967  1.00 28.41  ? 70  ASP B CG    1 
ATOM   5821 O OD1   . ASP F 5 70  ? 39.741  31.511  94.008  1.00 28.41  ? 70  ASP B OD1   1 
ATOM   5822 O OD2   . ASP F 5 70  ? 38.915  32.400  92.180  1.00 28.41  ? 70  ASP B OD2   1 
ATOM   5823 N N     . VAL F 5 71  ? 43.947  34.270  93.149  1.00 18.07  ? 71  VAL B N     1 
ATOM   5824 C CA    . VAL F 5 71  ? 45.320  34.554  92.743  1.00 18.07  ? 71  VAL B CA    1 
ATOM   5825 C C     . VAL F 5 71  ? 46.248  34.308  93.923  1.00 18.07  ? 71  VAL B C     1 
ATOM   5826 O O     . VAL F 5 71  ? 47.387  33.882  93.743  1.00 18.07  ? 71  VAL B O     1 
ATOM   5827 C CB    . VAL F 5 71  ? 45.492  36.016  92.270  1.00 12.46  ? 71  VAL B CB    1 
ATOM   5828 C CG1   . VAL F 5 71  ? 46.966  36.335  92.098  1.00 12.46  ? 71  VAL B CG1   1 
ATOM   5829 C CG2   . VAL F 5 71  ? 44.761  36.226  90.960  1.00 12.46  ? 71  VAL B CG2   1 
ATOM   5830 N N     . ARG F 5 72  ? 45.757  34.579  95.130  1.00 17.65  ? 72  ARG B N     1 
ATOM   5831 C CA    . ARG F 5 72  ? 46.546  34.364  96.338  1.00 17.65  ? 72  ARG B CA    1 
ATOM   5832 C C     . ARG F 5 72  ? 46.843  32.878  96.460  1.00 17.65  ? 72  ARG B C     1 
ATOM   5833 O O     . ARG F 5 72  ? 47.985  32.476  96.673  1.00 17.65  ? 72  ARG B O     1 
ATOM   5834 C CB    . ARG F 5 72  ? 45.779  34.837  97.575  1.00 22.71  ? 72  ARG B CB    1 
ATOM   5835 C CG    . ARG F 5 72  ? 46.669  35.434  98.657  1.00 22.71  ? 72  ARG B CG    1 
ATOM   5836 C CD    . ARG F 5 72  ? 46.013  35.380  100.030 1.00 22.71  ? 72  ARG B CD    1 
ATOM   5837 N NE    . ARG F 5 72  ? 46.158  34.062  100.639 1.00 22.71  ? 72  ARG B NE    1 
ATOM   5838 C CZ    . ARG F 5 72  ? 46.565  33.853  101.885 1.00 22.71  ? 72  ARG B CZ    1 
ATOM   5839 N NH1   . ARG F 5 72  ? 46.873  34.873  102.672 1.00 22.71  ? 72  ARG B NH1   1 
ATOM   5840 N NH2   . ARG F 5 72  ? 46.673  32.617  102.343 1.00 22.71  ? 72  ARG B NH2   1 
ATOM   5841 N N     . ASP F 5 73  ? 45.805  32.062  96.316  1.00 13.95  ? 73  ASP B N     1 
ATOM   5842 C CA    . ASP F 5 73  ? 45.959  30.617  96.400  1.00 13.95  ? 73  ASP B CA    1 
ATOM   5843 C C     . ASP F 5 73  ? 46.930  30.136  95.331  1.00 13.95  ? 73  ASP B C     1 
ATOM   5844 O O     . ASP F 5 73  ? 47.680  29.181  95.540  1.00 13.95  ? 73  ASP B O     1 
ATOM   5845 C CB    . ASP F 5 73  ? 44.610  29.929  96.201  1.00 43.35  ? 73  ASP B CB    1 
ATOM   5846 C CG    . ASP F 5 73  ? 43.671  30.151  97.360  1.00 43.35  ? 73  ASP B CG    1 
ATOM   5847 O OD1   . ASP F 5 73  ? 44.157  30.479  98.463  1.00 43.35  ? 73  ASP B OD1   1 
ATOM   5848 O OD2   . ASP F 5 73  ? 42.448  29.998  97.168  1.00 43.35  ? 73  ASP B OD2   1 
ATOM   5849 N N     . TYR F 5 74  ? 46.908  30.805  94.184  1.00 20.18  ? 74  TYR B N     1 
ATOM   5850 C CA    . TYR F 5 74  ? 47.778  30.448  93.071  1.00 20.18  ? 74  TYR B CA    1 
ATOM   5851 C C     . TYR F 5 74  ? 49.243  30.761  93.350  1.00 20.18  ? 74  TYR B C     1 
ATOM   5852 O O     . TYR F 5 74  ? 50.112  29.917  93.140  1.00 20.18  ? 74  TYR B O     1 
ATOM   5853 C CB    . TYR F 5 74  ? 47.332  31.181  91.806  1.00 19.04  ? 74  TYR B CB    1 
ATOM   5854 C CG    . TYR F 5 74  ? 48.208  30.918  90.602  1.00 19.04  ? 74  TYR B CG    1 
ATOM   5855 C CD1   . TYR F 5 74  ? 48.344  29.630  90.082  1.00 19.04  ? 74  TYR B CD1   1 
ATOM   5856 C CD2   . TYR F 5 74  ? 48.894  31.960  89.974  1.00 19.04  ? 74  TYR B CD2   1 
ATOM   5857 C CE1   . TYR F 5 74  ? 49.138  29.387  88.966  1.00 19.04  ? 74  TYR B CE1   1 
ATOM   5858 C CE2   . TYR F 5 74  ? 49.690  31.727  88.859  1.00 19.04  ? 74  TYR B CE2   1 
ATOM   5859 C CZ    . TYR F 5 74  ? 49.806  30.440  88.361  1.00 19.04  ? 74  TYR B CZ    1 
ATOM   5860 O OH    . TYR F 5 74  ? 50.580  30.209  87.251  1.00 19.04  ? 74  TYR B OH    1 
ATOM   5861 N N     . LEU F 5 75  ? 49.519  31.974  93.820  1.00 15.01  ? 75  LEU B N     1 
ATOM   5862 C CA    . LEU F 5 75  ? 50.892  32.374  94.106  1.00 15.01  ? 75  LEU B CA    1 
ATOM   5863 C C     . LEU F 5 75  ? 51.491  31.474  95.176  1.00 15.01  ? 75  LEU B C     1 
ATOM   5864 O O     . LEU F 5 75  ? 52.667  31.121  95.115  1.00 15.01  ? 75  LEU B O     1 
ATOM   5865 C CB    . LEU F 5 75  ? 50.938  33.838  94.557  1.00 9.15   ? 75  LEU B CB    1 
ATOM   5866 C CG    . LEU F 5 75  ? 50.293  34.860  93.613  1.00 9.15   ? 75  LEU B CG    1 
ATOM   5867 C CD1   . LEU F 5 75  ? 50.512  36.267  94.142  1.00 9.15   ? 75  LEU B CD1   1 
ATOM   5868 C CD2   . LEU F 5 75  ? 50.889  34.716  92.226  1.00 9.15   ? 75  LEU B CD2   1 
ATOM   5869 N N     . LEU F 5 76  ? 50.672  31.100  96.155  1.00 21.76  ? 76  LEU B N     1 
ATOM   5870 C CA    . LEU F 5 76  ? 51.120  30.227  97.234  1.00 21.76  ? 76  LEU B CA    1 
ATOM   5871 C C     . LEU F 5 76  ? 51.342  28.820  96.690  1.00 21.76  ? 76  LEU B C     1 
ATOM   5872 O O     . LEU F 5 76  ? 52.120  28.042  97.241  1.00 21.76  ? 76  LEU B O     1 
ATOM   5873 C CB    . LEU F 5 76  ? 50.082  30.193  98.356  1.00 6.00   ? 76  LEU B CB    1 
ATOM   5874 C CG    . LEU F 5 76  ? 50.078  31.418  99.273  1.00 6.00   ? 76  LEU B CG    1 
ATOM   5875 C CD1   . LEU F 5 76  ? 48.906  31.338  100.237 1.00 6.00   ? 76  LEU B CD1   1 
ATOM   5876 C CD2   . LEU F 5 76  ? 51.396  31.491  100.029 1.00 6.00   ? 76  LEU B CD2   1 
ATOM   5877 N N     . TYR F 5 77  ? 50.644  28.506  95.605  1.00 26.32  ? 77  TYR B N     1 
ATOM   5878 C CA    . TYR F 5 77  ? 50.757  27.208  94.948  1.00 26.32  ? 77  TYR B CA    1 
ATOM   5879 C C     . TYR F 5 77  ? 52.098  27.153  94.223  1.00 26.32  ? 77  TYR B C     1 
ATOM   5880 O O     . TYR F 5 77  ? 52.764  26.117  94.205  1.00 26.32  ? 77  TYR B O     1 
ATOM   5881 C CB    . TYR F 5 77  ? 49.603  27.030  93.954  1.00 29.93  ? 77  TYR B CB    1 
ATOM   5882 C CG    . TYR F 5 77  ? 49.839  25.999  92.874  1.00 29.93  ? 77  TYR B CG    1 
ATOM   5883 C CD1   . TYR F 5 77  ? 49.934  24.641  93.184  1.00 29.93  ? 77  TYR B CD1   1 
ATOM   5884 C CD2   . TYR F 5 77  ? 49.938  26.378  91.535  1.00 29.93  ? 77  TYR B CD2   1 
ATOM   5885 C CE1   . TYR F 5 77  ? 50.118  23.684  92.187  1.00 29.93  ? 77  TYR B CE1   1 
ATOM   5886 C CE2   . TYR F 5 77  ? 50.123  25.431  90.531  1.00 29.93  ? 77  TYR B CE2   1 
ATOM   5887 C CZ    . TYR F 5 77  ? 50.211  24.086  90.863  1.00 29.93  ? 77  TYR B CZ    1 
ATOM   5888 O OH    . TYR F 5 77  ? 50.385  23.148  89.871  1.00 29.93  ? 77  TYR B OH    1 
ATOM   5889 N N     . LEU F 5 78  ? 52.490  28.277  93.630  1.00 20.72  ? 78  LEU B N     1 
ATOM   5890 C CA    . LEU F 5 78  ? 53.760  28.357  92.925  1.00 20.72  ? 78  LEU B CA    1 
ATOM   5891 C C     . LEU F 5 78  ? 54.870  28.224  93.954  1.00 20.72  ? 78  LEU B C     1 
ATOM   5892 O O     . LEU F 5 78  ? 55.834  27.488  93.750  1.00 20.72  ? 78  LEU B O     1 
ATOM   5893 C CB    . LEU F 5 78  ? 53.888  29.697  92.199  1.00 11.61  ? 78  LEU B CB    1 
ATOM   5894 C CG    . LEU F 5 78  ? 52.780  30.041  91.205  1.00 11.61  ? 78  LEU B CG    1 
ATOM   5895 C CD1   . LEU F 5 78  ? 53.042  31.414  90.607  1.00 11.61  ? 78  LEU B CD1   1 
ATOM   5896 C CD2   . LEU F 5 78  ? 52.722  28.985  90.115  1.00 11.61  ? 78  LEU B CD2   1 
ATOM   5897 N N     . GLN F 5 79  ? 54.724  28.942  95.065  1.00 18.69  ? 79  GLN B N     1 
ATOM   5898 C CA    . GLN F 5 79  ? 55.709  28.894  96.138  1.00 18.69  ? 79  GLN B CA    1 
ATOM   5899 C C     . GLN F 5 79  ? 55.910  27.443  96.548  1.00 18.69  ? 79  GLN B C     1 
ATOM   5900 O O     . GLN F 5 79  ? 57.039  26.979  96.687  1.00 18.69  ? 79  GLN B O     1 
ATOM   5901 C CB    . GLN F 5 79  ? 55.235  29.708  97.346  1.00 18.11  ? 79  GLN B CB    1 
ATOM   5902 C CG    . GLN F 5 79  ? 56.193  29.666  98.534  1.00 18.11  ? 79  GLN B CG    1 
ATOM   5903 C CD    . GLN F 5 79  ? 55.646  30.375  99.765  1.00 18.11  ? 79  GLN B CD    1 
ATOM   5904 O OE1   . GLN F 5 79  ? 54.458  30.285  100.068 1.00 18.11  ? 79  GLN B OE1   1 
ATOM   5905 N NE2   . GLN F 5 79  ? 56.515  31.081  100.480 1.00 18.11  ? 79  GLN B NE2   1 
ATOM   5906 N N     . ALA F 5 80  ? 54.802  26.734  96.736  1.00 39.66  ? 80  ALA B N     1 
ATOM   5907 C CA    . ALA F 5 80  ? 54.844  25.331  97.126  1.00 39.66  ? 80  ALA B CA    1 
ATOM   5908 C C     . ALA F 5 80  ? 55.584  24.499  96.088  1.00 39.66  ? 80  ALA B C     1 
ATOM   5909 O O     . ALA F 5 80  ? 56.332  23.588  96.435  1.00 39.66  ? 80  ALA B O     1 
ATOM   5910 C CB    . ALA F 5 80  ? 53.430  24.796  97.311  1.00 13.31  ? 80  ALA B CB    1 
ATOM   5911 N N     . ARG F 5 81  ? 55.376  24.806  94.813  1.00 24.03  ? 81  ARG B N     1 
ATOM   5912 C CA    . ARG F 5 81  ? 56.044  24.070  93.749  1.00 24.03  ? 81  ARG B CA    1 
ATOM   5913 C C     . ARG F 5 81  ? 57.549  24.304  93.792  1.00 24.03  ? 81  ARG B C     1 
ATOM   5914 O O     . ARG F 5 81  ? 58.308  23.644  93.085  1.00 24.03  ? 81  ARG B O     1 
ATOM   5915 C CB    . ARG F 5 81  ? 55.502  24.504  92.392  1.00 40.44  ? 81  ARG B CB    1 
ATOM   5916 C CG    . ARG F 5 81  ? 54.019  24.281  92.232  1.00 40.44  ? 81  ARG B CG    1 
ATOM   5917 C CD    . ARG F 5 81  ? 53.733  23.451  91.003  1.00 40.44  ? 81  ARG B CD    1 
ATOM   5918 N NE    . ARG F 5 81  ? 54.823  23.507  90.033  1.00 40.44  ? 81  ARG B NE    1 
ATOM   5919 C CZ    . ARG F 5 81  ? 54.782  24.206  88.903  1.00 40.44  ? 81  ARG B CZ    1 
ATOM   5920 N NH1   . ARG F 5 81  ? 53.704  24.914  88.594  1.00 40.44  ? 81  ARG B NH1   1 
ATOM   5921 N NH2   . ARG F 5 81  ? 55.813  24.186  88.074  1.00 40.44  ? 81  ARG B NH2   1 
ATOM   5922 N N     . GLY F 5 82  ? 57.974  25.253  94.618  1.00 24.48  ? 82  GLY B N     1 
ATOM   5923 C CA    . GLY F 5 82  ? 59.388  25.547  94.733  1.00 24.48  ? 82  GLY B CA    1 
ATOM   5924 C C     . GLY F 5 82  ? 59.871  26.594  93.748  1.00 24.48  ? 82  GLY B C     1 
ATOM   5925 O O     . GLY F 5 82  ? 61.073  26.821  93.621  1.00 24.48  ? 82  GLY B O     1 
ATOM   5926 N N     . LEU F 5 83  ? 58.942  27.233  93.046  1.00 24.38  ? 83  LEU B N     1 
ATOM   5927 C CA    . LEU F 5 83  ? 59.305  28.264  92.080  1.00 24.38  ? 83  LEU B CA    1 
ATOM   5928 C C     . LEU F 5 83  ? 60.069  29.380  92.782  1.00 24.38  ? 83  LEU B C     1 
ATOM   5929 O O     . LEU F 5 83  ? 59.865  29.628  93.968  1.00 24.38  ? 83  LEU B O     1 
ATOM   5930 C CB    . LEU F 5 83  ? 58.053  28.848  91.419  1.00 17.65  ? 83  LEU B CB    1 
ATOM   5931 C CG    . LEU F 5 83  ? 57.251  27.975  90.448  1.00 17.65  ? 83  LEU B CG    1 
ATOM   5932 C CD1   . LEU F 5 83  ? 56.311  28.863  89.648  1.00 17.65  ? 83  LEU B CD1   1 
ATOM   5933 C CD2   . LEU F 5 83  ? 58.186  27.215  89.519  1.00 17.65  ? 83  LEU B CD2   1 
ATOM   5934 N N     . ALA F 5 84  ? 60.945  30.052  92.044  1.00 36.78  ? 84  ALA B N     1 
ATOM   5935 C CA    . ALA F 5 84  ? 61.735  31.148  92.597  1.00 36.78  ? 84  ALA B CA    1 
ATOM   5936 C C     . ALA F 5 84  ? 60.848  32.365  92.836  1.00 36.78  ? 84  ALA B C     1 
ATOM   5937 O O     . ALA F 5 84  ? 59.757  32.466  92.275  1.00 36.78  ? 84  ALA B O     1 
ATOM   5938 C CB    . ALA F 5 84  ? 62.866  31.505  91.642  1.00 10.88  ? 84  ALA B CB    1 
ATOM   5939 N N     . VAL F 5 85  ? 61.314  33.289  93.666  1.00 20.22  ? 85  VAL B N     1 
ATOM   5940 C CA    . VAL F 5 85  ? 60.541  34.485  93.961  1.00 20.22  ? 85  VAL B CA    1 
ATOM   5941 C C     . VAL F 5 85  ? 60.385  35.379  92.733  1.00 20.22  ? 85  VAL B C     1 
ATOM   5942 O O     . VAL F 5 85  ? 59.334  35.987  92.522  1.00 20.22  ? 85  VAL B O     1 
ATOM   5943 C CB    . VAL F 5 85  ? 61.192  35.303  95.096  1.00 15.68  ? 85  VAL B CB    1 
ATOM   5944 C CG1   . VAL F 5 85  ? 60.464  36.622  95.275  1.00 15.68  ? 85  VAL B CG1   1 
ATOM   5945 C CG2   . VAL F 5 85  ? 61.160  34.507  96.391  1.00 15.68  ? 85  VAL B CG2   1 
ATOM   5946 N N     . LYS F 5 86  ? 61.431  35.455  91.919  1.00 34.02  ? 86  LYS B N     1 
ATOM   5947 C CA    . LYS F 5 86  ? 61.396  36.285  90.720  1.00 34.02  ? 86  LYS B CA    1 
ATOM   5948 C C     . LYS F 5 86  ? 60.384  35.792  89.692  1.00 34.02  ? 86  LYS B C     1 
ATOM   5949 O O     . LYS F 5 86  ? 59.822  36.585  88.936  1.00 34.02  ? 86  LYS B O     1 
ATOM   5950 C CB    . LYS F 5 86  ? 62.783  36.342  90.080  1.00 52.88  ? 86  LYS B CB    1 
ATOM   5951 C CG    . LYS F 5 86  ? 63.313  37.749  89.889  1.00 52.88  ? 86  LYS B CG    1 
ATOM   5952 C CD    . LYS F 5 86  ? 64.743  37.865  90.385  1.00 52.88  ? 86  LYS B CD    1 
ATOM   5953 C CE    . LYS F 5 86  ? 65.424  39.112  89.841  1.00 52.88  ? 86  LYS B CE    1 
ATOM   5954 N NZ    . LYS F 5 86  ? 66.842  39.209  90.295  1.00 52.88  ? 86  LYS B NZ    1 
ATOM   5955 N N     . THR F 5 87  ? 60.148  34.485  89.661  1.00 23.71  ? 87  THR B N     1 
ATOM   5956 C CA    . THR F 5 87  ? 59.204  33.916  88.707  1.00 23.71  ? 87  THR B CA    1 
ATOM   5957 C C     . THR F 5 87  ? 57.774  34.000  89.216  1.00 23.71  ? 87  THR B C     1 
ATOM   5958 O O     . THR F 5 87  ? 56.834  34.108  88.431  1.00 23.71  ? 87  THR B O     1 
ATOM   5959 C CB    . THR F 5 87  ? 59.535  32.448  88.392  1.00 28.13  ? 87  THR B CB    1 
ATOM   5960 O OG1   . THR F 5 87  ? 58.626  31.593  89.093  1.00 28.13  ? 87  THR B OG1   1 
ATOM   5961 C CG2   . THR F 5 87  ? 60.955  32.127  88.800  1.00 28.13  ? 87  THR B CG2   1 
ATOM   5962 N N     . ILE F 5 88  ? 57.607  33.939  90.532  1.00 16.95  ? 88  ILE B N     1 
ATOM   5963 C CA    . ILE F 5 88  ? 56.279  34.041  91.113  1.00 16.95  ? 88  ILE B CA    1 
ATOM   5964 C C     . ILE F 5 88  ? 55.793  35.453  90.815  1.00 16.95  ? 88  ILE B C     1 
ATOM   5965 O O     . ILE F 5 88  ? 54.619  35.672  90.526  1.00 16.95  ? 88  ILE B O     1 
ATOM   5966 C CB    . ILE F 5 88  ? 56.313  33.836  92.636  1.00 5.00   ? 88  ILE B CB    1 
ATOM   5967 C CG1   . ILE F 5 88  ? 56.378  32.340  92.956  1.00 5.00   ? 88  ILE B CG1   1 
ATOM   5968 C CG2   . ILE F 5 88  ? 55.076  34.457  93.271  1.00 5.00   ? 88  ILE B CG2   1 
ATOM   5969 C CD1   . ILE F 5 88  ? 57.228  32.007  94.163  1.00 5.00   ? 88  ILE B CD1   1 
ATOM   5970 N N     . GLN F 5 89  ? 56.717  36.406  90.882  1.00 17.41  ? 89  GLN B N     1 
ATOM   5971 C CA    . GLN F 5 89  ? 56.407  37.802  90.613  1.00 17.41  ? 89  GLN B CA    1 
ATOM   5972 C C     . GLN F 5 89  ? 56.051  37.991  89.143  1.00 17.41  ? 89  GLN B C     1 
ATOM   5973 O O     . GLN F 5 89  ? 55.269  38.876  88.795  1.00 17.41  ? 89  GLN B O     1 
ATOM   5974 C CB    . GLN F 5 89  ? 57.604  38.683  90.968  1.00 42.77  ? 89  GLN B CB    1 
ATOM   5975 C CG    . GLN F 5 89  ? 57.985  38.641  92.434  1.00 42.77  ? 89  GLN B CG    1 
ATOM   5976 C CD    . GLN F 5 89  ? 59.142  39.564  92.756  1.00 42.77  ? 89  GLN B CD    1 
ATOM   5977 O OE1   . GLN F 5 89  ? 60.143  39.594  92.040  1.00 42.77  ? 89  GLN B OE1   1 
ATOM   5978 N NE2   . GLN F 5 89  ? 59.010  40.326  93.840  1.00 42.77  ? 89  GLN B NE2   1 
ATOM   5979 N N     . GLN F 5 90  ? 56.635  37.163  88.281  1.00 19.58  ? 90  GLN B N     1 
ATOM   5980 C CA    . GLN F 5 90  ? 56.356  37.236  86.851  1.00 19.58  ? 90  GLN B CA    1 
ATOM   5981 C C     . GLN F 5 90  ? 54.909  36.824  86.617  1.00 19.58  ? 90  GLN B C     1 
ATOM   5982 O O     . GLN F 5 90  ? 54.168  37.496  85.899  1.00 19.58  ? 90  GLN B O     1 
ATOM   5983 C CB    . GLN F 5 90  ? 57.288  36.306  86.071  1.00 27.74  ? 90  GLN B CB    1 
ATOM   5984 C CG    . GLN F 5 90  ? 56.883  36.101  84.618  1.00 27.74  ? 90  GLN B CG    1 
ATOM   5985 C CD    . GLN F 5 90  ? 57.309  37.250  83.720  1.00 27.74  ? 90  GLN B CD    1 
ATOM   5986 O OE1   . GLN F 5 90  ? 56.485  37.867  83.048  1.00 27.74  ? 90  GLN B OE1   1 
ATOM   5987 N NE2   . GLN F 5 90  ? 58.603  37.541  83.704  1.00 27.74  ? 90  GLN B NE2   1 
ATOM   5988 N N     . HIS F 5 91  ? 54.518  35.713  87.234  1.00 31.32  ? 91  HIS B N     1 
ATOM   5989 C CA    . HIS F 5 91  ? 53.159  35.203  87.111  1.00 31.32  ? 91  HIS B CA    1 
ATOM   5990 C C     . HIS F 5 91  ? 52.156  36.245  87.598  1.00 31.32  ? 91  HIS B C     1 
ATOM   5991 O O     . HIS F 5 91  ? 51.040  36.330  87.087  1.00 31.32  ? 91  HIS B O     1 
ATOM   5992 C CB    . HIS F 5 91  ? 53.012  33.910  87.913  1.00 13.48  ? 91  HIS B CB    1 
ATOM   5993 C CG    . HIS F 5 91  ? 53.635  32.721  87.252  1.00 13.48  ? 91  HIS B CG    1 
ATOM   5994 N ND1   . HIS F 5 91  ? 52.902  31.630  86.837  1.00 13.48  ? 91  HIS B ND1   1 
ATOM   5995 C CD2   . HIS F 5 91  ? 54.921  32.456  86.923  1.00 13.48  ? 91  HIS B CD2   1 
ATOM   5996 C CE1   . HIS F 5 91  ? 53.708  30.744  86.281  1.00 13.48  ? 91  HIS B CE1   1 
ATOM   5997 N NE2   . HIS F 5 91  ? 54.939  31.221  86.320  1.00 13.48  ? 91  HIS B NE2   1 
ATOM   5998 N N     . LEU F 5 92  ? 52.558  37.037  88.587  1.00 31.64  ? 92  LEU B N     1 
ATOM   5999 C CA    . LEU F 5 92  ? 51.697  38.086  89.123  1.00 31.64  ? 92  LEU B CA    1 
ATOM   6000 C C     . LEU F 5 92  ? 51.731  39.272  88.166  1.00 31.64  ? 92  LEU B C     1 
ATOM   6001 O O     . LEU F 5 92  ? 50.718  39.933  87.937  1.00 31.64  ? 92  LEU B O     1 
ATOM   6002 C CB    . LEU F 5 92  ? 52.193  38.536  90.501  1.00 14.39  ? 92  LEU B CB    1 
ATOM   6003 C CG    . LEU F 5 92  ? 51.170  38.964  91.561  1.00 14.39  ? 92  LEU B CG    1 
ATOM   6004 C CD1   . LEU F 5 92  ? 51.730  40.126  92.359  1.00 14.39  ? 92  LEU B CD1   1 
ATOM   6005 C CD2   . LEU F 5 92  ? 49.858  39.356  90.910  1.00 14.39  ? 92  LEU B CD2   1 
ATOM   6006 N N     . GLY F 5 93  ? 52.908  39.525  87.604  1.00 25.13  ? 93  GLY B N     1 
ATOM   6007 C CA    . GLY F 5 93  ? 53.072  40.633  86.684  1.00 25.13  ? 93  GLY B CA    1 
ATOM   6008 C C     . GLY F 5 93  ? 52.207  40.514  85.447  1.00 25.13  ? 93  GLY B C     1 
ATOM   6009 O O     . GLY F 5 93  ? 51.576  41.486  85.028  1.00 25.13  ? 93  GLY B O     1 
ATOM   6010 N N     . GLN F 5 94  ? 52.172  39.326  84.854  1.00 21.33  ? 94  GLN B N     1 
ATOM   6011 C CA    . GLN F 5 94  ? 51.373  39.110  83.657  1.00 21.33  ? 94  GLN B CA    1 
ATOM   6012 C C     . GLN F 5 94  ? 49.891  39.232  83.994  1.00 21.33  ? 94  GLN B C     1 
ATOM   6013 O O     . GLN F 5 94  ? 49.121  39.825  83.240  1.00 21.33  ? 94  GLN B O     1 
ATOM   6014 C CB    . GLN F 5 94  ? 51.668  37.731  83.064  1.00 22.02  ? 94  GLN B CB    1 
ATOM   6015 C CG    . GLN F 5 94  ? 53.061  37.600  82.466  1.00 22.02  ? 94  GLN B CG    1 
ATOM   6016 C CD    . GLN F 5 94  ? 53.388  38.708  81.478  1.00 22.02  ? 94  GLN B CD    1 
ATOM   6017 O OE1   . GLN F 5 94  ? 52.563  39.072  80.638  1.00 22.02  ? 94  GLN B OE1   1 
ATOM   6018 N NE2   . GLN F 5 94  ? 54.595  39.250  81.577  1.00 22.02  ? 94  GLN B NE2   1 
ATOM   6019 N N     . LEU F 5 95  ? 49.502  38.678  85.138  1.00 20.49  ? 95  LEU B N     1 
ATOM   6020 C CA    . LEU F 5 95  ? 48.114  38.728  85.583  1.00 20.49  ? 95  LEU B CA    1 
ATOM   6021 C C     . LEU F 5 95  ? 47.666  40.178  85.736  1.00 20.49  ? 95  LEU B C     1 
ATOM   6022 O O     . LEU F 5 95  ? 46.542  40.533  85.385  1.00 20.49  ? 95  LEU B O     1 
ATOM   6023 C CB    . LEU F 5 95  ? 47.968  37.999  86.922  1.00 11.22  ? 95  LEU B CB    1 
ATOM   6024 C CG    . LEU F 5 95  ? 47.195  36.673  86.969  1.00 11.22  ? 95  LEU B CG    1 
ATOM   6025 C CD1   . LEU F 5 95  ? 47.108  36.046  85.589  1.00 11.22  ? 95  LEU B CD1   1 
ATOM   6026 C CD2   . LEU F 5 95  ? 47.892  35.730  87.935  1.00 11.22  ? 95  LEU B CD2   1 
ATOM   6027 N N     . ASN F 5 96  ? 48.558  41.012  86.262  1.00 19.79  ? 96  ASN B N     1 
ATOM   6028 C CA    . ASN F 5 96  ? 48.267  42.425  86.468  1.00 19.79  ? 96  ASN B CA    1 
ATOM   6029 C C     . ASN F 5 96  ? 48.096  43.155  85.137  1.00 19.79  ? 96  ASN B C     1 
ATOM   6030 O O     . ASN F 5 96  ? 47.183  43.966  84.971  1.00 19.79  ? 96  ASN B O     1 
ATOM   6031 C CB    . ASN F 5 96  ? 49.401  43.079  87.263  1.00 12.10  ? 96  ASN B CB    1 
ATOM   6032 C CG    . ASN F 5 96  ? 49.255  42.888  88.758  1.00 12.10  ? 96  ASN B CG    1 
ATOM   6033 O OD1   . ASN F 5 96  ? 48.164  42.637  89.261  1.00 12.10  ? 96  ASN B OD1   1 
ATOM   6034 N ND2   . ASN F 5 96  ? 50.360  43.012  89.478  1.00 12.10  ? 96  ASN B ND2   1 
ATOM   6035 N N     . MET F 5 97  ? 48.984  42.863  84.195  1.00 40.05  ? 97  MET B N     1 
ATOM   6036 C CA    . MET F 5 97  ? 48.946  43.491  82.882  1.00 40.05  ? 97  MET B CA    1 
ATOM   6037 C C     . MET F 5 97  ? 47.665  43.147  82.132  1.00 40.05  ? 97  MET B C     1 
ATOM   6038 O O     . MET F 5 97  ? 46.981  44.027  81.612  1.00 40.05  ? 97  MET B O     1 
ATOM   6039 C CB    . MET F 5 97  ? 50.158  43.046  82.057  1.00 30.44  ? 97  MET B CB    1 
ATOM   6040 C CG    . MET F 5 97  ? 50.494  43.965  80.896  1.00 30.44  ? 97  MET B CG    1 
ATOM   6041 S SD    . MET F 5 97  ? 50.658  43.062  79.346  1.00 30.44  ? 97  MET B SD    1 
ATOM   6042 C CE    . MET F 5 97  ? 52.414  42.816  79.283  1.00 30.44  ? 97  MET B CE    1 
ATOM   6043 N N     . LEU F 5 98  ? 47.342  41.860  82.086  1.00 20.38  ? 98  LEU B N     1 
ATOM   6044 C CA    . LEU F 5 98  ? 46.152  41.402  81.390  1.00 20.38  ? 98  LEU B CA    1 
ATOM   6045 C C     . LEU F 5 98  ? 44.899  42.068  81.927  1.00 20.38  ? 98  LEU B C     1 
ATOM   6046 O O     . LEU F 5 98  ? 43.922  42.230  81.201  1.00 20.38  ? 98  LEU B O     1 
ATOM   6047 C CB    . LEU F 5 98  ? 46.012  39.887  81.518  1.00 29.92  ? 98  LEU B CB    1 
ATOM   6048 C CG    . LEU F 5 98  ? 44.782  39.297  80.827  1.00 29.92  ? 98  LEU B CG    1 
ATOM   6049 C CD1   . LEU F 5 98  ? 44.962  39.378  79.320  1.00 29.92  ? 98  LEU B CD1   1 
ATOM   6050 C CD2   . LEU F 5 98  ? 44.580  37.859  81.275  1.00 29.92  ? 98  LEU B CD2   1 
ATOM   6051 N N     . HIS F 5 99  ? 44.925  42.457  83.197  1.00 15.17  ? 99  HIS B N     1 
ATOM   6052 C CA    . HIS F 5 99  ? 43.768  43.093  83.804  1.00 15.17  ? 99  HIS B CA    1 
ATOM   6053 C C     . HIS F 5 99  ? 43.794  44.606  83.650  1.00 15.17  ? 99  HIS B C     1 
ATOM   6054 O O     . HIS F 5 99  ? 42.745  45.229  83.489  1.00 15.17  ? 99  HIS B O     1 
ATOM   6055 C CB    . HIS F 5 99  ? 43.672  42.718  85.284  1.00 21.90  ? 99  HIS B CB    1 
ATOM   6056 C CG    . HIS F 5 99  ? 43.062  41.372  85.524  1.00 21.90  ? 99  HIS B CG    1 
ATOM   6057 N ND1   . HIS F 5 99  ? 43.708  40.178  85.294  1.00 21.90  ? 99  HIS B ND1   1 
ATOM   6058 C CD2   . HIS F 5 99  ? 41.828  41.038  85.980  1.00 21.90  ? 99  HIS B CD2   1 
ATOM   6059 C CE1   . HIS F 5 99  ? 42.869  39.179  85.609  1.00 21.90  ? 99  HIS B CE1   1 
ATOM   6060 N NE2   . HIS F 5 99  ? 41.711  39.649  86.031  1.00 21.90  ? 99  HIS B NE2   1 
ATOM   6061 N N     . ARG F 5 100 ? 44.983  45.200  83.700  1.00 12.18  ? 100 ARG B N     1 
ATOM   6062 C CA    . ARG F 5 100 ? 45.103  46.648  83.551  1.00 12.18  ? 100 ARG B CA    1 
ATOM   6063 C C     . ARG F 5 100 ? 44.883  47.034  82.098  1.00 12.18  ? 100 ARG B C     1 
ATOM   6064 O O     . ARG F 5 100 ? 44.129  47.956  81.793  1.00 12.18  ? 100 ARG B O     1 
ATOM   6065 C CB    . ARG F 5 100 ? 46.482  47.128  84.004  1.00 42.03  ? 100 ARG B CB    1 
ATOM   6066 C CG    . ARG F 5 100 ? 46.423  48.369  84.880  1.00 42.03  ? 100 ARG B CG    1 
ATOM   6067 C CD    . ARG F 5 100 ? 47.749  49.094  84.920  1.00 42.03  ? 100 ARG B CD    1 
ATOM   6068 N NE    . ARG F 5 100 ? 48.260  49.379  83.582  1.00 42.03  ? 100 ARG B NE    1 
ATOM   6069 C CZ    . ARG F 5 100 ? 49.137  50.341  83.306  1.00 42.03  ? 100 ARG B CZ    1 
ATOM   6070 N NH1   . ARG F 5 100 ? 49.605  51.117  84.275  1.00 42.03  ? 100 ARG B NH1   1 
ATOM   6071 N NH2   . ARG F 5 100 ? 49.551  50.526  82.060  1.00 42.03  ? 100 ARG B NH2   1 
ATOM   6072 N N     . ARG F 5 101 ? 45.552  46.316  81.205  1.00 20.45  ? 101 ARG B N     1 
ATOM   6073 C CA    . ARG F 5 101 ? 45.432  46.559  79.777  1.00 20.45  ? 101 ARG B CA    1 
ATOM   6074 C C     . ARG F 5 101 ? 44.066  46.095  79.282  1.00 20.45  ? 101 ARG B C     1 
ATOM   6075 O O     . ARG F 5 101 ? 43.791  46.112  78.090  1.00 20.45  ? 101 ARG B O     1 
ATOM   6076 C CB    . ARG F 5 101 ? 46.533  45.810  79.024  1.00 25.11  ? 101 ARG B CB    1 
ATOM   6077 C CG    . ARG F 5 101 ? 47.578  46.710  78.379  1.00 25.11  ? 101 ARG B CG    1 
ATOM   6078 C CD    . ARG F 5 101 ? 48.912  46.629  79.105  1.00 25.11  ? 101 ARG B CD    1 
ATOM   6079 N NE    . ARG F 5 101 ? 49.970  47.341  78.393  1.00 25.11  ? 101 ARG B NE    1 
ATOM   6080 C CZ    . ARG F 5 101 ? 49.958  48.648  78.157  1.00 25.11  ? 101 ARG B CZ    1 
ATOM   6081 N NH1   . ARG F 5 101 ? 48.944  49.389  78.574  1.00 25.11  ? 101 ARG B NH1   1 
ATOM   6082 N NH2   . ARG F 5 101 ? 50.960  49.216  77.506  1.00 25.11  ? 101 ARG B NH2   1 
ATOM   6083 N N     . SER F 5 102 ? 43.207  45.665  80.196  1.00 21.46  ? 102 SER B N     1 
ATOM   6084 C CA    . SER F 5 102 ? 41.882  45.217  79.807  1.00 21.46  ? 102 SER B CA    1 
ATOM   6085 C C     . SER F 5 102 ? 40.834  46.115  80.446  1.00 21.46  ? 102 SER B C     1 
ATOM   6086 O O     . SER F 5 102 ? 39.638  45.950  80.218  1.00 21.46  ? 102 SER B O     1 
ATOM   6087 C CB    . SER F 5 102 ? 41.662  43.764  80.232  1.00 41.10  ? 102 SER B CB    1 
ATOM   6088 O OG    . SER F 5 102 ? 40.741  43.688  81.301  1.00 41.10  ? 102 SER B OG    1 
ATOM   6089 N N     . GLY F 5 103 ? 41.293  47.063  81.254  1.00 38.47  ? 103 GLY B N     1 
ATOM   6090 C CA    . GLY F 5 103 ? 40.384  47.988  81.906  1.00 38.47  ? 103 GLY B CA    1 
ATOM   6091 C C     . GLY F 5 103 ? 39.896  47.561  83.277  1.00 38.47  ? 103 GLY B C     1 
ATOM   6092 O O     . GLY F 5 103 ? 39.312  48.363  84.006  1.00 38.47  ? 103 GLY B O     1 
ATOM   6093 N N     . LEU F 5 104 ? 40.129  46.303  83.634  1.00 23.40  ? 104 LEU B N     1 
ATOM   6094 C CA    . LEU F 5 104 ? 39.698  45.782  84.927  1.00 23.40  ? 104 LEU B CA    1 
ATOM   6095 C C     . LEU F 5 104 ? 40.739  46.040  86.012  1.00 23.40  ? 104 LEU B C     1 
ATOM   6096 O O     . LEU F 5 104 ? 41.891  46.346  85.713  1.00 23.40  ? 104 LEU B O     1 
ATOM   6097 C CB    . LEU F 5 104 ? 39.434  44.280  84.815  1.00 22.23  ? 104 LEU B CB    1 
ATOM   6098 C CG    . LEU F 5 104 ? 38.299  43.885  83.873  1.00 22.23  ? 104 LEU B CG    1 
ATOM   6099 C CD1   . LEU F 5 104 ? 38.388  42.403  83.557  1.00 22.23  ? 104 LEU B CD1   1 
ATOM   6100 C CD2   . LEU F 5 104 ? 36.965  44.220  84.518  1.00 22.23  ? 104 LEU B CD2   1 
ATOM   6101 N N     . PRO F 5 105 ? 40.340  45.937  87.290  1.00 31.07  ? 105 PRO B N     1 
ATOM   6102 C CA    . PRO F 5 105 ? 41.282  46.164  88.392  1.00 31.07  ? 105 PRO B CA    1 
ATOM   6103 C C     . PRO F 5 105 ? 42.289  45.025  88.485  1.00 31.07  ? 105 PRO B C     1 
ATOM   6104 O O     . PRO F 5 105 ? 41.930  43.856  88.343  1.00 31.07  ? 105 PRO B O     1 
ATOM   6105 C CB    . PRO F 5 105 ? 40.389  46.239  89.633  1.00 38.01  ? 105 PRO B CB    1 
ATOM   6106 C CG    . PRO F 5 105 ? 38.980  46.321  89.113  1.00 38.01  ? 105 PRO B CG    1 
ATOM   6107 C CD    . PRO F 5 105 ? 38.991  45.635  87.788  1.00 38.01  ? 105 PRO B CD    1 
ATOM   6108 N N     . ARG F 5 106 ? 43.548  45.371  88.726  1.00 22.04  ? 106 ARG B N     1 
ATOM   6109 C CA    . ARG F 5 106 ? 44.605  44.372  88.825  1.00 22.04  ? 106 ARG B CA    1 
ATOM   6110 C C     . ARG F 5 106 ? 44.505  43.598  90.127  1.00 22.04  ? 106 ARG B C     1 
ATOM   6111 O O     . ARG F 5 106 ? 44.080  44.135  91.147  1.00 22.04  ? 106 ARG B O     1 
ATOM   6112 C CB    . ARG F 5 106 ? 45.980  45.041  88.741  1.00 34.29  ? 106 ARG B CB    1 
ATOM   6113 C CG    . ARG F 5 106 ? 45.991  46.355  87.979  1.00 34.29  ? 106 ARG B CG    1 
ATOM   6114 C CD    . ARG F 5 106 ? 46.901  47.368  88.648  1.00 34.29  ? 106 ARG B CD    1 
ATOM   6115 N NE    . ARG F 5 106 ? 48.248  46.842  88.839  1.00 34.29  ? 106 ARG B NE    1 
ATOM   6116 C CZ    . ARG F 5 106 ? 48.960  47.000  89.951  1.00 34.29  ? 106 ARG B CZ    1 
ATOM   6117 N NH1   . ARG F 5 106 ? 48.455  47.670  90.979  1.00 34.29  ? 106 ARG B NH1   1 
ATOM   6118 N NH2   . ARG F 5 106 ? 50.179  46.489  90.035  1.00 34.29  ? 106 ARG B NH2   1 
ATOM   6119 N N     . PRO F 5 107 ? 44.882  42.312  90.107  1.00 24.91  ? 107 PRO B N     1 
ATOM   6120 C CA    . PRO F 5 107 ? 44.811  41.517  91.336  1.00 24.91  ? 107 PRO B CA    1 
ATOM   6121 C C     . PRO F 5 107 ? 45.642  42.152  92.447  1.00 24.91  ? 107 PRO B C     1 
ATOM   6122 O O     . PRO F 5 107 ? 45.258  42.131  93.616  1.00 24.91  ? 107 PRO B O     1 
ATOM   6123 C CB    . PRO F 5 107 ? 45.366  40.155  90.918  1.00 20.74  ? 107 PRO B CB    1 
ATOM   6124 C CG    . PRO F 5 107 ? 45.197  40.109  89.439  1.00 20.74  ? 107 PRO B CG    1 
ATOM   6125 C CD    . PRO F 5 107 ? 45.369  41.520  88.965  1.00 20.74  ? 107 PRO B CD    1 
ATOM   6126 N N     . SER F 5 108 ? 46.776  42.729  92.068  1.00 19.07  ? 108 SER B N     1 
ATOM   6127 C CA    . SER F 5 108 ? 47.669  43.358  93.029  1.00 19.07  ? 108 SER B CA    1 
ATOM   6128 C C     . SER F 5 108 ? 47.008  44.528  93.749  1.00 19.07  ? 108 SER B C     1 
ATOM   6129 O O     . SER F 5 108 ? 47.523  45.032  94.755  1.00 19.07  ? 108 SER B O     1 
ATOM   6130 C CB    . SER F 5 108 ? 48.939  43.839  92.332  1.00 36.29  ? 108 SER B CB    1 
ATOM   6131 O OG    . SER F 5 108 ? 50.008  42.942  92.593  1.00 36.29  ? 108 SER B OG    1 
ATOM   6132 N N     . ASP F 5 109 ? 45.877  44.946  93.235  1.00 31.94  ? 109 ASP B N     1 
ATOM   6133 C CA    . ASP F 5 109 ? 45.130  46.050  93.843  1.00 31.94  ? 109 ASP B CA    1 
ATOM   6134 C C     . ASP F 5 109 ? 44.365  45.540  95.066  1.00 31.94  ? 109 ASP B C     1 
ATOM   6135 O O     . ASP F 5 109 ? 43.508  46.238  95.620  1.00 31.94  ? 109 ASP B O     1 
ATOM   6136 C CB    . ASP F 5 109 ? 44.140  46.635  92.842  1.00 63.44  ? 109 ASP B CB    1 
ATOM   6137 C CG    . ASP F 5 109 ? 44.825  47.396  91.711  1.00 63.44  ? 109 ASP B CG    1 
ATOM   6138 O OD1   . ASP F 5 109 ? 45.950  47.987  91.923  1.00 63.44  ? 109 ASP B OD1   1 
ATOM   6139 O OD2   . ASP F 5 109 ? 44.276  47.443  90.547  1.00 63.44  ? 109 ASP B OD2   1 
ATOM   6140 N N     . SER F 5 110 ? 44.698  44.323  95.461  1.00 22.27  ? 110 SER B N     1 
ATOM   6141 C CA    . SER F 5 110 ? 44.055  43.664  96.612  1.00 22.27  ? 110 SER B CA    1 
ATOM   6142 C C     . SER F 5 110 ? 45.080  43.371  97.709  1.00 22.27  ? 110 SER B C     1 
ATOM   6143 O O     . SER F 5 110 ? 46.217  42.968  97.433  1.00 22.27  ? 110 SER B O     1 
ATOM   6144 C CB    . SER F 5 110 ? 43.421  42.342  96.173  1.00 43.63  ? 110 SER B CB    1 
ATOM   6145 O OG    . SER F 5 110 ? 42.019  42.379  96.391  1.00 43.63  ? 110 SER B OG    1 
ATOM   6146 N N     . ASN F 5 111 ? 44.641  43.583  98.936  1.00 14.81  ? 111 ASN B N     1 
ATOM   6147 C CA    . ASN F 5 111 ? 45.471  43.342  100.124 1.00 14.81  ? 111 ASN B CA    1 
ATOM   6148 C C     . ASN F 5 111 ? 45.935  41.890  100.133 1.00 14.81  ? 111 ASN B C     1 
ATOM   6149 O O     . ASN F 5 111 ? 47.084  41.597  100.438 1.00 14.81  ? 111 ASN B O     1 
ATOM   6150 C CB    . ASN F 5 111 ? 44.662  43.609  101.389 1.00 24.96  ? 111 ASN B CB    1 
ATOM   6151 C CG    . ASN F 5 111 ? 45.085  44.888  102.104 1.00 24.96  ? 111 ASN B CG    1 
ATOM   6152 O OD1   . ASN F 5 111 ? 45.896  45.647  101.576 1.00 24.96  ? 111 ASN B OD1   1 
ATOM   6153 N ND2   . ASN F 5 111 ? 44.577  45.173  103.287 1.00 24.96  ? 111 ASN B ND2   1 
ATOM   6154 N N     . ALA F 5 112 ? 45.023  40.985  99.798  1.00 19.88  ? 112 ALA B N     1 
ATOM   6155 C CA    . ALA F 5 112 ? 45.325  39.561  99.777  1.00 19.88  ? 112 ALA B CA    1 
ATOM   6156 C C     . ALA F 5 112 ? 46.551  39.253  98.928  1.00 19.88  ? 112 ALA B C     1 
ATOM   6157 O O     . ALA F 5 112 ? 47.522  38.675  99.413  1.00 19.88  ? 112 ALA B O     1 
ATOM   6158 C CB    . ALA F 5 112 ? 44.121  38.784  99.256  1.00 7.56   ? 112 ALA B CB    1 
ATOM   6159 N N     . VAL F 5 113 ? 46.499  39.638  97.657  1.00 16.31  ? 113 VAL B N     1 
ATOM   6160 C CA    . VAL F 5 113 ? 47.602  39.399  96.734  1.00 16.31  ? 113 VAL B CA    1 
ATOM   6161 C C     . VAL F 5 113 ? 48.848  40.193  97.107  1.00 16.31  ? 113 VAL B C     1 
ATOM   6162 O O     . VAL F 5 113 ? 49.947  39.642  97.208  1.00 16.31  ? 113 VAL B O     1 
ATOM   6163 C CB    . VAL F 5 113 ? 47.203  39.772  95.296  1.00 5.58   ? 113 VAL B CB    1 
ATOM   6164 C CG1   . VAL F 5 113 ? 48.327  39.426  94.340  1.00 5.58   ? 113 VAL B CG1   1 
ATOM   6165 C CG2   . VAL F 5 113 ? 45.927  39.042  94.910  1.00 5.58   ? 113 VAL B CG2   1 
ATOM   6166 N N     . SER F 5 114 ? 48.668  41.492  97.310  1.00 19.26  ? 114 SER B N     1 
ATOM   6167 C CA    . SER F 5 114 ? 49.772  42.374  97.656  1.00 19.26  ? 114 SER B CA    1 
ATOM   6168 C C     . SER F 5 114 ? 50.528  41.899  98.893  1.00 19.26  ? 114 SER B C     1 
ATOM   6169 O O     . SER F 5 114 ? 51.754  41.960  98.936  1.00 19.26  ? 114 SER B O     1 
ATOM   6170 C CB    . SER F 5 114 ? 49.251  43.799  97.873  1.00 37.90  ? 114 SER B CB    1 
ATOM   6171 O OG    . SER F 5 114 ? 48.945  44.037  99.236  1.00 37.90  ? 114 SER B OG    1 
ATOM   6172 N N     . LEU F 5 115 ? 49.797  41.422  99.895  1.00 16.27  ? 115 LEU B N     1 
ATOM   6173 C CA    . LEU F 5 115 ? 50.413  40.947  101.130 1.00 16.27  ? 115 LEU B CA    1 
ATOM   6174 C C     . LEU F 5 115 ? 51.034  39.562  100.986 1.00 16.27  ? 115 LEU B C     1 
ATOM   6175 O O     . LEU F 5 115 ? 52.112  39.306  101.515 1.00 16.27  ? 115 LEU B O     1 
ATOM   6176 C CB    . LEU F 5 115 ? 49.387  40.926  102.263 1.00 17.39  ? 115 LEU B CB    1 
ATOM   6177 C CG    . LEU F 5 115 ? 48.853  42.273  102.752 1.00 17.39  ? 115 LEU B CG    1 
ATOM   6178 C CD1   . LEU F 5 115 ? 47.909  42.039  103.918 1.00 17.39  ? 115 LEU B CD1   1 
ATOM   6179 C CD2   . LEU F 5 115 ? 50.001  43.178  103.166 1.00 17.39  ? 115 LEU B CD2   1 
ATOM   6180 N N     . VAL F 5 116 ? 50.361  38.663  100.277 1.00 19.19  ? 116 VAL B N     1 
ATOM   6181 C CA    . VAL F 5 116 ? 50.903  37.322  100.103 1.00 19.19  ? 116 VAL B CA    1 
ATOM   6182 C C     . VAL F 5 116 ? 52.200  37.350  99.306  1.00 19.19  ? 116 VAL B C     1 
ATOM   6183 O O     . VAL F 5 116 ? 53.071  36.503  99.501  1.00 19.19  ? 116 VAL B O     1 
ATOM   6184 C CB    . VAL F 5 116 ? 49.907  36.383  99.387  1.00 21.49  ? 116 VAL B CB    1 
ATOM   6185 C CG1   . VAL F 5 116 ? 49.822  36.730  97.912  1.00 21.49  ? 116 VAL B CG1   1 
ATOM   6186 C CG2   . VAL F 5 116 ? 50.350  34.941  99.563  1.00 21.49  ? 116 VAL B CG2   1 
ATOM   6187 N N     . MET F 5 117 ? 52.328  38.322  98.409  1.00 13.64  ? 117 MET B N     1 
ATOM   6188 C CA    . MET F 5 117 ? 53.531  38.436  97.596  1.00 13.64  ? 117 MET B CA    1 
ATOM   6189 C C     . MET F 5 117 ? 54.694  38.910  98.456  1.00 13.64  ? 117 MET B C     1 
ATOM   6190 O O     . MET F 5 117 ? 55.825  38.463  98.281  1.00 13.64  ? 117 MET B O     1 
ATOM   6191 C CB    . MET F 5 117 ? 53.303  39.408  96.439  1.00 27.55  ? 117 MET B CB    1 
ATOM   6192 C CG    . MET F 5 117 ? 54.448  39.449  95.437  1.00 27.55  ? 117 MET B CG    1 
ATOM   6193 S SD    . MET F 5 117 ? 54.682  37.899  94.531  1.00 27.55  ? 117 MET B SD    1 
ATOM   6194 C CE    . MET F 5 117 ? 56.139  37.250  95.347  1.00 27.55  ? 117 MET B CE    1 
ATOM   6195 N N     . ARG F 5 118 ? 54.416  39.822  99.383  1.00 15.12  ? 118 ARG B N     1 
ATOM   6196 C CA    . ARG F 5 118 ? 55.445  40.330  100.286 1.00 15.12  ? 118 ARG B CA    1 
ATOM   6197 C C     . ARG F 5 118 ? 55.862  39.189  101.209 1.00 15.12  ? 118 ARG B C     1 
ATOM   6198 O O     . ARG F 5 118 ? 57.044  39.004  101.495 1.00 15.12  ? 118 ARG B O     1 
ATOM   6199 C CB    . ARG F 5 118 ? 54.898  41.489  101.123 1.00 28.71  ? 118 ARG B CB    1 
ATOM   6200 C CG    . ARG F 5 118 ? 55.609  42.815  100.914 1.00 28.71  ? 118 ARG B CG    1 
ATOM   6201 C CD    . ARG F 5 118 ? 55.413  43.744  102.107 1.00 28.71  ? 118 ARG B CD    1 
ATOM   6202 N NE    . ARG F 5 118 ? 56.448  43.536  103.115 1.00 28.71  ? 118 ARG B NE    1 
ATOM   6203 C CZ    . ARG F 5 118 ? 57.452  44.376  103.340 1.00 28.71  ? 118 ARG B CZ    1 
ATOM   6204 N NH1   . ARG F 5 118 ? 57.561  45.492  102.633 1.00 28.71  ? 118 ARG B NH1   1 
ATOM   6205 N NH2   . ARG F 5 118 ? 58.358  44.091  104.267 1.00 28.71  ? 118 ARG B NH2   1 
ATOM   6206 N N     . ARG F 5 119 ? 54.878  38.424  101.669 1.00 23.81  ? 119 ARG B N     1 
ATOM   6207 C CA    . ARG F 5 119 ? 55.138  37.302  102.560 1.00 23.81  ? 119 ARG B CA    1 
ATOM   6208 C C     . ARG F 5 119 ? 56.026  36.277  101.873 1.00 23.81  ? 119 ARG B C     1 
ATOM   6209 O O     . ARG F 5 119 ? 57.114  35.965  102.353 1.00 23.81  ? 119 ARG B O     1 
ATOM   6210 C CB    . ARG F 5 119 ? 53.825  36.646  102.977 1.00 29.92  ? 119 ARG B CB    1 
ATOM   6211 C CG    . ARG F 5 119 ? 54.006  35.384  103.793 1.00 29.92  ? 119 ARG B CG    1 
ATOM   6212 C CD    . ARG F 5 119 ? 52.843  34.441  103.584 1.00 29.92  ? 119 ARG B CD    1 
ATOM   6213 N NE    . ARG F 5 119 ? 52.445  33.776  104.818 1.00 29.92  ? 119 ARG B NE    1 
ATOM   6214 C CZ    . ARG F 5 119 ? 51.289  33.141  104.980 1.00 29.92  ? 119 ARG B CZ    1 
ATOM   6215 N NH1   . ARG F 5 119 ? 50.417  33.086  103.981 1.00 29.92  ? 119 ARG B NH1   1 
ATOM   6216 N NH2   . ARG F 5 119 ? 51.003  32.560  106.138 1.00 29.92  ? 119 ARG B NH2   1 
ATOM   6217 N N     . ILE F 5 120 ? 55.556  35.751  100.747 1.00 26.75  ? 120 ILE B N     1 
ATOM   6218 C CA    . ILE F 5 120 ? 56.322  34.766  99.997  1.00 26.75  ? 120 ILE B CA    1 
ATOM   6219 C C     . ILE F 5 120 ? 57.759  35.242  99.796  1.00 26.75  ? 120 ILE B C     1 
ATOM   6220 O O     . ILE F 5 120 ? 58.705  34.468  99.956  1.00 26.75  ? 120 ILE B O     1 
ATOM   6221 C CB    . ILE F 5 120 ? 55.679  34.495  98.622  1.00 18.33  ? 120 ILE B CB    1 
ATOM   6222 C CG1   . ILE F 5 120 ? 54.375  33.714  98.808  1.00 18.33  ? 120 ILE B CG1   1 
ATOM   6223 C CG2   . ILE F 5 120 ? 56.640  33.709  97.740  1.00 18.33  ? 120 ILE B CG2   1 
ATOM   6224 C CD1   . ILE F 5 120 ? 53.443  33.795  97.627  1.00 18.33  ? 120 ILE B CD1   1 
ATOM   6225 N N     . ARG F 5 121 ? 57.924  36.514  99.448  1.00 24.12  ? 121 ARG B N     1 
ATOM   6226 C CA    . ARG F 5 121 ? 59.257  37.067  99.246  1.00 24.12  ? 121 ARG B CA    1 
ATOM   6227 C C     . ARG F 5 121 ? 60.081  36.888  100.519 1.00 24.12  ? 121 ARG B C     1 
ATOM   6228 O O     . ARG F 5 121 ? 61.203  36.392  100.473 1.00 24.12  ? 121 ARG B O     1 
ATOM   6229 C CB    . ARG F 5 121 ? 59.176  38.554  98.888  1.00 48.97  ? 121 ARG B CB    1 
ATOM   6230 C CG    . ARG F 5 121 ? 60.501  39.148  98.436  1.00 48.97  ? 121 ARG B CG    1 
ATOM   6231 C CD    . ARG F 5 121 ? 60.359  40.610  98.042  1.00 48.97  ? 121 ARG B CD    1 
ATOM   6232 N NE    . ARG F 5 121 ? 59.061  40.897  97.439  1.00 48.97  ? 121 ARG B NE    1 
ATOM   6233 C CZ    . ARG F 5 121 ? 58.451  42.077  97.502  1.00 48.97  ? 121 ARG B CZ    1 
ATOM   6234 N NH1   . ARG F 5 121 ? 59.019  43.091  98.141  1.00 48.97  ? 121 ARG B NH1   1 
ATOM   6235 N NH2   . ARG F 5 121 ? 57.264  42.243  96.929  1.00 48.97  ? 121 ARG B NH2   1 
ATOM   6236 N N     . LYS F 5 122 ? 59.513  37.288  101.653 1.00 20.11  ? 122 LYS B N     1 
ATOM   6237 C CA    . LYS F 5 122 ? 60.194  37.170  102.937 1.00 20.11  ? 122 LYS B CA    1 
ATOM   6238 C C     . LYS F 5 122 ? 60.535  35.716  103.231 1.00 20.11  ? 122 LYS B C     1 
ATOM   6239 O O     . LYS F 5 122 ? 61.696  35.324  103.193 1.00 20.11  ? 122 LYS B O     1 
ATOM   6240 C CB    . LYS F 5 122 ? 59.312  37.723  104.058 1.00 27.04  ? 122 LYS B CB    1 
ATOM   6241 C CG    . LYS F 5 122 ? 59.523  39.198  104.352 1.00 27.04  ? 122 LYS B CG    1 
ATOM   6242 C CD    . LYS F 5 122 ? 59.123  39.542  105.779 1.00 27.04  ? 122 LYS B CD    1 
ATOM   6243 C CE    . LYS F 5 122 ? 60.283  39.337  106.743 1.00 27.04  ? 122 LYS B CE    1 
ATOM   6244 N NZ    . LYS F 5 122 ? 60.958  40.618  107.100 1.00 27.04  ? 122 LYS B NZ    1 
ATOM   6245 N N     . GLU F 5 123 ? 59.511  34.922  103.523 1.00 35.42  ? 123 GLU B N     1 
ATOM   6246 C CA    . GLU F 5 123 ? 59.685  33.507  103.831 1.00 35.42  ? 123 GLU B CA    1 
ATOM   6247 C C     . GLU F 5 123 ? 60.756  32.835  102.978 1.00 35.42  ? 123 GLU B C     1 
ATOM   6248 O O     . GLU F 5 123 ? 61.642  32.161  103.500 1.00 35.42  ? 123 GLU B O     1 
ATOM   6249 C CB    . GLU F 5 123 ? 58.359  32.762  103.656 1.00 64.84  ? 123 GLU B CB    1 
ATOM   6250 C CG    . GLU F 5 123 ? 57.159  33.460  104.271 1.00 64.84  ? 123 GLU B CG    1 
ATOM   6251 C CD    . GLU F 5 123 ? 55.949  32.551  104.381 1.00 64.84  ? 123 GLU B CD    1 
ATOM   6252 O OE1   . GLU F 5 123 ? 55.734  31.725  103.466 1.00 64.84  ? 123 GLU B OE1   1 
ATOM   6253 O OE2   . GLU F 5 123 ? 55.210  32.661  105.383 1.00 64.84  ? 123 GLU B OE2   1 
ATOM   6254 N N     . ASN F 5 124 ? 60.677  33.019  101.666 1.00 28.71  ? 124 ASN B N     1 
ATOM   6255 C CA    . ASN F 5 124 ? 61.646  32.405  100.768 1.00 28.71  ? 124 ASN B CA    1 
ATOM   6256 C C     . ASN F 5 124 ? 63.052  32.941  101.034 1.00 28.71  ? 124 ASN B C     1 
ATOM   6257 O O     . ASN F 5 124 ? 63.998  32.172  101.252 1.00 28.71  ? 124 ASN B O     1 
ATOM   6258 C CB    . ASN F 5 124 ? 61.257  32.664  99.312  1.00 19.94  ? 124 ASN B CB    1 
ATOM   6259 C CG    . ASN F 5 124 ? 60.254  31.650  98.772  1.00 19.94  ? 124 ASN B CG    1 
ATOM   6260 O OD1   . ASN F 5 124 ? 59.396  31.181  99.518  1.00 19.94  ? 124 ASN B OD1   1 
ATOM   6261 N ND2   . ASN F 5 124 ? 60.313  31.281  97.508  1.00 19.94  ? 124 ASN B ND2   1 
ATOM   6262 N N     . VAL F 5 125 ? 63.164  34.252  101.014 1.00 35.55  ? 125 VAL B N     1 
ATOM   6263 C CA    . VAL F 5 125 ? 64.451  34.924  101.231 1.00 35.55  ? 125 VAL B CA    1 
ATOM   6264 C C     . VAL F 5 125 ? 65.070  34.492  102.563 1.00 35.55  ? 125 VAL B C     1 
ATOM   6265 O O     . VAL F 5 125 ? 66.230  34.065  102.621 1.00 35.55  ? 125 VAL B O     1 
ATOM   6266 C CB    . VAL F 5 125 ? 64.272  36.437  101.241 1.00 28.64  ? 125 VAL B CB    1 
ATOM   6267 C CG1   . VAL F 5 125 ? 65.485  37.168  101.820 1.00 28.64  ? 125 VAL B CG1   1 
ATOM   6268 C CG2   . VAL F 5 125 ? 64.060  37.011  99.840  1.00 28.64  ? 125 VAL B CG2   1 
ATOM   6269 N N     . ASP F 5 126 ? 64.282  34.614  103.612 1.00 73.51  ? 126 ASP B N     1 
ATOM   6270 C CA    . ASP F 5 126 ? 64.726  34.247  104.963 1.00 73.51  ? 126 ASP B CA    1 
ATOM   6271 C C     . ASP F 5 126 ? 65.116  32.770  105.000 1.00 73.51  ? 126 ASP B C     1 
ATOM   6272 O O     . ASP F 5 126 ? 65.953  32.348  105.808 1.00 73.51  ? 126 ASP B O     1 
ATOM   6273 C CB    . ASP F 5 126 ? 63.612  34.501  105.972 1.00 86.10  ? 126 ASP B CB    1 
ATOM   6274 C CG    . ASP F 5 126 ? 63.385  35.987  106.223 1.00 86.10  ? 126 ASP B CG    1 
ATOM   6275 O OD1   . ASP F 5 126 ? 64.061  36.859  105.557 1.00 86.10  ? 126 ASP B OD1   1 
ATOM   6276 O OD2   . ASP F 5 126 ? 62.520  36.366  107.097 1.00 86.10  ? 126 ASP B OD2   1 
ATOM   6277 N N     . ALA F 5 127 ? 64.494  32.015  104.116 1.00 34.20  ? 127 ALA B N     1 
ATOM   6278 C CA    . ALA F 5 127 ? 64.748  30.574  104.006 1.00 34.20  ? 127 ALA B CA    1 
ATOM   6279 C C     . ALA F 5 127 ? 66.121  30.335  103.376 1.00 34.20  ? 127 ALA B C     1 
ATOM   6280 O O     . ALA F 5 127 ? 66.607  29.199  103.305 1.00 34.20  ? 127 ALA B O     1 
ATOM   6281 C CB    . ALA F 5 127 ? 63.676  29.909  103.151 1.00 25.24  ? 127 ALA B CB    1 
ATOM   6282 N N     . GLY F 5 128 ? 66.719  31.418  102.913 1.00 52.66  ? 128 GLY B N     1 
ATOM   6283 C CA    . GLY F 5 128 ? 68.064  31.366  102.330 1.00 52.66  ? 128 GLY B CA    1 
ATOM   6284 C C     . GLY F 5 128 ? 68.075  31.677  100.846 1.00 52.66  ? 128 GLY B C     1 
ATOM   6285 O O     . GLY F 5 128 ? 69.114  32.040  100.293 1.00 52.66  ? 128 GLY B O     1 
ATOM   6286 N N     . GLU F 5 129 ? 66.921  31.539  100.200 1.00 34.72  ? 129 GLU B N     1 
ATOM   6287 C CA    . GLU F 5 129 ? 66.814  31.795  98.768  1.00 34.72  ? 129 GLU B CA    1 
ATOM   6288 C C     . GLU F 5 129 ? 67.462  33.108  98.355  1.00 34.72  ? 129 GLU B C     1 
ATOM   6289 O O     . GLU F 5 129 ? 67.452  34.088  99.098  1.00 34.72  ? 129 GLU B O     1 
ATOM   6290 C CB    . GLU F 5 129 ? 65.347  31.794  98.328  1.00 58.69  ? 129 GLU B CB    1 
ATOM   6291 C CG    . GLU F 5 129 ? 65.101  31.082  97.003  1.00 58.69  ? 129 GLU B CG    1 
ATOM   6292 C CD    . GLU F 5 129 ? 64.089  31.796  96.120  1.00 58.69  ? 129 GLU B CD    1 
ATOM   6293 O OE1   . GLU F 5 129 ? 64.502  32.653  95.310  1.00 58.69  ? 129 GLU B OE1   1 
ATOM   6294 O OE2   . GLU F 5 129 ? 62.881  31.497  96.230  1.00 58.69  ? 129 GLU B OE2   1 
ATOM   6295 N N     . ARG F 5 130 ? 68.038  33.113  97.160  1.00 57.10  ? 130 ARG B N     1 
ATOM   6296 C CA    . ARG F 5 130 ? 68.687  34.300  96.630  1.00 57.10  ? 130 ARG B CA    1 
ATOM   6297 C C     . ARG F 5 130 ? 68.784  34.196  95.113  1.00 57.10  ? 130 ARG B C     1 
ATOM   6298 O O     . ARG F 5 130 ? 68.811  33.099  94.557  1.00 57.10  ? 130 ARG B O     1 
ATOM   6299 C CB    . ARG F 5 130 ? 70.085  34.457  97.232  1.00 100.00 ? 130 ARG B CB    1 
ATOM   6300 C CG    . ARG F 5 130 ? 70.869  35.626  96.657  1.00 100.00 ? 130 ARG B CG    1 
ATOM   6301 C CD    . ARG F 5 130 ? 72.159  35.875  97.418  1.00 100.00 ? 130 ARG B CD    1 
ATOM   6302 N NE    . ARG F 5 130 ? 73.256  36.228  96.519  1.00 100.00 ? 130 ARG B NE    1 
ATOM   6303 C CZ    . ARG F 5 130 ? 74.255  35.411  96.198  1.00 100.00 ? 130 ARG B CZ    1 
ATOM   6304 N NH1   . ARG F 5 130 ? 74.305  34.184  96.702  1.00 100.00 ? 130 ARG B NH1   1 
ATOM   6305 N NH2   . ARG F 5 130 ? 75.207  35.820  95.368  1.00 100.00 ? 130 ARG B NH2   1 
ATOM   6306 N N     . ALA F 5 131 ? 68.824  35.344  94.446  1.00 38.38  ? 131 ALA B N     1 
ATOM   6307 C CA    . ALA F 5 131 ? 68.920  35.367  92.994  1.00 38.38  ? 131 ALA B CA    1 
ATOM   6308 C C     . ALA F 5 131 ? 70.282  34.834  92.569  1.00 38.38  ? 131 ALA B C     1 
ATOM   6309 O O     . ALA F 5 131 ? 71.265  34.970  93.297  1.00 38.38  ? 131 ALA B O     1 
ATOM   6310 C CB    . ALA F 5 131 ? 68.727  36.789  92.479  1.00 43.35  ? 131 ALA B CB    1 
ATOM   6311 N N     . LYS F 5 132 ? 70.332  34.218  91.393  1.00 27.00  ? 132 LYS B N     1 
ATOM   6312 C CA    . LYS F 5 132 ? 71.578  33.677  90.871  1.00 27.00  ? 132 LYS B CA    1 
ATOM   6313 C C     . LYS F 5 132 ? 72.042  34.536  89.707  1.00 27.00  ? 132 LYS B C     1 
ATOM   6314 O O     . LYS F 5 132 ? 71.254  35.267  89.115  1.00 27.00  ? 132 LYS B O     1 
ATOM   6315 C CB    . LYS F 5 132 ? 71.377  32.238  90.393  1.00 51.58  ? 132 LYS B CB    1 
ATOM   6316 C CG    . LYS F 5 132 ? 70.951  31.275  91.488  1.00 51.58  ? 132 LYS B CG    1 
ATOM   6317 C CD    . LYS F 5 132 ? 70.729  29.876  90.938  1.00 51.58  ? 132 LYS B CD    1 
ATOM   6318 C CE    . LYS F 5 132 ? 71.751  28.898  91.495  1.00 51.58  ? 132 LYS B CE    1 
ATOM   6319 N NZ    . LYS F 5 132 ? 72.625  28.331  90.428  1.00 51.58  ? 132 LYS B NZ    1 
ATOM   6320 N N     . GLN F 5 133 ? 73.327  34.458  89.392  1.00 40.85  ? 133 GLN B N     1 
ATOM   6321 C CA    . GLN F 5 133 ? 73.873  35.221  88.283  1.00 40.85  ? 133 GLN B CA    1 
ATOM   6322 C C     . GLN F 5 133 ? 74.784  34.325  87.455  1.00 40.85  ? 133 GLN B C     1 
ATOM   6323 O O     . GLN F 5 133 ? 75.396  33.389  87.971  1.00 40.85  ? 133 GLN B O     1 
ATOM   6324 C CB    . GLN F 5 133 ? 74.636  36.444  88.796  1.00 83.71  ? 133 GLN B CB    1 
ATOM   6325 C CG    . GLN F 5 133 ? 76.062  36.172  89.230  1.00 83.71  ? 133 GLN B CG    1 
ATOM   6326 C CD    . GLN F 5 133 ? 76.695  37.371  89.911  1.00 83.71  ? 133 GLN B CD    1 
ATOM   6327 O OE1   . GLN F 5 133 ? 77.883  37.361  90.228  1.00 83.71  ? 133 GLN B OE1   1 
ATOM   6328 N NE2   . GLN F 5 133 ? 75.899  38.410  90.143  1.00 83.71  ? 133 GLN B NE2   1 
ATOM   6329 N N     . ALA F 5 134 ? 74.856  34.614  86.163  1.00 25.96  ? 134 ALA B N     1 
ATOM   6330 C CA    . ALA F 5 134 ? 75.664  33.834  85.243  1.00 25.96  ? 134 ALA B CA    1 
ATOM   6331 C C     . ALA F 5 134 ? 77.104  33.635  85.692  1.00 25.96  ? 134 ALA B C     1 
ATOM   6332 O O     . ALA F 5 134 ? 77.746  34.551  86.205  1.00 25.96  ? 134 ALA B O     1 
ATOM   6333 C CB    . ALA F 5 134 ? 75.636  34.480  83.863  1.00 46.97  ? 134 ALA B CB    1 
ATOM   6334 N N     . LEU F 5 135 ? 77.592  32.414  85.505  1.00 25.24  ? 135 LEU B N     1 
ATOM   6335 C CA    . LEU F 5 135 ? 78.962  32.062  85.834  1.00 25.24  ? 135 LEU B CA    1 
ATOM   6336 C C     . LEU F 5 135 ? 79.838  33.035  85.053  1.00 25.24  ? 135 LEU B C     1 
ATOM   6337 O O     . LEU F 5 135 ? 79.700  33.162  83.837  1.00 25.24  ? 135 LEU B O     1 
ATOM   6338 C CB    . LEU F 5 135 ? 79.235  30.629  85.388  1.00 21.38  ? 135 LEU B CB    1 
ATOM   6339 C CG    . LEU F 5 135 ? 80.624  30.043  85.620  1.00 21.38  ? 135 LEU B CG    1 
ATOM   6340 C CD1   . LEU F 5 135 ? 80.899  29.938  87.112  1.00 21.38  ? 135 LEU B CD1   1 
ATOM   6341 C CD2   . LEU F 5 135 ? 80.698  28.674  84.959  1.00 21.38  ? 135 LEU B CD2   1 
ATOM   6342 N N     . ALA F 5 136 ? 80.734  33.720  85.751  1.00 16.14  ? 136 ALA B N     1 
ATOM   6343 C CA    . ALA F 5 136 ? 81.601  34.705  85.121  1.00 16.14  ? 136 ALA B CA    1 
ATOM   6344 C C     . ALA F 5 136 ? 82.578  34.165  84.079  1.00 16.14  ? 136 ALA B C     1 
ATOM   6345 O O     . ALA F 5 136 ? 83.065  33.038  84.178  1.00 16.14  ? 136 ALA B O     1 
ATOM   6346 C CB    . ALA F 5 136 ? 82.365  35.469  86.190  1.00 33.63  ? 136 ALA B CB    1 
ATOM   6347 N N     . PHE F 5 137 ? 82.847  34.997  83.075  1.00 20.90  ? 137 PHE B N     1 
ATOM   6348 C CA    . PHE F 5 137 ? 83.780  34.688  81.996  1.00 20.90  ? 137 PHE B CA    1 
ATOM   6349 C C     . PHE F 5 137 ? 84.708  35.904  81.934  1.00 20.90  ? 137 PHE B C     1 
ATOM   6350 O O     . PHE F 5 137 ? 84.437  36.878  81.229  1.00 20.90  ? 137 PHE B O     1 
ATOM   6351 C CB    . PHE F 5 137 ? 83.019  34.511  80.674  1.00 11.09  ? 137 PHE B CB    1 
ATOM   6352 C CG    . PHE F 5 137 ? 83.904  34.216  79.486  1.00 11.09  ? 137 PHE B CG    1 
ATOM   6353 C CD1   . PHE F 5 137 ? 84.434  32.945  79.289  1.00 11.09  ? 137 PHE B CD1   1 
ATOM   6354 C CD2   . PHE F 5 137 ? 84.197  35.210  78.556  1.00 11.09  ? 137 PHE B CD2   1 
ATOM   6355 C CE1   . PHE F 5 137 ? 85.241  32.671  78.181  1.00 11.09  ? 137 PHE B CE1   1 
ATOM   6356 C CE2   . PHE F 5 137 ? 85.001  34.945  77.450  1.00 11.09  ? 137 PHE B CE2   1 
ATOM   6357 C CZ    . PHE F 5 137 ? 85.524  33.674  77.263  1.00 11.09  ? 137 PHE B CZ    1 
ATOM   6358 N N     . GLU F 5 138 ? 85.797  35.845  82.693  1.00 13.99  ? 138 GLU B N     1 
ATOM   6359 C CA    . GLU F 5 138 ? 86.748  36.947  82.762  1.00 13.99  ? 138 GLU B CA    1 
ATOM   6360 C C     . GLU F 5 138 ? 87.871  36.866  81.743  1.00 13.99  ? 138 GLU B C     1 
ATOM   6361 O O     . GLU F 5 138 ? 87.869  36.012  80.857  1.00 13.99  ? 138 GLU B O     1 
ATOM   6362 C CB    . GLU F 5 138 ? 87.349  37.040  84.168  1.00 65.23  ? 138 GLU B CB    1 
ATOM   6363 C CG    . GLU F 5 138 ? 87.091  35.827  85.047  1.00 65.23  ? 138 GLU B CG    1 
ATOM   6364 C CD    . GLU F 5 138 ? 86.541  36.198  86.412  1.00 65.23  ? 138 GLU B CD    1 
ATOM   6365 O OE1   . GLU F 5 138 ? 85.503  36.891  86.470  1.00 65.23  ? 138 GLU B OE1   1 
ATOM   6366 O OE2   . GLU F 5 138 ? 87.146  35.795  87.427  1.00 65.23  ? 138 GLU B OE2   1 
ATOM   6367 N N     . ARG F 5 139 ? 88.831  37.773  81.889  1.00 33.99  ? 139 ARG B N     1 
ATOM   6368 C CA    . ARG F 5 139 ? 89.980  37.858  81.000  1.00 33.99  ? 139 ARG B CA    1 
ATOM   6369 C C     . ARG F 5 139 ? 90.732  36.544  80.899  1.00 33.99  ? 139 ARG B C     1 
ATOM   6370 O O     . ARG F 5 139 ? 90.971  36.043  79.804  1.00 33.99  ? 139 ARG B O     1 
ATOM   6371 C CB    . ARG F 5 139 ? 90.937  38.946  81.486  1.00 43.81  ? 139 ARG B CB    1 
ATOM   6372 C CG    . ARG F 5 139 ? 91.357  39.935  80.410  1.00 43.81  ? 139 ARG B CG    1 
ATOM   6373 C CD    . ARG F 5 139 ? 92.050  39.242  79.247  1.00 43.81  ? 139 ARG B CD    1 
ATOM   6374 N NE    . ARG F 5 139 ? 93.443  39.657  79.104  1.00 43.81  ? 139 ARG B NE    1 
ATOM   6375 C CZ    . ARG F 5 139 ? 93.839  40.919  78.975  1.00 43.81  ? 139 ARG B CZ    1 
ATOM   6376 N NH1   . ARG F 5 139 ? 92.948  41.902  78.968  1.00 43.81  ? 139 ARG B NH1   1 
ATOM   6377 N NH2   . ARG F 5 139 ? 95.129  41.201  78.851  1.00 43.81  ? 139 ARG B NH2   1 
ATOM   6378 N N     . THR F 5 140 ? 91.113  35.995  82.046  1.00 12.46  ? 140 THR B N     1 
ATOM   6379 C CA    . THR F 5 140 ? 91.848  34.737  82.072  1.00 12.46  ? 140 THR B CA    1 
ATOM   6380 C C     . THR F 5 140 ? 91.169  33.691  81.193  1.00 12.46  ? 140 THR B C     1 
ATOM   6381 O O     . THR F 5 140 ? 91.824  32.998  80.417  1.00 12.46  ? 140 THR B O     1 
ATOM   6382 C CB    . THR F 5 140 ? 91.962  34.196  83.507  1.00 18.55  ? 140 THR B CB    1 
ATOM   6383 O OG1   . THR F 5 140 ? 92.736  35.106  84.296  1.00 18.55  ? 140 THR B OG1   1 
ATOM   6384 C CG2   . THR F 5 140 ? 92.641  32.838  83.510  1.00 18.55  ? 140 THR B CG2   1 
ATOM   6385 N N     . ASP F 5 141 ? 89.850  33.593  81.306  1.00 28.98  ? 141 ASP B N     1 
ATOM   6386 C CA    . ASP F 5 141 ? 89.095  32.632  80.518  1.00 28.98  ? 141 ASP B CA    1 
ATOM   6387 C C     . ASP F 5 141 ? 89.234  32.916  79.034  1.00 28.98  ? 141 ASP B C     1 
ATOM   6388 O O     . ASP F 5 141 ? 89.550  32.024  78.250  1.00 28.98  ? 141 ASP B O     1 
ATOM   6389 C CB    . ASP F 5 141 ? 87.624  32.675  80.910  1.00 26.37  ? 141 ASP B CB    1 
ATOM   6390 C CG    . ASP F 5 141 ? 87.425  32.511  82.392  1.00 26.37  ? 141 ASP B CG    1 
ATOM   6391 O OD1   . ASP F 5 141 ? 87.710  31.411  82.908  1.00 26.37  ? 141 ASP B OD1   1 
ATOM   6392 O OD2   . ASP F 5 141 ? 86.993  33.480  83.045  1.00 26.37  ? 141 ASP B OD2   1 
ATOM   6393 N N     . PHE F 5 142 ? 88.995  34.165  78.651  1.00 24.44  ? 142 PHE B N     1 
ATOM   6394 C CA    . PHE F 5 142 ? 89.098  34.556  77.252  1.00 24.44  ? 142 PHE B CA    1 
ATOM   6395 C C     . PHE F 5 142 ? 90.492  34.274  76.707  1.00 24.44  ? 142 PHE B C     1 
ATOM   6396 O O     . PHE F 5 142 ? 90.641  33.692  75.634  1.00 24.44  ? 142 PHE B O     1 
ATOM   6397 C CB    . PHE F 5 142 ? 88.776  36.042  77.090  1.00 25.17  ? 142 PHE B CB    1 
ATOM   6398 C CG    . PHE F 5 142 ? 88.924  36.540  75.683  1.00 25.17  ? 142 PHE B CG    1 
ATOM   6399 C CD1   . PHE F 5 142 ? 88.308  35.872  74.630  1.00 25.17  ? 142 PHE B CD1   1 
ATOM   6400 C CD2   . PHE F 5 142 ? 89.692  37.664  75.406  1.00 25.17  ? 142 PHE B CD2   1 
ATOM   6401 C CE1   . PHE F 5 142 ? 88.458  36.315  73.317  1.00 25.17  ? 142 PHE B CE1   1 
ATOM   6402 C CE2   . PHE F 5 142 ? 89.850  38.117  74.096  1.00 25.17  ? 142 PHE B CE2   1 
ATOM   6403 C CZ    . PHE F 5 142 ? 89.232  37.441  73.050  1.00 25.17  ? 142 PHE B CZ    1 
ATOM   6404 N N     . ASP F 5 143 ? 91.512  34.678  77.457  1.00 22.74  ? 143 ASP B N     1 
ATOM   6405 C CA    . ASP F 5 143 ? 92.897  34.479  77.044  1.00 22.74  ? 143 ASP B CA    1 
ATOM   6406 C C     . ASP F 5 143 ? 93.221  32.997  76.910  1.00 22.74  ? 143 ASP B C     1 
ATOM   6407 O O     . ASP F 5 143 ? 93.994  32.602  76.041  1.00 22.74  ? 143 ASP B O     1 
ATOM   6408 C CB    . ASP F 5 143 ? 93.846  35.128  78.053  1.00 45.70  ? 143 ASP B CB    1 
ATOM   6409 C CG    . ASP F 5 143 ? 94.025  36.616  77.814  1.00 45.70  ? 143 ASP B CG    1 
ATOM   6410 O OD1   . ASP F 5 143 ? 93.120  37.240  77.220  1.00 45.70  ? 143 ASP B OD1   1 
ATOM   6411 O OD2   . ASP F 5 143 ? 95.071  37.163  78.219  1.00 45.70  ? 143 ASP B OD2   1 
ATOM   6412 N N     . GLN F 5 144 ? 92.623  32.181  77.774  1.00 26.34  ? 144 GLN B N     1 
ATOM   6413 C CA    . GLN F 5 144 ? 92.849  30.741  77.752  1.00 26.34  ? 144 GLN B CA    1 
ATOM   6414 C C     . GLN F 5 144 ? 92.163  30.093  76.555  1.00 26.34  ? 144 GLN B C     1 
ATOM   6415 O O     . GLN F 5 144 ? 92.783  29.320  75.822  1.00 26.34  ? 144 GLN B O     1 
ATOM   6416 C CB    . GLN F 5 144 ? 92.349  30.109  79.056  1.00 24.98  ? 144 GLN B CB    1 
ATOM   6417 C CG    . GLN F 5 144 ? 93.251  30.401  80.252  1.00 24.98  ? 144 GLN B CG    1 
ATOM   6418 C CD    . GLN F 5 144 ? 92.748  29.801  81.557  1.00 24.98  ? 144 GLN B CD    1 
ATOM   6419 O OE1   . GLN F 5 144 ? 93.382  29.951  82.601  1.00 24.98  ? 144 GLN B OE1   1 
ATOM   6420 N NE2   . GLN F 5 144 ? 91.608  29.121  81.503  1.00 24.98  ? 144 GLN B NE2   1 
ATOM   6421 N N     . VAL F 5 145 ? 90.886  30.406  76.358  1.00 21.77  ? 145 VAL B N     1 
ATOM   6422 C CA    . VAL F 5 145 ? 90.140  29.852  75.235  1.00 21.77  ? 145 VAL B CA    1 
ATOM   6423 C C     . VAL F 5 145 ? 90.792  30.276  73.929  1.00 21.77  ? 145 VAL B C     1 
ATOM   6424 O O     . VAL F 5 145 ? 90.918  29.481  73.001  1.00 21.77  ? 145 VAL B O     1 
ATOM   6425 C CB    . VAL F 5 145 ? 88.681  30.335  75.227  1.00 18.76  ? 145 VAL B CB    1 
ATOM   6426 C CG1   . VAL F 5 145 ? 87.997  29.887  73.942  1.00 18.76  ? 145 VAL B CG1   1 
ATOM   6427 C CG2   . VAL F 5 145 ? 87.948  29.790  76.444  1.00 18.76  ? 145 VAL B CG2   1 
ATOM   6428 N N     . ARG F 5 146 ? 91.200  31.537  73.861  1.00 29.37  ? 146 ARG B N     1 
ATOM   6429 C CA    . ARG F 5 146 ? 91.845  32.064  72.667  1.00 29.37  ? 146 ARG B CA    1 
ATOM   6430 C C     . ARG F 5 146 ? 93.124  31.279  72.379  1.00 29.37  ? 146 ARG B C     1 
ATOM   6431 O O     . ARG F 5 146 ? 93.349  30.830  71.256  1.00 29.37  ? 146 ARG B O     1 
ATOM   6432 C CB    . ARG F 5 146 ? 92.173  33.548  72.861  1.00 33.16  ? 146 ARG B CB    1 
ATOM   6433 C CG    . ARG F 5 146 ? 92.945  34.171  71.713  1.00 33.16  ? 146 ARG B CG    1 
ATOM   6434 C CD    . ARG F 5 146 ? 92.684  35.667  71.614  1.00 33.16  ? 146 ARG B CD    1 
ATOM   6435 N NE    . ARG F 5 146 ? 93.222  36.400  72.757  1.00 33.16  ? 146 ARG B NE    1 
ATOM   6436 C CZ    . ARG F 5 146 ? 93.570  37.683  72.724  1.00 33.16  ? 146 ARG B CZ    1 
ATOM   6437 N NH1   . ARG F 5 146 ? 93.441  38.380  71.603  1.00 33.16  ? 146 ARG B NH1   1 
ATOM   6438 N NH2   . ARG F 5 146 ? 94.050  38.269  73.810  1.00 33.16  ? 146 ARG B NH2   1 
ATOM   6439 N N     . SER F 5 147 ? 93.950  31.109  73.406  1.00 21.92  ? 147 SER B N     1 
ATOM   6440 C CA    . SER F 5 147 ? 95.212  30.384  73.280  1.00 21.92  ? 147 SER B CA    1 
ATOM   6441 C C     . SER F 5 147 ? 95.020  28.958  72.788  1.00 21.92  ? 147 SER B C     1 
ATOM   6442 O O     . SER F 5 147 ? 95.975  28.310  72.361  1.00 21.92  ? 147 SER B O     1 
ATOM   6443 C CB    . SER F 5 147 ? 95.930  30.341  74.629  1.00 21.53  ? 147 SER B CB    1 
ATOM   6444 O OG    . SER F 5 147 ? 95.589  29.160  75.338  1.00 21.53  ? 147 SER B OG    1 
ATOM   6445 N N     . LEU F 5 148 ? 93.784  28.474  72.848  1.00 30.69  ? 148 LEU B N     1 
ATOM   6446 C CA    . LEU F 5 148 ? 93.479  27.113  72.427  1.00 30.69  ? 148 LEU B CA    1 
ATOM   6447 C C     . LEU F 5 148 ? 92.799  27.018  71.061  1.00 30.69  ? 148 LEU B C     1 
ATOM   6448 O O     . LEU F 5 148 ? 93.011  26.055  70.326  1.00 30.69  ? 148 LEU B O     1 
ATOM   6449 C CB    . LEU F 5 148 ? 92.593  26.438  73.475  1.00 29.33  ? 148 LEU B CB    1 
ATOM   6450 C CG    . LEU F 5 148 ? 93.295  25.714  74.623  1.00 29.33  ? 148 LEU B CG    1 
ATOM   6451 C CD1   . LEU F 5 148 ? 92.306  25.481  75.752  1.00 29.33  ? 148 LEU B CD1   1 
ATOM   6452 C CD2   . LEU F 5 148 ? 93.862  24.393  74.129  1.00 29.33  ? 148 LEU B CD2   1 
ATOM   6453 N N     . MET F 5 149 ? 91.983  28.012  70.722  1.00 28.10  ? 149 MET B N     1 
ATOM   6454 C CA    . MET F 5 149 ? 91.263  28.002  69.452  1.00 28.10  ? 149 MET B CA    1 
ATOM   6455 C C     . MET F 5 149 ? 91.880  28.877  68.370  1.00 28.10  ? 149 MET B C     1 
ATOM   6456 O O     . MET F 5 149 ? 91.555  28.731  67.194  1.00 28.10  ? 149 MET B O     1 
ATOM   6457 C CB    . MET F 5 149 ? 89.812  28.435  69.670  1.00 58.65  ? 149 MET B CB    1 
ATOM   6458 C CG    . MET F 5 149 ? 88.959  27.424  70.412  1.00 58.65  ? 149 MET B CG    1 
ATOM   6459 S SD    . MET F 5 149 ? 87.425  28.148  71.028  1.00 58.65  ? 149 MET B SD    1 
ATOM   6460 C CE    . MET F 5 149 ? 86.311  27.829  69.644  1.00 58.65  ? 149 MET B CE    1 
ATOM   6461 N N     . GLU F 5 150 ? 92.764  29.787  68.762  1.00 23.45  ? 150 GLU B N     1 
ATOM   6462 C CA    . GLU F 5 150 ? 93.400  30.684  67.804  1.00 23.45  ? 150 GLU B CA    1 
ATOM   6463 C C     . GLU F 5 150 ? 94.224  29.911  66.786  1.00 23.45  ? 150 GLU B C     1 
ATOM   6464 O O     . GLU F 5 150 ? 94.581  30.436  65.728  1.00 23.45  ? 150 GLU B O     1 
ATOM   6465 C CB    . GLU F 5 150 ? 94.292  31.688  68.533  1.00 36.33  ? 150 GLU B CB    1 
ATOM   6466 C CG    . GLU F 5 150 ? 95.671  31.162  68.885  1.00 36.33  ? 150 GLU B CG    1 
ATOM   6467 C CD    . GLU F 5 150 ? 96.495  32.180  69.645  1.00 36.33  ? 150 GLU B CD    1 
ATOM   6468 O OE1   . GLU F 5 150 ? 96.435  33.377  69.291  1.00 36.33  ? 150 GLU B OE1   1 
ATOM   6469 O OE2   . GLU F 5 150 ? 97.201  31.785  70.596  1.00 36.33  ? 150 GLU B OE2   1 
ATOM   6470 N N     . ASN F 5 151 ? 94.518  28.659  67.116  1.00 51.59  ? 151 ASN B N     1 
ATOM   6471 C CA    . ASN F 5 151 ? 95.309  27.800  66.250  1.00 51.59  ? 151 ASN B CA    1 
ATOM   6472 C C     . ASN F 5 151 ? 94.451  26.988  65.288  1.00 51.59  ? 151 ASN B C     1 
ATOM   6473 O O     . ASN F 5 151 ? 94.954  26.445  64.306  1.00 51.59  ? 151 ASN B O     1 
ATOM   6474 C CB    . ASN F 5 151 ? 96.165  26.864  67.104  1.00 56.24  ? 151 ASN B CB    1 
ATOM   6475 C CG    . ASN F 5 151 ? 97.258  27.600  67.850  1.00 56.24  ? 151 ASN B CG    1 
ATOM   6476 O OD1   . ASN F 5 151 ? 97.907  28.490  67.302  1.00 56.24  ? 151 ASN B OD1   1 
ATOM   6477 N ND2   . ASN F 5 151 ? 97.464  27.236  69.109  1.00 56.24  ? 151 ASN B ND2   1 
ATOM   6478 N N     . SER F 5 152 ? 93.155  26.914  65.568  1.00 33.07  ? 152 SER B N     1 
ATOM   6479 C CA    . SER F 5 152 ? 92.234  26.164  64.723  1.00 33.07  ? 152 SER B CA    1 
ATOM   6480 C C     . SER F 5 152 ? 91.913  26.910  63.432  1.00 33.07  ? 152 SER B C     1 
ATOM   6481 O O     . SER F 5 152 ? 91.846  28.137  63.412  1.00 33.07  ? 152 SER B O     1 
ATOM   6482 C CB    . SER F 5 152 ? 90.937  25.877  65.481  1.00 34.92  ? 152 SER B CB    1 
ATOM   6483 O OG    . SER F 5 152 ? 89.982  25.272  64.629  1.00 34.92  ? 152 SER B OG    1 
ATOM   6484 N N     . ASP F 5 153 ? 91.723  26.159  62.353  1.00 34.05  ? 153 ASP B N     1 
ATOM   6485 C CA    . ASP F 5 153 ? 91.408  26.745  61.057  1.00 34.05  ? 153 ASP B CA    1 
ATOM   6486 C C     . ASP F 5 153 ? 89.946  26.489  60.721  1.00 34.05  ? 153 ASP B C     1 
ATOM   6487 O O     . ASP F 5 153 ? 89.420  27.010  59.737  1.00 34.05  ? 153 ASP B O     1 
ATOM   6488 C CB    . ASP F 5 153 ? 92.306  26.146  59.975  1.00 96.25  ? 153 ASP B CB    1 
ATOM   6489 C CG    . ASP F 5 153 ? 93.719  26.686  60.030  1.00 96.25  ? 153 ASP B CG    1 
ATOM   6490 O OD1   . ASP F 5 153 ? 93.885  27.923  59.968  1.00 96.25  ? 153 ASP B OD1   1 
ATOM   6491 O OD2   . ASP F 5 153 ? 94.665  25.877  60.137  1.00 96.25  ? 153 ASP B OD2   1 
ATOM   6492 N N     . ARG F 5 154 ? 89.298  25.677  61.548  1.00 20.88  ? 154 ARG B N     1 
ATOM   6493 C CA    . ARG F 5 154 ? 87.892  25.353  61.362  1.00 20.88  ? 154 ARG B CA    1 
ATOM   6494 C C     . ARG F 5 154 ? 87.085  26.639  61.404  1.00 20.88  ? 154 ARG B C     1 
ATOM   6495 O O     . ARG F 5 154 ? 87.380  27.536  62.190  1.00 20.88  ? 154 ARG B O     1 
ATOM   6496 C CB    . ARG F 5 154 ? 87.414  24.420  62.475  1.00 44.92  ? 154 ARG B CB    1 
ATOM   6497 C CG    . ARG F 5 154 ? 87.852  22.980  62.311  1.00 44.92  ? 154 ARG B CG    1 
ATOM   6498 C CD    . ARG F 5 154 ? 87.343  22.126  63.454  1.00 44.92  ? 154 ARG B CD    1 
ATOM   6499 N NE    . ARG F 5 154 ? 85.934  22.383  63.743  1.00 44.92  ? 154 ARG B NE    1 
ATOM   6500 C CZ    . ARG F 5 154 ? 85.421  22.424  64.969  1.00 44.92  ? 154 ARG B CZ    1 
ATOM   6501 N NH1   . ARG F 5 154 ? 86.200  22.225  66.023  1.00 44.92  ? 154 ARG B NH1   1 
ATOM   6502 N NH2   . ARG F 5 154 ? 84.126  22.657  65.142  1.00 44.92  ? 154 ARG B NH2   1 
ATOM   6503 N N     . CYS F 5 155 ? 86.069  26.731  60.556  1.00 28.72  ? 155 CYS B N     1 
ATOM   6504 C CA    . CYS F 5 155 ? 85.229  27.921  60.520  1.00 28.72  ? 155 CYS B CA    1 
ATOM   6505 C C     . CYS F 5 155 ? 84.460  28.070  61.830  1.00 28.72  ? 155 CYS B C     1 
ATOM   6506 O O     . CYS F 5 155 ? 84.309  29.175  62.348  1.00 28.72  ? 155 CYS B O     1 
ATOM   6507 C CB    . CYS F 5 155 ? 84.248  27.840  59.350  1.00 46.27  ? 155 CYS B CB    1 
ATOM   6508 S SG    . CYS F 5 155 ? 83.748  29.445  58.690  1.00 46.27  ? 155 CYS B SG    1 
ATOM   6509 N N     . GLN F 5 156 ? 83.981  26.952  62.365  1.00 26.30  ? 156 GLN B N     1 
ATOM   6510 C CA    . GLN F 5 156 ? 83.232  26.963  63.616  1.00 26.30  ? 156 GLN B CA    1 
ATOM   6511 C C     . GLN F 5 156 ? 84.095  27.531  64.735  1.00 26.30  ? 156 GLN B C     1 
ATOM   6512 O O     . GLN F 5 156 ? 83.638  28.347  65.534  1.00 26.30  ? 156 GLN B O     1 
ATOM   6513 C CB    . GLN F 5 156 ? 82.785  25.545  63.979  1.00 45.46  ? 156 GLN B CB    1 
ATOM   6514 C CG    . GLN F 5 156 ? 82.337  25.384  65.422  1.00 45.46  ? 156 GLN B CG    1 
ATOM   6515 C CD    . GLN F 5 156 ? 80.829  25.364  65.568  1.00 45.46  ? 156 GLN B CD    1 
ATOM   6516 O OE1   . GLN F 5 156 ? 80.273  25.983  66.476  1.00 45.46  ? 156 GLN B OE1   1 
ATOM   6517 N NE2   . GLN F 5 156 ? 80.155  24.647  64.672  1.00 45.46  ? 156 GLN B NE2   1 
ATOM   6518 N N     . ASP F 5 157 ? 85.348  27.092  64.784  1.00 26.37  ? 157 ASP B N     1 
ATOM   6519 C CA    . ASP F 5 157 ? 86.283  27.556  65.800  1.00 26.37  ? 157 ASP B CA    1 
ATOM   6520 C C     . ASP F 5 157 ? 86.617  29.029  65.599  1.00 26.37  ? 157 ASP B C     1 
ATOM   6521 O O     . ASP F 5 157 ? 86.742  29.783  66.562  1.00 26.37  ? 157 ASP B O     1 
ATOM   6522 C CB    . ASP F 5 157 ? 87.564  26.720  65.754  1.00 52.94  ? 157 ASP B CB    1 
ATOM   6523 C CG    . ASP F 5 157 ? 87.374  25.336  66.338  1.00 52.94  ? 157 ASP B CG    1 
ATOM   6524 O OD1   . ASP F 5 157 ? 86.737  25.228  67.407  1.00 52.94  ? 157 ASP B OD1   1 
ATOM   6525 O OD2   . ASP F 5 157 ? 87.857  24.357  65.733  1.00 52.94  ? 157 ASP B OD2   1 
ATOM   6526 N N     . ILE F 5 158 ? 86.750  29.436  64.342  1.00 36.21  ? 158 ILE B N     1 
ATOM   6527 C CA    . ILE F 5 158 ? 87.069  30.820  64.020  1.00 36.21  ? 158 ILE B CA    1 
ATOM   6528 C C     . ILE F 5 158 ? 85.921  31.762  64.371  1.00 36.21  ? 158 ILE B C     1 
ATOM   6529 O O     . ILE F 5 158 ? 86.144  32.929  64.688  1.00 36.21  ? 158 ILE B O     1 
ATOM   6530 C CB    . ILE F 5 158 ? 87.413  30.973  62.522  1.00 20.95  ? 158 ILE B CB    1 
ATOM   6531 C CG1   . ILE F 5 158 ? 88.698  30.205  62.209  1.00 20.95  ? 158 ILE B CG1   1 
ATOM   6532 C CG2   . ILE F 5 158 ? 87.590  32.444  62.169  1.00 20.95  ? 158 ILE B CG2   1 
ATOM   6533 C CD1   . ILE F 5 158 ? 89.119  30.274  60.762  1.00 20.95  ? 158 ILE B CD1   1 
ATOM   6534 N N     . ARG F 5 159 ? 84.693  31.255  64.317  1.00 33.02  ? 159 ARG B N     1 
ATOM   6535 C CA    . ARG F 5 159 ? 83.528  32.070  64.637  1.00 33.02  ? 159 ARG B CA    1 
ATOM   6536 C C     . ARG F 5 159 ? 83.314  32.179  66.135  1.00 33.02  ? 159 ARG B C     1 
ATOM   6537 O O     . ARG F 5 159 ? 83.112  33.269  66.667  1.00 33.02  ? 159 ARG B O     1 
ATOM   6538 C CB    . ARG F 5 159 ? 82.268  31.482  64.013  1.00 17.91  ? 159 ARG B CB    1 
ATOM   6539 C CG    . ARG F 5 159 ? 81.046  32.356  64.224  1.00 17.91  ? 159 ARG B CG    1 
ATOM   6540 C CD    . ARG F 5 159 ? 79.764  31.572  64.042  1.00 17.91  ? 159 ARG B CD    1 
ATOM   6541 N NE    . ARG F 5 159 ? 79.758  30.351  64.839  1.00 17.91  ? 159 ARG B NE    1 
ATOM   6542 C CZ    . ARG F 5 159 ? 78.775  29.458  64.811  1.00 17.91  ? 159 ARG B CZ    1 
ATOM   6543 N NH1   . ARG F 5 159 ? 77.725  29.661  64.029  1.00 17.91  ? 159 ARG B NH1   1 
ATOM   6544 N NH2   . ARG F 5 159 ? 78.835  28.369  65.567  1.00 17.91  ? 159 ARG B NH2   1 
ATOM   6545 N N     . ASN F 5 160 ? 83.349  31.037  66.809  1.00 22.58  ? 160 ASN B N     1 
ATOM   6546 C CA    . ASN F 5 160 ? 83.153  31.002  68.248  1.00 22.58  ? 160 ASN B CA    1 
ATOM   6547 C C     . ASN F 5 160 ? 84.168  31.865  68.979  1.00 22.58  ? 160 ASN B C     1 
ATOM   6548 O O     . ASN F 5 160 ? 83.836  32.510  69.970  1.00 22.58  ? 160 ASN B O     1 
ATOM   6549 C CB    . ASN F 5 160 ? 83.234  29.564  68.742  1.00 18.25  ? 160 ASN B CB    1 
ATOM   6550 C CG    . ASN F 5 160 ? 82.151  28.692  68.146  1.00 18.25  ? 160 ASN B CG    1 
ATOM   6551 O OD1   . ASN F 5 160 ? 81.400  29.127  67.271  1.00 18.25  ? 160 ASN B OD1   1 
ATOM   6552 N ND2   . ASN F 5 160 ? 82.062  27.454  68.616  1.00 18.25  ? 160 ASN B ND2   1 
ATOM   6553 N N     . LEU F 5 161 ? 85.401  31.889  68.488  1.00 15.61  ? 161 LEU B N     1 
ATOM   6554 C CA    . LEU F 5 161 ? 86.439  32.686  69.123  1.00 15.61  ? 161 LEU B CA    1 
ATOM   6555 C C     . LEU F 5 161 ? 86.229  34.181  68.903  1.00 15.61  ? 161 LEU B C     1 
ATOM   6556 O O     . LEU F 5 161 ? 86.533  34.991  69.775  1.00 15.61  ? 161 LEU B O     1 
ATOM   6557 C CB    . LEU F 5 161 ? 87.818  32.277  68.603  1.00 19.92  ? 161 LEU B CB    1 
ATOM   6558 C CG    . LEU F 5 161 ? 89.025  32.944  69.271  1.00 19.92  ? 161 LEU B CG    1 
ATOM   6559 C CD1   . LEU F 5 161 ? 88.796  33.055  70.772  1.00 19.92  ? 161 LEU B CD1   1 
ATOM   6560 C CD2   . LEU F 5 161 ? 90.277  32.134  68.981  1.00 19.92  ? 161 LEU B CD2   1 
ATOM   6561 N N     . ALA F 5 162 ? 85.714  34.549  67.736  1.00 25.10  ? 162 ALA B N     1 
ATOM   6562 C CA    . ALA F 5 162 ? 85.471  35.956  67.437  1.00 25.10  ? 162 ALA B CA    1 
ATOM   6563 C C     . ALA F 5 162 ? 84.255  36.433  68.217  1.00 25.10  ? 162 ALA B C     1 
ATOM   6564 O O     . ALA F 5 162 ? 84.188  37.585  68.647  1.00 25.10  ? 162 ALA B O     1 
ATOM   6565 C CB    . ALA F 5 162 ? 85.241  36.146  65.948  1.00 5.00   ? 162 ALA B CB    1 
ATOM   6566 N N     . PHE F 5 163 ? 83.295  35.534  68.400  1.00 29.32  ? 163 PHE B N     1 
ATOM   6567 C CA    . PHE F 5 163 ? 82.082  35.858  69.133  1.00 29.32  ? 163 PHE B CA    1 
ATOM   6568 C C     . PHE F 5 163 ? 82.407  36.133  70.601  1.00 29.32  ? 163 PHE B C     1 
ATOM   6569 O O     . PHE F 5 163 ? 82.029  37.171  71.143  1.00 29.32  ? 163 PHE B O     1 
ATOM   6570 C CB    . PHE F 5 163 ? 81.087  34.706  69.019  1.00 16.92  ? 163 PHE B CB    1 
ATOM   6571 C CG    . PHE F 5 163 ? 80.019  34.726  70.068  1.00 16.92  ? 163 PHE B CG    1 
ATOM   6572 C CD1   . PHE F 5 163 ? 78.998  35.667  70.019  1.00 16.92  ? 163 PHE B CD1   1 
ATOM   6573 C CD2   . PHE F 5 163 ? 80.033  33.803  71.110  1.00 16.92  ? 163 PHE B CD2   1 
ATOM   6574 C CE1   . PHE F 5 163 ? 78.007  35.689  70.992  1.00 16.92  ? 163 PHE B CE1   1 
ATOM   6575 C CE2   . PHE F 5 163 ? 79.047  33.817  72.088  1.00 16.92  ? 163 PHE B CE2   1 
ATOM   6576 C CZ    . PHE F 5 163 ? 78.031  34.763  72.029  1.00 16.92  ? 163 PHE B CZ    1 
ATOM   6577 N N     . LEU F 5 164 ? 83.107  35.196  71.237  1.00 31.18  ? 164 LEU B N     1 
ATOM   6578 C CA    . LEU F 5 164 ? 83.497  35.344  72.634  1.00 31.18  ? 164 LEU B CA    1 
ATOM   6579 C C     . LEU F 5 164 ? 84.324  36.611  72.830  1.00 31.18  ? 164 LEU B C     1 
ATOM   6580 O O     . LEU F 5 164 ? 84.203  37.290  73.850  1.00 31.18  ? 164 LEU B O     1 
ATOM   6581 C CB    . LEU F 5 164 ? 84.305  34.128  73.086  1.00 12.04  ? 164 LEU B CB    1 
ATOM   6582 C CG    . LEU F 5 164 ? 83.558  32.796  73.005  1.00 12.04  ? 164 LEU B CG    1 
ATOM   6583 C CD1   . LEU F 5 164 ? 84.532  31.647  73.202  1.00 12.04  ? 164 LEU B CD1   1 
ATOM   6584 C CD2   . LEU F 5 164 ? 82.461  32.755  74.054  1.00 12.04  ? 164 LEU B CD2   1 
ATOM   6585 N N     . GLY F 5 165 ? 85.165  36.924  71.849  1.00 27.68  ? 165 GLY B N     1 
ATOM   6586 C CA    . GLY F 5 165 ? 85.984  38.117  71.940  1.00 27.68  ? 165 GLY B CA    1 
ATOM   6587 C C     . GLY F 5 165 ? 85.117  39.360  71.906  1.00 27.68  ? 165 GLY B C     1 
ATOM   6588 O O     . GLY F 5 165 ? 85.368  40.329  72.622  1.00 27.68  ? 165 GLY B O     1 
ATOM   6589 N N     . ILE F 5 166 ? 84.088  39.328  71.067  1.00 27.70  ? 166 ILE B N     1 
ATOM   6590 C CA    . ILE F 5 166 ? 83.168  40.448  70.934  1.00 27.70  ? 166 ILE B CA    1 
ATOM   6591 C C     . ILE F 5 166 ? 82.321  40.557  72.197  1.00 27.70  ? 166 ILE B C     1 
ATOM   6592 O O     . ILE F 5 166 ? 82.057  41.652  72.692  1.00 27.70  ? 166 ILE B O     1 
ATOM   6593 C CB    . ILE F 5 166 ? 82.231  40.255  69.714  1.00 14.12  ? 166 ILE B CB    1 
ATOM   6594 C CG1   . ILE F 5 166 ? 82.892  40.811  68.452  1.00 14.12  ? 166 ILE B CG1   1 
ATOM   6595 C CG2   . ILE F 5 166 ? 80.901  40.956  69.953  1.00 14.12  ? 166 ILE B CG2   1 
ATOM   6596 C CD1   . ILE F 5 166 ? 82.135  40.500  67.184  1.00 14.12  ? 166 ILE B CD1   1 
ATOM   6597 N N     . ALA F 5 167 ? 81.902  39.408  72.713  1.00 16.17  ? 167 ALA B N     1 
ATOM   6598 C CA    . ALA F 5 167 ? 81.078  39.365  73.913  1.00 16.17  ? 167 ALA B CA    1 
ATOM   6599 C C     . ALA F 5 167 ? 81.800  39.965  75.112  1.00 16.17  ? 167 ALA B C     1 
ATOM   6600 O O     . ALA F 5 167 ? 81.229  40.762  75.857  1.00 16.17  ? 167 ALA B O     1 
ATOM   6601 C CB    . ALA F 5 167 ? 80.681  37.934  74.215  1.00 5.00   ? 167 ALA B CB    1 
ATOM   6602 N N     . TYR F 5 168 ? 83.060  39.584  75.294  1.00 17.67  ? 168 TYR B N     1 
ATOM   6603 C CA    . TYR F 5 168 ? 83.848  40.084  76.413  1.00 17.67  ? 168 TYR B CA    1 
ATOM   6604 C C     . TYR F 5 168 ? 84.160  41.564  76.237  1.00 17.67  ? 168 TYR B C     1 
ATOM   6605 O O     . TYR F 5 168 ? 83.822  42.389  77.085  1.00 17.67  ? 168 TYR B O     1 
ATOM   6606 C CB    . TYR F 5 168 ? 85.151  39.287  76.535  1.00 19.42  ? 168 TYR B CB    1 
ATOM   6607 C CG    . TYR F 5 168 ? 86.009  39.709  77.701  1.00 19.42  ? 168 TYR B CG    1 
ATOM   6608 C CD1   . TYR F 5 168 ? 85.629  39.423  79.011  1.00 19.42  ? 168 TYR B CD1   1 
ATOM   6609 C CD2   . TYR F 5 168 ? 87.185  40.424  77.499  1.00 19.42  ? 168 TYR B CD2   1 
ATOM   6610 C CE1   . TYR F 5 168 ? 86.397  39.844  80.091  1.00 19.42  ? 168 TYR B CE1   1 
ATOM   6611 C CE2   . TYR F 5 168 ? 87.962  40.850  78.571  1.00 19.42  ? 168 TYR B CE2   1 
ATOM   6612 C CZ    . TYR F 5 168 ? 87.561  40.558  79.862  1.00 19.42  ? 168 TYR B CZ    1 
ATOM   6613 O OH    . TYR F 5 168 ? 88.319  40.992  80.924  1.00 19.42  ? 168 TYR B OH    1 
ATOM   6614 N N     . ASN F 5 169 ? 84.807  41.888  75.124  1.00 18.95  ? 169 ASN B N     1 
ATOM   6615 C CA    . ASN F 5 169 ? 85.186  43.257  74.808  1.00 18.95  ? 169 ASN B CA    1 
ATOM   6616 C C     . ASN F 5 169 ? 84.023  44.245  74.865  1.00 18.95  ? 169 ASN B C     1 
ATOM   6617 O O     . ASN F 5 169 ? 84.128  45.296  75.494  1.00 18.95  ? 169 ASN B O     1 
ATOM   6618 C CB    . ASN F 5 169 ? 85.814  43.303  73.411  1.00 28.23  ? 169 ASN B CB    1 
ATOM   6619 C CG    . ASN F 5 169 ? 86.649  44.550  73.178  1.00 28.23  ? 169 ASN B CG    1 
ATOM   6620 O OD1   . ASN F 5 169 ? 87.458  44.601  72.250  1.00 28.23  ? 169 ASN B OD1   1 
ATOM   6621 N ND2   . ASN F 5 169 ? 86.458  45.563  74.017  1.00 28.23  ? 169 ASN B ND2   1 
ATOM   6622 N N     . THR F 5 170 ? 82.915  43.899  74.216  1.00 21.10  ? 170 THR B N     1 
ATOM   6623 C CA    . THR F 5 170 ? 81.757  44.784  74.155  1.00 21.10  ? 170 THR B CA    1 
ATOM   6624 C C     . THR F 5 170 ? 80.709  44.626  75.251  1.00 21.10  ? 170 THR B C     1 
ATOM   6625 O O     . THR F 5 170 ? 79.850  45.492  75.412  1.00 21.10  ? 170 THR B O     1 
ATOM   6626 C CB    . THR F 5 170 ? 81.050  44.649  72.798  1.00 12.64  ? 170 THR B CB    1 
ATOM   6627 O OG1   . THR F 5 170 ? 80.268  43.451  72.784  1.00 12.64  ? 170 THR B OG1   1 
ATOM   6628 C CG2   . THR F 5 170 ? 82.072  44.593  71.673  1.00 12.64  ? 170 THR B CG2   1 
ATOM   6629 N N     . LEU F 5 171 ? 80.768  43.529  75.997  1.00 35.26  ? 171 LEU B N     1 
ATOM   6630 C CA    . LEU F 5 171 ? 79.805  43.287  77.072  1.00 35.26  ? 171 LEU B CA    1 
ATOM   6631 C C     . LEU F 5 171 ? 78.380  43.190  76.546  1.00 35.26  ? 171 LEU B C     1 
ATOM   6632 O O     . LEU F 5 171 ? 77.435  43.088  77.320  1.00 35.26  ? 171 LEU B O     1 
ATOM   6633 C CB    . LEU F 5 171 ? 79.862  44.414  78.103  1.00 24.09  ? 171 LEU B CB    1 
ATOM   6634 C CG    . LEU F 5 171 ? 80.859  44.283  79.252  1.00 24.09  ? 171 LEU B CG    1 
ATOM   6635 C CD1   . LEU F 5 171 ? 82.193  44.886  78.843  1.00 24.09  ? 171 LEU B CD1   1 
ATOM   6636 C CD2   . LEU F 5 171 ? 80.306  44.984  80.482  1.00 24.09  ? 171 LEU B CD2   1 
ATOM   6637 N N     . LEU F 5 172 ? 78.227  43.230  75.230  1.00 25.19  ? 172 LEU B N     1 
ATOM   6638 C CA    . LEU F 5 172 ? 76.906  43.158  74.620  1.00 25.19  ? 172 LEU B CA    1 
ATOM   6639 C C     . LEU F 5 172 ? 76.170  41.865  74.950  1.00 25.19  ? 172 LEU B C     1 
ATOM   6640 O O     . LEU F 5 172 ? 76.794  40.828  75.179  1.00 25.19  ? 172 LEU B O     1 
ATOM   6641 C CB    . LEU F 5 172 ? 77.026  43.294  73.103  1.00 29.99  ? 172 LEU B CB    1 
ATOM   6642 C CG    . LEU F 5 172 ? 77.472  44.656  72.571  1.00 29.99  ? 172 LEU B CG    1 
ATOM   6643 C CD1   . LEU F 5 172 ? 77.931  44.511  71.132  1.00 29.99  ? 172 LEU B CD1   1 
ATOM   6644 C CD2   . LEU F 5 172 ? 76.323  45.646  72.664  1.00 29.99  ? 172 LEU B CD2   1 
ATOM   6645 N N     . LYS F 5 173 ? 74.840  41.940  74.979  1.00 26.47  ? 173 LYS B N     1 
ATOM   6646 C CA    . LYS F 5 173 ? 73.997  40.778  75.250  1.00 26.47  ? 173 LYS B CA    1 
ATOM   6647 C C     . LYS F 5 173 ? 73.967  39.928  73.983  1.00 26.47  ? 173 LYS B C     1 
ATOM   6648 O O     . LYS F 5 173 ? 74.288  40.415  72.900  1.00 26.47  ? 173 LYS B O     1 
ATOM   6649 C CB    . LYS F 5 173 ? 72.578  41.220  75.612  1.00 38.06  ? 173 LYS B CB    1 
ATOM   6650 C CG    . LYS F 5 173 ? 72.504  42.166  76.801  1.00 38.06  ? 173 LYS B CG    1 
ATOM   6651 C CD    . LYS F 5 173 ? 71.079  42.287  77.313  1.00 38.06  ? 173 LYS B CD    1 
ATOM   6652 C CE    . LYS F 5 173 ? 70.558  43.708  77.180  1.00 38.06  ? 173 LYS B CE    1 
ATOM   6653 N NZ    . LYS F 5 173 ? 69.117  43.743  76.798  1.00 38.06  ? 173 LYS B NZ    1 
ATOM   6654 N N     . ILE F 5 174 ? 73.574  38.666  74.106  1.00 36.18  ? 174 ILE B N     1 
ATOM   6655 C CA    . ILE F 5 174 ? 73.549  37.785  72.947  1.00 36.18  ? 174 ILE B CA    1 
ATOM   6656 C C     . ILE F 5 174 ? 72.580  38.217  71.847  1.00 36.18  ? 174 ILE B C     1 
ATOM   6657 O O     . ILE F 5 174 ? 72.858  38.032  70.661  1.00 36.18  ? 174 ILE B O     1 
ATOM   6658 C CB    . ILE F 5 174 ? 73.235  36.331  73.364  1.00 16.78  ? 174 ILE B CB    1 
ATOM   6659 C CG1   . ILE F 5 174 ? 71.913  36.269  74.124  1.00 16.78  ? 174 ILE B CG1   1 
ATOM   6660 C CG2   . ILE F 5 174 ? 74.356  35.793  74.233  1.00 16.78  ? 174 ILE B CG2   1 
ATOM   6661 C CD1   . ILE F 5 174 ? 71.500  34.864  74.495  1.00 16.78  ? 174 ILE B CD1   1 
ATOM   6662 N N     . ALA F 5 175 ? 71.448  38.797  72.231  1.00 28.43  ? 175 ALA B N     1 
ATOM   6663 C CA    . ALA F 5 175 ? 70.463  39.240  71.249  1.00 28.43  ? 175 ALA B CA    1 
ATOM   6664 C C     . ALA F 5 175 ? 70.962  40.437  70.435  1.00 28.43  ? 175 ALA B C     1 
ATOM   6665 O O     . ALA F 5 175 ? 70.605  40.592  69.266  1.00 28.43  ? 175 ALA B O     1 
ATOM   6666 C CB    . ALA F 5 175 ? 69.152  39.588  71.941  1.00 42.71  ? 175 ALA B CB    1 
ATOM   6667 N N     . GLU F 5 176 ? 71.781  41.285  71.051  1.00 26.25  ? 176 GLU B N     1 
ATOM   6668 C CA    . GLU F 5 176 ? 72.316  42.452  70.359  1.00 26.25  ? 176 GLU B CA    1 
ATOM   6669 C C     . GLU F 5 176 ? 73.435  41.991  69.441  1.00 26.25  ? 176 GLU B C     1 
ATOM   6670 O O     . GLU F 5 176 ? 73.559  42.455  68.308  1.00 26.25  ? 176 GLU B O     1 
ATOM   6671 C CB    . GLU F 5 176 ? 72.869  43.483  71.355  1.00 54.08  ? 176 GLU B CB    1 
ATOM   6672 C CG    . GLU F 5 176 ? 72.121  43.570  72.678  1.00 54.08  ? 176 GLU B CG    1 
ATOM   6673 C CD    . GLU F 5 176 ? 72.494  44.805  73.485  1.00 54.08  ? 176 GLU B CD    1 
ATOM   6674 O OE1   . GLU F 5 176 ? 72.027  45.909  73.133  1.00 54.08  ? 176 GLU B OE1   1 
ATOM   6675 O OE2   . GLU F 5 176 ? 73.252  44.674  74.472  1.00 54.08  ? 176 GLU B OE2   1 
ATOM   6676 N N     . ILE F 5 177 ? 74.248  41.067  69.941  1.00 41.95  ? 177 ILE B N     1 
ATOM   6677 C CA    . ILE F 5 177 ? 75.360  40.532  69.173  1.00 41.95  ? 177 ILE B CA    1 
ATOM   6678 C C     . ILE F 5 177 ? 74.835  39.809  67.942  1.00 41.95  ? 177 ILE B C     1 
ATOM   6679 O O     . ILE F 5 177 ? 75.466  39.829  66.889  1.00 41.95  ? 177 ILE B O     1 
ATOM   6680 C CB    . ILE F 5 177 ? 76.195  39.535  70.010  1.00 28.35  ? 177 ILE B CB    1 
ATOM   6681 C CG1   . ILE F 5 177 ? 77.008  40.288  71.066  1.00 28.35  ? 177 ILE B CG1   1 
ATOM   6682 C CG2   . ILE F 5 177 ? 77.124  38.741  69.102  1.00 28.35  ? 177 ILE B CG2   1 
ATOM   6683 C CD1   . ILE F 5 177 ? 77.831  39.387  71.976  1.00 28.35  ? 177 ILE B CD1   1 
ATOM   6684 N N     . ALA F 5 178 ? 73.673  39.179  68.082  1.00 29.73  ? 178 ALA B N     1 
ATOM   6685 C CA    . ALA F 5 178 ? 73.063  38.434  66.985  1.00 29.73  ? 178 ALA B CA    1 
ATOM   6686 C C     . ALA F 5 178 ? 72.398  39.335  65.952  1.00 29.73  ? 178 ALA B C     1 
ATOM   6687 O O     . ALA F 5 178 ? 72.071  38.893  64.850  1.00 29.73  ? 178 ALA B O     1 
ATOM   6688 C CB    . ALA F 5 178 ? 72.044  37.444  67.536  1.00 7.07   ? 178 ALA B CB    1 
ATOM   6689 N N     . ARG F 5 179 ? 72.198  40.599  66.308  1.00 45.33  ? 179 ARG B N     1 
ATOM   6690 C CA    . ARG F 5 179 ? 71.560  41.547  65.406  1.00 45.33  ? 179 ARG B CA    1 
ATOM   6691 C C     . ARG F 5 179 ? 72.560  42.355  64.596  1.00 45.33  ? 179 ARG B C     1 
ATOM   6692 O O     . ARG F 5 179 ? 72.186  43.020  63.633  1.00 45.33  ? 179 ARG B O     1 
ATOM   6693 C CB    . ARG F 5 179 ? 70.666  42.499  66.199  1.00 74.78  ? 179 ARG B CB    1 
ATOM   6694 C CG    . ARG F 5 179 ? 69.193  42.143  66.142  1.00 74.78  ? 179 ARG B CG    1 
ATOM   6695 C CD    . ARG F 5 179 ? 68.331  43.355  66.438  1.00 74.78  ? 179 ARG B CD    1 
ATOM   6696 N NE    . ARG F 5 179 ? 68.734  44.011  67.677  1.00 74.78  ? 179 ARG B NE    1 
ATOM   6697 C CZ    . ARG F 5 179 ? 68.320  43.638  68.883  1.00 74.78  ? 179 ARG B CZ    1 
ATOM   6698 N NH1   . ARG F 5 179 ? 67.488  42.612  69.016  1.00 74.78  ? 179 ARG B NH1   1 
ATOM   6699 N NH2   . ARG F 5 179 ? 68.739  44.292  69.957  1.00 74.78  ? 179 ARG B NH2   1 
ATOM   6700 N N     . ILE F 5 180 ? 73.831  42.297  64.982  1.00 37.69  ? 180 ILE B N     1 
ATOM   6701 C CA    . ILE F 5 180 ? 74.871  43.038  64.278  1.00 37.69  ? 180 ILE B CA    1 
ATOM   6702 C C     . ILE F 5 180 ? 74.952  42.650  62.806  1.00 37.69  ? 180 ILE B C     1 
ATOM   6703 O O     . ILE F 5 180 ? 75.114  41.478  62.472  1.00 37.69  ? 180 ILE B O     1 
ATOM   6704 C CB    . ILE F 5 180 ? 76.264  42.801  64.904  1.00 35.97  ? 180 ILE B CB    1 
ATOM   6705 C CG1   . ILE F 5 180 ? 76.248  43.163  66.391  1.00 35.97  ? 180 ILE B CG1   1 
ATOM   6706 C CG2   . ILE F 5 180 ? 77.309  43.635  64.170  1.00 35.97  ? 180 ILE B CG2   1 
ATOM   6707 C CD1   . ILE F 5 180 ? 77.529  42.802  67.119  1.00 35.97  ? 180 ILE B CD1   1 
ATOM   6708 N N     . ARG F 5 181 ? 74.837  43.645  61.933  1.00 30.57  ? 181 ARG B N     1 
ATOM   6709 C CA    . ARG F 5 181 ? 74.918  43.422  60.495  1.00 30.57  ? 181 ARG B CA    1 
ATOM   6710 C C     . ARG F 5 181 ? 76.281  43.914  60.028  1.00 30.57  ? 181 ARG B C     1 
ATOM   6711 O O     . ARG F 5 181 ? 76.883  44.780  60.661  1.00 30.57  ? 181 ARG B O     1 
ATOM   6712 C CB    . ARG F 5 181 ? 73.816  44.194  59.767  1.00 49.75  ? 181 ARG B CB    1 
ATOM   6713 C CG    . ARG F 5 181 ? 72.410  43.696  60.057  1.00 49.75  ? 181 ARG B CG    1 
ATOM   6714 C CD    . ARG F 5 181 ? 71.400  44.263  59.067  1.00 49.75  ? 181 ARG B CD    1 
ATOM   6715 N NE    . ARG F 5 181 ? 70.421  43.258  58.659  1.00 49.75  ? 181 ARG B NE    1 
ATOM   6716 C CZ    . ARG F 5 181 ? 69.161  43.228  59.080  1.00 49.75  ? 181 ARG B CZ    1 
ATOM   6717 N NH1   . ARG F 5 181 ? 68.720  44.152  59.926  1.00 49.75  ? 181 ARG B NH1   1 
ATOM   6718 N NH2   . ARG F 5 181 ? 68.344  42.270  58.661  1.00 49.75  ? 181 ARG B NH2   1 
ATOM   6719 N N     . VAL F 5 182 ? 76.766  43.366  58.922  1.00 27.49  ? 182 VAL B N     1 
ATOM   6720 C CA    . VAL F 5 182 ? 78.066  43.760  58.394  1.00 27.49  ? 182 VAL B CA    1 
ATOM   6721 C C     . VAL F 5 182 ? 78.177  45.275  58.234  1.00 27.49  ? 182 VAL B C     1 
ATOM   6722 O O     . VAL F 5 182 ? 79.183  45.873  58.613  1.00 27.49  ? 182 VAL B O     1 
ATOM   6723 C CB    . VAL F 5 182 ? 78.337  43.088  57.028  1.00 32.14  ? 182 VAL B CB    1 
ATOM   6724 C CG1   . VAL F 5 182 ? 79.735  43.433  56.544  1.00 32.14  ? 182 VAL B CG1   1 
ATOM   6725 C CG2   . VAL F 5 182 ? 78.179  41.582  57.153  1.00 32.14  ? 182 VAL B CG2   1 
ATOM   6726 N N     . LYS F 5 183 ? 77.139  45.891  57.678  1.00 48.60  ? 183 LYS B N     1 
ATOM   6727 C CA    . LYS F 5 183 ? 77.125  47.335  57.459  1.00 48.60  ? 183 LYS B CA    1 
ATOM   6728 C C     . LYS F 5 183 ? 77.343  48.118  58.750  1.00 48.60  ? 183 LYS B C     1 
ATOM   6729 O O     . LYS F 5 183 ? 77.821  49.251  58.724  1.00 48.60  ? 183 LYS B O     1 
ATOM   6730 C CB    . LYS F 5 183 ? 75.797  47.760  56.828  1.00 33.75  ? 183 LYS B CB    1 
ATOM   6731 C CG    . LYS F 5 183 ? 74.592  47.507  57.714  1.00 33.75  ? 183 LYS B CG    1 
ATOM   6732 C CD    . LYS F 5 183 ? 73.467  48.481  57.416  1.00 33.75  ? 183 LYS B CD    1 
ATOM   6733 C CE    . LYS F 5 183 ? 72.293  47.772  56.764  1.00 33.75  ? 183 LYS B CE    1 
ATOM   6734 N NZ    . LYS F 5 183 ? 70.983  48.336  57.194  1.00 33.75  ? 183 LYS B NZ    1 
ATOM   6735 N N     . ASP F 5 184 ? 76.985  47.512  59.877  1.00 59.43  ? 184 ASP B N     1 
ATOM   6736 C CA    . ASP F 5 184 ? 77.134  48.156  61.178  1.00 59.43  ? 184 ASP B CA    1 
ATOM   6737 C C     . ASP F 5 184 ? 78.599  48.297  61.581  1.00 59.43  ? 184 ASP B C     1 
ATOM   6738 O O     . ASP F 5 184 ? 78.973  49.250  62.266  1.00 59.43  ? 184 ASP B O     1 
ATOM   6739 C CB    . ASP F 5 184 ? 76.380  47.360  62.249  1.00 50.63  ? 184 ASP B CB    1 
ATOM   6740 C CG    . ASP F 5 184 ? 74.875  47.547  62.165  1.00 50.63  ? 184 ASP B CG    1 
ATOM   6741 O OD1   . ASP F 5 184 ? 74.430  48.668  61.843  1.00 50.63  ? 184 ASP B OD1   1 
ATOM   6742 O OD2   . ASP F 5 184 ? 74.138  46.572  62.420  1.00 50.63  ? 184 ASP B OD2   1 
ATOM   6743 N N     . ILE F 5 185 ? 79.427  47.350  61.152  1.00 36.17  ? 185 ILE B N     1 
ATOM   6744 C CA    . ILE F 5 185 ? 80.849  47.373  61.478  1.00 36.17  ? 185 ILE B CA    1 
ATOM   6745 C C     . ILE F 5 185 ? 81.574  48.495  60.741  1.00 36.17  ? 185 ILE B C     1 
ATOM   6746 O O     . ILE F 5 185 ? 81.310  48.749  59.567  1.00 36.17  ? 185 ILE B O     1 
ATOM   6747 C CB    . ILE F 5 185 ? 81.527  46.029  61.119  1.00 33.22  ? 185 ILE B CB    1 
ATOM   6748 C CG1   . ILE F 5 185 ? 80.978  44.915  62.011  1.00 33.22  ? 185 ILE B CG1   1 
ATOM   6749 C CG2   . ILE F 5 185 ? 83.035  46.136  61.297  1.00 33.22  ? 185 ILE B CG2   1 
ATOM   6750 C CD1   . ILE F 5 185 ? 80.692  43.625  61.274  1.00 33.22  ? 185 ILE B CD1   1 
ATOM   6751 N N     . SER F 5 186 ? 82.486  49.163  61.440  1.00 38.05  ? 186 SER B N     1 
ATOM   6752 C CA    . SER F 5 186 ? 83.262  50.250  60.853  1.00 38.05  ? 186 SER B CA    1 
ATOM   6753 C C     . SER F 5 186 ? 84.677  50.239  61.427  1.00 38.05  ? 186 SER B C     1 
ATOM   6754 O O     . SER F 5 186 ? 85.005  49.398  62.264  1.00 38.05  ? 186 SER B O     1 
ATOM   6755 C CB    . SER F 5 186 ? 82.589  51.597  61.137  1.00 46.85  ? 186 SER B CB    1 
ATOM   6756 O OG    . SER F 5 186 ? 82.460  51.827  62.528  1.00 46.85  ? 186 SER B OG    1 
ATOM   6757 N N     . ARG F 5 187 ? 85.515  51.167  60.977  1.00 45.07  ? 187 ARG B N     1 
ATOM   6758 C CA    . ARG F 5 187 ? 86.888  51.234  61.462  1.00 45.07  ? 187 ARG B CA    1 
ATOM   6759 C C     . ARG F 5 187 ? 87.195  52.576  62.110  1.00 45.07  ? 187 ARG B C     1 
ATOM   6760 O O     . ARG F 5 187 ? 86.416  53.522  61.999  1.00 45.07  ? 187 ARG B O     1 
ATOM   6761 C CB    . ARG F 5 187 ? 87.867  50.981  60.315  1.00 68.80  ? 187 ARG B CB    1 
ATOM   6762 C CG    . ARG F 5 187 ? 88.840  49.843  60.574  1.00 68.80  ? 187 ARG B CG    1 
ATOM   6763 C CD    . ARG F 5 187 ? 88.118  48.506  60.650  1.00 68.80  ? 187 ARG B CD    1 
ATOM   6764 N NE    . ARG F 5 187 ? 88.980  47.397  60.252  1.00 68.80  ? 187 ARG B NE    1 
ATOM   6765 C CZ    . ARG F 5 187 ? 88.703  46.557  59.260  1.00 68.80  ? 187 ARG B CZ    1 
ATOM   6766 N NH1   . ARG F 5 187 ? 87.585  46.696  58.558  1.00 68.80  ? 187 ARG B NH1   1 
ATOM   6767 N NH2   . ARG F 5 187 ? 89.548  45.579  58.964  1.00 68.80  ? 187 ARG B NH2   1 
ATOM   6768 N N     . THR F 5 188 ? 88.336  52.651  62.785  1.00 53.27  ? 188 THR B N     1 
ATOM   6769 C CA    . THR F 5 188 ? 88.750  53.877  63.455  1.00 53.27  ? 188 THR B CA    1 
ATOM   6770 C C     . THR F 5 188 ? 90.072  54.401  62.907  1.00 53.27  ? 188 THR B C     1 
ATOM   6771 O O     . THR F 5 188 ? 90.619  53.865  61.942  1.00 53.27  ? 188 THR B O     1 
ATOM   6772 C CB    . THR F 5 188 ? 88.923  53.656  64.968  1.00 43.84  ? 188 THR B CB    1 
ATOM   6773 O OG1   . THR F 5 188 ? 90.022  52.765  65.200  1.00 43.84  ? 188 THR B OG1   1 
ATOM   6774 C CG2   . THR F 5 188 ? 87.664  53.064  65.565  1.00 43.84  ? 188 THR B CG2   1 
ATOM   6775 N N     . ASP F 5 189 ? 90.579  55.456  63.536  1.00 100.00 ? 189 ASP B N     1 
ATOM   6776 C CA    . ASP F 5 189 ? 91.841  56.063  63.136  1.00 100.00 ? 189 ASP B CA    1 
ATOM   6777 C C     . ASP F 5 189 ? 92.993  55.116  63.458  1.00 100.00 ? 189 ASP B C     1 
ATOM   6778 O O     . ASP F 5 189 ? 94.042  55.155  62.814  1.00 100.00 ? 189 ASP B O     1 
ATOM   6779 C CB    . ASP F 5 189 ? 92.046  57.388  63.879  1.00 100.00 ? 189 ASP B CB    1 
ATOM   6780 C CG    . ASP F 5 189 ? 91.077  58.467  63.433  1.00 100.00 ? 189 ASP B CG    1 
ATOM   6781 O OD1   . ASP F 5 189 ? 89.864  58.330  63.701  1.00 100.00 ? 189 ASP B OD1   1 
ATOM   6782 O OD2   . ASP F 5 189 ? 91.532  59.454  62.817  1.00 100.00 ? 189 ASP B OD2   1 
ATOM   6783 N N     . GLY F 5 190 ? 92.785  54.265  64.459  1.00 68.84  ? 190 GLY B N     1 
ATOM   6784 C CA    . GLY F 5 190 ? 93.811  53.321  64.863  1.00 68.84  ? 190 GLY B CA    1 
ATOM   6785 C C     . GLY F 5 190 ? 93.727  51.993  64.138  1.00 68.84  ? 190 GLY B C     1 
ATOM   6786 O O     . GLY F 5 190 ? 94.681  51.215  64.145  1.00 68.84  ? 190 GLY B O     1 
ATOM   6787 N N     . GLY F 5 191 ? 92.581  51.727  63.518  1.00 49.43  ? 191 GLY B N     1 
ATOM   6788 C CA    . GLY F 5 191 ? 92.412  50.484  62.787  1.00 49.43  ? 191 GLY B CA    1 
ATOM   6789 C C     . GLY F 5 191 ? 91.507  49.474  63.462  1.00 49.43  ? 191 GLY B C     1 
ATOM   6790 O O     . GLY F 5 191 ? 91.240  48.409  62.904  1.00 49.43  ? 191 GLY B O     1 
ATOM   6791 N N     . ARG F 5 192 ? 91.032  49.797  64.662  1.00 41.04  ? 192 ARG B N     1 
ATOM   6792 C CA    . ARG F 5 192 ? 90.151  48.890  65.390  1.00 41.04  ? 192 ARG B CA    1 
ATOM   6793 C C     . ARG F 5 192 ? 88.716  49.020  64.902  1.00 41.04  ? 192 ARG B C     1 
ATOM   6794 O O     . ARG F 5 192 ? 88.244  50.119  64.607  1.00 41.04  ? 192 ARG B O     1 
ATOM   6795 C CB    . ARG F 5 192 ? 90.197  49.167  66.897  1.00 42.21  ? 192 ARG B CB    1 
ATOM   6796 C CG    . ARG F 5 192 ? 91.188  50.230  67.327  1.00 42.21  ? 192 ARG B CG    1 
ATOM   6797 C CD    . ARG F 5 192 ? 91.156  50.425  68.835  1.00 42.21  ? 192 ARG B CD    1 
ATOM   6798 N NE    . ARG F 5 192 ? 92.436  50.100  69.462  1.00 42.21  ? 192 ARG B NE    1 
ATOM   6799 C CZ    . ARG F 5 192 ? 93.551  50.804  69.292  1.00 42.21  ? 192 ARG B CZ    1 
ATOM   6800 N NH1   . ARG F 5 192 ? 93.552  51.878  68.513  1.00 42.21  ? 192 ARG B NH1   1 
ATOM   6801 N NH2   . ARG F 5 192 ? 94.671  50.432  69.896  1.00 42.21  ? 192 ARG B NH2   1 
ATOM   6802 N N     . MET F 5 193 ? 88.031  47.887  64.812  1.00 23.75  ? 193 MET B N     1 
ATOM   6803 C CA    . MET F 5 193 ? 86.646  47.858  64.367  1.00 23.75  ? 193 MET B CA    1 
ATOM   6804 C C     . MET F 5 193 ? 85.749  48.630  65.324  1.00 23.75  ? 193 MET B C     1 
ATOM   6805 O O     . MET F 5 193 ? 86.128  48.911  66.462  1.00 23.75  ? 193 MET B O     1 
ATOM   6806 C CB    . MET F 5 193 ? 86.154  46.415  64.271  1.00 31.03  ? 193 MET B CB    1 
ATOM   6807 C CG    . MET F 5 193 ? 86.841  45.591  63.203  1.00 31.03  ? 193 MET B CG    1 
ATOM   6808 S SD    . MET F 5 193 ? 85.860  44.150  62.790  1.00 31.03  ? 193 MET B SD    1 
ATOM   6809 C CE    . MET F 5 193 ? 86.020  44.144  61.015  1.00 31.03  ? 193 MET B CE    1 
ATOM   6810 N N     . LEU F 5 194 ? 84.553  48.961  64.850  1.00 51.59  ? 194 LEU B N     1 
ATOM   6811 C CA    . LEU F 5 194 ? 83.577  49.703  65.639  1.00 51.59  ? 194 LEU B CA    1 
ATOM   6812 C C     . LEU F 5 194 ? 82.176  49.194  65.320  1.00 51.59  ? 194 LEU B C     1 
ATOM   6813 O O     . LEU F 5 194 ? 81.627  49.505  64.262  1.00 51.59  ? 194 LEU B O     1 
ATOM   6814 C CB    . LEU F 5 194 ? 83.658  51.194  65.307  1.00 40.23  ? 194 LEU B CB    1 
ATOM   6815 C CG    . LEU F 5 194 ? 84.461  52.107  66.235  1.00 40.23  ? 194 LEU B CG    1 
ATOM   6816 C CD1   . LEU F 5 194 ? 84.475  53.515  65.665  1.00 40.23  ? 194 LEU B CD1   1 
ATOM   6817 C CD2   . LEU F 5 194 ? 83.847  52.104  67.624  1.00 40.23  ? 194 LEU B CD2   1 
ATOM   6818 N N     . ILE F 5 195 ? 81.600  48.411  66.227  1.00 27.01  ? 195 ILE B N     1 
ATOM   6819 C CA    . ILE F 5 195 ? 80.262  47.877  66.020  1.00 27.01  ? 195 ILE B CA    1 
ATOM   6820 C C     . ILE F 5 195 ? 79.207  48.866  66.495  1.00 27.01  ? 195 ILE B C     1 
ATOM   6821 O O     . ILE F 5 195 ? 79.239  49.325  67.638  1.00 27.01  ? 195 ILE B O     1 
ATOM   6822 C CB    . ILE F 5 195 ? 80.060  46.553  66.776  1.00 38.81  ? 195 ILE B CB    1 
ATOM   6823 C CG1   . ILE F 5 195 ? 81.268  45.642  66.564  1.00 38.81  ? 195 ILE B CG1   1 
ATOM   6824 C CG2   . ILE F 5 195 ? 78.791  45.871  66.294  1.00 38.81  ? 195 ILE B CG2   1 
ATOM   6825 C CD1   . ILE F 5 195 ? 81.406  44.564  67.611  1.00 38.81  ? 195 ILE B CD1   1 
ATOM   6826 N N     . HIS F 5 196 ? 78.275  49.199  65.609  1.00 35.83  ? 196 HIS B N     1 
ATOM   6827 C CA    . HIS F 5 196 ? 77.211  50.130  65.950  1.00 35.83  ? 196 HIS B CA    1 
ATOM   6828 C C     . HIS F 5 196 ? 75.973  49.355  66.381  1.00 35.83  ? 196 HIS B C     1 
ATOM   6829 O O     . HIS F 5 196 ? 75.423  48.571  65.604  1.00 35.83  ? 196 HIS B O     1 
ATOM   6830 C CB    . HIS F 5 196 ? 76.865  51.021  64.752  1.00 69.39  ? 196 HIS B CB    1 
ATOM   6831 C CG    . HIS F 5 196 ? 75.622  51.835  64.948  1.00 69.39  ? 196 HIS B CG    1 
ATOM   6832 N ND1   . HIS F 5 196 ? 75.614  53.030  65.636  1.00 69.39  ? 196 HIS B ND1   1 
ATOM   6833 C CD2   . HIS F 5 196 ? 74.340  51.610  64.573  1.00 69.39  ? 196 HIS B CD2   1 
ATOM   6834 C CE1   . HIS F 5 196 ? 74.382  53.505  65.679  1.00 69.39  ? 196 HIS B CE1   1 
ATOM   6835 N NE2   . HIS F 5 196 ? 73.590  52.663  65.042  1.00 69.39  ? 196 HIS B NE2   1 
ATOM   6836 N N     . ILE F 5 197 ? 75.545  49.568  67.622  1.00 33.45  ? 197 ILE B N     1 
ATOM   6837 C CA    . ILE F 5 197 ? 74.366  48.889  68.138  1.00 33.45  ? 197 ILE B CA    1 
ATOM   6838 C C     . ILE F 5 197 ? 73.133  49.750  67.885  1.00 33.45  ? 197 ILE B C     1 
ATOM   6839 O O     . ILE F 5 197 ? 72.968  50.816  68.482  1.00 33.45  ? 197 ILE B O     1 
ATOM   6840 C CB    . ILE F 5 197 ? 74.502  48.599  69.650  1.00 36.30  ? 197 ILE B CB    1 
ATOM   6841 C CG1   . ILE F 5 197 ? 75.228  47.269  69.862  1.00 36.30  ? 197 ILE B CG1   1 
ATOM   6842 C CG2   . ILE F 5 197 ? 73.128  48.511  70.297  1.00 36.30  ? 197 ILE B CG2   1 
ATOM   6843 C CD1   . ILE F 5 197 ? 76.590  47.192  69.210  1.00 36.30  ? 197 ILE B CD1   1 
ATOM   6844 N N     . GLY F 5 198 ? 72.274  49.274  66.991  1.00 101.62 ? 198 GLY B N     1 
ATOM   6845 C CA    . GLY F 5 198 ? 71.068  50.007  66.650  1.00 101.62 ? 198 GLY B CA    1 
ATOM   6846 C C     . GLY F 5 198 ? 69.821  49.483  67.334  1.00 101.62 ? 198 GLY B C     1 
ATOM   6847 O O     . GLY F 5 198 ? 69.012  48.780  66.724  1.00 101.62 ? 198 GLY B O     1 
ATOM   6848 N N     . ARG F 5 199 ? 69.676  49.836  68.607  1.00 81.17  ? 199 ARG B N     1 
ATOM   6849 C CA    . ARG F 5 199 ? 68.542  49.435  69.426  1.00 81.17  ? 199 ARG B CA    1 
ATOM   6850 C C     . ARG F 5 199 ? 68.870  49.695  70.889  1.00 81.17  ? 199 ARG B C     1 
ATOM   6851 O O     . ARG F 5 199 ? 69.535  48.887  71.535  1.00 81.17  ? 199 ARG B O     1 
ATOM   6852 C CB    . ARG F 5 199 ? 68.226  47.949  69.234  1.00 101.62 ? 199 ARG B CB    1 
ATOM   6853 C CG    . ARG F 5 199 ? 66.739  47.642  69.146  1.00 101.62 ? 199 ARG B CG    1 
ATOM   6854 C CD    . ARG F 5 199 ? 66.408  46.297  69.768  1.00 101.62 ? 199 ARG B CD    1 
ATOM   6855 N NE    . ARG F 5 199 ? 65.592  45.478  68.877  1.00 101.62 ? 199 ARG B NE    1 
ATOM   6856 C CZ    . ARG F 5 199 ? 64.944  44.380  69.251  1.00 101.62 ? 199 ARG B CZ    1 
ATOM   6857 N NH1   . ARG F 5 199 ? 65.012  43.955  70.506  1.00 101.62 ? 199 ARG B NH1   1 
ATOM   6858 N NH2   . ARG F 5 199 ? 64.229  43.700  68.368  1.00 101.62 ? 199 ARG B NH2   1 
ATOM   6859 N N     . THR F 5 200 ? 68.400  50.824  71.408  1.00 101.53 ? 200 THR B N     1 
ATOM   6860 C CA    . THR F 5 200 ? 68.639  51.189  72.803  1.00 101.53 ? 200 THR B CA    1 
ATOM   6861 C C     . THR F 5 200 ? 67.290  51.239  73.515  1.00 101.53 ? 200 THR B C     1 
ATOM   6862 O O     . THR F 5 200 ? 66.299  51.654  72.909  1.00 101.53 ? 200 THR B O     1 
ATOM   6863 C CB    . THR F 5 200 ? 69.323  52.580  72.919  1.00 101.62 ? 200 THR B CB    1 
ATOM   6864 O OG1   . THR F 5 200 ? 68.375  53.542  73.398  1.00 101.62 ? 200 THR B OG1   1 
ATOM   6865 C CG2   . THR F 5 200 ? 69.879  53.039  71.561  1.00 101.62 ? 200 THR B CG2   1 
ATOM   6866 N N     . LYS F 5 201 ? 67.245  50.844  74.788  1.00 101.62 ? 201 LYS B N     1 
ATOM   6867 C CA    . LYS F 5 201 ? 65.985  50.833  75.539  1.00 101.62 ? 201 LYS B CA    1 
ATOM   6868 C C     . LYS F 5 201 ? 65.713  52.104  76.346  1.00 101.62 ? 201 LYS B C     1 
ATOM   6869 O O     . LYS F 5 201 ? 64.622  52.271  76.906  1.00 101.62 ? 201 LYS B O     1 
ATOM   6870 C CB    . LYS F 5 201 ? 65.932  49.626  76.477  1.00 101.62 ? 201 LYS B CB    1 
ATOM   6871 C CG    . LYS F 5 201 ? 65.870  48.250  75.796  1.00 101.62 ? 201 LYS B CG    1 
ATOM   6872 C CD    . LYS F 5 201 ? 64.856  48.208  74.665  1.00 101.62 ? 201 LYS B CD    1 
ATOM   6873 C CE    . LYS F 5 201 ? 63.736  47.232  74.982  1.00 101.62 ? 201 LYS B CE    1 
ATOM   6874 N NZ    . LYS F 5 201 ? 63.373  46.363  73.825  1.00 101.62 ? 201 LYS B NZ    1 
ATOM   6875 N N     . THR F 5 202 ? 66.699  52.991  76.448  1.00 101.62 ? 202 THR B N     1 
ATOM   6876 C CA    . THR F 5 202 ? 66.452  54.244  77.159  1.00 101.62 ? 202 THR B CA    1 
ATOM   6877 C C     . THR F 5 202 ? 65.975  55.064  75.967  1.00 101.62 ? 202 THR B C     1 
ATOM   6878 O O     . THR F 5 202 ? 66.742  55.771  75.314  1.00 101.62 ? 202 THR B O     1 
ATOM   6879 C CB    . THR F 5 202 ? 67.736  54.825  77.799  1.00 101.62 ? 202 THR B CB    1 
ATOM   6880 O OG1   . THR F 5 202 ? 67.506  56.189  78.193  1.00 101.62 ? 202 THR B OG1   1 
ATOM   6881 C CG2   . THR F 5 202 ? 68.898  54.752  76.832  1.00 101.62 ? 202 THR B CG2   1 
ATOM   6882 N N     . LEU F 5 203 ? 64.692  54.915  75.657  1.00 101.62 ? 203 LEU B N     1 
ATOM   6883 C CA    . LEU F 5 203 ? 64.143  55.586  74.489  1.00 101.62 ? 203 LEU B CA    1 
ATOM   6884 C C     . LEU F 5 203 ? 64.003  57.106  74.372  1.00 101.62 ? 203 LEU B C     1 
ATOM   6885 O O     . LEU F 5 203 ? 63.406  57.792  75.216  1.00 101.62 ? 203 LEU B O     1 
ATOM   6886 C CB    . LEU F 5 203 ? 62.807  54.946  74.123  1.00 101.62 ? 203 LEU B CB    1 
ATOM   6887 C CG    . LEU F 5 203 ? 62.938  53.719  73.234  1.00 101.62 ? 203 LEU B CG    1 
ATOM   6888 C CD1   . LEU F 5 203 ? 64.020  53.913  72.196  1.00 101.62 ? 203 LEU B CD1   1 
ATOM   6889 C CD2   . LEU F 5 203 ? 63.254  52.552  74.107  1.00 101.62 ? 203 LEU B CD2   1 
ATOM   6890 N N     . VAL F 5 204 ? 64.547  57.588  73.255  1.00 101.62 ? 204 VAL B N     1 
ATOM   6891 C CA    . VAL F 5 204 ? 64.557  58.986  72.817  1.00 101.62 ? 204 VAL B CA    1 
ATOM   6892 C C     . VAL F 5 204 ? 65.244  58.890  71.447  1.00 101.62 ? 204 VAL B C     1 
ATOM   6893 O O     . VAL F 5 204 ? 64.649  58.367  70.505  1.00 101.62 ? 204 VAL B O     1 
ATOM   6894 C CB    . VAL F 5 204 ? 65.355  59.907  73.791  1.00 101.62 ? 204 VAL B CB    1 
ATOM   6895 C CG1   . VAL F 5 204 ? 66.686  59.279  74.155  1.00 101.62 ? 204 VAL B CG1   1 
ATOM   6896 C CG2   . VAL F 5 204 ? 65.552  61.288  73.172  1.00 101.62 ? 204 VAL B CG2   1 
ATOM   6897 N N     . SER F 5 205 ? 66.480  59.363  71.322  1.00 101.62 ? 205 SER B N     1 
ATOM   6898 C CA    . SER F 5 205 ? 67.194  59.258  70.056  1.00 101.62 ? 205 SER B CA    1 
ATOM   6899 C C     . SER F 5 205 ? 68.690  59.090  70.258  1.00 101.62 ? 205 SER B C     1 
ATOM   6900 O O     . SER F 5 205 ? 69.496  59.695  69.548  1.00 101.62 ? 205 SER B O     1 
ATOM   6901 C CB    . SER F 5 205 ? 66.927  60.479  69.174  1.00 101.62 ? 205 SER B CB    1 
ATOM   6902 O OG    . SER F 5 205 ? 67.098  60.141  67.807  1.00 101.62 ? 205 SER B OG    1 
ATOM   6903 N N     . THR F 5 206 ? 69.060  58.273  71.237  1.00 101.62 ? 206 THR B N     1 
ATOM   6904 C CA    . THR F 5 206 ? 70.465  58.024  71.492  1.00 101.62 ? 206 THR B CA    1 
ATOM   6905 C C     . THR F 5 206 ? 70.920  57.190  70.301  1.00 101.62 ? 206 THR B C     1 
ATOM   6906 O O     . THR F 5 206 ? 70.723  55.976  70.275  1.00 101.62 ? 206 THR B O     1 
ATOM   6907 C CB    . THR F 5 206 ? 70.672  57.239  72.807  1.00 101.62 ? 206 THR B CB    1 
ATOM   6908 O OG1   . THR F 5 206 ? 70.333  58.075  73.922  1.00 101.62 ? 206 THR B OG1   1 
ATOM   6909 C CG2   . THR F 5 206 ? 72.119  56.794  72.941  1.00 101.62 ? 206 THR B CG2   1 
ATOM   6910 N N     . ALA F 5 207 ? 71.492  57.871  69.311  1.00 101.62 ? 207 ALA B N     1 
ATOM   6911 C CA    . ALA F 5 207 ? 71.979  57.245  68.089  1.00 101.62 ? 207 ALA B CA    1 
ATOM   6912 C C     . ALA F 5 207 ? 72.348  55.783  68.275  1.00 101.62 ? 207 ALA B C     1 
ATOM   6913 O O     . ALA F 5 207 ? 72.149  54.961  67.379  1.00 101.62 ? 207 ALA B O     1 
ATOM   6914 C CB    . ALA F 5 207 ? 73.178  58.014  67.564  1.00 79.71  ? 207 ALA B CB    1 
ATOM   6915 N N     . GLY F 5 208 ? 72.890  55.469  69.445  1.00 59.76  ? 208 GLY B N     1 
ATOM   6916 C CA    . GLY F 5 208 ? 73.294  54.111  69.736  1.00 59.76  ? 208 GLY B CA    1 
ATOM   6917 C C     . GLY F 5 208 ? 74.749  54.133  70.140  1.00 59.76  ? 208 GLY B C     1 
ATOM   6918 O O     . GLY F 5 208 ? 75.442  55.123  69.910  1.00 59.76  ? 208 GLY B O     1 
ATOM   6919 N N     . VAL F 5 209 ? 75.217  53.052  70.747  1.00 70.80  ? 209 VAL B N     1 
ATOM   6920 C CA    . VAL F 5 209 ? 76.605  52.990  71.169  1.00 70.80  ? 209 VAL B CA    1 
ATOM   6921 C C     . VAL F 5 209 ? 77.477  52.451  70.047  1.00 70.80  ? 209 VAL B C     1 
ATOM   6922 O O     . VAL F 5 209 ? 77.077  51.549  69.309  1.00 70.80  ? 209 VAL B O     1 
ATOM   6923 C CB    . VAL F 5 209 ? 76.779  52.090  72.411  1.00 100.00 ? 209 VAL B CB    1 
ATOM   6924 C CG1   . VAL F 5 209 ? 76.397  52.860  73.666  1.00 100.00 ? 209 VAL B CG1   1 
ATOM   6925 C CG2   . VAL F 5 209 ? 75.929  50.838  72.274  1.00 100.00 ? 209 VAL B CG2   1 
ATOM   6926 N N     . GLU F 5 210 ? 78.670  53.018  69.919  1.00 86.82  ? 210 GLU B N     1 
ATOM   6927 C CA    . GLU F 5 210 ? 79.610  52.586  68.898  1.00 86.82  ? 210 GLU B CA    1 
ATOM   6928 C C     . GLU F 5 210 ? 80.675  51.756  69.592  1.00 86.82  ? 210 GLU B C     1 
ATOM   6929 O O     . GLU F 5 210 ? 81.757  52.252  69.907  1.00 86.82  ? 210 GLU B O     1 
ATOM   6930 C CB    . GLU F 5 210 ? 80.249  53.795  68.211  1.00 58.21  ? 210 GLU B CB    1 
ATOM   6931 C CG    . GLU F 5 210 ? 79.555  54.220  66.924  1.00 58.21  ? 210 GLU B CG    1 
ATOM   6932 C CD    . GLU F 5 210 ? 79.894  53.324  65.746  1.00 58.21  ? 210 GLU B CD    1 
ATOM   6933 O OE1   . GLU F 5 210 ? 80.948  52.657  65.787  1.00 58.21  ? 210 GLU B OE1   1 
ATOM   6934 O OE2   . GLU F 5 210 ? 79.106  53.288  64.776  1.00 58.21  ? 210 GLU B OE2   1 
ATOM   6935 N N     . LYS F 5 211 ? 80.355  50.490  69.838  1.00 33.84  ? 211 LYS B N     1 
ATOM   6936 C CA    . LYS F 5 211 ? 81.277  49.585  70.507  1.00 33.84  ? 211 LYS B CA    1 
ATOM   6937 C C     . LYS F 5 211 ? 82.584  49.456  69.740  1.00 33.84  ? 211 LYS B C     1 
ATOM   6938 O O     . LYS F 5 211 ? 82.585  49.152  68.547  1.00 33.84  ? 211 LYS B O     1 
ATOM   6939 C CB    . LYS F 5 211 ? 80.635  48.208  70.663  1.00 56.23  ? 211 LYS B CB    1 
ATOM   6940 C CG    . LYS F 5 211 ? 79.438  48.195  71.597  1.00 56.23  ? 211 LYS B CG    1 
ATOM   6941 C CD    . LYS F 5 211 ? 79.879  48.097  73.048  1.00 56.23  ? 211 LYS B CD    1 
ATOM   6942 C CE    . LYS F 5 211 ? 79.490  49.340  73.830  1.00 56.23  ? 211 LYS B CE    1 
ATOM   6943 N NZ    . LYS F 5 211 ? 78.874  48.995  75.139  1.00 56.23  ? 211 LYS B NZ    1 
ATOM   6944 N N     . ALA F 5 212 ? 83.694  49.701  70.431  1.00 40.55  ? 212 ALA B N     1 
ATOM   6945 C CA    . ALA F 5 212 ? 85.015  49.603  69.823  1.00 40.55  ? 212 ALA B CA    1 
ATOM   6946 C C     . ALA F 5 212 ? 85.686  48.304  70.256  1.00 40.55  ? 212 ALA B C     1 
ATOM   6947 O O     . ALA F 5 212 ? 85.575  47.895  71.412  1.00 40.55  ? 212 ALA B O     1 
ATOM   6948 C CB    . ALA F 5 212 ? 85.871  50.793  70.233  1.00 28.88  ? 212 ALA B CB    1 
ATOM   6949 N N     . LEU F 5 213 ? 86.378  47.656  69.326  1.00 18.88  ? 213 LEU B N     1 
ATOM   6950 C CA    . LEU F 5 213 ? 87.062  46.405  69.626  1.00 18.88  ? 213 LEU B CA    1 
ATOM   6951 C C     . LEU F 5 213 ? 88.560  46.634  69.733  1.00 18.88  ? 213 LEU B C     1 
ATOM   6952 O O     . LEU F 5 213 ? 89.087  47.598  69.186  1.00 18.88  ? 213 LEU B O     1 
ATOM   6953 C CB    . LEU F 5 213 ? 86.781  45.372  68.532  1.00 12.23  ? 213 LEU B CB    1 
ATOM   6954 C CG    . LEU F 5 213 ? 85.318  45.055  68.222  1.00 12.23  ? 213 LEU B CG    1 
ATOM   6955 C CD1   . LEU F 5 213 ? 85.243  43.960  67.173  1.00 12.23  ? 213 LEU B CD1   1 
ATOM   6956 C CD2   . LEU F 5 213 ? 84.613  44.623  69.493  1.00 12.23  ? 213 LEU B CD2   1 
ATOM   6957 N N     . SER F 5 214 ? 89.240  45.747  70.448  1.00 31.97  ? 214 SER B N     1 
ATOM   6958 C CA    . SER F 5 214 ? 90.683  45.843  70.614  1.00 31.97  ? 214 SER B CA    1 
ATOM   6959 C C     . SER F 5 214 ? 91.332  45.323  69.340  1.00 31.97  ? 214 SER B C     1 
ATOM   6960 O O     . SER F 5 214 ? 90.738  44.521  68.625  1.00 31.97  ? 214 SER B O     1 
ATOM   6961 C CB    . SER F 5 214 ? 91.135  44.992  71.797  1.00 34.01  ? 214 SER B CB    1 
ATOM   6962 O OG    . SER F 5 214 ? 91.759  43.805  71.343  1.00 34.01  ? 214 SER B OG    1 
ATOM   6963 N N     . LEU F 5 215 ? 92.548  45.773  69.055  1.00 22.36  ? 215 LEU B N     1 
ATOM   6964 C CA    . LEU F 5 215 ? 93.240  45.326  67.853  1.00 22.36  ? 215 LEU B CA    1 
ATOM   6965 C C     . LEU F 5 215 ? 93.274  43.802  67.799  1.00 22.36  ? 215 LEU B C     1 
ATOM   6966 O O     . LEU F 5 215 ? 93.011  43.200  66.759  1.00 22.36  ? 215 LEU B O     1 
ATOM   6967 C CB    . LEU F 5 215 ? 94.664  45.881  67.824  1.00 34.30  ? 215 LEU B CB    1 
ATOM   6968 C CG    . LEU F 5 215 ? 94.771  47.385  67.562  1.00 34.30  ? 215 LEU B CG    1 
ATOM   6969 C CD1   . LEU F 5 215 ? 96.204  47.837  67.783  1.00 34.30  ? 215 LEU B CD1   1 
ATOM   6970 C CD2   . LEU F 5 215 ? 94.315  47.696  66.140  1.00 34.30  ? 215 LEU B CD2   1 
ATOM   6971 N N     . GLY F 5 216 ? 93.588  43.180  68.930  1.00 27.80  ? 216 GLY B N     1 
ATOM   6972 C CA    . GLY F 5 216 ? 93.643  41.733  68.979  1.00 27.80  ? 216 GLY B CA    1 
ATOM   6973 C C     . GLY F 5 216 ? 92.291  41.104  68.708  1.00 27.80  ? 216 GLY B C     1 
ATOM   6974 O O     . GLY F 5 216 ? 92.202  40.092  68.015  1.00 27.80  ? 216 GLY B O     1 
ATOM   6975 N N     . VAL F 5 217 ? 91.234  41.706  69.247  1.00 24.46  ? 217 VAL B N     1 
ATOM   6976 C CA    . VAL F 5 217 ? 89.886  41.183  69.062  1.00 24.46  ? 217 VAL B CA    1 
ATOM   6977 C C     . VAL F 5 217 ? 89.375  41.460  67.655  1.00 24.46  ? 217 VAL B C     1 
ATOM   6978 O O     . VAL F 5 217 ? 88.647  40.647  67.081  1.00 24.46  ? 217 VAL B O     1 
ATOM   6979 C CB    . VAL F 5 217 ? 88.905  41.791  70.089  1.00 22.43  ? 217 VAL B CB    1 
ATOM   6980 C CG1   . VAL F 5 217 ? 87.472  41.647  69.600  1.00 22.43  ? 217 VAL B CG1   1 
ATOM   6981 C CG2   . VAL F 5 217 ? 89.067  41.094  71.428  1.00 22.43  ? 217 VAL B CG2   1 
ATOM   6982 N N     . THR F 5 218 ? 89.751  42.607  67.100  1.00 33.58  ? 218 THR B N     1 
ATOM   6983 C CA    . THR F 5 218 ? 89.321  42.957  65.755  1.00 33.58  ? 218 THR B CA    1 
ATOM   6984 C C     . THR F 5 218 ? 89.934  41.954  64.790  1.00 33.58  ? 218 THR B C     1 
ATOM   6985 O O     . THR F 5 218 ? 89.321  41.580  63.792  1.00 33.58  ? 218 THR B O     1 
ATOM   6986 C CB    . THR F 5 218 ? 89.774  44.373  65.361  1.00 37.31  ? 218 THR B CB    1 
ATOM   6987 O OG1   . THR F 5 218 ? 91.201  44.453  65.423  1.00 37.31  ? 218 THR B OG1   1 
ATOM   6988 C CG2   . THR F 5 218 ? 89.182  45.397  66.299  1.00 37.31  ? 218 THR B CG2   1 
ATOM   6989 N N     . LYS F 5 219 ? 91.148  41.513  65.098  1.00 26.19  ? 219 LYS B N     1 
ATOM   6990 C CA    . LYS F 5 219 ? 91.831  40.544  64.254  1.00 26.19  ? 219 LYS B CA    1 
ATOM   6991 C C     . LYS F 5 219 ? 91.022  39.255  64.229  1.00 26.19  ? 219 LYS B C     1 
ATOM   6992 O O     . LYS F 5 219 ? 90.904  38.606  63.194  1.00 26.19  ? 219 LYS B O     1 
ATOM   6993 C CB    . LYS F 5 219 ? 93.235  40.263  64.790  1.00 58.93  ? 219 LYS B CB    1 
ATOM   6994 C CG    . LYS F 5 219 ? 94.342  40.526  63.783  1.00 58.93  ? 219 LYS B CG    1 
ATOM   6995 C CD    . LYS F 5 219 ? 95.665  40.821  64.473  1.00 58.93  ? 219 LYS B CD    1 
ATOM   6996 C CE    . LYS F 5 219 ? 96.175  39.606  65.236  1.00 58.93  ? 219 LYS B CE    1 
ATOM   6997 N NZ    . LYS F 5 219 ? 97.533  39.186  64.791  1.00 58.93  ? 219 LYS B NZ    1 
ATOM   6998 N N     . LEU F 5 220 ? 90.459  38.895  65.376  1.00 17.47  ? 220 LEU B N     1 
ATOM   6999 C CA    . LEU F 5 220 ? 89.656  37.683  65.482  1.00 17.47  ? 220 LEU B CA    1 
ATOM   7000 C C     . LEU F 5 220 ? 88.421  37.779  64.591  1.00 17.47  ? 220 LEU B C     1 
ATOM   7001 O O     . LEU F 5 220 ? 88.093  36.843  63.859  1.00 17.47  ? 220 LEU B O     1 
ATOM   7002 C CB    . LEU F 5 220 ? 89.221  37.461  66.933  1.00 15.62  ? 220 LEU B CB    1 
ATOM   7003 C CG    . LEU F 5 220 ? 90.306  37.101  67.950  1.00 15.62  ? 220 LEU B CG    1 
ATOM   7004 C CD1   . LEU F 5 220 ? 89.738  37.215  69.354  1.00 15.62  ? 220 LEU B CD1   1 
ATOM   7005 C CD2   . LEU F 5 220 ? 90.813  35.693  67.692  1.00 15.62  ? 220 LEU B CD2   1 
ATOM   7006 N N     . VAL F 5 221 ? 87.738  38.916  64.659  1.00 30.87  ? 221 VAL B N     1 
ATOM   7007 C CA    . VAL F 5 221 ? 86.538  39.128  63.860  1.00 30.87  ? 221 VAL B CA    1 
ATOM   7008 C C     . VAL F 5 221 ? 86.907  39.180  62.386  1.00 30.87  ? 221 VAL B C     1 
ATOM   7009 O O     . VAL F 5 221 ? 86.211  38.621  61.540  1.00 30.87  ? 221 VAL B O     1 
ATOM   7010 C CB    . VAL F 5 221 ? 85.831  40.447  64.254  1.00 27.76  ? 221 VAL B CB    1 
ATOM   7011 C CG1   . VAL F 5 221 ? 84.769  40.799  63.228  1.00 27.76  ? 221 VAL B CG1   1 
ATOM   7012 C CG2   . VAL F 5 221 ? 85.206  40.309  65.633  1.00 27.76  ? 221 VAL B CG2   1 
ATOM   7013 N N     . GLU F 5 222 ? 88.015  39.848  62.089  1.00 38.46  ? 222 GLU B N     1 
ATOM   7014 C CA    . GLU F 5 222 ? 88.483  39.981  60.719  1.00 38.46  ? 222 GLU B CA    1 
ATOM   7015 C C     . GLU F 5 222 ? 88.722  38.614  60.097  1.00 38.46  ? 222 GLU B C     1 
ATOM   7016 O O     . GLU F 5 222 ? 88.347  38.373  58.951  1.00 38.46  ? 222 GLU B O     1 
ATOM   7017 C CB    . GLU F 5 222 ? 89.772  40.804  60.677  1.00 89.19  ? 222 GLU B CB    1 
ATOM   7018 C CG    . GLU F 5 222 ? 89.628  42.142  59.970  1.00 89.19  ? 222 GLU B CG    1 
ATOM   7019 C CD    . GLU F 5 222 ? 90.350  43.267  60.688  1.00 89.19  ? 222 GLU B CD    1 
ATOM   7020 O OE1   . GLU F 5 222 ? 91.600  43.269  60.692  1.00 89.19  ? 222 GLU B OE1   1 
ATOM   7021 O OE2   . GLU F 5 222 ? 89.666  44.150  61.248  1.00 89.19  ? 222 GLU B OE2   1 
ATOM   7022 N N     . ARG F 5 223 ? 89.345  37.718  60.855  1.00 34.60  ? 223 ARG B N     1 
ATOM   7023 C CA    . ARG F 5 223 ? 89.625  36.375  60.363  1.00 34.60  ? 223 ARG B CA    1 
ATOM   7024 C C     . ARG F 5 223 ? 88.345  35.580  60.108  1.00 34.60  ? 223 ARG B C     1 
ATOM   7025 O O     . ARG F 5 223 ? 88.283  34.776  59.180  1.00 34.60  ? 223 ARG B O     1 
ATOM   7026 C CB    . ARG F 5 223 ? 90.506  35.618  61.357  1.00 33.38  ? 223 ARG B CB    1 
ATOM   7027 C CG    . ARG F 5 223 ? 90.968  34.262  60.850  1.00 33.38  ? 223 ARG B CG    1 
ATOM   7028 C CD    . ARG F 5 223 ? 91.821  33.543  61.879  1.00 33.38  ? 223 ARG B CD    1 
ATOM   7029 N NE    . ARG F 5 223 ? 92.503  32.384  61.308  1.00 33.38  ? 223 ARG B NE    1 
ATOM   7030 C CZ    . ARG F 5 223 ? 92.674  31.228  61.943  1.00 33.38  ? 223 ARG B CZ    1 
ATOM   7031 N NH1   . ARG F 5 223 ? 92.215  31.067  63.177  1.00 33.38  ? 223 ARG B NH1   1 
ATOM   7032 N NH2   . ARG F 5 223 ? 93.310  30.230  61.343  1.00 33.38  ? 223 ARG B NH2   1 
ATOM   7033 N N     . TRP F 5 224 ? 87.326  35.804  60.931  1.00 30.04  ? 224 TRP B N     1 
ATOM   7034 C CA    . TRP F 5 224 ? 86.062  35.095  60.770  1.00 30.04  ? 224 TRP B CA    1 
ATOM   7035 C C     . TRP F 5 224 ? 85.323  35.585  59.532  1.00 30.04  ? 224 TRP B C     1 
ATOM   7036 O O     . TRP F 5 224 ? 84.848  34.786  58.727  1.00 30.04  ? 224 TRP B O     1 
ATOM   7037 C CB    . TRP F 5 224 ? 85.183  35.285  62.007  1.00 22.23  ? 224 TRP B CB    1 
ATOM   7038 C CG    . TRP F 5 224 ? 83.721  35.388  61.696  1.00 22.23  ? 224 TRP B CG    1 
ATOM   7039 C CD1   . TRP F 5 224 ? 82.959  36.518  61.716  1.00 22.23  ? 224 TRP B CD1   1 
ATOM   7040 C CD2   . TRP F 5 224 ? 82.846  34.321  61.309  1.00 22.23  ? 224 TRP B CD2   1 
ATOM   7041 N NE1   . TRP F 5 224 ? 81.665  36.224  61.367  1.00 22.23  ? 224 TRP B NE1   1 
ATOM   7042 C CE2   . TRP F 5 224 ? 81.566  34.882  61.111  1.00 22.23  ? 224 TRP B CE2   1 
ATOM   7043 C CE3   . TRP F 5 224 ? 83.019  32.945  61.110  1.00 22.23  ? 224 TRP B CE3   1 
ATOM   7044 C CZ2   . TRP F 5 224 ? 80.463  34.116  60.725  1.00 22.23  ? 224 TRP B CZ2   1 
ATOM   7045 C CZ3   . TRP F 5 224 ? 81.919  32.182  60.725  1.00 22.23  ? 224 TRP B CZ3   1 
ATOM   7046 C CH2   . TRP F 5 224 ? 80.658  32.772  60.537  1.00 22.23  ? 224 TRP B CH2   1 
ATOM   7047 N N     . ILE F 5 225 ? 85.220  36.902  59.390  1.00 26.50  ? 225 ILE B N     1 
ATOM   7048 C CA    . ILE F 5 225 ? 84.544  37.490  58.242  1.00 26.50  ? 225 ILE B CA    1 
ATOM   7049 C C     . ILE F 5 225 ? 85.110  36.864  56.974  1.00 26.50  ? 225 ILE B C     1 
ATOM   7050 O O     . ILE F 5 225 ? 84.370  36.436  56.091  1.00 26.50  ? 225 ILE B O     1 
ATOM   7051 C CB    . ILE F 5 225 ? 84.762  39.020  58.195  1.00 12.86  ? 225 ILE B CB    1 
ATOM   7052 C CG1   . ILE F 5 225 ? 83.689  39.720  59.030  1.00 12.86  ? 225 ILE B CG1   1 
ATOM   7053 C CG2   . ILE F 5 225 ? 84.706  39.524  56.762  1.00 12.86  ? 225 ILE B CG2   1 
ATOM   7054 C CD1   . ILE F 5 225 ? 84.041  41.142  59.400  1.00 12.86  ? 225 ILE B CD1   1 
ATOM   7055 N N     . SER F 5 226 ? 86.434  36.807  56.905  1.00 29.71  ? 226 SER B N     1 
ATOM   7056 C CA    . SER F 5 226 ? 87.136  36.236  55.763  1.00 29.71  ? 226 SER B CA    1 
ATOM   7057 C C     . SER F 5 226 ? 86.666  34.813  55.459  1.00 29.71  ? 226 SER B C     1 
ATOM   7058 O O     . SER F 5 226 ? 86.025  34.564  54.438  1.00 29.71  ? 226 SER B O     1 
ATOM   7059 C CB    . SER F 5 226 ? 88.643  36.237  56.041  1.00 26.73  ? 226 SER B CB    1 
ATOM   7060 O OG    . SER F 5 226 ? 89.378  35.778  54.922  1.00 26.73  ? 226 SER B OG    1 
ATOM   7061 N N     . VAL F 5 227 ? 86.984  33.886  56.356  1.00 32.95  ? 227 VAL B N     1 
ATOM   7062 C CA    . VAL F 5 227 ? 86.615  32.486  56.190  1.00 32.95  ? 227 VAL B CA    1 
ATOM   7063 C C     . VAL F 5 227 ? 85.111  32.236  56.109  1.00 32.95  ? 227 VAL B C     1 
ATOM   7064 O O     . VAL F 5 227 ? 84.681  31.137  55.759  1.00 32.95  ? 227 VAL B O     1 
ATOM   7065 C CB    . VAL F 5 227 ? 87.182  31.631  57.341  1.00 31.51  ? 227 VAL B CB    1 
ATOM   7066 C CG1   . VAL F 5 227 ? 88.662  31.932  57.529  1.00 31.51  ? 227 VAL B CG1   1 
ATOM   7067 C CG2   . VAL F 5 227 ? 86.422  31.912  58.624  1.00 31.51  ? 227 VAL B CG2   1 
ATOM   7068 N N     . SER F 5 228 ? 84.310  33.244  56.430  1.00 22.38  ? 228 SER B N     1 
ATOM   7069 C CA    . SER F 5 228 ? 82.861  33.084  56.393  1.00 22.38  ? 228 SER B CA    1 
ATOM   7070 C C     . SER F 5 228 ? 82.238  33.739  55.171  1.00 22.38  ? 228 SER B C     1 
ATOM   7071 O O     . SER F 5 228 ? 81.169  33.331  54.717  1.00 22.38  ? 228 SER B O     1 
ATOM   7072 C CB    . SER F 5 228 ? 82.236  33.678  57.650  1.00 21.32  ? 228 SER B CB    1 
ATOM   7073 O OG    . SER F 5 228 ? 82.264  35.094  57.600  1.00 21.32  ? 228 SER B OG    1 
ATOM   7074 N N     . GLY F 5 229 ? 82.906  34.757  54.642  1.00 60.49  ? 229 GLY B N     1 
ATOM   7075 C CA    . GLY F 5 229 ? 82.386  35.448  53.478  1.00 60.49  ? 229 GLY B CA    1 
ATOM   7076 C C     . GLY F 5 229 ? 81.018  36.061  53.714  1.00 60.49  ? 229 GLY B C     1 
ATOM   7077 O O     . GLY F 5 229 ? 80.168  36.052  52.825  1.00 60.49  ? 229 GLY B O     1 
ATOM   7078 N N     . VAL F 5 230 ? 80.800  36.592  54.914  1.00 35.26  ? 230 VAL B N     1 
ATOM   7079 C CA    . VAL F 5 230 ? 79.523  37.218  55.248  1.00 35.26  ? 230 VAL B CA    1 
ATOM   7080 C C     . VAL F 5 230 ? 79.482  38.622  54.662  1.00 35.26  ? 230 VAL B C     1 
ATOM   7081 O O     . VAL F 5 230 ? 78.413  39.211  54.498  1.00 35.26  ? 230 VAL B O     1 
ATOM   7082 C CB    . VAL F 5 230 ? 79.321  37.326  56.775  1.00 30.25  ? 230 VAL B CB    1 
ATOM   7083 C CG1   . VAL F 5 230 ? 78.825  36.001  57.330  1.00 30.25  ? 230 VAL B CG1   1 
ATOM   7084 C CG2   . VAL F 5 230 ? 80.622  37.738  57.443  1.00 30.25  ? 230 VAL B CG2   1 
ATOM   7085 N N     . ALA F 5 231 ? 80.660  39.149  54.347  1.00 42.37  ? 231 ALA B N     1 
ATOM   7086 C CA    . ALA F 5 231 ? 80.782  40.483  53.782  1.00 42.37  ? 231 ALA B CA    1 
ATOM   7087 C C     . ALA F 5 231 ? 80.294  40.514  52.338  1.00 42.37  ? 231 ALA B C     1 
ATOM   7088 O O     . ALA F 5 231 ? 80.381  41.543  51.669  1.00 42.37  ? 231 ALA B O     1 
ATOM   7089 C CB    . ALA F 5 231 ? 82.231  40.946  53.855  1.00 27.12  ? 231 ALA B CB    1 
ATOM   7090 N N     . ASP F 5 232 ? 79.786  39.381  51.861  1.00 65.81  ? 232 ASP B N     1 
ATOM   7091 C CA    . ASP F 5 232 ? 79.272  39.279  50.499  1.00 65.81  ? 232 ASP B CA    1 
ATOM   7092 C C     . ASP F 5 232 ? 78.078  40.210  50.353  1.00 65.81  ? 232 ASP B C     1 
ATOM   7093 O O     . ASP F 5 232 ? 77.700  40.595  49.246  1.00 65.81  ? 232 ASP B O     1 
ATOM   7094 C CB    . ASP F 5 232 ? 78.836  37.843  50.201  1.00 85.80  ? 232 ASP B CB    1 
ATOM   7095 C CG    . ASP F 5 232 ? 79.947  37.011  49.595  1.00 85.80  ? 232 ASP B CG    1 
ATOM   7096 O OD1   . ASP F 5 232 ? 80.926  37.599  49.091  1.00 85.80  ? 232 ASP B OD1   1 
ATOM   7097 O OD2   . ASP F 5 232 ? 79.840  35.768  49.623  1.00 85.80  ? 232 ASP B OD2   1 
ATOM   7098 N N     . ASP F 5 233 ? 77.491  40.563  51.490  1.00 46.21  ? 233 ASP B N     1 
ATOM   7099 C CA    . ASP F 5 233 ? 76.335  41.446  51.538  1.00 46.21  ? 233 ASP B CA    1 
ATOM   7100 C C     . ASP F 5 233 ? 76.412  42.251  52.832  1.00 46.21  ? 233 ASP B C     1 
ATOM   7101 O O     . ASP F 5 233 ? 76.323  41.690  53.923  1.00 46.21  ? 233 ASP B O     1 
ATOM   7102 C CB    . ASP F 5 233 ? 75.049  40.616  51.510  1.00 46.20  ? 233 ASP B CB    1 
ATOM   7103 C CG    . ASP F 5 233 ? 73.804  41.464  51.333  1.00 46.20  ? 233 ASP B CG    1 
ATOM   7104 O OD1   . ASP F 5 233 ? 73.807  42.637  51.763  1.00 46.20  ? 233 ASP B OD1   1 
ATOM   7105 O OD2   . ASP F 5 233 ? 72.817  40.953  50.762  1.00 46.20  ? 233 ASP B OD2   1 
ATOM   7106 N N     . PRO F 5 234 ? 76.590  43.577  52.729  1.00 34.54  ? 234 PRO B N     1 
ATOM   7107 C CA    . PRO F 5 234 ? 76.675  44.428  53.923  1.00 34.54  ? 234 PRO B CA    1 
ATOM   7108 C C     . PRO F 5 234 ? 75.398  44.438  54.760  1.00 34.54  ? 234 PRO B C     1 
ATOM   7109 O O     . PRO F 5 234 ? 75.333  45.095  55.798  1.00 34.54  ? 234 PRO B O     1 
ATOM   7110 C CB    . PRO F 5 234 ? 77.011  45.811  53.362  1.00 43.85  ? 234 PRO B CB    1 
ATOM   7111 C CG    . PRO F 5 234 ? 76.549  45.771  51.948  1.00 43.85  ? 234 PRO B CG    1 
ATOM   7112 C CD    . PRO F 5 234 ? 76.727  44.354  51.486  1.00 43.85  ? 234 PRO B CD    1 
ATOM   7113 N N     . ASN F 5 235 ? 74.384  43.713  54.299  1.00 27.81  ? 235 ASN B N     1 
ATOM   7114 C CA    . ASN F 5 235 ? 73.115  43.622  55.013  1.00 27.81  ? 235 ASN B CA    1 
ATOM   7115 C C     . ASN F 5 235 ? 73.064  42.275  55.723  1.00 27.81  ? 235 ASN B C     1 
ATOM   7116 O O     . ASN F 5 235 ? 72.108  41.960  56.429  1.00 27.81  ? 235 ASN B O     1 
ATOM   7117 C CB    . ASN F 5 235 ? 71.944  43.748  54.035  1.00 48.83  ? 235 ASN B CB    1 
ATOM   7118 C CG    . ASN F 5 235 ? 71.608  45.192  53.711  1.00 48.83  ? 235 ASN B CG    1 
ATOM   7119 O OD1   . ASN F 5 235 ? 71.420  46.014  54.607  1.00 48.83  ? 235 ASN B OD1   1 
ATOM   7120 N ND2   . ASN F 5 235 ? 71.532  45.508  52.425  1.00 48.83  ? 235 ASN B ND2   1 
ATOM   7121 N N     . ASN F 5 236 ? 74.111  41.485  55.516  1.00 36.26  ? 236 ASN B N     1 
ATOM   7122 C CA    . ASN F 5 236 ? 74.227  40.171  56.131  1.00 36.26  ? 236 ASN B CA    1 
ATOM   7123 C C     . ASN F 5 236 ? 74.522  40.343  57.612  1.00 36.26  ? 236 ASN B C     1 
ATOM   7124 O O     . ASN F 5 236 ? 75.091  41.351  58.030  1.00 36.26  ? 236 ASN B O     1 
ATOM   7125 C CB    . ASN F 5 236 ? 75.372  39.388  55.489  1.00 24.80  ? 236 ASN B CB    1 
ATOM   7126 C CG    . ASN F 5 236 ? 74.904  38.466  54.387  1.00 24.80  ? 236 ASN B CG    1 
ATOM   7127 O OD1   . ASN F 5 236 ? 73.734  38.095  54.327  1.00 24.80  ? 236 ASN B OD1   1 
ATOM   7128 N ND2   . ASN F 5 236 ? 75.822  38.087  53.506  1.00 24.80  ? 236 ASN B ND2   1 
ATOM   7129 N N     . TYR F 5 237 ? 74.133  39.355  58.406  1.00 32.37  ? 237 TYR B N     1 
ATOM   7130 C CA    . TYR F 5 237 ? 74.376  39.403  59.839  1.00 32.37  ? 237 TYR B CA    1 
ATOM   7131 C C     . TYR F 5 237 ? 75.825  38.996  60.089  1.00 32.37  ? 237 TYR B C     1 
ATOM   7132 O O     . TYR F 5 237 ? 76.292  37.992  59.559  1.00 32.37  ? 237 TYR B O     1 
ATOM   7133 C CB    . TYR F 5 237 ? 73.429  38.441  60.563  1.00 26.80  ? 237 TYR B CB    1 
ATOM   7134 C CG    . TYR F 5 237 ? 71.991  38.915  60.632  1.00 26.80  ? 237 TYR B CG    1 
ATOM   7135 C CD1   . TYR F 5 237 ? 71.652  40.083  61.317  1.00 26.80  ? 237 TYR B CD1   1 
ATOM   7136 C CD2   . TYR F 5 237 ? 70.968  38.191  60.021  1.00 26.80  ? 237 TYR B CD2   1 
ATOM   7137 C CE1   . TYR F 5 237 ? 70.329  40.518  61.392  1.00 26.80  ? 237 TYR B CE1   1 
ATOM   7138 C CE2   . TYR F 5 237 ? 69.639  38.620  60.091  1.00 26.80  ? 237 TYR B CE2   1 
ATOM   7139 C CZ    . TYR F 5 237 ? 69.330  39.784  60.777  1.00 26.80  ? 237 TYR B CZ    1 
ATOM   7140 O OH    . TYR F 5 237 ? 68.029  40.225  60.850  1.00 26.80  ? 237 TYR B OH    1 
ATOM   7141 N N     . LEU F 5 238 ? 76.545  39.778  60.883  1.00 41.16  ? 238 LEU B N     1 
ATOM   7142 C CA    . LEU F 5 238 ? 77.935  39.456  61.171  1.00 41.16  ? 238 LEU B CA    1 
ATOM   7143 C C     . LEU F 5 238 ? 78.125  37.974  61.477  1.00 41.16  ? 238 LEU B C     1 
ATOM   7144 O O     . LEU F 5 238 ? 79.077  37.358  61.000  1.00 41.16  ? 238 LEU B O     1 
ATOM   7145 C CB    . LEU F 5 238 ? 78.438  40.283  62.352  1.00 16.56  ? 238 LEU B CB    1 
ATOM   7146 C CG    . LEU F 5 238 ? 79.879  40.010  62.784  1.00 16.56  ? 238 LEU B CG    1 
ATOM   7147 C CD1   . LEU F 5 238 ? 80.812  40.072  61.585  1.00 16.56  ? 238 LEU B CD1   1 
ATOM   7148 C CD2   . LEU F 5 238 ? 80.286  41.033  63.822  1.00 16.56  ? 238 LEU B CD2   1 
ATOM   7149 N N     . PHE F 5 239 ? 77.217  37.404  62.266  1.00 33.70  ? 239 PHE B N     1 
ATOM   7150 C CA    . PHE F 5 239 ? 77.301  35.993  62.636  1.00 33.70  ? 239 PHE B CA    1 
ATOM   7151 C C     . PHE F 5 239 ? 76.212  35.136  62.004  1.00 33.70  ? 239 PHE B C     1 
ATOM   7152 O O     . PHE F 5 239 ? 75.039  35.501  62.001  1.00 33.70  ? 239 PHE B O     1 
ATOM   7153 C CB    . PHE F 5 239 ? 77.243  35.843  64.158  1.00 16.63  ? 239 PHE B CB    1 
ATOM   7154 C CG    . PHE F 5 239 ? 78.443  36.399  64.864  1.00 16.63  ? 239 PHE B CG    1 
ATOM   7155 C CD1   . PHE F 5 239 ? 79.672  35.754  64.782  1.00 16.63  ? 239 PHE B CD1   1 
ATOM   7156 C CD2   . PHE F 5 239 ? 78.354  37.583  65.586  1.00 16.63  ? 239 PHE B CD2   1 
ATOM   7157 C CE1   . PHE F 5 239 ? 80.795  36.284  65.407  1.00 16.63  ? 239 PHE B CE1   1 
ATOM   7158 C CE2   . PHE F 5 239 ? 79.472  38.119  66.214  1.00 16.63  ? 239 PHE B CE2   1 
ATOM   7159 C CZ    . PHE F 5 239 ? 80.694  37.470  66.124  1.00 16.63  ? 239 PHE B CZ    1 
ATOM   7160 N N     . CYS F 5 240 ? 76.617  33.987  61.476  1.00 19.93  ? 240 CYS B N     1 
ATOM   7161 C CA    . CYS F 5 240 ? 75.696  33.059  60.835  1.00 19.93  ? 240 CYS B CA    1 
ATOM   7162 C C     . CYS F 5 240 ? 76.049  31.645  61.269  1.00 19.93  ? 240 CYS B C     1 
ATOM   7163 O O     . CYS F 5 240 ? 76.953  31.449  62.079  1.00 19.93  ? 240 CYS B O     1 
ATOM   7164 C CB    . CYS F 5 240 ? 75.817  33.168  59.317  1.00 34.63  ? 240 CYS B CB    1 
ATOM   7165 S SG    . CYS F 5 240 ? 77.370  32.514  58.678  1.00 34.63  ? 240 CYS B SG    1 
ATOM   7166 N N     . ARG F 5 241 ? 75.345  30.657  60.730  1.00 22.32  ? 241 ARG B N     1 
ATOM   7167 C CA    . ARG F 5 241 ? 75.630  29.278  61.090  1.00 22.32  ? 241 ARG B CA    1 
ATOM   7168 C C     . ARG F 5 241 ? 76.699  28.684  60.190  1.00 22.32  ? 241 ARG B C     1 
ATOM   7169 O O     . ARG F 5 241 ? 76.969  29.187  59.103  1.00 22.32  ? 241 ARG B O     1 
ATOM   7170 C CB    . ARG F 5 241 ? 74.363  28.424  61.023  1.00 30.72  ? 241 ARG B CB    1 
ATOM   7171 C CG    . ARG F 5 241 ? 73.590  28.529  59.728  1.00 30.72  ? 241 ARG B CG    1 
ATOM   7172 C CD    . ARG F 5 241 ? 72.217  27.896  59.874  1.00 30.72  ? 241 ARG B CD    1 
ATOM   7173 N NE    . ARG F 5 241 ? 72.287  26.449  60.071  1.00 30.72  ? 241 ARG B NE    1 
ATOM   7174 C CZ    . ARG F 5 241 ? 71.214  25.670  60.179  1.00 30.72  ? 241 ARG B CZ    1 
ATOM   7175 N NH1   . ARG F 5 241 ? 70.006  26.208  60.110  1.00 30.72  ? 241 ARG B NH1   1 
ATOM   7176 N NH2   . ARG F 5 241 ? 71.341  24.360  60.342  1.00 30.72  ? 241 ARG B NH2   1 
ATOM   7177 N N     . VAL F 5 242 ? 77.310  27.610  60.668  1.00 20.92  ? 242 VAL B N     1 
ATOM   7178 C CA    . VAL F 5 242 ? 78.354  26.912  59.939  1.00 20.92  ? 242 VAL B CA    1 
ATOM   7179 C C     . VAL F 5 242 ? 78.022  25.430  60.030  1.00 20.92  ? 242 VAL B C     1 
ATOM   7180 O O     . VAL F 5 242 ? 78.066  24.842  61.111  1.00 20.92  ? 242 VAL B O     1 
ATOM   7181 C CB    . VAL F 5 242 ? 79.732  27.167  60.571  1.00 15.01  ? 242 VAL B CB    1 
ATOM   7182 C CG1   . VAL F 5 242 ? 80.820  26.561  59.705  1.00 15.01  ? 242 VAL B CG1   1 
ATOM   7183 C CG2   . VAL F 5 242 ? 79.955  28.658  60.739  1.00 15.01  ? 242 VAL B CG2   1 
ATOM   7184 N N     . ARG F 5 243 ? 77.678  24.831  58.895  1.00 23.59  ? 243 ARG B N     1 
ATOM   7185 C CA    . ARG F 5 243 ? 77.307  23.425  58.868  1.00 23.59  ? 243 ARG B CA    1 
ATOM   7186 C C     . ARG F 5 243 ? 78.474  22.472  59.108  1.00 23.59  ? 243 ARG B C     1 
ATOM   7187 O O     . ARG F 5 243 ? 79.623  22.892  59.237  1.00 23.59  ? 243 ARG B O     1 
ATOM   7188 C CB    . ARG F 5 243 ? 76.611  23.099  57.544  1.00 42.19  ? 243 ARG B CB    1 
ATOM   7189 C CG    . ARG F 5 243 ? 75.099  22.932  57.681  1.00 42.19  ? 243 ARG B CG    1 
ATOM   7190 C CD    . ARG F 5 243 ? 74.329  23.774  56.668  1.00 42.19  ? 243 ARG B CD    1 
ATOM   7191 N NE    . ARG F 5 243 ? 72.901  23.884  56.983  1.00 42.19  ? 243 ARG B NE    1 
ATOM   7192 C CZ    . ARG F 5 243 ? 72.095  22.852  57.233  1.00 42.19  ? 243 ARG B CZ    1 
ATOM   7193 N NH1   . ARG F 5 243 ? 72.564  21.611  57.212  1.00 42.19  ? 243 ARG B NH1   1 
ATOM   7194 N NH2   . ARG F 5 243 ? 70.811  23.060  57.497  1.00 42.19  ? 243 ARG B NH2   1 
ATOM   7195 N N     . LYS F 5 244 ? 78.158  21.185  59.176  1.00 32.61  ? 244 LYS B N     1 
ATOM   7196 C CA    . LYS F 5 244 ? 79.149  20.143  59.420  1.00 32.61  ? 244 LYS B CA    1 
ATOM   7197 C C     . LYS F 5 244 ? 80.412  20.268  58.575  1.00 32.61  ? 244 LYS B C     1 
ATOM   7198 O O     . LYS F 5 244 ? 81.523  20.137  59.089  1.00 32.61  ? 244 LYS B O     1 
ATOM   7199 C CB    . LYS F 5 244 ? 78.522  18.763  59.193  1.00 77.17  ? 244 LYS B CB    1 
ATOM   7200 C CG    . LYS F 5 244 ? 77.213  18.787  58.414  1.00 77.17  ? 244 LYS B CG    1 
ATOM   7201 C CD    . LYS F 5 244 ? 77.081  17.575  57.504  1.00 77.17  ? 244 LYS B CD    1 
ATOM   7202 C CE    . LYS F 5 244 ? 76.783  16.313  58.300  1.00 77.17  ? 244 LYS B CE    1 
ATOM   7203 N NZ    . LYS F 5 244 ? 77.039  15.078  57.505  1.00 77.17  ? 244 LYS B NZ    1 
ATOM   7204 N N     . ASN F 5 245 ? 80.243  20.518  57.281  1.00 34.97  ? 245 ASN B N     1 
ATOM   7205 C CA    . ASN F 5 245 ? 81.385  20.632  56.380  1.00 34.97  ? 245 ASN B CA    1 
ATOM   7206 C C     . ASN F 5 245 ? 82.140  21.946  56.526  1.00 34.97  ? 245 ASN B C     1 
ATOM   7207 O O     . ASN F 5 245 ? 82.894  22.336  55.636  1.00 34.97  ? 245 ASN B O     1 
ATOM   7208 C CB    . ASN F 5 245 ? 80.929  20.469  54.932  1.00 30.78  ? 245 ASN B CB    1 
ATOM   7209 C CG    . ASN F 5 245 ? 79.879  21.479  54.539  1.00 30.78  ? 245 ASN B CG    1 
ATOM   7210 O OD1   . ASN F 5 245 ? 79.843  22.590  55.064  1.00 30.78  ? 245 ASN B OD1   1 
ATOM   7211 N ND2   . ASN F 5 245 ? 79.013  21.098  53.610  1.00 30.78  ? 245 ASN B ND2   1 
ATOM   7212 N N     . GLY F 5 246 ? 81.936  22.629  57.645  1.00 32.96  ? 246 GLY B N     1 
ATOM   7213 C CA    . GLY F 5 246 ? 82.619  23.889  57.876  1.00 32.96  ? 246 GLY B CA    1 
ATOM   7214 C C     . GLY F 5 246 ? 82.290  24.965  56.862  1.00 32.96  ? 246 GLY B C     1 
ATOM   7215 O O     . GLY F 5 246 ? 83.096  25.859  56.620  1.00 32.96  ? 246 GLY B O     1 
ATOM   7216 N N     . VAL F 5 247 ? 81.105  24.886  56.267  1.00 21.85  ? 247 VAL B N     1 
ATOM   7217 C CA    . VAL F 5 247 ? 80.690  25.875  55.282  1.00 21.85  ? 247 VAL B CA    1 
ATOM   7218 C C     . VAL F 5 247 ? 79.727  26.868  55.906  1.00 21.85  ? 247 VAL B C     1 
ATOM   7219 O O     . VAL F 5 247 ? 78.668  26.486  56.408  1.00 21.85  ? 247 VAL B O     1 
ATOM   7220 C CB    . VAL F 5 247 ? 79.998  25.216  54.073  1.00 24.57  ? 247 VAL B CB    1 
ATOM   7221 C CG1   . VAL F 5 247 ? 79.219  26.258  53.279  1.00 24.57  ? 247 VAL B CG1   1 
ATOM   7222 C CG2   . VAL F 5 247 ? 81.034  24.549  53.192  1.00 24.57  ? 247 VAL B CG2   1 
ATOM   7223 N N     . ALA F 5 248 ? 80.101  28.143  55.866  1.00 35.57  ? 248 ALA B N     1 
ATOM   7224 C CA    . ALA F 5 248 ? 79.276  29.206  56.425  1.00 35.57  ? 248 ALA B CA    1 
ATOM   7225 C C     . ALA F 5 248 ? 77.975  29.364  55.641  1.00 35.57  ? 248 ALA B C     1 
ATOM   7226 O O     . ALA F 5 248 ? 77.905  29.032  54.458  1.00 35.57  ? 248 ALA B O     1 
ATOM   7227 C CB    . ALA F 5 248 ? 80.050  30.517  56.425  1.00 18.83  ? 248 ALA B CB    1 
ATOM   7228 N N     . ALA F 5 249 ? 76.948  29.874  56.309  1.00 30.17  ? 249 ALA B N     1 
ATOM   7229 C CA    . ALA F 5 249 ? 75.651  30.080  55.682  1.00 30.17  ? 249 ALA B CA    1 
ATOM   7230 C C     . ALA F 5 249 ? 75.141  31.481  56.003  1.00 30.17  ? 249 ALA B C     1 
ATOM   7231 O O     . ALA F 5 249 ? 74.168  31.643  56.739  1.00 30.17  ? 249 ALA B O     1 
ATOM   7232 C CB    . ALA F 5 249 ? 74.663  29.036  56.183  1.00 7.69   ? 249 ALA B CB    1 
ATOM   7233 N N     . PRO F 5 250 ? 75.792  32.515  55.445  1.00 33.47  ? 250 PRO B N     1 
ATOM   7234 C CA    . PRO F 5 250 ? 75.382  33.901  55.693  1.00 33.47  ? 250 PRO B CA    1 
ATOM   7235 C C     . PRO F 5 250 ? 73.933  34.170  55.305  1.00 33.47  ? 250 PRO B C     1 
ATOM   7236 O O     . PRO F 5 250 ? 73.332  33.416  54.537  1.00 33.47  ? 250 PRO B O     1 
ATOM   7237 C CB    . PRO F 5 250 ? 76.360  34.726  54.856  1.00 32.55  ? 250 PRO B CB    1 
ATOM   7238 C CG    . PRO F 5 250 ? 77.527  33.823  54.621  1.00 32.55  ? 250 PRO B CG    1 
ATOM   7239 C CD    . PRO F 5 250 ? 76.951  32.442  54.540  1.00 32.55  ? 250 PRO B CD    1 
ATOM   7240 N N     . SER F 5 251 ? 73.375  35.250  55.841  1.00 35.08  ? 251 SER B N     1 
ATOM   7241 C CA    . SER F 5 251 ? 71.999  35.621  55.547  1.00 35.08  ? 251 SER B CA    1 
ATOM   7242 C C     . SER F 5 251 ? 71.706  37.023  56.058  1.00 35.08  ? 251 SER B C     1 
ATOM   7243 O O     . SER F 5 251 ? 72.243  37.444  57.081  1.00 35.08  ? 251 SER B O     1 
ATOM   7244 C CB    . SER F 5 251 ? 71.034  34.627  56.193  1.00 37.23  ? 251 SER B CB    1 
ATOM   7245 O OG    . SER F 5 251 ? 69.703  35.112  56.145  1.00 37.23  ? 251 SER B OG    1 
ATOM   7246 N N     . ALA F 5 252 ? 70.857  37.748  55.338  1.00 43.61  ? 252 ALA B N     1 
ATOM   7247 C CA    . ALA F 5 252 ? 70.497  39.101  55.733  1.00 43.61  ? 252 ALA B CA    1 
ATOM   7248 C C     . ALA F 5 252 ? 69.094  39.105  56.316  1.00 43.61  ? 252 ALA B C     1 
ATOM   7249 O O     . ALA F 5 252 ? 68.628  40.122  56.829  1.00 43.61  ? 252 ALA B O     1 
ATOM   7250 C CB    . ALA F 5 252 ? 70.569  40.032  54.538  1.00 12.35  ? 252 ALA B CB    1 
ATOM   7251 N N     . THR F 5 253 ? 68.425  37.959  56.233  1.00 40.70  ? 253 THR B N     1 
ATOM   7252 C CA    . THR F 5 253 ? 67.072  37.820  56.755  1.00 40.70  ? 253 THR B CA    1 
ATOM   7253 C C     . THR F 5 253 ? 67.087  37.163  58.133  1.00 40.70  ? 253 THR B C     1 
ATOM   7254 O O     . THR F 5 253 ? 66.800  37.810  59.139  1.00 40.70  ? 253 THR B O     1 
ATOM   7255 C CB    . THR F 5 253 ? 66.197  36.977  55.811  1.00 50.30  ? 253 THR B CB    1 
ATOM   7256 O OG1   . THR F 5 253 ? 66.908  35.793  55.431  1.00 50.30  ? 253 THR B OG1   1 
ATOM   7257 C CG2   . THR F 5 253 ? 65.847  37.771  54.563  1.00 50.30  ? 253 THR B CG2   1 
ATOM   7258 N N     . SER F 5 254 ? 67.421  35.878  58.178  1.00 39.43  ? 254 SER B N     1 
ATOM   7259 C CA    . SER F 5 254 ? 67.478  35.157  59.444  1.00 39.43  ? 254 SER B CA    1 
ATOM   7260 C C     . SER F 5 254 ? 68.839  35.354  60.102  1.00 39.43  ? 254 SER B C     1 
ATOM   7261 O O     . SER F 5 254 ? 69.846  35.542  59.423  1.00 39.43  ? 254 SER B O     1 
ATOM   7262 C CB    . SER F 5 254 ? 67.228  33.667  59.215  1.00 47.30  ? 254 SER B CB    1 
ATOM   7263 O OG    . SER F 5 254 ? 68.320  33.074  58.538  1.00 47.30  ? 254 SER B OG    1 
ATOM   7264 N N     . GLN F 5 255 ? 68.864  35.305  61.428  1.00 37.06  ? 255 GLN B N     1 
ATOM   7265 C CA    . GLN F 5 255 ? 70.100  35.490  62.175  1.00 37.06  ? 255 GLN B CA    1 
ATOM   7266 C C     . GLN F 5 255 ? 70.335  34.313  63.106  1.00 37.06  ? 255 GLN B C     1 
ATOM   7267 O O     . GLN F 5 255 ? 69.393  33.621  63.489  1.00 37.06  ? 255 GLN B O     1 
ATOM   7268 C CB    . GLN F 5 255 ? 70.021  36.773  62.998  1.00 34.49  ? 255 GLN B CB    1 
ATOM   7269 C CG    . GLN F 5 255 ? 68.811  36.819  63.906  1.00 34.49  ? 255 GLN B CG    1 
ATOM   7270 C CD    . GLN F 5 255 ? 68.696  38.123  64.661  1.00 34.49  ? 255 GLN B CD    1 
ATOM   7271 O OE1   . GLN F 5 255 ? 68.451  39.175  64.071  1.00 34.49  ? 255 GLN B OE1   1 
ATOM   7272 N NE2   . GLN F 5 255 ? 68.869  38.061  65.978  1.00 34.49  ? 255 GLN B NE2   1 
ATOM   7273 N N     . LEU F 5 256 ? 71.593  34.092  63.470  1.00 15.89  ? 256 LEU B N     1 
ATOM   7274 C CA    . LEU F 5 256 ? 71.943  33.000  64.367  1.00 15.89  ? 256 LEU B CA    1 
ATOM   7275 C C     . LEU F 5 256 ? 71.087  33.099  65.626  1.00 15.89  ? 256 LEU B C     1 
ATOM   7276 O O     . LEU F 5 256 ? 71.025  34.147  66.262  1.00 15.89  ? 256 LEU B O     1 
ATOM   7277 C CB    . LEU F 5 256 ? 73.428  33.077  64.731  1.00 8.71   ? 256 LEU B CB    1 
ATOM   7278 C CG    . LEU F 5 256 ? 74.056  31.897  65.481  1.00 8.71   ? 256 LEU B CG    1 
ATOM   7279 C CD1   . LEU F 5 256 ? 73.770  30.600  64.746  1.00 8.71   ? 256 LEU B CD1   1 
ATOM   7280 C CD2   . LEU F 5 256 ? 75.553  32.118  65.608  1.00 8.71   ? 256 LEU B CD2   1 
ATOM   7281 N N     . SER F 5 257 ? 70.420  32.008  65.974  1.00 20.63  ? 257 SER B N     1 
ATOM   7282 C CA    . SER F 5 257 ? 69.567  31.987  67.152  1.00 20.63  ? 257 SER B CA    1 
ATOM   7283 C C     . SER F 5 257 ? 70.384  32.226  68.409  1.00 20.63  ? 257 SER B C     1 
ATOM   7284 O O     . SER F 5 257 ? 71.517  31.764  68.515  1.00 20.63  ? 257 SER B O     1 
ATOM   7285 C CB    . SER F 5 257 ? 68.851  30.643  67.263  1.00 22.39  ? 257 SER B CB    1 
ATOM   7286 O OG    . SER F 5 257 ? 69.709  29.661  67.811  1.00 22.39  ? 257 SER B OG    1 
ATOM   7287 N N     . THR F 5 258 ? 69.808  32.957  69.359  1.00 25.89  ? 258 THR B N     1 
ATOM   7288 C CA    . THR F 5 258 ? 70.498  33.239  70.611  1.00 25.89  ? 258 THR B CA    1 
ATOM   7289 C C     . THR F 5 258 ? 70.766  31.927  71.331  1.00 25.89  ? 258 THR B C     1 
ATOM   7290 O O     . THR F 5 258 ? 71.674  31.834  72.155  1.00 25.89  ? 258 THR B O     1 
ATOM   7291 C CB    . THR F 5 258 ? 69.663  34.160  71.529  1.00 29.09  ? 258 THR B CB    1 
ATOM   7292 O OG1   . THR F 5 258 ? 68.314  33.681  71.595  1.00 29.09  ? 258 THR B OG1   1 
ATOM   7293 C CG2   . THR F 5 258 ? 69.666  35.585  70.994  1.00 29.09  ? 258 THR B CG2   1 
ATOM   7294 N N     . ARG F 5 259 ? 69.972  30.910  71.015  1.00 19.96  ? 259 ARG B N     1 
ATOM   7295 C CA    . ARG F 5 259 ? 70.152  29.603  71.631  1.00 19.96  ? 259 ARG B CA    1 
ATOM   7296 C C     . ARG F 5 259 ? 71.493  29.045  71.167  1.00 19.96  ? 259 ARG B C     1 
ATOM   7297 O O     . ARG F 5 259 ? 72.147  28.282  71.883  1.00 19.96  ? 259 ARG B O     1 
ATOM   7298 C CB    . ARG F 5 259 ? 69.025  28.657  71.216  1.00 15.87  ? 259 ARG B CB    1 
ATOM   7299 C CG    . ARG F 5 259 ? 69.047  27.316  71.932  1.00 15.87  ? 259 ARG B CG    1 
ATOM   7300 C CD    . ARG F 5 259 ? 68.587  27.452  73.375  1.00 15.87  ? 259 ARG B CD    1 
ATOM   7301 N NE    . ARG F 5 259 ? 68.835  26.243  74.157  1.00 15.87  ? 259 ARG B NE    1 
ATOM   7302 C CZ    . ARG F 5 259 ? 70.035  25.860  74.579  1.00 15.87  ? 259 ARG B CZ    1 
ATOM   7303 N NH1   . ARG F 5 259 ? 71.106  26.592  74.291  1.00 15.87  ? 259 ARG B NH1   1 
ATOM   7304 N NH2   . ARG F 5 259 ? 70.164  24.752  75.301  1.00 15.87  ? 259 ARG B NH2   1 
ATOM   7305 N N     . ALA F 5 260 ? 71.888  29.439  69.960  1.00 28.03  ? 260 ALA B N     1 
ATOM   7306 C CA    . ALA F 5 260 ? 73.144  29.010  69.359  1.00 28.03  ? 260 ALA B CA    1 
ATOM   7307 C C     . ALA F 5 260 ? 74.318  29.723  70.017  1.00 28.03  ? 260 ALA B C     1 
ATOM   7308 O O     . ALA F 5 260 ? 75.372  29.128  70.237  1.00 28.03  ? 260 ALA B O     1 
ATOM   7309 C CB    . ALA F 5 260 ? 73.128  29.301  67.865  1.00 14.78  ? 260 ALA B CB    1 
ATOM   7310 N N     . LEU F 5 261 ? 74.133  31.002  70.322  1.00 19.56  ? 261 LEU B N     1 
ATOM   7311 C CA    . LEU F 5 261 ? 75.180  31.786  70.960  1.00 19.56  ? 261 LEU B CA    1 
ATOM   7312 C C     . LEU F 5 261 ? 75.402  31.302  72.399  1.00 19.56  ? 261 LEU B C     1 
ATOM   7313 O O     . LEU F 5 261 ? 76.532  31.247  72.880  1.00 19.56  ? 261 LEU B O     1 
ATOM   7314 C CB    . LEU F 5 261 ? 74.806  33.274  70.935  1.00 15.59  ? 261 LEU B CB    1 
ATOM   7315 C CG    . LEU F 5 261 ? 74.664  33.899  69.540  1.00 15.59  ? 261 LEU B CG    1 
ATOM   7316 C CD1   . LEU F 5 261 ? 74.345  35.387  69.659  1.00 15.59  ? 261 LEU B CD1   1 
ATOM   7317 C CD2   . LEU F 5 261 ? 75.948  33.692  68.755  1.00 15.59  ? 261 LEU B CD2   1 
ATOM   7318 N N     . GLU F 5 262 ? 74.318  30.948  73.079  1.00 18.71  ? 262 GLU B N     1 
ATOM   7319 C CA    . GLU F 5 262 ? 74.410  30.447  74.445  1.00 18.71  ? 262 GLU B CA    1 
ATOM   7320 C C     . GLU F 5 262 ? 75.145  29.116  74.366  1.00 18.71  ? 262 GLU B C     1 
ATOM   7321 O O     . GLU F 5 262 ? 75.905  28.752  75.265  1.00 18.71  ? 262 GLU B O     1 
ATOM   7322 C CB    . GLU F 5 262 ? 73.014  30.212  75.025  1.00 28.22  ? 262 GLU B CB    1 
ATOM   7323 C CG    . GLU F 5 262 ? 72.459  31.356  75.855  1.00 28.22  ? 262 GLU B CG    1 
ATOM   7324 C CD    . GLU F 5 262 ? 70.989  31.160  76.191  1.00 28.22  ? 262 GLU B CD    1 
ATOM   7325 O OE1   . GLU F 5 262 ? 70.197  30.920  75.258  1.00 28.22  ? 262 GLU B OE1   1 
ATOM   7326 O OE2   . GLU F 5 262 ? 70.622  31.244  77.384  1.00 28.22  ? 262 GLU B OE2   1 
ATOM   7327 N N     . GLY F 5 263 ? 74.899  28.396  73.274  1.00 30.58  ? 263 GLY B N     1 
ATOM   7328 C CA    . GLY F 5 263 ? 75.526  27.105  73.055  1.00 30.58  ? 263 GLY B CA    1 
ATOM   7329 C C     . GLY F 5 263 ? 77.029  27.205  72.903  1.00 30.58  ? 263 GLY B C     1 
ATOM   7330 O O     . GLY F 5 263 ? 77.756  26.289  73.291  1.00 30.58  ? 263 GLY B O     1 
ATOM   7331 N N     . ILE F 5 264 ? 77.501  28.308  72.331  1.00 22.17  ? 264 ILE B N     1 
ATOM   7332 C CA    . ILE F 5 264 ? 78.934  28.506  72.156  1.00 22.17  ? 264 ILE B CA    1 
ATOM   7333 C C     . ILE F 5 264 ? 79.559  28.632  73.542  1.00 22.17  ? 264 ILE B C     1 
ATOM   7334 O O     . ILE F 5 264 ? 80.599  28.041  73.825  1.00 22.17  ? 264 ILE B O     1 
ATOM   7335 C CB    . ILE F 5 264 ? 79.236  29.790  71.345  1.00 17.67  ? 264 ILE B CB    1 
ATOM   7336 C CG1   . ILE F 5 264 ? 78.791  29.606  69.892  1.00 17.67  ? 264 ILE B CG1   1 
ATOM   7337 C CG2   . ILE F 5 264 ? 80.728  30.111  71.402  1.00 17.67  ? 264 ILE B CG2   1 
ATOM   7338 C CD1   . ILE F 5 264 ? 78.926  30.856  69.040  1.00 17.67  ? 264 ILE B CD1   1 
ATOM   7339 N N     . PHE F 5 265 ? 78.904  29.400  74.407  1.00 22.12  ? 265 PHE B N     1 
ATOM   7340 C CA    . PHE F 5 265 ? 79.391  29.604  75.761  1.00 22.12  ? 265 PHE B CA    1 
ATOM   7341 C C     . PHE F 5 265 ? 79.423  28.282  76.518  1.00 22.12  ? 265 PHE B C     1 
ATOM   7342 O O     . PHE F 5 265 ? 80.372  27.998  77.249  1.00 22.12  ? 265 PHE B O     1 
ATOM   7343 C CB    . PHE F 5 265 ? 78.497  30.604  76.499  1.00 17.35  ? 265 PHE B CB    1 
ATOM   7344 C CG    . PHE F 5 265 ? 78.997  32.023  76.444  1.00 17.35  ? 265 PHE B CG    1 
ATOM   7345 C CD1   . PHE F 5 265 ? 80.289  32.338  76.858  1.00 17.35  ? 265 PHE B CD1   1 
ATOM   7346 C CD2   . PHE F 5 265 ? 78.177  33.045  75.977  1.00 17.35  ? 265 PHE B CD2   1 
ATOM   7347 C CE1   . PHE F 5 265 ? 80.757  33.650  76.808  1.00 17.35  ? 265 PHE B CE1   1 
ATOM   7348 C CE2   . PHE F 5 265 ? 78.635  34.363  75.922  1.00 17.35  ? 265 PHE B CE2   1 
ATOM   7349 C CZ    . PHE F 5 265 ? 79.927  34.667  76.339  1.00 17.35  ? 265 PHE B CZ    1 
ATOM   7350 N N     . GLU F 5 266 ? 78.386  27.473  76.336  1.00 41.46  ? 266 GLU B N     1 
ATOM   7351 C CA    . GLU F 5 266 ? 78.300  26.179  77.007  1.00 41.46  ? 266 GLU B CA    1 
ATOM   7352 C C     . GLU F 5 266 ? 79.350  25.202  76.477  1.00 41.46  ? 266 GLU B C     1 
ATOM   7353 O O     . GLU F 5 266 ? 79.990  24.489  77.250  1.00 41.46  ? 266 GLU B O     1 
ATOM   7354 C CB    . GLU F 5 266 ? 76.896  25.589  76.828  1.00 99.99  ? 266 GLU B CB    1 
ATOM   7355 C CG    . GLU F 5 266 ? 76.793  24.100  77.119  1.00 99.99  ? 266 GLU B CG    1 
ATOM   7356 C CD    . GLU F 5 266 ? 75.835  23.392  76.180  1.00 99.99  ? 266 GLU B CD    1 
ATOM   7357 O OE1   . GLU F 5 266 ? 74.629  23.716  76.207  1.00 99.99  ? 266 GLU B OE1   1 
ATOM   7358 O OE2   . GLU F 5 266 ? 76.288  22.512  75.416  1.00 99.99  ? 266 GLU B OE2   1 
ATOM   7359 N N     . ALA F 5 267 ? 79.527  25.179  75.159  1.00 30.26  ? 267 ALA B N     1 
ATOM   7360 C CA    . ALA F 5 267 ? 80.492  24.285  74.529  1.00 30.26  ? 267 ALA B CA    1 
ATOM   7361 C C     . ALA F 5 267 ? 81.931  24.672  74.857  1.00 30.26  ? 267 ALA B C     1 
ATOM   7362 O O     . ALA F 5 267 ? 82.761  23.811  75.149  1.00 30.26  ? 267 ALA B O     1 
ATOM   7363 C CB    . ALA F 5 267 ? 80.288  24.279  73.023  1.00 9.27   ? 267 ALA B CB    1 
ATOM   7364 N N     . THR F 5 268 ? 82.226  25.966  74.805  1.00 27.88  ? 268 THR B N     1 
ATOM   7365 C CA    . THR F 5 268 ? 83.571  26.441  75.101  1.00 27.88  ? 268 THR B CA    1 
ATOM   7366 C C     . THR F 5 268 ? 83.949  26.107  76.538  1.00 27.88  ? 268 THR B C     1 
ATOM   7367 O O     . THR F 5 268 ? 85.128  26.021  76.879  1.00 27.88  ? 268 THR B O     1 
ATOM   7368 C CB    . THR F 5 268 ? 83.689  27.957  74.904  1.00 19.49  ? 268 THR B CB    1 
ATOM   7369 O OG1   . THR F 5 268 ? 83.253  28.303  73.584  1.00 19.49  ? 268 THR B OG1   1 
ATOM   7370 C CG2   . THR F 5 268 ? 85.131  28.399  75.083  1.00 19.49  ? 268 THR B CG2   1 
ATOM   7371 N N     . HIS F 5 269 ? 82.935  25.922  77.376  1.00 25.69  ? 269 HIS B N     1 
ATOM   7372 C CA    . HIS F 5 269 ? 83.145  25.594  78.777  1.00 25.69  ? 269 HIS B CA    1 
ATOM   7373 C C     . HIS F 5 269 ? 83.379  24.095  78.929  1.00 25.69  ? 269 HIS B C     1 
ATOM   7374 O O     . HIS F 5 269 ? 84.249  23.667  79.687  1.00 25.69  ? 269 HIS B O     1 
ATOM   7375 C CB    . HIS F 5 269 ? 81.927  26.022  79.594  1.00 25.68  ? 269 HIS B CB    1 
ATOM   7376 C CG    . HIS F 5 269 ? 82.077  25.802  81.066  1.00 25.68  ? 269 HIS B CG    1 
ATOM   7377 N ND1   . HIS F 5 269 ? 81.565  24.696  81.709  1.00 25.68  ? 269 HIS B ND1   1 
ATOM   7378 C CD2   . HIS F 5 269 ? 82.679  26.548  82.023  1.00 25.68  ? 269 HIS B CD2   1 
ATOM   7379 C CE1   . HIS F 5 269 ? 81.843  24.769  82.998  1.00 25.68  ? 269 HIS B CE1   1 
ATOM   7380 N NE2   . HIS F 5 269 ? 82.518  25.883  83.215  1.00 25.68  ? 269 HIS B NE2   1 
ATOM   7381 N N     . ARG F 5 270 ? 82.593  23.305  78.204  1.00 33.59  ? 270 ARG B N     1 
ATOM   7382 C CA    . ARG F 5 270 ? 82.698  21.849  78.238  1.00 33.59  ? 270 ARG B CA    1 
ATOM   7383 C C     . ARG F 5 270 ? 84.000  21.417  77.577  1.00 33.59  ? 270 ARG B C     1 
ATOM   7384 O O     . ARG F 5 270 ? 84.555  20.364  77.888  1.00 33.59  ? 270 ARG B O     1 
ATOM   7385 C CB    . ARG F 5 270 ? 81.511  21.222  77.498  1.00 35.54  ? 270 ARG B CB    1 
ATOM   7386 C CG    . ARG F 5 270 ? 81.544  19.702  77.407  1.00 35.54  ? 270 ARG B CG    1 
ATOM   7387 C CD    . ARG F 5 270 ? 80.471  19.180  76.453  1.00 35.54  ? 270 ARG B CD    1 
ATOM   7388 N NE    . ARG F 5 270 ? 80.613  19.745  75.113  1.00 35.54  ? 270 ARG B NE    1 
ATOM   7389 C CZ    . ARG F 5 270 ? 79.720  20.543  74.535  1.00 35.54  ? 270 ARG B CZ    1 
ATOM   7390 N NH1   . ARG F 5 270 ? 78.604  20.873  75.174  1.00 35.54  ? 270 ARG B NH1   1 
ATOM   7391 N NH2   . ARG F 5 270 ? 79.946  21.016  73.316  1.00 35.54  ? 270 ARG B NH2   1 
ATOM   7392 N N     . LEU F 5 271 ? 84.481  22.251  76.663  1.00 34.78  ? 271 LEU B N     1 
ATOM   7393 C CA    . LEU F 5 271 ? 85.713  21.988  75.935  1.00 34.78  ? 271 LEU B CA    1 
ATOM   7394 C C     . LEU F 5 271 ? 86.922  22.165  76.847  1.00 34.78  ? 271 LEU B C     1 
ATOM   7395 O O     . LEU F 5 271 ? 88.019  21.713  76.529  1.00 34.78  ? 271 LEU B O     1 
ATOM   7396 C CB    . LEU F 5 271 ? 85.805  22.945  74.740  1.00 10.60  ? 271 LEU B CB    1 
ATOM   7397 C CG    . LEU F 5 271 ? 87.044  23.012  73.843  1.00 10.60  ? 271 LEU B CG    1 
ATOM   7398 C CD1   . LEU F 5 271 ? 88.033  23.982  74.447  1.00 10.60  ? 271 LEU B CD1   1 
ATOM   7399 C CD2   . LEU F 5 271 ? 87.660  21.632  73.663  1.00 10.60  ? 271 LEU B CD2   1 
ATOM   7400 N N     . ILE F 5 272 ? 86.714  22.818  77.986  1.00 30.22  ? 272 ILE B N     1 
ATOM   7401 C CA    . ILE F 5 272 ? 87.796  23.062  78.933  1.00 30.22  ? 272 ILE B CA    1 
ATOM   7402 C C     . ILE F 5 272 ? 87.596  22.384  80.285  1.00 30.22  ? 272 ILE B C     1 
ATOM   7403 O O     . ILE F 5 272 ? 88.568  22.046  80.963  1.00 30.22  ? 272 ILE B O     1 
ATOM   7404 C CB    . ILE F 5 272 ? 87.979  24.575  79.195  1.00 12.89  ? 272 ILE B CB    1 
ATOM   7405 C CG1   . ILE F 5 272 ? 88.346  25.293  77.898  1.00 12.89  ? 272 ILE B CG1   1 
ATOM   7406 C CG2   . ILE F 5 272 ? 89.070  24.797  80.243  1.00 12.89  ? 272 ILE B CG2   1 
ATOM   7407 C CD1   . ILE F 5 272 ? 88.640  26.761  78.093  1.00 12.89  ? 272 ILE B CD1   1 
ATOM   7408 N N     . TYR F 5 273 ? 86.344  22.183  80.682  1.00 25.63  ? 273 TYR B N     1 
ATOM   7409 C CA    . TYR F 5 273 ? 86.064  21.572  81.974  1.00 25.63  ? 273 TYR B CA    1 
ATOM   7410 C C     . TYR F 5 273 ? 85.251  20.293  81.891  1.00 25.63  ? 273 TYR B C     1 
ATOM   7411 O O     . TYR F 5 273 ? 84.949  19.681  82.913  1.00 25.63  ? 273 TYR B O     1 
ATOM   7412 C CB    . TYR F 5 273 ? 85.342  22.573  82.875  1.00 31.24  ? 273 TYR B CB    1 
ATOM   7413 C CG    . TYR F 5 273 ? 86.069  23.888  83.006  1.00 31.24  ? 273 TYR B CG    1 
ATOM   7414 C CD1   . TYR F 5 273 ? 85.831  24.932  82.113  1.00 31.24  ? 273 TYR B CD1   1 
ATOM   7415 C CD2   . TYR F 5 273 ? 87.010  24.084  84.012  1.00 31.24  ? 273 TYR B CD2   1 
ATOM   7416 C CE1   . TYR F 5 273 ? 86.513  26.139  82.220  1.00 31.24  ? 273 TYR B CE1   1 
ATOM   7417 C CE2   . TYR F 5 273 ? 87.698  25.286  84.129  1.00 31.24  ? 273 TYR B CE2   1 
ATOM   7418 C CZ    . TYR F 5 273 ? 87.447  26.308  83.231  1.00 31.24  ? 273 TYR B CZ    1 
ATOM   7419 O OH    . TYR F 5 273 ? 88.130  27.497  83.347  1.00 31.24  ? 273 TYR B OH    1 
ATOM   7420 N N     . GLY F 5 274 ? 84.893  19.893  80.677  1.00 22.68  ? 274 GLY B N     1 
ATOM   7421 C CA    . GLY F 5 274 ? 84.120  18.677  80.514  1.00 22.68  ? 274 GLY B CA    1 
ATOM   7422 C C     . GLY F 5 274 ? 82.653  18.861  80.846  1.00 22.68  ? 274 GLY B C     1 
ATOM   7423 O O     . GLY F 5 274 ? 82.200  19.970  81.125  1.00 22.68  ? 274 GLY B O     1 
ATOM   7424 N N     . ALA F 5 275 ? 81.908  17.762  80.817  1.00 42.49  ? 275 ALA B N     1 
ATOM   7425 C CA    . ALA F 5 275 ? 80.479  17.784  81.099  1.00 42.49  ? 275 ALA B CA    1 
ATOM   7426 C C     . ALA F 5 275 ? 80.170  18.257  82.514  1.00 42.49  ? 275 ALA B C     1 
ATOM   7427 O O     . ALA F 5 275 ? 80.919  17.978  83.450  1.00 42.49  ? 275 ALA B O     1 
ATOM   7428 C CB    . ALA F 5 275 ? 79.889  16.398  80.873  1.00 100.00 ? 275 ALA B CB    1 
ATOM   7429 N N     . LYS F 5 276 ? 79.057  18.971  82.660  1.00 43.91  ? 276 LYS B N     1 
ATOM   7430 C CA    . LYS F 5 276 ? 78.633  19.481  83.959  1.00 43.91  ? 276 LYS B CA    1 
ATOM   7431 C C     . LYS F 5 276 ? 77.877  18.391  84.712  1.00 43.91  ? 276 LYS B C     1 
ATOM   7432 O O     . LYS F 5 276 ? 77.222  17.548  84.101  1.00 43.91  ? 276 LYS B O     1 
ATOM   7433 C CB    . LYS F 5 276 ? 77.730  20.703  83.778  1.00 18.35  ? 276 LYS B CB    1 
ATOM   7434 C CG    . LYS F 5 276 ? 76.682  20.540  82.690  1.00 18.35  ? 276 LYS B CG    1 
ATOM   7435 C CD    . LYS F 5 276 ? 76.123  21.883  82.261  1.00 18.35  ? 276 LYS B CD    1 
ATOM   7436 C CE    . LYS F 5 276 ? 74.607  21.847  82.189  1.00 18.35  ? 276 LYS B CE    1 
ATOM   7437 N NZ    . LYS F 5 276 ? 74.043  23.201  81.957  1.00 18.35  ? 276 LYS B NZ    1 
ATOM   7438 N N     . ASP F 5 277 ? 77.972  18.410  86.038  1.00 51.73  ? 277 ASP B N     1 
ATOM   7439 C CA    . ASP F 5 277 ? 77.296  17.415  86.862  1.00 51.73  ? 277 ASP B CA    1 
ATOM   7440 C C     . ASP F 5 277 ? 75.799  17.397  86.580  1.00 51.73  ? 277 ASP B C     1 
ATOM   7441 O O     . ASP F 5 277 ? 75.246  18.365  86.064  1.00 51.73  ? 277 ASP B O     1 
ATOM   7442 C CB    . ASP F 5 277 ? 77.540  17.693  88.349  1.00 78.45  ? 277 ASP B CB    1 
ATOM   7443 C CG    . ASP F 5 277 ? 77.184  19.112  88.746  1.00 78.45  ? 277 ASP B CG    1 
ATOM   7444 O OD1   . ASP F 5 277 ? 77.258  20.012  87.883  1.00 78.45  ? 277 ASP B OD1   1 
ATOM   7445 O OD2   . ASP F 5 277 ? 76.830  19.327  89.924  1.00 78.45  ? 277 ASP B OD2   1 
ATOM   7446 N N     . ASP F 5 278 ? 75.150  16.287  86.918  1.00 100.00 ? 278 ASP B N     1 
ATOM   7447 C CA    . ASP F 5 278 ? 73.716  16.148  86.698  1.00 100.00 ? 278 ASP B CA    1 
ATOM   7448 C C     . ASP F 5 278 ? 72.923  16.724  87.867  1.00 100.00 ? 278 ASP B C     1 
ATOM   7449 O O     . ASP F 5 278 ? 71.806  16.286  88.148  1.00 100.00 ? 278 ASP B O     1 
ATOM   7450 C CB    . ASP F 5 278 ? 73.347  14.672  86.496  1.00 100.00 ? 278 ASP B CB    1 
ATOM   7451 C CG    . ASP F 5 278 ? 74.151  13.739  87.382  1.00 100.00 ? 278 ASP B CG    1 
ATOM   7452 O OD1   . ASP F 5 278 ? 75.279  13.370  86.990  1.00 100.00 ? 278 ASP B OD1   1 
ATOM   7453 O OD2   . ASP F 5 278 ? 73.656  13.372  88.469  1.00 100.00 ? 278 ASP B OD2   1 
ATOM   7454 N N     . SER F 5 279 ? 73.507  17.708  88.544  1.00 62.86  ? 279 SER B N     1 
ATOM   7455 C CA    . SER F 5 279 ? 72.853  18.347  89.678  1.00 62.86  ? 279 SER B CA    1 
ATOM   7456 C C     . SER F 5 279 ? 71.578  19.065  89.237  1.00 62.86  ? 279 SER B C     1 
ATOM   7457 O O     . SER F 5 279 ? 70.668  19.285  90.038  1.00 62.86  ? 279 SER B O     1 
ATOM   7458 C CB    . SER F 5 279 ? 73.813  19.336  90.349  1.00 47.90  ? 279 SER B CB    1 
ATOM   7459 O OG    . SER F 5 279 ? 73.607  20.660  89.889  1.00 47.90  ? 279 SER B OG    1 
ATOM   7460 N N     . GLY F 5 280 ? 71.515  19.421  87.956  1.00 62.08  ? 280 GLY B N     1 
ATOM   7461 C CA    . GLY F 5 280 ? 70.346  20.108  87.433  1.00 62.08  ? 280 GLY B CA    1 
ATOM   7462 C C     . GLY F 5 280 ? 70.409  21.606  87.650  1.00 62.08  ? 280 GLY B C     1 
ATOM   7463 O O     . GLY F 5 280 ? 69.673  22.367  87.021  1.00 62.08  ? 280 GLY B O     1 
ATOM   7464 N N     . GLN F 5 281 ? 71.299  22.024  88.544  1.00 60.71  ? 281 GLN B N     1 
ATOM   7465 C CA    . GLN F 5 281 ? 71.482  23.433  88.870  1.00 60.71  ? 281 GLN B CA    1 
ATOM   7466 C C     . GLN F 5 281 ? 71.716  24.299  87.638  1.00 60.71  ? 281 GLN B C     1 
ATOM   7467 O O     . GLN F 5 281 ? 72.148  23.816  86.592  1.00 60.71  ? 281 GLN B O     1 
ATOM   7468 C CB    . GLN F 5 281 ? 72.663  23.593  89.828  1.00 100.00 ? 281 GLN B CB    1 
ATOM   7469 C CG    . GLN F 5 281 ? 72.312  24.264  91.140  1.00 100.00 ? 281 GLN B CG    1 
ATOM   7470 C CD    . GLN F 5 281 ? 73.413  24.122  92.170  1.00 100.00 ? 281 GLN B CD    1 
ATOM   7471 O OE1   . GLN F 5 281 ? 73.407  23.191  92.976  1.00 100.00 ? 281 GLN B OE1   1 
ATOM   7472 N NE2   . GLN F 5 281 ? 74.367  25.047  92.149  1.00 100.00 ? 281 GLN B NE2   1 
ATOM   7473 N N     . ARG F 5 282 ? 71.429  25.589  87.777  1.00 34.43  ? 282 ARG B N     1 
ATOM   7474 C CA    . ARG F 5 282 ? 71.609  26.535  86.689  1.00 34.43  ? 282 ARG B CA    1 
ATOM   7475 C C     . ARG F 5 282 ? 72.997  27.158  86.795  1.00 34.43  ? 282 ARG B C     1 
ATOM   7476 O O     . ARG F 5 282 ? 73.632  27.104  87.847  1.00 34.43  ? 282 ARG B O     1 
ATOM   7477 C CB    . ARG F 5 282 ? 70.538  27.627  86.762  1.00 22.13  ? 282 ARG B CB    1 
ATOM   7478 C CG    . ARG F 5 282 ? 70.016  28.089  85.412  1.00 22.13  ? 282 ARG B CG    1 
ATOM   7479 C CD    . ARG F 5 282 ? 68.607  28.658  85.521  1.00 22.13  ? 282 ARG B CD    1 
ATOM   7480 N NE    . ARG F 5 282 ? 67.630  27.852  84.791  1.00 22.13  ? 282 ARG B NE    1 
ATOM   7481 C CZ    . ARG F 5 282 ? 66.538  28.343  84.210  1.00 22.13  ? 282 ARG B CZ    1 
ATOM   7482 N NH1   . ARG F 5 282 ? 66.279  29.640  84.271  1.00 22.13  ? 282 ARG B NH1   1 
ATOM   7483 N NH2   . ARG F 5 282 ? 65.703  27.536  83.571  1.00 22.13  ? 282 ARG B NH2   1 
ATOM   7484 N N     . TYR F 5 283 ? 73.457  27.748  85.697  1.00 34.71  ? 283 TYR B N     1 
ATOM   7485 C CA    . TYR F 5 283 ? 74.764  28.390  85.649  1.00 34.71  ? 283 TYR B CA    1 
ATOM   7486 C C     . TYR F 5 283 ? 75.918  27.477  86.054  1.00 34.71  ? 283 TYR B C     1 
ATOM   7487 O O     . TYR F 5 283 ? 76.842  27.902  86.752  1.00 34.71  ? 283 TYR B O     1 
ATOM   7488 C CB    . TYR F 5 283 ? 74.763  29.639  86.530  1.00 26.75  ? 283 TYR B CB    1 
ATOM   7489 C CG    . TYR F 5 283 ? 73.742  30.669  86.113  1.00 26.75  ? 283 TYR B CG    1 
ATOM   7490 C CD1   . TYR F 5 283 ? 73.736  31.189  84.820  1.00 26.75  ? 283 TYR B CD1   1 
ATOM   7491 C CD2   . TYR F 5 283 ? 72.787  31.133  87.013  1.00 26.75  ? 283 TYR B CD2   1 
ATOM   7492 C CE1   . TYR F 5 283 ? 72.803  32.150  84.433  1.00 26.75  ? 283 TYR B CE1   1 
ATOM   7493 C CE2   . TYR F 5 283 ? 71.850  32.094  86.638  1.00 26.75  ? 283 TYR B CE2   1 
ATOM   7494 C CZ    . TYR F 5 283 ? 71.864  32.598  85.347  1.00 26.75  ? 283 TYR B CZ    1 
ATOM   7495 O OH    . TYR F 5 283 ? 70.943  33.552  84.979  1.00 26.75  ? 283 TYR B OH    1 
ATOM   7496 N N     . LEU F 5 284 ? 75.864  26.223  85.615  1.00 30.26  ? 284 LEU B N     1 
ATOM   7497 C CA    . LEU F 5 284 ? 76.925  25.272  85.915  1.00 30.26  ? 284 LEU B CA    1 
ATOM   7498 C C     . LEU F 5 284 ? 78.018  25.457  84.867  1.00 30.26  ? 284 LEU B C     1 
ATOM   7499 O O     . LEU F 5 284 ? 79.086  24.851  84.944  1.00 30.26  ? 284 LEU B O     1 
ATOM   7500 C CB    . LEU F 5 284 ? 76.392  23.838  85.866  1.00 30.82  ? 284 LEU B CB    1 
ATOM   7501 C CG    . LEU F 5 284 ? 75.609  23.357  87.091  1.00 30.82  ? 284 LEU B CG    1 
ATOM   7502 C CD1   . LEU F 5 284 ? 75.133  21.936  86.859  1.00 30.82  ? 284 LEU B CD1   1 
ATOM   7503 C CD2   . LEU F 5 284 ? 76.482  23.429  88.331  1.00 30.82  ? 284 LEU B CD2   1 
ATOM   7504 N N     . ALA F 5 285 ? 77.726  26.300  83.882  1.00 14.93  ? 285 ALA B N     1 
ATOM   7505 C CA    . ALA F 5 285 ? 78.662  26.603  82.811  1.00 14.93  ? 285 ALA B CA    1 
ATOM   7506 C C     . ALA F 5 285 ? 78.367  28.009  82.304  1.00 14.93  ? 285 ALA B C     1 
ATOM   7507 O O     . ALA F 5 285 ? 77.421  28.652  82.758  1.00 14.93  ? 285 ALA B O     1 
ATOM   7508 C CB    . ALA F 5 285 ? 78.515  25.590  81.680  1.00 8.65   ? 285 ALA B CB    1 
ATOM   7509 N N     . TRP F 5 286 ? 79.172  28.483  81.361  1.00 26.65  ? 286 TRP B N     1 
ATOM   7510 C CA    . TRP F 5 286 ? 78.983  29.817  80.808  1.00 26.65  ? 286 TRP B CA    1 
ATOM   7511 C C     . TRP F 5 286 ? 77.720  29.938  79.968  1.00 26.65  ? 286 TRP B C     1 
ATOM   7512 O O     . TRP F 5 286 ? 77.434  29.090  79.123  1.00 26.65  ? 286 TRP B O     1 
ATOM   7513 C CB    . TRP F 5 286 ? 80.194  30.214  79.963  1.00 22.12  ? 286 TRP B CB    1 
ATOM   7514 C CG    . TRP F 5 286 ? 81.448  30.354  80.758  1.00 22.12  ? 286 TRP B CG    1 
ATOM   7515 C CD1   . TRP F 5 286 ? 81.568  30.882  82.009  1.00 22.12  ? 286 TRP B CD1   1 
ATOM   7516 C CD2   . TRP F 5 286 ? 82.763  29.948  80.365  1.00 22.12  ? 286 TRP B CD2   1 
ATOM   7517 N NE1   . TRP F 5 286 ? 82.876  30.830  82.421  1.00 22.12  ? 286 TRP B NE1   1 
ATOM   7518 C CE2   . TRP F 5 286 ? 83.631  30.261  81.431  1.00 22.12  ? 286 TRP B CE2   1 
ATOM   7519 C CE3   . TRP F 5 286 ? 83.291  29.349  79.214  1.00 22.12  ? 286 TRP B CE3   1 
ATOM   7520 C CZ2   . TRP F 5 286 ? 85.001  29.996  81.384  1.00 22.12  ? 286 TRP B CZ2   1 
ATOM   7521 C CZ3   . TRP F 5 286 ? 84.656  29.085  79.166  1.00 22.12  ? 286 TRP B CZ3   1 
ATOM   7522 C CH2   . TRP F 5 286 ? 85.494  29.409  80.247  1.00 22.12  ? 286 TRP B CH2   1 
ATOM   7523 N N     . SER F 5 287 ? 76.969  31.006  80.209  1.00 22.61  ? 287 SER B N     1 
ATOM   7524 C CA    . SER F 5 287 ? 75.744  31.260  79.473  1.00 22.61  ? 287 SER B CA    1 
ATOM   7525 C C     . SER F 5 287 ? 75.859  32.605  78.761  1.00 22.61  ? 287 SER B C     1 
ATOM   7526 O O     . SER F 5 287 ? 76.898  33.263  78.833  1.00 22.61  ? 287 SER B O     1 
ATOM   7527 C CB    . SER F 5 287 ? 74.550  31.262  80.429  1.00 24.76  ? 287 SER B CB    1 
ATOM   7528 O OG    . SER F 5 287 ? 74.950  31.587  81.749  1.00 24.76  ? 287 SER B OG    1 
ATOM   7529 N N     . GLY F 5 288 ? 74.790  33.007  78.081  1.00 25.52  ? 288 GLY B N     1 
ATOM   7530 C CA    . GLY F 5 288 ? 74.790  34.261  77.349  1.00 25.52  ? 288 GLY B CA    1 
ATOM   7531 C C     . GLY F 5 288 ? 75.176  35.523  78.104  1.00 25.52  ? 288 GLY B C     1 
ATOM   7532 O O     . GLY F 5 288 ? 75.436  36.548  77.481  1.00 25.52  ? 288 GLY B O     1 
ATOM   7533 N N     . HIS F 5 289 ? 75.226  35.468  79.430  1.00 23.65  ? 289 HIS B N     1 
ATOM   7534 C CA    . HIS F 5 289 ? 75.579  36.650  80.217  1.00 23.65  ? 289 HIS B CA    1 
ATOM   7535 C C     . HIS F 5 289 ? 76.935  36.544  80.911  1.00 23.65  ? 289 HIS B C     1 
ATOM   7536 O O     . HIS F 5 289 ? 77.348  37.462  81.620  1.00 23.65  ? 289 HIS B O     1 
ATOM   7537 C CB    . HIS F 5 289 ? 74.499  36.917  81.269  1.00 35.86  ? 289 HIS B CB    1 
ATOM   7538 C CG    . HIS F 5 289 ? 73.721  38.173  81.034  1.00 35.86  ? 289 HIS B CG    1 
ATOM   7539 N ND1   . HIS F 5 289 ? 72.891  38.342  79.946  1.00 35.86  ? 289 HIS B ND1   1 
ATOM   7540 C CD2   . HIS F 5 289 ? 73.640  39.320  81.749  1.00 35.86  ? 289 HIS B CD2   1 
ATOM   7541 C CE1   . HIS F 5 289 ? 72.332  39.537  80.001  1.00 35.86  ? 289 HIS B CE1   1 
ATOM   7542 N NE2   . HIS F 5 289 ? 72.770  40.151  81.086  1.00 35.86  ? 289 HIS B NE2   1 
ATOM   7543 N N     . SER F 5 290 ? 77.625  35.430  80.699  1.00 19.85  ? 290 SER B N     1 
ATOM   7544 C CA    . SER F 5 290 ? 78.921  35.198  81.323  1.00 19.85  ? 290 SER B CA    1 
ATOM   7545 C C     . SER F 5 290 ? 79.946  36.305  81.099  1.00 19.85  ? 290 SER B C     1 
ATOM   7546 O O     . SER F 5 290 ? 80.570  36.777  82.050  1.00 19.85  ? 290 SER B O     1 
ATOM   7547 C CB    . SER F 5 290 ? 79.494  33.872  80.836  1.00 24.86  ? 290 SER B CB    1 
ATOM   7548 O OG    . SER F 5 290 ? 78.780  32.787  81.397  1.00 24.86  ? 290 SER B OG    1 
ATOM   7549 N N     . ALA F 5 291 ? 80.123  36.712  79.845  1.00 19.12  ? 291 ALA B N     1 
ATOM   7550 C CA    . ALA F 5 291 ? 81.091  37.753  79.507  1.00 19.12  ? 291 ALA B CA    1 
ATOM   7551 C C     . ALA F 5 291 ? 80.719  39.088  80.137  1.00 19.12  ? 291 ALA B C     1 
ATOM   7552 O O     . ALA F 5 291 ? 81.591  39.887  80.482  1.00 19.12  ? 291 ALA B O     1 
ATOM   7553 C CB    . ALA F 5 291 ? 81.194  37.898  77.993  1.00 10.43  ? 291 ALA B CB    1 
ATOM   7554 N N     . ARG F 5 292 ? 79.421  39.325  80.285  1.00 28.54  ? 292 ARG B N     1 
ATOM   7555 C CA    . ARG F 5 292 ? 78.938  40.565  80.875  1.00 28.54  ? 292 ARG B CA    1 
ATOM   7556 C C     . ARG F 5 292 ? 79.361  40.668  82.337  1.00 28.54  ? 292 ARG B C     1 
ATOM   7557 O O     . ARG F 5 292 ? 80.086  41.586  82.716  1.00 28.54  ? 292 ARG B O     1 
ATOM   7558 C CB    . ARG F 5 292 ? 77.413  40.644  80.767  1.00 28.56  ? 292 ARG B CB    1 
ATOM   7559 C CG    . ARG F 5 292 ? 76.926  41.671  79.758  1.00 28.56  ? 292 ARG B CG    1 
ATOM   7560 C CD    . ARG F 5 292 ? 75.416  41.852  79.808  1.00 28.56  ? 292 ARG B CD    1 
ATOM   7561 N NE    . ARG F 5 292 ? 75.035  43.103  80.459  1.00 28.56  ? 292 ARG B NE    1 
ATOM   7562 C CZ    . ARG F 5 292 ? 75.137  44.303  79.894  1.00 28.56  ? 292 ARG B CZ    1 
ATOM   7563 N NH1   . ARG F 5 292 ? 75.609  44.422  78.661  1.00 28.56  ? 292 ARG B NH1   1 
ATOM   7564 N NH2   . ARG F 5 292 ? 74.772  45.386  80.566  1.00 28.56  ? 292 ARG B NH2   1 
ATOM   7565 N N     . VAL F 5 293 ? 78.911  39.720  83.153  1.00 34.76  ? 293 VAL B N     1 
ATOM   7566 C CA    . VAL F 5 293 ? 79.255  39.719  84.571  1.00 34.76  ? 293 VAL B CA    1 
ATOM   7567 C C     . VAL F 5 293 ? 80.764  39.592  84.746  1.00 34.76  ? 293 VAL B C     1 
ATOM   7568 O O     . VAL F 5 293 ? 81.335  40.108  85.706  1.00 34.76  ? 293 VAL B O     1 
ATOM   7569 C CB    . VAL F 5 293 ? 78.560  38.553  85.337  1.00 26.83  ? 293 VAL B CB    1 
ATOM   7570 C CG1   . VAL F 5 293 ? 77.272  38.163  84.642  1.00 26.83  ? 293 VAL B CG1   1 
ATOM   7571 C CG2   . VAL F 5 293 ? 79.488  37.352  85.438  1.00 26.83  ? 293 VAL B CG2   1 
ATOM   7572 N N     . GLY F 5 294 ? 81.403  38.906  83.805  1.00 26.91  ? 294 GLY B N     1 
ATOM   7573 C CA    . GLY F 5 294 ? 82.838  38.710  83.873  1.00 26.91  ? 294 GLY B CA    1 
ATOM   7574 C C     . GLY F 5 294 ? 83.638  39.947  83.524  1.00 26.91  ? 294 GLY B C     1 
ATOM   7575 O O     . GLY F 5 294 ? 84.691  40.191  84.106  1.00 26.91  ? 294 GLY B O     1 
ATOM   7576 N N     . ALA F 5 295 ? 83.147  40.732  82.572  1.00 30.28  ? 295 ALA B N     1 
ATOM   7577 C CA    . ALA F 5 295 ? 83.848  41.943  82.166  1.00 30.28  ? 295 ALA B CA    1 
ATOM   7578 C C     . ALA F 5 295 ? 83.710  43.027  83.234  1.00 30.28  ? 295 ALA B C     1 
ATOM   7579 O O     . ALA F 5 295 ? 84.646  43.786  83.483  1.00 30.28  ? 295 ALA B O     1 
ATOM   7580 C CB    . ALA F 5 295 ? 83.301  42.441  80.836  1.00 17.58  ? 295 ALA B CB    1 
ATOM   7581 N N     . ALA F 5 296 ? 82.542  43.085  83.867  1.00 36.47  ? 296 ALA B N     1 
ATOM   7582 C CA    . ALA F 5 296 ? 82.274  44.076  84.904  1.00 36.47  ? 296 ALA B CA    1 
ATOM   7583 C C     . ALA F 5 296 ? 83.244  43.935  86.069  1.00 36.47  ? 296 ALA B C     1 
ATOM   7584 O O     . ALA F 5 296 ? 83.777  44.925  86.569  1.00 36.47  ? 296 ALA B O     1 
ATOM   7585 C CB    . ALA F 5 296 ? 80.845  43.935  85.400  1.00 35.19  ? 296 ALA B CB    1 
ATOM   7586 N N     . ARG F 5 297 ? 83.465  42.699  86.503  1.00 40.51  ? 297 ARG B N     1 
ATOM   7587 C CA    . ARG F 5 297 ? 84.378  42.433  87.605  1.00 40.51  ? 297 ARG B CA    1 
ATOM   7588 C C     . ARG F 5 297 ? 85.818  42.758  87.221  1.00 40.51  ? 297 ARG B C     1 
ATOM   7589 O O     . ARG F 5 297 ? 86.556  43.347  88.005  1.00 40.51  ? 297 ARG B O     1 
ATOM   7590 C CB    . ARG F 5 297 ? 84.284  40.968  88.027  1.00 59.01  ? 297 ARG B CB    1 
ATOM   7591 C CG    . ARG F 5 297 ? 83.070  40.646  88.869  1.00 59.01  ? 297 ARG B CG    1 
ATOM   7592 C CD    . ARG F 5 297 ? 83.057  39.182  89.253  1.00 59.01  ? 297 ARG B CD    1 
ATOM   7593 N NE    . ARG F 5 297 ? 81.779  38.559  88.934  1.00 59.01  ? 297 ARG B NE    1 
ATOM   7594 C CZ    . ARG F 5 297 ? 81.392  37.377  89.399  1.00 59.01  ? 297 ARG B CZ    1 
ATOM   7595 N NH1   . ARG F 5 297 ? 82.191  36.689  90.205  1.00 59.01  ? 297 ARG B NH1   1 
ATOM   7596 N NH2   . ARG F 5 297 ? 80.209  36.883  89.058  1.00 59.01  ? 297 ARG B NH2   1 
ATOM   7597 N N     . ASP F 5 298 ? 86.212  42.371  86.013  1.00 31.12  ? 298 ASP B N     1 
ATOM   7598 C CA    . ASP F 5 298 ? 87.568  42.619  85.537  1.00 31.12  ? 298 ASP B CA    1 
ATOM   7599 C C     . ASP F 5 298 ? 87.918  44.101  85.560  1.00 31.12  ? 298 ASP B C     1 
ATOM   7600 O O     . ASP F 5 298 ? 89.058  44.474  85.841  1.00 31.12  ? 298 ASP B O     1 
ATOM   7601 C CB    . ASP F 5 298 ? 87.734  42.074  84.116  1.00 62.17  ? 298 ASP B CB    1 
ATOM   7602 C CG    . ASP F 5 298 ? 88.091  40.603  84.096  1.00 62.17  ? 298 ASP B CG    1 
ATOM   7603 O OD1   . ASP F 5 298 ? 88.900  40.173  84.944  1.00 62.17  ? 298 ASP B OD1   1 
ATOM   7604 O OD2   . ASP F 5 298 ? 87.561  39.874  83.233  1.00 62.17  ? 298 ASP B OD2   1 
ATOM   7605 N N     . MET F 5 299 ? 86.935  44.943  85.255  1.00 31.96  ? 299 MET B N     1 
ATOM   7606 C CA    . MET F 5 299 ? 87.141  46.386  85.244  1.00 31.96  ? 299 MET B CA    1 
ATOM   7607 C C     . MET F 5 299 ? 87.211  46.902  86.672  1.00 31.96  ? 299 MET B C     1 
ATOM   7608 O O     . MET F 5 299 ? 88.135  47.629  87.038  1.00 31.96  ? 299 MET B O     1 
ATOM   7609 C CB    . MET F 5 299 ? 85.993  47.075  84.509  1.00 34.14  ? 299 MET B CB    1 
ATOM   7610 C CG    . MET F 5 299 ? 86.062  46.943  83.000  1.00 34.14  ? 299 MET B CG    1 
ATOM   7611 S SD    . MET F 5 299 ? 84.818  47.950  82.169  1.00 34.14  ? 299 MET B SD    1 
ATOM   7612 C CE    . MET F 5 299 ? 83.397  46.864  82.247  1.00 34.14  ? 299 MET B CE    1 
ATOM   7613 N N     . ALA F 5 300 ? 86.225  46.514  87.473  1.00 43.91  ? 300 ALA B N     1 
ATOM   7614 C CA    . ALA F 5 300 ? 86.161  46.923  88.868  1.00 43.91  ? 300 ALA B CA    1 
ATOM   7615 C C     . ALA F 5 300 ? 87.449  46.538  89.590  1.00 43.91  ? 300 ALA B C     1 
ATOM   7616 O O     . ALA F 5 300 ? 88.098  47.377  90.215  1.00 43.91  ? 300 ALA B O     1 
ATOM   7617 C CB    . ALA F 5 300 ? 84.964  46.266  89.541  1.00 18.78  ? 300 ALA B CB    1 
ATOM   7618 N N     . ARG F 5 301 ? 87.811  45.263  89.492  1.00 38.12  ? 301 ARG B N     1 
ATOM   7619 C CA    . ARG F 5 301 ? 89.015  44.741  90.130  1.00 38.12  ? 301 ARG B CA    1 
ATOM   7620 C C     . ARG F 5 301 ? 90.281  45.478  89.692  1.00 38.12  ? 301 ARG B C     1 
ATOM   7621 O O     . ARG F 5 301 ? 91.285  45.474  90.405  1.00 38.12  ? 301 ARG B O     1 
ATOM   7622 C CB    . ARG F 5 301 ? 89.152  43.243  89.831  1.00 97.71  ? 301 ARG B CB    1 
ATOM   7623 C CG    . ARG F 5 301 ? 90.584  42.726  89.804  1.00 97.71  ? 301 ARG B CG    1 
ATOM   7624 C CD    . ARG F 5 301 ? 90.708  41.400  90.536  1.00 97.71  ? 301 ARG B CD    1 
ATOM   7625 N NE    . ARG F 5 301 ? 91.621  41.488  91.672  1.00 97.71  ? 301 ARG B NE    1 
ATOM   7626 C CZ    . ARG F 5 301 ? 91.278  41.229  92.930  1.00 97.71  ? 301 ARG B CZ    1 
ATOM   7627 N NH1   . ARG F 5 301 ? 90.037  40.864  93.221  1.00 97.71  ? 301 ARG B NH1   1 
ATOM   7628 N NH2   . ARG F 5 301 ? 92.176  41.339  93.900  1.00 97.71  ? 301 ARG B NH2   1 
ATOM   7629 N N     . ALA F 5 302 ? 90.236  46.108  88.522  1.00 48.49  ? 302 ALA B N     1 
ATOM   7630 C CA    . ALA F 5 302 ? 91.392  46.836  88.007  1.00 48.49  ? 302 ALA B CA    1 
ATOM   7631 C C     . ALA F 5 302 ? 91.173  48.343  88.060  1.00 48.49  ? 302 ALA B C     1 
ATOM   7632 O O     . ALA F 5 302 ? 91.552  49.064  87.138  1.00 48.49  ? 302 ALA B O     1 
ATOM   7633 C CB    . ALA F 5 302 ? 91.679  46.405  86.577  1.00 32.48  ? 302 ALA B CB    1 
ATOM   7634 N N     . GLY F 5 303 ? 90.570  48.816  89.146  1.00 46.83  ? 303 GLY B N     1 
ATOM   7635 C CA    . GLY F 5 303 ? 90.305  50.237  89.282  1.00 46.83  ? 303 GLY B CA    1 
ATOM   7636 C C     . GLY F 5 303 ? 89.066  50.621  88.496  1.00 46.83  ? 303 GLY B C     1 
ATOM   7637 O O     . GLY F 5 303 ? 87.948  50.321  88.908  1.00 46.83  ? 303 GLY B O     1 
ATOM   7638 N N     . VAL F 5 304 ? 89.266  51.283  87.363  1.00 44.60  ? 304 VAL B N     1 
ATOM   7639 C CA    . VAL F 5 304 ? 88.168  51.704  86.495  1.00 44.60  ? 304 VAL B CA    1 
ATOM   7640 C C     . VAL F 5 304 ? 86.979  52.309  87.236  1.00 44.60  ? 304 VAL B C     1 
ATOM   7641 O O     . VAL F 5 304 ? 86.185  51.595  87.847  1.00 44.60  ? 304 VAL B O     1 
ATOM   7642 C CB    . VAL F 5 304 ? 87.648  50.525  85.643  1.00 16.33  ? 304 VAL B CB    1 
ATOM   7643 C CG1   . VAL F 5 304 ? 86.650  51.032  84.619  1.00 16.33  ? 304 VAL B CG1   1 
ATOM   7644 C CG2   . VAL F 5 304 ? 88.809  49.827  84.952  1.00 16.33  ? 304 VAL B CG2   1 
ATOM   7645 N N     . SER F 5 305 ? 86.854  53.630  87.163  1.00 47.32  ? 305 SER B N     1 
ATOM   7646 C CA    . SER F 5 305 ? 85.756  54.327  87.820  1.00 47.32  ? 305 SER B CA    1 
ATOM   7647 C C     . SER F 5 305 ? 84.428  53.677  87.459  1.00 47.32  ? 305 SER B C     1 
ATOM   7648 O O     . SER F 5 305 ? 84.268  53.149  86.361  1.00 47.32  ? 305 SER B O     1 
ATOM   7649 C CB    . SER F 5 305 ? 85.739  55.796  87.397  1.00 100.00 ? 305 SER B CB    1 
ATOM   7650 O OG    . SER F 5 305 ? 86.259  55.954  86.088  1.00 100.00 ? 305 SER B OG    1 
ATOM   7651 N N     . ILE F 5 306 ? 83.480  53.715  88.389  1.00 55.12  ? 306 ILE B N     1 
ATOM   7652 C CA    . ILE F 5 306 ? 82.164  53.128  88.160  1.00 55.12  ? 306 ILE B CA    1 
ATOM   7653 C C     . ILE F 5 306 ? 81.481  53.700  86.917  1.00 55.12  ? 306 ILE B C     1 
ATOM   7654 O O     . ILE F 5 306 ? 80.896  52.959  86.130  1.00 55.12  ? 306 ILE B O     1 
ATOM   7655 C CB    . ILE F 5 306 ? 81.237  53.342  89.377  1.00 48.11  ? 306 ILE B CB    1 
ATOM   7656 C CG1   . ILE F 5 306 ? 81.872  52.730  90.632  1.00 48.11  ? 306 ILE B CG1   1 
ATOM   7657 C CG2   . ILE F 5 306 ? 79.868  52.730  89.105  1.00 48.11  ? 306 ILE B CG2   1 
ATOM   7658 C CD1   . ILE F 5 306 ? 81.863  51.215  90.667  1.00 48.11  ? 306 ILE B CD1   1 
ATOM   7659 N N     . PRO F 5 307 ? 81.545  55.028  86.726  1.00 67.43  ? 307 PRO B N     1 
ATOM   7660 C CA    . PRO F 5 307 ? 80.908  55.636  85.551  1.00 67.43  ? 307 PRO B CA    1 
ATOM   7661 C C     . PRO F 5 307 ? 81.322  54.987  84.232  1.00 67.43  ? 307 PRO B C     1 
ATOM   7662 O O     . PRO F 5 307 ? 80.479  54.702  83.381  1.00 67.43  ? 307 PRO B O     1 
ATOM   7663 C CB    . PRO F 5 307 ? 81.333  57.107  85.625  1.00 100.00 ? 307 PRO B CB    1 
ATOM   7664 C CG    . PRO F 5 307 ? 82.475  57.140  86.599  1.00 100.00 ? 307 PRO B CG    1 
ATOM   7665 C CD    . PRO F 5 307 ? 82.197  56.041  87.570  1.00 100.00 ? 307 PRO B CD    1 
ATOM   7666 N N     . GLU F 5 308 ? 82.622  54.760  84.066  1.00 65.35  ? 308 GLU B N     1 
ATOM   7667 C CA    . GLU F 5 308 ? 83.132  54.142  82.847  1.00 65.35  ? 308 GLU B CA    1 
ATOM   7668 C C     . GLU F 5 308 ? 82.550  52.743  82.703  1.00 65.35  ? 308 GLU B C     1 
ATOM   7669 O O     . GLU F 5 308 ? 82.229  52.308  81.598  1.00 65.35  ? 308 GLU B O     1 
ATOM   7670 C CB    . GLU F 5 308 ? 84.663  54.068  82.879  1.00 72.62  ? 308 GLU B CB    1 
ATOM   7671 C CG    . GLU F 5 308 ? 85.354  55.284  82.272  1.00 72.62  ? 308 GLU B CG    1 
ATOM   7672 C CD    . GLU F 5 308 ? 86.732  54.969  81.719  1.00 72.62  ? 308 GLU B CD    1 
ATOM   7673 O OE1   . GLU F 5 308 ? 87.688  54.866  82.518  1.00 72.62  ? 308 GLU B OE1   1 
ATOM   7674 O OE2   . GLU F 5 308 ? 86.859  54.829  80.483  1.00 72.62  ? 308 GLU B OE2   1 
ATOM   7675 N N     . ILE F 5 309 ? 82.411  52.041  83.824  1.00 40.17  ? 309 ILE B N     1 
ATOM   7676 C CA    . ILE F 5 309 ? 81.855  50.696  83.806  1.00 40.17  ? 309 ILE B CA    1 
ATOM   7677 C C     . ILE F 5 309 ? 80.438  50.757  83.258  1.00 40.17  ? 309 ILE B C     1 
ATOM   7678 O O     . ILE F 5 309 ? 80.064  49.976  82.382  1.00 40.17  ? 309 ILE B O     1 
ATOM   7679 C CB    . ILE F 5 309 ? 81.808  50.076  85.215  1.00 20.27  ? 309 ILE B CB    1 
ATOM   7680 C CG1   . ILE F 5 309 ? 83.230  49.889  85.749  1.00 20.27  ? 309 ILE B CG1   1 
ATOM   7681 C CG2   . ILE F 5 309 ? 81.076  48.736  85.167  1.00 20.27  ? 309 ILE B CG2   1 
ATOM   7682 C CD1   . ILE F 5 309 ? 83.335  48.948  86.941  1.00 20.27  ? 309 ILE B CD1   1 
ATOM   7683 N N     . MET F 5 310 ? 79.651  51.691  83.779  1.00 48.97  ? 310 MET B N     1 
ATOM   7684 C CA    . MET F 5 310 ? 78.277  51.856  83.330  1.00 48.97  ? 310 MET B CA    1 
ATOM   7685 C C     . MET F 5 310 ? 78.286  51.989  81.815  1.00 48.97  ? 310 MET B C     1 
ATOM   7686 O O     . MET F 5 310 ? 77.580  51.272  81.110  1.00 48.97  ? 310 MET B O     1 
ATOM   7687 C CB    . MET F 5 310 ? 77.664  53.111  83.955  1.00 100.00 ? 310 MET B CB    1 
ATOM   7688 C CG    . MET F 5 310 ? 76.697  52.831  85.094  1.00 100.00 ? 310 MET B CG    1 
ATOM   7689 S SD    . MET F 5 310 ? 77.432  53.089  86.722  1.00 100.00 ? 310 MET B SD    1 
ATOM   7690 C CE    . MET F 5 310 ? 77.144  54.842  86.950  1.00 100.00 ? 310 MET B CE    1 
ATOM   7691 N N     . GLN F 5 311 ? 79.107  52.910  81.325  1.00 64.91  ? 311 GLN B N     1 
ATOM   7692 C CA    . GLN F 5 311 ? 79.229  53.153  79.896  1.00 64.91  ? 311 GLN B CA    1 
ATOM   7693 C C     . GLN F 5 311 ? 79.516  51.859  79.138  1.00 64.91  ? 311 GLN B C     1 
ATOM   7694 O O     . GLN F 5 311 ? 78.813  51.512  78.190  1.00 64.91  ? 311 GLN B O     1 
ATOM   7695 C CB    . GLN F 5 311 ? 80.353  54.158  79.641  1.00 100.00 ? 311 GLN B CB    1 
ATOM   7696 C CG    . GLN F 5 311 ? 79.936  55.370  78.831  1.00 100.00 ? 311 GLN B CG    1 
ATOM   7697 C CD    . GLN F 5 311 ? 80.911  55.676  77.710  1.00 100.00 ? 311 GLN B CD    1 
ATOM   7698 O OE1   . GLN F 5 311 ? 81.307  54.787  76.957  1.00 100.00 ? 311 GLN B OE1   1 
ATOM   7699 N NE2   . GLN F 5 311 ? 81.303  56.941  77.594  1.00 100.00 ? 311 GLN B NE2   1 
ATOM   7700 N N     . ALA F 5 312 ? 80.551  51.148  79.573  1.00 37.26  ? 312 ALA B N     1 
ATOM   7701 C CA    . ALA F 5 312 ? 80.962  49.899  78.944  1.00 37.26  ? 312 ALA B CA    1 
ATOM   7702 C C     . ALA F 5 312 ? 79.826  48.896  78.789  1.00 37.26  ? 312 ALA B C     1 
ATOM   7703 O O     . ALA F 5 312 ? 79.593  48.372  77.701  1.00 37.26  ? 312 ALA B O     1 
ATOM   7704 C CB    . ALA F 5 312 ? 82.098  49.275  79.742  1.00 15.07  ? 312 ALA B CB    1 
ATOM   7705 N N     . GLY F 5 313 ? 79.122  48.626  79.880  1.00 28.87  ? 313 GLY B N     1 
ATOM   7706 C CA    . GLY F 5 313 ? 78.033  47.671  79.827  1.00 28.87  ? 313 GLY B CA    1 
ATOM   7707 C C     . GLY F 5 313 ? 76.716  48.282  79.404  1.00 28.87  ? 313 GLY B C     1 
ATOM   7708 O O     . GLY F 5 313 ? 75.711  47.582  79.287  1.00 28.87  ? 313 GLY B O     1 
ATOM   7709 N N     . GLY F 5 314 ? 76.718  49.590  79.173  1.00 46.17  ? 314 GLY B N     1 
ATOM   7710 C CA    . GLY F 5 314 ? 75.502  50.266  78.765  1.00 46.17  ? 314 GLY B CA    1 
ATOM   7711 C C     . GLY F 5 314 ? 74.493  50.396  79.889  1.00 46.17  ? 314 GLY B C     1 
ATOM   7712 O O     . GLY F 5 314 ? 73.289  50.476  79.646  1.00 46.17  ? 314 GLY B O     1 
ATOM   7713 N N     . TRP F 5 315 ? 74.981  50.416  81.124  1.00 72.71  ? 315 TRP B N     1 
ATOM   7714 C CA    . TRP F 5 315 ? 74.109  50.542  82.285  1.00 72.71  ? 315 TRP B CA    1 
ATOM   7715 C C     . TRP F 5 315 ? 73.813  52.009  82.579  1.00 72.71  ? 315 TRP B C     1 
ATOM   7716 O O     . TRP F 5 315 ? 74.666  52.876  82.377  1.00 72.71  ? 315 TRP B O     1 
ATOM   7717 C CB    . TRP F 5 315 ? 74.764  49.909  83.512  1.00 39.86  ? 315 TRP B CB    1 
ATOM   7718 C CG    . TRP F 5 315 ? 74.824  48.420  83.471  1.00 39.86  ? 315 TRP B CG    1 
ATOM   7719 C CD1   . TRP F 5 315 ? 73.771  47.554  83.550  1.00 39.86  ? 315 TRP B CD1   1 
ATOM   7720 C CD2   . TRP F 5 315 ? 76.003  47.613  83.369  1.00 39.86  ? 315 TRP B CD2   1 
ATOM   7721 N NE1   . TRP F 5 315 ? 74.223  46.257  83.505  1.00 39.86  ? 315 TRP B NE1   1 
ATOM   7722 C CE2   . TRP F 5 315 ? 75.589  46.263  83.394  1.00 39.86  ? 315 TRP B CE2   1 
ATOM   7723 C CE3   . TRP F 5 315 ? 77.371  47.900  83.260  1.00 39.86  ? 315 TRP B CE3   1 
ATOM   7724 C CZ2   . TRP F 5 315 ? 76.494  45.200  83.313  1.00 39.86  ? 315 TRP B CZ2   1 
ATOM   7725 C CZ3   . TRP F 5 315 ? 78.271  46.841  83.180  1.00 39.86  ? 315 TRP B CZ3   1 
ATOM   7726 C CH2   . TRP F 5 315 ? 77.826  45.508  83.207  1.00 39.86  ? 315 TRP B CH2   1 
ATOM   7727 N N     . THR F 5 316 ? 72.602  52.280  83.058  1.00 99.39  ? 316 THR B N     1 
ATOM   7728 C CA    . THR F 5 316 ? 72.202  53.641  83.390  1.00 99.39  ? 316 THR B CA    1 
ATOM   7729 C C     . THR F 5 316 ? 71.978  53.770  84.893  1.00 99.39  ? 316 THR B C     1 
ATOM   7730 O O     . THR F 5 316 ? 71.590  54.831  85.381  1.00 99.39  ? 316 THR B O     1 
ATOM   7731 C CB    . THR F 5 316 ? 70.903  54.041  82.653  1.00 99.82  ? 316 THR B CB    1 
ATOM   7732 O OG1   . THR F 5 316 ? 69.793  53.328  83.212  1.00 99.82  ? 316 THR B OG1   1 
ATOM   7733 C CG2   . THR F 5 316 ? 71.008  53.721  81.169  1.00 99.82  ? 316 THR B CG2   1 
ATOM   7734 N N     . ASN F 5 317 ? 72.230  52.687  85.622  1.00 100.00 ? 317 ASN B N     1 
ATOM   7735 C CA    . ASN F 5 317 ? 72.050  52.684  87.068  1.00 100.00 ? 317 ASN B CA    1 
ATOM   7736 C C     . ASN F 5 317 ? 73.309  52.265  87.820  1.00 100.00 ? 317 ASN B C     1 
ATOM   7737 O O     . ASN F 5 317 ? 74.422  52.498  87.351  1.00 100.00 ? 317 ASN B O     1 
ATOM   7738 C CB    . ASN F 5 317 ? 70.885  51.773  87.448  1.00 99.78  ? 317 ASN B CB    1 
ATOM   7739 C CG    . ASN F 5 317 ? 69.642  52.552  87.820  1.00 99.78  ? 317 ASN B CG    1 
ATOM   7740 O OD1   . ASN F 5 317 ? 68.596  51.971  88.111  1.00 99.78  ? 317 ASN B OD1   1 
ATOM   7741 N ND2   . ASN F 5 317 ? 69.750  53.881  87.814  1.00 99.78  ? 317 ASN B ND2   1 
ATOM   7742 N N     . VAL F 5 318 ? 73.136  51.649  88.986  1.00 100.00 ? 318 VAL B N     1 
ATOM   7743 C CA    . VAL F 5 318 ? 74.286  51.238  89.782  1.00 100.00 ? 318 VAL B CA    1 
ATOM   7744 C C     . VAL F 5 318 ? 74.159  49.879  90.462  1.00 100.00 ? 318 VAL B C     1 
ATOM   7745 O O     . VAL F 5 318 ? 75.164  49.209  90.701  1.00 100.00 ? 318 VAL B O     1 
ATOM   7746 C CB    . VAL F 5 318 ? 74.589  52.281  90.874  1.00 93.72  ? 318 VAL B CB    1 
ATOM   7747 C CG1   . VAL F 5 318 ? 75.184  53.531  90.249  1.00 93.72  ? 318 VAL B CG1   1 
ATOM   7748 C CG2   . VAL F 5 318 ? 73.315  52.617  91.632  1.00 93.72  ? 318 VAL B CG2   1 
ATOM   7749 N N     . ASN F 5 319 ? 72.936  49.472  90.780  1.00 91.43  ? 319 ASN B N     1 
ATOM   7750 C CA    . ASN F 5 319 ? 72.729  48.196  91.457  1.00 91.43  ? 319 ASN B CA    1 
ATOM   7751 C C     . ASN F 5 319 ? 73.429  47.015  90.766  1.00 91.43  ? 319 ASN B C     1 
ATOM   7752 O O     . ASN F 5 319 ? 74.331  46.387  91.335  1.00 91.43  ? 319 ASN B O     1 
ATOM   7753 C CB    . ASN F 5 319 ? 71.231  47.904  91.598  1.00 100.00 ? 319 ASN B CB    1 
ATOM   7754 C CG    . ASN F 5 319 ? 70.929  46.958  92.757  1.00 100.00 ? 319 ASN B CG    1 
ATOM   7755 O OD1   . ASN F 5 319 ? 70.262  47.351  93.712  1.00 100.00 ? 319 ASN B OD1   1 
ATOM   7756 N ND2   . ASN F 5 319 ? 71.390  45.722  92.729  1.00 100.00 ? 319 ASN B ND2   1 
ATOM   7757 N N     . ILE F 5 320 ? 73.009  46.725  89.556  1.00 51.86  ? 320 ILE B N     1 
ATOM   7758 C CA    . ILE F 5 320 ? 73.520  45.563  88.801  1.00 51.86  ? 320 ILE B CA    1 
ATOM   7759 C C     . ILE F 5 320 ? 75.060  45.508  88.738  1.00 51.86  ? 320 ILE B C     1 
ATOM   7760 O O     . ILE F 5 320 ? 75.675  44.466  88.998  1.00 51.86  ? 320 ILE B O     1 
ATOM   7761 C CB    . ILE F 5 320 ? 72.982  45.566  87.378  1.00 79.72  ? 320 ILE B CB    1 
ATOM   7762 C CG1   . ILE F 5 320 ? 71.461  45.402  87.330  1.00 79.72  ? 320 ILE B CG1   1 
ATOM   7763 C CG2   . ILE F 5 320 ? 73.558  44.428  86.532  1.00 79.72  ? 320 ILE B CG2   1 
ATOM   7764 C CD1   . ILE F 5 320 ? 70.976  44.091  87.955  1.00 79.72  ? 320 ILE B CD1   1 
ATOM   7765 N N     . VAL F 5 321 ? 75.692  46.615  88.385  1.00 60.71  ? 321 VAL B N     1 
ATOM   7766 C CA    . VAL F 5 321 ? 77.165  46.643  88.260  1.00 60.71  ? 321 VAL B CA    1 
ATOM   7767 C C     . VAL F 5 321 ? 77.828  46.214  89.575  1.00 60.71  ? 321 VAL B C     1 
ATOM   7768 O O     . VAL F 5 321 ? 78.762  45.401  89.587  1.00 60.71  ? 321 VAL B O     1 
ATOM   7769 C CB    . VAL F 5 321 ? 77.665  48.036  87.882  1.00 85.12  ? 321 VAL B CB    1 
ATOM   7770 C CG1   . VAL F 5 321 ? 76.977  48.591  86.636  1.00 85.12  ? 321 VAL B CG1   1 
ATOM   7771 C CG2   . VAL F 5 321 ? 77.454  49.068  88.986  1.00 85.12  ? 321 VAL B CG2   1 
ATOM   7772 N N     . MET F 5 322 ? 77.333  46.768  90.665  1.00 54.54  ? 322 MET B N     1 
ATOM   7773 C CA    . MET F 5 322 ? 77.861  46.459  92.002  1.00 54.54  ? 322 MET B CA    1 
ATOM   7774 C C     . MET F 5 322 ? 77.661  44.970  92.316  1.00 54.54  ? 322 MET B C     1 
ATOM   7775 O O     . MET F 5 322 ? 78.601  44.263  92.698  1.00 54.54  ? 322 MET B O     1 
ATOM   7776 C CB    . MET F 5 322 ? 77.135  47.289  93.065  1.00 99.62  ? 322 MET B CB    1 
ATOM   7777 C CG    . MET F 5 322 ? 77.723  48.692  93.242  1.00 99.62  ? 322 MET B CG    1 
ATOM   7778 S SD    . MET F 5 322 ? 78.493  48.929  94.829  1.00 99.62  ? 322 MET B SD    1 
ATOM   7779 C CE    . MET F 5 322 ? 80.226  48.550  94.709  1.00 99.62  ? 322 MET B CE    1 
ATOM   7780 N N     . ASN F 5 323 ? 76.430  44.538  92.135  1.00 68.16  ? 323 ASN B N     1 
ATOM   7781 C CA    . ASN F 5 323 ? 76.012  43.155  92.417  1.00 68.16  ? 323 ASN B CA    1 
ATOM   7782 C C     . ASN F 5 323 ? 76.954  42.131  91.783  1.00 68.16  ? 323 ASN B C     1 
ATOM   7783 O O     . ASN F 5 323 ? 77.245  41.094  92.380  1.00 68.16  ? 323 ASN B O     1 
ATOM   7784 C CB    . ASN F 5 323 ? 74.601  42.919  91.885  1.00 88.69  ? 323 ASN B CB    1 
ATOM   7785 C CG    . ASN F 5 323 ? 73.923  41.706  92.520  1.00 88.69  ? 323 ASN B CG    1 
ATOM   7786 O OD1   . ASN F 5 323 ? 73.934  41.563  93.742  1.00 88.69  ? 323 ASN B OD1   1 
ATOM   7787 N ND2   . ASN F 5 323 ? 73.329  40.815  91.751  1.00 88.69  ? 323 ASN B ND2   1 
ATOM   7788 N N     . TYR F 5 324 ? 77.431  42.425  90.578  1.00 52.32  ? 324 TYR B N     1 
ATOM   7789 C CA    . TYR F 5 324 ? 78.328  41.517  89.872  1.00 52.32  ? 324 TYR B CA    1 
ATOM   7790 C C     . TYR F 5 324 ? 79.705  41.417  90.519  1.00 52.32  ? 324 TYR B C     1 
ATOM   7791 O O     . TYR F 5 324 ? 80.423  40.440  90.307  1.00 52.32  ? 324 TYR B O     1 
ATOM   7792 C CB    . TYR F 5 324 ? 78.486  41.957  88.415  1.00 39.08  ? 324 TYR B CB    1 
ATOM   7793 C CG    . TYR F 5 324 ? 77.282  41.674  87.544  1.00 39.08  ? 324 TYR B CG    1 
ATOM   7794 C CD1   . TYR F 5 324 ? 76.362  40.682  87.887  1.00 39.08  ? 324 TYR B CD1   1 
ATOM   7795 C CD2   . TYR F 5 324 ? 77.060  42.401  86.374  1.00 39.08  ? 324 TYR B CD2   1 
ATOM   7796 C CE1   . TYR F 5 324 ? 75.247  40.422  87.087  1.00 39.08  ? 324 TYR B CE1   1 
ATOM   7797 C CE2   . TYR F 5 324 ? 75.951  42.151  85.566  1.00 39.08  ? 324 TYR B CE2   1 
ATOM   7798 C CZ    . TYR F 5 324 ? 75.050  41.161  85.928  1.00 39.08  ? 324 TYR B CZ    1 
ATOM   7799 O OH    . TYR F 5 324 ? 73.958  40.906  85.127  1.00 39.08  ? 324 TYR B OH    1 
ATOM   7800 N N     . ILE F 5 325 ? 80.075  42.428  91.301  1.00 63.16  ? 325 ILE B N     1 
ATOM   7801 C CA    . ILE F 5 325 ? 81.373  42.440  91.971  1.00 63.16  ? 325 ILE B CA    1 
ATOM   7802 C C     . ILE F 5 325 ? 81.296  41.867  93.399  1.00 63.16  ? 325 ILE B C     1 
ATOM   7803 O O     . ILE F 5 325 ? 81.561  40.678  93.623  1.00 63.16  ? 325 ILE B O     1 
ATOM   7804 C CB    . ILE F 5 325 ? 81.958  43.869  92.041  1.00 79.76  ? 325 ILE B CB    1 
ATOM   7805 C CG1   . ILE F 5 325 ? 81.551  44.734  90.846  1.00 79.76  ? 325 ILE B CG1   1 
ATOM   7806 C CG2   . ILE F 5 325 ? 83.487  43.879  92.076  1.00 79.76  ? 325 ILE B CG2   1 
ATOM   7807 C CD1   . ILE F 5 325 ? 82.055  44.184  89.509  1.00 79.76  ? 325 ILE B CD1   1 
ATOM   7808 N N     . ARG F 5 326 ? 80.947  42.741  94.325  1.00 72.61  ? 326 ARG B N     1 
ATOM   7809 C CA    . ARG F 5 326 ? 80.852  42.417  95.767  1.00 72.61  ? 326 ARG B CA    1 
ATOM   7810 C C     . ARG F 5 326 ? 81.301  40.981  96.071  1.00 72.61  ? 326 ARG B C     1 
ATOM   7811 O O     . ARG F 5 326 ? 80.481  40.077  96.284  1.00 72.61  ? 326 ARG B O     1 
ATOM   7812 C CB    . ARG F 5 326 ? 79.412  42.556  96.279  1.00 100.00 ? 326 ARG B CB    1 
ATOM   7813 C CG    . ARG F 5 326 ? 78.364  42.663  95.172  1.00 100.00 ? 326 ARG B CG    1 
ATOM   7814 C CD    . ARG F 5 326 ? 76.964  42.957  95.719  1.00 100.00 ? 326 ARG B CD    1 
ATOM   7815 N NE    . ARG F 5 326 ? 76.640  44.388  95.714  1.00 100.00 ? 326 ARG B NE    1 
ATOM   7816 C CZ    . ARG F 5 326 ? 75.397  44.876  95.757  1.00 100.00 ? 326 ARG B CZ    1 
ATOM   7817 N NH1   . ARG F 5 326 ? 74.338  44.059  95.817  1.00 100.00 ? 326 ARG B NH1   1 
ATOM   7818 N NH2   . ARG F 5 326 ? 75.112  46.185  95.741  1.00 100.00 ? 326 ARG B NH2   1 
ATOM   7819 N N     . ASN F 5 327 ? 82.609  40.790  96.102  1.00 100.00 ? 327 ASN B N     1 
ATOM   7820 C CA    . ASN F 5 327 ? 83.180  39.479  96.428  1.00 100.00 ? 327 ASN B CA    1 
ATOM   7821 C C     . ASN F 5 327 ? 84.689  39.446  96.338  1.00 100.00 ? 327 ASN B C     1 
ATOM   7822 O O     . ASN F 5 327 ? 85.346  38.522  96.828  1.00 100.00 ? 327 ASN B O     1 
ATOM   7823 C CB    . ASN F 5 327 ? 82.664  38.409  95.461  1.00 100.00 ? 327 ASN B CB    1 
ATOM   7824 C CG    . ASN F 5 327 ? 82.812  36.993  96.022  1.00 100.00 ? 327 ASN B CG    1 
ATOM   7825 O OD1   . ASN F 5 327 ? 83.157  36.072  95.286  1.00 100.00 ? 327 ASN B OD1   1 
ATOM   7826 N ND2   . ASN F 5 327 ? 82.571  36.763  97.301  1.00 100.00 ? 327 ASN B ND2   1 
ATOM   7827 N N     . LEU F 5 328 ? 85.238  40.445  95.730  1.00 100.00 ? 328 LEU B N     1 
ATOM   7828 C CA    . LEU F 5 328 ? 86.667  40.455  95.497  1.00 100.00 ? 328 LEU B CA    1 
ATOM   7829 C C     . LEU F 5 328 ? 87.425  41.073  96.619  1.00 100.00 ? 328 LEU B C     1 
ATOM   7830 O O     . LEU F 5 328 ? 87.800  40.410  97.588  1.00 100.00 ? 328 LEU B O     1 
ATOM   7831 C CB    . LEU F 5 328 ? 86.971  41.238  94.250  1.00 99.90  ? 328 LEU B CB    1 
ATOM   7832 C CG    . LEU F 5 328 ? 86.452  40.517  93.027  1.00 99.90  ? 328 LEU B CG    1 
ATOM   7833 C CD1   . LEU F 5 328 ? 84.996  40.855  92.719  1.00 99.90  ? 328 LEU B CD1   1 
ATOM   7834 C CD2   . LEU F 5 328 ? 87.251  40.839  91.774  1.00 99.90  ? 328 LEU B CD2   1 
ATOM   7835 N N     . ASP F 5 329 ? 87.650  42.318  96.441  1.00 100.00 ? 329 ASP B N     1 
ATOM   7836 C CA    . ASP F 5 329 ? 88.404  43.041  97.399  1.00 100.00 ? 329 ASP B CA    1 
ATOM   7837 C C     . ASP F 5 329 ? 87.521  43.449  98.504  1.00 100.00 ? 329 ASP B C     1 
ATOM   7838 O O     . ASP F 5 329 ? 87.301  44.644  98.724  1.00 100.00 ? 329 ASP B O     1 
ATOM   7839 C CB    . ASP F 5 329 ? 88.994  44.244  96.770  1.00 100.00 ? 329 ASP B CB    1 
ATOM   7840 C CG    . ASP F 5 329 ? 88.092  44.790  95.697  1.00 100.00 ? 329 ASP B CG    1 
ATOM   7841 O OD1   . ASP F 5 329 ? 86.820  44.604  95.779  1.00 100.00 ? 329 ASP B OD1   1 
ATOM   7842 O OD2   . ASP F 5 329 ? 88.608  45.429  94.717  1.00 100.00 ? 329 ASP B OD2   1 
ATOM   7843 N N     . SER F 5 330 ? 87.055  42.441  99.113  1.00 101.62 ? 330 SER B N     1 
ATOM   7844 C CA    . SER F 5 330 ? 86.287  42.590  100.279 1.00 101.62 ? 330 SER B CA    1 
ATOM   7845 C C     . SER F 5 330 ? 87.312  42.738  101.387 1.00 101.62 ? 330 SER B C     1 
ATOM   7846 O O     . SER F 5 330 ? 87.671  43.858  101.779 1.00 101.62 ? 330 SER B O     1 
ATOM   7847 C CB    . SER F 5 330 ? 85.402  41.363  100.397 1.00 101.62 ? 330 SER B CB    1 
ATOM   7848 O OG    . SER F 5 330 ? 85.278  40.740  99.117  1.00 101.62 ? 330 SER B OG    1 
ATOM   7849 N N     . GLU F 5 331 ? 87.778  41.592  101.810 1.00 101.62 ? 331 GLU B N     1 
ATOM   7850 C CA    . GLU F 5 331 ? 88.755  41.481  102.889 1.00 101.62 ? 331 GLU B CA    1 
ATOM   7851 C C     . GLU F 5 331 ? 90.155  41.871  102.411 1.00 101.62 ? 331 GLU B C     1 
ATOM   7852 O O     . GLU F 5 331 ? 90.316  42.662  101.468 1.00 101.62 ? 331 GLU B O     1 
ATOM   7853 C CB    . GLU F 5 331 ? 88.796  40.042  103.394 1.00 101.62 ? 331 GLU B CB    1 
ATOM   7854 C CG    . GLU F 5 331 ? 88.760  39.948  104.918 1.00 101.62 ? 331 GLU B CG    1 
ATOM   7855 C CD    . GLU F 5 331 ? 87.563  40.670  105.540 1.00 101.62 ? 331 GLU B CD    1 
ATOM   7856 O OE1   . GLU F 5 331 ? 86.385  40.524  105.034 1.00 101.62 ? 331 GLU B OE1   1 
ATOM   7857 O OE2   . GLU F 5 331 ? 87.730  41.425  106.573 1.00 101.62 ? 331 GLU B OE2   1 
ATOM   7858 N N     . THR F 5 332 ? 91.113  41.286  103.105 1.00 101.62 ? 332 THR B N     1 
ATOM   7859 C CA    . THR F 5 332 ? 92.544  41.495  102.861 1.00 101.62 ? 332 THR B CA    1 
ATOM   7860 C C     . THR F 5 332 ? 92.956  42.900  103.294 1.00 101.62 ? 332 THR B C     1 
ATOM   7861 O O     . THR F 5 332 ? 92.423  43.895  102.802 1.00 101.62 ? 332 THR B O     1 
ATOM   7862 C CB    . THR F 5 332 ? 92.871  41.318  101.377 1.00 101.62 ? 332 THR B CB    1 
ATOM   7863 O OG1   . THR F 5 332 ? 92.139  40.225  100.845 1.00 101.62 ? 332 THR B OG1   1 
ATOM   7864 C CG2   . THR F 5 332 ? 94.356  41.037  101.125 1.00 101.62 ? 332 THR B CG2   1 
ATOM   7865 N N     . GLY F 5 333 ? 93.910  42.970  104.218 1.00 101.62 ? 333 GLY B N     1 
ATOM   7866 C CA    . GLY F 5 333 ? 94.376  44.254  104.710 1.00 101.62 ? 333 GLY B CA    1 
ATOM   7867 C C     . GLY F 5 333 ? 93.280  45.019  105.428 1.00 101.62 ? 333 GLY B C     1 
ATOM   7868 O O     . GLY F 5 333 ? 92.818  44.604  106.492 1.00 101.62 ? 333 GLY B O     1 
ATOM   7869 N N     . ALA F 5 334 ? 92.868  46.141  104.847 1.00 100.00 ? 334 ALA B N     1 
ATOM   7870 C CA    . ALA F 5 334 ? 91.816  46.972  105.420 1.00 100.00 ? 334 ALA B CA    1 
ATOM   7871 C C     . ALA F 5 334 ? 92.005  47.182  106.922 1.00 100.00 ? 334 ALA B C     1 
ATOM   7872 O O     . ALA F 5 334 ? 93.016  47.736  107.357 1.00 100.00 ? 334 ALA B O     1 
ATOM   7873 C CB    . ALA F 5 334 ? 90.452  46.344  105.139 1.00 100.00 ? 334 ALA B CB    1 
ATOM   7874 N N     . MET F 5 335 ? 91.028  46.741  107.710 1.00 99.95  ? 335 MET B N     1 
ATOM   7875 C CA    . MET F 5 335 ? 91.084  46.877  109.162 1.00 99.95  ? 335 MET B CA    1 
ATOM   7876 C C     . MET F 5 335 ? 92.219  46.049  109.755 1.00 99.95  ? 335 MET B C     1 
ATOM   7877 O O     . MET F 5 335 ? 92.928  46.505  110.650 1.00 99.95  ? 335 MET B O     1 
ATOM   7878 C CB    . MET F 5 335 ? 89.754  46.442  109.781 1.00 70.85  ? 335 MET B CB    1 
ATOM   7879 C CG    . MET F 5 335 ? 88.694  47.529  109.797 1.00 70.85  ? 335 MET B CG    1 
ATOM   7880 S SD    . MET F 5 335 ? 88.627  48.401  111.372 1.00 70.85  ? 335 MET B SD    1 
ATOM   7881 C CE    . MET F 5 335 ? 90.133  49.371  111.286 1.00 70.85  ? 335 MET B CE    1 
ATOM   7882 N N     . VAL F 5 336 ? 92.381  44.829  109.254 1.00 72.80  ? 336 VAL B N     1 
ATOM   7883 C CA    . VAL F 5 336 ? 93.430  43.937  109.727 1.00 72.80  ? 336 VAL B CA    1 
ATOM   7884 C C     . VAL F 5 336 ? 94.783  44.635  109.688 1.00 72.80  ? 336 VAL B C     1 
ATOM   7885 O O     . VAL F 5 336 ? 95.422  44.823  110.721 1.00 72.80  ? 336 VAL B O     1 
ATOM   7886 C CB    . VAL F 5 336 ? 93.515  42.667  108.860 1.00 34.62  ? 336 VAL B CB    1 
ATOM   7887 C CG1   . VAL F 5 336 ? 94.577  41.731  109.412 1.00 34.62  ? 336 VAL B CG1   1 
ATOM   7888 C CG2   . VAL F 5 336 ? 92.162  41.979  108.815 1.00 34.62  ? 336 VAL B CG2   1 
ATOM   7889 N N     . ARG F 5 337 ? 95.211  45.015  108.488 1.00 81.92  ? 337 ARG B N     1 
ATOM   7890 C CA    . ARG F 5 337 ? 96.489  45.690  108.310 1.00 81.92  ? 337 ARG B CA    1 
ATOM   7891 C C     . ARG F 5 337 ? 96.612  46.890  109.244 1.00 81.92  ? 337 ARG B C     1 
ATOM   7892 O O     . ARG F 5 337 ? 97.710  47.244  109.673 1.00 81.92  ? 337 ARG B O     1 
ATOM   7893 C CB    . ARG F 5 337 ? 96.653  46.137  106.851 1.00 100.00 ? 337 ARG B CB    1 
ATOM   7894 C CG    . ARG F 5 337 ? 96.029  47.489  106.520 1.00 100.00 ? 337 ARG B CG    1 
ATOM   7895 C CD    . ARG F 5 337 ? 96.796  48.196  105.408 1.00 100.00 ? 337 ARG B CD    1 
ATOM   7896 N NE    . ARG F 5 337 ? 96.291  49.544  105.162 1.00 100.00 ? 337 ARG B NE    1 
ATOM   7897 C CZ    . ARG F 5 337 ? 96.809  50.647  105.695 1.00 100.00 ? 337 ARG B CZ    1 
ATOM   7898 N NH1   . ARG F 5 337 ? 97.853  50.566  106.508 1.00 100.00 ? 337 ARG B NH1   1 
ATOM   7899 N NH2   . ARG F 5 337 ? 96.284  51.832  105.416 1.00 100.00 ? 337 ARG B NH2   1 
ATOM   7900 N N     . LEU F 5 338 ? 95.478  47.507  109.560 1.00 64.24  ? 338 LEU B N     1 
ATOM   7901 C CA    . LEU F 5 338 ? 95.462  48.666  110.445 1.00 64.24  ? 338 LEU B CA    1 
ATOM   7902 C C     . LEU F 5 338 ? 95.632  48.242  111.899 1.00 64.24  ? 338 LEU B C     1 
ATOM   7903 O O     . LEU F 5 338 ? 96.320  48.906  112.674 1.00 64.24  ? 338 LEU B O     1 
ATOM   7904 C CB    . LEU F 5 338 ? 94.147  49.433  110.287 1.00 53.36  ? 338 LEU B CB    1 
ATOM   7905 C CG    . LEU F 5 338 ? 94.227  50.963  110.333 1.00 53.36  ? 338 LEU B CG    1 
ATOM   7906 C CD1   . LEU F 5 338 ? 92.881  51.552  109.950 1.00 53.36  ? 338 LEU B CD1   1 
ATOM   7907 C CD2   . LEU F 5 338 ? 94.632  51.425  111.726 1.00 53.36  ? 338 LEU B CD2   1 
ATOM   7908 N N     . LEU F 5 339 ? 95.007  47.126  112.259 1.00 62.84  ? 339 LEU B N     1 
ATOM   7909 C CA    . LEU F 5 339 ? 95.074  46.617  113.623 1.00 62.84  ? 339 LEU B CA    1 
ATOM   7910 C C     . LEU F 5 339 ? 96.469  46.115  113.958 1.00 62.84  ? 339 LEU B C     1 
ATOM   7911 O O     . LEU F 5 339 ? 96.999  46.404  115.028 1.00 62.84  ? 339 LEU B O     1 
ATOM   7912 C CB    . LEU F 5 339 ? 94.060  45.486  113.813 1.00 66.72  ? 339 LEU B CB    1 
ATOM   7913 C CG    . LEU F 5 339 ? 92.863  45.795  114.717 1.00 66.72  ? 339 LEU B CG    1 
ATOM   7914 C CD1   . LEU F 5 339 ? 91.618  45.099  114.183 1.00 66.72  ? 339 LEU B CD1   1 
ATOM   7915 C CD2   . LEU F 5 339 ? 93.167  45.340  116.134 1.00 66.72  ? 339 LEU B CD2   1 
ATOM   7916 N N     . GLU F 5 340 ? 97.061  45.362  113.037 1.00 100.00 ? 340 GLU B N     1 
ATOM   7917 C CA    . GLU F 5 340 ? 98.398  44.822  113.243 1.00 100.00 ? 340 GLU B CA    1 
ATOM   7918 C C     . GLU F 5 340 ? 99.378  45.943  113.576 1.00 100.00 ? 340 GLU B C     1 
ATOM   7919 O O     . GLU F 5 340 ? 99.577  46.276  114.745 1.00 100.00 ? 340 GLU B O     1 
ATOM   7920 C CB    . GLU F 5 340 ? 98.860  44.071  111.991 1.00 79.79  ? 340 GLU B CB    1 
ATOM   7921 C CG    . GLU F 5 340 ? 99.021  42.570  112.190 1.00 79.79  ? 340 GLU B CG    1 
ATOM   7922 C CD    . GLU F 5 340 ? 97.790  41.786  111.773 1.00 79.79  ? 340 GLU B CD    1 
ATOM   7923 O OE1   . GLU F 5 340 ? 96.724  42.407  111.576 1.00 79.79  ? 340 GLU B OE1   1 
ATOM   7924 O OE2   . GLU F 5 340 ? 97.890  40.547  111.643 1.00 79.79  ? 340 GLU B OE2   1 
ATOM   7925 N N     . ASP F 5 341 ? 99.986  46.525  112.548 1.00 87.49  ? 341 ASP B N     1 
ATOM   7926 C CA    . ASP F 5 341 ? 100.941 47.608  112.745 1.00 87.49  ? 341 ASP B CA    1 
ATOM   7927 C C     . ASP F 5 341 ? 100.449 48.886  112.079 1.00 87.49  ? 341 ASP B C     1 
ATOM   7928 O O     . ASP F 5 341 ? 99.265  49.213  112.148 1.00 87.49  ? 341 ASP B O     1 
ATOM   7929 C CB    . ASP F 5 341 ? 102.308 47.220  112.174 1.00 100.00 ? 341 ASP B CB    1 
ATOM   7930 C CG    . ASP F 5 341 ? 103.144 46.419  113.155 1.00 100.00 ? 341 ASP B CG    1 
ATOM   7931 O OD1   . ASP F 5 341 ? 103.455 46.949  114.244 1.00 100.00 ? 341 ASP B OD1   1 
ATOM   7932 O OD2   . ASP F 5 341 ? 103.490 45.261  112.838 1.00 100.00 ? 341 ASP B OD2   1 
HETATM 7933 O O     . HOH G 6 .   ? 77.935  25.297  68.415  1.00 29.90  ? 36  HOH C O     1 
HETATM 7934 O O     . HOH G 6 .   ? 82.424  19.150  66.400  1.00 50.73  ? 37  HOH C O     1 
HETATM 7935 O O     . HOH G 6 .   ? 54.580  29.755  69.663  1.00 51.10  ? 38  HOH C O     1 
HETATM 7936 O O     . HOH G 6 .   ? 67.365  38.381  81.708  1.00 39.04  ? 39  HOH C O     1 
HETATM 7937 O O     . HOH G 6 .   ? 64.571  34.909  92.393  1.00 67.41  ? 40  HOH C O     1 
HETATM 7938 O O     . HOH G 6 .   ? 82.774  18.995  62.018  1.00 36.20  ? 41  HOH C O     1 
HETATM 7939 O O     . HOH G 6 .   ? 74.905  13.556  51.202  1.00 61.83  ? 42  HOH C O     1 
HETATM 7940 O O     . HOH G 6 .   ? 54.057  27.917  84.167  1.00 68.73  ? 43  HOH C O     1 
HETATM 7941 O O     . HOH G 6 .   ? 71.843  31.491  60.643  1.00 75.84  ? 44  HOH C O     1 
HETATM 7942 O O     . HOH G 6 .   ? 76.926  10.629  58.712  1.00 56.98  ? 45  HOH C O     1 
HETATM 7943 O O     . HOH G 6 .   ? 60.071  30.801  73.284  1.00 59.58  ? 46  HOH C O     1 
HETATM 7944 O O     . HOH G 6 .   ? 58.396  57.083  79.907  1.00 82.84  ? 47  HOH C O     1 
HETATM 7945 O O     . HOH G 6 .   ? 59.385  21.767  68.998  1.00 53.60  ? 48  HOH C O     1 
HETATM 7946 O O     . HOH G 6 .   ? 59.529  63.530  83.839  1.00 92.49  ? 49  HOH C O     1 
HETATM 7947 O O     . HOH H 6 .   ? 77.124  41.230  130.761 1.00 49.51  ? 36  HOH D O     1 
HETATM 7948 O O     . HOH H 6 .   ? 73.115  37.427  148.199 1.00 90.42  ? 37  HOH D O     1 
HETATM 7949 O O     . HOH H 6 .   ? 78.994  22.346  50.842  1.00 37.23  ? 38  HOH D O     1 
HETATM 7950 O O     . HOH H 6 .   ? 55.059  15.724  65.237  1.00 89.53  ? 39  HOH D O     1 
HETATM 7951 O O     . HOH H 6 .   ? 68.988  40.954  79.877  1.00 31.76  ? 40  HOH D O     1 
HETATM 7952 O O     . HOH H 6 .   ? 72.574  28.025  78.071  1.00 96.58  ? 41  HOH D O     1 
HETATM 7953 O O     . HOH H 6 .   ? 80.461  41.291  138.698 1.00 51.66  ? 42  HOH D O     1 
HETATM 7954 O O     . HOH H 6 .   ? 48.095  50.354  88.126  1.00 62.07  ? 43  HOH D O     1 
HETATM 7955 O O     . HOH H 6 .   ? 78.632  43.387  141.627 1.00 88.94  ? 44  HOH D O     1 
HETATM 7956 O O     . HOH H 6 .   ? 69.050  53.620  116.694 1.00 55.82  ? 45  HOH D O     1 
HETATM 7957 O O     . HOH H 6 .   ? 65.489  58.693  106.818 1.00 100.00 ? 46  HOH D O     1 
HETATM 7958 O O     . HOH H 6 .   ? 53.083  44.659  87.919  1.00 70.61  ? 47  HOH D O     1 
HETATM 7959 O O     . HOH H 6 .   ? 57.583  42.409  89.038  1.00 79.54  ? 48  HOH D O     1 
HETATM 7960 O O     . HOH H 6 .   ? 77.044  20.624  55.646  1.00 20.48  ? 49  HOH D O     1 
HETATM 7961 O O     . HOH H 6 .   ? 73.564  34.068  136.450 1.00 45.03  ? 50  HOH D O     1 
HETATM 7962 O O     . HOH H 6 .   ? 61.102  53.768  125.434 1.00 84.98  ? 51  HOH D O     1 
HETATM 7963 O O     . HOH H 6 .   ? 73.184  37.398  148.133 1.00 89.26  ? 52  HOH D O     1 
HETATM 7964 O O     . HOH H 6 .   ? 55.897  41.590  84.551  1.00 21.64  ? 53  HOH D O     1 
HETATM 7965 O O     . HOH H 6 .   ? 69.734  22.865  72.230  1.00 50.26  ? 54  HOH D O     1 
HETATM 7966 O O     . HOH H 6 .   ? 57.978  40.316  86.961  1.00 72.83  ? 55  HOH D O     1 
HETATM 7967 O O     . HOH H 6 .   ? 73.585  34.790  132.864 1.00 42.04  ? 56  HOH D O     1 
HETATM 7968 O O     . HOH H 6 .   ? 64.022  32.373  75.247  1.00 64.10  ? 57  HOH D O     1 
HETATM 7969 O O     . HOH H 6 .   ? 69.290  58.792  108.538 1.00 49.49  ? 58  HOH D O     1 
HETATM 7970 O O     . HOH H 6 .   ? 66.382  42.622  80.393  1.00 41.62  ? 59  HOH D O     1 
HETATM 7971 O O     . HOH H 6 .   ? 53.433  45.524  100.293 1.00 52.97  ? 60  HOH D O     1 
HETATM 7972 O O     . HOH H 6 .   ? 68.234  41.348  141.557 1.00 77.42  ? 61  HOH D O     1 
HETATM 7973 O O     . HOH H 6 .   ? 60.280  41.965  89.214  1.00 40.22  ? 62  HOH D O     1 
HETATM 7974 O O     . HOH H 6 .   ? 64.632  19.563  52.867  1.00 58.55  ? 63  HOH D O     1 
HETATM 7975 O O     . HOH H 6 .   ? 72.574  25.510  49.750  1.00 81.20  ? 64  HOH D O     1 
HETATM 7976 O O     . HOH H 6 .   ? 67.091  36.910  122.767 1.00 58.75  ? 65  HOH D O     1 
HETATM 7977 O O     . HOH H 6 .   ? 73.955  41.634  130.489 1.00 61.08  ? 66  HOH D O     1 
HETATM 7978 O O     . HOH H 6 .   ? 55.481  46.365  98.729  1.00 72.05  ? 67  HOH D O     1 
HETATM 7979 O O     . HOH I 6 .   ? 72.497  50.302  125.051 1.00 34.01  ? 55  HOH E O     1 
HETATM 7980 O O     . HOH I 6 .   ? 59.525  55.417  110.562 1.00 41.03  ? 63  HOH E O     1 
HETATM 7981 O O     . HOH I 6 .   ? 66.010  47.790  107.204 1.00 69.12  ? 96  HOH E O     1 
HETATM 7982 O O     . HOH I 6 .   ? 64.448  48.571  105.962 1.00 54.90  ? 103 HOH E O     1 
HETATM 7983 O O     . HOH I 6 .   ? 67.344  49.429  109.425 1.00 56.91  ? 116 HOH E O     1 
HETATM 7984 O O     . HOH I 6 .   ? 76.996  32.010  144.029 1.00 43.83  ? 126 HOH E O     1 
HETATM 7985 O O     . HOH I 6 .   ? 52.602  47.224  109.183 1.00 41.78  ? 142 HOH E O     1 
HETATM 7986 O O     . HOH I 6 .   ? 73.103  32.438  137.933 1.00 61.81  ? 178 HOH E O     1 
HETATM 7987 O O     . HOH I 6 .   ? 59.388  59.395  95.759  1.00 100.00 ? 200 HOH E O     1 
HETATM 7988 O O     . HOH J 6 .   ? 38.672  40.234  113.585 1.00 52.76  ? 344 HOH A O     1 
HETATM 7989 O O     . HOH J 6 .   ? 77.034  55.238  122.302 1.00 21.04  ? 345 HOH A O     1 
HETATM 7990 O O     . HOH J 6 .   ? 58.633  67.257  120.316 1.00 28.24  ? 346 HOH A O     1 
HETATM 7991 O O     . HOH J 6 .   ? 84.152  28.136  132.021 1.00 62.29  ? 347 HOH A O     1 
HETATM 7992 O O     . HOH J 6 .   ? 30.870  36.904  109.724 1.00 58.80  ? 348 HOH A O     1 
HETATM 7993 O O     . HOH J 6 .   ? 46.088  38.223  103.285 1.00 26.51  ? 349 HOH A O     1 
HETATM 7994 O O     . HOH J 6 .   ? 35.513  58.915  111.134 1.00 53.51  ? 350 HOH A O     1 
HETATM 7995 O O     . HOH J 6 .   ? 79.512  48.130  116.610 1.00 28.55  ? 351 HOH A O     1 
HETATM 7996 O O     . HOH J 6 .   ? 75.409  51.930  111.339 1.00 95.02  ? 352 HOH A O     1 
HETATM 7997 O O     . HOH J 6 .   ? 41.161  41.461  99.512  1.00 50.72  ? 353 HOH A O     1 
HETATM 7998 O O     . HOH J 6 .   ? 36.409  57.756  126.612 1.00 71.01  ? 354 HOH A O     1 
HETATM 7999 O O     . HOH J 6 .   ? 53.122  31.016  107.170 1.00 56.14  ? 355 HOH A O     1 
HETATM 8000 O O     . HOH J 6 .   ? 62.095  40.572  114.101 1.00 64.80  ? 356 HOH A O     1 
HETATM 8001 O O     . HOH J 6 .   ? 54.563  46.275  120.981 1.00 43.86  ? 357 HOH A O     1 
HETATM 8002 O O     . HOH J 6 .   ? 63.868  43.037  115.665 1.00 43.46  ? 358 HOH A O     1 
HETATM 8003 O O     . HOH J 6 .   ? 75.227  46.816  115.560 1.00 26.40  ? 359 HOH A O     1 
HETATM 8004 O O     . HOH J 6 .   ? 93.625  37.387  126.859 1.00 57.75  ? 360 HOH A O     1 
HETATM 8005 O O     . HOH J 6 .   ? 68.261  45.624  119.180 1.00 55.95  ? 361 HOH A O     1 
HETATM 8006 O O     . HOH J 6 .   ? 70.118  36.963  119.392 1.00 37.26  ? 362 HOH A O     1 
HETATM 8007 O O     . HOH J 6 .   ? 93.787  29.766  114.599 1.00 46.37  ? 363 HOH A O     1 
HETATM 8008 O O     . HOH J 6 .   ? 29.714  39.781  108.151 1.00 62.73  ? 364 HOH A O     1 
HETATM 8009 O O     . HOH J 6 .   ? 37.693  65.568  112.155 1.00 36.99  ? 365 HOH A O     1 
HETATM 8010 O O     . HOH J 6 .   ? 78.932  60.868  136.599 1.00 53.73  ? 366 HOH A O     1 
HETATM 8011 O O     . HOH J 6 .   ? 40.223  66.749  125.199 1.00 35.07  ? 367 HOH A O     1 
HETATM 8012 O O     . HOH J 6 .   ? 98.756  41.255  125.581 1.00 100.00 ? 368 HOH A O     1 
HETATM 8013 O O     . HOH J 6 .   ? 90.459  57.342  119.757 1.00 52.37  ? 369 HOH A O     1 
HETATM 8014 O O     . HOH J 6 .   ? 81.557  45.990  115.171 1.00 31.93  ? 370 HOH A O     1 
HETATM 8015 O O     . HOH J 6 .   ? 67.344  41.311  122.124 1.00 49.25  ? 371 HOH A O     1 
HETATM 8016 O O     . HOH J 6 .   ? 50.407  41.427  106.858 1.00 54.60  ? 372 HOH A O     1 
HETATM 8017 O O     . HOH J 6 .   ? 52.402  58.438  124.417 1.00 53.85  ? 373 HOH A O     1 
HETATM 8018 O O     . HOH J 6 .   ? 37.830  64.583  127.818 1.00 63.16  ? 374 HOH A O     1 
HETATM 8019 O O     . HOH J 6 .   ? 90.871  38.376  129.193 1.00 76.86  ? 375 HOH A O     1 
HETATM 8020 O O     . HOH J 6 .   ? 44.229  54.428  113.987 1.00 81.70  ? 376 HOH A O     1 
HETATM 8021 O O     . HOH J 6 .   ? 81.499  25.489  128.815 1.00 47.60  ? 377 HOH A O     1 
HETATM 8022 O O     . HOH J 6 .   ? 46.221  74.174  103.172 1.00 44.91  ? 378 HOH A O     1 
HETATM 8023 O O     . HOH J 6 .   ? 88.918  25.878  116.176 1.00 91.87  ? 379 HOH A O     1 
HETATM 8024 O O     . HOH J 6 .   ? 83.378  35.601  134.875 1.00 63.57  ? 380 HOH A O     1 
HETATM 8025 O O     . HOH J 6 .   ? 55.649  67.495  106.422 1.00 57.70  ? 381 HOH A O     1 
HETATM 8026 O O     . HOH J 6 .   ? 49.913  47.082  108.294 1.00 34.48  ? 382 HOH A O     1 
HETATM 8027 O O     . HOH J 6 .   ? 60.353  58.393  110.767 1.00 41.94  ? 383 HOH A O     1 
HETATM 8028 O O     . HOH J 6 .   ? 78.079  33.644  118.433 1.00 51.93  ? 384 HOH A O     1 
HETATM 8029 O O     . HOH J 6 .   ? 93.078  52.980  131.828 1.00 49.29  ? 385 HOH A O     1 
HETATM 8030 O O     . HOH J 6 .   ? 35.949  61.350  117.935 1.00 59.60  ? 386 HOH A O     1 
HETATM 8031 O O     . HOH J 6 .   ? 76.225  64.229  130.349 1.00 43.30  ? 387 HOH A O     1 
HETATM 8032 O O     . HOH J 6 .   ? 88.188  32.974  137.937 1.00 60.53  ? 388 HOH A O     1 
HETATM 8033 O O     . HOH J 6 .   ? 75.636  60.521  114.242 1.00 68.88  ? 389 HOH A O     1 
HETATM 8034 O O     . HOH J 6 .   ? 65.734  41.930  118.543 1.00 100.00 ? 390 HOH A O     1 
HETATM 8035 O O     . HOH J 6 .   ? 73.626  46.988  130.546 1.00 31.79  ? 391 HOH A O     1 
HETATM 8036 O O     . HOH J 6 .   ? 37.124  46.873  96.751  1.00 98.70  ? 392 HOH A O     1 
HETATM 8037 O O     . HOH J 6 .   ? 52.171  71.238  121.034 1.00 43.98  ? 393 HOH A O     1 
HETATM 8038 O O     . HOH J 6 .   ? 39.714  65.573  102.615 1.00 46.98  ? 394 HOH A O     1 
HETATM 8039 O O     . HOH J 6 .   ? 86.510  60.757  119.381 1.00 58.94  ? 395 HOH A O     1 
HETATM 8040 O O     . HOH J 6 .   ? 75.411  34.078  119.641 1.00 39.19  ? 396 HOH A O     1 
HETATM 8041 O O     . HOH J 6 .   ? 41.007  68.212  103.793 1.00 53.93  ? 397 HOH A O     1 
HETATM 8042 O O     . HOH J 6 .   ? 85.149  31.399  134.625 1.00 35.99  ? 398 HOH A O     1 
HETATM 8043 O O     . HOH J 6 .   ? 32.685  45.593  96.590  1.00 81.54  ? 399 HOH A O     1 
HETATM 8044 O O     . HOH J 6 .   ? 49.510  48.615  100.515 1.00 100.00 ? 400 HOH A O     1 
HETATM 8045 O O     . HOH J 6 .   ? 93.273  34.415  140.266 1.00 100.00 ? 401 HOH A O     1 
HETATM 8046 O O     . HOH J 6 .   ? 35.238  63.023  109.796 1.00 62.17  ? 402 HOH A O     1 
HETATM 8047 O O     . HOH J 6 .   ? 53.956  55.499  125.411 1.00 53.42  ? 403 HOH A O     1 
HETATM 8048 O O     . HOH J 6 .   ? 94.310  55.803  112.035 1.00 64.32  ? 404 HOH A O     1 
HETATM 8049 O O     . HOH J 6 .   ? 82.456  43.372  102.324 1.00 82.88  ? 405 HOH A O     1 
HETATM 8050 O O     . HOH J 6 .   ? 79.051  47.677  135.107 1.00 95.59  ? 406 HOH A O     1 
HETATM 8051 O O     . HOH J 6 .   ? 77.153  65.594  134.670 1.00 100.00 ? 407 HOH A O     1 
HETATM 8052 O O     . HOH J 6 .   ? 88.420  66.554  103.220 1.00 58.02  ? 408 HOH A O     1 
HETATM 8053 O O     . HOH J 6 .   ? 69.823  23.837  113.581 1.00 90.22  ? 409 HOH A O     1 
HETATM 8054 O O     . HOH J 6 .   ? 61.828  69.337  120.623 1.00 49.10  ? 410 HOH A O     1 
HETATM 8055 O O     . HOH J 6 .   ? 63.016  41.241  120.520 1.00 49.18  ? 411 HOH A O     1 
HETATM 8056 O O     . HOH J 6 .   ? 49.904  72.495  121.962 1.00 72.20  ? 412 HOH A O     1 
HETATM 8057 O O     . HOH J 6 .   ? 40.703  69.016  106.916 1.00 66.60  ? 413 HOH A O     1 
HETATM 8058 O O     . HOH J 6 .   ? 42.832  67.026  100.764 1.00 49.74  ? 414 HOH A O     1 
HETATM 8059 O O     . HOH J 6 .   ? 95.349  32.553  143.172 1.00 64.23  ? 415 HOH A O     1 
HETATM 8060 O O     . HOH J 6 .   ? 83.911  33.122  140.531 1.00 58.36  ? 416 HOH A O     1 
HETATM 8061 O O     . HOH J 6 .   ? 85.728  30.433  139.318 1.00 74.97  ? 417 HOH A O     1 
HETATM 8062 O O     . HOH J 6 .   ? 86.158  65.812  101.641 1.00 60.54  ? 418 HOH A O     1 
HETATM 8063 O O     . HOH J 6 .   ? 88.043  63.590  101.029 1.00 62.21  ? 419 HOH A O     1 
HETATM 8064 O O     . HOH J 6 .   ? 87.718  60.407  101.319 1.00 60.30  ? 420 HOH A O     1 
HETATM 8065 O O     . HOH J 6 .   ? 74.247  50.743  113.404 1.00 66.76  ? 421 HOH A O     1 
HETATM 8066 O O     . HOH J 6 .   ? 73.640  61.032  128.599 1.00 51.27  ? 422 HOH A O     1 
HETATM 8067 O O     . HOH J 6 .   ? 79.742  55.184  131.472 1.00 46.18  ? 423 HOH A O     1 
HETATM 8068 O O     . HOH J 6 .   ? 46.047  66.416  124.898 1.00 57.21  ? 424 HOH A O     1 
HETATM 8069 O O     . HOH J 6 .   ? 46.720  68.670  121.993 1.00 60.91  ? 425 HOH A O     1 
HETATM 8070 O O     . HOH K 6 .   ? 78.909  40.015  76.421  1.00 15.47  ? 344 HOH B O     1 
HETATM 8071 O O     . HOH K 6 .   ? 92.801  41.894  72.649  1.00 40.33  ? 345 HOH B O     1 
HETATM 8072 O O     . HOH K 6 .   ? 39.089  33.300  89.291  1.00 29.98  ? 346 HOH B O     1 
HETATM 8073 O O     . HOH K 6 .   ? 71.187  35.409  83.168  1.00 43.72  ? 347 HOH B O     1 
HETATM 8074 O O     . HOH K 6 .   ? 59.082  28.828  96.653  1.00 41.82  ? 348 HOH B O     1 
HETATM 8075 O O     . HOH K 6 .   ? 51.443  34.811  107.719 1.00 41.41  ? 349 HOH B O     1 
HETATM 8076 O O     . HOH K 6 .   ? 88.123  34.605  64.960  1.00 25.40  ? 350 HOH B O     1 
HETATM 8077 O O     . HOH K 6 .   ? 51.448  51.966  75.999  1.00 52.40  ? 351 HOH B O     1 
HETATM 8078 O O     . HOH K 6 .   ? 95.696  34.985  74.357  1.00 81.97  ? 352 HOH B O     1 
HETATM 8079 O O     . HOH K 6 .   ? 49.749  47.540  82.550  1.00 24.69  ? 353 HOH B O     1 
HETATM 8080 O O     . HOH K 6 .   ? 53.167  27.476  100.355 1.00 60.39  ? 354 HOH B O     1 
HETATM 8081 O O     . HOH K 6 .   ? 89.154  28.922  81.250  1.00 44.75  ? 355 HOH B O     1 
HETATM 8082 O O     . HOH K 6 .   ? 47.950  22.819  87.699  1.00 57.85  ? 356 HOH B O     1 
HETATM 8083 O O     . HOH K 6 .   ? 80.099  33.934  89.108  1.00 45.15  ? 357 HOH B O     1 
HETATM 8084 O O     . HOH K 6 .   ? 79.974  20.977  86.967  1.00 72.61  ? 358 HOH B O     1 
HETATM 8085 O O     . HOH K 6 .   ? 80.769  22.031  81.480  1.00 26.47  ? 359 HOH B O     1 
HETATM 8086 O O     . HOH K 6 .   ? 46.157  24.803  95.400  1.00 52.35  ? 360 HOH B O     1 
HETATM 8087 O O     . HOH K 6 .   ? 72.740  34.613  59.787  1.00 42.81  ? 361 HOH B O     1 
HETATM 8088 O O     . HOH K 6 .   ? 68.221  31.768  54.796  1.00 95.70  ? 362 HOH B O     1 
HETATM 8089 O O     . HOH K 6 .   ? 93.998  37.691  68.581  1.00 46.72  ? 363 HOH B O     1 
HETATM 8090 O O     . HOH K 6 .   ? 75.802  49.270  75.265  1.00 89.19  ? 364 HOH B O     1 
HETATM 8091 O O     . HOH K 6 .   ? 41.567  40.843  90.253  1.00 49.69  ? 365 HOH B O     1 
HETATM 8092 O O     . HOH K 6 .   ? 49.753  25.254  87.022  1.00 34.46  ? 366 HOH B O     1 
HETATM 8093 O O     . HOH K 6 .   ? 40.802  50.302  74.271  1.00 50.30  ? 367 HOH B O     1 
HETATM 8094 O O     . HOH K 6 .   ? 51.667  26.097  82.282  1.00 54.60  ? 368 HOH B O     1 
HETATM 8095 O O     . HOH K 6 .   ? 38.202  37.498  95.880  1.00 75.04  ? 369 HOH B O     1 
HETATM 8096 O O     . HOH K 6 .   ? 95.315  25.256  70.060  1.00 46.32  ? 370 HOH B O     1 
HETATM 8097 O O     . HOH K 6 .   ? 43.420  33.200  99.571  1.00 46.82  ? 371 HOH B O     1 
HETATM 8098 O O     . HOH K 6 .   ? 77.021  31.228  83.452  1.00 24.93  ? 372 HOH B O     1 
HETATM 8099 O O     . HOH K 6 .   ? 73.539  23.969  60.963  1.00 36.98  ? 373 HOH B O     1 
HETATM 8100 O O     . HOH K 6 .   ? 73.498  37.903  77.123  1.00 21.52  ? 374 HOH B O     1 
HETATM 8101 O O     . HOH K 6 .   ? 94.743  35.167  67.858  1.00 47.42  ? 375 HOH B O     1 
HETATM 8102 O O     . HOH K 6 .   ? 68.894  29.801  95.626  1.00 95.41  ? 376 HOH B O     1 
HETATM 8103 O O     . HOH K 6 .   ? 98.388  29.188  71.160  1.00 41.75  ? 377 HOH B O     1 
HETATM 8104 O O     . HOH K 6 .   ? 67.899  42.356  72.900  1.00 70.26  ? 378 HOH B O     1 
HETATM 8105 O O     . HOH K 6 .   ? 77.752  38.179  78.042  1.00 37.46  ? 379 HOH B O     1 
HETATM 8106 O O     . HOH K 6 .   ? 34.212  27.262  86.189  1.00 59.45  ? 380 HOH B O     1 
HETATM 8107 O O     . HOH K 6 .   ? 84.109  52.857  78.998  1.00 78.69  ? 381 HOH B O     1 
HETATM 8108 O O     . HOH K 6 .   ? 36.089  24.880  84.852  1.00 76.47  ? 382 HOH B O     1 
HETATM 8109 O O     . HOH K 6 .   ? 47.952  49.270  94.409  1.00 79.87  ? 383 HOH B O     1 
HETATM 8110 O O     . HOH K 6 .   ? 68.373  29.265  58.772  1.00 72.25  ? 384 HOH B O     1 
HETATM 8111 O O     . HOH K 6 .   ? 49.743  29.632  103.885 1.00 87.96  ? 385 HOH B O     1 
HETATM 8112 O O     . HOH K 6 .   ? 79.883  37.787  93.102  1.00 75.29  ? 386 HOH B O     1 
HETATM 8113 O O     . HOH K 6 .   ? 54.050  42.545  81.717  1.00 82.33  ? 387 HOH B O     1 
HETATM 8114 O O     . HOH K 6 .   ? 71.811  39.166  90.605  1.00 57.87  ? 388 HOH B O     1 
HETATM 8115 O O     . HOH K 6 .   ? 60.082  41.721  69.202  1.00 49.99  ? 389 HOH B O     1 
HETATM 8116 O O     . HOH K 6 .   ? 77.300  22.842  54.669  1.00 31.50  ? 390 HOH B O     1 
HETATM 8117 O O     . HOH K 6 .   ? 76.861  46.866  76.810  1.00 62.09  ? 391 HOH B O     1 
HETATM 8118 O O     . HOH K 6 .   ? 75.407  39.209  64.573  1.00 29.49  ? 392 HOH B O     1 
HETATM 8119 O O     . HOH K 6 .   ? 92.445  33.386  65.384  1.00 39.13  ? 393 HOH B O     1 
HETATM 8120 O O     . HOH K 6 .   ? 51.632  42.759  63.710  1.00 47.23  ? 394 HOH B O     1 
HETATM 8121 O O     . HOH K 6 .   ? 38.456  42.291  87.909  1.00 94.25  ? 395 HOH B O     1 
HETATM 8122 O O     . HOH K 6 .   ? 39.864  50.256  86.799  1.00 75.80  ? 396 HOH B O     1 
HETATM 8123 O O     . HOH K 6 .   ? 47.684  31.321  104.528 1.00 67.73  ? 397 HOH B O     1 
HETATM 8124 O O     . HOH K 6 .   ? 77.060  38.548  94.580  1.00 70.00  ? 398 HOH B O     1 
HETATM 8125 O O     . HOH K 6 .   ? 52.178  26.376  87.041  1.00 61.10  ? 399 HOH B O     1 
HETATM 8126 O O     . HOH K 6 .   ? 71.822  45.048  49.641  1.00 83.41  ? 400 HOH B O     1 
HETATM 8127 O O     . HOH K 6 .   ? 85.165  46.376  56.590  1.00 58.07  ? 401 HOH B O     1 
HETATM 8128 O O     . HOH K 6 .   ? 73.492  36.688  63.712  1.00 42.16  ? 402 HOH B O     1 
HETATM 8129 O O     . HOH K 6 .   ? 50.452  44.276  65.528  1.00 41.67  ? 403 HOH B O     1 
HETATM 8130 O O     . HOH K 6 .   ? 35.989  21.983  90.623  1.00 39.35  ? 404 HOH B O     1 
HETATM 8131 O O     . HOH K 6 .   ? 65.286  35.074  70.936  1.00 60.09  ? 405 HOH B O     1 
HETATM 8132 O O     . HOH K 6 .   ? 56.160  43.348  93.897  1.00 66.77  ? 406 HOH B O     1 
HETATM 8133 O O     . HOH K 6 .   ? 52.325  21.886  87.032  1.00 69.92  ? 407 HOH B O     1 
HETATM 8134 O O     . HOH K 6 .   ? 52.941  20.131  90.734  1.00 56.04  ? 408 HOH B O     1 
HETATM 8135 O O     . HOH K 6 .   ? 92.050  32.391  57.142  1.00 46.78  ? 409 HOH B O     1 
HETATM 8136 O O     . HOH K 6 .   ? 73.507  43.944  98.141  1.00 94.38  ? 410 HOH B O     1 
HETATM 8137 O O     . HOH K 6 .   ? 71.264  48.046  97.708  1.00 76.85  ? 411 HOH B O     1 
HETATM 8138 O O     . HOH K 6 .   ? 41.517  19.708  81.645  1.00 53.57  ? 412 HOH B O     1 
HETATM 8139 O O     . HOH K 6 .   ? 43.557  48.516  86.829  1.00 39.30  ? 413 HOH B O     1 
HETATM 8140 O O     . HOH K 6 .   ? 89.058  59.414  60.949  1.00 91.68  ? 414 HOH B O     1 
HETATM 8141 O O     . HOH K 6 .   ? 88.581  17.817  81.947  1.00 40.59  ? 415 HOH B O     1 
HETATM 8142 O O     . HOH K 6 .   ? 39.656  27.225  83.399  1.00 62.74  ? 416 HOH B O     1 
HETATM 8143 O O     . HOH K 6 .   ? 75.432  36.655  58.288  1.00 56.97  ? 417 HOH B O     1 
HETATM 8144 O O     . HOH K 6 .   ? 85.353  28.884  86.160  1.00 42.94  ? 418 HOH B O     1 
HETATM 8145 O O     . HOH K 6 .   ? 74.718  55.228  63.008  1.00 78.70  ? 419 HOH B O     1 
HETATM 8146 O O     . HOH K 6 .   ? 92.127  30.055  58.199  1.00 75.33  ? 420 HOH B O     1 
HETATM 8147 O O     . HOH K 6 .   ? 40.285  45.613  94.007  1.00 83.79  ? 421 HOH B O     1 
HETATM 8148 O O     . HOH K 6 .   ? 86.914  43.485  107.788 1.00 56.85  ? 422 HOH B O     1 
HETATM 8149 O O     . HOH K 6 .   ? 72.577  48.963  74.620  1.00 93.42  ? 423 HOH B O     1 
HETATM 8150 O O     . HOH K 6 .   ? 90.877  38.345  84.789  1.00 52.02  ? 424 HOH B O     1 
HETATM 8151 O O     . HOH K 6 .   ? 68.594  32.351  85.162  1.00 57.52  ? 425 HOH B O     1 
HETATM 8152 O O     . HOH K 6 .   ? 43.403  24.547  81.181  1.00 99.40  ? 426 HOH B O     1 
HETATM 8153 O O     . HOH K 6 .   ? 36.443  46.970  92.407  1.00 64.33  ? 427 HOH B O     1 
HETATM 8154 O O     . HOH K 6 .   ? 41.687  43.269  92.509  1.00 49.42  ? 428 HOH B O     1 
HETATM 8155 O O     . HOH K 6 .   ? 87.267  36.646  52.004  1.00 59.02  ? 429 HOH B O     1 
HETATM 8156 O O     . HOH K 6 .   ? 53.068  41.777  61.020  1.00 50.55  ? 430 HOH B O     1 
HETATM 8157 O O     . HOH K 6 .   ? 71.742  47.328  65.449  1.00 59.76  ? 431 HOH B O     1 
HETATM 8158 O O     . HOH K 6 .   ? 45.927  48.631  99.441  1.00 53.09  ? 432 HOH B O     1 
HETATM 8159 O O     . HOH K 6 .   ? 77.145  34.266  50.239  1.00 74.53  ? 433 HOH B O     1 
HETATM 8160 O O     . HOH K 6 .   ? 37.192  27.518  80.777  1.00 82.10  ? 434 HOH B O     1 
HETATM 8161 O O     . HOH K 6 .   ? 96.484  39.217  75.619  1.00 68.41  ? 435 HOH B O     1 
HETATM 8162 O O     . HOH K 6 .   ? 96.186  43.775  79.616  1.00 49.63  ? 436 HOH B O     1 
HETATM 8163 O O     . HOH K 6 .   ? 49.131  22.661  96.406  1.00 58.07  ? 437 HOH B O     1 
HETATM 8164 O O     . HOH K 6 .   ? 49.559  24.903  98.011  1.00 64.32  ? 438 HOH B O     1 
HETATM 8165 O O     . HOH K 6 .   ? 71.021  31.029  53.779  1.00 98.96  ? 439 HOH B O     1 
HETATM 8166 O O     . HOH K 6 .   ? 84.418  26.572  86.010  1.00 75.05  ? 440 HOH B O     1 
HETATM 8167 O O     . HOH K 6 .   ? 39.806  43.236  95.941  1.00 60.42  ? 441 HOH B O     1 
HETATM 8168 O O     . HOH K 6 .   ? 70.865  30.749  53.975  1.00 93.47  ? 442 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DT  1   1   1   DT  T   C . n 
A 1 2   DA  2   2   2   DA  A   C . n 
A 1 3   DT  3   3   3   DT  T   C . n 
A 1 4   DA  4   4   4   DA  A   C . n 
A 1 5   DA  5   5   5   DA  A   C . n 
A 1 6   DG  6   6   6   DG  G   C . n 
A 1 7   DT  7   7   7   DT  T   C . n 
A 1 8   DT  8   8   8   DT  T   C . n 
A 1 9   DC  9   9   9   DC  C   C . n 
A 1 10  DG  10  10  10  DG  G   C . n 
A 1 11  DT  11  11  11  DT  T   C . n 
A 1 12  DA  12  12  12  DA  A   C . n 
A 1 13  DT  13  13  13  DT  T   C . n 
A 1 14  DA  14  14  14  DA  A   C . n 
A 1 15  DG  15  15  15  DG  G   C . n 
A 1 16  DC  16  16  16  DC  C   C . n 
A 1 17  DA  17  17  17  DA  A   C . n 
A 1 18  DT  18  18  18  DT  T   C . n 
A 1 19  DA  19  19  19  DA  A   C . n 
A 1 20  DC  20  20  20  DC  C   C . n 
A 1 21  DA  21  21  21  DA  A   C . n 
A 1 22  DT  22  22  22  DT  T   C . n 
A 1 23  DT  23  23  23  DT  T   C . n 
A 1 24  DA  24  24  24  DA  A   C . n 
A 1 25  DT  25  25  25  DT  T   C . n 
A 1 26  DA  26  26  26  DA  A   C . n 
A 1 27  DC  27  27  27  DC  C   C . n 
A 1 28  DG  28  28  28  DG  G   C . n 
A 1 29  DA  29  29  29  DA  A   C . n 
A 1 30  DA  30  30  30  DA  A   C . n 
A 1 31  DT  31  31  31  DT  T   C . n 
A 1 32  DT  32  32  32  DT  T   C . n 
A 1 33  DT  33  33  33  DT  T   C . n 
A 1 34  DA  34  34  34  DA  A   C . n 
A 1 35  DT  35  35  35  DT  T   C . n 
B 2 1   DT  1   1   ?   ?   ?   D . n 
B 2 2   DA  2   2   2   DA  A   D . n 
B 2 3   DT  3   3   3   DT  T   D . n 
B 2 4   DA  4   4   4   DA  A   D . n 
B 2 5   DA  5   5   5   DA  A   D . n 
B 2 6   DT  6   6   6   DT  T   D . n 
B 2 7   DT  7   7   7   DT  T   D . n 
B 2 8   DT  8   8   8   DT  T   D . n 
B 2 9   DC  9   9   9   DC  C   D . n 
B 2 10  DG  10  10  10  DG  G   D . n 
B 2 11  DT  11  11  11  DT  T   D . n 
B 2 12  DA  12  12  12  DA  A   D . n 
B 2 13  DT  13  13  13  DT  T   D . n 
B 2 14  DA  14  14  14  DA  A   D . n 
B 2 15  DT  15  15  15  DT  T   D . n 
B 2 16  DA  16  16  16  DA  A   D . n 
B 2 17  DC  17  17  17  DC  C   D . n 
B 2 18  DA  18  18  18  DA  A   D . n 
B 2 19  DA  19  19  19  DA  A   D . n 
B 2 20  DT  20  20  20  DT  T   D . n 
B 2 21  DG  21  21  21  DG  G   D . n 
B 2 22  DC  22  22  22  DC  C   D . n 
B 2 23  DT  23  23  23  DT  T   D . n 
B 2 24  DA  24  24  24  DA  A   D . n 
B 2 25  DT  25  25  25  DT  T   D . n 
B 2 26  DA  26  26  26  DA  A   D . n 
B 2 27  DC  27  27  27  DC  C   D . n 
B 2 28  DG  28  28  28  DG  G   D . n 
B 2 29  DA  29  29  29  DA  A   D . n 
B 2 30  DA  30  30  30  DA  A   D . n 
B 2 31  DC  31  31  31  DC  C   D . n 
B 2 32  DT  32  32  32  DT  T   D . n 
B 2 33  DT  33  33  33  DT  T   D . n 
B 2 34  DA  34  34  34  DA  A   D . n 
B 2 35  DT  35  35  35  DT  T   D . n 
C 3 1   DT  1   1   1   DT  T   E . n 
C 3 2   DA  2   2   2   DA  A   E . n 
C 3 3   DT  3   3   3   DT  T   E . n 
C 3 4   DA  4   4   4   DA  A   E . n 
C 3 5   DA  5   5   5   DA  A   E . n 
C 3 6   DC  6   6   6   DC  C   E . n 
C 3 7   DT  7   7   7   DT  T   E . n 
C 3 8   DT  8   8   8   DT  T   E . n 
C 3 9   DC  9   9   9   DC  C   E . n 
C 3 10  DG  10  10  10  DG  G   E . n 
C 3 11  DT  11  11  11  DT  T   E . n 
C 3 12  DA  12  12  12  DA  A   E . n 
C 3 13  DT  13  13  13  DT  T   E . n 
C 3 14  DA  14  14  14  DA  A   E . n 
C 3 15  DC  15  15  15  DC  C   E . n 
C 3 16  DG  16  16  16  DG  G   E . n 
C 3 17  DT  17  17  17  DT  T   E . n 
C 3 18  DA  18  18  18  DA  A   E . n 
C 3 19  DT  19  19  19  DT  T   E . n 
C 3 20  DG  20  20  20  DG  G   E . n 
C 3 21  DT  21  21  21  DT  T   E . n 
C 3 22  DA  22  22  22  DA  A   E . n 
C 3 23  DT  23  23  23  DT  T   E . n 
C 3 24  DA  24  24  24  DA  A   E . n 
C 3 25  DT  25  25  25  DT  T   E . n 
C 3 26  DA  26  26  26  DA  A   E . n 
C 3 27  DC  27  27  27  DC  C   E . n 
C 3 28  DG  28  28  28  DG  G   E . n 
C 3 29  DA  29  29  29  DA  A   E . n 
C 3 30  DA  30  30  30  DA  A   E . n 
C 3 31  DA  31  31  31  DA  A   E . n 
C 3 32  DT  32  32  32  DT  T   E . n 
C 3 33  DT  33  33  33  DT  T   E . n 
C 3 34  DA  34  34  34  DA  A   E . n 
C 3 35  DT  35  35  35  DT  T   E . n 
D 4 1   DT  1   1   ?   ?   ?   F . n 
D 4 2   DA  2   2   2   DA  A   F . n 
D 4 3   DT  3   3   3   DT  T   F . n 
D 4 4   DA  4   4   4   DA  A   F . n 
D 4 5   DA  5   5   5   DA  A   F . n 
D 4 6   DA  6   6   6   DA  A   F . n 
D 4 7   DT  7   7   7   DT  T   F . n 
D 4 8   DT  8   8   8   DT  T   F . n 
D 4 9   DC  9   9   9   DC  C   F . n 
D 4 10  DG  10  10  10  DG  G   F . n 
D 4 11  DT  11  11  11  DT  T   F . n 
D 4 12  DA  12  12  12  DA  A   F . n 
D 4 13  DT  13  13  13  DT  T   F . n 
D 4 14  DA  14  14  14  DA  A   F . n 
D 4 15  DA  15  15  15  DA  A   F . n 
D 4 16  DT  16  16  16  DT  T   F . n 
D 4 17  DG  17  17  17  DG  G   F . n 
D 4 18  DT  18  18  18  DT  T   F . n 
D 4 19  DT  19  19  19  DT  T   F . n 
D 4 20  DA  20  20  20  DA  A   F . n 
D 4 21  DC  21  21  21  DC  C   F . n 
D 4 22  DG  22  22  22  DG  G   F . n 
D 4 23  DT  23  23  23  DT  T   F . n 
D 4 24  DA  24  24  24  DA  A   F . n 
D 4 25  DT  25  25  25  DT  T   F . n 
D 4 26  DA  26  26  26  DA  A   F . n 
D 4 27  DC  27  27  27  DC  C   F . n 
D 4 28  DG  28  28  28  DG  G   F . n 
D 4 29  DA  29  29  29  DA  A   F . n 
D 4 30  DA  30  30  30  DA  A   F . n 
D 4 31  DG  31  31  31  DG  G   F . n 
D 4 32  DT  32  32  32  DT  T   F . n 
D 4 33  DT  33  33  33  DT  T   F . n 
D 4 34  DA  34  34  34  DA  A   F . n 
D 4 35  DT  35  35  35  DT  T   F . n 
E 5 1   MET 1   1   ?   ?   ?   A . n 
E 5 2   SER 2   2   ?   ?   ?   A . n 
E 5 3   ASN 3   3   ?   ?   ?   A . n 
E 5 4   LEU 4   4   ?   ?   ?   A . n 
E 5 5   LEU 5   5   ?   ?   ?   A . n 
E 5 6   THR 6   6   ?   ?   ?   A . n 
E 5 7   VAL 7   7   ?   ?   ?   A . n 
E 5 8   HIS 8   8   ?   ?   ?   A . n 
E 5 9   GLN 9   9   ?   ?   ?   A . n 
E 5 10  ASN 10  10  ?   ?   ?   A . n 
E 5 11  LEU 11  11  ?   ?   ?   A . n 
E 5 12  PRO 12  12  ?   ?   ?   A . n 
E 5 13  ALA 13  13  ?   ?   ?   A . n 
E 5 14  LEU 14  14  ?   ?   ?   A . n 
E 5 15  PRO 15  15  ?   ?   ?   A . n 
E 5 16  VAL 16  16  ?   ?   ?   A . n 
E 5 17  ASP 17  17  ?   ?   ?   A . n 
E 5 18  ALA 18  18  ?   ?   ?   A . n 
E 5 19  THR 19  19  19  THR THR A . n 
E 5 20  SER 20  20  20  SER SER A . n 
E 5 21  ASP 21  21  21  ASP ASP A . n 
E 5 22  GLU 22  22  22  GLU GLU A . n 
E 5 23  VAL 23  23  23  VAL VAL A . n 
E 5 24  ARG 24  24  24  ARG ARG A . n 
E 5 25  LYS 25  25  25  LYS LYS A . n 
E 5 26  ASN 26  26  26  ASN ASN A . n 
E 5 27  LEU 27  27  27  LEU LEU A . n 
E 5 28  MET 28  28  28  MET MET A . n 
E 5 29  ASP 29  29  29  ASP ASP A . n 
E 5 30  MET 30  30  30  MET MET A . n 
E 5 31  PHE 31  31  31  PHE PHE A . n 
E 5 32  ARG 32  32  32  ARG ARG A . n 
E 5 33  ASP 33  33  33  ASP ASP A . n 
E 5 34  ARG 34  34  34  ARG ARG A . n 
E 5 35  GLN 35  35  35  GLN GLN A . n 
E 5 36  ALA 36  36  36  ALA ALA A . n 
E 5 37  PHE 37  37  37  PHE PHE A . n 
E 5 38  SER 38  38  38  SER SER A . n 
E 5 39  GLU 39  39  39  GLU GLU A . n 
E 5 40  HIS 40  40  40  HIS HIS A . n 
E 5 41  THR 41  41  41  THR THR A . n 
E 5 42  TRP 42  42  42  TRP TRP A . n 
E 5 43  LYS 43  43  43  LYS LYS A . n 
E 5 44  MET 44  44  44  MET MET A . n 
E 5 45  LEU 45  45  45  LEU LEU A . n 
E 5 46  LEU 46  46  46  LEU LEU A . n 
E 5 47  SER 47  47  47  SER SER A . n 
E 5 48  VAL 48  48  48  VAL VAL A . n 
E 5 49  CYS 49  49  49  CYS CYS A . n 
E 5 50  ARG 50  50  50  ARG ARG A . n 
E 5 51  SER 51  51  51  SER SER A . n 
E 5 52  TRP 52  52  52  TRP TRP A . n 
E 5 53  ALA 53  53  53  ALA ALA A . n 
E 5 54  ALA 54  54  54  ALA ALA A . n 
E 5 55  TRP 55  55  55  TRP TRP A . n 
E 5 56  CYS 56  56  56  CYS CYS A . n 
E 5 57  LYS 57  57  57  LYS LYS A . n 
E 5 58  LEU 58  58  58  LEU LEU A . n 
E 5 59  ASN 59  59  59  ASN ASN A . n 
E 5 60  ASN 60  60  60  ASN ASN A . n 
E 5 61  ARG 61  61  61  ARG ARG A . n 
E 5 62  LYS 62  62  62  LYS LYS A . n 
E 5 63  TRP 63  63  63  TRP TRP A . n 
E 5 64  PHE 64  64  64  PHE PHE A . n 
E 5 65  PRO 65  65  65  PRO PRO A . n 
E 5 66  ALA 66  66  66  ALA ALA A . n 
E 5 67  GLU 67  67  67  GLU GLU A . n 
E 5 68  PRO 68  68  68  PRO PRO A . n 
E 5 69  GLU 69  69  69  GLU GLU A . n 
E 5 70  ASP 70  70  70  ASP ASP A . n 
E 5 71  VAL 71  71  71  VAL VAL A . n 
E 5 72  ARG 72  72  72  ARG ARG A . n 
E 5 73  ASP 73  73  73  ASP ASP A . n 
E 5 74  TYR 74  74  74  TYR TYR A . n 
E 5 75  LEU 75  75  75  LEU LEU A . n 
E 5 76  LEU 76  76  76  LEU LEU A . n 
E 5 77  TYR 77  77  77  TYR TYR A . n 
E 5 78  LEU 78  78  78  LEU LEU A . n 
E 5 79  GLN 79  79  79  GLN GLN A . n 
E 5 80  ALA 80  80  80  ALA ALA A . n 
E 5 81  ARG 81  81  81  ARG ARG A . n 
E 5 82  GLY 82  82  82  GLY GLY A . n 
E 5 83  LEU 83  83  83  LEU LEU A . n 
E 5 84  ALA 84  84  84  ALA ALA A . n 
E 5 85  VAL 85  85  85  VAL VAL A . n 
E 5 86  LYS 86  86  86  LYS LYS A . n 
E 5 87  THR 87  87  87  THR THR A . n 
E 5 88  ILE 88  88  88  ILE ILE A . n 
E 5 89  GLN 89  89  89  GLN GLN A . n 
E 5 90  GLN 90  90  90  GLN GLN A . n 
E 5 91  HIS 91  91  91  HIS HIS A . n 
E 5 92  LEU 92  92  92  LEU LEU A . n 
E 5 93  GLY 93  93  93  GLY GLY A . n 
E 5 94  GLN 94  94  94  GLN GLN A . n 
E 5 95  LEU 95  95  95  LEU LEU A . n 
E 5 96  ASN 96  96  96  ASN ASN A . n 
E 5 97  MET 97  97  97  MET MET A . n 
E 5 98  LEU 98  98  98  LEU LEU A . n 
E 5 99  HIS 99  99  99  HIS HIS A . n 
E 5 100 ARG 100 100 100 ARG ARG A . n 
E 5 101 ARG 101 101 101 ARG ARG A . n 
E 5 102 SER 102 102 102 SER SER A . n 
E 5 103 GLY 103 103 103 GLY GLY A . n 
E 5 104 LEU 104 104 104 LEU LEU A . n 
E 5 105 PRO 105 105 105 PRO PRO A . n 
E 5 106 ARG 106 106 106 ARG ARG A . n 
E 5 107 PRO 107 107 107 PRO PRO A . n 
E 5 108 SER 108 108 108 SER SER A . n 
E 5 109 ASP 109 109 109 ASP ASP A . n 
E 5 110 SER 110 110 110 SER SER A . n 
E 5 111 ASN 111 111 111 ASN ASN A . n 
E 5 112 ALA 112 112 112 ALA ALA A . n 
E 5 113 VAL 113 113 113 VAL VAL A . n 
E 5 114 SER 114 114 114 SER SER A . n 
E 5 115 LEU 115 115 115 LEU LEU A . n 
E 5 116 VAL 116 116 116 VAL VAL A . n 
E 5 117 MET 117 117 117 MET MET A . n 
E 5 118 ARG 118 118 118 ARG ARG A . n 
E 5 119 ARG 119 119 119 ARG ARG A . n 
E 5 120 ILE 120 120 120 ILE ILE A . n 
E 5 121 ARG 121 121 121 ARG ARG A . n 
E 5 122 LYS 122 122 122 LYS LYS A . n 
E 5 123 GLU 123 123 123 GLU GLU A . n 
E 5 124 ASN 124 124 124 ASN ASN A . n 
E 5 125 VAL 125 125 125 VAL VAL A . n 
E 5 126 ASP 126 126 126 ASP ASP A . n 
E 5 127 ALA 127 127 127 ALA ALA A . n 
E 5 128 GLY 128 128 128 GLY GLY A . n 
E 5 129 GLU 129 129 129 GLU GLU A . n 
E 5 130 ARG 130 130 130 ARG ARG A . n 
E 5 131 ALA 131 131 131 ALA ALA A . n 
E 5 132 LYS 132 132 132 LYS LYS A . n 
E 5 133 GLN 133 133 133 GLN GLN A . n 
E 5 134 ALA 134 134 134 ALA ALA A . n 
E 5 135 LEU 135 135 135 LEU LEU A . n 
E 5 136 ALA 136 136 136 ALA ALA A . n 
E 5 137 PHE 137 137 137 PHE PHE A . n 
E 5 138 GLU 138 138 138 GLU GLU A . n 
E 5 139 ARG 139 139 139 ARG ARG A . n 
E 5 140 THR 140 140 140 THR THR A . n 
E 5 141 ASP 141 141 141 ASP ASP A . n 
E 5 142 PHE 142 142 142 PHE PHE A . n 
E 5 143 ASP 143 143 143 ASP ASP A . n 
E 5 144 GLN 144 144 144 GLN GLN A . n 
E 5 145 VAL 145 145 145 VAL VAL A . n 
E 5 146 ARG 146 146 146 ARG ARG A . n 
E 5 147 SER 147 147 147 SER SER A . n 
E 5 148 LEU 148 148 148 LEU LEU A . n 
E 5 149 MET 149 149 149 MET MET A . n 
E 5 150 GLU 150 150 150 GLU GLU A . n 
E 5 151 ASN 151 151 151 ASN ASN A . n 
E 5 152 SER 152 152 152 SER SER A . n 
E 5 153 ASP 153 153 153 ASP ASP A . n 
E 5 154 ARG 154 154 154 ARG ARG A . n 
E 5 155 CYS 155 155 155 CYS CYS A . n 
E 5 156 GLN 156 156 156 GLN GLN A . n 
E 5 157 ASP 157 157 157 ASP ASP A . n 
E 5 158 ILE 158 158 158 ILE ILE A . n 
E 5 159 ARG 159 159 159 ARG ARG A . n 
E 5 160 ASN 160 160 160 ASN ASN A . n 
E 5 161 LEU 161 161 161 LEU LEU A . n 
E 5 162 ALA 162 162 162 ALA ALA A . n 
E 5 163 PHE 163 163 163 PHE PHE A . n 
E 5 164 LEU 164 164 164 LEU LEU A . n 
E 5 165 GLY 165 165 165 GLY GLY A . n 
E 5 166 ILE 166 166 166 ILE ILE A . n 
E 5 167 ALA 167 167 167 ALA ALA A . n 
E 5 168 TYR 168 168 168 TYR TYR A . n 
E 5 169 ASN 169 169 169 ASN ASN A . n 
E 5 170 THR 170 170 170 THR THR A . n 
E 5 171 LEU 171 171 171 LEU LEU A . n 
E 5 172 LEU 172 172 172 LEU LEU A . n 
E 5 173 LYS 173 173 173 LYS LYS A . n 
E 5 174 ILE 174 174 174 ILE ILE A . n 
E 5 175 ALA 175 175 175 ALA ALA A . n 
E 5 176 GLU 176 176 176 GLU GLU A . n 
E 5 177 ILE 177 177 177 ILE ILE A . n 
E 5 178 ALA 178 178 178 ALA ALA A . n 
E 5 179 ARG 179 179 179 ARG ARG A . n 
E 5 180 ILE 180 180 180 ILE ILE A . n 
E 5 181 ARG 181 181 181 ARG ARG A . n 
E 5 182 VAL 182 182 182 VAL VAL A . n 
E 5 183 LYS 183 183 183 LYS LYS A . n 
E 5 184 ASP 184 184 184 ASP ASP A . n 
E 5 185 ILE 185 185 185 ILE ILE A . n 
E 5 186 SER 186 186 186 SER SER A . n 
E 5 187 ARG 187 187 187 ARG ARG A . n 
E 5 188 THR 188 188 188 THR THR A . n 
E 5 189 ASP 189 189 189 ASP ASP A . n 
E 5 190 GLY 190 190 190 GLY GLY A . n 
E 5 191 GLY 191 191 191 GLY GLY A . n 
E 5 192 ARG 192 192 192 ARG ARG A . n 
E 5 193 MET 193 193 193 MET MET A . n 
E 5 194 LEU 194 194 194 LEU LEU A . n 
E 5 195 ILE 195 195 195 ILE ILE A . n 
E 5 196 HIS 196 196 196 HIS HIS A . n 
E 5 197 ILE 197 197 197 ILE ILE A . n 
E 5 198 GLY 198 198 198 GLY GLY A . n 
E 5 199 ARG 199 199 199 ARG ARG A . n 
E 5 200 THR 200 200 200 THR THR A . n 
E 5 201 LYS 201 201 201 LYS LYS A . n 
E 5 202 THR 202 202 202 THR THR A . n 
E 5 203 LEU 203 203 203 LEU LEU A . n 
E 5 204 VAL 204 204 204 VAL VAL A . n 
E 5 205 SER 205 205 205 SER SER A . n 
E 5 206 THR 206 206 206 THR THR A . n 
E 5 207 ALA 207 207 207 ALA ALA A . n 
E 5 208 GLY 208 208 208 GLY GLY A . n 
E 5 209 VAL 209 209 209 VAL VAL A . n 
E 5 210 GLU 210 210 210 GLU GLU A . n 
E 5 211 LYS 211 211 211 LYS LYS A . n 
E 5 212 ALA 212 212 212 ALA ALA A . n 
E 5 213 LEU 213 213 213 LEU LEU A . n 
E 5 214 SER 214 214 214 SER SER A . n 
E 5 215 LEU 215 215 215 LEU LEU A . n 
E 5 216 GLY 216 216 216 GLY GLY A . n 
E 5 217 VAL 217 217 217 VAL VAL A . n 
E 5 218 THR 218 218 218 THR THR A . n 
E 5 219 LYS 219 219 219 LYS LYS A . n 
E 5 220 LEU 220 220 220 LEU LEU A . n 
E 5 221 VAL 221 221 221 VAL VAL A . n 
E 5 222 GLU 222 222 222 GLU GLU A . n 
E 5 223 ARG 223 223 223 ARG ARG A . n 
E 5 224 TRP 224 224 224 TRP TRP A . n 
E 5 225 ILE 225 225 225 ILE ILE A . n 
E 5 226 SER 226 226 226 SER SER A . n 
E 5 227 VAL 227 227 227 VAL VAL A . n 
E 5 228 SER 228 228 228 SER SER A . n 
E 5 229 GLY 229 229 229 GLY GLY A . n 
E 5 230 VAL 230 230 230 VAL VAL A . n 
E 5 231 ALA 231 231 231 ALA ALA A . n 
E 5 232 ASP 232 232 232 ASP ASP A . n 
E 5 233 ASP 233 233 233 ASP ASP A . n 
E 5 234 PRO 234 234 234 PRO PRO A . n 
E 5 235 ASN 235 235 235 ASN ASN A . n 
E 5 236 ASN 236 236 236 ASN ASN A . n 
E 5 237 TYR 237 237 237 TYR TYR A . n 
E 5 238 LEU 238 238 238 LEU LEU A . n 
E 5 239 PHE 239 239 239 PHE PHE A . n 
E 5 240 CYS 240 240 240 CYS CYS A . n 
E 5 241 ARG 241 241 241 ARG ARG A . n 
E 5 242 VAL 242 242 242 VAL VAL A . n 
E 5 243 ARG 243 243 243 ARG ARG A . n 
E 5 244 LYS 244 244 244 LYS LYS A . n 
E 5 245 ASN 245 245 245 ASN ASN A . n 
E 5 246 GLY 246 246 246 GLY GLY A . n 
E 5 247 VAL 247 247 247 VAL VAL A . n 
E 5 248 ALA 248 248 248 ALA ALA A . n 
E 5 249 ALA 249 249 249 ALA ALA A . n 
E 5 250 PRO 250 250 250 PRO PRO A . n 
E 5 251 SER 251 251 251 SER SER A . n 
E 5 252 ALA 252 252 252 ALA ALA A . n 
E 5 253 THR 253 253 253 THR THR A . n 
E 5 254 SER 254 254 254 SER SER A . n 
E 5 255 GLN 255 255 255 GLN GLN A . n 
E 5 256 LEU 256 256 256 LEU LEU A . n 
E 5 257 SER 257 257 257 SER SER A . n 
E 5 258 THR 258 258 258 THR THR A . n 
E 5 259 ARG 259 259 259 ARG ARG A . n 
E 5 260 ALA 260 260 260 ALA ALA A . n 
E 5 261 LEU 261 261 261 LEU LEU A . n 
E 5 262 GLU 262 262 262 GLU GLU A . n 
E 5 263 GLY 263 263 263 GLY GLY A . n 
E 5 264 ILE 264 264 264 ILE ILE A . n 
E 5 265 PHE 265 265 265 PHE PHE A . n 
E 5 266 GLU 266 266 266 GLU GLU A . n 
E 5 267 ALA 267 267 267 ALA ALA A . n 
E 5 268 THR 268 268 268 THR THR A . n 
E 5 269 HIS 269 269 269 HIS HIS A . n 
E 5 270 ARG 270 270 270 ARG ARG A . n 
E 5 271 LEU 271 271 271 LEU LEU A . n 
E 5 272 ILE 272 272 272 ILE ILE A . n 
E 5 273 TYR 273 273 273 TYR TYR A . n 
E 5 274 GLY 274 274 274 GLY GLY A . n 
E 5 275 ALA 275 275 275 ALA ALA A . n 
E 5 276 LYS 276 276 276 LYS LYS A . n 
E 5 277 ASP 277 277 277 ASP ASP A . n 
E 5 278 ASP 278 278 278 ASP ASP A . n 
E 5 279 SER 279 279 279 SER SER A . n 
E 5 280 GLY 280 280 280 GLY GLY A . n 
E 5 281 GLN 281 281 281 GLN GLN A . n 
E 5 282 ARG 282 282 282 ARG ARG A . n 
E 5 283 TYR 283 283 283 TYR TYR A . n 
E 5 284 LEU 284 284 284 LEU LEU A . n 
E 5 285 ALA 285 285 285 ALA ALA A . n 
E 5 286 TRP 286 286 286 TRP TRP A . n 
E 5 287 SER 287 287 287 SER SER A . n 
E 5 288 GLY 288 288 288 GLY GLY A . n 
E 5 289 HIS 289 289 289 HIS HIS A . n 
E 5 290 SER 290 290 290 SER SER A . n 
E 5 291 ALA 291 291 291 ALA ALA A . n 
E 5 292 ARG 292 292 292 ARG ARG A . n 
E 5 293 VAL 293 293 293 VAL VAL A . n 
E 5 294 GLY 294 294 294 GLY GLY A . n 
E 5 295 ALA 295 295 295 ALA ALA A . n 
E 5 296 ALA 296 296 296 ALA ALA A . n 
E 5 297 ARG 297 297 297 ARG ARG A . n 
E 5 298 ASP 298 298 298 ASP ASP A . n 
E 5 299 MET 299 299 299 MET MET A . n 
E 5 300 ALA 300 300 300 ALA ALA A . n 
E 5 301 ARG 301 301 301 ARG ARG A . n 
E 5 302 ALA 302 302 302 ALA ALA A . n 
E 5 303 GLY 303 303 303 GLY GLY A . n 
E 5 304 VAL 304 304 304 VAL VAL A . n 
E 5 305 SER 305 305 305 SER SER A . n 
E 5 306 ILE 306 306 306 ILE ILE A . n 
E 5 307 PRO 307 307 307 PRO PRO A . n 
E 5 308 GLU 308 308 308 GLU GLU A . n 
E 5 309 ILE 309 309 309 ILE ILE A . n 
E 5 310 MET 310 310 310 MET MET A . n 
E 5 311 GLN 311 311 311 GLN GLN A . n 
E 5 312 ALA 312 312 312 ALA ALA A . n 
E 5 313 GLY 313 313 313 GLY GLY A . n 
E 5 314 GLY 314 314 314 GLY GLY A . n 
E 5 315 TRP 315 315 315 TRP TRP A . n 
E 5 316 THR 316 316 316 THR THR A . n 
E 5 317 ASN 317 317 317 ASN ASN A . n 
E 5 318 VAL 318 318 318 VAL VAL A . n 
E 5 319 ASN 319 319 319 ASN ASN A . n 
E 5 320 ILE 320 320 320 ILE ILE A . n 
E 5 321 VAL 321 321 321 VAL VAL A . n 
E 5 322 MET 322 322 322 MET MET A . n 
E 5 323 ASN 323 323 323 ASN ASN A . n 
E 5 324 TYR 324 324 324 TYR TYR A . n 
E 5 325 ILE 325 325 325 ILE ILE A . n 
E 5 326 ARG 326 326 326 ARG ARG A . n 
E 5 327 ASN 327 327 327 ASN ASN A . n 
E 5 328 LEU 328 328 328 LEU LEU A . n 
E 5 329 ASP 329 329 329 ASP ASP A . n 
E 5 330 SER 330 330 330 SER SER A . n 
E 5 331 GLU 331 331 331 GLU GLU A . n 
E 5 332 THR 332 332 332 THR THR A . n 
E 5 333 GLY 333 333 333 GLY GLY A . n 
E 5 334 ALA 334 334 334 ALA ALA A . n 
E 5 335 MET 335 335 335 MET MET A . n 
E 5 336 VAL 336 336 336 VAL VAL A . n 
E 5 337 ARG 337 337 337 ARG ARG A . n 
E 5 338 LEU 338 338 338 LEU LEU A . n 
E 5 339 LEU 339 339 339 LEU LEU A . n 
E 5 340 GLU 340 340 340 GLU GLU A . n 
E 5 341 ASP 341 341 341 ASP ASP A . n 
E 5 342 GLY 342 342 ?   ?   ?   A . n 
E 5 343 ASP 343 343 ?   ?   ?   A . n 
F 5 1   MET 1   1   ?   ?   ?   B . n 
F 5 2   SER 2   2   ?   ?   ?   B . n 
F 5 3   ASN 3   3   ?   ?   ?   B . n 
F 5 4   LEU 4   4   ?   ?   ?   B . n 
F 5 5   LEU 5   5   ?   ?   ?   B . n 
F 5 6   THR 6   6   ?   ?   ?   B . n 
F 5 7   VAL 7   7   ?   ?   ?   B . n 
F 5 8   HIS 8   8   ?   ?   ?   B . n 
F 5 9   GLN 9   9   ?   ?   ?   B . n 
F 5 10  ASN 10  10  ?   ?   ?   B . n 
F 5 11  LEU 11  11  ?   ?   ?   B . n 
F 5 12  PRO 12  12  ?   ?   ?   B . n 
F 5 13  ALA 13  13  ?   ?   ?   B . n 
F 5 14  LEU 14  14  ?   ?   ?   B . n 
F 5 15  PRO 15  15  ?   ?   ?   B . n 
F 5 16  VAL 16  16  ?   ?   ?   B . n 
F 5 17  ASP 17  17  ?   ?   ?   B . n 
F 5 18  ALA 18  18  ?   ?   ?   B . n 
F 5 19  THR 19  19  19  THR THR B . n 
F 5 20  SER 20  20  20  SER SER B . n 
F 5 21  ASP 21  21  21  ASP ASP B . n 
F 5 22  GLU 22  22  22  GLU GLU B . n 
F 5 23  VAL 23  23  23  VAL VAL B . n 
F 5 24  ARG 24  24  24  ARG ARG B . n 
F 5 25  LYS 25  25  25  LYS LYS B . n 
F 5 26  ASN 26  26  26  ASN ASN B . n 
F 5 27  LEU 27  27  27  LEU LEU B . n 
F 5 28  MET 28  28  28  MET MET B . n 
F 5 29  ASP 29  29  29  ASP ASP B . n 
F 5 30  MET 30  30  30  MET MET B . n 
F 5 31  PHE 31  31  31  PHE PHE B . n 
F 5 32  ARG 32  32  32  ARG ARG B . n 
F 5 33  ASP 33  33  33  ASP ASP B . n 
F 5 34  ARG 34  34  34  ARG ARG B . n 
F 5 35  GLN 35  35  35  GLN GLN B . n 
F 5 36  ALA 36  36  36  ALA ALA B . n 
F 5 37  PHE 37  37  37  PHE PHE B . n 
F 5 38  SER 38  38  38  SER SER B . n 
F 5 39  GLU 39  39  39  GLU GLU B . n 
F 5 40  HIS 40  40  40  HIS HIS B . n 
F 5 41  THR 41  41  41  THR THR B . n 
F 5 42  TRP 42  42  42  TRP TRP B . n 
F 5 43  LYS 43  43  43  LYS LYS B . n 
F 5 44  MET 44  44  44  MET MET B . n 
F 5 45  LEU 45  45  45  LEU LEU B . n 
F 5 46  LEU 46  46  46  LEU LEU B . n 
F 5 47  SER 47  47  47  SER SER B . n 
F 5 48  VAL 48  48  48  VAL VAL B . n 
F 5 49  CYS 49  49  49  CYS CYS B . n 
F 5 50  ARG 50  50  50  ARG ARG B . n 
F 5 51  SER 51  51  51  SER SER B . n 
F 5 52  TRP 52  52  52  TRP TRP B . n 
F 5 53  ALA 53  53  53  ALA ALA B . n 
F 5 54  ALA 54  54  54  ALA ALA B . n 
F 5 55  TRP 55  55  55  TRP TRP B . n 
F 5 56  CYS 56  56  56  CYS CYS B . n 
F 5 57  LYS 57  57  57  LYS LYS B . n 
F 5 58  LEU 58  58  58  LEU LEU B . n 
F 5 59  ASN 59  59  59  ASN ASN B . n 
F 5 60  ASN 60  60  60  ASN ASN B . n 
F 5 61  ARG 61  61  61  ARG ARG B . n 
F 5 62  LYS 62  62  62  LYS LYS B . n 
F 5 63  TRP 63  63  63  TRP TRP B . n 
F 5 64  PHE 64  64  64  PHE PHE B . n 
F 5 65  PRO 65  65  65  PRO PRO B . n 
F 5 66  ALA 66  66  66  ALA ALA B . n 
F 5 67  GLU 67  67  67  GLU GLU B . n 
F 5 68  PRO 68  68  68  PRO PRO B . n 
F 5 69  GLU 69  69  69  GLU GLU B . n 
F 5 70  ASP 70  70  70  ASP ASP B . n 
F 5 71  VAL 71  71  71  VAL VAL B . n 
F 5 72  ARG 72  72  72  ARG ARG B . n 
F 5 73  ASP 73  73  73  ASP ASP B . n 
F 5 74  TYR 74  74  74  TYR TYR B . n 
F 5 75  LEU 75  75  75  LEU LEU B . n 
F 5 76  LEU 76  76  76  LEU LEU B . n 
F 5 77  TYR 77  77  77  TYR TYR B . n 
F 5 78  LEU 78  78  78  LEU LEU B . n 
F 5 79  GLN 79  79  79  GLN GLN B . n 
F 5 80  ALA 80  80  80  ALA ALA B . n 
F 5 81  ARG 81  81  81  ARG ARG B . n 
F 5 82  GLY 82  82  82  GLY GLY B . n 
F 5 83  LEU 83  83  83  LEU LEU B . n 
F 5 84  ALA 84  84  84  ALA ALA B . n 
F 5 85  VAL 85  85  85  VAL VAL B . n 
F 5 86  LYS 86  86  86  LYS LYS B . n 
F 5 87  THR 87  87  87  THR THR B . n 
F 5 88  ILE 88  88  88  ILE ILE B . n 
F 5 89  GLN 89  89  89  GLN GLN B . n 
F 5 90  GLN 90  90  90  GLN GLN B . n 
F 5 91  HIS 91  91  91  HIS HIS B . n 
F 5 92  LEU 92  92  92  LEU LEU B . n 
F 5 93  GLY 93  93  93  GLY GLY B . n 
F 5 94  GLN 94  94  94  GLN GLN B . n 
F 5 95  LEU 95  95  95  LEU LEU B . n 
F 5 96  ASN 96  96  96  ASN ASN B . n 
F 5 97  MET 97  97  97  MET MET B . n 
F 5 98  LEU 98  98  98  LEU LEU B . n 
F 5 99  HIS 99  99  99  HIS HIS B . n 
F 5 100 ARG 100 100 100 ARG ARG B . n 
F 5 101 ARG 101 101 101 ARG ARG B . n 
F 5 102 SER 102 102 102 SER SER B . n 
F 5 103 GLY 103 103 103 GLY GLY B . n 
F 5 104 LEU 104 104 104 LEU LEU B . n 
F 5 105 PRO 105 105 105 PRO PRO B . n 
F 5 106 ARG 106 106 106 ARG ARG B . n 
F 5 107 PRO 107 107 107 PRO PRO B . n 
F 5 108 SER 108 108 108 SER SER B . n 
F 5 109 ASP 109 109 109 ASP ASP B . n 
F 5 110 SER 110 110 110 SER SER B . n 
F 5 111 ASN 111 111 111 ASN ASN B . n 
F 5 112 ALA 112 112 112 ALA ALA B . n 
F 5 113 VAL 113 113 113 VAL VAL B . n 
F 5 114 SER 114 114 114 SER SER B . n 
F 5 115 LEU 115 115 115 LEU LEU B . n 
F 5 116 VAL 116 116 116 VAL VAL B . n 
F 5 117 MET 117 117 117 MET MET B . n 
F 5 118 ARG 118 118 118 ARG ARG B . n 
F 5 119 ARG 119 119 119 ARG ARG B . n 
F 5 120 ILE 120 120 120 ILE ILE B . n 
F 5 121 ARG 121 121 121 ARG ARG B . n 
F 5 122 LYS 122 122 122 LYS LYS B . n 
F 5 123 GLU 123 123 123 GLU GLU B . n 
F 5 124 ASN 124 124 124 ASN ASN B . n 
F 5 125 VAL 125 125 125 VAL VAL B . n 
F 5 126 ASP 126 126 126 ASP ASP B . n 
F 5 127 ALA 127 127 127 ALA ALA B . n 
F 5 128 GLY 128 128 128 GLY GLY B . n 
F 5 129 GLU 129 129 129 GLU GLU B . n 
F 5 130 ARG 130 130 130 ARG ARG B . n 
F 5 131 ALA 131 131 131 ALA ALA B . n 
F 5 132 LYS 132 132 132 LYS LYS B . n 
F 5 133 GLN 133 133 133 GLN GLN B . n 
F 5 134 ALA 134 134 134 ALA ALA B . n 
F 5 135 LEU 135 135 135 LEU LEU B . n 
F 5 136 ALA 136 136 136 ALA ALA B . n 
F 5 137 PHE 137 137 137 PHE PHE B . n 
F 5 138 GLU 138 138 138 GLU GLU B . n 
F 5 139 ARG 139 139 139 ARG ARG B . n 
F 5 140 THR 140 140 140 THR THR B . n 
F 5 141 ASP 141 141 141 ASP ASP B . n 
F 5 142 PHE 142 142 142 PHE PHE B . n 
F 5 143 ASP 143 143 143 ASP ASP B . n 
F 5 144 GLN 144 144 144 GLN GLN B . n 
F 5 145 VAL 145 145 145 VAL VAL B . n 
F 5 146 ARG 146 146 146 ARG ARG B . n 
F 5 147 SER 147 147 147 SER SER B . n 
F 5 148 LEU 148 148 148 LEU LEU B . n 
F 5 149 MET 149 149 149 MET MET B . n 
F 5 150 GLU 150 150 150 GLU GLU B . n 
F 5 151 ASN 151 151 151 ASN ASN B . n 
F 5 152 SER 152 152 152 SER SER B . n 
F 5 153 ASP 153 153 153 ASP ASP B . n 
F 5 154 ARG 154 154 154 ARG ARG B . n 
F 5 155 CYS 155 155 155 CYS CYS B . n 
F 5 156 GLN 156 156 156 GLN GLN B . n 
F 5 157 ASP 157 157 157 ASP ASP B . n 
F 5 158 ILE 158 158 158 ILE ILE B . n 
F 5 159 ARG 159 159 159 ARG ARG B . n 
F 5 160 ASN 160 160 160 ASN ASN B . n 
F 5 161 LEU 161 161 161 LEU LEU B . n 
F 5 162 ALA 162 162 162 ALA ALA B . n 
F 5 163 PHE 163 163 163 PHE PHE B . n 
F 5 164 LEU 164 164 164 LEU LEU B . n 
F 5 165 GLY 165 165 165 GLY GLY B . n 
F 5 166 ILE 166 166 166 ILE ILE B . n 
F 5 167 ALA 167 167 167 ALA ALA B . n 
F 5 168 TYR 168 168 168 TYR TYR B . n 
F 5 169 ASN 169 169 169 ASN ASN B . n 
F 5 170 THR 170 170 170 THR THR B . n 
F 5 171 LEU 171 171 171 LEU LEU B . n 
F 5 172 LEU 172 172 172 LEU LEU B . n 
F 5 173 LYS 173 173 173 LYS LYS B . n 
F 5 174 ILE 174 174 174 ILE ILE B . n 
F 5 175 ALA 175 175 175 ALA ALA B . n 
F 5 176 GLU 176 176 176 GLU GLU B . n 
F 5 177 ILE 177 177 177 ILE ILE B . n 
F 5 178 ALA 178 178 178 ALA ALA B . n 
F 5 179 ARG 179 179 179 ARG ARG B . n 
F 5 180 ILE 180 180 180 ILE ILE B . n 
F 5 181 ARG 181 181 181 ARG ARG B . n 
F 5 182 VAL 182 182 182 VAL VAL B . n 
F 5 183 LYS 183 183 183 LYS LYS B . n 
F 5 184 ASP 184 184 184 ASP ASP B . n 
F 5 185 ILE 185 185 185 ILE ILE B . n 
F 5 186 SER 186 186 186 SER SER B . n 
F 5 187 ARG 187 187 187 ARG ARG B . n 
F 5 188 THR 188 188 188 THR THR B . n 
F 5 189 ASP 189 189 189 ASP ASP B . n 
F 5 190 GLY 190 190 190 GLY GLY B . n 
F 5 191 GLY 191 191 191 GLY GLY B . n 
F 5 192 ARG 192 192 192 ARG ARG B . n 
F 5 193 MET 193 193 193 MET MET B . n 
F 5 194 LEU 194 194 194 LEU LEU B . n 
F 5 195 ILE 195 195 195 ILE ILE B . n 
F 5 196 HIS 196 196 196 HIS HIS B . n 
F 5 197 ILE 197 197 197 ILE ILE B . n 
F 5 198 GLY 198 198 198 GLY GLY B . n 
F 5 199 ARG 199 199 199 ARG ARG B . n 
F 5 200 THR 200 200 200 THR THR B . n 
F 5 201 LYS 201 201 201 LYS LYS B . n 
F 5 202 THR 202 202 202 THR THR B . n 
F 5 203 LEU 203 203 203 LEU LEU B . n 
F 5 204 VAL 204 204 204 VAL VAL B . n 
F 5 205 SER 205 205 205 SER SER B . n 
F 5 206 THR 206 206 206 THR THR B . n 
F 5 207 ALA 207 207 207 ALA ALA B . n 
F 5 208 GLY 208 208 208 GLY GLY B . n 
F 5 209 VAL 209 209 209 VAL VAL B . n 
F 5 210 GLU 210 210 210 GLU GLU B . n 
F 5 211 LYS 211 211 211 LYS LYS B . n 
F 5 212 ALA 212 212 212 ALA ALA B . n 
F 5 213 LEU 213 213 213 LEU LEU B . n 
F 5 214 SER 214 214 214 SER SER B . n 
F 5 215 LEU 215 215 215 LEU LEU B . n 
F 5 216 GLY 216 216 216 GLY GLY B . n 
F 5 217 VAL 217 217 217 VAL VAL B . n 
F 5 218 THR 218 218 218 THR THR B . n 
F 5 219 LYS 219 219 219 LYS LYS B . n 
F 5 220 LEU 220 220 220 LEU LEU B . n 
F 5 221 VAL 221 221 221 VAL VAL B . n 
F 5 222 GLU 222 222 222 GLU GLU B . n 
F 5 223 ARG 223 223 223 ARG ARG B . n 
F 5 224 TRP 224 224 224 TRP TRP B . n 
F 5 225 ILE 225 225 225 ILE ILE B . n 
F 5 226 SER 226 226 226 SER SER B . n 
F 5 227 VAL 227 227 227 VAL VAL B . n 
F 5 228 SER 228 228 228 SER SER B . n 
F 5 229 GLY 229 229 229 GLY GLY B . n 
F 5 230 VAL 230 230 230 VAL VAL B . n 
F 5 231 ALA 231 231 231 ALA ALA B . n 
F 5 232 ASP 232 232 232 ASP ASP B . n 
F 5 233 ASP 233 233 233 ASP ASP B . n 
F 5 234 PRO 234 234 234 PRO PRO B . n 
F 5 235 ASN 235 235 235 ASN ASN B . n 
F 5 236 ASN 236 236 236 ASN ASN B . n 
F 5 237 TYR 237 237 237 TYR TYR B . n 
F 5 238 LEU 238 238 238 LEU LEU B . n 
F 5 239 PHE 239 239 239 PHE PHE B . n 
F 5 240 CYS 240 240 240 CYS CYS B . n 
F 5 241 ARG 241 241 241 ARG ARG B . n 
F 5 242 VAL 242 242 242 VAL VAL B . n 
F 5 243 ARG 243 243 243 ARG ARG B . n 
F 5 244 LYS 244 244 244 LYS LYS B . n 
F 5 245 ASN 245 245 245 ASN ASN B . n 
F 5 246 GLY 246 246 246 GLY GLY B . n 
F 5 247 VAL 247 247 247 VAL VAL B . n 
F 5 248 ALA 248 248 248 ALA ALA B . n 
F 5 249 ALA 249 249 249 ALA ALA B . n 
F 5 250 PRO 250 250 250 PRO PRO B . n 
F 5 251 SER 251 251 251 SER SER B . n 
F 5 252 ALA 252 252 252 ALA ALA B . n 
F 5 253 THR 253 253 253 THR THR B . n 
F 5 254 SER 254 254 254 SER SER B . n 
F 5 255 GLN 255 255 255 GLN GLN B . n 
F 5 256 LEU 256 256 256 LEU LEU B . n 
F 5 257 SER 257 257 257 SER SER B . n 
F 5 258 THR 258 258 258 THR THR B . n 
F 5 259 ARG 259 259 259 ARG ARG B . n 
F 5 260 ALA 260 260 260 ALA ALA B . n 
F 5 261 LEU 261 261 261 LEU LEU B . n 
F 5 262 GLU 262 262 262 GLU GLU B . n 
F 5 263 GLY 263 263 263 GLY GLY B . n 
F 5 264 ILE 264 264 264 ILE ILE B . n 
F 5 265 PHE 265 265 265 PHE PHE B . n 
F 5 266 GLU 266 266 266 GLU GLU B . n 
F 5 267 ALA 267 267 267 ALA ALA B . n 
F 5 268 THR 268 268 268 THR THR B . n 
F 5 269 HIS 269 269 269 HIS HIS B . n 
F 5 270 ARG 270 270 270 ARG ARG B . n 
F 5 271 LEU 271 271 271 LEU LEU B . n 
F 5 272 ILE 272 272 272 ILE ILE B . n 
F 5 273 TYR 273 273 273 TYR TYR B . n 
F 5 274 GLY 274 274 274 GLY GLY B . n 
F 5 275 ALA 275 275 275 ALA ALA B . n 
F 5 276 LYS 276 276 276 LYS LYS B . n 
F 5 277 ASP 277 277 277 ASP ASP B . n 
F 5 278 ASP 278 278 278 ASP ASP B . n 
F 5 279 SER 279 279 279 SER SER B . n 
F 5 280 GLY 280 280 280 GLY GLY B . n 
F 5 281 GLN 281 281 281 GLN GLN B . n 
F 5 282 ARG 282 282 282 ARG ARG B . n 
F 5 283 TYR 283 283 283 TYR TYR B . n 
F 5 284 LEU 284 284 284 LEU LEU B . n 
F 5 285 ALA 285 285 285 ALA ALA B . n 
F 5 286 TRP 286 286 286 TRP TRP B . n 
F 5 287 SER 287 287 287 SER SER B . n 
F 5 288 GLY 288 288 288 GLY GLY B . n 
F 5 289 HIS 289 289 289 HIS HIS B . n 
F 5 290 SER 290 290 290 SER SER B . n 
F 5 291 ALA 291 291 291 ALA ALA B . n 
F 5 292 ARG 292 292 292 ARG ARG B . n 
F 5 293 VAL 293 293 293 VAL VAL B . n 
F 5 294 GLY 294 294 294 GLY GLY B . n 
F 5 295 ALA 295 295 295 ALA ALA B . n 
F 5 296 ALA 296 296 296 ALA ALA B . n 
F 5 297 ARG 297 297 297 ARG ARG B . n 
F 5 298 ASP 298 298 298 ASP ASP B . n 
F 5 299 MET 299 299 299 MET MET B . n 
F 5 300 ALA 300 300 300 ALA ALA B . n 
F 5 301 ARG 301 301 301 ARG ARG B . n 
F 5 302 ALA 302 302 302 ALA ALA B . n 
F 5 303 GLY 303 303 303 GLY GLY B . n 
F 5 304 VAL 304 304 304 VAL VAL B . n 
F 5 305 SER 305 305 305 SER SER B . n 
F 5 306 ILE 306 306 306 ILE ILE B . n 
F 5 307 PRO 307 307 307 PRO PRO B . n 
F 5 308 GLU 308 308 308 GLU GLU B . n 
F 5 309 ILE 309 309 309 ILE ILE B . n 
F 5 310 MET 310 310 310 MET MET B . n 
F 5 311 GLN 311 311 311 GLN GLN B . n 
F 5 312 ALA 312 312 312 ALA ALA B . n 
F 5 313 GLY 313 313 313 GLY GLY B . n 
F 5 314 GLY 314 314 314 GLY GLY B . n 
F 5 315 TRP 315 315 315 TRP TRP B . n 
F 5 316 THR 316 316 316 THR THR B . n 
F 5 317 ASN 317 317 317 ASN ASN B . n 
F 5 318 VAL 318 318 318 VAL VAL B . n 
F 5 319 ASN 319 319 319 ASN ASN B . n 
F 5 320 ILE 320 320 320 ILE ILE B . n 
F 5 321 VAL 321 321 321 VAL VAL B . n 
F 5 322 MET 322 322 322 MET MET B . n 
F 5 323 ASN 323 323 323 ASN ASN B . n 
F 5 324 TYR 324 324 324 TYR TYR B . n 
F 5 325 ILE 325 325 325 ILE ILE B . n 
F 5 326 ARG 326 326 326 ARG ARG B . n 
F 5 327 ASN 327 327 327 ASN ASN B . n 
F 5 328 LEU 328 328 328 LEU LEU B . n 
F 5 329 ASP 329 329 329 ASP ASP B . n 
F 5 330 SER 330 330 330 SER SER B . n 
F 5 331 GLU 331 331 331 GLU GLU B . n 
F 5 332 THR 332 332 332 THR THR B . n 
F 5 333 GLY 333 333 333 GLY GLY B . n 
F 5 334 ALA 334 334 334 ALA ALA B . n 
F 5 335 MET 335 335 335 MET MET B . n 
F 5 336 VAL 336 336 336 VAL VAL B . n 
F 5 337 ARG 337 337 337 ARG ARG B . n 
F 5 338 LEU 338 338 338 LEU LEU B . n 
F 5 339 LEU 339 339 339 LEU LEU B . n 
F 5 340 GLU 340 340 340 GLU GLU B . n 
F 5 341 ASP 341 341 341 ASP ASP B . n 
F 5 342 GLY 342 342 ?   ?   ?   B . n 
F 5 343 ASP 343 343 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 6 HOH 1  36  10  HOH HOH C . 
G 6 HOH 2  37  46  HOH HOH C . 
G 6 HOH 3  38  47  HOH HOH C . 
G 6 HOH 4  39  65  HOH HOH C . 
G 6 HOH 5  40  70  HOH HOH C . 
G 6 HOH 6  41  89  HOH HOH C . 
G 6 HOH 7  42  92  HOH HOH C . 
G 6 HOH 8  43  104 HOH HOH C . 
G 6 HOH 9  44  105 HOH HOH C . 
G 6 HOH 10 45  109 HOH HOH C . 
G 6 HOH 11 46  127 HOH HOH C . 
G 6 HOH 12 47  133 HOH HOH C . 
G 6 HOH 13 48  182 HOH HOH C . 
G 6 HOH 14 49  226 HOH HOH C . 
H 6 HOH 1  36  13  HOH HOH D . 
H 6 HOH 2  37  16  HOH HOH D . 
H 6 HOH 3  38  18  HOH HOH D . 
H 6 HOH 4  39  33  HOH HOH D . 
H 6 HOH 5  40  34  HOH HOH D . 
H 6 HOH 6  41  35  HOH HOH D . 
H 6 HOH 7  42  38  HOH HOH D . 
H 6 HOH 8  43  45  HOH HOH D . 
H 6 HOH 9  44  52  HOH HOH D . 
H 6 HOH 10 45  58  HOH HOH D . 
H 6 HOH 11 46  62  HOH HOH D . 
H 6 HOH 12 47  66  HOH HOH D . 
H 6 HOH 13 48  72  HOH HOH D . 
H 6 HOH 14 49  75  HOH HOH D . 
H 6 HOH 15 50  79  HOH HOH D . 
H 6 HOH 16 51  81  HOH HOH D . 
H 6 HOH 17 52  84  HOH HOH D . 
H 6 HOH 18 53  100 HOH HOH D . 
H 6 HOH 19 54  110 HOH HOH D . 
H 6 HOH 20 55  111 HOH HOH D . 
H 6 HOH 21 56  120 HOH HOH D . 
H 6 HOH 22 57  147 HOH HOH D . 
H 6 HOH 23 58  148 HOH HOH D . 
H 6 HOH 24 59  155 HOH HOH D . 
H 6 HOH 25 60  159 HOH HOH D . 
H 6 HOH 26 61  183 HOH HOH D . 
H 6 HOH 27 62  189 HOH HOH D . 
H 6 HOH 28 63  193 HOH HOH D . 
H 6 HOH 29 64  202 HOH HOH D . 
H 6 HOH 30 65  203 HOH HOH D . 
H 6 HOH 31 66  205 HOH HOH D . 
H 6 HOH 32 67  206 HOH HOH D . 
I 6 HOH 1  55  55  HOH HOH E . 
I 6 HOH 2  63  63  HOH HOH E . 
I 6 HOH 3  96  96  HOH HOH E . 
I 6 HOH 4  103 103 HOH HOH E . 
I 6 HOH 5  116 116 HOH HOH E . 
I 6 HOH 6  126 126 HOH HOH E . 
I 6 HOH 7  142 142 HOH HOH E . 
I 6 HOH 8  178 178 HOH HOH E . 
I 6 HOH 9  200 200 HOH HOH E . 
J 6 HOH 1  344 1   HOH HOH A . 
J 6 HOH 2  345 3   HOH HOH A . 
J 6 HOH 3  346 5   HOH HOH A . 
J 6 HOH 4  347 8   HOH HOH A . 
J 6 HOH 5  348 9   HOH HOH A . 
J 6 HOH 6  349 12  HOH HOH A . 
J 6 HOH 7  350 14  HOH HOH A . 
J 6 HOH 8  351 20  HOH HOH A . 
J 6 HOH 9  352 21  HOH HOH A . 
J 6 HOH 10 353 24  HOH HOH A . 
J 6 HOH 11 354 39  HOH HOH A . 
J 6 HOH 12 355 42  HOH HOH A . 
J 6 HOH 13 356 43  HOH HOH A . 
J 6 HOH 14 357 51  HOH HOH A . 
J 6 HOH 15 358 53  HOH HOH A . 
J 6 HOH 16 359 64  HOH HOH A . 
J 6 HOH 17 360 68  HOH HOH A . 
J 6 HOH 18 361 71  HOH HOH A . 
J 6 HOH 19 362 73  HOH HOH A . 
J 6 HOH 20 363 80  HOH HOH A . 
J 6 HOH 21 364 82  HOH HOH A . 
J 6 HOH 22 365 86  HOH HOH A . 
J 6 HOH 23 366 91  HOH HOH A . 
J 6 HOH 24 367 95  HOH HOH A . 
J 6 HOH 25 368 98  HOH HOH A . 
J 6 HOH 26 369 102 HOH HOH A . 
J 6 HOH 27 370 107 HOH HOH A . 
J 6 HOH 28 371 113 HOH HOH A . 
J 6 HOH 29 372 114 HOH HOH A . 
J 6 HOH 30 373 118 HOH HOH A . 
J 6 HOH 31 374 119 HOH HOH A . 
J 6 HOH 32 375 121 HOH HOH A . 
J 6 HOH 33 376 122 HOH HOH A . 
J 6 HOH 34 377 123 HOH HOH A . 
J 6 HOH 35 378 124 HOH HOH A . 
J 6 HOH 36 379 128 HOH HOH A . 
J 6 HOH 37 380 130 HOH HOH A . 
J 6 HOH 38 381 132 HOH HOH A . 
J 6 HOH 39 382 139 HOH HOH A . 
J 6 HOH 40 383 140 HOH HOH A . 
J 6 HOH 41 384 141 HOH HOH A . 
J 6 HOH 42 385 143 HOH HOH A . 
J 6 HOH 43 386 144 HOH HOH A . 
J 6 HOH 44 387 145 HOH HOH A . 
J 6 HOH 45 388 152 HOH HOH A . 
J 6 HOH 46 389 156 HOH HOH A . 
J 6 HOH 47 390 157 HOH HOH A . 
J 6 HOH 48 391 158 HOH HOH A . 
J 6 HOH 49 392 160 HOH HOH A . 
J 6 HOH 50 393 163 HOH HOH A . 
J 6 HOH 51 394 165 HOH HOH A . 
J 6 HOH 52 395 166 HOH HOH A . 
J 6 HOH 53 396 170 HOH HOH A . 
J 6 HOH 54 397 173 HOH HOH A . 
J 6 HOH 55 398 176 HOH HOH A . 
J 6 HOH 56 399 177 HOH HOH A . 
J 6 HOH 57 400 184 HOH HOH A . 
J 6 HOH 58 401 185 HOH HOH A . 
J 6 HOH 59 402 186 HOH HOH A . 
J 6 HOH 60 403 187 HOH HOH A . 
J 6 HOH 61 404 188 HOH HOH A . 
J 6 HOH 62 405 191 HOH HOH A . 
J 6 HOH 63 406 194 HOH HOH A . 
J 6 HOH 64 407 195 HOH HOH A . 
J 6 HOH 65 408 196 HOH HOH A . 
J 6 HOH 66 409 199 HOH HOH A . 
J 6 HOH 67 410 201 HOH HOH A . 
J 6 HOH 68 411 204 HOH HOH A . 
J 6 HOH 69 412 210 HOH HOH A . 
J 6 HOH 70 413 211 HOH HOH A . 
J 6 HOH 71 414 213 HOH HOH A . 
J 6 HOH 72 415 218 HOH HOH A . 
J 6 HOH 73 416 219 HOH HOH A . 
J 6 HOH 74 417 220 HOH HOH A . 
J 6 HOH 75 418 222 HOH HOH A . 
J 6 HOH 76 419 223 HOH HOH A . 
J 6 HOH 77 420 224 HOH HOH A . 
J 6 HOH 78 421 227 HOH HOH A . 
J 6 HOH 79 422 233 HOH HOH A . 
J 6 HOH 80 423 234 HOH HOH A . 
J 6 HOH 81 424 235 HOH HOH A . 
J 6 HOH 82 425 236 HOH HOH A . 
K 6 HOH 1  344 2   HOH HOH B . 
K 6 HOH 2  345 4   HOH HOH B . 
K 6 HOH 3  346 6   HOH HOH B . 
K 6 HOH 4  347 7   HOH HOH B . 
K 6 HOH 5  348 11  HOH HOH B . 
K 6 HOH 6  349 15  HOH HOH B . 
K 6 HOH 7  350 17  HOH HOH B . 
K 6 HOH 8  351 19  HOH HOH B . 
K 6 HOH 9  352 22  HOH HOH B . 
K 6 HOH 10 353 23  HOH HOH B . 
K 6 HOH 11 354 25  HOH HOH B . 
K 6 HOH 12 355 26  HOH HOH B . 
K 6 HOH 13 356 27  HOH HOH B . 
K 6 HOH 14 357 28  HOH HOH B . 
K 6 HOH 15 358 29  HOH HOH B . 
K 6 HOH 16 359 30  HOH HOH B . 
K 6 HOH 17 360 31  HOH HOH B . 
K 6 HOH 18 361 32  HOH HOH B . 
K 6 HOH 19 362 36  HOH HOH B . 
K 6 HOH 20 363 37  HOH HOH B . 
K 6 HOH 21 364 40  HOH HOH B . 
K 6 HOH 22 365 41  HOH HOH B . 
K 6 HOH 23 366 44  HOH HOH B . 
K 6 HOH 24 367 48  HOH HOH B . 
K 6 HOH 25 368 49  HOH HOH B . 
K 6 HOH 26 369 50  HOH HOH B . 
K 6 HOH 27 370 54  HOH HOH B . 
K 6 HOH 28 371 56  HOH HOH B . 
K 6 HOH 29 372 57  HOH HOH B . 
K 6 HOH 30 373 59  HOH HOH B . 
K 6 HOH 31 374 60  HOH HOH B . 
K 6 HOH 32 375 61  HOH HOH B . 
K 6 HOH 33 376 67  HOH HOH B . 
K 6 HOH 34 377 69  HOH HOH B . 
K 6 HOH 35 378 74  HOH HOH B . 
K 6 HOH 36 379 76  HOH HOH B . 
K 6 HOH 37 380 77  HOH HOH B . 
K 6 HOH 38 381 78  HOH HOH B . 
K 6 HOH 39 382 83  HOH HOH B . 
K 6 HOH 40 383 85  HOH HOH B . 
K 6 HOH 41 384 87  HOH HOH B . 
K 6 HOH 42 385 88  HOH HOH B . 
K 6 HOH 43 386 90  HOH HOH B . 
K 6 HOH 44 387 93  HOH HOH B . 
K 6 HOH 45 388 94  HOH HOH B . 
K 6 HOH 46 389 97  HOH HOH B . 
K 6 HOH 47 390 99  HOH HOH B . 
K 6 HOH 48 391 101 HOH HOH B . 
K 6 HOH 49 392 106 HOH HOH B . 
K 6 HOH 50 393 108 HOH HOH B . 
K 6 HOH 51 394 112 HOH HOH B . 
K 6 HOH 52 395 115 HOH HOH B . 
K 6 HOH 53 396 117 HOH HOH B . 
K 6 HOH 54 397 125 HOH HOH B . 
K 6 HOH 55 398 129 HOH HOH B . 
K 6 HOH 56 399 131 HOH HOH B . 
K 6 HOH 57 400 134 HOH HOH B . 
K 6 HOH 58 401 135 HOH HOH B . 
K 6 HOH 59 402 136 HOH HOH B . 
K 6 HOH 60 403 137 HOH HOH B . 
K 6 HOH 61 404 138 HOH HOH B . 
K 6 HOH 62 405 146 HOH HOH B . 
K 6 HOH 63 406 149 HOH HOH B . 
K 6 HOH 64 407 150 HOH HOH B . 
K 6 HOH 65 408 151 HOH HOH B . 
K 6 HOH 66 409 153 HOH HOH B . 
K 6 HOH 67 410 154 HOH HOH B . 
K 6 HOH 68 411 161 HOH HOH B . 
K 6 HOH 69 412 162 HOH HOH B . 
K 6 HOH 70 413 164 HOH HOH B . 
K 6 HOH 71 414 167 HOH HOH B . 
K 6 HOH 72 415 168 HOH HOH B . 
K 6 HOH 73 416 169 HOH HOH B . 
K 6 HOH 74 417 171 HOH HOH B . 
K 6 HOH 75 418 172 HOH HOH B . 
K 6 HOH 76 419 174 HOH HOH B . 
K 6 HOH 77 420 179 HOH HOH B . 
K 6 HOH 78 421 180 HOH HOH B . 
K 6 HOH 79 422 181 HOH HOH B . 
K 6 HOH 80 423 190 HOH HOH B . 
K 6 HOH 81 424 192 HOH HOH B . 
K 6 HOH 82 425 197 HOH HOH B . 
K 6 HOH 83 426 198 HOH HOH B . 
K 6 HOH 84 427 207 HOH HOH B . 
K 6 HOH 85 428 208 HOH HOH B . 
K 6 HOH 86 429 209 HOH HOH B . 
K 6 HOH 87 430 214 HOH HOH B . 
K 6 HOH 88 431 215 HOH HOH B . 
K 6 HOH 89 432 217 HOH HOH B . 
K 6 HOH 90 433 221 HOH HOH B . 
K 6 HOH 91 434 225 HOH HOH B . 
K 6 HOH 92 435 228 HOH HOH B . 
K 6 HOH 93 436 229 HOH HOH B . 
K 6 HOH 94 437 230 HOH HOH B . 
K 6 HOH 95 438 231 HOH HOH B . 
K 6 HOH 96 439 232 HOH HOH B . 
K 6 HOH 97 440 237 HOH HOH B . 
K 6 HOH 98 441 238 HOH HOH B . 
K 6 HOH 99 442 239 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dodecameric 
_pdbx_struct_assembly.oligomeric_count     12 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 4_566 x,-y+1,-z+1 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 122.7000000000 0.0000000000 0.0000000000 -1.0000000000 179.5000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-12-14 
2 'Structure model' 1 1 2008-05-22 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2021-11-03 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Database references'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2         
2 4 'Structure model' struct_ref_seq_dif 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_database_2.pdbx_DOI'                
2 4 'Structure model' '_database_2.pdbx_database_accession' 
3 4 'Structure model' '_struct_ref_seq_dif.details'         
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR    'model building' .     ? 1 
X-PLOR    refinement       3.851 ? 2 
DENZO     'data reduction' .     ? 3 
SCALEPACK 'data scaling'   .     ? 4 
X-PLOR    phasing          .     ? 5 
# 
_pdbx_entry_details.entry_id                 3CRX 
_pdbx_entry_details.compound_details         
;THE STRUCTURE REPRESENTED IN THIS ENTRY  CONTAINS TWO CRE
MOLECULES AND FOUR DNA STRANDS.  THE DNA IN THIS STRUCTURE
HAS TWO-FOLD DISORDER IN THE 4 BP REGIONS ADJACENT TO THE
BRANCH POINTS IN EACH A ARM AND IN SINGLE BASE PAIR LOCATED
WITHIN THE CRE BINDING SITE. THE OCCUPANCIES OF ATOMS THESE
DISORDERED REGIONS HAVE BEEN SET TO 0.5.
;
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O  D HOH 37  ? ? O D HOH 52  ? ? 0.10 
2 1 O  B HOH 439 ? ? O B HOH 442 ? ? 0.38 
3 1 O  B TYR 237 ? ? O B HOH 417 ? ? 2.04 
4 1 O  A THR 206 ? ? N A GLY 208 ? ? 2.04 
5 1 CB B ASN 60  ? ? O B HOH 404 ? ? 2.11 
6 1 O  E HOH 96  ? ? O E HOH 103 ? ? 2.14 
7 1 O  B LYS 62  ? ? O B HOH 346 ? ? 2.17 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O   C HOH 49  ? ? 1_555 O   E HOH 200 ? ? 4_566 0.28 
2 1 OD1 A ASP 126 ? ? 1_555 NH2 B ARG 199 ? ? 4_566 1.85 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CB 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            TYR 
_pdbx_validate_rmsd_bond.auth_seq_id_1             283 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            CG 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            TYR 
_pdbx_validate_rmsd_bond.auth_seq_id_2             283 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.621 
_pdbx_validate_rmsd_bond.bond_target_value         1.512 
_pdbx_validate_rmsd_bond.bond_deviation            0.109 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.015 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 187 ? ? CZ A ARG 187 ? ? NH2 A ARG 187 ? ? 123.86 120.30 3.56   0.50 N 
2 1 NE A ARG 282 ? ? CZ A ARG 282 ? ? NH2 A ARG 282 ? ? 123.86 120.30 3.56   0.50 N 
3 1 CB A TYR 283 ? ? CG A TYR 283 ? ? CD1 A TYR 283 ? ? 125.38 121.00 4.38   0.60 N 
4 1 NE A ARG 326 ? ? CZ A ARG 326 ? ? NH2 A ARG 326 ? ? 123.96 120.30 3.66   0.50 N 
5 1 O  A SER 330 ? ? C  A SER 330 ? ? N   A GLU 331 ? ? 132.79 122.70 10.09  1.60 Y 
6 1 O  B ASP 21  ? ? C  B ASP 21  ? ? N   B GLU 22  ? ? 112.58 122.70 -10.12 1.60 Y 
7 1 NE B ARG 24  ? ? CZ B ARG 24  ? ? NH2 B ARG 24  ? ? 123.61 120.30 3.31   0.50 N 
8 1 NE B ARG 61  ? ? CZ B ARG 61  ? ? NH2 B ARG 61  ? ? 123.54 120.30 3.24   0.50 N 
9 1 NE B ARG 326 ? ? CZ B ARG 326 ? ? NH2 B ARG 326 ? ? 123.67 120.30 3.37   0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 60  ? ? 63.95   69.38   
2  1 ALA A 131 ? ? -64.22  -167.76 
3  1 ARG A 146 ? ? -55.87  -9.39   
4  1 ALA A 167 ? ? -49.00  -73.90  
5  1 LEU A 171 ? ? 50.32   10.84   
6  1 THR A 188 ? ? -176.02 -179.37 
7  1 ILE A 197 ? ? -119.16 -156.97 
8  1 ARG A 199 ? ? 50.82   85.44   
9  1 THR A 200 ? ? 112.94  164.51  
10 1 LYS A 201 ? ? 165.21  84.63   
11 1 THR A 202 ? ? -169.30 58.95   
12 1 LEU A 203 ? ? 71.87   -73.12  
13 1 SER A 205 ? ? 176.91  179.37  
14 1 ALA A 207 ? ? -4.53   -60.47  
15 1 VAL A 209 ? ? -108.91 -153.18 
16 1 GLU A 210 ? ? -162.37 69.99   
17 1 VAL A 217 ? ? -160.81 -34.30  
18 1 ASP A 233 ? ? 173.87  105.20  
19 1 TYR A 273 ? ? -98.30  44.63   
20 1 LYS A 276 ? ? 33.14   -150.10 
21 1 ARG A 282 ? ? 67.81   60.49   
22 1 TYR A 283 ? ? 161.96  51.92   
23 1 ALA A 302 ? ? -68.56  6.50    
24 1 SER A 330 ? ? -164.51 -23.90  
25 1 GLU A 340 ? ? -84.29  46.70   
26 1 GLU B 22  ? ? -25.91  -38.47  
27 1 ASP B 33  ? ? -96.89  40.53   
28 1 LYS B 122 ? ? -59.49  -71.02  
29 1 ARG B 199 ? ? 165.32  97.90   
30 1 VAL B 204 ? ? -176.84 -108.58 
31 1 SER B 205 ? ? -147.54 41.33   
32 1 ALA B 207 ? ? -25.64  -35.82  
33 1 THR B 253 ? ? -98.86  -69.77  
34 1 ALA B 302 ? ? -108.49 40.47   
35 1 VAL B 304 ? ? 43.78   104.76  
36 1 ASN B 317 ? ? -124.75 -149.95 
37 1 VAL B 318 ? ? -140.07 -28.60  
38 1 ILE B 325 ? ? -93.69  -85.55  
39 1 ARG B 326 ? ? 4.07    78.16   
40 1 ASN B 327 ? ? 176.88  -14.11  
41 1 LEU B 328 ? ? -89.32  -93.60  
42 1 SER B 330 ? ? -82.89  -82.51  
43 1 GLU B 331 ? ? -75.52  -153.33 
44 1 THR B 332 ? ? 70.76   121.43  
45 1 ALA B 334 ? ? 45.25   -119.33 
46 1 GLU B 340 ? ? -54.66  -89.50  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 D DT  1   ? B DT  1   
2  1 Y 1 F DT  1   ? D DT  1   
3  1 Y 1 A MET 1   ? E MET 1   
4  1 Y 1 A SER 2   ? E SER 2   
5  1 Y 1 A ASN 3   ? E ASN 3   
6  1 Y 1 A LEU 4   ? E LEU 4   
7  1 Y 1 A LEU 5   ? E LEU 5   
8  1 Y 1 A THR 6   ? E THR 6   
9  1 Y 1 A VAL 7   ? E VAL 7   
10 1 Y 1 A HIS 8   ? E HIS 8   
11 1 Y 1 A GLN 9   ? E GLN 9   
12 1 Y 1 A ASN 10  ? E ASN 10  
13 1 Y 1 A LEU 11  ? E LEU 11  
14 1 Y 1 A PRO 12  ? E PRO 12  
15 1 Y 1 A ALA 13  ? E ALA 13  
16 1 Y 1 A LEU 14  ? E LEU 14  
17 1 Y 1 A PRO 15  ? E PRO 15  
18 1 Y 1 A VAL 16  ? E VAL 16  
19 1 Y 1 A ASP 17  ? E ASP 17  
20 1 Y 1 A ALA 18  ? E ALA 18  
21 1 Y 1 A GLY 342 ? E GLY 342 
22 1 Y 1 A ASP 343 ? E ASP 343 
23 1 Y 1 B MET 1   ? F MET 1   
24 1 Y 1 B SER 2   ? F SER 2   
25 1 Y 1 B ASN 3   ? F ASN 3   
26 1 Y 1 B LEU 4   ? F LEU 4   
27 1 Y 1 B LEU 5   ? F LEU 5   
28 1 Y 1 B THR 6   ? F THR 6   
29 1 Y 1 B VAL 7   ? F VAL 7   
30 1 Y 1 B HIS 8   ? F HIS 8   
31 1 Y 1 B GLN 9   ? F GLN 9   
32 1 Y 1 B ASN 10  ? F ASN 10  
33 1 Y 1 B LEU 11  ? F LEU 11  
34 1 Y 1 B PRO 12  ? F PRO 12  
35 1 Y 1 B ALA 13  ? F ALA 13  
36 1 Y 1 B LEU 14  ? F LEU 14  
37 1 Y 1 B PRO 15  ? F PRO 15  
38 1 Y 1 B VAL 16  ? F VAL 16  
39 1 Y 1 B ASP 17  ? F ASP 17  
40 1 Y 1 B ALA 18  ? F ALA 18  
41 1 Y 1 B GLY 342 ? F GLY 342 
42 1 Y 1 B ASP 343 ? F ASP 343 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
3CRX 'double helix'         
3CRX 'b-form double helix'  
3CRX 'mismatched base pair' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DA 2  1_555 B DT 35 1_555 -0.983 -0.010 0.641  3.929   -13.883 -4.712 1  C_DA2:DT35_D  C 2  ? D 35 ? 20 1 
1 A DT 3  1_555 B DA 34 1_555 0.106  -0.097 -0.223 5.016   -10.406 -1.036 2  C_DT3:DA34_D  C 3  ? D 34 ? 20 1 
1 A DA 4  1_555 B DT 33 1_555 -0.684 -0.218 0.166  1.730   -14.231 -0.368 3  C_DA4:DT33_D  C 4  ? D 33 ? 20 1 
1 A DA 5  1_555 B DT 32 1_555 0.931  0.093  0.614  15.527  -6.024  3.226  4  C_DA5:DT32_D  C 5  ? D 32 ? 20 1 
1 A DG 6  1_555 B DC 31 1_555 -0.136 -0.095 -0.465 1.567   -10.512 2.775  5  C_DG6:DC31_D  C 6  ? D 31 ? 19 1 
1 A DT 7  1_555 B DA 30 1_555 -0.444 0.035  -0.200 2.034   -16.006 1.245  6  C_DT7:DA30_D  C 7  ? D 30 ? 20 1 
1 A DT 8  1_555 B DA 29 1_555 -0.290 0.025  -0.064 -6.621  -11.807 3.005  7  C_DT8:DA29_D  C 8  ? D 29 ? 20 1 
1 A DC 9  1_555 B DG 28 1_555 0.689  0.050  -0.018 -4.474  -9.674  2.665  8  C_DC9:DG28_D  C 9  ? D 28 ? 19 1 
1 A DG 10 1_555 B DC 27 1_555 -0.661 -0.092 -0.095 0.286   4.237   2.326  9  C_DG10:DC27_D C 10 ? D 27 ? 19 1 
1 A DT 11 1_555 B DA 26 1_555 0.133  0.104  -0.190 15.935  -8.213  4.030  10 C_DT11:DA26_D C 11 ? D 26 ? 20 1 
1 A DA 12 1_555 B DT 25 1_555 -0.324 -0.019 0.015  -1.025  -8.270  1.567  11 C_DA12:DT25_D C 12 ? D 25 ? 20 1 
1 A DT 13 1_555 B DA 24 1_555 0.337  0.011  -0.130 0.766   5.404   2.545  12 C_DT13:DA24_D C 13 ? D 24 ? 20 1 
1 A DA 14 1_555 B DT 23 1_555 -0.010 0.191  -0.319 -11.403 -4.925  0.653  13 C_DA14:DT23_D C 14 ? D 23 ? 20 1 
1 A DG 15 1_555 B DC 22 1_555 0.791  -0.087 0.190  -0.745  -10.696 0.690  14 C_DG15:DC22_D C 15 ? D 22 ? 19 1 
1 A DC 16 1_555 B DG 21 1_555 -0.128 0.149  -0.475 6.765   -3.232  9.118  15 C_DC16:DG21_D C 16 ? D 21 ? 19 1 
1 A DA 17 1_555 B DT 20 1_555 0.016  0.099  0.192  1.220   -15.079 1.357  16 C_DA17:DT20_D C 17 ? D 20 ? 20 1 
1 A DT 18 1_555 B DA 19 1_555 0.361  0.346  0.407  3.499   -8.783  5.501  17 C_DT18:DA19_D C 18 ? D 19 ? ?  ? 
1 A DA 19 1_555 D DT 18 1_555 -0.548 0.067  0.276  -5.312  -8.830  4.708  18 C_DA19:DT18_F C 19 ? F 18 ? 20 1 
1 A DC 20 1_555 D DG 17 1_555 -0.949 0.582  0.098  9.967   -8.045  8.855  19 C_DC20:DG17_F C 20 ? F 17 ? ?  1 
1 A DA 21 1_555 D DT 16 1_555 -0.254 -0.239 0.451  12.045  -16.092 -0.507 20 C_DA21:DT16_F C 21 ? F 16 ? 20 1 
1 A DT 23 1_555 D DA 14 1_555 0.125  0.439  -0.105 9.758   -12.574 4.728  21 C_DT23:DA14_F C 23 ? F 14 ? ?  ? 
1 A DA 24 1_555 D DT 13 1_555 -0.476 0.340  -0.049 -1.201  -2.456  10.396 22 C_DA24:DT13_F C 24 ? F 13 ? ?  ? 
1 A DT 25 1_555 D DA 12 1_555 0.614  0.051  0.029  -3.098  -9.803  -1.891 23 C_DT25:DA12_F C 25 ? F 12 ? 20 1 
1 A DA 26 1_555 D DT 11 1_555 -1.115 -0.560 0.333  -19.407 2.021   9.800  24 C_DA26:DT11_F C 26 ? F 11 ? 20 1 
1 A DC 27 1_555 D DG 10 1_555 1.290  -0.263 -0.066 3.294   1.625   6.889  25 C_DC27:DG10_F C 27 ? F 10 ? 19 1 
1 A DG 28 1_555 D DC 9  1_555 -0.197 0.103  0.278  10.499  -5.621  1.907  26 C_DG28:DC9_F  C 28 ? F 9  ? 19 1 
1 A DA 29 1_555 D DT 8  1_555 -0.004 0.154  0.083  7.333   -11.992 8.941  27 C_DA29:DT8_F  C 29 ? F 8  ? 20 1 
1 A DA 30 1_555 D DT 7  1_555 -0.215 -0.018 -0.204 -1.436  -17.619 0.370  28 C_DA30:DT7_F  C 30 ? F 7  ? 20 1 
1 A DT 31 1_555 D DA 6  1_555 -0.976 -0.089 0.110  -10.296 -9.187  1.829  29 C_DT31:DA6_F  C 31 ? F 6  ? 20 1 
1 A DT 32 1_555 D DA 5  1_555 0.005  0.415  0.282  -13.948 -13.958 4.746  30 C_DT32:DA5_F  C 32 ? F 5  ? ?  ? 
1 A DT 33 1_555 D DA 4  1_555 0.593  0.133  -0.218 3.308   -18.279 -1.238 31 C_DT33:DA4_F  C 33 ? F 4  ? 20 1 
1 A DA 34 1_555 D DT 3  1_555 0.502  -0.283 -0.317 -7.795  -7.237  2.381  32 C_DA34:DT3_F  C 34 ? F 3  ? 20 1 
1 A DT 35 1_555 D DA 2  1_555 0.876  -0.246 -0.477 -0.615  -17.740 3.533  33 C_DT35:DA2_F  C 35 ? F 2  ? 20 1 
1 B DA 2  1_555 C DT 35 1_555 -0.881 -0.254 -0.476 0.626   -17.758 3.535  34 D_DA2:DT35_E  D 2  ? E 35 ? 20 1 
1 B DT 3  1_555 C DA 34 1_555 -0.510 -0.287 -0.319 7.795   -7.219  2.383  35 D_DT3:DA34_E  D 3  ? E 34 ? 20 1 
1 B DA 4  1_555 C DT 33 1_555 -0.601 0.137  -0.221 -3.299  -18.280 -1.223 36 D_DA4:DT33_E  D 4  ? E 33 ? 20 1 
1 B DA 5  1_555 C DT 32 1_555 -0.010 0.423  0.281  13.978  -13.943 4.738  37 D_DA5:DT32_E  D 5  ? E 32 ? ?  ? 
1 B DT 6  1_555 C DA 31 1_555 0.862  -0.003 -0.277 15.645  -12.369 2.387  38 D_DT6:DA31_E  D 6  ? E 31 ? 20 1 
1 B DT 7  1_555 C DA 30 1_555 0.220  -0.011 -0.207 1.441   -17.602 0.362  39 D_DT7:DA30_E  D 7  ? E 30 ? 20 1 
1 B DT 8  1_555 C DA 29 1_555 0.011  0.156  0.080  -7.332  -11.999 8.902  40 D_DT8:DA29_E  D 8  ? E 29 ? 20 1 
1 B DC 9  1_555 C DG 28 1_555 0.205  0.100  0.276  -10.489 -5.635  1.903  41 D_DC9:DG28_E  D 9  ? E 28 ? 19 1 
1 B DG 10 1_555 C DC 27 1_555 -1.283 -0.270 -0.068 -3.306  1.631   6.873  42 D_DG10:DC27_E D 10 ? E 27 ? 19 1 
1 B DT 11 1_555 C DA 26 1_555 1.116  -0.570 0.333  19.401  2.010   9.795  43 D_DT11:DA26_E D 11 ? E 26 ? 20 1 
1 B DA 12 1_555 C DT 25 1_555 -0.617 0.043  0.028  3.100   -9.829  -1.896 44 D_DA12:DT25_E D 12 ? E 25 ? 20 1 
1 B DT 13 1_555 C DA 24 1_555 0.468  0.337  -0.049 1.198   -2.445  10.399 45 D_DT13:DA24_E D 13 ? E 24 ? ?  ? 
1 B DA 14 1_555 C DT 23 1_555 -0.134 0.442  -0.105 -9.772  -12.584 4.724  46 D_DA14:DT23_E D 14 ? E 23 ? ?  ? 
1 B DA 16 1_555 C DT 21 1_555 -0.045 -0.151 0.729  -6.513  -16.664 2.413  47 D_DA16:DT21_E D 16 ? E 21 ? 20 1 
1 B DC 17 1_555 C DG 20 1_555 0.919  0.454  0.239  -4.526  -8.879  6.567  48 D_DC17:DG20_E D 17 ? E 20 ? ?  ? 
1 B DA 18 1_555 C DT 19 1_555 0.694  -0.196 0.625  0.353   -4.643  -1.703 49 D_DA18:DT19_E D 18 ? E 19 ? 20 1 
1 C DA 2  1_555 D DT 35 1_555 -0.981 -0.010 0.640  3.926   -13.894 -4.745 50 E_DA2:DT35_F  E 2  ? F 35 ? 20 1 
1 C DT 3  1_555 D DA 34 1_555 0.106  -0.097 -0.222 5.021   -10.408 -1.026 51 E_DT3:DA34_F  E 3  ? F 34 ? 20 1 
1 C DA 4  1_555 D DT 33 1_555 -0.683 -0.218 0.167  1.729   -14.235 -0.369 52 E_DA4:DT33_F  E 4  ? F 33 ? 20 1 
1 C DA 5  1_555 D DT 32 1_555 0.930  0.093  0.616  15.551  -6.042  3.239  53 E_DA5:DT32_F  E 5  ? F 32 ? 20 1 
1 C DC 6  1_555 D DG 31 1_555 -0.516 0.007  -0.272 7.315   -8.531  4.157  54 E_DC6:DG31_F  E 6  ? F 31 ? 19 1 
1 C DT 7  1_555 D DA 30 1_555 -0.443 0.035  -0.202 2.075   -16.013 1.250  55 E_DT7:DA30_F  E 7  ? F 30 ? 20 1 
1 C DT 8  1_555 D DA 29 1_555 -0.290 0.025  -0.064 -6.615  -11.802 3.012  56 E_DT8:DA29_F  E 8  ? F 29 ? 20 1 
1 C DC 9  1_555 D DG 28 1_555 0.691  0.050  -0.018 -4.470  -9.664  2.681  57 E_DC9:DG28_F  E 9  ? F 28 ? 19 1 
1 C DG 10 1_555 D DC 27 1_555 -0.661 -0.092 -0.095 0.266   4.233   2.328  58 E_DG10:DC27_F E 10 ? F 27 ? 19 1 
1 C DT 11 1_555 D DA 26 1_555 0.133  0.103  -0.190 15.924  -8.194  4.031  59 E_DT11:DA26_F E 11 ? F 26 ? 20 1 
1 C DA 12 1_555 D DT 25 1_555 -0.324 -0.018 0.014  -1.035  -8.274  1.584  60 E_DA12:DT25_F E 12 ? F 25 ? 20 1 
1 C DT 13 1_555 D DA 24 1_555 0.336  0.011  -0.131 0.770   5.423   2.548  61 E_DT13:DA24_F E 13 ? F 24 ? 20 1 
1 C DA 14 1_555 D DT 23 1_555 -0.010 0.191  -0.319 -11.408 -4.917  0.652  62 E_DA14:DT23_F E 14 ? F 23 ? 20 1 
1 C DC 15 1_555 D DG 22 1_555 0.414  0.067  0.424  -10.876 -12.963 2.865  63 E_DC15:DG22_F E 15 ? F 22 ? 19 1 
1 C DG 16 1_555 D DC 21 1_555 -0.495 -0.070 -0.880 -14.669 -7.298  4.648  64 E_DG16:DC21_F E 16 ? F 21 ? 19 1 
1 C DT 17 1_555 D DA 20 1_555 0.238  0.163  -0.600 13.651  -24.567 3.515  65 E_DT17:DA20_F E 17 ? F 20 ? 20 1 
1 C DA 18 1_555 D DT 19 1_555 1.248  0.178  0.457  7.488   -8.423  1.993  66 E_DA18:DT19_F E 18 ? F 19 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DA 2  1_555 B DT 35 1_555 A DT 3  1_555 B DA 34 1_555 -0.265 -1.054 3.362 7.690  -1.606  32.171 -1.573 1.799  3.260 -2.845  
-13.625 33.091 1  CC_DA2DT3:DA34DT35_DD   C 2  ? D 35 ? C 3  ? D 34 ? 
1 A DT 3  1_555 B DA 34 1_555 A DA 4  1_555 B DT 33 1_555 0.029  1.748  3.415 -0.918 -2.326  39.286 2.878  -0.155 3.309 -3.455  
1.364   39.362 2  CC_DT3DA4:DT33DA34_DD   C 3  ? D 34 ? C 4  ? D 33 ? 
1 A DA 4  1_555 B DT 33 1_555 A DA 5  1_555 B DT 32 1_555 0.380  -0.076 3.054 -3.374 8.216   36.036 -1.139 -1.016 2.922 13.037  
5.354   37.079 3  CC_DA4DA5:DT32DT33_DD   C 4  ? D 33 ? C 5  ? D 32 ? 
1 A DA 5  1_555 B DT 32 1_555 A DG 6  1_555 B DC 31 1_555 0.509  -1.599 3.771 5.020  2.170   25.368 -4.250 0.457  3.654 4.869   
-11.264 25.941 4  CC_DA5DG6:DC31DT32_DD   C 5  ? D 32 ? C 6  ? D 31 ? 
1 A DG 6  1_555 B DC 31 1_555 A DT 7  1_555 B DA 30 1_555 -0.033 -0.338 3.216 -0.367 -2.216  37.812 -0.241 0.005  3.230 -3.416  
0.566   37.876 5  CC_DG6DT7:DA30DC31_DD   C 6  ? D 31 ? C 7  ? D 30 ? 
1 A DT 7  1_555 B DA 30 1_555 A DT 8  1_555 B DA 29 1_555 0.380  -0.098 3.434 1.261  4.737   37.425 -0.794 -0.417 3.407 7.343   
-1.955  37.733 6  CC_DT7DT8:DA29DA30_DD   C 7  ? D 30 ? C 8  ? D 29 ? 
1 A DT 8  1_555 B DA 29 1_555 A DC 9  1_555 B DG 28 1_555 0.253  -0.616 3.194 1.091  6.501   34.035 -1.994 -0.263 3.034 10.979  
-1.843  34.649 7  CC_DT8DC9:DG28DA29_DD   C 8  ? D 29 ? C 9  ? D 28 ? 
1 A DC 9  1_555 B DG 28 1_555 A DG 10 1_555 B DC 27 1_555 0.576  0.849  3.234 2.313  5.910   29.175 0.393  -0.626 3.371 11.560  
-4.524  29.843 8  CC_DC9DG10:DC27DG28_DD  C 9  ? D 28 ? C 10 ? D 27 ? 
1 A DG 10 1_555 B DC 27 1_555 A DT 11 1_555 B DA 26 1_555 -0.383 0.284  3.016 -0.086 6.005   31.609 -0.487 0.677  3.018 10.900  
0.155   32.160 9  CC_DG10DT11:DA26DC27_DD C 10 ? D 27 ? C 11 ? D 26 ? 
1 A DT 11 1_555 B DA 26 1_555 A DA 12 1_555 B DT 25 1_555 0.262  -0.920 3.622 0.042  7.598   36.714 -2.508 -0.402 3.372 11.907  
-0.066  37.465 10 CC_DT11DA12:DT25DA26_DD C 11 ? D 26 ? C 12 ? D 25 ? 
1 A DA 12 1_555 B DT 25 1_555 A DT 13 1_555 B DA 24 1_555 0.708  -0.986 3.491 2.085  -4.551  34.064 -0.892 -0.842 3.624 -7.717  
-3.536  34.419 11 CC_DA12DT13:DA24DT25_DD C 12 ? D 25 ? C 13 ? D 24 ? 
1 A DT 13 1_555 B DA 24 1_555 A DA 14 1_555 B DT 23 1_555 -0.634 -0.466 3.605 0.131  -1.725  36.686 -0.479 1.026  3.621 -2.739  
-0.209  36.725 12 CC_DT13DA14:DT23DA24_DD C 13 ? D 24 ? C 14 ? D 23 ? 
1 A DA 14 1_555 B DT 23 1_555 A DG 15 1_555 B DC 22 1_555 -0.328 -0.526 3.150 -2.174 -10.722 40.724 0.361  0.235  3.195 -15.081 
3.058   42.108 13 CC_DA14DG15:DC22DT23_DD C 14 ? D 23 ? C 15 ? D 22 ? 
1 A DG 15 1_555 B DC 22 1_555 A DC 16 1_555 B DG 21 1_555 0.050  -1.334 3.143 5.603  4.446   19.253 -5.550 2.138  2.677 12.738  
-16.053 20.527 14 CC_DG15DC16:DG21DC22_DD C 15 ? D 22 ? C 16 ? D 21 ? 
1 A DC 16 1_555 B DG 21 1_555 A DA 17 1_555 B DT 20 1_555 -1.073 0.503  3.554 -6.147 6.905   33.892 -0.336 0.738  3.714 11.580  
10.309  35.095 15 CC_DC16DA17:DT20DG21_DD C 16 ? D 21 ? C 17 ? D 20 ? 
1 A DA 17 1_555 B DT 20 1_555 A DT 18 1_555 B DA 19 1_555 0.278  -0.056 3.391 -3.619 4.439   36.009 -0.725 -0.962 3.319 7.125   
5.809   36.447 16 CC_DA17DT18:DA19DT20_DD C 17 ? D 20 ? C 18 ? D 19 ? 
1 A DA 19 1_555 D DT 18 1_555 A DC 20 1_555 D DG 17 1_555 0.338  0.991  3.013 3.295  -0.716  34.142 1.785  -0.096 3.011 -1.216  
-5.596  34.303 17 CC_DA19DC20:DG17DT18_FF C 19 ? F 18 ? C 20 ? F 17 ? 
1 A DC 20 1_555 D DG 17 1_555 A DA 21 1_555 D DT 16 1_555 -0.282 -0.221 3.394 -1.580 -2.273  34.242 -0.005 0.221  3.410 -3.853  
2.678   34.350 18 CC_DC20DA21:DT16DG17_FF C 20 ? F 17 ? C 21 ? F 16 ? 
1 A DA 21 1_555 D DT 16 1_555 A DT 23 1_555 D DA 14 1_555 0.646  -0.551 6.628 5.016  -6.088  74.427 -0.072 -0.217 6.676 -5.019  
-4.135  74.784 19 CC_DA21DT23:DA14DT16_FF C 21 ? F 16 ? C 23 ? F 14 ? 
1 A DT 23 1_555 D DA 14 1_555 A DA 24 1_555 D DT 13 1_555 0.737  0.042  3.428 -0.258 0.355   38.198 0.018  -1.160 3.424 0.543   
0.394   38.200 20 CC_DT23DA24:DT13DA14_FF C 23 ? F 14 ? C 24 ? F 13 ? 
1 A DA 24 1_555 D DT 13 1_555 A DT 25 1_555 D DA 12 1_555 -1.085 -0.633 3.514 -3.106 -1.194  36.213 -0.833 1.267  3.609 -1.916  
4.983   36.360 21 CC_DA24DT25:DA12DT13_FF C 24 ? F 13 ? C 25 ? F 12 ? 
1 A DT 25 1_555 D DA 12 1_555 A DA 26 1_555 D DT 11 1_555 0.897  -0.606 3.459 -0.363 2.509   34.406 -1.430 -1.571 3.398 4.234   
0.612   34.497 22 CC_DT25DA26:DT11DA12_FF C 25 ? F 12 ? C 26 ? F 11 ? 
1 A DA 26 1_555 D DT 11 1_555 A DC 27 1_555 D DG 10 1_555 -0.152 0.372  2.730 1.968  8.658   32.231 -0.570 0.542  2.722 15.238  
-3.464  33.400 23 CC_DA26DC27:DG10DT11_FF C 26 ? F 11 ? C 27 ? F 10 ? 
1 A DC 27 1_555 D DG 10 1_555 A DG 28 1_555 D DC 9  1_555 -0.781 0.707  3.063 -3.767 2.695   30.161 0.829  0.764  3.185 5.141   
7.186   30.506 24 CC_DC27DG28:DC9DG10_FF  C 27 ? F 10 ? C 28 ? F 9  ? 
1 A DG 28 1_555 D DC 9  1_555 A DA 29 1_555 D DT 8  1_555 0.555  -1.002 3.242 0.829  6.513   31.847 -2.890 -0.851 2.997 11.715  
-1.490  32.500 25 CC_DG28DA29:DT8DC9_FF   C 28 ? F 9  ? C 29 ? F 8  ? 
1 A DA 29 1_555 D DT 8  1_555 A DA 30 1_555 D DT 7  1_555 -0.844 0.135  3.347 -0.458 2.856   38.693 -0.154 1.213  3.358 4.303   
0.690   38.797 26 CC_DA29DA30:DT7DT8_FF   C 29 ? F 8  ? C 30 ? F 7  ? 
1 A DA 30 1_555 D DT 7  1_555 A DT 31 1_555 D DA 6  1_555 0.089  -0.669 3.419 -3.221 -0.688  34.588 -1.011 -0.664 3.409 -1.153  
5.402   34.739 27 CC_DA30DT31:DA6DT7_FF   C 30 ? F 7  ? C 31 ? F 6  ? 
1 A DT 31 1_555 D DA 6  1_555 A DT 32 1_555 D DA 5  1_555 -0.371 -1.003 3.386 0.198  1.838   32.486 -2.119 0.698  3.323 3.282   
-0.354  32.537 28 CC_DT31DT32:DA5DA6_FF   C 31 ? F 6  ? C 32 ? F 5  ? 
1 A DT 32 1_555 D DA 5  1_555 A DT 33 1_555 D DA 4  1_555 -0.525 0.036  2.842 1.735  6.076   33.054 -0.797 1.152  2.774 10.559  
-3.015  33.636 29 CC_DT32DT33:DA4DA5_FF   C 32 ? F 5  ? C 33 ? F 4  ? 
1 A DT 33 1_555 D DA 4  1_555 A DA 34 1_555 D DT 3  1_555 0.792  1.123  3.558 2.329  0.828   39.848 1.540  -0.866 3.619 1.213   
-3.414  39.921 30 CC_DT33DA34:DT3DA4_FF   C 33 ? F 4  ? C 34 ? F 3  ? 
1 A DA 34 1_555 D DT 3  1_555 A DT 35 1_555 D DA 2  1_555 -0.292 -0.059 3.143 2.305  4.447   36.314 -0.677 0.767  3.091 7.094   
-3.677  36.647 31 CC_DA34DT35:DA2DT3_FF   C 34 ? F 3  ? C 35 ? F 2  ? 
1 B DA 2  1_555 C DT 35 1_555 B DT 3  1_555 C DA 34 1_555 0.291  -0.059 3.144 -2.293 4.435   36.325 -0.676 -0.764 3.092 7.073   
3.656   36.655 32 DD_DA2DT3:DA34DT35_EE   D 2  ? E 35 ? D 3  ? E 34 ? 
1 B DT 3  1_555 C DA 34 1_555 B DA 4  1_555 C DT 33 1_555 -0.792 1.124  3.558 -2.322 0.835   39.844 1.540  0.866  3.618 1.223   
3.403   39.918 33 DD_DT3DA4:DT33DA34_EE   D 3  ? E 34 ? D 4  ? E 33 ? 
1 B DA 4  1_555 C DT 33 1_555 B DA 5  1_555 C DT 32 1_555 0.524  0.036  2.841 -1.760 6.070   33.049 -0.797 -1.155 2.773 10.550  
3.059   33.631 34 DD_DA4DA5:DT32DT33_EE   D 4  ? E 33 ? D 5  ? E 32 ? 
1 B DA 5  1_555 C DT 32 1_555 B DT 6  1_555 C DA 31 1_555 0.469  -0.907 3.262 3.071  0.374   31.664 -1.724 -0.293 3.281 0.684   
-5.611  31.811 35 DD_DA5DT6:DA31DT32_EE   D 5  ? E 32 ? D 6  ? E 31 ? 
1 B DT 6  1_555 C DA 31 1_555 B DT 7  1_555 C DA 30 1_555 -0.034 -0.579 3.576 1.307  2.365   35.287 -1.331 0.265  3.527 3.894   
-2.153  35.387 36 DD_DT6DT7:DA30DA31_EE   D 6  ? E 31 ? D 7  ? E 30 ? 
1 B DT 7  1_555 C DA 30 1_555 B DT 8  1_555 C DA 29 1_555 0.843  0.135  3.348 0.449  2.849   38.685 -0.154 -1.213 3.358 4.293   
-0.677  38.788 37 DD_DT7DT8:DA29DA30_EE   D 7  ? E 30 ? D 8  ? E 29 ? 
1 B DT 8  1_555 C DA 29 1_555 B DC 9  1_555 C DG 28 1_555 -0.554 -1.003 3.242 -0.829 6.513   31.849 -2.890 0.850  2.996 11.713  
1.491   32.501 38 DD_DT8DC9:DG28DA29_EE   D 8  ? E 29 ? D 9  ? E 28 ? 
1 B DC 9  1_555 C DG 28 1_555 B DG 10 1_555 C DC 27 1_555 0.780  0.707  3.064 3.765  2.689   30.176 0.829  -0.763 3.185 5.128   
-7.178  30.521 39 DD_DC9DG10:DC27DG28_EE  D 9  ? E 28 ? D 10 ? E 27 ? 
1 B DG 10 1_555 C DC 27 1_555 B DT 11 1_555 C DA 26 1_555 0.153  0.372  2.730 -1.970 8.664   32.227 -0.572 -0.543 2.722 15.250  
3.468   33.398 40 DD_DG10DT11:DA26DC27_EE D 10 ? E 27 ? D 11 ? E 26 ? 
1 B DT 11 1_555 C DA 26 1_555 B DA 12 1_555 C DT 25 1_555 -0.897 -0.606 3.458 0.359  2.502   34.410 -1.429 1.571  3.398 4.222   
-0.605  34.499 41 DD_DT11DA12:DT25DA26_EE D 11 ? E 26 ? D 12 ? E 25 ? 
1 B DA 12 1_555 C DT 25 1_555 B DT 13 1_555 C DA 24 1_555 1.085  -0.634 3.513 3.105  -1.186  36.207 -0.835 -1.267 3.609 -1.903  
-4.983  36.354 42 DD_DA12DT13:DA24DT25_EE D 12 ? E 25 ? D 13 ? E 24 ? 
1 B DT 13 1_555 C DA 24 1_555 B DA 14 1_555 C DT 23 1_555 -0.738 0.042  3.429 0.246  0.351   38.200 0.019  1.160  3.424 0.536   
-0.376  38.203 43 DD_DT13DA14:DT23DA24_EE D 13 ? E 24 ? D 14 ? E 23 ? 
1 B DA 14 1_555 C DT 23 1_555 B DA 16 1_555 C DT 21 1_555 -0.410 -0.570 6.434 -5.406 -7.594  72.583 0.009  -0.002 6.472 -6.389  
4.549   73.097 44 DD_DA14DA16:DT21DT23_EE D 14 ? E 23 ? D 16 ? E 21 ? 
1 B DA 16 1_555 C DT 21 1_555 B DC 17 1_555 C DG 20 1_555 0.139  -0.230 3.397 2.659  -2.909  35.847 0.059  0.169  3.406 -4.708  
-4.303  36.056 45 DD_DA16DC17:DG20DT21_EE D 16 ? E 21 ? D 17 ? E 20 ? 
1 B DC 17 1_555 C DG 20 1_555 B DA 18 1_555 C DT 19 1_555 -0.525 0.817  3.368 -5.738 1.428   35.248 1.116  -0.012 3.438 2.338   
9.395   35.725 46 DD_DC17DA18:DT19DG20_EE D 17 ? E 20 ? D 18 ? E 19 ? 
1 C DA 2  1_555 D DT 35 1_555 C DT 3  1_555 D DA 34 1_555 -0.264 -1.054 3.361 7.678  -1.611  32.165 -1.572 1.795  3.261 -2.855  
-13.607 33.084 47 EE_DA2DT3:DA34DT35_FF   E 2  ? F 35 ? E 3  ? F 34 ? 
1 C DT 3  1_555 D DA 34 1_555 C DA 4  1_555 D DT 33 1_555 0.029  1.748  3.416 -0.914 -2.337  39.290 2.879  -0.155 3.309 -3.471  
1.358   39.367 48 EE_DT3DA4:DT33DA34_FF   E 3  ? F 34 ? E 4  ? F 33 ? 
1 C DA 4  1_555 D DT 33 1_555 C DA 5  1_555 D DT 32 1_555 0.380  -0.076 3.053 -3.385 8.231   36.024 -1.142 -1.018 2.920 13.065  
5.374   37.072 49 EE_DA4DA5:DT32DT33_FF   E 4  ? F 33 ? E 5  ? F 32 ? 
1 C DA 5  1_555 D DT 32 1_555 C DC 6  1_555 D DG 31 1_555 0.705  -1.704 3.543 3.853  -0.054  23.437 -4.122 -0.313 3.614 -0.131  
-9.403  23.748 50 EE_DA5DC6:DG31DT32_FF   E 5  ? F 32 ? E 6  ? F 31 ? 
1 C DC 6  1_555 D DG 31 1_555 C DT 7  1_555 D DA 30 1_555 -0.026 -0.276 3.404 1.852  -0.854  39.641 -0.303 0.263  3.405 -1.259  
-2.729  39.692 51 EE_DC6DT7:DA30DG31_FF   E 6  ? F 31 ? E 7  ? F 30 ? 
1 C DT 7  1_555 D DA 30 1_555 C DT 8  1_555 D DA 29 1_555 0.380  -0.097 3.435 1.243  4.741   37.416 -0.794 -0.419 3.408 7.352   
-1.927  37.725 52 EE_DT7DT8:DA29DA30_FF   E 7  ? F 30 ? E 8  ? F 29 ? 
1 C DT 8  1_555 D DA 29 1_555 C DC 9  1_555 D DG 28 1_555 0.252  -0.615 3.194 1.083  6.506   34.043 -1.994 -0.264 3.034 10.984  
-1.829  34.658 53 EE_DT8DC9:DG28DA29_FF   E 8  ? F 29 ? E 9  ? F 28 ? 
1 C DC 9  1_555 D DG 28 1_555 C DG 10 1_555 D DC 27 1_555 0.575  0.850  3.235 2.312  5.893   29.167 0.397  -0.625 3.372 11.531  
-4.525  29.832 54 EE_DC9DG10:DC27DG28_FF  E 9  ? F 28 ? E 10 ? F 27 ? 
1 C DG 10 1_555 D DC 27 1_555 C DT 11 1_555 D DA 26 1_555 -0.383 0.284  3.016 -0.091 6.009   31.611 -0.487 0.676  3.018 10.907  
0.165   32.163 55 EE_DG10DT11:DA26DC27_FF E 10 ? F 27 ? E 11 ? F 26 ? 
1 C DT 11 1_555 D DA 26 1_555 C DA 12 1_555 D DT 25 1_555 0.263  -0.920 3.621 0.045  7.602   36.710 -2.509 -0.402 3.371 11.914  
-0.070  37.462 56 EE_DT11DA12:DT25DA26_FF E 11 ? F 26 ? E 12 ? F 25 ? 
1 C DA 12 1_555 D DT 25 1_555 C DT 13 1_555 D DA 24 1_555 0.707  -0.986 3.490 2.085  -4.553  34.064 -0.891 -0.840 3.624 -7.720  
-3.535  34.420 57 EE_DA12DT13:DA24DT25_FF E 12 ? F 25 ? E 13 ? F 24 ? 
1 C DT 13 1_555 D DA 24 1_555 C DA 14 1_555 D DT 23 1_555 -0.634 -0.465 3.606 0.129  -1.730  36.690 -0.478 1.025  3.621 -2.746  
-0.204  36.729 58 EE_DT13DA14:DT23DA24_FF E 13 ? F 24 ? E 14 ? F 23 ? 
1 C DA 14 1_555 D DT 23 1_555 C DC 15 1_555 D DG 22 1_555 -0.301 -0.598 3.430 -3.780 -7.457  38.803 0.050  -0.029 3.494 -11.067 
5.610   39.660 59 EE_DA14DC15:DG22DT23_FF E 14 ? F 23 ? E 15 ? F 22 ? 
1 C DC 15 1_555 D DG 22 1_555 C DG 16 1_555 D DC 21 1_555 -0.461 -1.367 3.481 7.045  9.023   18.995 -6.821 3.748  2.293 24.653  
-19.249 22.151 60 EE_DC15DG16:DC21DG22_FF E 15 ? F 22 ? E 16 ? F 21 ? 
1 C DG 16 1_555 D DC 21 1_555 C DT 17 1_555 D DA 20 1_555 -0.892 0.936  2.439 -3.776 -1.872  36.762 1.664  1.023  2.467 -2.956  
5.964   36.995 61 EE_DG16DT17:DA20DC21_FF E 16 ? F 21 ? E 17 ? F 20 ? 
1 C DT 17 1_555 D DA 20 1_555 C DA 18 1_555 D DT 19 1_555 0.224  0.210  3.660 -8.052 8.596   40.117 -0.720 -1.265 3.524 12.216  
11.443  41.742 62 EE_DT17DA18:DT19DA20_FF E 17 ? F 20 ? E 18 ? F 19 ? 
# 
_pdbx_entity_nonpoly.entity_id   6 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#