data_3CVW
# 
_entry.id   3CVW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.350 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   3CVW         pdb_00003cvw 10.2210/pdb3cvw/pdb 
NDB   PD1118       ?            ?                   
RCSB  RCSB047275   ?            ?                   
WWPDB D_1000047275 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3CVU 
;Drosophila melanogaster (6-4) photolyase bound 
to ds DNA with a T-T (6-4) photolesion
;
unspecified 
PDB 3CVV 
;Drosophila melanogaster (6-4) photolyase bound to 
ds DNA with a T-T (6-4) photolesion and F0 cofactor
;
unspecified 
PDB 3CVX 
;Drosophila melanogaster (6-4) photolyase H369M mutant 
bound to ds DNA with a T-T (6-4) photolesion
;
unspecified 
PDB 3CVY 'Drosophila melanogaster (6-4) photolyase bound to repaired ds DNA'                                      unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3CVW 
_pdbx_database_status.recvd_initial_deposition_date   2008-04-20 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Maul, M.J.'      1 
'Barends, T.R.M.' 2 
'Glas, A.F.'      3 
'Cryle, M.J.'     4 
'Schlichting, I.' 5 
'Carell, T.'      6 
# 
_citation.id                        primary 
_citation.title                     
;Structure and mechanism of a cofactor f0 
accelerated (6-4) photolyase from the fruit fly
;
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Maul, M.J.'      1 ? 
primary 'Barends, T.'     2 ? 
primary 'Glas, A.F.'      3 ? 
primary 'Cryle, M.J.'     4 ? 
primary 'Schneider, S.'   5 ? 
primary 'Domratcheva, T.' 6 ? 
primary 'Schlichting, I.' 7 ? 
primary 'Carell, T.'      8 ? 
# 
_cell.entry_id           3CVW 
_cell.length_a           86.470 
_cell.length_b           89.510 
_cell.length_c           89.340 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3CVW 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 
;DNA (5'-D(*DAP*DCP*DAP*DGP*DCP*DGP*DGP*(64T)P*(5PY)P*DGP*DCP*DAP*DGP*DGP*DT)-3')
;
4652.039  1  ? ?     ? 'DNA with (6-4) photolesion' 
2 polymer     syn 
;DNA (5'-D(*DTP*DAP*DCP*DCP*DTP*DGP*DCP*DAP*DAP*DCP*DCP*DGP*DCP*DTP*DG)-3')
;
4529.949  1  ? ?     ? ?                            
3 polymer     man RE11660p                                                                                 62886.098 1  ? H365N ? 
?                            
4 non-polymer syn 'FLAVIN-ADENINE DINUCLEOTIDE'                                                            785.550   1  ? ?     ? 
?                            
5 non-polymer syn '1-deoxy-1-(8-hydroxy-2,4-dioxo-3,4-dihydropyrimido[4,5-b]quinolin-10(2H)-yl)-D-ribitol' 363.322   1  ? ?     ? 
?                            
6 water       nat water                                                                                    18.015    12 ? ?     ? 
?                            
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no yes '(DA)(DC)(DA)(DG)(DC)(DG)(DG)(64T)(5PY)(DG)(DC)(DA)(DG)(DG)(DT)' ACAGCGGTTGCAGGT C ? 
2 polydeoxyribonucleotide no no  '(DT)(DA)(DC)(DC)(DT)(DG)(DC)(DA)(DA)(DC)(DC)(DG)(DC)(DT)(DG)' TACCTGCAACCGCTG D ? 
3 'polypeptide(L)'        no no  
;MASWSHPQFEKGASTSLYKKAGLMDSQRSTLVHWFRKGLRLHDNPALSHIFTAANAAPGRYFVRPIFILDPGILDWMQVG
ANRWRFLQQTLEDLDNQLRKLNSRLFVVRGKPAEVFPRIFKSWRVEMLTFETDIEPYSVTRDAAVQKLAKAEGVRVETHC
SHTIYNPELVIAKNLGKAPITYQKFLGIVEQLKVPKVLGVPEKLKNMPTPPKDEVEQKDSAAYDCPTMKQLVKRPEELGP
NKFPGGETEALRRMEESLKDEIWVARFEKPNTAPNSLEPSTTVLSPYLKFGCLSARLFNQKLKEIIKRQPKHSQPPVSLI
GQLMWREFYYTVAAAEPNFDRMLGNVYCMQIPWQEHPDHLEAWTHGRTGYPFIDAIMRQLRQEGWIHNLARHAVACFLTR
GDLWISWEEGQRVFEQLLLDQDWALNAGNWMWLSASAFFHQYFRVYSPVAFGKKTDPQGHYIRKYVPELSKYPAGCIYEP
WKASLVDQRAYGCVLGTDYPHRIVKHEVVHKENIKRMGAAYKVNREVRTGKEEESSFEEKSET
;
;MASWSHPQFEKGASTSLYKKAGLMDSQRSTLVHWFRKGLRLHDNPALSHIFTAANAAPGRYFVRPIFILDPGILDWMQVG
ANRWRFLQQTLEDLDNQLRKLNSRLFVVRGKPAEVFPRIFKSWRVEMLTFETDIEPYSVTRDAAVQKLAKAEGVRVETHC
SHTIYNPELVIAKNLGKAPITYQKFLGIVEQLKVPKVLGVPEKLKNMPTPPKDEVEQKDSAAYDCPTMKQLVKRPEELGP
NKFPGGETEALRRMEESLKDEIWVARFEKPNTAPNSLEPSTTVLSPYLKFGCLSARLFNQKLKEIIKRQPKHSQPPVSLI
GQLMWREFYYTVAAAEPNFDRMLGNVYCMQIPWQEHPDHLEAWTHGRTGYPFIDAIMRQLRQEGWIHNLARHAVACFLTR
GDLWISWEEGQRVFEQLLLDQDWALNAGNWMWLSASAFFHQYFRVYSPVAFGKKTDPQGHYIRKYVPELSKYPAGCIYEP
WKASLVDQRAYGCVLGTDYPHRIVKHEVVHKENIKRMGAAYKVNREVRTGKEEESSFEEKSET
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DC  n 
1 3   DA  n 
1 4   DG  n 
1 5   DC  n 
1 6   DG  n 
1 7   DG  n 
1 8   64T n 
1 9   5PY n 
1 10  DG  n 
1 11  DC  n 
1 12  DA  n 
1 13  DG  n 
1 14  DG  n 
1 15  DT  n 
2 1   DT  n 
2 2   DA  n 
2 3   DC  n 
2 4   DC  n 
2 5   DT  n 
2 6   DG  n 
2 7   DC  n 
2 8   DA  n 
2 9   DA  n 
2 10  DC  n 
2 11  DC  n 
2 12  DG  n 
2 13  DC  n 
2 14  DT  n 
2 15  DG  n 
3 1   MET n 
3 2   ALA n 
3 3   SER n 
3 4   TRP n 
3 5   SER n 
3 6   HIS n 
3 7   PRO n 
3 8   GLN n 
3 9   PHE n 
3 10  GLU n 
3 11  LYS n 
3 12  GLY n 
3 13  ALA n 
3 14  SER n 
3 15  THR n 
3 16  SER n 
3 17  LEU n 
3 18  TYR n 
3 19  LYS n 
3 20  LYS n 
3 21  ALA n 
3 22  GLY n 
3 23  LEU n 
3 24  MET n 
3 25  ASP n 
3 26  SER n 
3 27  GLN n 
3 28  ARG n 
3 29  SER n 
3 30  THR n 
3 31  LEU n 
3 32  VAL n 
3 33  HIS n 
3 34  TRP n 
3 35  PHE n 
3 36  ARG n 
3 37  LYS n 
3 38  GLY n 
3 39  LEU n 
3 40  ARG n 
3 41  LEU n 
3 42  HIS n 
3 43  ASP n 
3 44  ASN n 
3 45  PRO n 
3 46  ALA n 
3 47  LEU n 
3 48  SER n 
3 49  HIS n 
3 50  ILE n 
3 51  PHE n 
3 52  THR n 
3 53  ALA n 
3 54  ALA n 
3 55  ASN n 
3 56  ALA n 
3 57  ALA n 
3 58  PRO n 
3 59  GLY n 
3 60  ARG n 
3 61  TYR n 
3 62  PHE n 
3 63  VAL n 
3 64  ARG n 
3 65  PRO n 
3 66  ILE n 
3 67  PHE n 
3 68  ILE n 
3 69  LEU n 
3 70  ASP n 
3 71  PRO n 
3 72  GLY n 
3 73  ILE n 
3 74  LEU n 
3 75  ASP n 
3 76  TRP n 
3 77  MET n 
3 78  GLN n 
3 79  VAL n 
3 80  GLY n 
3 81  ALA n 
3 82  ASN n 
3 83  ARG n 
3 84  TRP n 
3 85  ARG n 
3 86  PHE n 
3 87  LEU n 
3 88  GLN n 
3 89  GLN n 
3 90  THR n 
3 91  LEU n 
3 92  GLU n 
3 93  ASP n 
3 94  LEU n 
3 95  ASP n 
3 96  ASN n 
3 97  GLN n 
3 98  LEU n 
3 99  ARG n 
3 100 LYS n 
3 101 LEU n 
3 102 ASN n 
3 103 SER n 
3 104 ARG n 
3 105 LEU n 
3 106 PHE n 
3 107 VAL n 
3 108 VAL n 
3 109 ARG n 
3 110 GLY n 
3 111 LYS n 
3 112 PRO n 
3 113 ALA n 
3 114 GLU n 
3 115 VAL n 
3 116 PHE n 
3 117 PRO n 
3 118 ARG n 
3 119 ILE n 
3 120 PHE n 
3 121 LYS n 
3 122 SER n 
3 123 TRP n 
3 124 ARG n 
3 125 VAL n 
3 126 GLU n 
3 127 MET n 
3 128 LEU n 
3 129 THR n 
3 130 PHE n 
3 131 GLU n 
3 132 THR n 
3 133 ASP n 
3 134 ILE n 
3 135 GLU n 
3 136 PRO n 
3 137 TYR n 
3 138 SER n 
3 139 VAL n 
3 140 THR n 
3 141 ARG n 
3 142 ASP n 
3 143 ALA n 
3 144 ALA n 
3 145 VAL n 
3 146 GLN n 
3 147 LYS n 
3 148 LEU n 
3 149 ALA n 
3 150 LYS n 
3 151 ALA n 
3 152 GLU n 
3 153 GLY n 
3 154 VAL n 
3 155 ARG n 
3 156 VAL n 
3 157 GLU n 
3 158 THR n 
3 159 HIS n 
3 160 CYS n 
3 161 SER n 
3 162 HIS n 
3 163 THR n 
3 164 ILE n 
3 165 TYR n 
3 166 ASN n 
3 167 PRO n 
3 168 GLU n 
3 169 LEU n 
3 170 VAL n 
3 171 ILE n 
3 172 ALA n 
3 173 LYS n 
3 174 ASN n 
3 175 LEU n 
3 176 GLY n 
3 177 LYS n 
3 178 ALA n 
3 179 PRO n 
3 180 ILE n 
3 181 THR n 
3 182 TYR n 
3 183 GLN n 
3 184 LYS n 
3 185 PHE n 
3 186 LEU n 
3 187 GLY n 
3 188 ILE n 
3 189 VAL n 
3 190 GLU n 
3 191 GLN n 
3 192 LEU n 
3 193 LYS n 
3 194 VAL n 
3 195 PRO n 
3 196 LYS n 
3 197 VAL n 
3 198 LEU n 
3 199 GLY n 
3 200 VAL n 
3 201 PRO n 
3 202 GLU n 
3 203 LYS n 
3 204 LEU n 
3 205 LYS n 
3 206 ASN n 
3 207 MET n 
3 208 PRO n 
3 209 THR n 
3 210 PRO n 
3 211 PRO n 
3 212 LYS n 
3 213 ASP n 
3 214 GLU n 
3 215 VAL n 
3 216 GLU n 
3 217 GLN n 
3 218 LYS n 
3 219 ASP n 
3 220 SER n 
3 221 ALA n 
3 222 ALA n 
3 223 TYR n 
3 224 ASP n 
3 225 CYS n 
3 226 PRO n 
3 227 THR n 
3 228 MET n 
3 229 LYS n 
3 230 GLN n 
3 231 LEU n 
3 232 VAL n 
3 233 LYS n 
3 234 ARG n 
3 235 PRO n 
3 236 GLU n 
3 237 GLU n 
3 238 LEU n 
3 239 GLY n 
3 240 PRO n 
3 241 ASN n 
3 242 LYS n 
3 243 PHE n 
3 244 PRO n 
3 245 GLY n 
3 246 GLY n 
3 247 GLU n 
3 248 THR n 
3 249 GLU n 
3 250 ALA n 
3 251 LEU n 
3 252 ARG n 
3 253 ARG n 
3 254 MET n 
3 255 GLU n 
3 256 GLU n 
3 257 SER n 
3 258 LEU n 
3 259 LYS n 
3 260 ASP n 
3 261 GLU n 
3 262 ILE n 
3 263 TRP n 
3 264 VAL n 
3 265 ALA n 
3 266 ARG n 
3 267 PHE n 
3 268 GLU n 
3 269 LYS n 
3 270 PRO n 
3 271 ASN n 
3 272 THR n 
3 273 ALA n 
3 274 PRO n 
3 275 ASN n 
3 276 SER n 
3 277 LEU n 
3 278 GLU n 
3 279 PRO n 
3 280 SER n 
3 281 THR n 
3 282 THR n 
3 283 VAL n 
3 284 LEU n 
3 285 SER n 
3 286 PRO n 
3 287 TYR n 
3 288 LEU n 
3 289 LYS n 
3 290 PHE n 
3 291 GLY n 
3 292 CYS n 
3 293 LEU n 
3 294 SER n 
3 295 ALA n 
3 296 ARG n 
3 297 LEU n 
3 298 PHE n 
3 299 ASN n 
3 300 GLN n 
3 301 LYS n 
3 302 LEU n 
3 303 LYS n 
3 304 GLU n 
3 305 ILE n 
3 306 ILE n 
3 307 LYS n 
3 308 ARG n 
3 309 GLN n 
3 310 PRO n 
3 311 LYS n 
3 312 HIS n 
3 313 SER n 
3 314 GLN n 
3 315 PRO n 
3 316 PRO n 
3 317 VAL n 
3 318 SER n 
3 319 LEU n 
3 320 ILE n 
3 321 GLY n 
3 322 GLN n 
3 323 LEU n 
3 324 MET n 
3 325 TRP n 
3 326 ARG n 
3 327 GLU n 
3 328 PHE n 
3 329 TYR n 
3 330 TYR n 
3 331 THR n 
3 332 VAL n 
3 333 ALA n 
3 334 ALA n 
3 335 ALA n 
3 336 GLU n 
3 337 PRO n 
3 338 ASN n 
3 339 PHE n 
3 340 ASP n 
3 341 ARG n 
3 342 MET n 
3 343 LEU n 
3 344 GLY n 
3 345 ASN n 
3 346 VAL n 
3 347 TYR n 
3 348 CYS n 
3 349 MET n 
3 350 GLN n 
3 351 ILE n 
3 352 PRO n 
3 353 TRP n 
3 354 GLN n 
3 355 GLU n 
3 356 HIS n 
3 357 PRO n 
3 358 ASP n 
3 359 HIS n 
3 360 LEU n 
3 361 GLU n 
3 362 ALA n 
3 363 TRP n 
3 364 THR n 
3 365 HIS n 
3 366 GLY n 
3 367 ARG n 
3 368 THR n 
3 369 GLY n 
3 370 TYR n 
3 371 PRO n 
3 372 PHE n 
3 373 ILE n 
3 374 ASP n 
3 375 ALA n 
3 376 ILE n 
3 377 MET n 
3 378 ARG n 
3 379 GLN n 
3 380 LEU n 
3 381 ARG n 
3 382 GLN n 
3 383 GLU n 
3 384 GLY n 
3 385 TRP n 
3 386 ILE n 
3 387 HIS n 
3 388 ASN n 
3 389 LEU n 
3 390 ALA n 
3 391 ARG n 
3 392 HIS n 
3 393 ALA n 
3 394 VAL n 
3 395 ALA n 
3 396 CYS n 
3 397 PHE n 
3 398 LEU n 
3 399 THR n 
3 400 ARG n 
3 401 GLY n 
3 402 ASP n 
3 403 LEU n 
3 404 TRP n 
3 405 ILE n 
3 406 SER n 
3 407 TRP n 
3 408 GLU n 
3 409 GLU n 
3 410 GLY n 
3 411 GLN n 
3 412 ARG n 
3 413 VAL n 
3 414 PHE n 
3 415 GLU n 
3 416 GLN n 
3 417 LEU n 
3 418 LEU n 
3 419 LEU n 
3 420 ASP n 
3 421 GLN n 
3 422 ASP n 
3 423 TRP n 
3 424 ALA n 
3 425 LEU n 
3 426 ASN n 
3 427 ALA n 
3 428 GLY n 
3 429 ASN n 
3 430 TRP n 
3 431 MET n 
3 432 TRP n 
3 433 LEU n 
3 434 SER n 
3 435 ALA n 
3 436 SER n 
3 437 ALA n 
3 438 PHE n 
3 439 PHE n 
3 440 HIS n 
3 441 GLN n 
3 442 TYR n 
3 443 PHE n 
3 444 ARG n 
3 445 VAL n 
3 446 TYR n 
3 447 SER n 
3 448 PRO n 
3 449 VAL n 
3 450 ALA n 
3 451 PHE n 
3 452 GLY n 
3 453 LYS n 
3 454 LYS n 
3 455 THR n 
3 456 ASP n 
3 457 PRO n 
3 458 GLN n 
3 459 GLY n 
3 460 HIS n 
3 461 TYR n 
3 462 ILE n 
3 463 ARG n 
3 464 LYS n 
3 465 TYR n 
3 466 VAL n 
3 467 PRO n 
3 468 GLU n 
3 469 LEU n 
3 470 SER n 
3 471 LYS n 
3 472 TYR n 
3 473 PRO n 
3 474 ALA n 
3 475 GLY n 
3 476 CYS n 
3 477 ILE n 
3 478 TYR n 
3 479 GLU n 
3 480 PRO n 
3 481 TRP n 
3 482 LYS n 
3 483 ALA n 
3 484 SER n 
3 485 LEU n 
3 486 VAL n 
3 487 ASP n 
3 488 GLN n 
3 489 ARG n 
3 490 ALA n 
3 491 TYR n 
3 492 GLY n 
3 493 CYS n 
3 494 VAL n 
3 495 LEU n 
3 496 GLY n 
3 497 THR n 
3 498 ASP n 
3 499 TYR n 
3 500 PRO n 
3 501 HIS n 
3 502 ARG n 
3 503 ILE n 
3 504 VAL n 
3 505 LYS n 
3 506 HIS n 
3 507 GLU n 
3 508 VAL n 
3 509 VAL n 
3 510 HIS n 
3 511 LYS n 
3 512 GLU n 
3 513 ASN n 
3 514 ILE n 
3 515 LYS n 
3 516 ARG n 
3 517 MET n 
3 518 GLY n 
3 519 ALA n 
3 520 ALA n 
3 521 TYR n 
3 522 LYS n 
3 523 VAL n 
3 524 ASN n 
3 525 ARG n 
3 526 GLU n 
3 527 VAL n 
3 528 ARG n 
3 529 THR n 
3 530 GLY n 
3 531 LYS n 
3 532 GLU n 
3 533 GLU n 
3 534 GLU n 
3 535 SER n 
3 536 SER n 
3 537 PHE n 
3 538 GLU n 
3 539 GLU n 
3 540 LYS n 
3 541 SER n 
3 542 GLU n 
3 543 THR n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 phr64-520 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Drosophila melanogaster' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     7227 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'Rosetta-gami pLysS (DE-3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'derived from pDEST007' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP Q8SXK5_DROME Q8SXK5 3 
;MDSQRSTLVHWFRKGLRLHDNPALSHIFTAANAAPGRYFVRPIFILDPGILDWMQVGANRWRFLQQTLEDLDNQLRKLNS
RLFVVRGKPAEVFPRIFKSWRVEMLTFETDIEPYSVTRDAAVQKLAKAEGVRVETHCSHTIYNPELVIAKNLGKAPITYQ
KFLGIVEQLKVPKVLGVPEKLKNMPTPPKDEVEQKDSAAYDCPTMKQLVKRPEELGPNKFPGGETEALRRMEESLKDEIW
VARFEKPNTAPNSLEPSTTVLSPYLKFGCLSARLFNQKLKEIIKRQPKHSQPPVSLIGQLMWREFYYTVAAAEPNFDRML
GNVYCMQIPWQEHPDHLEAWTHGRTGYPFIDAIMRQLRQEGWIHHLARHAVACFLTRGDLWISWEEGQRVFEQLLLDQDW
ALNAGNWMWLSASAFFHQYFRVYSPVAFGKKTDPQGHYIRKYVPELSKYPAGCIYEPWKASLVDQRAYGCVLGTDYPHRI
VKHEVVHKENIKRMGAAYKVNREVRTGKEEESSFEEKSET
;
1 ? 
2 PDB 3CVW         3CVW   1 ACAGCGGTTGCAGGT ? ? 
3 PDB 3CVW         3CVW   2 TACCTGCAACCGCTG ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3CVW A 24 ? 543 ? Q8SXK5 1 ? 520 ? 1 520 
2 2 3CVW C 1  ? 15  ? 3CVW   1 ? 15  ? 1 15  
3 3 3CVW D 1  ? 15  ? 3CVW   1 ? 15  ? 1 15  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3CVW MET A 1   ? UNP Q8SXK5 ?   ?   'expression tag'      -22 1  
1 3CVW ALA A 2   ? UNP Q8SXK5 ?   ?   'expression tag'      -21 2  
1 3CVW SER A 3   ? UNP Q8SXK5 ?   ?   'expression tag'      -20 3  
1 3CVW TRP A 4   ? UNP Q8SXK5 ?   ?   'expression tag'      -19 4  
1 3CVW SER A 5   ? UNP Q8SXK5 ?   ?   'expression tag'      -18 5  
1 3CVW HIS A 6   ? UNP Q8SXK5 ?   ?   'expression tag'      -17 6  
1 3CVW PRO A 7   ? UNP Q8SXK5 ?   ?   'expression tag'      -16 7  
1 3CVW GLN A 8   ? UNP Q8SXK5 ?   ?   'expression tag'      -15 8  
1 3CVW PHE A 9   ? UNP Q8SXK5 ?   ?   'expression tag'      -14 9  
1 3CVW GLU A 10  ? UNP Q8SXK5 ?   ?   'expression tag'      -13 10 
1 3CVW LYS A 11  ? UNP Q8SXK5 ?   ?   'expression tag'      -12 11 
1 3CVW GLY A 12  ? UNP Q8SXK5 ?   ?   'expression tag'      -11 12 
1 3CVW ALA A 13  ? UNP Q8SXK5 ?   ?   'expression tag'      -10 13 
1 3CVW SER A 14  ? UNP Q8SXK5 ?   ?   'expression tag'      -9  14 
1 3CVW THR A 15  ? UNP Q8SXK5 ?   ?   'expression tag'      -8  15 
1 3CVW SER A 16  ? UNP Q8SXK5 ?   ?   'expression tag'      -7  16 
1 3CVW LEU A 17  ? UNP Q8SXK5 ?   ?   'expression tag'      -6  17 
1 3CVW TYR A 18  ? UNP Q8SXK5 ?   ?   'expression tag'      -5  18 
1 3CVW LYS A 19  ? UNP Q8SXK5 ?   ?   'expression tag'      -4  19 
1 3CVW LYS A 20  ? UNP Q8SXK5 ?   ?   'expression tag'      -3  20 
1 3CVW ALA A 21  ? UNP Q8SXK5 ?   ?   'expression tag'      -2  21 
1 3CVW GLY A 22  ? UNP Q8SXK5 ?   ?   'expression tag'      -1  22 
1 3CVW LEU A 23  ? UNP Q8SXK5 ?   ?   'expression tag'      0   23 
1 3CVW ASN A 388 ? UNP Q8SXK5 HIS 365 'engineered mutation' 365 24 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
5PY 'DNA linking'       n "1-(2'-DEOXY-5'-O-PHOSPHONO-BETA-D-ERYTHRO-PENTOFURANOSYL)-5-METHYLPYRIMIDIN-2(1H)-ONE"  ? 
'C10 H15 N2 O7 P'   306.209 
64T 'DNA linking'       n "5-HYDROXY-THYMIDINE-5'-MONOPHOSPHATE"                                                   ? 
'C10 H17 N2 O9 P'   340.224 
ALA 'L-peptide linking' y ALANINE                                                                                  ? 'C3 H7 N O2' 
89.093  
ARG 'L-peptide linking' y ARGININE                                                                                 ? 
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                               ? 'C4 H8 N2 O3' 
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                          ? 'C4 H7 N O4' 
133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                                 ? 
'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                                                     ? 
'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                                                      ? 
'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                                                     ? 
'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                                             ? 
'C10 H15 N2 O8 P'   322.208 
FAD non-polymer         . 'FLAVIN-ADENINE DINUCLEOTIDE'                                                            ? 
'C27 H33 N9 O15 P2' 785.550 
FO1 non-polymer         . '1-deoxy-1-(8-hydroxy-2,4-dioxo-3,4-dihydropyrimido[4,5-b]quinolin-10(2H)-yl)-D-ribitol' 
7,8-didemethyl-8-hydroxy-5-deazariboflavin 'C16 H17 N3 O7'     363.322 
GLN 'L-peptide linking' y GLUTAMINE                                                                                ? 
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                          ? 'C5 H9 N O4' 
147.129 
GLY 'peptide linking'   y GLYCINE                                                                                  ? 'C2 H5 N O2' 
75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                ? 
'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                                                                    ? 'H2 O' 18.015 
ILE 'L-peptide linking' y ISOLEUCINE                                                                               ? 'C6 H13 N O2' 
131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                  ? 'C6 H13 N O2' 
131.173 
LYS 'L-peptide linking' y LYSINE                                                                                   ? 
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                                                               ? 
'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                            ? 'C9 H11 N O2' 
165.189 
PRO 'L-peptide linking' y PROLINE                                                                                  ? 'C5 H9 N O2' 
115.130 
SER 'L-peptide linking' y SERINE                                                                                   ? 'C3 H7 N O3' 
105.093 
THR 'L-peptide linking' y THREONINE                                                                                ? 'C4 H9 N O3' 
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                               ? 
'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                 ? 'C9 H11 N O3' 
181.189 
VAL 'L-peptide linking' y VALINE                                                                                   ? 'C5 H11 N O2' 
117.146 
# 
_exptl.entry_id          3CVW 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.40 
_exptl_crystal.density_percent_sol   48.72 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.6 
_exptl_crystal_grow.pdbx_details    '15-25% PEG1500, 0.1 M MIB, pH 8.6, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 'MIB buffer' ? ? ? 
1 2 2 'MIB buffer' ? ? ? 
1 3 2 PEG1500      ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2008-02-22 
_diffrn_detector.details                'Dynamically bendable mirror' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97895 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97895 
# 
_reflns.entry_id                     3CVW 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            3.2 
_reflns.d_resolution_low             20 
_reflns.number_all                   10625 
_reflns.number_obs                   10625 
_reflns.percent_possible_obs         89.2 
_reflns.pdbx_Rmerge_I_obs            0.089 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        17.8 
_reflns.B_iso_Wilson_estimate        65.5 
_reflns.pdbx_redundancy              5.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.2 
_reflns_shell.d_res_low              3.3 
_reflns_shell.percent_possible_all   52.2 
_reflns_shell.Rmerge_I_obs           0.308 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.1 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      526 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3CVW 
_refine.ls_number_reflns_obs                     10463 
_refine.ls_number_reflns_all                     10463 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.87 
_refine.ls_d_res_high                            3.20 
_refine.ls_percent_reflns_obs                    93.00 
_refine.ls_R_factor_obs                          0.27526 
_refine.ls_R_factor_all                          0.27526 
_refine.ls_R_factor_R_work                       0.27241 
_refine.ls_R_factor_R_free                       0.3291 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  549 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.860 
_refine.correlation_coeff_Fo_to_Fc_free          0.792 
_refine.B_iso_mean                               49.849 
_refine.aniso_B[1][1]                            -3.23 
_refine.aniso_B[2][2]                            -1.04 
_refine.aniso_B[3][3]                            4.27 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.745 
_refine.overall_SU_ML                            0.594 
_refine.overall_SU_B                             35.355 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4117 
_refine_hist.pdbx_number_atoms_nucleic_acid   609 
_refine_hist.pdbx_number_atoms_ligand         79 
_refine_hist.number_atoms_solvent             12 
_refine_hist.number_atoms_total               4817 
_refine_hist.d_res_high                       3.20 
_refine_hist.d_res_low                        19.87 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.005  0.022  ? 5008 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          0.881  2.126  ? 6934 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       4.166  5.000  ? 501  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       32.890 23.058 ? 206  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       13.632 15.000 ? 725  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       11.565 15.000 ? 35   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.054  0.200  ? 725  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.000  0.020  ? 3625 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.152  0.200  ? 2305 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.294  0.200  ? 3342 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.114  0.200  ? 135  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.098  0.200  ? 33   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.067  0.200  ? 5    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       3.200 
_refine_ls_shell.d_res_low                        3.281 
_refine_ls_shell.number_reflns_R_work             457 
_refine_ls_shell.R_factor_R_work                  0.346 
_refine_ls_shell.percent_reflns_obs               59.56 
_refine_ls_shell.R_factor_R_free                  0.367 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             29 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3CVW 
_struct.title                     
'Drosophila melanogaster (6-4) photolyase H365N mutant bound to ds DNA with a T-T (6-4) photolesion and cofactor F0' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3CVW 
_struct_keywords.pdbx_keywords   Lyase/DNA 
_struct_keywords.text            'DNA repair, Lyase-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN C 44  ? ALA C 57  ? ASN A 21  ALA A 34  1 ? 14 
HELX_P HELX_P2  2  GLY C 72  ? MET C 77  ? GLY A 49  MET A 54  1 ? 6  
HELX_P HELX_P3  3  GLY C 80  ? LYS C 100 ? GLY A 57  LYS A 77  1 ? 21 
HELX_P HELX_P4  4  LYS C 111 ? ARG C 124 ? LYS A 88  ARG A 101 1 ? 14 
HELX_P HELX_P5  5  GLU C 135 ? GLU C 152 ? GLU A 112 GLU A 129 1 ? 18 
HELX_P HELX_P6  6  ASN C 166 ? ASN C 174 ? ASN A 143 ASN A 151 1 ? 9  
HELX_P HELX_P7  7  THR C 181 ? GLU C 190 ? THR A 158 GLU A 167 1 ? 10 
HELX_P HELX_P8  8  ASP C 213 ? ASP C 219 ? ASP A 190 ASP A 196 1 ? 7  
HELX_P HELX_P9  9  THR C 227 ? VAL C 232 ? THR A 204 VAL A 209 1 ? 6  
HELX_P HELX_P10 10 ARG C 234 ? LEU C 238 ? ARG A 211 LEU A 215 5 ? 5  
HELX_P HELX_P11 11 GLY C 246 ? LEU C 258 ? GLY A 223 LEU A 235 1 ? 13 
HELX_P HELX_P12 12 ASP C 260 ? ARG C 266 ? ASP A 237 ARG A 243 1 ? 7  
HELX_P HELX_P13 13 GLU C 268 ? THR C 272 ? GLU A 245 THR A 249 5 ? 5  
HELX_P HELX_P14 14 LEU C 284 ? PHE C 290 ? LEU A 261 PHE A 267 1 ? 7  
HELX_P HELX_P15 15 SER C 294 ? ARG C 308 ? SER A 271 ARG A 285 1 ? 15 
HELX_P HELX_P16 16 SER C 318 ? GLU C 336 ? SER A 295 GLU A 313 1 ? 19 
HELX_P HELX_P17 17 HIS C 356 ? HIS C 365 ? HIS A 333 HIS A 342 1 ? 10 
HELX_P HELX_P18 18 TYR C 370 ? GLU C 383 ? TYR A 347 GLU A 360 1 ? 14 
HELX_P HELX_P19 19 HIS C 387 ? THR C 399 ? HIS A 364 THR A 376 1 ? 13 
HELX_P HELX_P20 20 SER C 406 ? LEU C 418 ? SER A 383 LEU A 395 1 ? 13 
HELX_P HELX_P21 21 ASP C 422 ? SER C 434 ? ASP A 399 SER A 411 1 ? 13 
HELX_P HELX_P22 22 GLY C 459 ? VAL C 466 ? GLY A 436 VAL A 443 1 ? 8  
HELX_P HELX_P23 23 PRO C 467 ? SER C 470 ? PRO A 444 SER A 447 5 ? 4  
HELX_P HELX_P24 24 GLU C 479 ? ALA C 483 ? GLU A 456 ALA A 460 5 ? 5  
HELX_P HELX_P25 25 SER C 484 ? TYR C 491 ? SER A 461 TYR A 468 1 ? 8  
HELX_P HELX_P26 26 LYS C 505 ? ARG C 528 ? LYS A 482 ARG A 505 1 ? 24 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1  covale both ? A DG  7  "O3'" ? ? ? 1_555 A 64T 8  P  ? ? C DG  7  C 64T 8  1_555 ? ? ? ? ? ? ?            1.601 ? ? 
covale2  covale both ? A 64T 8  "O3'" ? ? ? 1_555 A 5PY 9  P  ? ? C 64T 8  C 5PY 9  1_555 ? ? ? ? ? ? ?            1.605 ? ? 
covale3  covale none ? A 64T 8  C6    ? ? ? 1_555 A 5PY 9  C4 ? ? C 64T 8  C 5PY 9  1_555 ? ? ? ? ? ? ?            1.528 ? ? 
covale4  covale both ? A 5PY 9  "O3'" ? ? ? 1_555 A DG  10 P  ? ? C 5PY 9  C DG  10 1_555 ? ? ? ? ? ? ?            1.600 ? ? 
hydrog1  hydrog ?    ? A DC  2  N4    ? ? ? 1_555 B DG  15 O6 ? ? C DC  2  D DG  15 1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? ? 
hydrog2  hydrog ?    ? A DA  3  N1    ? ? ? 1_555 B DT  14 N3 ? ? C DA  3  D DT  14 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog3  hydrog ?    ? A DA  3  N6    ? ? ? 1_555 B DT  14 O4 ? ? C DA  3  D DT  14 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog4  hydrog ?    ? A DG  4  N1    ? ? ? 1_555 B DC  13 N3 ? ? C DG  4  D DC  13 1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     ? ? 
hydrog5  hydrog ?    ? A DC  5  N3    ? ? ? 1_555 B DG  12 N1 ? ? C DC  5  D DG  12 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog6  hydrog ?    ? A DC  5  N4    ? ? ? 1_555 B DG  12 O6 ? ? C DC  5  D DG  12 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog7  hydrog ?    ? A DC  5  O2    ? ? ? 1_555 B DG  12 N2 ? ? C DC  5  D DG  12 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog8  hydrog ?    ? A DG  6  O6    ? ? ? 1_555 B DC  10 N4 ? ? C DG  6  D DC  10 1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     ? ? 
hydrog9  hydrog ?    ? A DG  6  N1    ? ? ? 1_555 B DC  11 N3 ? ? C DG  6  D DC  11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog10 hydrog ?    ? A DG  6  N2    ? ? ? 1_555 B DC  11 O2 ? ? C DG  6  D DC  11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog11 hydrog ?    ? A DG  6  O6    ? ? ? 1_555 B DC  11 N4 ? ? C DG  6  D DC  11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog12 hydrog ?    ? A DG  7  N1    ? ? ? 1_555 B DC  10 N3 ? ? C DG  7  D DC  10 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog13 hydrog ?    ? A DG  7  N2    ? ? ? 1_555 B DC  10 O2 ? ? C DG  7  D DC  10 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog14 hydrog ?    ? A DG  7  O6    ? ? ? 1_555 B DC  10 N4 ? ? C DG  7  D DC  10 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog15 hydrog ?    ? A DG  10 N1    ? ? ? 1_555 B DC  7  O2 ? ? C DG  10 D DC  7  1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     ? ? 
hydrog16 hydrog ?    ? A DC  11 N3    ? ? ? 1_555 B DG  6  N1 ? ? C DC  11 D DG  6  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog17 hydrog ?    ? A DC  11 N4    ? ? ? 1_555 B DG  6  O6 ? ? C DC  11 D DG  6  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog18 hydrog ?    ? A DC  11 O2    ? ? ? 1_555 B DG  6  N2 ? ? C DC  11 D DG  6  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog19 hydrog ?    ? A DA  12 N1    ? ? ? 1_555 B DT  5  N3 ? ? C DA  12 D DT  5  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog20 hydrog ?    ? A DA  12 N6    ? ? ? 1_555 B DT  5  O4 ? ? C DA  12 D DT  5  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog21 hydrog ?    ? A DG  13 N1    ? ? ? 1_555 B DC  4  N3 ? ? C DG  13 D DC  4  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog22 hydrog ?    ? A DG  13 N2    ? ? ? 1_555 B DC  4  O2 ? ? C DG  13 D DC  4  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog23 hydrog ?    ? A DG  13 O6    ? ? ? 1_555 B DC  4  N4 ? ? C DG  13 D DC  4  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog24 hydrog ?    ? A DG  14 N1    ? ? ? 1_555 B DC  3  N3 ? ? C DG  14 D DC  3  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog25 hydrog ?    ? A DG  14 N2    ? ? ? 1_555 B DC  3  O2 ? ? C DG  14 D DC  3  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog26 hydrog ?    ? A DG  14 O6    ? ? ? 1_555 B DC  3  N4 ? ? C DG  14 D DC  3  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog27 hydrog ?    ? A DT  15 N3    ? ? ? 1_555 B DA  2  N1 ? ? C DT  15 D DA  2  1_555 ? ? ? ? ? ? 'DT-DA PAIR' ?     ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          PRO 
_struct_mon_prot_cis.label_seq_id           315 
_struct_mon_prot_cis.label_asym_id          C 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           PRO 
_struct_mon_prot_cis.auth_seq_id            292 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    316 
_struct_mon_prot_cis.pdbx_label_asym_id_2   C 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     293 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       6.04 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
A 2 3 ? parallel 
A 3 4 ? parallel 
A 4 5 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE C 106 ? ARG C 109 ? PHE A 83  ARG A 86  
A 2 TYR C 61  ? LEU C 69  ? TYR A 38  LEU A 46  
A 3 SER C 29  ? PHE C 35  ? SER A 6   PHE A 12  
A 4 VAL C 125 ? PHE C 130 ? VAL A 102 PHE A 107 
A 5 ARG C 155 ? VAL C 156 ? ARG A 132 VAL A 133 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O VAL C 108 ? O VAL A 85  N LEU C 69  ? N LEU A 46  
A 2 3 O ILE C 66  ? O ILE A 43  N PHE C 35  ? N PHE A 12  
A 3 4 N TRP C 34  ? N TRP A 11  O THR C 129 ? O THR A 106 
A 4 5 N GLU C 126 ? N GLU A 103 O ARG C 155 ? O ARG A 132 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A FAD 521  ? 22 'BINDING SITE FOR RESIDUE FAD A 521'  
AC2 Software A FO1 1422 ? 13 'BINDING SITE FOR RESIDUE FO1 A 1422' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 22 PHE C 267 ? PHE A 244 . ? 1_555 ? 
2  AC1 22 LYS C 269 ? LYS A 246 . ? 1_555 ? 
3  AC1 22 THR C 281 ? THR A 258 . ? 1_555 ? 
4  AC1 22 THR C 282 ? THR A 259 . ? 1_555 ? 
5  AC1 22 LEU C 284 ? LEU A 261 . ? 1_555 ? 
6  AC1 22 SER C 285 ? SER A 262 . ? 1_555 ? 
7  AC1 22 LEU C 288 ? LEU A 265 . ? 1_555 ? 
8  AC1 22 GLN C 322 ? GLN A 299 . ? 1_555 ? 
9  AC1 22 TRP C 325 ? TRP A 302 . ? 1_555 ? 
10 AC1 22 ARG C 326 ? ARG A 303 . ? 1_555 ? 
11 AC1 22 TYR C 329 ? TYR A 306 . ? 1_555 ? 
12 AC1 22 TRP C 385 ? TRP A 362 . ? 1_555 ? 
13 AC1 22 ASN C 388 ? ASN A 365 . ? 1_555 ? 
14 AC1 22 ARG C 391 ? ARG A 368 . ? 1_555 ? 
15 AC1 22 HIS C 392 ? HIS A 369 . ? 1_555 ? 
16 AC1 22 ASP C 420 ? ASP A 397 . ? 1_555 ? 
17 AC1 22 GLN C 421 ? GLN A 398 . ? 1_555 ? 
18 AC1 22 ASP C 422 ? ASP A 399 . ? 1_555 ? 
19 AC1 22 LEU C 425 ? LEU A 402 . ? 1_555 ? 
20 AC1 22 ASN C 426 ? ASN A 403 . ? 1_555 ? 
21 AC1 22 ASN C 429 ? ASN A 406 . ? 1_555 ? 
22 AC1 22 TRP C 430 ? TRP A 407 . ? 1_555 ? 
23 AC2 13 ARG C 36  ? ARG A 13  . ? 1_555 ? 
24 AC2 13 LYS C 37  ? LYS A 14  . ? 1_555 ? 
25 AC2 13 PHE C 67  ? PHE A 44  . ? 1_555 ? 
26 AC2 13 ILE C 68  ? ILE A 45  . ? 1_555 ? 
27 AC2 13 LEU C 69  ? LEU A 46  . ? 1_555 ? 
28 AC2 13 ASP C 70  ? ASP A 47  . ? 1_555 ? 
29 AC2 13 ILE C 73  ? ILE A 50  . ? 1_555 ? 
30 AC2 13 MET C 77  ? MET A 54  . ? 1_555 ? 
31 AC2 13 ARG C 83  ? ARG A 60  . ? 1_555 ? 
32 AC2 13 ASP C 133 ? ASP A 110 . ? 1_555 ? 
33 AC2 13 GLU C 135 ? GLU A 112 . ? 1_555 ? 
34 AC2 13 ARG C 141 ? ARG A 118 . ? 1_555 ? 
35 AC2 13 LYS C 289 ? LYS A 266 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3CVW 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3CVW 
_atom_sites.fract_transf_matrix[1][1]   0.011565 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011172 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011193 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DA  A 1 1   ? 2.069   -29.546 -72.469 1.00 49.85 ? 1    DA  C "O5'" 1 
ATOM   2    C "C5'" . DA  A 1 1   ? 1.906   -29.392 -71.063 1.00 49.85 ? 1    DA  C "C5'" 1 
ATOM   3    C "C4'" . DA  A 1 1   ? 0.993   -30.469 -70.485 1.00 49.85 ? 1    DA  C "C4'" 1 
ATOM   4    O "O4'" . DA  A 1 1   ? 1.742   -31.352 -69.608 1.00 49.85 ? 1    DA  C "O4'" 1 
ATOM   5    C "C3'" . DA  A 1 1   ? -0.174  -29.967 -69.639 1.00 49.85 ? 1    DA  C "C3'" 1 
ATOM   6    O "O3'" . DA  A 1 1   ? -1.300  -30.850 -69.767 1.00 49.85 ? 1    DA  C "O3'" 1 
ATOM   7    C "C2'" . DA  A 1 1   ? 0.400   -29.965 -68.221 1.00 49.85 ? 1    DA  C "C2'" 1 
ATOM   8    C "C1'" . DA  A 1 1   ? 1.460   -31.068 -68.247 1.00 49.85 ? 1    DA  C "C1'" 1 
ATOM   9    N N9    . DA  A 1 1   ? 2.725   -30.713 -67.595 1.00 49.85 ? 1    DA  C N9    1 
ATOM   10   C C8    . DA  A 1 1   ? 3.378   -29.508 -67.654 1.00 49.85 ? 1    DA  C C8    1 
ATOM   11   N N7    . DA  A 1 1   ? 4.499   -29.467 -66.973 1.00 49.85 ? 1    DA  C N7    1 
ATOM   12   C C5    . DA  A 1 1   ? 4.595   -30.736 -66.426 1.00 49.85 ? 1    DA  C C5    1 
ATOM   13   C C6    . DA  A 1 1   ? 5.563   -31.343 -65.592 1.00 49.85 ? 1    DA  C C6    1 
ATOM   14   N N6    . DA  A 1 1   ? 6.656   -30.702 -65.160 1.00 49.85 ? 1    DA  C N6    1 
ATOM   15   N N1    . DA  A 1 1   ? 5.365   -32.631 -65.220 1.00 49.85 ? 1    DA  C N1    1 
ATOM   16   C C2    . DA  A 1 1   ? 4.267   -33.271 -65.656 1.00 49.85 ? 1    DA  C C2    1 
ATOM   17   N N3    . DA  A 1 1   ? 3.290   -32.805 -66.441 1.00 49.85 ? 1    DA  C N3    1 
ATOM   18   C C4    . DA  A 1 1   ? 3.511   -31.521 -66.797 1.00 49.85 ? 1    DA  C C4    1 
ATOM   19   P P     . DC  A 1 2   ? -2.785  -30.413 -69.327 1.00 49.85 ? 2    DC  C P     1 
ATOM   20   O OP1   . DC  A 1 2   ? -3.741  -31.260 -70.081 1.00 49.85 ? 2    DC  C OP1   1 
ATOM   21   O OP2   . DC  A 1 2   ? -2.894  -28.938 -69.442 1.00 49.85 ? 2    DC  C OP2   1 
ATOM   22   O "O5'" . DC  A 1 2   ? -2.831  -30.813 -67.768 1.00 49.85 ? 2    DC  C "O5'" 1 
ATOM   23   C "C5'" . DC  A 1 2   ? -3.221  -32.130 -67.343 1.00 49.85 ? 2    DC  C "C5'" 1 
ATOM   24   C "C4'" . DC  A 1 2   ? -2.352  -32.687 -66.218 1.00 49.85 ? 2    DC  C "C4'" 1 
ATOM   25   O "O4'" . DC  A 1 2   ? -1.090  -31.967 -66.101 1.00 49.85 ? 2    DC  C "O4'" 1 
ATOM   26   C "C3'" . DC  A 1 2   ? -2.977  -32.666 -64.820 1.00 49.85 ? 2    DC  C "C3'" 1 
ATOM   27   O "O3'" . DC  A 1 2   ? -2.712  -33.914 -64.163 1.00 49.85 ? 2    DC  C "O3'" 1 
ATOM   28   C "C2'" . DC  A 1 2   ? -2.243  -31.504 -64.152 1.00 49.85 ? 2    DC  C "C2'" 1 
ATOM   29   C "C1'" . DC  A 1 2   ? -0.849  -31.726 -64.727 1.00 49.85 ? 2    DC  C "C1'" 1 
ATOM   30   N N1    . DC  A 1 2   ? 0.126   -30.593 -64.547 1.00 49.85 ? 2    DC  C N1    1 
ATOM   31   C C2    . DC  A 1 2   ? 1.411   -30.846 -64.022 1.00 49.85 ? 2    DC  C C2    1 
ATOM   32   O O2    . DC  A 1 2   ? 1.745   -31.999 -63.708 1.00 49.85 ? 2    DC  C O2    1 
ATOM   33   N N3    . DC  A 1 2   ? 2.271   -29.802 -63.871 1.00 49.85 ? 2    DC  C N3    1 
ATOM   34   C C4    . DC  A 1 2   ? 1.898   -28.562 -64.215 1.00 49.85 ? 2    DC  C C4    1 
ATOM   35   N N4    . DC  A 1 2   ? 2.779   -27.572 -64.047 1.00 49.85 ? 2    DC  C N4    1 
ATOM   36   C C5    . DC  A 1 2   ? 0.601   -28.284 -64.748 1.00 49.85 ? 2    DC  C C5    1 
ATOM   37   C C6    . DC  A 1 2   ? -0.241  -29.317 -64.894 1.00 49.85 ? 2    DC  C C6    1 
ATOM   38   P P     . DA  A 1 3   ? -3.401  -34.341 -62.774 1.00 49.85 ? 3    DA  C P     1 
ATOM   39   O OP1   . DA  A 1 3   ? -4.702  -34.969 -63.101 1.00 49.85 ? 3    DA  C OP1   1 
ATOM   40   O OP2   . DA  A 1 3   ? -3.361  -33.198 -61.831 1.00 49.85 ? 3    DA  C OP2   1 
ATOM   41   O "O5'" . DA  A 1 3   ? -2.413  -35.476 -62.215 1.00 49.85 ? 3    DA  C "O5'" 1 
ATOM   42   C "C5'" . DA  A 1 3   ? -0.998  -35.394 -62.412 1.00 49.85 ? 3    DA  C "C5'" 1 
ATOM   43   C "C4'" . DA  A 1 3   ? -0.226  -35.101 -61.128 1.00 49.85 ? 3    DA  C "C4'" 1 
ATOM   44   O "O4'" . DA  A 1 3   ? 0.441   -33.816 -61.255 1.00 49.85 ? 3    DA  C "O4'" 1 
ATOM   45   C "C3'" . DA  A 1 3   ? -1.014  -35.035 -59.816 1.00 49.85 ? 3    DA  C "C3'" 1 
ATOM   46   O "O3'" . DA  A 1 3   ? -0.249  -35.651 -58.778 1.00 49.85 ? 3    DA  C "O3'" 1 
ATOM   47   C "C2'" . DA  A 1 3   ? -1.152  -33.535 -59.570 1.00 49.85 ? 3    DA  C "C2'" 1 
ATOM   48   C "C1'" . DA  A 1 3   ? 0.197   -33.050 -60.090 1.00 49.85 ? 3    DA  C "C1'" 1 
ATOM   49   N N9    . DA  A 1 3   ? 0.261   -31.633 -60.441 1.00 49.85 ? 3    DA  C N9    1 
ATOM   50   C C8    . DA  A 1 3   ? -0.707  -30.877 -61.043 1.00 49.85 ? 3    DA  C C8    1 
ATOM   51   N N7    . DA  A 1 3   ? -0.364  -29.626 -61.236 1.00 49.85 ? 3    DA  C N7    1 
ATOM   52   C C5    . DA  A 1 3   ? 0.921   -29.557 -60.725 1.00 49.85 ? 3    DA  C C5    1 
ATOM   53   C C6    . DA  A 1 3   ? 1.852   -28.498 -60.625 1.00 49.85 ? 3    DA  C C6    1 
ATOM   54   N N6    . DA  A 1 3   ? 1.603   -27.258 -61.060 1.00 49.85 ? 3    DA  C N6    1 
ATOM   55   N N1    . DA  A 1 3   ? 3.052   -28.765 -60.059 1.00 49.85 ? 3    DA  C N1    1 
ATOM   56   C C2    . DA  A 1 3   ? 3.298   -30.010 -59.624 1.00 49.85 ? 3    DA  C C2    1 
ATOM   57   N N3    . DA  A 1 3   ? 2.506   -31.083 -59.664 1.00 49.85 ? 3    DA  C N3    1 
ATOM   58   C C4    . DA  A 1 3   ? 1.322   -30.787 -60.231 1.00 49.85 ? 3    DA  C C4    1 
ATOM   59   P P     . DG  A 1 4   ? -0.907  -36.224 -57.432 1.00 49.85 ? 4    DG  C P     1 
ATOM   60   O OP1   . DG  A 1 4   ? -0.993  -37.697 -57.581 1.00 49.85 ? 4    DG  C OP1   1 
ATOM   61   O OP2   . DG  A 1 4   ? -2.124  -35.444 -57.104 1.00 49.85 ? 4    DG  C OP2   1 
ATOM   62   O "O5'" . DG  A 1 4   ? 0.195   -35.866 -56.327 1.00 49.85 ? 4    DG  C "O5'" 1 
ATOM   63   C "C5'" . DG  A 1 4   ? 1.509   -36.412 -56.409 1.00 49.85 ? 4    DG  C "C5'" 1 
ATOM   64   C "C4'" . DG  A 1 4   ? 2.499   -35.540 -55.658 1.00 49.85 ? 4    DG  C "C4'" 1 
ATOM   65   O "O4'" . DG  A 1 4   ? 2.573   -34.237 -56.290 1.00 49.85 ? 4    DG  C "O4'" 1 
ATOM   66   C "C3'" . DG  A 1 4   ? 2.163   -35.303 -54.189 1.00 49.85 ? 4    DG  C "C3'" 1 
ATOM   67   O "O3'" . DG  A 1 4   ? 3.317   -35.590 -53.404 1.00 49.85 ? 4    DG  C "O3'" 1 
ATOM   68   C "C2'" . DG  A 1 4   ? 1.745   -33.833 -54.114 1.00 49.85 ? 4    DG  C "C2'" 1 
ATOM   69   C "C1'" . DG  A 1 4   ? 2.389   -33.203 -55.344 1.00 49.85 ? 4    DG  C "C1'" 1 
ATOM   70   N N9    . DG  A 1 4   ? 1.558   -32.182 -55.980 1.00 49.85 ? 4    DG  C N9    1 
ATOM   71   C C8    . DG  A 1 4   ? 0.278   -32.356 -56.451 1.00 49.85 ? 4    DG  C C8    1 
ATOM   72   N N7    . DG  A 1 4   ? -0.240  -31.282 -56.976 1.00 49.85 ? 4    DG  C N7    1 
ATOM   73   C C5    . DG  A 1 4   ? 0.759   -30.327 -56.849 1.00 49.85 ? 4    DG  C C5    1 
ATOM   74   C C6    . DG  A 1 4   ? 0.768   -28.963 -57.245 1.00 49.85 ? 4    DG  C C6    1 
ATOM   75   O O6    . DG  A 1 4   ? -0.136  -28.321 -57.801 1.00 49.85 ? 4    DG  C O6    1 
ATOM   76   N N1    . DG  A 1 4   ? 1.977   -28.335 -56.936 1.00 49.85 ? 4    DG  C N1    1 
ATOM   77   C C2    . DG  A 1 4   ? 3.042   -28.956 -56.320 1.00 49.85 ? 4    DG  C C2    1 
ATOM   78   N N2    . DG  A 1 4   ? 4.122   -28.194 -56.104 1.00 49.85 ? 4    DG  C N2    1 
ATOM   79   N N3    . DG  A 1 4   ? 3.047   -30.234 -55.944 1.00 49.85 ? 4    DG  C N3    1 
ATOM   80   C C4    . DG  A 1 4   ? 1.876   -30.863 -56.237 1.00 49.85 ? 4    DG  C C4    1 
ATOM   81   P P     . DC  A 1 5   ? 3.301   -35.510 -51.802 1.00 49.85 ? 5    DC  C P     1 
ATOM   82   O OP1   . DC  A 1 5   ? 4.364   -36.413 -51.298 1.00 49.85 ? 5    DC  C OP1   1 
ATOM   83   O OP2   . DC  A 1 5   ? 1.906   -35.683 -51.328 1.00 49.85 ? 5    DC  C OP2   1 
ATOM   84   O "O5'" . DC  A 1 5   ? 3.727   -33.988 -51.535 1.00 49.85 ? 5    DC  C "O5'" 1 
ATOM   85   C "C5'" . DC  A 1 5   ? 4.956   -33.478 -52.059 1.00 49.85 ? 5    DC  C "C5'" 1 
ATOM   86   C "C4'" . DC  A 1 5   ? 5.212   -32.047 -51.617 1.00 49.85 ? 5    DC  C "C4'" 1 
ATOM   87   O "O4'" . DC  A 1 5   ? 4.459   -31.142 -52.465 1.00 49.85 ? 5    DC  C "O4'" 1 
ATOM   88   C "C3'" . DC  A 1 5   ? 4.835   -31.718 -50.172 1.00 49.85 ? 5    DC  C "C3'" 1 
ATOM   89   O "O3'" . DC  A 1 5   ? 5.936   -31.082 -49.521 1.00 49.85 ? 5    DC  C "O3'" 1 
ATOM   90   C "C2'" . DC  A 1 5   ? 3.626   -30.792 -50.301 1.00 49.85 ? 5    DC  C "C2'" 1 
ATOM   91   C "C1'" . DC  A 1 5   ? 3.848   -30.150 -51.668 1.00 49.85 ? 5    DC  C "C1'" 1 
ATOM   92   N N1    . DC  A 1 5   ? 2.595   -29.688 -52.358 1.00 49.85 ? 5    DC  C N1    1 
ATOM   93   C C2    . DC  A 1 5   ? 2.495   -28.365 -52.832 1.00 49.85 ? 5    DC  C C2    1 
ATOM   94   O O2    . DC  A 1 5   ? 3.438   -27.577 -52.681 1.00 49.85 ? 5    DC  C O2    1 
ATOM   95   N N3    . DC  A 1 5   ? 1.349   -27.975 -53.453 1.00 49.85 ? 5    DC  C N3    1 
ATOM   96   C C4    . DC  A 1 5   ? 0.339   -28.838 -53.608 1.00 49.85 ? 5    DC  C C4    1 
ATOM   97   N N4    . DC  A 1 5   ? -0.762  -28.401 -54.226 1.00 49.85 ? 5    DC  C N4    1 
ATOM   98   C C5    . DC  A 1 5   ? 0.416   -30.185 -53.137 1.00 49.85 ? 5    DC  C C5    1 
ATOM   99   C C6    . DC  A 1 5   ? 1.549   -30.560 -52.527 1.00 49.85 ? 5    DC  C C6    1 
ATOM   100  P P     . DG  A 1 6   ? 6.015   -30.918 -47.924 1.00 49.85 ? 6    DG  C P     1 
ATOM   101  O OP1   . DG  A 1 6   ? 7.418   -31.168 -47.519 1.00 49.85 ? 6    DG  C OP1   1 
ATOM   102  O OP2   . DG  A 1 6   ? 4.916   -31.686 -47.291 1.00 49.85 ? 6    DG  C OP2   1 
ATOM   103  O "O5'" . DG  A 1 6   ? 5.693   -29.365 -47.731 1.00 49.85 ? 6    DG  C "O5'" 1 
ATOM   104  C "C5'" . DG  A 1 6   ? 6.599   -28.388 -48.233 1.00 49.85 ? 6    DG  C "C5'" 1 
ATOM   105  C "C4'" . DG  A 1 6   ? 5.969   -27.010 -48.179 1.00 49.85 ? 6    DG  C "C4'" 1 
ATOM   106  O "O4'" . DG  A 1 6   ? 4.796   -26.978 -49.027 1.00 49.85 ? 6    DG  C "O4'" 1 
ATOM   107  C "C3'" . DG  A 1 6   ? 5.522   -26.569 -46.789 1.00 49.85 ? 6    DG  C "C3'" 1 
ATOM   108  O "O3'" . DG  A 1 6   ? 6.095   -25.290 -46.524 1.00 49.85 ? 6    DG  C "O3'" 1 
ATOM   109  C "C2'" . DG  A 1 6   ? 3.992   -26.557 -46.864 1.00 49.85 ? 6    DG  C "C2'" 1 
ATOM   110  C "C1'" . DG  A 1 6   ? 3.732   -26.348 -48.351 1.00 49.85 ? 6    DG  C "C1'" 1 
ATOM   111  N N9    . DG  A 1 6   ? 2.502   -26.951 -48.858 1.00 49.85 ? 6    DG  C N9    1 
ATOM   112  C C8    . DG  A 1 6   ? 2.017   -28.210 -48.590 1.00 49.85 ? 6    DG  C C8    1 
ATOM   113  N N7    . DG  A 1 6   ? 0.890   -28.474 -49.191 1.00 49.85 ? 6    DG  C N7    1 
ATOM   114  C C5    . DG  A 1 6   ? 0.608   -27.317 -49.905 1.00 49.85 ? 6    DG  C C5    1 
ATOM   115  C C6    . DG  A 1 6   ? -0.489  -27.007 -50.752 1.00 49.85 ? 6    DG  C C6    1 
ATOM   116  O O6    . DG  A 1 6   ? -1.458  -27.722 -51.043 1.00 49.85 ? 6    DG  C O6    1 
ATOM   117  N N1    . DG  A 1 6   ? -0.394  -25.719 -51.284 1.00 49.85 ? 6    DG  C N1    1 
ATOM   118  C C2    . DG  A 1 6   ? 0.637   -24.841 -51.027 1.00 49.85 ? 6    DG  C C2    1 
ATOM   119  N N2    . DG  A 1 6   ? 0.564   -23.644 -51.625 1.00 49.85 ? 6    DG  C N2    1 
ATOM   120  N N3    . DG  A 1 6   ? 1.670   -25.119 -50.237 1.00 49.85 ? 6    DG  C N3    1 
ATOM   121  C C4    . DG  A 1 6   ? 1.592   -26.369 -49.711 1.00 49.85 ? 6    DG  C C4    1 
ATOM   122  P P     . DG  A 1 7   ? 5.886   -24.532 -45.131 1.00 49.85 ? 7    DG  C P     1 
ATOM   123  O OP1   . DG  A 1 7   ? 7.082   -23.694 -44.891 1.00 49.85 ? 7    DG  C OP1   1 
ATOM   124  O OP2   . DG  A 1 7   ? 5.450   -25.503 -44.099 1.00 49.85 ? 7    DG  C OP2   1 
ATOM   125  O "O5'" . DG  A 1 7   ? 4.655   -23.579 -45.481 1.00 49.85 ? 7    DG  C "O5'" 1 
ATOM   126  C "C5'" . DG  A 1 7   ? 4.727   -22.716 -46.610 1.00 49.85 ? 7    DG  C "C5'" 1 
ATOM   127  C "C4'" . DG  A 1 7   ? 3.402   -22.013 -46.826 1.00 49.85 ? 7    DG  C "C4'" 1 
ATOM   128  O "O4'" . DG  A 1 7   ? 2.440   -22.954 -47.358 1.00 49.85 ? 7    DG  C "O4'" 1 
ATOM   129  C "C3'" . DG  A 1 7   ? 2.775   -21.421 -45.564 1.00 49.85 ? 7    DG  C "C3'" 1 
ATOM   130  O "O3'" . DG  A 1 7   ? 2.401   -20.070 -45.807 1.00 49.85 ? 7    DG  C "O3'" 1 
ATOM   131  C "C2'" . DG  A 1 7   ? 1.557   -22.303 -45.298 1.00 49.85 ? 7    DG  C "C2'" 1 
ATOM   132  C "C1'" . DG  A 1 7   ? 1.204   -22.733 -46.717 1.00 49.85 ? 7    DG  C "C1'" 1 
ATOM   133  N N9    . DG  A 1 7   ? 0.399   -23.947 -46.819 1.00 49.85 ? 7    DG  C N9    1 
ATOM   134  C C8    . DG  A 1 7   ? 0.580   -25.141 -46.159 1.00 49.85 ? 7    DG  C C8    1 
ATOM   135  N N7    . DG  A 1 7   ? -0.310  -26.045 -46.464 1.00 49.85 ? 7    DG  C N7    1 
ATOM   136  C C5    . DG  A 1 7   ? -1.136  -25.412 -47.385 1.00 49.85 ? 7    DG  C C5    1 
ATOM   137  C C6    . DG  A 1 7   ? -2.281  -25.890 -48.074 1.00 49.85 ? 7    DG  C C6    1 
ATOM   138  O O6    . DG  A 1 7   ? -2.807  -27.010 -47.999 1.00 49.85 ? 7    DG  C O6    1 
ATOM   139  N N1    . DG  A 1 7   ? -2.825  -24.920 -48.922 1.00 49.85 ? 7    DG  C N1    1 
ATOM   140  C C2    . DG  A 1 7   ? -2.321  -23.646 -49.080 1.00 49.85 ? 7    DG  C C2    1 
ATOM   141  N N2    . DG  A 1 7   ? -2.965  -22.842 -49.934 1.00 49.85 ? 7    DG  C N2    1 
ATOM   142  N N3    . DG  A 1 7   ? -1.251  -23.189 -48.441 1.00 49.85 ? 7    DG  C N3    1 
ATOM   143  C C4    . DG  A 1 7   ? -0.711  -24.120 -47.613 1.00 49.85 ? 7    DG  C C4    1 
HETATM 144  P P     . 64T A 1 8   ? 3.347   -18.858 -45.362 1.00 49.85 ? 8    64T C P     1 
HETATM 145  O OP1   . 64T A 1 8   ? 2.688   -17.611 -45.808 1.00 49.85 ? 8    64T C OP1   1 
HETATM 146  O OP2   . 64T A 1 8   ? 4.732   -19.134 -45.813 1.00 49.85 ? 8    64T C OP2   1 
HETATM 147  O "O5'" . 64T A 1 8   ? 3.309   -18.934 -43.759 1.00 49.85 ? 8    64T C "O5'" 1 
HETATM 148  C "C5'" . 64T A 1 8   ? 2.094   -18.791 -43.020 1.00 49.85 ? 8    64T C "C5'" 1 
HETATM 149  C "C4'" . 64T A 1 8   ? 2.405   -18.746 -41.536 1.00 49.85 ? 8    64T C "C4'" 1 
HETATM 150  O "O4'" . 64T A 1 8   ? 2.820   -17.411 -41.168 1.00 49.85 ? 8    64T C "O4'" 1 
HETATM 151  C "C3'" . 64T A 1 8   ? 1.241   -18.999 -40.593 1.00 49.85 ? 8    64T C "C3'" 1 
HETATM 152  O "O3'" . 64T A 1 8   ? 0.919   -20.385 -40.523 1.00 49.85 ? 8    64T C "O3'" 1 
HETATM 153  C "C2'" . 64T A 1 8   ? 1.813   -18.460 -39.283 1.00 49.85 ? 8    64T C "C2'" 1 
HETATM 154  C "C1'" . 64T A 1 8   ? 2.627   -17.259 -39.774 1.00 49.85 ? 8    64T C "C1'" 1 
HETATM 155  N N1    . 64T A 1 8   ? 2.164   -15.842 -39.441 1.00 49.85 ? 8    64T C N1    1 
HETATM 156  C C2    . 64T A 1 8   ? 2.929   -15.158 -38.624 1.00 49.85 ? 8    64T C C2    1 
HETATM 157  O O2    . 64T A 1 8   ? 3.981   -15.600 -38.117 1.00 49.85 ? 8    64T C O2    1 
HETATM 158  N N3    . 64T A 1 8   ? 2.566   -13.850 -38.278 1.00 49.85 ? 8    64T C N3    1 
HETATM 159  C C4    . 64T A 1 8   ? 1.427   -13.195 -38.748 1.00 49.85 ? 8    64T C C4    1 
HETATM 160  O O4    . 64T A 1 8   ? 1.204   -12.048 -38.378 1.00 49.85 ? 8    64T C O4    1 
HETATM 161  C C5    . 64T A 1 8   ? 0.748   -13.828 -39.942 1.00 49.85 ? 8    64T C C5    1 
HETATM 162  C C5M   . 64T A 1 8   ? 1.406   -13.340 -41.230 1.00 49.85 ? 8    64T C C5M   1 
HETATM 163  O O5    . 64T A 1 8   ? -0.618  -13.436 -39.962 1.00 49.85 ? 8    64T C O5    1 
HETATM 164  C C6    . 64T A 1 8   ? 0.804   -15.386 -39.824 1.00 49.85 ? 8    64T C C6    1 
HETATM 165  P P     . 5PY A 1 9   ? -0.565  -20.909 -40.839 1.00 49.85 ? 9    5PY C P     1 
HETATM 166  O OP2   . 5PY A 1 9   ? -1.133  -20.085 -41.932 1.00 49.85 ? 9    5PY C OP2   1 
HETATM 167  O OP1   . 5PY A 1 9   ? -0.481  -22.377 -41.010 1.00 49.85 ? 9    5PY C OP1   1 
HETATM 168  O "O5'" . 5PY A 1 9   ? -1.372  -20.575 -39.494 1.00 49.85 ? 9    5PY C "O5'" 1 
HETATM 169  C "C5'" . 5PY A 1 9   ? -1.348  -21.469 -38.374 1.00 49.85 ? 9    5PY C "C5'" 1 
HETATM 170  C "C4'" . 5PY A 1 9   ? -1.942  -20.835 -37.124 1.00 49.85 ? 9    5PY C "C4'" 1 
HETATM 171  O "O4'" . 5PY A 1 9   ? -1.090  -19.742 -36.700 1.00 49.85 ? 9    5PY C "O4'" 1 
HETATM 172  C "C1'" . 5PY A 1 9   ? -1.874  -18.650 -36.251 1.00 49.85 ? 9    5PY C "C1'" 1 
HETATM 173  N N1    . 5PY A 1 9   ? -1.566  -17.427 -37.096 1.00 49.85 ? 9    5PY C N1    1 
HETATM 174  C C2    . 5PY A 1 9   ? -0.528  -16.645 -36.705 1.00 49.85 ? 9    5PY C C2    1 
HETATM 175  O O2    . 5PY A 1 9   ? -0.127  -16.615 -35.517 1.00 49.85 ? 9    5PY C O2    1 
HETATM 176  N N3    . 5PY A 1 9   ? 0.088   -15.873 -37.658 1.00 49.85 ? 9    5PY C N3    1 
HETATM 177  C C4    . 5PY A 1 9   ? -0.319  -15.890 -38.919 1.00 49.85 ? 9    5PY C C4    1 
HETATM 178  C C5    . 5PY A 1 9   ? -1.375  -16.673 -39.356 1.00 49.85 ? 9    5PY C C5    1 
HETATM 179  C C5M   . 5PY A 1 9   ? -1.900  -16.749 -40.772 1.00 49.85 ? 9    5PY C C5M   1 
HETATM 180  C C6    . 5PY A 1 9   ? -1.977  -17.433 -38.399 1.00 49.85 ? 9    5PY C C6    1 
HETATM 181  C "C2'" . 5PY A 1 9   ? -3.333  -19.109 -36.238 1.00 49.85 ? 9    5PY C "C2'" 1 
HETATM 182  C "C3'" . 5PY A 1 9   ? -3.323  -20.211 -37.293 1.00 49.85 ? 9    5PY C "C3'" 1 
HETATM 183  O "O3'" . 5PY A 1 9   ? -4.347  -21.168 -37.071 1.00 49.85 ? 9    5PY C "O3'" 1 
ATOM   184  P P     . DG  A 1 10  ? -4.947  -21.989 -38.306 1.00 49.85 ? 10   DG  C P     1 
ATOM   185  O OP1   . DG  A 1 10  ? -4.415  -23.368 -38.207 1.00 49.85 ? 10   DG  C OP1   1 
ATOM   186  O OP2   . DG  A 1 10  ? -4.753  -21.205 -39.549 1.00 49.85 ? 10   DG  C OP2   1 
ATOM   187  O "O5'" . DG  A 1 10  ? -6.504  -22.047 -37.965 1.00 49.85 ? 10   DG  C "O5'" 1 
ATOM   188  C "C5'" . DG  A 1 10  ? -7.333  -20.902 -38.109 1.00 49.85 ? 10   DG  C "C5'" 1 
ATOM   189  C "C4'" . DG  A 1 10  ? -8.783  -21.275 -37.847 1.00 49.85 ? 10   DG  C "C4'" 1 
ATOM   190  O "O4'" . DG  A 1 10  ? -9.198  -22.298 -38.787 1.00 49.85 ? 10   DG  C "O4'" 1 
ATOM   191  C "C3'" . DG  A 1 10  ? -9.077  -21.826 -36.455 1.00 49.85 ? 10   DG  C "C3'" 1 
ATOM   192  O "O3'" . DG  A 1 10  ? -10.296 -21.258 -35.977 1.00 49.85 ? 10   DG  C "O3'" 1 
ATOM   193  C "C2'" . DG  A 1 10  ? -9.162  -23.341 -36.657 1.00 49.85 ? 10   DG  C "C2'" 1 
ATOM   194  C "C1'" . DG  A 1 10  ? -9.567  -23.492 -38.121 1.00 49.85 ? 10   DG  C "C1'" 1 
ATOM   195  N N9    . DG  A 1 10  ? -8.923  -24.619 -38.805 1.00 49.85 ? 10   DG  C N9    1 
ATOM   196  C C8    . DG  A 1 10  ? -7.573  -24.831 -38.969 1.00 49.85 ? 10   DG  C C8    1 
ATOM   197  N N7    . DG  A 1 10  ? -7.283  -25.921 -39.623 1.00 49.85 ? 10   DG  C N7    1 
ATOM   198  C C5    . DG  A 1 10  ? -8.522  -26.477 -39.917 1.00 49.85 ? 10   DG  C C5    1 
ATOM   199  C C6    . DG  A 1 10  ? -8.846  -27.671 -40.614 1.00 49.85 ? 10   DG  C C6    1 
ATOM   200  O O6    . DG  A 1 10  ? -8.072  -28.494 -41.123 1.00 49.85 ? 10   DG  C O6    1 
ATOM   201  N N1    . DG  A 1 10  ? -10.226 -27.873 -40.695 1.00 49.85 ? 10   DG  C N1    1 
ATOM   202  C C2    . DG  A 1 10  ? -11.174 -27.025 -40.165 1.00 49.85 ? 10   DG  C C2    1 
ATOM   203  N N2    . DG  A 1 10  ? -12.456 -27.377 -40.337 1.00 49.85 ? 10   DG  C N2    1 
ATOM   204  N N3    . DG  A 1 10  ? -10.883 -25.905 -39.511 1.00 49.85 ? 10   DG  C N3    1 
ATOM   205  C C4    . DG  A 1 10  ? -9.543  -25.689 -39.422 1.00 49.85 ? 10   DG  C C4    1 
ATOM   206  P P     . DC  A 1 11  ? -10.909 -21.635 -34.545 1.00 49.85 ? 11   DC  C P     1 
ATOM   207  O OP1   . DC  A 1 11  ? -11.822 -20.542 -34.151 1.00 49.85 ? 11   DC  C OP1   1 
ATOM   208  O OP2   . DC  A 1 11  ? -9.817  -22.047 -33.633 1.00 49.85 ? 11   DC  C OP2   1 
ATOM   209  O "O5'" . DC  A 1 11  ? -11.772 -22.935 -34.879 1.00 49.85 ? 11   DC  C "O5'" 1 
ATOM   210  C "C5'" . DC  A 1 11  ? -12.885 -22.858 -35.762 1.00 49.85 ? 11   DC  C "C5'" 1 
ATOM   211  C "C4'" . DC  A 1 11  ? -13.679 -24.149 -35.725 1.00 49.85 ? 11   DC  C "C4'" 1 
ATOM   212  O "O4'" . DC  A 1 11  ? -12.992 -25.131 -36.540 1.00 49.85 ? 11   DC  C "O4'" 1 
ATOM   213  C "C3'" . DC  A 1 11  ? -13.846 -24.766 -34.336 1.00 49.85 ? 11   DC  C "C3'" 1 
ATOM   214  O "O3'" . DC  A 1 11  ? -15.225 -25.068 -34.100 1.00 49.85 ? 11   DC  C "O3'" 1 
ATOM   215  C "C2'" . DC  A 1 11  ? -12.955 -26.009 -34.369 1.00 49.85 ? 11   DC  C "C2'" 1 
ATOM   216  C "C1'" . DC  A 1 11  ? -12.962 -26.364 -35.851 1.00 49.85 ? 11   DC  C "C1'" 1 
ATOM   217  N N1    . DC  A 1 11  ? -11.775 -27.150 -36.321 1.00 49.85 ? 11   DC  C N1    1 
ATOM   218  C C2    . DC  A 1 11  ? -11.961 -28.392 -36.960 1.00 49.85 ? 11   DC  C C2    1 
ATOM   219  O O2    . DC  A 1 11  ? -13.104 -28.838 -37.135 1.00 49.85 ? 11   DC  C O2    1 
ATOM   220  N N3    . DC  A 1 11  ? -10.867 -29.083 -37.377 1.00 49.85 ? 11   DC  C N3    1 
ATOM   221  C C4    . DC  A 1 11  ? -9.640  -28.586 -37.180 1.00 49.85 ? 11   DC  C C4    1 
ATOM   222  N N4    . DC  A 1 11  ? -8.597  -29.307 -37.609 1.00 49.85 ? 11   DC  C N4    1 
ATOM   223  C C5    . DC  A 1 11  ? -9.430  -27.329 -36.534 1.00 49.85 ? 11   DC  C C5    1 
ATOM   224  C C6    . DC  A 1 11  ? -10.513 -26.655 -36.128 1.00 49.85 ? 11   DC  C C6    1 
ATOM   225  P P     . DA  A 1 12  ? -15.743 -25.681 -32.710 1.00 49.85 ? 12   DA  C P     1 
ATOM   226  O OP1   . DA  A 1 12  ? -17.125 -25.199 -32.493 1.00 49.85 ? 12   DA  C OP1   1 
ATOM   227  O OP2   . DA  A 1 12  ? -14.724 -25.474 -31.657 1.00 49.85 ? 12   DA  C OP2   1 
ATOM   228  O "O5'" . DA  A 1 12  ? -15.769 -27.246 -33.028 1.00 49.85 ? 12   DA  C "O5'" 1 
ATOM   229  C "C5'" . DA  A 1 12  ? -16.646 -27.790 -34.011 1.00 49.85 ? 12   DA  C "C5'" 1 
ATOM   230  C "C4'" . DA  A 1 12  ? -16.526 -29.303 -34.033 1.00 49.85 ? 12   DA  C "C4'" 1 
ATOM   231  O "O4'" . DA  A 1 12  ? -15.241 -29.674 -34.590 1.00 49.85 ? 12   DA  C "O4'" 1 
ATOM   232  C "C3'" . DA  A 1 12  ? -16.626 -29.983 -32.668 1.00 49.85 ? 12   DA  C "C3'" 1 
ATOM   233  O "O3'" . DA  A 1 12  ? -17.582 -31.040 -32.748 1.00 49.85 ? 12   DA  C "O3'" 1 
ATOM   234  C "C2'" . DA  A 1 12  ? -15.211 -30.485 -32.372 1.00 49.85 ? 12   DA  C "C2'" 1 
ATOM   235  C "C1'" . DA  A 1 12  ? -14.598 -30.622 -33.763 1.00 49.85 ? 12   DA  C "C1'" 1 
ATOM   236  N N9    . DA  A 1 12  ? -13.164 -30.348 -33.834 1.00 49.85 ? 12   DA  C N9    1 
ATOM   237  C C8    . DA  A 1 12  ? -12.491 -29.290 -33.282 1.00 49.85 ? 12   DA  C C8    1 
ATOM   238  N N7    . DA  A 1 12  ? -11.199 -29.297 -33.509 1.00 49.85 ? 12   DA  C N7    1 
ATOM   239  C C5    . DA  A 1 12  ? -11.007 -30.441 -34.264 1.00 49.85 ? 12   DA  C C5    1 
ATOM   240  C C6    . DA  A 1 12  ? -9.854  -31.024 -34.831 1.00 49.85 ? 12   DA  C C6    1 
ATOM   241  N N6    . DA  A 1 12  ? -8.633  -30.497 -34.708 1.00 49.85 ? 12   DA  C N6    1 
ATOM   242  N N1    . DA  A 1 12  ? -10.003 -32.174 -35.532 1.00 49.85 ? 12   DA  C N1    1 
ATOM   243  C C2    . DA  A 1 12  ? -11.230 -32.704 -35.655 1.00 49.85 ? 12   DA  C C2    1 
ATOM   244  N N3    . DA  A 1 12  ? -12.387 -32.247 -35.167 1.00 49.85 ? 12   DA  C N3    1 
ATOM   245  C C4    . DA  A 1 12  ? -12.207 -31.103 -34.476 1.00 49.85 ? 12   DA  C C4    1 
ATOM   246  P P     . DG  A 1 13  ? -18.126 -31.813 -31.451 1.00 49.85 ? 13   DG  C P     1 
ATOM   247  O OP1   . DG  A 1 13  ? -19.544 -32.153 -31.704 1.00 49.85 ? 13   DG  C OP1   1 
ATOM   248  O OP2   . DG  A 1 13  ? -17.756 -31.053 -30.232 1.00 49.85 ? 13   DG  C OP2   1 
ATOM   249  O "O5'" . DG  A 1 13  ? -17.283 -33.171 -31.476 1.00 49.85 ? 13   DG  C "O5'" 1 
ATOM   250  C "C5'" . DG  A 1 13  ? -17.058 -33.879 -32.694 1.00 49.85 ? 13   DG  C "C5'" 1 
ATOM   251  C "C4'" . DG  A 1 13  ? -15.875 -34.822 -32.553 1.00 49.85 ? 13   DG  C "C4'" 1 
ATOM   252  O "O4'" . DG  A 1 13  ? -14.638 -34.129 -32.867 1.00 49.85 ? 13   DG  C "O4'" 1 
ATOM   253  C "C3'" . DG  A 1 13  ? -15.681 -35.411 -31.153 1.00 49.85 ? 13   DG  C "C3'" 1 
ATOM   254  O "O3'" . DG  A 1 13  ? -15.819 -36.828 -31.196 1.00 49.85 ? 13   DG  C "O3'" 1 
ATOM   255  C "C2'" . DG  A 1 13  ? -14.266 -34.991 -30.757 1.00 49.85 ? 13   DG  C "C2'" 1 
ATOM   256  C "C1'" . DG  A 1 13  ? -13.630 -34.775 -32.123 1.00 49.85 ? 13   DG  C "C1'" 1 
ATOM   257  N N9    . DG  A 1 13  ? -12.398 -33.989 -32.076 1.00 49.85 ? 13   DG  C N9    1 
ATOM   258  C C8    . DG  A 1 13  ? -12.212 -32.756 -31.496 1.00 49.85 ? 13   DG  C C8    1 
ATOM   259  N N7    . DG  A 1 13  ? -10.993 -32.304 -31.613 1.00 49.85 ? 13   DG  C N7    1 
ATOM   260  C C5    . DG  A 1 13  ? -10.326 -33.299 -32.316 1.00 49.85 ? 13   DG  C C5    1 
ATOM   261  C C6    . DG  A 1 13  ? -8.973  -33.374 -32.741 1.00 49.85 ? 13   DG  C C6    1 
ATOM   262  O O6    . DG  A 1 13  ? -8.071  -32.540 -32.573 1.00 49.85 ? 13   DG  C O6    1 
ATOM   263  N N1    . DG  A 1 13  ? -8.703  -34.561 -33.429 1.00 49.85 ? 13   DG  C N1    1 
ATOM   264  C C2    . DG  A 1 13  ? -9.627  -35.556 -33.674 1.00 49.85 ? 13   DG  C C2    1 
ATOM   265  N N2    . DG  A 1 13  ? -9.193  -36.631 -34.351 1.00 49.85 ? 13   DG  C N2    1 
ATOM   266  N N3    . DG  A 1 13  ? -10.896 -35.496 -33.279 1.00 49.85 ? 13   DG  C N3    1 
ATOM   267  C C4    . DG  A 1 13  ? -11.178 -34.345 -32.609 1.00 49.85 ? 13   DG  C C4    1 
ATOM   268  P P     . DG  A 1 14  ? -15.882 -37.707 -29.856 1.00 49.85 ? 14   DG  C P     1 
ATOM   269  O OP1   . DG  A 1 14  ? -16.692 -38.907 -30.174 1.00 49.85 ? 14   DG  C OP1   1 
ATOM   270  O OP2   . DG  A 1 14  ? -16.292 -36.833 -28.730 1.00 49.85 ? 14   DG  C OP2   1 
ATOM   271  O "O5'" . DG  A 1 14  ? -14.347 -38.129 -29.627 1.00 49.85 ? 14   DG  C "O5'" 1 
ATOM   272  C "C5'" . DG  A 1 14  ? -13.750 -39.146 -30.437 1.00 49.85 ? 14   DG  C "C5'" 1 
ATOM   273  C "C4'" . DG  A 1 14  ? -12.235 -39.028 -30.544 1.00 49.85 ? 14   DG  C "C4'" 1 
ATOM   274  O "O4'" . DG  A 1 14  ? -11.813 -37.661 -30.765 1.00 49.85 ? 14   DG  C "O4'" 1 
ATOM   275  C "C3'" . DG  A 1 14  ? -11.430 -39.411 -29.311 1.00 49.85 ? 14   DG  C "C3'" 1 
ATOM   276  O "O3'" . DG  A 1 14  ? -11.336 -40.833 -29.175 1.00 49.85 ? 14   DG  C "O3'" 1 
ATOM   277  C "C2'" . DG  A 1 14  ? -10.070 -38.789 -29.626 1.00 49.85 ? 14   DG  C "C2'" 1 
ATOM   278  C "C1'" . DG  A 1 14  ? -10.406 -37.648 -30.585 1.00 49.85 ? 14   DG  C "C1'" 1 
ATOM   279  N N9    . DG  A 1 14  ? -9.950  -36.339 -30.109 1.00 49.85 ? 14   DG  C N9    1 
ATOM   280  C C8    . DG  A 1 14  ? -10.717 -35.328 -29.578 1.00 49.85 ? 14   DG  C C8    1 
ATOM   281  N N7    . DG  A 1 14  ? -10.029 -34.272 -29.242 1.00 49.85 ? 14   DG  C N7    1 
ATOM   282  C C5    . DG  A 1 14  ? -8.719  -34.598 -29.568 1.00 49.85 ? 14   DG  C C5    1 
ATOM   283  C C6    . DG  A 1 14  ? -7.524  -33.843 -29.429 1.00 49.85 ? 14   DG  C C6    1 
ATOM   284  O O6    . DG  A 1 14  ? -7.391  -32.698 -28.975 1.00 49.85 ? 14   DG  C O6    1 
ATOM   285  N N1    . DG  A 1 14  ? -6.402  -34.540 -29.881 1.00 49.85 ? 14   DG  C N1    1 
ATOM   286  C C2    . DG  A 1 14  ? -6.432  -35.815 -30.404 1.00 49.85 ? 14   DG  C C2    1 
ATOM   287  N N2    . DG  A 1 14  ? -5.251  -36.324 -30.787 1.00 49.85 ? 14   DG  C N2    1 
ATOM   288  N N3    . DG  A 1 14  ? -7.545  -36.534 -30.540 1.00 49.85 ? 14   DG  C N3    1 
ATOM   289  C C4    . DG  A 1 14  ? -8.650  -35.869 -30.104 1.00 49.85 ? 14   DG  C C4    1 
ATOM   290  P P     . DT  A 1 15  ? -10.925 -41.502 -27.772 1.00 49.85 ? 15   DT  C P     1 
ATOM   291  O OP1   . DT  A 1 15  ? -11.321 -42.931 -27.822 1.00 49.85 ? 15   DT  C OP1   1 
ATOM   292  O OP2   . DT  A 1 15  ? -11.453 -40.634 -26.692 1.00 49.85 ? 15   DT  C OP2   1 
ATOM   293  O "O5'" . DT  A 1 15  ? -9.319  -41.426 -27.770 1.00 49.85 ? 15   DT  C "O5'" 1 
ATOM   294  C "C5'" . DT  A 1 15  ? -8.545  -42.142 -28.743 1.00 49.85 ? 15   DT  C "C5'" 1 
ATOM   295  C "C4'" . DT  A 1 15  ? -7.100  -41.667 -28.786 1.00 49.85 ? 15   DT  C "C4'" 1 
ATOM   296  O "O4'" . DT  A 1 15  ? -7.054  -40.213 -28.835 1.00 49.85 ? 15   DT  C "O4'" 1 
ATOM   297  C "C3'" . DT  A 1 15  ? -6.236  -42.096 -27.598 1.00 49.85 ? 15   DT  C "C3'" 1 
ATOM   298  O "O3'" . DT  A 1 15  ? -5.027  -42.697 -28.060 1.00 49.85 ? 15   DT  C "O3'" 1 
ATOM   299  C "C2'" . DT  A 1 15  ? -5.964  -40.800 -26.833 1.00 49.85 ? 15   DT  C "C2'" 1 
ATOM   300  C "C1'" . DT  A 1 15  ? -6.077  -39.738 -27.926 1.00 49.85 ? 15   DT  C "C1'" 1 
ATOM   301  N N1    . DT  A 1 15  ? -6.458  -38.363 -27.424 1.00 49.85 ? 15   DT  C N1    1 
ATOM   302  C C2    . DT  A 1 15  ? -5.515  -37.346 -27.416 1.00 49.85 ? 15   DT  C C2    1 
ATOM   303  O O2    . DT  A 1 15  ? -4.363  -37.474 -27.795 1.00 49.85 ? 15   DT  C O2    1 
ATOM   304  N N3    . DT  A 1 15  ? -5.974  -36.141 -26.939 1.00 49.85 ? 15   DT  C N3    1 
ATOM   305  C C4    . DT  A 1 15  ? -7.250  -35.850 -26.478 1.00 49.85 ? 15   DT  C C4    1 
ATOM   306  O O4    . DT  A 1 15  ? -7.550  -34.729 -26.071 1.00 49.85 ? 15   DT  C O4    1 
ATOM   307  C C5    . DT  A 1 15  ? -8.189  -36.952 -26.512 1.00 49.85 ? 15   DT  C C5    1 
ATOM   308  C C7    . DT  A 1 15  ? -9.653  -36.714 -26.272 1.00 49.85 ? 15   DT  C C7    1 
ATOM   309  C C6    . DT  A 1 15  ? -7.751  -38.135 -26.975 1.00 49.85 ? 15   DT  C C6    1 
ATOM   310  O "O5'" . DT  B 2 1   ? -1.072  -29.460 -20.432 1.00 49.85 ? 1    DT  D "O5'" 1 
ATOM   311  C "C5'" . DT  B 2 1   ? -1.122  -30.666 -21.184 1.00 49.85 ? 1    DT  D "C5'" 1 
ATOM   312  C "C4'" . DT  B 2 1   ? 0.220   -30.977 -21.833 1.00 49.85 ? 1    DT  D "C4'" 1 
ATOM   313  O "O4'" . DT  B 2 1   ? 0.307   -32.398 -22.120 1.00 49.85 ? 1    DT  D "O4'" 1 
ATOM   314  C "C3'" . DT  B 2 1   ? 0.465   -30.267 -23.161 1.00 49.85 ? 1    DT  D "C3'" 1 
ATOM   315  O "O3'" . DT  B 2 1   ? 1.835   -29.876 -23.308 1.00 49.85 ? 1    DT  D "O3'" 1 
ATOM   316  C "C2'" . DT  B 2 1   ? 0.064   -31.299 -24.210 1.00 49.85 ? 1    DT  D "C2'" 1 
ATOM   317  C "C1'" . DT  B 2 1   ? 0.295   -32.638 -23.517 1.00 49.85 ? 1    DT  D "C1'" 1 
ATOM   318  N N1    . DT  B 2 1   ? -0.761  -33.661 -23.863 1.00 49.85 ? 1    DT  D N1    1 
ATOM   319  C C2    . DT  B 2 1   ? -0.403  -34.809 -24.557 1.00 49.85 ? 1    DT  D C2    1 
ATOM   320  O O2    . DT  B 2 1   ? 0.736   -35.064 -24.918 1.00 49.85 ? 1    DT  D O2    1 
ATOM   321  N N3    . DT  B 2 1   ? -1.449  -35.667 -24.816 1.00 49.85 ? 1    DT  D N3    1 
ATOM   322  C C4    . DT  B 2 1   ? -2.782  -35.501 -24.466 1.00 49.85 ? 1    DT  D C4    1 
ATOM   323  O O4    . DT  B 2 1   ? -3.633  -36.338 -24.753 1.00 49.85 ? 1    DT  D O4    1 
ATOM   324  C C5    . DT  B 2 1   ? -3.090  -34.283 -23.746 1.00 49.85 ? 1    DT  D C5    1 
ATOM   325  C C7    . DT  B 2 1   ? -4.515  -33.903 -23.455 1.00 49.85 ? 1    DT  D C7    1 
ATOM   326  C C6    . DT  B 2 1   ? -2.079  -33.437 -23.485 1.00 49.85 ? 1    DT  D C6    1 
ATOM   327  P P     . DA  B 2 2   ? 2.234   -28.695 -24.322 1.00 49.85 ? 2    DA  D P     1 
ATOM   328  O OP1   . DA  B 2 2   ? 3.556   -28.168 -23.908 1.00 49.85 ? 2    DA  D OP1   1 
ATOM   329  O OP2   . DA  B 2 2   ? 1.080   -27.768 -24.429 1.00 49.85 ? 2    DA  D OP2   1 
ATOM   330  O "O5'" . DA  B 2 2   ? 2.413   -29.444 -25.727 1.00 49.85 ? 2    DA  D "O5'" 1 
ATOM   331  C "C5'" . DA  B 2 2   ? 3.408   -30.451 -25.915 1.00 49.85 ? 2    DA  D "C5'" 1 
ATOM   332  C "C4'" . DA  B 2 2   ? 3.050   -31.355 -27.086 1.00 49.85 ? 2    DA  D "C4'" 1 
ATOM   333  O "O4'" . DA  B 2 2   ? 1.741   -31.950 -26.875 1.00 49.85 ? 2    DA  D "O4'" 1 
ATOM   334  C "C3'" . DA  B 2 2   ? 3.004   -30.669 -28.448 1.00 49.85 ? 2    DA  D "C3'" 1 
ATOM   335  O "O3'" . DA  B 2 2   ? 3.755   -31.439 -29.388 1.00 49.85 ? 2    DA  D "O3'" 1 
ATOM   336  C "C2'" . DA  B 2 2   ? 1.517   -30.615 -28.799 1.00 49.85 ? 2    DA  D "C2'" 1 
ATOM   337  C "C1'" . DA  B 2 2   ? 0.947   -31.806 -28.035 1.00 49.85 ? 2    DA  D "C1'" 1 
ATOM   338  N N9    . DA  B 2 2   ? -0.453  -31.647 -27.634 1.00 49.85 ? 2    DA  D N9    1 
ATOM   339  C C8    . DA  B 2 2   ? -1.071  -30.496 -27.220 1.00 49.85 ? 2    DA  D C8    1 
ATOM   340  N N7    . DA  B 2 2   ? -2.339  -30.647 -26.922 1.00 49.85 ? 2    DA  D N7    1 
ATOM   341  C C5    . DA  B 2 2   ? -2.577  -31.990 -27.156 1.00 49.85 ? 2    DA  D C5    1 
ATOM   342  C C6    . DA  B 2 2   ? -3.737  -32.787 -27.029 1.00 49.85 ? 2    DA  D C6    1 
ATOM   343  N N6    . DA  B 2 2   ? -4.914  -32.305 -26.616 1.00 49.85 ? 2    DA  D N6    1 
ATOM   344  N N1    . DA  B 2 2   ? -3.641  -34.101 -27.343 1.00 49.85 ? 2    DA  D N1    1 
ATOM   345  C C2    . DA  B 2 2   ? -2.458  -34.582 -27.758 1.00 49.85 ? 2    DA  D C2    1 
ATOM   346  N N3    . DA  B 2 2   ? -1.302  -33.929 -27.915 1.00 49.85 ? 2    DA  D N3    1 
ATOM   347  C C4    . DA  B 2 2   ? -1.426  -32.625 -27.595 1.00 49.85 ? 2    DA  D C4    1 
ATOM   348  P P     . DC  B 2 3   ? 4.150   -30.875 -30.839 1.00 49.85 ? 3    DC  D P     1 
ATOM   349  O OP1   . DC  B 2 3   ? 5.538   -31.319 -31.108 1.00 49.85 ? 3    DC  D OP1   1 
ATOM   350  O OP2   . DC  B 2 3   ? 3.818   -29.428 -30.907 1.00 49.85 ? 3    DC  D OP2   1 
ATOM   351  O "O5'" . DC  B 2 3   ? 3.144   -31.672 -31.805 1.00 49.85 ? 3    DC  D "O5'" 1 
ATOM   352  C "C5'" . DC  B 2 3   ? 3.245   -33.093 -31.929 1.00 49.85 ? 3    DC  D "C5'" 1 
ATOM   353  C "C4'" . DC  B 2 3   ? 1.886   -33.771 -31.999 1.00 49.85 ? 3    DC  D "C4'" 1 
ATOM   354  O "O4'" . DC  B 2 3   ? 0.885   -33.089 -31.200 1.00 49.85 ? 3    DC  D "O4'" 1 
ATOM   355  C "C3'" . DC  B 2 3   ? 1.277   -33.876 -33.396 1.00 49.85 ? 3    DC  D "C3'" 1 
ATOM   356  O "O3'" . DC  B 2 3   ? 1.441   -35.205 -33.896 1.00 49.85 ? 3    DC  D "O3'" 1 
ATOM   357  C "C2'" . DC  B 2 3   ? -0.202  -33.538 -33.194 1.00 49.85 ? 3    DC  D "C2'" 1 
ATOM   358  C "C1'" . DC  B 2 3   ? -0.350  -33.579 -31.679 1.00 49.85 ? 3    DC  D "C1'" 1 
ATOM   359  N N1    . DC  B 2 3   ? -1.526  -32.784 -31.179 1.00 49.85 ? 3    DC  D N1    1 
ATOM   360  C C2    . DC  B 2 3   ? -2.757  -33.435 -30.953 1.00 49.85 ? 3    DC  D C2    1 
ATOM   361  O O2    . DC  B 2 3   ? -2.869  -34.653 -31.162 1.00 49.85 ? 3    DC  D O2    1 
ATOM   362  N N3    . DC  B 2 3   ? -3.812  -32.702 -30.502 1.00 49.85 ? 3    DC  D N3    1 
ATOM   363  C C4    . DC  B 2 3   ? -3.676  -31.389 -30.281 1.00 49.85 ? 3    DC  D C4    1 
ATOM   364  N N4    . DC  B 2 3   ? -4.746  -30.721 -29.838 1.00 49.85 ? 3    DC  D N4    1 
ATOM   365  C C5    . DC  B 2 3   ? -2.438  -30.708 -30.503 1.00 49.85 ? 3    DC  D C5    1 
ATOM   366  C C6    . DC  B 2 3   ? -1.403  -31.436 -30.948 1.00 49.85 ? 3    DC  D C6    1 
ATOM   367  P P     . DC  B 2 4   ? 0.978   -35.621 -35.377 1.00 49.85 ? 4    DC  D P     1 
ATOM   368  O OP1   . DC  B 2 4   ? 1.972   -36.600 -35.885 1.00 49.85 ? 4    DC  D OP1   1 
ATOM   369  O OP2   . DC  B 2 4   ? 0.703   -34.395 -36.167 1.00 49.85 ? 4    DC  D OP2   1 
ATOM   370  O "O5'" . DC  B 2 4   ? -0.420  -36.362 -35.108 1.00 49.85 ? 4    DC  D "O5'" 1 
ATOM   371  C "C5'" . DC  B 2 4   ? -0.466  -37.769 -34.844 1.00 49.85 ? 4    DC  D "C5'" 1 
ATOM   372  C "C4'" . DC  B 2 4   ? -1.859  -38.338 -35.060 1.00 49.85 ? 4    DC  D "C4'" 1 
ATOM   373  O "O4'" . DC  B 2 4   ? -2.720  -37.912 -33.970 1.00 49.85 ? 4    DC  D "O4'" 1 
ATOM   374  C "C3'" . DC  B 2 4   ? -2.566  -37.859 -36.323 1.00 49.85 ? 4    DC  D "C3'" 1 
ATOM   375  O "O3'" . DC  B 2 4   ? -2.203  -38.654 -37.453 1.00 49.85 ? 4    DC  D "O3'" 1 
ATOM   376  C "C2'" . DC  B 2 4   ? -4.036  -38.014 -35.940 1.00 49.85 ? 4    DC  D "C2'" 1 
ATOM   377  C "C1'" . DC  B 2 4   ? -4.015  -37.604 -34.467 1.00 49.85 ? 4    DC  D "C1'" 1 
ATOM   378  N N1    . DC  B 2 4   ? -4.371  -36.149 -34.211 1.00 49.85 ? 4    DC  D N1    1 
ATOM   379  C C2    . DC  B 2 4   ? -5.659  -35.827 -33.742 1.00 49.85 ? 4    DC  D C2    1 
ATOM   380  O O2    . DC  B 2 4   ? -6.490  -36.725 -33.540 1.00 49.85 ? 4    DC  D O2    1 
ATOM   381  N N3    . DC  B 2 4   ? -5.966  -34.520 -33.516 1.00 49.85 ? 4    DC  D N3    1 
ATOM   382  C C4    . DC  B 2 4   ? -5.063  -33.558 -33.736 1.00 49.85 ? 4    DC  D C4    1 
ATOM   383  N N4    . DC  B 2 4   ? -5.424  -32.293 -33.496 1.00 49.85 ? 4    DC  D N4    1 
ATOM   384  C C5    . DC  B 2 4   ? -3.750  -33.858 -34.213 1.00 49.85 ? 4    DC  D C5    1 
ATOM   385  C C6    . DC  B 2 4   ? -3.455  -35.148 -34.432 1.00 49.85 ? 4    DC  D C6    1 
ATOM   386  P P     . DT  B 2 5   ? -2.311  -38.053 -38.941 1.00 49.85 ? 5    DT  D P     1 
ATOM   387  O OP1   . DT  B 2 5   ? -1.477  -38.895 -39.833 1.00 49.85 ? 5    DT  D OP1   1 
ATOM   388  O OP2   . DT  B 2 5   ? -2.065  -36.591 -38.877 1.00 49.85 ? 5    DT  D OP2   1 
ATOM   389  O "O5'" . DT  B 2 5   ? -3.849  -38.299 -39.317 1.00 49.85 ? 5    DT  D "O5'" 1 
ATOM   390  C "C5'" . DT  B 2 5   ? -4.453  -39.589 -39.182 1.00 49.85 ? 5    DT  D "C5'" 1 
ATOM   391  C "C4'" . DT  B 2 5   ? -5.962  -39.461 -39.264 1.00 49.85 ? 5    DT  D "C4'" 1 
ATOM   392  O "O4'" . DT  B 2 5   ? -6.410  -38.501 -38.270 1.00 49.85 ? 5    DT  D "O4'" 1 
ATOM   393  C "C3'" . DT  B 2 5   ? -6.454  -38.972 -40.626 1.00 49.85 ? 5    DT  D "C3'" 1 
ATOM   394  O "O3'" . DT  B 2 5   ? -7.358  -39.939 -41.217 1.00 49.85 ? 5    DT  D "O3'" 1 
ATOM   395  C "C2'" . DT  B 2 5   ? -7.021  -37.575 -40.352 1.00 49.85 ? 5    DT  D "C2'" 1 
ATOM   396  C "C1'" . DT  B 2 5   ? -7.314  -37.580 -38.852 1.00 49.85 ? 5    DT  D "C1'" 1 
ATOM   397  N N1    . DT  B 2 5   ? -7.201  -36.225 -38.184 1.00 49.85 ? 5    DT  D N1    1 
ATOM   398  C C2    . DT  B 2 5   ? -8.328  -35.646 -37.619 1.00 49.85 ? 5    DT  D C2    1 
ATOM   399  O O2    . DT  B 2 5   ? -9.433  -36.160 -37.621 1.00 49.85 ? 5    DT  D O2    1 
ATOM   400  N N3    . DT  B 2 5   ? -8.118  -34.417 -37.039 1.00 49.85 ? 5    DT  D N3    1 
ATOM   401  C C4    . DT  B 2 5   ? -6.924  -33.716 -36.963 1.00 49.85 ? 5    DT  D C4    1 
ATOM   402  O O4    . DT  B 2 5   ? -6.857  -32.617 -36.416 1.00 49.85 ? 5    DT  D O4    1 
ATOM   403  C C5    . DT  B 2 5   ? -5.782  -34.371 -37.572 1.00 49.85 ? 5    DT  D C5    1 
ATOM   404  C C7    . DT  B 2 5   ? -4.498  -33.621 -37.785 1.00 49.85 ? 5    DT  D C7    1 
ATOM   405  C C6    . DT  B 2 5   ? -5.976  -35.574 -38.141 1.00 49.85 ? 5    DT  D C6    1 
ATOM   406  P P     . DG  B 2 6   ? -8.950  -39.786 -41.390 1.00 49.85 ? 6    DG  D P     1 
ATOM   407  O OP1   . DG  B 2 6   ? -9.547  -39.553 -40.054 1.00 49.85 ? 6    DG  D OP1   1 
ATOM   408  O OP2   . DG  B 2 6   ? -9.403  -40.952 -42.187 1.00 49.85 ? 6    DG  D OP2   1 
ATOM   409  O "O5'" . DG  B 2 6   ? -9.123  -38.468 -42.289 1.00 49.85 ? 6    DG  D "O5'" 1 
ATOM   410  C "C5'" . DG  B 2 6   ? -10.234 -38.326 -43.173 1.00 49.85 ? 6    DG  D "C5'" 1 
ATOM   411  C "C4'" . DG  B 2 6   ? -11.478 -37.779 -42.486 1.00 49.85 ? 6    DG  D "C4'" 1 
ATOM   412  O "O4'" . DG  B 2 6   ? -11.210 -37.405 -41.106 1.00 49.85 ? 6    DG  D "O4'" 1 
ATOM   413  C "C3'" . DG  B 2 6   ? -12.031 -36.525 -43.149 1.00 49.85 ? 6    DG  D "C3'" 1 
ATOM   414  O "O3'" . DG  B 2 6   ? -12.862 -36.908 -44.273 1.00 49.85 ? 6    DG  D "O3'" 1 
ATOM   415  C "C2'" . DG  B 2 6   ? -12.717 -35.820 -41.975 1.00 49.85 ? 6    DG  D "C2'" 1 
ATOM   416  C "C1'" . DG  B 2 6   ? -11.782 -36.142 -40.812 1.00 49.85 ? 6    DG  D "C1'" 1 
ATOM   417  N N9    . DG  B 2 6   ? -10.707 -35.165 -40.589 1.00 49.85 ? 6    DG  D N9    1 
ATOM   418  C C8    . DG  B 2 6   ? -9.384  -35.316 -40.933 1.00 49.85 ? 6    DG  D C8    1 
ATOM   419  N N7    . DG  B 2 6   ? -8.629  -34.300 -40.622 1.00 49.85 ? 6    DG  D N7    1 
ATOM   420  C C5    . DG  B 2 6   ? -9.505  -33.405 -40.028 1.00 49.85 ? 6    DG  D C5    1 
ATOM   421  C C6    . DG  B 2 6   ? -9.252  -32.118 -39.491 1.00 49.85 ? 6    DG  D C6    1 
ATOM   422  O O6    . DG  B 2 6   ? -8.173  -31.514 -39.437 1.00 49.85 ? 6    DG  D O6    1 
ATOM   423  N N1    . DG  B 2 6   ? -10.407 -31.528 -38.979 1.00 49.85 ? 6    DG  D N1    1 
ATOM   424  C C2    . DG  B 2 6   ? -11.653 -32.114 -38.990 1.00 49.85 ? 6    DG  D C2    1 
ATOM   425  N N2    . DG  B 2 6   ? -12.645 -31.392 -38.451 1.00 49.85 ? 6    DG  D N2    1 
ATOM   426  N N3    . DG  B 2 6   ? -11.905 -33.322 -39.492 1.00 49.85 ? 6    DG  D N3    1 
ATOM   427  C C4    . DG  B 2 6   ? -10.789 -33.917 -39.997 1.00 49.85 ? 6    DG  D C4    1 
ATOM   428  P P     . DC  B 2 7   ? -14.467 -36.833 -44.335 1.00 49.85 ? 7    DC  D P     1 
ATOM   429  O OP1   . DC  B 2 7   ? -15.032 -37.450 -43.109 1.00 49.85 ? 7    DC  D OP1   1 
ATOM   430  O OP2   . DC  B 2 7   ? -14.871 -37.360 -45.659 1.00 49.85 ? 7    DC  D OP2   1 
ATOM   431  O "O5'" . DC  B 2 7   ? -14.734 -35.252 -44.368 1.00 49.85 ? 7    DC  D "O5'" 1 
ATOM   432  C "C5'" . DC  B 2 7   ? -15.775 -34.628 -43.614 1.00 49.85 ? 7    DC  D "C5'" 1 
ATOM   433  C "C4'" . DC  B 2 7   ? -15.537 -33.129 -43.509 1.00 49.85 ? 7    DC  D "C4'" 1 
ATOM   434  O "O4'" . DC  B 2 7   ? -14.431 -32.870 -42.612 1.00 49.85 ? 7    DC  D "O4'" 1 
ATOM   435  C "C3'" . DC  B 2 7   ? -15.110 -32.427 -44.792 1.00 49.85 ? 7    DC  D "C3'" 1 
ATOM   436  O "O3'" . DC  B 2 7   ? -16.238 -32.166 -45.630 1.00 49.85 ? 7    DC  D "O3'" 1 
ATOM   437  C "C2'" . DC  B 2 7   ? -14.472 -31.148 -44.257 1.00 49.85 ? 7    DC  D "C2'" 1 
ATOM   438  C "C1'" . DC  B 2 7   ? -13.883 -31.598 -42.917 1.00 49.85 ? 7    DC  D "C1'" 1 
ATOM   439  N N1    . DC  B 2 7   ? -12.378 -31.671 -42.896 1.00 49.85 ? 7    DC  D N1    1 
ATOM   440  C C2    . DC  B 2 7   ? -11.622 -30.584 -42.415 1.00 49.85 ? 7    DC  D C2    1 
ATOM   441  O O2    . DC  B 2 7   ? -12.192 -29.563 -42.007 1.00 49.85 ? 7    DC  D O2    1 
ATOM   442  N N3    . DC  B 2 7   ? -10.263 -30.681 -42.410 1.00 49.85 ? 7    DC  D N3    1 
ATOM   443  C C4    . DC  B 2 7   ? -9.663  -31.790 -42.854 1.00 49.85 ? 7    DC  D C4    1 
ATOM   444  N N4    . DC  B 2 7   ? -8.329  -31.834 -42.827 1.00 49.85 ? 7    DC  D N4    1 
ATOM   445  C C5    . DC  B 2 7   ? -10.408 -32.904 -43.346 1.00 49.85 ? 7    DC  D C5    1 
ATOM   446  C C6    . DC  B 2 7   ? -11.743 -32.798 -43.346 1.00 49.85 ? 7    DC  D C6    1 
ATOM   447  P P     . DA  B 2 8   ? -16.607 -33.156 -46.842 1.00 49.85 ? 8    DA  D P     1 
ATOM   448  O OP1   . DA  B 2 8   ? -17.683 -34.054 -46.364 1.00 49.85 ? 8    DA  D OP1   1 
ATOM   449  O OP2   . DA  B 2 8   ? -15.354 -33.760 -47.355 1.00 49.85 ? 8    DA  D OP2   1 
ATOM   450  O "O5'" . DA  B 2 8   ? -17.234 -32.193 -47.964 1.00 49.85 ? 8    DA  D "O5'" 1 
ATOM   451  C "C5'" . DA  B 2 8   ? -17.068 -30.766 -47.944 1.00 49.85 ? 8    DA  D "C5'" 1 
ATOM   452  C "C4'" . DA  B 2 8   ? -15.826 -30.310 -48.703 1.00 49.85 ? 8    DA  D "C4'" 1 
ATOM   453  O "O4'" . DA  B 2 8   ? -14.625 -30.683 -47.972 1.00 49.85 ? 8    DA  D "O4'" 1 
ATOM   454  C "C3'" . DA  B 2 8   ? -15.638 -30.851 -50.121 1.00 49.85 ? 8    DA  D "C3'" 1 
ATOM   455  O "O3'" . DA  B 2 8   ? -15.119 -29.815 -50.969 1.00 49.85 ? 8    DA  D "O3'" 1 
ATOM   456  C "C2'" . DA  B 2 8   ? -14.626 -31.970 -49.895 1.00 49.85 ? 8    DA  D "C2'" 1 
ATOM   457  C "C1'" . DA  B 2 8   ? -13.718 -31.288 -48.875 1.00 49.85 ? 8    DA  D "C1'" 1 
ATOM   458  N N9    . DA  B 2 8   ? -12.791 -32.157 -48.144 1.00 49.85 ? 8    DA  D N9    1 
ATOM   459  C C8    . DA  B 2 8   ? -12.212 -31.858 -46.941 1.00 49.85 ? 8    DA  D C8    1 
ATOM   460  N N7    . DA  B 2 8   ? -11.415 -32.790 -46.483 1.00 49.85 ? 8    DA  D N7    1 
ATOM   461  C C5    . DA  B 2 8   ? -11.467 -33.779 -47.448 1.00 49.85 ? 8    DA  D C5    1 
ATOM   462  C C6    . DA  B 2 8   ? -10.835 -35.040 -47.550 1.00 49.85 ? 8    DA  D C6    1 
ATOM   463  N N6    . DA  B 2 8   ? -10.000 -35.519 -46.622 1.00 49.85 ? 8    DA  D N6    1 
ATOM   464  N N1    . DA  B 2 8   ? -11.096 -35.794 -48.646 1.00 49.85 ? 8    DA  D N1    1 
ATOM   465  C C2    . DA  B 2 8   ? -11.936 -35.312 -49.577 1.00 49.85 ? 8    DA  D C2    1 
ATOM   466  N N3    . DA  B 2 8   ? -12.586 -34.143 -49.588 1.00 49.85 ? 8    DA  D N3    1 
ATOM   467  C C4    . DA  B 2 8   ? -12.311 -33.409 -48.487 1.00 49.85 ? 8    DA  D C4    1 
ATOM   468  P P     . DA  B 2 9   ? -14.352 -30.127 -52.349 1.00 49.85 ? 9    DA  D P     1 
ATOM   469  O OP1   . DA  B 2 9   ? -15.259 -30.944 -53.186 1.00 49.85 ? 9    DA  D OP1   1 
ATOM   470  O OP2   . DA  B 2 9   ? -12.993 -30.643 -52.051 1.00 49.85 ? 9    DA  D OP2   1 
ATOM   471  O "O5'" . DA  B 2 9   ? -14.214 -28.674 -53.017 1.00 49.85 ? 9    DA  D "O5'" 1 
ATOM   472  C "C5'" . DA  B 2 9   ? -13.890 -27.518 -52.233 1.00 49.85 ? 9    DA  D "C5'" 1 
ATOM   473  C "C4'" . DA  B 2 9   ? -12.398 -27.364 -51.961 1.00 49.85 ? 9    DA  D "C4'" 1 
ATOM   474  O "O4'" . DA  B 2 9   ? -12.020 -28.057 -50.749 1.00 49.85 ? 9    DA  D "O4'" 1 
ATOM   475  C "C3'" . DA  B 2 9   ? -11.425 -27.950 -52.977 1.00 49.85 ? 9    DA  D "C3'" 1 
ATOM   476  O "O3'" . DA  B 2 9   ? -11.403 -27.117 -54.142 1.00 49.85 ? 9    DA  D "O3'" 1 
ATOM   477  C "C2'" . DA  B 2 9   ? -10.126 -27.966 -52.167 1.00 49.85 ? 9    DA  D "C2'" 1 
ATOM   478  C "C1'" . DA  B 2 9   ? -10.605 -28.041 -50.713 1.00 49.85 ? 9    DA  D "C1'" 1 
ATOM   479  N N9    . DA  B 2 9   ? -10.112 -29.201 -49.965 1.00 49.85 ? 9    DA  D N9    1 
ATOM   480  C C8    . DA  B 2 9   ? -10.089 -30.508 -50.374 1.00 49.85 ? 9    DA  D C8    1 
ATOM   481  N N7    . DA  B 2 9   ? -9.587  -31.336 -49.488 1.00 49.85 ? 9    DA  D N7    1 
ATOM   482  C C5    . DA  B 2 9   ? -9.255  -30.519 -48.418 1.00 49.85 ? 9    DA  D C5    1 
ATOM   483  C C6    . DA  B 2 9   ? -8.676  -30.784 -47.153 1.00 49.85 ? 9    DA  D C6    1 
ATOM   484  N N6    . DA  B 2 9   ? -8.321  -32.009 -46.751 1.00 49.85 ? 9    DA  D N6    1 
ATOM   485  N N1    . DA  B 2 9   ? -8.476  -29.740 -46.313 1.00 49.85 ? 9    DA  D N1    1 
ATOM   486  C C2    . DA  B 2 9   ? -8.832  -28.509 -46.715 1.00 49.85 ? 9    DA  D C2    1 
ATOM   487  N N3    . DA  B 2 9   ? -9.382  -28.139 -47.877 1.00 49.85 ? 9    DA  D N3    1 
ATOM   488  C C4    . DA  B 2 9   ? -9.571  -29.197 -48.695 1.00 49.85 ? 9    DA  D C4    1 
ATOM   489  P P     . DC  B 2 10  ? -10.141 -26.914 -55.114 1.00 49.85 ? 10   DC  D P     1 
ATOM   490  O OP1   . DC  B 2 10  ? -10.679 -26.559 -56.449 1.00 49.85 ? 10   DC  D OP1   1 
ATOM   491  O OP2   . DC  B 2 10  ? -9.204  -28.057 -54.995 1.00 49.85 ? 10   DC  D OP2   1 
ATOM   492  O "O5'" . DC  B 2 10  ? -9.469  -25.597 -54.499 1.00 49.85 ? 10   DC  D "O5'" 1 
ATOM   493  C "C5'" . DC  B 2 10  ? -10.166 -24.353 -54.572 1.00 49.85 ? 10   DC  D "C5'" 1 
ATOM   494  C "C4'" . DC  B 2 10  ? -9.484  -23.288 -53.736 1.00 49.85 ? 10   DC  D "C4'" 1 
ATOM   495  O "O4'" . DC  B 2 10  ? -9.249  -23.787 -52.395 1.00 49.85 ? 10   DC  D "O4'" 1 
ATOM   496  C "C3'" . DC  B 2 10  ? -8.115  -22.858 -54.231 1.00 49.85 ? 10   DC  D "C3'" 1 
ATOM   497  O "O3'" . DC  B 2 10  ? -8.252  -21.870 -55.248 1.00 49.85 ? 10   DC  D "O3'" 1 
ATOM   498  C "C2'" . DC  B 2 10  ? -7.521  -22.282 -52.954 1.00 49.85 ? 10   DC  D "C2'" 1 
ATOM   499  C "C1'" . DC  B 2 10  ? -8.033  -23.257 -51.893 1.00 49.85 ? 10   DC  D "C1'" 1 
ATOM   500  N N1    . DC  B 2 10  ? -7.100  -24.394 -51.527 1.00 49.85 ? 10   DC  D N1    1 
ATOM   501  C C2    . DC  B 2 10  ? -5.738  -24.174 -51.227 1.00 49.85 ? 10   DC  D C2    1 
ATOM   502  O O2    . DC  B 2 10  ? -5.263  -23.031 -51.258 1.00 49.85 ? 10   DC  D O2    1 
ATOM   503  N N3    . DC  B 2 10  ? -4.952  -25.238 -50.903 1.00 49.85 ? 10   DC  D N3    1 
ATOM   504  C C4    . DC  B 2 10  ? -5.460  -26.474 -50.868 1.00 49.85 ? 10   DC  D C4    1 
ATOM   505  N N4    . DC  B 2 10  ? -4.641  -27.479 -50.543 1.00 49.85 ? 10   DC  D N4    1 
ATOM   506  C C5    . DC  B 2 10  ? -6.835  -26.724 -51.165 1.00 49.85 ? 10   DC  D C5    1 
ATOM   507  C C6    . DC  B 2 10  ? -7.600  -25.669 -51.483 1.00 49.85 ? 10   DC  D C6    1 
ATOM   508  P P     . DC  B 2 11  ? -7.677  -22.106 -56.727 1.00 49.85 ? 11   DC  D P     1 
ATOM   509  O OP1   . DC  B 2 11  ? -8.621  -21.470 -57.675 1.00 49.85 ? 11   DC  D OP1   1 
ATOM   510  O OP2   . DC  B 2 11  ? -7.333  -23.542 -56.872 1.00 49.85 ? 11   DC  D OP2   1 
ATOM   511  O "O5'" . DC  B 2 11  ? -6.306  -21.278 -56.740 1.00 49.85 ? 11   DC  D "O5'" 1 
ATOM   512  C "C5'" . DC  B 2 11  ? -6.261  -19.911 -56.333 1.00 49.85 ? 11   DC  D "C5'" 1 
ATOM   513  C "C4'" . DC  B 2 11  ? -5.067  -19.652 -55.430 1.00 49.85 ? 11   DC  D "C4'" 1 
ATOM   514  O "O4'" . DC  B 2 11  ? -5.019  -20.665 -54.398 1.00 49.85 ? 11   DC  D "O4'" 1 
ATOM   515  C "C3'" . DC  B 2 11  ? -3.718  -19.718 -56.130 1.00 49.85 ? 11   DC  D "C3'" 1 
ATOM   516  O "O3'" . DC  B 2 11  ? -3.325  -18.407 -56.515 1.00 49.85 ? 11   DC  D "O3'" 1 
ATOM   517  C "C2'" . DC  B 2 11  ? -2.767  -20.297 -55.086 1.00 49.85 ? 11   DC  D "C2'" 1 
ATOM   518  C "C1'" . DC  B 2 11  ? -3.678  -20.957 -54.052 1.00 49.85 ? 11   DC  D "C1'" 1 
ATOM   519  N N1    . DC  B 2 11  ? -3.506  -22.452 -53.914 1.00 49.85 ? 11   DC  D N1    1 
ATOM   520  C C2    . DC  B 2 11  ? -2.428  -22.985 -53.176 1.00 49.85 ? 11   DC  D C2    1 
ATOM   521  O O2    . DC  B 2 11  ? -1.610  -22.229 -52.634 1.00 49.85 ? 11   DC  D O2    1 
ATOM   522  N N3    . DC  B 2 11  ? -2.308  -24.337 -53.073 1.00 49.85 ? 11   DC  D N3    1 
ATOM   523  C C4    . DC  B 2 11  ? -3.199  -25.142 -53.663 1.00 49.85 ? 11   DC  D C4    1 
ATOM   524  N N4    . DC  B 2 11  ? -3.036  -26.461 -53.532 1.00 49.85 ? 11   DC  D N4    1 
ATOM   525  C C5    . DC  B 2 11  ? -4.299  -24.627 -54.415 1.00 49.85 ? 11   DC  D C5    1 
ATOM   526  C C6    . DC  B 2 11  ? -4.409  -23.295 -54.511 1.00 49.85 ? 11   DC  D C6    1 
ATOM   527  P P     . DG  B 2 12  ? -2.427  -18.184 -57.820 1.00 49.85 ? 12   DG  D P     1 
ATOM   528  O OP1   . DG  B 2 12  ? -2.556  -16.768 -58.235 1.00 49.85 ? 12   DG  D OP1   1 
ATOM   529  O OP2   . DG  B 2 12  ? -2.741  -19.268 -58.778 1.00 49.85 ? 12   DG  D OP2   1 
ATOM   530  O "O5'" . DG  B 2 12  ? -0.942  -18.435 -57.283 1.00 49.85 ? 12   DG  D "O5'" 1 
ATOM   531  C "C5'" . DG  B 2 12  ? -0.344  -17.556 -56.331 1.00 49.85 ? 12   DG  D "C5'" 1 
ATOM   532  C "C4'" . DG  B 2 12  ? 0.949   -18.154 -55.801 1.00 49.85 ? 12   DG  D "C4'" 1 
ATOM   533  O "O4'" . DG  B 2 12  ? 0.678   -19.466 -55.243 1.00 49.85 ? 12   DG  D "O4'" 1 
ATOM   534  C "C3'" . DG  B 2 12  ? 2.047   -18.338 -56.847 1.00 49.85 ? 12   DG  D "C3'" 1 
ATOM   535  O "O3'" . DG  B 2 12  ? 3.292   -17.839 -56.351 1.00 49.85 ? 12   DG  D "O3'" 1 
ATOM   536  C "C2'" . DG  B 2 12  ? 2.078   -19.844 -57.093 1.00 49.85 ? 12   DG  D "C2'" 1 
ATOM   537  C "C1'" . DG  B 2 12  ? 1.585   -20.413 -55.769 1.00 49.85 ? 12   DG  D "C1'" 1 
ATOM   538  N N9    . DG  B 2 12  ? 0.890   -21.691 -55.913 1.00 49.85 ? 12   DG  D N9    1 
ATOM   539  C C8    . DG  B 2 12  ? -0.238  -21.939 -56.660 1.00 49.85 ? 12   DG  D C8    1 
ATOM   540  N N7    . DG  B 2 12  ? -0.641  -23.178 -56.604 1.00 49.85 ? 12   DG  D N7    1 
ATOM   541  C C5    . DG  B 2 12  ? 0.277   -23.796 -55.766 1.00 49.85 ? 12   DG  D C5    1 
ATOM   542  C C6    . DG  B 2 12  ? 0.356   -25.145 -55.331 1.00 49.85 ? 12   DG  D C6    1 
ATOM   543  O O6    . DG  B 2 12  ? -0.398  -26.086 -55.613 1.00 49.85 ? 12   DG  D O6    1 
ATOM   544  N N1    . DG  B 2 12  ? 1.443   -25.361 -54.484 1.00 49.85 ? 12   DG  D N1    1 
ATOM   545  C C2    . DG  B 2 12  ? 2.343   -24.392 -54.105 1.00 49.85 ? 12   DG  D C2    1 
ATOM   546  N N2    . DG  B 2 12  ? 3.326   -24.785 -53.283 1.00 49.85 ? 12   DG  D N2    1 
ATOM   547  N N3    . DG  B 2 12  ? 2.282   -23.125 -54.504 1.00 49.85 ? 12   DG  D N3    1 
ATOM   548  C C4    . DG  B 2 12  ? 1.228   -22.895 -55.331 1.00 49.85 ? 12   DG  D C4    1 
ATOM   549  P P     . DC  B 2 13  ? 4.612   -17.786 -57.262 1.00 49.85 ? 13   DC  D P     1 
ATOM   550  O OP1   . DC  B 2 13  ? 5.486   -16.713 -56.733 1.00 49.85 ? 13   DC  D OP1   1 
ATOM   551  O OP2   . DC  B 2 13  ? 4.211   -17.767 -58.689 1.00 49.85 ? 13   DC  D OP2   1 
ATOM   552  O "O5'" . DC  B 2 13  ? 5.286   -19.206 -56.964 1.00 49.85 ? 13   DC  D "O5'" 1 
ATOM   553  C "C5'" . DC  B 2 13  ? 5.821   -19.499 -55.673 1.00 49.85 ? 13   DC  D "C5'" 1 
ATOM   554  C "C4'" . DC  B 2 13  ? 6.424   -20.893 -55.631 1.00 49.85 ? 13   DC  D "C4'" 1 
ATOM   555  O "O4'" . DC  B 2 13  ? 5.370   -21.883 -55.755 1.00 49.85 ? 13   DC  D "O4'" 1 
ATOM   556  C "C3'" . DC  B 2 13  ? 7.440   -21.196 -56.729 1.00 49.85 ? 13   DC  D "C3'" 1 
ATOM   557  O "O3'" . DC  B 2 13  ? 8.628   -21.720 -56.141 1.00 49.85 ? 13   DC  D "O3'" 1 
ATOM   558  C "C2'" . DC  B 2 13  ? 6.738   -22.213 -57.630 1.00 49.85 ? 13   DC  D "C2'" 1 
ATOM   559  C "C1'" . DC  B 2 13  ? 5.752   -22.882 -56.680 1.00 49.85 ? 13   DC  D "C1'" 1 
ATOM   560  N N1    . DC  B 2 13  ? 4.504   -23.432 -57.325 1.00 49.85 ? 13   DC  D N1    1 
ATOM   561  C C2    . DC  B 2 13  ? 4.100   -24.758 -57.075 1.00 49.85 ? 13   DC  D C2    1 
ATOM   562  O O2    . DC  B 2 13  ? 4.771   -25.479 -56.324 1.00 49.85 ? 13   DC  D O2    1 
ATOM   563  N N3    . DC  B 2 13  ? 2.968   -25.224 -57.671 1.00 49.85 ? 13   DC  D N3    1 
ATOM   564  C C4    . DC  B 2 13  ? 2.255   -24.431 -58.480 1.00 49.85 ? 13   DC  D C4    1 
ATOM   565  N N4    . DC  B 2 13  ? 1.151   -24.935 -59.041 1.00 49.85 ? 13   DC  D N4    1 
ATOM   566  C C5    . DC  B 2 13  ? 2.644   -23.083 -58.748 1.00 49.85 ? 13   DC  D C5    1 
ATOM   567  C C6    . DC  B 2 13  ? 3.760   -22.634 -58.156 1.00 49.85 ? 13   DC  D C6    1 
ATOM   568  P P     . DT  B 2 14  ? 9.962   -21.946 -57.000 1.00 49.85 ? 14   DT  D P     1 
ATOM   569  O OP1   . DT  B 2 14  ? 11.118  -21.695 -56.109 1.00 49.85 ? 14   DT  D OP1   1 
ATOM   570  O OP2   . DT  B 2 14  ? 9.851   -21.200 -58.276 1.00 49.85 ? 14   DT  D OP2   1 
ATOM   571  O "O5'" . DT  B 2 14  ? 9.884   -23.507 -57.336 1.00 49.85 ? 14   DT  D "O5'" 1 
ATOM   572  C "C5'" . DT  B 2 14  ? 10.089  -24.487 -56.320 1.00 49.85 ? 14   DT  D "C5'" 1 
ATOM   573  C "C4'" . DT  B 2 14  ? 9.775   -25.874 -56.851 1.00 49.85 ? 14   DT  D "C4'" 1 
ATOM   574  O "O4'" . DT  B 2 14  ? 8.379   -25.931 -57.213 1.00 49.85 ? 14   DT  D "O4'" 1 
ATOM   575  C "C3'" . DT  B 2 14  ? 10.528  -26.262 -58.117 1.00 49.85 ? 14   DT  D "C3'" 1 
ATOM   576  O "O3'" . DT  B 2 14  ? 11.682  -27.010 -57.765 1.00 49.85 ? 14   DT  D "O3'" 1 
ATOM   577  C "C2'" . DT  B 2 14  ? 9.541   -27.095 -58.936 1.00 49.85 ? 14   DT  D "C2'" 1 
ATOM   578  C "C1'" . DT  B 2 14  ? 8.198   -26.886 -58.239 1.00 49.85 ? 14   DT  D "C1'" 1 
ATOM   579  N N1    . DT  B 2 14  ? 7.085   -26.411 -59.127 1.00 49.85 ? 14   DT  D N1    1 
ATOM   580  C C2    . DT  B 2 14  ? 6.016   -27.255 -59.371 1.00 49.85 ? 14   DT  D C2    1 
ATOM   581  O O2    . DT  B 2 14  ? 5.921   -28.378 -58.905 1.00 49.85 ? 14   DT  D O2    1 
ATOM   582  N N3    . DT  B 2 14  ? 5.048   -26.728 -60.193 1.00 49.85 ? 14   DT  D N3    1 
ATOM   583  C C4    . DT  B 2 14  ? 5.040   -25.474 -60.781 1.00 49.85 ? 14   DT  D C4    1 
ATOM   584  O O4    . DT  B 2 14  ? 4.116   -25.112 -61.502 1.00 49.85 ? 14   DT  D O4    1 
ATOM   585  C C5    . DT  B 2 14  ? 6.186   -24.638 -60.488 1.00 49.85 ? 14   DT  D C5    1 
ATOM   586  C C7    . DT  B 2 14  ? 6.374   -23.316 -61.179 1.00 49.85 ? 14   DT  D C7    1 
ATOM   587  C C6    . DT  B 2 14  ? 7.138   -25.142 -59.685 1.00 49.85 ? 14   DT  D C6    1 
ATOM   588  P P     . DG  B 2 15  ? 12.943  -27.061 -58.749 1.00 49.85 ? 15   DG  D P     1 
ATOM   589  O OP1   . DG  B 2 15  ? 14.151  -27.284 -57.923 1.00 49.85 ? 15   DG  D OP1   1 
ATOM   590  O OP2   . DG  B 2 15  ? 12.881  -25.904 -59.674 1.00 49.85 ? 15   DG  D OP2   1 
ATOM   591  O "O5'" . DG  B 2 15  ? 12.647  -28.373 -59.609 1.00 49.85 ? 15   DG  D "O5'" 1 
ATOM   592  C "C5'" . DG  B 2 15  ? 12.604  -29.663 -59.005 1.00 49.85 ? 15   DG  D "C5'" 1 
ATOM   593  C "C4'" . DG  B 2 15  ? 11.879  -30.631 -59.919 1.00 49.85 ? 15   DG  D "C4'" 1 
ATOM   594  O "O4'" . DG  B 2 15  ? 10.536  -30.138 -60.121 1.00 49.85 ? 15   DG  D "O4'" 1 
ATOM   595  C "C3'" . DG  B 2 15  ? 12.481  -30.760 -61.315 1.00 49.85 ? 15   DG  D "C3'" 1 
ATOM   596  O "O3'" . DG  B 2 15  ? 13.306  -31.922 -61.385 1.00 49.85 ? 15   DG  D "O3'" 1 
ATOM   597  C "C2'" . DG  B 2 15  ? 11.281  -30.852 -62.260 1.00 49.85 ? 15   DG  D "C2'" 1 
ATOM   598  C "C1'" . DG  B 2 15  ? 10.063  -30.568 -61.379 1.00 49.85 ? 15   DG  D "C1'" 1 
ATOM   599  N N9    . DG  B 2 15  ? 9.156   -29.542 -61.901 1.00 49.85 ? 15   DG  D N9    1 
ATOM   600  C C8    . DG  B 2 15  ? 9.486   -28.269 -62.305 1.00 49.85 ? 15   DG  D C8    1 
ATOM   601  N N7    . DG  B 2 15  ? 8.466   -27.574 -62.726 1.00 49.85 ? 15   DG  D N7    1 
ATOM   602  C C5    . DG  B 2 15  ? 7.386   -28.437 -62.595 1.00 49.85 ? 15   DG  D C5    1 
ATOM   603  C C6    . DG  B 2 15  ? 6.012   -28.240 -62.897 1.00 49.85 ? 15   DG  D C6    1 
ATOM   604  O O6    . DG  B 2 15  ? 5.468   -27.225 -63.354 1.00 49.85 ? 15   DG  D O6    1 
ATOM   605  N N1    . DG  B 2 15  ? 5.242   -29.372 -62.617 1.00 49.85 ? 15   DG  D N1    1 
ATOM   606  C C2    . DG  B 2 15  ? 5.742   -30.549 -62.108 1.00 49.85 ? 15   DG  D C2    1 
ATOM   607  N N2    . DG  B 2 15  ? 4.855   -31.531 -61.903 1.00 49.85 ? 15   DG  D N2    1 
ATOM   608  N N3    . DG  B 2 15  ? 7.026   -30.747 -61.822 1.00 49.85 ? 15   DG  D N3    1 
ATOM   609  C C4    . DG  B 2 15  ? 7.793   -29.655 -62.088 1.00 49.85 ? 15   DG  D C4    1 
ATOM   610  N N     . GLN C 3 27  ? 24.923  34.744  -41.772 1.00 49.85 ? 4    GLN A N     1 
ATOM   611  C CA    . GLN C 3 27  ? 24.425  35.052  -43.144 1.00 49.85 ? 4    GLN A CA    1 
ATOM   612  C C     . GLN C 3 27  ? 24.911  33.987  -44.128 1.00 49.85 ? 4    GLN A C     1 
ATOM   613  O O     . GLN C 3 27  ? 25.875  34.198  -44.871 1.00 49.85 ? 4    GLN A O     1 
ATOM   614  C CB    . GLN C 3 27  ? 24.887  36.448  -43.575 1.00 49.85 ? 4    GLN A CB    1 
ATOM   615  C CG    . GLN C 3 27  ? 23.848  37.226  -44.367 1.00 49.85 ? 4    GLN A CG    1 
ATOM   616  C CD    . GLN C 3 27  ? 22.649  37.626  -43.522 1.00 49.85 ? 4    GLN A CD    1 
ATOM   617  O OE1   . GLN C 3 27  ? 22.798  38.151  -42.417 1.00 49.85 ? 4    GLN A OE1   1 
ATOM   618  N NE2   . GLN C 3 27  ? 21.452  37.378  -44.041 1.00 49.85 ? 4    GLN A NE2   1 
ATOM   619  N N     . ARG C 3 28  ? 24.229  32.841  -44.121 1.00 49.85 ? 5    ARG A N     1 
ATOM   620  C CA    . ARG C 3 28  ? 24.692  31.636  -44.820 1.00 49.85 ? 5    ARG A CA    1 
ATOM   621  C C     . ARG C 3 28  ? 23.544  30.736  -45.289 1.00 49.85 ? 5    ARG A C     1 
ATOM   622  O O     . ARG C 3 28  ? 22.379  30.980  -44.964 1.00 49.85 ? 5    ARG A O     1 
ATOM   623  C CB    . ARG C 3 28  ? 25.655  30.844  -43.925 1.00 49.85 ? 5    ARG A CB    1 
ATOM   624  C CG    . ARG C 3 28  ? 25.395  31.010  -42.431 1.00 49.85 ? 5    ARG A CG    1 
ATOM   625  C CD    . ARG C 3 28  ? 26.305  30.146  -41.586 1.00 49.85 ? 5    ARG A CD    1 
ATOM   626  N NE    . ARG C 3 28  ? 26.653  30.799  -40.326 1.00 49.85 ? 5    ARG A NE    1 
ATOM   627  C CZ    . ARG C 3 28  ? 26.874  30.162  -39.179 1.00 49.85 ? 5    ARG A CZ    1 
ATOM   628  N NH1   . ARG C 3 28  ? 26.781  28.839  -39.112 1.00 49.85 ? 5    ARG A NH1   1 
ATOM   629  N NH2   . ARG C 3 28  ? 27.185  30.855  -38.091 1.00 49.85 ? 5    ARG A NH2   1 
ATOM   630  N N     . SER C 3 29  ? 23.888  29.698  -46.054 1.00 49.85 ? 6    SER A N     1 
ATOM   631  C CA    . SER C 3 29  ? 22.908  28.742  -46.581 1.00 49.85 ? 6    SER A CA    1 
ATOM   632  C C     . SER C 3 29  ? 22.456  27.731  -45.521 1.00 49.85 ? 6    SER A C     1 
ATOM   633  O O     . SER C 3 29  ? 23.058  27.634  -44.448 1.00 49.85 ? 6    SER A O     1 
ATOM   634  C CB    . SER C 3 29  ? 23.460  28.020  -47.817 1.00 49.85 ? 6    SER A CB    1 
ATOM   635  O OG    . SER C 3 29  ? 24.541  27.166  -47.482 1.00 49.85 ? 6    SER A OG    1 
ATOM   636  N N     . THR C 3 30  ? 21.399  26.983  -45.834 1.00 49.85 ? 7    THR A N     1 
ATOM   637  C CA    . THR C 3 30  ? 20.747  26.107  -44.863 1.00 49.85 ? 7    THR A CA    1 
ATOM   638  C C     . THR C 3 30  ? 20.630  24.657  -45.341 1.00 49.85 ? 7    THR A C     1 
ATOM   639  O O     . THR C 3 30  ? 20.238  24.397  -46.479 1.00 49.85 ? 7    THR A O     1 
ATOM   640  C CB    . THR C 3 30  ? 19.346  26.664  -44.478 1.00 49.85 ? 7    THR A CB    1 
ATOM   641  O OG1   . THR C 3 30  ? 19.505  27.832  -43.665 1.00 49.85 ? 7    THR A OG1   1 
ATOM   642  C CG2   . THR C 3 30  ? 18.521  25.644  -43.709 1.00 49.85 ? 7    THR A CG2   1 
ATOM   643  N N     . LEU C 3 31  ? 20.977  23.725  -44.455 1.00 49.85 ? 8    LEU A N     1 
ATOM   644  C CA    . LEU C 3 31  ? 20.719  22.303  -44.668 1.00 49.85 ? 8    LEU A CA    1 
ATOM   645  C C     . LEU C 3 31  ? 19.412  21.914  -43.983 1.00 49.85 ? 8    LEU A C     1 
ATOM   646  O O     . LEU C 3 31  ? 19.096  22.413  -42.900 1.00 49.85 ? 8    LEU A O     1 
ATOM   647  C CB    . LEU C 3 31  ? 21.869  21.449  -44.128 1.00 49.85 ? 8    LEU A CB    1 
ATOM   648  C CG    . LEU C 3 31  ? 23.289  21.703  -44.644 1.00 49.85 ? 8    LEU A CG    1 
ATOM   649  C CD1   . LEU C 3 31  ? 24.294  20.876  -43.854 1.00 49.85 ? 8    LEU A CD1   1 
ATOM   650  C CD2   . LEU C 3 31  ? 23.416  21.422  -46.140 1.00 49.85 ? 8    LEU A CD2   1 
ATOM   651  N N     . VAL C 3 32  ? 18.658  21.021  -44.618 1.00 49.85 ? 9    VAL A N     1 
ATOM   652  C CA    . VAL C 3 32  ? 17.335  20.639  -44.131 1.00 49.85 ? 9    VAL A CA    1 
ATOM   653  C C     . VAL C 3 32  ? 17.152  19.124  -44.122 1.00 49.85 ? 9    VAL A C     1 
ATOM   654  O O     . VAL C 3 32  ? 17.388  18.455  -45.130 1.00 49.85 ? 9    VAL A O     1 
ATOM   655  C CB    . VAL C 3 32  ? 16.209  21.302  -44.981 1.00 49.85 ? 9    VAL A CB    1 
ATOM   656  C CG1   . VAL C 3 32  ? 14.846  20.672  -44.696 1.00 49.85 ? 9    VAL A CG1   1 
ATOM   657  C CG2   . VAL C 3 32  ? 16.160  22.808  -44.739 1.00 49.85 ? 9    VAL A CG2   1 
ATOM   658  N N     . HIS C 3 33  ? 16.735  18.590  -42.976 1.00 49.85 ? 10   HIS A N     1 
ATOM   659  C CA    . HIS C 3 33  ? 16.208  17.232  -42.916 1.00 49.85 ? 10   HIS A CA    1 
ATOM   660  C C     . HIS C 3 33  ? 14.700  17.295  -42.737 1.00 49.85 ? 10   HIS A C     1 
ATOM   661  O O     . HIS C 3 33  ? 14.196  18.023  -41.877 1.00 49.85 ? 10   HIS A O     1 
ATOM   662  C CB    . HIS C 3 33  ? 16.840  16.414  -41.791 1.00 49.85 ? 10   HIS A CB    1 
ATOM   663  C CG    . HIS C 3 33  ? 16.234  15.053  -41.633 1.00 49.85 ? 10   HIS A CG    1 
ATOM   664  N ND1   . HIS C 3 33  ? 16.506  14.011  -42.495 1.00 49.85 ? 10   HIS A ND1   1 
ATOM   665  C CD2   . HIS C 3 33  ? 15.365  14.565  -40.717 1.00 49.85 ? 10   HIS A CD2   1 
ATOM   666  C CE1   . HIS C 3 33  ? 15.832  12.940  -42.114 1.00 49.85 ? 10   HIS A CE1   1 
ATOM   667  N NE2   . HIS C 3 33  ? 15.132  13.249  -41.038 1.00 49.85 ? 10   HIS A NE2   1 
ATOM   668  N N     . TRP C 3 34  ? 13.987  16.527  -43.554 1.00 49.85 ? 11   TRP A N     1 
ATOM   669  C CA    . TRP C 3 34  ? 12.533  16.540  -43.540 1.00 49.85 ? 11   TRP A CA    1 
ATOM   670  C C     . TRP C 3 34  ? 11.974  15.239  -42.975 1.00 49.85 ? 11   TRP A C     1 
ATOM   671  O O     . TRP C 3 34  ? 12.116  14.171  -43.572 1.00 49.85 ? 11   TRP A O     1 
ATOM   672  C CB    . TRP C 3 34  ? 11.990  16.837  -44.944 1.00 49.85 ? 11   TRP A CB    1 
ATOM   673  C CG    . TRP C 3 34  ? 10.489  16.848  -45.058 1.00 49.85 ? 11   TRP A CG    1 
ATOM   674  C CD1   . TRP C 3 34  ? 9.586   17.161  -44.080 1.00 49.85 ? 11   TRP A CD1   1 
ATOM   675  C CD2   . TRP C 3 34  ? 9.721   16.536  -46.227 1.00 49.85 ? 11   TRP A CD2   1 
ATOM   676  N NE1   . TRP C 3 34  ? 8.305   17.058  -44.566 1.00 49.85 ? 11   TRP A NE1   1 
ATOM   677  C CE2   . TRP C 3 34  ? 8.358   16.677  -45.881 1.00 49.85 ? 11   TRP A CE2   1 
ATOM   678  C CE3   . TRP C 3 34  ? 10.051  16.148  -47.533 1.00 49.85 ? 11   TRP A CE3   1 
ATOM   679  C CZ2   . TRP C 3 34  ? 7.325   16.445  -46.795 1.00 49.85 ? 11   TRP A CZ2   1 
ATOM   680  C CZ3   . TRP C 3 34  ? 9.024   15.918  -48.440 1.00 49.85 ? 11   TRP A CZ3   1 
ATOM   681  C CH2   . TRP C 3 34  ? 7.677   16.067  -48.065 1.00 49.85 ? 11   TRP A CH2   1 
ATOM   682  N N     . PHE C 3 35  ? 11.340  15.352  -41.811 1.00 49.85 ? 12   PHE A N     1 
ATOM   683  C CA    . PHE C 3 35  ? 10.703  14.221  -41.154 1.00 49.85 ? 12   PHE A CA    1 
ATOM   684  C C     . PHE C 3 35  ? 9.320   13.978  -41.734 1.00 49.85 ? 12   PHE A C     1 
ATOM   685  O O     . PHE C 3 35  ? 8.554   14.919  -41.960 1.00 49.85 ? 12   PHE A O     1 
ATOM   686  C CB    . PHE C 3 35  ? 10.570  14.470  -39.648 1.00 49.85 ? 12   PHE A CB    1 
ATOM   687  C CG    . PHE C 3 35  ? 11.875  14.479  -38.904 1.00 49.85 ? 12   PHE A CG    1 
ATOM   688  C CD1   . PHE C 3 35  ? 12.515  13.287  -38.579 1.00 49.85 ? 12   PHE A CD1   1 
ATOM   689  C CD2   . PHE C 3 35  ? 12.461  15.679  -38.521 1.00 49.85 ? 12   PHE A CD2   1 
ATOM   690  C CE1   . PHE C 3 35  ? 13.721  13.292  -37.887 1.00 49.85 ? 12   PHE A CE1   1 
ATOM   691  C CE2   . PHE C 3 35  ? 13.666  15.695  -37.830 1.00 49.85 ? 12   PHE A CE2   1 
ATOM   692  C CZ    . PHE C 3 35  ? 14.297  14.499  -37.512 1.00 49.85 ? 12   PHE A CZ    1 
ATOM   693  N N     . ARG C 3 36  ? 9.014   12.708  -41.975 1.00 49.85 ? 13   ARG A N     1 
ATOM   694  C CA    . ARG C 3 36  ? 7.659   12.264  -42.285 1.00 49.85 ? 13   ARG A CA    1 
ATOM   695  C C     . ARG C 3 36  ? 7.473   10.967  -41.511 1.00 49.85 ? 13   ARG A C     1 
ATOM   696  O O     . ARG C 3 36  ? 6.840   10.948  -40.454 1.00 49.85 ? 13   ARG A O     1 
ATOM   697  C CB    . ARG C 3 36  ? 7.460   12.037  -43.789 1.00 49.85 ? 13   ARG A CB    1 
ATOM   698  C CG    . ARG C 3 36  ? 7.781   13.231  -44.689 1.00 49.85 ? 13   ARG A CG    1 
ATOM   699  C CD    . ARG C 3 36  ? 9.188   13.134  -45.279 1.00 49.85 ? 13   ARG A CD    1 
ATOM   700  N NE    . ARG C 3 36  ? 9.371   11.911  -46.060 1.00 49.85 ? 13   ARG A NE    1 
ATOM   701  C CZ    . ARG C 3 36  ? 9.012   11.765  -47.334 1.00 49.85 ? 13   ARG A CZ    1 
ATOM   702  N NH1   . ARG C 3 36  ? 8.445   12.767  -47.993 1.00 49.85 ? 13   ARG A NH1   1 
ATOM   703  N NH2   . ARG C 3 36  ? 9.221   10.611  -47.952 1.00 49.85 ? 13   ARG A NH2   1 
ATOM   704  N N     . LYS C 3 37  ? 8.033   9.888   -42.050 1.00 49.85 ? 14   LYS A N     1 
ATOM   705  C CA    . LYS C 3 37  ? 8.298   8.684   -41.279 1.00 49.85 ? 14   LYS A CA    1 
ATOM   706  C C     . LYS C 3 37  ? 9.744   8.782   -40.807 1.00 49.85 ? 14   LYS A C     1 
ATOM   707  O O     . LYS C 3 37  ? 10.481  9.670   -41.246 1.00 49.85 ? 14   LYS A O     1 
ATOM   708  C CB    . LYS C 3 37  ? 8.085   7.430   -42.129 1.00 49.85 ? 14   LYS A CB    1 
ATOM   709  C CG    . LYS C 3 37  ? 6.625   7.053   -42.328 1.00 49.85 ? 14   LYS A CG    1 
ATOM   710  C CD    . LYS C 3 37  ? 6.496   5.786   -43.157 1.00 49.85 ? 14   LYS A CD    1 
ATOM   711  C CE    . LYS C 3 37  ? 5.047   5.342   -43.281 1.00 49.85 ? 14   LYS A CE    1 
ATOM   712  N NZ    . LYS C 3 37  ? 4.916   4.097   -44.089 1.00 49.85 ? 14   LYS A NZ    1 
ATOM   713  N N     . GLY C 3 38  ? 10.151  7.881   -39.918 1.00 49.85 ? 15   GLY A N     1 
ATOM   714  C CA    . GLY C 3 38  ? 11.497  7.926   -39.355 1.00 49.85 ? 15   GLY A CA    1 
ATOM   715  C C     . GLY C 3 38  ? 11.650  9.100   -38.407 1.00 49.85 ? 15   GLY A C     1 
ATOM   716  O O     . GLY C 3 38  ? 12.486  9.982   -38.618 1.00 49.85 ? 15   GLY A O     1 
ATOM   717  N N     . LEU C 3 39  ? 10.831  9.101   -37.361 1.00 49.85 ? 16   LEU A N     1 
ATOM   718  C CA    . LEU C 3 39  ? 10.856  10.138  -36.337 1.00 49.85 ? 16   LEU A CA    1 
ATOM   719  C C     . LEU C 3 39  ? 11.798  9.726   -35.206 1.00 49.85 ? 16   LEU A C     1 
ATOM   720  O O     . LEU C 3 39  ? 11.368  9.469   -34.076 1.00 49.85 ? 16   LEU A O     1 
ATOM   721  C CB    . LEU C 3 39  ? 9.439   10.391  -35.814 1.00 49.85 ? 16   LEU A CB    1 
ATOM   722  C CG    . LEU C 3 39  ? 8.407   10.887  -36.832 1.00 49.85 ? 16   LEU A CG    1 
ATOM   723  C CD1   . LEU C 3 39  ? 7.014   10.386  -36.491 1.00 49.85 ? 16   LEU A CD1   1 
ATOM   724  C CD2   . LEU C 3 39  ? 8.428   12.405  -36.937 1.00 49.85 ? 16   LEU A CD2   1 
ATOM   725  N N     . ARG C 3 40  ? 13.089  9.667   -35.528 1.00 49.85 ? 17   ARG A N     1 
ATOM   726  C CA    . ARG C 3 40  ? 14.116  9.199   -34.598 1.00 49.85 ? 17   ARG A CA    1 
ATOM   727  C C     . ARG C 3 40  ? 15.475  9.847   -34.868 1.00 49.85 ? 17   ARG A C     1 
ATOM   728  O O     . ARG C 3 40  ? 15.689  10.438  -35.929 1.00 49.85 ? 17   ARG A O     1 
ATOM   729  C CB    . ARG C 3 40  ? 14.238  7.673   -34.674 1.00 49.85 ? 17   ARG A CB    1 
ATOM   730  C CG    . ARG C 3 40  ? 14.661  7.144   -36.040 1.00 49.85 ? 17   ARG A CG    1 
ATOM   731  C CD    . ARG C 3 40  ? 14.657  5.626   -36.077 1.00 49.85 ? 17   ARG A CD    1 
ATOM   732  N NE    . ARG C 3 40  ? 15.130  5.119   -37.363 1.00 49.85 ? 17   ARG A NE    1 
ATOM   733  C CZ    . ARG C 3 40  ? 14.344  4.828   -38.396 1.00 49.85 ? 17   ARG A CZ    1 
ATOM   734  N NH1   . ARG C 3 40  ? 13.031  4.990   -38.311 1.00 49.85 ? 17   ARG A NH1   1 
ATOM   735  N NH2   . ARG C 3 40  ? 14.876  4.372   -39.522 1.00 49.85 ? 17   ARG A NH2   1 
ATOM   736  N N     . LEU C 3 41  ? 16.385  9.733   -33.903 1.00 49.85 ? 18   LEU A N     1 
ATOM   737  C CA    . LEU C 3 41  ? 17.771  10.161  -34.085 1.00 49.85 ? 18   LEU A CA    1 
ATOM   738  C C     . LEU C 3 41  ? 18.654  8.978   -34.467 1.00 49.85 ? 18   LEU A C     1 
ATOM   739  O O     . LEU C 3 41  ? 19.480  9.080   -35.377 1.00 49.85 ? 18   LEU A O     1 
ATOM   740  C CB    . LEU C 3 41  ? 18.326  10.820  -32.818 1.00 49.85 ? 18   LEU A CB    1 
ATOM   741  C CG    . LEU C 3 41  ? 17.743  12.117  -32.254 1.00 49.85 ? 18   LEU A CG    1 
ATOM   742  C CD1   . LEU C 3 41  ? 18.546  12.523  -31.034 1.00 49.85 ? 18   LEU A CD1   1 
ATOM   743  C CD2   . LEU C 3 41  ? 17.740  13.237  -33.276 1.00 49.85 ? 18   LEU A CD2   1 
ATOM   744  N N     . HIS C 3 42  ? 18.475  7.859   -33.765 1.00 49.85 ? 19   HIS A N     1 
ATOM   745  C CA    . HIS C 3 42  ? 19.260  6.652   -34.005 1.00 49.85 ? 19   HIS A CA    1 
ATOM   746  C C     . HIS C 3 42  ? 18.953  6.060   -35.377 1.00 49.85 ? 19   HIS A C     1 
ATOM   747  O O     . HIS C 3 42  ? 17.814  6.115   -35.841 1.00 49.85 ? 19   HIS A O     1 
ATOM   748  C CB    . HIS C 3 42  ? 19.024  5.614   -32.899 1.00 49.85 ? 19   HIS A CB    1 
ATOM   749  C CG    . HIS C 3 42  ? 17.703  4.915   -32.987 1.00 49.85 ? 19   HIS A CG    1 
ATOM   750  N ND1   . HIS C 3 42  ? 16.562  5.399   -32.385 1.00 49.85 ? 19   HIS A ND1   1 
ATOM   751  C CD2   . HIS C 3 42  ? 17.341  3.767   -33.607 1.00 49.85 ? 19   HIS A CD2   1 
ATOM   752  C CE1   . HIS C 3 42  ? 15.555  4.580   -32.630 1.00 49.85 ? 19   HIS A CE1   1 
ATOM   753  N NE2   . HIS C 3 42  ? 16.001  3.582   -33.369 1.00 49.85 ? 19   HIS A NE2   1 
ATOM   754  N N     . ASP C 3 43  ? 19.980  5.501   -36.013 1.00 49.85 ? 20   ASP A N     1 
ATOM   755  C CA    . ASP C 3 43  ? 19.873  4.898   -37.345 1.00 49.85 ? 20   ASP A CA    1 
ATOM   756  C C     . ASP C 3 43  ? 19.015  5.725   -38.308 1.00 49.85 ? 20   ASP A C     1 
ATOM   757  O O     . ASP C 3 43  ? 18.049  5.229   -38.893 1.00 49.85 ? 20   ASP A O     1 
ATOM   758  C CB    . ASP C 3 43  ? 19.375  3.449   -37.252 1.00 49.85 ? 20   ASP A CB    1 
ATOM   759  C CG    . ASP C 3 43  ? 19.606  2.664   -38.535 1.00 49.85 ? 20   ASP A CG    1 
ATOM   760  O OD1   . ASP C 3 43  ? 20.598  2.932   -39.245 1.00 49.85 ? 20   ASP A OD1   1 
ATOM   761  O OD2   . ASP C 3 43  ? 18.789  1.774   -38.833 1.00 49.85 ? 20   ASP A OD2   1 
ATOM   762  N N     . ASN C 3 44  ? 19.382  6.993   -38.459 1.00 49.85 ? 21   ASN A N     1 
ATOM   763  C CA    . ASN C 3 44  ? 18.759  7.859   -39.448 1.00 49.85 ? 21   ASN A CA    1 
ATOM   764  C C     . ASN C 3 44  ? 19.831  8.437   -40.366 1.00 49.85 ? 21   ASN A C     1 
ATOM   765  O O     . ASN C 3 44  ? 20.349  9.528   -40.110 1.00 49.85 ? 21   ASN A O     1 
ATOM   766  C CB    . ASN C 3 44  ? 17.944  8.968   -38.774 1.00 49.85 ? 21   ASN A CB    1 
ATOM   767  C CG    . ASN C 3 44  ? 16.949  9.625   -39.719 1.00 49.85 ? 21   ASN A CG    1 
ATOM   768  O OD1   . ASN C 3 44  ? 17.017  9.459   -40.938 1.00 49.85 ? 21   ASN A OD1   1 
ATOM   769  N ND2   . ASN C 3 44  ? 16.015  10.379  -39.153 1.00 49.85 ? 21   ASN A ND2   1 
ATOM   770  N N     . PRO C 3 45  ? 20.169  7.700   -41.443 1.00 49.85 ? 22   PRO A N     1 
ATOM   771  C CA    . PRO C 3 45  ? 21.228  8.103   -42.370 1.00 49.85 ? 22   PRO A CA    1 
ATOM   772  C C     . PRO C 3 45  ? 20.913  9.411   -43.093 1.00 49.85 ? 22   PRO A C     1 
ATOM   773  O O     . PRO C 3 45  ? 21.832  10.142  -43.460 1.00 49.85 ? 22   PRO A O     1 
ATOM   774  C CB    . PRO C 3 45  ? 21.294  6.936   -43.363 1.00 49.85 ? 22   PRO A CB    1 
ATOM   775  C CG    . PRO C 3 45  ? 19.971  6.266   -43.265 1.00 49.85 ? 22   PRO A CG    1 
ATOM   776  C CD    . PRO C 3 45  ? 19.549  6.423   -41.842 1.00 49.85 ? 22   PRO A CD    1 
ATOM   777  N N     . ALA C 3 46  ? 19.626  9.691   -43.287 1.00 49.85 ? 23   ALA A N     1 
ATOM   778  C CA    . ALA C 3 46  ? 19.180  10.936  -43.907 1.00 49.85 ? 23   ALA A CA    1 
ATOM   779  C C     . ALA C 3 46  ? 19.427  12.134  -42.994 1.00 49.85 ? 23   ALA A C     1 
ATOM   780  O O     . ALA C 3 46  ? 19.736  13.227  -43.468 1.00 49.85 ? 23   ALA A O     1 
ATOM   781  C CB    . ALA C 3 46  ? 17.709  10.844  -44.287 1.00 49.85 ? 23   ALA A CB    1 
ATOM   782  N N     . LEU C 3 47  ? 19.288  11.915  -41.689 1.00 49.85 ? 24   LEU A N     1 
ATOM   783  C CA    . LEU C 3 47  ? 19.516  12.958  -40.694 1.00 49.85 ? 24   LEU A CA    1 
ATOM   784  C C     . LEU C 3 47  ? 21.000  13.110  -40.372 1.00 49.85 ? 24   LEU A C     1 
ATOM   785  O O     . LEU C 3 47  ? 21.496  14.230  -40.229 1.00 49.85 ? 24   LEU A O     1 
ATOM   786  C CB    . LEU C 3 47  ? 18.718  12.661  -39.421 1.00 49.85 ? 24   LEU A CB    1 
ATOM   787  C CG    . LEU C 3 47  ? 18.804  13.613  -38.224 1.00 49.85 ? 24   LEU A CG    1 
ATOM   788  C CD1   . LEU C 3 47  ? 18.228  14.982  -38.548 1.00 49.85 ? 24   LEU A CD1   1 
ATOM   789  C CD2   . LEU C 3 47  ? 18.086  13.001  -37.036 1.00 49.85 ? 24   LEU A CD2   1 
ATOM   790  N N     . SER C 3 48  ? 21.699  11.981  -40.259 1.00 49.85 ? 25   SER A N     1 
ATOM   791  C CA    . SER C 3 48  ? 23.129  11.971  -39.948 1.00 49.85 ? 25   SER A CA    1 
ATOM   792  C C     . SER C 3 48  ? 23.970  12.593  -41.059 1.00 49.85 ? 25   SER A C     1 
ATOM   793  O O     . SER C 3 48  ? 24.996  13.216  -40.787 1.00 49.85 ? 25   SER A O     1 
ATOM   794  C CB    . SER C 3 48  ? 23.608  10.548  -39.656 1.00 49.85 ? 25   SER A CB    1 
ATOM   795  O OG    . SER C 3 48  ? 23.090  10.083  -38.423 1.00 49.85 ? 25   SER A OG    1 
ATOM   796  N N     . HIS C 3 49  ? 23.527  12.420  -42.305 1.00 49.85 ? 26   HIS A N     1 
ATOM   797  C CA    . HIS C 3 49  ? 24.196  13.006  -43.467 1.00 49.85 ? 26   HIS A CA    1 
ATOM   798  C C     . HIS C 3 49  ? 24.176  14.534  -43.419 1.00 49.85 ? 26   HIS A C     1 
ATOM   799  O O     . HIS C 3 49  ? 25.112  15.184  -43.886 1.00 49.85 ? 26   HIS A O     1 
ATOM   800  C CB    . HIS C 3 49  ? 23.560  12.509  -44.766 1.00 49.85 ? 26   HIS A CB    1 
ATOM   801  C CG    . HIS C 3 49  ? 24.352  12.841  -45.992 1.00 49.85 ? 26   HIS A CG    1 
ATOM   802  N ND1   . HIS C 3 49  ? 25.278  11.977  -46.537 1.00 49.85 ? 26   HIS A ND1   1 
ATOM   803  C CD2   . HIS C 3 49  ? 24.357  13.943  -46.779 1.00 49.85 ? 26   HIS A CD2   1 
ATOM   804  C CE1   . HIS C 3 49  ? 25.819  12.532  -47.607 1.00 49.85 ? 26   HIS A CE1   1 
ATOM   805  N NE2   . HIS C 3 49  ? 25.277  13.725  -47.776 1.00 49.85 ? 26   HIS A NE2   1 
ATOM   806  N N     . ILE C 3 50  ? 23.107  15.094  -42.855 1.00 49.85 ? 27   ILE A N     1 
ATOM   807  C CA    . ILE C 3 50  ? 23.015  16.532  -42.613 1.00 49.85 ? 27   ILE A CA    1 
ATOM   808  C C     . ILE C 3 50  ? 24.002  16.934  -41.519 1.00 49.85 ? 27   ILE A C     1 
ATOM   809  O O     . ILE C 3 50  ? 24.788  17.870  -41.694 1.00 49.85 ? 27   ILE A O     1 
ATOM   810  C CB    . ILE C 3 50  ? 21.569  16.963  -42.216 1.00 49.85 ? 27   ILE A CB    1 
ATOM   811  C CG1   . ILE C 3 50  ? 20.582  16.736  -43.371 1.00 49.85 ? 27   ILE A CG1   1 
ATOM   812  C CG2   . ILE C 3 50  ? 21.530  18.417  -41.723 1.00 49.85 ? 27   ILE A CG2   1 
ATOM   813  C CD1   . ILE C 3 50  ? 20.746  17.667  -44.578 1.00 49.85 ? 27   ILE A CD1   1 
ATOM   814  N N     . PHE C 3 51  ? 23.952  16.214  -40.399 1.00 49.85 ? 28   PHE A N     1 
ATOM   815  C CA    . PHE C 3 51  ? 24.749  16.528  -39.212 1.00 49.85 ? 28   PHE A CA    1 
ATOM   816  C C     . PHE C 3 51  ? 26.258  16.366  -39.402 1.00 49.85 ? 28   PHE A C     1 
ATOM   817  O O     . PHE C 3 51  ? 27.037  17.151  -38.856 1.00 49.85 ? 28   PHE A O     1 
ATOM   818  C CB    . PHE C 3 51  ? 24.261  15.709  -38.012 1.00 49.85 ? 28   PHE A CB    1 
ATOM   819  C CG    . PHE C 3 51  ? 23.144  16.363  -37.248 1.00 49.85 ? 28   PHE A CG    1 
ATOM   820  C CD1   . PHE C 3 51  ? 21.867  16.460  -37.795 1.00 49.85 ? 28   PHE A CD1   1 
ATOM   821  C CD2   . PHE C 3 51  ? 23.369  16.883  -35.978 1.00 49.85 ? 28   PHE A CD2   1 
ATOM   822  C CE1   . PHE C 3 51  ? 20.833  17.067  -37.087 1.00 49.85 ? 28   PHE A CE1   1 
ATOM   823  C CE2   . PHE C 3 51  ? 22.341  17.491  -35.262 1.00 49.85 ? 28   PHE A CE2   1 
ATOM   824  C CZ    . PHE C 3 51  ? 21.071  17.584  -35.817 1.00 49.85 ? 28   PHE A CZ    1 
ATOM   825  N N     . THR C 3 52  ? 26.661  15.357  -40.172 1.00 49.85 ? 29   THR A N     1 
ATOM   826  C CA    . THR C 3 52  ? 28.078  15.138  -40.478 1.00 49.85 ? 29   THR A CA    1 
ATOM   827  C C     . THR C 3 52  ? 28.617  16.201  -41.429 1.00 49.85 ? 29   THR A C     1 
ATOM   828  O O     . THR C 3 52  ? 29.751  16.657  -41.272 1.00 49.85 ? 29   THR A O     1 
ATOM   829  C CB    . THR C 3 52  ? 28.342  13.743  -41.079 1.00 49.85 ? 29   THR A CB    1 
ATOM   830  O OG1   . THR C 3 52  ? 27.378  13.470  -42.104 1.00 49.85 ? 29   THR A OG1   1 
ATOM   831  C CG2   . THR C 3 52  ? 28.263  12.666  -40.002 1.00 49.85 ? 29   THR A CG2   1 
ATOM   832  N N     . ALA C 3 53  ? 27.800  16.589  -42.408 1.00 49.85 ? 30   ALA A N     1 
ATOM   833  C CA    . ALA C 3 53  ? 28.170  17.619  -43.380 1.00 49.85 ? 30   ALA A CA    1 
ATOM   834  C C     . ALA C 3 53  ? 28.260  19.006  -42.744 1.00 49.85 ? 30   ALA A C     1 
ATOM   835  O O     . ALA C 3 53  ? 29.176  19.773  -43.049 1.00 49.85 ? 30   ALA A O     1 
ATOM   836  C CB    . ALA C 3 53  ? 27.192  17.630  -44.546 1.00 49.85 ? 30   ALA A CB    1 
ATOM   837  N N     . ALA C 3 54  ? 27.308  19.316  -41.865 1.00 49.85 ? 31   ALA A N     1 
ATOM   838  C CA    . ALA C 3 54  ? 27.270  20.603  -41.167 1.00 49.85 ? 31   ALA A CA    1 
ATOM   839  C C     . ALA C 3 54  ? 28.463  20.775  -40.229 1.00 49.85 ? 31   ALA A C     1 
ATOM   840  O O     . ALA C 3 54  ? 29.040  21.861  -40.140 1.00 49.85 ? 31   ALA A O     1 
ATOM   841  C CB    . ALA C 3 54  ? 25.964  20.755  -40.404 1.00 49.85 ? 31   ALA A CB    1 
ATOM   842  N N     . ASN C 3 55  ? 28.823  19.698  -39.536 1.00 49.85 ? 32   ASN A N     1 
ATOM   843  C CA    . ASN C 3 55  ? 29.992  19.692  -38.660 1.00 49.85 ? 32   ASN A CA    1 
ATOM   844  C C     . ASN C 3 55  ? 31.312  19.544  -39.419 1.00 49.85 ? 32   ASN A C     1 
ATOM   845  O O     . ASN C 3 55  ? 32.381  19.822  -38.868 1.00 49.85 ? 32   ASN A O     1 
ATOM   846  C CB    . ASN C 3 55  ? 29.861  18.610  -37.581 1.00 49.85 ? 32   ASN A CB    1 
ATOM   847  C CG    . ASN C 3 55  ? 28.975  19.039  -36.420 1.00 49.85 ? 32   ASN A CG    1 
ATOM   848  O OD1   . ASN C 3 55  ? 29.016  20.189  -35.975 1.00 49.85 ? 32   ASN A OD1   1 
ATOM   849  N ND2   . ASN C 3 55  ? 28.169  18.109  -35.921 1.00 49.85 ? 32   ASN A ND2   1 
ATOM   850  N N     . ALA C 3 56  ? 31.234  19.107  -40.677 1.00 49.85 ? 33   ALA A N     1 
ATOM   851  C CA    . ALA C 3 56  ? 32.408  19.034  -41.550 1.00 49.85 ? 33   ALA A CA    1 
ATOM   852  C C     . ALA C 3 56  ? 32.905  20.431  -41.920 1.00 49.85 ? 33   ALA A C     1 
ATOM   853  O O     . ALA C 3 56  ? 34.113  20.663  -42.009 1.00 49.85 ? 33   ALA A O     1 
ATOM   854  C CB    . ALA C 3 56  ? 32.105  18.224  -42.801 1.00 49.85 ? 33   ALA A CB    1 
ATOM   855  N N     . ALA C 3 57  ? 31.968  21.353  -42.133 1.00 49.85 ? 34   ALA A N     1 
ATOM   856  C CA    . ALA C 3 57  ? 32.289  22.757  -42.372 1.00 49.85 ? 34   ALA A CA    1 
ATOM   857  C C     . ALA C 3 57  ? 31.597  23.636  -41.326 1.00 49.85 ? 34   ALA A C     1 
ATOM   858  O O     . ALA C 3 57  ? 30.553  24.233  -41.607 1.00 49.85 ? 34   ALA A O     1 
ATOM   859  C CB    . ALA C 3 57  ? 31.888  23.166  -43.785 1.00 49.85 ? 34   ALA A CB    1 
ATOM   860  N N     . PRO C 3 58  ? 32.177  23.717  -40.111 1.00 49.85 ? 35   PRO A N     1 
ATOM   861  C CA    . PRO C 3 58  ? 31.539  24.415  -38.992 1.00 49.85 ? 35   PRO A CA    1 
ATOM   862  C C     . PRO C 3 58  ? 31.428  25.918  -39.225 1.00 49.85 ? 35   PRO A C     1 
ATOM   863  O O     . PRO C 3 58  ? 32.390  26.548  -39.670 1.00 49.85 ? 35   PRO A O     1 
ATOM   864  C CB    . PRO C 3 58  ? 32.482  24.133  -37.811 1.00 49.85 ? 35   PRO A CB    1 
ATOM   865  C CG    . PRO C 3 58  ? 33.343  22.993  -38.248 1.00 49.85 ? 35   PRO A CG    1 
ATOM   866  C CD    . PRO C 3 58  ? 33.482  23.154  -39.722 1.00 49.85 ? 35   PRO A CD    1 
ATOM   867  N N     . GLY C 3 59  ? 30.257  26.476  -38.925 1.00 49.85 ? 36   GLY A N     1 
ATOM   868  C CA    . GLY C 3 59  ? 30.013  27.912  -39.068 1.00 49.85 ? 36   GLY A CA    1 
ATOM   869  C C     . GLY C 3 59  ? 29.669  28.356  -40.480 1.00 49.85 ? 36   GLY A C     1 
ATOM   870  O O     . GLY C 3 59  ? 29.651  29.554  -40.770 1.00 49.85 ? 36   GLY A O     1 
ATOM   871  N N     . ARG C 3 60  ? 29.393  27.392  -41.356 1.00 49.85 ? 37   ARG A N     1 
ATOM   872  C CA    . ARG C 3 60  ? 29.096  27.670  -42.761 1.00 49.85 ? 37   ARG A CA    1 
ATOM   873  C C     . ARG C 3 60  ? 27.617  27.436  -43.097 1.00 49.85 ? 37   ARG A C     1 
ATOM   874  O O     . ARG C 3 60  ? 27.133  27.881  -44.143 1.00 49.85 ? 37   ARG A O     1 
ATOM   875  C CB    . ARG C 3 60  ? 30.004  26.822  -43.665 1.00 49.85 ? 37   ARG A CB    1 
ATOM   876  C CG    . ARG C 3 60  ? 29.964  27.176  -45.152 1.00 49.85 ? 37   ARG A CG    1 
ATOM   877  C CD    . ARG C 3 60  ? 30.736  26.156  -45.984 1.00 49.85 ? 37   ARG A CD    1 
ATOM   878  N NE    . ARG C 3 60  ? 30.170  25.997  -47.326 1.00 49.85 ? 37   ARG A NE    1 
ATOM   879  C CZ    . ARG C 3 60  ? 30.586  25.106  -48.225 1.00 49.85 ? 37   ARG A CZ    1 
ATOM   880  N NH1   . ARG C 3 60  ? 31.581  24.272  -47.943 1.00 49.85 ? 37   ARG A NH1   1 
ATOM   881  N NH2   . ARG C 3 60  ? 30.002  25.046  -49.414 1.00 49.85 ? 37   ARG A NH2   1 
ATOM   882  N N     . TYR C 3 61  ? 26.904  26.745  -42.207 1.00 49.85 ? 38   TYR A N     1 
ATOM   883  C CA    . TYR C 3 61  ? 25.524  26.330  -42.472 1.00 49.85 ? 38   TYR A CA    1 
ATOM   884  C C     . TYR C 3 61  ? 24.538  26.601  -41.330 1.00 49.85 ? 38   TYR A C     1 
ATOM   885  O O     . TYR C 3 61  ? 24.933  26.895  -40.200 1.00 49.85 ? 38   TYR A O     1 
ATOM   886  C CB    . TYR C 3 61  ? 25.488  24.839  -42.828 1.00 49.85 ? 38   TYR A CB    1 
ATOM   887  C CG    . TYR C 3 61  ? 26.136  24.493  -44.149 1.00 49.85 ? 38   TYR A CG    1 
ATOM   888  C CD1   . TYR C 3 61  ? 25.410  24.551  -45.339 1.00 49.85 ? 38   TYR A CD1   1 
ATOM   889  C CD2   . TYR C 3 61  ? 27.476  24.104  -44.212 1.00 49.85 ? 38   TYR A CD2   1 
ATOM   890  C CE1   . TYR C 3 61  ? 25.999  24.232  -46.559 1.00 49.85 ? 38   TYR A CE1   1 
ATOM   891  C CE2   . TYR C 3 61  ? 28.075  23.783  -45.430 1.00 49.85 ? 38   TYR A CE2   1 
ATOM   892  C CZ    . TYR C 3 61  ? 27.330  23.850  -46.598 1.00 49.85 ? 38   TYR A CZ    1 
ATOM   893  O OH    . TYR C 3 61  ? 27.911  23.535  -47.804 1.00 49.85 ? 38   TYR A OH    1 
ATOM   894  N N     . PHE C 3 62  ? 23.250  26.498  -41.657 1.00 49.85 ? 39   PHE A N     1 
ATOM   895  C CA    . PHE C 3 62  ? 22.173  26.426  -40.672 1.00 49.85 ? 39   PHE A CA    1 
ATOM   896  C C     . PHE C 3 62  ? 21.421  25.108  -40.859 1.00 49.85 ? 39   PHE A C     1 
ATOM   897  O O     . PHE C 3 62  ? 21.204  24.667  -41.988 1.00 49.85 ? 39   PHE A O     1 
ATOM   898  C CB    . PHE C 3 62  ? 21.204  27.603  -40.818 1.00 49.85 ? 39   PHE A CB    1 
ATOM   899  C CG    . PHE C 3 62  ? 21.706  28.889  -40.220 1.00 49.85 ? 39   PHE A CG    1 
ATOM   900  C CD1   . PHE C 3 62  ? 21.905  29.005  -38.846 1.00 49.85 ? 39   PHE A CD1   1 
ATOM   901  C CD2   . PHE C 3 62  ? 21.975  29.987  -41.030 1.00 49.85 ? 39   PHE A CD2   1 
ATOM   902  C CE1   . PHE C 3 62  ? 22.368  30.196  -38.289 1.00 49.85 ? 39   PHE A CE1   1 
ATOM   903  C CE2   . PHE C 3 62  ? 22.438  31.182  -40.481 1.00 49.85 ? 39   PHE A CE2   1 
ATOM   904  C CZ    . PHE C 3 62  ? 22.635  31.285  -39.108 1.00 49.85 ? 39   PHE A CZ    1 
ATOM   905  N N     . VAL C 3 63  ? 21.025  24.483  -39.753 1.00 49.85 ? 40   VAL A N     1 
ATOM   906  C CA    . VAL C 3 63  ? 20.321  23.201  -39.808 1.00 49.85 ? 40   VAL A CA    1 
ATOM   907  C C     . VAL C 3 63  ? 18.856  23.362  -39.406 1.00 49.85 ? 40   VAL A C     1 
ATOM   908  O O     . VAL C 3 63  ? 18.549  23.911  -38.346 1.00 49.85 ? 40   VAL A O     1 
ATOM   909  C CB    . VAL C 3 63  ? 21.015  22.122  -38.933 1.00 49.85 ? 40   VAL A CB    1 
ATOM   910  C CG1   . VAL C 3 63  ? 20.248  20.804  -38.977 1.00 49.85 ? 40   VAL A CG1   1 
ATOM   911  C CG2   . VAL C 3 63  ? 22.449  21.905  -39.391 1.00 49.85 ? 40   VAL A CG2   1 
ATOM   912  N N     . ARG C 3 64  ? 17.962  22.878  -40.266 1.00 49.85 ? 41   ARG A N     1 
ATOM   913  C CA    . ARG C 3 64  ? 16.524  22.921  -40.009 1.00 49.85 ? 41   ARG A CA    1 
ATOM   914  C C     . ARG C 3 64  ? 15.908  21.519  -40.056 1.00 49.85 ? 41   ARG A C     1 
ATOM   915  O O     . ARG C 3 64  ? 15.416  21.094  -41.105 1.00 49.85 ? 41   ARG A O     1 
ATOM   916  C CB    . ARG C 3 64  ? 15.819  23.843  -41.013 1.00 49.85 ? 41   ARG A CB    1 
ATOM   917  C CG    . ARG C 3 64  ? 16.166  25.323  -40.896 1.00 49.85 ? 41   ARG A CG    1 
ATOM   918  C CD    . ARG C 3 64  ? 15.224  26.063  -39.961 1.00 49.85 ? 41   ARG A CD    1 
ATOM   919  N NE    . ARG C 3 64  ? 15.399  27.512  -40.056 1.00 49.85 ? 41   ARG A NE    1 
ATOM   920  C CZ    . ARG C 3 64  ? 14.652  28.411  -39.419 1.00 49.85 ? 41   ARG A CZ    1 
ATOM   921  N NH1   . ARG C 3 64  ? 13.661  28.029  -38.625 1.00 49.85 ? 41   ARG A NH1   1 
ATOM   922  N NH2   . ARG C 3 64  ? 14.897  29.704  -39.578 1.00 49.85 ? 41   ARG A NH2   1 
ATOM   923  N N     . PRO C 3 65  ? 15.937  20.792  -38.921 1.00 49.85 ? 42   PRO A N     1 
ATOM   924  C CA    . PRO C 3 65  ? 15.208  19.531  -38.839 1.00 49.85 ? 42   PRO A CA    1 
ATOM   925  C C     . PRO C 3 65  ? 13.718  19.830  -38.767 1.00 49.85 ? 42   PRO A C     1 
ATOM   926  O O     . PRO C 3 65  ? 13.221  20.286  -37.734 1.00 49.85 ? 42   PRO A O     1 
ATOM   927  C CB    . PRO C 3 65  ? 15.704  18.914  -37.522 1.00 49.85 ? 42   PRO A CB    1 
ATOM   928  C CG    . PRO C 3 65  ? 16.893  19.732  -37.110 1.00 49.85 ? 42   PRO A CG    1 
ATOM   929  C CD    . PRO C 3 65  ? 16.641  21.090  -37.663 1.00 49.85 ? 42   PRO A CD    1 
ATOM   930  N N     . ILE C 3 66  ? 13.017  19.577  -39.867 1.00 49.85 ? 43   ILE A N     1 
ATOM   931  C CA    . ILE C 3 66  ? 11.622  19.990  -39.991 1.00 49.85 ? 43   ILE A CA    1 
ATOM   932  C C     . ILE C 3 66  ? 10.641  18.828  -40.081 1.00 49.85 ? 43   ILE A C     1 
ATOM   933  O O     . ILE C 3 66  ? 10.962  17.758  -40.598 1.00 49.85 ? 43   ILE A O     1 
ATOM   934  C CB    . ILE C 3 66  ? 11.394  20.950  -41.198 1.00 49.85 ? 43   ILE A CB    1 
ATOM   935  C CG1   . ILE C 3 66  ? 11.763  20.271  -42.524 1.00 49.85 ? 43   ILE A CG1   1 
ATOM   936  C CG2   . ILE C 3 66  ? 12.163  22.260  -41.002 1.00 49.85 ? 43   ILE A CG2   1 
ATOM   937  C CD1   . ILE C 3 66  ? 11.016  20.815  -43.727 1.00 49.85 ? 43   ILE A CD1   1 
ATOM   938  N N     . PHE C 3 67  ? 9.441   19.062  -39.564 1.00 49.85 ? 44   PHE A N     1 
ATOM   939  C CA    . PHE C 3 67  ? 8.322   18.162  -39.757 1.00 49.85 ? 44   PHE A CA    1 
ATOM   940  C C     . PHE C 3 67  ? 7.153   18.993  -40.259 1.00 49.85 ? 44   PHE A C     1 
ATOM   941  O O     . PHE C 3 67  ? 6.624   19.838  -39.534 1.00 49.85 ? 44   PHE A O     1 
ATOM   942  C CB    . PHE C 3 67  ? 7.963   17.448  -38.452 1.00 49.85 ? 44   PHE A CB    1 
ATOM   943  C CG    . PHE C 3 67  ? 6.834   16.464  -38.587 1.00 49.85 ? 44   PHE A CG    1 
ATOM   944  C CD1   . PHE C 3 67  ? 7.077   15.161  -39.004 1.00 49.85 ? 44   PHE A CD1   1 
ATOM   945  C CD2   . PHE C 3 67  ? 5.528   16.840  -38.295 1.00 49.85 ? 44   PHE A CD2   1 
ATOM   946  C CE1   . PHE C 3 67  ? 6.038   14.245  -39.130 1.00 49.85 ? 44   PHE A CE1   1 
ATOM   947  C CE2   . PHE C 3 67  ? 4.483   15.932  -38.417 1.00 49.85 ? 44   PHE A CE2   1 
ATOM   948  C CZ    . PHE C 3 67  ? 4.740   14.632  -38.836 1.00 49.85 ? 44   PHE A CZ    1 
ATOM   949  N N     . ILE C 3 68  ? 6.758   18.750  -41.504 1.00 49.85 ? 45   ILE A N     1 
ATOM   950  C CA    . ILE C 3 68  ? 5.655   19.482  -42.112 1.00 49.85 ? 45   ILE A CA    1 
ATOM   951  C C     . ILE C 3 68  ? 4.327   18.902  -41.637 1.00 49.85 ? 45   ILE A C     1 
ATOM   952  O O     . ILE C 3 68  ? 3.973   17.775  -41.986 1.00 49.85 ? 45   ILE A O     1 
ATOM   953  C CB    . ILE C 3 68  ? 5.747   19.479  -43.659 1.00 49.85 ? 45   ILE A CB    1 
ATOM   954  C CG1   . ILE C 3 68  ? 6.988   20.258  -44.112 1.00 49.85 ? 45   ILE A CG1   1 
ATOM   955  C CG2   . ILE C 3 68  ? 4.485   20.074  -44.282 1.00 49.85 ? 45   ILE A CG2   1 
ATOM   956  C CD1   . ILE C 3 68  ? 7.264   20.192  -45.599 1.00 49.85 ? 45   ILE A CD1   1 
ATOM   957  N N     . LEU C 3 69  ? 3.600   19.679  -40.837 1.00 49.85 ? 46   LEU A N     1 
ATOM   958  C CA    . LEU C 3 69  ? 2.280   19.282  -40.365 1.00 49.85 ? 46   LEU A CA    1 
ATOM   959  C C     . LEU C 3 69  ? 1.299   19.448  -41.520 1.00 49.85 ? 46   LEU A C     1 
ATOM   960  O O     . LEU C 3 69  ? 0.588   20.451  -41.615 1.00 49.85 ? 46   LEU A O     1 
ATOM   961  C CB    . LEU C 3 69  ? 1.857   20.120  -39.152 1.00 49.85 ? 46   LEU A CB    1 
ATOM   962  C CG    . LEU C 3 69  ? 1.051   19.451  -38.029 1.00 49.85 ? 46   LEU A CG    1 
ATOM   963  C CD1   . LEU C 3 69  ? 0.919   20.403  -36.850 1.00 49.85 ? 46   LEU A CD1   1 
ATOM   964  C CD2   . LEU C 3 69  ? -0.327  18.978  -38.484 1.00 49.85 ? 46   LEU A CD2   1 
ATOM   965  N N     . ASP C 3 70  ? 1.280   18.446  -42.394 1.00 49.85 ? 47   ASP A N     1 
ATOM   966  C CA    . ASP C 3 70  ? 0.529   18.482  -43.644 1.00 49.85 ? 47   ASP A CA    1 
ATOM   967  C C     . ASP C 3 70  ? -0.974  18.306  -43.410 1.00 49.85 ? 47   ASP A C     1 
ATOM   968  O O     . ASP C 3 70  ? -1.410  17.247  -42.954 1.00 49.85 ? 47   ASP A O     1 
ATOM   969  C CB    . ASP C 3 70  ? 1.062   17.395  -44.589 1.00 49.85 ? 47   ASP A CB    1 
ATOM   970  C CG    . ASP C 3 70  ? 0.510   17.504  -46.003 1.00 49.85 ? 47   ASP A CG    1 
ATOM   971  O OD1   . ASP C 3 70  ? -0.332  18.384  -46.279 1.00 49.85 ? 47   ASP A OD1   1 
ATOM   972  O OD2   . ASP C 3 70  ? 0.931   16.692  -46.853 1.00 49.85 ? 47   ASP A OD2   1 
ATOM   973  N N     . PRO C 3 71  ? -1.773  19.348  -43.721 1.00 49.85 ? 48   PRO A N     1 
ATOM   974  C CA    . PRO C 3 71  ? -3.226  19.225  -43.659 1.00 49.85 ? 48   PRO A CA    1 
ATOM   975  C C     . PRO C 3 71  ? -3.798  18.714  -44.986 1.00 49.85 ? 48   PRO A C     1 
ATOM   976  O O     . PRO C 3 71  ? -4.728  19.308  -45.538 1.00 49.85 ? 48   PRO A O     1 
ATOM   977  C CB    . PRO C 3 71  ? -3.689  20.663  -43.370 1.00 49.85 ? 48   PRO A CB    1 
ATOM   978  C CG    . PRO C 3 71  ? -2.471  21.554  -43.590 1.00 49.85 ? 48   PRO A CG    1 
ATOM   979  C CD    . PRO C 3 71  ? -1.374  20.701  -44.142 1.00 49.85 ? 48   PRO A CD    1 
ATOM   980  N N     . GLY C 3 72  ? -3.231  17.616  -45.481 1.00 49.85 ? 49   GLY A N     1 
ATOM   981  C CA    . GLY C 3 72  ? -3.666  16.988  -46.728 1.00 49.85 ? 49   GLY A CA    1 
ATOM   982  C C     . GLY C 3 72  ? -3.735  15.481  -46.577 1.00 49.85 ? 49   GLY A C     1 
ATOM   983  O O     . GLY C 3 72  ? -4.397  14.793  -47.358 1.00 49.85 ? 49   GLY A O     1 
ATOM   984  N N     . ILE C 3 73  ? -3.038  14.979  -45.560 1.00 49.85 ? 50   ILE A N     1 
ATOM   985  C CA    . ILE C 3 73  ? -3.080  13.571  -45.170 1.00 49.85 ? 50   ILE A CA    1 
ATOM   986  C C     . ILE C 3 73  ? -4.487  13.153  -44.736 1.00 49.85 ? 50   ILE A C     1 
ATOM   987  O O     . ILE C 3 73  ? -4.838  11.974  -44.802 1.00 49.85 ? 50   ILE A O     1 
ATOM   988  C CB    . ILE C 3 73  ? -2.093  13.272  -44.013 1.00 49.85 ? 50   ILE A CB    1 
ATOM   989  C CG1   . ILE C 3 73  ? -2.336  14.228  -42.839 1.00 49.85 ? 50   ILE A CG1   1 
ATOM   990  C CG2   . ILE C 3 73  ? -0.649  13.372  -44.497 1.00 49.85 ? 50   ILE A CG2   1 
ATOM   991  C CD1   . ILE C 3 73  ? -2.245  13.582  -41.479 1.00 49.85 ? 50   ILE A CD1   1 
ATOM   992  N N     . LEU C 3 74  ? -5.280  14.130  -44.296 1.00 49.85 ? 51   LEU A N     1 
ATOM   993  C CA    . LEU C 3 74  ? -6.655  13.907  -43.850 1.00 49.85 ? 51   LEU A CA    1 
ATOM   994  C C     . LEU C 3 74  ? -7.549  13.408  -44.982 1.00 49.85 ? 51   LEU A C     1 
ATOM   995  O O     . LEU C 3 74  ? -8.500  12.662  -44.746 1.00 49.85 ? 51   LEU A O     1 
ATOM   996  C CB    . LEU C 3 74  ? -7.231  15.188  -43.242 1.00 49.85 ? 51   LEU A CB    1 
ATOM   997  C CG    . LEU C 3 74  ? -6.605  15.658  -41.925 1.00 49.85 ? 51   LEU A CG    1 
ATOM   998  C CD1   . LEU C 3 74  ? -6.573  17.180  -41.844 1.00 49.85 ? 51   LEU A CD1   1 
ATOM   999  C CD2   . LEU C 3 74  ? -7.325  15.058  -40.720 1.00 49.85 ? 51   LEU A CD2   1 
ATOM   1000 N N     . ASP C 3 75  ? -7.235  13.827  -46.207 1.00 49.85 ? 52   ASP A N     1 
ATOM   1001 C CA    . ASP C 3 75  ? -7.906  13.324  -47.403 1.00 49.85 ? 52   ASP A CA    1 
ATOM   1002 C C     . ASP C 3 75  ? -7.422  11.916  -47.724 1.00 49.85 ? 52   ASP A C     1 
ATOM   1003 O O     . ASP C 3 75  ? -8.172  11.098  -48.260 1.00 49.85 ? 52   ASP A O     1 
ATOM   1004 C CB    . ASP C 3 75  ? -7.645  14.246  -48.598 1.00 49.85 ? 52   ASP A CB    1 
ATOM   1005 C CG    . ASP C 3 75  ? -8.172  15.655  -48.380 1.00 49.85 ? 52   ASP A CG    1 
ATOM   1006 O OD1   . ASP C 3 75  ? -9.332  15.807  -47.934 1.00 49.85 ? 52   ASP A OD1   1 
ATOM   1007 O OD2   . ASP C 3 75  ? -7.421  16.615  -48.657 1.00 49.85 ? 52   ASP A OD2   1 
ATOM   1008 N N     . TRP C 3 76  ? -6.163  11.647  -47.387 1.00 49.85 ? 53   TRP A N     1 
ATOM   1009 C CA    . TRP C 3 76  ? -5.530  10.358  -47.649 1.00 49.85 ? 53   TRP A CA    1 
ATOM   1010 C C     . TRP C 3 76  ? -5.919  9.289   -46.622 1.00 49.85 ? 53   TRP A C     1 
ATOM   1011 O O     . TRP C 3 76  ? -6.163  8.138   -46.990 1.00 49.85 ? 53   TRP A O     1 
ATOM   1012 C CB    . TRP C 3 76  ? -4.005  10.531  -47.734 1.00 49.85 ? 53   TRP A CB    1 
ATOM   1013 C CG    . TRP C 3 76  ? -3.207  9.252   -47.718 1.00 49.85 ? 53   TRP A CG    1 
ATOM   1014 C CD1   . TRP C 3 76  ? -2.274  8.882   -46.789 1.00 49.85 ? 53   TRP A CD1   1 
ATOM   1015 C CD2   . TRP C 3 76  ? -3.270  8.180   -48.671 1.00 49.85 ? 53   TRP A CD2   1 
ATOM   1016 N NE1   . TRP C 3 76  ? -1.753  7.648   -47.102 1.00 49.85 ? 53   TRP A NE1   1 
ATOM   1017 C CE2   . TRP C 3 76  ? -2.346  7.194   -48.252 1.00 49.85 ? 53   TRP A CE2   1 
ATOM   1018 C CE3   . TRP C 3 76  ? -4.016  7.955   -49.838 1.00 49.85 ? 53   TRP A CE3   1 
ATOM   1019 C CZ2   . TRP C 3 76  ? -2.148  6.002   -48.958 1.00 49.85 ? 53   TRP A CZ2   1 
ATOM   1020 C CZ3   . TRP C 3 76  ? -3.819  6.768   -50.539 1.00 49.85 ? 53   TRP A CZ3   1 
ATOM   1021 C CH2   . TRP C 3 76  ? -2.892  5.808   -50.095 1.00 49.85 ? 53   TRP A CH2   1 
ATOM   1022 N N     . MET C 3 77  ? -5.978  9.668   -45.344 1.00 49.85 ? 54   MET A N     1 
ATOM   1023 C CA    . MET C 3 77  ? -6.253  8.702   -44.273 1.00 49.85 ? 54   MET A CA    1 
ATOM   1024 C C     . MET C 3 77  ? -7.100  9.221   -43.107 1.00 49.85 ? 54   MET A C     1 
ATOM   1025 O O     . MET C 3 77  ? -7.088  10.414  -42.793 1.00 49.85 ? 54   MET A O     1 
ATOM   1026 C CB    . MET C 3 77  ? -4.948  8.083   -43.743 1.00 49.85 ? 54   MET A CB    1 
ATOM   1027 C CG    . MET C 3 77  ? -3.978  9.070   -43.086 1.00 49.85 ? 54   MET A CG    1 
ATOM   1028 S SD    . MET C 3 77  ? -2.674  8.268   -42.126 1.00 49.85 ? 54   MET A SD    1 
ATOM   1029 C CE    . MET C 3 77  ? -1.644  7.570   -43.421 1.00 49.85 ? 54   MET A CE    1 
ATOM   1030 N N     . GLN C 3 78  ? -7.830  8.301   -42.480 1.00 49.85 ? 55   GLN A N     1 
ATOM   1031 C CA    . GLN C 3 78  ? -8.573  8.566   -41.249 1.00 49.85 ? 55   GLN A CA    1 
ATOM   1032 C C     . GLN C 3 78  ? -7.608  8.524   -40.068 1.00 49.85 ? 55   GLN A C     1 
ATOM   1033 O O     . GLN C 3 78  ? -6.790  7.607   -39.966 1.00 49.85 ? 55   GLN A O     1 
ATOM   1034 C CB    . GLN C 3 78  ? -9.660  7.505   -41.041 1.00 49.85 ? 55   GLN A CB    1 
ATOM   1035 C CG    . GLN C 3 78  ? -10.708 7.416   -42.146 1.00 49.85 ? 55   GLN A CG    1 
ATOM   1036 C CD    . GLN C 3 78  ? -11.939 8.268   -41.874 1.00 49.85 ? 55   GLN A CD    1 
ATOM   1037 O OE1   . GLN C 3 78  ? -12.445 8.319   -40.749 1.00 49.85 ? 55   GLN A OE1   1 
ATOM   1038 N NE2   . GLN C 3 78  ? -12.429 8.941   -42.911 1.00 49.85 ? 55   GLN A NE2   1 
ATOM   1039 N N     . VAL C 3 79  ? -7.699  9.511   -39.179 1.00 49.85 ? 56   VAL A N     1 
ATOM   1040 C CA    . VAL C 3 79  ? -6.852  9.538   -37.983 1.00 49.85 ? 56   VAL A CA    1 
ATOM   1041 C C     . VAL C 3 79  ? -7.685  9.788   -36.726 1.00 49.85 ? 56   VAL A C     1 
ATOM   1042 O O     . VAL C 3 79  ? -8.288  10.852  -36.568 1.00 49.85 ? 56   VAL A O     1 
ATOM   1043 C CB    . VAL C 3 79  ? -5.710  10.591  -38.078 1.00 49.85 ? 56   VAL A CB    1 
ATOM   1044 C CG1   . VAL C 3 79  ? -4.666  10.340  -36.998 1.00 49.85 ? 56   VAL A CG1   1 
ATOM   1045 C CG2   . VAL C 3 79  ? -5.048  10.573  -39.452 1.00 49.85 ? 56   VAL A CG2   1 
ATOM   1046 N N     . GLY C 3 80  ? -7.710  8.797   -35.838 1.00 49.85 ? 57   GLY A N     1 
ATOM   1047 C CA    . GLY C 3 80  ? -8.424  8.904   -34.567 1.00 49.85 ? 57   GLY A CA    1 
ATOM   1048 C C     . GLY C 3 80  ? -7.671  9.742   -33.552 1.00 49.85 ? 57   GLY A C     1 
ATOM   1049 O O     . GLY C 3 80  ? -6.547  10.179  -33.805 1.00 49.85 ? 57   GLY A O     1 
ATOM   1050 N N     . ALA C 3 81  ? -8.295  9.964   -32.398 1.00 49.85 ? 58   ALA A N     1 
ATOM   1051 C CA    . ALA C 3 81  ? -7.714  10.787  -31.340 1.00 49.85 ? 58   ALA A CA    1 
ATOM   1052 C C     . ALA C 3 81  ? -6.446  10.169  -30.754 1.00 49.85 ? 58   ALA A C     1 
ATOM   1053 O O     . ALA C 3 81  ? -5.474  10.877  -30.482 1.00 49.85 ? 58   ALA A O     1 
ATOM   1054 C CB    . ALA C 3 81  ? -8.738  11.041  -30.246 1.00 49.85 ? 58   ALA A CB    1 
ATOM   1055 N N     . ASN C 3 82  ? -6.470  8.850   -30.568 1.00 49.85 ? 59   ASN A N     1 
ATOM   1056 C CA    . ASN C 3 82  ? -5.359  8.114   -29.963 1.00 49.85 ? 59   ASN A CA    1 
ATOM   1057 C C     . ASN C 3 82  ? -4.038  8.252   -30.719 1.00 49.85 ? 59   ASN A C     1 
ATOM   1058 O O     . ASN C 3 82  ? -2.986  8.435   -30.102 1.00 49.85 ? 59   ASN A O     1 
ATOM   1059 C CB    . ASN C 3 82  ? -5.723  6.636   -29.798 1.00 49.85 ? 59   ASN A CB    1 
ATOM   1060 C CG    . ASN C 3 82  ? -6.813  6.411   -28.764 1.00 49.85 ? 59   ASN A CG    1 
ATOM   1061 O OD1   . ASN C 3 82  ? -6.897  7.123   -27.761 1.00 49.85 ? 59   ASN A OD1   1 
ATOM   1062 N ND2   . ASN C 3 82  ? -7.656  5.413   -29.004 1.00 49.85 ? 59   ASN A ND2   1 
ATOM   1063 N N     . ARG C 3 83  ? -4.100  8.165   -32.048 1.00 49.85 ? 60   ARG A N     1 
ATOM   1064 C CA    . ARG C 3 83  ? -2.913  8.303   -32.889 1.00 49.85 ? 60   ARG A CA    1 
ATOM   1065 C C     . ARG C 3 83  ? -2.400  9.744   -32.910 1.00 49.85 ? 60   ARG A C     1 
ATOM   1066 O O     . ARG C 3 83  ? -1.191  9.971   -32.988 1.00 49.85 ? 60   ARG A O     1 
ATOM   1067 C CB    . ARG C 3 83  ? -3.172  7.787   -34.311 1.00 49.85 ? 60   ARG A CB    1 
ATOM   1068 C CG    . ARG C 3 83  ? -1.904  7.647   -35.148 1.00 49.85 ? 60   ARG A CG    1 
ATOM   1069 C CD    . ARG C 3 83  ? -1.992  6.534   -36.179 1.00 49.85 ? 60   ARG A CD    1 
ATOM   1070 N NE    . ARG C 3 83  ? -2.562  6.978   -37.448 1.00 49.85 ? 60   ARG A NE    1 
ATOM   1071 C CZ    . ARG C 3 83  ? -3.811  6.744   -37.840 1.00 49.85 ? 60   ARG A CZ    1 
ATOM   1072 N NH1   . ARG C 3 83  ? -4.645  6.063   -37.063 1.00 49.85 ? 60   ARG A NH1   1 
ATOM   1073 N NH2   . ARG C 3 83  ? -4.228  7.192   -39.016 1.00 49.85 ? 60   ARG A NH2   1 
ATOM   1074 N N     . TRP C 3 84  ? -3.317  10.709  -32.837 1.00 49.85 ? 61   TRP A N     1 
ATOM   1075 C CA    . TRP C 3 84  ? -2.937  12.122  -32.745 1.00 49.85 ? 61   TRP A CA    1 
ATOM   1076 C C     . TRP C 3 84  ? -2.166  12.407  -31.456 1.00 49.85 ? 61   TRP A C     1 
ATOM   1077 O O     . TRP C 3 84  ? -1.240  13.219  -31.450 1.00 49.85 ? 61   TRP A O     1 
ATOM   1078 C CB    . TRP C 3 84  ? -4.156  13.047  -32.854 1.00 49.85 ? 61   TRP A CB    1 
ATOM   1079 C CG    . TRP C 3 84  ? -4.651  13.285  -34.263 1.00 49.85 ? 61   TRP A CG    1 
ATOM   1080 C CD1   . TRP C 3 84  ? -5.887  12.981  -34.756 1.00 49.85 ? 61   TRP A CD1   1 
ATOM   1081 C CD2   . TRP C 3 84  ? -3.922  13.875  -35.351 1.00 49.85 ? 61   TRP A CD2   1 
ATOM   1082 N NE1   . TRP C 3 84  ? -5.975  13.342  -36.078 1.00 49.85 ? 61   TRP A NE1   1 
ATOM   1083 C CE2   . TRP C 3 84  ? -4.784  13.893  -36.470 1.00 49.85 ? 61   TRP A CE2   1 
ATOM   1084 C CE3   . TRP C 3 84  ? -2.626  14.390  -35.490 1.00 49.85 ? 61   TRP A CE3   1 
ATOM   1085 C CZ2   . TRP C 3 84  ? -4.393  14.405  -37.712 1.00 49.85 ? 61   TRP A CZ2   1 
ATOM   1086 C CZ3   . TRP C 3 84  ? -2.237  14.900  -36.727 1.00 49.85 ? 61   TRP A CZ3   1 
ATOM   1087 C CH2   . TRP C 3 84  ? -3.119  14.902  -37.820 1.00 49.85 ? 61   TRP A CH2   1 
ATOM   1088 N N     . ARG C 3 85  ? -2.555  11.737  -30.373 1.00 49.85 ? 62   ARG A N     1 
ATOM   1089 C CA    . ARG C 3 85  ? -1.850  11.843  -29.098 1.00 49.85 ? 62   ARG A CA    1 
ATOM   1090 C C     . ARG C 3 85  ? -0.448  11.248  -29.206 1.00 49.85 ? 62   ARG A C     1 
ATOM   1091 O O     . ARG C 3 85  ? 0.512   11.805  -28.672 1.00 49.85 ? 62   ARG A O     1 
ATOM   1092 C CB    . ARG C 3 85  ? -2.643  11.162  -27.978 1.00 49.85 ? 62   ARG A CB    1 
ATOM   1093 C CG    . ARG C 3 85  ? -1.984  11.240  -26.602 1.00 49.85 ? 62   ARG A CG    1 
ATOM   1094 C CD    . ARG C 3 85  ? -2.967  10.977  -25.473 1.00 49.85 ? 62   ARG A CD    1 
ATOM   1095 N NE    . ARG C 3 85  ? -3.521  9.625   -25.512 1.00 49.85 ? 62   ARG A NE    1 
ATOM   1096 C CZ    . ARG C 3 85  ? -4.332  9.116   -24.589 1.00 49.85 ? 62   ARG A CZ    1 
ATOM   1097 N NH1   . ARG C 3 85  ? -4.696  9.841   -23.538 1.00 49.85 ? 62   ARG A NH1   1 
ATOM   1098 N NH2   . ARG C 3 85  ? -4.781  7.877   -24.718 1.00 49.85 ? 62   ARG A NH2   1 
ATOM   1099 N N     . PHE C 3 86  ? -0.344  10.118  -29.900 1.00 49.85 ? 63   PHE A N     1 
ATOM   1100 C CA    . PHE C 3 86  ? 0.934   9.451   -30.118 1.00 49.85 ? 63   PHE A CA    1 
ATOM   1101 C C     . PHE C 3 86  ? 1.904   10.371  -30.856 1.00 49.85 ? 63   PHE A C     1 
ATOM   1102 O O     . PHE C 3 86  ? 3.058   10.512  -30.451 1.00 49.85 ? 63   PHE A O     1 
ATOM   1103 C CB    . PHE C 3 86  ? 0.730   8.151   -30.899 1.00 49.85 ? 63   PHE A CB    1 
ATOM   1104 C CG    . PHE C 3 86  ? 1.890   7.197   -30.815 1.00 49.85 ? 63   PHE A CG    1 
ATOM   1105 C CD1   . PHE C 3 86  ? 1.885   6.161   -29.891 1.00 49.85 ? 63   PHE A CD1   1 
ATOM   1106 C CD2   . PHE C 3 86  ? 2.986   7.334   -31.660 1.00 49.85 ? 63   PHE A CD2   1 
ATOM   1107 C CE1   . PHE C 3 86  ? 2.954   5.277   -29.811 1.00 49.85 ? 63   PHE A CE1   1 
ATOM   1108 C CE2   . PHE C 3 86  ? 4.059   6.455   -31.586 1.00 49.85 ? 63   PHE A CE2   1 
ATOM   1109 C CZ    . PHE C 3 86  ? 4.042   5.426   -30.661 1.00 49.85 ? 63   PHE A CZ    1 
ATOM   1110 N N     . LEU C 3 87  ? 1.425   10.992  -31.932 1.00 49.85 ? 64   LEU A N     1 
ATOM   1111 C CA    . LEU C 3 87  ? 2.238   11.899  -32.742 1.00 49.85 ? 64   LEU A CA    1 
ATOM   1112 C C     . LEU C 3 87  ? 2.634   13.154  -31.969 1.00 49.85 ? 64   LEU A C     1 
ATOM   1113 O O     . LEU C 3 87  ? 3.741   13.664  -32.136 1.00 49.85 ? 64   LEU A O     1 
ATOM   1114 C CB    . LEU C 3 87  ? 1.504   12.274  -34.035 1.00 49.85 ? 64   LEU A CB    1 
ATOM   1115 C CG    . LEU C 3 87  ? 2.243   13.134  -35.068 1.00 49.85 ? 64   LEU A CG    1 
ATOM   1116 C CD1   . LEU C 3 87  ? 3.356   12.355  -35.759 1.00 49.85 ? 64   LEU A CD1   1 
ATOM   1117 C CD2   . LEU C 3 87  ? 1.266   13.687  -36.091 1.00 49.85 ? 64   LEU A CD2   1 
ATOM   1118 N N     . GLN C 3 88  ? 1.725   13.641  -31.128 1.00 49.85 ? 65   GLN A N     1 
ATOM   1119 C CA    . GLN C 3 88  ? 1.991   14.795  -30.273 1.00 49.85 ? 65   GLN A CA    1 
ATOM   1120 C C     . GLN C 3 88  ? 3.155   14.495  -29.335 1.00 49.85 ? 65   GLN A C     1 
ATOM   1121 O O     . GLN C 3 88  ? 4.054   15.320  -29.166 1.00 49.85 ? 65   GLN A O     1 
ATOM   1122 C CB    . GLN C 3 88  ? 0.740   15.161  -29.469 1.00 49.85 ? 65   GLN A CB    1 
ATOM   1123 C CG    . GLN C 3 88  ? 0.727   16.584  -28.914 1.00 49.85 ? 65   GLN A CG    1 
ATOM   1124 C CD    . GLN C 3 88  ? 1.613   16.765  -27.693 1.00 49.85 ? 65   GLN A CD    1 
ATOM   1125 O OE1   . GLN C 3 88  ? 1.698   15.888  -26.832 1.00 49.85 ? 65   GLN A OE1   1 
ATOM   1126 N NE2   . GLN C 3 88  ? 2.279   17.911  -27.614 1.00 49.85 ? 65   GLN A NE2   1 
ATOM   1127 N N     . GLN C 3 89  ? 3.125   13.307  -28.735 1.00 49.85 ? 66   GLN A N     1 
ATOM   1128 C CA    . GLN C 3 89  ? 4.166   12.860  -27.815 1.00 49.85 ? 66   GLN A CA    1 
ATOM   1129 C C     . GLN C 3 89  ? 5.470   12.551  -28.544 1.00 49.85 ? 66   GLN A C     1 
ATOM   1130 O O     . GLN C 3 89  ? 6.553   12.709  -27.981 1.00 49.85 ? 66   GLN A O     1 
ATOM   1131 C CB    . GLN C 3 89  ? 3.688   11.634  -27.034 1.00 49.85 ? 66   GLN A CB    1 
ATOM   1132 C CG    . GLN C 3 89  ? 2.543   11.927  -26.072 1.00 49.85 ? 66   GLN A CG    1 
ATOM   1133 C CD    . GLN C 3 89  ? 1.806   10.681  -25.617 1.00 49.85 ? 66   GLN A CD    1 
ATOM   1134 O OE1   . GLN C 3 89  ? 1.710   9.695   -26.348 1.00 49.85 ? 66   GLN A OE1   1 
ATOM   1135 N NE2   . GLN C 3 89  ? 1.277   10.722  -24.401 1.00 49.85 ? 66   GLN A NE2   1 
ATOM   1136 N N     . THR C 3 90  ? 5.352   12.114  -29.797 1.00 49.85 ? 67   THR A N     1 
ATOM   1137 C CA    . THR C 3 90  ? 6.504   11.796  -30.638 1.00 49.85 ? 67   THR A CA    1 
ATOM   1138 C C     . THR C 3 90  ? 7.283   13.054  -31.023 1.00 49.85 ? 67   THR A C     1 
ATOM   1139 O O     . THR C 3 90  ? 8.509   13.087  -30.916 1.00 49.85 ? 67   THR A O     1 
ATOM   1140 C CB    . THR C 3 90  ? 6.072   11.043  -31.915 1.00 49.85 ? 67   THR A CB    1 
ATOM   1141 O OG1   . THR C 3 90  ? 5.358   9.856   -31.551 1.00 49.85 ? 67   THR A OG1   1 
ATOM   1142 C CG2   . THR C 3 90  ? 7.277   10.656  -32.750 1.00 49.85 ? 67   THR A CG2   1 
ATOM   1143 N N     . LEU C 3 91  ? 6.560   14.080  -31.468 1.00 49.85 ? 68   LEU A N     1 
ATOM   1144 C CA    . LEU C 3 91  ? 7.163   15.349  -31.870 1.00 49.85 ? 68   LEU A CA    1 
ATOM   1145 C C     . LEU C 3 91  ? 7.763   16.088  -30.683 1.00 49.85 ? 68   LEU A C     1 
ATOM   1146 O O     . LEU C 3 91  ? 8.744   16.818  -30.830 1.00 49.85 ? 68   LEU A O     1 
ATOM   1147 C CB    . LEU C 3 91  ? 6.133   16.239  -32.570 1.00 49.85 ? 68   LEU A CB    1 
ATOM   1148 C CG    . LEU C 3 91  ? 5.598   15.772  -33.925 1.00 49.85 ? 68   LEU A CG    1 
ATOM   1149 C CD1   . LEU C 3 91  ? 4.386   16.591  -34.325 1.00 49.85 ? 68   LEU A CD1   1 
ATOM   1150 C CD2   . LEU C 3 91  ? 6.672   15.835  -35.000 1.00 49.85 ? 68   LEU A CD2   1 
ATOM   1151 N N     . GLU C 3 92  ? 7.165   15.891  -29.511 1.00 49.85 ? 69   GLU A N     1 
ATOM   1152 C CA    . GLU C 3 92  ? 7.648   16.495  -28.276 1.00 49.85 ? 69   GLU A CA    1 
ATOM   1153 C C     . GLU C 3 92  ? 8.953   15.841  -27.832 1.00 49.85 ? 69   GLU A C     1 
ATOM   1154 O O     . GLU C 3 92  ? 9.858   16.520  -27.351 1.00 49.85 ? 69   GLU A O     1 
ATOM   1155 C CB    . GLU C 3 92  ? 6.587   16.384  -27.183 1.00 49.85 ? 69   GLU A CB    1 
ATOM   1156 C CG    . GLU C 3 92  ? 6.673   17.462  -26.116 1.00 49.85 ? 69   GLU A CG    1 
ATOM   1157 C CD    . GLU C 3 92  ? 5.341   17.716  -25.432 1.00 49.85 ? 69   GLU A CD    1 
ATOM   1158 O OE1   . GLU C 3 92  ? 4.581   16.747  -25.208 1.00 49.85 ? 69   GLU A OE1   1 
ATOM   1159 O OE2   . GLU C 3 92  ? 5.053   18.890  -25.117 1.00 49.85 ? 69   GLU A OE2   1 
ATOM   1160 N N     . ASP C 3 93  ? 9.040   14.522  -27.999 1.00 49.85 ? 70   ASP A N     1 
ATOM   1161 C CA    . ASP C 3 93  ? 10.253  13.774  -27.680 1.00 49.85 ? 70   ASP A CA    1 
ATOM   1162 C C     . ASP C 3 93  ? 11.356  14.041  -28.699 1.00 49.85 ? 70   ASP A C     1 
ATOM   1163 O O     . ASP C 3 93  ? 12.507  14.257  -28.324 1.00 49.85 ? 70   ASP A O     1 
ATOM   1164 C CB    . ASP C 3 93  ? 9.963   12.271  -27.595 1.00 49.85 ? 70   ASP A CB    1 
ATOM   1165 C CG    . ASP C 3 93  ? 11.205  11.447  -27.288 1.00 49.85 ? 70   ASP A CG    1 
ATOM   1166 O OD1   . ASP C 3 93  ? 11.997  11.845  -26.406 1.00 49.85 ? 70   ASP A OD1   1 
ATOM   1167 O OD2   . ASP C 3 93  ? 11.388  10.394  -27.932 1.00 49.85 ? 70   ASP A OD2   1 
ATOM   1168 N N     . LEU C 3 94  ? 10.994  14.026  -29.981 1.00 49.85 ? 71   LEU A N     1 
ATOM   1169 C CA    . LEU C 3 94  ? 11.935  14.290  -31.070 1.00 49.85 ? 71   LEU A CA    1 
ATOM   1170 C C     . LEU C 3 94  ? 12.601  15.656  -30.921 1.00 49.85 ? 71   LEU A C     1 
ATOM   1171 O O     . LEU C 3 94  ? 13.776  15.817  -31.247 1.00 49.85 ? 71   LEU A O     1 
ATOM   1172 C CB    . LEU C 3 94  ? 11.231  14.186  -32.427 1.00 49.85 ? 71   LEU A CB    1 
ATOM   1173 C CG    . LEU C 3 94  ? 12.072  14.219  -33.708 1.00 49.85 ? 71   LEU A CG    1 
ATOM   1174 C CD1   . LEU C 3 94  ? 13.013  13.025  -33.799 1.00 49.85 ? 71   LEU A CD1   1 
ATOM   1175 C CD2   . LEU C 3 94  ? 11.169  14.273  -34.925 1.00 49.85 ? 71   LEU A CD2   1 
ATOM   1176 N N     . ASP C 3 95  ? 11.841  16.628  -30.425 1.00 49.85 ? 72   ASP A N     1 
ATOM   1177 C CA    . ASP C 3 95  ? 12.359  17.964  -30.153 1.00 49.85 ? 72   ASP A CA    1 
ATOM   1178 C C     . ASP C 3 95  ? 13.328  17.943  -28.974 1.00 49.85 ? 72   ASP A C     1 
ATOM   1179 O O     . ASP C 3 95  ? 14.385  18.571  -29.029 1.00 49.85 ? 72   ASP A O     1 
ATOM   1180 C CB    . ASP C 3 95  ? 11.207  18.937  -29.882 1.00 49.85 ? 72   ASP A CB    1 
ATOM   1181 C CG    . ASP C 3 95  ? 11.645  20.394  -29.904 1.00 49.85 ? 72   ASP A CG    1 
ATOM   1182 O OD1   . ASP C 3 95  ? 12.667  20.714  -30.548 1.00 49.85 ? 72   ASP A OD1   1 
ATOM   1183 O OD2   . ASP C 3 95  ? 10.958  21.223  -29.272 1.00 49.85 ? 72   ASP A OD2   1 
ATOM   1184 N N     . ASN C 3 96  ? 12.959  17.218  -27.917 1.00 49.85 ? 73   ASN A N     1 
ATOM   1185 C CA    . ASN C 3 96  ? 13.797  17.076  -26.724 1.00 49.85 ? 73   ASN A CA    1 
ATOM   1186 C C     . ASN C 3 96  ? 15.110  16.360  -27.016 1.00 49.85 ? 73   ASN A C     1 
ATOM   1187 O O     . ASN C 3 96  ? 16.150  16.695  -26.445 1.00 49.85 ? 73   ASN A O     1 
ATOM   1188 C CB    . ASN C 3 96  ? 13.044  16.336  -25.613 1.00 49.85 ? 73   ASN A CB    1 
ATOM   1189 C CG    . ASN C 3 96  ? 11.829  17.100  -25.112 1.00 49.85 ? 73   ASN A CG    1 
ATOM   1190 O OD1   . ASN C 3 96  ? 11.680  18.297  -25.359 1.00 49.85 ? 73   ASN A OD1   1 
ATOM   1191 N ND2   . ASN C 3 96  ? 10.951  16.404  -24.400 1.00 49.85 ? 73   ASN A ND2   1 
ATOM   1192 N N     . GLN C 3 97  ? 15.048  15.374  -27.908 1.00 49.85 ? 74   GLN A N     1 
ATOM   1193 C CA    . GLN C 3 97  ? 16.227  14.627  -28.324 1.00 49.85 ? 74   GLN A CA    1 
ATOM   1194 C C     . GLN C 3 97  ? 17.123  15.481  -29.217 1.00 49.85 ? 74   GLN A C     1 
ATOM   1195 O O     . GLN C 3 97  ? 18.350  15.427  -29.103 1.00 49.85 ? 74   GLN A O     1 
ATOM   1196 C CB    . GLN C 3 97  ? 15.827  13.332  -29.040 1.00 49.85 ? 74   GLN A CB    1 
ATOM   1197 C CG    . GLN C 3 97  ? 15.070  12.321  -28.176 1.00 49.85 ? 74   GLN A CG    1 
ATOM   1198 C CD    . GLN C 3 97  ? 15.784  11.978  -26.878 1.00 49.85 ? 74   GLN A CD    1 
ATOM   1199 O OE1   . GLN C 3 97  ? 16.994  11.750  -26.858 1.00 49.85 ? 74   GLN A OE1   1 
ATOM   1200 N NE2   . GLN C 3 97  ? 15.030  11.937  -25.785 1.00 49.85 ? 74   GLN A NE2   1 
ATOM   1201 N N     . LEU C 3 98  ? 16.502  16.266  -30.097 1.00 49.85 ? 75   LEU A N     1 
ATOM   1202 C CA    . LEU C 3 98  ? 17.225  17.189  -30.974 1.00 49.85 ? 75   LEU A CA    1 
ATOM   1203 C C     . LEU C 3 98  ? 17.804  18.375  -30.212 1.00 49.85 ? 75   LEU A C     1 
ATOM   1204 O O     . LEU C 3 98  ? 18.815  18.946  -30.625 1.00 49.85 ? 75   LEU A O     1 
ATOM   1205 C CB    . LEU C 3 98  ? 16.327  17.685  -32.111 1.00 49.85 ? 75   LEU A CB    1 
ATOM   1206 C CG    . LEU C 3 98  ? 16.185  16.794  -33.349 1.00 49.85 ? 75   LEU A CG    1 
ATOM   1207 C CD1   . LEU C 3 98  ? 14.958  17.185  -34.159 1.00 49.85 ? 75   LEU A CD1   1 
ATOM   1208 C CD2   . LEU C 3 98  ? 17.436  16.848  -34.217 1.00 49.85 ? 75   LEU A CD2   1 
ATOM   1209 N N     . ARG C 3 99  ? 17.161  18.739  -29.104 1.00 49.85 ? 76   ARG A N     1 
ATOM   1210 C CA    . ARG C 3 99  ? 17.627  19.836  -28.256 1.00 49.85 ? 76   ARG A CA    1 
ATOM   1211 C C     . ARG C 3 99  ? 18.971  19.506  -27.617 1.00 49.85 ? 76   ARG A C     1 
ATOM   1212 O O     . ARG C 3 99  ? 19.819  20.385  -27.456 1.00 49.85 ? 76   ARG A O     1 
ATOM   1213 C CB    . ARG C 3 99  ? 16.594  20.162  -27.175 1.00 49.85 ? 76   ARG A CB    1 
ATOM   1214 C CG    . ARG C 3 99  ? 16.802  21.515  -26.503 1.00 49.85 ? 76   ARG A CG    1 
ATOM   1215 C CD    . ARG C 3 99  ? 15.690  21.857  -25.517 1.00 49.85 ? 76   ARG A CD    1 
ATOM   1216 N NE    . ARG C 3 99  ? 14.369  21.834  -26.143 1.00 49.85 ? 76   ARG A NE    1 
ATOM   1217 C CZ    . ARG C 3 99  ? 13.379  21.023  -25.781 1.00 49.85 ? 76   ARG A CZ    1 
ATOM   1218 N NH1   . ARG C 3 99  ? 13.547  20.160  -24.787 1.00 49.85 ? 76   ARG A NH1   1 
ATOM   1219 N NH2   . ARG C 3 99  ? 12.215  21.076  -26.414 1.00 49.85 ? 76   ARG A NH2   1 
ATOM   1220 N N     . LYS C 3 100 ? 19.151  18.234  -27.261 1.00 49.85 ? 77   LYS A N     1 
ATOM   1221 C CA    . LYS C 3 100 ? 20.392  17.742  -26.660 1.00 49.85 ? 77   LYS A CA    1 
ATOM   1222 C C     . LYS C 3 100 ? 21.561  17.755  -27.648 1.00 49.85 ? 77   LYS A C     1 
ATOM   1223 O O     . LYS C 3 100 ? 22.725  17.722  -27.242 1.00 49.85 ? 77   LYS A O     1 
ATOM   1224 C CB    . LYS C 3 100 ? 20.192  16.330  -26.102 1.00 49.85 ? 77   LYS A CB    1 
ATOM   1225 C CG    . LYS C 3 100 ? 19.280  16.256  -24.885 1.00 49.85 ? 77   LYS A CG    1 
ATOM   1226 C CD    . LYS C 3 100 ? 19.021  14.814  -24.489 1.00 49.85 ? 77   LYS A CD    1 
ATOM   1227 C CE    . LYS C 3 100 ? 18.105  14.724  -23.282 1.00 49.85 ? 77   LYS A CE    1 
ATOM   1228 N NZ    . LYS C 3 100 ? 17.751  13.311  -22.971 1.00 49.85 ? 77   LYS A NZ    1 
ATOM   1229 N N     . LEU C 3 101 ? 21.242  17.804  -28.940 1.00 49.85 ? 78   LEU A N     1 
ATOM   1230 C CA    . LEU C 3 101 ? 22.250  17.891  -29.992 1.00 49.85 ? 78   LEU A CA    1 
ATOM   1231 C C     . LEU C 3 101 ? 22.446  19.335  -30.460 1.00 49.85 ? 78   LEU A C     1 
ATOM   1232 O O     . LEU C 3 101 ? 22.791  19.578  -31.620 1.00 49.85 ? 78   LEU A O     1 
ATOM   1233 C CB    . LEU C 3 101 ? 21.871  16.994  -31.177 1.00 49.85 ? 78   LEU A CB    1 
ATOM   1234 C CG    . LEU C 3 101 ? 21.630  15.498  -30.954 1.00 49.85 ? 78   LEU A CG    1 
ATOM   1235 C CD1   . LEU C 3 101 ? 21.159  14.860  -32.247 1.00 49.85 ? 78   LEU A CD1   1 
ATOM   1236 C CD2   . LEU C 3 101 ? 22.875  14.790  -30.435 1.00 49.85 ? 78   LEU A CD2   1 
ATOM   1237 N N     . ASN C 3 102 ? 22.225  20.282  -29.546 1.00 49.85 ? 79   ASN A N     1 
ATOM   1238 C CA    . ASN C 3 102 ? 22.344  21.726  -29.812 1.00 49.85 ? 79   ASN A CA    1 
ATOM   1239 C C     . ASN C 3 102 ? 21.430  22.264  -30.922 1.00 49.85 ? 79   ASN A C     1 
ATOM   1240 O O     . ASN C 3 102 ? 21.637  23.370  -31.430 1.00 49.85 ? 79   ASN A O     1 
ATOM   1241 C CB    . ASN C 3 102 ? 23.807  22.124  -30.067 1.00 49.85 ? 79   ASN A CB    1 
ATOM   1242 C CG    . ASN C 3 102 ? 24.630  22.189  -28.792 1.00 49.85 ? 79   ASN A CG    1 
ATOM   1243 O OD1   . ASN C 3 102 ? 24.096  22.365  -27.694 1.00 49.85 ? 79   ASN A OD1   1 
ATOM   1244 N ND2   . ASN C 3 102 ? 25.942  22.049  -28.934 1.00 49.85 ? 79   ASN A ND2   1 
ATOM   1245 N N     . SER C 3 103 ? 20.422  21.475  -31.286 1.00 49.85 ? 80   SER A N     1 
ATOM   1246 C CA    . SER C 3 103 ? 19.476  21.849  -32.329 1.00 49.85 ? 80   SER A CA    1 
ATOM   1247 C C     . SER C 3 103 ? 18.067  21.968  -31.745 1.00 49.85 ? 80   SER A C     1 
ATOM   1248 O O     . SER C 3 103 ? 17.905  22.285  -30.562 1.00 49.85 ? 80   SER A O     1 
ATOM   1249 C CB    . SER C 3 103 ? 19.517  20.821  -33.466 1.00 49.85 ? 80   SER A CB    1 
ATOM   1250 O OG    . SER C 3 103 ? 18.729  21.233  -34.570 1.00 49.85 ? 80   SER A OG    1 
ATOM   1251 N N     . ARG C 3 104 ? 17.061  21.718  -32.584 1.00 49.85 ? 81   ARG A N     1 
ATOM   1252 C CA    . ARG C 3 104 ? 15.651  21.685  -32.187 1.00 49.85 ? 81   ARG A CA    1 
ATOM   1253 C C     . ARG C 3 104 ? 14.803  21.207  -33.361 1.00 49.85 ? 81   ARG A C     1 
ATOM   1254 O O     . ARG C 3 104 ? 15.295  21.105  -34.487 1.00 49.85 ? 81   ARG A O     1 
ATOM   1255 C CB    . ARG C 3 104 ? 15.161  23.059  -31.700 1.00 49.85 ? 81   ARG A CB    1 
ATOM   1256 C CG    . ARG C 3 104 ? 15.284  24.187  -32.717 1.00 49.85 ? 81   ARG A CG    1 
ATOM   1257 C CD    . ARG C 3 104 ? 14.326  25.323  -32.408 1.00 49.85 ? 81   ARG A CD    1 
ATOM   1258 N NE    . ARG C 3 104 ? 12.936  24.945  -32.661 1.00 49.85 ? 81   ARG A NE    1 
ATOM   1259 C CZ    . ARG C 3 104 ? 11.894  25.762  -32.530 1.00 49.85 ? 81   ARG A CZ    1 
ATOM   1260 N NH1   . ARG C 3 104 ? 12.068  27.020  -32.145 1.00 49.85 ? 81   ARG A NH1   1 
ATOM   1261 N NH2   . ARG C 3 104 ? 10.670  25.318  -32.785 1.00 49.85 ? 81   ARG A NH2   1 
ATOM   1262 N N     . LEU C 3 105 ? 13.533  20.916  -33.095 1.00 49.85 ? 82   LEU A N     1 
ATOM   1263 C CA    . LEU C 3 105 ? 12.597  20.542  -34.148 1.00 49.85 ? 82   LEU A CA    1 
ATOM   1264 C C     . LEU C 3 105 ? 11.819  21.765  -34.630 1.00 49.85 ? 82   LEU A C     1 
ATOM   1265 O O     . LEU C 3 105 ? 11.593  22.710  -33.870 1.00 49.85 ? 82   LEU A O     1 
ATOM   1266 C CB    . LEU C 3 105 ? 11.640  19.445  -33.663 1.00 49.85 ? 82   LEU A CB    1 
ATOM   1267 C CG    . LEU C 3 105 ? 10.637  18.837  -34.655 1.00 49.85 ? 82   LEU A CG    1 
ATOM   1268 C CD1   . LEU C 3 105 ? 11.327  18.012  -35.733 1.00 49.85 ? 82   LEU A CD1   1 
ATOM   1269 C CD2   . LEU C 3 105 ? 9.611   17.998  -33.921 1.00 49.85 ? 82   LEU A CD2   1 
ATOM   1270 N N     . PHE C 3 106 ? 11.419  21.737  -35.898 1.00 49.85 ? 83   PHE A N     1 
ATOM   1271 C CA    . PHE C 3 106 ? 10.574  22.777  -36.469 1.00 49.85 ? 83   PHE A CA    1 
ATOM   1272 C C     . PHE C 3 106 ? 9.321   22.149  -37.073 1.00 49.85 ? 83   PHE A C     1 
ATOM   1273 O O     . PHE C 3 106 ? 9.390   21.453  -38.089 1.00 49.85 ? 83   PHE A O     1 
ATOM   1274 C CB    . PHE C 3 106 ? 11.337  23.579  -37.527 1.00 49.85 ? 83   PHE A CB    1 
ATOM   1275 C CG    . PHE C 3 106 ? 12.584  24.242  -37.010 1.00 49.85 ? 83   PHE A CG    1 
ATOM   1276 C CD1   . PHE C 3 106 ? 12.518  25.474  -36.366 1.00 49.85 ? 83   PHE A CD1   1 
ATOM   1277 C CD2   . PHE C 3 106 ? 13.827  23.636  -37.168 1.00 49.85 ? 83   PHE A CD2   1 
ATOM   1278 C CE1   . PHE C 3 106 ? 13.669  26.091  -35.886 1.00 49.85 ? 83   PHE A CE1   1 
ATOM   1279 C CE2   . PHE C 3 106 ? 14.983  24.246  -36.692 1.00 49.85 ? 83   PHE A CE2   1 
ATOM   1280 C CZ    . PHE C 3 106 ? 14.904  25.475  -36.051 1.00 49.85 ? 83   PHE A CZ    1 
ATOM   1281 N N     . VAL C 3 107 ? 8.179   22.394  -36.441 1.00 49.85 ? 84   VAL A N     1 
ATOM   1282 C CA    . VAL C 3 107 ? 6.909   21.868  -36.929 1.00 49.85 ? 84   VAL A CA    1 
ATOM   1283 C C     . VAL C 3 107 ? 6.233   22.910  -37.817 1.00 49.85 ? 84   VAL A C     1 
ATOM   1284 O O     . VAL C 3 107 ? 5.579   23.837  -37.329 1.00 49.85 ? 84   VAL A O     1 
ATOM   1285 C CB    . VAL C 3 107 ? 5.973   21.430  -35.779 1.00 49.85 ? 84   VAL A CB    1 
ATOM   1286 C CG1   . VAL C 3 107 ? 4.786   20.648  -36.328 1.00 49.85 ? 84   VAL A CG1   1 
ATOM   1287 C CG2   . VAL C 3 107 ? 6.730   20.589  -34.760 1.00 49.85 ? 84   VAL A CG2   1 
ATOM   1288 N N     . VAL C 3 108 ? 6.404   22.745  -39.125 1.00 49.85 ? 85   VAL A N     1 
ATOM   1289 C CA    . VAL C 3 108 ? 5.875   23.688  -40.102 1.00 49.85 ? 85   VAL A CA    1 
ATOM   1290 C C     . VAL C 3 108 ? 4.451   23.308  -40.493 1.00 49.85 ? 85   VAL A C     1 
ATOM   1291 O O     . VAL C 3 108 ? 4.169   22.151  -40.805 1.00 49.85 ? 85   VAL A O     1 
ATOM   1292 C CB    . VAL C 3 108 ? 6.769   23.767  -41.363 1.00 49.85 ? 85   VAL A CB    1 
ATOM   1293 C CG1   . VAL C 3 108 ? 6.270   24.851  -42.309 1.00 49.85 ? 85   VAL A CG1   1 
ATOM   1294 C CG2   . VAL C 3 108 ? 8.218   24.037  -40.976 1.00 49.85 ? 85   VAL A CG2   1 
ATOM   1295 N N     . ARG C 3 109 ? 3.561   24.296  -40.472 1.00 49.85 ? 86   ARG A N     1 
ATOM   1296 C CA    . ARG C 3 109 ? 2.166   24.099  -40.850 1.00 49.85 ? 86   ARG A CA    1 
ATOM   1297 C C     . ARG C 3 109 ? 1.950   24.424  -42.323 1.00 49.85 ? 86   ARG A C     1 
ATOM   1298 O O     . ARG C 3 109 ? 2.599   25.317  -42.872 1.00 49.85 ? 86   ARG A O     1 
ATOM   1299 C CB    . ARG C 3 109 ? 1.249   24.956  -39.975 1.00 49.85 ? 86   ARG A CB    1 
ATOM   1300 C CG    . ARG C 3 109 ? 0.990   24.391  -38.581 1.00 49.85 ? 86   ARG A CG    1 
ATOM   1301 C CD    . ARG C 3 109 ? 2.138   24.658  -37.612 1.00 49.85 ? 86   ARG A CD    1 
ATOM   1302 N NE    . ARG C 3 109 ? 1.811   24.219  -36.257 1.00 49.85 ? 86   ARG A NE    1 
ATOM   1303 C CZ    . ARG C 3 109 ? 2.628   24.310  -35.211 1.00 49.85 ? 86   ARG A CZ    1 
ATOM   1304 N NH1   . ARG C 3 109 ? 3.843   24.826  -35.345 1.00 49.85 ? 86   ARG A NH1   1 
ATOM   1305 N NH2   . ARG C 3 109 ? 2.227   23.880  -34.023 1.00 49.85 ? 86   ARG A NH2   1 
ATOM   1306 N N     . GLY C 3 110 ? 1.037   23.694  -42.956 1.00 49.85 ? 87   GLY A N     1 
ATOM   1307 C CA    . GLY C 3 110 ? 0.729   23.893  -44.371 1.00 49.85 ? 87   GLY A CA    1 
ATOM   1308 C C     . GLY C 3 110 ? 1.173   22.728  -45.233 1.00 49.85 ? 87   GLY A C     1 
ATOM   1309 O O     . GLY C 3 110 ? 1.926   21.863  -44.782 1.00 49.85 ? 87   GLY A O     1 
ATOM   1310 N N     . LYS C 3 111 ? 0.700   22.708  -46.477 1.00 49.85 ? 88   LYS A N     1 
ATOM   1311 C CA    . LYS C 3 111 ? 1.028   21.643  -47.423 1.00 49.85 ? 88   LYS A CA    1 
ATOM   1312 C C     . LYS C 3 111 ? 2.423   21.854  -48.016 1.00 49.85 ? 88   LYS A C     1 
ATOM   1313 O O     . LYS C 3 111 ? 2.794   22.989  -48.318 1.00 49.85 ? 88   LYS A O     1 
ATOM   1314 C CB    . LYS C 3 111 ? -0.027  21.570  -48.534 1.00 49.85 ? 88   LYS A CB    1 
ATOM   1315 C CG    . LYS C 3 111 ? -1.401  21.099  -48.059 1.00 49.85 ? 88   LYS A CG    1 
ATOM   1316 C CD    . LYS C 3 111 ? -2.452  21.233  -49.151 1.00 49.85 ? 88   LYS A CD    1 
ATOM   1317 C CE    . LYS C 3 111 ? -3.834  20.869  -48.632 1.00 49.85 ? 88   LYS A CE    1 
ATOM   1318 N NZ    . LYS C 3 111 ? -4.891  21.082  -49.659 1.00 49.85 ? 88   LYS A NZ    1 
ATOM   1319 N N     . PRO C 3 112 ? 3.197   20.759  -48.182 1.00 49.85 ? 89   PRO A N     1 
ATOM   1320 C CA    . PRO C 3 112 ? 4.568   20.802  -48.709 1.00 49.85 ? 89   PRO A CA    1 
ATOM   1321 C C     . PRO C 3 112 ? 4.682   21.542  -50.042 1.00 49.85 ? 89   PRO A C     1 
ATOM   1322 O O     . PRO C 3 112 ? 5.647   22.279  -50.254 1.00 49.85 ? 89   PRO A O     1 
ATOM   1323 C CB    . PRO C 3 112 ? 4.915   19.323  -48.901 1.00 49.85 ? 89   PRO A CB    1 
ATOM   1324 C CG    . PRO C 3 112 ? 4.072   18.615  -47.916 1.00 49.85 ? 89   PRO A CG    1 
ATOM   1325 C CD    . PRO C 3 112 ? 2.785   19.380  -47.862 1.00 49.85 ? 89   PRO A CD    1 
ATOM   1326 N N     . ALA C 3 113 ? 3.698   21.340  -50.920 1.00 49.85 ? 90   ALA A N     1 
ATOM   1327 C CA    . ALA C 3 113 ? 3.638   22.008  -52.222 1.00 49.85 ? 90   ALA A CA    1 
ATOM   1328 C C     . ALA C 3 113 ? 3.597   23.533  -52.095 1.00 49.85 ? 90   ALA A C     1 
ATOM   1329 O O     . ALA C 3 113 ? 4.117   24.248  -52.954 1.00 49.85 ? 90   ALA A O     1 
ATOM   1330 C CB    . ALA C 3 113 ? 2.441   21.508  -53.017 1.00 49.85 ? 90   ALA A CB    1 
ATOM   1331 N N     . GLU C 3 114 ? 2.976   24.018  -51.022 1.00 49.85 ? 91   GLU A N     1 
ATOM   1332 C CA    . GLU C 3 114 ? 2.937   25.445  -50.717 1.00 49.85 ? 91   GLU A CA    1 
ATOM   1333 C C     . GLU C 3 114 ? 4.147   25.852  -49.874 1.00 49.85 ? 91   GLU A C     1 
ATOM   1334 O O     . GLU C 3 114 ? 4.766   26.888  -50.126 1.00 49.85 ? 91   GLU A O     1 
ATOM   1335 C CB    . GLU C 3 114 ? 1.623   25.801  -50.005 1.00 49.85 ? 91   GLU A CB    1 
ATOM   1336 C CG    . GLU C 3 114 ? 1.488   27.263  -49.566 1.00 49.85 ? 91   GLU A CG    1 
ATOM   1337 C CD    . GLU C 3 114 ? 2.118   27.533  -48.208 1.00 49.85 ? 91   GLU A CD    1 
ATOM   1338 O OE1   . GLU C 3 114 ? 1.673   26.924  -47.210 1.00 49.85 ? 91   GLU A OE1   1 
ATOM   1339 O OE2   . GLU C 3 114 ? 3.058   28.356  -48.139 1.00 49.85 ? 91   GLU A OE2   1 
ATOM   1340 N N     . VAL C 3 115 ? 4.470   25.027  -48.879 1.00 49.85 ? 92   VAL A N     1 
ATOM   1341 C CA    . VAL C 3 115 ? 5.519   25.328  -47.902 1.00 49.85 ? 92   VAL A CA    1 
ATOM   1342 C C     . VAL C 3 115 ? 6.917   25.421  -48.524 1.00 49.85 ? 92   VAL A C     1 
ATOM   1343 O O     . VAL C 3 115 ? 7.617   26.418  -48.327 1.00 49.85 ? 92   VAL A O     1 
ATOM   1344 C CB    . VAL C 3 115 ? 5.502   24.311  -46.722 1.00 49.85 ? 92   VAL A CB    1 
ATOM   1345 C CG1   . VAL C 3 115 ? 6.784   24.393  -45.896 1.00 49.85 ? 92   VAL A CG1   1 
ATOM   1346 C CG2   . VAL C 3 115 ? 4.283   24.542  -45.837 1.00 49.85 ? 92   VAL A CG2   1 
ATOM   1347 N N     . PHE C 3 116 ? 7.311   24.388  -49.269 1.00 49.85 ? 93   PHE A N     1 
ATOM   1348 C CA    . PHE C 3 116 ? 8.665   24.300  -49.831 1.00 49.85 ? 93   PHE A CA    1 
ATOM   1349 C C     . PHE C 3 116 ? 9.138   25.524  -50.638 1.00 49.85 ? 93   PHE A C     1 
ATOM   1350 O O     . PHE C 3 116 ? 10.212  26.053  -50.347 1.00 49.85 ? 93   PHE A O     1 
ATOM   1351 C CB    . PHE C 3 116 ? 8.876   22.992  -50.606 1.00 49.85 ? 93   PHE A CB    1 
ATOM   1352 C CG    . PHE C 3 116 ? 9.171   21.809  -49.725 1.00 49.85 ? 93   PHE A CG    1 
ATOM   1353 C CD1   . PHE C 3 116 ? 10.289  21.806  -48.892 1.00 49.85 ? 93   PHE A CD1   1 
ATOM   1354 C CD2   . PHE C 3 116 ? 8.337   20.696  -49.726 1.00 49.85 ? 93   PHE A CD2   1 
ATOM   1355 C CE1   . PHE C 3 116 ? 10.568  20.715  -48.073 1.00 49.85 ? 93   PHE A CE1   1 
ATOM   1356 C CE2   . PHE C 3 116 ? 8.610   19.598  -48.908 1.00 49.85 ? 93   PHE A CE2   1 
ATOM   1357 C CZ    . PHE C 3 116 ? 9.729   19.609  -48.082 1.00 49.85 ? 93   PHE A CZ    1 
ATOM   1358 N N     . PRO C 3 117 ? 8.349   25.980  -51.641 1.00 49.85 ? 94   PRO A N     1 
ATOM   1359 C CA    . PRO C 3 117 ? 8.767   27.160  -52.411 1.00 49.85 ? 94   PRO A CA    1 
ATOM   1360 C C     . PRO C 3 117 ? 9.179   28.342  -51.529 1.00 49.85 ? 94   PRO A C     1 
ATOM   1361 O O     . PRO C 3 117 ? 10.161  29.026  -51.833 1.00 49.85 ? 94   PRO A O     1 
ATOM   1362 C CB    . PRO C 3 117 ? 7.511   27.520  -53.210 1.00 49.85 ? 94   PRO A CB    1 
ATOM   1363 C CG    . PRO C 3 117 ? 6.789   26.248  -53.365 1.00 49.85 ? 94   PRO A CG    1 
ATOM   1364 C CD    . PRO C 3 117 ? 7.055   25.453  -52.120 1.00 49.85 ? 94   PRO A CD    1 
ATOM   1365 N N     . ARG C 3 118 ? 8.431   28.567  -50.450 1.00 49.85 ? 95   ARG A N     1 
ATOM   1366 C CA    . ARG C 3 118 ? 8.695   29.667  -49.525 1.00 49.85 ? 95   ARG A CA    1 
ATOM   1367 C C     . ARG C 3 118 ? 9.966   29.440  -48.706 1.00 49.85 ? 95   ARG A C     1 
ATOM   1368 O O     . ARG C 3 118 ? 10.838  30.310  -48.657 1.00 49.85 ? 95   ARG A O     1 
ATOM   1369 C CB    . ARG C 3 118 ? 7.488   29.895  -48.605 1.00 49.85 ? 95   ARG A CB    1 
ATOM   1370 C CG    . ARG C 3 118 ? 7.695   30.969  -47.539 1.00 49.85 ? 95   ARG A CG    1 
ATOM   1371 C CD    . ARG C 3 118 ? 6.470   31.137  -46.641 1.00 49.85 ? 95   ARG A CD    1 
ATOM   1372 N NE    . ARG C 3 118 ? 6.050   29.887  -46.001 1.00 49.85 ? 95   ARG A NE    1 
ATOM   1373 C CZ    . ARG C 3 118 ? 6.593   29.372  -44.899 1.00 49.85 ? 95   ARG A CZ    1 
ATOM   1374 N NH1   . ARG C 3 118 ? 7.598   29.987  -44.285 1.00 49.85 ? 95   ARG A NH1   1 
ATOM   1375 N NH2   . ARG C 3 118 ? 6.127   28.230  -44.409 1.00 49.85 ? 95   ARG A NH2   1 
ATOM   1376 N N     . ILE C 3 119 ? 10.065  28.273  -48.071 1.00 49.85 ? 96   ILE A N     1 
ATOM   1377 C CA    . ILE C 3 119 ? 11.183  27.979  -47.169 1.00 49.85 ? 96   ILE A CA    1 
ATOM   1378 C C     . ILE C 3 119 ? 12.499  27.668  -47.890 1.00 49.85 ? 96   ILE A C     1 
ATOM   1379 O O     . ILE C 3 119 ? 13.569  27.717  -47.278 1.00 49.85 ? 96   ILE A O     1 
ATOM   1380 C CB    . ILE C 3 119 ? 10.836  26.876  -46.121 1.00 49.85 ? 96   ILE A CB    1 
ATOM   1381 C CG1   . ILE C 3 119 ? 10.424  25.560  -46.791 1.00 49.85 ? 96   ILE A CG1   1 
ATOM   1382 C CG2   . ILE C 3 119 ? 9.752   27.364  -45.171 1.00 49.85 ? 96   ILE A CG2   1 
ATOM   1383 C CD1   . ILE C 3 119 ? 11.553  24.556  -46.940 1.00 49.85 ? 96   ILE A CD1   1 
ATOM   1384 N N     . PHE C 3 120 ? 12.416  27.352  -49.183 1.00 49.85 ? 97   PHE A N     1 
ATOM   1385 C CA    . PHE C 3 120 ? 13.611  27.185  -50.011 1.00 49.85 ? 97   PHE A CA    1 
ATOM   1386 C C     . PHE C 3 120 ? 14.352  28.512  -50.186 1.00 49.85 ? 97   PHE A C     1 
ATOM   1387 O O     . PHE C 3 120 ? 15.578  28.567  -50.054 1.00 49.85 ? 97   PHE A O     1 
ATOM   1388 C CB    . PHE C 3 120 ? 13.265  26.597  -51.384 1.00 49.85 ? 97   PHE A CB    1 
ATOM   1389 C CG    . PHE C 3 120 ? 13.199  25.091  -51.415 1.00 49.85 ? 97   PHE A CG    1 
ATOM   1390 C CD1   . PHE C 3 120 ? 14.169  24.318  -50.782 1.00 49.85 ? 97   PHE A CD1   1 
ATOM   1391 C CD2   . PHE C 3 120 ? 12.166  24.443  -52.088 1.00 49.85 ? 97   PHE A CD2   1 
ATOM   1392 C CE1   . PHE C 3 120 ? 14.106  22.925  -50.815 1.00 49.85 ? 97   PHE A CE1   1 
ATOM   1393 C CE2   . PHE C 3 120 ? 12.095  23.052  -52.126 1.00 49.85 ? 97   PHE A CE2   1 
ATOM   1394 C CZ    . PHE C 3 120 ? 13.067  22.293  -51.489 1.00 49.85 ? 97   PHE A CZ    1 
ATOM   1395 N N     . LYS C 3 121 ? 13.599  29.572  -50.481 1.00 49.85 ? 98   LYS A N     1 
ATOM   1396 C CA    . LYS C 3 121 ? 14.170  30.903  -50.712 1.00 49.85 ? 98   LYS A CA    1 
ATOM   1397 C C     . LYS C 3 121 ? 14.533  31.615  -49.407 1.00 49.85 ? 98   LYS A C     1 
ATOM   1398 O O     . LYS C 3 121 ? 15.650  32.121  -49.260 1.00 49.85 ? 98   LYS A O     1 
ATOM   1399 C CB    . LYS C 3 121 ? 13.211  31.779  -51.532 1.00 49.85 ? 98   LYS A CB    1 
ATOM   1400 C CG    . LYS C 3 121 ? 12.879  31.246  -52.927 1.00 49.85 ? 98   LYS A CG    1 
ATOM   1401 C CD    . LYS C 3 121 ? 12.235  32.320  -53.814 1.00 49.85 ? 98   LYS A CD    1 
ATOM   1402 C CE    . LYS C 3 121 ? 10.836  32.724  -53.342 1.00 49.85 ? 98   LYS A CE    1 
ATOM   1403 N NZ    . LYS C 3 121 ? 9.842   31.619  -53.451 1.00 49.85 ? 98   LYS A NZ    1 
ATOM   1404 N N     . SER C 3 122 ? 13.584  31.647  -48.472 1.00 49.85 ? 99   SER A N     1 
ATOM   1405 C CA    . SER C 3 122 ? 13.735  32.379  -47.214 1.00 49.85 ? 99   SER A CA    1 
ATOM   1406 C C     . SER C 3 122 ? 14.876  31.857  -46.346 1.00 49.85 ? 99   SER A C     1 
ATOM   1407 O O     . SER C 3 122 ? 15.602  32.642  -45.735 1.00 49.85 ? 99   SER A O     1 
ATOM   1408 C CB    . SER C 3 122 ? 12.425  32.361  -46.426 1.00 49.85 ? 99   SER A CB    1 
ATOM   1409 O OG    . SER C 3 122 ? 12.017  31.034  -46.152 1.00 49.85 ? 99   SER A OG    1 
ATOM   1410 N N     . TRP C 3 123 ? 15.029  30.535  -46.294 1.00 49.85 ? 100  TRP A N     1 
ATOM   1411 C CA    . TRP C 3 123 ? 16.124  29.922  -45.543 1.00 49.85 ? 100  TRP A CA    1 
ATOM   1412 C C     . TRP C 3 123 ? 17.392  29.810  -46.384 1.00 49.85 ? 100  TRP A C     1 
ATOM   1413 O O     . TRP C 3 123 ? 18.491  29.698  -45.836 1.00 49.85 ? 100  TRP A O     1 
ATOM   1414 C CB    . TRP C 3 123 ? 15.737  28.538  -45.006 1.00 49.85 ? 100  TRP A CB    1 
ATOM   1415 C CG    . TRP C 3 123 ? 14.563  28.521  -44.059 1.00 49.85 ? 100  TRP A CG    1 
ATOM   1416 C CD1   . TRP C 3 123 ? 14.041  29.580  -43.365 1.00 49.85 ? 100  TRP A CD1   1 
ATOM   1417 C CD2   . TRP C 3 123 ? 13.774  27.379  -43.697 1.00 49.85 ? 100  TRP A CD2   1 
ATOM   1418 N NE1   . TRP C 3 123 ? 12.975  29.167  -42.602 1.00 49.85 ? 100  TRP A NE1   1 
ATOM   1419 C CE2   . TRP C 3 123 ? 12.790  27.822  -42.786 1.00 49.85 ? 100  TRP A CE2   1 
ATOM   1420 C CE3   . TRP C 3 123 ? 13.801  26.024  -44.056 1.00 49.85 ? 100  TRP A CE3   1 
ATOM   1421 C CZ2   . TRP C 3 123 ? 11.841  26.959  -42.228 1.00 49.85 ? 100  TRP A CZ2   1 
ATOM   1422 C CZ3   . TRP C 3 123 ? 12.857  25.166  -43.501 1.00 49.85 ? 100  TRP A CZ3   1 
ATOM   1423 C CH2   . TRP C 3 123 ? 11.891  25.639  -42.597 1.00 49.85 ? 100  TRP A CH2   1 
ATOM   1424 N N     . ARG C 3 124 ? 17.228  29.843  -47.708 1.00 49.85 ? 101  ARG A N     1 
ATOM   1425 C CA    . ARG C 3 124 ? 18.327  29.639  -48.660 1.00 49.85 ? 101  ARG A CA    1 
ATOM   1426 C C     . ARG C 3 124 ? 18.889  28.223  -48.510 1.00 49.85 ? 101  ARG A C     1 
ATOM   1427 O O     . ARG C 3 124 ? 19.990  28.026  -47.989 1.00 49.85 ? 101  ARG A O     1 
ATOM   1428 C CB    . ARG C 3 124 ? 19.429  30.694  -48.484 1.00 49.85 ? 101  ARG A CB    1 
ATOM   1429 C CG    . ARG C 3 124 ? 18.989  32.138  -48.717 1.00 49.85 ? 101  ARG A CG    1 
ATOM   1430 C CD    . ARG C 3 124 ? 19.931  33.118  -48.023 1.00 49.85 ? 101  ARG A CD    1 
ATOM   1431 N NE    . ARG C 3 124 ? 21.332  32.853  -48.348 1.00 49.85 ? 101  ARG A NE    1 
ATOM   1432 C CZ    . ARG C 3 124 ? 22.374  33.312  -47.659 1.00 49.85 ? 101  ARG A CZ    1 
ATOM   1433 N NH1   . ARG C 3 124 ? 22.196  34.074  -46.585 1.00 49.85 ? 101  ARG A NH1   1 
ATOM   1434 N NH2   . ARG C 3 124 ? 23.606  33.005  -48.048 1.00 49.85 ? 101  ARG A NH2   1 
ATOM   1435 N N     . VAL C 3 125 ? 18.116  27.245  -48.974 1.00 49.85 ? 102  VAL A N     1 
ATOM   1436 C CA    . VAL C 3 125 ? 18.442  25.831  -48.779 1.00 49.85 ? 102  VAL A CA    1 
ATOM   1437 C C     . VAL C 3 125 ? 19.331  25.289  -49.903 1.00 49.85 ? 102  VAL A C     1 
ATOM   1438 O O     . VAL C 3 125 ? 19.007  25.432  -51.085 1.00 49.85 ? 102  VAL A O     1 
ATOM   1439 C CB    . VAL C 3 125 ? 17.155  24.964  -48.647 1.00 49.85 ? 102  VAL A CB    1 
ATOM   1440 C CG1   . VAL C 3 125 ? 17.499  23.525  -48.268 1.00 49.85 ? 102  VAL A CG1   1 
ATOM   1441 C CG2   . VAL C 3 125 ? 16.195  25.568  -47.623 1.00 49.85 ? 102  VAL A CG2   1 
ATOM   1442 N N     . GLU C 3 126 ? 20.448  24.671  -49.520 1.00 49.85 ? 103  GLU A N     1 
ATOM   1443 C CA    . GLU C 3 126 ? 21.351  24.024  -50.474 1.00 49.85 ? 103  GLU A CA    1 
ATOM   1444 C C     . GLU C 3 126 ? 21.048  22.532  -50.611 1.00 49.85 ? 103  GLU A C     1 
ATOM   1445 O O     . GLU C 3 126 ? 21.019  22.001  -51.724 1.00 49.85 ? 103  GLU A O     1 
ATOM   1446 C CB    . GLU C 3 126 ? 22.818  24.229  -50.076 1.00 49.85 ? 103  GLU A CB    1 
ATOM   1447 C CG    . GLU C 3 126 ? 23.821  23.723  -51.117 1.00 49.85 ? 103  GLU A CG    1 
ATOM   1448 C CD    . GLU C 3 126 ? 25.200  23.448  -50.537 1.00 49.85 ? 103  GLU A CD    1 
ATOM   1449 O OE1   . GLU C 3 126 ? 25.742  24.326  -49.829 1.00 49.85 ? 103  GLU A OE1   1 
ATOM   1450 O OE2   . GLU C 3 126 ? 25.745  22.350  -50.792 1.00 49.85 ? 103  GLU A OE2   1 
ATOM   1451 N N     . MET C 3 127 ? 20.826  21.864  -49.480 1.00 49.85 ? 104  MET A N     1 
ATOM   1452 C CA    . MET C 3 127 ? 20.545  20.430  -49.480 1.00 49.85 ? 104  MET A CA    1 
ATOM   1453 C C     . MET C 3 127 ? 19.337  20.058  -48.620 1.00 49.85 ? 104  MET A C     1 
ATOM   1454 O O     . MET C 3 127 ? 19.113  20.639  -47.556 1.00 49.85 ? 104  MET A O     1 
ATOM   1455 C CB    . MET C 3 127 ? 21.780  19.632  -49.047 1.00 49.85 ? 104  MET A CB    1 
ATOM   1456 C CG    . MET C 3 127 ? 21.695  18.147  -49.368 1.00 49.85 ? 104  MET A CG    1 
ATOM   1457 S SD    . MET C 3 127 ? 23.219  17.253  -49.038 1.00 49.85 ? 104  MET A SD    1 
ATOM   1458 C CE    . MET C 3 127 ? 22.726  15.590  -49.480 1.00 49.85 ? 104  MET A CE    1 
ATOM   1459 N N     . LEU C 3 128 ? 18.571  19.082  -49.100 1.00 49.85 ? 105  LEU A N     1 
ATOM   1460 C CA    . LEU C 3 128 ? 17.384  18.596  -48.411 1.00 49.85 ? 105  LEU A CA    1 
ATOM   1461 C C     . LEU C 3 128 ? 17.368  17.070  -48.409 1.00 49.85 ? 105  LEU A C     1 
ATOM   1462 O O     . LEU C 3 128 ? 17.474  16.444  -49.466 1.00 49.85 ? 105  LEU A O     1 
ATOM   1463 C CB    . LEU C 3 128 ? 16.124  19.152  -49.082 1.00 49.85 ? 105  LEU A CB    1 
ATOM   1464 C CG    . LEU C 3 128 ? 14.739  18.782  -48.544 1.00 49.85 ? 105  LEU A CG    1 
ATOM   1465 C CD1   . LEU C 3 128 ? 13.829  19.988  -48.607 1.00 49.85 ? 105  LEU A CD1   1 
ATOM   1466 C CD2   . LEU C 3 128 ? 14.132  17.610  -49.307 1.00 49.85 ? 105  LEU A CD2   1 
ATOM   1467 N N     . THR C 3 129 ? 17.236  16.479  -47.223 1.00 49.85 ? 106  THR A N     1 
ATOM   1468 C CA    . THR C 3 129 ? 17.232  15.019  -47.082 1.00 49.85 ? 106  THR A CA    1 
ATOM   1469 C C     . THR C 3 129 ? 15.980  14.497  -46.383 1.00 49.85 ? 106  THR A C     1 
ATOM   1470 O O     . THR C 3 129 ? 15.428  15.156  -45.498 1.00 49.85 ? 106  THR A O     1 
ATOM   1471 C CB    . THR C 3 129 ? 18.460  14.513  -46.304 1.00 49.85 ? 106  THR A CB    1 
ATOM   1472 O OG1   . THR C 3 129 ? 18.477  15.106  -45.001 1.00 49.85 ? 106  THR A OG1   1 
ATOM   1473 C CG2   . THR C 3 129 ? 19.753  14.849  -47.041 1.00 49.85 ? 106  THR A CG2   1 
ATOM   1474 N N     . PHE C 3 130 ? 15.547  13.306  -46.793 1.00 49.85 ? 107  PHE A N     1 
ATOM   1475 C CA    . PHE C 3 130 ? 14.403  12.628  -46.184 1.00 49.85 ? 107  PHE A CA    1 
ATOM   1476 C C     . PHE C 3 130 ? 14.417  11.124  -46.452 1.00 49.85 ? 107  PHE A C     1 
ATOM   1477 O O     . PHE C 3 130 ? 15.061  10.655  -47.394 1.00 49.85 ? 107  PHE A O     1 
ATOM   1478 C CB    . PHE C 3 130 ? 13.075  13.254  -46.643 1.00 49.85 ? 107  PHE A CB    1 
ATOM   1479 C CG    . PHE C 3 130 ? 12.818  13.147  -48.123 1.00 49.85 ? 107  PHE A CG    1 
ATOM   1480 C CD1   . PHE C 3 130 ? 12.006  12.138  -48.626 1.00 49.85 ? 107  PHE A CD1   1 
ATOM   1481 C CD2   . PHE C 3 130 ? 13.381  14.058  -49.013 1.00 49.85 ? 107  PHE A CD2   1 
ATOM   1482 C CE1   . PHE C 3 130 ? 11.758  12.031  -49.993 1.00 49.85 ? 107  PHE A CE1   1 
ATOM   1483 C CE2   . PHE C 3 130 ? 13.142  13.961  -50.384 1.00 49.85 ? 107  PHE A CE2   1 
ATOM   1484 C CZ    . PHE C 3 130 ? 12.327  12.945  -50.874 1.00 49.85 ? 107  PHE A CZ    1 
ATOM   1485 N N     . GLU C 3 131 ? 13.702  10.379  -45.613 1.00 49.85 ? 108  GLU A N     1 
ATOM   1486 C CA    . GLU C 3 131 ? 13.567  8.933   -45.758 1.00 49.85 ? 108  GLU A CA    1 
ATOM   1487 C C     . GLU C 3 131 ? 12.522  8.605   -46.824 1.00 49.85 ? 108  GLU A C     1 
ATOM   1488 O O     . GLU C 3 131 ? 11.466  9.239   -46.881 1.00 49.85 ? 108  GLU A O     1 
ATOM   1489 C CB    . GLU C 3 131 ? 13.172  8.312   -44.417 1.00 49.85 ? 108  GLU A CB    1 
ATOM   1490 C CG    . GLU C 3 131 ? 13.425  6.815   -44.297 1.00 49.85 ? 108  GLU A CG    1 
ATOM   1491 C CD    . GLU C 3 131 ? 12.995  6.262   -42.948 1.00 49.85 ? 108  GLU A CD    1 
ATOM   1492 O OE1   . GLU C 3 131 ? 11.781  6.279   -42.651 1.00 49.85 ? 108  GLU A OE1   1 
ATOM   1493 O OE2   . GLU C 3 131 ? 13.869  5.807   -42.183 1.00 49.85 ? 108  GLU A OE2   1 
ATOM   1494 N N     . THR C 3 132 ? 12.823  7.616   -47.663 1.00 49.85 ? 109  THR A N     1 
ATOM   1495 C CA    . THR C 3 132 ? 11.917  7.198   -48.736 1.00 49.85 ? 109  THR A CA    1 
ATOM   1496 C C     . THR C 3 132 ? 10.711  6.439   -48.196 1.00 49.85 ? 109  THR A C     1 
ATOM   1497 O O     . THR C 3 132 ? 10.811  5.733   -47.190 1.00 49.85 ? 109  THR A O     1 
ATOM   1498 C CB    . THR C 3 132 ? 12.622  6.303   -49.781 1.00 49.85 ? 109  THR A CB    1 
ATOM   1499 O OG1   . THR C 3 132 ? 13.234  5.184   -49.125 1.00 49.85 ? 109  THR A OG1   1 
ATOM   1500 C CG2   . THR C 3 132 ? 13.677  7.084   -50.549 1.00 49.85 ? 109  THR A CG2   1 
ATOM   1501 N N     . ASP C 3 133 ? 9.575   6.592   -48.872 1.00 49.85 ? 110  ASP A N     1 
ATOM   1502 C CA    . ASP C 3 133 ? 8.356   5.872   -48.522 1.00 49.85 ? 110  ASP A CA    1 
ATOM   1503 C C     . ASP C 3 133 ? 7.609   5.429   -49.777 1.00 49.85 ? 110  ASP A C     1 
ATOM   1504 O O     . ASP C 3 133 ? 7.467   6.198   -50.729 1.00 49.85 ? 110  ASP A O     1 
ATOM   1505 C CB    . ASP C 3 133 ? 7.455   6.734   -47.635 1.00 49.85 ? 110  ASP A CB    1 
ATOM   1506 C CG    . ASP C 3 133 ? 6.410   5.917   -46.892 1.00 49.85 ? 110  ASP A CG    1 
ATOM   1507 O OD1   . ASP C 3 133 ? 6.757   4.854   -46.331 1.00 49.85 ? 110  ASP A OD1   1 
ATOM   1508 O OD2   . ASP C 3 133 ? 5.237   6.340   -46.868 1.00 49.85 ? 110  ASP A OD2   1 
ATOM   1509 N N     . ILE C 3 134 ? 7.135   4.187   -49.766 1.00 49.85 ? 111  ILE A N     1 
ATOM   1510 C CA    . ILE C 3 134 ? 6.488   3.581   -50.935 1.00 49.85 ? 111  ILE A CA    1 
ATOM   1511 C C     . ILE C 3 134 ? 5.030   4.013   -51.135 1.00 49.85 ? 111  ILE A C     1 
ATOM   1512 O O     . ILE C 3 134 ? 4.487   3.886   -52.236 1.00 49.85 ? 111  ILE A O     1 
ATOM   1513 C CB    . ILE C 3 134 ? 6.556   2.029   -50.895 1.00 49.85 ? 111  ILE A CB    1 
ATOM   1514 C CG1   . ILE C 3 134 ? 5.810   1.484   -49.672 1.00 49.85 ? 111  ILE A CG1   1 
ATOM   1515 C CG2   . ILE C 3 134 ? 8.008   1.551   -50.922 1.00 49.85 ? 111  ILE A CG2   1 
ATOM   1516 C CD1   . ILE C 3 134 ? 4.988   0.251   -49.958 1.00 49.85 ? 111  ILE A CD1   1 
ATOM   1517 N N     . GLU C 3 135 ? 4.409   4.519   -50.070 1.00 49.85 ? 112  GLU A N     1 
ATOM   1518 C CA    . GLU C 3 135 ? 2.984   4.866   -50.067 1.00 49.85 ? 112  GLU A CA    1 
ATOM   1519 C C     . GLU C 3 135 ? 2.614   5.867   -51.166 1.00 49.85 ? 112  GLU A C     1 
ATOM   1520 O O     . GLU C 3 135 ? 3.391   6.780   -51.455 1.00 49.85 ? 112  GLU A O     1 
ATOM   1521 C CB    . GLU C 3 135 ? 2.562   5.393   -48.690 1.00 49.85 ? 112  GLU A CB    1 
ATOM   1522 C CG    . GLU C 3 135 ? 2.565   4.331   -47.589 1.00 49.85 ? 112  GLU A CG    1 
ATOM   1523 C CD    . GLU C 3 135 ? 2.125   4.859   -46.232 1.00 49.85 ? 112  GLU A CD    1 
ATOM   1524 O OE1   . GLU C 3 135 ? 1.510   5.946   -46.164 1.00 49.85 ? 112  GLU A OE1   1 
ATOM   1525 O OE2   . GLU C 3 135 ? 2.397   4.174   -45.223 1.00 49.85 ? 112  GLU A OE2   1 
ATOM   1526 N N     . PRO C 3 136 ? 1.425   5.697   -51.781 1.00 49.85 ? 113  PRO A N     1 
ATOM   1527 C CA    . PRO C 3 136 ? 0.979   6.523   -52.909 1.00 49.85 ? 113  PRO A CA    1 
ATOM   1528 C C     . PRO C 3 136 ? 1.003   8.021   -52.618 1.00 49.85 ? 113  PRO A C     1 
ATOM   1529 O O     . PRO C 3 136 ? 1.389   8.805   -53.489 1.00 49.85 ? 113  PRO A O     1 
ATOM   1530 C CB    . PRO C 3 136 ? -0.461  6.055   -53.137 1.00 49.85 ? 113  PRO A CB    1 
ATOM   1531 C CG    . PRO C 3 136 ? -0.486  4.673   -52.623 1.00 49.85 ? 113  PRO A CG    1 
ATOM   1532 C CD    . PRO C 3 136 ? 0.414   4.685   -51.427 1.00 49.85 ? 113  PRO A CD    1 
ATOM   1533 N N     . TYR C 3 137 ? 0.596   8.407   -51.408 1.00 49.85 ? 114  TYR A N     1 
ATOM   1534 C CA    . TYR C 3 137 ? 0.595   9.811   -51.007 1.00 49.85 ? 114  TYR A CA    1 
ATOM   1535 C C     . TYR C 3 137 ? 2.002   10.401  -51.042 1.00 49.85 ? 114  TYR A C     1 
ATOM   1536 O O     . TYR C 3 137 ? 2.187   11.529  -51.497 1.00 49.85 ? 114  TYR A O     1 
ATOM   1537 C CB    . TYR C 3 137 ? -0.028  9.995   -49.618 1.00 49.85 ? 114  TYR A CB    1 
ATOM   1538 C CG    . TYR C 3 137 ? -0.275  11.445  -49.246 1.00 49.85 ? 114  TYR A CG    1 
ATOM   1539 C CD1   . TYR C 3 137 ? -1.448  12.092  -49.632 1.00 49.85 ? 114  TYR A CD1   1 
ATOM   1540 C CD2   . TYR C 3 137 ? 0.665   12.168  -48.509 1.00 49.85 ? 114  TYR A CD2   1 
ATOM   1541 C CE1   . TYR C 3 137 ? -1.682  13.421  -49.295 1.00 49.85 ? 114  TYR A CE1   1 
ATOM   1542 C CE2   . TYR C 3 137 ? 0.442   13.498  -48.167 1.00 49.85 ? 114  TYR A CE2   1 
ATOM   1543 C CZ    . TYR C 3 137 ? -0.734  14.118  -48.563 1.00 49.85 ? 114  TYR A CZ    1 
ATOM   1544 O OH    . TYR C 3 137 ? -0.964  15.434  -48.229 1.00 49.85 ? 114  TYR A OH    1 
ATOM   1545 N N     . SER C 3 138 ? 2.981   9.636   -50.564 1.00 49.85 ? 115  SER A N     1 
ATOM   1546 C CA    . SER C 3 138 ? 4.374   10.081  -50.555 1.00 49.85 ? 115  SER A CA    1 
ATOM   1547 C C     . SER C 3 138 ? 4.973   10.109  -51.960 1.00 49.85 ? 115  SER A C     1 
ATOM   1548 O O     . SER C 3 138 ? 5.635   11.075  -52.322 1.00 49.85 ? 115  SER A O     1 
ATOM   1549 C CB    . SER C 3 138 ? 5.230   9.225   -49.615 1.00 49.85 ? 115  SER A CB    1 
ATOM   1550 O OG    . SER C 3 138 ? 5.404   7.912   -50.117 1.00 49.85 ? 115  SER A OG    1 
ATOM   1551 N N     . VAL C 3 139 ? 4.736   9.055   -52.742 1.00 49.85 ? 116  VAL A N     1 
ATOM   1552 C CA    . VAL C 3 139 ? 5.267   8.962   -54.110 1.00 49.85 ? 116  VAL A CA    1 
ATOM   1553 C C     . VAL C 3 139 ? 4.990   10.240  -54.910 1.00 49.85 ? 116  VAL A C     1 
ATOM   1554 O O     . VAL C 3 139 ? 5.910   10.829  -55.486 1.00 49.85 ? 116  VAL A O     1 
ATOM   1555 C CB    . VAL C 3 139 ? 4.730   7.712   -54.860 1.00 49.85 ? 116  VAL A CB    1 
ATOM   1556 C CG1   . VAL C 3 139 ? 5.112   7.747   -56.337 1.00 49.85 ? 116  VAL A CG1   1 
ATOM   1557 C CG2   . VAL C 3 139 ? 5.258   6.441   -54.218 1.00 49.85 ? 116  VAL A CG2   1 
ATOM   1558 N N     . THR C 3 140 ? 3.725   10.659  -54.932 1.00 49.85 ? 117  THR A N     1 
ATOM   1559 C CA    . THR C 3 140 ? 3.308   11.879  -55.631 1.00 49.85 ? 117  THR A CA    1 
ATOM   1560 C C     . THR C 3 140 ? 3.850   13.143  -54.962 1.00 49.85 ? 117  THR A C     1 
ATOM   1561 O O     . THR C 3 140 ? 4.139   14.133  -55.637 1.00 49.85 ? 117  THR A O     1 
ATOM   1562 C CB    . THR C 3 140 ? 1.769   11.981  -55.742 1.00 49.85 ? 117  THR A CB    1 
ATOM   1563 O OG1   . THR C 3 140 ? 1.179   11.815  -54.446 1.00 49.85 ? 117  THR A OG1   1 
ATOM   1564 C CG2   . THR C 3 140 ? 1.221   10.917  -56.688 1.00 49.85 ? 117  THR A CG2   1 
ATOM   1565 N N     . ARG C 3 141 ? 3.981   13.094  -53.638 1.00 49.85 ? 118  ARG A N     1 
ATOM   1566 C CA    . ARG C 3 141 ? 4.503   14.208  -52.846 1.00 49.85 ? 118  ARG A CA    1 
ATOM   1567 C C     . ARG C 3 141 ? 6.016   14.360  -53.024 1.00 49.85 ? 118  ARG A C     1 
ATOM   1568 O O     . ARG C 3 141 ? 6.502   15.455  -53.306 1.00 49.85 ? 118  ARG A O     1 
ATOM   1569 C CB    . ARG C 3 141 ? 4.147   14.006  -51.369 1.00 49.85 ? 118  ARG A CB    1 
ATOM   1570 C CG    . ARG C 3 141 ? 4.715   15.039  -50.404 1.00 49.85 ? 118  ARG A CG    1 
ATOM   1571 C CD    . ARG C 3 141 ? 4.459   14.632  -48.954 1.00 49.85 ? 118  ARG A CD    1 
ATOM   1572 N NE    . ARG C 3 141 ? 5.135   13.382  -48.598 1.00 49.85 ? 118  ARG A NE    1 
ATOM   1573 C CZ    . ARG C 3 141 ? 4.987   12.741  -47.441 1.00 49.85 ? 118  ARG A CZ    1 
ATOM   1574 N NH1   . ARG C 3 141 ? 4.181   13.219  -46.500 1.00 49.85 ? 118  ARG A NH1   1 
ATOM   1575 N NH2   . ARG C 3 141 ? 5.648   11.613  -47.221 1.00 49.85 ? 118  ARG A NH2   1 
ATOM   1576 N N     . ASP C 3 142 ? 6.743   13.254  -52.860 1.00 49.85 ? 119  ASP A N     1 
ATOM   1577 C CA    . ASP C 3 142 ? 8.207   13.235  -52.963 1.00 49.85 ? 119  ASP A CA    1 
ATOM   1578 C C     . ASP C 3 142 ? 8.688   13.593  -54.369 1.00 49.85 ? 119  ASP A C     1 
ATOM   1579 O O     . ASP C 3 142 ? 9.737   14.223  -54.529 1.00 49.85 ? 119  ASP A O     1 
ATOM   1580 C CB    . ASP C 3 142 ? 8.769   11.862  -52.561 1.00 49.85 ? 119  ASP A CB    1 
ATOM   1581 C CG    . ASP C 3 142 ? 8.284   11.393  -51.190 1.00 49.85 ? 119  ASP A CG    1 
ATOM   1582 O OD1   . ASP C 3 142 ? 7.650   12.185  -50.458 1.00 49.85 ? 119  ASP A OD1   1 
ATOM   1583 O OD2   . ASP C 3 142 ? 8.541   10.220  -50.847 1.00 49.85 ? 119  ASP A OD2   1 
ATOM   1584 N N     . ALA C 3 143 ? 7.915   13.184  -55.376 1.00 49.85 ? 120  ALA A N     1 
ATOM   1585 C CA    . ALA C 3 143 ? 8.206   13.516  -56.769 1.00 49.85 ? 120  ALA A CA    1 
ATOM   1586 C C     . ALA C 3 143 ? 8.077   15.020  -57.009 1.00 49.85 ? 120  ALA A C     1 
ATOM   1587 O O     . ALA C 3 143 ? 9.001   15.647  -57.529 1.00 49.85 ? 120  ALA A O     1 
ATOM   1588 C CB    . ALA C 3 143 ? 7.293   12.739  -57.709 1.00 49.85 ? 120  ALA A CB    1 
ATOM   1589 N N     . ALA C 3 144 ? 6.932   15.584  -56.622 1.00 49.85 ? 121  ALA A N     1 
ATOM   1590 C CA    . ALA C 3 144 ? 6.656   17.017  -56.773 1.00 49.85 ? 121  ALA A CA    1 
ATOM   1591 C C     . ALA C 3 144 ? 7.656   17.907  -56.027 1.00 49.85 ? 121  ALA A C     1 
ATOM   1592 O O     . ALA C 3 144 ? 7.948   19.025  -56.463 1.00 49.85 ? 121  ALA A O     1 
ATOM   1593 C CB    . ALA C 3 144 ? 5.233   17.329  -56.330 1.00 49.85 ? 121  ALA A CB    1 
ATOM   1594 N N     . VAL C 3 145 ? 8.173   17.403  -54.908 1.00 49.85 ? 122  VAL A N     1 
ATOM   1595 C CA    . VAL C 3 145 ? 9.160   18.125  -54.106 1.00 49.85 ? 122  VAL A CA    1 
ATOM   1596 C C     . VAL C 3 145 ? 10.535  18.109  -54.782 1.00 49.85 ? 122  VAL A C     1 
ATOM   1597 O O     . VAL C 3 145 ? 11.212  19.141  -54.852 1.00 49.85 ? 122  VAL A O     1 
ATOM   1598 C CB    . VAL C 3 145 ? 9.247   17.558  -52.662 1.00 49.85 ? 122  VAL A CB    1 
ATOM   1599 C CG1   . VAL C 3 145 ? 10.400  18.188  -51.885 1.00 49.85 ? 122  VAL A CG1   1 
ATOM   1600 C CG2   . VAL C 3 145 ? 7.938   17.785  -51.925 1.00 49.85 ? 122  VAL A CG2   1 
ATOM   1601 N N     . GLN C 3 146 ? 10.935  16.941  -55.279 1.00 49.85 ? 123  GLN A N     1 
ATOM   1602 C CA    . GLN C 3 146 ? 12.249  16.771  -55.899 1.00 49.85 ? 123  GLN A CA    1 
ATOM   1603 C C     . GLN C 3 146 ? 12.349  17.471  -57.260 1.00 49.85 ? 123  GLN A C     1 
ATOM   1604 O O     . GLN C 3 146 ? 13.432  17.919  -57.653 1.00 49.85 ? 123  GLN A O     1 
ATOM   1605 C CB    . GLN C 3 146 ? 12.605  15.287  -56.017 1.00 49.85 ? 123  GLN A CB    1 
ATOM   1606 C CG    . GLN C 3 146 ? 14.103  15.002  -55.947 1.00 49.85 ? 123  GLN A CG    1 
ATOM   1607 C CD    . GLN C 3 146 ? 14.425  13.593  -55.468 1.00 49.85 ? 123  GLN A CD    1 
ATOM   1608 O OE1   . GLN C 3 146 ? 15.554  13.121  -55.615 1.00 49.85 ? 123  GLN A OE1   1 
ATOM   1609 N NE2   . GLN C 3 146 ? 13.435  12.915  -54.893 1.00 49.85 ? 123  GLN A NE2   1 
ATOM   1610 N N     . LYS C 3 147 ? 11.222  17.561  -57.968 1.00 49.85 ? 124  LYS A N     1 
ATOM   1611 C CA    . LYS C 3 147 ? 11.155  18.296  -59.233 1.00 49.85 ? 124  LYS A CA    1 
ATOM   1612 C C     . LYS C 3 147 ? 11.391  19.786  -58.999 1.00 49.85 ? 124  LYS A C     1 
ATOM   1613 O O     . LYS C 3 147 ? 12.137  20.426  -59.743 1.00 49.85 ? 124  LYS A O     1 
ATOM   1614 C CB    . LYS C 3 147 ? 9.808   18.079  -59.937 1.00 49.85 ? 124  LYS A CB    1 
ATOM   1615 C CG    . LYS C 3 147 ? 9.533   16.644  -60.400 1.00 49.85 ? 124  LYS A CG    1 
ATOM   1616 C CD    . LYS C 3 147 ? 10.389  16.223  -61.594 1.00 49.85 ? 124  LYS A CD    1 
ATOM   1617 C CE    . LYS C 3 147 ? 10.139  14.761  -61.955 1.00 49.85 ? 124  LYS A CE    1 
ATOM   1618 N NZ    . LYS C 3 147 ? 10.878  14.340  -63.180 1.00 49.85 ? 124  LYS A NZ    1 
ATOM   1619 N N     . LEU C 3 148 ? 10.752  20.322  -57.958 1.00 49.85 ? 125  LEU A N     1 
ATOM   1620 C CA    . LEU C 3 148 ? 10.889  21.729  -57.576 1.00 49.85 ? 125  LEU A CA    1 
ATOM   1621 C C     . LEU C 3 148 ? 12.290  22.038  -57.047 1.00 49.85 ? 125  LEU A C     1 
ATOM   1622 O O     . LEU C 3 148 ? 12.796  23.150  -57.220 1.00 49.85 ? 125  LEU A O     1 
ATOM   1623 C CB    . LEU C 3 148 ? 9.834   22.102  -56.529 1.00 49.85 ? 125  LEU A CB    1 
ATOM   1624 C CG    . LEU C 3 148 ? 9.685   23.578  -56.142 1.00 49.85 ? 125  LEU A CG    1 
ATOM   1625 C CD1   . LEU C 3 148 ? 8.861   24.351  -57.170 1.00 49.85 ? 125  LEU A CD1   1 
ATOM   1626 C CD2   . LEU C 3 148 ? 9.060   23.691  -54.764 1.00 49.85 ? 125  LEU A CD2   1 
ATOM   1627 N N     . ALA C 3 149 ? 12.903  21.047  -56.403 1.00 49.85 ? 126  ALA A N     1 
ATOM   1628 C CA    . ALA C 3 149 ? 14.269  21.166  -55.896 1.00 49.85 ? 126  ALA A CA    1 
ATOM   1629 C C     . ALA C 3 149 ? 15.270  21.339  -57.036 1.00 49.85 ? 126  ALA A C     1 
ATOM   1630 O O     . ALA C 3 149 ? 16.245  22.082  -56.904 1.00 49.85 ? 126  ALA A O     1 
ATOM   1631 C CB    . ALA C 3 149 ? 14.625  19.955  -55.054 1.00 49.85 ? 126  ALA A CB    1 
ATOM   1632 N N     . LYS C 3 150 ? 15.014  20.650  -58.149 1.00 49.85 ? 127  LYS A N     1 
ATOM   1633 C CA    . LYS C 3 150 ? 15.822  20.766  -59.366 1.00 49.85 ? 127  LYS A CA    1 
ATOM   1634 C C     . LYS C 3 150 ? 15.681  22.153  -60.000 1.00 49.85 ? 127  LYS A C     1 
ATOM   1635 O O     . LYS C 3 150 ? 16.630  22.668  -60.600 1.00 49.85 ? 127  LYS A O     1 
ATOM   1636 C CB    . LYS C 3 150 ? 15.433  19.671  -60.372 1.00 49.85 ? 127  LYS A CB    1 
ATOM   1637 C CG    . LYS C 3 150 ? 16.304  19.592  -61.630 1.00 49.85 ? 127  LYS A CG    1 
ATOM   1638 C CD    . LYS C 3 150 ? 17.684  19.009  -61.345 1.00 49.85 ? 127  LYS A CD    1 
ATOM   1639 C CE    . LYS C 3 150 ? 18.516  18.922  -62.616 1.00 49.85 ? 127  LYS A CE    1 
ATOM   1640 N NZ    . LYS C 3 150 ? 19.896  18.438  -62.344 1.00 49.85 ? 127  LYS A NZ    1 
ATOM   1641 N N     . ALA C 3 151 ? 14.496  22.745  -59.861 1.00 49.85 ? 128  ALA A N     1 
ATOM   1642 C CA    . ALA C 3 151 ? 14.217  24.081  -60.384 1.00 49.85 ? 128  ALA A CA    1 
ATOM   1643 C C     . ALA C 3 151 ? 14.892  25.183  -59.563 1.00 49.85 ? 128  ALA A C     1 
ATOM   1644 O O     . ALA C 3 151 ? 15.414  26.148  -60.127 1.00 49.85 ? 128  ALA A O     1 
ATOM   1645 C CB    . ALA C 3 151 ? 12.711  24.319  -60.467 1.00 49.85 ? 128  ALA A CB    1 
ATOM   1646 N N     . GLU C 3 152 ? 14.880  25.034  -58.239 1.00 49.85 ? 129  GLU A N     1 
ATOM   1647 C CA    . GLU C 3 152 ? 15.426  26.052  -57.335 1.00 49.85 ? 129  GLU A CA    1 
ATOM   1648 C C     . GLU C 3 152 ? 16.893  25.817  -56.972 1.00 49.85 ? 129  GLU A C     1 
ATOM   1649 O O     . GLU C 3 152 ? 17.447  26.513  -56.114 1.00 49.85 ? 129  GLU A O     1 
ATOM   1650 C CB    . GLU C 3 152 ? 14.569  26.163  -56.066 1.00 49.85 ? 129  GLU A CB    1 
ATOM   1651 C CG    . GLU C 3 152 ? 13.185  26.762  -56.295 1.00 49.85 ? 129  GLU A CG    1 
ATOM   1652 C CD    . GLU C 3 152 ? 13.237  28.226  -56.699 1.00 49.85 ? 129  GLU A CD    1 
ATOM   1653 O OE1   . GLU C 3 152 ? 13.571  29.072  -55.839 1.00 49.85 ? 129  GLU A OE1   1 
ATOM   1654 O OE2   . GLU C 3 152 ? 12.942  28.530  -57.877 1.00 49.85 ? 129  GLU A OE2   1 
ATOM   1655 N N     . GLY C 3 153 ? 17.513  24.839  -57.631 1.00 49.85 ? 130  GLY A N     1 
ATOM   1656 C CA    . GLY C 3 153 ? 18.917  24.502  -57.400 1.00 49.85 ? 130  GLY A CA    1 
ATOM   1657 C C     . GLY C 3 153 ? 19.171  23.994  -55.994 1.00 49.85 ? 130  GLY A C     1 
ATOM   1658 O O     . GLY C 3 153 ? 20.036  24.513  -55.283 1.00 49.85 ? 130  GLY A O     1 
ATOM   1659 N N     . VAL C 3 154 ? 18.408  22.976  -55.598 1.00 49.85 ? 131  VAL A N     1 
ATOM   1660 C CA    . VAL C 3 154 ? 18.532  22.369  -54.275 1.00 49.85 ? 131  VAL A CA    1 
ATOM   1661 C C     . VAL C 3 154 ? 18.916  20.898  -54.412 1.00 49.85 ? 131  VAL A C     1 
ATOM   1662 O O     . VAL C 3 154 ? 18.190  20.109  -55.025 1.00 49.85 ? 131  VAL A O     1 
ATOM   1663 C CB    . VAL C 3 154 ? 17.226  22.494  -53.446 1.00 49.85 ? 131  VAL A CB    1 
ATOM   1664 C CG1   . VAL C 3 154 ? 17.462  22.050  -52.007 1.00 49.85 ? 131  VAL A CG1   1 
ATOM   1665 C CG2   . VAL C 3 154 ? 16.691  23.923  -53.478 1.00 49.85 ? 131  VAL A CG2   1 
ATOM   1666 N N     . ARG C 3 155 ? 20.062  20.543  -53.836 1.00 49.85 ? 132  ARG A N     1 
ATOM   1667 C CA    . ARG C 3 155 ? 20.554  19.171  -53.851 1.00 49.85 ? 132  ARG A CA    1 
ATOM   1668 C C     . ARG C 3 155 ? 19.684  18.299  -52.954 1.00 49.85 ? 132  ARG A C     1 
ATOM   1669 O O     . ARG C 3 155 ? 19.384  18.670  -51.818 1.00 49.85 ? 132  ARG A O     1 
ATOM   1670 C CB    . ARG C 3 155 ? 22.007  19.127  -53.377 1.00 49.85 ? 132  ARG A CB    1 
ATOM   1671 C CG    . ARG C 3 155 ? 22.764  17.878  -53.785 1.00 49.85 ? 132  ARG A CG    1 
ATOM   1672 C CD    . ARG C 3 155 ? 23.954  17.645  -52.869 1.00 49.85 ? 132  ARG A CD    1 
ATOM   1673 N NE    . ARG C 3 155 ? 24.892  16.668  -53.417 1.00 49.85 ? 132  ARG A NE    1 
ATOM   1674 C CZ    . ARG C 3 155 ? 24.755  15.345  -53.330 1.00 49.85 ? 132  ARG A CZ    1 
ATOM   1675 N NH1   . ARG C 3 155 ? 23.708  14.809  -52.712 1.00 49.85 ? 132  ARG A NH1   1 
ATOM   1676 N NH2   . ARG C 3 155 ? 25.674  14.552  -53.868 1.00 49.85 ? 132  ARG A NH2   1 
ATOM   1677 N N     . VAL C 3 156 ? 19.279  17.142  -53.470 1.00 49.85 ? 133  VAL A N     1 
ATOM   1678 C CA    . VAL C 3 156 ? 18.444  16.210  -52.713 1.00 49.85 ? 133  VAL A CA    1 
ATOM   1679 C C     . VAL C 3 156 ? 18.993  14.790  -52.804 1.00 49.85 ? 133  VAL A C     1 
ATOM   1680 O O     . VAL C 3 156 ? 19.102  14.224  -53.896 1.00 49.85 ? 133  VAL A O     1 
ATOM   1681 C CB    . VAL C 3 156 ? 16.961  16.246  -53.180 1.00 49.85 ? 133  VAL A CB    1 
ATOM   1682 C CG1   . VAL C 3 156 ? 16.155  15.118  -52.542 1.00 49.85 ? 133  VAL A CG1   1 
ATOM   1683 C CG2   . VAL C 3 156 ? 16.328  17.587  -52.850 1.00 49.85 ? 133  VAL A CG2   1 
ATOM   1684 N N     . GLU C 3 157 ? 19.340  14.227  -51.650 1.00 49.85 ? 134  GLU A N     1 
ATOM   1685 C CA    . GLU C 3 157 ? 19.737  12.825  -51.564 1.00 49.85 ? 134  GLU A CA    1 
ATOM   1686 C C     . GLU C 3 157 ? 18.902  12.104  -50.508 1.00 49.85 ? 134  GLU A C     1 
ATOM   1687 O O     . GLU C 3 157 ? 18.959  12.431  -49.319 1.00 49.85 ? 134  GLU A O     1 
ATOM   1688 C CB    . GLU C 3 157 ? 21.236  12.687  -51.275 1.00 49.85 ? 134  GLU A CB    1 
ATOM   1689 C CG    . GLU C 3 157 ? 21.807  11.308  -51.607 1.00 49.85 ? 134  GLU A CG    1 
ATOM   1690 C CD    . GLU C 3 157 ? 23.260  11.145  -51.191 1.00 49.85 ? 134  GLU A CD    1 
ATOM   1691 O OE1   . GLU C 3 157 ? 24.039  12.117  -51.312 1.00 49.85 ? 134  GLU A OE1   1 
ATOM   1692 O OE2   . GLU C 3 157 ? 23.625  10.036  -50.742 1.00 49.85 ? 134  GLU A OE2   1 
ATOM   1693 N N     . THR C 3 158 ? 18.129  11.124  -50.966 1.00 49.85 ? 135  THR A N     1 
ATOM   1694 C CA    . THR C 3 158 ? 17.216  10.374  -50.110 1.00 49.85 ? 135  THR A CA    1 
ATOM   1695 C C     . THR C 3 158 ? 17.877  9.107   -49.575 1.00 49.85 ? 135  THR A C     1 
ATOM   1696 O O     . THR C 3 158 ? 18.828  8.593   -50.170 1.00 49.85 ? 135  THR A O     1 
ATOM   1697 C CB    . THR C 3 158 ? 15.925  9.984   -50.865 1.00 49.85 ? 135  THR A CB    1 
ATOM   1698 O OG1   . THR C 3 158 ? 16.220  8.978   -51.843 1.00 49.85 ? 135  THR A OG1   1 
ATOM   1699 C CG2   . THR C 3 158 ? 15.311  11.193  -51.558 1.00 49.85 ? 135  THR A CG2   1 
ATOM   1700 N N     . HIS C 3 159 ? 17.366  8.611   -48.452 1.00 49.85 ? 136  HIS A N     1 
ATOM   1701 C CA    . HIS C 3 159 ? 17.865  7.378   -47.849 1.00 49.85 ? 136  HIS A CA    1 
ATOM   1702 C C     . HIS C 3 159 ? 16.732  6.386   -47.607 1.00 49.85 ? 136  HIS A C     1 
ATOM   1703 O O     . HIS C 3 159 ? 15.577  6.777   -47.423 1.00 49.85 ? 136  HIS A O     1 
ATOM   1704 C CB    . HIS C 3 159 ? 18.611  7.678   -46.548 1.00 49.85 ? 136  HIS A CB    1 
ATOM   1705 C CG    . HIS C 3 159 ? 19.897  8.420   -46.747 1.00 49.85 ? 136  HIS A CG    1 
ATOM   1706 N ND1   . HIS C 3 159 ? 21.129  7.809   -46.660 1.00 49.85 ? 136  HIS A ND1   1 
ATOM   1707 C CD2   . HIS C 3 159 ? 20.141  9.721   -47.032 1.00 49.85 ? 136  HIS A CD2   1 
ATOM   1708 C CE1   . HIS C 3 159 ? 22.077  8.703   -46.881 1.00 49.85 ? 136  HIS A CE1   1 
ATOM   1709 N NE2   . HIS C 3 159 ? 21.504  9.870   -47.109 1.00 49.85 ? 136  HIS A NE2   1 
ATOM   1710 N N     . CYS C 3 160 ? 17.075  5.101   -47.611 1.00 49.85 ? 137  CYS A N     1 
ATOM   1711 C CA    . CYS C 3 160 ? 16.097  4.033   -47.449 1.00 49.85 ? 137  CYS A CA    1 
ATOM   1712 C C     . CYS C 3 160 ? 16.339  3.269   -46.148 1.00 49.85 ? 137  CYS A C     1 
ATOM   1713 O O     . CYS C 3 160 ? 17.112  2.308   -46.117 1.00 49.85 ? 137  CYS A O     1 
ATOM   1714 C CB    . CYS C 3 160 ? 16.153  3.093   -48.652 1.00 49.85 ? 137  CYS A CB    1 
ATOM   1715 S SG    . CYS C 3 160 ? 14.893  1.817   -48.639 1.00 49.85 ? 137  CYS A SG    1 
ATOM   1716 N N     . SER C 3 161 ? 15.673  3.702   -45.079 1.00 49.85 ? 138  SER A N     1 
ATOM   1717 C CA    . SER C 3 161 ? 15.926  3.164   -43.739 1.00 49.85 ? 138  SER A CA    1 
ATOM   1718 C C     . SER C 3 161 ? 14.674  2.798   -42.939 1.00 49.85 ? 138  SER A C     1 
ATOM   1719 O O     . SER C 3 161 ? 14.779  2.345   -41.796 1.00 49.85 ? 138  SER A O     1 
ATOM   1720 C CB    . SER C 3 161 ? 16.796  4.136   -42.935 1.00 49.85 ? 138  SER A CB    1 
ATOM   1721 O OG    . SER C 3 161 ? 16.201  5.417   -42.863 1.00 49.85 ? 138  SER A OG    1 
ATOM   1722 N N     . HIS C 3 162 ? 13.498  2.991   -43.531 1.00 49.85 ? 139  HIS A N     1 
ATOM   1723 C CA    . HIS C 3 162 ? 12.245  2.594   -42.890 1.00 49.85 ? 139  HIS A CA    1 
ATOM   1724 C C     . HIS C 3 162 ? 12.151  1.072   -42.828 1.00 49.85 ? 139  HIS A C     1 
ATOM   1725 O O     . HIS C 3 162 ? 11.801  0.503   -41.793 1.00 49.85 ? 139  HIS A O     1 
ATOM   1726 C CB    . HIS C 3 162 ? 11.044  3.184   -43.632 1.00 49.85 ? 139  HIS A CB    1 
ATOM   1727 C CG    . HIS C 3 162 ? 9.739   2.993   -42.921 1.00 49.85 ? 139  HIS A CG    1 
ATOM   1728 N ND1   . HIS C 3 162 ? 9.454   3.593   -41.713 1.00 49.85 ? 139  HIS A ND1   1 
ATOM   1729 C CD2   . HIS C 3 162 ? 8.642   2.272   -43.251 1.00 49.85 ? 139  HIS A CD2   1 
ATOM   1730 C CE1   . HIS C 3 162 ? 8.238   3.247   -41.328 1.00 49.85 ? 139  HIS A CE1   1 
ATOM   1731 N NE2   . HIS C 3 162 ? 7.723   2.446   -42.244 1.00 49.85 ? 139  HIS A NE2   1 
ATOM   1732 N N     . THR C 3 163 ? 12.469  0.427   -43.948 1.00 49.85 ? 140  THR A N     1 
ATOM   1733 C CA    . THR C 3 163 ? 12.541  -1.027  -44.028 1.00 49.85 ? 140  THR A CA    1 
ATOM   1734 C C     . THR C 3 163 ? 13.997  -1.478  -44.092 1.00 49.85 ? 140  THR A C     1 
ATOM   1735 O O     . THR C 3 163 ? 14.875  -0.713  -44.496 1.00 49.85 ? 140  THR A O     1 
ATOM   1736 C CB    . THR C 3 163 ? 11.785  -1.573  -45.260 1.00 49.85 ? 140  THR A CB    1 
ATOM   1737 O OG1   . THR C 3 163 ? 12.220  -0.884  -46.438 1.00 49.85 ? 140  THR A OG1   1 
ATOM   1738 C CG2   . THR C 3 163 ? 10.281  -1.397  -45.096 1.00 49.85 ? 140  THR A CG2   1 
ATOM   1739 N N     . ILE C 3 164 ? 14.239  -2.724  -43.690 1.00 49.85 ? 141  ILE A N     1 
ATOM   1740 C CA    . ILE C 3 164 ? 15.578  -3.317  -43.706 1.00 49.85 ? 141  ILE A CA    1 
ATOM   1741 C C     . ILE C 3 164 ? 16.093  -3.467  -45.140 1.00 49.85 ? 141  ILE A C     1 
ATOM   1742 O O     . ILE C 3 164 ? 17.237  -3.116  -45.436 1.00 49.85 ? 141  ILE A O     1 
ATOM   1743 C CB    . ILE C 3 164 ? 15.596  -4.685  -42.976 1.00 49.85 ? 141  ILE A CB    1 
ATOM   1744 C CG1   . ILE C 3 164 ? 15.004  -4.542  -41.571 1.00 49.85 ? 141  ILE A CG1   1 
ATOM   1745 C CG2   . ILE C 3 164 ? 17.015  -5.245  -42.904 1.00 49.85 ? 141  ILE A CG2   1 
ATOM   1746 C CD1   . ILE C 3 164 ? 14.411  -5.810  -41.010 1.00 49.85 ? 141  ILE A CD1   1 
ATOM   1747 N N     . TYR C 3 165 ? 15.241  -3.987  -46.019 1.00 49.85 ? 142  TYR A N     1 
ATOM   1748 C CA    . TYR C 3 165 ? 15.574  -4.143  -47.430 1.00 49.85 ? 142  TYR A CA    1 
ATOM   1749 C C     . TYR C 3 165 ? 14.772  -3.173  -48.290 1.00 49.85 ? 142  TYR A C     1 
ATOM   1750 O O     . TYR C 3 165 ? 13.583  -2.950  -48.046 1.00 49.85 ? 142  TYR A O     1 
ATOM   1751 C CB    . TYR C 3 165 ? 15.316  -5.581  -47.889 1.00 49.85 ? 142  TYR A CB    1 
ATOM   1752 C CG    . TYR C 3 165 ? 16.080  -6.630  -47.113 1.00 49.85 ? 142  TYR A CG    1 
ATOM   1753 C CD1   . TYR C 3 165 ? 17.414  -6.911  -47.409 1.00 49.85 ? 142  TYR A CD1   1 
ATOM   1754 C CD2   . TYR C 3 165 ? 15.469  -7.345  -46.084 1.00 49.85 ? 142  TYR A CD2   1 
ATOM   1755 C CE1   . TYR C 3 165 ? 18.120  -7.876  -46.698 1.00 49.85 ? 142  TYR A CE1   1 
ATOM   1756 C CE2   . TYR C 3 165 ? 16.167  -8.313  -45.366 1.00 49.85 ? 142  TYR A CE2   1 
ATOM   1757 C CZ    . TYR C 3 165 ? 17.491  -8.572  -45.679 1.00 49.85 ? 142  TYR A CZ    1 
ATOM   1758 O OH    . TYR C 3 165 ? 18.186  -9.527  -44.974 1.00 49.85 ? 142  TYR A OH    1 
ATOM   1759 N N     . ASN C 3 166 ? 15.430  -2.599  -49.295 1.00 49.85 ? 143  ASN A N     1 
ATOM   1760 C CA    . ASN C 3 166 ? 14.766  -1.730  -50.261 1.00 49.85 ? 143  ASN A CA    1 
ATOM   1761 C C     . ASN C 3 166 ? 13.854  -2.552  -51.172 1.00 49.85 ? 143  ASN A C     1 
ATOM   1762 O O     . ASN C 3 166 ? 14.322  -3.478  -51.839 1.00 49.85 ? 143  ASN A O     1 
ATOM   1763 C CB    . ASN C 3 166 ? 15.799  -0.953  -51.086 1.00 49.85 ? 143  ASN A CB    1 
ATOM   1764 C CG    . ASN C 3 166 ? 15.179  0.174   -51.903 1.00 49.85 ? 143  ASN A CG    1 
ATOM   1765 O OD1   . ASN C 3 166 ? 14.215  -0.026  -52.645 1.00 49.85 ? 143  ASN A OD1   1 
ATOM   1766 N ND2   . ASN C 3 166 ? 15.740  1.370   -51.770 1.00 49.85 ? 143  ASN A ND2   1 
ATOM   1767 N N     . PRO C 3 167 ? 12.549  -2.214  -51.202 1.00 49.85 ? 144  PRO A N     1 
ATOM   1768 C CA    . PRO C 3 167 ? 11.558  -2.967  -51.978 1.00 49.85 ? 144  PRO A CA    1 
ATOM   1769 C C     . PRO C 3 167 ? 11.895  -3.040  -53.468 1.00 49.85 ? 144  PRO A C     1 
ATOM   1770 O O     . PRO C 3 167 ? 11.691  -4.085  -54.092 1.00 49.85 ? 144  PRO A O     1 
ATOM   1771 C CB    . PRO C 3 167 ? 10.264  -2.174  -51.763 1.00 49.85 ? 144  PRO A CB    1 
ATOM   1772 C CG    . PRO C 3 167 ? 10.479  -1.424  -50.501 1.00 49.85 ? 144  PRO A CG    1 
ATOM   1773 C CD    . PRO C 3 167 ? 11.933  -1.080  -50.489 1.00 49.85 ? 144  PRO A CD    1 
ATOM   1774 N N     . GLU C 3 168 ? 12.405  -1.940  -54.021 1.00 49.85 ? 145  GLU A N     1 
ATOM   1775 C CA    . GLU C 3 168 ? 12.780  -1.873  -55.434 1.00 49.85 ? 145  GLU A CA    1 
ATOM   1776 C C     . GLU C 3 168 ? 13.886  -2.869  -55.785 1.00 49.85 ? 145  GLU A C     1 
ATOM   1777 O O     . GLU C 3 168 ? 13.830  -3.516  -56.832 1.00 49.85 ? 145  GLU A O     1 
ATOM   1778 C CB    . GLU C 3 168 ? 13.191  -0.451  -55.827 1.00 49.85 ? 145  GLU A CB    1 
ATOM   1779 C CG    . GLU C 3 168 ? 12.034  0.548   -55.833 1.00 49.85 ? 145  GLU A CG    1 
ATOM   1780 C CD    . GLU C 3 168 ? 12.361  1.855   -56.546 1.00 49.85 ? 145  GLU A CD    1 
ATOM   1781 O OE1   . GLU C 3 168 ? 13.491  2.004   -57.063 1.00 49.85 ? 145  GLU A OE1   1 
ATOM   1782 O OE2   . GLU C 3 168 ? 11.478  2.739   -56.590 1.00 49.85 ? 145  GLU A OE2   1 
ATOM   1783 N N     . LEU C 3 169 ? 14.879  -2.986  -54.905 1.00 49.85 ? 146  LEU A N     1 
ATOM   1784 C CA    . LEU C 3 169 ? 15.987  -3.925  -55.095 1.00 49.85 ? 146  LEU A CA    1 
ATOM   1785 C C     . LEU C 3 169 ? 15.531  -5.380  -54.972 1.00 49.85 ? 146  LEU A C     1 
ATOM   1786 O O     . LEU C 3 169 ? 16.061  -6.259  -55.655 1.00 49.85 ? 146  LEU A O     1 
ATOM   1787 C CB    . LEU C 3 169 ? 17.132  -3.634  -54.114 1.00 49.85 ? 146  LEU A CB    1 
ATOM   1788 C CG    . LEU C 3 169 ? 17.881  -2.296  -54.212 1.00 49.85 ? 146  LEU A CG    1 
ATOM   1789 C CD1   . LEU C 3 169 ? 18.823  -2.128  -53.030 1.00 49.85 ? 146  LEU A CD1   1 
ATOM   1790 C CD2   . LEU C 3 169 ? 18.647  -2.154  -55.525 1.00 49.85 ? 146  LEU A CD2   1 
ATOM   1791 N N     . VAL C 3 170 ? 14.552  -5.626  -54.102 1.00 49.85 ? 147  VAL A N     1 
ATOM   1792 C CA    . VAL C 3 170 ? 13.949  -6.954  -53.954 1.00 49.85 ? 147  VAL A CA    1 
ATOM   1793 C C     . VAL C 3 170 ? 13.178  -7.320  -55.225 1.00 49.85 ? 147  VAL A C     1 
ATOM   1794 O O     . VAL C 3 170 ? 13.291  -8.440  -55.731 1.00 49.85 ? 147  VAL A O     1 
ATOM   1795 C CB    . VAL C 3 170 ? 13.020  -7.033  -52.709 1.00 49.85 ? 147  VAL A CB    1 
ATOM   1796 C CG1   . VAL C 3 170 ? 12.350  -8.401  -52.606 1.00 49.85 ? 147  VAL A CG1   1 
ATOM   1797 C CG2   . VAL C 3 170 ? 13.803  -6.736  -51.437 1.00 49.85 ? 147  VAL A CG2   1 
ATOM   1798 N N     . ILE C 3 171 ? 12.401  -6.362  -55.728 1.00 49.85 ? 148  ILE A N     1 
ATOM   1799 C CA    . ILE C 3 171 ? 11.663  -6.508  -56.982 1.00 49.85 ? 148  ILE A CA    1 
ATOM   1800 C C     . ILE C 3 171 ? 12.625  -6.744  -58.153 1.00 49.85 ? 148  ILE A C     1 
ATOM   1801 O O     . ILE C 3 171 ? 12.404  -7.639  -58.977 1.00 49.85 ? 148  ILE A O     1 
ATOM   1802 C CB    . ILE C 3 171 ? 10.744  -5.275  -57.237 1.00 49.85 ? 148  ILE A CB    1 
ATOM   1803 C CG1   . ILE C 3 171 ? 9.521   -5.327  -56.312 1.00 49.85 ? 148  ILE A CG1   1 
ATOM   1804 C CG2   . ILE C 3 171 ? 10.305  -5.191  -58.703 1.00 49.85 ? 148  ILE A CG2   1 
ATOM   1805 C CD1   . ILE C 3 171 ? 8.759   -4.016  -56.198 1.00 49.85 ? 148  ILE A CD1   1 
ATOM   1806 N N     . ALA C 3 172 ? 13.688  -5.941  -58.210 1.00 49.85 ? 149  ALA A N     1 
ATOM   1807 C CA    . ALA C 3 172 ? 14.695  -6.035  -59.266 1.00 49.85 ? 149  ALA A CA    1 
ATOM   1808 C C     . ALA C 3 172 ? 15.323  -7.426  -59.342 1.00 49.85 ? 149  ALA A C     1 
ATOM   1809 O O     . ALA C 3 172 ? 15.338  -8.043  -60.409 1.00 49.85 ? 149  ALA A O     1 
ATOM   1810 C CB    . ALA C 3 172 ? 15.772  -4.969  -59.078 1.00 49.85 ? 149  ALA A CB    1 
ATOM   1811 N N     . LYS C 3 173 ? 15.830  -7.911  -58.209 1.00 49.85 ? 150  LYS A N     1 
ATOM   1812 C CA    . LYS C 3 173 ? 16.521  -9.203  -58.156 1.00 49.85 ? 150  LYS A CA    1 
ATOM   1813 C C     . LYS C 3 173 ? 15.590  -10.404 -58.330 1.00 49.85 ? 150  LYS A C     1 
ATOM   1814 O O     . LYS C 3 173 ? 16.051  -11.524 -58.564 1.00 49.85 ? 150  LYS A O     1 
ATOM   1815 C CB    . LYS C 3 173 ? 17.367  -9.333  -56.883 1.00 49.85 ? 150  LYS A CB    1 
ATOM   1816 C CG    . LYS C 3 173 ? 18.602  -8.445  -56.892 1.00 49.85 ? 150  LYS A CG    1 
ATOM   1817 C CD    . LYS C 3 173 ? 19.828  -9.170  -56.362 1.00 49.85 ? 150  LYS A CD    1 
ATOM   1818 C CE    . LYS C 3 173 ? 21.086  -8.344  -56.597 1.00 49.85 ? 150  LYS A CE    1 
ATOM   1819 N NZ    . LYS C 3 173 ? 22.317  -9.029  -56.119 1.00 49.85 ? 150  LYS A NZ    1 
ATOM   1820 N N     . ASN C 3 174 ? 14.285  -10.169 -58.216 1.00 49.85 ? 151  ASN A N     1 
ATOM   1821 C CA    . ASN C 3 174 ? 13.297  -11.168 -58.606 1.00 49.85 ? 151  ASN A CA    1 
ATOM   1822 C C     . ASN C 3 174 ? 12.715  -10.830 -59.984 1.00 49.85 ? 151  ASN A C     1 
ATOM   1823 O O     . ASN C 3 174 ? 11.506  -10.941 -60.221 1.00 49.85 ? 151  ASN A O     1 
ATOM   1824 C CB    . ASN C 3 174 ? 12.207  -11.324 -57.539 1.00 49.85 ? 151  ASN A CB    1 
ATOM   1825 C CG    . ASN C 3 174 ? 11.480  -12.659 -57.632 1.00 49.85 ? 151  ASN A CG    1 
ATOM   1826 O OD1   . ASN C 3 174 ? 12.096  -13.706 -57.844 1.00 49.85 ? 151  ASN A OD1   1 
ATOM   1827 N ND2   . ASN C 3 174 ? 10.162  -12.626 -57.472 1.00 49.85 ? 151  ASN A ND2   1 
ATOM   1828 N N     . LEU C 3 175 ? 13.612  -10.412 -60.880 1.00 49.85 ? 152  LEU A N     1 
ATOM   1829 C CA    . LEU C 3 175 ? 13.329  -10.186 -62.305 1.00 49.85 ? 152  LEU A CA    1 
ATOM   1830 C C     . LEU C 3 175 ? 12.238  -9.140  -62.581 1.00 49.85 ? 152  LEU A C     1 
ATOM   1831 O O     . LEU C 3 175 ? 11.367  -9.344  -63.433 1.00 49.85 ? 152  LEU A O     1 
ATOM   1832 C CB    . LEU C 3 175 ? 13.031  -11.515 -63.027 1.00 49.85 ? 152  LEU A CB    1 
ATOM   1833 C CG    . LEU C 3 175 ? 13.974  -12.707 -62.800 1.00 49.85 ? 152  LEU A CG    1 
ATOM   1834 C CD1   . LEU C 3 175 ? 13.382  -13.984 -63.389 1.00 49.85 ? 152  LEU A CD1   1 
ATOM   1835 C CD2   . LEU C 3 175 ? 15.375  -12.449 -63.355 1.00 49.85 ? 152  LEU A CD2   1 
ATOM   1836 N N     . GLY C 3 176 ? 12.296  -8.025  -61.857 1.00 49.85 ? 153  GLY A N     1 
ATOM   1837 C CA    . GLY C 3 176 ? 11.374  -6.909  -62.077 1.00 49.85 ? 153  GLY A CA    1 
ATOM   1838 C C     . GLY C 3 176 ? 9.960   -7.115  -61.561 1.00 49.85 ? 153  GLY A C     1 
ATOM   1839 O O     . GLY C 3 176 ? 9.042   -6.392  -61.955 1.00 49.85 ? 153  GLY A O     1 
ATOM   1840 N N     . LYS C 3 177 ? 9.782   -8.099  -60.681 1.00 49.85 ? 154  LYS A N     1 
ATOM   1841 C CA    . LYS C 3 177 ? 8.493   -8.342  -60.027 1.00 49.85 ? 154  LYS A CA    1 
ATOM   1842 C C     . LYS C 3 177 ? 8.648   -8.718  -58.553 1.00 49.85 ? 154  LYS A C     1 
ATOM   1843 O O     . LYS C 3 177 ? 9.696   -9.216  -58.134 1.00 49.85 ? 154  LYS A O     1 
ATOM   1844 C CB    . LYS C 3 177 ? 7.679   -9.407  -60.772 1.00 49.85 ? 154  LYS A CB    1 
ATOM   1845 C CG    . LYS C 3 177 ? 6.772   -8.836  -61.853 1.00 49.85 ? 154  LYS A CG    1 
ATOM   1846 C CD    . LYS C 3 177 ? 5.544   -9.705  -62.073 1.00 49.85 ? 154  LYS A CD    1 
ATOM   1847 C CE    . LYS C 3 177 ? 4.478   -8.956  -62.863 1.00 49.85 ? 154  LYS A CE    1 
ATOM   1848 N NZ    . LYS C 3 177 ? 3.212   -9.731  -62.986 1.00 49.85 ? 154  LYS A NZ    1 
ATOM   1849 N N     . ALA C 3 178 ? 7.593   -8.470  -57.779 1.00 49.85 ? 155  ALA A N     1 
ATOM   1850 C CA    . ALA C 3 178 ? 7.587   -8.738  -56.342 1.00 49.85 ? 155  ALA A CA    1 
ATOM   1851 C C     . ALA C 3 178 ? 7.138   -10.166 -56.043 1.00 49.85 ? 155  ALA A C     1 
ATOM   1852 O O     . ALA C 3 178 ? 6.184   -10.652 -56.655 1.00 49.85 ? 155  ALA A O     1 
ATOM   1853 C CB    . ALA C 3 178 ? 6.689   -7.738  -55.623 1.00 49.85 ? 155  ALA A CB    1 
ATOM   1854 N N     . PRO C 3 179 ? 7.826   -10.843 -55.101 1.00 49.85 ? 156  PRO A N     1 
ATOM   1855 C CA    . PRO C 3 179 ? 7.444   -12.196 -54.687 1.00 49.85 ? 156  PRO A CA    1 
ATOM   1856 C C     . PRO C 3 179 ? 6.077   -12.208 -54.008 1.00 49.85 ? 156  PRO A C     1 
ATOM   1857 O O     . PRO C 3 179 ? 5.848   -11.456 -53.059 1.00 49.85 ? 156  PRO A O     1 
ATOM   1858 C CB    . PRO C 3 179 ? 8.540   -12.585 -53.684 1.00 49.85 ? 156  PRO A CB    1 
ATOM   1859 C CG    . PRO C 3 179 ? 9.663   -11.633 -53.933 1.00 49.85 ? 156  PRO A CG    1 
ATOM   1860 C CD    . PRO C 3 179 ? 9.013   -10.366 -54.371 1.00 49.85 ? 156  PRO A CD    1 
ATOM   1861 N N     . ILE C 3 180 ? 5.180   -13.058 -54.499 1.00 49.85 ? 157  ILE A N     1 
ATOM   1862 C CA    . ILE C 3 180 ? 3.810   -13.119 -53.982 1.00 49.85 ? 157  ILE A CA    1 
ATOM   1863 C C     . ILE C 3 180 ? 3.614   -14.204 -52.914 1.00 49.85 ? 157  ILE A C     1 
ATOM   1864 O O     . ILE C 3 180 ? 2.490   -14.456 -52.469 1.00 49.85 ? 157  ILE A O     1 
ATOM   1865 C CB    . ILE C 3 180 ? 2.756   -13.237 -55.124 1.00 49.85 ? 157  ILE A CB    1 
ATOM   1866 C CG1   . ILE C 3 180 ? 3.044   -14.448 -56.023 1.00 49.85 ? 157  ILE A CG1   1 
ATOM   1867 C CG2   . ILE C 3 180 ? 2.706   -11.938 -55.934 1.00 49.85 ? 157  ILE A CG2   1 
ATOM   1868 C CD1   . ILE C 3 180 ? 2.025   -14.663 -57.139 1.00 49.85 ? 157  ILE A CD1   1 
ATOM   1869 N N     . THR C 3 181 ? 4.716   -14.837 -52.514 1.00 49.85 ? 158  THR A N     1 
ATOM   1870 C CA    . THR C 3 181 ? 4.727   -15.778 -51.391 1.00 49.85 ? 158  THR A CA    1 
ATOM   1871 C C     . THR C 3 181 ? 5.859   -15.446 -50.424 1.00 49.85 ? 158  THR A C     1 
ATOM   1872 O O     . THR C 3 181 ? 6.842   -14.809 -50.803 1.00 49.85 ? 158  THR A O     1 
ATOM   1873 C CB    . THR C 3 181 ? 4.853   -17.251 -51.849 1.00 49.85 ? 158  THR A CB    1 
ATOM   1874 O OG1   . THR C 3 181 ? 5.810   -17.352 -52.910 1.00 49.85 ? 158  THR A OG1   1 
ATOM   1875 C CG2   . THR C 3 181 ? 3.508   -17.786 -52.324 1.00 49.85 ? 158  THR A CG2   1 
ATOM   1876 N N     . TYR C 3 182 ? 5.707   -15.885 -49.177 1.00 49.85 ? 159  TYR A N     1 
ATOM   1877 C CA    . TYR C 3 182 ? 6.657   -15.574 -48.111 1.00 49.85 ? 159  TYR A CA    1 
ATOM   1878 C C     . TYR C 3 182 ? 7.982   -16.318 -48.263 1.00 49.85 ? 159  TYR A C     1 
ATOM   1879 O O     . TYR C 3 182 ? 9.051   -15.732 -48.075 1.00 49.85 ? 159  TYR A O     1 
ATOM   1880 C CB    . TYR C 3 182 ? 6.029   -15.873 -46.746 1.00 49.85 ? 159  TYR A CB    1 
ATOM   1881 C CG    . TYR C 3 182 ? 6.840   -15.403 -45.557 1.00 49.85 ? 159  TYR A CG    1 
ATOM   1882 C CD1   . TYR C 3 182 ? 6.814   -14.067 -45.151 1.00 49.85 ? 159  TYR A CD1   1 
ATOM   1883 C CD2   . TYR C 3 182 ? 7.629   -16.294 -44.833 1.00 49.85 ? 159  TYR A CD2   1 
ATOM   1884 C CE1   . TYR C 3 182 ? 7.557   -13.633 -44.057 1.00 49.85 ? 159  TYR A CE1   1 
ATOM   1885 C CE2   . TYR C 3 182 ? 8.375   -15.870 -43.740 1.00 49.85 ? 159  TYR A CE2   1 
ATOM   1886 C CZ    . TYR C 3 182 ? 8.334   -14.541 -43.357 1.00 49.85 ? 159  TYR A CZ    1 
ATOM   1887 O OH    . TYR C 3 182 ? 9.073   -14.126 -42.273 1.00 49.85 ? 159  TYR A OH    1 
ATOM   1888 N N     . GLN C 3 183 ? 7.904   -17.604 -48.601 1.00 49.85 ? 160  GLN A N     1 
ATOM   1889 C CA    . GLN C 3 183 ? 9.090   -18.455 -48.719 1.00 49.85 ? 160  GLN A CA    1 
ATOM   1890 C C     . GLN C 3 183 ? 9.961   -18.072 -49.913 1.00 49.85 ? 160  GLN A C     1 
ATOM   1891 O O     . GLN C 3 183 ? 11.184  -18.225 -49.870 1.00 49.85 ? 160  GLN A O     1 
ATOM   1892 C CB    . GLN C 3 183 ? 8.695   -19.933 -48.797 1.00 49.85 ? 160  GLN A CB    1 
ATOM   1893 C CG    . GLN C 3 183 ? 7.956   -20.461 -47.564 1.00 49.85 ? 160  GLN A CG    1 
ATOM   1894 C CD    . GLN C 3 183 ? 8.781   -20.385 -46.287 1.00 49.85 ? 160  GLN A CD    1 
ATOM   1895 O OE1   . GLN C 3 183 ? 9.964   -20.730 -46.270 1.00 49.85 ? 160  GLN A OE1   1 
ATOM   1896 N NE2   . GLN C 3 183 ? 8.153   -19.931 -45.208 1.00 49.85 ? 160  GLN A NE2   1 
ATOM   1897 N N     . LYS C 3 184 ? 9.323   -17.576 -50.971 1.00 49.85 ? 161  LYS A N     1 
ATOM   1898 C CA    . LYS C 3 184 ? 10.031  -17.057 -52.139 1.00 49.85 ? 161  LYS A CA    1 
ATOM   1899 C C     . LYS C 3 184 ? 10.702  -15.730 -51.790 1.00 49.85 ? 161  LYS A C     1 
ATOM   1900 O O     . LYS C 3 184 ? 11.823  -15.458 -52.226 1.00 49.85 ? 161  LYS A O     1 
ATOM   1901 C CB    . LYS C 3 184 ? 9.065   -16.875 -53.312 1.00 49.85 ? 161  LYS A CB    1 
ATOM   1902 C CG    . LYS C 3 184 ? 9.733   -16.612 -54.653 1.00 49.85 ? 161  LYS A CG    1 
ATOM   1903 C CD    . LYS C 3 184 ? 8.698   -16.275 -55.717 1.00 49.85 ? 161  LYS A CD    1 
ATOM   1904 C CE    . LYS C 3 184 ? 9.351   -15.987 -57.062 1.00 49.85 ? 161  LYS A CE    1 
ATOM   1905 N NZ    . LYS C 3 184 ? 8.355   -15.559 -58.085 1.00 49.85 ? 161  LYS A NZ    1 
ATOM   1906 N N     . PHE C 3 185 ? 10.002  -14.917 -51.000 1.00 49.85 ? 162  PHE A N     1 
ATOM   1907 C CA    . PHE C 3 185 ? 10.508  -13.629 -50.528 1.00 49.85 ? 162  PHE A CA    1 
ATOM   1908 C C     . PHE C 3 185 ? 11.786  -13.790 -49.699 1.00 49.85 ? 162  PHE A C     1 
ATOM   1909 O O     . PHE C 3 185 ? 12.731  -13.012 -49.853 1.00 49.85 ? 162  PHE A O     1 
ATOM   1910 C CB    . PHE C 3 185 ? 9.423   -12.897 -49.727 1.00 49.85 ? 162  PHE A CB    1 
ATOM   1911 C CG    . PHE C 3 185 ? 9.859   -11.568 -49.173 1.00 49.85 ? 162  PHE A CG    1 
ATOM   1912 C CD1   . PHE C 3 185 ? 9.954   -10.451 -49.997 1.00 49.85 ? 162  PHE A CD1   1 
ATOM   1913 C CD2   . PHE C 3 185 ? 10.172  -11.433 -47.823 1.00 49.85 ? 162  PHE A CD2   1 
ATOM   1914 C CE1   . PHE C 3 185 ? 10.357  -9.219  -49.487 1.00 49.85 ? 162  PHE A CE1   1 
ATOM   1915 C CE2   . PHE C 3 185 ? 10.575  -10.205 -47.304 1.00 49.85 ? 162  PHE A CE2   1 
ATOM   1916 C CZ    . PHE C 3 185 ? 10.667  -9.096  -48.139 1.00 49.85 ? 162  PHE A CZ    1 
ATOM   1917 N N     . LEU C 3 186 ? 11.800  -14.802 -48.829 1.00 49.85 ? 163  LEU A N     1 
ATOM   1918 C CA    . LEU C 3 186 ? 12.961  -15.115 -47.990 1.00 49.85 ? 163  LEU A CA    1 
ATOM   1919 C C     . LEU C 3 186 ? 14.206  -15.450 -48.811 1.00 49.85 ? 163  LEU A C     1 
ATOM   1920 O O     . LEU C 3 186 ? 15.321  -15.095 -48.424 1.00 49.85 ? 163  LEU A O     1 
ATOM   1921 C CB    . LEU C 3 186 ? 12.651  -16.277 -47.040 1.00 49.85 ? 163  LEU A CB    1 
ATOM   1922 C CG    . LEU C 3 186 ? 11.654  -16.080 -45.895 1.00 49.85 ? 163  LEU A CG    1 
ATOM   1923 C CD1   . LEU C 3 186 ? 11.364  -17.419 -45.234 1.00 49.85 ? 163  LEU A CD1   1 
ATOM   1924 C CD2   . LEU C 3 186 ? 12.161  -15.070 -44.869 1.00 49.85 ? 163  LEU A CD2   1 
ATOM   1925 N N     . GLY C 3 187 ? 14.003  -16.133 -49.937 1.00 49.85 ? 164  GLY A N     1 
ATOM   1926 C CA    . GLY C 3 187 ? 15.091  -16.502 -50.840 1.00 49.85 ? 164  GLY A CA    1 
ATOM   1927 C C     . GLY C 3 187 ? 15.729  -15.305 -51.521 1.00 49.85 ? 164  GLY A C     1 
ATOM   1928 O O     . GLY C 3 187 ? 16.934  -15.302 -51.782 1.00 49.85 ? 164  GLY A O     1 
ATOM   1929 N N     . ILE C 3 188 ? 14.917  -14.289 -51.805 1.00 49.85 ? 165  ILE A N     1 
ATOM   1930 C CA    . ILE C 3 188 ? 15.391  -13.074 -52.469 1.00 49.85 ? 165  ILE A CA    1 
ATOM   1931 C C     . ILE C 3 188 ? 16.149  -12.155 -51.503 1.00 49.85 ? 165  ILE A C     1 
ATOM   1932 O O     . ILE C 3 188 ? 17.175  -11.576 -51.870 1.00 49.85 ? 165  ILE A O     1 
ATOM   1933 C CB    . ILE C 3 188 ? 14.227  -12.297 -53.166 1.00 49.85 ? 165  ILE A CB    1 
ATOM   1934 C CG1   . ILE C 3 188 ? 13.387  -13.223 -54.063 1.00 49.85 ? 165  ILE A CG1   1 
ATOM   1935 C CG2   . ILE C 3 188 ? 14.750  -11.089 -53.954 1.00 49.85 ? 165  ILE A CG2   1 
ATOM   1936 C CD1   . ILE C 3 188 ? 14.158  -13.940 -55.178 1.00 49.85 ? 165  ILE A CD1   1 
ATOM   1937 N N     . VAL C 3 189 ? 15.647  -12.025 -50.276 1.00 49.85 ? 166  VAL A N     1 
ATOM   1938 C CA    . VAL C 3 189 ? 16.222  -11.079 -49.309 1.00 49.85 ? 166  VAL A CA    1 
ATOM   1939 C C     . VAL C 3 189 ? 17.518  -11.549 -48.638 1.00 49.85 ? 166  VAL A C     1 
ATOM   1940 O O     . VAL C 3 189 ? 18.374  -10.729 -48.295 1.00 49.85 ? 166  VAL A O     1 
ATOM   1941 C CB    . VAL C 3 189 ? 15.195  -10.611 -48.235 1.00 49.85 ? 166  VAL A CB    1 
ATOM   1942 C CG1   . VAL C 3 189 ? 14.080  -9.799  -48.879 1.00 49.85 ? 166  VAL A CG1   1 
ATOM   1943 C CG2   . VAL C 3 189 ? 14.635  -11.789 -47.442 1.00 49.85 ? 166  VAL A CG2   1 
ATOM   1944 N N     . GLU C 3 190 ? 17.657  -12.862 -48.457 1.00 49.85 ? 167  GLU A N     1 
ATOM   1945 C CA    . GLU C 3 190 ? 18.832  -13.432 -47.790 1.00 49.85 ? 167  GLU A CA    1 
ATOM   1946 C C     . GLU C 3 190 ? 20.118  -13.275 -48.611 1.00 49.85 ? 167  GLU A C     1 
ATOM   1947 O O     . GLU C 3 190 ? 21.221  -13.323 -48.061 1.00 49.85 ? 167  GLU A O     1 
ATOM   1948 C CB    . GLU C 3 190 ? 18.596  -14.900 -47.409 1.00 49.85 ? 167  GLU A CB    1 
ATOM   1949 C CG    . GLU C 3 190 ? 18.489  -15.867 -48.588 1.00 49.85 ? 167  GLU A CG    1 
ATOM   1950 C CD    . GLU C 3 190 ? 18.271  -17.314 -48.162 1.00 49.85 ? 167  GLU A CD    1 
ATOM   1951 O OE1   . GLU C 3 190 ? 18.286  -17.602 -46.943 1.00 49.85 ? 167  GLU A OE1   1 
ATOM   1952 O OE2   . GLU C 3 190 ? 18.084  -18.167 -49.055 1.00 49.85 ? 167  GLU A OE2   1 
ATOM   1953 N N     . GLN C 3 191 ? 19.966  -13.088 -49.921 1.00 49.85 ? 168  GLN A N     1 
ATOM   1954 C CA    . GLN C 3 191 ? 21.102  -12.823 -50.805 1.00 49.85 ? 168  GLN A CA    1 
ATOM   1955 C C     . GLN C 3 191 ? 21.263  -11.322 -51.098 1.00 49.85 ? 168  GLN A C     1 
ATOM   1956 O O     . GLN C 3 191 ? 21.642  -10.924 -52.204 1.00 49.85 ? 168  GLN A O     1 
ATOM   1957 C CB    . GLN C 3 191 ? 21.008  -13.653 -52.097 1.00 49.85 ? 168  GLN A CB    1 
ATOM   1958 C CG    . GLN C 3 191 ? 19.709  -13.496 -52.889 1.00 49.85 ? 168  GLN A CG    1 
ATOM   1959 C CD    . GLN C 3 191 ? 19.675  -14.362 -54.140 1.00 49.85 ? 168  GLN A CD    1 
ATOM   1960 O OE1   . GLN C 3 191 ? 19.701  -13.852 -55.260 1.00 49.85 ? 168  GLN A OE1   1 
ATOM   1961 N NE2   . GLN C 3 191 ? 19.618  -15.678 -53.953 1.00 49.85 ? 168  GLN A NE2   1 
ATOM   1962 N N     . LEU C 3 192 ? 20.970  -10.502 -50.090 1.00 49.85 ? 169  LEU A N     1 
ATOM   1963 C CA    . LEU C 3 192 ? 21.134  -9.051  -50.175 1.00 49.85 ? 169  LEU A CA    1 
ATOM   1964 C C     . LEU C 3 192 ? 21.879  -8.525  -48.952 1.00 49.85 ? 169  LEU A C     1 
ATOM   1965 O O     . LEU C 3 192 ? 21.746  -9.069  -47.852 1.00 49.85 ? 169  LEU A O     1 
ATOM   1966 C CB    . LEU C 3 192 ? 19.775  -8.353  -50.298 1.00 49.85 ? 169  LEU A CB    1 
ATOM   1967 C CG    . LEU C 3 192 ? 18.902  -8.634  -51.526 1.00 49.85 ? 169  LEU A CG    1 
ATOM   1968 C CD1   . LEU C 3 192 ? 17.496  -8.104  -51.305 1.00 49.85 ? 169  LEU A CD1   1 
ATOM   1969 C CD2   . LEU C 3 192 ? 19.506  -8.043  -52.794 1.00 49.85 ? 169  LEU A CD2   1 
ATOM   1970 N N     . LYS C 3 193 ? 22.660  -7.466  -49.151 1.00 49.85 ? 170  LYS A N     1 
ATOM   1971 C CA    . LYS C 3 193 ? 23.463  -6.880  -48.079 1.00 49.85 ? 170  LYS A CA    1 
ATOM   1972 C C     . LYS C 3 193 ? 22.600  -6.153  -47.054 1.00 49.85 ? 170  LYS A C     1 
ATOM   1973 O O     . LYS C 3 193 ? 21.744  -5.342  -47.414 1.00 49.85 ? 170  LYS A O     1 
ATOM   1974 C CB    . LYS C 3 193 ? 24.513  -5.922  -48.649 1.00 49.85 ? 170  LYS A CB    1 
ATOM   1975 C CG    . LYS C 3 193 ? 25.705  -6.605  -49.301 1.00 49.85 ? 170  LYS A CG    1 
ATOM   1976 C CD    . LYS C 3 193 ? 26.729  -5.579  -49.765 1.00 49.85 ? 170  LYS A CD    1 
ATOM   1977 C CE    . LYS C 3 193 ? 27.934  -6.245  -50.415 1.00 49.85 ? 170  LYS A CE    1 
ATOM   1978 N NZ    . LYS C 3 193 ? 28.933  -5.244  -50.889 1.00 49.85 ? 170  LYS A NZ    1 
ATOM   1979 N N     . VAL C 3 194 ? 22.833  -6.456  -45.779 1.00 49.85 ? 171  VAL A N     1 
ATOM   1980 C CA    . VAL C 3 194 ? 22.171  -5.761  -44.676 1.00 49.85 ? 171  VAL A CA    1 
ATOM   1981 C C     . VAL C 3 194 ? 22.929  -4.462  -44.396 1.00 49.85 ? 171  VAL A C     1 
ATOM   1982 O O     . VAL C 3 194 ? 24.109  -4.503  -44.038 1.00 49.85 ? 171  VAL A O     1 
ATOM   1983 C CB    . VAL C 3 194 ? 22.110  -6.630  -43.390 1.00 49.85 ? 171  VAL A CB    1 
ATOM   1984 C CG1   . VAL C 3 194 ? 21.377  -5.893  -42.271 1.00 49.85 ? 171  VAL A CG1   1 
ATOM   1985 C CG2   . VAL C 3 194 ? 21.440  -7.972  -43.670 1.00 49.85 ? 171  VAL A CG2   1 
ATOM   1986 N N     . PRO C 3 195 ? 22.254  -3.306  -44.559 1.00 49.85 ? 172  PRO A N     1 
ATOM   1987 C CA    . PRO C 3 195 ? 22.888  -1.993  -44.381 1.00 49.85 ? 172  PRO A CA    1 
ATOM   1988 C C     . PRO C 3 195 ? 23.379  -1.748  -42.954 1.00 49.85 ? 172  PRO A C     1 
ATOM   1989 O O     . PRO C 3 195 ? 22.878  -2.365  -42.010 1.00 49.85 ? 172  PRO A O     1 
ATOM   1990 C CB    . PRO C 3 195 ? 21.767  -1.007  -44.733 1.00 49.85 ? 172  PRO A CB    1 
ATOM   1991 C CG    . PRO C 3 195 ? 20.774  -1.804  -45.517 1.00 49.85 ? 172  PRO A CG    1 
ATOM   1992 C CD    . PRO C 3 195 ? 20.834  -3.174  -44.929 1.00 49.85 ? 172  PRO A CD    1 
ATOM   1993 N N     . LYS C 3 196 ? 24.354  -0.850  -42.815 1.00 49.85 ? 173  LYS A N     1 
ATOM   1994 C CA    . LYS C 3 196 ? 24.940  -0.520  -41.516 1.00 49.85 ? 173  LYS A CA    1 
ATOM   1995 C C     . LYS C 3 196 ? 23.968  0.278   -40.653 1.00 49.85 ? 173  LYS A C     1 
ATOM   1996 O O     . LYS C 3 196 ? 23.459  1.319   -41.073 1.00 49.85 ? 173  LYS A O     1 
ATOM   1997 C CB    . LYS C 3 196 ? 26.243  0.270   -41.687 1.00 49.85 ? 173  LYS A CB    1 
ATOM   1998 C CG    . LYS C 3 196 ? 27.406  -0.520  -42.287 1.00 49.85 ? 173  LYS A CG    1 
ATOM   1999 C CD    . LYS C 3 196 ? 28.698  0.302   -42.318 1.00 49.85 ? 173  LYS A CD    1 
ATOM   2000 C CE    . LYS C 3 196 ? 28.657  1.402   -43.377 1.00 49.85 ? 173  LYS A CE    1 
ATOM   2001 N NZ    . LYS C 3 196 ? 29.876  2.257   -43.342 1.00 49.85 ? 173  LYS A NZ    1 
ATOM   2002 N N     . VAL C 3 197 ? 23.718  -0.222  -39.447 1.00 49.85 ? 174  VAL A N     1 
ATOM   2003 C CA    . VAL C 3 197 ? 22.869  0.469   -38.486 1.00 49.85 ? 174  VAL A CA    1 
ATOM   2004 C C     . VAL C 3 197 ? 23.684  1.571   -37.816 1.00 49.85 ? 174  VAL A C     1 
ATOM   2005 O O     . VAL C 3 197 ? 24.692  1.299   -37.160 1.00 49.85 ? 174  VAL A O     1 
ATOM   2006 C CB    . VAL C 3 197 ? 22.289  -0.497  -37.424 1.00 49.85 ? 174  VAL A CB    1 
ATOM   2007 C CG1   . VAL C 3 197 ? 21.419  0.258   -36.429 1.00 49.85 ? 174  VAL A CG1   1 
ATOM   2008 C CG2   . VAL C 3 197 ? 21.488  -1.612  -38.089 1.00 49.85 ? 174  VAL A CG2   1 
ATOM   2009 N N     . LEU C 3 198 ? 23.240  2.812   -37.993 1.00 49.85 ? 175  LEU A N     1 
ATOM   2010 C CA    . LEU C 3 198 ? 23.953  3.973   -37.467 1.00 49.85 ? 175  LEU A CA    1 
ATOM   2011 C C     . LEU C 3 198 ? 23.494  4.343   -36.058 1.00 49.85 ? 175  LEU A C     1 
ATOM   2012 O O     . LEU C 3 198 ? 22.443  3.894   -35.597 1.00 49.85 ? 175  LEU A O     1 
ATOM   2013 C CB    . LEU C 3 198 ? 23.805  5.171   -38.414 1.00 49.85 ? 175  LEU A CB    1 
ATOM   2014 C CG    . LEU C 3 198 ? 24.361  5.043   -39.838 1.00 49.85 ? 175  LEU A CG    1 
ATOM   2015 C CD1   . LEU C 3 198 ? 23.971  6.253   -40.668 1.00 49.85 ? 175  LEU A CD1   1 
ATOM   2016 C CD2   . LEU C 3 198 ? 25.880  4.859   -39.844 1.00 49.85 ? 175  LEU A CD2   1 
ATOM   2017 N N     . GLY C 3 199 ? 24.295  5.162   -35.382 1.00 49.85 ? 176  GLY A N     1 
ATOM   2018 C CA    . GLY C 3 199 ? 23.971  5.629   -34.040 1.00 49.85 ? 176  GLY A CA    1 
ATOM   2019 C C     . GLY C 3 199 ? 23.290  6.983   -34.053 1.00 49.85 ? 176  GLY A C     1 
ATOM   2020 O O     . GLY C 3 199 ? 22.523  7.299   -34.966 1.00 49.85 ? 176  GLY A O     1 
ATOM   2021 N N     . VAL C 3 200 ? 23.579  7.781   -33.029 1.00 49.85 ? 177  VAL A N     1 
ATOM   2022 C CA    . VAL C 3 200 ? 23.012  9.118   -32.883 1.00 49.85 ? 177  VAL A CA    1 
ATOM   2023 C C     . VAL C 3 200 ? 23.998  10.160  -33.420 1.00 49.85 ? 177  VAL A C     1 
ATOM   2024 O O     . VAL C 3 200 ? 25.183  10.115  -33.084 1.00 49.85 ? 177  VAL A O     1 
ATOM   2025 C CB    . VAL C 3 200 ? 22.636  9.397   -31.401 1.00 49.85 ? 177  VAL A CB    1 
ATOM   2026 C CG1   . VAL C 3 200 ? 22.451  10.888  -31.129 1.00 49.85 ? 177  VAL A CG1   1 
ATOM   2027 C CG2   . VAL C 3 200 ? 21.381  8.624   -31.023 1.00 49.85 ? 177  VAL A CG2   1 
ATOM   2028 N N     . PRO C 3 201 ? 23.510  11.097  -34.260 1.00 49.85 ? 178  PRO A N     1 
ATOM   2029 C CA    . PRO C 3 201 ? 24.316  12.181  -34.836 1.00 49.85 ? 178  PRO A CA    1 
ATOM   2030 C C     . PRO C 3 201 ? 25.104  13.000  -33.808 1.00 49.85 ? 178  PRO A C     1 
ATOM   2031 O O     . PRO C 3 201 ? 24.781  12.987  -32.618 1.00 49.85 ? 178  PRO A O     1 
ATOM   2032 C CB    . PRO C 3 201 ? 23.268  13.066  -35.516 1.00 49.85 ? 178  PRO A CB    1 
ATOM   2033 C CG    . PRO C 3 201 ? 22.169  12.142  -35.857 1.00 49.85 ? 178  PRO A CG    1 
ATOM   2034 C CD    . PRO C 3 201 ? 22.111  11.165  -34.723 1.00 49.85 ? 178  PRO A CD    1 
ATOM   2035 N N     . GLU C 3 202 ? 26.129  13.704  -34.286 1.00 49.85 ? 179  GLU A N     1 
ATOM   2036 C CA    . GLU C 3 202 ? 27.006  14.520  -33.442 1.00 49.85 ? 179  GLU A CA    1 
ATOM   2037 C C     . GLU C 3 202 ? 26.283  15.723  -32.850 1.00 49.85 ? 179  GLU A C     1 
ATOM   2038 O O     . GLU C 3 202 ? 25.347  16.253  -33.449 1.00 49.85 ? 179  GLU A O     1 
ATOM   2039 C CB    . GLU C 3 202 ? 28.201  15.032  -34.251 1.00 49.85 ? 179  GLU A CB    1 
ATOM   2040 C CG    . GLU C 3 202 ? 29.088  13.963  -34.874 1.00 49.85 ? 179  GLU A CG    1 
ATOM   2041 C CD    . GLU C 3 202 ? 30.017  14.537  -35.935 1.00 49.85 ? 179  GLU A CD    1 
ATOM   2042 O OE1   . GLU C 3 202 ? 29.515  15.015  -36.978 1.00 49.85 ? 179  GLU A OE1   1 
ATOM   2043 O OE2   . GLU C 3 202 ? 31.250  14.510  -35.725 1.00 49.85 ? 179  GLU A OE2   1 
ATOM   2044 N N     . LYS C 3 203 ? 26.731  16.146  -31.670 1.00 49.85 ? 180  LYS A N     1 
ATOM   2045 C CA    . LYS C 3 203 ? 26.280  17.389  -31.054 1.00 49.85 ? 180  LYS A CA    1 
ATOM   2046 C C     . LYS C 3 203 ? 26.809  18.554  -31.893 1.00 49.85 ? 180  LYS A C     1 
ATOM   2047 O O     . LYS C 3 203 ? 28.021  18.714  -32.041 1.00 49.85 ? 180  LYS A O     1 
ATOM   2048 C CB    . LYS C 3 203 ? 26.795  17.465  -29.613 1.00 49.85 ? 180  LYS A CB    1 
ATOM   2049 C CG    . LYS C 3 203 ? 26.233  18.598  -28.765 1.00 49.85 ? 180  LYS A CG    1 
ATOM   2050 C CD    . LYS C 3 203 ? 26.392  18.280  -27.281 1.00 49.85 ? 180  LYS A CD    1 
ATOM   2051 C CE    . LYS C 3 203 ? 26.090  19.478  -26.396 1.00 49.85 ? 180  LYS A CE    1 
ATOM   2052 N NZ    . LYS C 3 203 ? 27.250  20.405  -26.298 1.00 49.85 ? 180  LYS A NZ    1 
ATOM   2053 N N     . LEU C 3 204 ? 25.896  19.355  -32.441 1.00 49.85 ? 181  LEU A N     1 
ATOM   2054 C CA    . LEU C 3 204 ? 26.251  20.428  -33.380 1.00 49.85 ? 181  LEU A CA    1 
ATOM   2055 C C     . LEU C 3 204 ? 27.249  21.438  -32.823 1.00 49.85 ? 181  LEU A C     1 
ATOM   2056 O O     . LEU C 3 204 ? 26.956  22.157  -31.861 1.00 49.85 ? 181  LEU A O     1 
ATOM   2057 C CB    . LEU C 3 204 ? 24.999  21.150  -33.892 1.00 49.85 ? 181  LEU A CB    1 
ATOM   2058 C CG    . LEU C 3 204 ? 24.261  20.520  -35.076 1.00 49.85 ? 181  LEU A CG    1 
ATOM   2059 C CD1   . LEU C 3 204 ? 22.902  21.173  -35.273 1.00 49.85 ? 181  LEU A CD1   1 
ATOM   2060 C CD2   . LEU C 3 204 ? 25.087  20.598  -36.356 1.00 49.85 ? 181  LEU A CD2   1 
ATOM   2061 N N     . LYS C 3 205 ? 28.426  21.480  -33.443 1.00 49.85 ? 182  LYS A N     1 
ATOM   2062 C CA    . LYS C 3 205 ? 29.475  22.426  -33.073 1.00 49.85 ? 182  LYS A CA    1 
ATOM   2063 C C     . LYS C 3 205 ? 29.243  23.756  -33.782 1.00 49.85 ? 182  LYS A C     1 
ATOM   2064 O O     . LYS C 3 205 ? 29.018  23.785  -34.996 1.00 49.85 ? 182  LYS A O     1 
ATOM   2065 C CB    . LYS C 3 205 ? 30.861  21.883  -33.436 1.00 49.85 ? 182  LYS A CB    1 
ATOM   2066 C CG    . LYS C 3 205 ? 31.148  20.458  -32.959 1.00 49.85 ? 182  LYS A CG    1 
ATOM   2067 C CD    . LYS C 3 205 ? 32.634  20.095  -33.076 1.00 49.85 ? 182  LYS A CD    1 
ATOM   2068 C CE    . LYS C 3 205 ? 33.133  20.066  -34.524 1.00 49.85 ? 182  LYS A CE    1 
ATOM   2069 N NZ    . LYS C 3 205 ? 32.520  18.973  -35.331 1.00 49.85 ? 182  LYS A NZ    1 
ATOM   2070 N N     . ASN C 3 206 ? 29.299  24.845  -33.016 1.00 49.85 ? 183  ASN A N     1 
ATOM   2071 C CA    . ASN C 3 206 ? 29.155  26.211  -33.543 1.00 49.85 ? 183  ASN A CA    1 
ATOM   2072 C C     . ASN C 3 206 ? 27.883  26.417  -34.375 1.00 49.85 ? 183  ASN A C     1 
ATOM   2073 O O     . ASN C 3 206 ? 27.944  26.739  -35.566 1.00 49.85 ? 183  ASN A O     1 
ATOM   2074 C CB    . ASN C 3 206 ? 30.405  26.626  -34.337 1.00 49.85 ? 183  ASN A CB    1 
ATOM   2075 C CG    . ASN C 3 206 ? 31.701  26.297  -33.610 1.00 49.85 ? 183  ASN A CG    1 
ATOM   2076 O OD1   . ASN C 3 206 ? 31.873  26.622  -32.432 1.00 49.85 ? 183  ASN A OD1   1 
ATOM   2077 N ND2   . ASN C 3 206 ? 32.621  25.646  -34.315 1.00 49.85 ? 183  ASN A ND2   1 
ATOM   2078 N N     . MET C 3 207 ? 26.735  26.226  -33.729 1.00 49.85 ? 184  MET A N     1 
ATOM   2079 C CA    . MET C 3 207 ? 25.437  26.335  -34.392 1.00 49.85 ? 184  MET A CA    1 
ATOM   2080 C C     . MET C 3 207 ? 24.490  27.267  -33.630 1.00 49.85 ? 184  MET A C     1 
ATOM   2081 O O     . MET C 3 207 ? 23.836  26.846  -32.670 1.00 49.85 ? 184  MET A O     1 
ATOM   2082 C CB    . MET C 3 207 ? 24.808  24.946  -34.571 1.00 49.85 ? 184  MET A CB    1 
ATOM   2083 C CG    . MET C 3 207 ? 23.478  24.930  -35.324 1.00 49.85 ? 184  MET A CG    1 
ATOM   2084 S SD    . MET C 3 207 ? 23.566  25.579  -37.006 1.00 49.85 ? 184  MET A SD    1 
ATOM   2085 C CE    . MET C 3 207 ? 24.703  24.423  -37.775 1.00 49.85 ? 184  MET A CE    1 
ATOM   2086 N N     . PRO C 3 208 ? 24.416  28.542  -34.056 1.00 49.85 ? 185  PRO A N     1 
ATOM   2087 C CA    . PRO C 3 208 ? 23.452  29.472  -33.472 1.00 49.85 ? 185  PRO A CA    1 
ATOM   2088 C C     . PRO C 3 208 ? 22.056  29.256  -34.053 1.00 49.85 ? 185  PRO A C     1 
ATOM   2089 O O     . PRO C 3 208 ? 21.914  28.610  -35.095 1.00 49.85 ? 185  PRO A O     1 
ATOM   2090 C CB    . PRO C 3 208 ? 23.999  30.838  -33.884 1.00 49.85 ? 185  PRO A CB    1 
ATOM   2091 C CG    . PRO C 3 208 ? 24.699  30.585  -35.173 1.00 49.85 ? 185  PRO A CG    1 
ATOM   2092 C CD    . PRO C 3 208 ? 25.234  29.179  -35.106 1.00 49.85 ? 185  PRO A CD    1 
ATOM   2093 N N     . THR C 3 209 ? 21.038  29.791  -33.383 1.00 49.85 ? 186  THR A N     1 
ATOM   2094 C CA    . THR C 3 209 ? 19.663  29.685  -33.869 1.00 49.85 ? 186  THR A CA    1 
ATOM   2095 C C     . THR C 3 209 ? 19.493  30.470  -35.165 1.00 49.85 ? 186  THR A C     1 
ATOM   2096 O O     . THR C 3 209 ? 19.834  31.655  -35.218 1.00 49.85 ? 186  THR A O     1 
ATOM   2097 C CB    . THR C 3 209 ? 18.629  30.178  -32.832 1.00 49.85 ? 186  THR A CB    1 
ATOM   2098 O OG1   . THR C 3 209 ? 19.006  31.473  -32.348 1.00 49.85 ? 186  THR A OG1   1 
ATOM   2099 C CG2   . THR C 3 209 ? 18.529  29.205  -31.666 1.00 49.85 ? 186  THR A CG2   1 
ATOM   2100 N N     . PRO C 3 210 ? 18.966  29.809  -36.216 1.00 49.85 ? 187  PRO A N     1 
ATOM   2101 C CA    . PRO C 3 210 ? 18.738  30.461  -37.504 1.00 49.85 ? 187  PRO A CA    1 
ATOM   2102 C C     . PRO C 3 210 ? 17.873  31.708  -37.340 1.00 49.85 ? 187  PRO A C     1 
ATOM   2103 O O     . PRO C 3 210 ? 16.868  31.659  -36.625 1.00 49.85 ? 187  PRO A O     1 
ATOM   2104 C CB    . PRO C 3 210 ? 17.991  29.395  -38.311 1.00 49.85 ? 187  PRO A CB    1 
ATOM   2105 C CG    . PRO C 3 210 ? 18.400  28.107  -37.702 1.00 49.85 ? 187  PRO A CG    1 
ATOM   2106 C CD    . PRO C 3 210 ? 18.554  28.393  -36.240 1.00 49.85 ? 187  PRO A CD    1 
ATOM   2107 N N     . PRO C 3 211 ? 18.262  32.820  -37.993 1.00 49.85 ? 188  PRO A N     1 
ATOM   2108 C CA    . PRO C 3 211 ? 17.536  34.085  -37.868 1.00 49.85 ? 188  PRO A CA    1 
ATOM   2109 C C     . PRO C 3 211 ? 16.077  33.938  -38.290 1.00 49.85 ? 188  PRO A C     1 
ATOM   2110 O O     . PRO C 3 211 ? 15.779  33.228  -39.254 1.00 49.85 ? 188  PRO A O     1 
ATOM   2111 C CB    . PRO C 3 211 ? 18.288  35.024  -38.822 1.00 49.85 ? 188  PRO A CB    1 
ATOM   2112 C CG    . PRO C 3 211 ? 19.063  34.124  -39.731 1.00 49.85 ? 188  PRO A CG    1 
ATOM   2113 C CD    . PRO C 3 211 ? 19.419  32.943  -38.897 1.00 49.85 ? 188  PRO A CD    1 
ATOM   2114 N N     . LYS C 3 212 ? 15.188  34.608  -37.563 1.00 49.85 ? 189  LYS A N     1 
ATOM   2115 C CA    . LYS C 3 212 ? 13.743  34.461  -37.743 1.00 49.85 ? 189  LYS A CA    1 
ATOM   2116 C C     . LYS C 3 212 ? 13.267  34.851  -39.144 1.00 49.85 ? 189  LYS A C     1 
ATOM   2117 O O     . LYS C 3 212 ? 13.550  35.953  -39.620 1.00 49.85 ? 189  LYS A O     1 
ATOM   2118 C CB    . LYS C 3 212 ? 12.989  35.261  -36.674 1.00 49.85 ? 189  LYS A CB    1 
ATOM   2119 C CG    . LYS C 3 212 ? 13.062  34.649  -35.279 1.00 49.85 ? 189  LYS A CG    1 
ATOM   2120 C CD    . LYS C 3 212 ? 12.270  35.453  -34.261 1.00 49.85 ? 189  LYS A CD    1 
ATOM   2121 C CE    . LYS C 3 212 ? 13.099  36.577  -33.661 1.00 49.85 ? 189  LYS A CE    1 
ATOM   2122 N NZ    . LYS C 3 212 ? 12.306  37.385  -32.694 1.00 49.85 ? 189  LYS A NZ    1 
ATOM   2123 N N     . ASP C 3 213 ? 12.546  33.938  -39.794 1.00 49.85 ? 190  ASP A N     1 
ATOM   2124 C CA    . ASP C 3 213 ? 12.007  34.188  -41.131 1.00 49.85 ? 190  ASP A CA    1 
ATOM   2125 C C     . ASP C 3 213 ? 10.747  35.064  -41.087 1.00 49.85 ? 190  ASP A C     1 
ATOM   2126 O O     . ASP C 3 213 ? 10.415  35.630  -40.044 1.00 49.85 ? 190  ASP A O     1 
ATOM   2127 C CB    . ASP C 3 213 ? 11.766  32.869  -41.892 1.00 49.85 ? 190  ASP A CB    1 
ATOM   2128 C CG    . ASP C 3 213 ? 10.637  32.023  -41.299 1.00 49.85 ? 190  ASP A CG    1 
ATOM   2129 O OD1   . ASP C 3 213 ? 9.964   32.458  -40.341 1.00 49.85 ? 190  ASP A OD1   1 
ATOM   2130 O OD2   . ASP C 3 213 ? 10.423  30.902  -41.806 1.00 49.85 ? 190  ASP A OD2   1 
ATOM   2131 N N     . GLU C 3 214 ? 10.055  35.165  -42.220 1.00 49.85 ? 191  GLU A N     1 
ATOM   2132 C CA    . GLU C 3 214 ? 8.841   35.979  -42.340 1.00 49.85 ? 191  GLU A CA    1 
ATOM   2133 C C     . GLU C 3 214 ? 7.724   35.531  -41.392 1.00 49.85 ? 191  GLU A C     1 
ATOM   2134 O O     . GLU C 3 214 ? 6.888   36.344  -40.986 1.00 49.85 ? 191  GLU A O     1 
ATOM   2135 C CB    . GLU C 3 214 ? 8.321   35.977  -43.784 1.00 49.85 ? 191  GLU A CB    1 
ATOM   2136 C CG    . GLU C 3 214 ? 9.343   36.388  -44.846 1.00 49.85 ? 191  GLU A CG    1 
ATOM   2137 C CD    . GLU C 3 214 ? 10.254  35.243  -45.268 1.00 49.85 ? 191  GLU A CD    1 
ATOM   2138 O OE1   . GLU C 3 214 ? 9.737   34.146  -45.582 1.00 49.85 ? 191  GLU A OE1   1 
ATOM   2139 O OE2   . GLU C 3 214 ? 11.488  35.445  -45.285 1.00 49.85 ? 191  GLU A OE2   1 
ATOM   2140 N N     . VAL C 3 215 ? 7.716   34.243  -41.048 1.00 49.85 ? 192  VAL A N     1 
ATOM   2141 C CA    . VAL C 3 215 ? 6.705   33.682  -40.149 1.00 49.85 ? 192  VAL A CA    1 
ATOM   2142 C C     . VAL C 3 215 ? 7.148   33.787  -38.688 1.00 49.85 ? 192  VAL A C     1 
ATOM   2143 O O     . VAL C 3 215 ? 6.349   34.132  -37.813 1.00 49.85 ? 192  VAL A O     1 
ATOM   2144 C CB    . VAL C 3 215 ? 6.377   32.207  -40.490 1.00 49.85 ? 192  VAL A CB    1 
ATOM   2145 C CG1   . VAL C 3 215 ? 5.098   31.768  -39.787 1.00 49.85 ? 192  VAL A CG1   1 
ATOM   2146 C CG2   . VAL C 3 215 ? 6.234   32.023  -41.991 1.00 49.85 ? 192  VAL A CG2   1 
ATOM   2147 N N     . GLU C 3 216 ? 8.422   33.489  -38.442 1.00 49.85 ? 193  GLU A N     1 
ATOM   2148 C CA    . GLU C 3 216 ? 8.998   33.522  -37.097 1.00 49.85 ? 193  GLU A CA    1 
ATOM   2149 C C     . GLU C 3 216 ? 9.076   34.934  -36.517 1.00 49.85 ? 193  GLU A C     1 
ATOM   2150 O O     . GLU C 3 216 ? 9.031   35.111  -35.297 1.00 49.85 ? 193  GLU A O     1 
ATOM   2151 C CB    . GLU C 3 216 ? 10.381  32.870  -37.091 1.00 49.85 ? 193  GLU A CB    1 
ATOM   2152 C CG    . GLU C 3 216 ? 10.362  31.354  -37.182 1.00 49.85 ? 193  GLU A CG    1 
ATOM   2153 C CD    . GLU C 3 216 ? 11.713  30.771  -37.557 1.00 49.85 ? 193  GLU A CD    1 
ATOM   2154 O OE1   . GLU C 3 216 ? 12.220  31.095  -38.653 1.00 49.85 ? 193  GLU A OE1   1 
ATOM   2155 O OE2   . GLU C 3 216 ? 12.268  29.987  -36.757 1.00 49.85 ? 193  GLU A OE2   1 
ATOM   2156 N N     . GLN C 3 217 ? 9.194   35.930  -37.394 1.00 49.85 ? 194  GLN A N     1 
ATOM   2157 C CA    . GLN C 3 217 ? 9.170   37.336  -36.986 1.00 49.85 ? 194  GLN A CA    1 
ATOM   2158 C C     . GLN C 3 217 ? 7.775   37.752  -36.520 1.00 49.85 ? 194  GLN A C     1 
ATOM   2159 O O     . GLN C 3 217 ? 7.636   38.518  -35.564 1.00 49.85 ? 194  GLN A O     1 
ATOM   2160 C CB    . GLN C 3 217 ? 9.630   38.245  -38.130 1.00 49.85 ? 194  GLN A CB    1 
ATOM   2161 C CG    . GLN C 3 217 ? 11.133  38.245  -38.375 1.00 49.85 ? 194  GLN A CG    1 
ATOM   2162 C CD    . GLN C 3 217 ? 11.519  38.962  -39.660 1.00 49.85 ? 194  GLN A CD    1 
ATOM   2163 O OE1   . GLN C 3 217 ? 11.174  40.128  -39.866 1.00 49.85 ? 194  GLN A OE1   1 
ATOM   2164 N NE2   . GLN C 3 217 ? 12.241  38.264  -40.532 1.00 49.85 ? 194  GLN A NE2   1 
ATOM   2165 N N     . LYS C 3 218 ? 6.752   37.240  -37.202 1.00 49.85 ? 195  LYS A N     1 
ATOM   2166 C CA    . LYS C 3 218 ? 5.360   37.569  -36.890 1.00 49.85 ? 195  LYS A CA    1 
ATOM   2167 C C     . LYS C 3 218 ? 4.814   36.737  -35.728 1.00 49.85 ? 195  LYS A C     1 
ATOM   2168 O O     . LYS C 3 218 ? 3.824   37.113  -35.098 1.00 49.85 ? 195  LYS A O     1 
ATOM   2169 C CB    . LYS C 3 218 ? 4.478   37.430  -38.136 1.00 49.85 ? 195  LYS A CB    1 
ATOM   2170 C CG    . LYS C 3 218 ? 4.788   38.464  -39.220 1.00 49.85 ? 195  LYS A CG    1 
ATOM   2171 C CD    . LYS C 3 218 ? 3.883   38.320  -40.434 1.00 49.85 ? 195  LYS A CD    1 
ATOM   2172 C CE    . LYS C 3 218 ? 4.210   39.374  -41.487 1.00 49.85 ? 195  LYS A CE    1 
ATOM   2173 N NZ    . LYS C 3 218 ? 3.292   39.310  -42.660 1.00 49.85 ? 195  LYS A NZ    1 
ATOM   2174 N N     . ASP C 3 219 ? 5.470   35.609  -35.458 1.00 49.85 ? 196  ASP A N     1 
ATOM   2175 C CA    . ASP C 3 219 ? 5.185   34.776  -34.289 1.00 49.85 ? 196  ASP A CA    1 
ATOM   2176 C C     . ASP C 3 219 ? 6.402   33.909  -33.982 1.00 49.85 ? 196  ASP A C     1 
ATOM   2177 O O     . ASP C 3 219 ? 6.794   33.072  -34.796 1.00 49.85 ? 196  ASP A O     1 
ATOM   2178 C CB    . ASP C 3 219 ? 3.949   33.898  -34.522 1.00 49.85 ? 196  ASP A CB    1 
ATOM   2179 C CG    . ASP C 3 219 ? 3.625   33.010  -33.328 1.00 49.85 ? 196  ASP A CG    1 
ATOM   2180 O OD1   . ASP C 3 219 ? 3.766   33.473  -32.174 1.00 49.85 ? 196  ASP A OD1   1 
ATOM   2181 O OD2   . ASP C 3 219 ? 3.226   31.845  -33.546 1.00 49.85 ? 196  ASP A OD2   1 
ATOM   2182 N N     . SER C 3 220 ? 6.996   34.115  -32.809 1.00 49.85 ? 197  SER A N     1 
ATOM   2183 C CA    . SER C 3 220 ? 8.218   33.405  -32.424 1.00 49.85 ? 197  SER A CA    1 
ATOM   2184 C C     . SER C 3 220 ? 7.991   31.903  -32.259 1.00 49.85 ? 197  SER A C     1 
ATOM   2185 O O     . SER C 3 220 ? 8.850   31.096  -32.623 1.00 49.85 ? 197  SER A O     1 
ATOM   2186 C CB    . SER C 3 220 ? 8.803   33.995  -31.139 1.00 49.85 ? 197  SER A CB    1 
ATOM   2187 O OG    . SER C 3 220 ? 7.928   33.792  -30.044 1.00 49.85 ? 197  SER A OG    1 
ATOM   2188 N N     . ALA C 3 221 ? 6.833   31.540  -31.714 1.00 49.85 ? 198  ALA A N     1 
ATOM   2189 C CA    . ALA C 3 221 ? 6.492   30.142  -31.463 1.00 49.85 ? 198  ALA A CA    1 
ATOM   2190 C C     . ALA C 3 221 ? 5.696   29.524  -32.617 1.00 49.85 ? 198  ALA A C     1 
ATOM   2191 O O     . ALA C 3 221 ? 4.815   28.688  -32.401 1.00 49.85 ? 198  ALA A O     1 
ATOM   2192 C CB    . ALA C 3 221 ? 5.730   30.018  -30.146 1.00 49.85 ? 198  ALA A CB    1 
ATOM   2193 N N     . ALA C 3 222 ? 6.016   29.939  -33.841 1.00 49.85 ? 199  ALA A N     1 
ATOM   2194 C CA    . ALA C 3 222 ? 5.287   29.500  -35.033 1.00 49.85 ? 199  ALA A CA    1 
ATOM   2195 C C     . ALA C 3 222 ? 5.600   28.062  -35.442 1.00 49.85 ? 199  ALA A C     1 
ATOM   2196 O O     . ALA C 3 222 ? 4.730   27.361  -35.962 1.00 49.85 ? 199  ALA A O     1 
ATOM   2197 C CB    . ALA C 3 222 ? 5.548   30.447  -36.195 1.00 49.85 ? 199  ALA A CB    1 
ATOM   2198 N N     . TYR C 3 223 ? 6.838   27.631  -35.209 1.00 49.85 ? 200  TYR A N     1 
ATOM   2199 C CA    . TYR C 3 223 ? 7.265   26.282  -35.577 1.00 49.85 ? 200  TYR A CA    1 
ATOM   2200 C C     . TYR C 3 223 ? 7.485   25.379  -34.363 1.00 49.85 ? 200  TYR A C     1 
ATOM   2201 O O     . TYR C 3 223 ? 8.203   24.379  -34.443 1.00 49.85 ? 200  TYR A O     1 
ATOM   2202 C CB    . TYR C 3 223 ? 8.525   26.331  -36.449 1.00 49.85 ? 200  TYR A CB    1 
ATOM   2203 C CG    . TYR C 3 223 ? 8.360   27.061  -37.767 1.00 49.85 ? 200  TYR A CG    1 
ATOM   2204 C CD1   . TYR C 3 223 ? 7.293   26.778  -38.621 1.00 49.85 ? 200  TYR A CD1   1 
ATOM   2205 C CD2   . TYR C 3 223 ? 9.276   28.033  -38.162 1.00 49.85 ? 200  TYR A CD2   1 
ATOM   2206 C CE1   . TYR C 3 223 ? 7.143   27.448  -39.832 1.00 49.85 ? 200  TYR A CE1   1 
ATOM   2207 C CE2   . TYR C 3 223 ? 9.135   28.708  -39.371 1.00 49.85 ? 200  TYR A CE2   1 
ATOM   2208 C CZ    . TYR C 3 223 ? 8.068   28.411  -40.199 1.00 49.85 ? 200  TYR A CZ    1 
ATOM   2209 O OH    . TYR C 3 223 ? 7.928   29.079  -41.395 1.00 49.85 ? 200  TYR A OH    1 
ATOM   2210 N N     . ASP C 3 224 ? 6.862   25.738  -33.243 1.00 49.85 ? 201  ASP A N     1 
ATOM   2211 C CA    . ASP C 3 224 ? 6.924   24.940  -32.020 1.00 49.85 ? 201  ASP A CA    1 
ATOM   2212 C C     . ASP C 3 224 ? 6.077   23.674  -32.128 1.00 49.85 ? 201  ASP A C     1 
ATOM   2213 O O     . ASP C 3 224 ? 5.279   23.529  -33.058 1.00 49.85 ? 201  ASP A O     1 
ATOM   2214 C CB    . ASP C 3 224 ? 6.474   25.772  -30.817 1.00 49.85 ? 201  ASP A CB    1 
ATOM   2215 C CG    . ASP C 3 224 ? 7.484   26.832  -30.427 1.00 49.85 ? 201  ASP A CG    1 
ATOM   2216 O OD1   . ASP C 3 224 ? 8.280   27.258  -31.291 1.00 49.85 ? 201  ASP A OD1   1 
ATOM   2217 O OD2   . ASP C 3 224 ? 7.481   27.241  -29.247 1.00 49.85 ? 201  ASP A OD2   1 
ATOM   2218 N N     . CYS C 3 225 ? 6.260   22.765  -31.171 1.00 49.85 ? 202  CYS A N     1 
ATOM   2219 C CA    . CYS C 3 225 ? 5.496   21.522  -31.111 1.00 49.85 ? 202  CYS A CA    1 
ATOM   2220 C C     . CYS C 3 225 ? 4.022   21.797  -30.843 1.00 49.85 ? 202  CYS A C     1 
ATOM   2221 O O     . CYS C 3 225 ? 3.690   22.522  -29.902 1.00 49.85 ? 202  CYS A O     1 
ATOM   2222 C CB    . CYS C 3 225 ? 6.051   20.596  -30.029 1.00 49.85 ? 202  CYS A CB    1 
ATOM   2223 S SG    . CYS C 3 225 ? 7.704   19.978  -30.366 1.00 49.85 ? 202  CYS A SG    1 
ATOM   2224 N N     . PRO C 3 226 ? 3.134   21.218  -31.672 1.00 49.85 ? 203  PRO A N     1 
ATOM   2225 C CA    . PRO C 3 226 ? 1.699   21.377  -31.458 1.00 49.85 ? 203  PRO A CA    1 
ATOM   2226 C C     . PRO C 3 226 ? 1.276   20.767  -30.128 1.00 49.85 ? 203  PRO A C     1 
ATOM   2227 O O     . PRO C 3 226 ? 1.646   19.632  -29.820 1.00 49.85 ? 203  PRO A O     1 
ATOM   2228 C CB    . PRO C 3 226 ? 1.076   20.608  -32.630 1.00 49.85 ? 203  PRO A CB    1 
ATOM   2229 C CG    . PRO C 3 226 ? 2.139   19.681  -33.101 1.00 49.85 ? 203  PRO A CG    1 
ATOM   2230 C CD    . PRO C 3 226 ? 3.428   20.388  -32.853 1.00 49.85 ? 203  PRO A CD    1 
ATOM   2231 N N     . THR C 3 227 ? 0.512   21.525  -29.350 1.00 49.85 ? 204  THR A N     1 
ATOM   2232 C CA    . THR C 3 227 ? 0.006   21.050  -28.067 1.00 49.85 ? 204  THR A CA    1 
ATOM   2233 C C     . THR C 3 227 ? -1.157  20.083  -28.276 1.00 49.85 ? 204  THR A C     1 
ATOM   2234 O O     . THR C 3 227 ? -1.678  19.958  -29.388 1.00 49.85 ? 204  THR A O     1 
ATOM   2235 C CB    . THR C 3 227 ? -0.439  22.219  -27.161 1.00 49.85 ? 204  THR A CB    1 
ATOM   2236 O OG1   . THR C 3 227 ? -1.351  23.064  -27.875 1.00 49.85 ? 204  THR A OG1   1 
ATOM   2237 C CG2   . THR C 3 227 ? 0.762   23.039  -26.708 1.00 49.85 ? 204  THR A CG2   1 
ATOM   2238 N N     . MET C 3 228 ? -1.555  19.402  -27.204 1.00 49.85 ? 205  MET A N     1 
ATOM   2239 C CA    . MET C 3 228 ? -2.685  18.473  -27.235 1.00 49.85 ? 205  MET A CA    1 
ATOM   2240 C C     . MET C 3 228 ? -3.948  19.110  -27.817 1.00 49.85 ? 205  MET A C     1 
ATOM   2241 O O     . MET C 3 228 ? -4.649  18.489  -28.620 1.00 49.85 ? 205  MET A O     1 
ATOM   2242 C CB    . MET C 3 228 ? -2.963  17.924  -25.834 1.00 49.85 ? 205  MET A CB    1 
ATOM   2243 C CG    . MET C 3 228 ? -2.025  16.805  -25.408 1.00 49.85 ? 205  MET A CG    1 
ATOM   2244 S SD    . MET C 3 228 ? -2.372  15.245  -26.245 1.00 49.85 ? 205  MET A SD    1 
ATOM   2245 C CE    . MET C 3 228 ? -3.847  14.715  -25.378 1.00 49.85 ? 205  MET A CE    1 
ATOM   2246 N N     . LYS C 3 229 ? -4.224  20.347  -27.406 1.00 49.85 ? 206  LYS A N     1 
ATOM   2247 C CA    . LYS C 3 229 ? -5.356  21.116  -27.924 1.00 49.85 ? 206  LYS A CA    1 
ATOM   2248 C C     . LYS C 3 229 ? -5.210  21.419  -29.416 1.00 49.85 ? 206  LYS A C     1 
ATOM   2249 O O     . LYS C 3 229 ? -6.194  21.396  -30.157 1.00 49.85 ? 206  LYS A O     1 
ATOM   2250 C CB    . LYS C 3 229 ? -5.524  22.420  -27.137 1.00 49.85 ? 206  LYS A CB    1 
ATOM   2251 C CG    . LYS C 3 229 ? -6.242  22.262  -25.808 1.00 49.85 ? 206  LYS A CG    1 
ATOM   2252 C CD    . LYS C 3 229 ? -6.308  23.583  -25.052 1.00 49.85 ? 206  LYS A CD    1 
ATOM   2253 C CE    . LYS C 3 229 ? -7.410  23.575  -23.997 1.00 49.85 ? 206  LYS A CE    1 
ATOM   2254 N NZ    . LYS C 3 229 ? -7.222  22.523  -22.953 1.00 49.85 ? 206  LYS A NZ    1 
ATOM   2255 N N     . GLN C 3 230 ? -3.978  21.697  -29.843 1.00 49.85 ? 207  GLN A N     1 
ATOM   2256 C CA    . GLN C 3 230 ? -3.681  22.033  -31.236 1.00 49.85 ? 207  GLN A CA    1 
ATOM   2257 C C     . GLN C 3 230 ? -3.801  20.844  -32.182 1.00 49.85 ? 207  GLN A C     1 
ATOM   2258 O O     . GLN C 3 230 ? -4.014  21.024  -33.383 1.00 49.85 ? 207  GLN A O     1 
ATOM   2259 C CB    . GLN C 3 230 ? -2.274  22.622  -31.360 1.00 49.85 ? 207  GLN A CB    1 
ATOM   2260 C CG    . GLN C 3 230 ? -2.157  24.086  -30.978 1.00 49.85 ? 207  GLN A CG    1 
ATOM   2261 C CD    . GLN C 3 230 ? -0.844  24.699  -31.432 1.00 49.85 ? 207  GLN A CD    1 
ATOM   2262 O OE1   . GLN C 3 230 ? -0.460  24.587  -32.598 1.00 49.85 ? 207  GLN A OE1   1 
ATOM   2263 N NE2   . GLN C 3 230 ? -0.147  25.354  -30.510 1.00 49.85 ? 207  GLN A NE2   1 
ATOM   2264 N N     . LEU C 3 231 ? -3.664  19.636  -31.641 1.00 49.85 ? 208  LEU A N     1 
ATOM   2265 C CA    . LEU C 3 231 ? -3.583  18.435  -32.467 1.00 49.85 ? 208  LEU A CA    1 
ATOM   2266 C C     . LEU C 3 231 ? -4.791  17.512  -32.317 1.00 49.85 ? 208  LEU A C     1 
ATOM   2267 O O     . LEU C 3 231 ? -5.376  17.085  -33.314 1.00 49.85 ? 208  LEU A O     1 
ATOM   2268 C CB    . LEU C 3 231 ? -2.279  17.685  -32.180 1.00 49.85 ? 208  LEU A CB    1 
ATOM   2269 C CG    . LEU C 3 231 ? -1.577  17.030  -33.371 1.00 49.85 ? 208  LEU A CG    1 
ATOM   2270 C CD1   . LEU C 3 231 ? -1.112  18.067  -34.392 1.00 49.85 ? 208  LEU A CD1   1 
ATOM   2271 C CD2   . LEU C 3 231 ? -0.404  16.197  -32.897 1.00 49.85 ? 208  LEU A CD2   1 
ATOM   2272 N N     . VAL C 3 232 ? -5.159  17.206  -31.074 1.00 49.85 ? 209  VAL A N     1 
ATOM   2273 C CA    . VAL C 3 232 ? -6.321  16.363  -30.799 1.00 49.85 ? 209  VAL A CA    1 
ATOM   2274 C C     . VAL C 3 232 ? -7.577  17.229  -30.732 1.00 49.85 ? 209  VAL A C     1 
ATOM   2275 O O     . VAL C 3 232 ? -7.758  18.006  -29.789 1.00 49.85 ? 209  VAL A O     1 
ATOM   2276 C CB    . VAL C 3 232 ? -6.160  15.551  -29.488 1.00 49.85 ? 209  VAL A CB    1 
ATOM   2277 C CG1   . VAL C 3 232 ? -7.362  14.640  -29.269 1.00 49.85 ? 209  VAL A CG1   1 
ATOM   2278 C CG2   . VAL C 3 232 ? -4.880  14.732  -29.514 1.00 49.85 ? 209  VAL A CG2   1 
ATOM   2279 N N     . LYS C 3 233 ? -8.436  17.089  -31.738 1.00 49.85 ? 210  LYS A N     1 
ATOM   2280 C CA    . LYS C 3 233 ? -9.660  17.884  -31.827 1.00 49.85 ? 210  LYS A CA    1 
ATOM   2281 C C     . LYS C 3 233 ? -10.768 17.370  -30.911 1.00 49.85 ? 210  LYS A C     1 
ATOM   2282 O O     . LYS C 3 233 ? -11.566 18.156  -30.398 1.00 49.85 ? 210  LYS A O     1 
ATOM   2283 C CB    . LYS C 3 233 ? -10.153 17.970  -33.274 1.00 49.85 ? 210  LYS A CB    1 
ATOM   2284 C CG    . LYS C 3 233 ? -9.375  18.961  -34.127 1.00 49.85 ? 210  LYS A CG    1 
ATOM   2285 C CD    . LYS C 3 233 ? -10.023 19.162  -35.490 1.00 49.85 ? 210  LYS A CD    1 
ATOM   2286 C CE    . LYS C 3 233 ? -9.316  20.260  -36.277 1.00 49.85 ? 210  LYS A CE    1 
ATOM   2287 N NZ    . LYS C 3 233 ? -9.991  20.551  -37.573 1.00 49.85 ? 210  LYS A NZ    1 
ATOM   2288 N N     . ARG C 3 234 ? -10.814 16.056  -30.707 1.00 49.85 ? 211  ARG A N     1 
ATOM   2289 C CA    . ARG C 3 234 ? -11.828 15.454  -29.843 1.00 49.85 ? 211  ARG A CA    1 
ATOM   2290 C C     . ARG C 3 234 ? -11.204 14.608  -28.728 1.00 49.85 ? 211  ARG A C     1 
ATOM   2291 O O     . ARG C 3 234 ? -11.020 13.398  -28.890 1.00 49.85 ? 211  ARG A O     1 
ATOM   2292 C CB    . ARG C 3 234 ? -12.834 14.644  -30.667 1.00 49.85 ? 211  ARG A CB    1 
ATOM   2293 C CG    . ARG C 3 234 ? -13.787 15.505  -31.489 1.00 49.85 ? 211  ARG A CG    1 
ATOM   2294 C CD    . ARG C 3 234 ? -14.755 14.663  -32.307 1.00 49.85 ? 211  ARG A CD    1 
ATOM   2295 N NE    . ARG C 3 234 ? -14.109 14.033  -33.458 1.00 49.85 ? 211  ARG A NE    1 
ATOM   2296 C CZ    . ARG C 3 234 ? -14.748 13.347  -34.402 1.00 49.85 ? 211  ARG A CZ    1 
ATOM   2297 N NH1   . ARG C 3 234 ? -16.067 13.190  -34.347 1.00 49.85 ? 211  ARG A NH1   1 
ATOM   2298 N NH2   . ARG C 3 234 ? -14.064 12.814  -35.407 1.00 49.85 ? 211  ARG A NH2   1 
ATOM   2299 N N     . PRO C 3 235 ? -10.877 15.250  -27.587 1.00 49.85 ? 212  PRO A N     1 
ATOM   2300 C CA    . PRO C 3 235 ? -10.220 14.586  -26.455 1.00 49.85 ? 212  PRO A CA    1 
ATOM   2301 C C     . PRO C 3 235 ? -11.108 13.589  -25.704 1.00 49.85 ? 212  PRO A C     1 
ATOM   2302 O O     . PRO C 3 235 ? -10.602 12.808  -24.895 1.00 49.85 ? 212  PRO A O     1 
ATOM   2303 C CB    . PRO C 3 235 ? -9.834  15.753  -25.541 1.00 49.85 ? 212  PRO A CB    1 
ATOM   2304 C CG    . PRO C 3 235 ? -10.814 16.819  -25.855 1.00 49.85 ? 212  PRO A CG    1 
ATOM   2305 C CD    . PRO C 3 235 ? -11.124 16.680  -27.317 1.00 49.85 ? 212  PRO A CD    1 
ATOM   2306 N N     . GLU C 3 236 ? -12.413 13.617  -25.967 1.00 49.85 ? 213  GLU A N     1 
ATOM   2307 C CA    . GLU C 3 236 ? -13.341 12.667  -25.353 1.00 49.85 ? 213  GLU A CA    1 
ATOM   2308 C C     . GLU C 3 236 ? -13.212 11.273  -25.974 1.00 49.85 ? 213  GLU A C     1 
ATOM   2309 O O     . GLU C 3 236 ? -13.626 10.278  -25.374 1.00 49.85 ? 213  GLU A O     1 
ATOM   2310 C CB    . GLU C 3 236 ? -14.791 13.180  -25.422 1.00 49.85 ? 213  GLU A CB    1 
ATOM   2311 C CG    . GLU C 3 236 ? -15.487 13.048  -26.784 1.00 49.85 ? 213  GLU A CG    1 
ATOM   2312 C CD    . GLU C 3 236 ? -15.129 14.150  -27.777 1.00 49.85 ? 213  GLU A CD    1 
ATOM   2313 O OE1   . GLU C 3 236 ? -14.296 15.028  -27.455 1.00 49.85 ? 213  GLU A OE1   1 
ATOM   2314 O OE2   . GLU C 3 236 ? -15.694 14.134  -28.892 1.00 49.85 ? 213  GLU A OE2   1 
ATOM   2315 N N     . GLU C 3 237 ? -12.635 11.216  -27.173 1.00 49.85 ? 214  GLU A N     1 
ATOM   2316 C CA    . GLU C 3 237 ? -12.400 9.956   -27.880 1.00 49.85 ? 214  GLU A CA    1 
ATOM   2317 C C     . GLU C 3 237 ? -11.124 9.254   -27.403 1.00 49.85 ? 214  GLU A C     1 
ATOM   2318 O O     . GLU C 3 237 ? -10.912 8.074   -27.695 1.00 49.85 ? 214  GLU A O     1 
ATOM   2319 C CB    . GLU C 3 237 ? -12.352 10.188  -29.394 1.00 49.85 ? 214  GLU A CB    1 
ATOM   2320 C CG    . GLU C 3 237 ? -13.695 10.580  -30.010 1.00 49.85 ? 214  GLU A CG    1 
ATOM   2321 C CD    . GLU C 3 237 ? -13.608 10.892  -31.500 1.00 49.85 ? 214  GLU A CD    1 
ATOM   2322 O OE1   . GLU C 3 237 ? -12.612 11.514  -31.935 1.00 49.85 ? 214  GLU A OE1   1 
ATOM   2323 O OE2   . GLU C 3 237 ? -14.544 10.515  -32.238 1.00 49.85 ? 214  GLU A OE2   1 
ATOM   2324 N N     . LEU C 3 238 ? -10.284 9.987   -26.673 1.00 49.85 ? 215  LEU A N     1 
ATOM   2325 C CA    . LEU C 3 238 ? -9.044  9.450   -26.116 1.00 49.85 ? 215  LEU A CA    1 
ATOM   2326 C C     . LEU C 3 238 ? -9.320  8.409   -25.039 1.00 49.85 ? 215  LEU A C     1 
ATOM   2327 O O     . LEU C 3 238 ? -10.203 8.593   -24.201 1.00 49.85 ? 215  LEU A O     1 
ATOM   2328 C CB    . LEU C 3 238 ? -8.189  10.572  -25.518 1.00 49.85 ? 215  LEU A CB    1 
ATOM   2329 C CG    . LEU C 3 238 ? -7.529  11.619  -26.418 1.00 49.85 ? 215  LEU A CG    1 
ATOM   2330 C CD1   . LEU C 3 238 ? -7.041  12.783  -25.576 1.00 49.85 ? 215  LEU A CD1   1 
ATOM   2331 C CD2   . LEU C 3 238 ? -6.381  11.025  -27.216 1.00 49.85 ? 215  LEU A CD2   1 
ATOM   2332 N N     . GLY C 3 239 ? -8.561  7.319   -25.070 1.00 49.85 ? 216  GLY A N     1 
ATOM   2333 C CA    . GLY C 3 239 ? -8.639  6.291   -24.035 1.00 49.85 ? 216  GLY A CA    1 
ATOM   2334 C C     . GLY C 3 239 ? -7.475  6.405   -23.068 1.00 49.85 ? 216  GLY A C     1 
ATOM   2335 O O     . GLY C 3 239 ? -6.849  7.463   -22.983 1.00 49.85 ? 216  GLY A O     1 
ATOM   2336 N N     . PRO C 3 240 ? -7.175  5.319   -22.329 1.00 49.85 ? 217  PRO A N     1 
ATOM   2337 C CA    . PRO C 3 240 ? -6.006  5.315   -21.448 1.00 49.85 ? 217  PRO A CA    1 
ATOM   2338 C C     . PRO C 3 240 ? -4.707  5.370   -22.251 1.00 49.85 ? 217  PRO A C     1 
ATOM   2339 O O     . PRO C 3 240 ? -4.577  4.678   -23.264 1.00 49.85 ? 217  PRO A O     1 
ATOM   2340 C CB    . PRO C 3 240 ? -6.126  3.981   -20.704 1.00 49.85 ? 217  PRO A CB    1 
ATOM   2341 C CG    . PRO C 3 240 ? -6.963  3.124   -21.579 1.00 49.85 ? 217  PRO A CG    1 
ATOM   2342 C CD    . PRO C 3 240 ? -7.913  4.044   -22.275 1.00 49.85 ? 217  PRO A CD    1 
ATOM   2343 N N     . ASN C 3 241 ? -3.761  6.190   -21.802 1.00 49.85 ? 218  ASN A N     1 
ATOM   2344 C CA    . ASN C 3 241 ? -2.492  6.349   -22.506 1.00 49.85 ? 218  ASN A CA    1 
ATOM   2345 C C     . ASN C 3 241 ? -1.505  5.240   -22.151 1.00 49.85 ? 218  ASN A C     1 
ATOM   2346 O O     . ASN C 3 241 ? -0.539  5.456   -21.416 1.00 49.85 ? 218  ASN A O     1 
ATOM   2347 C CB    . ASN C 3 241 ? -1.891  7.733   -22.241 1.00 49.85 ? 218  ASN A CB    1 
ATOM   2348 C CG    . ASN C 3 241 ? -0.796  8.094   -23.230 1.00 49.85 ? 218  ASN A CG    1 
ATOM   2349 O OD1   . ASN C 3 241 ? 0.293   8.508   -22.838 1.00 49.85 ? 218  ASN A OD1   1 
ATOM   2350 N ND2   . ASN C 3 241 ? -1.080  7.937   -24.519 1.00 49.85 ? 218  ASN A ND2   1 
ATOM   2351 N N     . LYS C 3 242 ? -1.765  4.049   -22.685 1.00 49.85 ? 219  LYS A N     1 
ATOM   2352 C CA    . LYS C 3 242 ? -0.955  2.870   -22.391 1.00 49.85 ? 219  LYS A CA    1 
ATOM   2353 C C     . LYS C 3 242 ? 0.356   2.863   -23.170 1.00 49.85 ? 219  LYS A C     1 
ATOM   2354 O O     . LYS C 3 242 ? 1.355   2.319   -22.701 1.00 49.85 ? 219  LYS A O     1 
ATOM   2355 C CB    . LYS C 3 242 ? -1.745  1.585   -22.668 1.00 49.85 ? 219  LYS A CB    1 
ATOM   2356 C CG    . LYS C 3 242 ? -2.917  1.346   -21.714 1.00 49.85 ? 219  LYS A CG    1 
ATOM   2357 C CD    . LYS C 3 242 ? -3.461  -0.075  -21.815 1.00 49.85 ? 219  LYS A CD    1 
ATOM   2358 C CE    . LYS C 3 242 ? -2.610  -1.065  -21.026 1.00 49.85 ? 219  LYS A CE    1 
ATOM   2359 N NZ    . LYS C 3 242 ? -3.059  -2.477  -21.197 1.00 49.85 ? 219  LYS A NZ    1 
ATOM   2360 N N     . PHE C 3 243 ? 0.346   3.468   -24.355 1.00 49.85 ? 220  PHE A N     1 
ATOM   2361 C CA    . PHE C 3 243 ? 1.520   3.475   -25.221 1.00 49.85 ? 220  PHE A CA    1 
ATOM   2362 C C     . PHE C 3 243 ? 1.923   4.896   -25.608 1.00 49.85 ? 220  PHE A C     1 
ATOM   2363 O O     . PHE C 3 243 ? 1.477   5.408   -26.636 1.00 49.85 ? 220  PHE A O     1 
ATOM   2364 C CB    . PHE C 3 243 ? 1.276   2.619   -26.469 1.00 49.85 ? 220  PHE A CB    1 
ATOM   2365 C CG    . PHE C 3 243 ? 0.730   1.251   -26.169 1.00 49.85 ? 220  PHE A CG    1 
ATOM   2366 C CD1   . PHE C 3 243 ? 1.546   0.264   -25.622 1.00 49.85 ? 220  PHE A CD1   1 
ATOM   2367 C CD2   . PHE C 3 243 ? -0.601  0.949   -26.432 1.00 49.85 ? 220  PHE A CD2   1 
ATOM   2368 C CE1   . PHE C 3 243 ? 1.042   -1.002  -25.342 1.00 49.85 ? 220  PHE A CE1   1 
ATOM   2369 C CE2   . PHE C 3 243 ? -1.115  -0.316  -26.156 1.00 49.85 ? 220  PHE A CE2   1 
ATOM   2370 C CZ    . PHE C 3 243 ? -0.292  -1.293  -25.610 1.00 49.85 ? 220  PHE A CZ    1 
ATOM   2371 N N     . PRO C 3 244 ? 2.769   5.538   -24.779 1.00 49.85 ? 221  PRO A N     1 
ATOM   2372 C CA    . PRO C 3 244 ? 3.265   6.887   -25.056 1.00 49.85 ? 221  PRO A CA    1 
ATOM   2373 C C     . PRO C 3 244 ? 4.165   6.915   -26.285 1.00 49.85 ? 221  PRO A C     1 
ATOM   2374 O O     . PRO C 3 244 ? 5.003   6.031   -26.456 1.00 49.85 ? 221  PRO A O     1 
ATOM   2375 C CB    . PRO C 3 244 ? 4.080   7.230   -23.801 1.00 49.85 ? 221  PRO A CB    1 
ATOM   2376 C CG    . PRO C 3 244 ? 3.635   6.259   -22.761 1.00 49.85 ? 221  PRO A CG    1 
ATOM   2377 C CD    . PRO C 3 244 ? 3.307   5.016   -23.512 1.00 49.85 ? 221  PRO A CD    1 
ATOM   2378 N N     . GLY C 3 245 ? 3.983   7.927   -27.128 1.00 49.85 ? 222  GLY A N     1 
ATOM   2379 C CA    . GLY C 3 245 ? 4.770   8.073   -28.348 1.00 49.85 ? 222  GLY A CA    1 
ATOM   2380 C C     . GLY C 3 245 ? 6.176   8.582   -28.099 1.00 49.85 ? 222  GLY A C     1 
ATOM   2381 O O     . GLY C 3 245 ? 6.453   9.181   -27.059 1.00 49.85 ? 222  GLY A O     1 
ATOM   2382 N N     . GLY C 3 246 ? 7.065   8.341   -29.058 1.00 49.85 ? 223  GLY A N     1 
ATOM   2383 C CA    . GLY C 3 246 ? 8.434   8.838   -28.979 1.00 49.85 ? 223  GLY A CA    1 
ATOM   2384 C C     . GLY C 3 246 ? 9.505   7.780   -29.148 1.00 49.85 ? 223  GLY A C     1 
ATOM   2385 O O     . GLY C 3 246 ? 9.275   6.596   -28.890 1.00 49.85 ? 223  GLY A O     1 
ATOM   2386 N N     . GLU C 3 247 ? 10.680  8.226   -29.586 1.00 49.85 ? 224  GLU A N     1 
ATOM   2387 C CA    . GLU C 3 247 ? 11.854  7.375   -29.767 1.00 49.85 ? 224  GLU A CA    1 
ATOM   2388 C C     . GLU C 3 247 ? 12.322  6.775   -28.442 1.00 49.85 ? 224  GLU A C     1 
ATOM   2389 O O     . GLU C 3 247 ? 12.679  5.598   -28.379 1.00 49.85 ? 224  GLU A O     1 
ATOM   2390 C CB    . GLU C 3 247 ? 12.983  8.189   -30.404 1.00 49.85 ? 224  GLU A CB    1 
ATOM   2391 C CG    . GLU C 3 247 ? 14.249  7.405   -30.733 1.00 49.85 ? 224  GLU A CG    1 
ATOM   2392 C CD    . GLU C 3 247 ? 15.408  8.298   -31.147 1.00 49.85 ? 224  GLU A CD    1 
ATOM   2393 O OE1   . GLU C 3 247 ? 15.188  9.500   -31.405 1.00 49.85 ? 224  GLU A OE1   1 
ATOM   2394 O OE2   . GLU C 3 247 ? 16.548  7.796   -31.217 1.00 49.85 ? 224  GLU A OE2   1 
ATOM   2395 N N     . THR C 3 248 ? 12.314  7.595   -27.392 1.00 49.85 ? 225  THR A N     1 
ATOM   2396 C CA    . THR C 3 248 ? 12.755  7.185   -26.058 1.00 49.85 ? 225  THR A CA    1 
ATOM   2397 C C     . THR C 3 248 ? 12.002  5.950   -25.570 1.00 49.85 ? 225  THR A C     1 
ATOM   2398 O O     . THR C 3 248 ? 12.620  4.971   -25.150 1.00 49.85 ? 225  THR A O     1 
ATOM   2399 C CB    . THR C 3 248 ? 12.604  8.336   -25.037 1.00 49.85 ? 225  THR A CB    1 
ATOM   2400 O OG1   . THR C 3 248 ? 13.237  9.515   -25.549 1.00 49.85 ? 225  THR A OG1   1 
ATOM   2401 C CG2   . THR C 3 248 ? 13.239  7.968   -23.703 1.00 49.85 ? 225  THR A CG2   1 
ATOM   2402 N N     . GLU C 3 249 ? 10.673  6.005   -25.635 1.00 49.85 ? 226  GLU A N     1 
ATOM   2403 C CA    . GLU C 3 249 ? 9.818   4.897   -25.211 1.00 49.85 ? 226  GLU A CA    1 
ATOM   2404 C C     . GLU C 3 249 ? 10.014  3.664   -26.091 1.00 49.85 ? 226  GLU A C     1 
ATOM   2405 O O     . GLU C 3 249 ? 9.990   2.539   -25.593 1.00 49.85 ? 226  GLU A O     1 
ATOM   2406 C CB    . GLU C 3 249 ? 8.345   5.330   -25.194 1.00 49.85 ? 226  GLU A CB    1 
ATOM   2407 C CG    . GLU C 3 249 ? 7.352   4.270   -24.694 1.00 49.85 ? 226  GLU A CG    1 
ATOM   2408 C CD    . GLU C 3 249 ? 7.389   4.042   -23.187 1.00 49.85 ? 226  GLU A CD    1 
ATOM   2409 O OE1   . GLU C 3 249 ? 8.063   4.806   -22.464 1.00 49.85 ? 226  GLU A OE1   1 
ATOM   2410 O OE2   . GLU C 3 249 ? 6.733   3.086   -22.725 1.00 49.85 ? 226  GLU A OE2   1 
ATOM   2411 N N     . ALA C 3 250 ? 10.210  3.883   -27.390 1.00 49.85 ? 227  ALA A N     1 
ATOM   2412 C CA    . ALA C 3 250 ? 10.460  2.799   -28.344 1.00 49.85 ? 227  ALA A CA    1 
ATOM   2413 C C     . ALA C 3 250 ? 11.669  1.959   -27.939 1.00 49.85 ? 227  ALA A C     1 
ATOM   2414 O O     . ALA C 3 250 ? 11.580  0.731   -27.853 1.00 49.85 ? 227  ALA A O     1 
ATOM   2415 C CB    . ALA C 3 250 ? 10.648  3.357   -29.749 1.00 49.85 ? 227  ALA A CB    1 
ATOM   2416 N N     . LEU C 3 251 ? 12.791  2.634   -27.690 1.00 49.85 ? 228  LEU A N     1 
ATOM   2417 C CA    . LEU C 3 251 ? 14.024  1.985   -27.252 1.00 49.85 ? 228  LEU A CA    1 
ATOM   2418 C C     . LEU C 3 251 ? 13.838  1.321   -25.891 1.00 49.85 ? 228  LEU A C     1 
ATOM   2419 O O     . LEU C 3 251 ? 14.243  0.175   -25.693 1.00 49.85 ? 228  LEU A O     1 
ATOM   2420 C CB    . LEU C 3 251 ? 15.174  2.997   -27.189 1.00 49.85 ? 228  LEU A CB    1 
ATOM   2421 C CG    . LEU C 3 251 ? 15.553  3.775   -28.453 1.00 49.85 ? 228  LEU A CG    1 
ATOM   2422 C CD1   . LEU C 3 251 ? 16.461  4.941   -28.095 1.00 49.85 ? 228  LEU A CD1   1 
ATOM   2423 C CD2   . LEU C 3 251 ? 16.209  2.876   -29.495 1.00 49.85 ? 228  LEU A CD2   1 
ATOM   2424 N N     . ARG C 3 252 ? 13.220  2.054   -24.965 1.00 49.85 ? 229  ARG A N     1 
ATOM   2425 C CA    . ARG C 3 252 ? 12.936  1.565   -23.617 1.00 49.85 ? 229  ARG A CA    1 
ATOM   2426 C C     . ARG C 3 252 ? 12.104  0.283   -23.648 1.00 49.85 ? 229  ARG A C     1 
ATOM   2427 O O     . ARG C 3 252 ? 12.418  -0.682  -22.950 1.00 49.85 ? 229  ARG A O     1 
ATOM   2428 C CB    . ARG C 3 252 ? 12.212  2.644   -22.808 1.00 49.85 ? 229  ARG A CB    1 
ATOM   2429 C CG    . ARG C 3 252 ? 12.017  2.308   -21.339 1.00 49.85 ? 229  ARG A CG    1 
ATOM   2430 C CD    . ARG C 3 252 ? 10.638  2.732   -20.859 1.00 49.85 ? 229  ARG A CD    1 
ATOM   2431 N NE    . ARG C 3 252 ? 9.576   1.972   -21.518 1.00 49.85 ? 229  ARG A NE    1 
ATOM   2432 C CZ    . ARG C 3 252 ? 9.105   0.801   -21.094 1.00 49.85 ? 229  ARG A CZ    1 
ATOM   2433 N NH1   . ARG C 3 252 ? 9.595   0.232   -20.000 1.00 49.85 ? 229  ARG A NH1   1 
ATOM   2434 N NH2   . ARG C 3 252 ? 8.139   0.195   -21.770 1.00 49.85 ? 229  ARG A NH2   1 
ATOM   2435 N N     . ARG C 3 253 ? 11.047  0.285   -24.461 1.00 49.85 ? 230  ARG A N     1 
ATOM   2436 C CA    . ARG C 3 253 ? 10.158  -0.868  -24.596 1.00 49.85 ? 230  ARG A CA    1 
ATOM   2437 C C     . ARG C 3 253 ? 10.858  -2.033  -25.291 1.00 49.85 ? 230  ARG A C     1 
ATOM   2438 O O     . ARG C 3 253 ? 10.583  -3.196  -24.988 1.00 49.85 ? 230  ARG A O     1 
ATOM   2439 C CB    . ARG C 3 253 ? 8.876   -0.485  -25.345 1.00 49.85 ? 230  ARG A CB    1 
ATOM   2440 C CG    . ARG C 3 253 ? 7.812   -1.571  -25.346 1.00 49.85 ? 230  ARG A CG    1 
ATOM   2441 C CD    . ARG C 3 253 ? 6.451   -1.042  -25.759 1.00 49.85 ? 230  ARG A CD    1 
ATOM   2442 N NE    . ARG C 3 253 ? 5.427   -2.082  -25.663 1.00 49.85 ? 230  ARG A NE    1 
ATOM   2443 C CZ    . ARG C 3 253 ? 4.718   -2.350  -24.568 1.00 49.85 ? 230  ARG A CZ    1 
ATOM   2444 N NH1   . ARG C 3 253 ? 4.908   -1.657  -23.454 1.00 49.85 ? 230  ARG A NH1   1 
ATOM   2445 N NH2   . ARG C 3 253 ? 3.812   -3.317  -24.587 1.00 49.85 ? 230  ARG A NH2   1 
ATOM   2446 N N     . MET C 3 254 ? 11.758  -1.714  -26.218 1.00 49.85 ? 231  MET A N     1 
ATOM   2447 C CA    . MET C 3 254 ? 12.536  -2.730  -26.920 1.00 49.85 ? 231  MET A CA    1 
ATOM   2448 C C     . MET C 3 254 ? 13.463  -3.466  -25.957 1.00 49.85 ? 231  MET A C     1 
ATOM   2449 O O     . MET C 3 254 ? 13.450  -4.696  -25.900 1.00 49.85 ? 231  MET A O     1 
ATOM   2450 C CB    . MET C 3 254 ? 13.341  -2.111  -28.063 1.00 49.85 ? 231  MET A CB    1 
ATOM   2451 C CG    . MET C 3 254 ? 13.978  -3.134  -28.991 1.00 49.85 ? 231  MET A CG    1 
ATOM   2452 S SD    . MET C 3 254 ? 15.260  -2.443  -30.049 1.00 49.85 ? 231  MET A SD    1 
ATOM   2453 C CE    . MET C 3 254 ? 16.582  -2.182  -28.867 1.00 49.85 ? 231  MET A CE    1 
ATOM   2454 N N     . GLU C 3 255 ? 14.258  -2.704  -25.205 1.00 49.85 ? 232  GLU A N     1 
ATOM   2455 C CA    . GLU C 3 255 ? 15.193  -3.264  -24.228 1.00 49.85 ? 232  GLU A CA    1 
ATOM   2456 C C     . GLU C 3 255 ? 14.473  -4.101  -23.172 1.00 49.85 ? 232  GLU A C     1 
ATOM   2457 O O     . GLU C 3 255 ? 14.996  -5.118  -22.712 1.00 49.85 ? 232  GLU A O     1 
ATOM   2458 C CB    . GLU C 3 255 ? 16.016  -2.157  -23.559 1.00 49.85 ? 232  GLU A CB    1 
ATOM   2459 C CG    . GLU C 3 255 ? 16.873  -1.315  -24.512 1.00 49.85 ? 232  GLU A CG    1 
ATOM   2460 C CD    . GLU C 3 255 ? 18.034  -2.077  -25.142 1.00 49.85 ? 232  GLU A CD    1 
ATOM   2461 O OE1   . GLU C 3 255 ? 18.390  -3.171  -24.652 1.00 49.85 ? 232  GLU A OE1   1 
ATOM   2462 O OE2   . GLU C 3 255 ? 18.598  -1.573  -26.137 1.00 49.85 ? 232  GLU A OE2   1 
ATOM   2463 N N     . GLU C 3 256 ? 13.273  -3.662  -22.798 1.00 49.85 ? 233  GLU A N     1 
ATOM   2464 C CA    . GLU C 3 256 ? 12.413  -4.404  -21.882 1.00 49.85 ? 233  GLU A CA    1 
ATOM   2465 C C     . GLU C 3 256 ? 11.971  -5.725  -22.508 1.00 49.85 ? 233  GLU A C     1 
ATOM   2466 O O     . GLU C 3 256 ? 11.910  -6.750  -21.829 1.00 49.85 ? 233  GLU A O     1 
ATOM   2467 C CB    . GLU C 3 256 ? 11.190  -3.562  -21.499 1.00 49.85 ? 233  GLU A CB    1 
ATOM   2468 C CG    . GLU C 3 256 ? 10.291  -4.189  -20.437 1.00 49.85 ? 233  GLU A CG    1 
ATOM   2469 C CD    . GLU C 3 256 ? 10.965  -4.287  -19.082 1.00 49.85 ? 233  GLU A CD    1 
ATOM   2470 O OE1   . GLU C 3 256 ? 11.300  -3.231  -18.504 1.00 49.85 ? 233  GLU A OE1   1 
ATOM   2471 O OE2   . GLU C 3 256 ? 11.160  -5.422  -18.595 1.00 49.85 ? 233  GLU A OE2   1 
ATOM   2472 N N     . SER C 3 257 ? 11.667  -5.686  -23.803 1.00 49.85 ? 234  SER A N     1 
ATOM   2473 C CA    . SER C 3 257 ? 11.206  -6.865  -24.535 1.00 49.85 ? 234  SER A CA    1 
ATOM   2474 C C     . SER C 3 257 ? 12.340  -7.842  -24.837 1.00 49.85 ? 234  SER A C     1 
ATOM   2475 O O     . SER C 3 257 ? 12.107  -9.046  -24.961 1.00 49.85 ? 234  SER A O     1 
ATOM   2476 C CB    . SER C 3 257 ? 10.504  -6.452  -25.830 1.00 49.85 ? 234  SER A CB    1 
ATOM   2477 O OG    . SER C 3 257 ? 9.348   -5.680  -25.554 1.00 49.85 ? 234  SER A OG    1 
ATOM   2478 N N     . LEU C 3 258 ? 13.558  -7.318  -24.951 1.00 49.85 ? 235  LEU A N     1 
ATOM   2479 C CA    . LEU C 3 258 ? 14.734  -8.135  -25.244 1.00 49.85 ? 235  LEU A CA    1 
ATOM   2480 C C     . LEU C 3 258 ? 15.480  -8.573  -23.983 1.00 49.85 ? 235  LEU A C     1 
ATOM   2481 O O     . LEU C 3 258 ? 16.536  -9.206  -24.071 1.00 49.85 ? 235  LEU A O     1 
ATOM   2482 C CB    . LEU C 3 258 ? 15.687  -7.394  -26.189 1.00 49.85 ? 235  LEU A CB    1 
ATOM   2483 C CG    . LEU C 3 258 ? 15.203  -6.985  -27.585 1.00 49.85 ? 235  LEU A CG    1 
ATOM   2484 C CD1   . LEU C 3 258 ? 16.258  -6.128  -28.266 1.00 49.85 ? 235  LEU A CD1   1 
ATOM   2485 C CD2   . LEU C 3 258 ? 14.843  -8.189  -28.451 1.00 49.85 ? 235  LEU A CD2   1 
ATOM   2486 N N     . LYS C 3 259 ? 14.929  -8.235  -22.817 1.00 49.85 ? 236  LYS A N     1 
ATOM   2487 C CA    . LYS C 3 259 ? 15.525  -8.599  -21.530 1.00 49.85 ? 236  LYS A CA    1 
ATOM   2488 C C     . LYS C 3 259 ? 15.561  -10.118 -21.347 1.00 49.85 ? 236  LYS A C     1 
ATOM   2489 O O     . LYS C 3 259 ? 16.624  -10.693 -21.102 1.00 49.85 ? 236  LYS A O     1 
ATOM   2490 C CB    . LYS C 3 259 ? 14.770  -7.930  -20.376 1.00 49.85 ? 236  LYS A CB    1 
ATOM   2491 C CG    . LYS C 3 259 ? 15.405  -8.127  -19.003 1.00 49.85 ? 236  LYS A CG    1 
ATOM   2492 C CD    . LYS C 3 259 ? 14.489  -7.633  -17.894 1.00 49.85 ? 236  LYS A CD    1 
ATOM   2493 C CE    . LYS C 3 259 ? 15.076  -7.919  -16.522 1.00 49.85 ? 236  LYS A CE    1 
ATOM   2494 N NZ    . LYS C 3 259 ? 14.184  -7.437  -15.432 1.00 49.85 ? 236  LYS A NZ    1 
ATOM   2495 N N     . ASP C 3 260 ? 14.400  -10.757 -21.465 1.00 49.85 ? 237  ASP A N     1 
ATOM   2496 C CA    . ASP C 3 260 ? 14.320  -12.211 -21.429 1.00 49.85 ? 237  ASP A CA    1 
ATOM   2497 C C     . ASP C 3 260 ? 14.701  -12.759 -22.801 1.00 49.85 ? 237  ASP A C     1 
ATOM   2498 O O     . ASP C 3 260 ? 13.868  -12.833 -23.709 1.00 49.85 ? 237  ASP A O     1 
ATOM   2499 C CB    . ASP C 3 260 ? 12.916  -12.672 -21.016 1.00 49.85 ? 237  ASP A CB    1 
ATOM   2500 C CG    . ASP C 3 260 ? 12.852  -14.160 -20.681 1.00 49.85 ? 237  ASP A CG    1 
ATOM   2501 O OD1   . ASP C 3 260 ? 13.910  -14.826 -20.627 1.00 49.85 ? 237  ASP A OD1   1 
ATOM   2502 O OD2   . ASP C 3 260 ? 11.731  -14.667 -20.467 1.00 49.85 ? 237  ASP A OD2   1 
ATOM   2503 N N     . GLU C 3 261 ? 15.970  -13.139 -22.938 1.00 49.85 ? 238  GLU A N     1 
ATOM   2504 C CA    . GLU C 3 261 ? 16.503  -13.662 -24.195 1.00 49.85 ? 238  GLU A CA    1 
ATOM   2505 C C     . GLU C 3 261 ? 15.941  -15.042 -24.530 1.00 49.85 ? 238  GLU A C     1 
ATOM   2506 O O     . GLU C 3 261 ? 15.859  -15.416 -25.702 1.00 49.85 ? 238  GLU A O     1 
ATOM   2507 C CB    . GLU C 3 261 ? 18.034  -13.695 -24.163 1.00 49.85 ? 238  GLU A CB    1 
ATOM   2508 C CG    . GLU C 3 261 ? 18.688  -12.316 -24.230 1.00 49.85 ? 238  GLU A CG    1 
ATOM   2509 C CD    . GLU C 3 261 ? 20.190  -12.371 -24.478 1.00 49.85 ? 238  GLU A CD    1 
ATOM   2510 O OE1   . GLU C 3 261 ? 20.668  -13.338 -25.112 1.00 49.85 ? 238  GLU A OE1   1 
ATOM   2511 O OE2   . GLU C 3 261 ? 20.897  -11.440 -24.036 1.00 49.85 ? 238  GLU A OE2   1 
ATOM   2512 N N     . ILE C 3 262 ? 15.558  -15.790 -23.496 1.00 49.85 ? 239  ILE A N     1 
ATOM   2513 C CA    . ILE C 3 262 ? 14.900  -17.087 -23.660 1.00 49.85 ? 239  ILE A CA    1 
ATOM   2514 C C     . ILE C 3 262 ? 13.552  -16.903 -24.363 1.00 49.85 ? 239  ILE A C     1 
ATOM   2515 O O     . ILE C 3 262 ? 13.211  -17.654 -25.279 1.00 49.85 ? 239  ILE A O     1 
ATOM   2516 C CB    . ILE C 3 262 ? 14.705  -17.813 -22.290 1.00 49.85 ? 239  ILE A CB    1 
ATOM   2517 C CG1   . ILE C 3 262 ? 16.032  -17.929 -21.517 1.00 49.85 ? 239  ILE A CG1   1 
ATOM   2518 C CG2   . ILE C 3 262 ? 14.030  -19.178 -22.469 1.00 49.85 ? 239  ILE A CG2   1 
ATOM   2519 C CD1   . ILE C 3 262 ? 17.115  -18.783 -22.187 1.00 49.85 ? 239  ILE A CD1   1 
ATOM   2520 N N     . TRP C 3 263 ? 12.801  -15.895 -23.920 1.00 49.85 ? 240  TRP A N     1 
ATOM   2521 C CA    . TRP C 3 263 ? 11.506  -15.545 -24.500 1.00 49.85 ? 240  TRP A CA    1 
ATOM   2522 C C     . TRP C 3 263 ? 11.645  -15.108 -25.960 1.00 49.85 ? 240  TRP A C     1 
ATOM   2523 O O     . TRP C 3 263 ? 10.852  -15.512 -26.814 1.00 49.85 ? 240  TRP A O     1 
ATOM   2524 C CB    . TRP C 3 263 ? 10.848  -14.438 -23.670 1.00 49.85 ? 240  TRP A CB    1 
ATOM   2525 C CG    . TRP C 3 263 ? 9.471   -14.055 -24.122 1.00 49.85 ? 240  TRP A CG    1 
ATOM   2526 C CD1   . TRP C 3 263 ? 8.296   -14.640 -23.752 1.00 49.85 ? 240  TRP A CD1   1 
ATOM   2527 C CD2   . TRP C 3 263 ? 9.126   -12.999 -25.028 1.00 49.85 ? 240  TRP A CD2   1 
ATOM   2528 N NE1   . TRP C 3 263 ? 7.241   -14.017 -24.370 1.00 49.85 ? 240  TRP A NE1   1 
ATOM   2529 C CE2   . TRP C 3 263 ? 7.721   -13.006 -25.160 1.00 49.85 ? 240  TRP A CE2   1 
ATOM   2530 C CE3   . TRP C 3 263 ? 9.869   -12.048 -25.742 1.00 49.85 ? 240  TRP A CE3   1 
ATOM   2531 C CZ2   . TRP C 3 263 ? 7.039   -12.098 -25.978 1.00 49.85 ? 240  TRP A CZ2   1 
ATOM   2532 C CZ3   . TRP C 3 263 ? 9.191   -11.144 -26.556 1.00 49.85 ? 240  TRP A CZ3   1 
ATOM   2533 C CH2   . TRP C 3 263 ? 7.789   -11.178 -26.666 1.00 49.85 ? 240  TRP A CH2   1 
ATOM   2534 N N     . VAL C 3 264 ? 12.657  -14.284 -26.228 1.00 49.85 ? 241  VAL A N     1 
ATOM   2535 C CA    . VAL C 3 264 ? 12.922  -13.742 -27.563 1.00 49.85 ? 241  VAL A CA    1 
ATOM   2536 C C     . VAL C 3 264 ? 13.261  -14.838 -28.580 1.00 49.85 ? 241  VAL A C     1 
ATOM   2537 O O     . VAL C 3 264 ? 12.687  -14.879 -29.672 1.00 49.85 ? 241  VAL A O     1 
ATOM   2538 C CB    . VAL C 3 264 ? 14.055  -12.677 -27.519 1.00 49.85 ? 241  VAL A CB    1 
ATOM   2539 C CG1   . VAL C 3 264 ? 14.538  -12.316 -28.916 1.00 49.85 ? 241  VAL A CG1   1 
ATOM   2540 C CG2   . VAL C 3 264 ? 13.587  -11.433 -26.786 1.00 49.85 ? 241  VAL A CG2   1 
ATOM   2541 N N     . ALA C 3 265 ? 14.190  -15.716 -28.207 1.00 49.85 ? 242  ALA A N     1 
ATOM   2542 C CA    . ALA C 3 265 ? 14.699  -16.760 -29.096 1.00 49.85 ? 242  ALA A CA    1 
ATOM   2543 C C     . ALA C 3 265 ? 13.624  -17.752 -29.538 1.00 49.85 ? 242  ALA A C     1 
ATOM   2544 O O     . ALA C 3 265 ? 13.507  -18.057 -30.725 1.00 49.85 ? 242  ALA A O     1 
ATOM   2545 C CB    . ALA C 3 265 ? 15.862  -17.490 -28.438 1.00 49.85 ? 242  ALA A CB    1 
ATOM   2546 N N     . ARG C 3 266 ? 12.845  -18.245 -28.579 1.00 49.85 ? 243  ARG A N     1 
ATOM   2547 C CA    . ARG C 3 266 ? 11.835  -19.271 -28.845 1.00 49.85 ? 243  ARG A CA    1 
ATOM   2548 C C     . ARG C 3 266 ? 10.460  -18.690 -29.182 1.00 49.85 ? 243  ARG A C     1 
ATOM   2549 O O     . ARG C 3 266 ? 9.473   -19.428 -29.255 1.00 49.85 ? 243  ARG A O     1 
ATOM   2550 C CB    . ARG C 3 266 ? 11.738  -20.241 -27.663 1.00 49.85 ? 243  ARG A CB    1 
ATOM   2551 C CG    . ARG C 3 266 ? 12.996  -21.066 -27.451 1.00 49.85 ? 243  ARG A CG    1 
ATOM   2552 C CD    . ARG C 3 266 ? 12.983  -21.786 -26.117 1.00 49.85 ? 243  ARG A CD    1 
ATOM   2553 N NE    . ARG C 3 266 ? 14.313  -22.283 -25.763 1.00 49.85 ? 243  ARG A NE    1 
ATOM   2554 C CZ    . ARG C 3 266 ? 14.605  -22.930 -24.638 1.00 49.85 ? 243  ARG A CZ    1 
ATOM   2555 N NH1   . ARG C 3 266 ? 13.661  -23.171 -23.734 1.00 49.85 ? 243  ARG A NH1   1 
ATOM   2556 N NH2   . ARG C 3 266 ? 15.847  -23.339 -24.415 1.00 49.85 ? 243  ARG A NH2   1 
ATOM   2557 N N     . PHE C 3 267 ? 10.406  -17.374 -29.389 1.00 49.85 ? 244  PHE A N     1 
ATOM   2558 C CA    . PHE C 3 267 ? 9.169   -16.680 -29.746 1.00 49.85 ? 244  PHE A CA    1 
ATOM   2559 C C     . PHE C 3 267 ? 8.522   -17.294 -30.983 1.00 49.85 ? 244  PHE A C     1 
ATOM   2560 O O     . PHE C 3 267 ? 9.097   -17.282 -32.073 1.00 49.85 ? 244  PHE A O     1 
ATOM   2561 C CB    . PHE C 3 267 ? 9.430   -15.183 -29.968 1.00 49.85 ? 244  PHE A CB    1 
ATOM   2562 C CG    . PHE C 3 267 ? 8.201   -14.391 -30.352 1.00 49.85 ? 244  PHE A CG    1 
ATOM   2563 C CD1   . PHE C 3 267 ? 7.407   -13.797 -29.376 1.00 49.85 ? 244  PHE A CD1   1 
ATOM   2564 C CD2   . PHE C 3 267 ? 7.841   -14.238 -31.691 1.00 49.85 ? 244  PHE A CD2   1 
ATOM   2565 C CE1   . PHE C 3 267 ? 6.272   -13.064 -29.726 1.00 49.85 ? 244  PHE A CE1   1 
ATOM   2566 C CE2   . PHE C 3 267 ? 6.709   -13.508 -32.050 1.00 49.85 ? 244  PHE A CE2   1 
ATOM   2567 C CZ    . PHE C 3 267 ? 5.924   -12.920 -31.066 1.00 49.85 ? 244  PHE A CZ    1 
ATOM   2568 N N     . GLU C 3 268 ? 7.322   -17.832 -30.794 1.00 49.85 ? 245  GLU A N     1 
ATOM   2569 C CA    . GLU C 3 268 ? 6.523   -18.363 -31.889 1.00 49.85 ? 245  GLU A CA    1 
ATOM   2570 C C     . GLU C 3 268 ? 5.166   -17.670 -31.880 1.00 49.85 ? 245  GLU A C     1 
ATOM   2571 O O     . GLU C 3 268 ? 4.446   -17.712 -30.880 1.00 49.85 ? 245  GLU A O     1 
ATOM   2572 C CB    . GLU C 3 268 ? 6.376   -19.882 -31.762 1.00 49.85 ? 245  GLU A CB    1 
ATOM   2573 C CG    . GLU C 3 268 ? 7.674   -20.654 -32.012 1.00 49.85 ? 245  GLU A CG    1 
ATOM   2574 C CD    . GLU C 3 268 ? 7.659   -22.061 -31.433 1.00 49.85 ? 245  GLU A CD    1 
ATOM   2575 O OE1   . GLU C 3 268 ? 6.709   -22.824 -31.715 1.00 49.85 ? 245  GLU A OE1   1 
ATOM   2576 O OE2   . GLU C 3 268 ? 8.607   -22.403 -30.693 1.00 49.85 ? 245  GLU A OE2   1 
ATOM   2577 N N     . LYS C 3 269 ? 4.831   -17.032 -33.001 1.00 49.85 ? 246  LYS A N     1 
ATOM   2578 C CA    . LYS C 3 269 ? 3.647   -16.169 -33.100 1.00 49.85 ? 246  LYS A CA    1 
ATOM   2579 C C     . LYS C 3 269 ? 2.303   -16.842 -32.766 1.00 49.85 ? 246  LYS A C     1 
ATOM   2580 O O     . LYS C 3 269 ? 1.520   -16.273 -32.006 1.00 49.85 ? 246  LYS A O     1 
ATOM   2581 C CB    . LYS C 3 269 ? 3.587   -15.468 -34.468 1.00 49.85 ? 246  LYS A CB    1 
ATOM   2582 C CG    . LYS C 3 269 ? 2.677   -14.238 -34.522 1.00 49.85 ? 246  LYS A CG    1 
ATOM   2583 C CD    . LYS C 3 269 ? 3.195   -13.100 -33.641 1.00 49.85 ? 246  LYS A CD    1 
ATOM   2584 C CE    . LYS C 3 269 ? 2.302   -11.871 -33.720 1.00 49.85 ? 246  LYS A CE    1 
ATOM   2585 N NZ    . LYS C 3 269 ? 2.511   -11.092 -34.972 1.00 49.85 ? 246  LYS A NZ    1 
ATOM   2586 N N     . PRO C 3 270 ? 2.030   -18.045 -33.323 1.00 49.85 ? 247  PRO A N     1 
ATOM   2587 C CA    . PRO C 3 270 ? 0.752   -18.705 -33.018 1.00 49.85 ? 247  PRO A CA    1 
ATOM   2588 C C     . PRO C 3 270 ? 0.567   -19.056 -31.539 1.00 49.85 ? 247  PRO A C     1 
ATOM   2589 O O     . PRO C 3 270 ? -0.570  -19.166 -31.072 1.00 49.85 ? 247  PRO A O     1 
ATOM   2590 C CB    . PRO C 3 270 ? 0.806   -19.988 -33.858 1.00 49.85 ? 247  PRO A CB    1 
ATOM   2591 C CG    . PRO C 3 270 ? 1.826   -19.718 -34.912 1.00 49.85 ? 247  PRO A CG    1 
ATOM   2592 C CD    . PRO C 3 270 ? 2.843   -18.859 -34.245 1.00 49.85 ? 247  PRO A CD    1 
ATOM   2593 N N     . ASN C 3 271 ? 1.674   -19.227 -30.818 1.00 49.85 ? 248  ASN A N     1 
ATOM   2594 C CA    . ASN C 3 271 ? 1.640   -19.562 -29.394 1.00 49.85 ? 248  ASN A CA    1 
ATOM   2595 C C     . ASN C 3 271 ? 1.226   -18.396 -28.500 1.00 49.85 ? 248  ASN A C     1 
ATOM   2596 O O     . ASN C 3 271 ? 0.857   -18.599 -27.342 1.00 49.85 ? 248  ASN A O     1 
ATOM   2597 C CB    . ASN C 3 271 ? 2.995   -20.113 -28.935 1.00 49.85 ? 248  ASN A CB    1 
ATOM   2598 C CG    . ASN C 3 271 ? 3.338   -21.449 -29.577 1.00 49.85 ? 248  ASN A CG    1 
ATOM   2599 O OD1   . ASN C 3 271 ? 2.758   -21.841 -30.593 1.00 49.85 ? 248  ASN A OD1   1 
ATOM   2600 N ND2   . ASN C 3 271 ? 4.292   -22.155 -28.981 1.00 49.85 ? 248  ASN A ND2   1 
ATOM   2601 N N     . THR C 3 272 ? 1.292   -17.181 -29.042 1.00 49.85 ? 249  THR A N     1 
ATOM   2602 C CA    . THR C 3 272 ? 0.939   -15.973 -28.296 1.00 49.85 ? 249  THR A CA    1 
ATOM   2603 C C     . THR C 3 272 ? -0.575  -15.795 -28.215 1.00 49.85 ? 249  THR A C     1 
ATOM   2604 O O     . THR C 3 272 ? -1.281  -15.946 -29.214 1.00 49.85 ? 249  THR A O     1 
ATOM   2605 C CB    . THR C 3 272 ? 1.569   -14.706 -28.914 1.00 49.85 ? 249  THR A CB    1 
ATOM   2606 O OG1   . THR C 3 272 ? 1.041   -14.497 -30.229 1.00 49.85 ? 249  THR A OG1   1 
ATOM   2607 C CG2   . THR C 3 272 ? 3.087   -14.836 -28.992 1.00 49.85 ? 249  THR A CG2   1 
ATOM   2608 N N     . ALA C 3 273 ? -1.059  -15.475 -27.017 1.00 49.85 ? 250  ALA A N     1 
ATOM   2609 C CA    . ALA C 3 273 ? -2.485  -15.281 -26.772 1.00 49.85 ? 250  ALA A CA    1 
ATOM   2610 C C     . ALA C 3 273 ? -2.987  -13.966 -27.373 1.00 49.85 ? 250  ALA A C     1 
ATOM   2611 O O     . ALA C 3 273 ? -2.300  -12.946 -27.292 1.00 49.85 ? 250  ALA A O     1 
ATOM   2612 C CB    . ALA C 3 273 ? -2.773  -15.329 -25.278 1.00 49.85 ? 250  ALA A CB    1 
ATOM   2613 N N     . PRO C 3 274 ? -4.187  -13.986 -27.983 1.00 49.85 ? 251  PRO A N     1 
ATOM   2614 C CA    . PRO C 3 274 ? -4.791  -12.761 -28.502 1.00 49.85 ? 251  PRO A CA    1 
ATOM   2615 C C     . PRO C 3 274 ? -5.557  -11.952 -27.452 1.00 49.85 ? 251  PRO A C     1 
ATOM   2616 O O     . PRO C 3 274 ? -5.730  -10.744 -27.612 1.00 49.85 ? 251  PRO A O     1 
ATOM   2617 C CB    . PRO C 3 274 ? -5.753  -13.274 -29.574 1.00 49.85 ? 251  PRO A CB    1 
ATOM   2618 C CG    . PRO C 3 274 ? -6.113  -14.658 -29.148 1.00 49.85 ? 251  PRO A CG    1 
ATOM   2619 C CD    . PRO C 3 274 ? -5.038  -15.168 -28.225 1.00 49.85 ? 251  PRO A CD    1 
ATOM   2620 N N     . ASN C 3 275 ? -6.004  -12.619 -26.394 1.00 49.85 ? 252  ASN A N     1 
ATOM   2621 C CA    . ASN C 3 275 ? -6.896  -12.010 -25.413 1.00 49.85 ? 252  ASN A CA    1 
ATOM   2622 C C     . ASN C 3 275 ? -6.360  -12.016 -23.976 1.00 49.85 ? 252  ASN A C     1 
ATOM   2623 O O     . ASN C 3 275 ? -7.126  -12.129 -23.015 1.00 49.85 ? 252  ASN A O     1 
ATOM   2624 C CB    . ASN C 3 275 ? -8.289  -12.656 -25.495 1.00 49.85 ? 252  ASN A CB    1 
ATOM   2625 C CG    . ASN C 3 275 ? -8.242  -14.181 -25.499 1.00 49.85 ? 252  ASN A CG    1 
ATOM   2626 O OD1   . ASN C 3 275 ? -7.179  -14.792 -25.376 1.00 49.85 ? 252  ASN A OD1   1 
ATOM   2627 N ND2   . ASN C 3 275 ? -9.407  -14.801 -25.643 1.00 49.85 ? 252  ASN A ND2   1 
ATOM   2628 N N     . SER C 3 276 ? -5.042  -11.893 -23.838 1.00 49.85 ? 253  SER A N     1 
ATOM   2629 C CA    . SER C 3 276 ? -4.413  -11.736 -22.529 1.00 49.85 ? 253  SER A CA    1 
ATOM   2630 C C     . SER C 3 276 ? -4.465  -10.264 -22.130 1.00 49.85 ? 253  SER A C     1 
ATOM   2631 O O     . SER C 3 276 ? -4.233  -9.386  -22.964 1.00 49.85 ? 253  SER A O     1 
ATOM   2632 C CB    . SER C 3 276 ? -2.968  -12.234 -22.557 1.00 49.85 ? 253  SER A CB    1 
ATOM   2633 O OG    . SER C 3 276 ? -2.203  -11.532 -23.520 1.00 49.85 ? 253  SER A OG    1 
ATOM   2634 N N     . LEU C 3 277 ? -4.770  -10.003 -20.859 1.00 49.85 ? 254  LEU A N     1 
ATOM   2635 C CA    . LEU C 3 277 ? -4.947  -8.634  -20.362 1.00 49.85 ? 254  LEU A CA    1 
ATOM   2636 C C     . LEU C 3 277 ? -3.745  -7.734  -20.649 1.00 49.85 ? 254  LEU A C     1 
ATOM   2637 O O     . LEU C 3 277 ? -3.903  -6.628  -21.170 1.00 49.85 ? 254  LEU A O     1 
ATOM   2638 C CB    . LEU C 3 277 ? -5.271  -8.628  -18.864 1.00 49.85 ? 254  LEU A CB    1 
ATOM   2639 C CG    . LEU C 3 277 ? -6.591  -9.233  -18.374 1.00 49.85 ? 254  LEU A CG    1 
ATOM   2640 C CD1   . LEU C 3 277 ? -6.772  -8.915  -16.899 1.00 49.85 ? 254  LEU A CD1   1 
ATOM   2641 C CD2   . LEU C 3 277 ? -7.793  -8.738  -19.173 1.00 49.85 ? 254  LEU A CD2   1 
ATOM   2642 N N     . GLU C 3 278 ? -2.553  -8.214  -20.306 1.00 49.85 ? 255  GLU A N     1 
ATOM   2643 C CA    . GLU C 3 278 ? -1.316  -7.533  -20.669 1.00 49.85 ? 255  GLU A CA    1 
ATOM   2644 C C     . GLU C 3 278 ? -0.701  -8.209  -21.895 1.00 49.85 ? 255  GLU A C     1 
ATOM   2645 O O     . GLU C 3 278 ? -0.627  -9.439  -21.946 1.00 49.85 ? 255  GLU A O     1 
ATOM   2646 C CB    . GLU C 3 278 ? -0.334  -7.494  -19.491 1.00 49.85 ? 255  GLU A CB    1 
ATOM   2647 C CG    . GLU C 3 278 ? -0.767  -6.576  -18.341 1.00 49.85 ? 255  GLU A CG    1 
ATOM   2648 C CD    . GLU C 3 278 ? -1.127  -5.164  -18.798 1.00 49.85 ? 255  GLU A CD    1 
ATOM   2649 O OE1   . GLU C 3 278 ? -0.290  -4.511  -19.458 1.00 49.85 ? 255  GLU A OE1   1 
ATOM   2650 O OE2   . GLU C 3 278 ? -2.250  -4.707  -18.497 1.00 49.85 ? 255  GLU A OE2   1 
ATOM   2651 N N     . PRO C 3 279 ? -0.262  -7.406  -22.887 1.00 49.85 ? 256  PRO A N     1 
ATOM   2652 C CA    . PRO C 3 279 ? 0.200   -7.886  -24.194 1.00 49.85 ? 256  PRO A CA    1 
ATOM   2653 C C     . PRO C 3 279 ? 1.147   -9.088  -24.145 1.00 49.85 ? 256  PRO A C     1 
ATOM   2654 O O     . PRO C 3 279 ? 2.132   -9.079  -23.402 1.00 49.85 ? 256  PRO A O     1 
ATOM   2655 C CB    . PRO C 3 279 ? 0.921   -6.667  -24.768 1.00 49.85 ? 256  PRO A CB    1 
ATOM   2656 C CG    . PRO C 3 279 ? 0.194   -5.517  -24.191 1.00 49.85 ? 256  PRO A CG    1 
ATOM   2657 C CD    . PRO C 3 279 ? -0.185  -5.934  -22.797 1.00 49.85 ? 256  PRO A CD    1 
ATOM   2658 N N     . SER C 3 280 ? 0.832   -10.108 -24.942 1.00 49.85 ? 257  SER A N     1 
ATOM   2659 C CA    . SER C 3 280 ? 1.659   -11.308 -25.055 1.00 49.85 ? 257  SER A CA    1 
ATOM   2660 C C     . SER C 3 280 ? 2.825   -11.109 -26.027 1.00 49.85 ? 257  SER A C     1 
ATOM   2661 O O     . SER C 3 280 ? 3.766   -11.906 -26.050 1.00 49.85 ? 257  SER A O     1 
ATOM   2662 C CB    . SER C 3 280 ? 0.807   -12.503 -25.491 1.00 49.85 ? 257  SER A CB    1 
ATOM   2663 O OG    . SER C 3 280 ? 0.244   -12.288 -26.773 1.00 49.85 ? 257  SER A OG    1 
ATOM   2664 N N     . THR C 3 281 ? 2.751   -10.046 -26.826 1.00 49.85 ? 258  THR A N     1 
ATOM   2665 C CA    . THR C 3 281 ? 3.822   -9.680  -27.752 1.00 49.85 ? 258  THR A CA    1 
ATOM   2666 C C     . THR C 3 281 ? 4.450   -8.336  -27.357 1.00 49.85 ? 258  THR A C     1 
ATOM   2667 O O     . THR C 3 281 ? 4.088   -7.758  -26.328 1.00 49.85 ? 258  THR A O     1 
ATOM   2668 C CB    . THR C 3 281 ? 3.333   -9.656  -29.221 1.00 49.85 ? 258  THR A CB    1 
ATOM   2669 O OG1   . THR C 3 281 ? 2.185   -8.808  -29.338 1.00 49.85 ? 258  THR A OG1   1 
ATOM   2670 C CG2   . THR C 3 281 ? 2.972   -11.057 -29.693 1.00 49.85 ? 258  THR A CG2   1 
ATOM   2671 N N     . THR C 3 282 ? 5.383   -7.851  -28.174 1.00 49.85 ? 259  THR A N     1 
ATOM   2672 C CA    . THR C 3 282 ? 6.221   -6.694  -27.829 1.00 49.85 ? 259  THR A CA    1 
ATOM   2673 C C     . THR C 3 282 ? 5.502   -5.342  -27.856 1.00 49.85 ? 259  THR A C     1 
ATOM   2674 O O     . THR C 3 282 ? 5.815   -4.454  -27.057 1.00 49.85 ? 259  THR A O     1 
ATOM   2675 C CB    . THR C 3 282 ? 7.464   -6.603  -28.746 1.00 49.85 ? 259  THR A CB    1 
ATOM   2676 O OG1   . THR C 3 282 ? 7.050   -6.397  -30.102 1.00 49.85 ? 259  THR A OG1   1 
ATOM   2677 C CG2   . THR C 3 282 ? 8.302   -7.874  -28.659 1.00 49.85 ? 259  THR A CG2   1 
ATOM   2678 N N     . VAL C 3 283 ? 4.546   -5.203  -28.776 1.00 49.85 ? 260  VAL A N     1 
ATOM   2679 C CA    . VAL C 3 283 ? 3.858   -3.933  -29.074 1.00 49.85 ? 260  VAL A CA    1 
ATOM   2680 C C     . VAL C 3 283 ? 4.855   -2.827  -29.437 1.00 49.85 ? 260  VAL A C     1 
ATOM   2681 O O     . VAL C 3 283 ? 4.902   -1.770  -28.804 1.00 49.85 ? 260  VAL A O     1 
ATOM   2682 C CB    . VAL C 3 283 ? 2.876   -3.477  -27.952 1.00 49.85 ? 260  VAL A CB    1 
ATOM   2683 C CG1   . VAL C 3 283 ? 1.876   -2.465  -28.500 1.00 49.85 ? 260  VAL A CG1   1 
ATOM   2684 C CG2   . VAL C 3 283 ? 2.136   -4.664  -27.367 1.00 49.85 ? 260  VAL A CG2   1 
ATOM   2685 N N     . LEU C 3 284 ? 5.653   -3.095  -30.465 1.00 49.85 ? 261  LEU A N     1 
ATOM   2686 C CA    . LEU C 3 284 ? 6.600   -2.120  -30.989 1.00 49.85 ? 261  LEU A CA    1 
ATOM   2687 C C     . LEU C 3 284 ? 6.146   -1.612  -32.355 1.00 49.85 ? 261  LEU A C     1 
ATOM   2688 O O     . LEU C 3 284 ? 6.806   -0.766  -32.962 1.00 49.85 ? 261  LEU A O     1 
ATOM   2689 C CB    . LEU C 3 284 ? 8.006   -2.725  -31.078 1.00 49.85 ? 261  LEU A CB    1 
ATOM   2690 C CG    . LEU C 3 284 ? 8.743   -3.032  -29.770 1.00 49.85 ? 261  LEU A CG    1 
ATOM   2691 C CD1   . LEU C 3 284 ? 9.924   -3.944  -30.037 1.00 49.85 ? 261  LEU A CD1   1 
ATOM   2692 C CD2   . LEU C 3 284 ? 9.201   -1.762  -29.063 1.00 49.85 ? 261  LEU A CD2   1 
ATOM   2693 N N     . SER C 3 285 ? 5.014   -2.135  -32.823 1.00 49.85 ? 262  SER A N     1 
ATOM   2694 C CA    . SER C 3 285 ? 4.469   -1.791  -34.138 1.00 49.85 ? 262  SER A CA    1 
ATOM   2695 C C     . SER C 3 285 ? 4.105   -0.314  -34.334 1.00 49.85 ? 262  SER A C     1 
ATOM   2696 O O     . SER C 3 285 ? 4.338   0.218   -35.420 1.00 49.85 ? 262  SER A O     1 
ATOM   2697 C CB    . SER C 3 285 ? 3.283   -2.692  -34.497 1.00 49.85 ? 262  SER A CB    1 
ATOM   2698 O OG    . SER C 3 285 ? 2.225   -2.545  -33.570 1.00 49.85 ? 262  SER A OG    1 
ATOM   2699 N N     . PRO C 3 286 ? 3.536   0.355   -33.302 1.00 49.85 ? 263  PRO A N     1 
ATOM   2700 C CA    . PRO C 3 286 ? 3.284   1.788   -33.480 1.00 49.85 ? 263  PRO A CA    1 
ATOM   2701 C C     . PRO C 3 286 ? 4.579   2.576   -33.619 1.00 49.85 ? 263  PRO A C     1 
ATOM   2702 O O     . PRO C 3 286 ? 4.636   3.544   -34.378 1.00 49.85 ? 263  PRO A O     1 
ATOM   2703 C CB    . PRO C 3 286 ? 2.558   2.185   -32.188 1.00 49.85 ? 263  PRO A CB    1 
ATOM   2704 C CG    . PRO C 3 286 ? 2.061   0.909   -31.610 1.00 49.85 ? 263  PRO A CG    1 
ATOM   2705 C CD    . PRO C 3 286 ? 3.095   -0.098  -31.970 1.00 49.85 ? 263  PRO A CD    1 
ATOM   2706 N N     . TYR C 3 287 ? 5.603   2.148   -32.887 1.00 49.85 ? 264  TYR A N     1 
ATOM   2707 C CA    . TYR C 3 287 ? 6.911   2.792   -32.891 1.00 49.85 ? 264  TYR A CA    1 
ATOM   2708 C C     . TYR C 3 287 ? 7.687   2.479   -34.167 1.00 49.85 ? 264  TYR A C     1 
ATOM   2709 O O     . TYR C 3 287 ? 8.567   3.240   -34.565 1.00 49.85 ? 264  TYR A O     1 
ATOM   2710 C CB    . TYR C 3 287 ? 7.707   2.367   -31.656 1.00 49.85 ? 264  TYR A CB    1 
ATOM   2711 C CG    . TYR C 3 287 ? 6.965   2.590   -30.354 1.00 49.85 ? 264  TYR A CG    1 
ATOM   2712 C CD1   . TYR C 3 287 ? 7.081   3.793   -29.659 1.00 49.85 ? 264  TYR A CD1   1 
ATOM   2713 C CD2   . TYR C 3 287 ? 6.143   1.598   -29.817 1.00 49.85 ? 264  TYR A CD2   1 
ATOM   2714 C CE1   . TYR C 3 287 ? 6.402   4.001   -28.465 1.00 49.85 ? 264  TYR A CE1   1 
ATOM   2715 C CE2   . TYR C 3 287 ? 5.458   1.798   -28.623 1.00 49.85 ? 264  TYR A CE2   1 
ATOM   2716 C CZ    . TYR C 3 287 ? 5.592   3.000   -27.955 1.00 49.85 ? 264  TYR A CZ    1 
ATOM   2717 O OH    . TYR C 3 287 ? 4.918   3.201   -26.775 1.00 49.85 ? 264  TYR A OH    1 
ATOM   2718 N N     . LEU C 3 288 ? 7.355   1.357   -34.801 1.00 49.85 ? 265  LEU A N     1 
ATOM   2719 C CA    . LEU C 3 288 ? 7.930   0.997   -36.094 1.00 49.85 ? 265  LEU A CA    1 
ATOM   2720 C C     . LEU C 3 288 ? 7.182   1.677   -37.237 1.00 49.85 ? 265  LEU A C     1 
ATOM   2721 O O     . LEU C 3 288 ? 7.775   1.997   -38.270 1.00 49.85 ? 265  LEU A O     1 
ATOM   2722 C CB    . LEU C 3 288 ? 7.926   -0.522  -36.293 1.00 49.85 ? 265  LEU A CB    1 
ATOM   2723 C CG    . LEU C 3 288 ? 8.925   -1.376  -35.505 1.00 49.85 ? 265  LEU A CG    1 
ATOM   2724 C CD1   . LEU C 3 288 ? 8.605   -2.844  -35.692 1.00 49.85 ? 265  LEU A CD1   1 
ATOM   2725 C CD2   . LEU C 3 288 ? 10.364  -1.095  -35.911 1.00 49.85 ? 265  LEU A CD2   1 
ATOM   2726 N N     . LYS C 3 289 ? 5.881   1.891   -37.040 1.00 49.85 ? 266  LYS A N     1 
ATOM   2727 C CA    . LYS C 3 289 ? 5.021   2.562   -38.018 1.00 49.85 ? 266  LYS A CA    1 
ATOM   2728 C C     . LYS C 3 289 ? 5.427   4.023   -38.218 1.00 49.85 ? 266  LYS A C     1 
ATOM   2729 O O     . LYS C 3 289 ? 5.552   4.487   -39.354 1.00 49.85 ? 266  LYS A O     1 
ATOM   2730 C CB    . LYS C 3 289 ? 3.548   2.443   -37.597 1.00 49.85 ? 266  LYS A CB    1 
ATOM   2731 C CG    . LYS C 3 289 ? 2.553   3.302   -38.372 1.00 49.85 ? 266  LYS A CG    1 
ATOM   2732 C CD    . LYS C 3 289 ? 2.168   4.543   -37.578 1.00 49.85 ? 266  LYS A CD    1 
ATOM   2733 C CE    . LYS C 3 289 ? 0.998   5.291   -38.197 1.00 49.85 ? 266  LYS A CE    1 
ATOM   2734 N NZ    . LYS C 3 289 ? 1.347   5.952   -39.485 1.00 49.85 ? 266  LYS A NZ    1 
ATOM   2735 N N     . PHE C 3 290 ? 5.630   4.734   -37.111 1.00 49.85 ? 267  PHE A N     1 
ATOM   2736 C CA    . PHE C 3 290 ? 6.062   6.130   -37.148 1.00 49.85 ? 267  PHE A CA    1 
ATOM   2737 C C     . PHE C 3 290 ? 7.563   6.270   -37.378 1.00 49.85 ? 267  PHE A C     1 
ATOM   2738 O O     . PHE C 3 290 ? 8.047   7.348   -37.733 1.00 49.85 ? 267  PHE A O     1 
ATOM   2739 C CB    . PHE C 3 290 ? 5.663   6.854   -35.861 1.00 49.85 ? 267  PHE A CB    1 
ATOM   2740 C CG    . PHE C 3 290 ? 4.244   7.344   -35.853 1.00 49.85 ? 267  PHE A CG    1 
ATOM   2741 C CD1   . PHE C 3 290 ? 3.294   6.740   -35.041 1.00 49.85 ? 267  PHE A CD1   1 
ATOM   2742 C CD2   . PHE C 3 290 ? 3.857   8.410   -36.658 1.00 49.85 ? 267  PHE A CD2   1 
ATOM   2743 C CE1   . PHE C 3 290 ? 1.978   7.189   -35.029 1.00 49.85 ? 267  PHE A CE1   1 
ATOM   2744 C CE2   . PHE C 3 290 ? 2.545   8.866   -36.653 1.00 49.85 ? 267  PHE A CE2   1 
ATOM   2745 C CZ    . PHE C 3 290 ? 1.604   8.255   -35.837 1.00 49.85 ? 267  PHE A CZ    1 
ATOM   2746 N N     . GLY C 3 291 ? 8.292   5.177   -37.173 1.00 49.85 ? 268  GLY A N     1 
ATOM   2747 C CA    . GLY C 3 291 ? 9.739   5.176   -37.328 1.00 49.85 ? 268  GLY A CA    1 
ATOM   2748 C C     . GLY C 3 291 ? 10.444  5.725   -36.105 1.00 49.85 ? 268  GLY A C     1 
ATOM   2749 O O     . GLY C 3 291 ? 11.510  6.322   -36.216 1.00 49.85 ? 268  GLY A O     1 
ATOM   2750 N N     . CYS C 3 292 ? 9.839   5.523   -34.937 1.00 49.85 ? 269  CYS A N     1 
ATOM   2751 C CA    . CYS C 3 292 ? 10.457  5.883   -33.664 1.00 49.85 ? 269  CYS A CA    1 
ATOM   2752 C C     . CYS C 3 292 ? 11.489  4.832   -33.274 1.00 49.85 ? 269  CYS A C     1 
ATOM   2753 O O     . CYS C 3 292 ? 12.431  5.117   -32.533 1.00 49.85 ? 269  CYS A O     1 
ATOM   2754 C CB    . CYS C 3 292 ? 9.397   6.006   -32.572 1.00 49.85 ? 269  CYS A CB    1 
ATOM   2755 S SG    . CYS C 3 292 ? 8.164   7.283   -32.881 1.00 49.85 ? 269  CYS A SG    1 
ATOM   2756 N N     . LEU C 3 293 ? 11.292  3.618   -33.781 1.00 49.85 ? 270  LEU A N     1 
ATOM   2757 C CA    . LEU C 3 293 ? 12.248  2.531   -33.628 1.00 49.85 ? 270  LEU A CA    1 
ATOM   2758 C C     . LEU C 3 293 ? 12.707  2.064   -35.002 1.00 49.85 ? 270  LEU A C     1 
ATOM   2759 O O     . LEU C 3 293 ? 11.890  1.837   -35.897 1.00 49.85 ? 270  LEU A O     1 
ATOM   2760 C CB    . LEU C 3 293 ? 11.619  1.367   -32.856 1.00 49.85 ? 270  LEU A CB    1 
ATOM   2761 C CG    . LEU C 3 293 ? 12.471  0.123   -32.583 1.00 49.85 ? 270  LEU A CG    1 
ATOM   2762 C CD1   . LEU C 3 293 ? 13.636  0.444   -31.658 1.00 49.85 ? 270  LEU A CD1   1 
ATOM   2763 C CD2   . LEU C 3 293 ? 11.614  -0.987  -32.000 1.00 49.85 ? 270  LEU A CD2   1 
ATOM   2764 N N     . SER C 3 294 ? 14.018  1.925   -35.163 1.00 49.85 ? 271  SER A N     1 
ATOM   2765 C CA    . SER C 3 294 ? 14.591  1.446   -36.412 1.00 49.85 ? 271  SER A CA    1 
ATOM   2766 C C     . SER C 3 294 ? 14.455  -0.067  -36.506 1.00 49.85 ? 271  SER A C     1 
ATOM   2767 O O     . SER C 3 294 ? 14.956  -0.797  -35.648 1.00 49.85 ? 271  SER A O     1 
ATOM   2768 C CB    . SER C 3 294 ? 16.059  1.852   -36.520 1.00 49.85 ? 271  SER A CB    1 
ATOM   2769 O OG    . SER C 3 294 ? 16.640  1.335   -37.703 1.00 49.85 ? 271  SER A OG    1 
ATOM   2770 N N     . ALA C 3 295 ? 13.773  -0.526  -37.553 1.00 49.85 ? 272  ALA A N     1 
ATOM   2771 C CA    . ALA C 3 295 ? 13.603  -1.956  -37.809 1.00 49.85 ? 272  ALA A CA    1 
ATOM   2772 C C     . ALA C 3 295 ? 14.945  -2.642  -38.057 1.00 49.85 ? 272  ALA A C     1 
ATOM   2773 O O     . ALA C 3 295 ? 15.125  -3.809  -37.711 1.00 49.85 ? 272  ALA A O     1 
ATOM   2774 C CB    . ALA C 3 295 ? 12.668  -2.176  -38.982 1.00 49.85 ? 272  ALA A CB    1 
ATOM   2775 N N     . ARG C 3 296 ? 15.876  -1.902  -38.655 1.00 49.85 ? 273  ARG A N     1 
ATOM   2776 C CA    . ARG C 3 296 ? 17.239  -2.373  -38.886 1.00 49.85 ? 273  ARG A CA    1 
ATOM   2777 C C     . ARG C 3 296 ? 17.953  -2.661  -37.567 1.00 49.85 ? 273  ARG A C     1 
ATOM   2778 O O     . ARG C 3 296 ? 18.611  -3.692  -37.428 1.00 49.85 ? 273  ARG A O     1 
ATOM   2779 C CB    . ARG C 3 296 ? 18.033  -1.334  -39.675 1.00 49.85 ? 273  ARG A CB    1 
ATOM   2780 C CG    . ARG C 3 296 ? 17.519  -1.036  -41.072 1.00 49.85 ? 273  ARG A CG    1 
ATOM   2781 C CD    . ARG C 3 296 ? 17.993  0.340   -41.490 1.00 49.85 ? 273  ARG A CD    1 
ATOM   2782 N NE    . ARG C 3 296 ? 18.289  0.440   -42.915 1.00 49.85 ? 273  ARG A NE    1 
ATOM   2783 C CZ    . ARG C 3 296 ? 19.082  1.366   -43.449 1.00 49.85 ? 273  ARG A CZ    1 
ATOM   2784 N NH1   . ARG C 3 296 ? 19.667  2.278   -42.680 1.00 49.85 ? 273  ARG A NH1   1 
ATOM   2785 N NH2   . ARG C 3 296 ? 19.293  1.381   -44.758 1.00 49.85 ? 273  ARG A NH2   1 
ATOM   2786 N N     . LEU C 3 297 ? 17.817  -1.744  -36.609 1.00 49.85 ? 274  LEU A N     1 
ATOM   2787 C CA    . LEU C 3 297 ? 18.407  -1.899  -35.279 1.00 49.85 ? 274  LEU A CA    1 
ATOM   2788 C C     . LEU C 3 297 ? 17.762  -3.058  -34.527 1.00 49.85 ? 274  LEU A C     1 
ATOM   2789 O O     . LEU C 3 297 ? 18.457  -3.890  -33.938 1.00 49.85 ? 274  LEU A O     1 
ATOM   2790 C CB    . LEU C 3 297 ? 18.273  -0.602  -34.468 1.00 49.85 ? 274  LEU A CB    1 
ATOM   2791 C CG    . LEU C 3 297 ? 18.748  -0.622  -33.008 1.00 49.85 ? 274  LEU A CG    1 
ATOM   2792 C CD1   . LEU C 3 297 ? 20.270  -0.618  -32.901 1.00 49.85 ? 274  LEU A CD1   1 
ATOM   2793 C CD2   . LEU C 3 297 ? 18.158  0.544   -32.238 1.00 49.85 ? 274  LEU A CD2   1 
ATOM   2794 N N     . PHE C 3 298 ? 16.431  -3.098  -34.556 1.00 49.85 ? 275  PHE A N     1 
ATOM   2795 C CA    . PHE C 3 298 ? 15.660  -4.171  -33.937 1.00 49.85 ? 275  PHE A CA    1 
ATOM   2796 C C     . PHE C 3 298 ? 16.053  -5.523  -34.533 1.00 49.85 ? 275  PHE A C     1 
ATOM   2797 O O     . PHE C 3 298 ? 16.188  -6.507  -33.808 1.00 49.85 ? 275  PHE A O     1 
ATOM   2798 C CB    . PHE C 3 298 ? 14.157  -3.905  -34.098 1.00 49.85 ? 275  PHE A CB    1 
ATOM   2799 C CG    . PHE C 3 298 ? 13.275  -4.855  -33.330 1.00 49.85 ? 275  PHE A CG    1 
ATOM   2800 C CD1   . PHE C 3 298 ? 13.532  -5.149  -31.993 1.00 49.85 ? 275  PHE A CD1   1 
ATOM   2801 C CD2   . PHE C 3 298 ? 12.179  -5.452  -33.945 1.00 49.85 ? 275  PHE A CD2   1 
ATOM   2802 C CE1   . PHE C 3 298 ? 12.714  -6.027  -31.285 1.00 49.85 ? 275  PHE A CE1   1 
ATOM   2803 C CE2   . PHE C 3 298 ? 11.355  -6.330  -33.244 1.00 49.85 ? 275  PHE A CE2   1 
ATOM   2804 C CZ    . PHE C 3 298 ? 11.624  -6.617  -31.912 1.00 49.85 ? 275  PHE A CZ    1 
ATOM   2805 N N     . ASN C 3 299 ? 16.240  -5.553  -35.852 1.00 49.85 ? 276  ASN A N     1 
ATOM   2806 C CA    . ASN C 3 299 ? 16.736  -6.734  -36.555 1.00 49.85 ? 276  ASN A CA    1 
ATOM   2807 C C     . ASN C 3 299 ? 18.136  -7.121  -36.083 1.00 49.85 ? 276  ASN A C     1 
ATOM   2808 O O     . ASN C 3 299 ? 18.409  -8.295  -35.827 1.00 49.85 ? 276  ASN A O     1 
ATOM   2809 C CB    . ASN C 3 299 ? 16.740  -6.486  -38.068 1.00 49.85 ? 276  ASN A CB    1 
ATOM   2810 C CG    . ASN C 3 299 ? 16.996  -7.747  -38.874 1.00 49.85 ? 276  ASN A CG    1 
ATOM   2811 O OD1   . ASN C 3 299 ? 16.370  -8.783  -38.652 1.00 49.85 ? 276  ASN A OD1   1 
ATOM   2812 N ND2   . ASN C 3 299 ? 17.922  -7.660  -39.821 1.00 49.85 ? 276  ASN A ND2   1 
ATOM   2813 N N     . GLN C 3 300 ? 19.010  -6.122  -35.969 1.00 49.85 ? 277  GLN A N     1 
ATOM   2814 C CA    . GLN C 3 300 ? 20.393  -6.320  -35.540 1.00 49.85 ? 277  GLN A CA    1 
ATOM   2815 C C     . GLN C 3 300 ? 20.466  -6.823  -34.101 1.00 49.85 ? 277  GLN A C     1 
ATOM   2816 O O     . GLN C 3 300 ? 21.291  -7.678  -33.780 1.00 49.85 ? 277  GLN A O     1 
ATOM   2817 C CB    . GLN C 3 300 ? 21.187  -5.019  -35.690 1.00 49.85 ? 277  GLN A CB    1 
ATOM   2818 C CG    . GLN C 3 300 ? 22.697  -5.202  -35.771 1.00 49.85 ? 277  GLN A CG    1 
ATOM   2819 C CD    . GLN C 3 300 ? 23.434  -3.895  -36.022 1.00 49.85 ? 277  GLN A CD    1 
ATOM   2820 O OE1   . GLN C 3 300 ? 23.353  -2.956  -35.227 1.00 49.85 ? 277  GLN A OE1   1 
ATOM   2821 N NE2   . GLN C 3 300 ? 24.161  -3.832  -37.133 1.00 49.85 ? 277  GLN A NE2   1 
ATOM   2822 N N     . LYS C 3 301 ? 19.598  -6.288  -33.244 1.00 49.85 ? 278  LYS A N     1 
ATOM   2823 C CA    . LYS C 3 301 ? 19.530  -6.693  -31.840 1.00 49.85 ? 278  LYS A CA    1 
ATOM   2824 C C     . LYS C 3 301 ? 19.022  -8.128  -31.684 1.00 49.85 ? 278  LYS A C     1 
ATOM   2825 O O     . LYS C 3 301 ? 19.509  -8.875  -30.832 1.00 49.85 ? 278  LYS A O     1 
ATOM   2826 C CB    . LYS C 3 301 ? 18.645  -5.727  -31.045 1.00 49.85 ? 278  LYS A CB    1 
ATOM   2827 C CG    . LYS C 3 301 ? 19.275  -4.370  -30.755 1.00 49.85 ? 278  LYS A CG    1 
ATOM   2828 C CD    . LYS C 3 301 ? 20.158  -4.407  -29.517 1.00 49.85 ? 278  LYS A CD    1 
ATOM   2829 C CE    . LYS C 3 301 ? 20.725  -3.034  -29.207 1.00 49.85 ? 278  LYS A CE    1 
ATOM   2830 N NZ    . LYS C 3 301 ? 21.514  -3.032  -27.945 1.00 49.85 ? 278  LYS A NZ    1 
ATOM   2831 N N     . LEU C 3 302 ? 18.045  -8.497  -32.513 1.00 49.85 ? 279  LEU A N     1 
ATOM   2832 C CA    . LEU C 3 302 ? 17.470  -9.842  -32.510 1.00 49.85 ? 279  LEU A CA    1 
ATOM   2833 C C     . LEU C 3 302 ? 18.474  -10.885 -32.989 1.00 49.85 ? 279  LEU A C     1 
ATOM   2834 O O     . LEU C 3 302 ? 18.555  -11.977 -32.426 1.00 49.85 ? 279  LEU A O     1 
ATOM   2835 C CB    . LEU C 3 302 ? 16.216  -9.900  -33.390 1.00 49.85 ? 279  LEU A CB    1 
ATOM   2836 C CG    . LEU C 3 302 ? 14.904  -9.277  -32.907 1.00 49.85 ? 279  LEU A CG    1 
ATOM   2837 C CD1   . LEU C 3 302 ? 13.962  -9.093  -34.081 1.00 49.85 ? 279  LEU A CD1   1 
ATOM   2838 C CD2   . LEU C 3 302 ? 14.245  -10.117 -31.828 1.00 49.85 ? 279  LEU A CD2   1 
ATOM   2839 N N     . LYS C 3 303 ? 19.232  -10.535 -34.027 1.00 49.85 ? 280  LYS A N     1 
ATOM   2840 C CA    . LYS C 3 303 ? 20.256  -11.414 -34.589 1.00 49.85 ? 280  LYS A CA    1 
ATOM   2841 C C     . LYS C 3 303 ? 21.312  -11.784 -33.553 1.00 49.85 ? 280  LYS A C     1 
ATOM   2842 O O     . LYS C 3 303 ? 21.718  -12.944 -33.463 1.00 49.85 ? 280  LYS A O     1 
ATOM   2843 C CB    . LYS C 3 303 ? 20.912  -10.763 -35.809 1.00 49.85 ? 280  LYS A CB    1 
ATOM   2844 C CG    . LYS C 3 303 ? 20.093  -10.881 -37.090 1.00 49.85 ? 280  LYS A CG    1 
ATOM   2845 C CD    . LYS C 3 303 ? 20.548  -9.888  -38.153 1.00 49.85 ? 280  LYS A CD    1 
ATOM   2846 C CE    . LYS C 3 303 ? 21.813  -10.342 -38.868 1.00 49.85 ? 280  LYS A CE    1 
ATOM   2847 N NZ    . LYS C 3 303 ? 22.174  -9.407  -39.968 1.00 49.85 ? 280  LYS A NZ    1 
ATOM   2848 N N     . GLU C 3 304 ? 21.745  -10.792 -32.776 1.00 49.85 ? 281  GLU A N     1 
ATOM   2849 C CA    . GLU C 3 304 ? 22.748  -10.982 -31.729 1.00 49.85 ? 281  GLU A CA    1 
ATOM   2850 C C     . GLU C 3 304 ? 22.300  -11.978 -30.657 1.00 49.85 ? 281  GLU A C     1 
ATOM   2851 O O     . GLU C 3 304 ? 23.094  -12.801 -30.200 1.00 49.85 ? 281  GLU A O     1 
ATOM   2852 C CB    . GLU C 3 304 ? 23.105  -9.641  -31.086 1.00 49.85 ? 281  GLU A CB    1 
ATOM   2853 C CG    . GLU C 3 304 ? 23.890  -8.705  -31.996 1.00 49.85 ? 281  GLU A CG    1 
ATOM   2854 C CD    . GLU C 3 304 ? 24.065  -7.308  -31.415 1.00 49.85 ? 281  GLU A CD    1 
ATOM   2855 O OE1   . GLU C 3 304 ? 23.910  -7.134  -30.185 1.00 49.85 ? 281  GLU A OE1   1 
ATOM   2856 O OE2   . GLU C 3 304 ? 24.362  -6.379  -32.197 1.00 49.85 ? 281  GLU A OE2   1 
ATOM   2857 N N     . ILE C 3 305 ? 21.030  -11.895 -30.268 1.00 49.85 ? 282  ILE A N     1 
ATOM   2858 C CA    . ILE C 3 305 ? 20.453  -12.798 -29.270 1.00 49.85 ? 282  ILE A CA    1 
ATOM   2859 C C     . ILE C 3 305 ? 20.368  -14.233 -29.800 1.00 49.85 ? 282  ILE A C     1 
ATOM   2860 O O     . ILE C 3 305 ? 20.674  -15.187 -29.079 1.00 49.85 ? 282  ILE A O     1 
ATOM   2861 C CB    . ILE C 3 305 ? 19.066  -12.295 -28.782 1.00 49.85 ? 282  ILE A CB    1 
ATOM   2862 C CG1   . ILE C 3 305 ? 19.225  -10.971 -28.023 1.00 49.85 ? 282  ILE A CG1   1 
ATOM   2863 C CG2   . ILE C 3 305 ? 18.373  -13.343 -27.907 1.00 49.85 ? 282  ILE A CG2   1 
ATOM   2864 C CD1   . ILE C 3 305 ? 17.921  -10.281 -27.661 1.00 49.85 ? 282  ILE A CD1   1 
ATOM   2865 N N     . ILE C 3 306 ? 19.955  -14.371 -31.060 1.00 49.85 ? 283  ILE A N     1 
ATOM   2866 C CA    . ILE C 3 306 ? 19.877  -15.671 -31.732 1.00 49.85 ? 283  ILE A CA    1 
ATOM   2867 C C     . ILE C 3 306 ? 21.216  -16.409 -31.674 1.00 49.85 ? 283  ILE A C     1 
ATOM   2868 O O     . ILE C 3 306 ? 21.260  -17.610 -31.406 1.00 49.85 ? 283  ILE A O     1 
ATOM   2869 C CB    . ILE C 3 306 ? 19.396  -15.519 -33.208 1.00 49.85 ? 283  ILE A CB    1 
ATOM   2870 C CG1   . ILE C 3 306 ? 17.940  -15.033 -33.265 1.00 49.85 ? 283  ILE A CG1   1 
ATOM   2871 C CG2   . ILE C 3 306 ? 19.575  -16.815 -34.001 1.00 49.85 ? 283  ILE A CG2   1 
ATOM   2872 C CD1   . ILE C 3 306 ? 16.921  -15.908 -32.530 1.00 49.85 ? 283  ILE A CD1   1 
ATOM   2873 N N     . LYS C 3 307 ? 22.299  -15.675 -31.922 1.00 49.85 ? 284  LYS A N     1 
ATOM   2874 C CA    . LYS C 3 307 ? 23.653  -16.230 -31.919 1.00 49.85 ? 284  LYS A CA    1 
ATOM   2875 C C     . LYS C 3 307 ? 24.124  -16.666 -30.525 1.00 49.85 ? 284  LYS A C     1 
ATOM   2876 O O     . LYS C 3 307 ? 25.048  -17.474 -30.403 1.00 49.85 ? 284  LYS A O     1 
ATOM   2877 C CB    . LYS C 3 307 ? 24.632  -15.229 -32.539 1.00 49.85 ? 284  LYS A CB    1 
ATOM   2878 C CG    . LYS C 3 307 ? 24.344  -14.935 -34.006 1.00 49.85 ? 284  LYS A CG    1 
ATOM   2879 C CD    . LYS C 3 307 ? 25.080  -13.701 -34.497 1.00 49.85 ? 284  LYS A CD    1 
ATOM   2880 C CE    . LYS C 3 307 ? 24.722  -13.397 -35.948 1.00 49.85 ? 284  LYS A CE    1 
ATOM   2881 N NZ    . LYS C 3 307 ? 25.607  -12.356 -36.549 1.00 49.85 ? 284  LYS A NZ    1 
ATOM   2882 N N     . ARG C 3 308 ? 23.486  -16.130 -29.485 1.00 49.85 ? 285  ARG A N     1 
ATOM   2883 C CA    . ARG C 3 308 ? 23.778  -16.514 -28.102 1.00 49.85 ? 285  ARG A CA    1 
ATOM   2884 C C     . ARG C 3 308 ? 22.762  -17.518 -27.555 1.00 49.85 ? 285  ARG A C     1 
ATOM   2885 O O     . ARG C 3 308 ? 22.854  -17.934 -26.397 1.00 49.85 ? 285  ARG A O     1 
ATOM   2886 C CB    . ARG C 3 308 ? 23.824  -15.282 -27.195 1.00 49.85 ? 285  ARG A CB    1 
ATOM   2887 C CG    . ARG C 3 308 ? 25.087  -14.444 -27.318 1.00 49.85 ? 285  ARG A CG    1 
ATOM   2888 C CD    . ARG C 3 308 ? 24.981  -13.186 -26.470 1.00 49.85 ? 285  ARG A CD    1 
ATOM   2889 N NE    . ARG C 3 308 ? 23.939  -12.284 -26.963 1.00 49.85 ? 285  ARG A NE    1 
ATOM   2890 C CZ    . ARG C 3 308 ? 23.312  -11.371 -26.225 1.00 49.85 ? 285  ARG A CZ    1 
ATOM   2891 N NH1   . ARG C 3 308 ? 23.609  -11.220 -24.940 1.00 49.85 ? 285  ARG A NH1   1 
ATOM   2892 N NH2   . ARG C 3 308 ? 22.382  -10.605 -26.776 1.00 49.85 ? 285  ARG A NH2   1 
ATOM   2893 N N     . GLN C 3 309 ? 21.799  -17.902 -28.389 1.00 49.85 ? 286  GLN A N     1 
ATOM   2894 C CA    . GLN C 3 309 ? 20.765  -18.854 -27.987 1.00 49.85 ? 286  GLN A CA    1 
ATOM   2895 C C     . GLN C 3 309 ? 20.670  -20.041 -28.950 1.00 49.85 ? 286  GLN A C     1 
ATOM   2896 O O     . GLN C 3 309 ? 20.302  -19.867 -30.115 1.00 49.85 ? 286  GLN A O     1 
ATOM   2897 C CB    . GLN C 3 309 ? 19.407  -18.157 -27.851 1.00 49.85 ? 286  GLN A CB    1 
ATOM   2898 C CG    . GLN C 3 309 ? 19.229  -17.361 -26.557 1.00 49.85 ? 286  GLN A CG    1 
ATOM   2899 C CD    . GLN C 3 309 ? 19.097  -18.242 -25.319 1.00 49.85 ? 286  GLN A CD    1 
ATOM   2900 O OE1   . GLN C 3 309 ? 19.641  -17.925 -24.260 1.00 49.85 ? 286  GLN A OE1   1 
ATOM   2901 N NE2   . GLN C 3 309 ? 18.373  -19.351 -25.448 1.00 49.85 ? 286  GLN A NE2   1 
ATOM   2902 N N     . PRO C 3 310 ? 21.003  -21.253 -28.461 1.00 49.85 ? 287  PRO A N     1 
ATOM   2903 C CA    . PRO C 3 310 ? 20.990  -22.462 -29.288 1.00 49.85 ? 287  PRO A CA    1 
ATOM   2904 C C     . PRO C 3 310 ? 19.579  -22.836 -29.747 1.00 49.85 ? 287  PRO A C     1 
ATOM   2905 O O     . PRO C 3 310 ? 19.316  -22.881 -30.952 1.00 49.85 ? 287  PRO A O     1 
ATOM   2906 C CB    . PRO C 3 310 ? 21.565  -23.540 -28.352 1.00 49.85 ? 287  PRO A CB    1 
ATOM   2907 C CG    . PRO C 3 310 ? 22.228  -22.788 -27.238 1.00 49.85 ? 287  PRO A CG    1 
ATOM   2908 C CD    . PRO C 3 310 ? 21.416  -21.548 -27.078 1.00 49.85 ? 287  PRO A CD    1 
ATOM   2909 N N     . LYS C 3 311 ? 18.686  -23.096 -28.793 1.00 49.85 ? 288  LYS A N     1 
ATOM   2910 C CA    . LYS C 3 311 ? 17.295  -23.419 -29.099 1.00 49.85 ? 288  LYS A CA    1 
ATOM   2911 C C     . LYS C 3 311 ? 16.512  -22.145 -29.408 1.00 49.85 ? 288  LYS A C     1 
ATOM   2912 O O     . LYS C 3 311 ? 16.079  -21.432 -28.499 1.00 49.85 ? 288  LYS A O     1 
ATOM   2913 C CB    . LYS C 3 311 ? 16.650  -24.199 -27.948 1.00 49.85 ? 288  LYS A CB    1 
ATOM   2914 C CG    . LYS C 3 311 ? 17.035  -25.676 -27.907 1.00 49.85 ? 288  LYS A CG    1 
ATOM   2915 C CD    . LYS C 3 311 ? 16.700  -26.329 -26.566 1.00 49.85 ? 288  LYS A CD    1 
ATOM   2916 C CE    . LYS C 3 311 ? 17.829  -26.154 -25.554 1.00 49.85 ? 288  LYS A CE    1 
ATOM   2917 N NZ    . LYS C 3 311 ? 17.569  -26.902 -24.294 1.00 49.85 ? 288  LYS A NZ    1 
ATOM   2918 N N     . HIS C 3 312 ? 16.343  -21.870 -30.701 1.00 49.85 ? 289  HIS A N     1 
ATOM   2919 C CA    . HIS C 3 312 ? 15.634  -20.676 -31.159 1.00 49.85 ? 289  HIS A CA    1 
ATOM   2920 C C     . HIS C 3 312 ? 14.694  -20.963 -32.334 1.00 49.85 ? 289  HIS A C     1 
ATOM   2921 O O     . HIS C 3 312 ? 14.954  -21.852 -33.148 1.00 49.85 ? 289  HIS A O     1 
ATOM   2922 C CB    . HIS C 3 312 ? 16.624  -19.554 -31.508 1.00 49.85 ? 289  HIS A CB    1 
ATOM   2923 C CG    . HIS C 3 312 ? 17.449  -19.822 -32.729 1.00 49.85 ? 289  HIS A CG    1 
ATOM   2924 N ND1   . HIS C 3 312 ? 17.045  -19.455 -33.995 1.00 49.85 ? 289  HIS A ND1   1 
ATOM   2925 C CD2   . HIS C 3 312 ? 18.655  -20.418 -32.878 1.00 49.85 ? 289  HIS A CD2   1 
ATOM   2926 C CE1   . HIS C 3 312 ? 17.965  -19.815 -34.871 1.00 49.85 ? 289  HIS A CE1   1 
ATOM   2927 N NE2   . HIS C 3 312 ? 18.953  -20.401 -34.219 1.00 49.85 ? 289  HIS A NE2   1 
ATOM   2928 N N     . SER C 3 313 ? 13.606  -20.199 -32.409 1.00 49.85 ? 290  SER A N     1 
ATOM   2929 C CA    . SER C 3 313 ? 12.594  -20.369 -33.449 1.00 49.85 ? 290  SER A CA    1 
ATOM   2930 C C     . SER C 3 313 ? 13.016  -19.750 -34.781 1.00 49.85 ? 290  SER A C     1 
ATOM   2931 O O     . SER C 3 313 ? 13.736  -18.750 -34.814 1.00 49.85 ? 290  SER A O     1 
ATOM   2932 C CB    . SER C 3 313 ? 11.257  -19.780 -32.994 1.00 49.85 ? 290  SER A CB    1 
ATOM   2933 O OG    . SER C 3 313 ? 11.378  -18.398 -32.715 1.00 49.85 ? 290  SER A OG    1 
ATOM   2934 N N     . GLN C 3 314 ? 12.556  -20.360 -35.871 1.00 49.85 ? 291  GLN A N     1 
ATOM   2935 C CA    . GLN C 3 314 ? 12.871  -19.913 -37.228 1.00 49.85 ? 291  GLN A CA    1 
ATOM   2936 C C     . GLN C 3 314 ? 11.627  -19.325 -37.908 1.00 49.85 ? 291  GLN A C     1 
ATOM   2937 O O     . GLN C 3 314 ? 10.506  -19.701 -37.559 1.00 49.85 ? 291  GLN A O     1 
ATOM   2938 C CB    . GLN C 3 314 ? 13.425  -21.083 -38.056 1.00 49.85 ? 291  GLN A CB    1 
ATOM   2939 C CG    . GLN C 3 314 ? 14.790  -21.619 -37.600 1.00 49.85 ? 291  GLN A CG    1 
ATOM   2940 C CD    . GLN C 3 314 ? 15.976  -20.788 -38.095 1.00 49.85 ? 291  GLN A CD    1 
ATOM   2941 O OE1   . GLN C 3 314 ? 15.810  -19.764 -38.764 1.00 49.85 ? 291  GLN A OE1   1 
ATOM   2942 N NE2   . GLN C 3 314 ? 17.183  -21.236 -37.764 1.00 49.85 ? 291  GLN A NE2   1 
ATOM   2943 N N     . PRO C 3 315 ? 11.821  -18.399 -38.877 1.00 49.85 ? 292  PRO A N     1 
ATOM   2944 C CA    . PRO C 3 315 ? 10.728  -17.804 -39.664 1.00 49.85 ? 292  PRO A CA    1 
ATOM   2945 C C     . PRO C 3 315 ? 9.818   -18.849 -40.321 1.00 49.85 ? 292  PRO A C     1 
ATOM   2946 O O     . PRO C 3 315 ? 10.289  -19.942 -40.641 1.00 49.85 ? 292  PRO A O     1 
ATOM   2947 C CB    . PRO C 3 315 ? 11.473  -17.010 -40.740 1.00 49.85 ? 292  PRO A CB    1 
ATOM   2948 C CG    . PRO C 3 315 ? 12.761  -16.657 -40.106 1.00 49.85 ? 292  PRO A CG    1 
ATOM   2949 C CD    . PRO C 3 315 ? 13.130  -17.850 -39.280 1.00 49.85 ? 292  PRO A CD    1 
ATOM   2950 N N     . PRO C 3 316 ? 8.522   -18.524 -40.530 1.00 49.85 ? 293  PRO A N     1 
ATOM   2951 C CA    . PRO C 3 316 ? 7.841   -17.236 -40.325 1.00 49.85 ? 293  PRO A CA    1 
ATOM   2952 C C     . PRO C 3 316 ? 7.388   -16.926 -38.890 1.00 49.85 ? 293  PRO A C     1 
ATOM   2953 O O     . PRO C 3 316 ? 7.140   -15.761 -38.573 1.00 49.85 ? 293  PRO A O     1 
ATOM   2954 C CB    . PRO C 3 316 ? 6.619   -17.348 -41.238 1.00 49.85 ? 293  PRO A CB    1 
ATOM   2955 C CG    . PRO C 3 316 ? 6.312   -18.797 -41.284 1.00 49.85 ? 293  PRO A CG    1 
ATOM   2956 C CD    . PRO C 3 316 ? 7.593   -19.552 -41.038 1.00 49.85 ? 293  PRO A CD    1 
ATOM   2957 N N     . VAL C 3 317 ? 7.285   -17.948 -38.043 1.00 49.85 ? 294  VAL A N     1 
ATOM   2958 C CA    . VAL C 3 317 ? 6.738   -17.788 -36.687 1.00 49.85 ? 294  VAL A CA    1 
ATOM   2959 C C     . VAL C 3 317 ? 7.638   -17.002 -35.721 1.00 49.85 ? 294  VAL A C     1 
ATOM   2960 O O     . VAL C 3 317 ? 7.163   -16.497 -34.701 1.00 49.85 ? 294  VAL A O     1 
ATOM   2961 C CB    . VAL C 3 317 ? 6.331   -19.155 -36.052 1.00 49.85 ? 294  VAL A CB    1 
ATOM   2962 C CG1   . VAL C 3 317 ? 5.253   -19.841 -36.886 1.00 49.85 ? 294  VAL A CG1   1 
ATOM   2963 C CG2   . VAL C 3 317 ? 7.543   -20.071 -35.870 1.00 49.85 ? 294  VAL A CG2   1 
ATOM   2964 N N     . SER C 3 318 ? 8.927   -16.903 -36.050 1.00 49.85 ? 295  SER A N     1 
ATOM   2965 C CA    . SER C 3 318 ? 9.912   -16.222 -35.202 1.00 49.85 ? 295  SER A CA    1 
ATOM   2966 C C     . SER C 3 318 ? 9.668   -14.718 -35.114 1.00 49.85 ? 295  SER A C     1 
ATOM   2967 O O     . SER C 3 318 ? 8.908   -14.160 -35.906 1.00 49.85 ? 295  SER A O     1 
ATOM   2968 C CB    . SER C 3 318 ? 11.330  -16.490 -35.713 1.00 49.85 ? 295  SER A CB    1 
ATOM   2969 O OG    . SER C 3 318 ? 11.536  -15.902 -36.988 1.00 49.85 ? 295  SER A OG    1 
ATOM   2970 N N     . LEU C 3 319 ? 10.320  -14.073 -34.147 1.00 49.85 ? 296  LEU A N     1 
ATOM   2971 C CA    . LEU C 3 319 ? 10.193  -12.630 -33.943 1.00 49.85 ? 296  LEU A CA    1 
ATOM   2972 C C     . LEU C 3 319 ? 10.820  -11.852 -35.099 1.00 49.85 ? 296  LEU A C     1 
ATOM   2973 O O     . LEU C 3 319 ? 10.288  -10.824 -35.523 1.00 49.85 ? 296  LEU A O     1 
ATOM   2974 C CB    . LEU C 3 319 ? 10.823  -12.216 -32.611 1.00 49.85 ? 296  LEU A CB    1 
ATOM   2975 C CG    . LEU C 3 319 ? 10.028  -11.256 -31.715 1.00 49.85 ? 296  LEU A CG    1 
ATOM   2976 C CD1   . LEU C 3 319 ? 10.621  -11.233 -30.317 1.00 49.85 ? 296  LEU A CD1   1 
ATOM   2977 C CD2   . LEU C 3 319 ? 9.947   -9.845  -32.285 1.00 49.85 ? 296  LEU A CD2   1 
ATOM   2978 N N     . ILE C 3 320 ? 11.949  -12.350 -35.601 1.00 49.85 ? 297  ILE A N     1 
ATOM   2979 C CA    . ILE C 3 320 ? 12.572  -11.813 -36.811 1.00 49.85 ? 297  ILE A CA    1 
ATOM   2980 C C     . ILE C 3 320 ? 11.657  -12.072 -38.011 1.00 49.85 ? 297  ILE A C     1 
ATOM   2981 O O     . ILE C 3 320 ? 11.548  -11.236 -38.910 1.00 49.85 ? 297  ILE A O     1 
ATOM   2982 C CB    . ILE C 3 320 ? 13.968  -12.439 -37.069 1.00 49.85 ? 297  ILE A CB    1 
ATOM   2983 C CG1   . ILE C 3 320 ? 14.808  -12.432 -35.787 1.00 49.85 ? 297  ILE A CG1   1 
ATOM   2984 C CG2   . ILE C 3 320 ? 14.694  -11.706 -38.204 1.00 49.85 ? 297  ILE A CG2   1 
ATOM   2985 C CD1   . ILE C 3 320 ? 16.054  -13.291 -35.852 1.00 49.85 ? 297  ILE A CD1   1 
ATOM   2986 N N     . GLY C 3 321 ? 11.005  -13.234 -38.008 1.00 49.85 ? 298  GLY A N     1 
ATOM   2987 C CA    . GLY C 3 321 ? 10.017  -13.588 -39.023 1.00 49.85 ? 298  GLY A CA    1 
ATOM   2988 C C     . GLY C 3 321 ? 8.884   -12.583 -39.099 1.00 49.85 ? 298  GLY A C     1 
ATOM   2989 O O     . GLY C 3 321 ? 8.447   -12.224 -40.192 1.00 49.85 ? 298  GLY A O     1 
ATOM   2990 N N     . GLN C 3 322 ? 8.415   -12.130 -37.936 1.00 49.85 ? 299  GLN A N     1 
ATOM   2991 C CA    . GLN C 3 322 ? 7.372   -11.102 -37.853 1.00 49.85 ? 299  GLN A CA    1 
ATOM   2992 C C     . GLN C 3 322 ? 7.845   -9.797  -38.475 1.00 49.85 ? 299  GLN A C     1 
ATOM   2993 O O     . GLN C 3 322 ? 7.079   -9.102  -39.142 1.00 49.85 ? 299  GLN A O     1 
ATOM   2994 C CB    . GLN C 3 322 ? 6.947   -10.850 -36.400 1.00 49.85 ? 299  GLN A CB    1 
ATOM   2995 C CG    . GLN C 3 322 ? 6.525   -12.087 -35.614 1.00 49.85 ? 299  GLN A CG    1 
ATOM   2996 C CD    . GLN C 3 322 ? 5.574   -12.985 -36.379 1.00 49.85 ? 299  GLN A CD    1 
ATOM   2997 O OE1   . GLN C 3 322 ? 4.514   -12.551 -36.829 1.00 49.85 ? 299  GLN A OE1   1 
ATOM   2998 N NE2   . GLN C 3 322 ? 5.951   -14.247 -36.529 1.00 49.85 ? 299  GLN A NE2   1 
ATOM   2999 N N     . LEU C 3 323 ? 9.116   -9.474  -38.249 1.00 49.85 ? 300  LEU A N     1 
ATOM   3000 C CA    . LEU C 3 323 ? 9.732   -8.287  -38.822 1.00 49.85 ? 300  LEU A CA    1 
ATOM   3001 C C     . LEU C 3 323 ? 9.904   -8.450  -40.330 1.00 49.85 ? 300  LEU A C     1 
ATOM   3002 O O     . LEU C 3 323 ? 9.880   -7.468  -41.071 1.00 49.85 ? 300  LEU A O     1 
ATOM   3003 C CB    . LEU C 3 323 ? 11.079  -8.016  -38.152 1.00 49.85 ? 300  LEU A CB    1 
ATOM   3004 C CG    . LEU C 3 323 ? 11.563  -6.567  -38.076 1.00 49.85 ? 300  LEU A CG    1 
ATOM   3005 C CD1   . LEU C 3 323 ? 10.607  -5.708  -37.258 1.00 49.85 ? 300  LEU A CD1   1 
ATOM   3006 C CD2   . LEU C 3 323 ? 12.957  -6.517  -37.480 1.00 49.85 ? 300  LEU A CD2   1 
ATOM   3007 N N     . MET C 3 324 ? 10.075  -9.696  -40.769 1.00 49.85 ? 301  MET A N     1 
ATOM   3008 C CA    . MET C 3 324 ? 10.176  -10.022 -42.190 1.00 49.85 ? 301  MET A CA    1 
ATOM   3009 C C     . MET C 3 324 ? 8.831   -9.920  -42.906 1.00 49.85 ? 301  MET A C     1 
ATOM   3010 O O     . MET C 3 324 ? 8.784   -9.625  -44.101 1.00 49.85 ? 301  MET A O     1 
ATOM   3011 C CB    . MET C 3 324 ? 10.773  -11.418 -42.387 1.00 49.85 ? 301  MET A CB    1 
ATOM   3012 C CG    . MET C 3 324 ? 12.274  -11.519 -42.151 1.00 49.85 ? 301  MET A CG    1 
ATOM   3013 S SD    . MET C 3 324 ? 13.241  -10.394 -43.177 1.00 49.85 ? 301  MET A SD    1 
ATOM   3014 C CE    . MET C 3 324 ? 13.663  -9.129  -41.988 1.00 49.85 ? 301  MET A CE    1 
ATOM   3015 N N     . TRP C 3 325 ? 7.747   -10.166 -42.171 1.00 49.85 ? 302  TRP A N     1 
ATOM   3016 C CA    . TRP C 3 325 ? 6.392   -9.996  -42.698 1.00 49.85 ? 302  TRP A CA    1 
ATOM   3017 C C     . TRP C 3 325 ? 6.120   -8.538  -43.050 1.00 49.85 ? 302  TRP A C     1 
ATOM   3018 O O     . TRP C 3 325 ? 5.504   -8.247  -44.074 1.00 49.85 ? 302  TRP A O     1 
ATOM   3019 C CB    . TRP C 3 325 ? 5.351   -10.509 -41.704 1.00 49.85 ? 302  TRP A CB    1 
ATOM   3020 C CG    . TRP C 3 325 ? 5.182   -11.992 -41.740 1.00 49.85 ? 302  TRP A CG    1 
ATOM   3021 C CD1   . TRP C 3 325 ? 5.640   -12.891 -40.822 1.00 49.85 ? 302  TRP A CD1   1 
ATOM   3022 C CD2   . TRP C 3 325 ? 4.508   -12.754 -42.748 1.00 49.85 ? 302  TRP A CD2   1 
ATOM   3023 N NE1   . TRP C 3 325 ? 5.293   -14.167 -41.194 1.00 49.85 ? 302  TRP A NE1   1 
ATOM   3024 C CE2   . TRP C 3 325 ? 4.597   -14.113 -42.372 1.00 49.85 ? 302  TRP A CE2   1 
ATOM   3025 C CE3   . TRP C 3 325 ? 3.835   -12.421 -43.932 1.00 49.85 ? 302  TRP A CE3   1 
ATOM   3026 C CZ2   . TRP C 3 325 ? 4.039   -15.141 -43.139 1.00 49.85 ? 302  TRP A CZ2   1 
ATOM   3027 C CZ3   . TRP C 3 325 ? 3.280   -13.444 -44.694 1.00 49.85 ? 302  TRP A CZ3   1 
ATOM   3028 C CH2   . TRP C 3 325 ? 3.386   -14.788 -44.293 1.00 49.85 ? 302  TRP A CH2   1 
ATOM   3029 N N     . ARG C 3 326 ? 6.589   -7.634  -42.192 1.00 49.85 ? 303  ARG A N     1 
ATOM   3030 C CA    . ARG C 3 326 ? 6.555   -6.198  -42.458 1.00 49.85 ? 303  ARG A CA    1 
ATOM   3031 C C     . ARG C 3 326 ? 7.293   -5.882  -43.759 1.00 49.85 ? 303  ARG A C     1 
ATOM   3032 O O     . ARG C 3 326 ? 6.801   -5.115  -44.589 1.00 49.85 ? 303  ARG A O     1 
ATOM   3033 C CB    . ARG C 3 326 ? 7.173   -5.434  -41.284 1.00 49.85 ? 303  ARG A CB    1 
ATOM   3034 C CG    . ARG C 3 326 ? 7.115   -3.917  -41.395 1.00 49.85 ? 303  ARG A CG    1 
ATOM   3035 C CD    . ARG C 3 326 ? 7.656   -3.270  -40.132 1.00 49.85 ? 303  ARG A CD    1 
ATOM   3036 N NE    . ARG C 3 326 ? 7.846   -1.828  -40.274 1.00 49.85 ? 303  ARG A NE    1 
ATOM   3037 C CZ    . ARG C 3 326 ? 8.957   -1.254  -40.728 1.00 49.85 ? 303  ARG A CZ    1 
ATOM   3038 N NH1   . ARG C 3 326 ? 9.996   -1.992  -41.093 1.00 49.85 ? 303  ARG A NH1   1 
ATOM   3039 N NH2   . ARG C 3 326 ? 9.030   0.065   -40.818 1.00 49.85 ? 303  ARG A NH2   1 
ATOM   3040 N N     . GLU C 3 327 ? 8.470   -6.484  -43.924 1.00 49.85 ? 304  GLU A N     1 
ATOM   3041 C CA    . GLU C 3 327 ? 9.274   -6.333  -45.135 1.00 49.85 ? 304  GLU A CA    1 
ATOM   3042 C C     . GLU C 3 327 ? 8.573   -6.935  -46.351 1.00 49.85 ? 304  GLU A C     1 
ATOM   3043 O O     . GLU C 3 327 ? 8.693   -6.415  -47.462 1.00 49.85 ? 304  GLU A O     1 
ATOM   3044 C CB    . GLU C 3 327 ? 10.649  -6.986  -44.956 1.00 49.85 ? 304  GLU A CB    1 
ATOM   3045 C CG    . GLU C 3 327 ? 11.458  -6.470  -43.768 1.00 49.85 ? 304  GLU A CG    1 
ATOM   3046 C CD    . GLU C 3 327 ? 12.038  -5.086  -43.991 1.00 49.85 ? 304  GLU A CD    1 
ATOM   3047 O OE1   . GLU C 3 327 ? 12.586  -4.833  -45.085 1.00 49.85 ? 304  GLU A OE1   1 
ATOM   3048 O OE2   . GLU C 3 327 ? 11.949  -4.251  -43.067 1.00 49.85 ? 304  GLU A OE2   1 
ATOM   3049 N N     . PHE C 3 328 ? 7.844   -8.028  -46.129 1.00 49.85 ? 305  PHE A N     1 
ATOM   3050 C CA    . PHE C 3 328 ? 7.126   -8.716  -47.199 1.00 49.85 ? 305  PHE A CA    1 
ATOM   3051 C C     . PHE C 3 328 ? 5.981   -7.879  -47.757 1.00 49.85 ? 305  PHE A C     1 
ATOM   3052 O O     . PHE C 3 328 ? 5.854   -7.729  -48.973 1.00 49.85 ? 305  PHE A O     1 
ATOM   3053 C CB    . PHE C 3 328 ? 6.610   -10.083 -46.731 1.00 49.85 ? 305  PHE A CB    1 
ATOM   3054 C CG    . PHE C 3 328 ? 5.635   -10.722 -47.684 1.00 49.85 ? 305  PHE A CG    1 
ATOM   3055 C CD1   . PHE C 3 328 ? 6.050   -11.168 -48.937 1.00 49.85 ? 305  PHE A CD1   1 
ATOM   3056 C CD2   . PHE C 3 328 ? 4.300   -10.878 -47.330 1.00 49.85 ? 305  PHE A CD2   1 
ATOM   3057 C CE1   . PHE C 3 328 ? 5.150   -11.759 -49.822 1.00 49.85 ? 305  PHE A CE1   1 
ATOM   3058 C CE2   . PHE C 3 328 ? 3.392   -11.469 -48.207 1.00 49.85 ? 305  PHE A CE2   1 
ATOM   3059 C CZ    . PHE C 3 328 ? 3.819   -11.910 -49.456 1.00 49.85 ? 305  PHE A CZ    1 
ATOM   3060 N N     . TYR C 3 329 ? 5.153   -7.339  -46.866 1.00 49.85 ? 306  TYR A N     1 
ATOM   3061 C CA    . TYR C 3 329 ? 4.005   -6.536  -47.278 1.00 49.85 ? 306  TYR A CA    1 
ATOM   3062 C C     . TYR C 3 329 ? 4.421   -5.199  -47.881 1.00 49.85 ? 306  TYR A C     1 
ATOM   3063 O O     . TYR C 3 329 ? 3.723   -4.665  -48.741 1.00 49.85 ? 306  TYR A O     1 
ATOM   3064 C CB    . TYR C 3 329 ? 3.024   -6.335  -46.120 1.00 49.85 ? 306  TYR A CB    1 
ATOM   3065 C CG    . TYR C 3 329 ? 2.212   -7.569  -45.781 1.00 49.85 ? 306  TYR A CG    1 
ATOM   3066 C CD1   . TYR C 3 329 ? 1.225   -8.040  -46.647 1.00 49.85 ? 306  TYR A CD1   1 
ATOM   3067 C CD2   . TYR C 3 329 ? 2.430   -8.264  -44.594 1.00 49.85 ? 306  TYR A CD2   1 
ATOM   3068 C CE1   . TYR C 3 329 ? 0.477   -9.174  -46.337 1.00 49.85 ? 306  TYR A CE1   1 
ATOM   3069 C CE2   . TYR C 3 329 ? 1.688   -9.398  -44.276 1.00 49.85 ? 306  TYR A CE2   1 
ATOM   3070 C CZ    . TYR C 3 329 ? 0.715   -9.847  -45.150 1.00 49.85 ? 306  TYR A CZ    1 
ATOM   3071 O OH    . TYR C 3 329 ? -0.018  -10.968 -44.834 1.00 49.85 ? 306  TYR A OH    1 
ATOM   3072 N N     . TYR C 3 330 ? 5.556   -4.667  -47.431 1.00 49.85 ? 307  TYR A N     1 
ATOM   3073 C CA    . TYR C 3 330 ? 6.102   -3.429  -47.988 1.00 49.85 ? 307  TYR A CA    1 
ATOM   3074 C C     . TYR C 3 330 ? 6.587   -3.591  -49.429 1.00 49.85 ? 307  TYR A C     1 
ATOM   3075 O O     . TYR C 3 330 ? 6.530   -2.644  -50.214 1.00 49.85 ? 307  TYR A O     1 
ATOM   3076 C CB    . TYR C 3 330 ? 7.224   -2.870  -47.104 1.00 49.85 ? 307  TYR A CB    1 
ATOM   3077 C CG    . TYR C 3 330 ? 6.794   -1.721  -46.212 1.00 49.85 ? 307  TYR A CG    1 
ATOM   3078 C CD1   . TYR C 3 330 ? 6.501   -1.926  -44.865 1.00 49.85 ? 307  TYR A CD1   1 
ATOM   3079 C CD2   . TYR C 3 330 ? 6.681   -0.425  -46.718 1.00 49.85 ? 307  TYR A CD2   1 
ATOM   3080 C CE1   . TYR C 3 330 ? 6.105   -0.871  -44.043 1.00 49.85 ? 307  TYR A CE1   1 
ATOM   3081 C CE2   . TYR C 3 330 ? 6.286   0.635   -45.905 1.00 49.85 ? 307  TYR A CE2   1 
ATOM   3082 C CZ    . TYR C 3 330 ? 6.000   0.404   -44.570 1.00 49.85 ? 307  TYR A CZ    1 
ATOM   3083 O OH    . TYR C 3 330 ? 5.611   1.447   -43.765 1.00 49.85 ? 307  TYR A OH    1 
ATOM   3084 N N     . THR C 3 331 ? 7.061   -4.787  -49.770 1.00 49.85 ? 308  THR A N     1 
ATOM   3085 C CA    . THR C 3 331 ? 7.572   -5.059  -51.114 1.00 49.85 ? 308  THR A CA    1 
ATOM   3086 C C     . THR C 3 331 ? 6.445   -5.175  -52.144 1.00 49.85 ? 308  THR A C     1 
ATOM   3087 O O     . THR C 3 331 ? 6.484   -4.511  -53.181 1.00 49.85 ? 308  THR A O     1 
ATOM   3088 C CB    . THR C 3 331 ? 8.474   -6.313  -51.142 1.00 49.85 ? 308  THR A CB    1 
ATOM   3089 O OG1   . THR C 3 331 ? 9.533   -6.155  -50.190 1.00 49.85 ? 308  THR A OG1   1 
ATOM   3090 C CG2   . THR C 3 331 ? 9.077   -6.515  -52.525 1.00 49.85 ? 308  THR A CG2   1 
ATOM   3091 N N     . VAL C 3 332 ? 5.448   -6.012  -51.856 1.00 49.85 ? 309  VAL A N     1 
ATOM   3092 C CA    . VAL C 3 332 ? 4.318   -6.220  -52.773 1.00 49.85 ? 309  VAL A CA    1 
ATOM   3093 C C     . VAL C 3 332 ? 3.499   -4.948  -53.010 1.00 49.85 ? 309  VAL A C     1 
ATOM   3094 O O     . VAL C 3 332 ? 2.952   -4.747  -54.097 1.00 49.85 ? 309  VAL A O     1 
ATOM   3095 C CB    . VAL C 3 332 ? 3.379   -7.376  -52.320 1.00 49.85 ? 309  VAL A CB    1 
ATOM   3096 C CG1   . VAL C 3 332 ? 4.013   -8.728  -52.610 1.00 49.85 ? 309  VAL A CG1   1 
ATOM   3097 C CG2   . VAL C 3 332 ? 3.005   -7.252  -50.845 1.00 49.85 ? 309  VAL A CG2   1 
ATOM   3098 N N     . ALA C 3 333 ? 3.427   -4.098  -51.989 1.00 49.85 ? 310  ALA A N     1 
ATOM   3099 C CA    . ALA C 3 333 ? 2.681   -2.847  -52.065 1.00 49.85 ? 310  ALA A CA    1 
ATOM   3100 C C     . ALA C 3 333 ? 3.432   -1.763  -52.837 1.00 49.85 ? 310  ALA A C     1 
ATOM   3101 O O     . ALA C 3 333 ? 2.818   -0.824  -53.348 1.00 49.85 ? 310  ALA A O     1 
ATOM   3102 C CB    . ALA C 3 333 ? 2.327   -2.361  -50.673 1.00 49.85 ? 310  ALA A CB    1 
ATOM   3103 N N     . ALA C 3 334 ? 4.755   -1.896  -52.918 1.00 49.85 ? 311  ALA A N     1 
ATOM   3104 C CA    . ALA C 3 334 ? 5.589   -0.942  -53.650 1.00 49.85 ? 311  ALA A CA    1 
ATOM   3105 C C     . ALA C 3 334 ? 5.262   -0.922  -55.144 1.00 49.85 ? 311  ALA A C     1 
ATOM   3106 O O     . ALA C 3 334 ? 5.324   0.129   -55.787 1.00 49.85 ? 311  ALA A O     1 
ATOM   3107 C CB    . ALA C 3 334 ? 7.059   -1.242  -53.431 1.00 49.85 ? 311  ALA A CB    1 
ATOM   3108 N N     . ALA C 3 335 ? 4.916   -2.089  -55.685 1.00 49.85 ? 312  ALA A N     1 
ATOM   3109 C CA    . ALA C 3 335 ? 4.536   -2.215  -57.089 1.00 49.85 ? 312  ALA A CA    1 
ATOM   3110 C C     . ALA C 3 335 ? 3.114   -1.711  -57.340 1.00 49.85 ? 312  ALA A C     1 
ATOM   3111 O O     . ALA C 3 335 ? 2.907   -0.841  -58.189 1.00 49.85 ? 312  ALA A O     1 
ATOM   3112 C CB    . ALA C 3 335 ? 4.689   -3.658  -57.557 1.00 49.85 ? 312  ALA A CB    1 
ATOM   3113 N N     . GLU C 3 336 ? 2.147   -2.255  -56.600 1.00 49.85 ? 313  GLU A N     1 
ATOM   3114 C CA    . GLU C 3 336 ? 0.730   -1.938  -56.795 1.00 49.85 ? 313  GLU A CA    1 
ATOM   3115 C C     . GLU C 3 336 ? 0.286   -0.684  -56.030 1.00 49.85 ? 313  GLU A C     1 
ATOM   3116 O O     . GLU C 3 336 ? 0.297   -0.675  -54.797 1.00 49.85 ? 313  GLU A O     1 
ATOM   3117 C CB    . GLU C 3 336 ? -0.141  -3.139  -56.403 1.00 49.85 ? 313  GLU A CB    1 
ATOM   3118 C CG    . GLU C 3 336 ? -1.646  -2.913  -56.534 1.00 49.85 ? 313  GLU A CG    1 
ATOM   3119 C CD    . GLU C 3 336 ? -2.115  -2.872  -57.978 1.00 49.85 ? 313  GLU A CD    1 
ATOM   3120 O OE1   . GLU C 3 336 ? -2.094  -3.929  -58.645 1.00 49.85 ? 313  GLU A OE1   1 
ATOM   3121 O OE2   . GLU C 3 336 ? -2.507  -1.781  -58.445 1.00 49.85 ? 313  GLU A OE2   1 
ATOM   3122 N N     . PRO C 3 337 ? -0.109  0.380   -56.760 1.00 49.85 ? 314  PRO A N     1 
ATOM   3123 C CA    . PRO C 3 337 ? -0.634  1.583   -56.107 1.00 49.85 ? 314  PRO A CA    1 
ATOM   3124 C C     . PRO C 3 337 ? -2.078  1.418   -55.621 1.00 49.85 ? 314  PRO A C     1 
ATOM   3125 O O     . PRO C 3 337 ? -2.522  2.172   -54.754 1.00 49.85 ? 314  PRO A O     1 
ATOM   3126 C CB    . PRO C 3 337 ? -0.557  2.640   -57.209 1.00 49.85 ? 314  PRO A CB    1 
ATOM   3127 C CG    . PRO C 3 337 ? -0.683  1.873   -58.474 1.00 49.85 ? 314  PRO A CG    1 
ATOM   3128 C CD    . PRO C 3 337 ? -0.082  0.516   -58.229 1.00 49.85 ? 314  PRO A CD    1 
ATOM   3129 N N     . ASN C 3 338 ? -2.793  0.442   -56.178 1.00 49.85 ? 315  ASN A N     1 
ATOM   3130 C CA    . ASN C 3 338 ? -4.162  0.132   -55.760 1.00 49.85 ? 315  ASN A CA    1 
ATOM   3131 C C     . ASN C 3 338 ? -4.193  -1.006  -54.736 1.00 49.85 ? 315  ASN A C     1 
ATOM   3132 O O     . ASN C 3 338 ? -5.126  -1.816  -54.710 1.00 49.85 ? 315  ASN A O     1 
ATOM   3133 C CB    . ASN C 3 338 ? -5.035  -0.214  -56.974 1.00 49.85 ? 315  ASN A CB    1 
ATOM   3134 C CG    . ASN C 3 338 ? -5.022  0.868   -58.043 1.00 49.85 ? 315  ASN A CG    1 
ATOM   3135 O OD1   . ASN C 3 338 ? -4.426  1.933   -57.869 1.00 49.85 ? 315  ASN A OD1   1 
ATOM   3136 N ND2   . ASN C 3 338 ? -5.686  0.596   -59.162 1.00 49.85 ? 315  ASN A ND2   1 
ATOM   3137 N N     . PHE C 3 339 ? -3.159  -1.048  -53.897 1.00 49.85 ? 316  PHE A N     1 
ATOM   3138 C CA    . PHE C 3 339 ? -2.975  -2.094  -52.889 1.00 49.85 ? 316  PHE A CA    1 
ATOM   3139 C C     . PHE C 3 339 ? -4.050  -2.065  -51.797 1.00 49.85 ? 316  PHE A C     1 
ATOM   3140 O O     . PHE C 3 339 ? -4.351  -3.092  -51.183 1.00 49.85 ? 316  PHE A O     1 
ATOM   3141 C CB    . PHE C 3 339 ? -1.579  -1.960  -52.271 1.00 49.85 ? 316  PHE A CB    1 
ATOM   3142 C CG    . PHE C 3 339 ? -1.134  -3.161  -51.484 1.00 49.85 ? 316  PHE A CG    1 
ATOM   3143 C CD1   . PHE C 3 339 ? -0.652  -4.296  -52.130 1.00 49.85 ? 316  PHE A CD1   1 
ATOM   3144 C CD2   . PHE C 3 339 ? -1.190  -3.156  -50.095 1.00 49.85 ? 316  PHE A CD2   1 
ATOM   3145 C CE1   . PHE C 3 339 ? -0.236  -5.411  -51.403 1.00 49.85 ? 316  PHE A CE1   1 
ATOM   3146 C CE2   . PHE C 3 339 ? -0.777  -4.264  -49.360 1.00 49.85 ? 316  PHE A CE2   1 
ATOM   3147 C CZ    . PHE C 3 339 ? -0.299  -5.394  -50.015 1.00 49.85 ? 316  PHE A CZ    1 
ATOM   3148 N N     . ASP C 3 340 ? -4.621  -0.884  -51.567 1.00 49.85 ? 317  ASP A N     1 
ATOM   3149 C CA    . ASP C 3 340 ? -5.625  -0.680  -50.522 1.00 49.85 ? 317  ASP A CA    1 
ATOM   3150 C C     . ASP C 3 340 ? -7.068  -0.928  -50.973 1.00 49.85 ? 317  ASP A C     1 
ATOM   3151 O O     . ASP C 3 340 ? -7.974  -0.994  -50.139 1.00 49.85 ? 317  ASP A O     1 
ATOM   3152 C CB    . ASP C 3 340 ? -5.494  0.727   -49.919 1.00 49.85 ? 317  ASP A CB    1 
ATOM   3153 C CG    . ASP C 3 340 ? -5.425  1.827   -50.976 1.00 49.85 ? 317  ASP A CG    1 
ATOM   3154 O OD1   . ASP C 3 340 ? -5.694  1.560   -52.169 1.00 49.85 ? 317  ASP A OD1   1 
ATOM   3155 O OD2   . ASP C 3 340 ? -5.096  2.974   -50.603 1.00 49.85 ? 317  ASP A OD2   1 
ATOM   3156 N N     . ARG C 3 341 ? -7.277  -1.063  -52.281 1.00 49.85 ? 318  ARG A N     1 
ATOM   3157 C CA    . ARG C 3 341 ? -8.614  -1.319  -52.831 1.00 49.85 ? 318  ARG A CA    1 
ATOM   3158 C C     . ARG C 3 341 ? -8.688  -2.648  -53.591 1.00 49.85 ? 318  ARG A C     1 
ATOM   3159 O O     . ARG C 3 341 ? -7.660  -3.260  -53.885 1.00 49.85 ? 318  ARG A O     1 
ATOM   3160 C CB    . ARG C 3 341 ? -9.082  -0.153  -53.715 1.00 49.85 ? 318  ARG A CB    1 
ATOM   3161 C CG    . ARG C 3 341 ? -8.207  0.120   -54.934 1.00 49.85 ? 318  ARG A CG    1 
ATOM   3162 C CD    . ARG C 3 341 ? -8.713  1.312   -55.741 1.00 49.85 ? 318  ARG A CD    1 
ATOM   3163 N NE    . ARG C 3 341 ? -8.667  2.566   -54.985 1.00 49.85 ? 318  ARG A NE    1 
ATOM   3164 C CZ    . ARG C 3 341 ? -7.610  3.375   -54.911 1.00 49.85 ? 318  ARG A CZ    1 
ATOM   3165 N NH1   . ARG C 3 341 ? -6.481  3.078   -55.546 1.00 49.85 ? 318  ARG A NH1   1 
ATOM   3166 N NH2   . ARG C 3 341 ? -7.681  4.490   -54.194 1.00 49.85 ? 318  ARG A NH2   1 
ATOM   3167 N N     . MET C 3 342 ? -9.909  -3.081  -53.901 1.00 49.85 ? 319  MET A N     1 
ATOM   3168 C CA    . MET C 3 342 ? -10.145 -4.332  -54.623 1.00 49.85 ? 319  MET A CA    1 
ATOM   3169 C C     . MET C 3 342 ? -9.992  -4.145  -56.133 1.00 49.85 ? 319  MET A C     1 
ATOM   3170 O O     . MET C 3 342 ? -9.314  -4.935  -56.797 1.00 49.85 ? 319  MET A O     1 
ATOM   3171 C CB    . MET C 3 342 ? -11.536 -4.891  -54.289 1.00 49.85 ? 319  MET A CB    1 
ATOM   3172 C CG    . MET C 3 342 ? -11.840 -6.256  -54.899 1.00 49.85 ? 319  MET A CG    1 
ATOM   3173 S SD    . MET C 3 342 ? -13.368 -7.000  -54.284 1.00 49.85 ? 319  MET A SD    1 
ATOM   3174 C CE    . MET C 3 342 ? -14.606 -6.074  -55.192 1.00 49.85 ? 319  MET A CE    1 
ATOM   3175 N N     . LEU C 3 343 ? -10.623 -3.098  -56.661 1.00 49.85 ? 320  LEU A N     1 
ATOM   3176 C CA    . LEU C 3 343 ? -10.611 -2.818  -58.096 1.00 49.85 ? 320  LEU A CA    1 
ATOM   3177 C C     . LEU C 3 343 ? -9.264  -2.258  -58.542 1.00 49.85 ? 320  LEU A C     1 
ATOM   3178 O O     . LEU C 3 343 ? -8.780  -1.263  -57.993 1.00 49.85 ? 320  LEU A O     1 
ATOM   3179 C CB    . LEU C 3 343 ? -11.745 -1.854  -58.470 1.00 49.85 ? 320  LEU A CB    1 
ATOM   3180 C CG    . LEU C 3 343 ? -13.189 -2.279  -58.166 1.00 49.85 ? 320  LEU A CG    1 
ATOM   3181 C CD1   . LEU C 3 343 ? -14.135 -1.085  -58.260 1.00 49.85 ? 320  LEU A CD1   1 
ATOM   3182 C CD2   . LEU C 3 343 ? -13.655 -3.416  -59.077 1.00 49.85 ? 320  LEU A CD2   1 
ATOM   3183 N N     . GLY C 3 344 ? -8.668  -2.907  -59.539 1.00 49.85 ? 321  GLY A N     1 
ATOM   3184 C CA    . GLY C 3 344 ? -7.366  -2.506  -60.067 1.00 49.85 ? 321  GLY A CA    1 
ATOM   3185 C C     . GLY C 3 344 ? -6.192  -3.040  -59.264 1.00 49.85 ? 321  GLY A C     1 
ATOM   3186 O O     . GLY C 3 344 ? -5.062  -2.574  -59.426 1.00 49.85 ? 321  GLY A O     1 
ATOM   3187 N N     . ASN C 3 345 ? -6.463  -4.018  -58.400 1.00 49.85 ? 322  ASN A N     1 
ATOM   3188 C CA    . ASN C 3 345 ? -5.432  -4.651  -57.581 1.00 49.85 ? 322  ASN A CA    1 
ATOM   3189 C C     . ASN C 3 345 ? -5.034  -6.005  -58.159 1.00 49.85 ? 322  ASN A C     1 
ATOM   3190 O O     . ASN C 3 345 ? -5.872  -6.900  -58.297 1.00 49.85 ? 322  ASN A O     1 
ATOM   3191 C CB    . ASN C 3 345 ? -5.920  -4.811  -56.139 1.00 49.85 ? 322  ASN A CB    1 
ATOM   3192 C CG    . ASN C 3 345 ? -4.783  -4.993  -55.140 1.00 49.85 ? 322  ASN A CG    1 
ATOM   3193 O OD1   . ASN C 3 345 ? -3.673  -5.395  -55.496 1.00 49.85 ? 322  ASN A OD1   1 
ATOM   3194 N ND2   . ASN C 3 345 ? -5.062  -4.693  -53.876 1.00 49.85 ? 322  ASN A ND2   1 
ATOM   3195 N N     . VAL C 3 346 ? -3.752  -6.142  -58.489 1.00 49.85 ? 323  VAL A N     1 
ATOM   3196 C CA    . VAL C 3 346 ? -3.232  -7.332  -59.170 1.00 49.85 ? 323  VAL A CA    1 
ATOM   3197 C C     . VAL C 3 346 ? -3.225  -8.587  -58.281 1.00 49.85 ? 323  VAL A C     1 
ATOM   3198 O O     . VAL C 3 346 ? -3.232  -9.712  -58.785 1.00 49.85 ? 323  VAL A O     1 
ATOM   3199 C CB    . VAL C 3 346 ? -1.827  -7.059  -59.803 1.00 49.85 ? 323  VAL A CB    1 
ATOM   3200 C CG1   . VAL C 3 346 ? -0.725  -7.036  -58.742 1.00 49.85 ? 323  VAL A CG1   1 
ATOM   3201 C CG2   . VAL C 3 346 ? -1.508  -8.070  -60.904 1.00 49.85 ? 323  VAL A CG2   1 
ATOM   3202 N N     . TYR C 3 347 ? -3.214  -8.386  -56.965 1.00 49.85 ? 324  TYR A N     1 
ATOM   3203 C CA    . TYR C 3 347 ? -3.188  -9.496  -56.012 1.00 49.85 ? 324  TYR A CA    1 
ATOM   3204 C C     . TYR C 3 347 ? -4.586  -9.865  -55.519 1.00 49.85 ? 324  TYR A C     1 
ATOM   3205 O O     . TYR C 3 347 ? -4.865  -11.034 -55.246 1.00 49.85 ? 324  TYR A O     1 
ATOM   3206 C CB    . TYR C 3 347 ? -2.300  -9.164  -54.806 1.00 49.85 ? 324  TYR A CB    1 
ATOM   3207 C CG    . TYR C 3 347 ? -0.987  -8.486  -55.134 1.00 49.85 ? 324  TYR A CG    1 
ATOM   3208 C CD1   . TYR C 3 347 ? 0.092   -9.211  -55.639 1.00 49.85 ? 324  TYR A CD1   1 
ATOM   3209 C CD2   . TYR C 3 347 ? -0.823  -7.115  -54.933 1.00 49.85 ? 324  TYR A CD2   1 
ATOM   3210 C CE1   . TYR C 3 347 ? 1.299   -8.587  -55.939 1.00 49.85 ? 324  TYR A CE1   1 
ATOM   3211 C CE2   . TYR C 3 347 ? 0.380   -6.483  -55.229 1.00 49.85 ? 324  TYR A CE2   1 
ATOM   3212 C CZ    . TYR C 3 347 ? 1.436   -7.224  -55.731 1.00 49.85 ? 324  TYR A CZ    1 
ATOM   3213 O OH    . TYR C 3 347 ? 2.630   -6.603  -56.027 1.00 49.85 ? 324  TYR A OH    1 
ATOM   3214 N N     . CYS C 3 348 ? -5.455  -8.862  -55.410 1.00 49.85 ? 325  CYS A N     1 
ATOM   3215 C CA    . CYS C 3 348 ? -6.758  -9.017  -54.764 1.00 49.85 ? 325  CYS A CA    1 
ATOM   3216 C C     . CYS C 3 348 ? -7.779  -9.777  -55.604 1.00 49.85 ? 325  CYS A C     1 
ATOM   3217 O O     . CYS C 3 348 ? -8.078  -9.397  -56.738 1.00 49.85 ? 325  CYS A O     1 
ATOM   3218 C CB    . CYS C 3 348 ? -7.319  -7.650  -54.364 1.00 49.85 ? 325  CYS A CB    1 
ATOM   3219 S SG    . CYS C 3 348 ? -8.874  -7.723  -53.452 1.00 49.85 ? 325  CYS A SG    1 
ATOM   3220 N N     . MET C 3 349 ? -8.305  -10.854 -55.024 1.00 49.85 ? 326  MET A N     1 
ATOM   3221 C CA    . MET C 3 349 ? -9.360  -11.659 -55.635 1.00 49.85 ? 326  MET A CA    1 
ATOM   3222 C C     . MET C 3 349 ? -10.651 -10.850 -55.713 1.00 49.85 ? 326  MET A C     1 
ATOM   3223 O O     . MET C 3 349 ? -11.127 -10.327 -54.701 1.00 49.85 ? 326  MET A O     1 
ATOM   3224 C CB    . MET C 3 349 ? -9.594  -12.928 -54.811 1.00 49.85 ? 326  MET A CB    1 
ATOM   3225 C CG    . MET C 3 349 ? -10.306 -14.050 -55.550 1.00 49.85 ? 326  MET A CG    1 
ATOM   3226 S SD    . MET C 3 349 ? -9.192  -15.067 -56.540 1.00 49.85 ? 326  MET A SD    1 
ATOM   3227 C CE    . MET C 3 349 ? -8.327  -16.001 -55.277 1.00 49.85 ? 326  MET A CE    1 
ATOM   3228 N N     . GLN C 3 350 ? -11.213 -10.750 -56.914 1.00 49.85 ? 327  GLN A N     1 
ATOM   3229 C CA    . GLN C 3 350 ? -12.452 -10.005 -57.121 1.00 49.85 ? 327  GLN A CA    1 
ATOM   3230 C C     . GLN C 3 350 ? -13.637 -10.778 -56.548 1.00 49.85 ? 327  GLN A C     1 
ATOM   3231 O O     . GLN C 3 350 ? -14.106 -11.757 -57.137 1.00 49.85 ? 327  GLN A O     1 
ATOM   3232 C CB    . GLN C 3 350 ? -12.661 -9.673  -58.605 1.00 49.85 ? 327  GLN A CB    1 
ATOM   3233 C CG    . GLN C 3 350 ? -11.526 -8.868  -59.244 1.00 49.85 ? 327  GLN A CG    1 
ATOM   3234 C CD    . GLN C 3 350 ? -11.235 -7.561  -58.518 1.00 49.85 ? 327  GLN A CD    1 
ATOM   3235 O OE1   . GLN C 3 350 ? -12.044 -6.631  -58.532 1.00 49.85 ? 327  GLN A OE1   1 
ATOM   3236 N NE2   . GLN C 3 350 ? -10.072 -7.488  -57.879 1.00 49.85 ? 327  GLN A NE2   1 
ATOM   3237 N N     . ILE C 3 351 ? -14.106 -10.325 -55.387 1.00 49.85 ? 328  ILE A N     1 
ATOM   3238 C CA    . ILE C 3 351 ? -15.201 -10.972 -54.667 1.00 49.85 ? 328  ILE A CA    1 
ATOM   3239 C C     . ILE C 3 351 ? -16.375 -9.999  -54.524 1.00 49.85 ? 328  ILE A C     1 
ATOM   3240 O O     . ILE C 3 351 ? -16.190 -8.871  -54.058 1.00 49.85 ? 328  ILE A O     1 
ATOM   3241 C CB    . ILE C 3 351 ? -14.745 -11.476 -53.266 1.00 49.85 ? 328  ILE A CB    1 
ATOM   3242 C CG1   . ILE C 3 351 ? -13.524 -12.396 -53.393 1.00 49.85 ? 328  ILE A CG1   1 
ATOM   3243 C CG2   . ILE C 3 351 ? -15.883 -12.206 -52.548 1.00 49.85 ? 328  ILE A CG2   1 
ATOM   3244 C CD1   . ILE C 3 351 ? -12.686 -12.505 -52.132 1.00 49.85 ? 328  ILE A CD1   1 
ATOM   3245 N N     . PRO C 3 352 ? -17.585 -10.429 -54.930 1.00 49.85 ? 329  PRO A N     1 
ATOM   3246 C CA    . PRO C 3 352 ? -18.781 -9.609  -54.732 1.00 49.85 ? 329  PRO A CA    1 
ATOM   3247 C C     . PRO C 3 352 ? -19.185 -9.505  -53.254 1.00 49.85 ? 329  PRO A C     1 
ATOM   3248 O O     . PRO C 3 352 ? -19.995 -10.299 -52.765 1.00 49.85 ? 329  PRO A O     1 
ATOM   3249 C CB    . PRO C 3 352 ? -19.851 -10.341 -55.551 1.00 49.85 ? 329  PRO A CB    1 
ATOM   3250 C CG    . PRO C 3 352 ? -19.392 -11.755 -55.599 1.00 49.85 ? 329  PRO A CG    1 
ATOM   3251 C CD    . PRO C 3 352 ? -17.894 -11.706 -55.604 1.00 49.85 ? 329  PRO A CD    1 
ATOM   3252 N N     . TRP C 3 353 ? -18.611 -8.528  -52.556 1.00 49.85 ? 330  TRP A N     1 
ATOM   3253 C CA    . TRP C 3 353 ? -18.960 -8.260  -51.164 1.00 49.85 ? 330  TRP A CA    1 
ATOM   3254 C C     . TRP C 3 353 ? -20.272 -7.484  -51.104 1.00 49.85 ? 330  TRP A C     1 
ATOM   3255 O O     . TRP C 3 353 ? -20.535 -6.633  -51.959 1.00 49.85 ? 330  TRP A O     1 
ATOM   3256 C CB    . TRP C 3 353 ? -17.853 -7.466  -50.468 1.00 49.85 ? 330  TRP A CB    1 
ATOM   3257 C CG    . TRP C 3 353 ? -16.512 -8.152  -50.442 1.00 49.85 ? 330  TRP A CG    1 
ATOM   3258 C CD1   . TRP C 3 353 ? -15.430 -7.865  -51.225 1.00 49.85 ? 330  TRP A CD1   1 
ATOM   3259 C CD2   . TRP C 3 353 ? -16.113 -9.232  -49.590 1.00 49.85 ? 330  TRP A CD2   1 
ATOM   3260 N NE1   . TRP C 3 353 ? -14.385 -8.700  -50.916 1.00 49.85 ? 330  TRP A NE1   1 
ATOM   3261 C CE2   . TRP C 3 353 ? -14.776 -9.549  -49.915 1.00 49.85 ? 330  TRP A CE2   1 
ATOM   3262 C CE3   . TRP C 3 353 ? -16.757 -9.965  -48.583 1.00 49.85 ? 330  TRP A CE3   1 
ATOM   3263 C CZ2   . TRP C 3 353 ? -14.068 -10.567 -49.269 1.00 49.85 ? 330  TRP A CZ2   1 
ATOM   3264 C CZ3   . TRP C 3 353 ? -16.052 -10.978 -47.941 1.00 49.85 ? 330  TRP A CZ3   1 
ATOM   3265 C CH2   . TRP C 3 353 ? -14.721 -11.268 -48.288 1.00 49.85 ? 330  TRP A CH2   1 
ATOM   3266 N N     . GLN C 3 354 ? -21.090 -7.777  -50.095 1.00 49.85 ? 331  GLN A N     1 
ATOM   3267 C CA    . GLN C 3 354 ? -22.413 -7.159  -49.975 1.00 49.85 ? 331  GLN A CA    1 
ATOM   3268 C C     . GLN C 3 354 ? -22.461 -5.981  -49.006 1.00 49.85 ? 331  GLN A C     1 
ATOM   3269 O O     . GLN C 3 354 ? -21.796 -5.983  -47.969 1.00 49.85 ? 331  GLN A O     1 
ATOM   3270 C CB    . GLN C 3 354 ? -23.475 -8.198  -49.595 1.00 49.85 ? 331  GLN A CB    1 
ATOM   3271 C CG    . GLN C 3 354 ? -23.899 -9.104  -50.750 1.00 49.85 ? 331  GLN A CG    1 
ATOM   3272 C CD    . GLN C 3 354 ? -25.319 -9.635  -50.605 1.00 49.85 ? 331  GLN A CD    1 
ATOM   3273 O OE1   . GLN C 3 354 ? -26.266 -8.872  -50.400 1.00 49.85 ? 331  GLN A OE1   1 
ATOM   3274 N NE2   . GLN C 3 354 ? -25.471 -10.951 -50.716 1.00 49.85 ? 331  GLN A NE2   1 
ATOM   3275 N N     . GLU C 3 355 ? -23.260 -4.979  -49.369 1.00 49.85 ? 332  GLU A N     1 
ATOM   3276 C CA    . GLU C 3 355 ? -23.512 -3.807  -48.535 1.00 49.85 ? 332  GLU A CA    1 
ATOM   3277 C C     . GLU C 3 355 ? -24.451 -4.143  -47.380 1.00 49.85 ? 332  GLU A C     1 
ATOM   3278 O O     . GLU C 3 355 ? -25.468 -4.814  -47.575 1.00 49.85 ? 332  GLU A O     1 
ATOM   3279 C CB    . GLU C 3 355 ? -24.135 -2.693  -49.381 1.00 49.85 ? 332  GLU A CB    1 
ATOM   3280 C CG    . GLU C 3 355 ? -23.141 -1.881  -50.198 1.00 49.85 ? 332  GLU A CG    1 
ATOM   3281 C CD    . GLU C 3 355 ? -22.542 -0.719  -49.420 1.00 49.85 ? 332  GLU A CD    1 
ATOM   3282 O OE1   . GLU C 3 355 ? -23.110 -0.332  -48.373 1.00 49.85 ? 332  GLU A OE1   1 
ATOM   3283 O OE2   . GLU C 3 355 ? -21.499 -0.190  -49.859 1.00 49.85 ? 332  GLU A OE2   1 
ATOM   3284 N N     . HIS C 3 356 ? -24.104 -3.675  -46.182 1.00 49.85 ? 333  HIS A N     1 
ATOM   3285 C CA    . HIS C 3 356 ? -24.975 -3.805  -45.012 1.00 49.85 ? 333  HIS A CA    1 
ATOM   3286 C C     . HIS C 3 356 ? -24.554 -2.831  -43.904 1.00 49.85 ? 333  HIS A C     1 
ATOM   3287 O O     . HIS C 3 356 ? -23.868 -3.227  -42.957 1.00 49.85 ? 333  HIS A O     1 
ATOM   3288 C CB    . HIS C 3 356 ? -24.989 -5.248  -44.491 1.00 49.85 ? 333  HIS A CB    1 
ATOM   3289 C CG    . HIS C 3 356 ? -26.331 -5.701  -44.007 1.00 49.85 ? 333  HIS A CG    1 
ATOM   3290 N ND1   . HIS C 3 356 ? -26.804 -5.414  -42.744 1.00 49.85 ? 333  HIS A ND1   1 
ATOM   3291 C CD2   . HIS C 3 356 ? -27.302 -6.421  -44.618 1.00 49.85 ? 333  HIS A CD2   1 
ATOM   3292 C CE1   . HIS C 3 356 ? -28.009 -5.939  -42.598 1.00 49.85 ? 333  HIS A CE1   1 
ATOM   3293 N NE2   . HIS C 3 356 ? -28.334 -6.555  -43.721 1.00 49.85 ? 333  HIS A NE2   1 
ATOM   3294 N N     . PRO C 3 357 ? -24.965 -1.549  -44.022 1.00 49.85 ? 334  PRO A N     1 
ATOM   3295 C CA    . PRO C 3 357 ? -24.592 -0.504  -43.059 1.00 49.85 ? 334  PRO A CA    1 
ATOM   3296 C C     . PRO C 3 357 ? -24.997 -0.825  -41.617 1.00 49.85 ? 334  PRO A C     1 
ATOM   3297 O O     . PRO C 3 357 ? -24.281 -0.453  -40.682 1.00 49.85 ? 334  PRO A O     1 
ATOM   3298 C CB    . PRO C 3 357 ? -25.351 0.728   -43.565 1.00 49.85 ? 334  PRO A CB    1 
ATOM   3299 C CG    . PRO C 3 357 ? -25.576 0.465   -45.007 1.00 49.85 ? 334  PRO A CG    1 
ATOM   3300 C CD    . PRO C 3 357 ? -25.820 -1.010  -45.095 1.00 49.85 ? 334  PRO A CD    1 
ATOM   3301 N N     . ASP C 3 358 ? -26.131 -1.508  -41.451 1.00 49.85 ? 335  ASP A N     1 
ATOM   3302 C CA    . ASP C 3 358 ? -26.586 -1.976  -40.139 1.00 49.85 ? 335  ASP A CA    1 
ATOM   3303 C C     . ASP C 3 358 ? -25.551 -2.887  -39.480 1.00 49.85 ? 335  ASP A C     1 
ATOM   3304 O O     . ASP C 3 358 ? -25.177 -2.679  -38.323 1.00 49.85 ? 335  ASP A O     1 
ATOM   3305 C CB    . ASP C 3 358 ? -27.926 -2.713  -40.258 1.00 49.85 ? 335  ASP A CB    1 
ATOM   3306 C CG    . ASP C 3 358 ? -29.116 -1.771  -40.320 1.00 49.85 ? 335  ASP A CG    1 
ATOM   3307 O OD1   . ASP C 3 358 ? -28.920 -0.546  -40.475 1.00 49.85 ? 335  ASP A OD1   1 
ATOM   3308 O OD2   . ASP C 3 358 ? -30.257 -2.266  -40.212 1.00 49.85 ? 335  ASP A OD2   1 
ATOM   3309 N N     . HIS C 3 359 ? -25.095 -3.890  -40.229 1.00 49.85 ? 336  HIS A N     1 
ATOM   3310 C CA    . HIS C 3 359 ? -24.095 -4.835  -39.742 1.00 49.85 ? 336  HIS A CA    1 
ATOM   3311 C C     . HIS C 3 359 ? -22.693 -4.230  -39.676 1.00 49.85 ? 336  HIS A C     1 
ATOM   3312 O O     . HIS C 3 359 ? -21.824 -4.742  -38.967 1.00 49.85 ? 336  HIS A O     1 
ATOM   3313 C CB    . HIS C 3 359 ? -24.091 -6.112  -40.589 1.00 49.85 ? 336  HIS A CB    1 
ATOM   3314 C CG    . HIS C 3 359 ? -25.219 -7.051  -40.280 1.00 49.85 ? 336  HIS A CG    1 
ATOM   3315 N ND1   . HIS C 3 359 ? -25.714 -7.948  -41.203 1.00 49.85 ? 336  HIS A ND1   1 
ATOM   3316 C CD2   . HIS C 3 359 ? -25.948 -7.231  -39.153 1.00 49.85 ? 336  HIS A CD2   1 
ATOM   3317 C CE1   . HIS C 3 359 ? -26.697 -8.641  -40.657 1.00 49.85 ? 336  HIS A CE1   1 
ATOM   3318 N NE2   . HIS C 3 359 ? -26.860 -8.225  -39.414 1.00 49.85 ? 336  HIS A NE2   1 
ATOM   3319 N N     . LEU C 3 360 ? -22.479 -3.143  -40.414 1.00 49.85 ? 337  LEU A N     1 
ATOM   3320 C CA    . LEU C 3 360 ? -21.201 -2.438  -40.392 1.00 49.85 ? 337  LEU A CA    1 
ATOM   3321 C C     . LEU C 3 360 ? -21.062 -1.570  -39.140 1.00 49.85 ? 337  LEU A C     1 
ATOM   3322 O O     . LEU C 3 360 ? -20.022 -1.594  -38.478 1.00 49.85 ? 337  LEU A O     1 
ATOM   3323 C CB    . LEU C 3 360 ? -21.028 -1.591  -41.657 1.00 49.85 ? 337  LEU A CB    1 
ATOM   3324 C CG    . LEU C 3 360 ? -19.689 -0.871  -41.845 1.00 49.85 ? 337  LEU A CG    1 
ATOM   3325 C CD1   . LEU C 3 360 ? -18.575 -1.859  -42.150 1.00 49.85 ? 337  LEU A CD1   1 
ATOM   3326 C CD2   . LEU C 3 360 ? -19.796 0.167   -42.944 1.00 49.85 ? 337  LEU A CD2   1 
ATOM   3327 N N     . GLU C 3 361 ? -22.113 -0.812  -38.827 1.00 49.85 ? 338  GLU A N     1 
ATOM   3328 C CA    . GLU C 3 361 ? -22.152 0.054   -37.644 1.00 49.85 ? 338  GLU A CA    1 
ATOM   3329 C C     . GLU C 3 361 ? -22.004 -0.753  -36.350 1.00 49.85 ? 338  GLU A C     1 
ATOM   3330 O O     . GLU C 3 361 ? -21.383 -0.289  -35.390 1.00 49.85 ? 338  GLU A O     1 
ATOM   3331 C CB    . GLU C 3 361 ? -23.453 0.874   -37.628 1.00 49.85 ? 338  GLU A CB    1 
ATOM   3332 C CG    . GLU C 3 361 ? -23.572 1.921   -36.505 1.00 49.85 ? 338  GLU A CG    1 
ATOM   3333 C CD    . GLU C 3 361 ? -22.781 3.205   -36.763 1.00 49.85 ? 338  GLU A CD    1 
ATOM   3334 O OE1   . GLU C 3 361 ? -22.381 3.460   -37.921 1.00 49.85 ? 338  GLU A OE1   1 
ATOM   3335 O OE2   . GLU C 3 361 ? -22.561 3.966   -35.795 1.00 49.85 ? 338  GLU A OE2   1 
ATOM   3336 N N     . ALA C 3 362 ? -22.574 -1.958  -36.338 1.00 49.85 ? 339  ALA A N     1 
ATOM   3337 C CA    . ALA C 3 362 ? -22.500 -2.855  -35.186 1.00 49.85 ? 339  ALA A CA    1 
ATOM   3338 C C     . ALA C 3 362 ? -21.081 -3.380  -34.961 1.00 49.85 ? 339  ALA A C     1 
ATOM   3339 O O     . ALA C 3 362 ? -20.598 -3.409  -33.826 1.00 49.85 ? 339  ALA A O     1 
ATOM   3340 C CB    . ALA C 3 362 ? -23.479 -4.009  -35.351 1.00 49.85 ? 339  ALA A CB    1 
ATOM   3341 N N     . TRP C 3 363 ? -20.426 -3.789  -36.046 1.00 49.85 ? 340  TRP A N     1 
ATOM   3342 C CA    . TRP C 3 363 ? -19.054 -4.295  -35.998 1.00 49.85 ? 340  TRP A CA    1 
ATOM   3343 C C     . TRP C 3 363 ? -18.083 -3.202  -35.567 1.00 49.85 ? 340  TRP A C     1 
ATOM   3344 O O     . TRP C 3 363 ? -17.214 -3.435  -34.730 1.00 49.85 ? 340  TRP A O     1 
ATOM   3345 C CB    . TRP C 3 363 ? -18.647 -4.863  -37.364 1.00 49.85 ? 340  TRP A CB    1 
ATOM   3346 C CG    . TRP C 3 363 ? -17.260 -5.452  -37.412 1.00 49.85 ? 340  TRP A CG    1 
ATOM   3347 C CD1   . TRP C 3 363 ? -16.895 -6.718  -37.053 1.00 49.85 ? 340  TRP A CD1   1 
ATOM   3348 C CD2   . TRP C 3 363 ? -16.060 -4.798  -37.849 1.00 49.85 ? 340  TRP A CD2   1 
ATOM   3349 N NE1   . TRP C 3 363 ? -15.544 -6.893  -37.237 1.00 49.85 ? 340  TRP A NE1   1 
ATOM   3350 C CE2   . TRP C 3 363 ? -15.007 -5.731  -37.724 1.00 49.85 ? 340  TRP A CE2   1 
ATOM   3351 C CE3   . TRP C 3 363 ? -15.773 -3.514  -38.332 1.00 49.85 ? 340  TRP A CE3   1 
ATOM   3352 C CZ2   . TRP C 3 363 ? -13.686 -5.422  -38.064 1.00 49.85 ? 340  TRP A CZ2   1 
ATOM   3353 C CZ3   . TRP C 3 363 ? -14.458 -3.207  -38.671 1.00 49.85 ? 340  TRP A CZ3   1 
ATOM   3354 C CH2   . TRP C 3 363 ? -13.432 -4.159  -38.535 1.00 49.85 ? 340  TRP A CH2   1 
ATOM   3355 N N     . THR C 3 364 ? -18.247 -2.014  -36.145 1.00 49.85 ? 341  THR A N     1 
ATOM   3356 C CA    . THR C 3 364 ? -17.364 -0.875  -35.892 1.00 49.85 ? 341  THR A CA    1 
ATOM   3357 C C     . THR C 3 364 ? -17.321 -0.484  -34.411 1.00 49.85 ? 341  THR A C     1 
ATOM   3358 O O     . THR C 3 364 ? -16.271 -0.089  -33.899 1.00 49.85 ? 341  THR A O     1 
ATOM   3359 C CB    . THR C 3 364 ? -17.768 0.347   -36.756 1.00 49.85 ? 341  THR A CB    1 
ATOM   3360 O OG1   . THR C 3 364 ? -17.912 -0.057  -38.123 1.00 49.85 ? 341  THR A OG1   1 
ATOM   3361 C CG2   . THR C 3 364 ? -16.721 1.451   -36.676 1.00 49.85 ? 341  THR A CG2   1 
ATOM   3362 N N     . HIS C 3 365 ? -18.457 -0.600  -33.728 1.00 49.85 ? 342  HIS A N     1 
ATOM   3363 C CA    . HIS C 3 365 ? -18.559 -0.166  -32.334 1.00 49.85 ? 342  HIS A CA    1 
ATOM   3364 C C     . HIS C 3 365 ? -18.657 -1.309  -31.329 1.00 49.85 ? 342  HIS A C     1 
ATOM   3365 O O     . HIS C 3 365 ? -18.882 -1.082  -30.137 1.00 49.85 ? 342  HIS A O     1 
ATOM   3366 C CB    . HIS C 3 365 ? -19.724 0.813   -32.170 1.00 49.85 ? 342  HIS A CB    1 
ATOM   3367 C CG    . HIS C 3 365 ? -19.539 2.091   -32.924 1.00 49.85 ? 342  HIS A CG    1 
ATOM   3368 N ND1   . HIS C 3 365 ? -19.954 2.251   -34.228 1.00 49.85 ? 342  HIS A ND1   1 
ATOM   3369 C CD2   . HIS C 3 365 ? -18.977 3.267   -32.560 1.00 49.85 ? 342  HIS A CD2   1 
ATOM   3370 C CE1   . HIS C 3 365 ? -19.660 3.473   -34.634 1.00 49.85 ? 342  HIS A CE1   1 
ATOM   3371 N NE2   . HIS C 3 365 ? -19.066 4.110   -33.641 1.00 49.85 ? 342  HIS A NE2   1 
ATOM   3372 N N     . GLY C 3 366 ? -18.484 -2.535  -31.816 1.00 49.85 ? 343  GLY A N     1 
ATOM   3373 C CA    . GLY C 3 366 ? -18.516 -3.721  -30.967 1.00 49.85 ? 343  GLY A CA    1 
ATOM   3374 C C     . GLY C 3 366 ? -19.867 -3.945  -30.321 1.00 49.85 ? 343  GLY A C     1 
ATOM   3375 O O     . GLY C 3 366 ? -19.973 -4.008  -29.094 1.00 49.85 ? 343  GLY A O     1 
ATOM   3376 N N     . ARG C 3 367 ? -20.899 -4.064  -31.153 1.00 49.85 ? 344  ARG A N     1 
ATOM   3377 C CA    . ARG C 3 367 ? -22.254 -4.363  -30.692 1.00 49.85 ? 344  ARG A CA    1 
ATOM   3378 C C     . ARG C 3 367 ? -22.861 -5.488  -31.530 1.00 49.85 ? 344  ARG A C     1 
ATOM   3379 O O     . ARG C 3 367 ? -24.068 -5.513  -31.779 1.00 49.85 ? 344  ARG A O     1 
ATOM   3380 C CB    . ARG C 3 367 ? -23.136 -3.111  -30.747 1.00 49.85 ? 344  ARG A CB    1 
ATOM   3381 C CG    . ARG C 3 367 ? -22.755 -2.019  -29.751 1.00 49.85 ? 344  ARG A CG    1 
ATOM   3382 C CD    . ARG C 3 367 ? -23.622 -0.776  -29.911 1.00 49.85 ? 344  ARG A CD    1 
ATOM   3383 N NE    . ARG C 3 367 ? -23.586 -0.244  -31.275 1.00 49.85 ? 344  ARG A NE    1 
ATOM   3384 C CZ    . ARG C 3 367 ? -24.164 0.891   -31.660 1.00 49.85 ? 344  ARG A CZ    1 
ATOM   3385 N NH1   . ARG C 3 367 ? -24.833 1.638   -30.789 1.00 49.85 ? 344  ARG A NH1   1 
ATOM   3386 N NH2   . ARG C 3 367 ? -24.071 1.284   -32.924 1.00 49.85 ? 344  ARG A NH2   1 
ATOM   3387 N N     . THR C 3 368 ? -22.005 -6.416  -31.956 1.00 49.85 ? 345  THR A N     1 
ATOM   3388 C CA    . THR C 3 368 ? -22.401 -7.525  -32.825 1.00 49.85 ? 345  THR A CA    1 
ATOM   3389 C C     . THR C 3 368 ? -23.275 -8.544  -32.105 1.00 49.85 ? 345  THR A C     1 
ATOM   3390 O O     . THR C 3 368 ? -24.160 -9.147  -32.711 1.00 49.85 ? 345  THR A O     1 
ATOM   3391 C CB    . THR C 3 368 ? -21.175 -8.272  -33.398 1.00 49.85 ? 345  THR A CB    1 
ATOM   3392 O OG1   . THR C 3 368 ? -20.443 -8.885  -32.329 1.00 49.85 ? 345  THR A OG1   1 
ATOM   3393 C CG2   . THR C 3 368 ? -20.262 -7.323  -34.165 1.00 49.85 ? 345  THR A CG2   1 
ATOM   3394 N N     . GLY C 3 369 ? -23.021 -8.730  -30.814 1.00 49.85 ? 346  GLY A N     1 
ATOM   3395 C CA    . GLY C 3 369 ? -23.705 -9.755  -30.036 1.00 49.85 ? 346  GLY A CA    1 
ATOM   3396 C C     . GLY C 3 369 ? -22.780 -10.919 -29.747 1.00 49.85 ? 346  GLY A C     1 
ATOM   3397 O O     . GLY C 3 369 ? -23.095 -11.785 -28.928 1.00 49.85 ? 346  GLY A O     1 
ATOM   3398 N N     . TYR C 3 370 ? -21.637 -10.933 -30.431 1.00 49.85 ? 347  TYR A N     1 
ATOM   3399 C CA    . TYR C 3 370 ? -20.566 -11.880 -30.151 1.00 49.85 ? 347  TYR A CA    1 
ATOM   3400 C C     . TYR C 3 370 ? -19.558 -11.218 -29.213 1.00 49.85 ? 347  TYR A C     1 
ATOM   3401 O O     . TYR C 3 370 ? -18.762 -10.380 -29.645 1.00 49.85 ? 347  TYR A O     1 
ATOM   3402 C CB    . TYR C 3 370 ? -19.891 -12.344 -31.446 1.00 49.85 ? 347  TYR A CB    1 
ATOM   3403 C CG    . TYR C 3 370 ? -20.734 -13.288 -32.273 1.00 49.85 ? 347  TYR A CG    1 
ATOM   3404 C CD1   . TYR C 3 370 ? -20.684 -14.667 -32.062 1.00 49.85 ? 347  TYR A CD1   1 
ATOM   3405 C CD2   . TYR C 3 370 ? -21.583 -12.805 -33.267 1.00 49.85 ? 347  TYR A CD2   1 
ATOM   3406 C CE1   . TYR C 3 370 ? -21.459 -15.539 -32.820 1.00 49.85 ? 347  TYR A CE1   1 
ATOM   3407 C CE2   . TYR C 3 370 ? -22.361 -13.667 -34.030 1.00 49.85 ? 347  TYR A CE2   1 
ATOM   3408 C CZ    . TYR C 3 370 ? -22.294 -15.031 -33.801 1.00 49.85 ? 347  TYR A CZ    1 
ATOM   3409 O OH    . TYR C 3 370 ? -23.064 -15.885 -34.556 1.00 49.85 ? 347  TYR A OH    1 
ATOM   3410 N N     . PRO C 3 371 ? -19.594 -11.594 -27.921 1.00 49.85 ? 348  PRO A N     1 
ATOM   3411 C CA    . PRO C 3 371 ? -18.814 -10.961 -26.857 1.00 49.85 ? 348  PRO A CA    1 
ATOM   3412 C C     . PRO C 3 371 ? -17.313 -10.920 -27.118 1.00 49.85 ? 348  PRO A C     1 
ATOM   3413 O O     . PRO C 3 371 ? -16.659 -9.948  -26.744 1.00 49.85 ? 348  PRO A O     1 
ATOM   3414 C CB    . PRO C 3 371 ? -19.123 -11.833 -25.638 1.00 49.85 ? 348  PRO A CB    1 
ATOM   3415 C CG    . PRO C 3 371 ? -20.454 -12.401 -25.931 1.00 49.85 ? 348  PRO A CG    1 
ATOM   3416 C CD    . PRO C 3 371 ? -20.423 -12.691 -27.392 1.00 49.85 ? 348  PRO A CD    1 
ATOM   3417 N N     . PHE C 3 372 ? -16.779 -11.961 -27.751 1.00 49.85 ? 349  PHE A N     1 
ATOM   3418 C CA    . PHE C 3 372 ? -15.359 -12.011 -28.076 1.00 49.85 ? 349  PHE A CA    1 
ATOM   3419 C C     . PHE C 3 372 ? -15.003 -10.998 -29.165 1.00 49.85 ? 349  PHE A C     1 
ATOM   3420 O O     . PHE C 3 372 ? -13.975 -10.327 -29.080 1.00 49.85 ? 349  PHE A O     1 
ATOM   3421 C CB    . PHE C 3 372 ? -14.942 -13.429 -28.479 1.00 49.85 ? 349  PHE A CB    1 
ATOM   3422 C CG    . PHE C 3 372 ? -13.475 -13.570 -28.782 1.00 49.85 ? 349  PHE A CG    1 
ATOM   3423 C CD1   . PHE C 3 372 ? -12.522 -13.393 -27.784 1.00 49.85 ? 349  PHE A CD1   1 
ATOM   3424 C CD2   . PHE C 3 372 ? -13.048 -13.883 -30.066 1.00 49.85 ? 349  PHE A CD2   1 
ATOM   3425 C CE1   . PHE C 3 372 ? -11.166 -13.523 -28.063 1.00 49.85 ? 349  PHE A CE1   1 
ATOM   3426 C CE2   . PHE C 3 372 ? -11.694 -14.016 -30.354 1.00 49.85 ? 349  PHE A CE2   1 
ATOM   3427 C CZ    . PHE C 3 372 ? -10.752 -13.836 -29.350 1.00 49.85 ? 349  PHE A CZ    1 
ATOM   3428 N N     . ILE C 3 373 ? -15.859 -10.893 -30.179 1.00 49.85 ? 350  ILE A N     1 
ATOM   3429 C CA    . ILE C 3 373 ? -15.672 -9.929  -31.265 1.00 49.85 ? 350  ILE A CA    1 
ATOM   3430 C C     . ILE C 3 373 ? -15.855 -8.500  -30.754 1.00 49.85 ? 350  ILE A C     1 
ATOM   3431 O O     . ILE C 3 373 ? -15.130 -7.591  -31.160 1.00 49.85 ? 350  ILE A O     1 
ATOM   3432 C CB    . ILE C 3 373 ? -16.633 -10.209 -32.458 1.00 49.85 ? 350  ILE A CB    1 
ATOM   3433 C CG1   . ILE C 3 373 ? -16.434 -11.630 -33.011 1.00 49.85 ? 350  ILE A CG1   1 
ATOM   3434 C CG2   . ILE C 3 373 ? -16.483 -9.157  -33.564 1.00 49.85 ? 350  ILE A CG2   1 
ATOM   3435 C CD1   . ILE C 3 373 ? -15.023 -11.956 -33.507 1.00 49.85 ? 350  ILE A CD1   1 
ATOM   3436 N N     . ASP C 3 374 ? -16.826 -8.317  -29.861 1.00 49.85 ? 351  ASP A N     1 
ATOM   3437 C CA    . ASP C 3 374 ? -17.110 -7.009  -29.275 1.00 49.85 ? 351  ASP A CA    1 
ATOM   3438 C C     . ASP C 3 374 ? -15.997 -6.545  -28.340 1.00 49.85 ? 351  ASP A C     1 
ATOM   3439 O O     . ASP C 3 374 ? -15.615 -5.375  -28.365 1.00 49.85 ? 351  ASP A O     1 
ATOM   3440 C CB    . ASP C 3 374 ? -18.457 -7.025  -28.544 1.00 49.85 ? 351  ASP A CB    1 
ATOM   3441 C CG    . ASP C 3 374 ? -19.639 -7.156  -29.493 1.00 49.85 ? 351  ASP A CG    1 
ATOM   3442 O OD1   . ASP C 3 374 ? -19.453 -6.995  -30.718 1.00 49.85 ? 351  ASP A OD1   1 
ATOM   3443 O OD2   . ASP C 3 374 ? -20.760 -7.418  -29.013 1.00 49.85 ? 351  ASP A OD2   1 
ATOM   3444 N N     . ALA C 3 375 ? -15.482 -7.466  -27.527 1.00 49.85 ? 352  ALA A N     1 
ATOM   3445 C CA    . ALA C 3 375 ? -14.401 -7.164  -26.588 1.00 49.85 ? 352  ALA A CA    1 
ATOM   3446 C C     . ALA C 3 375 ? -13.139 -6.685  -27.299 1.00 49.85 ? 352  ALA A C     1 
ATOM   3447 O O     . ALA C 3 375 ? -12.449 -5.791  -26.808 1.00 49.85 ? 352  ALA A O     1 
ATOM   3448 C CB    . ALA C 3 375 ? -14.099 -8.371  -25.711 1.00 49.85 ? 352  ALA A CB    1 
ATOM   3449 N N     . ILE C 3 376 ? -12.846 -7.283  -28.453 1.00 49.85 ? 353  ILE A N     1 
ATOM   3450 C CA    . ILE C 3 376 ? -11.694 -6.885  -29.260 1.00 49.85 ? 353  ILE A CA    1 
ATOM   3451 C C     . ILE C 3 376 ? -11.907 -5.495  -29.858 1.00 49.85 ? 353  ILE A C     1 
ATOM   3452 O O     . ILE C 3 376 ? -11.038 -4.628  -29.750 1.00 49.85 ? 353  ILE A O     1 
ATOM   3453 C CB    . ILE C 3 376 ? -11.383 -7.916  -30.377 1.00 49.85 ? 353  ILE A CB    1 
ATOM   3454 C CG1   . ILE C 3 376 ? -10.939 -9.248  -29.766 1.00 49.85 ? 353  ILE A CG1   1 
ATOM   3455 C CG2   . ILE C 3 376 ? -10.303 -7.384  -31.316 1.00 49.85 ? 353  ILE A CG2   1 
ATOM   3456 C CD1   . ILE C 3 376 ? -10.960 -10.417 -30.729 1.00 49.85 ? 353  ILE A CD1   1 
ATOM   3457 N N     . MET C 3 377 ? -13.067 -5.295  -30.481 1.00 49.85 ? 354  MET A N     1 
ATOM   3458 C CA    . MET C 3 377 ? -13.397 -4.029  -31.136 1.00 49.85 ? 354  MET A CA    1 
ATOM   3459 C C     . MET C 3 377 ? -13.454 -2.854  -30.164 1.00 49.85 ? 354  MET A C     1 
ATOM   3460 O O     . MET C 3 377 ? -13.133 -1.721  -30.532 1.00 49.85 ? 354  MET A O     1 
ATOM   3461 C CB    . MET C 3 377 ? -14.714 -4.142  -31.909 1.00 49.85 ? 354  MET A CB    1 
ATOM   3462 C CG    . MET C 3 377 ? -14.638 -5.001  -33.167 1.00 49.85 ? 354  MET A CG    1 
ATOM   3463 S SD    . MET C 3 377 ? -13.312 -4.543  -34.305 1.00 49.85 ? 354  MET A SD    1 
ATOM   3464 C CE    . MET C 3 377 ? -13.877 -2.950  -34.900 1.00 49.85 ? 354  MET A CE    1 
ATOM   3465 N N     . ARG C 3 378 ? -13.861 -3.128  -28.927 1.00 49.85 ? 355  ARG A N     1 
ATOM   3466 C CA    . ARG C 3 378 ? -13.922 -2.097  -27.896 1.00 49.85 ? 355  ARG A CA    1 
ATOM   3467 C C     . ARG C 3 378 ? -12.536 -1.710  -27.380 1.00 49.85 ? 355  ARG A C     1 
ATOM   3468 O O     . ARG C 3 378 ? -12.289 -0.535  -27.102 1.00 49.85 ? 355  ARG A O     1 
ATOM   3469 C CB    . ARG C 3 378 ? -14.847 -2.512  -26.751 1.00 49.85 ? 355  ARG A CB    1 
ATOM   3470 C CG    . ARG C 3 378 ? -16.320 -2.488  -27.129 1.00 49.85 ? 355  ARG A CG    1 
ATOM   3471 C CD    . ARG C 3 378 ? -17.206 -2.769  -25.935 1.00 49.85 ? 355  ARG A CD    1 
ATOM   3472 N NE    . ARG C 3 378 ? -18.553 -3.172  -26.332 1.00 49.85 ? 355  ARG A NE    1 
ATOM   3473 C CZ    . ARG C 3 378 ? -19.524 -3.489  -25.481 1.00 49.85 ? 355  ARG A CZ    1 
ATOM   3474 N NH1   . ARG C 3 378 ? -19.308 -3.451  -24.172 1.00 49.85 ? 355  ARG A NH1   1 
ATOM   3475 N NH2   . ARG C 3 378 ? -20.717 -3.844  -25.939 1.00 49.85 ? 355  ARG A NH2   1 
ATOM   3476 N N     . GLN C 3 379 ? -11.638 -2.689  -27.258 1.00 49.85 ? 356  GLN A N     1 
ATOM   3477 C CA    . GLN C 3 379 ? -10.243 -2.411  -26.904 1.00 49.85 ? 356  GLN A CA    1 
ATOM   3478 C C     . GLN C 3 379 ? -9.568  -1.610  -28.014 1.00 49.85 ? 356  GLN A C     1 
ATOM   3479 O O     . GLN C 3 379 ? -8.768  -0.712  -27.743 1.00 49.85 ? 356  GLN A O     1 
ATOM   3480 C CB    . GLN C 3 379 ? -9.461  -3.702  -26.633 1.00 49.85 ? 356  GLN A CB    1 
ATOM   3481 C CG    . GLN C 3 379 ? -8.036  -3.460  -26.129 1.00 49.85 ? 356  GLN A CG    1 
ATOM   3482 C CD    . GLN C 3 379 ? -7.221  -4.729  -25.975 1.00 49.85 ? 356  GLN A CD    1 
ATOM   3483 O OE1   . GLN C 3 379 ? -7.209  -5.587  -26.854 1.00 49.85 ? 356  GLN A OE1   1 
ATOM   3484 N NE2   . GLN C 3 379 ? -6.529  -4.851  -24.851 1.00 49.85 ? 356  GLN A NE2   1 
ATOM   3485 N N     . LEU C 3 380 ? -9.904  -1.946  -29.259 1.00 49.85 ? 357  LEU A N     1 
ATOM   3486 C CA    . LEU C 3 380 ? -9.381  -1.258  -30.437 1.00 49.85 ? 357  LEU A CA    1 
ATOM   3487 C C     . LEU C 3 380 ? -9.763  0.224   -30.457 1.00 49.85 ? 357  LEU A C     1 
ATOM   3488 O O     . LEU C 3 380 ? -8.945  1.074   -30.816 1.00 49.85 ? 357  LEU A O     1 
ATOM   3489 C CB    . LEU C 3 380 ? -9.864  -1.957  -31.713 1.00 49.85 ? 357  LEU A CB    1 
ATOM   3490 C CG    . LEU C 3 380 ? -9.542  -1.346  -33.082 1.00 49.85 ? 357  LEU A CG    1 
ATOM   3491 C CD1   . LEU C 3 380 ? -8.042  -1.233  -33.321 1.00 49.85 ? 357  LEU A CD1   1 
ATOM   3492 C CD2   . LEU C 3 380 ? -10.201 -2.151  -34.188 1.00 49.85 ? 357  LEU A CD2   1 
ATOM   3493 N N     . ARG C 3 381 ? -11.003 0.518   -30.070 1.00 49.85 ? 358  ARG A N     1 
ATOM   3494 C CA    . ARG C 3 381 ? -11.508 1.888   -30.023 1.00 49.85 ? 358  ARG A CA    1 
ATOM   3495 C C     . ARG C 3 381 ? -10.883 2.678   -28.875 1.00 49.85 ? 358  ARG A C     1 
ATOM   3496 O O     . ARG C 3 381 ? -10.442 3.814   -29.063 1.00 49.85 ? 358  ARG A O     1 
ATOM   3497 C CB    . ARG C 3 381 ? -13.038 1.892   -29.914 1.00 49.85 ? 358  ARG A CB    1 
ATOM   3498 C CG    . ARG C 3 381 ? -13.670 3.282   -29.907 1.00 49.85 ? 358  ARG A CG    1 
ATOM   3499 C CD    . ARG C 3 381 ? -15.138 3.247   -30.320 1.00 49.85 ? 358  ARG A CD    1 
ATOM   3500 N NE    . ARG C 3 381 ? -15.315 2.894   -31.731 1.00 49.85 ? 358  ARG A NE    1 
ATOM   3501 C CZ    . ARG C 3 381 ? -15.240 3.753   -32.746 1.00 49.85 ? 358  ARG A CZ    1 
ATOM   3502 N NH1   . ARG C 3 381 ? -14.987 5.038   -32.528 1.00 49.85 ? 358  ARG A NH1   1 
ATOM   3503 N NH2   . ARG C 3 381 ? -15.417 3.323   -33.988 1.00 49.85 ? 358  ARG A NH2   1 
ATOM   3504 N N     . GLN C 3 382 ? -10.849 2.066   -27.694 1.00 49.85 ? 359  GLN A N     1 
ATOM   3505 C CA    . GLN C 3 382 ? -10.351 2.716   -26.483 1.00 49.85 ? 359  GLN A CA    1 
ATOM   3506 C C     . GLN C 3 382 ? -8.830  2.892   -26.479 1.00 49.85 ? 359  GLN A C     1 
ATOM   3507 O O     . GLN C 3 382 ? -8.331  4.016   -26.409 1.00 49.85 ? 359  GLN A O     1 
ATOM   3508 C CB    . GLN C 3 382 ? -10.787 1.934   -25.240 1.00 49.85 ? 359  GLN A CB    1 
ATOM   3509 C CG    . GLN C 3 382 ? -12.287 1.914   -24.986 1.00 49.85 ? 359  GLN A CG    1 
ATOM   3510 C CD    . GLN C 3 382 ? -12.702 0.823   -24.013 1.00 49.85 ? 359  GLN A CD    1 
ATOM   3511 O OE1   . GLN C 3 382 ? -11.976 0.498   -23.074 1.00 49.85 ? 359  GLN A OE1   1 
ATOM   3512 N NE2   . GLN C 3 382 ? -13.879 0.253   -24.236 1.00 49.85 ? 359  GLN A NE2   1 
ATOM   3513 N N     . GLU C 3 383 ? -8.106  1.777   -26.556 1.00 49.85 ? 360  GLU A N     1 
ATOM   3514 C CA    . GLU C 3 383 ? -6.656  1.770   -26.343 1.00 49.85 ? 360  GLU A CA    1 
ATOM   3515 C C     . GLU C 3 383 ? -5.829  1.972   -27.614 1.00 49.85 ? 360  GLU A C     1 
ATOM   3516 O O     . GLU C 3 383 ? -4.673  2.395   -27.545 1.00 49.85 ? 360  GLU A O     1 
ATOM   3517 C CB    . GLU C 3 383 ? -6.235  0.486   -25.625 1.00 49.85 ? 360  GLU A CB    1 
ATOM   3518 C CG    . GLU C 3 383 ? -6.792  0.371   -24.212 1.00 49.85 ? 360  GLU A CG    1 
ATOM   3519 C CD    . GLU C 3 383 ? -6.533  -0.979  -23.571 1.00 49.85 ? 360  GLU A CD    1 
ATOM   3520 O OE1   . GLU C 3 383 ? -5.679  -1.741  -24.074 1.00 49.85 ? 360  GLU A OE1   1 
ATOM   3521 O OE2   . GLU C 3 383 ? -7.191  -1.276  -22.553 1.00 49.85 ? 360  GLU A OE2   1 
ATOM   3522 N N     . GLY C 3 384 ? -6.421  1.670   -28.766 1.00 49.85 ? 361  GLY A N     1 
ATOM   3523 C CA    . GLY C 3 384 ? -5.775  1.919   -30.053 1.00 49.85 ? 361  GLY A CA    1 
ATOM   3524 C C     . GLY C 3 384 ? -4.823  0.835   -30.522 1.00 49.85 ? 361  GLY A C     1 
ATOM   3525 O O     . GLY C 3 384 ? -4.103  1.022   -31.506 1.00 49.85 ? 361  GLY A O     1 
ATOM   3526 N N     . TRP C 3 385 ? -4.818  -0.296  -29.821 1.00 49.85 ? 362  TRP A N     1 
ATOM   3527 C CA    . TRP C 3 385 ? -4.013  -1.449  -30.213 1.00 49.85 ? 362  TRP A CA    1 
ATOM   3528 C C     . TRP C 3 385 ? -4.675  -2.752  -29.785 1.00 49.85 ? 362  TRP A C     1 
ATOM   3529 O O     . TRP C 3 385 ? -5.206  -2.860  -28.677 1.00 49.85 ? 362  TRP A O     1 
ATOM   3530 C CB    . TRP C 3 385 ? -2.598  -1.361  -29.629 1.00 49.85 ? 362  TRP A CB    1 
ATOM   3531 C CG    . TRP C 3 385 ? -1.691  -2.473  -30.085 1.00 49.85 ? 362  TRP A CG    1 
ATOM   3532 C CD1   . TRP C 3 385 ? -0.847  -2.454  -31.157 1.00 49.85 ? 362  TRP A CD1   1 
ATOM   3533 C CD2   . TRP C 3 385 ? -1.544  -3.768  -29.482 1.00 49.85 ? 362  TRP A CD2   1 
ATOM   3534 N NE1   . TRP C 3 385 ? -0.182  -3.653  -31.261 1.00 49.85 ? 362  TRP A NE1   1 
ATOM   3535 C CE2   . TRP C 3 385 ? -0.591  -4.477  -30.246 1.00 49.85 ? 362  TRP A CE2   1 
ATOM   3536 C CE3   . TRP C 3 385 ? -2.124  -4.396  -28.371 1.00 49.85 ? 362  TRP A CE3   1 
ATOM   3537 C CZ2   . TRP C 3 385 ? -0.203  -5.785  -29.935 1.00 49.85 ? 362  TRP A CZ2   1 
ATOM   3538 C CZ3   . TRP C 3 385 ? -1.739  -5.697  -28.063 1.00 49.85 ? 362  TRP A CZ3   1 
ATOM   3539 C CH2   . TRP C 3 385 ? -0.786  -6.376  -28.843 1.00 49.85 ? 362  TRP A CH2   1 
ATOM   3540 N N     . ILE C 3 386 ? -4.633  -3.735  -30.680 1.00 49.85 ? 363  ILE A N     1 
ATOM   3541 C CA    . ILE C 3 386 ? -5.103  -5.091  -30.399 1.00 49.85 ? 363  ILE A CA    1 
ATOM   3542 C C     . ILE C 3 386 ? -4.120  -6.124  -30.953 1.00 49.85 ? 363  ILE A C     1 
ATOM   3543 O O     . ILE C 3 386 ? -3.433  -5.867  -31.943 1.00 49.85 ? 363  ILE A O     1 
ATOM   3544 C CB    . ILE C 3 386 ? -6.531  -5.345  -30.951 1.00 49.85 ? 363  ILE A CB    1 
ATOM   3545 C CG1   . ILE C 3 386 ? -6.714  -4.678  -32.318 1.00 49.85 ? 363  ILE A CG1   1 
ATOM   3546 C CG2   . ILE C 3 386 ? -7.579  -4.843  -29.966 1.00 49.85 ? 363  ILE A CG2   1 
ATOM   3547 C CD1   . ILE C 3 386 ? -7.968  -5.101  -33.062 1.00 49.85 ? 363  ILE A CD1   1 
ATOM   3548 N N     . HIS C 3 387 ? -4.062  -7.286  -30.304 1.00 49.85 ? 364  HIS A N     1 
ATOM   3549 C CA    . HIS C 3 387 ? -3.163  -8.379  -30.687 1.00 49.85 ? 364  HIS A CA    1 
ATOM   3550 C C     . HIS C 3 387 ? -3.445  -8.893  -32.101 1.00 49.85 ? 364  HIS A C     1 
ATOM   3551 O O     . HIS C 3 387 ? -4.575  -8.809  -32.580 1.00 49.85 ? 364  HIS A O     1 
ATOM   3552 C CB    . HIS C 3 387 ? -3.276  -9.520  -29.672 1.00 49.85 ? 364  HIS A CB    1 
ATOM   3553 C CG    . HIS C 3 387 ? -2.278  -10.619 -29.871 1.00 49.85 ? 364  HIS A CG    1 
ATOM   3554 N ND1   . HIS C 3 387 ? -2.507  -11.691 -30.706 1.00 49.85 ? 364  HIS A ND1   1 
ATOM   3555 C CD2   . HIS C 3 387 ? -1.048  -10.813 -29.341 1.00 49.85 ? 364  HIS A CD2   1 
ATOM   3556 C CE1   . HIS C 3 387 ? -1.461  -12.497 -30.684 1.00 49.85 ? 364  HIS A CE1   1 
ATOM   3557 N NE2   . HIS C 3 387 ? -0.561  -11.987 -29.862 1.00 49.85 ? 364  HIS A NE2   1 
ATOM   3558 N N     . ASN C 3 388 ? -2.411  -9.421  -32.757 1.00 49.85 ? 365  ASN A N     1 
ATOM   3559 C CA    . ASN C 3 388 ? -2.507  -9.928  -34.130 1.00 49.85 ? 365  ASN A CA    1 
ATOM   3560 C C     . ASN C 3 388 ? -3.647  -10.919 -34.358 1.00 49.85 ? 365  ASN A C     1 
ATOM   3561 O O     . ASN C 3 388 ? -4.437  -10.756 -35.287 1.00 49.85 ? 365  ASN A O     1 
ATOM   3562 C CB    . ASN C 3 388 ? -1.173  -10.544 -34.568 1.00 49.85 ? 365  ASN A CB    1 
ATOM   3563 C CG    . ASN C 3 388 ? -1.173  -10.976 -36.026 1.00 49.85 ? 365  ASN A CG    1 
ATOM   3564 O OD1   . ASN C 3 388 ? -1.709  -10.287 -36.894 1.00 49.85 ? 365  ASN A OD1   1 
ATOM   3565 N ND2   . ASN C 3 388 ? -0.566  -12.125 -36.298 1.00 49.85 ? 365  ASN A ND2   1 
ATOM   3566 N N     . LEU C 3 389 ? -3.727  -11.940 -33.508 1.00 49.85 ? 366  LEU A N     1 
ATOM   3567 C CA    . LEU C 3 389 ? -4.782  -12.947 -33.605 1.00 49.85 ? 366  LEU A CA    1 
ATOM   3568 C C     . LEU C 3 389 ? -6.145  -12.399 -33.188 1.00 49.85 ? 366  LEU A C     1 
ATOM   3569 O O     . LEU C 3 389 ? -7.180  -12.952 -33.562 1.00 49.85 ? 366  LEU A O     1 
ATOM   3570 C CB    . LEU C 3 389 ? -4.429  -14.195 -32.791 1.00 49.85 ? 366  LEU A CB    1 
ATOM   3571 C CG    . LEU C 3 389 ? -3.346  -15.125 -33.346 1.00 49.85 ? 366  LEU A CG    1 
ATOM   3572 C CD1   . LEU C 3 389 ? -2.963  -16.171 -32.314 1.00 49.85 ? 366  LEU A CD1   1 
ATOM   3573 C CD2   . LEU C 3 389 ? -3.802  -15.787 -34.638 1.00 49.85 ? 366  LEU A CD2   1 
ATOM   3574 N N     . ALA C 3 390 ? -6.137  -11.315 -32.414 1.00 49.85 ? 367  ALA A N     1 
ATOM   3575 C CA    . ALA C 3 390 ? -7.364  -10.597 -32.076 1.00 49.85 ? 367  ALA A CA    1 
ATOM   3576 C C     . ALA C 3 390 ? -7.855  -9.808  -33.287 1.00 49.85 ? 367  ALA A C     1 
ATOM   3577 O O     . ALA C 3 390 ? -9.060  -9.684  -33.507 1.00 49.85 ? 367  ALA A O     1 
ATOM   3578 C CB    . ALA C 3 390 ? -7.143  -9.681  -30.883 1.00 49.85 ? 367  ALA A CB    1 
ATOM   3579 N N     . ARG C 3 391 ? -6.911  -9.281  -34.066 1.00 49.85 ? 368  ARG A N     1 
ATOM   3580 C CA    . ARG C 3 391 ? -7.218  -8.627  -35.337 1.00 49.85 ? 368  ARG A CA    1 
ATOM   3581 C C     . ARG C 3 391 ? -7.693  -9.648  -36.366 1.00 49.85 ? 368  ARG A C     1 
ATOM   3582 O O     . ARG C 3 391 ? -8.506  -9.326  -37.229 1.00 49.85 ? 368  ARG A O     1 
ATOM   3583 C CB    . ARG C 3 391 ? -6.001  -7.879  -35.885 1.00 49.85 ? 368  ARG A CB    1 
ATOM   3584 C CG    . ARG C 3 391 ? -5.389  -6.888  -34.925 1.00 49.85 ? 368  ARG A CG    1 
ATOM   3585 C CD    . ARG C 3 391 ? -4.327  -6.043  -35.587 1.00 49.85 ? 368  ARG A CD    1 
ATOM   3586 N NE    . ARG C 3 391 ? -3.471  -5.400  -34.593 1.00 49.85 ? 368  ARG A NE    1 
ATOM   3587 C CZ    . ARG C 3 391 ? -2.639  -4.394  -34.845 1.00 49.85 ? 368  ARG A CZ    1 
ATOM   3588 N NH1   . ARG C 3 391 ? -2.537  -3.893  -36.069 1.00 49.85 ? 368  ARG A NH1   1 
ATOM   3589 N NH2   . ARG C 3 391 ? -1.907  -3.884  -33.867 1.00 49.85 ? 368  ARG A NH2   1 
ATOM   3590 N N     . HIS C 3 392 ? -7.174  -10.872 -36.263 1.00 49.85 ? 369  HIS A N     1 
ATOM   3591 C CA    . HIS C 3 392 ? -7.582  -11.987 -37.119 1.00 49.85 ? 369  HIS A CA    1 
ATOM   3592 C C     . HIS C 3 392 ? -9.055  -12.330 -36.930 1.00 49.85 ? 369  HIS A C     1 
ATOM   3593 O O     . HIS C 3 392 ? -9.802  -12.433 -37.904 1.00 49.85 ? 369  HIS A O     1 
ATOM   3594 C CB    . HIS C 3 392 ? -6.732  -13.228 -36.826 1.00 49.85 ? 369  HIS A CB    1 
ATOM   3595 C CG    . HIS C 3 392 ? -5.472  -13.311 -37.630 1.00 49.85 ? 369  HIS A CG    1 
ATOM   3596 N ND1   . HIS C 3 392 ? -5.145  -14.419 -38.381 1.00 49.85 ? 369  HIS A ND1   1 
ATOM   3597 C CD2   . HIS C 3 392 ? -4.460  -12.428 -37.802 1.00 49.85 ? 369  HIS A CD2   1 
ATOM   3598 C CE1   . HIS C 3 392 ? -3.985  -14.215 -38.980 1.00 49.85 ? 369  HIS A CE1   1 
ATOM   3599 N NE2   . HIS C 3 392 ? -3.549  -13.014 -38.646 1.00 49.85 ? 369  HIS A NE2   1 
ATOM   3600 N N     . ALA C 3 393 ? -9.456  -12.501 -35.671 1.00 49.85 ? 370  ALA A N     1 
ATOM   3601 C CA    . ALA C 3 393 ? -10.817 -12.904 -35.317 1.00 49.85 ? 370  ALA A CA    1 
ATOM   3602 C C     . ALA C 3 393 ? -11.870 -11.945 -35.862 1.00 49.85 ? 370  ALA A C     1 
ATOM   3603 O O     . ALA C 3 393 ? -12.890 -12.380 -36.399 1.00 49.85 ? 370  ALA A O     1 
ATOM   3604 C CB    . ALA C 3 393 ? -10.955 -13.044 -33.806 1.00 49.85 ? 370  ALA A CB    1 
ATOM   3605 N N     . VAL C 3 394 ? -11.614 -10.647 -35.720 1.00 49.85 ? 371  VAL A N     1 
ATOM   3606 C CA    . VAL C 3 394 ? -12.552 -9.622  -36.173 1.00 49.85 ? 371  VAL A CA    1 
ATOM   3607 C C     . VAL C 3 394 ? -12.519 -9.428  -37.689 1.00 49.85 ? 371  VAL A C     1 
ATOM   3608 O O     . VAL C 3 394 ? -13.553 -9.159  -38.304 1.00 49.85 ? 371  VAL A O     1 
ATOM   3609 C CB    . VAL C 3 394 ? -12.355 -8.263  -35.437 1.00 49.85 ? 371  VAL A CB    1 
ATOM   3610 C CG1   . VAL C 3 394 ? -12.743 -8.388  -33.970 1.00 49.85 ? 371  VAL A CG1   1 
ATOM   3611 C CG2   . VAL C 3 394 ? -10.924 -7.743  -35.578 1.00 49.85 ? 371  VAL A CG2   1 
ATOM   3612 N N     . ALA C 3 395 ? -11.333 -9.569  -38.280 1.00 49.85 ? 372  ALA A N     1 
ATOM   3613 C CA    . ALA C 3 395 ? -11.151 -9.395  -39.721 1.00 49.85 ? 372  ALA A CA    1 
ATOM   3614 C C     . ALA C 3 395 ? -11.830 -10.504 -40.510 1.00 49.85 ? 372  ALA A C     1 
ATOM   3615 O O     . ALA C 3 395 ? -12.414 -10.254 -41.565 1.00 49.85 ? 372  ALA A O     1 
ATOM   3616 C CB    . ALA C 3 395 ? -9.676  -9.322  -40.071 1.00 49.85 ? 372  ALA A CB    1 
ATOM   3617 N N     . CYS C 3 396 ? -11.745 -11.725 -39.987 1.00 49.85 ? 373  CYS A N     1 
ATOM   3618 C CA    . CYS C 3 396 ? -12.413 -12.882 -40.572 1.00 49.85 ? 373  CYS A CA    1 
ATOM   3619 C C     . CYS C 3 396 ? -13.929 -12.736 -40.462 1.00 49.85 ? 373  CYS A C     1 
ATOM   3620 O O     . CYS C 3 396 ? -14.643 -12.916 -41.445 1.00 49.85 ? 373  CYS A O     1 
ATOM   3621 C CB    . CYS C 3 396 ? -11.946 -14.169 -39.886 1.00 49.85 ? 373  CYS A CB    1 
ATOM   3622 S SG    . CYS C 3 396 ? -12.706 -15.683 -40.509 1.00 49.85 ? 373  CYS A SG    1 
ATOM   3623 N N     . PHE C 3 397 ? -14.399 -12.405 -39.260 1.00 49.85 ? 374  PHE A N     1 
ATOM   3624 C CA    . PHE C 3 397 ? -15.824 -12.243 -38.965 1.00 49.85 ? 374  PHE A CA    1 
ATOM   3625 C C     . PHE C 3 397 ? -16.526 -11.250 -39.895 1.00 49.85 ? 374  PHE A C     1 
ATOM   3626 O O     . PHE C 3 397 ? -17.595 -11.550 -40.429 1.00 49.85 ? 374  PHE A O     1 
ATOM   3627 C CB    . PHE C 3 397 ? -16.015 -11.825 -37.500 1.00 49.85 ? 374  PHE A CB    1 
ATOM   3628 C CG    . PHE C 3 397 ? -17.453 -11.743 -37.070 1.00 49.85 ? 374  PHE A CG    1 
ATOM   3629 C CD1   . PHE C 3 397 ? -18.112 -12.867 -36.585 1.00 49.85 ? 374  PHE A CD1   1 
ATOM   3630 C CD2   . PHE C 3 397 ? -18.149 -10.539 -37.146 1.00 49.85 ? 374  PHE A CD2   1 
ATOM   3631 C CE1   . PHE C 3 397 ? -19.442 -12.796 -36.186 1.00 49.85 ? 374  PHE A CE1   1 
ATOM   3632 C CE2   . PHE C 3 397 ? -19.480 -10.458 -36.749 1.00 49.85 ? 374  PHE A CE2   1 
ATOM   3633 C CZ    . PHE C 3 397 ? -20.127 -11.588 -36.268 1.00 49.85 ? 374  PHE A CZ    1 
ATOM   3634 N N     . LEU C 3 398 ? -15.924 -10.076 -40.082 1.00 49.85 ? 375  LEU A N     1 
ATOM   3635 C CA    . LEU C 3 398 ? -16.491 -9.032  -40.938 1.00 49.85 ? 375  LEU A CA    1 
ATOM   3636 C C     . LEU C 3 398 ? -16.549 -9.457  -42.408 1.00 49.85 ? 375  LEU A C     1 
ATOM   3637 O O     . LEU C 3 398 ? -17.534 -9.188  -43.100 1.00 49.85 ? 375  LEU A O     1 
ATOM   3638 C CB    . LEU C 3 398 ? -15.693 -7.728  -40.796 1.00 49.85 ? 375  LEU A CB    1 
ATOM   3639 C CG    . LEU C 3 398 ? -16.061 -6.540  -41.698 1.00 49.85 ? 375  LEU A CG    1 
ATOM   3640 C CD1   . LEU C 3 398 ? -17.226 -5.736  -41.130 1.00 49.85 ? 375  LEU A CD1   1 
ATOM   3641 C CD2   . LEU C 3 398 ? -14.856 -5.647  -41.917 1.00 49.85 ? 375  LEU A CD2   1 
ATOM   3642 N N     . THR C 3 399 ? -15.492 -10.121 -42.870 1.00 49.85 ? 376  THR A N     1 
ATOM   3643 C CA    . THR C 3 399 ? -15.360 -10.493 -44.279 1.00 49.85 ? 376  THR A CA    1 
ATOM   3644 C C     . THR C 3 399 ? -15.902 -11.897 -44.568 1.00 49.85 ? 376  THR A C     1 
ATOM   3645 O O     . THR C 3 399 ? -17.076 -12.178 -44.311 1.00 49.85 ? 376  THR A O     1 
ATOM   3646 C CB    . THR C 3 399 ? -13.894 -10.372 -44.762 1.00 49.85 ? 376  THR A CB    1 
ATOM   3647 O OG1   . THR C 3 399 ? -13.054 -11.215 -43.965 1.00 49.85 ? 376  THR A OG1   1 
ATOM   3648 C CG2   . THR C 3 399 ? -13.406 -8.932  -44.661 1.00 49.85 ? 376  THR A CG2   1 
ATOM   3649 N N     . ARG C 3 400 ? -15.040 -12.766 -45.098 1.00 49.85 ? 377  ARG A N     1 
ATOM   3650 C CA    . ARG C 3 400 ? -15.408 -14.121 -45.535 1.00 49.85 ? 377  ARG A CA    1 
ATOM   3651 C C     . ARG C 3 400 ? -16.013 -15.004 -44.443 1.00 49.85 ? 377  ARG A C     1 
ATOM   3652 O O     . ARG C 3 400 ? -16.685 -15.991 -44.742 1.00 49.85 ? 377  ARG A O     1 
ATOM   3653 C CB    . ARG C 3 400 ? -14.202 -14.830 -46.166 1.00 49.85 ? 377  ARG A CB    1 
ATOM   3654 C CG    . ARG C 3 400 ? -12.989 -14.957 -45.252 1.00 49.85 ? 377  ARG A CG    1 
ATOM   3655 C CD    . ARG C 3 400 ? -11.978 -15.952 -45.795 1.00 49.85 ? 377  ARG A CD    1 
ATOM   3656 N NE    . ARG C 3 400 ? -10.818 -16.073 -44.914 1.00 49.85 ? 377  ARG A NE    1 
ATOM   3657 C CZ    . ARG C 3 400 ? -10.736 -16.906 -43.878 1.00 49.85 ? 377  ARG A CZ    1 
ATOM   3658 N NH1   . ARG C 3 400 ? -11.748 -17.710 -43.575 1.00 49.85 ? 377  ARG A NH1   1 
ATOM   3659 N NH2   . ARG C 3 400 ? -9.634  -16.935 -43.140 1.00 49.85 ? 377  ARG A NH2   1 
ATOM   3660 N N     . GLY C 3 401 ? -15.770 -14.648 -43.186 1.00 49.85 ? 378  GLY A N     1 
ATOM   3661 C CA    . GLY C 3 401 ? -16.286 -15.406 -42.053 1.00 49.85 ? 378  GLY A CA    1 
ATOM   3662 C C     . GLY C 3 401 ? -17.794 -15.338 -41.930 1.00 49.85 ? 378  GLY A C     1 
ATOM   3663 O O     . GLY C 3 401 ? -18.482 -16.327 -42.175 1.00 49.85 ? 378  GLY A O     1 
ATOM   3664 N N     . ASP C 3 402 ? -18.310 -14.171 -41.553 1.00 49.85 ? 379  ASP A N     1 
ATOM   3665 C CA    . ASP C 3 402 ? -19.733 -14.036 -41.241 1.00 49.85 ? 379  ASP A CA    1 
ATOM   3666 C C     . ASP C 3 402 ? -20.462 -12.944 -42.029 1.00 49.85 ? 379  ASP A C     1 
ATOM   3667 O O     . ASP C 3 402 ? -21.333 -13.245 -42.848 1.00 49.85 ? 379  ASP A O     1 
ATOM   3668 C CB    . ASP C 3 402 ? -19.932 -13.825 -39.734 1.00 49.85 ? 379  ASP A CB    1 
ATOM   3669 C CG    . ASP C 3 402 ? -19.569 -15.051 -38.914 1.00 49.85 ? 379  ASP A CG    1 
ATOM   3670 O OD1   . ASP C 3 402 ? -18.460 -15.597 -39.090 1.00 49.85 ? 379  ASP A OD1   1 
ATOM   3671 O OD2   . ASP C 3 402 ? -20.397 -15.470 -38.082 1.00 49.85 ? 379  ASP A OD2   1 
ATOM   3672 N N     . LEU C 3 403 ? -20.102 -11.686 -41.779 1.00 49.85 ? 380  LEU A N     1 
ATOM   3673 C CA    . LEU C 3 403 ? -20.875 -10.538 -42.266 1.00 49.85 ? 380  LEU A CA    1 
ATOM   3674 C C     . LEU C 3 403 ? -20.810 -10.302 -43.777 1.00 49.85 ? 380  LEU A C     1 
ATOM   3675 O O     . LEU C 3 403 ? -21.646 -9.582  -44.328 1.00 49.85 ? 380  LEU A O     1 
ATOM   3676 C CB    . LEU C 3 403 ? -20.477 -9.262  -41.513 1.00 49.85 ? 380  LEU A CB    1 
ATOM   3677 C CG    . LEU C 3 403 ? -20.774 -9.181  -40.011 1.00 49.85 ? 380  LEU A CG    1 
ATOM   3678 C CD1   . LEU C 3 403 ? -20.228 -7.885  -39.432 1.00 49.85 ? 380  LEU A CD1   1 
ATOM   3679 C CD2   . LEU C 3 403 ? -22.265 -9.310  -39.725 1.00 49.85 ? 380  LEU A CD2   1 
ATOM   3680 N N     . TRP C 3 404 ? -19.820 -10.907 -44.432 1.00 49.85 ? 381  TRP A N     1 
ATOM   3681 C CA    . TRP C 3 404 ? -19.614 -10.787 -45.885 1.00 49.85 ? 381  TRP A CA    1 
ATOM   3682 C C     . TRP C 3 404 ? -19.429 -9.336  -46.361 1.00 49.85 ? 381  TRP A C     1 
ATOM   3683 O O     . TRP C 3 404 ? -19.740 -8.996  -47.505 1.00 49.85 ? 381  TRP A O     1 
ATOM   3684 C CB    . TRP C 3 404 ? -20.731 -11.506 -46.662 1.00 49.85 ? 381  TRP A CB    1 
ATOM   3685 C CG    . TRP C 3 404 ? -20.342 -11.878 -48.064 1.00 49.85 ? 381  TRP A CG    1 
ATOM   3686 C CD1   . TRP C 3 404 ? -20.792 -11.305 -49.221 1.00 49.85 ? 381  TRP A CD1   1 
ATOM   3687 C CD2   . TRP C 3 404 ? -19.423 -12.905 -48.457 1.00 49.85 ? 381  TRP A CD2   1 
ATOM   3688 N NE1   . TRP C 3 404 ? -20.209 -11.911 -50.309 1.00 49.85 ? 381  TRP A NE1   1 
ATOM   3689 C CE2   . TRP C 3 404 ? -19.365 -12.896 -49.869 1.00 49.85 ? 381  TRP A CE2   1 
ATOM   3690 C CE3   . TRP C 3 404 ? -18.641 -13.832 -47.753 1.00 49.85 ? 381  TRP A CE3   1 
ATOM   3691 C CZ2   . TRP C 3 404 ? -18.556 -13.779 -50.591 1.00 49.85 ? 381  TRP A CZ2   1 
ATOM   3692 C CZ3   . TRP C 3 404 ? -17.838 -14.710 -48.471 1.00 49.85 ? 381  TRP A CZ3   1 
ATOM   3693 C CH2   . TRP C 3 404 ? -17.802 -14.676 -49.877 1.00 49.85 ? 381  TRP A CH2   1 
ATOM   3694 N N     . ILE C 3 405 ? -18.918 -8.489  -45.471 1.00 49.85 ? 382  ILE A N     1 
ATOM   3695 C CA    . ILE C 3 405 ? -18.662 -7.085  -45.786 1.00 49.85 ? 382  ILE A CA    1 
ATOM   3696 C C     . ILE C 3 405 ? -17.219 -6.910  -46.263 1.00 49.85 ? 382  ILE A C     1 
ATOM   3697 O O     . ILE C 3 405 ? -16.300 -7.533  -45.727 1.00 49.85 ? 382  ILE A O     1 
ATOM   3698 C CB    . ILE C 3 405 ? -18.964 -6.158  -44.575 1.00 49.85 ? 382  ILE A CB    1 
ATOM   3699 C CG1   . ILE C 3 405 ? -20.419 -6.336  -44.118 1.00 49.85 ? 382  ILE A CG1   1 
ATOM   3700 C CG2   . ILE C 3 405 ? -18.681 -4.689  -44.919 1.00 49.85 ? 382  ILE A CG2   1 
ATOM   3701 C CD1   . ILE C 3 405 ? -20.740 -5.711  -42.771 1.00 49.85 ? 382  ILE A CD1   1 
ATOM   3702 N N     . SER C 3 406 ? -17.038 -6.059  -47.272 1.00 49.85 ? 383  SER A N     1 
ATOM   3703 C CA    . SER C 3 406 ? -15.730 -5.796  -47.869 1.00 49.85 ? 383  SER A CA    1 
ATOM   3704 C C     . SER C 3 406 ? -14.669 -5.437  -46.833 1.00 49.85 ? 383  SER A C     1 
ATOM   3705 O O     . SER C 3 406 ? -14.957 -4.766  -45.838 1.00 49.85 ? 383  SER A O     1 
ATOM   3706 C CB    . SER C 3 406 ? -15.837 -4.684  -48.914 1.00 49.85 ? 383  SER A CB    1 
ATOM   3707 O OG    . SER C 3 406 ? -14.586 -4.442  -49.533 1.00 49.85 ? 383  SER A OG    1 
ATOM   3708 N N     . TRP C 3 407 ? -13.445 -5.895  -47.083 1.00 49.85 ? 384  TRP A N     1 
ATOM   3709 C CA    . TRP C 3 407 ? -12.304 -5.623  -46.209 1.00 49.85 ? 384  TRP A CA    1 
ATOM   3710 C C     . TRP C 3 407 ? -11.851 -4.167  -46.283 1.00 49.85 ? 384  TRP A C     1 
ATOM   3711 O O     . TRP C 3 407 ? -11.102 -3.702  -45.421 1.00 49.85 ? 384  TRP A O     1 
ATOM   3712 C CB    . TRP C 3 407 ? -11.137 -6.566  -46.529 1.00 49.85 ? 384  TRP A CB    1 
ATOM   3713 C CG    . TRP C 3 407 ? -10.686 -6.531  -47.963 1.00 49.85 ? 384  TRP A CG    1 
ATOM   3714 C CD1   . TRP C 3 407 ? -11.116 -7.338  -48.976 1.00 49.85 ? 384  TRP A CD1   1 
ATOM   3715 C CD2   . TRP C 3 407 ? -9.718  -5.644  -48.540 1.00 49.85 ? 384  TRP A CD2   1 
ATOM   3716 N NE1   . TRP C 3 407 ? -10.478 -7.011  -50.148 1.00 49.85 ? 384  TRP A NE1   1 
ATOM   3717 C CE2   . TRP C 3 407 ? -9.614  -5.974  -49.909 1.00 49.85 ? 384  TRP A CE2   1 
ATOM   3718 C CE3   . TRP C 3 407 ? -8.928  -4.602  -48.033 1.00 49.85 ? 384  TRP A CE3   1 
ATOM   3719 C CZ2   . TRP C 3 407 ? -8.752  -5.298  -50.780 1.00 49.85 ? 384  TRP A CZ2   1 
ATOM   3720 C CZ3   . TRP C 3 407 ? -8.072  -3.932  -48.899 1.00 49.85 ? 384  TRP A CZ3   1 
ATOM   3721 C CH2   . TRP C 3 407 ? -7.991  -4.284  -50.257 1.00 49.85 ? 384  TRP A CH2   1 
ATOM   3722 N N     . GLU C 3 408 ? -12.310 -3.459  -47.315 1.00 49.85 ? 385  GLU A N     1 
ATOM   3723 C CA    . GLU C 3 408 ? -12.038 -2.031  -47.483 1.00 49.85 ? 385  GLU A CA    1 
ATOM   3724 C C     . GLU C 3 408 ? -12.707 -1.199  -46.392 1.00 49.85 ? 385  GLU A C     1 
ATOM   3725 O O     . GLU C 3 408 ? -12.194 -0.148  -45.998 1.00 49.85 ? 385  GLU A O     1 
ATOM   3726 C CB    . GLU C 3 408 ? -12.514 -1.553  -48.856 1.00 49.85 ? 385  GLU A CB    1 
ATOM   3727 C CG    . GLU C 3 408 ? -11.630 -1.982  -50.020 1.00 49.85 ? 385  GLU A CG    1 
ATOM   3728 C CD    . GLU C 3 408 ? -12.106 -1.441  -51.357 1.00 49.85 ? 385  GLU A CD    1 
ATOM   3729 O OE1   . GLU C 3 408 ? -12.742 -0.365  -51.387 1.00 49.85 ? 385  GLU A OE1   1 
ATOM   3730 O OE2   . GLU C 3 408 ? -11.843 -2.096  -52.385 1.00 49.85 ? 385  GLU A OE2   1 
ATOM   3731 N N     . GLU C 3 409 ? -13.854 -1.680  -45.916 1.00 49.85 ? 386  GLU A N     1 
ATOM   3732 C CA    . GLU C 3 409 ? -14.608 -1.015  -44.857 1.00 49.85 ? 386  GLU A CA    1 
ATOM   3733 C C     . GLU C 3 409 ? -13.896 -1.142  -43.515 1.00 49.85 ? 386  GLU A C     1 
ATOM   3734 O O     . GLU C 3 409 ? -13.713 -0.150  -42.806 1.00 49.85 ? 386  GLU A O     1 
ATOM   3735 C CB    . GLU C 3 409 ? -16.027 -1.585  -44.766 1.00 49.85 ? 386  GLU A CB    1 
ATOM   3736 C CG    . GLU C 3 409 ? -16.883 -1.385  -46.014 1.00 49.85 ? 386  GLU A CG    1 
ATOM   3737 C CD    . GLU C 3 409 ? -17.283 0.064   -46.236 1.00 49.85 ? 386  GLU A CD    1 
ATOM   3738 O OE1   . GLU C 3 409 ? -16.433 0.867   -46.681 1.00 49.85 ? 386  GLU A OE1   1 
ATOM   3739 O OE2   . GLU C 3 409 ? -18.454 0.399   -45.967 1.00 49.85 ? 386  GLU A OE2   1 
ATOM   3740 N N     . GLY C 3 410 ? -13.497 -2.367  -43.178 1.00 49.85 ? 387  GLY A N     1 
ATOM   3741 C CA    . GLY C 3 410 ? -12.749 -2.636  -41.953 1.00 49.85 ? 387  GLY A CA    1 
ATOM   3742 C C     . GLY C 3 410 ? -11.366 -2.017  -41.976 1.00 49.85 ? 387  GLY A C     1 
ATOM   3743 O O     . GLY C 3 410 ? -10.787 -1.736  -40.927 1.00 49.85 ? 387  GLY A O     1 
ATOM   3744 N N     . GLN C 3 411 ? -10.841 -1.807  -43.181 1.00 49.85 ? 388  GLN A N     1 
ATOM   3745 C CA    . GLN C 3 411 ? -9.569  -1.123  -43.375 1.00 49.85 ? 388  GLN A CA    1 
ATOM   3746 C C     . GLN C 3 411 ? -9.618  0.301   -42.818 1.00 49.85 ? 388  GLN A C     1 
ATOM   3747 O O     . GLN C 3 411 ? -8.678  0.737   -42.154 1.00 49.85 ? 388  GLN A O     1 
ATOM   3748 C CB    . GLN C 3 411 ? -9.195  -1.111  -44.860 1.00 49.85 ? 388  GLN A CB    1 
ATOM   3749 C CG    . GLN C 3 411 ? -7.941  -0.324  -45.198 1.00 49.85 ? 388  GLN A CG    1 
ATOM   3750 C CD    . GLN C 3 411 ? -7.530  -0.490  -46.642 1.00 49.85 ? 388  GLN A CD    1 
ATOM   3751 O OE1   . GLN C 3 411 ? -6.954  -1.509  -47.020 1.00 49.85 ? 388  GLN A OE1   1 
ATOM   3752 N NE2   . GLN C 3 411 ? -7.823  0.513   -47.460 1.00 49.85 ? 388  GLN A NE2   1 
ATOM   3753 N N     . ARG C 3 412 ? -10.714 1.009   -43.091 1.00 49.85 ? 389  ARG A N     1 
ATOM   3754 C CA    . ARG C 3 412 ? -10.913 2.382   -42.609 1.00 49.85 ? 389  ARG A CA    1 
ATOM   3755 C C     . ARG C 3 412 ? -11.090 2.437   -41.092 1.00 49.85 ? 389  ARG A C     1 
ATOM   3756 O O     . ARG C 3 412 ? -10.565 3.337   -40.432 1.00 49.85 ? 389  ARG A O     1 
ATOM   3757 C CB    . ARG C 3 412 ? -12.114 3.038   -43.302 1.00 49.85 ? 389  ARG A CB    1 
ATOM   3758 C CG    . ARG C 3 412 ? -11.933 3.264   -44.796 1.00 49.85 ? 389  ARG A CG    1 
ATOM   3759 C CD    . ARG C 3 412 ? -13.262 3.569   -45.470 1.00 49.85 ? 389  ARG A CD    1 
ATOM   3760 N NE    . ARG C 3 412 ? -13.218 3.291   -46.906 1.00 49.85 ? 389  ARG A NE    1 
ATOM   3761 C CZ    . ARG C 3 412 ? -14.279 3.291   -47.711 1.00 49.85 ? 389  ARG A CZ    1 
ATOM   3762 N NH1   . ARG C 3 412 ? -15.490 3.554   -47.233 1.00 49.85 ? 389  ARG A NH1   1 
ATOM   3763 N NH2   . ARG C 3 412 ? -14.127 3.025   -49.002 1.00 49.85 ? 389  ARG A NH2   1 
ATOM   3764 N N     . VAL C 3 413 ? -11.832 1.470   -40.552 1.00 49.85 ? 390  VAL A N     1 
ATOM   3765 C CA    . VAL C 3 413 ? -12.041 1.354   -39.109 1.00 49.85 ? 390  VAL A CA    1 
ATOM   3766 C C     . VAL C 3 413 ? -10.692 1.195   -38.405 1.00 49.85 ? 390  VAL A C     1 
ATOM   3767 O O     . VAL C 3 413 ? -10.386 1.925   -37.459 1.00 49.85 ? 390  VAL A O     1 
ATOM   3768 C CB    . VAL C 3 413 ? -12.987 0.176   -38.757 1.00 49.85 ? 390  VAL A CB    1 
ATOM   3769 C CG1   . VAL C 3 413 ? -13.209 0.084   -37.250 1.00 49.85 ? 390  VAL A CG1   1 
ATOM   3770 C CG2   . VAL C 3 413 ? -14.320 0.327   -39.477 1.00 49.85 ? 390  VAL A CG2   1 
ATOM   3771 N N     . PHE C 3 414 ? -9.898  0.238   -38.884 1.00 49.85 ? 391  PHE A N     1 
ATOM   3772 C CA    . PHE C 3 414 ? -8.534  0.024   -38.411 1.00 49.85 ? 391  PHE A CA    1 
ATOM   3773 C C     . PHE C 3 414 ? -7.662  1.257   -38.652 1.00 49.85 ? 391  PHE A C     1 
ATOM   3774 O O     . PHE C 3 414 ? -6.862  1.629   -37.797 1.00 49.85 ? 391  PHE A O     1 
ATOM   3775 C CB    . PHE C 3 414 ? -7.921  -1.197  -39.105 1.00 49.85 ? 391  PHE A CB    1 
ATOM   3776 C CG    . PHE C 3 414 ? -8.218  -2.511  -38.425 1.00 49.85 ? 391  PHE A CG    1 
ATOM   3777 C CD1   . PHE C 3 414 ? -9.509  -2.834  -38.013 1.00 49.85 ? 391  PHE A CD1   1 
ATOM   3778 C CD2   . PHE C 3 414 ? -7.199  -3.431  -38.203 1.00 49.85 ? 391  PHE A CD2   1 
ATOM   3779 C CE1   . PHE C 3 414 ? -9.775  -4.050  -37.387 1.00 49.85 ? 391  PHE A CE1   1 
ATOM   3780 C CE2   . PHE C 3 414 ? -7.456  -4.648  -37.579 1.00 49.85 ? 391  PHE A CE2   1 
ATOM   3781 C CZ    . PHE C 3 414 ? -8.746  -4.958  -37.171 1.00 49.85 ? 391  PHE A CZ    1 
ATOM   3782 N N     . GLU C 3 415 ? -7.831  1.883   -39.817 1.00 49.85 ? 392  GLU A N     1 
ATOM   3783 C CA    . GLU C 3 415 ? -7.057  3.066   -40.208 1.00 49.85 ? 392  GLU A CA    1 
ATOM   3784 C C     . GLU C 3 415 ? -7.228  4.218   -39.222 1.00 49.85 ? 392  GLU A C     1 
ATOM   3785 O O     . GLU C 3 415 ? -6.275  4.933   -38.918 1.00 49.85 ? 392  GLU A O     1 
ATOM   3786 C CB    . GLU C 3 415 ? -7.451  3.514   -41.618 1.00 49.85 ? 392  GLU A CB    1 
ATOM   3787 C CG    . GLU C 3 415 ? -6.540  4.552   -42.251 1.00 49.85 ? 392  GLU A CG    1 
ATOM   3788 C CD    . GLU C 3 415 ? -6.815  4.730   -43.729 1.00 49.85 ? 392  GLU A CD    1 
ATOM   3789 O OE1   . GLU C 3 415 ? -7.418  5.757   -44.098 1.00 49.85 ? 392  GLU A OE1   1 
ATOM   3790 O OE2   . GLU C 3 415 ? -6.433  3.843   -44.522 1.00 49.85 ? 392  GLU A OE2   1 
ATOM   3791 N N     . GLN C 3 416 ? -8.452  4.380   -38.731 1.00 49.85 ? 393  GLN A N     1 
ATOM   3792 C CA    . GLN C 3 416 ? -8.788  5.426   -37.779 1.00 49.85 ? 393  GLN A CA    1 
ATOM   3793 C C     . GLN C 3 416 ? -8.281  5.096   -36.373 1.00 49.85 ? 393  GLN A C     1 
ATOM   3794 O O     . GLN C 3 416 ? -7.680  5.943   -35.710 1.00 49.85 ? 393  GLN A O     1 
ATOM   3795 C CB    . GLN C 3 416 ? -10.306 5.623   -37.762 1.00 49.85 ? 393  GLN A CB    1 
ATOM   3796 C CG    . GLN C 3 416 ? -10.811 6.767   -36.891 1.00 49.85 ? 393  GLN A CG    1 
ATOM   3797 C CD    . GLN C 3 416 ? -12.303 6.671   -36.612 1.00 49.85 ? 393  GLN A CD    1 
ATOM   3798 O OE1   . GLN C 3 416 ? -12.760 6.992   -35.515 1.00 49.85 ? 393  GLN A OE1   1 
ATOM   3799 N NE2   . GLN C 3 416 ? -13.069 6.225   -37.604 1.00 49.85 ? 393  GLN A NE2   1 
ATOM   3800 N N     . LEU C 3 417 ? -8.523  3.863   -35.932 1.00 49.85 ? 394  LEU A N     1 
ATOM   3801 C CA    . LEU C 3 417 ? -8.331  3.478   -34.530 1.00 49.85 ? 394  LEU A CA    1 
ATOM   3802 C C     . LEU C 3 417 ? -6.928  2.994   -34.151 1.00 49.85 ? 394  LEU A C     1 
ATOM   3803 O O     . LEU C 3 417 ? -6.506  3.177   -33.009 1.00 49.85 ? 394  LEU A O     1 
ATOM   3804 C CB    . LEU C 3 417 ? -9.377  2.435   -34.115 1.00 49.85 ? 394  LEU A CB    1 
ATOM   3805 C CG    . LEU C 3 417 ? -10.856 2.832   -34.198 1.00 49.85 ? 394  LEU A CG    1 
ATOM   3806 C CD1   . LEU C 3 417 ? -11.753 1.620   -33.997 1.00 49.85 ? 394  LEU A CD1   1 
ATOM   3807 C CD2   . LEU C 3 417 ? -11.203 3.934   -33.200 1.00 49.85 ? 394  LEU A CD2   1 
ATOM   3808 N N     . LEU C 3 418 ? -6.213  2.383   -35.095 1.00 49.85 ? 395  LEU A N     1 
ATOM   3809 C CA    . LEU C 3 418 ? -4.884  1.827   -34.818 1.00 49.85 ? 395  LEU A CA    1 
ATOM   3810 C C     . LEU C 3 418 ? -3.813  2.892   -34.619 1.00 49.85 ? 395  LEU A C     1 
ATOM   3811 O O     . LEU C 3 418 ? -3.778  3.895   -35.334 1.00 49.85 ? 395  LEU A O     1 
ATOM   3812 C CB    . LEU C 3 418 ? -4.434  0.877   -35.933 1.00 49.85 ? 395  LEU A CB    1 
ATOM   3813 C CG    . LEU C 3 418 ? -5.025  -0.528  -36.052 1.00 49.85 ? 395  LEU A CG    1 
ATOM   3814 C CD1   . LEU C 3 418 ? -4.497  -1.181  -37.317 1.00 49.85 ? 395  LEU A CD1   1 
ATOM   3815 C CD2   . LEU C 3 418 ? -4.707  -1.386  -34.835 1.00 49.85 ? 395  LEU A CD2   1 
ATOM   3816 N N     . LEU C 3 419 ? -2.944  2.656   -33.639 1.00 49.85 ? 396  LEU A N     1 
ATOM   3817 C CA    . LEU C 3 419 ? -1.767  3.491   -33.409 1.00 49.85 ? 396  LEU A CA    1 
ATOM   3818 C C     . LEU C 3 419 ? -0.664  3.133   -34.397 1.00 49.85 ? 396  LEU A C     1 
ATOM   3819 O O     . LEU C 3 419 ? 0.184   3.965   -34.724 1.00 49.85 ? 396  LEU A O     1 
ATOM   3820 C CB    . LEU C 3 419 ? -1.253  3.307   -31.979 1.00 49.85 ? 396  LEU A CB    1 
ATOM   3821 C CG    . LEU C 3 419 ? -2.087  3.854   -30.819 1.00 49.85 ? 396  LEU A CG    1 
ATOM   3822 C CD1   . LEU C 3 419 ? -1.740  3.131   -29.532 1.00 49.85 ? 396  LEU A CD1   1 
ATOM   3823 C CD2   . LEU C 3 419 ? -1.885  5.350   -30.661 1.00 49.85 ? 396  LEU A CD2   1 
ATOM   3824 N N     . ASP C 3 420 ? -0.690  1.887   -34.863 1.00 49.85 ? 397  ASP A N     1 
ATOM   3825 C CA    . ASP C 3 420 ? 0.305   1.368   -35.798 1.00 49.85 ? 397  ASP A CA    1 
ATOM   3826 C C     . ASP C 3 420 ? -0.200  1.305   -37.240 1.00 49.85 ? 397  ASP A C     1 
ATOM   3827 O O     . ASP C 3 420 ? 0.352   0.566   -38.057 1.00 49.85 ? 397  ASP A O     1 
ATOM   3828 C CB    . ASP C 3 420 ? 0.794   -0.016  -35.347 1.00 49.85 ? 397  ASP A CB    1 
ATOM   3829 C CG    . ASP C 3 420 ? -0.334  -1.025  -35.182 1.00 49.85 ? 397  ASP A CG    1 
ATOM   3830 O OD1   . ASP C 3 420 ? -1.517  -0.633  -35.236 1.00 49.85 ? 397  ASP A OD1   1 
ATOM   3831 O OD2   . ASP C 3 420 ? -0.030  -2.221  -34.994 1.00 49.85 ? 397  ASP A OD2   1 
ATOM   3832 N N     . GLN C 3 421 ? -1.242  2.080   -37.544 1.00 49.85 ? 398  GLN A N     1 
ATOM   3833 C CA    . GLN C 3 421 ? -1.838  2.106   -38.880 1.00 49.85 ? 398  GLN A CA    1 
ATOM   3834 C C     . GLN C 3 421 ? -0.779  2.246   -39.969 1.00 49.85 ? 398  GLN A C     1 
ATOM   3835 O O     . GLN C 3 421 ? -0.217  3.322   -40.171 1.00 49.85 ? 398  GLN A O     1 
ATOM   3836 C CB    . GLN C 3 421 ? -2.869  3.233   -38.988 1.00 49.85 ? 398  GLN A CB    1 
ATOM   3837 C CG    . GLN C 3 421 ? -3.622  3.283   -40.318 1.00 49.85 ? 398  GLN A CG    1 
ATOM   3838 C CD    . GLN C 3 421 ? -2.856  3.990   -41.429 1.00 49.85 ? 398  GLN A CD    1 
ATOM   3839 O OE1   . GLN C 3 421 ? -2.857  3.543   -42.576 1.00 49.85 ? 398  GLN A OE1   1 
ATOM   3840 N NE2   . GLN C 3 421 ? -2.199  5.096   -41.092 1.00 49.85 ? 398  GLN A NE2   1 
ATOM   3841 N N     . ASP C 3 422 ? -0.515  1.145   -40.664 1.00 49.85 ? 399  ASP A N     1 
ATOM   3842 C CA    . ASP C 3 422 ? 0.449   1.129   -41.755 1.00 49.85 ? 399  ASP A CA    1 
ATOM   3843 C C     . ASP C 3 422 ? -0.267  0.761   -43.048 1.00 49.85 ? 399  ASP A C     1 
ATOM   3844 O O     . ASP C 3 422 ? -0.799  -0.341  -43.173 1.00 49.85 ? 399  ASP A O     1 
ATOM   3845 C CB    . ASP C 3 422 ? 1.576   0.136   -41.453 1.00 49.85 ? 399  ASP A CB    1 
ATOM   3846 C CG    . ASP C 3 422 ? 2.764   0.300   -42.378 1.00 49.85 ? 399  ASP A CG    1 
ATOM   3847 O OD1   . ASP C 3 422 ? 2.664   -0.089  -43.562 1.00 49.85 ? 399  ASP A OD1   1 
ATOM   3848 O OD2   . ASP C 3 422 ? 3.804   0.818   -41.917 1.00 49.85 ? 399  ASP A OD2   1 
ATOM   3849 N N     . TRP C 3 423 ? -0.274  1.693   -44.002 1.00 49.85 ? 400  TRP A N     1 
ATOM   3850 C CA    . TRP C 3 423 ? -0.988  1.525   -45.272 1.00 49.85 ? 400  TRP A CA    1 
ATOM   3851 C C     . TRP C 3 423 ? -0.772  0.152   -45.902 1.00 49.85 ? 400  TRP A C     1 
ATOM   3852 O O     . TRP C 3 423 ? -1.734  -0.514  -46.289 1.00 49.85 ? 400  TRP A O     1 
ATOM   3853 C CB    . TRP C 3 423 ? -0.598  2.625   -46.266 1.00 49.85 ? 400  TRP A CB    1 
ATOM   3854 C CG    . TRP C 3 423 ? -1.175  2.423   -47.641 1.00 49.85 ? 400  TRP A CG    1 
ATOM   3855 C CD1   . TRP C 3 423 ? -2.462  2.652   -48.028 1.00 49.85 ? 400  TRP A CD1   1 
ATOM   3856 C CD2   . TRP C 3 423 ? -0.485  1.949   -48.807 1.00 49.85 ? 400  TRP A CD2   1 
ATOM   3857 N NE1   . TRP C 3 423 ? -2.619  2.353   -49.360 1.00 49.85 ? 400  TRP A NE1   1 
ATOM   3858 C CE2   . TRP C 3 423 ? -1.422  1.919   -49.863 1.00 49.85 ? 400  TRP A CE2   1 
ATOM   3859 C CE3   . TRP C 3 423 ? 0.834   1.547   -49.062 1.00 49.85 ? 400  TRP A CE3   1 
ATOM   3860 C CZ2   . TRP C 3 423 ? -1.084  1.503   -51.155 1.00 49.85 ? 400  TRP A CZ2   1 
ATOM   3861 C CZ3   . TRP C 3 423 ? 1.169   1.134   -50.349 1.00 49.85 ? 400  TRP A CZ3   1 
ATOM   3862 C CH2   . TRP C 3 423 ? 0.212   1.116   -51.378 1.00 49.85 ? 400  TRP A CH2   1 
ATOM   3863 N N     . ALA C 3 424 ? 0.492   -0.258  -45.996 1.00 49.85 ? 401  ALA A N     1 
ATOM   3864 C CA    . ALA C 3 424 ? 0.865   -1.526  -46.614 1.00 49.85 ? 401  ALA A CA    1 
ATOM   3865 C C     . ALA C 3 424 ? 0.474   -2.725  -45.754 1.00 49.85 ? 401  ALA A C     1 
ATOM   3866 O O     . ALA C 3 424 ? -0.095  -3.695  -46.258 1.00 49.85 ? 401  ALA A O     1 
ATOM   3867 C CB    . ALA C 3 424 ? 2.357   -1.548  -46.913 1.00 49.85 ? 401  ALA A CB    1 
ATOM   3868 N N     . LEU C 3 425 ? 0.779   -2.650  -44.461 1.00 49.85 ? 402  LEU A N     1 
ATOM   3869 C CA    . LEU C 3 425 ? 0.524   -3.750  -43.532 1.00 49.85 ? 402  LEU A CA    1 
ATOM   3870 C C     . LEU C 3 425 ? -0.964  -3.945  -43.259 1.00 49.85 ? 402  LEU A C     1 
ATOM   3871 O O     . LEU C 3 425 ? -1.437  -5.079  -43.174 1.00 49.85 ? 402  LEU A O     1 
ATOM   3872 C CB    . LEU C 3 425 ? 1.286   -3.535  -42.220 1.00 49.85 ? 402  LEU A CB    1 
ATOM   3873 C CG    . LEU C 3 425 ? 2.760   -3.958  -42.143 1.00 49.85 ? 402  LEU A CG    1 
ATOM   3874 C CD1   . LEU C 3 425 ? 3.625   -3.316  -43.219 1.00 49.85 ? 402  LEU A CD1   1 
ATOM   3875 C CD2   . LEU C 3 425 ? 3.328   -3.650  -40.767 1.00 49.85 ? 402  LEU A CD2   1 
ATOM   3876 N N     . ASN C 3 426 ? -1.689  -2.835  -43.125 1.00 49.85 ? 403  ASN A N     1 
ATOM   3877 C CA    . ASN C 3 426 ? -3.133  -2.860  -42.906 1.00 49.85 ? 403  ASN A CA    1 
ATOM   3878 C C     . ASN C 3 426 ? -3.868  -3.513  -44.074 1.00 49.85 ? 403  ASN A C     1 
ATOM   3879 O O     . ASN C 3 426 ? -4.647  -4.447  -43.878 1.00 49.85 ? 403  ASN A O     1 
ATOM   3880 C CB    . ASN C 3 426 ? -3.667  -1.442  -42.659 1.00 49.85 ? 403  ASN A CB    1 
ATOM   3881 C CG    . ASN C 3 426 ? -5.046  -1.430  -42.013 1.00 49.85 ? 403  ASN A CG    1 
ATOM   3882 O OD1   . ASN C 3 426 ? -5.449  -2.385  -41.346 1.00 49.85 ? 403  ASN A OD1   1 
ATOM   3883 N ND2   . ASN C 3 426 ? -5.775  -0.337  -42.209 1.00 49.85 ? 403  ASN A ND2   1 
ATOM   3884 N N     . ALA C 3 427 ? -3.608  -3.016  -45.283 1.00 49.85 ? 404  ALA A N     1 
ATOM   3885 C CA    . ALA C 3 427 ? -4.249  -3.515  -46.499 1.00 49.85 ? 404  ALA A CA    1 
ATOM   3886 C C     . ALA C 3 427 ? -3.901  -4.975  -46.794 1.00 49.85 ? 404  ALA A C     1 
ATOM   3887 O O     . ALA C 3 427 ? -4.779  -5.767  -47.146 1.00 49.85 ? 404  ALA A O     1 
ATOM   3888 C CB    . ALA C 3 427 ? -3.890  -2.632  -47.685 1.00 49.85 ? 404  ALA A CB    1 
ATOM   3889 N N     . GLY C 3 428 ? -2.623  -5.318  -46.645 1.00 49.85 ? 405  GLY A N     1 
ATOM   3890 C CA    . GLY C 3 428 ? -2.133  -6.666  -46.934 1.00 49.85 ? 405  GLY A CA    1 
ATOM   3891 C C     . GLY C 3 428 ? -2.717  -7.735  -46.031 1.00 49.85 ? 405  GLY A C     1 
ATOM   3892 O O     . GLY C 3 428 ? -3.163  -8.783  -46.506 1.00 49.85 ? 405  GLY A O     1 
ATOM   3893 N N     . ASN C 3 429 ? -2.712  -7.464  -44.727 1.00 49.85 ? 406  ASN A N     1 
ATOM   3894 C CA    . ASN C 3 429 ? -3.248  -8.392  -43.735 1.00 49.85 ? 406  ASN A CA    1 
ATOM   3895 C C     . ASN C 3 429 ? -4.768  -8.524  -43.799 1.00 49.85 ? 406  ASN A C     1 
ATOM   3896 O O     . ASN C 3 429 ? -5.318  -9.567  -43.439 1.00 49.85 ? 406  ASN A O     1 
ATOM   3897 C CB    . ASN C 3 429 ? -2.808  -7.986  -42.330 1.00 49.85 ? 406  ASN A CB    1 
ATOM   3898 C CG    . ASN C 3 429 ? -1.342  -8.275  -42.067 1.00 49.85 ? 406  ASN A CG    1 
ATOM   3899 O OD1   . ASN C 3 429 ? -0.889  -9.414  -42.179 1.00 49.85 ? 406  ASN A OD1   1 
ATOM   3900 N ND2   . ASN C 3 429 ? -0.592  -7.241  -41.710 1.00 49.85 ? 406  ASN A ND2   1 
ATOM   3901 N N     . TRP C 3 430 ? -5.439  -7.466  -44.255 1.00 49.85 ? 407  TRP A N     1 
ATOM   3902 C CA    . TRP C 3 430 ? -6.878  -7.516  -44.510 1.00 49.85 ? 407  TRP A CA    1 
ATOM   3903 C C     . TRP C 3 430 ? -7.186  -8.418  -45.701 1.00 49.85 ? 407  TRP A C     1 
ATOM   3904 O O     . TRP C 3 430 ? -8.192  -9.129  -45.700 1.00 49.85 ? 407  TRP A O     1 
ATOM   3905 C CB    . TRP C 3 430 ? -7.458  -6.116  -44.730 1.00 49.85 ? 407  TRP A CB    1 
ATOM   3906 C CG    . TRP C 3 430 ? -7.964  -5.471  -43.469 1.00 49.85 ? 407  TRP A CG    1 
ATOM   3907 C CD1   . TRP C 3 430 ? -7.369  -4.466  -42.764 1.00 49.85 ? 407  TRP A CD1   1 
ATOM   3908 C CD2   . TRP C 3 430 ? -9.171  -5.793  -42.764 1.00 49.85 ? 407  TRP A CD2   1 
ATOM   3909 N NE1   . TRP C 3 430 ? -8.127  -4.140  -41.666 1.00 49.85 ? 407  TRP A NE1   1 
ATOM   3910 C CE2   . TRP C 3 430 ? -9.239  -4.939  -41.642 1.00 49.85 ? 407  TRP A CE2   1 
ATOM   3911 C CE3   . TRP C 3 430 ? -10.201 -6.719  -42.972 1.00 49.85 ? 407  TRP A CE3   1 
ATOM   3912 C CZ2   . TRP C 3 430 ? -10.296 -4.984  -40.730 1.00 49.85 ? 407  TRP A CZ2   1 
ATOM   3913 C CZ3   . TRP C 3 430 ? -11.253 -6.761  -42.064 1.00 49.85 ? 407  TRP A CZ3   1 
ATOM   3914 C CH2   . TRP C 3 430 ? -11.290 -5.899  -40.957 1.00 49.85 ? 407  TRP A CH2   1 
ATOM   3915 N N     . MET C 3 431 ? -6.314  -8.382  -46.708 1.00 49.85 ? 408  MET A N     1 
ATOM   3916 C CA    . MET C 3 431 ? -6.417  -9.270  -47.866 1.00 49.85 ? 408  MET A CA    1 
ATOM   3917 C C     . MET C 3 431 ? -6.105  -10.715 -47.498 1.00 49.85 ? 408  MET A C     1 
ATOM   3918 O O     . MET C 3 431 ? -6.644  -11.643 -48.100 1.00 49.85 ? 408  MET A O     1 
ATOM   3919 C CB    . MET C 3 431 ? -5.501  -8.804  -48.998 1.00 49.85 ? 408  MET A CB    1 
ATOM   3920 C CG    . MET C 3 431 ? -6.073  -7.662  -49.823 1.00 49.85 ? 408  MET A CG    1 
ATOM   3921 S SD    . MET C 3 431 ? -5.110  -7.281  -51.301 1.00 49.85 ? 408  MET A SD    1 
ATOM   3922 C CE    . MET C 3 431 ? -3.722  -6.398  -50.596 1.00 49.85 ? 408  MET A CE    1 
ATOM   3923 N N     . TRP C 3 432 ? -5.234  -10.897 -46.509 1.00 49.85 ? 409  TRP A N     1 
ATOM   3924 C CA    . TRP C 3 432 ? -4.905  -12.223 -45.999 1.00 49.85 ? 409  TRP A CA    1 
ATOM   3925 C C     . TRP C 3 432 ? -6.122  -12.871 -45.334 1.00 49.85 ? 409  TRP A C     1 
ATOM   3926 O O     . TRP C 3 432 ? -6.479  -14.007 -45.652 1.00 49.85 ? 409  TRP A O     1 
ATOM   3927 C CB    . TRP C 3 432 ? -3.735  -12.144 -45.011 1.00 49.85 ? 409  TRP A CB    1 
ATOM   3928 C CG    . TRP C 3 432 ? -3.283  -13.481 -44.497 1.00 49.85 ? 409  TRP A CG    1 
ATOM   3929 C CD1   . TRP C 3 432 ? -3.935  -14.278 -43.599 1.00 49.85 ? 409  TRP A CD1   1 
ATOM   3930 C CD2   . TRP C 3 432 ? -2.080  -14.175 -44.849 1.00 49.85 ? 409  TRP A CD2   1 
ATOM   3931 N NE1   . TRP C 3 432 ? -3.216  -15.425 -43.373 1.00 49.85 ? 409  TRP A NE1   1 
ATOM   3932 C CE2   . TRP C 3 432 ? -2.072  -15.389 -44.126 1.00 49.85 ? 409  TRP A CE2   1 
ATOM   3933 C CE3   . TRP C 3 432 ? -1.009  -13.892 -45.706 1.00 49.85 ? 409  TRP A CE3   1 
ATOM   3934 C CZ2   . TRP C 3 432 ? -1.032  -16.320 -44.233 1.00 49.85 ? 409  TRP A CZ2   1 
ATOM   3935 C CZ3   . TRP C 3 432 ? 0.025   -14.818 -45.811 1.00 49.85 ? 409  TRP A CZ3   1 
ATOM   3936 C CH2   . TRP C 3 432 ? 0.004   -16.017 -45.078 1.00 49.85 ? 409  TRP A CH2   1 
ATOM   3937 N N     . LEU C 3 433 ? -6.753  -12.141 -44.417 1.00 49.85 ? 410  LEU A N     1 
ATOM   3938 C CA    . LEU C 3 433 ? -7.865  -12.671 -43.623 1.00 49.85 ? 410  LEU A CA    1 
ATOM   3939 C C     . LEU C 3 433 ? -9.173  -12.793 -44.404 1.00 49.85 ? 410  LEU A C     1 
ATOM   3940 O O     . LEU C 3 433 ? -10.018 -13.629 -44.077 1.00 49.85 ? 410  LEU A O     1 
ATOM   3941 C CB    . LEU C 3 433 ? -8.071  -11.835 -42.354 1.00 49.85 ? 410  LEU A CB    1 
ATOM   3942 C CG    . LEU C 3 433 ? -7.289  -12.198 -41.081 1.00 49.85 ? 410  LEU A CG    1 
ATOM   3943 C CD1   . LEU C 3 433 ? -7.712  -13.564 -40.543 1.00 49.85 ? 410  LEU A CD1   1 
ATOM   3944 C CD2   . LEU C 3 433 ? -5.773  -12.140 -41.279 1.00 49.85 ? 410  LEU A CD2   1 
ATOM   3945 N N     . SER C 3 434 ? -9.332  -11.959 -45.429 1.00 49.85 ? 411  SER A N     1 
ATOM   3946 C CA    . SER C 3 434 ? -10.471 -12.057 -46.338 1.00 49.85 ? 411  SER A CA    1 
ATOM   3947 C C     . SER C 3 434 ? -10.179 -13.047 -47.465 1.00 49.85 ? 411  SER A C     1 
ATOM   3948 O O     . SER C 3 434 ? -11.030 -13.294 -48.323 1.00 49.85 ? 411  SER A O     1 
ATOM   3949 C CB    . SER C 3 434 ? -10.817 -10.682 -46.915 1.00 49.85 ? 411  SER A CB    1 
ATOM   3950 O OG    . SER C 3 434 ? -9.725  -10.138 -47.637 1.00 49.85 ? 411  SER A OG    1 
ATOM   3951 N N     . ALA C 3 435 ? -8.968  -13.607 -47.446 1.00 49.85 ? 412  ALA A N     1 
ATOM   3952 C CA    . ALA C 3 435 ? -8.474  -14.534 -48.470 1.00 49.85 ? 412  ALA A CA    1 
ATOM   3953 C C     . ALA C 3 435 ? -8.566  -13.959 -49.889 1.00 49.85 ? 412  ALA A C     1 
ATOM   3954 O O     . ALA C 3 435 ? -8.832  -14.681 -50.854 1.00 49.85 ? 412  ALA A O     1 
ATOM   3955 C CB    . ALA C 3 435 ? -9.173  -15.895 -48.365 1.00 49.85 ? 412  ALA A CB    1 
ATOM   3956 N N     . SER C 3 436 ? -8.341  -12.651 -49.996 1.00 49.85 ? 413  SER A N     1 
ATOM   3957 C CA    . SER C 3 436 ? -8.286  -11.961 -51.281 1.00 49.85 ? 413  SER A CA    1 
ATOM   3958 C C     . SER C 3 436 ? -6.931  -12.178 -51.946 1.00 49.85 ? 413  SER A C     1 
ATOM   3959 O O     . SER C 3 436 ? -6.845  -12.354 -53.163 1.00 49.85 ? 413  SER A O     1 
ATOM   3960 C CB    . SER C 3 436 ? -8.539  -10.464 -51.095 1.00 49.85 ? 413  SER A CB    1 
ATOM   3961 O OG    . SER C 3 436 ? -9.830  -10.228 -50.564 1.00 49.85 ? 413  SER A OG    1 
ATOM   3962 N N     . ALA C 3 437 ? -5.877  -12.163 -51.135 1.00 49.85 ? 414  ALA A N     1 
ATOM   3963 C CA    . ALA C 3 437 ? -4.519  -12.370 -51.616 1.00 49.85 ? 414  ALA A CA    1 
ATOM   3964 C C     . ALA C 3 437 ? -3.685  -13.131 -50.589 1.00 49.85 ? 414  ALA A C     1 
ATOM   3965 O O     . ALA C 3 437 ? -4.055  -13.213 -49.414 1.00 49.85 ? 414  ALA A O     1 
ATOM   3966 C CB    . ALA C 3 437 ? -3.871  -11.034 -51.949 1.00 49.85 ? 414  ALA A CB    1 
ATOM   3967 N N     . PHE C 3 438 ? -2.563  -13.684 -51.053 1.00 49.85 ? 415  PHE A N     1 
ATOM   3968 C CA    . PHE C 3 438 ? -1.560  -14.367 -50.216 1.00 49.85 ? 415  PHE A CA    1 
ATOM   3969 C C     . PHE C 3 438 ? -2.082  -15.614 -49.489 1.00 49.85 ? 415  PHE A C     1 
ATOM   3970 O O     . PHE C 3 438 ? -1.521  -16.700 -49.644 1.00 49.85 ? 415  PHE A O     1 
ATOM   3971 C CB    . PHE C 3 438 ? -0.885  -13.386 -49.244 1.00 49.85 ? 415  PHE A CB    1 
ATOM   3972 C CG    . PHE C 3 438 ? -0.598  -12.035 -49.845 1.00 49.85 ? 415  PHE A CG    1 
ATOM   3973 C CD1   . PHE C 3 438 ? 0.361   -11.887 -50.844 1.00 49.85 ? 415  PHE A CD1   1 
ATOM   3974 C CD2   . PHE C 3 438 ? -1.289  -10.909 -49.412 1.00 49.85 ? 415  PHE A CD2   1 
ATOM   3975 C CE1   . PHE C 3 438 ? 0.627   -10.635 -51.403 1.00 49.85 ? 415  PHE A CE1   1 
ATOM   3976 C CE2   . PHE C 3 438 ? -1.030  -9.655  -49.964 1.00 49.85 ? 415  PHE A CE2   1 
ATOM   3977 C CZ    . PHE C 3 438 ? -0.070  -9.519  -50.961 1.00 49.85 ? 415  PHE A CZ    1 
ATOM   3978 N N     . PHE C 3 439 ? -3.146  -15.451 -48.705 1.00 49.85 ? 416  PHE A N     1 
ATOM   3979 C CA    . PHE C 3 439 ? -3.833  -16.569 -48.060 1.00 49.85 ? 416  PHE A CA    1 
ATOM   3980 C C     . PHE C 3 439 ? -5.024  -16.986 -48.914 1.00 49.85 ? 416  PHE A C     1 
ATOM   3981 O O     . PHE C 3 439 ? -5.723  -16.130 -49.461 1.00 49.85 ? 416  PHE A O     1 
ATOM   3982 C CB    . PHE C 3 439 ? -4.298  -16.163 -46.663 1.00 49.85 ? 416  PHE A CB    1 
ATOM   3983 C CG    . PHE C 3 439 ? -4.925  -17.280 -45.871 1.00 49.85 ? 416  PHE A CG    1 
ATOM   3984 C CD1   . PHE C 3 439 ? -4.134  -18.244 -45.251 1.00 49.85 ? 416  PHE A CD1   1 
ATOM   3985 C CD2   . PHE C 3 439 ? -6.309  -17.363 -45.741 1.00 49.85 ? 416  PHE A CD2   1 
ATOM   3986 C CE1   . PHE C 3 439 ? -4.713  -19.277 -44.516 1.00 49.85 ? 416  PHE A CE1   1 
ATOM   3987 C CE2   . PHE C 3 439 ? -6.896  -18.390 -45.009 1.00 49.85 ? 416  PHE A CE2   1 
ATOM   3988 C CZ    . PHE C 3 439 ? -6.097  -19.349 -44.395 1.00 49.85 ? 416  PHE A CZ    1 
ATOM   3989 N N     . HIS C 3 440 ? -5.254  -18.296 -49.026 1.00 49.85 ? 417  HIS A N     1 
ATOM   3990 C CA    . HIS C 3 440 ? -6.289  -18.820 -49.926 1.00 49.85 ? 417  HIS A CA    1 
ATOM   3991 C C     . HIS C 3 440 ? -7.168  -19.935 -49.345 1.00 49.85 ? 417  HIS A C     1 
ATOM   3992 O O     . HIS C 3 440 ? -8.215  -20.258 -49.912 1.00 49.85 ? 417  HIS A O     1 
ATOM   3993 C CB    . HIS C 3 440 ? -5.667  -19.269 -51.253 1.00 49.85 ? 417  HIS A CB    1 
ATOM   3994 C CG    . HIS C 3 440 ? -5.010  -18.161 -52.018 1.00 49.85 ? 417  HIS A CG    1 
ATOM   3995 N ND1   . HIS C 3 440 ? -5.722  -17.251 -52.769 1.00 49.85 ? 417  HIS A ND1   1 
ATOM   3996 C CD2   . HIS C 3 440 ? -3.707  -17.816 -52.145 1.00 49.85 ? 417  HIS A CD2   1 
ATOM   3997 C CE1   . HIS C 3 440 ? -4.886  -16.394 -53.327 1.00 49.85 ? 417  HIS A CE1   1 
ATOM   3998 N NE2   . HIS C 3 440 ? -3.657  -16.715 -52.965 1.00 49.85 ? 417  HIS A NE2   1 
ATOM   3999 N N     . GLN C 3 441 ? -6.749  -20.516 -48.224 1.00 49.85 ? 418  GLN A N     1 
ATOM   4000 C CA    . GLN C 3 441 ? -7.499  -21.607 -47.594 1.00 49.85 ? 418  GLN A CA    1 
ATOM   4001 C C     . GLN C 3 441 ? -8.765  -21.115 -46.881 1.00 49.85 ? 418  GLN A C     1 
ATOM   4002 O O     . GLN C 3 441 ? -8.774  -20.929 -45.660 1.00 49.85 ? 418  GLN A O     1 
ATOM   4003 C CB    . GLN C 3 441 ? -6.604  -22.388 -46.628 1.00 49.85 ? 418  GLN A CB    1 
ATOM   4004 C CG    . GLN C 3 441 ? -5.638  -23.343 -47.304 1.00 49.85 ? 418  GLN A CG    1 
ATOM   4005 C CD    . GLN C 3 441 ? -4.652  -23.956 -46.330 1.00 49.85 ? 418  GLN A CD    1 
ATOM   4006 O OE1   . GLN C 3 441 ? -3.778  -23.270 -45.800 1.00 49.85 ? 418  GLN A OE1   1 
ATOM   4007 N NE2   . GLN C 3 441 ? -4.787  -25.256 -46.091 1.00 49.85 ? 418  GLN A NE2   1 
ATOM   4008 N N     . TYR C 3 442 ? -9.831  -20.912 -47.654 1.00 49.85 ? 419  TYR A N     1 
ATOM   4009 C CA    . TYR C 3 442 ? -11.092 -20.378 -47.123 1.00 49.85 ? 419  TYR A CA    1 
ATOM   4010 C C     . TYR C 3 442 ? -11.885 -21.381 -46.270 1.00 49.85 ? 419  TYR A C     1 
ATOM   4011 O O     . TYR C 3 442 ? -12.945 -21.048 -45.733 1.00 49.85 ? 419  TYR A O     1 
ATOM   4012 C CB    . TYR C 3 442 ? -11.960 -19.798 -48.252 1.00 49.85 ? 419  TYR A CB    1 
ATOM   4013 C CG    . TYR C 3 442 ? -12.375 -20.801 -49.306 1.00 49.85 ? 419  TYR A CG    1 
ATOM   4014 C CD1   . TYR C 3 442 ? -11.584 -21.026 -50.433 1.00 49.85 ? 419  TYR A CD1   1 
ATOM   4015 C CD2   . TYR C 3 442 ? -13.560 -21.524 -49.177 1.00 49.85 ? 419  TYR A CD2   1 
ATOM   4016 C CE1   . TYR C 3 442 ? -11.963 -21.949 -51.406 1.00 49.85 ? 419  TYR A CE1   1 
ATOM   4017 C CE2   . TYR C 3 442 ? -13.949 -22.449 -50.143 1.00 49.85 ? 419  TYR A CE2   1 
ATOM   4018 C CZ    . TYR C 3 442 ? -13.147 -22.657 -51.254 1.00 49.85 ? 419  TYR A CZ    1 
ATOM   4019 O OH    . TYR C 3 442 ? -13.534 -23.572 -52.208 1.00 49.85 ? 419  TYR A OH    1 
ATOM   4020 N N     . PHE C 3 443 ? -11.368 -22.602 -46.150 1.00 49.85 ? 420  PHE A N     1 
ATOM   4021 C CA    . PHE C 3 443 ? -11.947 -23.608 -45.262 1.00 49.85 ? 420  PHE A CA    1 
ATOM   4022 C C     . PHE C 3 443 ? -11.634 -23.322 -43.796 1.00 49.85 ? 420  PHE A C     1 
ATOM   4023 O O     . PHE C 3 443 ? -12.428 -23.652 -42.910 1.00 49.85 ? 420  PHE A O     1 
ATOM   4024 C CB    . PHE C 3 443 ? -11.469 -25.011 -45.645 1.00 49.85 ? 420  PHE A CB    1 
ATOM   4025 C CG    . PHE C 3 443 ? -12.445 -25.771 -46.497 1.00 49.85 ? 420  PHE A CG    1 
ATOM   4026 C CD1   . PHE C 3 443 ? -12.640 -25.431 -47.835 1.00 49.85 ? 420  PHE A CD1   1 
ATOM   4027 C CD2   . PHE C 3 443 ? -13.174 -26.832 -45.962 1.00 49.85 ? 420  PHE A CD2   1 
ATOM   4028 C CE1   . PHE C 3 443 ? -13.548 -26.135 -48.629 1.00 49.85 ? 420  PHE A CE1   1 
ATOM   4029 C CE2   . PHE C 3 443 ? -14.084 -27.543 -46.747 1.00 49.85 ? 420  PHE A CE2   1 
ATOM   4030 C CZ    . PHE C 3 443 ? -14.270 -27.193 -48.084 1.00 49.85 ? 420  PHE A CZ    1 
ATOM   4031 N N     . ARG C 3 444 ? -10.477 -22.711 -43.548 1.00 49.85 ? 421  ARG A N     1 
ATOM   4032 C CA    . ARG C 3 444 ? -10.087 -22.308 -42.199 1.00 49.85 ? 421  ARG A CA    1 
ATOM   4033 C C     . ARG C 3 444 ? -10.784 -21.000 -41.820 1.00 49.85 ? 421  ARG A C     1 
ATOM   4034 O O     . ARG C 3 444 ? -10.324 -19.910 -42.175 1.00 49.85 ? 421  ARG A O     1 
ATOM   4035 C CB    . ARG C 3 444 ? -8.566  -22.155 -42.087 1.00 49.85 ? 421  ARG A CB    1 
ATOM   4036 C CG    . ARG C 3 444 ? -7.763  -23.434 -42.285 1.00 49.85 ? 421  ARG A CG    1 
ATOM   4037 C CD    . ARG C 3 444 ? -6.300  -23.191 -41.936 1.00 49.85 ? 421  ARG A CD    1 
ATOM   4038 N NE    . ARG C 3 444 ? -5.388  -24.081 -42.653 1.00 49.85 ? 421  ARG A NE    1 
ATOM   4039 C CZ    . ARG C 3 444 ? -4.064  -23.945 -42.675 1.00 49.85 ? 421  ARG A CZ    1 
ATOM   4040 N NH1   . ARG C 3 444 ? -3.478  -22.952 -42.020 1.00 49.85 ? 421  ARG A NH1   1 
ATOM   4041 N NH2   . ARG C 3 444 ? -3.320  -24.805 -43.356 1.00 49.85 ? 421  ARG A NH2   1 
ATOM   4042 N N     . VAL C 3 445 ? -11.898 -21.121 -41.100 1.00 49.85 ? 422  VAL A N     1 
ATOM   4043 C CA    . VAL C 3 445 ? -12.663 -19.961 -40.641 1.00 49.85 ? 422  VAL A CA    1 
ATOM   4044 C C     . VAL C 3 445 ? -12.653 -19.910 -39.115 1.00 49.85 ? 422  VAL A C     1 
ATOM   4045 O O     . VAL C 3 445 ? -12.921 -20.915 -38.452 1.00 49.85 ? 422  VAL A O     1 
ATOM   4046 C CB    . VAL C 3 445 ? -14.124 -19.980 -41.171 1.00 49.85 ? 422  VAL A CB    1 
ATOM   4047 C CG1   . VAL C 3 445 ? -14.910 -18.776 -40.660 1.00 49.85 ? 422  VAL A CG1   1 
ATOM   4048 C CG2   . VAL C 3 445 ? -14.147 -20.008 -42.694 1.00 49.85 ? 422  VAL A CG2   1 
ATOM   4049 N N     . TYR C 3 446 ? -12.340 -18.735 -38.571 1.00 49.85 ? 423  TYR A N     1 
ATOM   4050 C CA    . TYR C 3 446 ? -12.293 -18.527 -37.127 1.00 49.85 ? 423  TYR A CA    1 
ATOM   4051 C C     . TYR C 3 446 ? -13.689 -18.526 -36.516 1.00 49.85 ? 423  TYR A C     1 
ATOM   4052 O O     . TYR C 3 446 ? -14.600 -17.864 -37.020 1.00 49.85 ? 423  TYR A O     1 
ATOM   4053 C CB    . TYR C 3 446 ? -11.587 -17.211 -36.791 1.00 49.85 ? 423  TYR A CB    1 
ATOM   4054 C CG    . TYR C 3 446 ? -10.113 -17.183 -37.128 1.00 49.85 ? 423  TYR A CG    1 
ATOM   4055 C CD1   . TYR C 3 446 ? -9.161  -17.639 -36.217 1.00 49.85 ? 423  TYR A CD1   1 
ATOM   4056 C CD2   . TYR C 3 446 ? -9.670  -16.699 -38.357 1.00 49.85 ? 423  TYR A CD2   1 
ATOM   4057 C CE1   . TYR C 3 446 ? -7.804  -17.614 -36.523 1.00 49.85 ? 423  TYR A CE1   1 
ATOM   4058 C CE2   . TYR C 3 446 ? -8.316  -16.671 -38.672 1.00 49.85 ? 423  TYR A CE2   1 
ATOM   4059 C CZ    . TYR C 3 446 ? -7.390  -17.129 -37.751 1.00 49.85 ? 423  TYR A CZ    1 
ATOM   4060 O OH    . TYR C 3 446 ? -6.050  -17.101 -38.061 1.00 49.85 ? 423  TYR A OH    1 
ATOM   4061 N N     . SER C 3 447 ? -13.841 -19.276 -35.429 1.00 49.85 ? 424  SER A N     1 
ATOM   4062 C CA    . SER C 3 447 ? -15.073 -19.285 -34.653 1.00 49.85 ? 424  SER A CA    1 
ATOM   4063 C C     . SER C 3 447 ? -14.991 -18.215 -33.565 1.00 49.85 ? 424  SER A C     1 
ATOM   4064 O O     . SER C 3 447 ? -14.144 -18.305 -32.676 1.00 49.85 ? 424  SER A O     1 
ATOM   4065 C CB    . SER C 3 447 ? -15.307 -20.668 -34.036 1.00 49.85 ? 424  SER A CB    1 
ATOM   4066 O OG    . SER C 3 447 ? -16.371 -20.650 -33.100 1.00 49.85 ? 424  SER A OG    1 
ATOM   4067 N N     . PRO C 3 448 ? -15.870 -17.195 -33.633 1.00 49.85 ? 425  PRO A N     1 
ATOM   4068 C CA    . PRO C 3 448 ? -15.915 -16.150 -32.607 1.00 49.85 ? 425  PRO A CA    1 
ATOM   4069 C C     . PRO C 3 448 ? -16.286 -16.696 -31.228 1.00 49.85 ? 425  PRO A C     1 
ATOM   4070 O O     . PRO C 3 448 ? -16.050 -16.033 -30.217 1.00 49.85 ? 425  PRO A O     1 
ATOM   4071 C CB    . PRO C 3 448 ? -17.013 -15.208 -33.112 1.00 49.85 ? 425  PRO A CB    1 
ATOM   4072 C CG    . PRO C 3 448 ? -17.834 -16.028 -34.036 1.00 49.85 ? 425  PRO A CG    1 
ATOM   4073 C CD    . PRO C 3 448 ? -16.876 -16.967 -34.685 1.00 49.85 ? 425  PRO A CD    1 
ATOM   4074 N N     . VAL C 3 449 ? -16.860 -17.897 -31.205 1.00 49.85 ? 426  VAL A N     1 
ATOM   4075 C CA    . VAL C 3 449 ? -17.293 -18.549 -29.972 1.00 49.85 ? 426  VAL A CA    1 
ATOM   4076 C C     . VAL C 3 449 ? -16.188 -19.439 -29.388 1.00 49.85 ? 426  VAL A C     1 
ATOM   4077 O O     . VAL C 3 449 ? -16.031 -19.524 -28.167 1.00 49.85 ? 426  VAL A O     1 
ATOM   4078 C CB    . VAL C 3 449 ? -18.577 -19.392 -30.200 1.00 49.85 ? 426  VAL A CB    1 
ATOM   4079 C CG1   . VAL C 3 449 ? -19.221 -19.770 -28.875 1.00 49.85 ? 426  VAL A CG1   1 
ATOM   4080 C CG2   . VAL C 3 449 ? -19.575 -18.635 -31.068 1.00 49.85 ? 426  VAL A CG2   1 
ATOM   4081 N N     . ALA C 3 450 ? -15.426 -20.094 -30.263 1.00 49.85 ? 427  ALA A N     1 
ATOM   4082 C CA    . ALA C 3 450 ? -14.428 -21.078 -29.839 1.00 49.85 ? 427  ALA A CA    1 
ATOM   4083 C C     . ALA C 3 450 ? -12.999 -20.541 -29.744 1.00 49.85 ? 427  ALA A C     1 
ATOM   4084 O O     . ALA C 3 450 ? -12.269 -20.894 -28.819 1.00 49.85 ? 427  ALA A O     1 
ATOM   4085 C CB    . ALA C 3 450 ? -14.473 -22.301 -30.742 1.00 49.85 ? 427  ALA A CB    1 
ATOM   4086 N N     . PHE C 3 451 ? -12.607 -19.695 -30.696 1.00 49.85 ? 428  PHE A N     1 
ATOM   4087 C CA    . PHE C 3 451 ? -11.221 -19.226 -30.809 1.00 49.85 ? 428  PHE A CA    1 
ATOM   4088 C C     . PHE C 3 451 ? -10.657 -18.650 -29.509 1.00 49.85 ? 428  PHE A C     1 
ATOM   4089 O O     . PHE C 3 451 ? -9.534  -18.974 -29.117 1.00 49.85 ? 428  PHE A O     1 
ATOM   4090 C CB    . PHE C 3 451 ? -11.083 -18.208 -31.948 1.00 49.85 ? 428  PHE A CB    1 
ATOM   4091 C CG    . PHE C 3 451 ? -9.660  -17.887 -32.312 1.00 49.85 ? 428  PHE A CG    1 
ATOM   4092 C CD1   . PHE C 3 451 ? -8.816  -18.872 -32.819 1.00 49.85 ? 428  PHE A CD1   1 
ATOM   4093 C CD2   . PHE C 3 451 ? -9.163  -16.599 -32.151 1.00 49.85 ? 428  PHE A CD2   1 
ATOM   4094 C CE1   . PHE C 3 451 ? -7.498  -18.578 -33.157 1.00 49.85 ? 428  PHE A CE1   1 
ATOM   4095 C CE2   . PHE C 3 451 ? -7.846  -16.295 -32.487 1.00 49.85 ? 428  PHE A CE2   1 
ATOM   4096 C CZ    . PHE C 3 451 ? -7.013  -17.286 -32.991 1.00 49.85 ? 428  PHE A CZ    1 
ATOM   4097 N N     . GLY C 3 452 ? -11.442 -17.802 -28.850 1.00 49.85 ? 429  GLY A N     1 
ATOM   4098 C CA    . GLY C 3 452 ? -11.019 -17.156 -27.612 1.00 49.85 ? 429  GLY A CA    1 
ATOM   4099 C C     . GLY C 3 452 ? -10.886 -18.103 -26.436 1.00 49.85 ? 429  GLY A C     1 
ATOM   4100 O O     . GLY C 3 452 ? -10.045 -17.892 -25.559 1.00 49.85 ? 429  GLY A O     1 
ATOM   4101 N N     . LYS C 3 453 ? -11.716 -19.145 -26.422 1.00 49.85 ? 430  LYS A N     1 
ATOM   4102 C CA    . LYS C 3 453 ? -11.777 -20.101 -25.311 1.00 49.85 ? 430  LYS A CA    1 
ATOM   4103 C C     . LYS C 3 453 ? -10.438 -20.767 -25.002 1.00 49.85 ? 430  LYS A C     1 
ATOM   4104 O O     . LYS C 3 453 ? -10.108 -20.988 -23.838 1.00 49.85 ? 430  LYS A O     1 
ATOM   4105 C CB    . LYS C 3 453 ? -12.835 -21.177 -25.576 1.00 49.85 ? 430  LYS A CB    1 
ATOM   4106 C CG    . LYS C 3 453 ? -14.273 -20.725 -25.371 1.00 49.85 ? 430  LYS A CG    1 
ATOM   4107 C CD    . LYS C 3 453 ? -15.236 -21.890 -25.551 1.00 49.85 ? 430  LYS A CD    1 
ATOM   4108 C CE    . LYS C 3 453 ? -16.659 -21.499 -25.194 1.00 49.85 ? 430  LYS A CE    1 
ATOM   4109 N NZ    . LYS C 3 453 ? -17.604 -22.640 -25.346 1.00 49.85 ? 430  LYS A NZ    1 
ATOM   4110 N N     . LYS C 3 454 ? -9.677  -21.082 -26.046 1.00 49.85 ? 431  LYS A N     1 
ATOM   4111 C CA    . LYS C 3 454 ? -8.410  -21.797 -25.899 1.00 49.85 ? 431  LYS A CA    1 
ATOM   4112 C C     . LYS C 3 454 ? -7.435  -21.072 -24.971 1.00 49.85 ? 431  LYS A C     1 
ATOM   4113 O O     . LYS C 3 454 ? -6.914  -21.665 -24.026 1.00 49.85 ? 431  LYS A O     1 
ATOM   4114 C CB    . LYS C 3 454 ? -7.768  -22.041 -27.269 1.00 49.85 ? 431  LYS A CB    1 
ATOM   4115 C CG    . LYS C 3 454 ? -8.568  -22.973 -28.177 1.00 49.85 ? 431  LYS A CG    1 
ATOM   4116 C CD    . LYS C 3 454 ? -7.917  -23.135 -29.547 1.00 49.85 ? 431  LYS A CD    1 
ATOM   4117 C CE    . LYS C 3 454 ? -8.257  -21.980 -30.484 1.00 49.85 ? 431  LYS A CE    1 
ATOM   4118 N NZ    . LYS C 3 454 ? -7.635  -22.164 -31.827 1.00 49.85 ? 431  LYS A NZ    1 
ATOM   4119 N N     . THR C 3 455 ? -7.203  -19.791 -25.248 1.00 49.85 ? 432  THR A N     1 
ATOM   4120 C CA    . THR C 3 455 ? -6.237  -18.983 -24.502 1.00 49.85 ? 432  THR A CA    1 
ATOM   4121 C C     . THR C 3 455 ? -6.849  -18.321 -23.267 1.00 49.85 ? 432  THR A C     1 
ATOM   4122 O O     . THR C 3 455 ? -6.155  -18.084 -22.275 1.00 49.85 ? 432  THR A O     1 
ATOM   4123 C CB    . THR C 3 455 ? -5.608  -17.898 -25.395 1.00 49.85 ? 432  THR A CB    1 
ATOM   4124 O OG1   . THR C 3 455 ? -6.637  -17.243 -26.146 1.00 49.85 ? 432  THR A OG1   1 
ATOM   4125 C CG2   . THR C 3 455 ? -4.601  -18.514 -26.356 1.00 49.85 ? 432  THR A CG2   1 
ATOM   4126 N N     . ASP C 3 456 ? -8.145  -18.027 -23.337 1.00 49.85 ? 433  ASP A N     1 
ATOM   4127 C CA    . ASP C 3 456 ? -8.868  -17.417 -22.226 1.00 49.85 ? 433  ASP A CA    1 
ATOM   4128 C C     . ASP C 3 456 ? -10.154 -18.204 -21.936 1.00 49.85 ? 433  ASP A C     1 
ATOM   4129 O O     . ASP C 3 456 ? -11.241 -17.796 -22.352 1.00 49.85 ? 433  ASP A O     1 
ATOM   4130 C CB    . ASP C 3 456 ? -9.171  -15.946 -22.542 1.00 49.85 ? 433  ASP A CB    1 
ATOM   4131 C CG    . ASP C 3 456 ? -9.685  -15.167 -21.338 1.00 49.85 ? 433  ASP A CG    1 
ATOM   4132 O OD1   . ASP C 3 456 ? -9.620  -15.673 -20.197 1.00 49.85 ? 433  ASP A OD1   1 
ATOM   4133 O OD2   . ASP C 3 456 ? -10.160 -14.030 -21.545 1.00 49.85 ? 433  ASP A OD2   1 
ATOM   4134 N N     . PRO C 3 457 ? -10.031 -19.341 -21.218 1.00 49.85 ? 434  PRO A N     1 
ATOM   4135 C CA    . PRO C 3 457 ? -11.191 -20.179 -20.904 1.00 49.85 ? 434  PRO A CA    1 
ATOM   4136 C C     . PRO C 3 457 ? -12.210 -19.495 -19.994 1.00 49.85 ? 434  PRO A C     1 
ATOM   4137 O O     . PRO C 3 457 ? -13.405 -19.783 -20.088 1.00 49.85 ? 434  PRO A O     1 
ATOM   4138 C CB    . PRO C 3 457 ? -10.571 -21.388 -20.195 1.00 49.85 ? 434  PRO A CB    1 
ATOM   4139 C CG    . PRO C 3 457 ? -9.278  -20.900 -19.661 1.00 49.85 ? 434  PRO A CG    1 
ATOM   4140 C CD    . PRO C 3 457 ? -8.786  -19.904 -20.661 1.00 49.85 ? 434  PRO A CD    1 
ATOM   4141 N N     . GLN C 3 458 ? -11.738 -18.600 -19.129 1.00 49.85 ? 435  GLN A N     1 
ATOM   4142 C CA    . GLN C 3 458 ? -12.604 -17.906 -18.179 1.00 49.85 ? 435  GLN A CA    1 
ATOM   4143 C C     . GLN C 3 458 ? -13.279 -16.686 -18.796 1.00 49.85 ? 435  GLN A C     1 
ATOM   4144 O O     . GLN C 3 458 ? -14.365 -16.294 -18.373 1.00 49.85 ? 435  GLN A O     1 
ATOM   4145 C CB    . GLN C 3 458 ? -11.821 -17.501 -16.927 1.00 49.85 ? 435  GLN A CB    1 
ATOM   4146 C CG    . GLN C 3 458 ? -11.153 -18.660 -16.189 1.00 49.85 ? 435  GLN A CG    1 
ATOM   4147 C CD    . GLN C 3 458 ? -12.141 -19.663 -15.612 1.00 49.85 ? 435  GLN A CD    1 
ATOM   4148 O OE1   . GLN C 3 458 ? -13.327 -19.370 -15.447 1.00 49.85 ? 435  GLN A OE1   1 
ATOM   4149 N NE2   . GLN C 3 458 ? -11.650 -20.855 -15.299 1.00 49.85 ? 435  GLN A NE2   1 
ATOM   4150 N N     . GLY C 3 459 ? -12.630 -16.093 -19.794 1.00 49.85 ? 436  GLY A N     1 
ATOM   4151 C CA    . GLY C 3 459 ? -13.180 -14.937 -20.494 1.00 49.85 ? 436  GLY A CA    1 
ATOM   4152 C C     . GLY C 3 459 ? -12.931 -13.624 -19.777 1.00 49.85 ? 436  GLY A C     1 
ATOM   4153 O O     . GLY C 3 459 ? -13.781 -12.731 -19.797 1.00 49.85 ? 436  GLY A O     1 
ATOM   4154 N N     . HIS C 3 460 ? -11.763 -13.510 -19.146 1.00 49.85 ? 437  HIS A N     1 
ATOM   4155 C CA    . HIS C 3 460 ? -11.357 -12.287 -18.450 1.00 49.85 ? 437  HIS A CA    1 
ATOM   4156 C C     . HIS C 3 460 ? -11.362 -11.080 -19.389 1.00 49.85 ? 437  HIS A C     1 
ATOM   4157 O O     . HIS C 3 460 ? -11.773 -9.983  -19.003 1.00 49.85 ? 437  HIS A O     1 
ATOM   4158 C CB    . HIS C 3 460 ? -9.963  -12.449 -17.834 1.00 49.85 ? 437  HIS A CB    1 
ATOM   4159 C CG    . HIS C 3 460 ? -9.850  -13.582 -16.862 1.00 49.85 ? 437  HIS A CG    1 
ATOM   4160 N ND1   . HIS C 3 460 ? -10.653 -13.693 -15.748 1.00 49.85 ? 437  HIS A ND1   1 
ATOM   4161 C CD2   . HIS C 3 460 ? -9.020  -14.652 -16.835 1.00 49.85 ? 437  HIS A CD2   1 
ATOM   4162 C CE1   . HIS C 3 460 ? -10.326 -14.784 -15.078 1.00 49.85 ? 437  HIS A CE1   1 
ATOM   4163 N NE2   . HIS C 3 460 ? -9.338  -15.383 -15.716 1.00 49.85 ? 437  HIS A NE2   1 
ATOM   4164 N N     . TYR C 3 461 ? -10.902 -11.303 -20.619 1.00 49.85 ? 438  TYR A N     1 
ATOM   4165 C CA    . TYR C 3 461 ? -10.836 -10.279 -21.658 1.00 49.85 ? 438  TYR A CA    1 
ATOM   4166 C C     . TYR C 3 461 ? -12.214 -9.711  -21.983 1.00 49.85 ? 438  TYR A C     1 
ATOM   4167 O O     . TYR C 3 461 ? -12.363 -8.501  -22.169 1.00 49.85 ? 438  TYR A O     1 
ATOM   4168 C CB    . TYR C 3 461 ? -10.198 -10.871 -22.916 1.00 49.85 ? 438  TYR A CB    1 
ATOM   4169 C CG    . TYR C 3 461 ? -9.907  -9.882  -24.024 1.00 49.85 ? 438  TYR A CG    1 
ATOM   4170 C CD1   . TYR C 3 461 ? -8.799  -9.036  -23.962 1.00 49.85 ? 438  TYR A CD1   1 
ATOM   4171 C CD2   . TYR C 3 461 ? -10.737 -9.797  -25.141 1.00 49.85 ? 438  TYR A CD2   1 
ATOM   4172 C CE1   . TYR C 3 461 ? -8.528  -8.129  -24.981 1.00 49.85 ? 438  TYR A CE1   1 
ATOM   4173 C CE2   . TYR C 3 461 ? -10.474 -8.894  -26.163 1.00 49.85 ? 438  TYR A CE2   1 
ATOM   4174 C CZ    . TYR C 3 461 ? -9.370  -8.064  -26.077 1.00 49.85 ? 438  TYR A CZ    1 
ATOM   4175 O OH    . TYR C 3 461 ? -9.112  -7.172  -27.088 1.00 49.85 ? 438  TYR A OH    1 
ATOM   4176 N N     . ILE C 3 462 ? -13.214 -10.588 -22.047 1.00 49.85 ? 439  ILE A N     1 
ATOM   4177 C CA    . ILE C 3 462 ? -14.593 -10.178 -22.299 1.00 49.85 ? 439  ILE A CA    1 
ATOM   4178 C C     . ILE C 3 462 ? -15.120 -9.356  -21.125 1.00 49.85 ? 439  ILE A C     1 
ATOM   4179 O O     . ILE C 3 462 ? -15.741 -8.313  -21.322 1.00 49.85 ? 439  ILE A O     1 
ATOM   4180 C CB    . ILE C 3 462 ? -15.518 -11.394 -22.569 1.00 49.85 ? 439  ILE A CB    1 
ATOM   4181 C CG1   . ILE C 3 462 ? -15.090 -12.117 -23.850 1.00 49.85 ? 439  ILE A CG1   1 
ATOM   4182 C CG2   . ILE C 3 462 ? -16.983 -10.956 -22.665 1.00 49.85 ? 439  ILE A CG2   1 
ATOM   4183 C CD1   . ILE C 3 462 ? -15.713 -13.487 -24.033 1.00 49.85 ? 439  ILE A CD1   1 
ATOM   4184 N N     . ARG C 3 463 ? -14.862 -9.833  -19.910 1.00 49.85 ? 440  ARG A N     1 
ATOM   4185 C CA    . ARG C 3 463 ? -15.342 -9.174  -18.696 1.00 49.85 ? 440  ARG A CA    1 
ATOM   4186 C C     . ARG C 3 463 ? -14.803 -7.755  -18.542 1.00 49.85 ? 440  ARG A C     1 
ATOM   4187 O O     . ARG C 3 463 ? -15.503 -6.874  -18.038 1.00 49.85 ? 440  ARG A O     1 
ATOM   4188 C CB    . ARG C 3 463 ? -15.009 -10.012 -17.459 1.00 49.85 ? 440  ARG A CB    1 
ATOM   4189 C CG    . ARG C 3 463 ? -15.710 -11.356 -17.436 1.00 49.85 ? 440  ARG A CG    1 
ATOM   4190 C CD    . ARG C 3 463 ? -15.728 -11.970 -16.052 1.00 49.85 ? 440  ARG A CD    1 
ATOM   4191 N NE    . ARG C 3 463 ? -16.612 -13.133 -16.000 1.00 49.85 ? 440  ARG A NE    1 
ATOM   4192 C CZ    . ARG C 3 463 ? -16.218 -14.387 -16.201 1.00 49.85 ? 440  ARG A CZ    1 
ATOM   4193 N NH1   . ARG C 3 463 ? -14.947 -14.654 -16.468 1.00 49.85 ? 440  ARG A NH1   1 
ATOM   4194 N NH2   . ARG C 3 463 ? -17.095 -15.377 -16.135 1.00 49.85 ? 440  ARG A NH2   1 
ATOM   4195 N N     . LYS C 3 464 ? -13.565 -7.540  -18.980 1.00 49.85 ? 441  LYS A N     1 
ATOM   4196 C CA    . LYS C 3 464 ? -12.933 -6.229  -18.884 1.00 49.85 ? 441  LYS A CA    1 
ATOM   4197 C C     . LYS C 3 464 ? -13.530 -5.232  -19.876 1.00 49.85 ? 441  LYS A C     1 
ATOM   4198 O O     . LYS C 3 464 ? -13.923 -4.131  -19.491 1.00 49.85 ? 441  LYS A O     1 
ATOM   4199 C CB    . LYS C 3 464 ? -11.418 -6.342  -19.081 1.00 49.85 ? 441  LYS A CB    1 
ATOM   4200 C CG    . LYS C 3 464 ? -10.653 -5.063  -18.768 1.00 49.85 ? 441  LYS A CG    1 
ATOM   4201 C CD    . LYS C 3 464 ? -9.172  -5.219  -19.058 1.00 49.85 ? 441  LYS A CD    1 
ATOM   4202 C CE    . LYS C 3 464 ? -8.415  -3.930  -18.807 1.00 49.85 ? 441  LYS A CE    1 
ATOM   4203 N NZ    . LYS C 3 464 ? -6.964  -4.102  -19.079 1.00 49.85 ? 441  LYS A NZ    1 
ATOM   4204 N N     . TYR C 3 465 ? -13.599 -5.623  -21.145 1.00 49.85 ? 442  TYR A N     1 
ATOM   4205 C CA    . TYR C 3 465 ? -13.993 -4.701  -22.211 1.00 49.85 ? 442  TYR A CA    1 
ATOM   4206 C C     . TYR C 3 465 ? -15.490 -4.700  -22.523 1.00 49.85 ? 442  TYR A C     1 
ATOM   4207 O O     . TYR C 3 465 ? -16.004 -3.750  -23.115 1.00 49.85 ? 442  TYR A O     1 
ATOM   4208 C CB    . TYR C 3 465 ? -13.144 -4.933  -23.465 1.00 49.85 ? 442  TYR A CB    1 
ATOM   4209 C CG    . TYR C 3 465 ? -11.679 -4.649  -23.220 1.00 49.85 ? 442  TYR A CG    1 
ATOM   4210 C CD1   . TYR C 3 465 ? -11.190 -3.343  -23.246 1.00 49.85 ? 442  TYR A CD1   1 
ATOM   4211 C CD2   . TYR C 3 465 ? -10.783 -5.683  -22.956 1.00 49.85 ? 442  TYR A CD2   1 
ATOM   4212 C CE1   . TYR C 3 465 ? -9.847  -3.073  -23.018 1.00 49.85 ? 442  TYR A CE1   1 
ATOM   4213 C CE2   . TYR C 3 465 ? -9.438  -5.424  -22.727 1.00 49.85 ? 442  TYR A CE2   1 
ATOM   4214 C CZ    . TYR C 3 465 ? -8.978  -4.118  -22.759 1.00 49.85 ? 442  TYR A CZ    1 
ATOM   4215 O OH    . TYR C 3 465 ? -7.647  -3.855  -22.534 1.00 49.85 ? 442  TYR A OH    1 
ATOM   4216 N N     . VAL C 3 466 ? -16.179 -5.764  -22.122 1.00 49.85 ? 443  VAL A N     1 
ATOM   4217 C CA    . VAL C 3 466 ? -17.640 -5.806  -22.156 1.00 49.85 ? 443  VAL A CA    1 
ATOM   4218 C C     . VAL C 3 466 ? -18.143 -6.017  -20.720 1.00 49.85 ? 443  VAL A C     1 
ATOM   4219 O O     . VAL C 3 466 ? -18.548 -7.127  -20.358 1.00 49.85 ? 443  VAL A O     1 
ATOM   4220 C CB    . VAL C 3 466 ? -18.178 -6.919  -23.101 1.00 49.85 ? 443  VAL A CB    1 
ATOM   4221 C CG1   . VAL C 3 466 ? -19.690 -6.813  -23.258 1.00 49.85 ? 443  VAL A CG1   1 
ATOM   4222 C CG2   . VAL C 3 466 ? -17.509 -6.847  -24.464 1.00 49.85 ? 443  VAL A CG2   1 
ATOM   4223 N N     . PRO C 3 467 ? -18.116 -4.950  -19.891 1.00 49.85 ? 444  PRO A N     1 
ATOM   4224 C CA    . PRO C 3 467 ? -18.479 -5.098  -18.479 1.00 49.85 ? 444  PRO A CA    1 
ATOM   4225 C C     . PRO C 3 467 ? -19.953 -5.432  -18.240 1.00 49.85 ? 444  PRO A C     1 
ATOM   4226 O O     . PRO C 3 467 ? -20.327 -5.747  -17.110 1.00 49.85 ? 444  PRO A O     1 
ATOM   4227 C CB    . PRO C 3 467 ? -18.134 -3.729  -17.884 1.00 49.85 ? 444  PRO A CB    1 
ATOM   4228 C CG    . PRO C 3 467 ? -18.220 -2.790  -19.026 1.00 49.85 ? 444  PRO A CG    1 
ATOM   4229 C CD    . PRO C 3 467 ? -17.747 -3.558  -20.215 1.00 49.85 ? 444  PRO A CD    1 
ATOM   4230 N N     . GLU C 3 468 ? -20.773 -5.366  -19.290 1.00 49.85 ? 445  GLU A N     1 
ATOM   4231 C CA    . GLU C 3 468 ? -22.187 -5.741  -19.201 1.00 49.85 ? 445  GLU A CA    1 
ATOM   4232 C C     . GLU C 3 468 ? -22.348 -7.210  -18.824 1.00 49.85 ? 445  GLU A C     1 
ATOM   4233 O O     . GLU C 3 468 ? -23.255 -7.569  -18.073 1.00 49.85 ? 445  GLU A O     1 
ATOM   4234 C CB    . GLU C 3 468 ? -22.923 -5.493  -20.524 1.00 49.85 ? 445  GLU A CB    1 
ATOM   4235 C CG    . GLU C 3 468 ? -22.849 -4.079  -21.070 1.00 49.85 ? 445  GLU A CG    1 
ATOM   4236 C CD    . GLU C 3 468 ? -21.712 -3.896  -22.054 1.00 49.85 ? 445  GLU A CD    1 
ATOM   4237 O OE1   . GLU C 3 468 ? -21.989 -3.743  -23.262 1.00 49.85 ? 445  GLU A OE1   1 
ATOM   4238 O OE2   . GLU C 3 468 ? -20.542 -3.907  -21.623 1.00 49.85 ? 445  GLU A OE2   1 
ATOM   4239 N N     . LEU C 3 469 ? -21.458 -8.048  -19.353 1.00 49.85 ? 446  LEU A N     1 
ATOM   4240 C CA    . LEU C 3 469 ? -21.548 -9.498  -19.193 1.00 49.85 ? 446  LEU A CA    1 
ATOM   4241 C C     . LEU C 3 469 ? -20.545 -10.037 -18.170 1.00 49.85 ? 446  LEU A C     1 
ATOM   4242 O O     . LEU C 3 469 ? -20.229 -11.228 -18.173 1.00 49.85 ? 446  LEU A O     1 
ATOM   4243 C CB    . LEU C 3 469 ? -21.343 -10.191 -20.549 1.00 49.85 ? 446  LEU A CB    1 
ATOM   4244 C CG    . LEU C 3 469 ? -22.171 -9.749  -21.763 1.00 49.85 ? 446  LEU A CG    1 
ATOM   4245 C CD1   . LEU C 3 469 ? -21.459 -10.112 -23.056 1.00 49.85 ? 446  LEU A CD1   1 
ATOM   4246 C CD2   . LEU C 3 469 ? -23.571 -10.343 -21.744 1.00 49.85 ? 446  LEU A CD2   1 
ATOM   4247 N N     . SER C 3 470 ? -20.051 -9.161  -17.298 1.00 49.85 ? 447  SER A N     1 
ATOM   4248 C CA    . SER C 3 470 ? -19.007 -9.525  -16.335 1.00 49.85 ? 447  SER A CA    1 
ATOM   4249 C C     . SER C 3 470 ? -19.461 -10.518 -15.258 1.00 49.85 ? 447  SER A C     1 
ATOM   4250 O O     . SER C 3 470 ? -18.628 -11.163 -14.619 1.00 49.85 ? 447  SER A O     1 
ATOM   4251 C CB    . SER C 3 470 ? -18.416 -8.271  -15.684 1.00 49.85 ? 447  SER A CB    1 
ATOM   4252 O OG    . SER C 3 470 ? -19.407 -7.551  -14.974 1.00 49.85 ? 447  SER A OG    1 
ATOM   4253 N N     . LYS C 3 471 ? -20.772 -10.640 -15.062 1.00 49.85 ? 448  LYS A N     1 
ATOM   4254 C CA    . LYS C 3 471 ? -21.317 -11.556 -14.057 1.00 49.85 ? 448  LYS A CA    1 
ATOM   4255 C C     . LYS C 3 471 ? -21.745 -12.906 -14.638 1.00 49.85 ? 448  LYS A C     1 
ATOM   4256 O O     . LYS C 3 471 ? -22.141 -13.809 -13.895 1.00 49.85 ? 448  LYS A O     1 
ATOM   4257 C CB    . LYS C 3 471 ? -22.466 -10.899 -13.286 1.00 49.85 ? 448  LYS A CB    1 
ATOM   4258 C CG    . LYS C 3 471 ? -22.015 -9.815  -12.308 1.00 49.85 ? 448  LYS A CG    1 
ATOM   4259 C CD    . LYS C 3 471 ? -23.164 -9.308  -11.442 1.00 49.85 ? 448  LYS A CD    1 
ATOM   4260 C CE    . LYS C 3 471 ? -23.439 -10.233 -10.259 1.00 49.85 ? 448  LYS A CE    1 
ATOM   4261 N NZ    . LYS C 3 471 ? -24.608 -9.781  -9.452  1.00 49.85 ? 448  LYS A NZ    1 
ATOM   4262 N N     . TYR C 3 472 ? -21.661 -13.034 -15.962 1.00 49.85 ? 449  TYR A N     1 
ATOM   4263 C CA    . TYR C 3 472 ? -21.954 -14.288 -16.661 1.00 49.85 ? 449  TYR A CA    1 
ATOM   4264 C C     . TYR C 3 472 ? -20.924 -15.369 -16.337 1.00 49.85 ? 449  TYR A C     1 
ATOM   4265 O O     . TYR C 3 472 ? -19.741 -15.061 -16.183 1.00 49.85 ? 449  TYR A O     1 
ATOM   4266 C CB    . TYR C 3 472 ? -21.983 -14.058 -18.173 1.00 49.85 ? 449  TYR A CB    1 
ATOM   4267 C CG    . TYR C 3 472 ? -23.346 -13.716 -18.725 1.00 49.85 ? 449  TYR A CG    1 
ATOM   4268 C CD1   . TYR C 3 472 ? -23.886 -12.441 -18.565 1.00 49.85 ? 449  TYR A CD1   1 
ATOM   4269 C CD2   . TYR C 3 472 ? -24.098 -14.670 -19.411 1.00 49.85 ? 449  TYR A CD2   1 
ATOM   4270 C CE1   . TYR C 3 472 ? -25.141 -12.125 -19.073 1.00 49.85 ? 449  TYR A CE1   1 
ATOM   4271 C CE2   . TYR C 3 472 ? -25.353 -14.364 -19.924 1.00 49.85 ? 449  TYR A CE2   1 
ATOM   4272 C CZ    . TYR C 3 472 ? -25.868 -13.090 -19.750 1.00 49.85 ? 449  TYR A CZ    1 
ATOM   4273 O OH    . TYR C 3 472 ? -27.109 -12.776 -20.253 1.00 49.85 ? 449  TYR A OH    1 
ATOM   4274 N N     . PRO C 3 473 ? -21.370 -16.639 -16.233 1.00 49.85 ? 450  PRO A N     1 
ATOM   4275 C CA    . PRO C 3 473 ? -20.447 -17.752 -16.016 1.00 49.85 ? 450  PRO A CA    1 
ATOM   4276 C C     . PRO C 3 473 ? -19.630 -18.024 -17.270 1.00 49.85 ? 450  PRO A C     1 
ATOM   4277 O O     . PRO C 3 473 ? -20.022 -17.611 -18.362 1.00 49.85 ? 450  PRO A O     1 
ATOM   4278 C CB    . PRO C 3 473 ? -21.376 -18.942 -15.731 1.00 49.85 ? 450  PRO A CB    1 
ATOM   4279 C CG    . PRO C 3 473 ? -22.726 -18.361 -15.504 1.00 49.85 ? 450  PRO A CG    1 
ATOM   4280 C CD    . PRO C 3 473 ? -22.762 -17.110 -16.311 1.00 49.85 ? 450  PRO A CD    1 
ATOM   4281 N N     . ALA C 3 474 ? -18.507 -18.716 -17.107 1.00 49.85 ? 451  ALA A N     1 
ATOM   4282 C CA    . ALA C 3 474 ? -17.606 -19.005 -18.219 1.00 49.85 ? 451  ALA A CA    1 
ATOM   4283 C C     . ALA C 3 474 ? -18.210 -19.973 -19.240 1.00 49.85 ? 451  ALA A C     1 
ATOM   4284 O O     . ALA C 3 474 ? -17.759 -20.035 -20.384 1.00 49.85 ? 451  ALA A O     1 
ATOM   4285 C CB    . ALA C 3 474 ? -16.275 -19.528 -17.697 1.00 49.85 ? 451  ALA A CB    1 
ATOM   4286 N N     . GLY C 3 475 ? -19.229 -20.719 -18.820 1.00 49.85 ? 452  GLY A N     1 
ATOM   4287 C CA    . GLY C 3 475 ? -19.880 -21.711 -19.674 1.00 49.85 ? 452  GLY A CA    1 
ATOM   4288 C C     . GLY C 3 475 ? -20.764 -21.147 -20.773 1.00 49.85 ? 452  GLY A C     1 
ATOM   4289 O O     . GLY C 3 475 ? -21.157 -21.871 -21.689 1.00 49.85 ? 452  GLY A O     1 
ATOM   4290 N N     . CYS C 3 476 ? -21.079 -19.857 -20.683 1.00 49.85 ? 453  CYS A N     1 
ATOM   4291 C CA    . CYS C 3 476 ? -21.945 -19.198 -21.660 1.00 49.85 ? 453  CYS A CA    1 
ATOM   4292 C C     . CYS C 3 476 ? -21.662 -17.697 -21.782 1.00 49.85 ? 453  CYS A C     1 
ATOM   4293 O O     . CYS C 3 476 ? -22.555 -16.913 -22.112 1.00 49.85 ? 453  CYS A O     1 
ATOM   4294 C CB    . CYS C 3 476 ? -23.422 -19.444 -21.320 1.00 49.85 ? 453  CYS A CB    1 
ATOM   4295 S SG    . CYS C 3 476 ? -23.901 -18.943 -19.650 1.00 49.85 ? 453  CYS A SG    1 
ATOM   4296 N N     . ILE C 3 477 ? -20.417 -17.305 -21.517 1.00 49.85 ? 454  ILE A N     1 
ATOM   4297 C CA    . ILE C 3 477 ? -20.009 -15.902 -21.623 1.00 49.85 ? 454  ILE A CA    1 
ATOM   4298 C C     . ILE C 3 477 ? -19.626 -15.537 -23.062 1.00 49.85 ? 454  ILE A C     1 
ATOM   4299 O O     . ILE C 3 477 ? -19.812 -14.397 -23.487 1.00 49.85 ? 454  ILE A O     1 
ATOM   4300 C CB    . ILE C 3 477 ? -18.882 -15.542 -20.609 1.00 49.85 ? 454  ILE A CB    1 
ATOM   4301 C CG1   . ILE C 3 477 ? -18.667 -14.024 -20.543 1.00 49.85 ? 454  ILE A CG1   1 
ATOM   4302 C CG2   . ILE C 3 477 ? -17.586 -16.309 -20.914 1.00 49.85 ? 454  ILE A CG2   1 
ATOM   4303 C CD1   . ILE C 3 477 ? -18.024 -13.545 -19.259 1.00 49.85 ? 454  ILE A CD1   1 
ATOM   4304 N N     . TYR C 3 478 ? -19.097 -16.511 -23.800 1.00 49.85 ? 455  TYR A N     1 
ATOM   4305 C CA    . TYR C 3 478 ? -18.817 -16.356 -25.226 1.00 49.85 ? 455  TYR A CA    1 
ATOM   4306 C C     . TYR C 3 478 ? -20.109 -16.492 -26.024 1.00 49.85 ? 455  TYR A C     1 
ATOM   4307 O O     . TYR C 3 478 ? -20.195 -16.046 -27.170 1.00 49.85 ? 455  TYR A O     1 
ATOM   4308 C CB    . TYR C 3 478 ? -17.812 -17.416 -25.693 1.00 49.85 ? 455  TYR A CB    1 
ATOM   4309 C CG    . TYR C 3 478 ? -16.377 -17.135 -25.308 1.00 49.85 ? 455  TYR A CG    1 
ATOM   4310 C CD1   . TYR C 3 478 ? -15.509 -16.509 -26.200 1.00 49.85 ? 455  TYR A CD1   1 
ATOM   4311 C CD2   . TYR C 3 478 ? -15.885 -17.497 -24.055 1.00 49.85 ? 455  TYR A CD2   1 
ATOM   4312 C CE1   . TYR C 3 478 ? -14.188 -16.248 -25.855 1.00 49.85 ? 455  TYR A CE1   1 
ATOM   4313 C CE2   . TYR C 3 478 ? -14.564 -17.240 -23.698 1.00 49.85 ? 455  TYR A CE2   1 
ATOM   4314 C CZ    . TYR C 3 478 ? -13.723 -16.616 -24.604 1.00 49.85 ? 455  TYR A CZ    1 
ATOM   4315 O OH    . TYR C 3 478 ? -12.416 -16.358 -24.260 1.00 49.85 ? 455  TYR A OH    1 
ATOM   4316 N N     . GLU C 3 479 ? -21.107 -17.112 -25.400 1.00 49.85 ? 456  GLU A N     1 
ATOM   4317 C CA    . GLU C 3 479 ? -22.389 -17.401 -26.034 1.00 49.85 ? 456  GLU A CA    1 
ATOM   4318 C C     . GLU C 3 479 ? -23.546 -17.148 -25.056 1.00 49.85 ? 456  GLU A C     1 
ATOM   4319 O O     . GLU C 3 479 ? -24.092 -18.091 -24.476 1.00 49.85 ? 456  GLU A O     1 
ATOM   4320 C CB    . GLU C 3 479 ? -22.398 -18.843 -26.561 1.00 49.85 ? 456  GLU A CB    1 
ATOM   4321 C CG    . GLU C 3 479 ? -21.800 -19.869 -25.592 1.00 49.85 ? 456  GLU A CG    1 
ATOM   4322 C CD    . GLU C 3 479 ? -21.291 -21.124 -26.276 1.00 49.85 ? 456  GLU A CD    1 
ATOM   4323 O OE1   . GLU C 3 479 ? -21.845 -21.514 -27.327 1.00 49.85 ? 456  GLU A OE1   1 
ATOM   4324 O OE2   . GLU C 3 479 ? -20.328 -21.723 -25.752 1.00 49.85 ? 456  GLU A OE2   1 
ATOM   4325 N N     . PRO C 3 480 ? -23.921 -15.866 -24.869 1.00 49.85 ? 457  PRO A N     1 
ATOM   4326 C CA    . PRO C 3 480 ? -24.978 -15.492 -23.926 1.00 49.85 ? 457  PRO A CA    1 
ATOM   4327 C C     . PRO C 3 480 ? -26.355 -16.017 -24.324 1.00 49.85 ? 457  PRO A C     1 
ATOM   4328 O O     . PRO C 3 480 ? -27.182 -16.298 -23.451 1.00 49.85 ? 457  PRO A O     1 
ATOM   4329 C CB    . PRO C 3 480 ? -24.970 -13.958 -23.973 1.00 49.85 ? 457  PRO A CB    1 
ATOM   4330 C CG    . PRO C 3 480 ? -23.669 -13.587 -24.585 1.00 49.85 ? 457  PRO A CG    1 
ATOM   4331 C CD    . PRO C 3 480 ? -23.360 -14.682 -25.541 1.00 49.85 ? 457  PRO A CD    1 
ATOM   4332 N N     . TRP C 3 481 ? -26.589 -16.147 -25.629 1.00 49.85 ? 458  TRP A N     1 
ATOM   4333 C CA    . TRP C 3 481 ? -27.870 -16.617 -26.161 1.00 49.85 ? 458  TRP A CA    1 
ATOM   4334 C C     . TRP C 3 481 ? -28.219 -18.045 -25.727 1.00 49.85 ? 458  TRP A C     1 
ATOM   4335 O O     . TRP C 3 481 ? -29.342 -18.507 -25.938 1.00 49.85 ? 458  TRP A O     1 
ATOM   4336 C CB    . TRP C 3 481 ? -27.899 -16.490 -27.690 1.00 49.85 ? 458  TRP A CB    1 
ATOM   4337 C CG    . TRP C 3 481 ? -26.799 -17.235 -28.388 1.00 49.85 ? 458  TRP A CG    1 
ATOM   4338 C CD1   . TRP C 3 481 ? -26.822 -18.537 -28.800 1.00 49.85 ? 458  TRP A CD1   1 
ATOM   4339 C CD2   . TRP C 3 481 ? -25.513 -16.721 -28.757 1.00 49.85 ? 458  TRP A CD2   1 
ATOM   4340 N NE1   . TRP C 3 481 ? -25.632 -18.866 -29.402 1.00 49.85 ? 458  TRP A NE1   1 
ATOM   4341 C CE2   . TRP C 3 481 ? -24.810 -17.771 -29.389 1.00 49.85 ? 458  TRP A CE2   1 
ATOM   4342 C CE3   . TRP C 3 481 ? -24.887 -15.477 -28.615 1.00 49.85 ? 458  TRP A CE3   1 
ATOM   4343 C CZ2   . TRP C 3 481 ? -23.511 -17.614 -29.879 1.00 49.85 ? 458  TRP A CZ2   1 
ATOM   4344 C CZ3   . TRP C 3 481 ? -23.593 -15.322 -29.103 1.00 49.85 ? 458  TRP A CZ3   1 
ATOM   4345 C CH2   . TRP C 3 481 ? -22.921 -16.386 -29.727 1.00 49.85 ? 458  TRP A CH2   1 
ATOM   4346 N N     . LYS C 3 482 ? -27.253 -18.733 -25.122 1.00 49.85 ? 459  LYS A N     1 
ATOM   4347 C CA    . LYS C 3 482 ? -27.453 -20.090 -24.617 1.00 49.85 ? 459  LYS A CA    1 
ATOM   4348 C C     . LYS C 3 482 ? -28.202 -20.098 -23.284 1.00 49.85 ? 459  LYS A C     1 
ATOM   4349 O O     . LYS C 3 482 ? -28.978 -21.016 -23.008 1.00 49.85 ? 459  LYS A O     1 
ATOM   4350 C CB    . LYS C 3 482 ? -26.109 -20.814 -24.467 1.00 49.85 ? 459  LYS A CB    1 
ATOM   4351 C CG    . LYS C 3 482 ? -25.389 -21.122 -25.779 1.00 49.85 ? 459  LYS A CG    1 
ATOM   4352 C CD    . LYS C 3 482 ? -25.777 -22.485 -26.341 1.00 49.85 ? 459  LYS A CD    1 
ATOM   4353 C CE    . LYS C 3 482 ? -24.895 -22.861 -27.526 1.00 49.85 ? 459  LYS A CE    1 
ATOM   4354 N NZ    . LYS C 3 482 ? -25.164 -24.238 -28.031 1.00 49.85 ? 459  LYS A NZ    1 
ATOM   4355 N N     . ALA C 3 483 ? -27.965 -19.075 -22.466 1.00 49.85 ? 460  ALA A N     1 
ATOM   4356 C CA    . ALA C 3 483 ? -28.579 -18.973 -21.141 1.00 49.85 ? 460  ALA A CA    1 
ATOM   4357 C C     . ALA C 3 483 ? -30.031 -18.508 -21.211 1.00 49.85 ? 460  ALA A C     1 
ATOM   4358 O O     . ALA C 3 483 ? -30.383 -17.665 -22.038 1.00 49.85 ? 460  ALA A O     1 
ATOM   4359 C CB    . ALA C 3 483 ? -27.766 -18.045 -20.250 1.00 49.85 ? 460  ALA A CB    1 
ATOM   4360 N N     . SER C 3 484 ? -30.862 -19.067 -20.334 1.00 49.85 ? 461  SER A N     1 
ATOM   4361 C CA    . SER C 3 484 ? -32.279 -18.711 -20.244 1.00 49.85 ? 461  SER A CA    1 
ATOM   4362 C C     . SER C 3 484 ? -32.471 -17.287 -19.721 1.00 49.85 ? 461  SER A C     1 
ATOM   4363 O O     . SER C 3 484 ? -31.566 -16.720 -19.103 1.00 49.85 ? 461  SER A O     1 
ATOM   4364 C CB    . SER C 3 484 ? -33.012 -19.698 -19.335 1.00 49.85 ? 461  SER A CB    1 
ATOM   4365 O OG    . SER C 3 484 ? -32.401 -19.754 -18.057 1.00 49.85 ? 461  SER A OG    1 
ATOM   4366 N N     . LEU C 3 485 ? -33.652 -16.719 -19.973 1.00 49.85 ? 462  LEU A N     1 
ATOM   4367 C CA    . LEU C 3 485 ? -33.985 -15.365 -19.517 1.00 49.85 ? 462  LEU A CA    1 
ATOM   4368 C C     . LEU C 3 485 ? -33.878 -15.231 -17.998 1.00 49.85 ? 462  LEU A C     1 
ATOM   4369 O O     . LEU C 3 485 ? -33.309 -14.259 -17.496 1.00 49.85 ? 462  LEU A O     1 
ATOM   4370 C CB    . LEU C 3 485 ? -35.388 -14.959 -19.988 1.00 49.85 ? 462  LEU A CB    1 
ATOM   4371 C CG    . LEU C 3 485 ? -35.899 -13.566 -19.597 1.00 49.85 ? 462  LEU A CG    1 
ATOM   4372 C CD1   . LEU C 3 485 ? -35.357 -12.487 -20.529 1.00 49.85 ? 462  LEU A CD1   1 
ATOM   4373 C CD2   . LEU C 3 485 ? -37.417 -13.539 -19.582 1.00 49.85 ? 462  LEU A CD2   1 
ATOM   4374 N N     . VAL C 3 486 ? -34.426 -16.210 -17.279 1.00 49.85 ? 463  VAL A N     1 
ATOM   4375 C CA    . VAL C 3 486 ? -34.362 -16.238 -15.813 1.00 49.85 ? 463  VAL A CA    1 
ATOM   4376 C C     . VAL C 3 486 ? -32.919 -16.202 -15.300 1.00 49.85 ? 463  VAL A C     1 
ATOM   4377 O O     . VAL C 3 486 ? -32.660 -15.704 -14.202 1.00 49.85 ? 463  VAL A O     1 
ATOM   4378 C CB    . VAL C 3 486 ? -35.137 -17.445 -15.200 1.00 49.85 ? 463  VAL A CB    1 
ATOM   4379 C CG1   . VAL C 3 486 ? -36.642 -17.235 -15.319 1.00 49.85 ? 463  VAL A CG1   1 
ATOM   4380 C CG2   . VAL C 3 486 ? -34.721 -18.769 -15.843 1.00 49.85 ? 463  VAL A CG2   1 
ATOM   4381 N N     . ASP C 3 487 ? -31.992 -16.727 -16.101 1.00 49.85 ? 464  ASP A N     1 
ATOM   4382 C CA    . ASP C 3 487 ? -30.563 -16.653 -15.802 1.00 49.85 ? 464  ASP A CA    1 
ATOM   4383 C C     . ASP C 3 487 ? -29.973 -15.296 -16.183 1.00 49.85 ? 464  ASP A C     1 
ATOM   4384 O O     . ASP C 3 487 ? -29.150 -14.752 -15.447 1.00 49.85 ? 464  ASP A O     1 
ATOM   4385 C CB    . ASP C 3 487 ? -29.795 -17.783 -16.497 1.00 49.85 ? 464  ASP A CB    1 
ATOM   4386 C CG    . ASP C 3 487 ? -29.874 -19.102 -15.743 1.00 49.85 ? 464  ASP A CG    1 
ATOM   4387 O OD1   . ASP C 3 487 ? -30.010 -19.084 -14.499 1.00 49.85 ? 464  ASP A OD1   1 
ATOM   4388 O OD2   . ASP C 3 487 ? -29.797 -20.162 -16.403 1.00 49.85 ? 464  ASP A OD2   1 
ATOM   4389 N N     . GLN C 3 488 ? -30.397 -14.759 -17.328 1.00 49.85 ? 465  GLN A N     1 
ATOM   4390 C CA    . GLN C 3 488 ? -29.951 -13.440 -17.793 1.00 49.85 ? 465  GLN A CA    1 
ATOM   4391 C C     . GLN C 3 488 ? -30.202 -12.364 -16.738 1.00 49.85 ? 465  GLN A C     1 
ATOM   4392 O O     . GLN C 3 488 ? -29.335 -11.526 -16.473 1.00 49.85 ? 465  GLN A O     1 
ATOM   4393 C CB    . GLN C 3 488 ? -30.660 -13.050 -19.092 1.00 49.85 ? 465  GLN A CB    1 
ATOM   4394 C CG    . GLN C 3 488 ? -30.298 -13.886 -20.303 1.00 49.85 ? 465  GLN A CG    1 
ATOM   4395 C CD    . GLN C 3 488 ? -31.137 -13.535 -21.518 1.00 49.85 ? 465  GLN A CD    1 
ATOM   4396 O OE1   . GLN C 3 488 ? -31.266 -12.365 -21.883 1.00 49.85 ? 465  GLN A OE1   1 
ATOM   4397 N NE2   . GLN C 3 488 ? -31.713 -14.550 -22.152 1.00 49.85 ? 465  GLN A NE2   1 
ATOM   4398 N N     . ARG C 3 489 ? -31.396 -12.402 -16.145 1.00 49.85 ? 466  ARG A N     1 
ATOM   4399 C CA    . ARG C 3 489 ? -31.773 -11.487 -15.073 1.00 49.85 ? 466  ARG A CA    1 
ATOM   4400 C C     . ARG C 3 489 ? -30.880 -11.691 -13.854 1.00 49.85 ? 466  ARG A C     1 
ATOM   4401 O O     . ARG C 3 489 ? -30.508 -10.727 -13.184 1.00 49.85 ? 466  ARG A O     1 
ATOM   4402 C CB    . ARG C 3 489 ? -33.241 -11.685 -14.681 1.00 49.85 ? 466  ARG A CB    1 
ATOM   4403 C CG    . ARG C 3 489 ? -34.242 -11.396 -15.790 1.00 49.85 ? 466  ARG A CG    1 
ATOM   4404 C CD    . ARG C 3 489 ? -35.665 -11.681 -15.333 1.00 49.85 ? 466  ARG A CD    1 
ATOM   4405 N NE    . ARG C 3 489 ? -36.626 -11.587 -16.432 1.00 49.85 ? 466  ARG A NE    1 
ATOM   4406 C CZ    . ARG C 3 489 ? -37.257 -10.472 -16.798 1.00 49.85 ? 466  ARG A CZ    1 
ATOM   4407 N NH1   . ARG C 3 489 ? -37.040 -9.330  -16.157 1.00 49.85 ? 466  ARG A NH1   1 
ATOM   4408 N NH2   . ARG C 3 489 ? -38.112 -10.498 -17.812 1.00 49.85 ? 466  ARG A NH2   1 
ATOM   4409 N N     . ALA C 3 490 ? -30.540 -12.948 -13.578 1.00 49.85 ? 467  ALA A N     1 
ATOM   4410 C CA    . ALA C 3 490 ? -29.712 -13.300 -12.427 1.00 49.85 ? 467  ALA A CA    1 
ATOM   4411 C C     . ALA C 3 490 ? -28.250 -12.881 -12.594 1.00 49.85 ? 467  ALA A C     1 
ATOM   4412 O O     . ALA C 3 490 ? -27.528 -12.739 -11.604 1.00 49.85 ? 467  ALA A O     1 
ATOM   4413 C CB    . ALA C 3 490 ? -29.813 -14.790 -12.134 1.00 49.85 ? 467  ALA A CB    1 
ATOM   4414 N N     . TYR C 3 491 ? -27.818 -12.683 -13.839 1.00 49.85 ? 468  TYR A N     1 
ATOM   4415 C CA    . TYR C 3 491 ? -26.460 -12.202 -14.116 1.00 49.85 ? 468  TYR A CA    1 
ATOM   4416 C C     . TYR C 3 491 ? -26.424 -10.683 -14.291 1.00 49.85 ? 468  TYR A C     1 
ATOM   4417 O O     . TYR C 3 491 ? -25.372 -10.108 -14.583 1.00 49.85 ? 468  TYR A O     1 
ATOM   4418 C CB    . TYR C 3 491 ? -25.856 -12.893 -15.347 1.00 49.85 ? 468  TYR A CB    1 
ATOM   4419 C CG    . TYR C 3 491 ? -25.934 -14.407 -15.346 1.00 49.85 ? 468  TYR A CG    1 
ATOM   4420 C CD1   . TYR C 3 491 ? -25.705 -15.145 -14.182 1.00 49.85 ? 468  TYR A CD1   1 
ATOM   4421 C CD2   . TYR C 3 491 ? -26.232 -15.101 -16.518 1.00 49.85 ? 468  TYR A CD2   1 
ATOM   4422 C CE1   . TYR C 3 491 ? -25.778 -16.535 -14.188 1.00 49.85 ? 468  TYR A CE1   1 
ATOM   4423 C CE2   . TYR C 3 491 ? -26.307 -16.491 -16.534 1.00 49.85 ? 468  TYR A CE2   1 
ATOM   4424 C CZ    . TYR C 3 491 ? -26.079 -17.200 -15.367 1.00 49.85 ? 468  TYR A CZ    1 
ATOM   4425 O OH    . TYR C 3 491 ? -26.151 -18.573 -15.381 1.00 49.85 ? 468  TYR A OH    1 
ATOM   4426 N N     . GLY C 3 492 ? -27.579 -10.045 -14.111 1.00 49.85 ? 469  GLY A N     1 
ATOM   4427 C CA    . GLY C 3 492 ? -27.701 -8.590  -14.195 1.00 49.85 ? 469  GLY A CA    1 
ATOM   4428 C C     . GLY C 3 492 ? -27.551 -8.039  -15.601 1.00 49.85 ? 469  GLY A C     1 
ATOM   4429 O O     . GLY C 3 492 ? -27.192 -6.874  -15.783 1.00 49.85 ? 469  GLY A O     1 
ATOM   4430 N N     . CYS C 3 493 ? -27.828 -8.879  -16.595 1.00 49.85 ? 470  CYS A N     1 
ATOM   4431 C CA    . CYS C 3 493 ? -27.695 -8.487  -17.992 1.00 49.85 ? 470  CYS A CA    1 
ATOM   4432 C C     . CYS C 3 493 ? -28.691 -9.232  -18.874 1.00 49.85 ? 470  CYS A C     1 
ATOM   4433 O O     . CYS C 3 493 ? -28.554 -10.435 -19.105 1.00 49.85 ? 470  CYS A O     1 
ATOM   4434 C CB    . CYS C 3 493 ? -26.266 -8.728  -18.480 1.00 49.85 ? 470  CYS A CB    1 
ATOM   4435 S SG    . CYS C 3 493 ? -25.917 -8.055  -20.114 1.00 49.85 ? 470  CYS A SG    1 
ATOM   4436 N N     . VAL C 3 494 ? -29.691 -8.504  -19.362 1.00 49.85 ? 471  VAL A N     1 
ATOM   4437 C CA    . VAL C 3 494 ? -30.700 -9.073  -20.253 1.00 49.85 ? 471  VAL A CA    1 
ATOM   4438 C C     . VAL C 3 494 ? -30.378 -8.742  -21.712 1.00 49.85 ? 471  VAL A C     1 
ATOM   4439 O O     . VAL C 3 494 ? -30.035 -7.602  -22.040 1.00 49.85 ? 471  VAL A O     1 
ATOM   4440 C CB    . VAL C 3 494 ? -32.148 -8.633  -19.856 1.00 49.85 ? 471  VAL A CB    1 
ATOM   4441 C CG1   . VAL C 3 494 ? -32.317 -7.108  -19.916 1.00 49.85 ? 471  VAL A CG1   1 
ATOM   4442 C CG2   . VAL C 3 494 ? -33.198 -9.343  -20.714 1.00 49.85 ? 471  VAL A CG2   1 
ATOM   4443 N N     . LEU C 3 495 ? -30.490 -9.748  -22.576 1.00 49.85 ? 472  LEU A N     1 
ATOM   4444 C CA    . LEU C 3 495 ? -30.196 -9.588  -23.999 1.00 49.85 ? 472  LEU A CA    1 
ATOM   4445 C C     . LEU C 3 495 ? -31.267 -8.762  -24.709 1.00 49.85 ? 472  LEU A C     1 
ATOM   4446 O O     . LEU C 3 495 ? -32.464 -8.946  -24.477 1.00 49.85 ? 472  LEU A O     1 
ATOM   4447 C CB    . LEU C 3 495 ? -30.023 -10.952 -24.677 1.00 49.85 ? 472  LEU A CB    1 
ATOM   4448 C CG    . LEU C 3 495 ? -28.835 -11.812 -24.224 1.00 49.85 ? 472  LEU A CG    1 
ATOM   4449 C CD1   . LEU C 3 495 ? -29.022 -13.263 -24.646 1.00 49.85 ? 472  LEU A CD1   1 
ATOM   4450 C CD2   . LEU C 3 495 ? -27.512 -11.266 -24.748 1.00 49.85 ? 472  LEU A CD2   1 
ATOM   4451 N N     . GLY C 3 496 ? -30.822 -7.852  -25.572 1.00 49.85 ? 473  GLY A N     1 
ATOM   4452 C CA    . GLY C 3 496 ? -31.719 -6.941  -26.275 1.00 49.85 ? 473  GLY A CA    1 
ATOM   4453 C C     . GLY C 3 496 ? -31.706 -5.542  -25.692 1.00 49.85 ? 473  GLY A C     1 
ATOM   4454 O O     . GLY C 3 496 ? -31.874 -4.560  -26.416 1.00 49.85 ? 473  GLY A O     1 
ATOM   4455 N N     . THR C 3 497 ? -31.505 -5.456  -24.379 1.00 49.85 ? 474  THR A N     1 
ATOM   4456 C CA    . THR C 3 497 ? -31.446 -4.174  -23.683 1.00 49.85 ? 474  THR A CA    1 
ATOM   4457 C C     . THR C 3 497 ? -30.009 -3.868  -23.267 1.00 49.85 ? 474  THR A C     1 
ATOM   4458 O O     . THR C 3 497 ? -29.383 -2.948  -23.798 1.00 49.85 ? 474  THR A O     1 
ATOM   4459 C CB    . THR C 3 497 ? -32.367 -4.156  -22.436 1.00 49.85 ? 474  THR A CB    1 
ATOM   4460 O OG1   . THR C 3 497 ? -33.628 -4.759  -22.752 1.00 49.85 ? 474  THR A OG1   1 
ATOM   4461 C CG2   . THR C 3 497 ? -32.595 -2.726  -21.948 1.00 49.85 ? 474  THR A CG2   1 
ATOM   4462 N N     . ASP C 3 498 ? -29.499 -4.649  -22.318 1.00 49.85 ? 475  ASP A N     1 
ATOM   4463 C CA    . ASP C 3 498 ? -28.168 -4.437  -21.754 1.00 49.85 ? 475  ASP A CA    1 
ATOM   4464 C C     . ASP C 3 498 ? -27.065 -4.898  -22.704 1.00 49.85 ? 475  ASP A C     1 
ATOM   4465 O O     . ASP C 3 498 ? -25.946 -4.381  -22.664 1.00 49.85 ? 475  ASP A O     1 
ATOM   4466 C CB    . ASP C 3 498 ? -28.040 -5.154  -20.405 1.00 49.85 ? 475  ASP A CB    1 
ATOM   4467 C CG    . ASP C 3 498 ? -29.185 -4.832  -19.452 1.00 49.85 ? 475  ASP A CG    1 
ATOM   4468 O OD1   . ASP C 3 498 ? -29.734 -3.710  -19.517 1.00 49.85 ? 475  ASP A OD1   1 
ATOM   4469 O OD2   . ASP C 3 498 ? -29.537 -5.707  -18.633 1.00 49.85 ? 475  ASP A OD2   1 
ATOM   4470 N N     . TYR C 3 499 ? -27.389 -5.871  -23.553 1.00 49.85 ? 476  TYR A N     1 
ATOM   4471 C CA    . TYR C 3 499 ? -26.453 -6.389  -24.546 1.00 49.85 ? 476  TYR A CA    1 
ATOM   4472 C C     . TYR C 3 499 ? -27.197 -6.869  -25.798 1.00 49.85 ? 476  TYR A C     1 
ATOM   4473 O O     . TYR C 3 499 ? -28.129 -7.667  -25.693 1.00 49.85 ? 476  TYR A O     1 
ATOM   4474 C CB    . TYR C 3 499 ? -25.605 -7.516  -23.946 1.00 49.85 ? 476  TYR A CB    1 
ATOM   4475 C CG    . TYR C 3 499 ? -24.486 -7.987  -24.845 1.00 49.85 ? 476  TYR A CG    1 
ATOM   4476 C CD1   . TYR C 3 499 ? -23.311 -7.248  -24.973 1.00 49.85 ? 476  TYR A CD1   1 
ATOM   4477 C CD2   . TYR C 3 499 ? -24.602 -9.172  -25.568 1.00 49.85 ? 476  TYR A CD2   1 
ATOM   4478 C CE1   . TYR C 3 499 ? -22.282 -7.676  -25.798 1.00 49.85 ? 476  TYR A CE1   1 
ATOM   4479 C CE2   . TYR C 3 499 ? -23.580 -9.610  -26.395 1.00 49.85 ? 476  TYR A CE2   1 
ATOM   4480 C CZ    . TYR C 3 499 ? -22.424 -8.857  -26.504 1.00 49.85 ? 476  TYR A CZ    1 
ATOM   4481 O OH    . TYR C 3 499 ? -21.411 -9.287  -27.322 1.00 49.85 ? 476  TYR A OH    1 
ATOM   4482 N N     . PRO C 3 500 ? -26.784 -6.382  -26.987 1.00 49.85 ? 477  PRO A N     1 
ATOM   4483 C CA    . PRO C 3 500 ? -27.435 -6.694  -28.266 1.00 49.85 ? 477  PRO A CA    1 
ATOM   4484 C C     . PRO C 3 500 ? -27.507 -8.188  -28.581 1.00 49.85 ? 477  PRO A C     1 
ATOM   4485 O O     . PRO C 3 500 ? -26.618 -8.946  -28.190 1.00 49.85 ? 477  PRO A O     1 
ATOM   4486 C CB    . PRO C 3 500 ? -26.532 -6.002  -29.292 1.00 49.85 ? 477  PRO A CB    1 
ATOM   4487 C CG    . PRO C 3 500 ? -25.863 -4.918  -28.537 1.00 49.85 ? 477  PRO A CG    1 
ATOM   4488 C CD    . PRO C 3 500 ? -25.637 -5.475  -27.171 1.00 49.85 ? 477  PRO A CD    1 
ATOM   4489 N N     . HIS C 3 501 ? -28.566 -8.593  -29.284 1.00 49.85 ? 478  HIS A N     1 
ATOM   4490 C CA    . HIS C 3 501 ? -28.699 -9.960  -29.792 1.00 49.85 ? 478  HIS A CA    1 
ATOM   4491 C C     . HIS C 3 501 ? -27.658 -10.174 -30.881 1.00 49.85 ? 478  HIS A C     1 
ATOM   4492 O O     . HIS C 3 501 ? -27.314 -9.228  -31.597 1.00 49.85 ? 478  HIS A O     1 
ATOM   4493 C CB    . HIS C 3 501 ? -30.090 -10.193 -30.390 1.00 49.85 ? 478  HIS A CB    1 
ATOM   4494 C CG    . HIS C 3 501 ? -31.220 -9.895  -29.454 1.00 49.85 ? 478  HIS A CG    1 
ATOM   4495 N ND1   . HIS C 3 501 ? -31.494 -10.666 -28.345 1.00 49.85 ? 478  HIS A ND1   1 
ATOM   4496 C CD2   . HIS C 3 501 ? -32.150 -8.911  -29.465 1.00 49.85 ? 478  HIS A CD2   1 
ATOM   4497 C CE1   . HIS C 3 501 ? -32.541 -10.170 -27.712 1.00 49.85 ? 478  HIS A CE1   1 
ATOM   4498 N NE2   . HIS C 3 501 ? -32.959 -9.104  -28.372 1.00 49.85 ? 478  HIS A NE2   1 
ATOM   4499 N N     . ARG C 3 502 ? -27.158 -11.404 -31.009 1.00 49.85 ? 479  ARG A N     1 
ATOM   4500 C CA    . ARG C 3 502 ? -26.174 -11.715 -32.051 1.00 49.85 ? 479  ARG A CA    1 
ATOM   4501 C C     . ARG C 3 502 ? -26.761 -11.491 -33.451 1.00 49.85 ? 479  ARG A C     1 
ATOM   4502 O O     . ARG C 3 502 ? -27.722 -12.154 -33.850 1.00 49.85 ? 479  ARG A O     1 
ATOM   4503 C CB    . ARG C 3 502 ? -25.554 -13.113 -31.878 1.00 49.85 ? 479  ARG A CB    1 
ATOM   4504 C CG    . ARG C 3 502 ? -26.511 -14.294 -31.945 1.00 49.85 ? 479  ARG A CG    1 
ATOM   4505 C CD    . ARG C 3 502 ? -25.745 -15.575 -32.226 1.00 49.85 ? 479  ARG A CD    1 
ATOM   4506 N NE    . ARG C 3 502 ? -26.629 -16.726 -32.397 1.00 49.85 ? 479  ARG A NE    1 
ATOM   4507 C CZ    . ARG C 3 502 ? -26.228 -17.941 -32.766 1.00 49.85 ? 479  ARG A CZ    1 
ATOM   4508 N NH1   . ARG C 3 502 ? -24.947 -18.187 -33.010 1.00 49.85 ? 479  ARG A NH1   1 
ATOM   4509 N NH2   . ARG C 3 502 ? -27.115 -18.918 -32.891 1.00 49.85 ? 479  ARG A NH2   1 
ATOM   4510 N N     . ILE C 3 503 ? -26.169 -10.547 -34.180 1.00 49.85 ? 480  ILE A N     1 
ATOM   4511 C CA    . ILE C 3 503 ? -26.715 -10.069 -35.458 1.00 49.85 ? 480  ILE A CA    1 
ATOM   4512 C C     . ILE C 3 503 ? -26.808 -11.146 -36.544 1.00 49.85 ? 480  ILE A C     1 
ATOM   4513 O O     . ILE C 3 503 ? -27.713 -11.110 -37.382 1.00 49.85 ? 480  ILE A O     1 
ATOM   4514 C CB    . ILE C 3 503 ? -25.957 -8.820  -35.988 1.00 49.85 ? 480  ILE A CB    1 
ATOM   4515 C CG1   . ILE C 3 503 ? -24.438 -9.044  -35.965 1.00 49.85 ? 480  ILE A CG1   1 
ATOM   4516 C CG2   . ILE C 3 503 ? -26.355 -7.582  -35.184 1.00 49.85 ? 480  ILE A CG2   1 
ATOM   4517 C CD1   . ILE C 3 503 ? -23.619 -7.912  -36.564 1.00 49.85 ? 480  ILE A CD1   1 
ATOM   4518 N N     . VAL C 3 504 ? -25.873 -12.093 -36.521 1.00 49.85 ? 481  VAL A N     1 
ATOM   4519 C CA    . VAL C 3 504 ? -25.895 -13.244 -37.424 1.00 49.85 ? 481  VAL A CA    1 
ATOM   4520 C C     . VAL C 3 504 ? -25.647 -14.536 -36.646 1.00 49.85 ? 481  VAL A C     1 
ATOM   4521 O O     . VAL C 3 504 ? -25.153 -14.504 -35.518 1.00 49.85 ? 481  VAL A O     1 
ATOM   4522 C CB    . VAL C 3 504 ? -24.861 -13.114 -38.577 1.00 49.85 ? 481  VAL A CB    1 
ATOM   4523 C CG1   . VAL C 3 504 ? -25.287 -12.041 -39.576 1.00 49.85 ? 481  VAL A CG1   1 
ATOM   4524 C CG2   . VAL C 3 504 ? -23.463 -12.833 -38.035 1.00 49.85 ? 481  VAL A CG2   1 
ATOM   4525 N N     . LYS C 3 505 ? -25.995 -15.668 -37.250 1.00 49.85 ? 482  LYS A N     1 
ATOM   4526 C CA    . LYS C 3 505 ? -25.741 -16.971 -36.640 1.00 49.85 ? 482  LYS A CA    1 
ATOM   4527 C C     . LYS C 3 505 ? -24.552 -17.651 -37.319 1.00 49.85 ? 482  LYS A C     1 
ATOM   4528 O O     . LYS C 3 505 ? -24.671 -18.167 -38.434 1.00 49.85 ? 482  LYS A O     1 
ATOM   4529 C CB    . LYS C 3 505 ? -26.997 -17.852 -36.681 1.00 49.85 ? 482  LYS A CB    1 
ATOM   4530 C CG    . LYS C 3 505 ? -28.144 -17.334 -35.814 1.00 49.85 ? 482  LYS A CG    1 
ATOM   4531 C CD    . LYS C 3 505 ? -29.246 -18.371 -35.628 1.00 49.85 ? 482  LYS A CD    1 
ATOM   4532 C CE    . LYS C 3 505 ? -30.255 -18.349 -36.767 1.00 49.85 ? 482  LYS A CE    1 
ATOM   4533 N NZ    . LYS C 3 505 ? -31.384 -19.286 -36.510 1.00 49.85 ? 482  LYS A NZ    1 
ATOM   4534 N N     . HIS C 3 506 ? -23.412 -17.638 -36.629 1.00 49.85 ? 483  HIS A N     1 
ATOM   4535 C CA    . HIS C 3 506 ? -22.134 -18.111 -37.172 1.00 49.85 ? 483  HIS A CA    1 
ATOM   4536 C C     . HIS C 3 506 ? -22.202 -19.507 -37.786 1.00 49.85 ? 483  HIS A C     1 
ATOM   4537 O O     . HIS C 3 506 ? -21.789 -19.701 -38.931 1.00 49.85 ? 483  HIS A O     1 
ATOM   4538 C CB    . HIS C 3 506 ? -21.035 -18.047 -36.102 1.00 49.85 ? 483  HIS A CB    1 
ATOM   4539 C CG    . HIS C 3 506 ? -19.694 -18.512 -36.581 1.00 49.85 ? 483  HIS A CG    1 
ATOM   4540 N ND1   . HIS C 3 506 ? -18.955 -17.820 -37.517 1.00 49.85 ? 483  HIS A ND1   1 
ATOM   4541 C CD2   . HIS C 3 506 ? -18.958 -19.600 -36.251 1.00 49.85 ? 483  HIS A CD2   1 
ATOM   4542 C CE1   . HIS C 3 506 ? -17.823 -18.462 -37.744 1.00 49.85 ? 483  HIS A CE1   1 
ATOM   4543 N NE2   . HIS C 3 506 ? -17.800 -19.545 -36.988 1.00 49.85 ? 483  HIS A NE2   1 
ATOM   4544 N N     . GLU C 3 507 ? -22.727 -20.465 -37.022 1.00 49.85 ? 484  GLU A N     1 
ATOM   4545 C CA    . GLU C 3 507 ? -22.828 -21.863 -37.455 1.00 49.85 ? 484  GLU A CA    1 
ATOM   4546 C C     . GLU C 3 507 ? -23.645 -22.045 -38.740 1.00 49.85 ? 484  GLU A C     1 
ATOM   4547 O O     . GLU C 3 507 ? -23.597 -23.104 -39.369 1.00 49.85 ? 484  GLU A O     1 
ATOM   4548 C CB    . GLU C 3 507 ? -23.387 -22.745 -36.328 1.00 49.85 ? 484  GLU A CB    1 
ATOM   4549 C CG    . GLU C 3 507 ? -24.857 -22.504 -35.964 1.00 49.85 ? 484  GLU A CG    1 
ATOM   4550 C CD    . GLU C 3 507 ? -25.056 -21.360 -34.982 1.00 49.85 ? 484  GLU A CD    1 
ATOM   4551 O OE1   . GLU C 3 507 ? -24.892 -20.186 -35.379 1.00 49.85 ? 484  GLU A OE1   1 
ATOM   4552 O OE2   . GLU C 3 507 ? -25.381 -21.637 -33.809 1.00 49.85 ? 484  GLU A OE2   1 
ATOM   4553 N N     . VAL C 3 508 ? -24.388 -21.007 -39.116 1.00 49.85 ? 485  VAL A N     1 
ATOM   4554 C CA    . VAL C 3 508 ? -25.177 -21.016 -40.342 1.00 49.85 ? 485  VAL A CA    1 
ATOM   4555 C C     . VAL C 3 508 ? -24.486 -20.204 -41.438 1.00 49.85 ? 485  VAL A C     1 
ATOM   4556 O O     . VAL C 3 508 ? -24.270 -20.708 -42.540 1.00 49.85 ? 485  VAL A O     1 
ATOM   4557 C CB    . VAL C 3 508 ? -26.621 -20.489 -40.103 1.00 49.85 ? 485  VAL A CB    1 
ATOM   4558 C CG1   . VAL C 3 508 ? -27.384 -20.356 -41.419 1.00 49.85 ? 485  VAL A CG1   1 
ATOM   4559 C CG2   . VAL C 3 508 ? -27.377 -21.401 -39.140 1.00 49.85 ? 485  VAL A CG2   1 
ATOM   4560 N N     . VAL C 3 509 ? -24.139 -18.955 -41.127 1.00 49.85 ? 486  VAL A N     1 
ATOM   4561 C CA    . VAL C 3 509 ? -23.641 -18.008 -42.135 1.00 49.85 ? 486  VAL A CA    1 
ATOM   4562 C C     . VAL C 3 509 ? -22.271 -18.355 -42.723 1.00 49.85 ? 486  VAL A C     1 
ATOM   4563 O O     . VAL C 3 509 ? -22.031 -18.109 -43.905 1.00 49.85 ? 486  VAL A O     1 
ATOM   4564 C CB    . VAL C 3 509 ? -23.650 -16.527 -41.639 1.00 49.85 ? 486  VAL A CB    1 
ATOM   4565 C CG1   . VAL C 3 509 ? -25.075 -16.047 -41.386 1.00 49.85 ? 486  VAL A CG1   1 
ATOM   4566 C CG2   . VAL C 3 509 ? -22.781 -16.340 -40.397 1.00 49.85 ? 486  VAL A CG2   1 
ATOM   4567 N N     . HIS C 3 510 ? -21.383 -18.922 -41.910 1.00 49.85 ? 487  HIS A N     1 
ATOM   4568 C CA    . HIS C 3 510 ? -20.009 -19.172 -42.351 1.00 49.85 ? 487  HIS A CA    1 
ATOM   4569 C C     . HIS C 3 510 ? -19.914 -20.276 -43.407 1.00 49.85 ? 487  HIS A C     1 
ATOM   4570 O O     . HIS C 3 510 ? -19.036 -20.236 -44.269 1.00 49.85 ? 487  HIS A O     1 
ATOM   4571 C CB    . HIS C 3 510 ? -19.067 -19.423 -41.163 1.00 49.85 ? 487  HIS A CB    1 
ATOM   4572 C CG    . HIS C 3 510 ? -19.011 -20.848 -40.710 1.00 49.85 ? 487  HIS A CG    1 
ATOM   4573 N ND1   . HIS C 3 510 ? -20.006 -21.431 -39.955 1.00 49.85 ? 487  HIS A ND1   1 
ATOM   4574 C CD2   . HIS C 3 510 ? -18.075 -21.807 -40.902 1.00 49.85 ? 487  HIS A CD2   1 
ATOM   4575 C CE1   . HIS C 3 510 ? -19.686 -22.688 -39.704 1.00 49.85 ? 487  HIS A CE1   1 
ATOM   4576 N NE2   . HIS C 3 510 ? -18.519 -22.941 -40.268 1.00 49.85 ? 487  HIS A NE2   1 
ATOM   4577 N N     . LYS C 3 511 ? -20.821 -21.248 -43.333 1.00 49.85 ? 488  LYS A N     1 
ATOM   4578 C CA    . LYS C 3 511 ? -20.897 -22.324 -44.322 1.00 49.85 ? 488  LYS A CA    1 
ATOM   4579 C C     . LYS C 3 511 ? -21.428 -21.809 -45.659 1.00 49.85 ? 488  LYS A C     1 
ATOM   4580 O O     . LYS C 3 511 ? -20.965 -22.231 -46.720 1.00 49.85 ? 488  LYS A O     1 
ATOM   4581 C CB    . LYS C 3 511 ? -21.759 -23.481 -43.807 1.00 49.85 ? 488  LYS A CB    1 
ATOM   4582 C CG    . LYS C 3 511 ? -21.109 -24.297 -42.696 1.00 49.85 ? 488  LYS A CG    1 
ATOM   4583 C CD    . LYS C 3 511 ? -22.029 -25.405 -42.207 1.00 49.85 ? 488  LYS A CD    1 
ATOM   4584 C CE    . LYS C 3 511 ? -21.409 -26.189 -41.057 1.00 49.85 ? 488  LYS A CE    1 
ATOM   4585 N NZ    . LYS C 3 511 ? -20.269 -27.048 -41.491 1.00 49.85 ? 488  LYS A NZ    1 
ATOM   4586 N N     . GLU C 3 512 ? -22.397 -20.898 -45.595 1.00 49.85 ? 489  GLU A N     1 
ATOM   4587 C CA    . GLU C 3 512 ? -22.943 -20.237 -46.781 1.00 49.85 ? 489  GLU A CA    1 
ATOM   4588 C C     . GLU C 3 512 ? -21.896 -19.326 -47.436 1.00 49.85 ? 489  GLU A C     1 
ATOM   4589 O O     . GLU C 3 512 ? -21.855 -19.194 -48.662 1.00 49.85 ? 489  GLU A O     1 
ATOM   4590 C CB    . GLU C 3 512 ? -24.217 -19.456 -46.413 1.00 49.85 ? 489  GLU A CB    1 
ATOM   4591 C CG    . GLU C 3 512 ? -24.841 -18.616 -47.540 1.00 49.85 ? 489  GLU A CG    1 
ATOM   4592 C CD    . GLU C 3 512 ? -25.262 -19.432 -48.759 1.00 49.85 ? 489  GLU A CD    1 
ATOM   4593 O OE1   . GLU C 3 512 ? -25.863 -20.517 -48.590 1.00 49.85 ? 489  GLU A OE1   1 
ATOM   4594 O OE2   . GLU C 3 512 ? -24.990 -18.980 -49.893 1.00 49.85 ? 489  GLU A OE2   1 
ATOM   4595 N N     . ASN C 3 513 ? -21.057 -18.708 -46.608 1.00 49.85 ? 490  ASN A N     1 
ATOM   4596 C CA    . ASN C 3 513 ? -19.961 -17.866 -47.086 1.00 49.85 ? 490  ASN A CA    1 
ATOM   4597 C C     . ASN C 3 513 ? -18.815 -18.670 -47.696 1.00 49.85 ? 490  ASN A C     1 
ATOM   4598 O O     . ASN C 3 513 ? -18.145 -18.198 -48.616 1.00 49.85 ? 490  ASN A O     1 
ATOM   4599 C CB    . ASN C 3 513 ? -19.440 -16.973 -45.958 1.00 49.85 ? 490  ASN A CB    1 
ATOM   4600 C CG    . ASN C 3 513 ? -20.440 -15.906 -45.541 1.00 49.85 ? 490  ASN A CG    1 
ATOM   4601 O OD1   . ASN C 3 513 ? -21.622 -15.967 -45.889 1.00 49.85 ? 490  ASN A OD1   1 
ATOM   4602 N ND2   . ASN C 3 513 ? -19.967 -14.920 -44.787 1.00 49.85 ? 490  ASN A ND2   1 
ATOM   4603 N N     . ILE C 3 514 ? -18.597 -19.880 -47.179 1.00 49.85 ? 491  ILE A N     1 
ATOM   4604 C CA    . ILE C 3 514 ? -17.607 -20.807 -47.735 1.00 49.85 ? 491  ILE A CA    1 
ATOM   4605 C C     . ILE C 3 514 ? -17.946 -21.133 -49.193 1.00 49.85 ? 491  ILE A C     1 
ATOM   4606 O O     . ILE C 3 514 ? -17.075 -21.073 -50.066 1.00 49.85 ? 491  ILE A O     1 
ATOM   4607 C CB    . ILE C 3 514 ? -17.483 -22.099 -46.871 1.00 49.85 ? 491  ILE A CB    1 
ATOM   4608 C CG1   . ILE C 3 514 ? -16.603 -21.835 -45.645 1.00 49.85 ? 491  ILE A CG1   1 
ATOM   4609 C CG2   . ILE C 3 514 ? -16.910 -23.267 -47.682 1.00 49.85 ? 491  ILE A CG2   1 
ATOM   4610 C CD1   . ILE C 3 514 ? -16.754 -22.859 -44.531 1.00 49.85 ? 491  ILE A CD1   1 
ATOM   4611 N N     . LYS C 3 515 ? -19.213 -21.471 -49.440 1.00 49.85 ? 492  LYS A N     1 
ATOM   4612 C CA    . LYS C 3 515 ? -19.716 -21.760 -50.785 1.00 49.85 ? 492  LYS A CA    1 
ATOM   4613 C C     . LYS C 3 515 ? -19.605 -20.537 -51.696 1.00 49.85 ? 492  LYS A C     1 
ATOM   4614 O O     . LYS C 3 515 ? -19.315 -20.667 -52.888 1.00 49.85 ? 492  LYS A O     1 
ATOM   4615 C CB    . LYS C 3 515 ? -21.174 -22.230 -50.730 1.00 49.85 ? 492  LYS A CB    1 
ATOM   4616 C CG    . LYS C 3 515 ? -21.424 -23.472 -49.887 1.00 49.85 ? 492  LYS A CG    1 
ATOM   4617 C CD    . LYS C 3 515 ? -22.867 -23.938 -50.034 1.00 49.85 ? 492  LYS A CD    1 
ATOM   4618 C CE    . LYS C 3 515 ? -23.181 -25.121 -49.128 1.00 49.85 ? 492  LYS A CE    1 
ATOM   4619 N NZ    . LYS C 3 515 ? -23.408 -24.714 -47.713 1.00 49.85 ? 492  LYS A NZ    1 
ATOM   4620 N N     . ARG C 3 516 ? -19.838 -19.357 -51.120 1.00 49.85 ? 493  ARG A N     1 
ATOM   4621 C CA    . ARG C 3 516 ? -19.709 -18.087 -51.833 1.00 49.85 ? 493  ARG A CA    1 
ATOM   4622 C C     . ARG C 3 516 ? -18.262 -17.816 -52.228 1.00 49.85 ? 493  ARG A C     1 
ATOM   4623 O O     . ARG C 3 516 ? -17.998 -17.286 -53.310 1.00 49.85 ? 493  ARG A O     1 
ATOM   4624 C CB    . ARG C 3 516 ? -20.228 -16.932 -50.976 1.00 49.85 ? 493  ARG A CB    1 
ATOM   4625 C CG    . ARG C 3 516 ? -21.735 -16.794 -50.937 1.00 49.85 ? 493  ARG A CG    1 
ATOM   4626 C CD    . ARG C 3 516 ? -22.141 -15.510 -50.232 1.00 49.85 ? 493  ARG A CD    1 
ATOM   4627 N NE    . ARG C 3 516 ? -23.594 -15.385 -50.125 1.00 49.85 ? 493  ARG A NE    1 
ATOM   4628 C CZ    . ARG C 3 516 ? -24.230 -14.310 -49.666 1.00 49.85 ? 493  ARG A CZ    1 
ATOM   4629 N NH1   . ARG C 3 516 ? -23.550 -13.243 -49.261 1.00 49.85 ? 493  ARG A NH1   1 
ATOM   4630 N NH2   . ARG C 3 516 ? -25.555 -14.303 -49.611 1.00 49.85 ? 493  ARG A NH2   1 
ATOM   4631 N N     . MET C 3 517 ? -17.336 -18.182 -51.342 1.00 49.85 ? 494  MET A N     1 
ATOM   4632 C CA    . MET C 3 517 ? -15.905 -18.039 -51.600 1.00 49.85 ? 494  MET A CA    1 
ATOM   4633 C C     . MET C 3 517 ? -15.451 -18.940 -52.748 1.00 49.85 ? 494  MET A C     1 
ATOM   4634 O O     . MET C 3 517 ? -14.717 -18.497 -53.633 1.00 49.85 ? 494  MET A O     1 
ATOM   4635 C CB    . MET C 3 517 ? -15.089 -18.327 -50.334 1.00 49.85 ? 494  MET A CB    1 
ATOM   4636 C CG    . MET C 3 517 ? -15.060 -17.180 -49.327 1.00 49.85 ? 494  MET A CG    1 
ATOM   4637 S SD    . MET C 3 517 ? -14.232 -15.687 -49.926 1.00 49.85 ? 494  MET A SD    1 
ATOM   4638 C CE    . MET C 3 517 ? -12.518 -16.203 -49.915 1.00 49.85 ? 494  MET A CE    1 
ATOM   4639 N N     . GLY C 3 518 ? -15.895 -20.197 -52.723 1.00 49.85 ? 495  GLY A N     1 
ATOM   4640 C CA    . GLY C 3 518 ? -15.594 -21.161 -53.781 1.00 49.85 ? 495  GLY A CA    1 
ATOM   4641 C C     . GLY C 3 518 ? -16.112 -20.720 -55.138 1.00 49.85 ? 495  GLY A C     1 
ATOM   4642 O O     . GLY C 3 518 ? -15.451 -20.923 -56.160 1.00 49.85 ? 495  GLY A O     1 
ATOM   4643 N N     . ALA C 3 519 ? -17.298 -20.115 -55.138 1.00 49.85 ? 496  ALA A N     1 
ATOM   4644 C CA    . ALA C 3 519 ? -17.923 -19.599 -56.354 1.00 49.85 ? 496  ALA A CA    1 
ATOM   4645 C C     . ALA C 3 519 ? -17.107 -18.470 -56.987 1.00 49.85 ? 496  ALA A C     1 
ATOM   4646 O O     . ALA C 3 519 ? -16.878 -18.472 -58.199 1.00 49.85 ? 496  ALA A O     1 
ATOM   4647 C CB    . ALA C 3 519 ? -19.348 -19.139 -56.066 1.00 49.85 ? 496  ALA A CB    1 
ATOM   4648 N N     . ALA C 3 520 ? -16.674 -17.517 -56.161 1.00 49.85 ? 497  ALA A N     1 
ATOM   4649 C CA    . ALA C 3 520 ? -15.887 -16.371 -56.626 1.00 49.85 ? 497  ALA A CA    1 
ATOM   4650 C C     . ALA C 3 520 ? -14.455 -16.764 -56.996 1.00 49.85 ? 497  ALA A C     1 
ATOM   4651 O O     . ALA C 3 520 ? -13.812 -16.092 -57.807 1.00 49.85 ? 497  ALA A O     1 
ATOM   4652 C CB    . ALA C 3 520 ? -15.888 -15.261 -55.579 1.00 49.85 ? 497  ALA A CB    1 
ATOM   4653 N N     . TYR C 3 521 ? -13.969 -17.851 -56.398 1.00 49.85 ? 498  TYR A N     1 
ATOM   4654 C CA    . TYR C 3 521 ? -12.648 -18.400 -56.713 1.00 49.85 ? 498  TYR A CA    1 
ATOM   4655 C C     . TYR C 3 521 ? -12.605 -18.993 -58.119 1.00 49.85 ? 498  TYR A C     1 
ATOM   4656 O O     . TYR C 3 521 ? -11.578 -18.916 -58.797 1.00 49.85 ? 498  TYR A O     1 
ATOM   4657 C CB    . TYR C 3 521 ? -12.229 -19.442 -55.667 1.00 49.85 ? 498  TYR A CB    1 
ATOM   4658 C CG    . TYR C 3 521 ? -11.369 -18.890 -54.543 1.00 49.85 ? 498  TYR A CG    1 
ATOM   4659 C CD1   . TYR C 3 521 ? -11.604 -17.621 -54.008 1.00 49.85 ? 498  TYR A CD1   1 
ATOM   4660 C CD2   . TYR C 3 521 ? -10.322 -19.641 -54.012 1.00 49.85 ? 498  TYR A CD2   1 
ATOM   4661 C CE1   . TYR C 3 521 ? -10.820 -17.116 -52.980 1.00 49.85 ? 498  TYR A CE1   1 
ATOM   4662 C CE2   . TYR C 3 521 ? -9.530  -19.144 -52.981 1.00 49.85 ? 498  TYR A CE2   1 
ATOM   4663 C CZ    . TYR C 3 521 ? -9.787  -17.881 -52.471 1.00 49.85 ? 498  TYR A CZ    1 
ATOM   4664 O OH    . TYR C 3 521 ? -9.010  -17.382 -51.453 1.00 49.85 ? 498  TYR A OH    1 
ATOM   4665 N N     . LYS C 3 522 ? -13.723 -19.578 -58.547 1.00 49.85 ? 499  LYS A N     1 
ATOM   4666 C CA    . LYS C 3 522 ? -13.885 -20.034 -59.927 1.00 49.85 ? 499  LYS A CA    1 
ATOM   4667 C C     . LYS C 3 522 ? -13.882 -18.862 -60.910 1.00 49.85 ? 499  LYS A C     1 
ATOM   4668 O O     . LYS C 3 522 ? -13.158 -18.887 -61.904 1.00 49.85 ? 499  LYS A O     1 
ATOM   4669 C CB    . LYS C 3 522 ? -15.168 -20.855 -60.088 1.00 49.85 ? 499  LYS A CB    1 
ATOM   4670 C CG    . LYS C 3 522 ? -15.022 -22.326 -59.739 1.00 49.85 ? 499  LYS A CG    1 
ATOM   4671 C CD    . LYS C 3 522 ? -16.188 -23.131 -60.293 1.00 49.85 ? 499  LYS A CD    1 
ATOM   4672 C CE    . LYS C 3 522 ? -15.983 -24.623 -60.096 1.00 49.85 ? 499  LYS A CE    1 
ATOM   4673 N NZ    . LYS C 3 522 ? -17.051 -25.411 -60.769 1.00 49.85 ? 499  LYS A NZ    1 
ATOM   4674 N N     . VAL C 3 523 ? -14.691 -17.843 -60.616 1.00 49.85 ? 500  VAL A N     1 
ATOM   4675 C CA    . VAL C 3 523 ? -14.847 -16.658 -61.472 1.00 49.85 ? 500  VAL A CA    1 
ATOM   4676 C C     . VAL C 3 523 ? -13.506 -15.999 -61.826 1.00 49.85 ? 500  VAL A C     1 
ATOM   4677 O O     . VAL C 3 523 ? -13.277 -15.622 -62.981 1.00 49.85 ? 500  VAL A O     1 
ATOM   4678 C CB    . VAL C 3 523 ? -15.818 -15.619 -60.834 1.00 49.85 ? 500  VAL A CB    1 
ATOM   4679 C CG1   . VAL C 3 523 ? -15.902 -14.347 -61.673 1.00 49.85 ? 500  VAL A CG1   1 
ATOM   4680 C CG2   . VAL C 3 523 ? -17.207 -16.224 -60.653 1.00 49.85 ? 500  VAL A CG2   1 
ATOM   4681 N N     . ASN C 3 524 ? -12.631 -15.868 -60.831 1.00 49.85 ? 501  ASN A N     1 
ATOM   4682 C CA    . ASN C 3 524 ? -11.305 -15.286 -61.035 1.00 49.85 ? 501  ASN A CA    1 
ATOM   4683 C C     . ASN C 3 524 ? -10.373 -16.222 -61.802 1.00 49.85 ? 501  ASN A C     1 
ATOM   4684 O O     . ASN C 3 524 ? -9.541  -15.772 -62.595 1.00 49.85 ? 501  ASN A O     1 
ATOM   4685 C CB    . ASN C 3 524 ? -10.673 -14.896 -59.696 1.00 49.85 ? 501  ASN A CB    1 
ATOM   4686 C CG    . ASN C 3 524 ? -11.327 -13.674 -59.067 1.00 49.85 ? 501  ASN A CG    1 
ATOM   4687 O OD1   . ASN C 3 524 ? -10.721 -12.606 -58.996 1.00 49.85 ? 501  ASN A OD1   1 
ATOM   4688 N ND2   . ASN C 3 524 ? -12.565 -13.827 -58.608 1.00 49.85 ? 501  ASN A ND2   1 
ATOM   4689 N N     . ARG C 3 525 ? -10.528 -17.521 -61.554 1.00 49.85 ? 502  ARG A N     1 
ATOM   4690 C CA    . ARG C 3 525 ? -9.743  -18.566 -62.211 1.00 49.85 ? 502  ARG A CA    1 
ATOM   4691 C C     . ARG C 3 525 ? -10.008 -18.616 -63.721 1.00 49.85 ? 502  ARG A C     1 
ATOM   4692 O O     . ARG C 3 525 ? -9.091  -18.869 -64.507 1.00 49.85 ? 502  ARG A O     1 
ATOM   4693 C CB    . ARG C 3 525 ? -10.056 -19.920 -61.567 1.00 49.85 ? 502  ARG A CB    1 
ATOM   4694 C CG    . ARG C 3 525 ? -9.055  -21.028 -61.838 1.00 49.85 ? 502  ARG A CG    1 
ATOM   4695 C CD    . ARG C 3 525 ? -9.351  -22.218 -60.940 1.00 49.85 ? 502  ARG A CD    1 
ATOM   4696 N NE    . ARG C 3 525 ? -8.533  -23.387 -61.256 1.00 49.85 ? 502  ARG A NE    1 
ATOM   4697 C CZ    . ARG C 3 525 ? -8.529  -24.516 -60.550 1.00 49.85 ? 502  ARG A CZ    1 
ATOM   4698 N NH1   . ARG C 3 525 ? -9.301  -24.644 -59.477 1.00 49.85 ? 502  ARG A NH1   1 
ATOM   4699 N NH2   . ARG C 3 525 ? -7.748  -25.523 -60.920 1.00 49.85 ? 502  ARG A NH2   1 
ATOM   4700 N N     . GLU C 3 526 ? -11.263 -18.370 -64.105 1.00 49.85 ? 503  GLU A N     1 
ATOM   4701 C CA    . GLU C 3 526 ? -11.707 -18.402 -65.506 1.00 49.85 ? 503  GLU A CA    1 
ATOM   4702 C C     . GLU C 3 526 ? -10.913 -17.450 -66.399 1.00 49.85 ? 503  GLU A C     1 
ATOM   4703 O O     . GLU C 3 526 ? -10.455 -17.839 -67.478 1.00 49.85 ? 503  GLU A O     1 
ATOM   4704 C CB    . GLU C 3 526 ? -13.204 -18.064 -65.617 1.00 49.85 ? 503  GLU A CB    1 
ATOM   4705 C CG    . GLU C 3 526 ? -14.148 -18.960 -64.814 1.00 49.85 ? 503  GLU A CG    1 
ATOM   4706 C CD    . GLU C 3 526 ? -14.226 -20.383 -65.342 1.00 49.85 ? 503  GLU A CD    1 
ATOM   4707 O OE1   . GLU C 3 526 ? -14.669 -20.570 -66.497 1.00 49.85 ? 503  GLU A OE1   1 
ATOM   4708 O OE2   . GLU C 3 526 ? -13.846 -21.313 -64.597 1.00 49.85 ? 503  GLU A OE2   1 
ATOM   4709 N N     . VAL C 3 527 ? -10.757 -16.209 -65.938 1.00 49.85 ? 504  VAL A N     1 
ATOM   4710 C CA    . VAL C 3 527 ? -10.096 -15.146 -66.704 1.00 49.85 ? 504  VAL A CA    1 
ATOM   4711 C C     . VAL C 3 527 ? -8.643  -15.503 -67.035 1.00 49.85 ? 504  VAL A C     1 
ATOM   4712 O O     . VAL C 3 527 ? -8.142  -15.166 -68.112 1.00 49.85 ? 504  VAL A O     1 
ATOM   4713 C CB    . VAL C 3 527 ? -10.152 -13.779 -65.962 1.00 49.85 ? 504  VAL A CB    1 
ATOM   4714 C CG1   . VAL C 3 527 ? -9.958  -12.625 -66.941 1.00 49.85 ? 504  VAL A CG1   1 
ATOM   4715 C CG2   . VAL C 3 527 ? -11.474 -13.617 -65.215 1.00 49.85 ? 504  VAL A CG2   1 
ATOM   4716 N N     . ARG C 3 528 ? -7.979  -16.186 -66.104 1.00 49.85 ? 505  ARG A N     1 
ATOM   4717 C CA    . ARG C 3 528 ? -6.603  -16.634 -66.298 1.00 49.85 ? 505  ARG A CA    1 
ATOM   4718 C C     . ARG C 3 528 ? -6.561  -18.096 -66.741 1.00 49.85 ? 505  ARG A C     1 
ATOM   4719 O O     . ARG C 3 528 ? -7.206  -18.480 -67.717 1.00 49.85 ? 505  ARG A O     1 
ATOM   4720 C CB    . ARG C 3 528 ? -5.799  -16.445 -65.010 1.00 49.85 ? 505  ARG A CB    1 
ATOM   4721 C CG    . ARG C 3 528 ? -4.299  -16.685 -65.152 1.00 49.85 ? 505  ARG A CG    1 
ATOM   4722 C CD    . ARG C 3 528 ? -3.610  -16.641 -63.796 1.00 49.85 ? 505  ARG A CD    1 
ATOM   4723 N NE    . ARG C 3 528 ? -4.023  -17.752 -62.937 1.00 49.85 ? 505  ARG A NE    1 
ATOM   4724 C CZ    . ARG C 3 528 ? -3.876  -17.785 -61.614 1.00 49.85 ? 505  ARG A CZ    1 
ATOM   4725 N NH1   . ARG C 3 528 ? -3.322  -16.766 -60.965 1.00 49.85 ? 505  ARG A NH1   1 
ATOM   4726 N NH2   . ARG C 3 528 ? -4.288  -18.847 -60.934 1.00 49.85 ? 505  ARG A NH2   1 
HETATM 4727 P PA    . FAD D 4 .   ? 5.101   -8.496  -32.768 1.00 49.85 ? 521  FAD A PA    1 
HETATM 4728 O O1A   . FAD D 4 .   ? 5.929   -7.990  -31.612 1.00 49.85 ? 521  FAD A O1A   1 
HETATM 4729 O O2A   . FAD D 4 .   ? 4.551   -9.870  -32.474 1.00 49.85 ? 521  FAD A O2A   1 
HETATM 4730 O O5B   . FAD D 4 .   ? 5.979   -8.501  -34.121 1.00 49.85 ? 521  FAD A O5B   1 
HETATM 4731 C C5B   . FAD D 4 .   ? 7.133   -7.696  -34.239 1.00 49.85 ? 521  FAD A C5B   1 
HETATM 4732 C C4B   . FAD D 4 .   ? 6.947   -6.618  -35.303 1.00 49.85 ? 521  FAD A C4B   1 
HETATM 4733 O O4B   . FAD D 4 .   ? 6.710   -7.201  -36.570 1.00 49.85 ? 521  FAD A O4B   1 
HETATM 4734 C C3B   . FAD D 4 .   ? 5.767   -5.705  -35.012 1.00 49.85 ? 521  FAD A C3B   1 
HETATM 4735 O O3B   . FAD D 4 .   ? 6.191   -4.520  -34.381 1.00 49.85 ? 521  FAD A O3B   1 
HETATM 4736 C C2B   . FAD D 4 .   ? 5.130   -5.446  -36.361 1.00 49.85 ? 521  FAD A C2B   1 
HETATM 4737 O O2B   . FAD D 4 .   ? 5.519   -4.188  -36.859 1.00 49.85 ? 521  FAD A O2B   1 
HETATM 4738 C C1B   . FAD D 4 .   ? 5.669   -6.541  -37.267 1.00 49.85 ? 521  FAD A C1B   1 
HETATM 4739 N N9A   . FAD D 4 .   ? 4.598   -7.505  -37.591 1.00 49.85 ? 521  FAD A N9A   1 
HETATM 4740 C C8A   . FAD D 4 .   ? 4.036   -8.423  -36.739 1.00 49.85 ? 521  FAD A C8A   1 
HETATM 4741 N N7A   . FAD D 4 .   ? 3.091   -9.119  -37.410 1.00 49.85 ? 521  FAD A N7A   1 
HETATM 4742 C C5A   . FAD D 4 .   ? 3.037   -8.662  -38.680 1.00 49.85 ? 521  FAD A C5A   1 
HETATM 4743 C C6A   . FAD D 4 .   ? 2.254   -9.021  -39.777 1.00 49.85 ? 521  FAD A C6A   1 
HETATM 4744 N N6A   . FAD D 4 .   ? 1.147   -9.733  -39.594 1.00 49.85 ? 521  FAD A N6A   1 
HETATM 4745 N N1A   . FAD D 4 .   ? 2.429   -8.360  -40.978 1.00 49.85 ? 521  FAD A N1A   1 
HETATM 4746 C C2A   . FAD D 4 .   ? 3.370   -7.355  -41.088 1.00 49.85 ? 521  FAD A C2A   1 
HETATM 4747 N N3A   . FAD D 4 .   ? 4.142   -7.004  -39.996 1.00 49.85 ? 521  FAD A N3A   1 
HETATM 4748 C C4A   . FAD D 4 .   ? 3.981   -7.646  -38.809 1.00 49.85 ? 521  FAD A C4A   1 
HETATM 4749 N N1    . FAD D 4 .   ? 0.420   -4.180  -38.189 1.00 49.85 ? 521  FAD A N1    1 
HETATM 4750 C C2    . FAD D 4 .   ? 0.891   -2.889  -38.308 1.00 49.85 ? 521  FAD A C2    1 
HETATM 4751 O O2    . FAD D 4 .   ? 2.018   -2.611  -37.901 1.00 49.85 ? 521  FAD A O2    1 
HETATM 4752 N N3    . FAD D 4 .   ? 0.096   -1.917  -38.885 1.00 49.85 ? 521  FAD A N3    1 
HETATM 4753 C C4    . FAD D 4 .   ? -1.170  -2.232  -39.342 1.00 49.85 ? 521  FAD A C4    1 
HETATM 4754 O O4    . FAD D 4 .   ? -1.808  -1.392  -39.974 1.00 49.85 ? 521  FAD A O4    1 
HETATM 4755 C C4X   . FAD D 4 .   ? -1.646  -3.536  -39.221 1.00 49.85 ? 521  FAD A C4X   1 
HETATM 4756 N N5    . FAD D 4 .   ? -2.908  -3.859  -39.674 1.00 49.85 ? 521  FAD A N5    1 
HETATM 4757 C C5X   . FAD D 4 .   ? -3.379  -5.150  -39.554 1.00 49.85 ? 521  FAD A C5X   1 
HETATM 4758 C C6    . FAD D 4 .   ? -4.657  -5.451  -40.020 1.00 49.85 ? 521  FAD A C6    1 
HETATM 4759 C C7    . FAD D 4 .   ? -5.155  -6.747  -39.910 1.00 49.85 ? 521  FAD A C7    1 
HETATM 4760 C C7M   . FAD D 4 .   ? -6.541  -7.040  -40.408 1.00 49.85 ? 521  FAD A C7M   1 
HETATM 4761 C C8    . FAD D 4 .   ? -4.363  -7.744  -39.328 1.00 49.85 ? 521  FAD A C8    1 
HETATM 4762 C C8M   . FAD D 4 .   ? -4.843  -9.163  -39.228 1.00 49.85 ? 521  FAD A C8M   1 
HETATM 4763 C C9    . FAD D 4 .   ? -3.086  -7.437  -38.865 1.00 49.85 ? 521  FAD A C9    1 
HETATM 4764 C C9A   . FAD D 4 .   ? -2.579  -6.140  -38.972 1.00 49.85 ? 521  FAD A C9A   1 
HETATM 4765 N N10   . FAD D 4 .   ? -1.302  -5.824  -38.509 1.00 49.85 ? 521  FAD A N10   1 
HETATM 4766 C C10   . FAD D 4 .   ? -0.843  -4.519  -38.639 1.00 49.85 ? 521  FAD A C10   1 
HETATM 4767 C "C1'" . FAD D 4 .   ? -0.291  -6.916  -38.260 1.00 49.85 ? 521  FAD A "C1'" 1 
HETATM 4768 C "C2'" . FAD D 4 .   ? -0.181  -7.321  -36.784 1.00 49.85 ? 521  FAD A "C2'" 1 
HETATM 4769 O "O2'" . FAD D 4 .   ? -1.471  -7.512  -36.244 1.00 49.85 ? 521  FAD A "O2'" 1 
HETATM 4770 C "C3'" . FAD D 4 .   ? 0.594   -6.323  -35.919 1.00 49.85 ? 521  FAD A "C3'" 1 
HETATM 4771 O "O3'" . FAD D 4 .   ? 1.794   -5.958  -36.566 1.00 49.85 ? 521  FAD A "O3'" 1 
HETATM 4772 C "C4'" . FAD D 4 .   ? 0.935   -6.856  -34.529 1.00 49.85 ? 521  FAD A "C4'" 1 
HETATM 4773 O "O4'" . FAD D 4 .   ? -0.185  -7.464  -33.927 1.00 49.85 ? 521  FAD A "O4'" 1 
HETATM 4774 C "C5'" . FAD D 4 .   ? 1.400   -5.717  -33.634 1.00 49.85 ? 521  FAD A "C5'" 1 
HETATM 4775 O "O5'" . FAD D 4 .   ? 1.827   -6.222  -32.391 1.00 49.85 ? 521  FAD A "O5'" 1 
HETATM 4776 P P     . FAD D 4 .   ? 3.392   -6.361  -32.047 1.00 49.85 ? 521  FAD A P     1 
HETATM 4777 O O1P   . FAD D 4 .   ? 4.095   -5.046  -32.282 1.00 49.85 ? 521  FAD A O1P   1 
HETATM 4778 O O2P   . FAD D 4 .   ? 3.573   -6.828  -30.626 1.00 49.85 ? 521  FAD A O2P   1 
HETATM 4779 O O3P   . FAD D 4 .   ? 3.909   -7.466  -33.098 1.00 49.85 ? 521  FAD A O3P   1 
HETATM 4780 N N1    . FO1 E 5 .   ? 3.191   12.940  -42.528 1.00 49.85 ? 1422 FO1 A N1    1 
HETATM 4781 C C1    . FO1 E 5 .   ? 3.604   14.224  -42.684 1.00 49.85 ? 1422 FO1 A C1    1 
HETATM 4782 O O1    . FO1 E 5 .   ? 4.438   14.500  -43.575 1.00 49.85 ? 1422 FO1 A O1    1 
HETATM 4783 N N2    . FO1 E 5 .   ? 3.129   15.212  -41.891 1.00 49.85 ? 1422 FO1 A N2    1 
HETATM 4784 C C2    . FO1 E 5 .   ? 2.229   14.947  -40.922 1.00 49.85 ? 1422 FO1 A C2    1 
HETATM 4785 O O2    . FO1 E 5 .   ? 1.799   15.870  -40.197 1.00 49.85 ? 1422 FO1 A O2    1 
HETATM 4786 C C3    . FO1 E 5 .   ? 1.766   13.544  -40.738 1.00 49.85 ? 1422 FO1 A C3    1 
HETATM 4787 C C4    . FO1 E 5 .   ? 0.841   13.237  -39.748 1.00 49.85 ? 1422 FO1 A C4    1 
HETATM 4788 C C5    . FO1 E 5 .   ? 0.429   11.924  -39.601 1.00 49.85 ? 1422 FO1 A C5    1 
HETATM 4789 C C6    . FO1 E 5 .   ? -0.493  11.560  -38.631 1.00 49.85 ? 1422 FO1 A C6    1 
HETATM 4790 C C7    . FO1 E 5 .   ? -0.847  10.217  -38.558 1.00 49.85 ? 1422 FO1 A C7    1 
HETATM 4791 C C9    . FO1 E 5 .   ? -0.280  9.294   -39.440 1.00 49.85 ? 1422 FO1 A C9    1 
HETATM 4792 O O10   . FO1 E 5 .   ? -0.641  7.983   -39.352 1.00 49.85 ? 1422 FO1 A O10   1 
HETATM 4793 C C11   . FO1 E 5 .   ? 0.578   9.647   -40.342 1.00 49.85 ? 1422 FO1 A C11   1 
HETATM 4794 C C12   . FO1 E 5 .   ? 0.980   10.869  -40.497 1.00 49.85 ? 1422 FO1 A C12   1 
HETATM 4795 N N3    . FO1 E 5 .   ? 1.923   11.191  -41.509 1.00 49.85 ? 1422 FO1 A N3    1 
HETATM 4796 C C13   . FO1 E 5 .   ? 2.291   12.563  -41.584 1.00 49.85 ? 1422 FO1 A C13   1 
HETATM 4797 C C14   . FO1 E 5 .   ? 3.111   10.321  -41.453 1.00 49.85 ? 1422 FO1 A C14   1 
HETATM 4798 C C15   . FO1 E 5 .   ? 3.027   9.394   -42.663 1.00 49.85 ? 1422 FO1 A C15   1 
HETATM 4799 O O3    . FO1 E 5 .   ? 3.070   8.031   -42.219 1.00 49.85 ? 1422 FO1 A O3    1 
HETATM 4800 C C16   . FO1 E 5 .   ? 4.134   9.658   -43.683 1.00 49.85 ? 1422 FO1 A C16   1 
HETATM 4801 O O4    . FO1 E 5 .   ? 4.134   11.037  -44.076 1.00 49.85 ? 1422 FO1 A O4    1 
HETATM 4802 C C17   . FO1 E 5 .   ? 3.992   8.779   -44.924 1.00 49.85 ? 1422 FO1 A C17   1 
HETATM 4803 O O5    . FO1 E 5 .   ? 5.247   8.747   -45.612 1.00 49.85 ? 1422 FO1 A O5    1 
HETATM 4804 C C18   . FO1 E 5 .   ? 2.905   9.263   -45.882 1.00 49.85 ? 1422 FO1 A C18   1 
HETATM 4805 O O6    . FO1 E 5 .   ? 2.627   8.242   -46.847 1.00 49.85 ? 1422 FO1 A O6    1 
HETATM 4806 O O     . HOH F 6 .   ? -4.883  -29.150 -41.464 1.00 49.85 ? 16   HOH C O     1 
HETATM 4807 O O     . HOH G 6 .   ? -10.304 8.923   -45.953 1.00 49.85 ? 1423 HOH A O     1 
HETATM 4808 O O     . HOH G 6 .   ? 6.975   36.903  -31.192 1.00 49.85 ? 1424 HOH A O     1 
HETATM 4809 O O     . HOH G 6 .   ? 13.411  39.942  -33.488 1.00 49.85 ? 1425 HOH A O     1 
HETATM 4810 O O     . HOH G 6 .   ? 17.877  -9.745  -41.585 1.00 49.85 ? 1426 HOH A O     1 
HETATM 4811 O O     . HOH G 6 .   ? -11.786 -22.397 -58.862 1.00 49.85 ? 1427 HOH A O     1 
HETATM 4812 O O     . HOH G 6 .   ? -23.978 -6.345  -13.638 1.00 49.85 ? 1428 HOH A O     1 
HETATM 4813 O O     . HOH G 6 .   ? -31.806 1.382   -38.686 1.00 49.85 ? 1429 HOH A O     1 
HETATM 4814 O O     . HOH G 6 .   ? -8.745  -17.425 -18.373 1.00 49.85 ? 1430 HOH A O     1 
HETATM 4815 O O     . HOH G 6 .   ? 0.124   18.426  -49.752 1.00 49.85 ? 1431 HOH A O     1 
HETATM 4816 O O     . HOH G 6 .   ? -15.257 6.413   -48.237 1.00 49.85 ? 1432 HOH A O     1 
HETATM 4817 O O     . HOH G 6 .   ? -15.573 3.098   -21.276 1.00 49.85 ? 1433 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DA  1   1   1   DA  DA  C . n 
A 1 2   DC  2   2   2   DC  DC  C . n 
A 1 3   DA  3   3   3   DA  DA  C . n 
A 1 4   DG  4   4   4   DG  DG  C . n 
A 1 5   DC  5   5   5   DC  DC  C . n 
A 1 6   DG  6   6   6   DG  DG  C . n 
A 1 7   DG  7   7   7   DG  DG  C . n 
A 1 8   64T 8   8   8   64T TDX C . n 
A 1 9   5PY 9   9   9   5PY TDY C . n 
A 1 10  DG  10  10  10  DG  DG  C . n 
A 1 11  DC  11  11  11  DC  DC  C . n 
A 1 12  DA  12  12  12  DA  DA  C . n 
A 1 13  DG  13  13  13  DG  DG  C . n 
A 1 14  DG  14  14  14  DG  DG  C . n 
A 1 15  DT  15  15  15  DT  DT  C . n 
B 2 1   DT  1   1   1   DT  DT  D . n 
B 2 2   DA  2   2   2   DA  DA  D . n 
B 2 3   DC  3   3   3   DC  DC  D . n 
B 2 4   DC  4   4   4   DC  DC  D . n 
B 2 5   DT  5   5   5   DT  DT  D . n 
B 2 6   DG  6   6   6   DG  DG  D . n 
B 2 7   DC  7   7   7   DC  DC  D . n 
B 2 8   DA  8   8   8   DA  DA  D . n 
B 2 9   DA  9   9   9   DA  DA  D . n 
B 2 10  DC  10  10  10  DC  DC  D . n 
B 2 11  DC  11  11  11  DC  DC  D . n 
B 2 12  DG  12  12  12  DG  DG  D . n 
B 2 13  DC  13  13  13  DC  DC  D . n 
B 2 14  DT  14  14  14  DT  DT  D . n 
B 2 15  DG  15  15  15  DG  DG  D . n 
C 3 1   MET 1   -22 ?   ?   ?   A . n 
C 3 2   ALA 2   -21 ?   ?   ?   A . n 
C 3 3   SER 3   -20 ?   ?   ?   A . n 
C 3 4   TRP 4   -19 ?   ?   ?   A . n 
C 3 5   SER 5   -18 ?   ?   ?   A . n 
C 3 6   HIS 6   -17 ?   ?   ?   A . n 
C 3 7   PRO 7   -16 ?   ?   ?   A . n 
C 3 8   GLN 8   -15 ?   ?   ?   A . n 
C 3 9   PHE 9   -14 ?   ?   ?   A . n 
C 3 10  GLU 10  -13 ?   ?   ?   A . n 
C 3 11  LYS 11  -12 ?   ?   ?   A . n 
C 3 12  GLY 12  -11 ?   ?   ?   A . n 
C 3 13  ALA 13  -10 ?   ?   ?   A . n 
C 3 14  SER 14  -9  ?   ?   ?   A . n 
C 3 15  THR 15  -8  ?   ?   ?   A . n 
C 3 16  SER 16  -7  ?   ?   ?   A . n 
C 3 17  LEU 17  -6  ?   ?   ?   A . n 
C 3 18  TYR 18  -5  ?   ?   ?   A . n 
C 3 19  LYS 19  -4  ?   ?   ?   A . n 
C 3 20  LYS 20  -3  ?   ?   ?   A . n 
C 3 21  ALA 21  -2  ?   ?   ?   A . n 
C 3 22  GLY 22  -1  ?   ?   ?   A . n 
C 3 23  LEU 23  0   ?   ?   ?   A . n 
C 3 24  MET 24  1   ?   ?   ?   A . n 
C 3 25  ASP 25  2   ?   ?   ?   A . n 
C 3 26  SER 26  3   ?   ?   ?   A . n 
C 3 27  GLN 27  4   4   GLN GLN A . n 
C 3 28  ARG 28  5   5   ARG ARG A . n 
C 3 29  SER 29  6   6   SER SER A . n 
C 3 30  THR 30  7   7   THR THR A . n 
C 3 31  LEU 31  8   8   LEU LEU A . n 
C 3 32  VAL 32  9   9   VAL VAL A . n 
C 3 33  HIS 33  10  10  HIS HIS A . n 
C 3 34  TRP 34  11  11  TRP TRP A . n 
C 3 35  PHE 35  12  12  PHE PHE A . n 
C 3 36  ARG 36  13  13  ARG ARG A . n 
C 3 37  LYS 37  14  14  LYS LYS A . n 
C 3 38  GLY 38  15  15  GLY GLY A . n 
C 3 39  LEU 39  16  16  LEU LEU A . n 
C 3 40  ARG 40  17  17  ARG ARG A . n 
C 3 41  LEU 41  18  18  LEU LEU A . n 
C 3 42  HIS 42  19  19  HIS HIS A . n 
C 3 43  ASP 43  20  20  ASP ASP A . n 
C 3 44  ASN 44  21  21  ASN ASN A . n 
C 3 45  PRO 45  22  22  PRO PRO A . n 
C 3 46  ALA 46  23  23  ALA ALA A . n 
C 3 47  LEU 47  24  24  LEU LEU A . n 
C 3 48  SER 48  25  25  SER SER A . n 
C 3 49  HIS 49  26  26  HIS HIS A . n 
C 3 50  ILE 50  27  27  ILE ILE A . n 
C 3 51  PHE 51  28  28  PHE PHE A . n 
C 3 52  THR 52  29  29  THR THR A . n 
C 3 53  ALA 53  30  30  ALA ALA A . n 
C 3 54  ALA 54  31  31  ALA ALA A . n 
C 3 55  ASN 55  32  32  ASN ASN A . n 
C 3 56  ALA 56  33  33  ALA ALA A . n 
C 3 57  ALA 57  34  34  ALA ALA A . n 
C 3 58  PRO 58  35  35  PRO PRO A . n 
C 3 59  GLY 59  36  36  GLY GLY A . n 
C 3 60  ARG 60  37  37  ARG ARG A . n 
C 3 61  TYR 61  38  38  TYR TYR A . n 
C 3 62  PHE 62  39  39  PHE PHE A . n 
C 3 63  VAL 63  40  40  VAL VAL A . n 
C 3 64  ARG 64  41  41  ARG ARG A . n 
C 3 65  PRO 65  42  42  PRO PRO A . n 
C 3 66  ILE 66  43  43  ILE ILE A . n 
C 3 67  PHE 67  44  44  PHE PHE A . n 
C 3 68  ILE 68  45  45  ILE ILE A . n 
C 3 69  LEU 69  46  46  LEU LEU A . n 
C 3 70  ASP 70  47  47  ASP ASP A . n 
C 3 71  PRO 71  48  48  PRO PRO A . n 
C 3 72  GLY 72  49  49  GLY GLY A . n 
C 3 73  ILE 73  50  50  ILE ILE A . n 
C 3 74  LEU 74  51  51  LEU LEU A . n 
C 3 75  ASP 75  52  52  ASP ASP A . n 
C 3 76  TRP 76  53  53  TRP TRP A . n 
C 3 77  MET 77  54  54  MET MET A . n 
C 3 78  GLN 78  55  55  GLN GLN A . n 
C 3 79  VAL 79  56  56  VAL VAL A . n 
C 3 80  GLY 80  57  57  GLY GLY A . n 
C 3 81  ALA 81  58  58  ALA ALA A . n 
C 3 82  ASN 82  59  59  ASN ASN A . n 
C 3 83  ARG 83  60  60  ARG ARG A . n 
C 3 84  TRP 84  61  61  TRP TRP A . n 
C 3 85  ARG 85  62  62  ARG ARG A . n 
C 3 86  PHE 86  63  63  PHE PHE A . n 
C 3 87  LEU 87  64  64  LEU LEU A . n 
C 3 88  GLN 88  65  65  GLN GLN A . n 
C 3 89  GLN 89  66  66  GLN GLN A . n 
C 3 90  THR 90  67  67  THR THR A . n 
C 3 91  LEU 91  68  68  LEU LEU A . n 
C 3 92  GLU 92  69  69  GLU GLU A . n 
C 3 93  ASP 93  70  70  ASP ASP A . n 
C 3 94  LEU 94  71  71  LEU LEU A . n 
C 3 95  ASP 95  72  72  ASP ASP A . n 
C 3 96  ASN 96  73  73  ASN ASN A . n 
C 3 97  GLN 97  74  74  GLN GLN A . n 
C 3 98  LEU 98  75  75  LEU LEU A . n 
C 3 99  ARG 99  76  76  ARG ARG A . n 
C 3 100 LYS 100 77  77  LYS LYS A . n 
C 3 101 LEU 101 78  78  LEU LEU A . n 
C 3 102 ASN 102 79  79  ASN ASN A . n 
C 3 103 SER 103 80  80  SER SER A . n 
C 3 104 ARG 104 81  81  ARG ARG A . n 
C 3 105 LEU 105 82  82  LEU LEU A . n 
C 3 106 PHE 106 83  83  PHE PHE A . n 
C 3 107 VAL 107 84  84  VAL VAL A . n 
C 3 108 VAL 108 85  85  VAL VAL A . n 
C 3 109 ARG 109 86  86  ARG ARG A . n 
C 3 110 GLY 110 87  87  GLY GLY A . n 
C 3 111 LYS 111 88  88  LYS LYS A . n 
C 3 112 PRO 112 89  89  PRO PRO A . n 
C 3 113 ALA 113 90  90  ALA ALA A . n 
C 3 114 GLU 114 91  91  GLU GLU A . n 
C 3 115 VAL 115 92  92  VAL VAL A . n 
C 3 116 PHE 116 93  93  PHE PHE A . n 
C 3 117 PRO 117 94  94  PRO PRO A . n 
C 3 118 ARG 118 95  95  ARG ARG A . n 
C 3 119 ILE 119 96  96  ILE ILE A . n 
C 3 120 PHE 120 97  97  PHE PHE A . n 
C 3 121 LYS 121 98  98  LYS LYS A . n 
C 3 122 SER 122 99  99  SER SER A . n 
C 3 123 TRP 123 100 100 TRP TRP A . n 
C 3 124 ARG 124 101 101 ARG ARG A . n 
C 3 125 VAL 125 102 102 VAL VAL A . n 
C 3 126 GLU 126 103 103 GLU GLU A . n 
C 3 127 MET 127 104 104 MET MET A . n 
C 3 128 LEU 128 105 105 LEU LEU A . n 
C 3 129 THR 129 106 106 THR THR A . n 
C 3 130 PHE 130 107 107 PHE PHE A . n 
C 3 131 GLU 131 108 108 GLU GLU A . n 
C 3 132 THR 132 109 109 THR THR A . n 
C 3 133 ASP 133 110 110 ASP ASP A . n 
C 3 134 ILE 134 111 111 ILE ILE A . n 
C 3 135 GLU 135 112 112 GLU GLU A . n 
C 3 136 PRO 136 113 113 PRO PRO A . n 
C 3 137 TYR 137 114 114 TYR TYR A . n 
C 3 138 SER 138 115 115 SER SER A . n 
C 3 139 VAL 139 116 116 VAL VAL A . n 
C 3 140 THR 140 117 117 THR THR A . n 
C 3 141 ARG 141 118 118 ARG ARG A . n 
C 3 142 ASP 142 119 119 ASP ASP A . n 
C 3 143 ALA 143 120 120 ALA ALA A . n 
C 3 144 ALA 144 121 121 ALA ALA A . n 
C 3 145 VAL 145 122 122 VAL VAL A . n 
C 3 146 GLN 146 123 123 GLN GLN A . n 
C 3 147 LYS 147 124 124 LYS LYS A . n 
C 3 148 LEU 148 125 125 LEU LEU A . n 
C 3 149 ALA 149 126 126 ALA ALA A . n 
C 3 150 LYS 150 127 127 LYS LYS A . n 
C 3 151 ALA 151 128 128 ALA ALA A . n 
C 3 152 GLU 152 129 129 GLU GLU A . n 
C 3 153 GLY 153 130 130 GLY GLY A . n 
C 3 154 VAL 154 131 131 VAL VAL A . n 
C 3 155 ARG 155 132 132 ARG ARG A . n 
C 3 156 VAL 156 133 133 VAL VAL A . n 
C 3 157 GLU 157 134 134 GLU GLU A . n 
C 3 158 THR 158 135 135 THR THR A . n 
C 3 159 HIS 159 136 136 HIS HIS A . n 
C 3 160 CYS 160 137 137 CYS CYS A . n 
C 3 161 SER 161 138 138 SER SER A . n 
C 3 162 HIS 162 139 139 HIS HIS A . n 
C 3 163 THR 163 140 140 THR THR A . n 
C 3 164 ILE 164 141 141 ILE ILE A . n 
C 3 165 TYR 165 142 142 TYR TYR A . n 
C 3 166 ASN 166 143 143 ASN ASN A . n 
C 3 167 PRO 167 144 144 PRO PRO A . n 
C 3 168 GLU 168 145 145 GLU GLU A . n 
C 3 169 LEU 169 146 146 LEU LEU A . n 
C 3 170 VAL 170 147 147 VAL VAL A . n 
C 3 171 ILE 171 148 148 ILE ILE A . n 
C 3 172 ALA 172 149 149 ALA ALA A . n 
C 3 173 LYS 173 150 150 LYS LYS A . n 
C 3 174 ASN 174 151 151 ASN ASN A . n 
C 3 175 LEU 175 152 152 LEU LEU A . n 
C 3 176 GLY 176 153 153 GLY GLY A . n 
C 3 177 LYS 177 154 154 LYS LYS A . n 
C 3 178 ALA 178 155 155 ALA ALA A . n 
C 3 179 PRO 179 156 156 PRO PRO A . n 
C 3 180 ILE 180 157 157 ILE ILE A . n 
C 3 181 THR 181 158 158 THR THR A . n 
C 3 182 TYR 182 159 159 TYR TYR A . n 
C 3 183 GLN 183 160 160 GLN GLN A . n 
C 3 184 LYS 184 161 161 LYS LYS A . n 
C 3 185 PHE 185 162 162 PHE PHE A . n 
C 3 186 LEU 186 163 163 LEU LEU A . n 
C 3 187 GLY 187 164 164 GLY GLY A . n 
C 3 188 ILE 188 165 165 ILE ILE A . n 
C 3 189 VAL 189 166 166 VAL VAL A . n 
C 3 190 GLU 190 167 167 GLU GLU A . n 
C 3 191 GLN 191 168 168 GLN GLN A . n 
C 3 192 LEU 192 169 169 LEU LEU A . n 
C 3 193 LYS 193 170 170 LYS LYS A . n 
C 3 194 VAL 194 171 171 VAL VAL A . n 
C 3 195 PRO 195 172 172 PRO PRO A . n 
C 3 196 LYS 196 173 173 LYS LYS A . n 
C 3 197 VAL 197 174 174 VAL VAL A . n 
C 3 198 LEU 198 175 175 LEU LEU A . n 
C 3 199 GLY 199 176 176 GLY GLY A . n 
C 3 200 VAL 200 177 177 VAL VAL A . n 
C 3 201 PRO 201 178 178 PRO PRO A . n 
C 3 202 GLU 202 179 179 GLU GLU A . n 
C 3 203 LYS 203 180 180 LYS LYS A . n 
C 3 204 LEU 204 181 181 LEU LEU A . n 
C 3 205 LYS 205 182 182 LYS LYS A . n 
C 3 206 ASN 206 183 183 ASN ASN A . n 
C 3 207 MET 207 184 184 MET MET A . n 
C 3 208 PRO 208 185 185 PRO PRO A . n 
C 3 209 THR 209 186 186 THR THR A . n 
C 3 210 PRO 210 187 187 PRO PRO A . n 
C 3 211 PRO 211 188 188 PRO PRO A . n 
C 3 212 LYS 212 189 189 LYS LYS A . n 
C 3 213 ASP 213 190 190 ASP ASP A . n 
C 3 214 GLU 214 191 191 GLU GLU A . n 
C 3 215 VAL 215 192 192 VAL VAL A . n 
C 3 216 GLU 216 193 193 GLU GLU A . n 
C 3 217 GLN 217 194 194 GLN GLN A . n 
C 3 218 LYS 218 195 195 LYS LYS A . n 
C 3 219 ASP 219 196 196 ASP ASP A . n 
C 3 220 SER 220 197 197 SER SER A . n 
C 3 221 ALA 221 198 198 ALA ALA A . n 
C 3 222 ALA 222 199 199 ALA ALA A . n 
C 3 223 TYR 223 200 200 TYR TYR A . n 
C 3 224 ASP 224 201 201 ASP ASP A . n 
C 3 225 CYS 225 202 202 CYS CYS A . n 
C 3 226 PRO 226 203 203 PRO PRO A . n 
C 3 227 THR 227 204 204 THR THR A . n 
C 3 228 MET 228 205 205 MET MET A . n 
C 3 229 LYS 229 206 206 LYS LYS A . n 
C 3 230 GLN 230 207 207 GLN GLN A . n 
C 3 231 LEU 231 208 208 LEU LEU A . n 
C 3 232 VAL 232 209 209 VAL VAL A . n 
C 3 233 LYS 233 210 210 LYS LYS A . n 
C 3 234 ARG 234 211 211 ARG ARG A . n 
C 3 235 PRO 235 212 212 PRO PRO A . n 
C 3 236 GLU 236 213 213 GLU GLU A . n 
C 3 237 GLU 237 214 214 GLU GLU A . n 
C 3 238 LEU 238 215 215 LEU LEU A . n 
C 3 239 GLY 239 216 216 GLY GLY A . n 
C 3 240 PRO 240 217 217 PRO PRO A . n 
C 3 241 ASN 241 218 218 ASN ASN A . n 
C 3 242 LYS 242 219 219 LYS LYS A . n 
C 3 243 PHE 243 220 220 PHE PHE A . n 
C 3 244 PRO 244 221 221 PRO PRO A . n 
C 3 245 GLY 245 222 222 GLY GLY A . n 
C 3 246 GLY 246 223 223 GLY GLY A . n 
C 3 247 GLU 247 224 224 GLU GLU A . n 
C 3 248 THR 248 225 225 THR THR A . n 
C 3 249 GLU 249 226 226 GLU GLU A . n 
C 3 250 ALA 250 227 227 ALA ALA A . n 
C 3 251 LEU 251 228 228 LEU LEU A . n 
C 3 252 ARG 252 229 229 ARG ARG A . n 
C 3 253 ARG 253 230 230 ARG ARG A . n 
C 3 254 MET 254 231 231 MET MET A . n 
C 3 255 GLU 255 232 232 GLU GLU A . n 
C 3 256 GLU 256 233 233 GLU GLU A . n 
C 3 257 SER 257 234 234 SER SER A . n 
C 3 258 LEU 258 235 235 LEU LEU A . n 
C 3 259 LYS 259 236 236 LYS LYS A . n 
C 3 260 ASP 260 237 237 ASP ASP A . n 
C 3 261 GLU 261 238 238 GLU GLU A . n 
C 3 262 ILE 262 239 239 ILE ILE A . n 
C 3 263 TRP 263 240 240 TRP TRP A . n 
C 3 264 VAL 264 241 241 VAL VAL A . n 
C 3 265 ALA 265 242 242 ALA ALA A . n 
C 3 266 ARG 266 243 243 ARG ARG A . n 
C 3 267 PHE 267 244 244 PHE PHE A . n 
C 3 268 GLU 268 245 245 GLU GLU A . n 
C 3 269 LYS 269 246 246 LYS LYS A . n 
C 3 270 PRO 270 247 247 PRO PRO A . n 
C 3 271 ASN 271 248 248 ASN ASN A . n 
C 3 272 THR 272 249 249 THR THR A . n 
C 3 273 ALA 273 250 250 ALA ALA A . n 
C 3 274 PRO 274 251 251 PRO PRO A . n 
C 3 275 ASN 275 252 252 ASN ASN A . n 
C 3 276 SER 276 253 253 SER SER A . n 
C 3 277 LEU 277 254 254 LEU LEU A . n 
C 3 278 GLU 278 255 255 GLU GLU A . n 
C 3 279 PRO 279 256 256 PRO PRO A . n 
C 3 280 SER 280 257 257 SER SER A . n 
C 3 281 THR 281 258 258 THR THR A . n 
C 3 282 THR 282 259 259 THR THR A . n 
C 3 283 VAL 283 260 260 VAL VAL A . n 
C 3 284 LEU 284 261 261 LEU LEU A . n 
C 3 285 SER 285 262 262 SER SER A . n 
C 3 286 PRO 286 263 263 PRO PRO A . n 
C 3 287 TYR 287 264 264 TYR TYR A . n 
C 3 288 LEU 288 265 265 LEU LEU A . n 
C 3 289 LYS 289 266 266 LYS LYS A . n 
C 3 290 PHE 290 267 267 PHE PHE A . n 
C 3 291 GLY 291 268 268 GLY GLY A . n 
C 3 292 CYS 292 269 269 CYS CYS A . n 
C 3 293 LEU 293 270 270 LEU LEU A . n 
C 3 294 SER 294 271 271 SER SER A . n 
C 3 295 ALA 295 272 272 ALA ALA A . n 
C 3 296 ARG 296 273 273 ARG ARG A . n 
C 3 297 LEU 297 274 274 LEU LEU A . n 
C 3 298 PHE 298 275 275 PHE PHE A . n 
C 3 299 ASN 299 276 276 ASN ASN A . n 
C 3 300 GLN 300 277 277 GLN GLN A . n 
C 3 301 LYS 301 278 278 LYS LYS A . n 
C 3 302 LEU 302 279 279 LEU LEU A . n 
C 3 303 LYS 303 280 280 LYS LYS A . n 
C 3 304 GLU 304 281 281 GLU GLU A . n 
C 3 305 ILE 305 282 282 ILE ILE A . n 
C 3 306 ILE 306 283 283 ILE ILE A . n 
C 3 307 LYS 307 284 284 LYS LYS A . n 
C 3 308 ARG 308 285 285 ARG ARG A . n 
C 3 309 GLN 309 286 286 GLN GLN A . n 
C 3 310 PRO 310 287 287 PRO PRO A . n 
C 3 311 LYS 311 288 288 LYS LYS A . n 
C 3 312 HIS 312 289 289 HIS HIS A . n 
C 3 313 SER 313 290 290 SER SER A . n 
C 3 314 GLN 314 291 291 GLN GLN A . n 
C 3 315 PRO 315 292 292 PRO PRO A . n 
C 3 316 PRO 316 293 293 PRO PRO A . n 
C 3 317 VAL 317 294 294 VAL VAL A . n 
C 3 318 SER 318 295 295 SER SER A . n 
C 3 319 LEU 319 296 296 LEU LEU A . n 
C 3 320 ILE 320 297 297 ILE ILE A . n 
C 3 321 GLY 321 298 298 GLY GLY A . n 
C 3 322 GLN 322 299 299 GLN GLN A . n 
C 3 323 LEU 323 300 300 LEU LEU A . n 
C 3 324 MET 324 301 301 MET MET A . n 
C 3 325 TRP 325 302 302 TRP TRP A . n 
C 3 326 ARG 326 303 303 ARG ARG A . n 
C 3 327 GLU 327 304 304 GLU GLU A . n 
C 3 328 PHE 328 305 305 PHE PHE A . n 
C 3 329 TYR 329 306 306 TYR TYR A . n 
C 3 330 TYR 330 307 307 TYR TYR A . n 
C 3 331 THR 331 308 308 THR THR A . n 
C 3 332 VAL 332 309 309 VAL VAL A . n 
C 3 333 ALA 333 310 310 ALA ALA A . n 
C 3 334 ALA 334 311 311 ALA ALA A . n 
C 3 335 ALA 335 312 312 ALA ALA A . n 
C 3 336 GLU 336 313 313 GLU GLU A . n 
C 3 337 PRO 337 314 314 PRO PRO A . n 
C 3 338 ASN 338 315 315 ASN ASN A . n 
C 3 339 PHE 339 316 316 PHE PHE A . n 
C 3 340 ASP 340 317 317 ASP ASP A . n 
C 3 341 ARG 341 318 318 ARG ARG A . n 
C 3 342 MET 342 319 319 MET MET A . n 
C 3 343 LEU 343 320 320 LEU LEU A . n 
C 3 344 GLY 344 321 321 GLY GLY A . n 
C 3 345 ASN 345 322 322 ASN ASN A . n 
C 3 346 VAL 346 323 323 VAL VAL A . n 
C 3 347 TYR 347 324 324 TYR TYR A . n 
C 3 348 CYS 348 325 325 CYS CYS A . n 
C 3 349 MET 349 326 326 MET MET A . n 
C 3 350 GLN 350 327 327 GLN GLN A . n 
C 3 351 ILE 351 328 328 ILE ILE A . n 
C 3 352 PRO 352 329 329 PRO PRO A . n 
C 3 353 TRP 353 330 330 TRP TRP A . n 
C 3 354 GLN 354 331 331 GLN GLN A . n 
C 3 355 GLU 355 332 332 GLU GLU A . n 
C 3 356 HIS 356 333 333 HIS HIS A . n 
C 3 357 PRO 357 334 334 PRO PRO A . n 
C 3 358 ASP 358 335 335 ASP ASP A . n 
C 3 359 HIS 359 336 336 HIS HIS A . n 
C 3 360 LEU 360 337 337 LEU LEU A . n 
C 3 361 GLU 361 338 338 GLU GLU A . n 
C 3 362 ALA 362 339 339 ALA ALA A . n 
C 3 363 TRP 363 340 340 TRP TRP A . n 
C 3 364 THR 364 341 341 THR THR A . n 
C 3 365 HIS 365 342 342 HIS HIS A . n 
C 3 366 GLY 366 343 343 GLY GLY A . n 
C 3 367 ARG 367 344 344 ARG ARG A . n 
C 3 368 THR 368 345 345 THR THR A . n 
C 3 369 GLY 369 346 346 GLY GLY A . n 
C 3 370 TYR 370 347 347 TYR TYR A . n 
C 3 371 PRO 371 348 348 PRO PRO A . n 
C 3 372 PHE 372 349 349 PHE PHE A . n 
C 3 373 ILE 373 350 350 ILE ILE A . n 
C 3 374 ASP 374 351 351 ASP ASP A . n 
C 3 375 ALA 375 352 352 ALA ALA A . n 
C 3 376 ILE 376 353 353 ILE ILE A . n 
C 3 377 MET 377 354 354 MET MET A . n 
C 3 378 ARG 378 355 355 ARG ARG A . n 
C 3 379 GLN 379 356 356 GLN GLN A . n 
C 3 380 LEU 380 357 357 LEU LEU A . n 
C 3 381 ARG 381 358 358 ARG ARG A . n 
C 3 382 GLN 382 359 359 GLN GLN A . n 
C 3 383 GLU 383 360 360 GLU GLU A . n 
C 3 384 GLY 384 361 361 GLY GLY A . n 
C 3 385 TRP 385 362 362 TRP TRP A . n 
C 3 386 ILE 386 363 363 ILE ILE A . n 
C 3 387 HIS 387 364 364 HIS HIS A . n 
C 3 388 ASN 388 365 365 ASN ASN A . n 
C 3 389 LEU 389 366 366 LEU LEU A . n 
C 3 390 ALA 390 367 367 ALA ALA A . n 
C 3 391 ARG 391 368 368 ARG ARG A . n 
C 3 392 HIS 392 369 369 HIS HIS A . n 
C 3 393 ALA 393 370 370 ALA ALA A . n 
C 3 394 VAL 394 371 371 VAL VAL A . n 
C 3 395 ALA 395 372 372 ALA ALA A . n 
C 3 396 CYS 396 373 373 CYS CYS A . n 
C 3 397 PHE 397 374 374 PHE PHE A . n 
C 3 398 LEU 398 375 375 LEU LEU A . n 
C 3 399 THR 399 376 376 THR THR A . n 
C 3 400 ARG 400 377 377 ARG ARG A . n 
C 3 401 GLY 401 378 378 GLY GLY A . n 
C 3 402 ASP 402 379 379 ASP ASP A . n 
C 3 403 LEU 403 380 380 LEU LEU A . n 
C 3 404 TRP 404 381 381 TRP TRP A . n 
C 3 405 ILE 405 382 382 ILE ILE A . n 
C 3 406 SER 406 383 383 SER SER A . n 
C 3 407 TRP 407 384 384 TRP TRP A . n 
C 3 408 GLU 408 385 385 GLU GLU A . n 
C 3 409 GLU 409 386 386 GLU GLU A . n 
C 3 410 GLY 410 387 387 GLY GLY A . n 
C 3 411 GLN 411 388 388 GLN GLN A . n 
C 3 412 ARG 412 389 389 ARG ARG A . n 
C 3 413 VAL 413 390 390 VAL VAL A . n 
C 3 414 PHE 414 391 391 PHE PHE A . n 
C 3 415 GLU 415 392 392 GLU GLU A . n 
C 3 416 GLN 416 393 393 GLN GLN A . n 
C 3 417 LEU 417 394 394 LEU LEU A . n 
C 3 418 LEU 418 395 395 LEU LEU A . n 
C 3 419 LEU 419 396 396 LEU LEU A . n 
C 3 420 ASP 420 397 397 ASP ASP A . n 
C 3 421 GLN 421 398 398 GLN GLN A . n 
C 3 422 ASP 422 399 399 ASP ASP A . n 
C 3 423 TRP 423 400 400 TRP TRP A . n 
C 3 424 ALA 424 401 401 ALA ALA A . n 
C 3 425 LEU 425 402 402 LEU LEU A . n 
C 3 426 ASN 426 403 403 ASN ASN A . n 
C 3 427 ALA 427 404 404 ALA ALA A . n 
C 3 428 GLY 428 405 405 GLY GLY A . n 
C 3 429 ASN 429 406 406 ASN ASN A . n 
C 3 430 TRP 430 407 407 TRP TRP A . n 
C 3 431 MET 431 408 408 MET MET A . n 
C 3 432 TRP 432 409 409 TRP TRP A . n 
C 3 433 LEU 433 410 410 LEU LEU A . n 
C 3 434 SER 434 411 411 SER SER A . n 
C 3 435 ALA 435 412 412 ALA ALA A . n 
C 3 436 SER 436 413 413 SER SER A . n 
C 3 437 ALA 437 414 414 ALA ALA A . n 
C 3 438 PHE 438 415 415 PHE PHE A . n 
C 3 439 PHE 439 416 416 PHE PHE A . n 
C 3 440 HIS 440 417 417 HIS HIS A . n 
C 3 441 GLN 441 418 418 GLN GLN A . n 
C 3 442 TYR 442 419 419 TYR TYR A . n 
C 3 443 PHE 443 420 420 PHE PHE A . n 
C 3 444 ARG 444 421 421 ARG ARG A . n 
C 3 445 VAL 445 422 422 VAL VAL A . n 
C 3 446 TYR 446 423 423 TYR TYR A . n 
C 3 447 SER 447 424 424 SER SER A . n 
C 3 448 PRO 448 425 425 PRO PRO A . n 
C 3 449 VAL 449 426 426 VAL VAL A . n 
C 3 450 ALA 450 427 427 ALA ALA A . n 
C 3 451 PHE 451 428 428 PHE PHE A . n 
C 3 452 GLY 452 429 429 GLY GLY A . n 
C 3 453 LYS 453 430 430 LYS LYS A . n 
C 3 454 LYS 454 431 431 LYS LYS A . n 
C 3 455 THR 455 432 432 THR THR A . n 
C 3 456 ASP 456 433 433 ASP ASP A . n 
C 3 457 PRO 457 434 434 PRO PRO A . n 
C 3 458 GLN 458 435 435 GLN GLN A . n 
C 3 459 GLY 459 436 436 GLY GLY A . n 
C 3 460 HIS 460 437 437 HIS HIS A . n 
C 3 461 TYR 461 438 438 TYR TYR A . n 
C 3 462 ILE 462 439 439 ILE ILE A . n 
C 3 463 ARG 463 440 440 ARG ARG A . n 
C 3 464 LYS 464 441 441 LYS LYS A . n 
C 3 465 TYR 465 442 442 TYR TYR A . n 
C 3 466 VAL 466 443 443 VAL VAL A . n 
C 3 467 PRO 467 444 444 PRO PRO A . n 
C 3 468 GLU 468 445 445 GLU GLU A . n 
C 3 469 LEU 469 446 446 LEU LEU A . n 
C 3 470 SER 470 447 447 SER SER A . n 
C 3 471 LYS 471 448 448 LYS LYS A . n 
C 3 472 TYR 472 449 449 TYR TYR A . n 
C 3 473 PRO 473 450 450 PRO PRO A . n 
C 3 474 ALA 474 451 451 ALA ALA A . n 
C 3 475 GLY 475 452 452 GLY GLY A . n 
C 3 476 CYS 476 453 453 CYS CYS A . n 
C 3 477 ILE 477 454 454 ILE ILE A . n 
C 3 478 TYR 478 455 455 TYR TYR A . n 
C 3 479 GLU 479 456 456 GLU GLU A . n 
C 3 480 PRO 480 457 457 PRO PRO A . n 
C 3 481 TRP 481 458 458 TRP TRP A . n 
C 3 482 LYS 482 459 459 LYS LYS A . n 
C 3 483 ALA 483 460 460 ALA ALA A . n 
C 3 484 SER 484 461 461 SER SER A . n 
C 3 485 LEU 485 462 462 LEU LEU A . n 
C 3 486 VAL 486 463 463 VAL VAL A . n 
C 3 487 ASP 487 464 464 ASP ASP A . n 
C 3 488 GLN 488 465 465 GLN GLN A . n 
C 3 489 ARG 489 466 466 ARG ARG A . n 
C 3 490 ALA 490 467 467 ALA ALA A . n 
C 3 491 TYR 491 468 468 TYR TYR A . n 
C 3 492 GLY 492 469 469 GLY GLY A . n 
C 3 493 CYS 493 470 470 CYS CYS A . n 
C 3 494 VAL 494 471 471 VAL VAL A . n 
C 3 495 LEU 495 472 472 LEU LEU A . n 
C 3 496 GLY 496 473 473 GLY GLY A . n 
C 3 497 THR 497 474 474 THR THR A . n 
C 3 498 ASP 498 475 475 ASP ASP A . n 
C 3 499 TYR 499 476 476 TYR TYR A . n 
C 3 500 PRO 500 477 477 PRO PRO A . n 
C 3 501 HIS 501 478 478 HIS HIS A . n 
C 3 502 ARG 502 479 479 ARG ARG A . n 
C 3 503 ILE 503 480 480 ILE ILE A . n 
C 3 504 VAL 504 481 481 VAL VAL A . n 
C 3 505 LYS 505 482 482 LYS LYS A . n 
C 3 506 HIS 506 483 483 HIS HIS A . n 
C 3 507 GLU 507 484 484 GLU GLU A . n 
C 3 508 VAL 508 485 485 VAL VAL A . n 
C 3 509 VAL 509 486 486 VAL VAL A . n 
C 3 510 HIS 510 487 487 HIS HIS A . n 
C 3 511 LYS 511 488 488 LYS LYS A . n 
C 3 512 GLU 512 489 489 GLU GLU A . n 
C 3 513 ASN 513 490 490 ASN ASN A . n 
C 3 514 ILE 514 491 491 ILE ILE A . n 
C 3 515 LYS 515 492 492 LYS LYS A . n 
C 3 516 ARG 516 493 493 ARG ARG A . n 
C 3 517 MET 517 494 494 MET MET A . n 
C 3 518 GLY 518 495 495 GLY GLY A . n 
C 3 519 ALA 519 496 496 ALA ALA A . n 
C 3 520 ALA 520 497 497 ALA ALA A . n 
C 3 521 TYR 521 498 498 TYR TYR A . n 
C 3 522 LYS 522 499 499 LYS LYS A . n 
C 3 523 VAL 523 500 500 VAL VAL A . n 
C 3 524 ASN 524 501 501 ASN ASN A . n 
C 3 525 ARG 525 502 502 ARG ARG A . n 
C 3 526 GLU 526 503 503 GLU GLU A . n 
C 3 527 VAL 527 504 504 VAL VAL A . n 
C 3 528 ARG 528 505 505 ARG ARG A . n 
C 3 529 THR 529 506 ?   ?   ?   A . n 
C 3 530 GLY 530 507 ?   ?   ?   A . n 
C 3 531 LYS 531 508 ?   ?   ?   A . n 
C 3 532 GLU 532 509 ?   ?   ?   A . n 
C 3 533 GLU 533 510 ?   ?   ?   A . n 
C 3 534 GLU 534 511 ?   ?   ?   A . n 
C 3 535 SER 535 512 ?   ?   ?   A . n 
C 3 536 SER 536 513 ?   ?   ?   A . n 
C 3 537 PHE 537 514 ?   ?   ?   A . n 
C 3 538 GLU 538 515 ?   ?   ?   A . n 
C 3 539 GLU 539 516 ?   ?   ?   A . n 
C 3 540 LYS 540 517 ?   ?   ?   A . n 
C 3 541 SER 541 518 ?   ?   ?   A . n 
C 3 542 GLU 542 519 ?   ?   ?   A . n 
C 3 543 THR 543 520 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 FAD 1  521  1    FAD FAD A . 
E 5 FO1 1  1422 1422 FO1 HDB A . 
F 6 HOH 1  16   16   HOH HOH C . 
G 6 HOH 1  1423 1    HOH HOH A . 
G 6 HOH 2  1424 2    HOH HOH A . 
G 6 HOH 3  1425 3    HOH HOH A . 
G 6 HOH 4  1426 4    HOH HOH A . 
G 6 HOH 5  1427 6    HOH HOH A . 
G 6 HOH 6  1428 7    HOH HOH A . 
G 6 HOH 7  1429 8    HOH HOH A . 
G 6 HOH 8  1430 9    HOH HOH A . 
G 6 HOH 9  1431 11   HOH HOH A . 
G 6 HOH 10 1432 12   HOH HOH A . 
G 6 HOH 11 1433 15   HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A 64T 8 C 64T 8 ? DT "5-HYDROXY-THYMIDINE-5'-MONOPHOSPHATE" 
2 A 5PY 9 C 5PY 9 ? DT ?                                      
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5680  ? 
1 MORE         -20   ? 
1 'SSA (A^2)'  24910 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-10-13 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-10-25 
4 'Structure model' 1 3 2021-10-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Refinement description'    
3 4 'Structure model' 'Database references'       
4 4 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' software           
2 4 'Structure model' database_2         
3 4 'Structure model' struct_conn        
4 4 'Structure model' struct_ref_seq_dif 
5 4 'Structure model' struct_site        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  3 'Structure model' '_software.name'                      
2  4 'Structure model' '_database_2.pdbx_DOI'                
3  4 'Structure model' '_database_2.pdbx_database_accession' 
4  4 'Structure model' '_struct_conn.pdbx_dist_value'        
5  4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
6  4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'     
7  4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'      
8  4 'Structure model' '_struct_conn.ptnr1_label_atom_id'    
9  4 'Structure model' '_struct_conn.ptnr1_label_comp_id'    
10 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'     
11 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'     
12 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'      
13 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'    
14 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'    
15 4 'Structure model' '_struct_conn.ptnr2_label_seq_id'     
16 4 'Structure model' '_struct_ref_seq_dif.details'         
17 4 'Structure model' '_struct_site.pdbx_auth_asym_id'      
18 4 'Structure model' '_struct_site.pdbx_auth_comp_id'      
19 4 'Structure model' '_struct_site.pdbx_auth_seq_id'       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement        5.2.0005 ? 1 
MAR345 'data collection' software ? 2 
XDS    'data reduction'  .        ? 3 
XSCALE 'data scaling'    .        ? 4 
REFMAC phasing           .        ? 5 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "O4'" C DC 2  ? ? "C1'" C DC 2  ? ? N1    C DC 2  ? ? 110.76 108.30 2.46  0.30 N 
2  1 "O4'" C DG 13 ? ? "C1'" C DG 13 ? ? N9    C DG 13 ? ? 111.91 108.30 3.61  0.30 N 
3  1 "O4'" C DG 14 ? ? "C4'" C DG 14 ? ? "C3'" C DG 14 ? ? 101.96 104.50 -2.54 0.40 N 
4  1 "O4'" C DG 14 ? ? "C1'" C DG 14 ? ? N9    C DG 14 ? ? 110.98 108.30 2.68  0.30 N 
5  1 "O4'" C DT 15 ? ? "C1'" C DT 15 ? ? N1    C DT 15 ? ? 110.13 108.30 1.83  0.30 N 
6  1 "O4'" D DT 1  ? ? "C1'" D DT 1  ? ? N1    D DT 1  ? ? 110.26 108.30 1.96  0.30 N 
7  1 "O4'" D DC 3  ? ? "C1'" D DC 3  ? ? N1    D DC 3  ? ? 112.79 108.30 4.49  0.30 N 
8  1 "O4'" D DC 4  ? ? "C1'" D DC 4  ? ? N1    D DC 4  ? ? 111.23 108.30 2.93  0.30 N 
9  1 "O4'" D DT 5  ? ? "C1'" D DT 5  ? ? N1    D DT 5  ? ? 110.67 108.30 2.37  0.30 N 
10 1 "O4'" D DA 9  ? ? "C4'" D DA 9  ? ? "C3'" D DA 9  ? ? 101.98 104.50 -2.52 0.40 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ARG A 13  ? ? -138.56 -78.52  
2  1 ASN A 79  ? ? 59.06   15.95   
3  1 SER A 80  ? ? -117.21 -151.44 
4  1 ARG A 101 ? ? 63.48   72.60   
5  1 ASN A 151 ? ? -101.07 41.88   
6  1 GLN A 168 ? ? -98.37  35.79   
7  1 ASP A 190 ? ? -78.42  -169.15 
8  1 ALA A 198 ? ? -93.79  35.12   
9  1 ASN A 315 ? ? -95.74  34.01   
10 1 PRO A 329 ? ? -69.88  87.29   
11 1 HIS A 333 ? ? -162.44 80.58   
12 1 THR A 376 ? ? -92.77  -121.84 
13 1 ASP A 379 ? ? -125.15 -66.51  
14 1 GLN A 398 ? ? -47.91  105.30  
15 1 PHE A 415 ? ? 62.30   -56.13  
16 1 VAL A 443 ? ? -119.54 76.40   
17 1 CYS A 453 ? ? -152.86 28.64   
18 1 THR A 474 ? ? -107.62 -68.44  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -22 ? C MET 1   
2  1 Y 1 A ALA -21 ? C ALA 2   
3  1 Y 1 A SER -20 ? C SER 3   
4  1 Y 1 A TRP -19 ? C TRP 4   
5  1 Y 1 A SER -18 ? C SER 5   
6  1 Y 1 A HIS -17 ? C HIS 6   
7  1 Y 1 A PRO -16 ? C PRO 7   
8  1 Y 1 A GLN -15 ? C GLN 8   
9  1 Y 1 A PHE -14 ? C PHE 9   
10 1 Y 1 A GLU -13 ? C GLU 10  
11 1 Y 1 A LYS -12 ? C LYS 11  
12 1 Y 1 A GLY -11 ? C GLY 12  
13 1 Y 1 A ALA -10 ? C ALA 13  
14 1 Y 1 A SER -9  ? C SER 14  
15 1 Y 1 A THR -8  ? C THR 15  
16 1 Y 1 A SER -7  ? C SER 16  
17 1 Y 1 A LEU -6  ? C LEU 17  
18 1 Y 1 A TYR -5  ? C TYR 18  
19 1 Y 1 A LYS -4  ? C LYS 19  
20 1 Y 1 A LYS -3  ? C LYS 20  
21 1 Y 1 A ALA -2  ? C ALA 21  
22 1 Y 1 A GLY -1  ? C GLY 22  
23 1 Y 1 A LEU 0   ? C LEU 23  
24 1 Y 1 A MET 1   ? C MET 24  
25 1 Y 1 A ASP 2   ? C ASP 25  
26 1 Y 1 A SER 3   ? C SER 26  
27 1 Y 1 A THR 506 ? C THR 529 
28 1 Y 1 A GLY 507 ? C GLY 530 
29 1 Y 1 A LYS 508 ? C LYS 531 
30 1 Y 1 A GLU 509 ? C GLU 532 
31 1 Y 1 A GLU 510 ? C GLU 533 
32 1 Y 1 A GLU 511 ? C GLU 534 
33 1 Y 1 A SER 512 ? C SER 535 
34 1 Y 1 A SER 513 ? C SER 536 
35 1 Y 1 A PHE 514 ? C PHE 537 
36 1 Y 1 A GLU 515 ? C GLU 538 
37 1 Y 1 A GLU 516 ? C GLU 539 
38 1 Y 1 A LYS 517 ? C LYS 540 
39 1 Y 1 A SER 518 ? C SER 541 
40 1 Y 1 A GLU 519 ? C GLU 542 
41 1 Y 1 A THR 520 ? C THR 543 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
3CVW 'double helix'        
3CVW 'b-form double helix' 
3CVW 'internal loop'       
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DC 2  1_555 B DG 15 1_555 -0.686 0.156  -0.291 -11.082 -10.493 -11.193 1  C_DC2:DG15_D C 2  ? D 15 ? ?  ? 
1 A DA 3  1_555 B DT 14 1_555 -0.558 -0.146 0.477  1.825   -11.074 7.290   2  C_DA3:DT14_D C 3  ? D 14 ? 20 1 
1 A DG 4  1_555 B DC 13 1_555 -0.042 0.475  0.311  -0.368  -12.302 10.163  3  C_DG4:DC13_D C 4  ? D 13 ? ?  1 
1 A DC 5  1_555 B DG 12 1_555 0.325  -0.307 0.369  -1.313  -12.659 -4.984  4  C_DC5:DG12_D C 5  ? D 12 ? 19 1 
1 A DG 6  1_555 B DC 11 1_555 0.304  0.014  0.482  8.692   -18.549 2.227   5  C_DG6:DC11_D C 6  ? D 11 ? 19 1 
1 A DG 7  1_555 B DC 10 1_555 0.407  -0.151 1.388  23.119  -13.260 -0.702  6  C_DG7:DC10_D C 7  ? D 10 ? 19 1 
1 A DG 10 1_555 B DC 7  1_555 -1.681 -0.091 0.258  4.780   7.044   12.557  7  C_DG10:DC7_D C 10 ? D 7  ? ?  1 
1 A DC 11 1_555 B DG 6  1_555 -0.738 -0.086 0.339  2.542   -8.212  -3.596  8  C_DC11:DG6_D C 11 ? D 6  ? 19 1 
1 A DA 12 1_555 B DT 5  1_555 1.088  0.262  -0.078 0.834   -6.187  -4.538  9  C_DA12:DT5_D C 12 ? D 5  ? 20 1 
1 A DG 13 1_555 B DC 4  1_555 -0.836 -0.523 -0.418 4.425   -21.010 3.984   10 C_DG13:DC4_D C 13 ? D 4  ? 19 1 
1 A DG 14 1_555 B DC 3  1_555 -0.440 0.182  0.492  -11.052 -8.118  2.767   11 C_DG14:DC3_D C 14 ? D 3  ? 19 1 
1 A DT 15 1_555 B DA 2  1_555 0.377  0.213  0.307  -1.329  -3.398  8.863   12 C_DT15:DA2_D C 15 ? D 2  ? ?  1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DC 2  1_555 B DG 15 1_555 A DA 3  1_555 B DT 14 1_555 0.634  0.348  3.035 -9.111 6.970  30.791 -0.479 -2.553 2.754 12.591 
16.459 32.810 1  CC_DC2DA3:DT14DG15_DD C 2  ? D 15 ? C 3  ? D 14 ? 
1 A DA 3  1_555 B DT 14 1_555 A DG 4  1_555 B DC 13 1_555 -0.488 0.449  3.359 -1.912 0.855  41.198 0.543  0.480  3.385 1.214  
2.716  41.249 2  CC_DA3DG4:DC13DT14_DD C 3  ? D 14 ? C 4  ? D 13 ? 
1 A DG 4  1_555 B DC 13 1_555 A DC 5  1_555 B DG 12 1_555 -0.782 -0.396 3.303 -1.833 1.459  35.414 -0.866 1.011  3.320 2.395  
3.010  35.489 3  CC_DG4DC5:DG12DC13_DD C 4  ? D 13 ? C 5  ? D 12 ? 
1 A DC 5  1_555 B DG 12 1_555 A DG 6  1_555 B DC 11 1_555 0.482  0.300  3.148 -0.368 5.249  36.828 -0.206 -0.803 3.155 8.257  
0.579  37.189 4  CC_DC5DG6:DC11DG12_DD C 5  ? D 12 ? C 6  ? D 11 ? 
1 A DG 6  1_555 B DC 11 1_555 A DG 7  1_555 B DC 10 1_555 0.438  -0.636 2.886 -7.045 -3.941 33.861 -0.535 -1.679 2.795 -6.650 
11.886 34.782 5  CC_DG6DG7:DC10DC11_DD C 6  ? D 11 ? C 7  ? D 10 ? 
1 A DG 10 1_555 B DC 7  1_555 A DC 11 1_555 B DG 6  1_555 -0.932 -0.868 3.376 -2.383 6.433  36.113 -2.272 1.147  3.232 10.263 
3.802  36.737 6  CC_DG10DC11:DG6DC7_DD C 10 ? D 7  ? C 11 ? D 6  ? 
1 A DC 11 1_555 B DG 6  1_555 A DA 12 1_555 B DT 5  1_555 0.196  -0.063 3.316 4.666  1.717  44.612 -0.240 0.173  3.315 2.253  
-6.124 44.874 7  CC_DC11DA12:DT5DG6_DD C 11 ? D 6  ? C 12 ? D 5  ? 
1 A DA 12 1_555 B DT 5  1_555 A DG 13 1_555 B DC 4  1_555 0.399  -0.739 3.207 -1.710 14.519 16.483 -6.940 -1.634 1.894 41.538 
4.892  21.999 8  CC_DA12DG13:DC4DT5_DD C 12 ? D 5  ? C 13 ? D 4  ? 
1 A DG 13 1_555 B DC 4  1_555 A DG 14 1_555 B DC 3  1_555 1.299  -0.920 3.464 -4.984 -0.883 41.285 -1.198 -2.378 3.310 -1.247 
7.037  41.581 9  CC_DG13DG14:DC3DC4_DD C 13 ? D 4  ? C 14 ? D 3  ? 
1 A DG 14 1_555 B DC 3  1_555 A DT 15 1_555 B DA 2  1_555 -0.228 -0.692 3.170 4.280  0.553  30.489 -1.407 1.235  3.097 1.044  
-8.087 30.786 10 CC_DG14DT15:DA2DC3_DD C 14 ? D 3  ? C 15 ? D 2  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'FLAVIN-ADENINE DINUCLEOTIDE'                                                            FAD 
5 '1-deoxy-1-(8-hydroxy-2,4-dioxo-3,4-dihydropyrimido[4,5-b]quinolin-10(2H)-yl)-D-ribitol' FO1 
6 water                                                                                    HOH 
#