data_3CY2
# 
_entry.id   3CY2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.350 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   3CY2         pdb_00003cy2 10.2210/pdb3cy2/pdb 
RCSB  RCSB047353   ?            ?                   
WWPDB D_1000047353 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3CXW 
;Crystal structure of human proto-oncogene serine threonine kinase (PIM1) in complex with a consensus peptide and a beta carboline ligand I
;
unspecified 
PDB 3CY3 
;Crystal structure of human proto-oncogene serine threonine kinase (PIM1) in complex with a consensus peptide and the JNK inhibitor V
;
unspecified 
# 
_pdbx_database_status.entry_id                        3CY2 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2008-04-25 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Filippakopoulos, P.'                  1  
'Bullock, A.'                          2  
'Fedorov, O.'                          3  
'Huber, K.'                            4  
'Bracher, F.'                          5  
'Pike, A.C.W.'                         6  
'von Delft, F.'                        7  
'Arrowsmith, C.H.'                     8  
'Edwards, A.M.'                        9  
'Bountra, C.'                          10 
'Knapp, S.'                            11 
'Structural Genomics Consortium (SGC)' 12 
# 
_citation.id                        primary 
_citation.title                     
;7,8-Dichloro-1-oxo-beta-carbolines as a Versatile Scaffold for the Development of Potent and Selective Kinase Inhibitors with Unusual Binding Modes
;
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_volume            55 
_citation.page_first                403 
_citation.page_last                 413 
_citation.year                      2012 
_citation.journal_id_ASTM           JMCMAR 
_citation.country                   US 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_id_CSD            0151 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22136433 
_citation.pdbx_database_id_DOI      10.1021/jm201286z 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Huber, K.'           1  ? 
primary 'Brault, L.'          2  ? 
primary 'Fedorov, O.'         3  ? 
primary 'Gasser, C.'          4  ? 
primary 'Filippakopoulos, P.' 5  ? 
primary 'Bullock, A.N.'       6  ? 
primary 'Fabbro, D.'          7  ? 
primary 'Trappe, J.'          8  ? 
primary 'Schwaller, J.'       9  ? 
primary 'Knapp, S.'           10 ? 
primary 'Bracher, F.'         11 ? 
# 
_cell.length_a           98.668 
_cell.length_b           98.668 
_cell.length_c           81.129 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        120.000 
_cell.entry_id           3CY2 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              6 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 65' 
_symmetry.entry_id                         3CY2 
_symmetry.Int_Tables_number                170 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Proto-oncogene serine/threonine-protein kinase Pim-1, Isoform 2'                                     35719.680 
1   2.7.11.1 ? ? ? 
2 polymer     syn 'Pimtide peptide'                                                                                     1592.850  
1   ?        ? ? ? 
3 non-polymer syn 'CHLORIDE ION'                                                                                        35.453    
1   ?        ? ? ? 
4 non-polymer syn "(4R)-7-chloro-9-methyl-1-oxo-1,2,4,9-tetrahydrospiro[beta-carboline-3,4'-piperidine]-4-carbonitrile" 328.796   
1   ?        ? ? ? 
5 non-polymer syn 1,2-ETHANEDIOL                                                                                        62.068    
1   ?        ? ? ? 
6 water       nat water                                                                                                 18.015    
207 ?        ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;SMLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGE
LPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCH
NCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGD
IPFEHDEEIIGGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK
;
;SMLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGE
LPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCH
NCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGD
IPFEHDEEIIGGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK
;
A ? 
2 'polypeptide(L)' no no ARKRRRHPSGPPTA ARKRRRHPSGPPTA B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   MET n 
1 3   LEU n 
1 4   LEU n 
1 5   SER n 
1 6   LYS n 
1 7   ILE n 
1 8   ASN n 
1 9   SER n 
1 10  LEU n 
1 11  ALA n 
1 12  HIS n 
1 13  LEU n 
1 14  ARG n 
1 15  ALA n 
1 16  ALA n 
1 17  PRO n 
1 18  CYS n 
1 19  ASN n 
1 20  ASP n 
1 21  LEU n 
1 22  HIS n 
1 23  ALA n 
1 24  THR n 
1 25  LYS n 
1 26  LEU n 
1 27  ALA n 
1 28  PRO n 
1 29  GLY n 
1 30  LYS n 
1 31  GLU n 
1 32  LYS n 
1 33  GLU n 
1 34  PRO n 
1 35  LEU n 
1 36  GLU n 
1 37  SER n 
1 38  GLN n 
1 39  TYR n 
1 40  GLN n 
1 41  VAL n 
1 42  GLY n 
1 43  PRO n 
1 44  LEU n 
1 45  LEU n 
1 46  GLY n 
1 47  SER n 
1 48  GLY n 
1 49  GLY n 
1 50  PHE n 
1 51  GLY n 
1 52  SER n 
1 53  VAL n 
1 54  TYR n 
1 55  SER n 
1 56  GLY n 
1 57  ILE n 
1 58  ARG n 
1 59  VAL n 
1 60  SER n 
1 61  ASP n 
1 62  ASN n 
1 63  LEU n 
1 64  PRO n 
1 65  VAL n 
1 66  ALA n 
1 67  ILE n 
1 68  LYS n 
1 69  HIS n 
1 70  VAL n 
1 71  GLU n 
1 72  LYS n 
1 73  ASP n 
1 74  ARG n 
1 75  ILE n 
1 76  SER n 
1 77  ASP n 
1 78  TRP n 
1 79  GLY n 
1 80  GLU n 
1 81  LEU n 
1 82  PRO n 
1 83  ASN n 
1 84  GLY n 
1 85  THR n 
1 86  ARG n 
1 87  VAL n 
1 88  PRO n 
1 89  MET n 
1 90  GLU n 
1 91  VAL n 
1 92  VAL n 
1 93  LEU n 
1 94  LEU n 
1 95  LYS n 
1 96  LYS n 
1 97  VAL n 
1 98  SER n 
1 99  SER n 
1 100 GLY n 
1 101 PHE n 
1 102 SER n 
1 103 GLY n 
1 104 VAL n 
1 105 ILE n 
1 106 ARG n 
1 107 LEU n 
1 108 LEU n 
1 109 ASP n 
1 110 TRP n 
1 111 PHE n 
1 112 GLU n 
1 113 ARG n 
1 114 PRO n 
1 115 ASP n 
1 116 SER n 
1 117 PHE n 
1 118 VAL n 
1 119 LEU n 
1 120 ILE n 
1 121 LEU n 
1 122 GLU n 
1 123 ARG n 
1 124 PRO n 
1 125 GLU n 
1 126 PRO n 
1 127 VAL n 
1 128 GLN n 
1 129 ASP n 
1 130 LEU n 
1 131 PHE n 
1 132 ASP n 
1 133 PHE n 
1 134 ILE n 
1 135 THR n 
1 136 GLU n 
1 137 ARG n 
1 138 GLY n 
1 139 ALA n 
1 140 LEU n 
1 141 GLN n 
1 142 GLU n 
1 143 GLU n 
1 144 LEU n 
1 145 ALA n 
1 146 ARG n 
1 147 SER n 
1 148 PHE n 
1 149 PHE n 
1 150 TRP n 
1 151 GLN n 
1 152 VAL n 
1 153 LEU n 
1 154 GLU n 
1 155 ALA n 
1 156 VAL n 
1 157 ARG n 
1 158 HIS n 
1 159 CYS n 
1 160 HIS n 
1 161 ASN n 
1 162 CYS n 
1 163 GLY n 
1 164 VAL n 
1 165 LEU n 
1 166 HIS n 
1 167 ARG n 
1 168 ASP n 
1 169 ILE n 
1 170 LYS n 
1 171 ASP n 
1 172 GLU n 
1 173 ASN n 
1 174 ILE n 
1 175 LEU n 
1 176 ILE n 
1 177 ASP n 
1 178 LEU n 
1 179 ASN n 
1 180 ARG n 
1 181 GLY n 
1 182 GLU n 
1 183 LEU n 
1 184 LYS n 
1 185 LEU n 
1 186 ILE n 
1 187 ASP n 
1 188 PHE n 
1 189 GLY n 
1 190 SER n 
1 191 GLY n 
1 192 ALA n 
1 193 LEU n 
1 194 LEU n 
1 195 LYS n 
1 196 ASP n 
1 197 THR n 
1 198 VAL n 
1 199 TYR n 
1 200 THR n 
1 201 ASP n 
1 202 PHE n 
1 203 ASP n 
1 204 GLY n 
1 205 THR n 
1 206 ARG n 
1 207 VAL n 
1 208 TYR n 
1 209 SER n 
1 210 PRO n 
1 211 PRO n 
1 212 GLU n 
1 213 TRP n 
1 214 ILE n 
1 215 ARG n 
1 216 TYR n 
1 217 HIS n 
1 218 ARG n 
1 219 TYR n 
1 220 HIS n 
1 221 GLY n 
1 222 ARG n 
1 223 SER n 
1 224 ALA n 
1 225 ALA n 
1 226 VAL n 
1 227 TRP n 
1 228 SER n 
1 229 LEU n 
1 230 GLY n 
1 231 ILE n 
1 232 LEU n 
1 233 LEU n 
1 234 TYR n 
1 235 ASP n 
1 236 MET n 
1 237 VAL n 
1 238 CYS n 
1 239 GLY n 
1 240 ASP n 
1 241 ILE n 
1 242 PRO n 
1 243 PHE n 
1 244 GLU n 
1 245 HIS n 
1 246 ASP n 
1 247 GLU n 
1 248 GLU n 
1 249 ILE n 
1 250 ILE n 
1 251 GLY n 
1 252 GLY n 
1 253 GLN n 
1 254 VAL n 
1 255 PHE n 
1 256 PHE n 
1 257 ARG n 
1 258 GLN n 
1 259 ARG n 
1 260 VAL n 
1 261 SER n 
1 262 SER n 
1 263 GLU n 
1 264 CYS n 
1 265 GLN n 
1 266 HIS n 
1 267 LEU n 
1 268 ILE n 
1 269 ARG n 
1 270 TRP n 
1 271 CYS n 
1 272 LEU n 
1 273 ALA n 
1 274 LEU n 
1 275 ARG n 
1 276 PRO n 
1 277 SER n 
1 278 ASP n 
1 279 ARG n 
1 280 PRO n 
1 281 THR n 
1 282 PHE n 
1 283 GLU n 
1 284 GLU n 
1 285 ILE n 
1 286 GLN n 
1 287 ASN n 
1 288 HIS n 
1 289 PRO n 
1 290 TRP n 
1 291 MET n 
1 292 GLN n 
1 293 ASP n 
1 294 VAL n 
1 295 LEU n 
1 296 LEU n 
1 297 PRO n 
1 298 GLN n 
1 299 GLU n 
1 300 THR n 
1 301 ALA n 
1 302 GLU n 
1 303 ILE n 
1 304 HIS n 
1 305 LEU n 
1 306 HIS n 
1 307 SER n 
1 308 LEU n 
1 309 SER n 
1 310 PRO n 
1 311 GLY n 
1 312 PRO n 
1 313 SER n 
1 314 LYS n 
2 1   ALA n 
2 2   ARG n 
2 3   LYS n 
2 4   ARG n 
2 5   ARG n 
2 6   ARG n 
2 7   HIS n 
2 8   PRO n 
2 9   SER n 
2 10  GLY n 
2 11  PRO n 
2 12  PRO n 
2 13  THR n 
2 14  ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 PIM1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)-R3' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pNIC28-BSA4 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'Synthetic peptide' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP PIM1_HUMAN P11309 1 
;MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGEL
PNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHN
CGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK
;
1 ? 
2 PDB 3CY2       3CY2   2 ARKRRRHPSGPPTA 1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3CY2 A 2 ? 314 ? P11309 1 ? 313 ? 1 313 
2 2 3CY2 B 1 ? 14  ? 3CY2   1 ? 14  ? 1 14  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3CY2 SER A 1   ? UNP P11309 ?   ?   'expression tag'      0   1 
1 3CY2 GLY A 251 ? UNP P11309 ARG 250 'engineered mutation' 250 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                                               ? 
'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                                                                              ? 
'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                            ? 
'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                                       ? 
'C4 H7 N O4'      133.103 
CL  non-polymer         . 'CHLORIDE ION'                                                                                        ? 
'Cl -1'           35.453  
CYS 'L-peptide linking' y CYSTEINE                                                                                              ? 
'C3 H7 N O2 S'    121.158 
EDO non-polymer         . 1,2-ETHANEDIOL                                                                                        
'ETHYLENE GLYCOL' 'C2 H6 O2'        62.068  
GLN 'L-peptide linking' y GLUTAMINE                                                                                             ? 
'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                                       ? 
'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                                                                               ? 
'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                             ? 
'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                                                                                 ? 
'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                                            ? 
'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                               ? 
'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                                                                                ? 
'C6 H15 N2 O2 1'  147.195 
MB9 non-polymer         . "(4R)-7-chloro-9-methyl-1-oxo-1,2,4,9-tetrahydrospiro[beta-carboline-3,4'-piperidine]-4-carbonitrile" ? 
'C17 H17 Cl N4 O' 328.796 
MET 'L-peptide linking' y METHIONINE                                                                                            ? 
'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                                         ? 
'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                                                                               ? 
'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                                                                                ? 
'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                                                                             ? 
'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                            ? 
'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                              ? 
'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                                                                                ? 
'C5 H11 N O2'     117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3CY2 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      3.06 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   59.74 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    '0.56 M Na succinate pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2007-09-14 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54178 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU FR-E+ SUPERBRIGHT' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.54178 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
# 
_reflns.entry_id                     3CY2 
_reflns.d_resolution_high            2.01 
_reflns.d_resolution_low             32.297 
_reflns.number_all                   ? 
_reflns.number_obs                   29963 
_reflns.pdbx_Rmerge_I_obs            0.075 
_reflns.pdbx_netI_over_sigmaI        8.400 
_reflns.pdbx_Rsym_value              0.075 
_reflns.pdbx_redundancy              5.200 
_reflns.percent_possible_obs         100.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.01 2.12   ? 22252 ? 0.704 1.1  0.704 ? 5.10 ? 4345 100.00 1  1 
2.12 2.25   ? 21266 ? 0.453 1.7  0.453 ? 5.20 ? 4127 100.00 2  1 
2.25 2.40   ? 20128 ? 0.280 2.7  0.280 ? 5.20 ? 3881 100.00 3  1 
2.40 2.59   ? 18786 ? 0.194 3.9  0.194 ? 5.20 ? 3603 100.00 4  1 
2.59 2.84   ? 17413 ? 0.126 6.0  0.126 ? 5.20 ? 3327 100.00 5  1 
2.84 3.18   ? 15909 ? 0.078 9.4  0.078 ? 5.30 ? 3021 100.00 6  1 
3.18 3.67   ? 14018 ? 0.051 13.5 0.051 ? 5.30 ? 2655 100.00 7  1 
3.67 4.49   ? 11944 ? 0.040 15.9 0.040 ? 5.30 ? 2262 100.00 8  1 
4.49 6.36   ? 9231  ? 0.034 17.9 0.034 ? 5.20 ? 1765 100.00 9  1 
6.36 32.297 ? 4794  ? 0.033 16.6 0.033 ? 4.90 ? 977  99.30  10 1 
# 
_refine.entry_id                                 3CY2 
_refine.ls_d_res_high                            2.010 
_refine.ls_d_res_low                             32.297 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    99.980 
_refine.ls_number_reflns_obs                     29927 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.ls_R_factor_obs                          0.169 
_refine.ls_R_factor_R_work                       0.167 
_refine.ls_R_factor_R_free                       0.199 
_refine.ls_percent_reflns_R_free                 5.200 
_refine.ls_number_reflns_R_free                  1553 
_refine.B_iso_mean                               26.309 
_refine.aniso_B[1][1]                            0.270 
_refine.aniso_B[2][2]                            0.270 
_refine.aniso_B[3][3]                            -0.400 
_refine.aniso_B[1][2]                            0.130 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.965 
_refine.correlation_coeff_Fo_to_Fc_free          0.952 
_refine.pdbx_overall_ESU_R                       0.127 
_refine.pdbx_overall_ESU_R_Free                  0.122 
_refine.overall_SU_ML                            0.084 
_refine.overall_SU_B                             5.454 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     29927 
_refine.ls_R_factor_all                          0.169 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_starting_model                      'PDB entry 2C3I' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2266 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         28 
_refine_hist.number_atoms_solvent             207 
_refine_hist.number_atoms_total               2501 
_refine_hist.d_res_high                       2.010 
_refine_hist.d_res_low                        32.297 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       2386 0.015  0.021  ? 'X-RAY DIFFRACTION' ? 
r_bond_other_d         1674 0.001  0.020  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    3233 1.371  1.961  ? 'X-RAY DIFFRACTION' ? 
r_angle_other_deg      4017 1.609  3.001  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 277  6.337  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 123  32.211 22.683 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 399  13.647 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 26   20.209 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr         340  0.085  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   2625 0.007  0.021  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_other     520  0.001  0.020  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it            1393 2.280  3.000  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_other         566  0.712  3.000  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it           2258 3.382  5.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it            993  5.660  8.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it           975  7.690  11.000 ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.010 
_refine_ls_shell.d_res_low                        2.062 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               100.000 
_refine_ls_shell.number_reflns_R_work             2096 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.278 
_refine_ls_shell.R_factor_R_free                  0.372 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             114 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                2210 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3CY2 
_struct.title                     
;Crystal structure of human proto-oncogene serine threonine kinase (PIM1) in complex with a consensus peptide and a beta carboline ligand II
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3CY2 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;oncogene, kinase, serine-threonine, PIM1, Structural Genomics Consortium, SGC, Alternative initiation, ATP-binding, Manganese, Membrane, Metal-binding, Nucleotide-binding, Nucleus, Phosphoprotein, Proto-oncogene, Serine/threonine-protein kinase, Transferase, Host-virus interaction, Viral immunoevasion, Virion, Virulence
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   
;AUTHORS STATE THAT BY GEL FILTRATION THE PROTEIN APPEARS TO BE MONOMERIC. THE BIOLOGICAL ASSEMBLY SHOWN IN REMARK 350 IS A MONOMERIC COMPLEX BETWEEN THE PROTEIN AND THE CONSENSUS PEPTIDE.
;
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 34  ? GLN A 38  ? PRO A 33  GLN A 37  1 ? 5  
HELX_P HELX_P2  2  ASP A 73  ? ILE A 75  ? ASP A 72  ILE A 74  5 ? 3  
HELX_P HELX_P3  3  MET A 89  ? SER A 98  ? MET A 88  SER A 97  1 ? 10 
HELX_P HELX_P4  4  LEU A 130 ? GLY A 138 ? LEU A 129 GLY A 137 1 ? 9  
HELX_P HELX_P5  5  GLN A 141 ? CYS A 162 ? GLN A 140 CYS A 161 1 ? 22 
HELX_P HELX_P6  6  LYS A 170 ? GLU A 172 ? LYS A 169 GLU A 171 5 ? 3  
HELX_P HELX_P7  7  THR A 205 ? SER A 209 ? THR A 204 SER A 208 5 ? 5  
HELX_P HELX_P8  8  PRO A 210 ? HIS A 217 ? PRO A 209 HIS A 216 1 ? 8  
HELX_P HELX_P9  9  HIS A 220 ? GLY A 239 ? HIS A 219 GLY A 238 1 ? 20 
HELX_P HELX_P10 10 HIS A 245 ? GLY A 252 ? HIS A 244 GLY A 251 1 ? 8  
HELX_P HELX_P11 11 SER A 261 ? LEU A 272 ? SER A 260 LEU A 271 1 ? 12 
HELX_P HELX_P12 12 ARG A 275 ? ARG A 279 ? ARG A 274 ARG A 278 5 ? 5  
HELX_P HELX_P13 13 THR A 281 ? HIS A 288 ? THR A 280 HIS A 287 1 ? 8  
HELX_P HELX_P14 14 PRO A 289 ? GLN A 292 ? PRO A 288 GLN A 291 5 ? 4  
HELX_P HELX_P15 15 LEU A 296 ? LEU A 305 ? LEU A 295 LEU A 304 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLU 
_struct_mon_prot_cis.label_seq_id           125 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLU 
_struct_mon_prot_cis.auth_seq_id            124 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    126 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     125 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -9.66 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 2 ? 
C ? 3 ? 
D ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 39  ? GLY A 48  ? TYR A 38  GLY A 47  
A 2 GLY A 51  ? ARG A 58  ? GLY A 50  ARG A 57  
A 3 PRO A 64  ? GLU A 71  ? PRO A 63  GLU A 70  
A 4 SER A 116 ? GLU A 122 ? SER A 115 GLU A 121 
A 5 LEU A 107 ? GLU A 112 ? LEU A 106 GLU A 111 
B 1 TRP A 78  ? GLU A 80  ? TRP A 77  GLU A 79  
B 2 ARG A 86  ? PRO A 88  ? ARG A 85  PRO A 87  
C 1 VAL A 127 ? ASP A 129 ? VAL A 126 ASP A 128 
C 2 ILE A 174 ? ASP A 177 ? ILE A 173 ASP A 176 
C 3 GLU A 182 ? LEU A 185 ? GLU A 181 LEU A 184 
D 1 VAL A 164 ? LEU A 165 ? VAL A 163 LEU A 164 
D 2 ALA A 192 ? LEU A 193 ? ALA A 191 LEU A 192 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLY A 42  ? N GLY A 41  O SER A 55  ? O SER A 54  
A 2 3 N SER A 52  ? N SER A 51  O HIS A 69  ? O HIS A 68  
A 3 4 N LYS A 68  ? N LYS A 67  O LEU A 119 ? O LEU A 118 
A 4 5 O ILE A 120 ? O ILE A 119 N LEU A 108 ? N LEU A 107 
B 1 2 N GLY A 79  ? N GLY A 78  O VAL A 87  ? O VAL A 86  
C 1 2 N GLN A 128 ? N GLN A 127 O ILE A 176 ? O ILE A 175 
C 2 3 N ASP A 177 ? N ASP A 176 O GLU A 182 ? O GLU A 181 
D 1 2 N LEU A 165 ? N LEU A 164 O ALA A 192 ? O ALA A 191 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A CL  401 ? 2 'BINDING SITE FOR RESIDUE CL A 401'  
AC2 Software A MB9 501 ? 9 'BINDING SITE FOR RESIDUE MB9 A 501' 
AC3 Software A EDO 551 ? 3 'BINDING SITE FOR RESIDUE EDO A 551' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 2 LYS A 68  ? LYS A 67  . ? 1_555 ? 
2  AC1 2 ASP A 187 ? ASP A 186 . ? 1_555 ? 
3  AC2 9 GLY A 46  ? GLY A 45  . ? 1_555 ? 
4  AC2 9 PHE A 50  ? PHE A 49  . ? 1_555 ? 
5  AC2 9 LYS A 68  ? LYS A 67  . ? 1_555 ? 
6  AC2 9 ARG A 123 ? ARG A 122 . ? 1_555 ? 
7  AC2 9 GLU A 172 ? GLU A 171 . ? 1_555 ? 
8  AC2 9 ASN A 173 ? ASN A 172 . ? 1_555 ? 
9  AC2 9 LEU A 175 ? LEU A 174 . ? 1_555 ? 
10 AC2 9 ILE A 186 ? ILE A 185 . ? 1_555 ? 
11 AC2 9 ASP A 187 ? ASP A 186 . ? 1_555 ? 
12 AC3 3 HIS A 220 ? HIS A 219 . ? 1_555 ? 
13 AC3 3 ARG A 222 ? ARG A 221 . ? 1_555 ? 
14 AC3 3 SER A 223 ? SER A 222 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3CY2 
_atom_sites.fract_transf_matrix[1][1]   0.010135 
_atom_sites.fract_transf_matrix[1][2]   0.005851 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011703 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012326 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N    . PRO A 1 34  ? -31.057 27.177 16.152  1.00 53.48 ? 33  PRO A N    1 
ATOM   2    C  CA   . PRO A 1 34  ? -31.400 26.530 14.888  1.00 54.21 ? 33  PRO A CA   1 
ATOM   3    C  C    . PRO A 1 34  ? -31.341 27.482 13.683  1.00 54.55 ? 33  PRO A C    1 
ATOM   4    O  O    . PRO A 1 34  ? -32.113 28.435 13.608  1.00 54.93 ? 33  PRO A O    1 
ATOM   5    C  CB   . PRO A 1 34  ? -32.825 26.028 15.144  1.00 54.19 ? 33  PRO A CB   1 
ATOM   6    C  CG   . PRO A 1 34  ? -32.841 25.715 16.632  1.00 53.29 ? 33  PRO A CG   1 
ATOM   7    C  CD   . PRO A 1 34  ? -31.758 26.555 17.291  1.00 53.19 ? 33  PRO A CD   1 
ATOM   8    N  N    . LEU A 1 35  ? -30.434 27.199 12.748  1.00 54.47 ? 34  LEU A N    1 
ATOM   9    C  CA   . LEU A 1 35  ? -30.111 28.106 11.634  1.00 54.58 ? 34  LEU A CA   1 
ATOM   10   C  C    . LEU A 1 35  ? -31.320 28.529 10.792  1.00 53.85 ? 34  LEU A C    1 
ATOM   11   O  O    . LEU A 1 35  ? -31.596 29.723 10.634  1.00 51.30 ? 34  LEU A O    1 
ATOM   12   C  CB   . LEU A 1 35  ? -29.061 27.440 10.720  1.00 55.87 ? 34  LEU A CB   1 
ATOM   13   C  CG   . LEU A 1 35  ? -28.380 28.206 9.570   1.00 56.41 ? 34  LEU A CG   1 
ATOM   14   C  CD1  . LEU A 1 35  ? -27.213 27.369 9.096   1.00 60.60 ? 34  LEU A CD1  1 
ATOM   15   C  CD2  . LEU A 1 35  ? -29.299 28.539 8.381   1.00 57.37 ? 34  LEU A CD2  1 
ATOM   16   N  N    . GLU A 1 36  ? -32.034 27.538 10.265  1.00 54.13 ? 35  GLU A N    1 
ATOM   17   C  CA   . GLU A 1 36  ? -33.061 27.755 9.233   1.00 53.81 ? 35  GLU A CA   1 
ATOM   18   C  C    . GLU A 1 36  ? -34.254 28.608 9.716   1.00 52.17 ? 35  GLU A C    1 
ATOM   19   O  O    . GLU A 1 36  ? -34.900 29.292 8.911   1.00 52.31 ? 35  GLU A O    1 
ATOM   20   C  CB   . GLU A 1 36  ? -33.560 26.407 8.677   1.00 54.16 ? 35  GLU A CB   1 
ATOM   21   C  CG   . GLU A 1 36  ? -32.456 25.477 8.145   1.00 55.57 ? 35  GLU A CG   1 
ATOM   22   C  CD   . GLU A 1 36  ? -31.955 24.479 9.186   1.00 57.26 ? 35  GLU A CD   1 
ATOM   23   O  OE1  . GLU A 1 36  ? -32.777 23.691 9.699   1.00 75.10 ? 35  GLU A OE1  1 
ATOM   24   O  OE2  . GLU A 1 36  ? -30.744 24.474 9.494   1.00 54.59 ? 35  GLU A OE2  1 
ATOM   25   N  N    . SER A 1 37  ? -34.536 28.572 11.019  1.00 49.80 ? 36  SER A N    1 
ATOM   26   C  CA   . SER A 1 37  ? -35.600 29.401 11.608  1.00 49.53 ? 36  SER A CA   1 
ATOM   27   C  C    . SER A 1 37  ? -35.176 30.872 11.754  1.00 47.48 ? 36  SER A C    1 
ATOM   28   O  O    . SER A 1 37  ? -35.999 31.773 11.582  1.00 48.27 ? 36  SER A O    1 
ATOM   29   C  CB   . SER A 1 37  ? -36.049 28.838 12.967  1.00 46.53 ? 36  SER A CB   1 
ATOM   30   N  N    . GLN A 1 38  ? -33.894 31.111 12.039  1.00 46.32 ? 37  GLN A N    1 
ATOM   31   C  CA   . GLN A 1 38  ? -33.412 32.452 12.393  1.00 42.50 ? 37  GLN A CA   1 
ATOM   32   C  C    . GLN A 1 38  ? -33.025 33.358 11.209  1.00 38.40 ? 37  GLN A C    1 
ATOM   33   O  O    . GLN A 1 38  ? -33.001 34.577 11.366  1.00 34.58 ? 37  GLN A O    1 
ATOM   34   C  CB   . GLN A 1 38  ? -32.245 32.349 13.376  1.00 41.57 ? 37  GLN A CB   1 
ATOM   35   C  CG   . GLN A 1 38  ? -32.134 33.560 14.288  1.00 44.94 ? 37  GLN A CG   1 
ATOM   36   C  CD   . GLN A 1 38  ? -30.936 33.495 15.214  1.00 48.50 ? 37  GLN A CD   1 
ATOM   37   O  OE1  . GLN A 1 38  ? -30.512 32.413 15.636  1.00 45.81 ? 37  GLN A OE1  1 
ATOM   38   N  NE2  . GLN A 1 38  ? -30.384 34.661 15.541  1.00 40.46 ? 37  GLN A NE2  1 
ATOM   39   N  N    . TYR A 1 39  ? -32.729 32.778 10.042  1.00 38.03 ? 38  TYR A N    1 
ATOM   40   C  CA   . TYR A 1 39  ? -32.380 33.564 8.841   1.00 38.10 ? 38  TYR A CA   1 
ATOM   41   C  C    . TYR A 1 39  ? -33.288 33.226 7.670   1.00 38.25 ? 38  TYR A C    1 
ATOM   42   O  O    . TYR A 1 39  ? -33.583 32.056 7.412   1.00 42.27 ? 38  TYR A O    1 
ATOM   43   C  CB   . TYR A 1 39  ? -30.897 33.385 8.446   1.00 36.38 ? 38  TYR A CB   1 
ATOM   44   C  CG   . TYR A 1 39  ? -29.993 33.774 9.577   1.00 39.11 ? 38  TYR A CG   1 
ATOM   45   C  CD1  . TYR A 1 39  ? -29.664 35.107 9.804   1.00 37.74 ? 38  TYR A CD1  1 
ATOM   46   C  CD2  . TYR A 1 39  ? -29.523 32.820 10.472  1.00 33.94 ? 38  TYR A CD2  1 
ATOM   47   C  CE1  . TYR A 1 39  ? -28.870 35.471 10.866  1.00 30.80 ? 38  TYR A CE1  1 
ATOM   48   C  CE2  . TYR A 1 39  ? -28.735 33.182 11.541  1.00 34.55 ? 38  TYR A CE2  1 
ATOM   49   C  CZ   . TYR A 1 39  ? -28.413 34.506 11.731  1.00 31.19 ? 38  TYR A CZ   1 
ATOM   50   O  OH   . TYR A 1 39  ? -27.635 34.857 12.796  1.00 26.82 ? 38  TYR A OH   1 
ATOM   51   N  N    . GLN A 1 40  ? -33.766 34.265 6.994   1.00 35.04 ? 39  GLN A N    1 
ATOM   52   C  CA   . GLN A 1 40  ? -34.436 34.109 5.724   1.00 31.03 ? 39  GLN A CA   1 
ATOM   53   C  C    . GLN A 1 40  ? -33.342 34.121 4.651   1.00 31.41 ? 39  GLN A C    1 
ATOM   54   O  O    . GLN A 1 40  ? -32.609 35.102 4.506   1.00 28.64 ? 39  GLN A O    1 
ATOM   55   C  CB   . GLN A 1 40  ? -35.455 35.233 5.515   1.00 29.68 ? 39  GLN A CB   1 
ATOM   56   C  CG   . GLN A 1 40  ? -36.329 35.070 4.299   1.00 30.00 ? 39  GLN A CG   1 
ATOM   57   N  N    . VAL A 1 41  ? -33.220 33.005 3.931   1.00 32.30 ? 40  VAL A N    1 
ATOM   58   C  CA   . VAL A 1 41  ? -32.247 32.852 2.855   1.00 34.59 ? 40  VAL A CA   1 
ATOM   59   C  C    . VAL A 1 41  ? -32.756 33.557 1.603   1.00 35.43 ? 40  VAL A C    1 
ATOM   60   O  O    . VAL A 1 41  ? -33.935 33.492 1.290   1.00 33.33 ? 40  VAL A O    1 
ATOM   61   C  CB   . VAL A 1 41  ? -32.023 31.365 2.489   1.00 35.38 ? 40  VAL A CB   1 
ATOM   62   C  CG1  . VAL A 1 41  ? -30.848 31.233 1.498   1.00 33.11 ? 40  VAL A CG1  1 
ATOM   63   C  CG2  . VAL A 1 41  ? -31.768 30.545 3.735   1.00 38.89 ? 40  VAL A CG2  1 
ATOM   64   N  N    . GLY A 1 42  ? -31.864 34.228 0.885   1.00 36.07 ? 41  GLY A N    1 
ATOM   65   C  CA   . GLY A 1 42  ? -32.215 34.844 -0.389  1.00 34.90 ? 41  GLY A CA   1 
ATOM   66   C  C    . GLY A 1 42  ? -31.416 34.226 -1.529  1.00 35.86 ? 41  GLY A C    1 
ATOM   67   O  O    . GLY A 1 42  ? -31.063 33.029 -1.485  1.00 38.09 ? 41  GLY A O    1 
ATOM   68   N  N    . PRO A 1 43  ? -31.090 35.062 -2.535  1.00 35.35 ? 42  PRO A N    1 
ATOM   69   C  CA   . PRO A 1 43  ? -30.243 34.656 -3.682  1.00 36.35 ? 42  PRO A CA   1 
ATOM   70   C  C    . PRO A 1 43  ? -28.781 34.243 -3.351  1.00 29.62 ? 42  PRO A C    1 
ATOM   71   O  O    . PRO A 1 43  ? -28.165 34.781 -2.434  1.00 31.34 ? 42  PRO A O    1 
ATOM   72   C  CB   . PRO A 1 43  ? -30.226 35.910 -4.580  1.00 33.95 ? 42  PRO A CB   1 
ATOM   73   C  CG   . PRO A 1 43  ? -31.405 36.713 -4.146  1.00 37.36 ? 42  PRO A CG   1 
ATOM   74   C  CD   . PRO A 1 43  ? -31.567 36.457 -2.698  1.00 33.79 ? 42  PRO A CD   1 
ATOM   75   N  N    . LEU A 1 44  ? -28.273 33.278 -4.120  1.00 27.32 ? 43  LEU A N    1 
ATOM   76   C  CA   . LEU A 1 44  ? -26.871 32.912 -4.119  1.00 30.06 ? 43  LEU A CA   1 
ATOM   77   C  C    . LEU A 1 44  ? -26.064 34.139 -4.546  1.00 29.58 ? 43  LEU A C    1 
ATOM   78   O  O    . LEU A 1 44  ? -26.394 34.764 -5.542  1.00 31.51 ? 43  LEU A O    1 
ATOM   79   C  CB   . LEU A 1 44  ? -26.620 31.713 -5.057  1.00 30.13 ? 43  LEU A CB   1 
ATOM   80   C  CG   . LEU A 1 44  ? -25.171 31.161 -5.072  1.00 29.08 ? 43  LEU A CG   1 
ATOM   81   C  CD1  . LEU A 1 44  ? -24.899 30.375 -3.827  1.00 22.39 ? 43  LEU A CD1  1 
ATOM   82   C  CD2  . LEU A 1 44  ? -24.924 30.300 -6.285  1.00 36.39 ? 43  LEU A CD2  1 
ATOM   83   N  N    . LEU A 1 45  ? -25.039 34.489 -3.762  1.00 33.44 ? 44  LEU A N    1 
ATOM   84   C  CA   . LEU A 1 45  ? -24.148 35.620 -4.049  1.00 31.77 ? 44  LEU A CA   1 
ATOM   85   C  C    . LEU A 1 45  ? -22.841 35.173 -4.714  1.00 34.77 ? 44  LEU A C    1 
ATOM   86   O  O    . LEU A 1 45  ? -22.283 35.901 -5.544  1.00 33.76 ? 44  LEU A O    1 
ATOM   87   C  CB   . LEU A 1 45  ? -23.832 36.406 -2.772  1.00 34.41 ? 44  LEU A CB   1 
ATOM   88   C  CG   . LEU A 1 45  ? -24.987 37.112 -2.071  1.00 34.06 ? 44  LEU A CG   1 
ATOM   89   C  CD1  . LEU A 1 45  ? -24.496 37.778 -0.770  1.00 25.71 ? 44  LEU A CD1  1 
ATOM   90   C  CD2  . LEU A 1 45  ? -25.662 38.116 -2.999  1.00 32.54 ? 44  LEU A CD2  1 
ATOM   91   N  N    . GLY A 1 46  ? -22.360 33.981 -4.360  1.00 33.22 ? 45  GLY A N    1 
ATOM   92   C  CA   . GLY A 1 46  ? -21.154 33.421 -4.971  1.00 29.99 ? 45  GLY A CA   1 
ATOM   93   C  C    . GLY A 1 46  ? -20.921 31.970 -4.570  1.00 29.94 ? 45  GLY A C    1 
ATOM   94   O  O    . GLY A 1 46  ? -21.464 31.498 -3.589  1.00 28.43 ? 45  GLY A O    1 
ATOM   95   N  N    . SER A 1 47  ? -20.138 31.250 -5.358  1.00 28.54 ? 46  SER A N    1 
ATOM   96   C  CA   . SER A 1 47  ? -19.711 29.898 -4.996  1.00 32.00 ? 46  SER A CA   1 
ATOM   97   C  C    . SER A 1 47  ? -18.349 29.599 -5.603  1.00 28.47 ? 46  SER A C    1 
ATOM   98   O  O    . SER A 1 47  ? -17.972 30.196 -6.598  1.00 26.86 ? 46  SER A O    1 
ATOM   99   C  CB   . SER A 1 47  ? -20.730 28.834 -5.468  1.00 27.85 ? 46  SER A CB   1 
ATOM   100  O  OG   . SER A 1 47  ? -20.847 28.813 -6.869  1.00 36.65 ? 46  SER A OG   1 
ATOM   101  N  N    . GLY A 1 48  ? -17.627 28.663 -5.005  1.00 30.69 ? 47  GLY A N    1 
ATOM   102  C  CA   . GLY A 1 48  ? -16.396 28.164 -5.593  1.00 33.18 ? 47  GLY A CA   1 
ATOM   103  C  C    . GLY A 1 48  ? -15.839 27.032 -4.760  1.00 37.59 ? 47  GLY A C    1 
ATOM   104  O  O    . GLY A 1 48  ? -16.590 26.319 -4.101  1.00 37.61 ? 47  GLY A O    1 
ATOM   105  N  N    . GLY A 1 49  ? -14.516 26.890 -4.777  1.00 41.40 ? 48  GLY A N    1 
ATOM   106  C  CA   . GLY A 1 49  ? -13.829 25.844 -4.023  1.00 41.69 ? 48  GLY A CA   1 
ATOM   107  C  C    . GLY A 1 49  ? -14.212 25.856 -2.556  1.00 40.81 ? 48  GLY A C    1 
ATOM   108  O  O    . GLY A 1 49  ? -14.498 24.805 -1.977  1.00 39.97 ? 48  GLY A O    1 
ATOM   109  N  N    . PHE A 1 50  ? -14.233 27.060 -1.978  1.00 37.28 ? 49  PHE A N    1 
ATOM   110  C  CA   . PHE A 1 50  ? -14.587 27.275 -0.570  1.00 38.50 ? 49  PHE A CA   1 
ATOM   111  C  C    . PHE A 1 50  ? -15.948 26.671 -0.192  1.00 34.73 ? 49  PHE A C    1 
ATOM   112  O  O    . PHE A 1 50  ? -16.098 26.063 0.877   1.00 38.81 ? 49  PHE A O    1 
ATOM   113  C  CB   . PHE A 1 50  ? -14.547 28.790 -0.218  1.00 36.03 ? 49  PHE A CB   1 
ATOM   114  C  CG   . PHE A 1 50  ? -15.636 29.616 -0.872  1.00 34.10 ? 49  PHE A CG   1 
ATOM   115  C  CD1  . PHE A 1 50  ? -15.434 30.184 -2.107  1.00 24.46 ? 49  PHE A CD1  1 
ATOM   116  C  CD2  . PHE A 1 50  ? -16.855 29.843 -0.220  1.00 43.99 ? 49  PHE A CD2  1 
ATOM   117  C  CE1  . PHE A 1 50  ? -16.435 30.943 -2.728  1.00 37.67 ? 49  PHE A CE1  1 
ATOM   118  C  CE2  . PHE A 1 50  ? -17.855 30.617 -0.814  1.00 31.21 ? 49  PHE A CE2  1 
ATOM   119  C  CZ   . PHE A 1 50  ? -17.652 31.162 -2.074  1.00 36.58 ? 49  PHE A CZ   1 
ATOM   120  N  N    . GLY A 1 51  ? -16.920 26.820 -1.092  1.00 32.13 ? 50  GLY A N    1 
ATOM   121  C  CA   . GLY A 1 51  ? -18.316 26.569 -0.788  1.00 28.67 ? 50  GLY A CA   1 
ATOM   122  C  C    . GLY A 1 51  ? -19.206 27.589 -1.473  1.00 28.59 ? 50  GLY A C    1 
ATOM   123  O  O    . GLY A 1 51  ? -18.909 28.008 -2.587  1.00 25.70 ? 50  GLY A O    1 
ATOM   124  N  N    . SER A 1 52  ? -20.295 27.986 -0.804  1.00 26.72 ? 51  SER A N    1 
ATOM   125  C  CA   . SER A 1 52  ? -21.337 28.824 -1.430  1.00 27.52 ? 51  SER A CA   1 
ATOM   126  C  C    . SER A 1 52  ? -21.793 29.864 -0.443  1.00 27.19 ? 51  SER A C    1 
ATOM   127  O  O    . SER A 1 52  ? -21.897 29.583 0.737   1.00 30.58 ? 51  SER A O    1 
ATOM   128  C  CB   . SER A 1 52  ? -22.532 27.966 -1.866  1.00 24.77 ? 51  SER A CB   1 
ATOM   129  O  OG   . SER A 1 52  ? -22.179 26.968 -2.813  1.00 26.11 ? 51  SER A OG   1 
ATOM   130  N  N    . VAL A 1 53  ? -22.071 31.073 -0.904  1.00 32.40 ? 52  VAL A N    1 
ATOM   131  C  CA   . VAL A 1 53  ? -22.526 32.135 0.011   1.00 32.03 ? 52  VAL A CA   1 
ATOM   132  C  C    . VAL A 1 53  ? -23.812 32.778 -0.546  1.00 31.71 ? 52  VAL A C    1 
ATOM   133  O  O    . VAL A 1 53  ? -23.911 33.073 -1.742  1.00 29.68 ? 52  VAL A O    1 
ATOM   134  C  CB   . VAL A 1 53  ? -21.391 33.186 0.322   1.00 31.32 ? 52  VAL A CB   1 
ATOM   135  C  CG1  . VAL A 1 53  ? -20.804 33.762 -0.943  1.00 25.98 ? 52  VAL A CG1  1 
ATOM   136  C  CG2  . VAL A 1 53  ? -21.898 34.294 1.230   1.00 33.31 ? 52  VAL A CG2  1 
ATOM   137  N  N    . TYR A 1 54  ? -24.787 32.959 0.341   1.00 28.59 ? 53  TYR A N    1 
ATOM   138  C  CA   . TYR A 1 54  ? -26.114 33.459 -0.001  1.00 30.71 ? 53  TYR A CA   1 
ATOM   139  C  C    . TYR A 1 54  ? -26.354 34.777 0.710   1.00 30.51 ? 53  TYR A C    1 
ATOM   140  O  O    . TYR A 1 54  ? -25.800 35.037 1.792   1.00 27.13 ? 53  TYR A O    1 
ATOM   141  C  CB   . TYR A 1 54  ? -27.211 32.476 0.453   1.00 24.19 ? 53  TYR A CB   1 
ATOM   142  C  CG   . TYR A 1 54  ? -27.193 31.149 -0.269  1.00 30.18 ? 53  TYR A CG   1 
ATOM   143  C  CD1  . TYR A 1 54  ? -26.289 30.149 0.102   1.00 28.78 ? 53  TYR A CD1  1 
ATOM   144  C  CD2  . TYR A 1 54  ? -28.069 30.892 -1.329  1.00 27.51 ? 53  TYR A CD2  1 
ATOM   145  C  CE1  . TYR A 1 54  ? -26.251 28.941 -0.564  1.00 28.03 ? 53  TYR A CE1  1 
ATOM   146  C  CE2  . TYR A 1 54  ? -28.046 29.668 -2.005  1.00 28.40 ? 53  TYR A CE2  1 
ATOM   147  C  CZ   . TYR A 1 54  ? -27.133 28.710 -1.618  1.00 24.82 ? 53  TYR A CZ   1 
ATOM   148  O  OH   . TYR A 1 54  ? -27.063 27.526 -2.268  1.00 22.36 ? 53  TYR A OH   1 
ATOM   149  N  N    . SER A 1 55  ? -27.223 35.580 0.099   1.00 31.22 ? 54  SER A N    1 
ATOM   150  C  CA   . SER A 1 55  ? -27.782 36.747 0.731   1.00 30.71 ? 54  SER A CA   1 
ATOM   151  C  C    . SER A 1 55  ? -28.830 36.260 1.719   1.00 29.35 ? 54  SER A C    1 
ATOM   152  O  O    . SER A 1 55  ? -29.511 35.268 1.481   1.00 32.79 ? 54  SER A O    1 
ATOM   153  C  CB   . SER A 1 55  ? -28.387 37.684 -0.317  1.00 31.25 ? 54  SER A CB   1 
ATOM   154  O  OG   . SER A 1 55  ? -28.827 38.897 0.253   1.00 32.30 ? 54  SER A OG   1 
ATOM   155  N  N    . GLY A 1 56  ? -28.943 36.957 2.841   1.00 30.83 ? 55  GLY A N    1 
ATOM   156  C  CA   . GLY A 1 56  ? -29.855 36.572 3.891   1.00 27.52 ? 55  GLY A CA   1 
ATOM   157  C  C    . GLY A 1 56  ? -30.272 37.773 4.712   1.00 27.82 ? 55  GLY A C    1 
ATOM   158  O  O    . GLY A 1 56  ? -29.701 38.861 4.606   1.00 26.37 ? 55  GLY A O    1 
ATOM   159  N  N    . ILE A 1 57  ? -31.310 37.581 5.503   1.00 26.74 ? 56  ILE A N    1 
ATOM   160  C  CA   . ILE A 1 57  ? -31.759 38.594 6.439   1.00 27.96 ? 56  ILE A CA   1 
ATOM   161  C  C    . ILE A 1 57  ? -31.978 37.864 7.751   1.00 29.31 ? 56  ILE A C    1 
ATOM   162  O  O    . ILE A 1 57  ? -32.603 36.800 7.771   1.00 32.40 ? 56  ILE A O    1 
ATOM   163  C  CB   . ILE A 1 57  ? -33.068 39.258 5.964   1.00 30.37 ? 56  ILE A CB   1 
ATOM   164  C  CG1  . ILE A 1 57  ? -32.837 40.089 4.694   1.00 20.63 ? 56  ILE A CG1  1 
ATOM   165  C  CG2  . ILE A 1 57  ? -33.670 40.133 7.053   1.00 29.56 ? 56  ILE A CG2  1 
ATOM   166  C  CD1  . ILE A 1 57  ? -34.116 40.198 3.836   1.00 34.28 ? 56  ILE A CD1  1 
ATOM   167  N  N    . ARG A 1 58  ? -31.428 38.406 8.833   1.00 29.84 ? 57  ARG A N    1 
ATOM   168  C  CA   . ARG A 1 58  ? -31.748 37.915 10.160  1.00 31.23 ? 57  ARG A CA   1 
ATOM   169  C  C    . ARG A 1 58  ? -33.192 38.325 10.455  1.00 28.37 ? 57  ARG A C    1 
ATOM   170  O  O    . ARG A 1 58  ? -33.523 39.508 10.402  1.00 27.80 ? 57  ARG A O    1 
ATOM   171  C  CB   . ARG A 1 58  ? -30.789 38.493 11.200  1.00 31.97 ? 57  ARG A CB   1 
ATOM   172  C  CG   . ARG A 1 58  ? -30.946 37.869 12.582  1.00 27.98 ? 57  ARG A CG   1 
ATOM   173  C  CD   . ARG A 1 58  ? -29.735 38.155 13.444  1.00 32.72 ? 57  ARG A CD   1 
ATOM   174  N  NE   . ARG A 1 58  ? -29.616 39.577 13.755  1.00 29.43 ? 57  ARG A NE   1 
ATOM   175  C  CZ   . ARG A 1 58  ? -28.532 40.153 14.284  1.00 38.16 ? 57  ARG A CZ   1 
ATOM   176  N  NH1  . ARG A 1 58  ? -28.544 41.458 14.542  1.00 32.94 ? 57  ARG A NH1  1 
ATOM   177  N  NH2  . ARG A 1 58  ? -27.441 39.443 14.577  1.00 28.22 ? 57  ARG A NH2  1 
ATOM   178  N  N    . VAL A 1 59  ? -34.051 37.344 10.726  1.00 26.29 ? 58  VAL A N    1 
ATOM   179  C  CA   . VAL A 1 59  ? -35.474 37.606 10.924  1.00 25.92 ? 58  VAL A CA   1 
ATOM   180  C  C    . VAL A 1 59  ? -35.720 38.458 12.164  1.00 28.17 ? 58  VAL A C    1 
ATOM   181  O  O    . VAL A 1 59  ? -36.668 39.242 12.200  1.00 29.58 ? 58  VAL A O    1 
ATOM   182  C  CB   . VAL A 1 59  ? -36.299 36.295 11.007  1.00 22.46 ? 58  VAL A CB   1 
ATOM   183  C  CG1  . VAL A 1 59  ? -37.743 36.593 11.358  1.00 25.80 ? 58  VAL A CG1  1 
ATOM   184  C  CG2  . VAL A 1 59  ? -36.215 35.544 9.690   1.00 21.83 ? 58  VAL A CG2  1 
ATOM   185  N  N    . SER A 1 60  ? -34.853 38.306 13.165  1.00 31.44 ? 59  SER A N    1 
ATOM   186  C  CA   . SER A 1 60  ? -34.954 39.038 14.435  1.00 32.42 ? 59  SER A CA   1 
ATOM   187  C  C    . SER A 1 60  ? -35.197 40.538 14.214  1.00 31.67 ? 59  SER A C    1 
ATOM   188  O  O    . SER A 1 60  ? -36.156 41.097 14.747  1.00 24.88 ? 59  SER A O    1 
ATOM   189  C  CB   . SER A 1 60  ? -33.672 38.841 15.269  1.00 34.72 ? 59  SER A CB   1 
ATOM   190  O  OG   . SER A 1 60  ? -33.002 37.623 14.949  1.00 39.35 ? 59  SER A OG   1 
ATOM   191  N  N    . ASP A 1 61  ? -34.329 41.169 13.414  1.00 31.53 ? 60  ASP A N    1 
ATOM   192  C  CA   . ASP A 1 61  ? -34.346 42.629 13.206  1.00 30.95 ? 60  ASP A CA   1 
ATOM   193  C  C    . ASP A 1 61  ? -34.120 43.069 11.747  1.00 29.57 ? 60  ASP A C    1 
ATOM   194  O  O    . ASP A 1 61  ? -33.780 44.221 11.494  1.00 27.83 ? 60  ASP A O    1 
ATOM   195  C  CB   . ASP A 1 61  ? -33.268 43.271 14.086  1.00 31.18 ? 60  ASP A CB   1 
ATOM   196  C  CG   . ASP A 1 61  ? -31.860 42.887 13.655  1.00 30.86 ? 60  ASP A CG   1 
ATOM   197  O  OD1  . ASP A 1 61  ? -31.718 41.845 12.984  1.00 26.75 ? 60  ASP A OD1  1 
ATOM   198  O  OD2  . ASP A 1 61  ? -30.902 43.626 13.977  1.00 40.87 ? 60  ASP A OD2  1 
ATOM   199  N  N    . ASN A 1 62  ? -34.301 42.156 10.799  1.00 29.49 ? 61  ASN A N    1 
ATOM   200  C  CA   . ASN A 1 62  ? -34.082 42.433 9.370   1.00 31.26 ? 61  ASN A CA   1 
ATOM   201  C  C    . ASN A 1 62  ? -32.646 42.819 8.954   1.00 29.43 ? 61  ASN A C    1 
ATOM   202  O  O    . ASN A 1 62  ? -32.451 43.353 7.861   1.00 30.17 ? 61  ASN A O    1 
ATOM   203  C  CB   . ASN A 1 62  ? -35.073 43.490 8.848   1.00 32.02 ? 61  ASN A CB   1 
ATOM   204  C  CG   . ASN A 1 62  ? -36.518 43.028 8.902   1.00 30.16 ? 61  ASN A CG   1 
ATOM   205  O  OD1  . ASN A 1 62  ? -36.850 41.893 8.550   1.00 38.11 ? 61  ASN A OD1  1 
ATOM   206  N  ND2  . ASN A 1 62  ? -37.391 43.925 9.322   1.00 25.39 ? 61  ASN A ND2  1 
ATOM   207  N  N    . LEU A 1 63  ? -31.658 42.549 9.809   1.00 28.07 ? 62  LEU A N    1 
ATOM   208  C  CA   . LEU A 1 63  ? -30.262 42.858 9.509   1.00 28.58 ? 62  LEU A CA   1 
ATOM   209  C  C    . LEU A 1 63  ? -29.808 42.086 8.276   1.00 27.51 ? 62  LEU A C    1 
ATOM   210  O  O    . LEU A 1 63  ? -29.987 40.862 8.224   1.00 24.62 ? 62  LEU A O    1 
ATOM   211  C  CB   . LEU A 1 63  ? -29.350 42.480 10.676  1.00 29.46 ? 62  LEU A CB   1 
ATOM   212  C  CG   . LEU A 1 63  ? -27.906 42.985 10.598  1.00 26.21 ? 62  LEU A CG   1 
ATOM   213  C  CD1  . LEU A 1 63  ? -27.861 44.454 10.991  1.00 23.11 ? 62  LEU A CD1  1 
ATOM   214  C  CD2  . LEU A 1 63  ? -26.956 42.146 11.475  1.00 20.88 ? 62  LEU A CD2  1 
ATOM   215  N  N    . PRO A 1 64  ? -29.221 42.790 7.285   1.00 28.04 ? 63  PRO A N    1 
ATOM   216  C  CA   . PRO A 1 64  ? -28.637 42.102 6.126   1.00 29.31 ? 63  PRO A CA   1 
ATOM   217  C  C    . PRO A 1 64  ? -27.427 41.249 6.506   1.00 27.64 ? 63  PRO A C    1 
ATOM   218  O  O    . PRO A 1 64  ? -26.507 41.716 7.190   1.00 26.87 ? 63  PRO A O    1 
ATOM   219  C  CB   . PRO A 1 64  ? -28.221 43.245 5.174   1.00 29.13 ? 63  PRO A CB   1 
ATOM   220  C  CG   . PRO A 1 64  ? -28.773 44.489 5.738   1.00 35.06 ? 63  PRO A CG   1 
ATOM   221  C  CD   . PRO A 1 64  ? -29.115 44.259 7.176   1.00 30.39 ? 63  PRO A CD   1 
ATOM   222  N  N    . VAL A 1 65  ? -27.458 39.991 6.094   1.00 28.04 ? 64  VAL A N    1 
ATOM   223  C  CA   . VAL A 1 65  ? -26.367 39.074 6.350   1.00 26.26 ? 64  VAL A CA   1 
ATOM   224  C  C    . VAL A 1 65  ? -25.939 38.361 5.068   1.00 28.45 ? 64  VAL A C    1 
ATOM   225  O  O    . VAL A 1 65  ? -26.644 38.390 4.043   1.00 25.31 ? 64  VAL A O    1 
ATOM   226  C  CB   . VAL A 1 65  ? -26.709 38.034 7.476   1.00 28.74 ? 64  VAL A CB   1 
ATOM   227  C  CG1  . VAL A 1 65  ? -26.987 38.761 8.802   1.00 23.07 ? 64  VAL A CG1  1 
ATOM   228  C  CG2  . VAL A 1 65  ? -27.853 37.113 7.077   1.00 25.37 ? 64  VAL A CG2  1 
ATOM   229  N  N    . ALA A 1 66  ? -24.765 37.755 5.150   1.00 28.06 ? 65  ALA A N    1 
ATOM   230  C  CA   . ALA A 1 66  ? -24.302 36.766 4.179   1.00 30.42 ? 65  ALA A CA   1 
ATOM   231  C  C    . ALA A 1 66  ? -24.179 35.415 4.910   1.00 29.53 ? 65  ALA A C    1 
ATOM   232  O  O    . ALA A 1 66  ? -23.646 35.335 6.044   1.00 27.83 ? 65  ALA A O    1 
ATOM   233  C  CB   . ALA A 1 66  ? -22.934 37.208 3.552   1.00 26.56 ? 65  ALA A CB   1 
ATOM   234  N  N    . ILE A 1 67  ? -24.714 34.374 4.279   1.00 29.68 ? 66  ILE A N    1 
ATOM   235  C  CA   . ILE A 1 67  ? -24.733 33.021 4.830   1.00 30.83 ? 66  ILE A CA   1 
ATOM   236  C  C    . ILE A 1 67  ? -23.768 32.158 4.011   1.00 28.44 ? 66  ILE A C    1 
ATOM   237  O  O    . ILE A 1 67  ? -24.049 31.825 2.866   1.00 28.99 ? 66  ILE A O    1 
ATOM   238  C  CB   . ILE A 1 67  ? -26.157 32.393 4.794   1.00 26.19 ? 66  ILE A CB   1 
ATOM   239  C  CG1  . ILE A 1 67  ? -27.190 33.314 5.457   1.00 30.38 ? 66  ILE A CG1  1 
ATOM   240  C  CG2  . ILE A 1 67  ? -26.175 31.034 5.506   1.00 28.71 ? 66  ILE A CG2  1 
ATOM   241  C  CD1  . ILE A 1 67  ? -28.644 32.872 5.226   1.00 25.55 ? 66  ILE A CD1  1 
ATOM   242  N  N    . LYS A 1 68  ? -22.655 31.798 4.634   1.00 29.00 ? 67  LYS A N    1 
ATOM   243  C  CA   . LYS A 1 68  ? -21.539 31.140 3.969   1.00 31.03 ? 67  LYS A CA   1 
ATOM   244  C  C    . LYS A 1 68  ? -21.452 29.676 4.395   1.00 27.08 ? 67  LYS A C    1 
ATOM   245  O  O    . LYS A 1 68  ? -21.231 29.364 5.565   1.00 28.95 ? 67  LYS A O    1 
ATOM   246  C  CB   . LYS A 1 68  ? -20.213 31.857 4.303   1.00 28.07 ? 67  LYS A CB   1 
ATOM   247  C  CG   . LYS A 1 68  ? -18.982 31.245 3.611   1.00 23.32 ? 67  LYS A CG   1 
ATOM   248  C  CD   . LYS A 1 68  ? -17.705 31.979 4.000   1.00 27.87 ? 67  LYS A CD   1 
ATOM   249  C  CE   . LYS A 1 68  ? -16.517 31.583 3.122   1.00 25.50 ? 67  LYS A CE   1 
ATOM   250  N  NZ   . LYS A 1 68  ? -15.304 32.441 3.363   1.00 21.75 ? 67  LYS A NZ   1 
ATOM   251  N  N    . HIS A 1 69  ? -21.606 28.794 3.417   1.00 29.85 ? 68  HIS A N    1 
ATOM   252  C  CA   . HIS A 1 69  ? -21.572 27.357 3.615   1.00 26.73 ? 68  HIS A CA   1 
ATOM   253  C  C    . HIS A 1 69  ? -20.194 26.862 3.215   1.00 26.10 ? 68  HIS A C    1 
ATOM   254  O  O    . HIS A 1 69  ? -19.786 26.989 2.063   1.00 30.37 ? 68  HIS A O    1 
ATOM   255  C  CB   . HIS A 1 69  ? -22.662 26.674 2.773   1.00 26.95 ? 68  HIS A CB   1 
ATOM   256  C  CG   . HIS A 1 69  ? -24.055 27.114 3.113   1.00 25.29 ? 68  HIS A CG   1 
ATOM   257  N  ND1  . HIS A 1 69  ? -24.900 26.375 3.914   1.00 21.79 ? 68  HIS A ND1  1 
ATOM   258  C  CD2  . HIS A 1 69  ? -24.745 28.229 2.770   1.00 23.34 ? 68  HIS A CD2  1 
ATOM   259  C  CE1  . HIS A 1 69  ? -26.054 27.008 4.033   1.00 20.27 ? 68  HIS A CE1  1 
ATOM   260  N  NE2  . HIS A 1 69  ? -25.984 28.137 3.354   1.00 22.75 ? 68  HIS A NE2  1 
ATOM   261  N  N    . VAL A 1 70  ? -19.475 26.323 4.186   1.00 26.10 ? 69  VAL A N    1 
ATOM   262  C  CA   . VAL A 1 70  ? -18.115 25.803 4.023   1.00 28.94 ? 69  VAL A CA   1 
ATOM   263  C  C    . VAL A 1 70  ? -18.162 24.279 4.193   1.00 30.34 ? 69  VAL A C    1 
ATOM   264  O  O    . VAL A 1 70  ? -18.466 23.768 5.288   1.00 28.17 ? 69  VAL A O    1 
ATOM   265  C  CB   . VAL A 1 70  ? -17.176 26.451 5.059   1.00 32.72 ? 69  VAL A CB   1 
ATOM   266  C  CG1  . VAL A 1 70  ? -15.808 25.773 5.068   1.00 44.07 ? 69  VAL A CG1  1 
ATOM   267  C  CG2  . VAL A 1 70  ? -17.053 27.964 4.794   1.00 36.21 ? 69  VAL A CG2  1 
ATOM   268  N  N    . GLU A 1 71  ? -17.897 23.552 3.108   1.00 29.91 ? 70  GLU A N    1 
ATOM   269  C  CA   . GLU A 1 71  ? -17.914 22.082 3.151   1.00 32.10 ? 70  GLU A CA   1 
ATOM   270  C  C    . GLU A 1 71  ? -16.727 21.544 3.965   1.00 26.73 ? 70  GLU A C    1 
ATOM   271  O  O    . GLU A 1 71  ? -15.612 22.038 3.835   1.00 27.32 ? 70  GLU A O    1 
ATOM   272  C  CB   . GLU A 1 71  ? -17.926 21.471 1.737   1.00 31.96 ? 70  GLU A CB   1 
ATOM   273  C  CG   . GLU A 1 71  ? -19.328 21.179 1.185   1.00 36.03 ? 70  GLU A CG   1 
ATOM   274  C  CD   . GLU A 1 71  ? -19.300 20.669 -0.243  1.00 47.73 ? 70  GLU A CD   1 
ATOM   275  O  OE1  . GLU A 1 71  ? -18.188 20.397 -0.746  1.00 52.95 ? 70  GLU A OE1  1 
ATOM   276  O  OE2  . GLU A 1 71  ? -20.384 20.533 -0.868  1.00 51.25 ? 70  GLU A OE2  1 
ATOM   277  N  N    . LYS A 1 72  ? -16.981 20.536 4.796   1.00 26.88 ? 71  LYS A N    1 
ATOM   278  C  CA   . LYS A 1 72  ? -15.941 20.002 5.694   1.00 25.12 ? 71  LYS A CA   1 
ATOM   279  C  C    . LYS A 1 72  ? -14.778 19.361 4.923   1.00 27.95 ? 71  LYS A C    1 
ATOM   280  O  O    . LYS A 1 72  ? -13.626 19.423 5.365   1.00 29.56 ? 71  LYS A O    1 
ATOM   281  C  CB   . LYS A 1 72  ? -16.547 19.022 6.701   1.00 24.32 ? 71  LYS A CB   1 
ATOM   282  C  CG   . LYS A 1 72  ? -17.403 19.687 7.772   1.00 12.93 ? 71  LYS A CG   1 
ATOM   283  C  CD   . LYS A 1 72  ? -17.943 18.675 8.750   1.00 22.16 ? 71  LYS A CD   1 
ATOM   284  C  CE   . LYS A 1 72  ? -18.750 19.346 9.867   1.00 20.33 ? 71  LYS A CE   1 
ATOM   285  N  NZ   . LYS A 1 72  ? -19.347 18.360 10.822  1.00 2.00  ? 71  LYS A NZ   1 
ATOM   286  N  N    . ASP A 1 73  ? -15.090 18.781 3.760   1.00 30.63 ? 72  ASP A N    1 
ATOM   287  C  CA   . ASP A 1 73  ? -14.094 18.174 2.863   1.00 32.53 ? 72  ASP A CA   1 
ATOM   288  C  C    . ASP A 1 73  ? -12.985 19.135 2.409   1.00 32.63 ? 72  ASP A C    1 
ATOM   289  O  O    . ASP A 1 73  ? -11.835 18.722 2.246   1.00 30.80 ? 72  ASP A O    1 
ATOM   290  C  CB   . ASP A 1 73  ? -14.777 17.559 1.627   1.00 32.88 ? 72  ASP A CB   1 
ATOM   291  C  CG   . ASP A 1 73  ? -15.362 16.184 1.907   1.00 34.83 ? 72  ASP A CG   1 
ATOM   292  N  N    . ARG A 1 74  ? -13.320 20.404 2.193   1.00 34.24 ? 73  ARG A N    1 
ATOM   293  C  CA   . ARG A 1 74  ? -12.334 21.361 1.687   1.00 36.58 ? 73  ARG A CA   1 
ATOM   294  C  C    . ARG A 1 74  ? -11.704 22.229 2.791   1.00 38.23 ? 73  ARG A C    1 
ATOM   295  O  O    . ARG A 1 74  ? -10.939 23.146 2.486   1.00 39.45 ? 73  ARG A O    1 
ATOM   296  C  CB   . ARG A 1 74  ? -12.943 22.222 0.568   1.00 39.30 ? 73  ARG A CB   1 
ATOM   297  C  CG   . ARG A 1 74  ? -12.884 21.577 -0.835  1.00 41.48 ? 73  ARG A CG   1 
ATOM   298  C  CD   . ARG A 1 74  ? -11.457 21.611 -1.396  1.00 45.60 ? 73  ARG A CD   1 
ATOM   299  N  NE   . ARG A 1 74  ? -11.336 20.977 -2.704  1.00 42.82 ? 73  ARG A NE   1 
ATOM   300  C  CZ   . ARG A 1 74  ? -10.190 20.540 -3.219  1.00 48.40 ? 73  ARG A CZ   1 
ATOM   301  N  N    . ILE A 1 75  ? -12.008 21.937 4.061   1.00 37.81 ? 74  ILE A N    1 
ATOM   302  C  CA   . ILE A 1 75  ? -11.378 22.633 5.197   1.00 35.34 ? 74  ILE A CA   1 
ATOM   303  C  C    . ILE A 1 75  ? -10.057 21.949 5.466   1.00 36.79 ? 74  ILE A C    1 
ATOM   304  O  O    . ILE A 1 75  ? -10.038 20.787 5.875   1.00 35.59 ? 74  ILE A O    1 
ATOM   305  C  CB   . ILE A 1 75  ? -12.238 22.578 6.488   1.00 33.13 ? 74  ILE A CB   1 
ATOM   306  C  CG1  . ILE A 1 75  ? -13.559 23.303 6.282   1.00 33.03 ? 74  ILE A CG1  1 
ATOM   307  C  CG2  . ILE A 1 75  ? -11.499 23.200 7.672   1.00 29.28 ? 74  ILE A CG2  1 
ATOM   308  C  CD1  . ILE A 1 75  ? -14.568 23.025 7.361   1.00 37.12 ? 74  ILE A CD1  1 
ATOM   309  N  N    . SER A 1 76  ? -8.960  22.668 5.235   1.00 39.25 ? 75  SER A N    1 
ATOM   310  C  CA   . SER A 1 76  ? -7.618  22.150 5.496   1.00 39.86 ? 75  SER A CA   1 
ATOM   311  C  C    . SER A 1 76  ? -7.194  22.348 6.948   1.00 38.17 ? 75  SER A C    1 
ATOM   312  O  O    . SER A 1 76  ? -6.832  21.383 7.636   1.00 37.30 ? 75  SER A O    1 
ATOM   313  C  CB   . SER A 1 76  ? -6.591  22.831 4.588   1.00 42.42 ? 75  SER A CB   1 
ATOM   314  O  OG   . SER A 1 76  ? -5.296  22.277 4.800   1.00 45.66 ? 75  SER A OG   1 
ATOM   315  N  N    . ASP A 1 77  ? -7.216  23.603 7.393   1.00 34.67 ? 76  ASP A N    1 
ATOM   316  C  CA   . ASP A 1 77  ? -6.776  23.964 8.733   1.00 33.77 ? 76  ASP A CA   1 
ATOM   317  C  C    . ASP A 1 77  ? -7.935  24.085 9.720   1.00 28.49 ? 76  ASP A C    1 
ATOM   318  O  O    . ASP A 1 77  ? -8.921  24.764 9.458   1.00 24.97 ? 76  ASP A O    1 
ATOM   319  C  CB   . ASP A 1 77  ? -5.984  25.275 8.705   1.00 36.12 ? 76  ASP A CB   1 
ATOM   320  C  CG   . ASP A 1 77  ? -4.640  25.140 8.005   1.00 43.93 ? 76  ASP A CG   1 
ATOM   321  O  OD1  . ASP A 1 77  ? -4.260  24.020 7.593   1.00 52.92 ? 76  ASP A OD1  1 
ATOM   322  O  OD2  . ASP A 1 77  ? -3.951  26.172 7.873   1.00 57.71 ? 76  ASP A OD2  1 
ATOM   323  N  N    . TRP A 1 78  ? -7.777  23.424 10.863  1.00 28.45 ? 77  TRP A N    1 
ATOM   324  C  CA   . TRP A 1 78  ? -8.758  23.430 11.940  1.00 27.12 ? 77  TRP A CA   1 
ATOM   325  C  C    . TRP A 1 78  ? -8.126  24.046 13.171  1.00 26.34 ? 77  TRP A C    1 
ATOM   326  O  O    . TRP A 1 78  ? -6.913  23.944 13.370  1.00 23.86 ? 77  TRP A O    1 
ATOM   327  C  CB   . TRP A 1 78  ? -9.202  22.000 12.276  1.00 26.42 ? 77  TRP A CB   1 
ATOM   328  C  CG   . TRP A 1 78  ? -9.887  21.280 11.152  1.00 22.46 ? 77  TRP A CG   1 
ATOM   329  C  CD1  . TRP A 1 78  ? -9.291  20.667 10.090  1.00 22.16 ? 77  TRP A CD1  1 
ATOM   330  C  CD2  . TRP A 1 78  ? -11.295 21.089 10.990  1.00 22.59 ? 77  TRP A CD2  1 
ATOM   331  N  NE1  . TRP A 1 78  ? -10.243 20.113 9.269   1.00 21.11 ? 77  TRP A NE1  1 
ATOM   332  C  CE2  . TRP A 1 78  ? -11.483 20.358 9.797   1.00 22.13 ? 77  TRP A CE2  1 
ATOM   333  C  CE3  . TRP A 1 78  ? -12.419 21.478 11.730  1.00 27.10 ? 77  TRP A CE3  1 
ATOM   334  C  CZ2  . TRP A 1 78  ? -12.753 19.994 9.330   1.00 25.53 ? 77  TRP A CZ2  1 
ATOM   335  C  CZ3  . TRP A 1 78  ? -13.676 21.123 11.266  1.00 27.25 ? 77  TRP A CZ3  1 
ATOM   336  C  CH2  . TRP A 1 78  ? -13.833 20.385 10.076  1.00 30.12 ? 77  TRP A CH2  1 
ATOM   337  N  N    . GLY A 1 79  ? -8.958  24.679 13.990  1.00 27.44 ? 78  GLY A N    1 
ATOM   338  C  CA   . GLY A 1 79  ? -8.532  25.250 15.260  1.00 28.81 ? 78  GLY A CA   1 
ATOM   339  C  C    . GLY A 1 79  ? -9.454  24.818 16.380  1.00 30.78 ? 78  GLY A C    1 
ATOM   340  O  O    . GLY A 1 79  ? -10.337 23.972 16.193  1.00 29.00 ? 78  GLY A O    1 
ATOM   341  N  N    . GLU A 1 80  ? -9.227  25.388 17.558  1.00 35.13 ? 79  GLU A N    1 
ATOM   342  C  CA   . GLU A 1 80  ? -10.101 25.171 18.701  1.00 39.52 ? 79  GLU A CA   1 
ATOM   343  C  C    . GLU A 1 80  ? -10.416 26.520 19.334  1.00 44.44 ? 79  GLU A C    1 
ATOM   344  O  O    . GLU A 1 80  ? -9.512  27.322 19.575  1.00 44.88 ? 79  GLU A O    1 
ATOM   345  C  CB   . GLU A 1 80  ? -9.436  24.246 19.725  1.00 38.23 ? 79  GLU A CB   1 
ATOM   346  N  N    . LEU A 1 81  ? -11.700 26.782 19.567  1.00 49.59 ? 80  LEU A N    1 
ATOM   347  C  CA   . LEU A 1 81  ? -12.115 27.916 20.393  1.00 53.63 ? 80  LEU A CA   1 
ATOM   348  C  C    . LEU A 1 81  ? -12.044 27.470 21.862  1.00 55.15 ? 80  LEU A C    1 
ATOM   349  O  O    . LEU A 1 81  ? -12.254 26.286 22.158  1.00 56.40 ? 80  LEU A O    1 
ATOM   350  C  CB   . LEU A 1 81  ? -13.536 28.355 20.029  1.00 54.69 ? 80  LEU A CB   1 
ATOM   351  C  CG   . LEU A 1 81  ? -13.766 28.796 18.584  1.00 58.67 ? 80  LEU A CG   1 
ATOM   352  C  CD1  . LEU A 1 81  ? -15.256 28.879 18.275  1.00 63.98 ? 80  LEU A CD1  1 
ATOM   353  C  CD2  . LEU A 1 81  ? -13.077 30.127 18.315  1.00 63.95 ? 80  LEU A CD2  1 
ATOM   354  N  N    . PRO A 1 82  ? -11.741 28.402 22.790  1.00 55.79 ? 81  PRO A N    1 
ATOM   355  C  CA   . PRO A 1 82  ? -11.615 27.977 24.194  1.00 55.31 ? 81  PRO A CA   1 
ATOM   356  C  C    . PRO A 1 82  ? -12.964 27.679 24.846  1.00 54.48 ? 81  PRO A C    1 
ATOM   357  O  O    . PRO A 1 82  ? -13.424 26.537 24.809  1.00 53.35 ? 81  PRO A O    1 
ATOM   358  C  CB   . PRO A 1 82  ? -10.931 29.173 24.879  1.00 55.03 ? 81  PRO A CB   1 
ATOM   359  C  CG   . PRO A 1 82  ? -10.603 30.160 23.782  1.00 55.99 ? 81  PRO A CG   1 
ATOM   360  C  CD   . PRO A 1 82  ? -11.488 29.844 22.625  1.00 55.90 ? 81  PRO A CD   1 
ATOM   361  N  N    . THR A 1 85  ? -14.782 24.075 20.931  1.00 54.68 ? 84  THR A N    1 
ATOM   362  C  CA   . THR A 1 85  ? -14.874 22.835 20.157  1.00 55.55 ? 84  THR A CA   1 
ATOM   363  C  C    . THR A 1 85  ? -13.923 22.857 18.948  1.00 54.53 ? 84  THR A C    1 
ATOM   364  O  O    . THR A 1 85  ? -13.082 23.753 18.823  1.00 55.70 ? 84  THR A O    1 
ATOM   365  C  CB   . THR A 1 85  ? -16.324 22.585 19.677  1.00 54.65 ? 84  THR A CB   1 
ATOM   366  N  N    . ARG A 1 86  ? -14.051 21.858 18.074  1.00 53.10 ? 85  ARG A N    1 
ATOM   367  C  CA   . ARG A 1 86  ? -13.275 21.799 16.830  1.00 51.39 ? 85  ARG A CA   1 
ATOM   368  C  C    . ARG A 1 86  ? -13.992 22.571 15.710  1.00 47.56 ? 85  ARG A C    1 
ATOM   369  O  O    . ARG A 1 86  ? -15.114 22.233 15.318  1.00 46.74 ? 85  ARG A O    1 
ATOM   370  C  CB   . ARG A 1 86  ? -13.047 20.340 16.410  1.00 51.76 ? 85  ARG A CB   1 
ATOM   371  C  CG   . ARG A 1 86  ? -12.207 20.175 15.154  1.00 55.35 ? 85  ARG A CG   1 
ATOM   372  C  CD   . ARG A 1 86  ? -11.687 18.755 14.990  1.00 56.77 ? 85  ARG A CD   1 
ATOM   373  N  NE   . ARG A 1 86  ? -10.613 18.694 13.991  1.00 56.56 ? 85  ARG A NE   1 
ATOM   374  C  CZ   . ARG A 1 86  ? -10.697 18.131 12.783  1.00 59.03 ? 85  ARG A CZ   1 
ATOM   375  N  NH1  . ARG A 1 86  ? -11.813 17.535 12.359  1.00 52.80 ? 85  ARG A NH1  1 
ATOM   376  N  NH2  . ARG A 1 86  ? -9.634  18.156 11.983  1.00 62.20 ? 85  ARG A NH2  1 
ATOM   377  N  N    . VAL A 1 87  ? -13.337 23.614 15.204  1.00 44.35 ? 86  VAL A N    1 
ATOM   378  C  CA   . VAL A 1 87  ? -13.929 24.466 14.181  1.00 38.82 ? 86  VAL A CA   1 
ATOM   379  C  C    . VAL A 1 87  ? -12.924 24.721 13.058  1.00 37.00 ? 86  VAL A C    1 
ATOM   380  O  O    . VAL A 1 87  ? -11.715 24.498 13.225  1.00 36.29 ? 86  VAL A O    1 
ATOM   381  C  CB   . VAL A 1 87  ? -14.442 25.805 14.784  1.00 39.55 ? 86  VAL A CB   1 
ATOM   382  C  CG1  . VAL A 1 87  ? -15.528 25.538 15.826  1.00 40.99 ? 86  VAL A CG1  1 
ATOM   383  C  CG2  . VAL A 1 87  ? -13.316 26.606 15.399  1.00 34.47 ? 86  VAL A CG2  1 
ATOM   384  N  N    . PRO A 1 88  ? -13.418 25.175 11.896  1.00 34.04 ? 87  PRO A N    1 
ATOM   385  C  CA   . PRO A 1 88  ? -12.463 25.618 10.893  1.00 32.50 ? 87  PRO A CA   1 
ATOM   386  C  C    . PRO A 1 88  ? -11.567 26.731 11.438  1.00 27.96 ? 87  PRO A C    1 
ATOM   387  O  O    . PRO A 1 88  ? -12.007 27.561 12.244  1.00 27.90 ? 87  PRO A O    1 
ATOM   388  C  CB   . PRO A 1 88  ? -13.358 26.128 9.761   1.00 30.85 ? 87  PRO A CB   1 
ATOM   389  C  CG   . PRO A 1 88  ? -14.650 25.418 9.963   1.00 35.92 ? 87  PRO A CG   1 
ATOM   390  C  CD   . PRO A 1 88  ? -14.805 25.294 11.424  1.00 30.22 ? 87  PRO A CD   1 
ATOM   391  N  N    . MET A 1 89  ? -10.311 26.745 11.012  1.00 30.39 ? 88  MET A N    1 
ATOM   392  C  CA   . MET A 1 89  ? -9.420  27.861 11.326  1.00 31.44 ? 88  MET A CA   1 
ATOM   393  C  C    . MET A 1 89  ? -10.054 29.208 10.954  1.00 29.02 ? 88  MET A C    1 
ATOM   394  O  O    . MET A 1 89  ? -9.868  30.194 11.651  1.00 31.15 ? 88  MET A O    1 
ATOM   395  C  CB   . MET A 1 89  ? -8.080  27.699 10.595  1.00 33.72 ? 88  MET A CB   1 
ATOM   396  C  CG   . MET A 1 89  ? -7.019  28.765 10.953  1.00 45.50 ? 88  MET A CG   1 
ATOM   397  S  SD   . MET A 1 89  ? -6.676  29.002 12.724  1.00 48.71 ? 88  MET A SD   1 
ATOM   398  C  CE   . MET A 1 89  ? -6.791  27.339 13.363  1.00 25.08 ? 88  MET A CE   1 
ATOM   399  N  N    . GLU A 1 90  ? -10.812 29.242 9.866   1.00 28.16 ? 89  GLU A N    1 
ATOM   400  C  CA   . GLU A 1 90  ? -11.535 30.455 9.447   1.00 25.84 ? 89  GLU A CA   1 
ATOM   401  C  C    . GLU A 1 90  ? -12.369 31.095 10.581  1.00 23.66 ? 89  GLU A C    1 
ATOM   402  O  O    . GLU A 1 90  ? -12.329 32.324 10.773  1.00 26.22 ? 89  GLU A O    1 
ATOM   403  C  CB   . GLU A 1 90  ? -12.399 30.143 8.215   1.00 26.36 ? 89  GLU A CB   1 
ATOM   404  C  CG   . GLU A 1 90  ? -13.192 31.337 7.666   1.00 25.89 ? 89  GLU A CG   1 
ATOM   405  C  CD   . GLU A 1 90  ? -13.825 31.101 6.291   1.00 28.92 ? 89  GLU A CD   1 
ATOM   406  O  OE1  . GLU A 1 90  ? -13.766 29.974 5.762   1.00 27.99 ? 89  GLU A OE1  1 
ATOM   407  O  OE2  . GLU A 1 90  ? -14.360 32.078 5.724   1.00 32.76 ? 89  GLU A OE2  1 
ATOM   408  N  N    . VAL A 1 91  ? -13.094 30.252 11.323  1.00 25.91 ? 90  VAL A N    1 
ATOM   409  C  CA   . VAL A 1 91  ? -13.923 30.671 12.465  1.00 25.51 ? 90  VAL A CA   1 
ATOM   410  C  C    . VAL A 1 91  ? -13.042 31.202 13.613  1.00 25.51 ? 90  VAL A C    1 
ATOM   411  O  O    . VAL A 1 91  ? -13.353 32.227 14.192  1.00 27.64 ? 90  VAL A O    1 
ATOM   412  C  CB   . VAL A 1 91  ? -14.875 29.516 12.961  1.00 26.49 ? 90  VAL A CB   1 
ATOM   413  C  CG1  . VAL A 1 91  ? -15.556 29.895 14.274  1.00 27.12 ? 90  VAL A CG1  1 
ATOM   414  C  CG2  . VAL A 1 91  ? -15.929 29.137 11.865  1.00 25.86 ? 90  VAL A CG2  1 
ATOM   415  N  N    . VAL A 1 92  ? -11.941 30.522 13.915  1.00 25.22 ? 91  VAL A N    1 
ATOM   416  C  CA   . VAL A 1 92  ? -10.989 31.018 14.930  1.00 27.75 ? 91  VAL A CA   1 
ATOM   417  C  C    . VAL A 1 92  ? -10.468 32.430 14.573  1.00 28.43 ? 91  VAL A C    1 
ATOM   418  O  O    . VAL A 1 92  ? -10.456 33.352 15.415  1.00 25.29 ? 91  VAL A O    1 
ATOM   419  C  CB   . VAL A 1 92  ? -9.787  30.044 15.106  1.00 30.10 ? 91  VAL A CB   1 
ATOM   420  C  CG1  . VAL A 1 92  ? -8.698  30.655 16.029  1.00 27.56 ? 91  VAL A CG1  1 
ATOM   421  C  CG2  . VAL A 1 92  ? -10.271 28.674 15.628  1.00 26.59 ? 91  VAL A CG2  1 
ATOM   422  N  N    . LEU A 1 93  ? -10.068 32.603 13.312  1.00 29.27 ? 92  LEU A N    1 
ATOM   423  C  CA   . LEU A 1 93  ? -9.468  33.860 12.855  1.00 28.95 ? 92  LEU A CA   1 
ATOM   424  C  C    . LEU A 1 93  ? -10.505 34.988 12.827  1.00 27.52 ? 92  LEU A C    1 
ATOM   425  O  O    . LEU A 1 93  ? -10.208 36.090 13.239  1.00 27.85 ? 92  LEU A O    1 
ATOM   426  C  CB   . LEU A 1 93  ? -8.806  33.690 11.474  1.00 31.40 ? 92  LEU A CB   1 
ATOM   427  C  CG   . LEU A 1 93  ? -7.711  32.620 11.332  1.00 24.50 ? 92  LEU A CG   1 
ATOM   428  C  CD1  . LEU A 1 93  ? -7.268  32.486 9.878   1.00 22.34 ? 92  LEU A CD1  1 
ATOM   429  C  CD2  . LEU A 1 93  ? -6.498  32.872 12.272  1.00 23.45 ? 92  LEU A CD2  1 
ATOM   430  N  N    . LEU A 1 94  ? -11.709 34.695 12.333  1.00 25.97 ? 93  LEU A N    1 
ATOM   431  C  CA   . LEU A 1 94  ? -12.824 35.631 12.359  1.00 29.23 ? 93  LEU A CA   1 
ATOM   432  C  C    . LEU A 1 94  ? -13.210 36.090 13.775  1.00 28.02 ? 93  LEU A C    1 
ATOM   433  O  O    . LEU A 1 94  ? -13.406 37.281 13.998  1.00 28.74 ? 93  LEU A O    1 
ATOM   434  C  CB   . LEU A 1 94  ? -14.051 35.052 11.611  1.00 29.98 ? 93  LEU A CB   1 
ATOM   435  C  CG   . LEU A 1 94  ? -13.997 35.078 10.081  1.00 28.50 ? 93  LEU A CG   1 
ATOM   436  C  CD1  . LEU A 1 94  ? -15.083 34.103 9.507   1.00 27.69 ? 93  LEU A CD1  1 
ATOM   437  C  CD2  . LEU A 1 94  ? -14.134 36.482 9.527   1.00 28.06 ? 93  LEU A CD2  1 
ATOM   438  N  N    . LYS A 1 95  ? -13.297 35.155 14.718  1.00 31.06 ? 94  LYS A N    1 
ATOM   439  C  CA   . LYS A 1 95  ? -13.527 35.499 16.126  1.00 32.50 ? 94  LYS A CA   1 
ATOM   440  C  C    . LYS A 1 95  ? -12.413 36.422 16.663  1.00 33.16 ? 94  LYS A C    1 
ATOM   441  O  O    . LYS A 1 95  ? -12.698 37.379 17.368  1.00 29.54 ? 94  LYS A O    1 
ATOM   442  C  CB   . LYS A 1 95  ? -13.692 34.225 16.990  1.00 33.50 ? 94  LYS A CB   1 
ATOM   443  C  CG   . LYS A 1 95  ? -15.050 33.532 16.788  1.00 33.85 ? 94  LYS A CG   1 
ATOM   444  C  CD   . LYS A 1 95  ? -15.311 32.345 17.750  1.00 42.20 ? 94  LYS A CD   1 
ATOM   445  N  N    . LYS A 1 96  ? -11.156 36.162 16.292  1.00 29.28 ? 95  LYS A N    1 
ATOM   446  C  CA   . LYS A 1 96  ? -10.042 36.978 16.746  1.00 30.60 ? 95  LYS A CA   1 
ATOM   447  C  C    . LYS A 1 96  ? -10.082 38.428 16.217  1.00 29.16 ? 95  LYS A C    1 
ATOM   448  O  O    . LYS A 1 96  ? -9.672  39.336 16.927  1.00 30.01 ? 95  LYS A O    1 
ATOM   449  C  CB   . LYS A 1 96  ? -8.691  36.318 16.396  1.00 30.10 ? 95  LYS A CB   1 
ATOM   450  C  CG   . LYS A 1 96  ? -8.339  35.166 17.315  1.00 28.94 ? 95  LYS A CG   1 
ATOM   451  C  CD   . LYS A 1 96  ? -7.101  34.366 16.869  1.00 39.01 ? 95  LYS A CD   1 
ATOM   452  C  CE   . LYS A 1 96  ? -5.796  35.130 17.055  1.00 46.56 ? 95  LYS A CE   1 
ATOM   453  N  NZ   . LYS A 1 96  ? -5.511  35.565 18.461  1.00 41.86 ? 95  LYS A NZ   1 
ATOM   454  N  N    . VAL A 1 97  ? -10.554 38.641 14.989  1.00 29.43 ? 96  VAL A N    1 
ATOM   455  C  CA   . VAL A 1 97  ? -10.597 39.992 14.402  1.00 31.97 ? 96  VAL A CA   1 
ATOM   456  C  C    . VAL A 1 97  ? -11.952 40.685 14.574  1.00 35.23 ? 96  VAL A C    1 
ATOM   457  O  O    . VAL A 1 97  ? -12.128 41.850 14.130  1.00 36.74 ? 96  VAL A O    1 
ATOM   458  C  CB   . VAL A 1 97  ? -10.259 39.967 12.902  1.00 33.40 ? 96  VAL A CB   1 
ATOM   459  C  CG1  . VAL A 1 97  ? -8.911  39.318 12.689  1.00 28.16 ? 96  VAL A CG1  1 
ATOM   460  C  CG2  . VAL A 1 97  ? -11.376 39.261 12.088  1.00 29.91 ? 96  VAL A CG2  1 
ATOM   461  N  N    . SER A 1 98  ? -12.900 39.965 15.189  1.00 31.02 ? 97  SER A N    1 
ATOM   462  C  CA   . SER A 1 98  ? -14.259 40.451 15.396  1.00 38.62 ? 97  SER A CA   1 
ATOM   463  C  C    . SER A 1 98  ? -14.266 41.690 16.302  1.00 40.59 ? 97  SER A C    1 
ATOM   464  O  O    . SER A 1 98  ? -13.623 41.721 17.356  1.00 39.32 ? 97  SER A O    1 
ATOM   465  C  CB   . SER A 1 98  ? -15.131 39.361 16.022  1.00 41.60 ? 97  SER A CB   1 
ATOM   466  O  OG   . SER A 1 98  ? -16.428 39.869 16.239  1.00 48.83 ? 97  SER A OG   1 
ATOM   467  N  N    . SER A 1 99  ? -15.007 42.707 15.884  1.00 46.84 ? 98  SER A N    1 
ATOM   468  C  CA   . SER A 1 99  ? -14.905 44.041 16.489  1.00 48.79 ? 98  SER A CA   1 
ATOM   469  C  C    . SER A 1 99  ? -15.869 45.016 15.809  1.00 47.78 ? 98  SER A C    1 
ATOM   470  O  O    . SER A 1 99  ? -16.396 44.733 14.731  1.00 46.31 ? 98  SER A O    1 
ATOM   471  C  CB   . SER A 1 99  ? -13.466 44.565 16.352  1.00 50.54 ? 98  SER A CB   1 
ATOM   472  O  OG   . SER A 1 99  ? -13.436 45.974 16.208  1.00 50.01 ? 98  SER A OG   1 
ATOM   473  N  N    . GLY A 1 100 ? -16.078 46.162 16.454  1.00 47.97 ? 99  GLY A N    1 
ATOM   474  C  CA   . GLY A 1 100 ? -16.889 47.247 15.909  1.00 48.01 ? 99  GLY A CA   1 
ATOM   475  C  C    . GLY A 1 100 ? -16.209 47.952 14.748  1.00 47.33 ? 99  GLY A C    1 
ATOM   476  O  O    . GLY A 1 100 ? -16.884 48.579 13.930  1.00 45.51 ? 99  GLY A O    1 
ATOM   477  N  N    . PHE A 1 101 ? -14.878 47.842 14.685  1.00 44.65 ? 100 PHE A N    1 
ATOM   478  C  CA   . PHE A 1 101 ? -14.087 48.311 13.549  1.00 41.33 ? 100 PHE A CA   1 
ATOM   479  C  C    . PHE A 1 101 ? -14.571 47.677 12.274  1.00 42.86 ? 100 PHE A C    1 
ATOM   480  O  O    . PHE A 1 101 ? -14.601 46.457 12.157  1.00 47.10 ? 100 PHE A O    1 
ATOM   481  C  CB   . PHE A 1 101 ? -12.608 47.969 13.737  1.00 42.30 ? 100 PHE A CB   1 
ATOM   482  C  CG   . PHE A 1 101 ? -11.746 48.299 12.541  1.00 42.08 ? 100 PHE A CG   1 
ATOM   483  C  CD1  . PHE A 1 101 ? -11.556 49.636 12.127  1.00 39.71 ? 100 PHE A CD1  1 
ATOM   484  C  CD2  . PHE A 1 101 ? -11.101 47.285 11.837  1.00 31.47 ? 100 PHE A CD2  1 
ATOM   485  C  CE1  . PHE A 1 101 ? -10.714 49.949 11.020  1.00 35.86 ? 100 PHE A CE1  1 
ATOM   486  C  CE2  . PHE A 1 101 ? -10.251 47.586 10.709  1.00 38.65 ? 100 PHE A CE2  1 
ATOM   487  C  CZ   . PHE A 1 101 ? -10.059 48.908 10.308  1.00 30.08 ? 100 PHE A CZ   1 
ATOM   488  N  N    . SER A 1 102 ? -14.943 48.515 11.309  1.00 44.87 ? 101 SER A N    1 
ATOM   489  C  CA   . SER A 1 102 ? -15.683 48.059 10.148  1.00 47.12 ? 101 SER A CA   1 
ATOM   490  C  C    . SER A 1 102 ? -14.787 47.635 8.988   1.00 43.60 ? 101 SER A C    1 
ATOM   491  O  O    . SER A 1 102 ? -15.296 47.156 7.953   1.00 43.34 ? 101 SER A O    1 
ATOM   492  C  CB   . SER A 1 102 ? -16.709 49.128 9.707   1.00 49.10 ? 101 SER A CB   1 
ATOM   493  O  OG   . SER A 1 102 ? -16.086 50.234 9.070   1.00 50.25 ? 101 SER A OG   1 
ATOM   494  N  N    . GLY A 1 103 ? -13.467 47.779 9.151   1.00 37.56 ? 102 GLY A N    1 
ATOM   495  C  CA   . GLY A 1 103 ? -12.540 47.427 8.084   1.00 32.03 ? 102 GLY A CA   1 
ATOM   496  C  C    . GLY A 1 103 ? -12.418 45.941 7.799   1.00 31.11 ? 102 GLY A C    1 
ATOM   497  O  O    . GLY A 1 103 ? -11.910 45.565 6.776   1.00 30.68 ? 102 GLY A O    1 
ATOM   498  N  N    . VAL A 1 104 ? -12.846 45.105 8.746   1.00 28.64 ? 103 VAL A N    1 
ATOM   499  C  CA   . VAL A 1 104 ? -12.844 43.648 8.627   1.00 31.75 ? 103 VAL A CA   1 
ATOM   500  C  C    . VAL A 1 104 ? -14.298 43.165 8.808   1.00 31.82 ? 103 VAL A C    1 
ATOM   501  O  O    . VAL A 1 104 ? -15.033 43.698 9.638   1.00 30.52 ? 103 VAL A O    1 
ATOM   502  C  CB   . VAL A 1 104 ? -11.883 42.988 9.673   1.00 32.86 ? 103 VAL A CB   1 
ATOM   503  C  CG1  . VAL A 1 104 ? -11.878 41.496 9.555   1.00 39.07 ? 103 VAL A CG1  1 
ATOM   504  C  CG2  . VAL A 1 104 ? -10.466 43.536 9.493   1.00 28.00 ? 103 VAL A CG2  1 
ATOM   505  N  N    . ILE A 1 105 ? -14.699 42.184 8.012   1.00 31.13 ? 104 ILE A N    1 
ATOM   506  C  CA   . ILE A 1 105 ? -16.023 41.562 8.116   1.00 34.07 ? 104 ILE A CA   1 
ATOM   507  C  C    . ILE A 1 105 ? -16.239 41.003 9.545   1.00 31.51 ? 104 ILE A C    1 
ATOM   508  O  O    . ILE A 1 105 ? -15.324 40.452 10.178  1.00 31.00 ? 104 ILE A O    1 
ATOM   509  C  CB   . ILE A 1 105 ? -16.267 40.483 6.973   1.00 38.02 ? 104 ILE A CB   1 
ATOM   510  C  CG1  . ILE A 1 105 ? -17.777 40.202 6.747   1.00 37.59 ? 104 ILE A CG1  1 
ATOM   511  C  CG2  . ILE A 1 105 ? -15.477 39.173 7.231   1.00 31.64 ? 104 ILE A CG2  1 
ATOM   512  C  CD1  . ILE A 1 105 ? -18.350 40.844 5.524   1.00 42.62 ? 104 ILE A CD1  1 
ATOM   513  N  N    . ARG A 1 106 ? -17.446 41.219 10.055  1.00 32.50 ? 105 ARG A N    1 
ATOM   514  C  CA   . ARG A 1 106 ? -17.874 40.699 11.347  1.00 33.35 ? 105 ARG A CA   1 
ATOM   515  C  C    . ARG A 1 106 ? -18.616 39.373 11.193  1.00 29.78 ? 105 ARG A C    1 
ATOM   516  O  O    . ARG A 1 106 ? -19.665 39.300 10.551  1.00 27.35 ? 105 ARG A O    1 
ATOM   517  C  CB   . ARG A 1 106 ? -18.786 41.711 12.053  1.00 35.57 ? 105 ARG A CB   1 
ATOM   518  C  CG   A ARG A 1 106 ? -19.006 41.541 13.543  0.50 40.13 ? 105 ARG A CG   1 
ATOM   519  C  CG   B ARG A 1 106 ? -18.865 41.421 13.562  0.50 42.52 ? 105 ARG A CG   1 
ATOM   520  C  CD   A ARG A 1 106 ? -19.748 42.781 14.091  0.50 43.76 ? 105 ARG A CD   1 
ATOM   521  C  CD   B ARG A 1 106 ? -20.109 41.954 14.254  0.50 49.17 ? 105 ARG A CD   1 
ATOM   522  N  NE   A ARG A 1 106 ? -19.047 44.026 13.752  0.50 48.64 ? 105 ARG A NE   1 
ATOM   523  N  NE   B ARG A 1 106 ? -19.906 43.258 14.882  0.50 59.91 ? 105 ARG A NE   1 
ATOM   524  C  CZ   A ARG A 1 106 ? -19.630 45.199 13.514  0.50 49.13 ? 105 ARG A CZ   1 
ATOM   525  C  CZ   B ARG A 1 106 ? -19.084 43.488 15.904  0.50 62.99 ? 105 ARG A CZ   1 
ATOM   526  N  NH1  A ARG A 1 106 ? -20.947 45.325 13.570  0.50 41.64 ? 105 ARG A NH1  1 
ATOM   527  N  NH1  B ARG A 1 106 ? -18.347 42.508 16.410  0.50 63.15 ? 105 ARG A NH1  1 
ATOM   528  N  NH2  A ARG A 1 106 ? -18.886 46.255 13.207  0.50 54.80 ? 105 ARG A NH2  1 
ATOM   529  N  NH2  B ARG A 1 106 ? -18.987 44.712 16.407  0.50 60.75 ? 105 ARG A NH2  1 
ATOM   530  N  N    . LEU A 1 107 ? -18.075 38.336 11.815  1.00 26.08 ? 106 LEU A N    1 
ATOM   531  C  CA   . LEU A 1 107 ? -18.777 37.083 11.994  1.00 29.25 ? 106 LEU A CA   1 
ATOM   532  C  C    . LEU A 1 107 ? -19.840 37.233 13.116  1.00 30.80 ? 106 LEU A C    1 
ATOM   533  O  O    . LEU A 1 107 ? -19.497 37.492 14.255  1.00 30.71 ? 106 LEU A O    1 
ATOM   534  C  CB   . LEU A 1 107 ? -17.792 35.975 12.375  1.00 28.13 ? 106 LEU A CB   1 
ATOM   535  C  CG   . LEU A 1 107 ? -18.421 34.587 12.637  1.00 29.20 ? 106 LEU A CG   1 
ATOM   536  C  CD1  . LEU A 1 107 ? -19.118 33.992 11.357  1.00 25.41 ? 106 LEU A CD1  1 
ATOM   537  C  CD2  . LEU A 1 107 ? -17.361 33.629 13.182  1.00 27.90 ? 106 LEU A CD2  1 
ATOM   538  N  N    . LEU A 1 108 ? -21.111 37.080 12.766  1.00 30.03 ? 107 LEU A N    1 
ATOM   539  C  CA   . LEU A 1 108 ? -22.231 37.269 13.703  1.00 29.44 ? 107 LEU A CA   1 
ATOM   540  C  C    . LEU A 1 108 ? -22.598 35.987 14.426  1.00 30.56 ? 107 LEU A C    1 
ATOM   541  O  O    . LEU A 1 108 ? -23.066 36.027 15.573  1.00 31.05 ? 107 LEU A O    1 
ATOM   542  C  CB   . LEU A 1 108 ? -23.459 37.811 12.949  1.00 29.57 ? 107 LEU A CB   1 
ATOM   543  C  CG   . LEU A 1 108 ? -23.221 39.144 12.226  1.00 30.29 ? 107 LEU A CG   1 
ATOM   544  C  CD1  . LEU A 1 108 ? -24.397 39.519 11.346  1.00 26.79 ? 107 LEU A CD1  1 
ATOM   545  C  CD2  . LEU A 1 108 ? -22.919 40.270 13.211  1.00 39.04 ? 107 LEU A CD2  1 
ATOM   546  N  N    . ASP A 1 109 ? -22.421 34.850 13.756  1.00 28.67 ? 108 ASP A N    1 
ATOM   547  C  CA   . ASP A 1 109 ? -22.770 33.545 14.340  1.00 32.25 ? 108 ASP A CA   1 
ATOM   548  C  C    . ASP A 1 109 ? -22.268 32.443 13.403  1.00 28.98 ? 108 ASP A C    1 
ATOM   549  O  O    . ASP A 1 109 ? -21.879 32.725 12.288  1.00 25.58 ? 108 ASP A O    1 
ATOM   550  C  CB   . ASP A 1 109 ? -24.285 33.427 14.532  1.00 31.05 ? 108 ASP A CB   1 
ATOM   551  C  CG   . ASP A 1 109 ? -24.684 32.428 15.614  1.00 34.60 ? 108 ASP A CG   1 
ATOM   552  O  OD1  . ASP A 1 109 ? -23.834 31.937 16.401  1.00 39.56 ? 108 ASP A OD1  1 
ATOM   553  O  OD2  . ASP A 1 109 ? -25.884 32.133 15.675  1.00 34.44 ? 108 ASP A OD2  1 
ATOM   554  N  N    . TRP A 1 110 ? -22.245 31.212 13.896  1.00 31.27 ? 109 TRP A N    1 
ATOM   555  C  CA   . TRP A 1 110 ? -21.862 30.054 13.104  1.00 32.21 ? 109 TRP A CA   1 
ATOM   556  C  C    . TRP A 1 110 ? -22.519 28.804 13.658  1.00 30.59 ? 109 TRP A C    1 
ATOM   557  O  O    . TRP A 1 110 ? -22.811 28.717 14.849  1.00 28.86 ? 109 TRP A O    1 
ATOM   558  C  CB   . TRP A 1 110 ? -20.324 29.900 13.050  1.00 31.19 ? 109 TRP A CB   1 
ATOM   559  C  CG   . TRP A 1 110 ? -19.731 29.578 14.378  1.00 31.95 ? 109 TRP A CG   1 
ATOM   560  C  CD1  . TRP A 1 110 ? -19.376 30.466 15.350  1.00 31.62 ? 109 TRP A CD1  1 
ATOM   561  C  CD2  . TRP A 1 110 ? -19.454 28.274 14.902  1.00 36.32 ? 109 TRP A CD2  1 
ATOM   562  N  NE1  . TRP A 1 110 ? -18.887 29.800 16.442  1.00 35.20 ? 109 TRP A NE1  1 
ATOM   563  C  CE2  . TRP A 1 110 ? -18.929 28.453 16.203  1.00 34.60 ? 109 TRP A CE2  1 
ATOM   564  C  CE3  . TRP A 1 110 ? -19.610 26.972 14.407  1.00 41.79 ? 109 TRP A CE3  1 
ATOM   565  C  CZ2  . TRP A 1 110 ? -18.543 27.374 17.016  1.00 46.35 ? 109 TRP A CZ2  1 
ATOM   566  C  CZ3  . TRP A 1 110 ? -19.234 25.894 15.220  1.00 48.11 ? 109 TRP A CZ3  1 
ATOM   567  C  CH2  . TRP A 1 110 ? -18.705 26.106 16.512  1.00 44.14 ? 109 TRP A CH2  1 
ATOM   568  N  N    . PHE A 1 111 ? -22.739 27.837 12.770  1.00 30.61 ? 110 PHE A N    1 
ATOM   569  C  CA   . PHE A 1 111 ? -23.460 26.604 13.042  1.00 29.94 ? 110 PHE A CA   1 
ATOM   570  C  C    . PHE A 1 111 ? -22.690 25.448 12.430  1.00 28.21 ? 110 PHE A C    1 
ATOM   571  O  O    . PHE A 1 111 ? -22.083 25.613 11.397  1.00 25.93 ? 110 PHE A O    1 
ATOM   572  C  CB   . PHE A 1 111 ? -24.845 26.652 12.385  1.00 30.22 ? 110 PHE A CB   1 
ATOM   573  C  CG   . PHE A 1 111 ? -25.694 27.792 12.850  1.00 43.77 ? 110 PHE A CG   1 
ATOM   574  C  CD1  . PHE A 1 111 ? -26.548 27.638 13.949  1.00 47.28 ? 110 PHE A CD1  1 
ATOM   575  C  CD2  . PHE A 1 111 ? -25.640 29.025 12.204  1.00 41.52 ? 110 PHE A CD2  1 
ATOM   576  C  CE1  . PHE A 1 111 ? -27.328 28.702 14.391  1.00 51.11 ? 110 PHE A CE1  1 
ATOM   577  C  CE2  . PHE A 1 111 ? -26.417 30.093 12.639  1.00 46.73 ? 110 PHE A CE2  1 
ATOM   578  C  CZ   . PHE A 1 111 ? -27.262 29.935 13.731  1.00 52.40 ? 110 PHE A CZ   1 
ATOM   579  N  N    . GLU A 1 112 ? -22.707 24.281 13.061  1.00 29.83 ? 111 GLU A N    1 
ATOM   580  C  CA   . GLU A 1 112 ? -22.154 23.087 12.433  1.00 31.04 ? 111 GLU A CA   1 
ATOM   581  C  C    . GLU A 1 112 ? -23.296 22.197 11.926  1.00 32.73 ? 111 GLU A C    1 
ATOM   582  O  O    . GLU A 1 112 ? -24.314 22.046 12.598  1.00 31.72 ? 111 GLU A O    1 
ATOM   583  C  CB   . GLU A 1 112 ? -21.280 22.305 13.408  1.00 30.74 ? 111 GLU A CB   1 
ATOM   584  C  CG   . GLU A 1 112 ? -20.741 20.995 12.813  1.00 31.92 ? 111 GLU A CG   1 
ATOM   585  C  CD   . GLU A 1 112 ? -19.765 20.264 13.727  1.00 34.81 ? 111 GLU A CD   1 
ATOM   586  O  OE1  . GLU A 1 112 ? -19.508 20.752 14.840  1.00 34.13 ? 111 GLU A OE1  1 
ATOM   587  O  OE2  . GLU A 1 112 ? -19.257 19.198 13.319  1.00 39.22 ? 111 GLU A OE2  1 
ATOM   588  N  N    . ARG A 1 113 ? -23.115 21.634 10.732  1.00 32.34 ? 112 ARG A N    1 
ATOM   589  C  CA   . ARG A 1 113 ? -24.001 20.605 10.202  1.00 31.17 ? 112 ARG A CA   1 
ATOM   590  C  C    . ARG A 1 113 ? -23.185 19.331 9.976   1.00 30.80 ? 112 ARG A C    1 
ATOM   591  O  O    . ARG A 1 113 ? -21.969 19.327 10.192  1.00 29.66 ? 112 ARG A O    1 
ATOM   592  C  CB   . ARG A 1 113 ? -24.633 21.087 8.889   1.00 30.56 ? 112 ARG A CB   1 
ATOM   593  C  CG   . ARG A 1 113 ? -25.708 22.146 9.064   1.00 29.65 ? 112 ARG A CG   1 
ATOM   594  C  CD   . ARG A 1 113 ? -25.972 22.869 7.758   1.00 27.52 ? 112 ARG A CD   1 
ATOM   595  N  NE   . ARG A 1 113 ? -27.338 23.390 7.681   1.00 30.31 ? 112 ARG A NE   1 
ATOM   596  C  CZ   . ARG A 1 113 ? -27.869 23.983 6.614   1.00 29.87 ? 112 ARG A CZ   1 
ATOM   597  N  NH1  . ARG A 1 113 ? -27.154 24.155 5.508   1.00 27.85 ? 112 ARG A NH1  1 
ATOM   598  N  NH2  . ARG A 1 113 ? -29.125 24.414 6.655   1.00 36.05 ? 112 ARG A NH2  1 
ATOM   599  N  N    . PRO A 1 114 ? -23.843 18.237 9.548   1.00 33.24 ? 113 PRO A N    1 
ATOM   600  C  CA   . PRO A 1 114 ? -23.101 16.994 9.336   1.00 32.60 ? 113 PRO A CA   1 
ATOM   601  C  C    . PRO A 1 114 ? -21.909 17.107 8.400   1.00 32.89 ? 113 PRO A C    1 
ATOM   602  O  O    . PRO A 1 114 ? -20.854 16.549 8.697   1.00 32.68 ? 113 PRO A O    1 
ATOM   603  C  CB   . PRO A 1 114 ? -24.163 16.059 8.759   1.00 35.18 ? 113 PRO A CB   1 
ATOM   604  C  CG   . PRO A 1 114 ? -25.408 16.471 9.486   1.00 36.06 ? 113 PRO A CG   1 
ATOM   605  C  CD   . PRO A 1 114 ? -25.298 17.992 9.580   1.00 33.83 ? 113 PRO A CD   1 
ATOM   606  N  N    . ASP A 1 115 ? -22.064 17.845 7.299   1.00 33.35 ? 114 ASP A N    1 
ATOM   607  C  CA   . ASP A 1 115 ? -21.049 17.878 6.244   1.00 32.42 ? 114 ASP A CA   1 
ATOM   608  C  C    . ASP A 1 115 ? -20.528 19.273 5.954   1.00 30.12 ? 114 ASP A C    1 
ATOM   609  O  O    . ASP A 1 115 ? -19.763 19.477 5.010   1.00 31.88 ? 114 ASP A O    1 
ATOM   610  C  CB   . ASP A 1 115 ? -21.628 17.227 4.987   1.00 33.32 ? 114 ASP A CB   1 
ATOM   611  C  CG   . ASP A 1 115 ? -21.872 15.747 5.179   1.00 41.22 ? 114 ASP A CG   1 
ATOM   612  O  OD1  . ASP A 1 115 ? -20.861 15.031 5.323   1.00 47.78 ? 114 ASP A OD1  1 
ATOM   613  O  OD2  . ASP A 1 115 ? -23.053 15.307 5.220   1.00 40.42 ? 114 ASP A OD2  1 
ATOM   614  N  N    . SER A 1 116 ? -20.876 20.227 6.813   1.00 33.09 ? 115 SER A N    1 
ATOM   615  C  CA   . SER A 1 116 ? -20.485 21.611 6.594   1.00 29.66 ? 115 SER A CA   1 
ATOM   616  C  C    . SER A 1 116 ? -20.554 22.460 7.860   1.00 28.42 ? 115 SER A C    1 
ATOM   617  O  O    . SER A 1 116 ? -21.140 22.065 8.872   1.00 29.93 ? 115 SER A O    1 
ATOM   618  C  CB   . SER A 1 116 ? -21.404 22.232 5.532   1.00 31.28 ? 115 SER A CB   1 
ATOM   619  O  OG   . SER A 1 116 ? -22.749 22.248 5.998   1.00 27.85 ? 115 SER A OG   1 
ATOM   620  N  N    . PHE A 1 117 ? -19.948 23.638 7.765   1.00 30.80 ? 116 PHE A N    1 
ATOM   621  C  CA   . PHE A 1 117 ? -20.172 24.732 8.701   1.00 30.47 ? 116 PHE A CA   1 
ATOM   622  C  C    . PHE A 1 117 ? -20.915 25.863 7.993   1.00 27.07 ? 116 PHE A C    1 
ATOM   623  O  O    . PHE A 1 117 ? -20.716 26.080 6.809   1.00 28.40 ? 116 PHE A O    1 
ATOM   624  C  CB   . PHE A 1 117 ? -18.842 25.236 9.258   1.00 29.73 ? 116 PHE A CB   1 
ATOM   625  C  CG   . PHE A 1 117 ? -18.244 24.317 10.277  1.00 33.06 ? 116 PHE A CG   1 
ATOM   626  C  CD1  . PHE A 1 117 ? -18.518 24.482 11.628  1.00 36.03 ? 116 PHE A CD1  1 
ATOM   627  C  CD2  . PHE A 1 117 ? -17.423 23.260 9.878   1.00 32.05 ? 116 PHE A CD2  1 
ATOM   628  C  CE1  . PHE A 1 117 ? -17.975 23.607 12.572  1.00 32.06 ? 116 PHE A CE1  1 
ATOM   629  C  CE2  . PHE A 1 117 ? -16.884 22.396 10.810  1.00 30.86 ? 116 PHE A CE2  1 
ATOM   630  C  CZ   . PHE A 1 117 ? -17.168 22.566 12.153  1.00 29.61 ? 116 PHE A CZ   1 
ATOM   631  N  N    . VAL A 1 118 ? -21.774 26.572 8.723   1.00 22.52 ? 117 VAL A N    1 
ATOM   632  C  CA   . VAL A 1 118 ? -22.492 27.714 8.177   1.00 23.73 ? 117 VAL A CA   1 
ATOM   633  C  C    . VAL A 1 118 ? -22.067 28.946 8.952   1.00 23.64 ? 117 VAL A C    1 
ATOM   634  O  O    . VAL A 1 118 ? -22.153 28.981 10.178  1.00 22.90 ? 117 VAL A O    1 
ATOM   635  C  CB   . VAL A 1 118 ? -24.044 27.533 8.187   1.00 24.99 ? 117 VAL A CB   1 
ATOM   636  C  CG1  . VAL A 1 118 ? -24.704 28.614 7.301   1.00 24.01 ? 117 VAL A CG1  1 
ATOM   637  C  CG2  . VAL A 1 118 ? -24.433 26.124 7.708   1.00 22.23 ? 117 VAL A CG2  1 
ATOM   638  N  N    . LEU A 1 119 ? -21.551 29.931 8.232   1.00 25.09 ? 118 LEU A N    1 
ATOM   639  C  CA   . LEU A 1 119 ? -21.026 31.147 8.845   1.00 25.74 ? 118 LEU A CA   1 
ATOM   640  C  C    . LEU A 1 119 ? -21.970 32.288 8.486   1.00 27.34 ? 118 LEU A C    1 
ATOM   641  O  O    . LEU A 1 119 ? -22.299 32.472 7.311   1.00 26.51 ? 118 LEU A O    1 
ATOM   642  C  CB   . LEU A 1 119 ? -19.587 31.433 8.364   1.00 26.75 ? 118 LEU A CB   1 
ATOM   643  C  CG   . LEU A 1 119 ? -18.388 30.751 9.061   1.00 29.97 ? 118 LEU A CG   1 
ATOM   644  C  CD1  . LEU A 1 119 ? -18.530 29.255 9.147   1.00 25.40 ? 118 LEU A CD1  1 
ATOM   645  C  CD2  . LEU A 1 119 ? -17.057 31.104 8.351   1.00 26.77 ? 118 LEU A CD2  1 
ATOM   646  N  N    . ILE A 1 120 ? -22.423 33.026 9.501   1.00 26.28 ? 119 ILE A N    1 
ATOM   647  C  CA   . ILE A 1 120 ? -23.244 34.227 9.300   1.00 29.02 ? 119 ILE A CA   1 
ATOM   648  C  C    . ILE A 1 120 ? -22.347 35.465 9.430   1.00 31.29 ? 119 ILE A C    1 
ATOM   649  O  O    . ILE A 1 120 ? -21.757 35.730 10.508  1.00 29.69 ? 119 ILE A O    1 
ATOM   650  C  CB   . ILE A 1 120 ? -24.431 34.346 10.323  1.00 28.86 ? 119 ILE A CB   1 
ATOM   651  C  CG1  . ILE A 1 120 ? -25.155 33.003 10.527  1.00 27.44 ? 119 ILE A CG1  1 
ATOM   652  C  CG2  . ILE A 1 120 ? -25.400 35.463 9.897   1.00 26.93 ? 119 ILE A CG2  1 
ATOM   653  C  CD1  . ILE A 1 120 ? -25.911 32.466 9.327   1.00 26.68 ? 119 ILE A CD1  1 
ATOM   654  N  N    . LEU A 1 121 ? -22.262 36.213 8.330   1.00 29.57 ? 120 LEU A N    1 
ATOM   655  C  CA   . LEU A 1 121 ? -21.426 37.390 8.207   1.00 31.41 ? 120 LEU A CA   1 
ATOM   656  C  C    . LEU A 1 121 ? -22.293 38.634 8.038   1.00 31.21 ? 120 LEU A C    1 
ATOM   657  O  O    . LEU A 1 121 ? -23.367 38.570 7.454   1.00 31.59 ? 120 LEU A O    1 
ATOM   658  C  CB   . LEU A 1 121 ? -20.476 37.245 6.997   1.00 28.47 ? 120 LEU A CB   1 
ATOM   659  C  CG   . LEU A 1 121 ? -19.526 36.026 7.047   1.00 31.41 ? 120 LEU A CG   1 
ATOM   660  C  CD1  . LEU A 1 121 ? -18.956 35.765 5.666   1.00 32.08 ? 120 LEU A CD1  1 
ATOM   661  C  CD2  . LEU A 1 121 ? -18.410 36.219 8.077   1.00 33.30 ? 120 LEU A CD2  1 
ATOM   662  N  N    . GLU A 1 122 ? -21.831 39.770 8.557   1.00 31.17 ? 121 GLU A N    1 
ATOM   663  C  CA   . GLU A 1 122 ? -22.510 41.053 8.291   1.00 33.89 ? 121 GLU A CA   1 
ATOM   664  C  C    . GLU A 1 122 ? -22.413 41.362 6.788   1.00 33.35 ? 121 GLU A C    1 
ATOM   665  O  O    . GLU A 1 122 ? -21.403 41.080 6.142   1.00 39.22 ? 121 GLU A O    1 
ATOM   666  C  CB   . GLU A 1 122 ? -21.938 42.221 9.140   1.00 34.74 ? 121 GLU A CB   1 
ATOM   667  C  CG   A GLU A 1 122 ? -22.903 42.465 10.303  0.50 39.43 ? 121 GLU A CG   1 
ATOM   668  C  CG   B GLU A 1 122 ? -20.637 42.687 8.451   0.50 32.72 ? 121 GLU A CG   1 
ATOM   669  C  CD   A GLU A 1 122 ? -22.770 43.864 10.904  0.50 41.63 ? 121 GLU A CD   1 
ATOM   670  C  CD   B GLU A 1 122 ? -19.836 43.663 9.281   0.50 31.51 ? 121 GLU A CD   1 
ATOM   671  O  OE1  A GLU A 1 122 ? -23.760 44.614 10.844  0.50 34.30 ? 121 GLU A OE1  1 
ATOM   672  O  OE1  B GLU A 1 122 ? -18.615 43.508 9.293   0.50 22.92 ? 121 GLU A OE1  1 
ATOM   673  O  OE2  A GLU A 1 122 ? -21.686 44.215 11.422  0.50 34.24 ? 121 GLU A OE2  1 
ATOM   674  O  OE2  B GLU A 1 122 ? -20.423 44.556 9.932   0.50 40.27 ? 121 GLU A OE2  1 
ATOM   675  N  N    . ARG A 1 123 ? -23.477 41.906 6.218   1.00 29.29 ? 122 ARG A N    1 
ATOM   676  C  CA   . ARG A 1 123 ? -23.471 42.217 4.793   1.00 31.47 ? 122 ARG A CA   1 
ATOM   677  C  C    . ARG A 1 123 ? -23.768 43.694 4.611   1.00 32.67 ? 122 ARG A C    1 
ATOM   678  O  O    . ARG A 1 123 ? -24.870 44.136 4.955   1.00 35.76 ? 122 ARG A O    1 
ATOM   679  C  CB   . ARG A 1 123 ? -24.516 41.371 4.042   1.00 29.01 ? 122 ARG A CB   1 
ATOM   680  C  CG   . ARG A 1 123 ? -24.792 41.819 2.626   1.00 28.97 ? 122 ARG A CG   1 
ATOM   681  C  CD   . ARG A 1 123 ? -25.576 40.763 1.852   1.00 26.86 ? 122 ARG A CD   1 
ATOM   682  N  NE   . ARG A 1 123 ? -26.920 40.519 2.371   1.00 27.57 ? 122 ARG A NE   1 
ATOM   683  C  CZ   . ARG A 1 123 ? -27.985 41.294 2.137   1.00 33.94 ? 122 ARG A CZ   1 
ATOM   684  N  NH1  . ARG A 1 123 ? -29.163 40.979 2.650   1.00 28.66 ? 122 ARG A NH1  1 
ATOM   685  N  NH2  . ARG A 1 123 ? -27.898 42.369 1.368   1.00 27.58 ? 122 ARG A NH2  1 
ATOM   686  N  N    . PRO A 1 124 ? -22.803 44.452 4.050   1.00 36.78 ? 123 PRO A N    1 
ATOM   687  C  CA   . PRO A 1 124 ? -23.113 45.831 3.660   1.00 37.38 ? 123 PRO A CA   1 
ATOM   688  C  C    . PRO A 1 124 ? -24.136 45.890 2.518   1.00 34.58 ? 123 PRO A C    1 
ATOM   689  O  O    . PRO A 1 124 ? -24.192 44.991 1.691   1.00 29.91 ? 123 PRO A O    1 
ATOM   690  C  CB   . PRO A 1 124 ? -21.755 46.396 3.196   1.00 37.02 ? 123 PRO A CB   1 
ATOM   691  C  CG   . PRO A 1 124 ? -20.724 45.358 3.518   1.00 41.28 ? 123 PRO A CG   1 
ATOM   692  C  CD   . PRO A 1 124 ? -21.434 44.058 3.653   1.00 36.23 ? 123 PRO A CD   1 
ATOM   693  N  N    . GLU A 1 125 ? -24.930 46.952 2.499   1.00 35.87 ? 124 GLU A N    1 
ATOM   694  C  CA   . GLU A 1 125 ? -26.015 47.121 1.531   1.00 39.63 ? 124 GLU A CA   1 
ATOM   695  C  C    . GLU A 1 125 ? -26.154 48.630 1.246   1.00 35.61 ? 124 GLU A C    1 
ATOM   696  O  O    . GLU A 1 125 ? -26.403 49.403 2.164   1.00 41.12 ? 124 GLU A O    1 
ATOM   697  C  CB   . GLU A 1 125 ? -27.335 46.590 2.126   1.00 38.02 ? 124 GLU A CB   1 
ATOM   698  C  CG   . GLU A 1 125 ? -28.231 45.770 1.195   1.00 54.60 ? 124 GLU A CG   1 
ATOM   699  C  CD   . GLU A 1 125 ? -28.498 46.409 -0.164  1.00 60.77 ? 124 GLU A CD   1 
ATOM   700  O  OE1  . GLU A 1 125 ? -29.361 47.309 -0.256  1.00 64.76 ? 124 GLU A OE1  1 
ATOM   701  O  OE2  . GLU A 1 125 ? -27.859 45.981 -1.152  1.00 60.32 ? 124 GLU A OE2  1 
ATOM   702  N  N    . PRO A 1 126 ? -25.961 49.067 -0.005  1.00 35.43 ? 125 PRO A N    1 
ATOM   703  C  CA   . PRO A 1 126 ? -25.444 48.365 -1.173  1.00 33.87 ? 125 PRO A CA   1 
ATOM   704  C  C    . PRO A 1 126 ? -23.928 48.132 -1.125  1.00 36.20 ? 125 PRO A C    1 
ATOM   705  O  O    . PRO A 1 126 ? -23.179 48.864 -0.460  1.00 35.11 ? 125 PRO A O    1 
ATOM   706  C  CB   . PRO A 1 126 ? -25.843 49.282 -2.343  1.00 36.35 ? 125 PRO A CB   1 
ATOM   707  C  CG   . PRO A 1 126 ? -25.977 50.634 -1.755  1.00 35.19 ? 125 PRO A CG   1 
ATOM   708  C  CD   . PRO A 1 126 ? -26.451 50.419 -0.349  1.00 32.72 ? 125 PRO A CD   1 
ATOM   709  N  N    . VAL A 1 127 ? -23.506 47.097 -1.844  1.00 32.33 ? 126 VAL A N    1 
ATOM   710  C  CA   . VAL A 1 127 ? -22.155 46.611 -1.817  1.00 31.32 ? 126 VAL A CA   1 
ATOM   711  C  C    . VAL A 1 127 ? -21.712 46.239 -3.229  1.00 32.07 ? 126 VAL A C    1 
ATOM   712  O  O    . VAL A 1 127 ? -22.530 45.818 -4.065  1.00 32.43 ? 126 VAL A O    1 
ATOM   713  C  CB   . VAL A 1 127 ? -22.039 45.379 -0.882  1.00 32.42 ? 126 VAL A CB   1 
ATOM   714  C  CG1  . VAL A 1 127 ? -22.653 44.112 -1.567  1.00 31.72 ? 126 VAL A CG1  1 
ATOM   715  C  CG2  . VAL A 1 127 ? -20.577 45.156 -0.445  1.00 28.85 ? 126 VAL A CG2  1 
ATOM   716  N  N    . GLN A 1 128 ? -20.439 46.472 -3.507  1.00 33.30 ? 127 GLN A N    1 
ATOM   717  C  CA   . GLN A 1 128 ? -19.759 45.856 -4.639  1.00 32.15 ? 127 GLN A CA   1 
ATOM   718  C  C    . GLN A 1 128 ? -18.372 45.447 -4.193  1.00 34.39 ? 127 GLN A C    1 
ATOM   719  O  O    . GLN A 1 128 ? -17.718 46.175 -3.429  1.00 30.49 ? 127 GLN A O    1 
ATOM   720  C  CB   . GLN A 1 128 ? -19.643 46.811 -5.809  1.00 34.09 ? 127 GLN A CB   1 
ATOM   721  C  CG   . GLN A 1 128 ? -19.236 46.141 -7.146  1.00 30.91 ? 127 GLN A CG   1 
ATOM   722  C  CD   . GLN A 1 128 ? -19.250 47.136 -8.283  1.00 37.13 ? 127 GLN A CD   1 
ATOM   723  O  OE1  . GLN A 1 128 ? -18.838 48.279 -8.103  1.00 30.20 ? 127 GLN A OE1  1 
ATOM   724  N  NE2  . GLN A 1 128 ? -19.726 46.719 -9.448  1.00 27.79 ? 127 GLN A NE2  1 
ATOM   725  N  N    . ASP A 1 129 ? -17.924 44.283 -4.664  1.00 32.11 ? 128 ASP A N    1 
ATOM   726  C  CA   . ASP A 1 129 ? -16.552 43.887 -4.441  1.00 32.90 ? 128 ASP A CA   1 
ATOM   727  C  C    . ASP A 1 129 ? -15.599 44.707 -5.342  1.00 30.92 ? 128 ASP A C    1 
ATOM   728  O  O    . ASP A 1 129 ? -16.009 45.329 -6.364  1.00 27.63 ? 128 ASP A O    1 
ATOM   729  C  CB   . ASP A 1 129 ? -16.352 42.353 -4.465  1.00 33.31 ? 128 ASP A CB   1 
ATOM   730  C  CG   . ASP A 1 129 ? -16.166 41.760 -5.844  1.00 36.07 ? 128 ASP A CG   1 
ATOM   731  O  OD1  . ASP A 1 129 ? -15.554 42.354 -6.741  1.00 29.11 ? 128 ASP A OD1  1 
ATOM   732  O  OD2  . ASP A 1 129 ? -16.568 40.603 -5.998  1.00 35.76 ? 128 ASP A OD2  1 
ATOM   733  N  N    . LEU A 1 130 ? -14.362 44.795 -4.872  1.00 31.23 ? 129 LEU A N    1 
ATOM   734  C  CA   . LEU A 1 130 ? -13.380 45.652 -5.495  1.00 33.46 ? 129 LEU A CA   1 
ATOM   735  C  C    . LEU A 1 130 ? -12.936 45.122 -6.853  1.00 28.97 ? 129 LEU A C    1 
ATOM   736  O  O    . LEU A 1 130 ? -12.570 45.928 -7.722  1.00 29.57 ? 129 LEU A O    1 
ATOM   737  C  CB   . LEU A 1 130 ? -12.189 45.922 -4.560  1.00 28.78 ? 129 LEU A CB   1 
ATOM   738  C  CG   . LEU A 1 130 ? -11.065 46.838 -5.091  1.00 33.05 ? 129 LEU A CG   1 
ATOM   739  C  CD1  . LEU A 1 130 ? -11.630 48.278 -5.420  1.00 25.69 ? 129 LEU A CD1  1 
ATOM   740  C  CD2  . LEU A 1 130 ? -9.924  46.875 -4.068  1.00 31.15 ? 129 LEU A CD2  1 
ATOM   741  N  N    . PHE A 1 131 ? -12.976 43.798 -7.038  1.00 28.27 ? 130 PHE A N    1 
ATOM   742  C  CA   . PHE A 1 131 ? -12.728 43.203 -8.338  1.00 28.97 ? 130 PHE A CA   1 
ATOM   743  C  C    . PHE A 1 131 ? -13.691 43.755 -9.397  1.00 31.37 ? 130 PHE A C    1 
ATOM   744  O  O    . PHE A 1 131 ? -13.264 44.240 -10.436 1.00 27.96 ? 130 PHE A O    1 
ATOM   745  C  CB   . PHE A 1 131 ? -12.764 41.659 -8.326  1.00 29.32 ? 130 PHE A CB   1 
ATOM   746  C  CG   . PHE A 1 131 ? -12.483 41.070 -9.672  1.00 27.07 ? 130 PHE A CG   1 
ATOM   747  C  CD1  . PHE A 1 131 ? -11.167 40.763 -10.069 1.00 26.88 ? 130 PHE A CD1  1 
ATOM   748  C  CD2  . PHE A 1 131 ? -13.512 40.945 -10.608 1.00 34.05 ? 130 PHE A CD2  1 
ATOM   749  C  CE1  . PHE A 1 131 ? -10.914 40.281 -11.325 1.00 25.29 ? 130 PHE A CE1  1 
ATOM   750  C  CE2  . PHE A 1 131 ? -13.261 40.474 -11.880 1.00 35.17 ? 130 PHE A CE2  1 
ATOM   751  C  CZ   . PHE A 1 131 ? -11.952 40.149 -12.255 1.00 30.65 ? 130 PHE A CZ   1 
ATOM   752  N  N    . ASP A 1 132 ? -14.986 43.703 -9.111  1.00 33.52 ? 131 ASP A N    1 
ATOM   753  C  CA   . ASP A 1 132 ? -16.015 44.168 -10.038 1.00 32.05 ? 131 ASP A CA   1 
ATOM   754  C  C    . ASP A 1 132 ? -15.980 45.680 -10.233 1.00 29.86 ? 131 ASP A C    1 
ATOM   755  O  O    . ASP A 1 132 ? -16.186 46.196 -11.331 1.00 29.05 ? 131 ASP A O    1 
ATOM   756  C  CB   . ASP A 1 132 ? -17.419 43.725 -9.540  1.00 31.59 ? 131 ASP A CB   1 
ATOM   757  C  CG   . ASP A 1 132 ? -17.654 42.230 -9.672  1.00 37.14 ? 131 ASP A CG   1 
ATOM   758  O  OD1  . ASP A 1 132 ? -16.984 41.531 -10.465 1.00 34.73 ? 131 ASP A OD1  1 
ATOM   759  O  OD2  . ASP A 1 132 ? -18.548 41.741 -8.977  1.00 35.85 ? 131 ASP A OD2  1 
ATOM   760  N  N    . PHE A 1 133 ? -15.710 46.401 -9.156  1.00 29.34 ? 132 PHE A N    1 
ATOM   761  C  CA   . PHE A 1 133 ? -15.570 47.846 -9.223  1.00 29.39 ? 132 PHE A CA   1 
ATOM   762  C  C    . PHE A 1 133 ? -14.461 48.255 -10.211 1.00 27.73 ? 132 PHE A C    1 
ATOM   763  O  O    . PHE A 1 133 ? -14.704 49.075 -11.110 1.00 28.86 ? 132 PHE A O    1 
ATOM   764  C  CB   . PHE A 1 133 ? -15.288 48.369 -7.819  1.00 31.24 ? 132 PHE A CB   1 
ATOM   765  C  CG   . PHE A 1 133 ? -15.267 49.863 -7.706  1.00 28.48 ? 132 PHE A CG   1 
ATOM   766  C  CD1  . PHE A 1 133 ? -16.455 50.577 -7.481  1.00 30.46 ? 132 PHE A CD1  1 
ATOM   767  C  CD2  . PHE A 1 133 ? -14.066 50.563 -7.820  1.00 26.75 ? 132 PHE A CD2  1 
ATOM   768  C  CE1  . PHE A 1 133 ? -16.429 51.959 -7.341  1.00 39.38 ? 132 PHE A CE1  1 
ATOM   769  C  CE2  . PHE A 1 133 ? -14.033 51.953 -7.698  1.00 34.24 ? 132 PHE A CE2  1 
ATOM   770  C  CZ   . PHE A 1 133 ? -15.213 52.654 -7.457  1.00 28.36 ? 132 PHE A CZ   1 
ATOM   771  N  N    . ILE A 1 134 ? -13.280 47.645 -10.071 1.00 30.49 ? 133 ILE A N    1 
ATOM   772  C  CA   . ILE A 1 134 ? -12.135 47.878 -11.000 1.00 30.78 ? 133 ILE A CA   1 
ATOM   773  C  C    . ILE A 1 134 ? -12.437 47.419 -12.446 1.00 32.09 ? 133 ILE A C    1 
ATOM   774  O  O    . ILE A 1 134 ? -12.111 48.130 -13.409 1.00 35.63 ? 133 ILE A O    1 
ATOM   775  C  CB   . ILE A 1 134 ? -10.784 47.283 -10.465 1.00 26.50 ? 133 ILE A CB   1 
ATOM   776  C  CG1  . ILE A 1 134 ? -10.342 48.003 -9.163  1.00 28.13 ? 133 ILE A CG1  1 
ATOM   777  C  CG2  . ILE A 1 134 ? -9.691  47.310 -11.559 1.00 27.46 ? 133 ILE A CG2  1 
ATOM   778  C  CD1  . ILE A 1 134 ? -9.259  47.243 -8.301  1.00 22.17 ? 133 ILE A CD1  1 
ATOM   779  N  N    . THR A 1 135 ? -13.063 46.258 -12.602 1.00 32.94 ? 134 THR A N    1 
ATOM   780  C  CA   . THR A 1 135 ? -13.517 45.825 -13.930 1.00 31.43 ? 134 THR A CA   1 
ATOM   781  C  C    . THR A 1 135 ? -14.441 46.865 -14.584 1.00 34.12 ? 134 THR A C    1 
ATOM   782  O  O    . THR A 1 135 ? -14.250 47.205 -15.747 1.00 33.38 ? 134 THR A O    1 
ATOM   783  C  CB   . THR A 1 135 ? -14.228 44.471 -13.911 1.00 33.80 ? 134 THR A CB   1 
ATOM   784  O  OG1  . THR A 1 135 ? -13.376 43.508 -13.320 1.00 31.06 ? 134 THR A OG1  1 
ATOM   785  C  CG2  . THR A 1 135 ? -14.663 44.009 -15.388 1.00 31.40 ? 134 THR A CG2  1 
ATOM   786  N  N    . GLU A 1 136 ? -15.422 47.378 -13.842 1.00 31.68 ? 135 GLU A N    1 
ATOM   787  C  CA   . GLU A 1 136 ? -16.382 48.333 -14.408 1.00 34.28 ? 135 GLU A CA   1 
ATOM   788  C  C    . GLU A 1 136 ? -15.777 49.706 -14.650 1.00 33.77 ? 135 GLU A C    1 
ATOM   789  O  O    . GLU A 1 136 ? -16.061 50.327 -15.665 1.00 32.11 ? 135 GLU A O    1 
ATOM   790  C  CB   . GLU A 1 136 ? -17.616 48.463 -13.518 1.00 34.61 ? 135 GLU A CB   1 
ATOM   791  C  CG   . GLU A 1 136 ? -18.401 47.174 -13.467 1.00 42.99 ? 135 GLU A CG   1 
ATOM   792  C  CD   . GLU A 1 136 ? -19.638 47.260 -12.597 1.00 52.94 ? 135 GLU A CD   1 
ATOM   793  O  OE1  . GLU A 1 136 ? -19.981 48.371 -12.114 1.00 53.96 ? 135 GLU A OE1  1 
ATOM   794  O  OE2  . GLU A 1 136 ? -20.264 46.194 -12.413 1.00 51.06 ? 135 GLU A OE2  1 
ATOM   795  N  N    . ARG A 1 137 ? -14.953 50.177 -13.714 1.00 32.03 ? 136 ARG A N    1 
ATOM   796  C  CA   . ARG A 1 137 ? -14.439 51.551 -13.773 1.00 34.37 ? 136 ARG A CA   1 
ATOM   797  C  C    . ARG A 1 137 ? -13.088 51.713 -14.430 1.00 32.37 ? 136 ARG A C    1 
ATOM   798  O  O    . ARG A 1 137 ? -12.713 52.823 -14.819 1.00 33.20 ? 136 ARG A O    1 
ATOM   799  C  CB   . ARG A 1 137 ? -14.502 52.178 -12.378 1.00 33.03 ? 136 ARG A CB   1 
ATOM   800  C  CG   . ARG A 1 137 ? -15.986 52.265 -12.029 1.00 50.94 ? 136 ARG A CG   1 
ATOM   801  C  CD   . ARG A 1 137 ? -16.308 52.743 -10.693 1.00 52.50 ? 136 ARG A CD   1 
ATOM   802  N  NE   . ARG A 1 137 ? -15.696 54.036 -10.415 1.00 57.79 ? 136 ARG A NE   1 
ATOM   803  C  CZ   . ARG A 1 137 ? -16.269 54.998 -9.704  1.00 40.34 ? 136 ARG A CZ   1 
ATOM   804  N  NH1  . ARG A 1 137 ? -17.494 54.837 -9.201  1.00 42.37 ? 136 ARG A NH1  1 
ATOM   805  N  NH2  . ARG A 1 137 ? -15.584 56.113 -9.471  1.00 43.40 ? 136 ARG A NH2  1 
ATOM   806  N  N    . GLY A 1 138 ? -12.390 50.603 -14.618 1.00 34.25 ? 137 GLY A N    1 
ATOM   807  C  CA   . GLY A 1 138 ? -11.013 50.634 -15.099 1.00 33.53 ? 137 GLY A CA   1 
ATOM   808  C  C    . GLY A 1 138 ? -10.050 51.095 -14.017 1.00 32.36 ? 137 GLY A C    1 
ATOM   809  O  O    . GLY A 1 138 ? -10.380 51.098 -12.816 1.00 34.61 ? 137 GLY A O    1 
ATOM   810  N  N    . ALA A 1 139 ? -8.870  51.518 -14.471 1.00 30.83 ? 138 ALA A N    1 
ATOM   811  C  CA   . ALA A 1 139 ? -7.833  52.102 -13.634 1.00 31.90 ? 138 ALA A CA   1 
ATOM   812  C  C    . ALA A 1 139 ? -8.426  53.245 -12.794 1.00 32.81 ? 138 ALA A C    1 
ATOM   813  O  O    . ALA A 1 139 ? -9.094  54.131 -13.327 1.00 28.94 ? 138 ALA A O    1 
ATOM   814  C  CB   . ALA A 1 139 ? -6.639  52.612 -14.506 1.00 26.08 ? 138 ALA A CB   1 
ATOM   815  N  N    . LEU A 1 140 ? -8.204  53.183 -11.481 1.00 29.21 ? 139 LEU A N    1 
ATOM   816  C  CA   . LEU A 1 140 ? -8.726  54.169 -10.558 1.00 28.54 ? 139 LEU A CA   1 
ATOM   817  C  C    . LEU A 1 140 ? -7.839  55.413 -10.510 1.00 30.71 ? 139 LEU A C    1 
ATOM   818  O  O    . LEU A 1 140 ? -6.602  55.334 -10.568 1.00 29.84 ? 139 LEU A O    1 
ATOM   819  C  CB   . LEU A 1 140 ? -8.915  53.546 -9.169  1.00 28.37 ? 139 LEU A CB   1 
ATOM   820  C  CG   . LEU A 1 140 ? -9.756  52.259 -9.066  1.00 29.38 ? 139 LEU A CG   1 
ATOM   821  C  CD1  . LEU A 1 140 ? -9.846  51.815 -7.589  1.00 29.64 ? 139 LEU A CD1  1 
ATOM   822  C  CD2  . LEU A 1 140 ? -11.173 52.377 -9.698  1.00 27.95 ? 139 LEU A CD2  1 
ATOM   823  N  N    . GLN A 1 141 ? -8.484  56.579 -10.432 1.00 28.95 ? 140 GLN A N    1 
ATOM   824  C  CA   . GLN A 1 141 ? -7.798  57.819 -10.078 1.00 29.35 ? 140 GLN A CA   1 
ATOM   825  C  C    . GLN A 1 141 ? -6.987  57.599 -8.811  1.00 25.29 ? 140 GLN A C    1 
ATOM   826  O  O    . GLN A 1 141 ? -7.458  56.920 -7.885  1.00 27.77 ? 140 GLN A O    1 
ATOM   827  C  CB   . GLN A 1 141 ? -8.790  58.959 -9.806  1.00 27.24 ? 140 GLN A CB   1 
ATOM   828  C  CG   . GLN A 1 141 ? -9.617  59.406 -10.992 1.00 41.86 ? 140 GLN A CG   1 
ATOM   829  C  CD   . GLN A 1 141 ? -10.534 60.570 -10.637 1.00 44.11 ? 140 GLN A CD   1 
ATOM   830  O  OE1  . GLN A 1 141 ? -10.275 61.328 -9.694  1.00 41.09 ? 140 GLN A OE1  1 
ATOM   831  N  NE2  . GLN A 1 141 ? -11.599 60.730 -11.408 1.00 58.79 ? 140 GLN A NE2  1 
ATOM   832  N  N    . GLU A 1 142 ? -5.796  58.209 -8.757  1.00 24.75 ? 141 GLU A N    1 
ATOM   833  C  CA   . GLU A 1 142 ? -4.882  58.040 -7.624  1.00 26.71 ? 141 GLU A CA   1 
ATOM   834  C  C    . GLU A 1 142 ? -5.464  58.433 -6.256  1.00 26.36 ? 141 GLU A C    1 
ATOM   835  O  O    . GLU A 1 142 ? -5.184  57.762 -5.276  1.00 24.72 ? 141 GLU A O    1 
ATOM   836  C  CB   . GLU A 1 142 ? -3.539  58.717 -7.880  1.00 22.92 ? 141 GLU A CB   1 
ATOM   837  C  CG   . GLU A 1 142 ? -2.676  57.813 -8.788  1.00 29.87 ? 141 GLU A CG   1 
ATOM   838  C  CD   . GLU A 1 142 ? -1.322  58.376 -9.096  1.00 26.78 ? 141 GLU A CD   1 
ATOM   839  O  OE1  . GLU A 1 142 ? -0.672  58.909 -8.176  1.00 29.53 ? 141 GLU A OE1  1 
ATOM   840  O  OE2  . GLU A 1 142 ? -0.903  58.258 -10.265 1.00 27.58 ? 141 GLU A OE2  1 
ATOM   841  N  N    . GLU A 1 143 ? -6.263  59.494 -6.224  1.00 23.74 ? 142 GLU A N    1 
ATOM   842  C  CA   . GLU A 1 143 ? -6.986  59.920 -5.036  1.00 27.94 ? 142 GLU A CA   1 
ATOM   843  C  C    . GLU A 1 143 ? -7.904  58.816 -4.501  1.00 27.55 ? 142 GLU A C    1 
ATOM   844  O  O    . GLU A 1 143 ? -7.994  58.603 -3.270  1.00 26.42 ? 142 GLU A O    1 
ATOM   845  C  CB   . GLU A 1 143 ? -7.814  61.180 -5.326  1.00 28.02 ? 142 GLU A CB   1 
ATOM   846  C  CG   . GLU A 1 143 ? -8.557  61.723 -4.112  1.00 28.94 ? 142 GLU A CG   1 
ATOM   847  C  CD   . GLU A 1 143 ? -9.423  62.929 -4.441  1.00 31.10 ? 142 GLU A CD   1 
ATOM   848  O  OE1  . GLU A 1 143 ? -10.458 62.751 -5.108  1.00 28.04 ? 142 GLU A OE1  1 
ATOM   849  O  OE2  . GLU A 1 143 ? -9.067  64.044 -4.004  1.00 31.69 ? 142 GLU A OE2  1 
ATOM   850  N  N    . LEU A 1 144 ? -8.573  58.124 -5.425  1.00 24.01 ? 143 LEU A N    1 
ATOM   851  C  CA   . LEU A 1 144 ? -9.451  57.040 -5.046  1.00 25.43 ? 143 LEU A CA   1 
ATOM   852  C  C    . LEU A 1 144 ? -8.639  55.819 -4.597  1.00 24.95 ? 143 LEU A C    1 
ATOM   853  O  O    . LEU A 1 144 ? -8.941  55.186 -3.565  1.00 23.11 ? 143 LEU A O    1 
ATOM   854  C  CB   . LEU A 1 144 ? -10.448 56.711 -6.186  1.00 25.30 ? 143 LEU A CB   1 
ATOM   855  C  CG   . LEU A 1 144 ? -11.434 55.573 -5.930  1.00 29.22 ? 143 LEU A CG   1 
ATOM   856  C  CD1  . LEU A 1 144 ? -12.250 55.853 -4.640  1.00 23.74 ? 143 LEU A CD1  1 
ATOM   857  C  CD2  . LEU A 1 144 ? -12.389 55.362 -7.158  1.00 22.11 ? 143 LEU A CD2  1 
ATOM   858  N  N    . ALA A 1 145 ? -7.606  55.474 -5.369  1.00 27.45 ? 144 ALA A N    1 
ATOM   859  C  CA   . ALA A 1 145 ? -6.720  54.391 -5.011  1.00 26.26 ? 144 ALA A CA   1 
ATOM   860  C  C    . ALA A 1 145 ? -6.044  54.615 -3.636  1.00 24.88 ? 144 ALA A C    1 
ATOM   861  O  O    . ALA A 1 145 ? -5.842  53.652 -2.893  1.00 22.66 ? 144 ALA A O    1 
ATOM   862  C  CB   . ALA A 1 145 ? -5.632  54.119 -6.137  1.00 22.38 ? 144 ALA A CB   1 
ATOM   863  N  N    . ARG A 1 146 ? -5.663  55.861 -3.346  1.00 25.43 ? 145 ARG A N    1 
ATOM   864  C  CA   . ARG A 1 146 ? -5.050  56.241 -2.073  1.00 25.72 ? 145 ARG A CA   1 
ATOM   865  C  C    . ARG A 1 146 ? -6.001  55.977 -0.911  1.00 26.71 ? 145 ARG A C    1 
ATOM   866  O  O    . ARG A 1 146 ? -5.591  55.396 0.107   1.00 24.36 ? 145 ARG A O    1 
ATOM   867  C  CB   . ARG A 1 146 ? -4.564  57.712 -2.084  1.00 22.62 ? 145 ARG A CB   1 
ATOM   868  C  CG   . ARG A 1 146 ? -4.108  58.250 -0.701  1.00 29.64 ? 145 ARG A CG   1 
ATOM   869  C  CD   . ARG A 1 146 ? -3.704  59.719 -0.733  1.00 23.19 ? 145 ARG A CD   1 
ATOM   870  N  NE   . ARG A 1 146 ? -2.706  59.915 -1.764  1.00 26.43 ? 145 ARG A NE   1 
ATOM   871  C  CZ   . ARG A 1 146 ? -2.885  60.573 -2.916  1.00 33.19 ? 145 ARG A CZ   1 
ATOM   872  N  NH1  . ARG A 1 146 ? -4.003  61.243 -3.198  1.00 28.10 ? 145 ARG A NH1  1 
ATOM   873  N  NH2  . ARG A 1 146 ? -1.896  60.571 -3.794  1.00 24.29 ? 145 ARG A NH2  1 
ATOM   874  N  N    . SER A 1 147 ? -7.259  56.385 -1.075  1.00 25.04 ? 146 SER A N    1 
ATOM   875  C  CA   . SER A 1 147 ? -8.281  56.187 -0.060  1.00 23.69 ? 146 SER A CA   1 
ATOM   876  C  C    . SER A 1 147 ? -8.552  54.717 0.208   1.00 27.96 ? 146 SER A C    1 
ATOM   877  O  O    . SER A 1 147 ? -8.548  54.272 1.365   1.00 25.46 ? 146 SER A O    1 
ATOM   878  C  CB   . SER A 1 147 ? -9.559  56.911 -0.454  1.00 25.41 ? 146 SER A CB   1 
ATOM   879  O  OG   . SER A 1 147 ? -10.643 56.578 0.388   1.00 26.27 ? 146 SER A OG   1 
ATOM   880  N  N    . PHE A 1 148 ? -8.755  53.955 -0.874  1.00 24.27 ? 147 PHE A N    1 
ATOM   881  C  CA   . PHE A 1 148 ? -8.967  52.527 -0.773  1.00 27.05 ? 147 PHE A CA   1 
ATOM   882  C  C    . PHE A 1 148 ? -7.753  51.807 -0.180  1.00 26.59 ? 147 PHE A C    1 
ATOM   883  O  O    . PHE A 1 148 ? -7.926  50.999 0.701   1.00 22.78 ? 147 PHE A O    1 
ATOM   884  C  CB   . PHE A 1 148 ? -9.328  51.929 -2.146  1.00 26.02 ? 147 PHE A CB   1 
ATOM   885  C  CG   . PHE A 1 148 ? -10.752 52.184 -2.596  1.00 26.96 ? 147 PHE A CG   1 
ATOM   886  C  CD1  . PHE A 1 148 ? -11.669 52.953 -1.855  1.00 31.57 ? 147 PHE A CD1  1 
ATOM   887  C  CD2  . PHE A 1 148 ? -11.187 51.638 -3.798  1.00 32.83 ? 147 PHE A CD2  1 
ATOM   888  C  CE1  . PHE A 1 148 ? -12.990 53.131 -2.308  1.00 33.44 ? 147 PHE A CE1  1 
ATOM   889  C  CE2  . PHE A 1 148 ? -12.486 51.858 -4.259  1.00 25.96 ? 147 PHE A CE2  1 
ATOM   890  C  CZ   . PHE A 1 148 ? -13.397 52.574 -3.504  1.00 28.32 ? 147 PHE A CZ   1 
ATOM   891  N  N    . PHE A 1 149 ? -6.543  52.083 -0.691  1.00 25.12 ? 148 PHE A N    1 
ATOM   892  C  CA   . PHE A 1 149 ? -5.338  51.395 -0.249  1.00 28.13 ? 148 PHE A CA   1 
ATOM   893  C  C    . PHE A 1 149 ? -5.041  51.648 1.233   1.00 25.88 ? 148 PHE A C    1 
ATOM   894  O  O    . PHE A 1 149 ? -4.704  50.710 1.978   1.00 23.92 ? 148 PHE A O    1 
ATOM   895  C  CB   . PHE A 1 149 ? -4.145  51.780 -1.137  1.00 24.37 ? 148 PHE A CB   1 
ATOM   896  C  CG   . PHE A 1 149 ? -2.943  50.905 -0.942  1.00 27.07 ? 148 PHE A CG   1 
ATOM   897  C  CD1  . PHE A 1 149 ? -3.007  49.557 -1.242  1.00 28.77 ? 148 PHE A CD1  1 
ATOM   898  C  CD2  . PHE A 1 149 ? -1.749  51.436 -0.484  1.00 26.26 ? 148 PHE A CD2  1 
ATOM   899  C  CE1  . PHE A 1 149 ? -1.893  48.731 -1.062  1.00 26.50 ? 148 PHE A CE1  1 
ATOM   900  C  CE2  . PHE A 1 149 ? -0.616  50.613 -0.324  1.00 25.80 ? 148 PHE A CE2  1 
ATOM   901  C  CZ   . PHE A 1 149 ? -0.695  49.271 -0.622  1.00 28.54 ? 148 PHE A CZ   1 
ATOM   902  N  N    . TRP A 1 150 ? -5.233  52.901 1.660   1.00 28.89 ? 149 TRP A N    1 
ATOM   903  C  CA   . TRP A 1 150 ? -5.123  53.302 3.069   1.00 27.41 ? 149 TRP A CA   1 
ATOM   904  C  C    . TRP A 1 150 ? -6.050  52.495 3.977   1.00 28.36 ? 149 TRP A C    1 
ATOM   905  O  O    . TRP A 1 150 ? -5.613  51.968 5.024   1.00 23.38 ? 149 TRP A O    1 
ATOM   906  C  CB   . TRP A 1 150 ? -5.442  54.797 3.228   1.00 25.45 ? 149 TRP A CB   1 
ATOM   907  C  CG   . TRP A 1 150 ? -5.253  55.307 4.603   1.00 25.39 ? 149 TRP A CG   1 
ATOM   908  C  CD1  . TRP A 1 150 ? -6.189  55.345 5.597   1.00 26.58 ? 149 TRP A CD1  1 
ATOM   909  C  CD2  . TRP A 1 150 ? -4.050  55.820 5.174   1.00 25.67 ? 149 TRP A CD2  1 
ATOM   910  N  NE1  . TRP A 1 150 ? -5.659  55.878 6.732   1.00 29.27 ? 149 TRP A NE1  1 
ATOM   911  C  CE2  . TRP A 1 150 ? -4.353  56.201 6.503   1.00 27.28 ? 149 TRP A CE2  1 
ATOM   912  C  CE3  . TRP A 1 150 ? -2.760  56.045 4.685   1.00 24.80 ? 149 TRP A CE3  1 
ATOM   913  C  CZ2  . TRP A 1 150 ? -3.405  56.757 7.362   1.00 23.73 ? 149 TRP A CZ2  1 
ATOM   914  C  CZ3  . TRP A 1 150 ? -1.815  56.618 5.543   1.00 30.68 ? 149 TRP A CZ3  1 
ATOM   915  C  CH2  . TRP A 1 150 ? -2.156  56.964 6.876   1.00 26.15 ? 149 TRP A CH2  1 
ATOM   916  N  N    . GLN A 1 151 ? -7.315  52.384 3.563   1.00 27.76 ? 150 GLN A N    1 
ATOM   917  C  CA   . GLN A 1 151 ? -8.297  51.613 4.305   1.00 26.79 ? 150 GLN A CA   1 
ATOM   918  C  C    . GLN A 1 151 ? -7.918  50.132 4.380   1.00 27.05 ? 150 GLN A C    1 
ATOM   919  O  O    . GLN A 1 151 ? -8.163  49.515 5.393   1.00 25.45 ? 150 GLN A O    1 
ATOM   920  C  CB   . GLN A 1 151 ? -9.713  51.776 3.738   1.00 26.05 ? 150 GLN A CB   1 
ATOM   921  C  CG   . GLN A 1 151 ? -10.397 53.123 4.086   1.00 28.22 ? 150 GLN A CG   1 
ATOM   922  C  CD   . GLN A 1 151 ? -11.876 53.133 3.679   1.00 26.26 ? 150 GLN A CD   1 
ATOM   923  O  OE1  . GLN A 1 151 ? -12.617 52.215 4.023   1.00 25.99 ? 150 GLN A OE1  1 
ATOM   924  N  NE2  . GLN A 1 151 ? -12.305 54.176 2.957   1.00 27.47 ? 150 GLN A NE2  1 
ATOM   925  N  N    . VAL A 1 152 ? -7.328  49.581 3.310   1.00 26.95 ? 151 VAL A N    1 
ATOM   926  C  CA   . VAL A 1 152 ? -6.870  48.210 3.311   1.00 27.74 ? 151 VAL A CA   1 
ATOM   927  C  C    . VAL A 1 152 ? -5.704  48.026 4.277   1.00 26.42 ? 151 VAL A C    1 
ATOM   928  O  O    . VAL A 1 152 ? -5.679  47.079 5.067   1.00 26.15 ? 151 VAL A O    1 
ATOM   929  C  CB   . VAL A 1 152 ? -6.542  47.684 1.858   1.00 26.63 ? 151 VAL A CB   1 
ATOM   930  C  CG1  . VAL A 1 152 ? -5.978  46.270 1.910   1.00 23.97 ? 151 VAL A CG1  1 
ATOM   931  C  CG2  . VAL A 1 152 ? -7.808  47.651 0.999   1.00 24.25 ? 151 VAL A CG2  1 
ATOM   932  N  N    . LEU A 1 153 ? -4.756  48.947 4.239   1.00 26.56 ? 152 LEU A N    1 
ATOM   933  C  CA   . LEU A 1 153 ? -3.679  48.970 5.218   1.00 27.88 ? 152 LEU A CA   1 
ATOM   934  C  C    . LEU A 1 153 ? -4.177  48.939 6.669   1.00 24.36 ? 152 LEU A C    1 
ATOM   935  O  O    . LEU A 1 153 ? -3.694  48.139 7.455   1.00 25.39 ? 152 LEU A O    1 
ATOM   936  C  CB   . LEU A 1 153 ? -2.734  50.161 4.989   1.00 25.55 ? 152 LEU A CB   1 
ATOM   937  C  CG   A LEU A 1 153 ? -1.698  49.857 3.886   0.60 29.07 ? 152 LEU A CG   1 
ATOM   938  C  CG   B LEU A 1 153 ? -1.552  49.960 4.023   0.40 29.03 ? 152 LEU A CG   1 
ATOM   939  C  CD1  A LEU A 1 153 ? -1.273  51.154 3.201   0.60 38.55 ? 152 LEU A CD1  1 
ATOM   940  C  CD1  B LEU A 1 153 ? -1.897  49.154 2.793   0.40 18.21 ? 152 LEU A CD1  1 
ATOM   941  C  CD2  A LEU A 1 153 ? -0.495  49.097 4.413   0.60 22.26 ? 152 LEU A CD2  1 
ATOM   942  C  CD2  B LEU A 1 153 ? -1.011  51.320 3.624   0.40 36.88 ? 152 LEU A CD2  1 
ATOM   943  N  N    . GLU A 1 154 ? -5.122  49.810 7.011   1.00 25.50 ? 153 GLU A N    1 
ATOM   944  C  CA   . GLU A 1 154 ? -5.707  49.866 8.351   1.00 24.07 ? 153 GLU A CA   1 
ATOM   945  C  C    . GLU A 1 154 ? -6.385  48.570 8.731   1.00 23.18 ? 153 GLU A C    1 
ATOM   946  O  O    . GLU A 1 154 ? -6.223  48.109 9.851   1.00 23.49 ? 153 GLU A O    1 
ATOM   947  C  CB   . GLU A 1 154 ? -6.698  51.024 8.484   1.00 25.44 ? 153 GLU A CB   1 
ATOM   948  C  CG   . GLU A 1 154 ? -6.083  52.413 8.399   1.00 26.58 ? 153 GLU A CG   1 
ATOM   949  C  CD   . GLU A 1 154 ? -5.268  52.778 9.654   1.00 29.99 ? 153 GLU A CD   1 
ATOM   950  O  OE1  . GLU A 1 154 ? -5.750  52.556 10.772  1.00 32.62 ? 153 GLU A OE1  1 
ATOM   951  O  OE2  . GLU A 1 154 ? -4.149  53.316 9.523   1.00 28.02 ? 153 GLU A OE2  1 
ATOM   952  N  N    . ALA A 1 155 ? -7.092  47.955 7.775   1.00 23.30 ? 154 ALA A N    1 
ATOM   953  C  CA   . ALA A 1 155 ? -7.729  46.624 7.976   1.00 23.04 ? 154 ALA A CA   1 
ATOM   954  C  C    . ALA A 1 155 ? -6.722  45.472 8.251   1.00 23.64 ? 154 ALA A C    1 
ATOM   955  O  O    . ALA A 1 155 ? -6.886  44.649 9.160   1.00 24.49 ? 154 ALA A O    1 
ATOM   956  C  CB   . ALA A 1 155 ? -8.639  46.307 6.771   1.00 20.77 ? 154 ALA A CB   1 
ATOM   957  N  N    . VAL A 1 156 ? -5.654  45.447 7.477   1.00 27.36 ? 155 VAL A N    1 
ATOM   958  C  CA   . VAL A 1 156 ? -4.609  44.437 7.601   1.00 26.75 ? 155 VAL A CA   1 
ATOM   959  C  C    . VAL A 1 156 ? -3.818  44.612 8.898   1.00 29.02 ? 155 VAL A C    1 
ATOM   960  O  O    . VAL A 1 156 ? -3.469  43.618 9.556   1.00 25.78 ? 155 VAL A O    1 
ATOM   961  C  CB   . VAL A 1 156 ? -3.674  44.432 6.332   1.00 28.98 ? 155 VAL A CB   1 
ATOM   962  C  CG1  . VAL A 1 156 ? -2.500  43.508 6.518   1.00 24.59 ? 155 VAL A CG1  1 
ATOM   963  C  CG2  . VAL A 1 156 ? -4.477  44.022 5.035   1.00 21.38 ? 155 VAL A CG2  1 
ATOM   964  N  N    . ARG A 1 157 ? -3.522  45.864 9.259   1.00 24.81 ? 156 ARG A N    1 
ATOM   965  C  CA   . ARG A 1 157 ? -2.924  46.178 10.568  1.00 25.32 ? 156 ARG A CA   1 
ATOM   966  C  C    . ARG A 1 157 ? -3.823  45.698 11.718  1.00 26.27 ? 156 ARG A C    1 
ATOM   967  O  O    . ARG A 1 157 ? -3.328  45.133 12.678  1.00 23.51 ? 156 ARG A O    1 
ATOM   968  C  CB   . ARG A 1 157 ? -2.687  47.676 10.718  1.00 24.87 ? 156 ARG A CB   1 
ATOM   969  C  CG   . ARG A 1 157 ? -1.496  48.244 9.913   1.00 25.36 ? 156 ARG A CG   1 
ATOM   970  C  CD   . ARG A 1 157 ? -1.396  49.746 10.178  1.00 22.01 ? 156 ARG A CD   1 
ATOM   971  N  NE   . ARG A 1 157 ? -1.112  50.035 11.562  1.00 26.48 ? 156 ARG A NE   1 
ATOM   972  C  CZ   . ARG A 1 157 ? -1.282  51.215 12.153  1.00 23.20 ? 156 ARG A CZ   1 
ATOM   973  N  NH1  . ARG A 1 157 ? -1.722  52.257 11.474  1.00 22.60 ? 156 ARG A NH1  1 
ATOM   974  N  NH2  . ARG A 1 157 ? -0.973  51.338 13.429  1.00 22.42 ? 156 ARG A NH2  1 
ATOM   975  N  N    . HIS A 1 158 ? -5.137  45.915 11.601  1.00 26.50 ? 157 HIS A N    1 
ATOM   976  C  CA   . HIS A 1 158 ? -6.095  45.365 12.562  1.00 27.12 ? 157 HIS A CA   1 
ATOM   977  C  C    . HIS A 1 158 ? -5.938  43.824 12.731  1.00 27.13 ? 157 HIS A C    1 
ATOM   978  O  O    . HIS A 1 158 ? -5.861  43.325 13.842  1.00 24.73 ? 157 HIS A O    1 
ATOM   979  C  CB   . HIS A 1 158 ? -7.542  45.724 12.180  1.00 28.23 ? 157 HIS A CB   1 
ATOM   980  C  CG   . HIS A 1 158 ? -8.576  45.060 13.051  1.00 31.35 ? 157 HIS A CG   1 
ATOM   981  N  ND1  . HIS A 1 158 ? -8.867  45.491 14.326  1.00 28.30 ? 157 HIS A ND1  1 
ATOM   982  C  CD2  . HIS A 1 158 ? -9.350  43.967 12.841  1.00 29.70 ? 157 HIS A CD2  1 
ATOM   983  C  CE1  . HIS A 1 158 ? -9.811  44.723 14.846  1.00 27.66 ? 157 HIS A CE1  1 
ATOM   984  N  NE2  . HIS A 1 158 ? -10.119 43.789 13.966  1.00 30.70 ? 157 HIS A NE2  1 
ATOM   985  N  N    . CYS A 1 159 ? -5.900  43.099 11.613  1.00 28.17 ? 158 CYS A N    1 
ATOM   986  C  CA   . CYS A 1 159 ? -5.724  41.659 11.623  1.00 29.51 ? 158 CYS A CA   1 
ATOM   987  C  C    . CYS A 1 159 ? -4.439  41.262 12.344  1.00 28.44 ? 158 CYS A C    1 
ATOM   988  O  O    . CYS A 1 159 ? -4.467  40.412 13.247  1.00 27.77 ? 158 CYS A O    1 
ATOM   989  C  CB   . CYS A 1 159 ? -5.695  41.108 10.195  1.00 29.01 ? 158 CYS A CB   1 
ATOM   990  S  SG   . CYS A 1 159 ? -7.271  41.256 9.332   1.00 29.85 ? 158 CYS A SG   1 
ATOM   991  N  N    . HIS A 1 160 ? -3.315  41.866 11.934  1.00 27.28 ? 159 HIS A N    1 
ATOM   992  C  CA   . HIS A 1 160 ? -2.012  41.591 12.545  1.00 28.65 ? 159 HIS A CA   1 
ATOM   993  C  C    . HIS A 1 160 ? -1.950  41.925 14.032  1.00 25.86 ? 159 HIS A C    1 
ATOM   994  O  O    . HIS A 1 160 ? -1.378  41.154 14.808  1.00 24.58 ? 159 HIS A O    1 
ATOM   995  C  CB   . HIS A 1 160 ? -0.871  42.293 11.791  1.00 27.18 ? 159 HIS A CB   1 
ATOM   996  C  CG   . HIS A 1 160 ? -0.634  41.735 10.427  1.00 30.02 ? 159 HIS A CG   1 
ATOM   997  N  ND1  . HIS A 1 160 ? 0.611   41.688 9.851   1.00 36.03 ? 159 HIS A ND1  1 
ATOM   998  C  CD2  . HIS A 1 160 ? -1.478  41.141 9.541   1.00 36.28 ? 159 HIS A CD2  1 
ATOM   999  C  CE1  . HIS A 1 160 ? 0.524   41.129 8.656   1.00 39.40 ? 159 HIS A CE1  1 
ATOM   1000 N  NE2  . HIS A 1 160 ? -0.732  40.794 8.442   1.00 27.42 ? 159 HIS A NE2  1 
ATOM   1001 N  N    . ASN A 1 161 ? -2.527  43.057 14.421  1.00 26.05 ? 160 ASN A N    1 
ATOM   1002 C  CA   . ASN A 1 161 ? -2.684  43.393 15.831  1.00 28.63 ? 160 ASN A CA   1 
ATOM   1003 C  C    . ASN A 1 161 ? -3.478  42.355 16.644  1.00 28.48 ? 160 ASN A C    1 
ATOM   1004 O  O    . ASN A 1 161 ? -3.231  42.196 17.818  1.00 26.53 ? 160 ASN A O    1 
ATOM   1005 C  CB   . ASN A 1 161 ? -3.454  44.688 16.011  1.00 29.20 ? 160 ASN A CB   1 
ATOM   1006 C  CG   A ASN A 1 161 ? -2.804  45.615 17.060  0.50 33.01 ? 160 ASN A CG   1 
ATOM   1007 C  CG   B ASN A 1 161 ? -2.671  45.941 15.641  0.50 28.05 ? 160 ASN A CG   1 
ATOM   1008 O  OD1  A ASN A 1 161 ? -3.509  46.269 17.835  0.50 41.12 ? 160 ASN A OD1  1 
ATOM   1009 O  OD1  B ASN A 1 161 ? -1.504  45.883 15.262  0.50 32.25 ? 160 ASN A OD1  1 
ATOM   1010 N  ND2  A ASN A 1 161 ? -1.478  45.558 17.181  0.50 29.47 ? 160 ASN A ND2  1 
ATOM   1011 N  ND2  B ASN A 1 161 ? -3.379  47.068 15.608  0.50 40.07 ? 160 ASN A ND2  1 
ATOM   1012 N  N    . CYS A 1 162 ? -4.454  41.710 16.013  1.00 29.96 ? 161 CYS A N    1 
ATOM   1013 C  CA   . CYS A 1 162 ? -5.256  40.625 16.615  1.00 29.88 ? 161 CYS A CA   1 
ATOM   1014 C  C    . CYS A 1 162 ? -4.649  39.221 16.475  1.00 29.16 ? 161 CYS A C    1 
ATOM   1015 O  O    . CYS A 1 162 ? -5.289  38.238 16.836  1.00 25.53 ? 161 CYS A O    1 
ATOM   1016 C  CB   . CYS A 1 162 ? -6.655  40.592 15.968  1.00 29.96 ? 161 CYS A CB   1 
ATOM   1017 S  SG   . CYS A 1 162 ? -7.616  42.066 16.285  1.00 32.19 ? 161 CYS A SG   1 
ATOM   1018 N  N    . GLY A 1 163 ? -3.449  39.127 15.920  1.00 27.16 ? 162 GLY A N    1 
ATOM   1019 C  CA   . GLY A 1 163 ? -2.725  37.869 15.791  1.00 29.91 ? 162 GLY A CA   1 
ATOM   1020 C  C    . GLY A 1 163 ? -3.103  37.022 14.592  1.00 25.58 ? 162 GLY A C    1 
ATOM   1021 O  O    . GLY A 1 163 ? -2.882  35.806 14.597  1.00 26.40 ? 162 GLY A O    1 
ATOM   1022 N  N    . VAL A 1 164 ? -3.654  37.663 13.560  1.00 27.90 ? 163 VAL A N    1 
ATOM   1023 C  CA   . VAL A 1 164 ? -4.183  36.988 12.387  1.00 29.77 ? 163 VAL A CA   1 
ATOM   1024 C  C    . VAL A 1 164 ? -3.456  37.454 11.122  1.00 28.42 ? 163 VAL A C    1 
ATOM   1025 O  O    . VAL A 1 164 ? -3.371  38.656 10.819  1.00 26.59 ? 163 VAL A O    1 
ATOM   1026 C  CB   . VAL A 1 164 ? -5.711  37.256 12.264  1.00 28.70 ? 163 VAL A CB   1 
ATOM   1027 C  CG1  . VAL A 1 164 ? -6.266  36.770 10.932  1.00 28.46 ? 163 VAL A CG1  1 
ATOM   1028 C  CG2  . VAL A 1 164 ? -6.454  36.610 13.464  1.00 28.29 ? 163 VAL A CG2  1 
ATOM   1029 N  N    . LEU A 1 165 ? -2.923  36.490 10.386  1.00 25.01 ? 164 LEU A N    1 
ATOM   1030 C  CA   . LEU A 1 165 ? -2.382  36.729 9.043   1.00 26.96 ? 164 LEU A CA   1 
ATOM   1031 C  C    . LEU A 1 165 ? -3.435  36.285 7.991   1.00 26.25 ? 164 LEU A C    1 
ATOM   1032 O  O    . LEU A 1 165 ? -3.906  35.151 8.002   1.00 28.98 ? 164 LEU A O    1 
ATOM   1033 C  CB   . LEU A 1 165 ? -1.063  35.953 8.905   1.00 27.17 ? 164 LEU A CB   1 
ATOM   1034 C  CG   . LEU A 1 165 ? -0.289  36.136 7.602   1.00 26.97 ? 164 LEU A CG   1 
ATOM   1035 C  CD1  . LEU A 1 165 ? 0.412   37.506 7.522   1.00 23.78 ? 164 LEU A CD1  1 
ATOM   1036 C  CD2  . LEU A 1 165 ? 0.649   34.971 7.444   1.00 22.54 ? 164 LEU A CD2  1 
ATOM   1037 N  N    . HIS A 1 166 ? -3.820  37.201 7.107   1.00 26.32 ? 165 HIS A N    1 
ATOM   1038 C  CA   . HIS A 1 166 ? -4.910  36.961 6.161   1.00 25.13 ? 165 HIS A CA   1 
ATOM   1039 C  C    . HIS A 1 166 ? -4.521  35.937 5.045   1.00 25.13 ? 165 HIS A C    1 
ATOM   1040 O  O    . HIS A 1 166 ? -5.249  34.982 4.824   1.00 26.12 ? 165 HIS A O    1 
ATOM   1041 C  CB   . HIS A 1 166 ? -5.419  38.291 5.573   1.00 25.16 ? 165 HIS A CB   1 
ATOM   1042 C  CG   . HIS A 1 166 ? -6.690  38.160 4.775   1.00 24.91 ? 165 HIS A CG   1 
ATOM   1043 N  ND1  . HIS A 1 166 ? -6.701  37.715 3.478   1.00 21.81 ? 165 HIS A ND1  1 
ATOM   1044 C  CD2  . HIS A 1 166 ? -7.980  38.409 5.093   1.00 27.46 ? 165 HIS A CD2  1 
ATOM   1045 C  CE1  . HIS A 1 166 ? -7.945  37.680 3.030   1.00 26.00 ? 165 HIS A CE1  1 
ATOM   1046 N  NE2  . HIS A 1 166 ? -8.742  38.099 3.991   1.00 24.76 ? 165 HIS A NE2  1 
ATOM   1047 N  N    . ARG A 1 167 ? -3.398  36.176 4.351   1.00 25.90 ? 166 ARG A N    1 
ATOM   1048 C  CA   . ARG A 1 167 ? -2.822  35.298 3.300   1.00 26.80 ? 166 ARG A CA   1 
ATOM   1049 C  C    . ARG A 1 167 ? -3.583  35.213 1.974   1.00 26.41 ? 166 ARG A C    1 
ATOM   1050 O  O    . ARG A 1 167 ? -3.233  34.427 1.097   1.00 28.47 ? 166 ARG A O    1 
ATOM   1051 C  CB   . ARG A 1 167 ? -2.529  33.884 3.842   1.00 29.08 ? 166 ARG A CB   1 
ATOM   1052 C  CG   . ARG A 1 167 ? -1.560  33.894 5.000   1.00 28.68 ? 166 ARG A CG   1 
ATOM   1053 C  CD   . ARG A 1 167 ? -0.877  32.530 5.212   1.00 31.16 ? 166 ARG A CD   1 
ATOM   1054 N  NE   . ARG A 1 167 ? -1.800  31.474 5.612   1.00 26.34 ? 166 ARG A NE   1 
ATOM   1055 C  CZ   . ARG A 1 167 ? -1.439  30.214 5.871   1.00 28.29 ? 166 ARG A CZ   1 
ATOM   1056 N  NH1  . ARG A 1 167 ? -2.354  29.335 6.234   1.00 31.70 ? 166 ARG A NH1  1 
ATOM   1057 N  NH2  . ARG A 1 167 ? -0.170  29.839 5.784   1.00 28.06 ? 166 ARG A NH2  1 
ATOM   1058 N  N    . ASP A 1 168 ? -4.606  36.031 1.810   1.00 24.96 ? 167 ASP A N    1 
ATOM   1059 C  CA   . ASP A 1 168 ? -5.325  36.100 0.557   1.00 28.89 ? 167 ASP A CA   1 
ATOM   1060 C  C    . ASP A 1 168 ? -5.869  37.519 0.281   1.00 28.42 ? 167 ASP A C    1 
ATOM   1061 O  O    . ASP A 1 168 ? -7.027  37.717 -0.164  1.00 27.49 ? 167 ASP A O    1 
ATOM   1062 C  CB   . ASP A 1 168 ? -6.433  35.039 0.540   1.00 28.32 ? 167 ASP A CB   1 
ATOM   1063 C  CG   . ASP A 1 168 ? -6.885  34.661 -0.883  1.00 35.45 ? 167 ASP A CG   1 
ATOM   1064 O  OD1  . ASP A 1 168 ? -6.188  34.986 -1.878  1.00 26.71 ? 167 ASP A OD1  1 
ATOM   1065 O  OD2  . ASP A 1 168 ? -7.962  34.031 -0.989  1.00 26.90 ? 167 ASP A OD2  1 
ATOM   1066 N  N    . ILE A 1 169 ? -5.011  38.509 0.511   1.00 31.10 ? 168 ILE A N    1 
ATOM   1067 C  CA   . ILE A 1 169 ? -5.367  39.890 0.212   1.00 28.66 ? 168 ILE A CA   1 
ATOM   1068 C  C    . ILE A 1 169 ? -5.425  40.040 -1.328  1.00 29.45 ? 168 ILE A C    1 
ATOM   1069 O  O    . ILE A 1 169 ? -4.434  39.801 -2.043  1.00 28.77 ? 168 ILE A O    1 
ATOM   1070 C  CB   . ILE A 1 169 ? -4.365  40.904 0.846   1.00 31.79 ? 168 ILE A CB   1 
ATOM   1071 C  CG1  . ILE A 1 169 ? -4.354  40.819 2.386   1.00 26.25 ? 168 ILE A CG1  1 
ATOM   1072 C  CG2  . ILE A 1 169 ? -4.654  42.323 0.350   1.00 26.00 ? 168 ILE A CG2  1 
ATOM   1073 C  CD1  . ILE A 1 169 ? -3.044  41.421 3.071   1.00 21.64 ? 168 ILE A CD1  1 
ATOM   1074 N  N    . LYS A 1 170 ? -6.598  40.406 -1.820  1.00 26.87 ? 169 LYS A N    1 
ATOM   1075 C  CA   . LYS A 1 170 ? -6.837  40.659 -3.243  1.00 28.52 ? 169 LYS A CA   1 
ATOM   1076 C  C    . LYS A 1 170 ? -8.118  41.464 -3.420  1.00 24.23 ? 169 LYS A C    1 
ATOM   1077 O  O    . LYS A 1 170 ? -8.926  41.535 -2.511  1.00 25.46 ? 169 LYS A O    1 
ATOM   1078 C  CB   . LYS A 1 170 ? -6.923  39.352 -4.060  1.00 27.66 ? 169 LYS A CB   1 
ATOM   1079 C  CG   . LYS A 1 170 ? -7.962  38.335 -3.606  1.00 30.11 ? 169 LYS A CG   1 
ATOM   1080 C  CD   . LYS A 1 170 ? -7.942  37.151 -4.593  1.00 24.35 ? 169 LYS A CD   1 
ATOM   1081 C  CE   . LYS A 1 170 ? -8.761  35.970 -4.136  1.00 30.81 ? 169 LYS A CE   1 
ATOM   1082 N  NZ   . LYS A 1 170 ? -8.887  35.020 -5.243  1.00 31.79 ? 169 LYS A NZ   1 
ATOM   1083 N  N    . ASP A 1 171 ? -8.295  42.071 -4.592  1.00 24.12 ? 170 ASP A N    1 
ATOM   1084 C  CA   . ASP A 1 171 ? -9.528  42.821 -4.868  1.00 27.46 ? 170 ASP A CA   1 
ATOM   1085 C  C    . ASP A 1 171 ? -10.842 42.014 -4.723  1.00 23.82 ? 170 ASP A C    1 
ATOM   1086 O  O    . ASP A 1 171 ? -11.828 42.567 -4.254  1.00 24.38 ? 170 ASP A O    1 
ATOM   1087 C  CB   . ASP A 1 171 ? -9.483  43.557 -6.214  1.00 26.05 ? 170 ASP A CB   1 
ATOM   1088 C  CG   . ASP A 1 171 ? -9.245  42.657 -7.413  1.00 25.44 ? 170 ASP A CG   1 
ATOM   1089 O  OD1  . ASP A 1 171 ? -9.194  41.416 -7.303  1.00 28.91 ? 170 ASP A OD1  1 
ATOM   1090 O  OD2  . ASP A 1 171 ? -9.074  43.251 -8.493  1.00 27.77 ? 170 ASP A OD2  1 
ATOM   1091 N  N    . GLU A 1 172 ? -10.818 40.720 -5.063  1.00 26.02 ? 171 GLU A N    1 
ATOM   1092 C  CA   . GLU A 1 172 ? -11.991 39.815 -4.882  1.00 27.96 ? 171 GLU A CA   1 
ATOM   1093 C  C    . GLU A 1 172 ? -12.392 39.663 -3.419  1.00 27.43 ? 171 GLU A C    1 
ATOM   1094 O  O    . GLU A 1 172 ? -13.526 39.326 -3.123  1.00 27.48 ? 171 GLU A O    1 
ATOM   1095 C  CB   . GLU A 1 172 ? -11.680 38.419 -5.408  1.00 27.29 ? 171 GLU A CB   1 
ATOM   1096 C  CG   . GLU A 1 172 ? -11.216 38.353 -6.865  1.00 29.14 ? 171 GLU A CG   1 
ATOM   1097 C  CD   . GLU A 1 172 ? -10.999 36.933 -7.322  1.00 31.31 ? 171 GLU A CD   1 
ATOM   1098 O  OE1  . GLU A 1 172 ? -11.995 36.200 -7.338  1.00 30.54 ? 171 GLU A OE1  1 
ATOM   1099 O  OE2  . GLU A 1 172 ? -9.860  36.568 -7.677  1.00 30.25 ? 171 GLU A OE2  1 
ATOM   1100 N  N    . ASN A 1 173 ? -11.448 39.889 -2.501  1.00 26.53 ? 172 ASN A N    1 
ATOM   1101 C  CA   . ASN A 1 173 ? -11.686 39.698 -1.049  1.00 27.37 ? 172 ASN A CA   1 
ATOM   1102 C  C    . ASN A 1 173 ? -11.848 41.029 -0.302  1.00 26.60 ? 172 ASN A C    1 
ATOM   1103 O  O    . ASN A 1 173 ? -11.596 41.135 0.902   1.00 26.61 ? 172 ASN A O    1 
ATOM   1104 C  CB   . ASN A 1 173 ? -10.583 38.819 -0.452  1.00 27.69 ? 172 ASN A CB   1 
ATOM   1105 C  CG   . ASN A 1 173 ? -10.663 37.374 -0.917  1.00 24.15 ? 172 ASN A CG   1 
ATOM   1106 O  OD1  . ASN A 1 173 ? -11.710 36.926 -1.356  1.00 28.92 ? 172 ASN A OD1  1 
ATOM   1107 N  ND2  . ASN A 1 173 ? -9.560  36.613 -0.769  1.00 22.31 ? 172 ASN A ND2  1 
ATOM   1108 N  N    . ILE A 1 174 ? -12.233 42.072 -1.052  1.00 26.65 ? 173 ILE A N    1 
ATOM   1109 C  CA   . ILE A 1 174 ? -12.524 43.412 -0.502  1.00 24.37 ? 173 ILE A CA   1 
ATOM   1110 C  C    . ILE A 1 174 ? -13.925 43.861 -0.967  1.00 24.53 ? 173 ILE A C    1 
ATOM   1111 O  O    . ILE A 1 174 ? -14.207 43.866 -2.156  1.00 29.68 ? 173 ILE A O    1 
ATOM   1112 C  CB   . ILE A 1 174 ? -11.443 44.451 -0.888  1.00 27.88 ? 173 ILE A CB   1 
ATOM   1113 C  CG1  . ILE A 1 174 ? -10.072 44.033 -0.337  1.00 31.41 ? 173 ILE A CG1  1 
ATOM   1114 C  CG2  . ILE A 1 174 ? -11.866 45.878 -0.405  1.00 27.99 ? 173 ILE A CG2  1 
ATOM   1115 C  CD1  . ILE A 1 174 ? -8.857  44.764 -0.981  1.00 25.96 ? 173 ILE A CD1  1 
ATOM   1116 N  N    . LEU A 1 175 ? -14.803 44.170 0.002   1.00 28.40 ? 174 LEU A N    1 
ATOM   1117 C  CA   . LEU A 1 175 ? -16.119 44.732 -0.255  1.00 27.98 ? 174 LEU A CA   1 
ATOM   1118 C  C    . LEU A 1 175 ? -16.084 46.259 -0.055  1.00 26.57 ? 174 LEU A C    1 
ATOM   1119 O  O    . LEU A 1 175 ? -15.400 46.754 0.828   1.00 27.75 ? 174 LEU A O    1 
ATOM   1120 C  CB   . LEU A 1 175 ? -17.165 44.118 0.678   1.00 28.87 ? 174 LEU A CB   1 
ATOM   1121 C  CG   . LEU A 1 175 ? -17.433 42.607 0.630   1.00 29.07 ? 174 LEU A CG   1 
ATOM   1122 C  CD1  . LEU A 1 175 ? -18.652 42.253 1.590   1.00 23.62 ? 174 LEU A CD1  1 
ATOM   1123 C  CD2  . LEU A 1 175 ? -17.655 42.174 -0.821  1.00 25.99 ? 174 LEU A CD2  1 
ATOM   1124 N  N    . ILE A 1 176 ? -16.777 46.973 -0.929  1.00 27.42 ? 175 ILE A N    1 
ATOM   1125 C  CA   . ILE A 1 176 ? -16.994 48.418 -0.832  1.00 28.39 ? 175 ILE A CA   1 
ATOM   1126 C  C    . ILE A 1 176 ? -18.432 48.651 -0.377  1.00 28.91 ? 175 ILE A C    1 
ATOM   1127 O  O    . ILE A 1 176 ? -19.397 48.308 -1.082  1.00 28.89 ? 175 ILE A O    1 
ATOM   1128 C  CB   . ILE A 1 176 ? -16.783 49.162 -2.194  1.00 24.72 ? 175 ILE A CB   1 
ATOM   1129 C  CG1  . ILE A 1 176 ? -15.487 48.749 -2.875  1.00 29.23 ? 175 ILE A CG1  1 
ATOM   1130 C  CG2  . ILE A 1 176 ? -16.847 50.678 -2.001  1.00 24.32 ? 175 ILE A CG2  1 
ATOM   1131 C  CD1  . ILE A 1 176 ? -15.403 49.178 -4.306  1.00 24.52 ? 175 ILE A CD1  1 
ATOM   1132 N  N    . ASP A 1 177 ? -18.572 49.179 0.839   1.00 30.47 ? 176 ASP A N    1 
ATOM   1133 C  CA   . ASP A 1 177 ? -19.818 49.808 1.318   1.00 33.51 ? 176 ASP A CA   1 
ATOM   1134 C  C    . ASP A 1 177 ? -19.951 51.126 0.515   1.00 33.15 ? 176 ASP A C    1 
ATOM   1135 O  O    . ASP A 1 177 ? -19.293 52.134 0.798   1.00 32.05 ? 176 ASP A O    1 
ATOM   1136 C  CB   . ASP A 1 177 ? -19.718 50.026 2.843   1.00 32.79 ? 176 ASP A CB   1 
ATOM   1137 C  CG   . ASP A 1 177 ? -21.048 50.453 3.512   1.00 32.29 ? 176 ASP A CG   1 
ATOM   1138 O  OD1  . ASP A 1 177 ? -21.897 51.077 2.875   1.00 32.94 ? 176 ASP A OD1  1 
ATOM   1139 O  OD2  . ASP A 1 177 ? -21.182 50.186 4.730   1.00 37.46 ? 176 ASP A OD2  1 
ATOM   1140 N  N    . LEU A 1 178 ? -20.777 51.078 -0.522  1.00 30.56 ? 177 LEU A N    1 
ATOM   1141 C  CA   . LEU A 1 178 ? -20.869 52.144 -1.507  1.00 34.21 ? 177 LEU A CA   1 
ATOM   1142 C  C    . LEU A 1 178 ? -21.438 53.451 -0.927  1.00 37.16 ? 177 LEU A C    1 
ATOM   1143 O  O    . LEU A 1 178 ? -21.112 54.527 -1.409  1.00 42.25 ? 177 LEU A O    1 
ATOM   1144 C  CB   . LEU A 1 178 ? -21.718 51.690 -2.705  1.00 32.41 ? 177 LEU A CB   1 
ATOM   1145 C  CG   . LEU A 1 178 ? -21.143 50.546 -3.539  1.00 28.51 ? 177 LEU A CG   1 
ATOM   1146 C  CD1  . LEU A 1 178 ? -22.267 49.853 -4.371  1.00 32.61 ? 177 LEU A CD1  1 
ATOM   1147 C  CD2  . LEU A 1 178 ? -19.959 51.063 -4.424  1.00 28.88 ? 177 LEU A CD2  1 
ATOM   1148 N  N    . ASN A 1 179 ? -22.274 53.347 0.100   1.00 34.32 ? 178 ASN A N    1 
ATOM   1149 C  CA   . ASN A 1 179 ? -22.893 54.520 0.717   1.00 35.01 ? 178 ASN A CA   1 
ATOM   1150 C  C    . ASN A 1 179 ? -21.959 55.224 1.713   1.00 33.73 ? 178 ASN A C    1 
ATOM   1151 O  O    . ASN A 1 179 ? -21.924 56.454 1.775   1.00 31.28 ? 178 ASN A O    1 
ATOM   1152 C  CB   . ASN A 1 179 ? -24.222 54.136 1.381   1.00 34.36 ? 178 ASN A CB   1 
ATOM   1153 C  CG   . ASN A 1 179 ? -25.407 54.098 0.366   1.00 45.18 ? 178 ASN A CG   1 
ATOM   1154 O  OD1  . ASN A 1 179 ? -25.254 54.444 -0.809  1.00 41.97 ? 178 ASN A OD1  1 
ATOM   1155 N  ND2  . ASN A 1 179 ? -26.569 53.677 0.830   1.00 42.54 ? 178 ASN A ND2  1 
ATOM   1156 N  N    . ARG A 1 180 ? -21.184 54.430 2.448   1.00 33.26 ? 179 ARG A N    1 
ATOM   1157 C  CA   . ARG A 1 180 ? -20.256 54.932 3.466   1.00 31.22 ? 179 ARG A CA   1 
ATOM   1158 C  C    . ARG A 1 180 ? -18.832 55.199 2.946   1.00 31.48 ? 179 ARG A C    1 
ATOM   1159 O  O    . ARG A 1 180 ? -18.044 55.878 3.614   1.00 32.84 ? 179 ARG A O    1 
ATOM   1160 C  CB   . ARG A 1 180 ? -20.245 53.937 4.634   1.00 33.49 ? 179 ARG A CB   1 
ATOM   1161 C  CG   . ARG A 1 180 ? -21.644 53.761 5.294   1.00 36.24 ? 179 ARG A CG   1 
ATOM   1162 C  CD   . ARG A 1 180 ? -21.525 53.154 6.692   1.00 36.97 ? 179 ARG A CD   1 
ATOM   1163 N  NE   . ARG A 1 180 ? -20.908 54.127 7.604   1.00 60.10 ? 179 ARG A NE   1 
ATOM   1164 C  CZ   . ARG A 1 180 ? -20.216 53.838 8.709   1.00 65.14 ? 179 ARG A CZ   1 
ATOM   1165 N  NH1  . ARG A 1 180 ? -20.035 52.575 9.107   1.00 78.27 ? 179 ARG A NH1  1 
ATOM   1166 N  NH2  . ARG A 1 180 ? -19.687 54.829 9.429   1.00 45.99 ? 179 ARG A NH2  1 
ATOM   1167 N  N    . GLY A 1 181 ? -18.511 54.673 1.758   1.00 28.24 ? 180 GLY A N    1 
ATOM   1168 C  CA   . GLY A 1 181 ? -17.158 54.724 1.204   1.00 28.85 ? 180 GLY A CA   1 
ATOM   1169 C  C    . GLY A 1 181 ? -16.165 53.937 2.063   1.00 30.17 ? 180 GLY A C    1 
ATOM   1170 O  O    . GLY A 1 181 ? -14.987 54.240 2.074   1.00 26.40 ? 180 GLY A O    1 
ATOM   1171 N  N    . GLU A 1 182 ? -16.658 52.923 2.764   1.00 27.83 ? 181 GLU A N    1 
ATOM   1172 C  CA   . GLU A 1 182 ? -15.830 52.084 3.631   1.00 30.92 ? 181 GLU A CA   1 
ATOM   1173 C  C    . GLU A 1 182 ? -15.595 50.705 3.012   1.00 30.00 ? 181 GLU A C    1 
ATOM   1174 O  O    . GLU A 1 182 ? -16.528 50.062 2.499   1.00 27.55 ? 181 GLU A O    1 
ATOM   1175 C  CB   . GLU A 1 182 ? -16.484 51.926 4.984   1.00 27.31 ? 181 GLU A CB   1 
ATOM   1176 C  CG   . GLU A 1 182 ? -16.436 53.182 5.823   1.00 30.07 ? 181 GLU A CG   1 
ATOM   1177 C  CD   . GLU A 1 182 ? -17.251 53.056 7.104   1.00 47.44 ? 181 GLU A CD   1 
ATOM   1178 O  OE1  . GLU A 1 182 ? -17.849 51.990 7.316   1.00 36.19 ? 181 GLU A OE1  1 
ATOM   1179 O  OE2  . GLU A 1 182 ? -17.284 54.021 7.897   1.00 49.85 ? 181 GLU A OE2  1 
ATOM   1180 N  N    . LEU A 1 183 ? -14.335 50.290 3.042   1.00 26.84 ? 182 LEU A N    1 
ATOM   1181 C  CA   . LEU A 1 183 ? -13.901 48.986 2.561   1.00 28.46 ? 182 LEU A CA   1 
ATOM   1182 C  C    . LEU A 1 183 ? -13.886 47.973 3.711   1.00 30.39 ? 182 LEU A C    1 
ATOM   1183 O  O    . LEU A 1 183 ? -13.641 48.333 4.875   1.00 29.86 ? 182 LEU A O    1 
ATOM   1184 C  CB   . LEU A 1 183 ? -12.534 49.086 1.874   1.00 29.30 ? 182 LEU A CB   1 
ATOM   1185 C  CG   . LEU A 1 183 ? -12.518 49.340 0.356   1.00 37.35 ? 182 LEU A CG   1 
ATOM   1186 C  CD1  . LEU A 1 183 ? -13.303 50.562 -0.014  1.00 32.01 ? 182 LEU A CD1  1 
ATOM   1187 C  CD2  . LEU A 1 183 ? -11.044 49.398 -0.178  1.00 32.14 ? 182 LEU A CD2  1 
ATOM   1188 N  N    . LYS A 1 184 ? -14.160 46.718 3.357   1.00 27.25 ? 183 LYS A N    1 
ATOM   1189 C  CA   . LYS A 1 184 ? -14.231 45.600 4.296   1.00 28.23 ? 183 LYS A CA   1 
ATOM   1190 C  C    . LYS A 1 184 ? -13.459 44.385 3.757   1.00 25.35 ? 183 LYS A C    1 
ATOM   1191 O  O    . LYS A 1 184 ? -13.742 43.869 2.670   1.00 26.25 ? 183 LYS A O    1 
ATOM   1192 C  CB   . LYS A 1 184 ? -15.692 45.265 4.584   1.00 27.57 ? 183 LYS A CB   1 
ATOM   1193 C  CG   . LYS A 1 184 ? -15.938 44.398 5.781   1.00 40.51 ? 183 LYS A CG   1 
ATOM   1194 C  CD   . LYS A 1 184 ? -17.447 44.124 5.932   1.00 56.71 ? 183 LYS A CD   1 
ATOM   1195 C  CE   . LYS A 1 184 ? -18.251 45.390 6.263   1.00 54.66 ? 183 LYS A CE   1 
ATOM   1196 N  NZ   . LYS A 1 184 ? -17.707 46.170 7.417   1.00 44.57 ? 183 LYS A NZ   1 
ATOM   1197 N  N    . LEU A 1 185 ? -12.455 43.958 4.530   1.00 26.43 ? 184 LEU A N    1 
ATOM   1198 C  CA   . LEU A 1 185 ? -11.676 42.786 4.210   1.00 27.23 ? 184 LEU A CA   1 
ATOM   1199 C  C    . LEU A 1 185 ? -12.505 41.543 4.580   1.00 25.90 ? 184 LEU A C    1 
ATOM   1200 O  O    . LEU A 1 185 ? -13.053 41.439 5.691   1.00 32.55 ? 184 LEU A O    1 
ATOM   1201 C  CB   . LEU A 1 185 ? -10.306 42.842 4.924   1.00 24.87 ? 184 LEU A CB   1 
ATOM   1202 C  CG   . LEU A 1 185 ? -9.241  41.777 4.671   1.00 32.83 ? 184 LEU A CG   1 
ATOM   1203 C  CD1  . LEU A 1 185 ? -8.814  41.750 3.202   1.00 34.24 ? 184 LEU A CD1  1 
ATOM   1204 C  CD2  . LEU A 1 185 ? -8.014  42.047 5.638   1.00 27.45 ? 184 LEU A CD2  1 
ATOM   1205 N  N    . ILE A 1 186 ? -12.621 40.640 3.617   1.00 27.27 ? 185 ILE A N    1 
ATOM   1206 C  CA   . ILE A 1 186 ? -13.369 39.404 3.759   1.00 28.48 ? 185 ILE A CA   1 
ATOM   1207 C  C    . ILE A 1 186 ? -12.467 38.222 3.390   1.00 29.31 ? 185 ILE A C    1 
ATOM   1208 O  O    . ILE A 1 186 ? -11.293 38.391 3.009   1.00 26.52 ? 185 ILE A O    1 
ATOM   1209 C  CB   . ILE A 1 186 ? -14.712 39.421 2.914   1.00 26.47 ? 185 ILE A CB   1 
ATOM   1210 C  CG1  . ILE A 1 186 ? -14.449 39.368 1.403   1.00 29.96 ? 185 ILE A CG1  1 
ATOM   1211 C  CG2  . ILE A 1 186 ? -15.592 40.662 3.304   1.00 22.72 ? 185 ILE A CG2  1 
ATOM   1212 C  CD1  . ILE A 1 186 ? -15.699 39.103 0.575   1.00 23.64 ? 185 ILE A CD1  1 
ATOM   1213 N  N    . ASP A 1 187 ? -13.031 37.028 3.562   1.00 28.52 ? 186 ASP A N    1 
ATOM   1214 C  CA   . ASP A 1 187 ? -12.425 35.739 3.169   1.00 28.27 ? 186 ASP A CA   1 
ATOM   1215 C  C    . ASP A 1 187 ? -11.145 35.360 3.907   1.00 27.60 ? 186 ASP A C    1 
ATOM   1216 O  O    . ASP A 1 187 ? -10.022 35.411 3.359   1.00 27.87 ? 186 ASP A O    1 
ATOM   1217 C  CB   . ASP A 1 187 ? -12.241 35.644 1.643   1.00 26.27 ? 186 ASP A CB   1 
ATOM   1218 C  CG   . ASP A 1 187 ? -11.836 34.250 1.174   1.00 38.27 ? 186 ASP A CG   1 
ATOM   1219 O  OD1  . ASP A 1 187 ? -11.593 33.327 2.002   1.00 33.76 ? 186 ASP A OD1  1 
ATOM   1220 O  OD2  . ASP A 1 187 ? -11.730 34.082 -0.048  1.00 33.27 ? 186 ASP A OD2  1 
ATOM   1221 N  N    . PHE A 1 188 ? -11.352 34.880 5.128   1.00 29.19 ? 187 PHE A N    1 
ATOM   1222 C  CA   . PHE A 1 188 ? -10.273 34.397 5.964   1.00 29.13 ? 187 PHE A CA   1 
ATOM   1223 C  C    . PHE A 1 188 ? -10.048 32.882 5.808   1.00 30.02 ? 187 PHE A C    1 
ATOM   1224 O  O    . PHE A 1 188 ? -9.408  32.264 6.647   1.00 27.08 ? 187 PHE A O    1 
ATOM   1225 C  CB   . PHE A 1 188 ? -10.514 34.807 7.426   1.00 27.65 ? 187 PHE A CB   1 
ATOM   1226 C  CG   . PHE A 1 188 ? -10.314 36.277 7.670   1.00 30.77 ? 187 PHE A CG   1 
ATOM   1227 C  CD1  . PHE A 1 188 ? -9.175  36.745 8.352   1.00 27.80 ? 187 PHE A CD1  1 
ATOM   1228 C  CD2  . PHE A 1 188 ? -11.246 37.210 7.225   1.00 31.27 ? 187 PHE A CD2  1 
ATOM   1229 C  CE1  . PHE A 1 188 ? -8.990  38.104 8.583   1.00 26.93 ? 187 PHE A CE1  1 
ATOM   1230 C  CE2  . PHE A 1 188 ? -11.051 38.584 7.459   1.00 29.85 ? 187 PHE A CE2  1 
ATOM   1231 C  CZ   . PHE A 1 188 ? -9.915  39.024 8.116   1.00 27.13 ? 187 PHE A CZ   1 
ATOM   1232 N  N    . GLY A 1 189 ? -10.548 32.306 4.713   1.00 29.21 ? 188 GLY A N    1 
ATOM   1233 C  CA   . GLY A 1 189 ? -10.409 30.880 4.442   1.00 29.73 ? 188 GLY A CA   1 
ATOM   1234 C  C    . GLY A 1 189 ? -9.022  30.354 4.140   1.00 31.08 ? 188 GLY A C    1 
ATOM   1235 O  O    . GLY A 1 189 ? -8.844  29.159 4.117   1.00 30.34 ? 188 GLY A O    1 
ATOM   1236 N  N    . SER A 1 190 ? -8.044  31.234 3.897   1.00 31.25 ? 189 SER A N    1 
ATOM   1237 C  CA   . SER A 1 190 ? -6.630  30.845 3.713   1.00 29.97 ? 189 SER A CA   1 
ATOM   1238 C  C    . SER A 1 190 ? -5.703  31.337 4.839   1.00 27.92 ? 189 SER A C    1 
ATOM   1239 O  O    . SER A 1 190 ? -4.490  31.191 4.756   1.00 28.05 ? 189 SER A O    1 
ATOM   1240 C  CB   . SER A 1 190 ? -6.099  31.385 2.371   1.00 30.93 ? 189 SER A CB   1 
ATOM   1241 O  OG   . SER A 1 190 ? -6.995  31.118 1.311   1.00 38.95 ? 189 SER A OG   1 
ATOM   1242 N  N    . GLY A 1 191 ? -6.267  31.937 5.886   1.00 30.80 ? 190 GLY A N    1 
ATOM   1243 C  CA   . GLY A 1 191 ? -5.467  32.625 6.887   1.00 28.70 ? 190 GLY A CA   1 
ATOM   1244 C  C    . GLY A 1 191 ? -4.772  31.708 7.868   1.00 29.83 ? 190 GLY A C    1 
ATOM   1245 O  O    . GLY A 1 191 ? -4.966  30.488 7.860   1.00 30.92 ? 190 GLY A O    1 
ATOM   1246 N  N    . ALA A 1 192 ? -3.923  32.301 8.699   1.00 31.71 ? 191 ALA A N    1 
ATOM   1247 C  CA   . ALA A 1 192 ? -3.264  31.580 9.767   1.00 29.23 ? 191 ALA A CA   1 
ATOM   1248 C  C    . ALA A 1 192 ? -3.117  32.486 10.976  1.00 31.00 ? 191 ALA A C    1 
ATOM   1249 O  O    . ALA A 1 192 ? -3.313  33.708 10.886  1.00 29.01 ? 191 ALA A O    1 
ATOM   1250 C  CB   . ALA A 1 192 ? -1.886  31.060 9.286   1.00 28.89 ? 191 ALA A CB   1 
ATOM   1251 N  N    . LEU A 1 193 ? -2.771  31.892 12.121  1.00 27.12 ? 192 LEU A N    1 
ATOM   1252 C  CA   . LEU A 1 193 ? -2.253  32.669 13.231  1.00 27.42 ? 192 LEU A CA   1 
ATOM   1253 C  C    . LEU A 1 193 ? -0.941  33.312 12.748  1.00 28.68 ? 192 LEU A C    1 
ATOM   1254 O  O    . LEU A 1 193 ? -0.151  32.676 12.012  1.00 26.48 ? 192 LEU A O    1 
ATOM   1255 C  CB   . LEU A 1 193 ? -2.073  31.826 14.488  1.00 29.55 ? 192 LEU A CB   1 
ATOM   1256 C  CG   . LEU A 1 193 ? -3.337  31.188 15.072  1.00 30.55 ? 192 LEU A CG   1 
ATOM   1257 C  CD1  . LEU A 1 193 ? -2.956  30.378 16.320  1.00 35.09 ? 192 LEU A CD1  1 
ATOM   1258 C  CD2  . LEU A 1 193 ? -4.443  32.233 15.385  1.00 26.19 ? 192 LEU A CD2  1 
ATOM   1259 N  N    . LEU A 1 194 ? -0.767  34.594 13.090  1.00 27.01 ? 193 LEU A N    1 
ATOM   1260 C  CA   . LEU A 1 194 ? 0.450   35.331 12.779  1.00 30.42 ? 193 LEU A CA   1 
ATOM   1261 C  C    . LEU A 1 194 ? 1.597   34.800 13.671  1.00 30.71 ? 193 LEU A C    1 
ATOM   1262 O  O    . LEU A 1 194 ? 1.405   34.547 14.856  1.00 30.38 ? 193 LEU A O    1 
ATOM   1263 C  CB   . LEU A 1 194 ? 0.246   36.857 12.951  1.00 29.49 ? 193 LEU A CB   1 
ATOM   1264 C  CG   . LEU A 1 194 ? 1.447   37.766 12.623  1.00 35.86 ? 193 LEU A CG   1 
ATOM   1265 C  CD1  . LEU A 1 194 ? 1.757   37.750 11.152  1.00 31.71 ? 193 LEU A CD1  1 
ATOM   1266 C  CD2  . LEU A 1 194 ? 1.246   39.226 13.131  1.00 28.98 ? 193 LEU A CD2  1 
ATOM   1267 N  N    . LYS A 1 195 ? 2.761   34.579 13.061  1.00 29.44 ? 194 LYS A N    1 
ATOM   1268 C  CA   . LYS A 1 195 ? 3.971   34.133 13.749  1.00 30.65 ? 194 LYS A CA   1 
ATOM   1269 C  C    . LYS A 1 195 ? 5.196   34.770 13.095  1.00 29.08 ? 194 LYS A C    1 
ATOM   1270 O  O    . LYS A 1 195 ? 5.091   35.355 12.014  1.00 28.16 ? 194 LYS A O    1 
ATOM   1271 C  CB   . LYS A 1 195 ? 4.091   32.612 13.705  1.00 29.28 ? 194 LYS A CB   1 
ATOM   1272 C  CG   . LYS A 1 195 ? 4.465   32.078 12.331  1.00 30.53 ? 194 LYS A CG   1 
ATOM   1273 C  CD   . LYS A 1 195 ? 4.211   30.592 12.232  1.00 33.45 ? 194 LYS A CD   1 
ATOM   1274 C  CE   . LYS A 1 195 ? 4.821   30.004 10.971  1.00 30.29 ? 194 LYS A CE   1 
ATOM   1275 N  NZ   . LYS A 1 195 ? 4.403   28.589 10.793  1.00 39.54 ? 194 LYS A NZ   1 
ATOM   1276 N  N    . ASP A 1 196 ? 6.355   34.633 13.748  1.00 25.96 ? 195 ASP A N    1 
ATOM   1277 C  CA   . ASP A 1 196 ? 7.587   35.325 13.325  1.00 27.95 ? 195 ASP A CA   1 
ATOM   1278 C  C    . ASP A 1 196 ? 8.537   34.422 12.572  1.00 28.32 ? 195 ASP A C    1 
ATOM   1279 O  O    . ASP A 1 196 ? 9.573   34.871 12.093  1.00 30.04 ? 195 ASP A O    1 
ATOM   1280 C  CB   . ASP A 1 196 ? 8.304   35.930 14.533  1.00 32.67 ? 195 ASP A CB   1 
ATOM   1281 C  CG   . ASP A 1 196 ? 7.466   36.983 15.223  1.00 26.07 ? 195 ASP A CG   1 
ATOM   1282 O  OD1  . ASP A 1 196 ? 7.004   37.878 14.529  1.00 34.20 ? 195 ASP A OD1  1 
ATOM   1283 O  OD2  . ASP A 1 196 ? 7.261   36.882 16.455  1.00 31.24 ? 195 ASP A OD2  1 
ATOM   1284 N  N    . THR A 1 197 ? 8.157   33.157 12.463  1.00 30.41 ? 196 THR A N    1 
ATOM   1285 C  CA   . THR A 1 197 ? 8.921   32.162 11.737  1.00 32.87 ? 196 THR A CA   1 
ATOM   1286 C  C    . THR A 1 197 ? 8.326   31.923 10.337  1.00 34.03 ? 196 THR A C    1 
ATOM   1287 O  O    . THR A 1 197 ? 7.310   32.530 9.945   1.00 31.31 ? 196 THR A O    1 
ATOM   1288 C  CB   . THR A 1 197 ? 9.043   30.852 12.574  1.00 32.70 ? 196 THR A CB   1 
ATOM   1289 O  OG1  . THR A 1 197 ? 7.744   30.407 12.969  1.00 33.86 ? 196 THR A OG1  1 
ATOM   1290 C  CG2  . THR A 1 197 ? 9.909   31.100 13.822  1.00 36.02 ? 196 THR A CG2  1 
ATOM   1291 N  N    . VAL A 1 198 ? 8.996   31.071 9.577   1.00 31.70 ? 197 VAL A N    1 
ATOM   1292 C  CA   . VAL A 1 198 ? 8.647   30.829 8.192   1.00 33.76 ? 197 VAL A CA   1 
ATOM   1293 C  C    . VAL A 1 198 ? 7.344   30.025 8.084   1.00 32.86 ? 197 VAL A C    1 
ATOM   1294 O  O    . VAL A 1 198 ? 7.047   29.151 8.916   1.00 30.06 ? 197 VAL A O    1 
ATOM   1295 C  CB   . VAL A 1 198 ? 9.817   30.139 7.412   1.00 31.82 ? 197 VAL A CB   1 
ATOM   1296 C  CG1  . VAL A 1 198 ? 9.461   29.912 5.958   1.00 31.59 ? 197 VAL A CG1  1 
ATOM   1297 C  CG2  . VAL A 1 198 ? 11.052  30.997 7.453   1.00 44.82 ? 197 VAL A CG2  1 
ATOM   1298 N  N    . TYR A 1 199 ? 6.545   30.374 7.084   1.00 32.16 ? 198 TYR A N    1 
ATOM   1299 C  CA   . TYR A 1 199 ? 5.435   29.539 6.657   1.00 32.28 ? 198 TYR A CA   1 
ATOM   1300 C  C    . TYR A 1 199 ? 5.926   28.721 5.465   1.00 30.64 ? 198 TYR A C    1 
ATOM   1301 O  O    . TYR A 1 199 ? 6.660   29.219 4.616   1.00 34.37 ? 198 TYR A O    1 
ATOM   1302 C  CB   . TYR A 1 199 ? 4.217   30.367 6.260   1.00 28.72 ? 198 TYR A CB   1 
ATOM   1303 C  CG   . TYR A 1 199 ? 3.571   31.159 7.369   1.00 31.62 ? 198 TYR A CG   1 
ATOM   1304 C  CD1  . TYR A 1 199 ? 2.433   30.693 8.029   1.00 27.98 ? 198 TYR A CD1  1 
ATOM   1305 C  CD2  . TYR A 1 199 ? 4.089   32.399 7.749   1.00 27.37 ? 198 TYR A CD2  1 
ATOM   1306 C  CE1  . TYR A 1 199 ? 1.837   31.444 9.057   1.00 24.19 ? 198 TYR A CE1  1 
ATOM   1307 C  CE2  . TYR A 1 199 ? 3.508   33.142 8.773   1.00 24.63 ? 198 TYR A CE2  1 
ATOM   1308 C  CZ   . TYR A 1 199 ? 2.374   32.684 9.398   1.00 26.32 ? 198 TYR A CZ   1 
ATOM   1309 O  OH   . TYR A 1 199 ? 1.830   33.476 10.378  1.00 25.89 ? 198 TYR A OH   1 
ATOM   1310 N  N    . THR A 1 200 ? 5.555   27.453 5.434   1.00 28.88 ? 199 THR A N    1 
ATOM   1311 C  CA   . THR A 1 200 ? 5.938   26.563 4.356   1.00 33.27 ? 199 THR A CA   1 
ATOM   1312 C  C    . THR A 1 200 ? 4.681   26.001 3.675   1.00 36.16 ? 199 THR A C    1 
ATOM   1313 O  O    . THR A 1 200 ? 4.786   25.183 2.757   1.00 35.26 ? 199 THR A O    1 
ATOM   1314 C  CB   . THR A 1 200 ? 6.845   25.429 4.864   1.00 35.12 ? 199 THR A CB   1 
ATOM   1315 O  OG1  . THR A 1 200 ? 6.163   24.719 5.901   1.00 31.70 ? 199 THR A OG1  1 
ATOM   1316 C  CG2  . THR A 1 200 ? 8.190   25.992 5.410   1.00 33.12 ? 199 THR A CG2  1 
ATOM   1317 N  N    . ASP A 1 201 ? 3.510   26.458 4.128   1.00 36.43 ? 200 ASP A N    1 
ATOM   1318 C  CA   . ASP A 1 201 ? 2.218   26.153 3.510   1.00 39.40 ? 200 ASP A CA   1 
ATOM   1319 C  C    . ASP A 1 201 ? 1.608   27.452 2.987   1.00 35.31 ? 200 ASP A C    1 
ATOM   1320 O  O    . ASP A 1 201 ? 1.839   28.506 3.556   1.00 36.38 ? 200 ASP A O    1 
ATOM   1321 C  CB   . ASP A 1 201 ? 1.240   25.506 4.511   1.00 42.04 ? 200 ASP A CB   1 
ATOM   1322 C  CG   . ASP A 1 201 ? 0.764   26.476 5.637   1.00 45.55 ? 200 ASP A CG   1 
ATOM   1323 O  OD1  . ASP A 1 201 ? 1.597   27.034 6.398   1.00 55.51 ? 200 ASP A OD1  1 
ATOM   1324 O  OD2  . ASP A 1 201 ? -0.468  26.650 5.784   1.00 49.46 ? 200 ASP A OD2  1 
ATOM   1325 N  N    . PHE A 1 202 ? 0.820   27.335 1.916   1.00 31.95 ? 201 PHE A N    1 
ATOM   1326 C  CA   . PHE A 1 202 ? 0.105   28.454 1.317   1.00 31.64 ? 201 PHE A CA   1 
ATOM   1327 C  C    . PHE A 1 202 ? -1.019  27.924 0.431   1.00 29.59 ? 201 PHE A C    1 
ATOM   1328 O  O    . PHE A 1 202 ? -0.779  27.075 -0.400  1.00 32.55 ? 201 PHE A O    1 
ATOM   1329 C  CB   . PHE A 1 202 ? 1.053   29.306 0.472   1.00 28.49 ? 201 PHE A CB   1 
ATOM   1330 C  CG   . PHE A 1 202 ? 0.382   30.446 -0.234  1.00 32.56 ? 201 PHE A CG   1 
ATOM   1331 C  CD1  . PHE A 1 202 ? -0.080  31.553 0.478   1.00 25.42 ? 201 PHE A CD1  1 
ATOM   1332 C  CD2  . PHE A 1 202 ? 0.190   30.404 -1.610  1.00 32.16 ? 201 PHE A CD2  1 
ATOM   1333 C  CE1  . PHE A 1 202 ? -0.727  32.626 -0.190  1.00 27.48 ? 201 PHE A CE1  1 
ATOM   1334 C  CE2  . PHE A 1 202 ? -0.443  31.468 -2.284  1.00 29.95 ? 201 PHE A CE2  1 
ATOM   1335 C  CZ   . PHE A 1 202 ? -0.890  32.571 -1.575  1.00 27.73 ? 201 PHE A CZ   1 
ATOM   1336 N  N    . ASP A 1 203 ? -2.230  28.437 0.626   1.00 30.17 ? 202 ASP A N    1 
ATOM   1337 C  CA   . ASP A 1 203 ? -3.383  28.123 -0.215  1.00 34.48 ? 202 ASP A CA   1 
ATOM   1338 C  C    . ASP A 1 203 ? -4.154  29.365 -0.625  1.00 32.38 ? 202 ASP A C    1 
ATOM   1339 O  O    . ASP A 1 203 ? -5.336  29.270 -0.994  1.00 29.60 ? 202 ASP A O    1 
ATOM   1340 C  CB   . ASP A 1 203 ? -4.329  27.157 0.517   1.00 38.98 ? 202 ASP A CB   1 
ATOM   1341 C  CG   . ASP A 1 203 ? -3.735  25.766 0.646   1.00 45.80 ? 202 ASP A CG   1 
ATOM   1342 O  OD1  . ASP A 1 203 ? -3.765  25.027 -0.368  1.00 55.47 ? 202 ASP A OD1  1 
ATOM   1343 O  OD2  . ASP A 1 203 ? -3.215  25.430 1.740   1.00 52.01 ? 202 ASP A OD2  1 
ATOM   1344 N  N    . GLY A 1 204 ? -3.501  30.530 -0.581  1.00 32.25 ? 203 GLY A N    1 
ATOM   1345 C  CA   . GLY A 1 204 ? -4.117  31.756 -1.080  1.00 27.67 ? 203 GLY A CA   1 
ATOM   1346 C  C    . GLY A 1 204 ? -4.058  31.826 -2.594  1.00 26.95 ? 203 GLY A C    1 
ATOM   1347 O  O    . GLY A 1 204 ? -4.003  30.807 -3.283  1.00 33.79 ? 203 GLY A O    1 
ATOM   1348 N  N    . THR A 1 205 ? -4.059  33.046 -3.122  1.00 29.95 ? 204 THR A N    1 
ATOM   1349 C  CA   . THR A 1 205 ? -4.053  33.267 -4.564  1.00 29.32 ? 204 THR A CA   1 
ATOM   1350 C  C    . THR A 1 205 ? -2.611  33.436 -5.099  1.00 27.69 ? 204 THR A C    1 
ATOM   1351 O  O    . THR A 1 205 ? -1.875  34.325 -4.682  1.00 26.24 ? 204 THR A O    1 
ATOM   1352 C  CB   . THR A 1 205 ? -4.954  34.466 -4.949  1.00 32.89 ? 204 THR A CB   1 
ATOM   1353 O  OG1  . THR A 1 205 ? -6.247  34.271 -4.381  1.00 28.55 ? 204 THR A OG1  1 
ATOM   1354 C  CG2  . THR A 1 205 ? -5.090  34.593 -6.435  1.00 23.88 ? 204 THR A CG2  1 
ATOM   1355 N  N    . ARG A 1 206 ? -2.240  32.569 -6.044  1.00 26.91 ? 205 ARG A N    1 
ATOM   1356 C  CA   . ARG A 1 206 ? -0.878  32.468 -6.543  1.00 30.39 ? 205 ARG A CA   1 
ATOM   1357 C  C    . ARG A 1 206 ? -0.395  33.768 -7.173  1.00 29.48 ? 205 ARG A C    1 
ATOM   1358 O  O    . ARG A 1 206 ? 0.718   34.188 -6.899  1.00 27.30 ? 205 ARG A O    1 
ATOM   1359 C  CB   . ARG A 1 206 ? -0.741  31.302 -7.532  1.00 27.00 ? 205 ARG A CB   1 
ATOM   1360 C  CG   . ARG A 1 206 ? 0.693   30.912 -7.791  1.00 31.93 ? 205 ARG A CG   1 
ATOM   1361 C  CD   . ARG A 1 206 ? 0.782   29.608 -8.579  1.00 29.03 ? 205 ARG A CD   1 
ATOM   1362 N  NE   . ARG A 1 206 ? 2.168   29.240 -8.860  1.00 30.03 ? 205 ARG A NE   1 
ATOM   1363 C  CZ   . ARG A 1 206 ? 2.955   28.520 -8.049  1.00 30.31 ? 205 ARG A CZ   1 
ATOM   1364 N  NH1  . ARG A 1 206 ? 2.536   28.079 -6.876  1.00 31.11 ? 205 ARG A NH1  1 
ATOM   1365 N  NH2  . ARG A 1 206 ? 4.192   28.244 -8.414  1.00 33.68 ? 205 ARG A NH2  1 
ATOM   1366 N  N    . VAL A 1 207 ? -1.242  34.428 -7.962  1.00 28.54 ? 206 VAL A N    1 
ATOM   1367 C  CA   . VAL A 1 207 ? -0.826  35.665 -8.644  1.00 28.06 ? 206 VAL A CA   1 
ATOM   1368 C  C    . VAL A 1 207 ? -0.586  36.832 -7.659  1.00 25.27 ? 206 VAL A C    1 
ATOM   1369 O  O    . VAL A 1 207 ? 0.014   37.825 -8.041  1.00 24.85 ? 206 VAL A O    1 
ATOM   1370 C  CB   . VAL A 1 207 ? -1.760  36.065 -9.832  1.00 25.23 ? 206 VAL A CB   1 
ATOM   1371 C  CG1  . VAL A 1 207 ? -1.621  35.054 -11.019 1.00 24.24 ? 206 VAL A CG1  1 
ATOM   1372 C  CG2  . VAL A 1 207 ? -3.238  36.250 -9.376  1.00 25.82 ? 206 VAL A CG2  1 
ATOM   1373 N  N    . TYR A 1 208 ? -1.017  36.694 -6.398  1.00 27.03 ? 207 TYR A N    1 
ATOM   1374 C  CA   . TYR A 1 208 ? -0.748  37.697 -5.356  1.00 29.47 ? 207 TYR A CA   1 
ATOM   1375 C  C    . TYR A 1 208 ? 0.351   37.192 -4.397  1.00 25.80 ? 207 TYR A C    1 
ATOM   1376 O  O    . TYR A 1 208 ? 0.688   37.867 -3.428  1.00 28.40 ? 207 TYR A O    1 
ATOM   1377 C  CB   . TYR A 1 208 ? -2.034  38.016 -4.571  1.00 27.53 ? 207 TYR A CB   1 
ATOM   1378 C  CG   . TYR A 1 208 ? -3.037  38.942 -5.252  1.00 30.18 ? 207 TYR A CG   1 
ATOM   1379 C  CD1  . TYR A 1 208 ? -3.123  40.273 -4.884  1.00 27.09 ? 207 TYR A CD1  1 
ATOM   1380 C  CD2  . TYR A 1 208 ? -3.923  38.474 -6.248  1.00 25.40 ? 207 TYR A CD2  1 
ATOM   1381 C  CE1  . TYR A 1 208 ? -4.041  41.147 -5.485  1.00 25.62 ? 207 TYR A CE1  1 
ATOM   1382 C  CE2  . TYR A 1 208 ? -4.839  39.332 -6.844  1.00 28.09 ? 207 TYR A CE2  1 
ATOM   1383 C  CZ   . TYR A 1 208 ? -4.884  40.672 -6.469  1.00 25.91 ? 207 TYR A CZ   1 
ATOM   1384 O  OH   . TYR A 1 208 ? -5.800  41.537 -7.029  1.00 27.05 ? 207 TYR A OH   1 
ATOM   1385 N  N    . SER A 1 209 ? 0.885   35.995 -4.672  1.00 25.94 ? 208 SER A N    1 
ATOM   1386 C  CA   . SER A 1 209 ? 1.903   35.352 -3.829  1.00 26.81 ? 208 SER A CA   1 
ATOM   1387 C  C    . SER A 1 209 ? 3.320   35.803 -4.219  1.00 26.97 ? 208 SER A C    1 
ATOM   1388 O  O    . SER A 1 209 ? 3.592   36.137 -5.382  1.00 29.59 ? 208 SER A O    1 
ATOM   1389 C  CB   . SER A 1 209 ? 1.770   33.800 -3.835  1.00 30.66 ? 208 SER A CB   1 
ATOM   1390 O  OG   . SER A 1 209 ? 2.426   33.225 -4.950  1.00 28.40 ? 208 SER A OG   1 
ATOM   1391 N  N    . PRO A 1 210 ? 4.229   35.841 -3.236  1.00 27.43 ? 209 PRO A N    1 
ATOM   1392 C  CA   . PRO A 1 210 ? 5.518   36.433 -3.476  1.00 27.00 ? 209 PRO A CA   1 
ATOM   1393 C  C    . PRO A 1 210 ? 6.521   35.458 -4.119  1.00 25.63 ? 209 PRO A C    1 
ATOM   1394 O  O    . PRO A 1 210 ? 6.333   34.220 -4.086  1.00 26.16 ? 209 PRO A O    1 
ATOM   1395 C  CB   . PRO A 1 210 ? 5.938   36.878 -2.072  1.00 25.79 ? 209 PRO A CB   1 
ATOM   1396 C  CG   . PRO A 1 210 ? 5.339   35.836 -1.154  1.00 29.03 ? 209 PRO A CG   1 
ATOM   1397 C  CD   . PRO A 1 210 ? 4.118   35.288 -1.868  1.00 28.33 ? 209 PRO A CD   1 
ATOM   1398 N  N    . PRO A 1 211 ? 7.583   36.001 -4.728  1.00 27.97 ? 210 PRO A N    1 
ATOM   1399 C  CA   . PRO A 1 211 ? 8.600   35.189 -5.416  1.00 28.53 ? 210 PRO A CA   1 
ATOM   1400 C  C    . PRO A 1 211 ? 9.288   34.126 -4.552  1.00 29.30 ? 210 PRO A C    1 
ATOM   1401 O  O    . PRO A 1 211 ? 9.638   33.060 -5.059  1.00 27.81 ? 210 PRO A O    1 
ATOM   1402 C  CB   . PRO A 1 211 ? 9.625   36.229 -5.892  1.00 32.01 ? 210 PRO A CB   1 
ATOM   1403 C  CG   . PRO A 1 211 ? 9.298   37.480 -5.203  1.00 31.05 ? 210 PRO A CG   1 
ATOM   1404 C  CD   . PRO A 1 211 ? 7.901   37.437 -4.787  1.00 25.86 ? 210 PRO A CD   1 
ATOM   1405 N  N    . GLU A 1 212 ? 9.508   34.423 -3.278  1.00 29.69 ? 211 GLU A N    1 
ATOM   1406 C  CA   . GLU A 1 212 ? 10.085  33.455 -2.340  1.00 32.74 ? 211 GLU A CA   1 
ATOM   1407 C  C    . GLU A 1 212 ? 9.169   32.222 -2.123  1.00 30.04 ? 211 GLU A C    1 
ATOM   1408 O  O    . GLU A 1 212 ? 9.668   31.111 -1.939  1.00 29.14 ? 211 GLU A O    1 
ATOM   1409 C  CB   . GLU A 1 212 ? 10.453  34.127 -1.008  1.00 31.23 ? 211 GLU A CB   1 
ATOM   1410 C  CG   . GLU A 1 212 ? 9.270   34.648 -0.207  1.00 30.92 ? 211 GLU A CG   1 
ATOM   1411 C  CD   . GLU A 1 212 ? 8.963   36.097 -0.442  1.00 31.13 ? 211 GLU A CD   1 
ATOM   1412 O  OE1  . GLU A 1 212 ? 9.317   36.631 -1.521  1.00 28.85 ? 211 GLU A OE1  1 
ATOM   1413 O  OE2  . GLU A 1 212 ? 8.336   36.699 0.465   1.00 29.38 ? 211 GLU A OE2  1 
ATOM   1414 N  N    . TRP A 1 213 ? 7.852   32.409 -2.194  1.00 26.74 ? 212 TRP A N    1 
ATOM   1415 C  CA   . TRP A 1 213 ? 6.923   31.282 -2.202  1.00 27.91 ? 212 TRP A CA   1 
ATOM   1416 C  C    . TRP A 1 213 ? 7.045   30.490 -3.515  1.00 30.07 ? 212 TRP A C    1 
ATOM   1417 O  O    . TRP A 1 213 ? 7.154   29.271 -3.497  1.00 29.51 ? 212 TRP A O    1 
ATOM   1418 C  CB   . TRP A 1 213 ? 5.465   31.737 -2.024  1.00 27.83 ? 212 TRP A CB   1 
ATOM   1419 C  CG   . TRP A 1 213 ? 4.504   30.641 -2.361  1.00 29.67 ? 212 TRP A CG   1 
ATOM   1420 C  CD1  . TRP A 1 213 ? 3.683   30.557 -3.460  1.00 31.81 ? 212 TRP A CD1  1 
ATOM   1421 C  CD2  . TRP A 1 213 ? 4.321   29.424 -1.630  1.00 31.25 ? 212 TRP A CD2  1 
ATOM   1422 N  NE1  . TRP A 1 213 ? 2.989   29.373 -3.431  1.00 35.31 ? 212 TRP A NE1  1 
ATOM   1423 C  CE2  . TRP A 1 213 ? 3.360   28.661 -2.319  1.00 33.25 ? 212 TRP A CE2  1 
ATOM   1424 C  CE3  . TRP A 1 213 ? 4.864   28.914 -0.446  1.00 30.58 ? 212 TRP A CE3  1 
ATOM   1425 C  CZ2  . TRP A 1 213 ? 2.940   27.398 -1.867  1.00 30.75 ? 212 TRP A CZ2  1 
ATOM   1426 C  CZ3  . TRP A 1 213 ? 4.427   27.665 0.010   1.00 30.80 ? 212 TRP A CZ3  1 
ATOM   1427 C  CH2  . TRP A 1 213 ? 3.491   26.927 -0.707  1.00 31.15 ? 212 TRP A CH2  1 
ATOM   1428 N  N    . ILE A 1 214 ? 7.015   31.193 -4.649  1.00 30.48 ? 213 ILE A N    1 
ATOM   1429 C  CA   . ILE A 1 214 ? 7.144   30.566 -5.974  1.00 34.06 ? 213 ILE A CA   1 
ATOM   1430 C  C    . ILE A 1 214 ? 8.478   29.779 -6.073  1.00 36.93 ? 213 ILE A C    1 
ATOM   1431 O  O    . ILE A 1 214 ? 8.491   28.616 -6.468  1.00 33.50 ? 213 ILE A O    1 
ATOM   1432 C  CB   . ILE A 1 214 ? 7.058   31.614 -7.157  1.00 34.62 ? 213 ILE A CB   1 
ATOM   1433 C  CG1  . ILE A 1 214 ? 5.759   32.450 -7.113  1.00 32.13 ? 213 ILE A CG1  1 
ATOM   1434 C  CG2  . ILE A 1 214 ? 7.219   30.914 -8.526  1.00 26.15 ? 213 ILE A CG2  1 
ATOM   1435 C  CD1  . ILE A 1 214 ? 4.431   31.682 -7.392  1.00 23.58 ? 213 ILE A CD1  1 
ATOM   1436 N  N    . ARG A 1 215 ? 9.586   30.403 -5.673  1.00 34.40 ? 214 ARG A N    1 
ATOM   1437 C  CA   . ARG A 1 215 ? 10.890  29.760 -5.757  1.00 35.56 ? 214 ARG A CA   1 
ATOM   1438 C  C    . ARG A 1 215 ? 11.161  28.693 -4.706  1.00 34.66 ? 214 ARG A C    1 
ATOM   1439 O  O    . ARG A 1 215 ? 11.690  27.634 -5.042  1.00 33.86 ? 214 ARG A O    1 
ATOM   1440 C  CB   . ARG A 1 215 ? 11.996  30.780 -5.646  1.00 38.52 ? 214 ARG A CB   1 
ATOM   1441 C  CG   . ARG A 1 215 ? 12.157  31.657 -6.839  1.00 44.49 ? 214 ARG A CG   1 
ATOM   1442 C  CD   . ARG A 1 215 ? 13.236  32.677 -6.531  1.00 61.50 ? 214 ARG A CD   1 
ATOM   1443 N  NE   . ARG A 1 215 ? 13.784  33.283 -7.740  1.00 74.42 ? 214 ARG A NE   1 
ATOM   1444 C  CZ   . ARG A 1 215 ? 15.014  33.094 -8.213  1.00 78.35 ? 214 ARG A CZ   1 
ATOM   1445 N  NH1  . ARG A 1 215 ? 15.376  33.715 -9.333  1.00 79.15 ? 214 ARG A NH1  1 
ATOM   1446 N  NH2  . ARG A 1 215 ? 15.888  32.305 -7.586  1.00 78.19 ? 214 ARG A NH2  1 
ATOM   1447 N  N    . TYR A 1 216 ? 10.831  28.983 -3.445  1.00 32.13 ? 215 TYR A N    1 
ATOM   1448 C  CA   . TYR A 1 216 ? 11.285  28.168 -2.306  1.00 32.65 ? 215 TYR A CA   1 
ATOM   1449 C  C    . TYR A 1 216 ? 10.201  27.522 -1.458  1.00 31.35 ? 215 TYR A C    1 
ATOM   1450 O  O    . TYR A 1 216 ? 10.514  26.755 -0.537  1.00 32.62 ? 215 TYR A O    1 
ATOM   1451 C  CB   . TYR A 1 216 ? 12.165  29.014 -1.385  1.00 29.11 ? 215 TYR A CB   1 
ATOM   1452 C  CG   . TYR A 1 216 ? 13.245  29.754 -2.134  1.00 34.83 ? 215 TYR A CG   1 
ATOM   1453 C  CD1  . TYR A 1 216 ? 14.246  29.068 -2.814  1.00 41.87 ? 215 TYR A CD1  1 
ATOM   1454 C  CD2  . TYR A 1 216 ? 13.260  31.135 -2.175  1.00 35.57 ? 215 TYR A CD2  1 
ATOM   1455 C  CE1  . TYR A 1 216 ? 15.239  29.753 -3.512  1.00 39.76 ? 215 TYR A CE1  1 
ATOM   1456 C  CE2  . TYR A 1 216 ? 14.246  31.825 -2.872  1.00 40.29 ? 215 TYR A CE2  1 
ATOM   1457 C  CZ   . TYR A 1 216 ? 15.226  31.139 -3.529  1.00 45.82 ? 215 TYR A CZ   1 
ATOM   1458 O  OH   . TYR A 1 216 ? 16.189  31.853 -4.204  1.00 53.19 ? 215 TYR A OH   1 
ATOM   1459 N  N    . HIS A 1 217 ? 8.939   27.786 -1.766  1.00 31.49 ? 216 HIS A N    1 
ATOM   1460 C  CA   . HIS A 1 217 ? 7.845   27.354 -0.893  1.00 33.13 ? 216 HIS A CA   1 
ATOM   1461 C  C    . HIS A 1 217 ? 8.056   27.813 0.577   1.00 32.21 ? 216 HIS A C    1 
ATOM   1462 O  O    . HIS A 1 217 ? 7.709   27.105 1.534   1.00 26.91 ? 216 HIS A O    1 
ATOM   1463 C  CB   . HIS A 1 217 ? 7.632   25.826 -1.016  1.00 34.01 ? 216 HIS A CB   1 
ATOM   1464 C  CG   . HIS A 1 217 ? 6.699   25.444 -2.128  1.00 48.90 ? 216 HIS A CG   1 
ATOM   1465 N  ND1  . HIS A 1 217 ? 5.918   24.306 -2.094  1.00 55.35 ? 216 HIS A ND1  1 
ATOM   1466 C  CD2  . HIS A 1 217 ? 6.401   26.071 -3.295  1.00 53.07 ? 216 HIS A CD2  1 
ATOM   1467 C  CE1  . HIS A 1 217 ? 5.193   24.242 -3.199  1.00 59.81 ? 216 HIS A CE1  1 
ATOM   1468 N  NE2  . HIS A 1 217 ? 5.468   25.302 -3.943  1.00 53.10 ? 216 HIS A NE2  1 
ATOM   1469 N  N    . ARG A 1 218 ? 8.603   29.018 0.747   1.00 33.73 ? 217 ARG A N    1 
ATOM   1470 C  CA   . ARG A 1 218 ? 8.871   29.583 2.084   1.00 32.57 ? 217 ARG A CA   1 
ATOM   1471 C  C    . ARG A 1 218 ? 8.634   31.093 2.066   1.00 32.93 ? 217 ARG A C    1 
ATOM   1472 O  O    . ARG A 1 218 ? 8.994   31.765 1.099   1.00 32.57 ? 217 ARG A O    1 
ATOM   1473 C  CB   . ARG A 1 218 ? 10.319  29.309 2.534   1.00 32.33 ? 217 ARG A CB   1 
ATOM   1474 C  CG   . ARG A 1 218 ? 10.617  27.882 2.928   1.00 34.68 ? 217 ARG A CG   1 
ATOM   1475 C  CD   . ARG A 1 218 ? 12.124  27.634 3.065   1.00 34.39 ? 217 ARG A CD   1 
ATOM   1476 N  NE   . ARG A 1 218 ? 12.705  28.326 4.217   1.00 43.80 ? 217 ARG A NE   1 
ATOM   1477 C  CZ   . ARG A 1 218 ? 12.674  27.878 5.476   1.00 52.46 ? 217 ARG A CZ   1 
ATOM   1478 N  NH1  . ARG A 1 218 ? 12.096  26.703 5.781   1.00 39.86 ? 217 ARG A NH1  1 
ATOM   1479 N  NH2  . ARG A 1 218 ? 13.229  28.617 6.444   1.00 46.29 ? 217 ARG A NH2  1 
ATOM   1480 N  N    . TYR A 1 219 ? 8.023   31.616 3.132   1.00 31.90 ? 218 TYR A N    1 
ATOM   1481 C  CA   . TYR A 1 219 ? 7.828   33.065 3.282   1.00 28.65 ? 218 TYR A CA   1 
ATOM   1482 C  C    . TYR A 1 219 ? 7.571   33.428 4.748   1.00 27.24 ? 218 TYR A C    1 
ATOM   1483 O  O    . TYR A 1 219 ? 7.136   32.601 5.565   1.00 29.36 ? 218 TYR A O    1 
ATOM   1484 C  CB   . TYR A 1 219 ? 6.674   33.576 2.381   1.00 27.29 ? 218 TYR A CB   1 
ATOM   1485 C  CG   . TYR A 1 219 ? 5.353   32.932 2.712   1.00 28.79 ? 218 TYR A CG   1 
ATOM   1486 C  CD1  . TYR A 1 219 ? 4.451   33.546 3.570   1.00 25.94 ? 218 TYR A CD1  1 
ATOM   1487 C  CD2  . TYR A 1 219 ? 5.036   31.656 2.214   1.00 22.96 ? 218 TYR A CD2  1 
ATOM   1488 C  CE1  . TYR A 1 219 ? 3.257   32.946 3.906   1.00 27.10 ? 218 TYR A CE1  1 
ATOM   1489 C  CE2  . TYR A 1 219 ? 3.852   31.055 2.530   1.00 24.68 ? 218 TYR A CE2  1 
ATOM   1490 C  CZ   . TYR A 1 219 ? 2.964   31.692 3.386   1.00 29.92 ? 218 TYR A CZ   1 
ATOM   1491 O  OH   . TYR A 1 219 ? 1.791   31.057 3.683   1.00 28.16 ? 218 TYR A OH   1 
ATOM   1492 N  N    . HIS A 1 220 ? 7.872   34.671 5.081   1.00 28.46 ? 219 HIS A N    1 
ATOM   1493 C  CA   . HIS A 1 220 ? 7.430   35.268 6.337   1.00 24.66 ? 219 HIS A CA   1 
ATOM   1494 C  C    . HIS A 1 220 ? 6.151   36.050 6.100   1.00 24.15 ? 219 HIS A C    1 
ATOM   1495 O  O    . HIS A 1 220 ? 5.939   36.571 5.010   1.00 29.04 ? 219 HIS A O    1 
ATOM   1496 C  CB   . HIS A 1 220 ? 8.559   36.122 6.947   1.00 26.51 ? 219 HIS A CB   1 
ATOM   1497 C  CG   . HIS A 1 220 ? 9.683   35.291 7.475   1.00 32.43 ? 219 HIS A CG   1 
ATOM   1498 N  ND1  . HIS A 1 220 ? 10.740  34.882 6.688   1.00 36.32 ? 219 HIS A ND1  1 
ATOM   1499 C  CD2  . HIS A 1 220 ? 9.873   34.719 8.686   1.00 31.95 ? 219 HIS A CD2  1 
ATOM   1500 C  CE1  . HIS A 1 220 ? 11.550  34.127 7.404   1.00 40.23 ? 219 HIS A CE1  1 
ATOM   1501 N  NE2  . HIS A 1 220 ? 11.052  34.019 8.623   1.00 37.22 ? 219 HIS A NE2  1 
ATOM   1502 N  N    . GLY A 1 221 ? 5.293   36.100 7.113   1.00 26.62 ? 220 GLY A N    1 
ATOM   1503 C  CA   . GLY A 1 221 ? 3.914   36.611 6.987   1.00 29.47 ? 220 GLY A CA   1 
ATOM   1504 C  C    . GLY A 1 221 ? 3.806   38.062 6.539   1.00 27.59 ? 220 GLY A C    1 
ATOM   1505 O  O    . GLY A 1 221 ? 3.217   38.346 5.525   1.00 25.69 ? 220 GLY A O    1 
ATOM   1506 N  N    . ARG A 1 222 ? 4.435   38.965 7.279   1.00 26.36 ? 221 ARG A N    1 
ATOM   1507 C  CA   . ARG A 1 222 ? 4.367   40.367 7.004   1.00 30.36 ? 221 ARG A CA   1 
ATOM   1508 C  C    . ARG A 1 222 ? 4.894   40.753 5.611   1.00 26.95 ? 221 ARG A C    1 
ATOM   1509 O  O    . ARG A 1 222 ? 4.224   41.485 4.901   1.00 27.31 ? 221 ARG A O    1 
ATOM   1510 C  CB   . ARG A 1 222 ? 5.148   41.101 8.076   1.00 29.46 ? 221 ARG A CB   1 
ATOM   1511 C  CG   A ARG A 1 222 ? 4.387   41.506 9.349   0.50 36.79 ? 221 ARG A CG   1 
ATOM   1512 C  CG   B ARG A 1 222 ? 4.498   42.362 8.661   0.50 42.71 ? 221 ARG A CG   1 
ATOM   1513 C  CD   A ARG A 1 222 ? 5.366   41.499 10.570  0.50 32.46 ? 221 ARG A CD   1 
ATOM   1514 C  CD   B ARG A 1 222 ? 4.964   43.681 7.910   0.50 44.85 ? 221 ARG A CD   1 
ATOM   1515 N  NE   A ARG A 1 222 ? 4.763   41.316 11.896  0.50 38.73 ? 221 ARG A NE   1 
ATOM   1516 N  NE   B ARG A 1 222 ? 6.335   43.582 7.368   0.50 44.24 ? 221 ARG A NE   1 
ATOM   1517 C  CZ   A ARG A 1 222 ? 4.785   40.173 12.576  0.50 22.12 ? 221 ARG A CZ   1 
ATOM   1518 C  CZ   B ARG A 1 222 ? 7.456   43.692 8.080   0.50 47.44 ? 221 ARG A CZ   1 
ATOM   1519 N  NH1  A ARG A 1 222 ? 5.373   39.115 12.070  0.50 30.18 ? 221 ARG A NH1  1 
ATOM   1520 N  NH1  B ARG A 1 222 ? 7.418   43.945 9.378   0.50 45.22 ? 221 ARG A NH1  1 
ATOM   1521 N  NH2  A ARG A 1 222 ? 4.247   40.097 13.782  0.50 41.83 ? 221 ARG A NH2  1 
ATOM   1522 N  NH2  B ARG A 1 222 ? 8.634   43.547 7.489   0.50 56.34 ? 221 ARG A NH2  1 
ATOM   1523 N  N    . SER A 1 223 ? 6.088   40.275 5.245   1.00 25.40 ? 222 SER A N    1 
ATOM   1524 C  CA   . SER A 1 223 ? 6.699   40.632 3.962   1.00 27.21 ? 222 SER A CA   1 
ATOM   1525 C  C    . SER A 1 223 ? 5.930   40.057 2.774   1.00 26.99 ? 222 SER A C    1 
ATOM   1526 O  O    . SER A 1 223 ? 5.856   40.696 1.713   1.00 26.20 ? 222 SER A O    1 
ATOM   1527 C  CB   . SER A 1 223 ? 8.194   40.221 3.899   1.00 27.77 ? 222 SER A CB   1 
ATOM   1528 O  OG   . SER A 1 223 ? 8.380   38.883 4.307   1.00 27.84 ? 222 SER A OG   1 
ATOM   1529 N  N    . ALA A 1 224 ? 5.351   38.873 2.961   1.00 27.62 ? 223 ALA A N    1 
ATOM   1530 C  CA   . ALA A 1 224 ? 4.421   38.285 1.975   1.00 27.48 ? 223 ALA A CA   1 
ATOM   1531 C  C    . ALA A 1 224 ? 3.142   39.124 1.857   1.00 27.20 ? 223 ALA A C    1 
ATOM   1532 O  O    . ALA A 1 224 ? 2.618   39.325 0.736   1.00 25.51 ? 223 ALA A O    1 
ATOM   1533 C  CB   . ALA A 1 224 ? 4.089   36.830 2.361   1.00 25.50 ? 223 ALA A CB   1 
ATOM   1534 N  N    . ALA A 1 225 ? 2.645   39.637 2.997   1.00 27.47 ? 224 ALA A N    1 
ATOM   1535 C  CA   . ALA A 1 225 ? 1.466   40.497 3.001   1.00 27.26 ? 224 ALA A CA   1 
ATOM   1536 C  C    . ALA A 1 225 ? 1.743   41.775 2.200   1.00 26.73 ? 224 ALA A C    1 
ATOM   1537 O  O    . ALA A 1 225 ? 0.913   42.173 1.395   1.00 26.45 ? 224 ALA A O    1 
ATOM   1538 C  CB   . ALA A 1 225 ? 0.978   40.828 4.431   1.00 22.47 ? 224 ALA A CB   1 
ATOM   1539 N  N    . VAL A 1 226 ? 2.904   42.390 2.426   1.00 26.06 ? 225 VAL A N    1 
ATOM   1540 C  CA   . VAL A 1 226 ? 3.305   43.627 1.737   1.00 27.17 ? 225 VAL A CA   1 
ATOM   1541 C  C    . VAL A 1 226 ? 3.428   43.400 0.235   1.00 26.05 ? 225 VAL A C    1 
ATOM   1542 O  O    . VAL A 1 226 ? 3.017   44.260 -0.564  1.00 24.74 ? 225 VAL A O    1 
ATOM   1543 C  CB   . VAL A 1 226 ? 4.625   44.255 2.395   1.00 28.69 ? 225 VAL A CB   1 
ATOM   1544 C  CG1  . VAL A 1 226 ? 5.312   45.349 1.472   1.00 23.82 ? 225 VAL A CG1  1 
ATOM   1545 C  CG2  . VAL A 1 226 ? 4.309   44.758 3.835   1.00 22.39 ? 225 VAL A CG2  1 
ATOM   1546 N  N    . TRP A 1 227 ? 3.976   42.243 -0.158  1.00 27.40 ? 226 TRP A N    1 
ATOM   1547 C  CA   . TRP A 1 227 ? 3.980   41.850 -1.564  1.00 26.39 ? 226 TRP A CA   1 
ATOM   1548 C  C    . TRP A 1 227 ? 2.536   41.836 -2.165  1.00 25.79 ? 226 TRP A C    1 
ATOM   1549 O  O    . TRP A 1 227 ? 2.279   42.474 -3.189  1.00 25.13 ? 226 TRP A O    1 
ATOM   1550 C  CB   . TRP A 1 227 ? 4.722   40.503 -1.790  1.00 24.67 ? 226 TRP A CB   1 
ATOM   1551 C  CG   . TRP A 1 227 ? 4.672   40.090 -3.217  1.00 27.43 ? 226 TRP A CG   1 
ATOM   1552 C  CD1  . TRP A 1 227 ? 3.601   39.502 -3.874  1.00 23.79 ? 226 TRP A CD1  1 
ATOM   1553 C  CD2  . TRP A 1 227 ? 5.668   40.315 -4.210  1.00 23.24 ? 226 TRP A CD2  1 
ATOM   1554 N  NE1  . TRP A 1 227 ? 3.882   39.350 -5.196  1.00 25.40 ? 226 TRP A NE1  1 
ATOM   1555 C  CE2  . TRP A 1 227 ? 5.136   39.850 -5.449  1.00 22.90 ? 226 TRP A CE2  1 
ATOM   1556 C  CE3  . TRP A 1 227 ? 6.944   40.900 -4.197  1.00 25.85 ? 226 TRP A CE3  1 
ATOM   1557 C  CZ2  . TRP A 1 227 ? 5.870   39.886 -6.651  1.00 26.58 ? 226 TRP A CZ2  1 
ATOM   1558 C  CZ3  . TRP A 1 227 ? 7.671   40.955 -5.404  1.00 24.75 ? 226 TRP A CZ3  1 
ATOM   1559 C  CH2  . TRP A 1 227 ? 7.119   40.449 -6.614  1.00 28.04 ? 226 TRP A CH2  1 
ATOM   1560 N  N    . SER A 1 228 ? 1.590   41.168 -1.515  1.00 25.03 ? 227 SER A N    1 
ATOM   1561 C  CA   . SER A 1 228 ? 0.212   41.154 -2.003  1.00 24.52 ? 227 SER A CA   1 
ATOM   1562 C  C    . SER A 1 228 ? -0.410  42.576 -2.070  1.00 26.31 ? 227 SER A C    1 
ATOM   1563 O  O    . SER A 1 228 ? -1.199  42.868 -2.949  1.00 27.96 ? 227 SER A O    1 
ATOM   1564 C  CB   . SER A 1 228 ? -0.651  40.153 -1.205  1.00 26.55 ? 227 SER A CB   1 
ATOM   1565 O  OG   . SER A 1 228 ? -0.891  40.556 0.139   1.00 25.01 ? 227 SER A OG   1 
ATOM   1566 N  N    . LEU A 1 229 ? -0.023  43.462 -1.159  1.00 26.04 ? 228 LEU A N    1 
ATOM   1567 C  CA   . LEU A 1 229 ? -0.498  44.832 -1.148  1.00 26.97 ? 228 LEU A CA   1 
ATOM   1568 C  C    . LEU A 1 229 ? 0.075   45.629 -2.343  1.00 22.76 ? 228 LEU A C    1 
ATOM   1569 O  O    . LEU A 1 229 ? -0.637  46.412 -2.951  1.00 25.10 ? 228 LEU A O    1 
ATOM   1570 C  CB   . LEU A 1 229 ? -0.215  45.495 0.215   1.00 22.17 ? 228 LEU A CB   1 
ATOM   1571 C  CG   . LEU A 1 229 ? -1.042  44.939 1.397   1.00 28.41 ? 228 LEU A CG   1 
ATOM   1572 C  CD1  . LEU A 1 229 ? -0.386  45.309 2.737   1.00 25.56 ? 228 LEU A CD1  1 
ATOM   1573 C  CD2  . LEU A 1 229 ? -2.476  45.458 1.356   1.00 22.97 ? 228 LEU A CD2  1 
ATOM   1574 N  N    . GLY A 1 230 ? 1.338   45.373 -2.698  1.00 23.41 ? 229 GLY A N    1 
ATOM   1575 C  CA   . GLY A 1 230 ? 1.934   45.894 -3.942  1.00 23.11 ? 229 GLY A CA   1 
ATOM   1576 C  C    . GLY A 1 230 ? 1.170   45.526 -5.200  1.00 23.00 ? 229 GLY A C    1 
ATOM   1577 O  O    . GLY A 1 230 ? 0.874   46.378 -6.044  1.00 24.42 ? 229 GLY A O    1 
ATOM   1578 N  N    . ILE A 1 231 ? 0.834   44.250 -5.296  1.00 25.18 ? 230 ILE A N    1 
ATOM   1579 C  CA   . ILE A 1 231 ? -0.008  43.707 -6.375  1.00 26.44 ? 230 ILE A CA   1 
ATOM   1580 C  C    . ILE A 1 231 ? -1.364  44.394 -6.398  1.00 25.93 ? 230 ILE A C    1 
ATOM   1581 O  O    . ILE A 1 231 ? -1.862  44.786 -7.468  1.00 26.17 ? 230 ILE A O    1 
ATOM   1582 C  CB   . ILE A 1 231 ? -0.184  42.152 -6.254  1.00 25.05 ? 230 ILE A CB   1 
ATOM   1583 C  CG1  . ILE A 1 231 ? 1.173   41.429 -6.268  1.00 33.14 ? 230 ILE A CG1  1 
ATOM   1584 C  CG2  . ILE A 1 231 ? -1.191  41.622 -7.349  1.00 23.12 ? 230 ILE A CG2  1 
ATOM   1585 C  CD1  . ILE A 1 231 ? 2.009   41.623 -7.562  1.00 20.89 ? 230 ILE A CD1  1 
ATOM   1586 N  N    . LEU A 1 232 ? -1.969  44.553 -5.215  1.00 26.14 ? 231 LEU A N    1 
ATOM   1587 C  CA   . LEU A 1 232 ? -3.253  45.193 -5.105  1.00 27.47 ? 231 LEU A CA   1 
ATOM   1588 C  C    . LEU A 1 232 ? -3.237  46.681 -5.546  1.00 24.48 ? 231 LEU A C    1 
ATOM   1589 O  O    . LEU A 1 232 ? -4.150  47.148 -6.265  1.00 24.75 ? 231 LEU A O    1 
ATOM   1590 C  CB   . LEU A 1 232 ? -3.811  45.043 -3.674  1.00 28.13 ? 231 LEU A CB   1 
ATOM   1591 C  CG   . LEU A 1 232 ? -5.154  45.717 -3.422  1.00 22.73 ? 231 LEU A CG   1 
ATOM   1592 C  CD1  . LEU A 1 232 ? -6.325  45.007 -4.192  1.00 24.56 ? 231 LEU A CD1  1 
ATOM   1593 C  CD2  . LEU A 1 232 ? -5.417  45.825 -1.876  1.00 25.32 ? 231 LEU A CD2  1 
ATOM   1594 N  N    . LEU A 1 233 ? -2.235  47.415 -5.092  1.00 23.21 ? 232 LEU A N    1 
ATOM   1595 C  CA   . LEU A 1 233 ? -2.073  48.801 -5.458  1.00 24.56 ? 232 LEU A CA   1 
ATOM   1596 C  C    . LEU A 1 233 ? -1.861  48.992 -6.994  1.00 25.72 ? 232 LEU A C    1 
ATOM   1597 O  O    . LEU A 1 233 ? -2.507  49.872 -7.583  1.00 26.62 ? 232 LEU A O    1 
ATOM   1598 C  CB   . LEU A 1 233 ? -1.008  49.488 -4.583  1.00 24.40 ? 232 LEU A CB   1 
ATOM   1599 C  CG   . LEU A 1 233 ? -0.781  51.001 -4.808  1.00 29.58 ? 232 LEU A CG   1 
ATOM   1600 C  CD1  . LEU A 1 233 ? -2.101  51.809 -4.684  1.00 24.06 ? 232 LEU A CD1  1 
ATOM   1601 C  CD2  . LEU A 1 233 ? 0.334   51.532 -3.830  1.00 25.32 ? 232 LEU A CD2  1 
ATOM   1602 N  N    . TYR A 1 234 ? -1.001  48.179 -7.619  1.00 28.23 ? 233 TYR A N    1 
ATOM   1603 C  CA   . TYR A 1 234 ? -0.817  48.144 -9.075  1.00 25.29 ? 233 TYR A CA   1 
ATOM   1604 C  C    . TYR A 1 234 ? -2.167  47.904 -9.770  1.00 23.59 ? 233 TYR A C    1 
ATOM   1605 O  O    . TYR A 1 234 ? -2.536  48.608 -10.705 1.00 25.03 ? 233 TYR A O    1 
ATOM   1606 C  CB   . TYR A 1 234 ? 0.223   47.055 -9.482  1.00 26.67 ? 233 TYR A CB   1 
ATOM   1607 C  CG   . TYR A 1 234 ? 0.521   47.066 -10.968 1.00 25.54 ? 233 TYR A CG   1 
ATOM   1608 C  CD1  . TYR A 1 234 ? 1.668   47.660 -11.468 1.00 24.23 ? 233 TYR A CD1  1 
ATOM   1609 C  CD2  . TYR A 1 234 ? -0.388  46.503 -11.894 1.00 20.35 ? 233 TYR A CD2  1 
ATOM   1610 C  CE1  . TYR A 1 234 ? 1.903   47.705 -12.824 1.00 29.29 ? 233 TYR A CE1  1 
ATOM   1611 C  CE2  . TYR A 1 234 ? -0.180  46.568 -13.230 1.00 24.51 ? 233 TYR A CE2  1 
ATOM   1612 C  CZ   . TYR A 1 234 ? 0.972   47.156 -13.703 1.00 25.48 ? 233 TYR A CZ   1 
ATOM   1613 O  OH   . TYR A 1 234 ? 1.173   47.223 -15.048 1.00 26.17 ? 233 TYR A OH   1 
ATOM   1614 N  N    . ASP A 1 235 ? -2.914  46.931 -9.259  1.00 23.52 ? 234 ASP A N    1 
ATOM   1615 C  CA   . ASP A 1 235 ? -4.235  46.566 -9.745  1.00 24.84 ? 234 ASP A CA   1 
ATOM   1616 C  C    . ASP A 1 235 ? -5.182  47.769 -9.718  1.00 26.75 ? 234 ASP A C    1 
ATOM   1617 O  O    . ASP A 1 235 ? -5.801  48.087 -10.725 1.00 25.12 ? 234 ASP A O    1 
ATOM   1618 C  CB   . ASP A 1 235 ? -4.726  45.392 -8.905  1.00 26.45 ? 234 ASP A CB   1 
ATOM   1619 C  CG   . ASP A 1 235 ? -6.112  44.891 -9.265  1.00 26.99 ? 234 ASP A CG   1 
ATOM   1620 O  OD1  . ASP A 1 235 ? -6.425  44.614 -10.447 1.00 27.23 ? 234 ASP A OD1  1 
ATOM   1621 O  OD2  . ASP A 1 235 ? -6.887  44.702 -8.298  1.00 29.09 ? 234 ASP A OD2  1 
ATOM   1622 N  N    . MET A 1 236 ? -5.237  48.475 -8.588  1.00 23.27 ? 235 MET A N    1 
ATOM   1623 C  CA   . MET A 1 236 ? -5.998  49.714 -8.477  1.00 26.30 ? 235 MET A CA   1 
ATOM   1624 C  C    . MET A 1 236 ? -5.634  50.799 -9.503  1.00 26.16 ? 235 MET A C    1 
ATOM   1625 O  O    . MET A 1 236 ? -6.512  51.381 -10.157 1.00 28.37 ? 235 MET A O    1 
ATOM   1626 C  CB   . MET A 1 236 ? -5.930  50.255 -7.032  1.00 22.84 ? 235 MET A CB   1 
ATOM   1627 C  CG   . MET A 1 236 ? -6.805  49.465 -6.035  1.00 31.29 ? 235 MET A CG   1 
ATOM   1628 S  SD   . MET A 1 236 ? -6.678  50.232 -4.413  1.00 41.41 ? 235 MET A SD   1 
ATOM   1629 C  CE   . MET A 1 236 ? -7.021  48.885 -3.264  1.00 47.50 ? 235 MET A CE   1 
ATOM   1630 N  N    . VAL A 1 237 ? -4.355  51.107 -9.642  1.00 28.57 ? 236 VAL A N    1 
ATOM   1631 C  CA   . VAL A 1 237 ? -3.971  52.242 -10.476 1.00 27.16 ? 236 VAL A CA   1 
ATOM   1632 C  C    . VAL A 1 237 ? -3.763  51.925 -11.974 1.00 26.75 ? 236 VAL A C    1 
ATOM   1633 O  O    . VAL A 1 237 ? -3.728  52.856 -12.794 1.00 26.68 ? 236 VAL A O    1 
ATOM   1634 C  CB   . VAL A 1 237 ? -2.746  53.017 -9.891  1.00 25.01 ? 236 VAL A CB   1 
ATOM   1635 C  CG1  . VAL A 1 237 ? -3.088  53.572 -8.498  1.00 27.91 ? 236 VAL A CG1  1 
ATOM   1636 C  CG2  . VAL A 1 237 ? -1.415  52.145 -9.928  1.00 20.65 ? 236 VAL A CG2  1 
ATOM   1637 N  N    . CYS A 1 238 ? -3.652  50.639 -12.315 1.00 28.00 ? 237 CYS A N    1 
ATOM   1638 C  CA   . CYS A 1 238 ? -3.507  50.190 -13.693 1.00 29.43 ? 237 CYS A CA   1 
ATOM   1639 C  C    . CYS A 1 238 ? -4.719  49.441 -14.259 1.00 29.29 ? 237 CYS A C    1 
ATOM   1640 O  O    . CYS A 1 238 ? -4.778  49.228 -15.460 1.00 28.08 ? 237 CYS A O    1 
ATOM   1641 C  CB   . CYS A 1 238 ? -2.231  49.351 -13.862 1.00 23.96 ? 237 CYS A CB   1 
ATOM   1642 S  SG   . CYS A 1 238 ? -0.695  50.318 -13.620 1.00 29.52 ? 237 CYS A SG   1 
ATOM   1643 N  N    . GLY A 1 239 ? -5.657  49.035 -13.403 1.00 30.95 ? 238 GLY A N    1 
ATOM   1644 C  CA   . GLY A 1 239 ? -6.867  48.329 -13.824 1.00 29.94 ? 238 GLY A CA   1 
ATOM   1645 C  C    . GLY A 1 239 ? -6.767  46.803 -13.927 1.00 29.42 ? 238 GLY A C    1 
ATOM   1646 O  O    . GLY A 1 239 ? -7.772  46.147 -14.144 1.00 29.83 ? 238 GLY A O    1 
ATOM   1647 N  N    . ASP A 1 240 ? -5.562  46.244 -13.801 1.00 28.59 ? 239 ASP A N    1 
ATOM   1648 C  CA   . ASP A 1 240 ? -5.374  44.814 -13.585 1.00 28.08 ? 239 ASP A CA   1 
ATOM   1649 C  C    . ASP A 1 240 ? -4.056  44.567 -12.855 1.00 28.90 ? 239 ASP A C    1 
ATOM   1650 O  O    . ASP A 1 240 ? -3.217  45.475 -12.747 1.00 26.50 ? 239 ASP A O    1 
ATOM   1651 C  CB   . ASP A 1 240 ? -5.447  44.038 -14.916 1.00 26.99 ? 239 ASP A CB   1 
ATOM   1652 C  CG   . ASP A 1 240 ? -5.887  42.574 -14.742 1.00 29.54 ? 239 ASP A CG   1 
ATOM   1653 O  OD1  . ASP A 1 240 ? -6.237  42.128 -13.603 1.00 30.25 ? 239 ASP A OD1  1 
ATOM   1654 O  OD2  . ASP A 1 240 ? -5.860  41.861 -15.770 1.00 37.63 ? 239 ASP A OD2  1 
ATOM   1655 N  N    . ILE A 1 241 ? -3.896  43.339 -12.345 1.00 26.74 ? 240 ILE A N    1 
ATOM   1656 C  CA   . ILE A 1 241 ? -2.686  42.896 -11.671 1.00 26.64 ? 240 ILE A CA   1 
ATOM   1657 C  C    . ILE A 1 241 ? -1.494  42.838 -12.652 1.00 27.90 ? 240 ILE A C    1 
ATOM   1658 O  O    . ILE A 1 241 ? -1.679  42.681 -13.854 1.00 30.09 ? 240 ILE A O    1 
ATOM   1659 C  CB   . ILE A 1 241 ? -2.890  41.501 -10.957 1.00 26.55 ? 240 ILE A CB   1 
ATOM   1660 C  CG1  . ILE A 1 241 ? -3.226  40.394 -11.977 1.00 25.61 ? 240 ILE A CG1  1 
ATOM   1661 C  CG2  . ILE A 1 241 ? -3.975  41.604 -9.919  1.00 27.27 ? 240 ILE A CG2  1 
ATOM   1662 C  CD1  . ILE A 1 241 ? -3.320  39.027 -11.359 1.00 28.47 ? 240 ILE A CD1  1 
ATOM   1663 N  N    . PRO A 1 242 ? -0.269  43.008 -12.138 1.00 26.07 ? 241 PRO A N    1 
ATOM   1664 C  CA   . PRO A 1 242 ? 0.890   43.082 -13.041 1.00 27.49 ? 241 PRO A CA   1 
ATOM   1665 C  C    . PRO A 1 242 ? 1.344   41.733 -13.568 1.00 26.46 ? 241 PRO A C    1 
ATOM   1666 O  O    . PRO A 1 242 ? 1.912   41.691 -14.633 1.00 26.68 ? 241 PRO A O    1 
ATOM   1667 C  CB   . PRO A 1 242 ? 2.006   43.687 -12.160 1.00 28.15 ? 241 PRO A CB   1 
ATOM   1668 C  CG   . PRO A 1 242 ? 1.609   43.307 -10.733 1.00 29.59 ? 241 PRO A CG   1 
ATOM   1669 C  CD   . PRO A 1 242 ? 0.085   43.325 -10.739 1.00 27.83 ? 241 PRO A CD   1 
ATOM   1670 N  N    . PHE A 1 243 ? 1.137   40.653 -12.806 1.00 28.72 ? 242 PHE A N    1 
ATOM   1671 C  CA   . PHE A 1 243 ? 1.713   39.345 -13.143 1.00 29.05 ? 242 PHE A CA   1 
ATOM   1672 C  C    . PHE A 1 243 ? 0.636   38.266 -13.232 1.00 26.86 ? 242 PHE A C    1 
ATOM   1673 O  O    . PHE A 1 243 ? -0.251  38.190 -12.381 1.00 29.39 ? 242 PHE A O    1 
ATOM   1674 C  CB   . PHE A 1 243 ? 2.762   38.889 -12.116 1.00 30.74 ? 242 PHE A CB   1 
ATOM   1675 C  CG   . PHE A 1 243 ? 3.753   39.950 -11.711 1.00 26.38 ? 242 PHE A CG   1 
ATOM   1676 C  CD1  . PHE A 1 243 ? 4.423   40.720 -12.676 1.00 35.65 ? 242 PHE A CD1  1 
ATOM   1677 C  CD2  . PHE A 1 243 ? 4.057   40.149 -10.367 1.00 26.51 ? 242 PHE A CD2  1 
ATOM   1678 C  CE1  . PHE A 1 243 ? 5.347   41.699 -12.301 1.00 34.83 ? 242 PHE A CE1  1 
ATOM   1679 C  CE2  . PHE A 1 243 ? 4.970   41.162 -9.969  1.00 29.22 ? 242 PHE A CE2  1 
ATOM   1680 C  CZ   . PHE A 1 243 ? 5.630   41.918 -10.948 1.00 32.72 ? 242 PHE A CZ   1 
ATOM   1681 N  N    . GLU A 1 244 ? 0.738   37.421 -14.262 1.00 32.65 ? 243 GLU A N    1 
ATOM   1682 C  CA   . GLU A 1 244 ? -0.081  36.209 -14.378 1.00 31.21 ? 243 GLU A CA   1 
ATOM   1683 C  C    . GLU A 1 244 ? 0.762   34.939 -14.233 1.00 33.64 ? 243 GLU A C    1 
ATOM   1684 O  O    . GLU A 1 244 ? 0.269   33.920 -13.771 1.00 35.85 ? 243 GLU A O    1 
ATOM   1685 C  CB   . GLU A 1 244 ? -0.824  36.176 -15.727 1.00 33.48 ? 243 GLU A CB   1 
ATOM   1686 C  CG   . GLU A 1 244 ? -1.872  37.268 -15.927 1.00 34.62 ? 243 GLU A CG   1 
ATOM   1687 C  CD   . GLU A 1 244 ? -3.145  37.085 -15.076 1.00 34.22 ? 243 GLU A CD   1 
ATOM   1688 O  OE1  . GLU A 1 244 ? -3.442  35.954 -14.619 1.00 37.37 ? 243 GLU A OE1  1 
ATOM   1689 O  OE2  . GLU A 1 244 ? -3.854  38.097 -14.881 1.00 44.82 ? 243 GLU A OE2  1 
ATOM   1690 N  N    . HIS A 1 245 ? 2.028   35.008 -14.622 1.00 34.02 ? 244 HIS A N    1 
ATOM   1691 C  CA   . HIS A 1 245 ? 2.865   33.830 -14.730 1.00 35.44 ? 244 HIS A CA   1 
ATOM   1692 C  C    . HIS A 1 245 ? 3.989   33.842 -13.685 1.00 28.33 ? 244 HIS A C    1 
ATOM   1693 O  O    . HIS A 1 245 ? 4.490   34.902 -13.304 1.00 30.70 ? 244 HIS A O    1 
ATOM   1694 C  CB   . HIS A 1 245 ? 3.418   33.733 -16.160 1.00 36.70 ? 244 HIS A CB   1 
ATOM   1695 C  CG   . HIS A 1 245 ? 2.350   33.805 -17.215 1.00 41.68 ? 244 HIS A CG   1 
ATOM   1696 N  ND1  . HIS A 1 245 ? 1.408   32.812 -17.387 1.00 37.97 ? 244 HIS A ND1  1 
ATOM   1697 C  CD2  . HIS A 1 245 ? 2.048   34.769 -18.119 1.00 41.62 ? 244 HIS A CD2  1 
ATOM   1698 C  CE1  . HIS A 1 245 ? 0.585   33.152 -18.365 1.00 47.07 ? 244 HIS A CE1  1 
ATOM   1699 N  NE2  . HIS A 1 245 ? 0.959   34.330 -18.834 1.00 49.13 ? 244 HIS A NE2  1 
ATOM   1700 N  N    . ASP A 1 246 ? 4.338   32.651 -13.207 1.00 30.08 ? 245 ASP A N    1 
ATOM   1701 C  CA   . ASP A 1 246 ? 5.464   32.454 -12.270 1.00 28.68 ? 245 ASP A CA   1 
ATOM   1702 C  C    . ASP A 1 246 ? 6.742   33.209 -12.635 1.00 33.10 ? 245 ASP A C    1 
ATOM   1703 O  O    . ASP A 1 246 ? 7.369   33.847 -11.778 1.00 31.63 ? 245 ASP A O    1 
ATOM   1704 C  CB   . ASP A 1 246 ? 5.751   30.965 -12.109 1.00 29.40 ? 245 ASP A CB   1 
ATOM   1705 C  CG   . ASP A 1 246 ? 4.625   30.234 -11.420 1.00 33.68 ? 245 ASP A CG   1 
ATOM   1706 O  OD1  . ASP A 1 246 ? 3.601   30.873 -11.088 1.00 37.31 ? 245 ASP A OD1  1 
ATOM   1707 O  OD2  . ASP A 1 246 ? 4.769   29.020 -11.195 1.00 28.33 ? 245 ASP A OD2  1 
ATOM   1708 N  N    . GLU A 1 247 ? 7.109   33.165 -13.908 1.00 32.99 ? 246 GLU A N    1 
ATOM   1709 C  CA   . GLU A 1 247 ? 8.322   33.841 -14.401 1.00 35.00 ? 246 GLU A CA   1 
ATOM   1710 C  C    . GLU A 1 247 ? 8.241   35.373 -14.277 1.00 33.32 ? 246 GLU A C    1 
ATOM   1711 O  O    . GLU A 1 247 ? 9.242   36.030 -14.017 1.00 31.30 ? 246 GLU A O    1 
ATOM   1712 C  CB   . GLU A 1 247 ? 8.628   33.436 -15.854 1.00 36.53 ? 246 GLU A CB   1 
ATOM   1713 C  CG   . GLU A 1 247 ? 7.432   32.866 -16.658 1.00 52.49 ? 246 GLU A CG   1 
ATOM   1714 C  CD   . GLU A 1 247 ? 7.003   31.469 -16.176 1.00 58.33 ? 246 GLU A CD   1 
ATOM   1715 O  OE1  . GLU A 1 247 ? 5.787   31.266 -15.995 1.00 46.11 ? 246 GLU A OE1  1 
ATOM   1716 O  OE2  . GLU A 1 247 ? 7.874   30.587 -15.945 1.00 69.46 ? 246 GLU A OE2  1 
ATOM   1717 N  N    . GLU A 1 248 ? 7.044   35.927 -14.451 1.00 31.99 ? 247 GLU A N    1 
ATOM   1718 C  CA   . GLU A 1 248 ? 6.817   37.352 -14.211 1.00 31.92 ? 247 GLU A CA   1 
ATOM   1719 C  C    . GLU A 1 248 ? 6.953   37.719 -12.729 1.00 30.58 ? 247 GLU A C    1 
ATOM   1720 O  O    . GLU A 1 248 ? 7.589   38.741 -12.398 1.00 32.49 ? 247 GLU A O    1 
ATOM   1721 C  CB   . GLU A 1 248 ? 5.434   37.755 -14.694 1.00 34.33 ? 247 GLU A CB   1 
ATOM   1722 C  CG   . GLU A 1 248 ? 5.205   37.615 -16.162 1.00 35.15 ? 247 GLU A CG   1 
ATOM   1723 C  CD   . GLU A 1 248 ? 3.798   37.969 -16.539 1.00 47.17 ? 247 GLU A CD   1 
ATOM   1724 O  OE1  . GLU A 1 248 ? 3.624   38.880 -17.357 1.00 71.79 ? 247 GLU A OE1  1 
ATOM   1725 O  OE2  . GLU A 1 248 ? 2.855   37.365 -16.005 1.00 36.96 ? 247 GLU A OE2  1 
ATOM   1726 N  N    . ILE A 1 249 ? 6.340   36.901 -11.863 1.00 30.95 ? 248 ILE A N    1 
ATOM   1727 C  CA   . ILE A 1 249 ? 6.380   37.082 -10.406 1.00 31.22 ? 248 ILE A CA   1 
ATOM   1728 C  C    . ILE A 1 249 ? 7.822   37.098 -9.908  1.00 30.88 ? 248 ILE A C    1 
ATOM   1729 O  O    . ILE A 1 249 ? 8.187   37.965 -9.124  1.00 28.42 ? 248 ILE A O    1 
ATOM   1730 C  CB   . ILE A 1 249 ? 5.555   35.998 -9.617  1.00 31.86 ? 248 ILE A CB   1 
ATOM   1731 C  CG1  . ILE A 1 249 ? 4.070   36.075 -10.017 1.00 29.94 ? 248 ILE A CG1  1 
ATOM   1732 C  CG2  . ILE A 1 249 ? 5.709   36.198 -8.068  1.00 30.22 ? 248 ILE A CG2  1 
ATOM   1733 C  CD1  . ILE A 1 249 ? 3.187   34.946 -9.512  1.00 27.33 ? 248 ILE A CD1  1 
ATOM   1734 N  N    . ILE A 1 250 ? 8.649   36.167 -10.381 1.00 33.35 ? 249 ILE A N    1 
ATOM   1735 C  CA   . ILE A 1 250 ? 10.058  36.136 -9.946  1.00 37.33 ? 249 ILE A CA   1 
ATOM   1736 C  C    . ILE A 1 250 ? 11.007  37.046 -10.750 1.00 34.93 ? 249 ILE A C    1 
ATOM   1737 O  O    . ILE A 1 250 ? 12.118  37.324 -10.303 1.00 30.49 ? 249 ILE A O    1 
ATOM   1738 C  CB   . ILE A 1 250 ? 10.622  34.676 -9.865  1.00 38.97 ? 249 ILE A CB   1 
ATOM   1739 C  CG1  . ILE A 1 250 ? 10.894  34.076 -11.255 1.00 37.32 ? 249 ILE A CG1  1 
ATOM   1740 C  CG2  . ILE A 1 250 ? 9.687   33.778 -9.031  1.00 41.53 ? 249 ILE A CG2  1 
ATOM   1741 C  CD1  . ILE A 1 250 ? 11.509  32.709 -11.177 1.00 40.26 ? 249 ILE A CD1  1 
ATOM   1742 N  N    . GLY A 1 251 ? 10.569  37.525 -11.909 1.00 36.21 ? 250 GLY A N    1 
ATOM   1743 C  CA   . GLY A 1 251 ? 11.437  38.304 -12.799 1.00 39.52 ? 250 GLY A CA   1 
ATOM   1744 C  C    . GLY A 1 251 ? 11.942  39.667 -12.322 1.00 39.64 ? 250 GLY A C    1 
ATOM   1745 O  O    . GLY A 1 251 ? 12.958  40.155 -12.806 1.00 42.29 ? 250 GLY A O    1 
ATOM   1746 N  N    . GLY A 1 252 ? 11.236  40.303 -11.410 1.00 37.47 ? 251 GLY A N    1 
ATOM   1747 C  CA   . GLY A 1 252 ? 11.683  41.598 -10.872 1.00 42.95 ? 251 GLY A CA   1 
ATOM   1748 C  C    . GLY A 1 252 ? 11.476  42.887 -11.682 1.00 43.09 ? 251 GLY A C    1 
ATOM   1749 O  O    . GLY A 1 252 ? 12.085  43.912 -11.338 1.00 43.67 ? 251 GLY A O    1 
ATOM   1750 N  N    . GLN A 1 253 ? 10.654  42.845 -12.746 1.00 38.10 ? 252 GLN A N    1 
ATOM   1751 C  CA   . GLN A 1 253 ? 10.313  44.029 -13.536 1.00 36.82 ? 252 GLN A CA   1 
ATOM   1752 C  C    . GLN A 1 253 ? 8.841   44.380 -13.341 1.00 30.36 ? 252 GLN A C    1 
ATOM   1753 O  O    . GLN A 1 253 ? 7.970   43.550 -13.508 1.00 31.25 ? 252 GLN A O    1 
ATOM   1754 C  CB   . GLN A 1 253 ? 10.582  43.822 -15.050 1.00 37.82 ? 252 GLN A CB   1 
ATOM   1755 C  CG   . GLN A 1 253 ? 12.065  43.899 -15.512 1.00 44.83 ? 252 GLN A CG   1 
ATOM   1756 C  CD   . GLN A 1 253 ? 12.846  45.050 -14.888 1.00 44.79 ? 252 GLN A CD   1 
ATOM   1757 O  OE1  . GLN A 1 253 ? 12.431  46.214 -14.939 1.00 39.65 ? 252 GLN A OE1  1 
ATOM   1758 N  NE2  . GLN A 1 253 ? 13.985  44.720 -14.284 1.00 39.90 ? 252 GLN A NE2  1 
ATOM   1759 N  N    . VAL A 1 254 ? 8.578   45.625 -12.989 1.00 32.07 ? 253 VAL A N    1 
ATOM   1760 C  CA   . VAL A 1 254 ? 7.225   46.135 -12.902 1.00 29.72 ? 253 VAL A CA   1 
ATOM   1761 C  C    . VAL A 1 254 ? 7.059   47.131 -14.049 1.00 32.66 ? 253 VAL A C    1 
ATOM   1762 O  O    . VAL A 1 254 ? 7.625   48.236 -14.010 1.00 36.67 ? 253 VAL A O    1 
ATOM   1763 C  CB   . VAL A 1 254 ? 6.928   46.771 -11.532 1.00 28.88 ? 253 VAL A CB   1 
ATOM   1764 C  CG1  . VAL A 1 254 ? 5.437   47.134 -11.435 1.00 26.85 ? 253 VAL A CG1  1 
ATOM   1765 C  CG2  . VAL A 1 254 ? 7.352   45.829 -10.357 1.00 27.57 ? 253 VAL A CG2  1 
ATOM   1766 N  N    . PHE A 1 255 ? 6.336   46.709 -15.090 1.00 28.13 ? 254 PHE A N    1 
ATOM   1767 C  CA   . PHE A 1 255 ? 5.946   47.578 -16.219 1.00 26.34 ? 254 PHE A CA   1 
ATOM   1768 C  C    . PHE A 1 255 ? 4.598   48.233 -15.914 1.00 25.62 ? 254 PHE A C    1 
ATOM   1769 O  O    . PHE A 1 255 ? 3.631   47.552 -15.529 1.00 25.11 ? 254 PHE A O    1 
ATOM   1770 C  CB   . PHE A 1 255 ? 5.829   46.755 -17.518 1.00 27.28 ? 254 PHE A CB   1 
ATOM   1771 C  CG   . PHE A 1 255 ? 5.228   47.520 -18.691 1.00 25.85 ? 254 PHE A CG   1 
ATOM   1772 C  CD1  . PHE A 1 255 ? 6.034   48.347 -19.485 1.00 23.44 ? 254 PHE A CD1  1 
ATOM   1773 C  CD2  . PHE A 1 255 ? 3.872   47.383 -19.031 1.00 23.30 ? 254 PHE A CD2  1 
ATOM   1774 C  CE1  . PHE A 1 255 ? 5.507   49.037 -20.579 1.00 23.71 ? 254 PHE A CE1  1 
ATOM   1775 C  CE2  . PHE A 1 255 ? 3.326   48.078 -20.117 1.00 24.73 ? 254 PHE A CE2  1 
ATOM   1776 C  CZ   . PHE A 1 255 ? 4.141   48.892 -20.903 1.00 26.64 ? 254 PHE A CZ   1 
ATOM   1777 N  N    . PHE A 1 256 ? 4.539   49.553 -16.042 1.00 24.39 ? 255 PHE A N    1 
ATOM   1778 C  CA   . PHE A 1 256 ? 3.302   50.298 -15.828 1.00 26.32 ? 255 PHE A CA   1 
ATOM   1779 C  C    . PHE A 1 256 ? 2.558   50.486 -17.145 1.00 24.85 ? 255 PHE A C    1 
ATOM   1780 O  O    . PHE A 1 256 ? 3.059   51.113 -18.065 1.00 29.63 ? 255 PHE A O    1 
ATOM   1781 C  CB   . PHE A 1 256 ? 3.583   51.625 -15.090 1.00 26.38 ? 255 PHE A CB   1 
ATOM   1782 C  CG   . PHE A 1 256 ? 3.752   51.424 -13.631 1.00 30.93 ? 255 PHE A CG   1 
ATOM   1783 C  CD1  . PHE A 1 256 ? 2.676   51.518 -12.782 1.00 27.85 ? 255 PHE A CD1  1 
ATOM   1784 C  CD2  . PHE A 1 256 ? 4.973   51.051 -13.115 1.00 24.77 ? 255 PHE A CD2  1 
ATOM   1785 C  CE1  . PHE A 1 256 ? 2.821   51.278 -11.442 1.00 26.83 ? 255 PHE A CE1  1 
ATOM   1786 C  CE2  . PHE A 1 256 ? 5.111   50.797 -11.781 1.00 24.55 ? 255 PHE A CE2  1 
ATOM   1787 C  CZ   . PHE A 1 256 ? 4.045   50.909 -10.948 1.00 21.90 ? 255 PHE A CZ   1 
ATOM   1788 N  N    . ARG A 1 257 ? 1.362   49.896 -17.229 1.00 26.51 ? 256 ARG A N    1 
ATOM   1789 C  CA   . ARG A 1 257 ? 0.565   49.899 -18.450 1.00 29.61 ? 256 ARG A CA   1 
ATOM   1790 C  C    . ARG A 1 257 ? -0.339  51.118 -18.549 1.00 29.44 ? 256 ARG A C    1 
ATOM   1791 O  O    . ARG A 1 257 ? -0.984  51.338 -19.573 1.00 29.21 ? 256 ARG A O    1 
ATOM   1792 C  CB   . ARG A 1 257 ? -0.295  48.622 -18.564 1.00 29.67 ? 256 ARG A CB   1 
ATOM   1793 C  CG   . ARG A 1 257 ? -1.324  48.422 -17.444 1.00 32.27 ? 256 ARG A CG   1 
ATOM   1794 C  CD   . ARG A 1 257 ? -1.832  46.968 -17.415 1.00 35.83 ? 256 ARG A CD   1 
ATOM   1795 N  NE   . ARG A 1 257 ? -0.835  46.022 -16.892 1.00 35.28 ? 256 ARG A NE   1 
ATOM   1796 C  CZ   . ARG A 1 257 ? -0.968  44.694 -16.918 1.00 36.18 ? 256 ARG A CZ   1 
ATOM   1797 N  NH1  . ARG A 1 257 ? -2.043  44.141 -17.469 1.00 38.32 ? 256 ARG A NH1  1 
ATOM   1798 N  NH2  . ARG A 1 257 ? -0.006  43.909 -16.428 1.00 32.44 ? 256 ARG A NH2  1 
ATOM   1799 N  N    . GLN A 1 258 ? -0.383  51.880 -17.461 1.00 22.74 ? 257 GLN A N    1 
ATOM   1800 C  CA   . GLN A 1 258 ? -1.174  53.067 -17.344 1.00 28.41 ? 257 GLN A CA   1 
ATOM   1801 C  C    . GLN A 1 258 ? -0.225  54.176 -16.842 1.00 24.77 ? 257 GLN A C    1 
ATOM   1802 O  O    . GLN A 1 258 ? 0.840   53.910 -16.239 1.00 26.44 ? 257 GLN A O    1 
ATOM   1803 C  CB   . GLN A 1 258 ? -2.310  52.761 -16.348 1.00 28.98 ? 257 GLN A CB   1 
ATOM   1804 C  CG   . GLN A 1 258 ? -3.288  53.876 -16.053 1.00 37.50 ? 257 GLN A CG   1 
ATOM   1805 C  CD   . GLN A 1 258 ? -4.368  54.053 -17.146 1.00 48.29 ? 257 GLN A CD   1 
ATOM   1806 O  OE1  . GLN A 1 258 ? -4.591  53.174 -17.991 1.00 34.67 ? 257 GLN A OE1  1 
ATOM   1807 N  NE2  . GLN A 1 258 ? -5.030  55.205 -17.121 1.00 53.40 ? 257 GLN A NE2  1 
ATOM   1808 N  N    . ARG A 1 259 ? -0.600  55.402 -17.164 1.00 24.64 ? 258 ARG A N    1 
ATOM   1809 C  CA   . ARG A 1 259 ? -0.016  56.583 -16.603 1.00 22.48 ? 258 ARG A CA   1 
ATOM   1810 C  C    . ARG A 1 259 ? -0.227  56.648 -15.081 1.00 25.92 ? 258 ARG A C    1 
ATOM   1811 O  O    . ARG A 1 259 ? -1.350  56.753 -14.586 1.00 30.15 ? 258 ARG A O    1 
ATOM   1812 C  CB   . ARG A 1 259 ? -0.567  57.823 -17.304 1.00 24.20 ? 258 ARG A CB   1 
ATOM   1813 C  CG   . ARG A 1 259 ? -0.258  59.113 -16.583 1.00 31.43 ? 258 ARG A CG   1 
ATOM   1814 C  CD   . ARG A 1 259 ? 1.199   59.371 -16.529 1.00 28.04 ? 258 ARG A CD   1 
ATOM   1815 N  NE   . ARG A 1 259 ? 1.536   60.274 -15.425 1.00 28.88 ? 258 ARG A NE   1 
ATOM   1816 C  CZ   . ARG A 1 259 ? 2.653   60.992 -15.369 1.00 30.14 ? 258 ARG A CZ   1 
ATOM   1817 N  NH1  . ARG A 1 259 ? 2.838   61.804 -14.329 1.00 31.56 ? 258 ARG A NH1  1 
ATOM   1818 N  NH2  . ARG A 1 259 ? 3.577   60.918 -16.361 1.00 26.12 ? 258 ARG A NH2  1 
ATOM   1819 N  N    . VAL A 1 260 ? 0.875   56.560 -14.359 1.00 25.35 ? 259 VAL A N    1 
ATOM   1820 C  CA   . VAL A 1 260 ? 0.897   56.544 -12.891 1.00 24.98 ? 259 VAL A CA   1 
ATOM   1821 C  C    . VAL A 1 260 ? 2.018   57.483 -12.440 1.00 27.67 ? 259 VAL A C    1 
ATOM   1822 O  O    . VAL A 1 260 ? 3.127   57.412 -12.989 1.00 29.03 ? 259 VAL A O    1 
ATOM   1823 C  CB   . VAL A 1 260 ? 1.130   55.117 -12.355 1.00 25.60 ? 259 VAL A CB   1 
ATOM   1824 C  CG1  . VAL A 1 260 ? 1.258   55.116 -10.822 1.00 29.00 ? 259 VAL A CG1  1 
ATOM   1825 C  CG2  . VAL A 1 260 ? -0.031  54.148 -12.820 1.00 29.35 ? 259 VAL A CG2  1 
ATOM   1826 N  N    . SER A 1 261 ? 1.725   58.334 -11.445 1.00 26.31 ? 260 SER A N    1 
ATOM   1827 C  CA   . SER A 1 261 ? 2.700   59.265 -10.825 1.00 25.47 ? 260 SER A CA   1 
ATOM   1828 C  C    . SER A 1 261 ? 3.980   58.531 -10.400 1.00 24.36 ? 260 SER A C    1 
ATOM   1829 O  O    . SER A 1 261 ? 3.957   57.360 -10.041 1.00 23.80 ? 260 SER A O    1 
ATOM   1830 C  CB   . SER A 1 261 ? 2.088   60.003 -9.616  1.00 26.48 ? 260 SER A CB   1 
ATOM   1831 O  OG   . SER A 1 261 ? 1.970   59.164 -8.471  1.00 26.31 ? 260 SER A OG   1 
ATOM   1832 N  N    . SER A 1 262 ? 5.103   59.210 -10.484 1.00 26.24 ? 261 SER A N    1 
ATOM   1833 C  CA   . SER A 1 262 ? 6.358   58.632 -10.002 1.00 27.59 ? 261 SER A CA   1 
ATOM   1834 C  C    . SER A 1 262 ? 6.350   58.194 -8.544  1.00 27.70 ? 261 SER A C    1 
ATOM   1835 O  O    . SER A 1 262 ? 6.996   57.215 -8.186  1.00 21.32 ? 261 SER A O    1 
ATOM   1836 C  CB   . SER A 1 262 ? 7.481   59.609 -10.228 1.00 28.98 ? 261 SER A CB   1 
ATOM   1837 O  OG   . SER A 1 262 ? 7.637   59.756 -11.623 1.00 29.28 ? 261 SER A OG   1 
ATOM   1838 N  N    . GLU A 1 263 ? 5.616   58.925 -7.707  1.00 24.79 ? 262 GLU A N    1 
ATOM   1839 C  CA   . GLU A 1 263 ? 5.557   58.627 -6.289  1.00 28.38 ? 262 GLU A CA   1 
ATOM   1840 C  C    . GLU A 1 263 ? 4.813   57.314 -6.050  1.00 25.04 ? 262 GLU A C    1 
ATOM   1841 O  O    . GLU A 1 263 ? 5.243   56.476 -5.239  1.00 24.95 ? 262 GLU A O    1 
ATOM   1842 C  CB   A GLU A 1 263 ? 5.003   59.784 -5.444  0.50 28.33 ? 262 GLU A CB   1 
ATOM   1843 C  CB   B GLU A 1 263 ? 4.846   59.799 -5.574  0.50 28.56 ? 262 GLU A CB   1 
ATOM   1844 C  CG   A GLU A 1 263 ? 6.120   60.714 -4.943  0.50 30.38 ? 262 GLU A CG   1 
ATOM   1845 C  CG   B GLU A 1 263 ? 5.506   61.230 -5.720  0.50 30.16 ? 262 GLU A CG   1 
ATOM   1846 C  CD   A GLU A 1 263 ? 5.625   61.787 -4.008  0.50 35.03 ? 262 GLU A CD   1 
ATOM   1847 C  CD   B GLU A 1 263 ? 5.532   61.843 -7.155  0.50 29.69 ? 262 GLU A CD   1 
ATOM   1848 O  OE1  A GLU A 1 263 ? 4.456   61.706 -3.575  0.50 37.14 ? 262 GLU A OE1  1 
ATOM   1849 O  OE1  B GLU A 1 263 ? 4.630   61.601 -7.982  0.50 15.34 ? 262 GLU A OE1  1 
ATOM   1850 O  OE2  A GLU A 1 263 ? 6.414   62.705 -3.696  0.50 37.48 ? 262 GLU A OE2  1 
ATOM   1851 O  OE2  B GLU A 1 263 ? 6.486   62.602 -7.454  0.50 41.40 ? 262 GLU A OE2  1 
ATOM   1852 N  N    . CYS A 1 264 ? 3.726   57.108 -6.789  1.00 26.38 ? 263 CYS A N    1 
ATOM   1853 C  CA   . CYS A 1 264 ? 2.960   55.862 -6.713  1.00 25.99 ? 263 CYS A CA   1 
ATOM   1854 C  C    . CYS A 1 264 ? 3.739   54.662 -7.251  1.00 25.46 ? 263 CYS A C    1 
ATOM   1855 O  O    . CYS A 1 264 ? 3.799   53.595 -6.585  1.00 24.18 ? 263 CYS A O    1 
ATOM   1856 C  CB   . CYS A 1 264 ? 1.631   56.019 -7.443  1.00 26.68 ? 263 CYS A CB   1 
ATOM   1857 S  SG   . CYS A 1 264 ? 0.522   54.651 -7.338  1.00 33.23 ? 263 CYS A SG   1 
ATOM   1858 N  N    . GLN A 1 265 ? 4.373   54.841 -8.411  1.00 26.40 ? 264 GLN A N    1 
ATOM   1859 C  CA   . GLN A 1 265 ? 5.269   53.819 -8.956  1.00 25.60 ? 264 GLN A CA   1 
ATOM   1860 C  C    . GLN A 1 265 ? 6.315   53.411 -7.920  1.00 25.68 ? 264 GLN A C    1 
ATOM   1861 O  O    . GLN A 1 265 ? 6.590   52.229 -7.752  1.00 25.62 ? 264 GLN A O    1 
ATOM   1862 C  CB   . GLN A 1 265 ? 5.974   54.303 -10.238 1.00 26.65 ? 264 GLN A CB   1 
ATOM   1863 C  CG   . GLN A 1 265 ? 5.093   54.517 -11.474 1.00 27.03 ? 264 GLN A CG   1 
ATOM   1864 C  CD   . GLN A 1 265 ? 5.891   54.423 -12.783 1.00 29.57 ? 264 GLN A CD   1 
ATOM   1865 O  OE1  . GLN A 1 265 ? 7.020   53.966 -12.771 1.00 25.32 ? 264 GLN A OE1  1 
ATOM   1866 N  NE2  . GLN A 1 265 ? 5.309   54.864 -13.902 1.00 19.82 ? 264 GLN A NE2  1 
ATOM   1867 N  N    . HIS A 1 266 ? 6.890   54.400 -7.227  1.00 26.43 ? 265 HIS A N    1 
ATOM   1868 C  CA   . HIS A 1 266 ? 7.949   54.168 -6.251  1.00 25.49 ? 265 HIS A CA   1 
ATOM   1869 C  C    . HIS A 1 266 ? 7.491   53.254 -5.106  1.00 26.07 ? 265 HIS A C    1 
ATOM   1870 O  O    . HIS A 1 266 ? 8.164   52.288 -4.784  1.00 27.39 ? 265 HIS A O    1 
ATOM   1871 C  CB   . HIS A 1 266 ? 8.482   55.487 -5.673  1.00 27.49 ? 265 HIS A CB   1 
ATOM   1872 C  CG   . HIS A 1 266 ? 9.550   55.284 -4.651  1.00 30.24 ? 265 HIS A CG   1 
ATOM   1873 N  ND1  . HIS A 1 266 ? 9.269   55.063 -3.322  1.00 26.28 ? 265 HIS A ND1  1 
ATOM   1874 C  CD2  . HIS A 1 266 ? 10.902  55.228 -4.767  1.00 34.88 ? 265 HIS A CD2  1 
ATOM   1875 C  CE1  . HIS A 1 266 ? 10.398  54.875 -2.661  1.00 40.02 ? 265 HIS A CE1  1 
ATOM   1876 N  NE2  . HIS A 1 266 ? 11.403  54.972 -3.514  1.00 37.82 ? 265 HIS A NE2  1 
ATOM   1877 N  N    . LEU A 1 267 ? 6.330   53.561 -4.530  1.00 25.90 ? 266 LEU A N    1 
ATOM   1878 C  CA   . LEU A 1 267 ? 5.726   52.752 -3.486  1.00 24.04 ? 266 LEU A CA   1 
ATOM   1879 C  C    . LEU A 1 267 ? 5.430   51.330 -3.955  1.00 22.08 ? 266 LEU A C    1 
ATOM   1880 O  O    . LEU A 1 267 ? 5.738   50.347 -3.259  1.00 23.27 ? 266 LEU A O    1 
ATOM   1881 C  CB   . LEU A 1 267 ? 4.446   53.441 -2.968  1.00 22.99 ? 266 LEU A CB   1 
ATOM   1882 C  CG   . LEU A 1 267 ? 3.650   52.724 -1.859  1.00 32.30 ? 266 LEU A CG   1 
ATOM   1883 C  CD1  . LEU A 1 267 ? 4.543   52.357 -0.682  1.00 21.19 ? 266 LEU A CD1  1 
ATOM   1884 C  CD2  . LEU A 1 267 ? 2.446   53.563 -1.379  1.00 25.95 ? 266 LEU A CD2  1 
ATOM   1885 N  N    . ILE A 1 268 ? 4.846   51.213 -5.139  1.00 24.25 ? 267 ILE A N    1 
ATOM   1886 C  CA   . ILE A 1 268 ? 4.546   49.907 -5.702  1.00 24.76 ? 267 ILE A CA   1 
ATOM   1887 C  C    . ILE A 1 268 ? 5.801   49.055 -5.818  1.00 24.62 ? 267 ILE A C    1 
ATOM   1888 O  O    . ILE A 1 268 ? 5.829   47.896 -5.381  1.00 26.25 ? 267 ILE A O    1 
ATOM   1889 C  CB   . ILE A 1 268 ? 3.782   49.998 -7.055  1.00 26.35 ? 267 ILE A CB   1 
ATOM   1890 C  CG1  . ILE A 1 268 ? 2.382   50.605 -6.836  1.00 27.90 ? 267 ILE A CG1  1 
ATOM   1891 C  CG2  . ILE A 1 268 ? 3.730   48.594 -7.737  1.00 23.56 ? 267 ILE A CG2  1 
ATOM   1892 C  CD1  . ILE A 1 268 ? 1.547   50.970 -8.128  1.00 25.01 ? 267 ILE A CD1  1 
ATOM   1893 N  N    . ARG A 1 269 ? 6.823   49.631 -6.442  1.00 27.95 ? 268 ARG A N    1 
ATOM   1894 C  CA   . ARG A 1 269 ? 8.054   48.936 -6.689  1.00 29.22 ? 268 ARG A CA   1 
ATOM   1895 C  C    . ARG A 1 269 ? 8.776   48.576 -5.388  1.00 26.13 ? 268 ARG A C    1 
ATOM   1896 O  O    . ARG A 1 269 ? 9.468   47.570 -5.338  1.00 25.63 ? 268 ARG A O    1 
ATOM   1897 C  CB   . ARG A 1 269 ? 8.973   49.771 -7.595  1.00 27.87 ? 268 ARG A CB   1 
ATOM   1898 C  CG   . ARG A 1 269 ? 8.543   49.791 -9.062  1.00 34.96 ? 268 ARG A CG   1 
ATOM   1899 C  CD   . ARG A 1 269 ? 9.775   49.958 -9.983  1.00 48.03 ? 268 ARG A CD   1 
ATOM   1900 N  NE   . ARG A 1 269 ? 9.407   49.926 -11.406 1.00 45.77 ? 268 ARG A NE   1 
ATOM   1901 C  CZ   . ARG A 1 269 ? 8.894   50.960 -12.051 1.00 30.75 ? 268 ARG A CZ   1 
ATOM   1902 N  NH1  . ARG A 1 269 ? 8.713   52.098 -11.413 1.00 37.43 ? 268 ARG A NH1  1 
ATOM   1903 N  NH2  . ARG A 1 269 ? 8.555   50.857 -13.318 1.00 30.27 ? 268 ARG A NH2  1 
ATOM   1904 N  N    . TRP A 1 270 ? 8.615   49.401 -4.349  1.00 27.21 ? 269 TRP A N    1 
ATOM   1905 C  CA   . TRP A 1 270 ? 9.131   49.079 -3.024  1.00 23.78 ? 269 TRP A CA   1 
ATOM   1906 C  C    . TRP A 1 270 ? 8.421   47.862 -2.404  1.00 26.08 ? 269 TRP A C    1 
ATOM   1907 O  O    . TRP A 1 270 ? 9.081   46.939 -1.917  1.00 26.41 ? 269 TRP A O    1 
ATOM   1908 C  CB   . TRP A 1 270 ? 9.053   50.332 -2.136  1.00 22.71 ? 269 TRP A CB   1 
ATOM   1909 C  CG   . TRP A 1 270 ? 9.830   50.315 -0.886  1.00 24.60 ? 269 TRP A CG   1 
ATOM   1910 C  CD1  . TRP A 1 270 ? 10.804  49.435 -0.531  1.00 29.68 ? 269 TRP A CD1  1 
ATOM   1911 C  CD2  . TRP A 1 270 ? 9.727   51.261 0.190   1.00 27.12 ? 269 TRP A CD2  1 
ATOM   1912 N  NE1  . TRP A 1 270 ? 11.308  49.761 0.702   1.00 25.91 ? 269 TRP A NE1  1 
ATOM   1913 C  CE2  . TRP A 1 270 ? 10.668  50.877 1.171   1.00 25.09 ? 269 TRP A CE2  1 
ATOM   1914 C  CE3  . TRP A 1 270 ? 8.926   52.389 0.422   1.00 31.74 ? 269 TRP A CE3  1 
ATOM   1915 C  CZ2  . TRP A 1 270 ? 10.850  51.588 2.359   1.00 28.94 ? 269 TRP A CZ2  1 
ATOM   1916 C  CZ3  . TRP A 1 270 ? 9.092   53.086 1.607   1.00 34.35 ? 269 TRP A CZ3  1 
ATOM   1917 C  CH2  . TRP A 1 270 ? 10.062  52.682 2.564   1.00 28.97 ? 269 TRP A CH2  1 
ATOM   1918 N  N    . CYS A 1 271 ? 7.085   47.853 -2.463  1.00 25.92 ? 270 CYS A N    1 
ATOM   1919 C  CA   . CYS A 1 271 ? 6.275   46.711 -2.010  1.00 26.83 ? 270 CYS A CA   1 
ATOM   1920 C  C    . CYS A 1 271 ? 6.604   45.423 -2.752  1.00 25.03 ? 270 CYS A C    1 
ATOM   1921 O  O    . CYS A 1 271 ? 6.533   44.336 -2.171  1.00 26.30 ? 270 CYS A O    1 
ATOM   1922 C  CB   . CYS A 1 271 ? 4.777   47.008 -2.161  1.00 26.92 ? 270 CYS A CB   1 
ATOM   1923 S  SG   . CYS A 1 271 ? 4.156   48.259 -0.990  1.00 28.22 ? 270 CYS A SG   1 
ATOM   1924 N  N    . LEU A 1 272 ? 6.943   45.571 -4.032  1.00 24.33 ? 271 LEU A N    1 
ATOM   1925 C  CA   . LEU A 1 272 ? 7.288   44.456 -4.908  1.00 27.78 ? 271 LEU A CA   1 
ATOM   1926 C  C    . LEU A 1 272 ? 8.793   44.230 -5.059  1.00 28.42 ? 271 LEU A C    1 
ATOM   1927 O  O    . LEU A 1 272 ? 9.247   43.648 -6.053  1.00 29.03 ? 271 LEU A O    1 
ATOM   1928 C  CB   . LEU A 1 272 ? 6.590   44.622 -6.278  1.00 27.58 ? 271 LEU A CB   1 
ATOM   1929 C  CG   . LEU A 1 272 ? 5.066   44.709 -6.254  1.00 32.86 ? 271 LEU A CG   1 
ATOM   1930 C  CD1  . LEU A 1 272 ? 4.528   44.976 -7.681  1.00 24.55 ? 271 LEU A CD1  1 
ATOM   1931 C  CD2  . LEU A 1 272 ? 4.426   43.463 -5.628  1.00 25.11 ? 271 LEU A CD2  1 
ATOM   1932 N  N    . ALA A 1 273 ? 9.570   44.625 -4.043  1.00 29.38 ? 272 ALA A N    1 
ATOM   1933 C  CA   . ALA A 1 273 ? 10.995  44.283 -4.009  1.00 29.68 ? 272 ALA A CA   1 
ATOM   1934 C  C    . ALA A 1 273 ? 11.163  42.747 -4.003  1.00 27.52 ? 272 ALA A C    1 
ATOM   1935 O  O    . ALA A 1 273 ? 10.485  42.050 -3.264  1.00 26.83 ? 272 ALA A O    1 
ATOM   1936 C  CB   . ALA A 1 273 ? 11.693  44.946 -2.804  1.00 24.32 ? 272 ALA A CB   1 
ATOM   1937 N  N    . LEU A 1 274 ? 12.031  42.217 -4.870  1.00 29.58 ? 273 LEU A N    1 
ATOM   1938 C  CA   . LEU A 1 274 ? 12.282  40.761 -4.925  1.00 30.50 ? 273 LEU A CA   1 
ATOM   1939 C  C    . LEU A 1 274 ? 12.736  40.209 -3.578  1.00 28.78 ? 273 LEU A C    1 
ATOM   1940 O  O    . LEU A 1 274 ? 12.290  39.145 -3.151  1.00 29.72 ? 273 LEU A O    1 
ATOM   1941 C  CB   . LEU A 1 274 ? 13.309  40.393 -6.020  1.00 32.80 ? 273 LEU A CB   1 
ATOM   1942 C  CG   . LEU A 1 274 ? 12.831  40.409 -7.476  1.00 32.44 ? 273 LEU A CG   1 
ATOM   1943 C  CD1  . LEU A 1 274 ? 13.946  39.891 -8.443  1.00 26.74 ? 273 LEU A CD1  1 
ATOM   1944 C  CD2  . LEU A 1 274 ? 11.525  39.561 -7.606  1.00 35.84 ? 273 LEU A CD2  1 
ATOM   1945 N  N    . ARG A 1 275 ? 13.619  40.932 -2.902  1.00 31.02 ? 274 ARG A N    1 
ATOM   1946 C  CA   . ARG A 1 275 ? 14.096  40.488 -1.587  1.00 31.41 ? 274 ARG A CA   1 
ATOM   1947 C  C    . ARG A 1 275 ? 13.131  40.932 -0.485  1.00 30.22 ? 274 ARG A C    1 
ATOM   1948 O  O    . ARG A 1 275 ? 12.828  42.122 -0.365  1.00 26.04 ? 274 ARG A O    1 
ATOM   1949 C  CB   . ARG A 1 275 ? 15.501  40.999 -1.322  1.00 33.15 ? 274 ARG A CB   1 
ATOM   1950 C  CG   . ARG A 1 275 ? 16.542  40.343 -2.257  1.00 44.72 ? 274 ARG A CG   1 
ATOM   1951 C  CD   . ARG A 1 275 ? 17.943  40.993 -2.176  1.00 59.08 ? 274 ARG A CD   1 
ATOM   1952 N  NE   . ARG A 1 275 ? 18.354  41.329 -0.805  1.00 67.30 ? 274 ARG A NE   1 
ATOM   1953 C  CZ   . ARG A 1 275 ? 18.916  42.481 -0.427  1.00 80.34 ? 274 ARG A CZ   1 
ATOM   1954 N  NH1  . ARG A 1 275 ? 19.240  42.666 0.848   1.00 86.39 ? 274 ARG A NH1  1 
ATOM   1955 N  NH2  . ARG A 1 275 ? 19.175  43.450 -1.306  1.00 86.51 ? 274 ARG A NH2  1 
ATOM   1956 N  N    . PRO A 1 276 ? 12.621  39.972 0.308   1.00 29.26 ? 275 PRO A N    1 
ATOM   1957 C  CA   . PRO A 1 276 ? 11.601  40.313 1.314   1.00 32.71 ? 275 PRO A CA   1 
ATOM   1958 C  C    . PRO A 1 276 ? 12.008  41.415 2.307   1.00 33.65 ? 275 PRO A C    1 
ATOM   1959 O  O    . PRO A 1 276 ? 11.174  42.244 2.679   1.00 31.14 ? 275 PRO A O    1 
ATOM   1960 C  CB   . PRO A 1 276 ? 11.362  38.989 2.025   1.00 32.32 ? 275 PRO A CB   1 
ATOM   1961 C  CG   . PRO A 1 276 ? 11.736  37.941 1.011   1.00 32.47 ? 275 PRO A CG   1 
ATOM   1962 C  CD   . PRO A 1 276 ? 12.825  38.515 0.186   1.00 29.24 ? 275 PRO A CD   1 
ATOM   1963 N  N    . SER A 1 277 ? 13.289  41.444 2.675   1.00 34.19 ? 276 SER A N    1 
ATOM   1964 C  CA   . SER A 1 277 ? 13.855  42.472 3.560   1.00 33.83 ? 276 SER A CA   1 
ATOM   1965 C  C    . SER A 1 277 ? 14.017  43.840 2.872   1.00 33.07 ? 276 SER A C    1 
ATOM   1966 O  O    . SER A 1 277 ? 14.265  44.820 3.529   1.00 32.54 ? 276 SER A O    1 
ATOM   1967 C  CB   . SER A 1 277 ? 15.232  42.009 4.099   1.00 32.81 ? 276 SER A CB   1 
ATOM   1968 O  OG   . SER A 1 277 ? 16.187  41.986 3.049   1.00 35.64 ? 276 SER A OG   1 
ATOM   1969 N  N    . ASP A 1 278 ? 13.902  43.913 1.554   1.00 33.30 ? 277 ASP A N    1 
ATOM   1970 C  CA   . ASP A 1 278 ? 13.877  45.206 0.893   1.00 35.16 ? 277 ASP A CA   1 
ATOM   1971 C  C    . ASP A 1 278 ? 12.489  45.878 0.861   1.00 32.46 ? 277 ASP A C    1 
ATOM   1972 O  O    . ASP A 1 278 ? 12.399  47.010 0.420   1.00 34.14 ? 277 ASP A O    1 
ATOM   1973 C  CB   . ASP A 1 278 ? 14.419  45.115 -0.530  1.00 33.18 ? 277 ASP A CB   1 
ATOM   1974 C  CG   . ASP A 1 278 ? 15.910  44.890 -0.581  1.00 31.21 ? 277 ASP A CG   1 
ATOM   1975 O  OD1  . ASP A 1 278 ? 16.613  45.223 0.387   1.00 30.72 ? 277 ASP A OD1  1 
ATOM   1976 O  OD2  . ASP A 1 278 ? 16.373  44.390 -1.629  1.00 31.27 ? 277 ASP A OD2  1 
ATOM   1977 N  N    . ARG A 1 279 ? 11.445  45.166 1.290   1.00 30.31 ? 278 ARG A N    1 
ATOM   1978 C  CA   . ARG A 1 279 ? 10.069  45.653 1.272   1.00 29.27 ? 278 ARG A CA   1 
ATOM   1979 C  C    . ARG A 1 279 ? 9.808   46.561 2.479   1.00 30.15 ? 278 ARG A C    1 
ATOM   1980 O  O    . ARG A 1 279 ? 10.433  46.412 3.531   1.00 31.45 ? 278 ARG A O    1 
ATOM   1981 C  CB   . ARG A 1 279 ? 9.055   44.496 1.225   1.00 28.54 ? 278 ARG A CB   1 
ATOM   1982 C  CG   . ARG A 1 279 ? 9.076   43.709 -0.078  1.00 24.72 ? 278 ARG A CG   1 
ATOM   1983 C  CD   . ARG A 1 279 ? 8.171   42.445 -0.078  1.00 30.72 ? 278 ARG A CD   1 
ATOM   1984 N  NE   . ARG A 1 279 ? 8.750   41.511 -1.043  1.00 29.67 ? 278 ARG A NE   1 
ATOM   1985 C  CZ   . ARG A 1 279 ? 8.712   40.185 -0.971  1.00 24.03 ? 278 ARG A CZ   1 
ATOM   1986 N  NH1  . ARG A 1 279 ? 8.034   39.561 -0.022  1.00 25.52 ? 278 ARG A NH1  1 
ATOM   1987 N  NH2  . ARG A 1 279 ? 9.374   39.480 -1.878  1.00 26.24 ? 278 ARG A NH2  1 
ATOM   1988 N  N    . PRO A 1 280 ? 8.910   47.536 2.311   1.00 27.61 ? 279 PRO A N    1 
ATOM   1989 C  CA   . PRO A 1 280 ? 8.562   48.383 3.437   1.00 28.30 ? 279 PRO A CA   1 
ATOM   1990 C  C    . PRO A 1 280 ? 7.774   47.664 4.554   1.00 24.87 ? 279 PRO A C    1 
ATOM   1991 O  O    . PRO A 1 280 ? 7.057   46.686 4.328   1.00 29.99 ? 279 PRO A O    1 
ATOM   1992 C  CB   . PRO A 1 280 ? 7.687   49.491 2.782   1.00 25.93 ? 279 PRO A CB   1 
ATOM   1993 C  CG   . PRO A 1 280 ? 7.063   48.843 1.614   1.00 24.74 ? 279 PRO A CG   1 
ATOM   1994 C  CD   . PRO A 1 280 ? 8.049   47.789 1.130   1.00 26.32 ? 279 PRO A CD   1 
ATOM   1995 N  N    . THR A 1 281 ? 7.876   48.187 5.759   1.00 27.81 ? 280 THR A N    1 
ATOM   1996 C  CA   . THR A 1 281 ? 6.913   47.849 6.820   1.00 31.34 ? 280 THR A CA   1 
ATOM   1997 C  C    . THR A 1 281 ? 5.571   48.608 6.569   1.00 31.99 ? 280 THR A C    1 
ATOM   1998 O  O    . THR A 1 281 ? 5.526   49.524 5.735   1.00 26.65 ? 280 THR A O    1 
ATOM   1999 C  CB   . THR A 1 281 ? 7.457   48.263 8.174   1.00 30.03 ? 280 THR A CB   1 
ATOM   2000 O  OG1  . THR A 1 281 ? 7.535   49.699 8.229   1.00 26.52 ? 280 THR A OG1  1 
ATOM   2001 C  CG2  . THR A 1 281 ? 8.848   47.612 8.462   1.00 27.43 ? 280 THR A CG2  1 
ATOM   2002 N  N    . PHE A 1 282 ? 4.508   48.251 7.297   1.00 30.25 ? 281 PHE A N    1 
ATOM   2003 C  CA   . PHE A 1 282 ? 3.213   48.963 7.225   1.00 28.95 ? 281 PHE A CA   1 
ATOM   2004 C  C    . PHE A 1 282 ? 3.382   50.423 7.569   1.00 29.98 ? 281 PHE A C    1 
ATOM   2005 O  O    . PHE A 1 282 ? 2.778   51.286 6.933   1.00 28.51 ? 281 PHE A O    1 
ATOM   2006 C  CB   . PHE A 1 282 ? 2.166   48.358 8.169   1.00 30.85 ? 281 PHE A CB   1 
ATOM   2007 C  CG   . PHE A 1 282 ? 1.739   46.939 7.820   1.00 31.73 ? 281 PHE A CG   1 
ATOM   2008 C  CD1  . PHE A 1 282 ? 1.715   46.477 6.512   1.00 39.42 ? 281 PHE A CD1  1 
ATOM   2009 C  CD2  . PHE A 1 282 ? 1.297   46.080 8.827   1.00 48.14 ? 281 PHE A CD2  1 
ATOM   2010 C  CE1  . PHE A 1 282 ? 1.295   45.152 6.210   1.00 34.98 ? 281 PHE A CE1  1 
ATOM   2011 C  CE2  . PHE A 1 282 ? 0.860   44.789 8.531   1.00 43.13 ? 281 PHE A CE2  1 
ATOM   2012 C  CZ   . PHE A 1 282 ? 0.873   44.324 7.217   1.00 47.24 ? 281 PHE A CZ   1 
ATOM   2013 N  N    . GLU A 1 283 ? 4.230   50.707 8.562   1.00 23.09 ? 282 GLU A N    1 
ATOM   2014 C  CA   . GLU A 1 283 ? 4.527   52.080 8.948   1.00 25.18 ? 282 GLU A CA   1 
ATOM   2015 C  C    . GLU A 1 283 ? 5.176   52.866 7.811   1.00 22.20 ? 282 GLU A C    1 
ATOM   2016 O  O    . GLU A 1 283 ? 4.781   54.004 7.518   1.00 26.71 ? 282 GLU A O    1 
ATOM   2017 C  CB   . GLU A 1 283 ? 5.446   52.098 10.164  1.00 23.72 ? 282 GLU A CB   1 
ATOM   2018 C  CG   . GLU A 1 283 ? 5.810   53.510 10.609  1.00 23.59 ? 282 GLU A CG   1 
ATOM   2019 C  CD   . GLU A 1 283 ? 6.603   53.513 11.914  1.00 39.04 ? 282 GLU A CD   1 
ATOM   2020 O  OE1  . GLU A 1 283 ? 7.002   52.424 12.379  1.00 45.11 ? 282 GLU A OE1  1 
ATOM   2021 O  OE2  . GLU A 1 283 ? 6.818   54.603 12.456  1.00 38.95 ? 282 GLU A OE2  1 
ATOM   2022 N  N    . GLU A 1 284 ? 6.163   52.252 7.166   1.00 24.31 ? 283 GLU A N    1 
ATOM   2023 C  CA   . GLU A 1 284 ? 6.858   52.870 6.020   1.00 25.91 ? 283 GLU A CA   1 
ATOM   2024 C  C    . GLU A 1 284 ? 5.914   53.104 4.820   1.00 24.59 ? 283 GLU A C    1 
ATOM   2025 O  O    . GLU A 1 284 ? 5.976   54.168 4.176   1.00 24.43 ? 283 GLU A O    1 
ATOM   2026 C  CB   . GLU A 1 284 ? 8.063   52.043 5.601   1.00 25.93 ? 283 GLU A CB   1 
ATOM   2027 C  CG   . GLU A 1 284 ? 9.245   52.156 6.546   1.00 28.37 ? 283 GLU A CG   1 
ATOM   2028 C  CD   . GLU A 1 284 ? 10.351  51.204 6.176   1.00 30.43 ? 283 GLU A CD   1 
ATOM   2029 O  OE1  . GLU A 1 284 ? 10.052  50.042 5.850   1.00 24.96 ? 283 GLU A OE1  1 
ATOM   2030 O  OE2  . GLU A 1 284 ? 11.520  51.615 6.211   1.00 33.40 ? 283 GLU A OE2  1 
ATOM   2031 N  N    . ILE A 1 285 ? 5.015   52.158 4.576   1.00 24.52 ? 284 ILE A N    1 
ATOM   2032 C  CA   . ILE A 1 285 ? 3.950   52.341 3.564   1.00 25.33 ? 284 ILE A CA   1 
ATOM   2033 C  C    . ILE A 1 285 ? 3.086   53.575 3.904   1.00 26.87 ? 284 ILE A C    1 
ATOM   2034 O  O    . ILE A 1 285 ? 2.911   54.468 3.084   1.00 23.28 ? 284 ILE A O    1 
ATOM   2035 C  CB   . ILE A 1 285 ? 3.064   51.074 3.373   1.00 25.77 ? 284 ILE A CB   1 
ATOM   2036 C  CG1  . ILE A 1 285 ? 3.882   49.914 2.777   1.00 24.46 ? 284 ILE A CG1  1 
ATOM   2037 C  CG2  . ILE A 1 285 ? 1.809   51.408 2.497   1.00 23.89 ? 284 ILE A CG2  1 
ATOM   2038 C  CD1  . ILE A 1 285 ? 3.163   48.522 2.730   1.00 22.38 ? 284 ILE A CD1  1 
ATOM   2039 N  N    . GLN A 1 286 ? 2.541   53.618 5.115   1.00 25.06 ? 285 GLN A N    1 
ATOM   2040 C  CA   . GLN A 1 286 ? 1.644   54.714 5.472   1.00 27.89 ? 285 GLN A CA   1 
ATOM   2041 C  C    . GLN A 1 286 ? 2.319   56.092 5.626   1.00 27.05 ? 285 GLN A C    1 
ATOM   2042 O  O    . GLN A 1 286 ? 1.633   57.103 5.544   1.00 28.27 ? 285 GLN A O    1 
ATOM   2043 C  CB   . GLN A 1 286 ? 0.824   54.352 6.706   1.00 26.19 ? 285 GLN A CB   1 
ATOM   2044 C  CG   . GLN A 1 286 ? -0.173  53.224 6.460   1.00 27.86 ? 285 GLN A CG   1 
ATOM   2045 C  CD   . GLN A 1 286 ? -1.118  53.029 7.627   1.00 25.93 ? 285 GLN A CD   1 
ATOM   2046 O  OE1  . GLN A 1 286 ? -0.694  52.650 8.714   1.00 27.01 ? 285 GLN A OE1  1 
ATOM   2047 N  NE2  . GLN A 1 286 ? -2.401  53.273 7.398   1.00 26.71 ? 285 GLN A NE2  1 
ATOM   2048 N  N    . ASN A 1 287 ? 3.643   56.096 5.831   1.00 24.47 ? 286 ASN A N    1 
ATOM   2049 C  CA   . ASN A 1 287 ? 4.464   57.297 5.873   1.00 24.49 ? 286 ASN A CA   1 
ATOM   2050 C  C    . ASN A 1 287 ? 5.020   57.691 4.505   1.00 25.84 ? 286 ASN A C    1 
ATOM   2051 O  O    . ASN A 1 287 ? 5.617   58.740 4.393   1.00 25.47 ? 286 ASN A O    1 
ATOM   2052 C  CB   . ASN A 1 287 ? 5.599   57.177 6.915   1.00 23.99 ? 286 ASN A CB   1 
ATOM   2053 C  CG   . ASN A 1 287 ? 5.100   57.283 8.358   1.00 29.84 ? 286 ASN A CG   1 
ATOM   2054 O  OD1  . ASN A 1 287 ? 4.117   57.950 8.630   1.00 32.63 ? 286 ASN A OD1  1 
ATOM   2055 N  ND2  . ASN A 1 287 ? 5.824   56.649 9.292   1.00 28.61 ? 286 ASN A ND2  1 
ATOM   2056 N  N    . HIS A 1 288 ? 4.780   56.876 3.472   1.00 26.35 ? 287 HIS A N    1 
ATOM   2057 C  CA   . HIS A 1 288 ? 5.260   57.174 2.125   1.00 28.19 ? 287 HIS A CA   1 
ATOM   2058 C  C    . HIS A 1 288 ? 4.624   58.468 1.602   1.00 24.25 ? 287 HIS A C    1 
ATOM   2059 O  O    . HIS A 1 288 ? 3.463   58.731 1.874   1.00 23.33 ? 287 HIS A O    1 
ATOM   2060 C  CB   . HIS A 1 288 ? 4.947   56.002 1.162   1.00 26.73 ? 287 HIS A CB   1 
ATOM   2061 C  CG   . HIS A 1 288 ? 5.696   56.073 -0.138  1.00 26.00 ? 287 HIS A CG   1 
ATOM   2062 N  ND1  . HIS A 1 288 ? 5.236   56.778 -1.238  1.00 25.46 ? 287 HIS A ND1  1 
ATOM   2063 C  CD2  . HIS A 1 288 ? 6.865   55.511 -0.517  1.00 26.97 ? 287 HIS A CD2  1 
ATOM   2064 C  CE1  . HIS A 1 288 ? 6.097   56.653 -2.230  1.00 30.99 ? 287 HIS A CE1  1 
ATOM   2065 N  NE2  . HIS A 1 288 ? 7.104   55.901 -1.817  1.00 28.96 ? 287 HIS A NE2  1 
ATOM   2066 N  N    . PRO A 1 289 ? 5.393   59.295 0.875   1.00 28.09 ? 288 PRO A N    1 
ATOM   2067 C  CA   . PRO A 1 289 ? 4.787   60.531 0.420   1.00 30.34 ? 288 PRO A CA   1 
ATOM   2068 C  C    . PRO A 1 289 ? 3.532   60.356 -0.450  1.00 26.08 ? 288 PRO A C    1 
ATOM   2069 O  O    . PRO A 1 289 ? 2.652   61.201 -0.367  1.00 28.60 ? 288 PRO A O    1 
ATOM   2070 C  CB   . PRO A 1 289 ? 5.931   61.257 -0.304  1.00 31.96 ? 288 PRO A CB   1 
ATOM   2071 C  CG   . PRO A 1 289 ? 6.959   60.287 -0.479  1.00 34.52 ? 288 PRO A CG   1 
ATOM   2072 C  CD   . PRO A 1 289 ? 6.835   59.288 0.623   1.00 29.49 ? 288 PRO A CD   1 
ATOM   2073 N  N    . TRP A 1 290 ? 3.421   59.272 -1.228  1.00 25.47 ? 289 TRP A N    1 
ATOM   2074 C  CA   . TRP A 1 290 ? 2.191   59.016 -1.989  1.00 25.70 ? 289 TRP A CA   1 
ATOM   2075 C  C    . TRP A 1 290 ? 0.950   58.844 -1.092  1.00 26.18 ? 289 TRP A C    1 
ATOM   2076 O  O    . TRP A 1 290 ? -0.158  59.150 -1.507  1.00 26.44 ? 289 TRP A O    1 
ATOM   2077 C  CB   . TRP A 1 290 ? 2.333   57.839 -2.974  1.00 27.28 ? 289 TRP A CB   1 
ATOM   2078 C  CG   . TRP A 1 290 ? 1.115   57.709 -3.871  1.00 24.40 ? 289 TRP A CG   1 
ATOM   2079 C  CD1  . TRP A 1 290 ? 0.792   58.506 -4.940  1.00 26.13 ? 289 TRP A CD1  1 
ATOM   2080 C  CD2  . TRP A 1 290 ? 0.028   56.779 -3.716  1.00 29.08 ? 289 TRP A CD2  1 
ATOM   2081 N  NE1  . TRP A 1 290 ? -0.400  58.098 -5.477  1.00 25.34 ? 289 TRP A NE1  1 
ATOM   2082 C  CE2  . TRP A 1 290 ? -0.891  57.040 -4.752  1.00 26.94 ? 289 TRP A CE2  1 
ATOM   2083 C  CE3  . TRP A 1 290 ? -0.231  55.716 -2.831  1.00 24.97 ? 289 TRP A CE3  1 
ATOM   2084 C  CZ2  . TRP A 1 290 ? -2.071  56.299 -4.918  1.00 31.49 ? 289 TRP A CZ2  1 
ATOM   2085 C  CZ3  . TRP A 1 290 ? -1.416  54.983 -2.993  1.00 25.10 ? 289 TRP A CZ3  1 
ATOM   2086 C  CH2  . TRP A 1 290 ? -2.312  55.279 -4.046  1.00 30.32 ? 289 TRP A CH2  1 
ATOM   2087 N  N    . MET A 1 291 ? 1.148   58.400 0.146   1.00 24.39 ? 290 MET A N    1 
ATOM   2088 C  CA   . MET A 1 291 ? 0.052   58.101 1.050   1.00 25.33 ? 290 MET A CA   1 
ATOM   2089 C  C    . MET A 1 291 ? -0.486  59.291 1.856   1.00 25.10 ? 290 MET A C    1 
ATOM   2090 O  O    . MET A 1 291 ? -1.432  59.131 2.635   1.00 29.85 ? 290 MET A O    1 
ATOM   2091 C  CB   . MET A 1 291 ? 0.453   56.949 1.997   1.00 21.21 ? 290 MET A CB   1 
ATOM   2092 C  CG   . MET A 1 291 ? 0.587   55.597 1.313   1.00 30.69 ? 290 MET A CG   1 
ATOM   2093 S  SD   . MET A 1 291 ? -1.028  54.832 1.038   1.00 35.05 ? 290 MET A SD   1 
ATOM   2094 C  CE   . MET A 1 291 ? -1.045  53.733 2.358   1.00 36.10 ? 290 MET A CE   1 
ATOM   2095 N  N    . GLN A 1 292 ? 0.071   60.484 1.651   1.00 28.42 ? 291 GLN A N    1 
ATOM   2096 C  CA   . GLN A 1 292 ? -0.306  61.651 2.444   1.00 27.32 ? 291 GLN A CA   1 
ATOM   2097 C  C    . GLN A 1 292 ? -1.660  62.236 1.961   1.00 29.04 ? 291 GLN A C    1 
ATOM   2098 O  O    . GLN A 1 292 ? -2.075  62.047 0.784   1.00 26.48 ? 291 GLN A O    1 
ATOM   2099 C  CB   . GLN A 1 292 ? 0.827   62.709 2.459   1.00 32.67 ? 291 GLN A CB   1 
ATOM   2100 C  CG   A GLN A 1 292 ? 2.155   61.998 3.027   0.50 32.92 ? 291 GLN A CG   1 
ATOM   2101 C  CG   B GLN A 1 292 ? 2.302   62.304 2.673   0.50 34.20 ? 291 GLN A CG   1 
ATOM   2102 C  CD   A GLN A 1 292 ? 1.912   61.024 4.270   0.50 32.09 ? 291 GLN A CD   1 
ATOM   2103 C  CD   B GLN A 1 292 ? 3.327   63.323 2.057   0.50 42.06 ? 291 GLN A CD   1 
ATOM   2104 O  OE1  A GLN A 1 292 ? 1.602   61.489 5.366   0.50 38.32 ? 291 GLN A OE1  1 
ATOM   2105 O  OE1  B GLN A 1 292 ? 4.327   63.653 2.699   0.50 41.36 ? 291 GLN A OE1  1 
ATOM   2106 N  NE2  A GLN A 1 292 ? 2.058   59.688 4.075   0.50 15.16 ? 291 GLN A NE2  1 
ATOM   2107 N  NE2  B GLN A 1 292 ? 3.088   63.785 0.808   0.50 25.61 ? 291 GLN A NE2  1 
ATOM   2108 N  N    . ASP A 1 293 ? -2.365  62.866 2.907   1.00 29.69 ? 292 ASP A N    1 
ATOM   2109 C  CA   . ASP A 1 293 ? -3.619  63.616 2.673   1.00 30.88 ? 292 ASP A CA   1 
ATOM   2110 C  C    . ASP A 1 293 ? -4.751  62.758 2.115   1.00 28.44 ? 292 ASP A C    1 
ATOM   2111 O  O    . ASP A 1 293 ? -5.423  63.142 1.150   1.00 27.37 ? 292 ASP A O    1 
ATOM   2112 C  CB   . ASP A 1 293 ? -3.372  64.822 1.758   1.00 33.90 ? 292 ASP A CB   1 
ATOM   2113 C  CG   . ASP A 1 293 ? -2.285  65.756 2.296   1.00 43.55 ? 292 ASP A CG   1 
ATOM   2114 O  OD1  . ASP A 1 293 ? -2.443  66.273 3.423   1.00 50.94 ? 292 ASP A OD1  1 
ATOM   2115 O  OD2  . ASP A 1 293 ? -1.271  65.963 1.591   1.00 47.35 ? 292 ASP A OD2  1 
ATOM   2116 N  N    . VAL A 1 294 ? -4.947  61.599 2.736   1.00 28.68 ? 293 VAL A N    1 
ATOM   2117 C  CA   . VAL A 1 294 ? -5.987  60.658 2.356   1.00 27.19 ? 293 VAL A CA   1 
ATOM   2118 C  C    . VAL A 1 294 ? -7.363  61.288 2.604   1.00 26.66 ? 293 VAL A C    1 
ATOM   2119 O  O    . VAL A 1 294 ? -7.557  62.065 3.542   1.00 22.51 ? 293 VAL A O    1 
ATOM   2120 C  CB   . VAL A 1 294 ? -5.825  59.288 3.120   1.00 26.56 ? 293 VAL A CB   1 
ATOM   2121 C  CG1  . VAL A 1 294 ? -6.133  59.475 4.606   1.00 25.19 ? 293 VAL A CG1  1 
ATOM   2122 C  CG2  . VAL A 1 294 ? -6.702  58.229 2.530   1.00 25.14 ? 293 VAL A CG2  1 
ATOM   2123 N  N    . LEU A 1 295 ? -8.289  60.989 1.706   1.00 25.87 ? 294 LEU A N    1 
ATOM   2124 C  CA   . LEU A 1 295 ? -9.688  61.315 1.898   1.00 27.36 ? 294 LEU A CA   1 
ATOM   2125 C  C    . LEU A 1 295 ? -10.266 60.465 3.042   1.00 22.08 ? 294 LEU A C    1 
ATOM   2126 O  O    . LEU A 1 295 ? -9.866  59.314 3.271   1.00 25.87 ? 294 LEU A O    1 
ATOM   2127 C  CB   . LEU A 1 295 ? -10.501 61.040 0.616   1.00 26.28 ? 294 LEU A CB   1 
ATOM   2128 C  CG   . LEU A 1 295 ? -10.245 61.895 -0.630  1.00 28.67 ? 294 LEU A CG   1 
ATOM   2129 C  CD1  . LEU A 1 295 ? -11.106 61.360 -1.774  1.00 24.67 ? 294 LEU A CD1  1 
ATOM   2130 C  CD2  . LEU A 1 295 ? -10.548 63.395 -0.359  1.00 24.91 ? 294 LEU A CD2  1 
ATOM   2131 N  N    . LEU A 1 296 ? -11.213 61.062 3.742   1.00 24.23 ? 295 LEU A N    1 
ATOM   2132 C  CA   . LEU A 1 296 ? -12.073 60.364 4.667   1.00 22.84 ? 295 LEU A CA   1 
ATOM   2133 C  C    . LEU A 1 296 ? -12.987 59.434 3.879   1.00 24.45 ? 295 LEU A C    1 
ATOM   2134 O  O    . LEU A 1 296 ? -13.258 59.688 2.713   1.00 22.07 ? 295 LEU A O    1 
ATOM   2135 C  CB   . LEU A 1 296 ? -12.887 61.366 5.499   1.00 26.51 ? 295 LEU A CB   1 
ATOM   2136 C  CG   . LEU A 1 296 ? -12.137 62.494 6.230   1.00 26.71 ? 295 LEU A CG   1 
ATOM   2137 C  CD1  . LEU A 1 296 ? -13.134 63.295 7.081   1.00 25.76 ? 295 LEU A CD1  1 
ATOM   2138 C  CD2  . LEU A 1 296 ? -10.918 62.021 7.043   1.00 28.77 ? 295 LEU A CD2  1 
ATOM   2139 N  N    . PRO A 1 297 ? -13.456 58.338 4.498   1.00 25.88 ? 296 PRO A N    1 
ATOM   2140 C  CA   . PRO A 1 297 ? -14.420 57.459 3.787   1.00 28.24 ? 296 PRO A CA   1 
ATOM   2141 C  C    . PRO A 1 297 ? -15.664 58.171 3.247   1.00 29.49 ? 296 PRO A C    1 
ATOM   2142 O  O    . PRO A 1 297 ? -16.066 57.936 2.111   1.00 24.98 ? 296 PRO A O    1 
ATOM   2143 C  CB   . PRO A 1 297 ? -14.806 56.429 4.849   1.00 29.26 ? 296 PRO A CB   1 
ATOM   2144 C  CG   . PRO A 1 297 ? -13.616 56.381 5.750   1.00 27.77 ? 296 PRO A CG   1 
ATOM   2145 C  CD   . PRO A 1 297 ? -13.068 57.780 5.798   1.00 30.32 ? 296 PRO A CD   1 
ATOM   2146 N  N    . GLN A 1 298 ? -16.272 59.022 4.069   1.00 29.51 ? 297 GLN A N    1 
ATOM   2147 C  CA   . GLN A 1 298 ? -17.424 59.808 3.660   1.00 34.50 ? 297 GLN A CA   1 
ATOM   2148 C  C    . GLN A 1 298 ? -17.146 60.741 2.454   1.00 31.60 ? 297 GLN A C    1 
ATOM   2149 O  O    . GLN A 1 298 ? -17.969 60.843 1.546   1.00 29.77 ? 297 GLN A O    1 
ATOM   2150 C  CB   . GLN A 1 298 ? -17.963 60.606 4.862   1.00 35.62 ? 297 GLN A CB   1 
ATOM   2151 C  CG   . GLN A 1 298 ? -16.889 61.419 5.646   1.00 48.49 ? 297 GLN A CG   1 
ATOM   2152 C  CD   . GLN A 1 298 ? -16.303 60.694 6.868   1.00 46.48 ? 297 GLN A CD   1 
ATOM   2153 O  OE1  . GLN A 1 298 ? -15.738 59.592 6.777   1.00 33.01 ? 297 GLN A OE1  1 
ATOM   2154 N  NE2  . GLN A 1 298 ? -16.430 61.326 8.015   1.00 50.61 ? 297 GLN A NE2  1 
ATOM   2155 N  N    . GLU A 1 299 ? -15.984 61.392 2.435   1.00 30.03 ? 298 GLU A N    1 
ATOM   2156 C  CA   . GLU A 1 299 ? -15.562 62.217 1.292   1.00 28.42 ? 298 GLU A CA   1 
ATOM   2157 C  C    . GLU A 1 299 ? -15.386 61.360 0.030   1.00 28.13 ? 298 GLU A C    1 
ATOM   2158 O  O    . GLU A 1 299 ? -15.701 61.799 -1.094  1.00 30.98 ? 298 GLU A O    1 
ATOM   2159 C  CB   . GLU A 1 299 ? -14.232 62.945 1.573   1.00 26.53 ? 298 GLU A CB   1 
ATOM   2160 C  CG   . GLU A 1 299 ? -14.215 63.875 2.774   1.00 30.99 ? 298 GLU A CG   1 
ATOM   2161 C  CD   . GLU A 1 299 ? -12.811 64.420 3.097   1.00 31.36 ? 298 GLU A CD   1 
ATOM   2162 O  OE1  . GLU A 1 299 ? -11.802 63.754 2.789   1.00 26.80 ? 298 GLU A OE1  1 
ATOM   2163 O  OE2  . GLU A 1 299 ? -12.719 65.517 3.705   1.00 36.10 ? 298 GLU A OE2  1 
ATOM   2164 N  N    . THR A 1 300 ? -14.849 60.160 0.230   1.00 25.75 ? 299 THR A N    1 
ATOM   2165 C  CA   . THR A 1 300 ? -14.594 59.196 -0.849  1.00 28.53 ? 299 THR A CA   1 
ATOM   2166 C  C    . THR A 1 300 ? -15.917 58.806 -1.489  1.00 28.35 ? 299 THR A C    1 
ATOM   2167 O  O    . THR A 1 300 ? -16.028 58.779 -2.704  1.00 27.60 ? 299 THR A O    1 
ATOM   2168 C  CB   . THR A 1 300 ? -13.830 57.935 -0.329  1.00 28.21 ? 299 THR A CB   1 
ATOM   2169 O  OG1  . THR A 1 300 ? -12.592 58.342 0.249   1.00 30.76 ? 299 THR A OG1  1 
ATOM   2170 C  CG2  . THR A 1 300 ? -13.535 56.896 -1.465  1.00 26.17 ? 299 THR A CG2  1 
ATOM   2171 N  N    . ALA A 1 301 ? -16.911 58.509 -0.657  1.00 27.14 ? 300 ALA A N    1 
ATOM   2172 C  CA   . ALA A 1 301 ? -18.243 58.162 -1.150  1.00 29.90 ? 300 ALA A CA   1 
ATOM   2173 C  C    . ALA A 1 301 ? -18.854 59.319 -1.944  1.00 30.44 ? 300 ALA A C    1 
ATOM   2174 O  O    . ALA A 1 301 ? -19.350 59.112 -3.041  1.00 26.65 ? 300 ALA A O    1 
ATOM   2175 C  CB   . ALA A 1 301 ? -19.171 57.719 0.002   1.00 27.53 ? 300 ALA A CB   1 
ATOM   2176 N  N    . GLU A 1 302 ? -18.765 60.539 -1.415  1.00 32.34 ? 301 GLU A N    1 
ATOM   2177 C  CA   . GLU A 1 302 ? -19.355 61.705 -2.070  1.00 35.84 ? 301 GLU A CA   1 
ATOM   2178 C  C    . GLU A 1 302 ? -18.692 62.022 -3.406  1.00 36.44 ? 301 GLU A C    1 
ATOM   2179 O  O    . GLU A 1 302 ? -19.378 62.273 -4.404  1.00 29.49 ? 301 GLU A O    1 
ATOM   2180 C  CB   . GLU A 1 302 ? -19.293 62.937 -1.157  1.00 35.76 ? 301 GLU A CB   1 
ATOM   2181 C  CG   . GLU A 1 302 ? -20.236 62.837 0.031   1.00 54.42 ? 301 GLU A CG   1 
ATOM   2182 C  CD   . GLU A 1 302 ? -19.970 63.873 1.124   1.00 67.69 ? 301 GLU A CD   1 
ATOM   2183 O  OE1  . GLU A 1 302 ? -19.018 64.688 1.006   1.00 73.24 ? 301 GLU A OE1  1 
ATOM   2184 O  OE2  . GLU A 1 302 ? -20.731 63.856 2.115   1.00 66.06 ? 301 GLU A OE2  1 
ATOM   2185 N  N    . ILE A 1 303 ? -17.362 62.022 -3.422  1.00 32.75 ? 302 ILE A N    1 
ATOM   2186 C  CA   . ILE A 1 303 ? -16.621 62.392 -4.622  1.00 33.68 ? 302 ILE A CA   1 
ATOM   2187 C  C    . ILE A 1 303 ? -16.642 61.280 -5.682  1.00 34.69 ? 302 ILE A C    1 
ATOM   2188 O  O    . ILE A 1 303 ? -16.783 61.568 -6.874  1.00 31.53 ? 302 ILE A O    1 
ATOM   2189 C  CB   . ILE A 1 303 ? -15.157 62.770 -4.284  1.00 35.14 ? 302 ILE A CB   1 
ATOM   2190 C  CG1  . ILE A 1 303 ? -15.123 64.036 -3.414  1.00 36.40 ? 302 ILE A CG1  1 
ATOM   2191 C  CG2  . ILE A 1 303 ? -14.335 62.969 -5.565  1.00 26.79 ? 302 ILE A CG2  1 
ATOM   2192 C  CD1  . ILE A 1 303 ? -13.802 64.225 -2.642  1.00 37.36 ? 302 ILE A CD1  1 
ATOM   2193 N  N    . HIS A 1 304 ? -16.514 60.025 -5.255  1.00 30.91 ? 303 HIS A N    1 
ATOM   2194 C  CA   . HIS A 1 304 ? -16.256 58.908 -6.200  1.00 30.84 ? 303 HIS A CA   1 
ATOM   2195 C  C    . HIS A 1 304 ? -17.321 57.812 -6.331  1.00 32.76 ? 303 HIS A C    1 
ATOM   2196 O  O    . HIS A 1 304 ? -17.267 57.035 -7.297  1.00 33.17 ? 303 HIS A O    1 
ATOM   2197 C  CB   . HIS A 1 304 ? -14.941 58.215 -5.815  1.00 28.65 ? 303 HIS A CB   1 
ATOM   2198 C  CG   . HIS A 1 304 ? -13.737 59.100 -5.948  1.00 30.64 ? 303 HIS A CG   1 
ATOM   2199 N  ND1  . HIS A 1 304 ? -13.139 59.365 -7.164  1.00 31.56 ? 303 HIS A ND1  1 
ATOM   2200 C  CD2  . HIS A 1 304 ? -13.038 59.798 -5.023  1.00 34.33 ? 303 HIS A CD2  1 
ATOM   2201 C  CE1  . HIS A 1 304 ? -12.112 60.173 -6.976  1.00 30.49 ? 303 HIS A CE1  1 
ATOM   2202 N  NE2  . HIS A 1 304 ? -12.029 60.452 -5.686  1.00 28.23 ? 303 HIS A NE2  1 
ATOM   2203 N  N    . LEU A 1 305 ? -18.219 57.680 -5.352  1.00 33.59 ? 304 LEU A N    1 
ATOM   2204 C  CA   . LEU A 1 305 ? -19.158 56.549 -5.318  1.00 37.86 ? 304 LEU A CA   1 
ATOM   2205 C  C    . LEU A 1 305 ? -20.635 56.935 -5.505  1.00 44.82 ? 304 LEU A C    1 
ATOM   2206 O  O    . LEU A 1 305 ? -21.405 56.140 -6.050  1.00 47.93 ? 304 LEU A O    1 
ATOM   2207 C  CB   . LEU A 1 305 ? -18.991 55.740 -4.017  1.00 37.66 ? 304 LEU A CB   1 
ATOM   2208 C  CG   . LEU A 1 305 ? -17.575 55.273 -3.673  1.00 34.44 ? 304 LEU A CG   1 
ATOM   2209 C  CD1  . LEU A 1 305 ? -17.502 54.508 -2.293  1.00 25.51 ? 304 LEU A CD1  1 
ATOM   2210 C  CD2  . LEU A 1 305 ? -17.006 54.427 -4.804  1.00 29.78 ? 304 LEU A CD2  1 
ATOM   2211 N  N    . HIS A 1 306 ? -21.025 58.128 -5.052  1.00 47.68 ? 305 HIS A N    1 
ATOM   2212 C  CA   . HIS A 1 306 ? -22.431 58.556 -5.065  1.00 53.82 ? 305 HIS A CA   1 
ATOM   2213 C  C    . HIS A 1 306 ? -22.829 59.153 -6.415  1.00 56.27 ? 305 HIS A C    1 
ATOM   2214 O  O    . HIS A 1 306 ? -22.370 58.703 -7.466  1.00 61.09 ? 305 HIS A O    1 
ATOM   2215 C  CB   . HIS A 1 306 ? -22.711 59.589 -3.965  1.00 54.01 ? 305 HIS A CB   1 
ATOM   2216 C  CG   . HIS A 1 306 ? -22.666 59.035 -2.571  1.00 58.25 ? 305 HIS A CG   1 
ATOM   2217 N  ND1  . HIS A 1 306 ? -22.610 59.846 -1.455  1.00 46.30 ? 305 HIS A ND1  1 
ATOM   2218 C  CD2  . HIS A 1 306 ? -22.658 57.760 -2.110  1.00 60.84 ? 305 HIS A CD2  1 
ATOM   2219 C  CE1  . HIS A 1 306 ? -22.583 59.095 -0.368  1.00 54.05 ? 305 HIS A CE1  1 
ATOM   2220 N  NE2  . HIS A 1 306 ? -22.609 57.826 -0.737  1.00 63.77 ? 305 HIS A NE2  1 
ATOM   2221 N  N    . ARG B 2 2   ? -7.195  43.254 -23.552 1.00 63.41 ? 2   ARG B N    1 
ATOM   2222 C  CA   . ARG B 2 2   ? -6.470  42.291 -22.661 1.00 60.33 ? 2   ARG B CA   1 
ATOM   2223 C  C    . ARG B 2 2   ? -7.403  41.768 -21.566 1.00 59.58 ? 2   ARG B C    1 
ATOM   2224 O  O    . ARG B 2 2   ? -8.063  42.565 -20.869 1.00 59.22 ? 2   ARG B O    1 
ATOM   2225 C  CB   . ARG B 2 2   ? -5.244  42.951 -22.025 1.00 60.08 ? 2   ARG B CB   1 
ATOM   2226 C  CG   . ARG B 2 2   ? -4.434  42.013 -21.117 1.00 53.07 ? 2   ARG B CG   1 
ATOM   2227 C  CD   . ARG B 2 2   ? -3.254  42.736 -20.463 1.00 44.66 ? 2   ARG B CD   1 
ATOM   2228 N  NE   . ARG B 2 2   ? -2.415  43.428 -21.442 1.00 38.67 ? 2   ARG B NE   1 
ATOM   2229 C  CZ   . ARG B 2 2   ? -2.391  44.741 -21.658 1.00 43.34 ? 2   ARG B CZ   1 
ATOM   2230 N  NH1  . ARG B 2 2   ? -3.156  45.578 -20.950 1.00 44.07 ? 2   ARG B NH1  1 
ATOM   2231 N  NH2  . ARG B 2 2   ? -1.596  45.221 -22.618 1.00 33.61 ? 2   ARG B NH2  1 
ATOM   2232 N  N    . LYS B 2 3   ? -7.422  40.441 -21.392 1.00 55.58 ? 3   LYS B N    1 
ATOM   2233 C  CA   . LYS B 2 3   ? -8.417  39.789 -20.531 1.00 52.72 ? 3   LYS B CA   1 
ATOM   2234 C  C    . LYS B 2 3   ? -8.042  39.901 -19.043 1.00 45.79 ? 3   LYS B C    1 
ATOM   2235 O  O    . LYS B 2 3   ? -6.974  39.492 -18.613 1.00 49.42 ? 3   LYS B O    1 
ATOM   2236 C  CB   . LYS B 2 3   ? -8.635  38.324 -20.932 1.00 50.42 ? 3   LYS B CB   1 
ATOM   2237 C  CG   . LYS B 2 3   ? -9.838  37.646 -20.264 1.00 53.70 ? 3   LYS B CG   1 
ATOM   2238 N  N    . ARG B 2 4   ? -8.950  40.476 -18.278 1.00 39.53 ? 4   ARG B N    1 
ATOM   2239 C  CA   . ARG B 2 4   ? -8.854  40.532 -16.836 1.00 34.69 ? 4   ARG B CA   1 
ATOM   2240 C  C    . ARG B 2 4   ? -9.694  39.389 -16.330 1.00 34.86 ? 4   ARG B C    1 
ATOM   2241 O  O    . ARG B 2 4   ? -10.808 39.177 -16.823 1.00 36.51 ? 4   ARG B O    1 
ATOM   2242 C  CB   . ARG B 2 4   ? -9.411  41.847 -16.341 1.00 33.61 ? 4   ARG B CB   1 
ATOM   2243 C  CG   . ARG B 2 4   ? -9.495  41.982 -14.862 1.00 27.19 ? 4   ARG B CG   1 
ATOM   2244 C  CD   . ARG B 2 4   ? -9.904  43.381 -14.536 1.00 27.76 ? 4   ARG B CD   1 
ATOM   2245 N  NE   . ARG B 2 4   ? -10.499 43.545 -13.218 1.00 26.85 ? 4   ARG B NE   1 
ATOM   2246 C  CZ   . ARG B 2 4   ? -9.804  43.580 -12.076 1.00 34.76 ? 4   ARG B CZ   1 
ATOM   2247 N  NH1  . ARG B 2 4   ? -10.424 43.766 -10.922 1.00 27.77 ? 4   ARG B NH1  1 
ATOM   2248 N  NH2  . ARG B 2 4   ? -8.491  43.444 -12.077 1.00 26.17 ? 4   ARG B NH2  1 
ATOM   2249 N  N    . ARG B 2 5   ? -9.164  38.644 -15.361 1.00 34.18 ? 5   ARG B N    1 
ATOM   2250 C  CA   . ARG B 2 5   ? -9.895  37.536 -14.759 1.00 35.05 ? 5   ARG B CA   1 
ATOM   2251 C  C    . ARG B 2 5   ? -9.701  37.434 -13.247 1.00 35.11 ? 5   ARG B C    1 
ATOM   2252 O  O    . ARG B 2 5   ? -8.772  38.012 -12.675 1.00 31.60 ? 5   ARG B O    1 
ATOM   2253 C  CB   . ARG B 2 5   ? -9.492  36.206 -15.415 1.00 32.70 ? 5   ARG B CB   1 
ATOM   2254 C  CG   . ARG B 2 5   ? -8.054  35.808 -15.227 1.00 36.62 ? 5   ARG B CG   1 
ATOM   2255 C  CD   . ARG B 2 5   ? -7.710  34.696 -16.184 1.00 51.17 ? 5   ARG B CD   1 
ATOM   2256 N  NE   . ARG B 2 5   ? -6.565  33.880 -15.792 1.00 59.78 ? 5   ARG B NE   1 
ATOM   2257 C  CZ   . ARG B 2 5   ? -6.572  32.932 -14.849 1.00 62.38 ? 5   ARG B CZ   1 
ATOM   2258 N  NH1  . ARG B 2 5   ? -7.660  32.675 -14.103 1.00 55.43 ? 5   ARG B NH1  1 
ATOM   2259 N  NH2  . ARG B 2 5   ? -5.454  32.252 -14.622 1.00 64.05 ? 5   ARG B NH2  1 
ATOM   2260 N  N    . ARG B 2 6   ? -10.631 36.721 -12.619 1.00 29.60 ? 6   ARG B N    1 
ATOM   2261 C  CA   . ARG B 2 6   ? -10.504 36.319 -11.249 1.00 31.45 ? 6   ARG B CA   1 
ATOM   2262 C  C    . ARG B 2 6   ? -9.551  35.148 -11.200 1.00 32.58 ? 6   ARG B C    1 
ATOM   2263 O  O    . ARG B 2 6   ? -9.277  34.502 -12.219 1.00 36.74 ? 6   ARG B O    1 
ATOM   2264 C  CB   . ARG B 2 6   ? -11.866 35.926 -10.663 1.00 30.21 ? 6   ARG B CB   1 
ATOM   2265 C  CG   . ARG B 2 6   ? -12.845 37.053 -10.584 1.00 30.62 ? 6   ARG B CG   1 
ATOM   2266 C  CD   . ARG B 2 6   ? -14.160 36.596 -9.989  1.00 28.17 ? 6   ARG B CD   1 
ATOM   2267 N  NE   . ARG B 2 6   ? -15.045 37.730 -9.733  1.00 33.13 ? 6   ARG B NE   1 
ATOM   2268 C  CZ   . ARG B 2 6   ? -15.251 38.308 -8.544  1.00 35.08 ? 6   ARG B CZ   1 
ATOM   2269 N  NH1  . ARG B 2 6   ? -14.629 37.903 -7.446  1.00 39.51 ? 6   ARG B NH1  1 
ATOM   2270 N  NH2  . ARG B 2 6   ? -16.090 39.322 -8.454  1.00 29.60 ? 6   ARG B NH2  1 
ATOM   2271 N  N    . HIS B 2 7   ? -9.025  34.894 -10.009 1.00 32.14 ? 7   HIS B N    1 
ATOM   2272 C  CA   . HIS B 2 7   ? -8.106  33.796 -9.785  1.00 29.75 ? 7   HIS B CA   1 
ATOM   2273 C  C    . HIS B 2 7   ? -8.552  33.102 -8.495  1.00 32.13 ? 7   HIS B C    1 
ATOM   2274 O  O    . HIS B 2 7   ? -8.316  33.613 -7.403  1.00 34.05 ? 7   HIS B O    1 
ATOM   2275 C  CB   . HIS B 2 7   ? -6.675  34.304 -9.657  1.00 28.43 ? 7   HIS B CB   1 
ATOM   2276 C  CG   . HIS B 2 7   ? -6.206  35.109 -10.824 1.00 25.21 ? 7   HIS B CG   1 
ATOM   2277 N  ND1  . HIS B 2 7   ? -6.549  36.429 -10.997 1.00 25.13 ? 7   HIS B ND1  1 
ATOM   2278 C  CD2  . HIS B 2 7   ? -5.421  34.779 -11.879 1.00 24.40 ? 7   HIS B CD2  1 
ATOM   2279 C  CE1  . HIS B 2 7   ? -5.994  36.883 -12.104 1.00 22.20 ? 7   HIS B CE1  1 
ATOM   2280 N  NE2  . HIS B 2 7   ? -5.282  35.911 -12.645 1.00 25.83 ? 7   HIS B NE2  1 
ATOM   2281 N  N    . PRO B 2 8   ? -9.231  31.947 -8.612  1.00 41.65 ? 8   PRO B N    1 
ATOM   2282 C  CA   . PRO B 2 8   ? -9.572  31.213 -7.385  1.00 41.76 ? 8   PRO B CA   1 
ATOM   2283 C  C    . PRO B 2 8   ? -8.367  30.948 -6.461  1.00 37.94 ? 8   PRO B C    1 
ATOM   2284 O  O    . PRO B 2 8   ? -7.236  30.789 -6.919  1.00 42.06 ? 8   PRO B O    1 
ATOM   2285 C  CB   . PRO B 2 8   ? -10.165 29.896 -7.925  1.00 45.39 ? 8   PRO B CB   1 
ATOM   2286 C  CG   . PRO B 2 8   ? -10.845 30.309 -9.224  1.00 41.74 ? 8   PRO B CG   1 
ATOM   2287 C  CD   . PRO B 2 8   ? -10.013 31.461 -9.778  1.00 43.53 ? 8   PRO B CD   1 
ATOM   2288 N  N    . SER B 2 9   ? -8.633  30.937 -5.161  1.00 35.25 ? 9   SER B N    1 
ATOM   2289 C  CA   . SER B 2 9   ? -7.629  30.642 -4.156  1.00 43.90 ? 9   SER B CA   1 
ATOM   2290 C  C    . SER B 2 9   ? -7.296  29.150 -4.202  1.00 49.12 ? 9   SER B C    1 
ATOM   2291 O  O    . SER B 2 9   ? -8.133  28.332 -4.598  1.00 50.27 ? 9   SER B O    1 
ATOM   2292 C  CB   . SER B 2 9   ? -8.133  31.051 -2.775  1.00 45.43 ? 9   SER B CB   1 
ATOM   2293 O  OG   . SER B 2 9   ? -8.659  32.384 -2.825  1.00 46.60 ? 9   SER B OG   1 
ATOM   2294 N  N    . GLY B 2 10  ? -6.065  28.816 -3.825  1.00 52.44 ? 10  GLY B N    1 
ATOM   2295 C  CA   . GLY B 2 10  ? -5.519  27.481 -4.012  1.00 54.95 ? 10  GLY B CA   1 
ATOM   2296 C  C    . GLY B 2 10  ? -4.578  27.502 -5.200  1.00 60.32 ? 10  GLY B C    1 
ATOM   2297 O  O    . GLY B 2 10  ? -4.517  26.551 -5.977  1.00 66.25 ? 10  GLY B O    1 
HETATM 2298 CL CL   . CL  C 3 .   ? -15.838 35.598 3.432   1.00 30.68 ? 401 CL  A CL   1 
HETATM 2299 C  C1K  . MB9 D 4 .   ? -15.253 33.874 -0.924  1.00 26.78 ? 501 MB9 A C1K  1 
HETATM 2300 C  C1I  . MB9 D 4 .   ? -14.200 33.623 -2.004  1.00 29.08 ? 501 MB9 A C1I  1 
HETATM 2301 N  N1M  . MB9 D 4 .   ? -13.423 34.848 -2.374  1.00 27.58 ? 501 MB9 A N1M  1 
HETATM 2302 C  C1J  . MB9 D 4 .   ? -14.259 36.025 -2.653  1.00 23.03 ? 501 MB9 A C1J  1 
HETATM 2303 C  C1L  . MB9 D 4 .   ? -15.208 36.314 -1.496  1.00 30.66 ? 501 MB9 A C1L  1 
HETATM 2304 C  C1W  . MB9 D 4 .   ? -16.093 35.095 -1.161  1.00 32.33 ? 501 MB9 A C1W  1 
HETATM 2305 N  N1N  . MB9 D 4 .   ? -16.892 34.857 -2.386  1.00 33.80 ? 501 MB9 A N1N  1 
HETATM 2306 C  C1O  . MB9 D 4 .   ? -17.955 35.686 -2.686  1.00 33.26 ? 501 MB9 A C1O  1 
HETATM 2307 O  O1C  . MB9 D 4 .   ? -18.544 35.466 -3.741  1.00 35.49 ? 501 MB9 A O1C  1 
HETATM 2308 C  C1Q  . MB9 D 4 .   ? -18.506 36.504 -1.705  1.00 30.25 ? 501 MB9 A C1Q  1 
HETATM 2309 N  N1V  . MB9 D 4 .   ? -19.487 37.411 -1.726  1.00 24.69 ? 501 MB9 A N1V  1 
HETATM 2310 C  C1A  . MB9 D 4 .   ? -20.197 37.845 -2.946  1.00 32.27 ? 501 MB9 A C1A  1 
HETATM 2311 C  C1T  . MB9 D 4 .   ? -19.715 37.917 -0.511  1.00 27.04 ? 501 MB9 A C1T  1 
HETATM 2312 C  C1H  . MB9 D 4 .   ? -20.591 38.905 -0.052  1.00 29.00 ? 501 MB9 A C1H  1 
HETATM 2313 C  C1P  . MB9 D 4 .   ? -20.593 39.202 1.307   1.00 33.18 ? 501 MB9 A C1P  1 
HETATM 2314 CL CL1D . MB9 D 4 .   ? -21.702 40.405 1.877   1.00 48.92 ? 501 MB9 A CL1D 1 
HETATM 2315 C  C1F  . MB9 D 4 .   ? -19.736 38.558 2.207   1.00 25.79 ? 501 MB9 A C1F  1 
HETATM 2316 C  C1G  . MB9 D 4 .   ? -18.834 37.614 1.736   1.00 27.99 ? 501 MB9 A C1G  1 
HETATM 2317 C  C1S  . MB9 D 4 .   ? -18.826 37.298 0.382   1.00 27.39 ? 501 MB9 A C1S  1 
HETATM 2318 C  C1R  . MB9 D 4 .   ? -18.060 36.402 -0.370  1.00 28.62 ? 501 MB9 A C1R  1 
HETATM 2319 C  C1U  . MB9 D 4 .   ? -16.952 35.429 0.047   1.00 28.37 ? 501 MB9 A C1U  1 
HETATM 2320 C  C1E  . MB9 D 4 .   ? -17.561 34.221 0.631   1.00 33.09 ? 501 MB9 A C1E  1 
HETATM 2321 N  N1B  . MB9 D 4 .   ? -18.056 33.289 1.038   1.00 32.26 ? 501 MB9 A N1B  1 
HETATM 2322 C  C1   . EDO E 5 .   ? 9.363   40.156 7.357   1.00 45.01 ? 551 EDO A C1   1 
HETATM 2323 O  O1   . EDO E 5 .   ? 8.115   39.474 7.473   1.00 30.64 ? 551 EDO A O1   1 
HETATM 2324 C  C2   . EDO E 5 .   ? 10.467  39.125 7.149   1.00 51.30 ? 551 EDO A C2   1 
HETATM 2325 O  O2   . EDO E 5 .   ? 10.644  38.812 5.757   1.00 36.25 ? 551 EDO A O2   1 
HETATM 2326 O  O    . HOH F 6 .   ? -4.352  37.098 -2.657  1.00 24.47 ? 601 HOH A O    1 
HETATM 2327 O  O    . HOH F 6 .   ? -7.719  34.136 3.956   1.00 25.61 ? 602 HOH A O    1 
HETATM 2328 O  O    . HOH F 6 .   ? -2.331  39.691 6.545   1.00 21.98 ? 603 HOH A O    1 
HETATM 2329 O  O    . HOH F 6 .   ? 2.578   37.829 -7.314  1.00 22.33 ? 604 HOH A O    1 
HETATM 2330 O  O    . HOH F 6 .   ? -1.982  38.330 1.263   1.00 20.35 ? 605 HOH A O    1 
HETATM 2331 O  O    . HOH F 6 .   ? 0.997   36.969 4.245   1.00 24.04 ? 606 HOH A O    1 
HETATM 2332 O  O    . HOH F 6 .   ? -7.290  59.931 -0.917  1.00 22.36 ? 607 HOH A O    1 
HETATM 2333 O  O    . HOH F 6 .   ? -4.938  59.483 -11.275 1.00 32.87 ? 608 HOH A O    1 
HETATM 2334 O  O    . HOH F 6 .   ? 7.638   43.974 4.662   1.00 26.97 ? 609 HOH A O    1 
HETATM 2335 O  O    . HOH F 6 .   ? 1.636   37.481 -1.003  1.00 25.63 ? 610 HOH A O    1 
HETATM 2336 O  O    . HOH F 6 .   ? 3.097   55.239 -15.804 1.00 21.94 ? 611 HOH A O    1 
HETATM 2337 O  O    . HOH F 6 .   ? -10.067 50.223 7.343   1.00 24.57 ? 612 HOH A O    1 
HETATM 2338 O  O    . HOH F 6 .   ? 0.066   39.769 -10.244 1.00 23.44 ? 613 HOH A O    1 
HETATM 2339 O  O    . HOH F 6 .   ? 8.697   36.563 3.000   1.00 26.04 ? 614 HOH A O    1 
HETATM 2340 O  O    . HOH F 6 .   ? -12.662 50.518 6.180   1.00 27.98 ? 615 HOH A O    1 
HETATM 2341 O  O    . HOH F 6 .   ? -2.755  60.124 4.807   1.00 29.13 ? 616 HOH A O    1 
HETATM 2342 O  O    . HOH F 6 .   ? 7.062   51.150 -16.374 1.00 31.41 ? 617 HOH A O    1 
HETATM 2343 O  O    . HOH F 6 .   ? 0.617   48.210 12.830  1.00 30.13 ? 618 HOH A O    1 
HETATM 2344 O  O    . HOH F 6 .   ? -15.316 38.834 12.577  1.00 33.47 ? 619 HOH A O    1 
HETATM 2345 O  O    . HOH F 6 .   ? -1.380  38.249 4.221   1.00 21.01 ? 620 HOH A O    1 
HETATM 2346 O  O    . HOH F 6 .   ? 4.704   48.684 10.673  1.00 26.40 ? 621 HOH A O    1 
HETATM 2347 O  O    . HOH F 6 .   ? -11.404 56.601 -10.594 1.00 28.01 ? 622 HOH A O    1 
HETATM 2348 O  O    . HOH F 6 .   ? -28.301 29.430 2.820   1.00 42.51 ? 623 HOH A O    1 
HETATM 2349 O  O    . HOH F 6 .   ? 5.829   38.068 9.731   1.00 39.83 ? 624 HOH A O    1 
HETATM 2350 O  O    . HOH F 6 .   ? -10.420 56.656 3.209   1.00 25.27 ? 625 HOH A O    1 
HETATM 2351 O  O    . HOH F 6 .   ? -7.706  37.727 -8.785  1.00 25.59 ? 626 HOH A O    1 
HETATM 2352 O  O    . HOH F 6 .   ? -7.301  40.293 -9.090  1.00 24.77 ? 627 HOH A O    1 
HETATM 2353 O  O    . HOH F 6 .   ? 0.727   39.160 -18.126 1.00 41.32 ? 628 HOH A O    1 
HETATM 2354 O  O    . HOH F 6 .   ? -14.069 34.653 6.033   1.00 26.16 ? 629 HOH A O    1 
HETATM 2355 O  O    . HOH F 6 .   ? -2.888  29.491 2.939   1.00 31.74 ? 630 HOH A O    1 
HETATM 2356 O  O    . HOH F 6 .   ? -2.401  35.418 -1.803  1.00 28.95 ? 631 HOH A O    1 
HETATM 2357 O  O    . HOH F 6 .   ? -10.099 47.262 -15.101 1.00 26.61 ? 632 HOH A O    1 
HETATM 2358 O  O    . HOH F 6 .   ? 6.334   34.971 9.738   1.00 25.46 ? 633 HOH A O    1 
HETATM 2359 O  O    . HOH F 6 .   ? 3.757   26.947 7.799   1.00 40.41 ? 634 HOH A O    1 
HETATM 2360 O  O    . HOH F 6 .   ? -3.494  32.751 -9.033  1.00 27.56 ? 635 HOH A O    1 
HETATM 2361 O  O    . HOH F 6 .   ? 5.099   62.019 -11.565 1.00 31.67 ? 636 HOH A O    1 
HETATM 2362 O  O    . HOH F 6 .   ? -6.072  62.302 -1.343  1.00 26.29 ? 637 HOH A O    1 
HETATM 2363 O  O    . HOH F 6 .   ? -6.143  61.660 -8.262  1.00 28.84 ? 638 HOH A O    1 
HETATM 2364 O  O    . HOH F 6 .   ? -14.906 55.076 8.794   1.00 36.34 ? 639 HOH A O    1 
HETATM 2365 O  O    . HOH F 6 .   ? -10.802 32.771 18.309  1.00 38.58 ? 640 HOH A O    1 
HETATM 2366 O  O    . HOH F 6 .   ? 8.678   40.545 -13.895 1.00 31.52 ? 641 HOH A O    1 
HETATM 2367 O  O    . HOH F 6 .   ? -9.072  32.457 0.853   1.00 27.38 ? 642 HOH A O    1 
HETATM 2368 O  O    . HOH F 6 .   ? 8.985   50.602 10.064  1.00 34.53 ? 643 HOH A O    1 
HETATM 2369 O  O    . HOH F 6 .   ? 2.732   45.037 -16.516 1.00 39.14 ? 644 HOH A O    1 
HETATM 2370 O  O    . HOH F 6 .   ? -15.337 57.580 9.314   1.00 40.09 ? 645 HOH A O    1 
HETATM 2371 O  O    . HOH F 6 .   ? -19.578 42.585 -6.536  1.00 36.56 ? 646 HOH A O    1 
HETATM 2372 O  O    . HOH F 6 .   ? 8.049   55.756 4.046   1.00 28.94 ? 647 HOH A O    1 
HETATM 2373 O  O    . HOH F 6 .   ? -6.118  63.449 5.258   1.00 36.47 ? 648 HOH A O    1 
HETATM 2374 O  O    . HOH F 6 .   ? -2.320  28.981 12.142  1.00 32.54 ? 649 HOH A O    1 
HETATM 2375 O  O    . HOH F 6 .   ? 7.147   27.944 -11.658 1.00 49.95 ? 650 HOH A O    1 
HETATM 2376 O  O    . HOH F 6 .   ? 13.186  43.995 -6.908  1.00 33.04 ? 651 HOH A O    1 
HETATM 2377 O  O    . HOH F 6 .   ? 3.002   30.244 -14.431 1.00 37.97 ? 652 HOH A O    1 
HETATM 2378 O  O    . HOH F 6 .   ? -24.465 23.720 4.467   1.00 33.17 ? 653 HOH A O    1 
HETATM 2379 O  O    . HOH F 6 .   ? 12.162  47.759 -4.759  1.00 39.82 ? 654 HOH A O    1 
HETATM 2380 O  O    . HOH F 6 .   ? 9.977   53.689 -9.325  1.00 39.82 ? 655 HOH A O    1 
HETATM 2381 O  O    . HOH F 6 .   ? -19.123 49.797 6.374   1.00 47.79 ? 656 HOH A O    1 
HETATM 2382 O  O    . HOH F 6 .   ? -13.589 58.064 -9.560  1.00 32.53 ? 657 HOH A O    1 
HETATM 2383 O  O    . HOH F 6 .   ? -8.442  51.249 -17.324 1.00 39.25 ? 658 HOH A O    1 
HETATM 2384 O  O    . HOH F 6 .   ? 3.905   25.850 -5.583  1.00 54.83 ? 659 HOH A O    1 
HETATM 2385 O  O    . HOH F 6 .   ? -13.737 29.516 3.079   1.00 38.88 ? 660 HOH A O    1 
HETATM 2386 O  O    . HOH F 6 .   ? -2.781  57.917 -12.257 1.00 39.14 ? 661 HOH A O    1 
HETATM 2387 O  O    . HOH F 6 .   ? -9.131  48.440 14.858  1.00 43.02 ? 662 HOH A O    1 
HETATM 2388 O  O    . HOH F 6 .   ? 0.800   35.004 2.161   1.00 25.42 ? 663 HOH A O    1 
HETATM 2389 O  O    . HOH F 6 .   ? 11.135  35.511 3.957   1.00 39.46 ? 664 HOH A O    1 
HETATM 2390 O  O    . HOH F 6 .   ? 2.178   49.196 11.757  1.00 31.96 ? 665 HOH A O    1 
HETATM 2391 O  O    . HOH F 6 .   ? 9.448   47.759 -17.291 1.00 31.97 ? 666 HOH A O    1 
HETATM 2392 O  O    . HOH F 6 .   ? 13.470  49.099 2.693   1.00 46.97 ? 667 HOH A O    1 
HETATM 2393 O  O    . HOH F 6 .   ? 10.731  51.885 -5.149  1.00 32.08 ? 668 HOH A O    1 
HETATM 2394 O  O    . HOH F 6 .   ? -3.155  31.941 -11.893 1.00 36.54 ? 669 HOH A O    1 
HETATM 2395 O  O    . HOH F 6 .   ? -3.201  62.052 -10.081 1.00 47.17 ? 670 HOH A O    1 
HETATM 2396 O  O    . HOH F 6 .   ? 4.862   44.238 -14.980 1.00 47.83 ? 671 HOH A O    1 
HETATM 2397 O  O    . HOH F 6 .   ? 8.659   50.419 -18.618 1.00 36.44 ? 672 HOH A O    1 
HETATM 2398 O  O    . HOH F 6 .   ? -10.398 54.280 -15.573 1.00 39.85 ? 673 HOH A O    1 
HETATM 2399 O  O    . HOH F 6 .   ? -5.443  49.918 12.150  1.00 34.48 ? 674 HOH A O    1 
HETATM 2400 O  O    . HOH F 6 .   ? -1.299  63.073 -1.426  1.00 36.22 ? 675 HOH A O    1 
HETATM 2401 O  O    . HOH F 6 .   ? 0.431   40.820 16.611  1.00 46.63 ? 676 HOH A O    1 
HETATM 2402 O  O    . HOH F 6 .   ? 8.814   57.445 -12.796 1.00 36.14 ? 677 HOH A O    1 
HETATM 2403 O  O    . HOH F 6 .   ? 11.868  54.345 5.509   1.00 43.29 ? 678 HOH A O    1 
HETATM 2404 O  O    . HOH F 6 .   ? 8.332   55.427 8.220   1.00 39.98 ? 679 HOH A O    1 
HETATM 2405 O  O    . HOH F 6 .   ? -4.407  62.538 -5.771  1.00 40.31 ? 680 HOH A O    1 
HETATM 2406 O  O    . HOH F 6 .   ? -16.086 41.980 -12.755 1.00 38.41 ? 681 HOH A O    1 
HETATM 2407 O  O    . HOH F 6 .   ? -11.398 34.754 19.610  1.00 46.64 ? 682 HOH A O    1 
HETATM 2408 O  O    . HOH F 6 .   ? -1.172  63.390 5.423   1.00 36.88 ? 683 HOH A O    1 
HETATM 2409 O  O    . HOH F 6 .   ? 10.121  46.494 -7.917  1.00 40.91 ? 684 HOH A O    1 
HETATM 2410 O  O    . HOH F 6 .   ? 11.754  48.084 5.363   1.00 38.85 ? 685 HOH A O    1 
HETATM 2411 O  O    . HOH F 6 .   ? 15.074  43.428 -3.614  1.00 35.47 ? 686 HOH A O    1 
HETATM 2412 O  O    . HOH F 6 .   ? -10.687 27.154 7.689   1.00 40.49 ? 687 HOH A O    1 
HETATM 2413 O  O    . HOH F 6 .   ? 14.268  55.343 -2.324  1.00 55.09 ? 688 HOH A O    1 
HETATM 2414 O  O    . HOH F 6 .   ? 6.160   26.973 -6.527  1.00 41.82 ? 689 HOH A O    1 
HETATM 2415 O  O    . HOH F 6 .   ? -7.461  27.754 2.105   1.00 56.08 ? 690 HOH A O    1 
HETATM 2416 O  O    . HOH F 6 .   ? -18.542 56.844 6.119   1.00 43.99 ? 691 HOH A O    1 
HETATM 2417 O  O    . HOH F 6 .   ? 1.315   32.291 -11.470 1.00 36.10 ? 692 HOH A O    1 
HETATM 2418 O  O    . HOH F 6 .   ? -4.569  55.449 -12.103 1.00 32.34 ? 693 HOH A O    1 
HETATM 2419 O  O    . HOH F 6 .   ? 2.696   27.199 -11.616 1.00 47.68 ? 694 HOH A O    1 
HETATM 2420 O  O    . HOH F 6 .   ? -23.746 24.112 15.536  1.00 62.72 ? 695 HOH A O    1 
HETATM 2421 O  O    . HOH F 6 .   ? -14.767 42.367 12.680  1.00 35.95 ? 696 HOH A O    1 
HETATM 2422 O  O    . HOH F 6 .   ? -0.695  36.361 0.138   1.00 28.37 ? 697 HOH A O    1 
HETATM 2423 O  O    . HOH F 6 .   ? 0.418   30.022 12.156  1.00 35.80 ? 698 HOH A O    1 
HETATM 2424 O  O    . HOH F 6 .   ? -0.892  61.386 -7.123  1.00 48.67 ? 699 HOH A O    1 
HETATM 2425 O  O    . HOH F 6 .   ? -2.339  33.390 -13.860 1.00 40.81 ? 700 HOH A O    1 
HETATM 2426 O  O    . HOH F 6 .   ? 3.676   37.601 16.007  1.00 54.57 ? 701 HOH A O    1 
HETATM 2427 O  O    . HOH F 6 .   ? 10.322  43.758 4.594   1.00 33.85 ? 702 HOH A O    1 
HETATM 2428 O  O    . HOH F 6 .   ? 12.482  51.879 -2.847  1.00 49.58 ? 703 HOH A O    1 
HETATM 2429 O  O    . HOH F 6 .   ? -25.830 43.767 -0.001  1.00 39.79 ? 704 HOH A O    1 
HETATM 2430 O  O    . HOH F 6 .   ? -6.447  46.373 16.055  1.00 39.81 ? 705 HOH A O    1 
HETATM 2431 O  O    . HOH F 6 .   ? 9.644   55.994 6.142   1.00 36.84 ? 706 HOH A O    1 
HETATM 2432 O  O    . HOH F 6 .   ? 13.022  52.961 -0.746  1.00 46.85 ? 707 HOH A O    1 
HETATM 2433 O  O    . HOH F 6 .   ? 9.584   56.656 1.728   1.00 42.40 ? 708 HOH A O    1 
HETATM 2434 O  O    . HOH F 6 .   ? 11.085  44.046 -8.406  1.00 43.68 ? 709 HOH A O    1 
HETATM 2435 O  O    . HOH F 6 .   ? 16.719  42.551 -5.721  1.00 42.33 ? 710 HOH A O    1 
HETATM 2436 O  O    . HOH F 6 .   ? -6.302  39.193 -14.666 1.00 32.88 ? 711 HOH A O    1 
HETATM 2437 O  O    . HOH F 6 .   ? 12.916  40.120 5.331   1.00 46.42 ? 712 HOH A O    1 
HETATM 2438 O  O    . HOH F 6 .   ? -2.927  27.588 9.916   1.00 51.94 ? 713 HOH A O    1 
HETATM 2439 O  O    . HOH F 6 .   ? -25.824 45.735 -3.083  1.00 36.19 ? 714 HOH A O    1 
HETATM 2440 O  O    . HOH F 6 .   ? -5.638  47.466 -17.320 1.00 38.33 ? 715 HOH A O    1 
HETATM 2441 O  O    . HOH F 6 .   ? 0.845   62.727 -2.564  1.00 45.34 ? 716 HOH A O    1 
HETATM 2442 O  O    . HOH F 6 .   ? -19.638 39.402 -9.786  1.00 47.04 ? 717 HOH A O    1 
HETATM 2443 O  O    . HOH F 6 .   ? -2.868  56.244 -19.144 1.00 45.74 ? 718 HOH A O    1 
HETATM 2444 O  O    . HOH F 6 .   ? 9.061   42.961 -8.767  1.00 37.53 ? 719 HOH A O    1 
HETATM 2445 O  O    . HOH F 6 .   ? 13.768  50.827 5.050   1.00 44.57 ? 720 HOH A O    1 
HETATM 2446 O  O    . HOH F 6 .   ? -25.365 41.700 -1.583  1.00 36.27 ? 721 HOH A O    1 
HETATM 2447 O  O    . HOH F 6 .   ? 1.278   25.682 -9.481  1.00 56.10 ? 722 HOH A O    1 
HETATM 2448 O  O    . HOH F 6 .   ? -13.321 31.357 1.644   1.00 36.40 ? 723 HOH A O    1 
HETATM 2449 O  O    . HOH F 6 .   ? -25.463 22.102 2.680   1.00 36.96 ? 724 HOH A O    1 
HETATM 2450 O  O    . HOH F 6 .   ? -31.564 38.526 0.957   1.00 43.57 ? 725 HOH A O    1 
HETATM 2451 O  O    . HOH F 6 .   ? -25.087 34.023 -7.846  1.00 47.47 ? 726 HOH A O    1 
HETATM 2452 O  O    . HOH F 6 .   ? -33.329 36.804 2.394   1.00 45.52 ? 727 HOH A O    1 
HETATM 2453 O  O    . HOH F 6 .   ? -13.945 24.566 2.216   1.00 55.50 ? 728 HOH A O    1 
HETATM 2454 O  O    . HOH F 6 .   ? 8.918   40.691 -10.102 1.00 40.55 ? 729 HOH A O    1 
HETATM 2455 O  O    . HOH F 6 .   ? -20.334 25.181 -3.007  1.00 41.06 ? 730 HOH A O    1 
HETATM 2456 O  O    . HOH F 6 .   ? -2.064  29.143 -4.472  1.00 39.05 ? 731 HOH A O    1 
HETATM 2457 O  O    . HOH F 6 .   ? 0.290   28.672 -4.973  1.00 26.12 ? 732 HOH A O    1 
HETATM 2458 O  O    . HOH F 6 .   ? 0.087   61.196 -13.099 1.00 32.30 ? 733 HOH A O    1 
HETATM 2459 O  O    . HOH F 6 .   ? 14.714  38.506 3.753   1.00 45.66 ? 734 HOH A O    1 
HETATM 2460 O  O    . HOH F 6 .   ? 12.573  36.447 -3.592  1.00 47.60 ? 735 HOH A O    1 
HETATM 2461 O  O    . HOH F 6 .   ? -5.326  27.354 4.562   1.00 52.34 ? 736 HOH A O    1 
HETATM 2462 O  O    . HOH F 6 .   ? -2.263  34.760 17.048  1.00 51.85 ? 737 HOH A O    1 
HETATM 2463 O  O    . HOH F 6 .   ? -20.938 43.908 -9.499  1.00 48.09 ? 738 HOH A O    1 
HETATM 2464 O  O    . HOH F 6 .   ? -15.566 38.583 -4.734  1.00 28.86 ? 739 HOH A O    1 
HETATM 2465 O  O    . HOH F 6 .   ? -2.453  40.694 -15.534 1.00 44.35 ? 740 HOH A O    1 
HETATM 2466 O  O    . HOH F 6 .   ? 0.917   24.526 0.672   1.00 46.25 ? 741 HOH A O    1 
HETATM 2467 O  O    . HOH F 6 .   ? -29.862 32.201 -6.232  1.00 44.16 ? 742 HOH A O    1 
HETATM 2468 O  O    . HOH F 6 .   ? 5.222   56.814 12.150  1.00 47.49 ? 743 HOH A O    1 
HETATM 2469 O  O    . HOH F 6 .   ? -16.420 33.159 -4.800  1.00 42.67 ? 744 HOH A O    1 
HETATM 2470 O  O    . HOH F 6 .   ? -13.652 62.814 -9.645  1.00 52.63 ? 745 HOH A O    1 
HETATM 2471 O  O    . HOH F 6 .   ? 5.126   61.018 6.363   1.00 56.00 ? 746 HOH A O    1 
HETATM 2472 O  O    . HOH F 6 .   ? -12.031 33.726 -7.832  1.00 32.98 ? 747 HOH A O    1 
HETATM 2473 O  O    . HOH F 6 .   ? -24.474 48.888 4.789   1.00 45.65 ? 748 HOH A O    1 
HETATM 2474 O  O    . HOH F 6 .   ? -22.283 31.054 -8.234  1.00 54.28 ? 749 HOH A O    1 
HETATM 2475 O  O    . HOH F 6 .   ? 2.716   43.024 11.758  1.00 65.59 ? 750 HOH A O    1 
HETATM 2476 O  O    . HOH F 6 .   ? -31.390 30.742 -2.808  1.00 43.58 ? 751 HOH A O    1 
HETATM 2477 O  O    . HOH F 6 .   ? -28.051 40.865 -1.481  1.00 42.50 ? 752 HOH A O    1 
HETATM 2478 O  O    . HOH F 6 .   ? -7.857  38.664 19.282  1.00 49.51 ? 753 HOH A O    1 
HETATM 2479 O  O    . HOH F 6 .   ? 12.869  25.616 0.348   1.00 55.20 ? 754 HOH A O    1 
HETATM 2480 O  O    . HOH F 6 .   ? 11.883  35.048 -14.336 1.00 51.26 ? 755 HOH A O    1 
HETATM 2481 O  O    . HOH F 6 .   ? -6.349  43.158 -18.100 1.00 36.73 ? 756 HOH A O    1 
HETATM 2482 O  O    . HOH F 6 .   ? 11.672  32.813 2.228   1.00 46.38 ? 757 HOH A O    1 
HETATM 2483 O  O    . HOH F 6 .   ? 1.596   28.293 10.697  1.00 43.22 ? 758 HOH A O    1 
HETATM 2484 O  O    . HOH F 6 .   ? 1.759   32.351 16.534  1.00 49.72 ? 759 HOH A O    1 
HETATM 2485 O  O    . HOH F 6 .   ? -25.492 44.268 7.842   1.00 63.78 ? 760 HOH A O    1 
HETATM 2486 O  O    . HOH F 6 .   ? 14.329  48.585 -0.627  1.00 51.38 ? 761 HOH A O    1 
HETATM 2487 O  O    . HOH F 6 .   ? 9.417   56.159 -9.206  1.00 43.09 ? 762 HOH A O    1 
HETATM 2488 O  O    . HOH F 6 .   ? -24.365 51.634 4.237   1.00 53.10 ? 763 HOH A O    1 
HETATM 2489 O  O    . HOH F 6 .   ? -23.838 50.799 1.333   1.00 45.57 ? 764 HOH A O    1 
HETATM 2490 O  O    . HOH F 6 .   ? -6.863  64.481 -2.621  1.00 38.35 ? 765 HOH A O    1 
HETATM 2491 O  O    . HOH F 6 .   ? -10.160 26.521 3.758   1.00 51.72 ? 766 HOH A O    1 
HETATM 2492 O  O    . HOH F 6 .   ? -23.805 19.691 5.473   1.00 52.10 ? 767 HOH A O    1 
HETATM 2493 O  O    . HOH F 6 .   ? -20.316 27.408 -9.229  1.00 59.64 ? 768 HOH A O    1 
HETATM 2494 O  O    . HOH F 6 .   ? -31.570 43.000 2.881   1.00 46.41 ? 769 HOH A O    1 
HETATM 2495 O  O    . HOH F 6 .   ? -9.773  37.331 20.640  1.00 59.57 ? 770 HOH A O    1 
HETATM 2496 O  O    . HOH F 6 .   ? -14.372 54.905 -15.419 1.00 55.64 ? 771 HOH A O    1 
HETATM 2497 O  O    . HOH F 6 .   ? 0.629   30.742 -15.932 1.00 57.88 ? 772 HOH A O    1 
HETATM 2498 O  O    . HOH F 6 .   ? 1.447   43.693 14.035  1.00 50.13 ? 773 HOH A O    1 
HETATM 2499 O  O    . HOH F 6 .   ? -8.206  45.058 -18.329 1.00 55.30 ? 774 HOH A O    1 
HETATM 2500 O  O    . HOH F 6 .   ? -7.818  29.028 -0.108  1.00 53.55 ? 775 HOH A O    1 
HETATM 2501 O  O    . HOH F 6 .   ? -12.887 27.362 6.249   1.00 43.46 ? 776 HOH A O    1 
HETATM 2502 O  O    . HOH F 6 .   ? -8.569  31.600 19.264  1.00 50.72 ? 777 HOH A O    1 
HETATM 2503 O  O    . HOH F 6 .   ? -13.827 50.988 8.565   1.00 40.99 ? 778 HOH A O    1 
HETATM 2504 O  O    . HOH F 6 .   ? -17.455 45.159 10.728  1.00 51.97 ? 779 HOH A O    1 
HETATM 2505 O  O    . HOH F 6 .   ? -15.868 44.219 12.209  1.00 46.92 ? 780 HOH A O    1 
HETATM 2506 O  O    . HOH F 6 .   ? -11.744 31.277 -0.980  1.00 48.39 ? 781 HOH A O    1 
HETATM 2507 O  O    . HOH F 6 .   ? -6.228  28.405 6.767   1.00 43.87 ? 782 HOH A O    1 
HETATM 2508 O  O    . HOH F 6 .   ? -2.619  27.068 3.792   1.00 40.30 ? 783 HOH A O    1 
HETATM 2509 O  O    . HOH F 6 .   ? 1.530   29.832 14.831  1.00 47.25 ? 784 HOH A O    1 
HETATM 2510 O  O    . HOH F 6 .   ? 9.226   39.802 14.595  1.00 48.24 ? 785 HOH A O    1 
HETATM 2511 O  O    . HOH F 6 .   ? -0.824  30.918 -11.495 1.00 53.91 ? 786 HOH A O    1 
HETATM 2512 O  O    . HOH F 6 .   ? 13.816  36.006 3.737   1.00 37.92 ? 787 HOH A O    1 
HETATM 2513 O  O    . HOH F 6 .   ? 15.748  39.413 1.807   1.00 39.69 ? 788 HOH A O    1 
HETATM 2514 O  O    . HOH F 6 .   ? 14.054  45.544 -5.304  1.00 46.35 ? 789 HOH A O    1 
HETATM 2515 O  O    . HOH F 6 .   ? 13.402  49.421 -3.205  1.00 51.75 ? 790 HOH A O    1 
HETATM 2516 O  O    . HOH F 6 .   ? 6.482   49.568 12.439  1.00 42.78 ? 791 HOH A O    1 
HETATM 2517 O  O    . HOH F 6 .   ? 0.579   66.339 3.547   1.00 64.81 ? 792 HOH A O    1 
HETATM 2518 O  O    . HOH F 6 .   ? -7.526  65.303 1.474   1.00 48.21 ? 793 HOH A O    1 
HETATM 2519 O  O    . HOH F 6 .   ? -11.338 67.976 2.208   1.00 63.06 ? 794 HOH A O    1 
HETATM 2520 O  O    . HOH F 6 .   ? -17.577 63.726 -7.938  1.00 44.27 ? 795 HOH A O    1 
HETATM 2521 O  O    . HOH F 6 .   ? -13.792 32.065 -5.715  1.00 47.18 ? 796 HOH A O    1 
HETATM 2522 O  O    . HOH F 6 .   ? -13.612 32.758 -10.032 1.00 49.58 ? 797 HOH A O    1 
HETATM 2523 O  O    . HOH F 6 .   ? -23.014 40.722 -3.448  1.00 48.29 ? 798 HOH A O    1 
HETATM 2524 O  O    . HOH F 6 .   ? 11.589  53.177 -7.655  1.00 41.64 ? 799 HOH A O    1 
HETATM 2525 O  O    . HOH F 6 .   ? -20.942 58.819 3.513   1.00 44.75 ? 800 HOH A O    1 
HETATM 2526 O  O    . HOH G 6 .   ? -4.565  45.393 -18.372 1.00 34.85 ? 92  HOH B O    1 
HETATM 2527 O  O    . HOH G 6 .   ? -16.473 38.379 -12.244 1.00 41.30 ? 106 HOH B O    1 
HETATM 2528 O  O    . HOH G 6 .   ? -11.197 33.394 -4.139  1.00 46.59 ? 124 HOH B O    1 
HETATM 2529 O  O    . HOH G 6 .   ? -7.134  40.119 -11.807 1.00 24.76 ? 137 HOH B O    1 
HETATM 2530 O  O    . HOH G 6 .   ? -13.045 35.930 -14.221 1.00 34.52 ? 141 HOH B O    1 
HETATM 2531 O  O    . HOH G 6 .   ? -4.373  30.761 -7.132  1.00 33.43 ? 142 HOH B O    1 
HETATM 2532 O  O    . HOH G 6 .   ? -5.991  30.977 -11.609 1.00 58.21 ? 221 HOH B O    1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   0   ?   ?   ?   A . n 
A 1 2   MET 2   1   ?   ?   ?   A . n 
A 1 3   LEU 3   2   ?   ?   ?   A . n 
A 1 4   LEU 4   3   ?   ?   ?   A . n 
A 1 5   SER 5   4   ?   ?   ?   A . n 
A 1 6   LYS 6   5   ?   ?   ?   A . n 
A 1 7   ILE 7   6   ?   ?   ?   A . n 
A 1 8   ASN 8   7   ?   ?   ?   A . n 
A 1 9   SER 9   8   ?   ?   ?   A . n 
A 1 10  LEU 10  9   ?   ?   ?   A . n 
A 1 11  ALA 11  10  ?   ?   ?   A . n 
A 1 12  HIS 12  11  ?   ?   ?   A . n 
A 1 13  LEU 13  12  ?   ?   ?   A . n 
A 1 14  ARG 14  13  ?   ?   ?   A . n 
A 1 15  ALA 15  14  ?   ?   ?   A . n 
A 1 16  ALA 16  15  ?   ?   ?   A . n 
A 1 17  PRO 17  16  ?   ?   ?   A . n 
A 1 18  CYS 18  17  ?   ?   ?   A . n 
A 1 19  ASN 19  18  ?   ?   ?   A . n 
A 1 20  ASP 20  19  ?   ?   ?   A . n 
A 1 21  LEU 21  20  ?   ?   ?   A . n 
A 1 22  HIS 22  21  ?   ?   ?   A . n 
A 1 23  ALA 23  22  ?   ?   ?   A . n 
A 1 24  THR 24  23  ?   ?   ?   A . n 
A 1 25  LYS 25  24  ?   ?   ?   A . n 
A 1 26  LEU 26  25  ?   ?   ?   A . n 
A 1 27  ALA 27  26  ?   ?   ?   A . n 
A 1 28  PRO 28  27  ?   ?   ?   A . n 
A 1 29  GLY 29  28  ?   ?   ?   A . n 
A 1 30  LYS 30  29  ?   ?   ?   A . n 
A 1 31  GLU 31  30  ?   ?   ?   A . n 
A 1 32  LYS 32  31  ?   ?   ?   A . n 
A 1 33  GLU 33  32  ?   ?   ?   A . n 
A 1 34  PRO 34  33  33  PRO PRO A . n 
A 1 35  LEU 35  34  34  LEU LEU A . n 
A 1 36  GLU 36  35  35  GLU GLU A . n 
A 1 37  SER 37  36  36  SER SER A . n 
A 1 38  GLN 38  37  37  GLN GLN A . n 
A 1 39  TYR 39  38  38  TYR TYR A . n 
A 1 40  GLN 40  39  39  GLN GLN A . n 
A 1 41  VAL 41  40  40  VAL VAL A . n 
A 1 42  GLY 42  41  41  GLY GLY A . n 
A 1 43  PRO 43  42  42  PRO PRO A . n 
A 1 44  LEU 44  43  43  LEU LEU A . n 
A 1 45  LEU 45  44  44  LEU LEU A . n 
A 1 46  GLY 46  45  45  GLY GLY A . n 
A 1 47  SER 47  46  46  SER SER A . n 
A 1 48  GLY 48  47  47  GLY GLY A . n 
A 1 49  GLY 49  48  48  GLY GLY A . n 
A 1 50  PHE 50  49  49  PHE PHE A . n 
A 1 51  GLY 51  50  50  GLY GLY A . n 
A 1 52  SER 52  51  51  SER SER A . n 
A 1 53  VAL 53  52  52  VAL VAL A . n 
A 1 54  TYR 54  53  53  TYR TYR A . n 
A 1 55  SER 55  54  54  SER SER A . n 
A 1 56  GLY 56  55  55  GLY GLY A . n 
A 1 57  ILE 57  56  56  ILE ILE A . n 
A 1 58  ARG 58  57  57  ARG ARG A . n 
A 1 59  VAL 59  58  58  VAL VAL A . n 
A 1 60  SER 60  59  59  SER SER A . n 
A 1 61  ASP 61  60  60  ASP ASP A . n 
A 1 62  ASN 62  61  61  ASN ASN A . n 
A 1 63  LEU 63  62  62  LEU LEU A . n 
A 1 64  PRO 64  63  63  PRO PRO A . n 
A 1 65  VAL 65  64  64  VAL VAL A . n 
A 1 66  ALA 66  65  65  ALA ALA A . n 
A 1 67  ILE 67  66  66  ILE ILE A . n 
A 1 68  LYS 68  67  67  LYS LYS A . n 
A 1 69  HIS 69  68  68  HIS HIS A . n 
A 1 70  VAL 70  69  69  VAL VAL A . n 
A 1 71  GLU 71  70  70  GLU GLU A . n 
A 1 72  LYS 72  71  71  LYS LYS A . n 
A 1 73  ASP 73  72  72  ASP ASP A . n 
A 1 74  ARG 74  73  73  ARG ARG A . n 
A 1 75  ILE 75  74  74  ILE ILE A . n 
A 1 76  SER 76  75  75  SER SER A . n 
A 1 77  ASP 77  76  76  ASP ASP A . n 
A 1 78  TRP 78  77  77  TRP TRP A . n 
A 1 79  GLY 79  78  78  GLY GLY A . n 
A 1 80  GLU 80  79  79  GLU GLU A . n 
A 1 81  LEU 81  80  80  LEU LEU A . n 
A 1 82  PRO 82  81  81  PRO PRO A . n 
A 1 83  ASN 83  82  ?   ?   ?   A . n 
A 1 84  GLY 84  83  ?   ?   ?   A . n 
A 1 85  THR 85  84  84  THR THR A . n 
A 1 86  ARG 86  85  85  ARG ARG A . n 
A 1 87  VAL 87  86  86  VAL VAL A . n 
A 1 88  PRO 88  87  87  PRO PRO A . n 
A 1 89  MET 89  88  88  MET MET A . n 
A 1 90  GLU 90  89  89  GLU GLU A . n 
A 1 91  VAL 91  90  90  VAL VAL A . n 
A 1 92  VAL 92  91  91  VAL VAL A . n 
A 1 93  LEU 93  92  92  LEU LEU A . n 
A 1 94  LEU 94  93  93  LEU LEU A . n 
A 1 95  LYS 95  94  94  LYS LYS A . n 
A 1 96  LYS 96  95  95  LYS LYS A . n 
A 1 97  VAL 97  96  96  VAL VAL A . n 
A 1 98  SER 98  97  97  SER SER A . n 
A 1 99  SER 99  98  98  SER SER A . n 
A 1 100 GLY 100 99  99  GLY GLY A . n 
A 1 101 PHE 101 100 100 PHE PHE A . n 
A 1 102 SER 102 101 101 SER SER A . n 
A 1 103 GLY 103 102 102 GLY GLY A . n 
A 1 104 VAL 104 103 103 VAL VAL A . n 
A 1 105 ILE 105 104 104 ILE ILE A . n 
A 1 106 ARG 106 105 105 ARG ARG A . n 
A 1 107 LEU 107 106 106 LEU LEU A . n 
A 1 108 LEU 108 107 107 LEU LEU A . n 
A 1 109 ASP 109 108 108 ASP ASP A . n 
A 1 110 TRP 110 109 109 TRP TRP A . n 
A 1 111 PHE 111 110 110 PHE PHE A . n 
A 1 112 GLU 112 111 111 GLU GLU A . n 
A 1 113 ARG 113 112 112 ARG ARG A . n 
A 1 114 PRO 114 113 113 PRO PRO A . n 
A 1 115 ASP 115 114 114 ASP ASP A . n 
A 1 116 SER 116 115 115 SER SER A . n 
A 1 117 PHE 117 116 116 PHE PHE A . n 
A 1 118 VAL 118 117 117 VAL VAL A . n 
A 1 119 LEU 119 118 118 LEU LEU A . n 
A 1 120 ILE 120 119 119 ILE ILE A . n 
A 1 121 LEU 121 120 120 LEU LEU A . n 
A 1 122 GLU 122 121 121 GLU GLU A . n 
A 1 123 ARG 123 122 122 ARG ARG A . n 
A 1 124 PRO 124 123 123 PRO PRO A . n 
A 1 125 GLU 125 124 124 GLU GLU A . n 
A 1 126 PRO 126 125 125 PRO PRO A . n 
A 1 127 VAL 127 126 126 VAL VAL A . n 
A 1 128 GLN 128 127 127 GLN GLN A . n 
A 1 129 ASP 129 128 128 ASP ASP A . n 
A 1 130 LEU 130 129 129 LEU LEU A . n 
A 1 131 PHE 131 130 130 PHE PHE A . n 
A 1 132 ASP 132 131 131 ASP ASP A . n 
A 1 133 PHE 133 132 132 PHE PHE A . n 
A 1 134 ILE 134 133 133 ILE ILE A . n 
A 1 135 THR 135 134 134 THR THR A . n 
A 1 136 GLU 136 135 135 GLU GLU A . n 
A 1 137 ARG 137 136 136 ARG ARG A . n 
A 1 138 GLY 138 137 137 GLY GLY A . n 
A 1 139 ALA 139 138 138 ALA ALA A . n 
A 1 140 LEU 140 139 139 LEU LEU A . n 
A 1 141 GLN 141 140 140 GLN GLN A . n 
A 1 142 GLU 142 141 141 GLU GLU A . n 
A 1 143 GLU 143 142 142 GLU GLU A . n 
A 1 144 LEU 144 143 143 LEU LEU A . n 
A 1 145 ALA 145 144 144 ALA ALA A . n 
A 1 146 ARG 146 145 145 ARG ARG A . n 
A 1 147 SER 147 146 146 SER SER A . n 
A 1 148 PHE 148 147 147 PHE PHE A . n 
A 1 149 PHE 149 148 148 PHE PHE A . n 
A 1 150 TRP 150 149 149 TRP TRP A . n 
A 1 151 GLN 151 150 150 GLN GLN A . n 
A 1 152 VAL 152 151 151 VAL VAL A . n 
A 1 153 LEU 153 152 152 LEU LEU A . n 
A 1 154 GLU 154 153 153 GLU GLU A . n 
A 1 155 ALA 155 154 154 ALA ALA A . n 
A 1 156 VAL 156 155 155 VAL VAL A . n 
A 1 157 ARG 157 156 156 ARG ARG A . n 
A 1 158 HIS 158 157 157 HIS HIS A . n 
A 1 159 CYS 159 158 158 CYS CYS A . n 
A 1 160 HIS 160 159 159 HIS HIS A . n 
A 1 161 ASN 161 160 160 ASN ASN A . n 
A 1 162 CYS 162 161 161 CYS CYS A . n 
A 1 163 GLY 163 162 162 GLY GLY A . n 
A 1 164 VAL 164 163 163 VAL VAL A . n 
A 1 165 LEU 165 164 164 LEU LEU A . n 
A 1 166 HIS 166 165 165 HIS HIS A . n 
A 1 167 ARG 167 166 166 ARG ARG A . n 
A 1 168 ASP 168 167 167 ASP ASP A . n 
A 1 169 ILE 169 168 168 ILE ILE A . n 
A 1 170 LYS 170 169 169 LYS LYS A . n 
A 1 171 ASP 171 170 170 ASP ASP A . n 
A 1 172 GLU 172 171 171 GLU GLU A . n 
A 1 173 ASN 173 172 172 ASN ASN A . n 
A 1 174 ILE 174 173 173 ILE ILE A . n 
A 1 175 LEU 175 174 174 LEU LEU A . n 
A 1 176 ILE 176 175 175 ILE ILE A . n 
A 1 177 ASP 177 176 176 ASP ASP A . n 
A 1 178 LEU 178 177 177 LEU LEU A . n 
A 1 179 ASN 179 178 178 ASN ASN A . n 
A 1 180 ARG 180 179 179 ARG ARG A . n 
A 1 181 GLY 181 180 180 GLY GLY A . n 
A 1 182 GLU 182 181 181 GLU GLU A . n 
A 1 183 LEU 183 182 182 LEU LEU A . n 
A 1 184 LYS 184 183 183 LYS LYS A . n 
A 1 185 LEU 185 184 184 LEU LEU A . n 
A 1 186 ILE 186 185 185 ILE ILE A . n 
A 1 187 ASP 187 186 186 ASP ASP A . n 
A 1 188 PHE 188 187 187 PHE PHE A . n 
A 1 189 GLY 189 188 188 GLY GLY A . n 
A 1 190 SER 190 189 189 SER SER A . n 
A 1 191 GLY 191 190 190 GLY GLY A . n 
A 1 192 ALA 192 191 191 ALA ALA A . n 
A 1 193 LEU 193 192 192 LEU LEU A . n 
A 1 194 LEU 194 193 193 LEU LEU A . n 
A 1 195 LYS 195 194 194 LYS LYS A . n 
A 1 196 ASP 196 195 195 ASP ASP A . n 
A 1 197 THR 197 196 196 THR THR A . n 
A 1 198 VAL 198 197 197 VAL VAL A . n 
A 1 199 TYR 199 198 198 TYR TYR A . n 
A 1 200 THR 200 199 199 THR THR A . n 
A 1 201 ASP 201 200 200 ASP ASP A . n 
A 1 202 PHE 202 201 201 PHE PHE A . n 
A 1 203 ASP 203 202 202 ASP ASP A . n 
A 1 204 GLY 204 203 203 GLY GLY A . n 
A 1 205 THR 205 204 204 THR THR A . n 
A 1 206 ARG 206 205 205 ARG ARG A . n 
A 1 207 VAL 207 206 206 VAL VAL A . n 
A 1 208 TYR 208 207 207 TYR TYR A . n 
A 1 209 SER 209 208 208 SER SER A . n 
A 1 210 PRO 210 209 209 PRO PRO A . n 
A 1 211 PRO 211 210 210 PRO PRO A . n 
A 1 212 GLU 212 211 211 GLU GLU A . n 
A 1 213 TRP 213 212 212 TRP TRP A . n 
A 1 214 ILE 214 213 213 ILE ILE A . n 
A 1 215 ARG 215 214 214 ARG ARG A . n 
A 1 216 TYR 216 215 215 TYR TYR A . n 
A 1 217 HIS 217 216 216 HIS HIS A . n 
A 1 218 ARG 218 217 217 ARG ARG A . n 
A 1 219 TYR 219 218 218 TYR TYR A . n 
A 1 220 HIS 220 219 219 HIS HIS A . n 
A 1 221 GLY 221 220 220 GLY GLY A . n 
A 1 222 ARG 222 221 221 ARG ARG A . n 
A 1 223 SER 223 222 222 SER SER A . n 
A 1 224 ALA 224 223 223 ALA ALA A . n 
A 1 225 ALA 225 224 224 ALA ALA A . n 
A 1 226 VAL 226 225 225 VAL VAL A . n 
A 1 227 TRP 227 226 226 TRP TRP A . n 
A 1 228 SER 228 227 227 SER SER A . n 
A 1 229 LEU 229 228 228 LEU LEU A . n 
A 1 230 GLY 230 229 229 GLY GLY A . n 
A 1 231 ILE 231 230 230 ILE ILE A . n 
A 1 232 LEU 232 231 231 LEU LEU A . n 
A 1 233 LEU 233 232 232 LEU LEU A . n 
A 1 234 TYR 234 233 233 TYR TYR A . n 
A 1 235 ASP 235 234 234 ASP ASP A . n 
A 1 236 MET 236 235 235 MET MET A . n 
A 1 237 VAL 237 236 236 VAL VAL A . n 
A 1 238 CYS 238 237 237 CYS CYS A . n 
A 1 239 GLY 239 238 238 GLY GLY A . n 
A 1 240 ASP 240 239 239 ASP ASP A . n 
A 1 241 ILE 241 240 240 ILE ILE A . n 
A 1 242 PRO 242 241 241 PRO PRO A . n 
A 1 243 PHE 243 242 242 PHE PHE A . n 
A 1 244 GLU 244 243 243 GLU GLU A . n 
A 1 245 HIS 245 244 244 HIS HIS A . n 
A 1 246 ASP 246 245 245 ASP ASP A . n 
A 1 247 GLU 247 246 246 GLU GLU A . n 
A 1 248 GLU 248 247 247 GLU GLU A . n 
A 1 249 ILE 249 248 248 ILE ILE A . n 
A 1 250 ILE 250 249 249 ILE ILE A . n 
A 1 251 GLY 251 250 250 GLY GLY A . n 
A 1 252 GLY 252 251 251 GLY GLY A . n 
A 1 253 GLN 253 252 252 GLN GLN A . n 
A 1 254 VAL 254 253 253 VAL VAL A . n 
A 1 255 PHE 255 254 254 PHE PHE A . n 
A 1 256 PHE 256 255 255 PHE PHE A . n 
A 1 257 ARG 257 256 256 ARG ARG A . n 
A 1 258 GLN 258 257 257 GLN GLN A . n 
A 1 259 ARG 259 258 258 ARG ARG A . n 
A 1 260 VAL 260 259 259 VAL VAL A . n 
A 1 261 SER 261 260 260 SER SER A . n 
A 1 262 SER 262 261 261 SER SER A . n 
A 1 263 GLU 263 262 262 GLU GLU A . n 
A 1 264 CYS 264 263 263 CYS CYS A . n 
A 1 265 GLN 265 264 264 GLN GLN A . n 
A 1 266 HIS 266 265 265 HIS HIS A . n 
A 1 267 LEU 267 266 266 LEU LEU A . n 
A 1 268 ILE 268 267 267 ILE ILE A . n 
A 1 269 ARG 269 268 268 ARG ARG A . n 
A 1 270 TRP 270 269 269 TRP TRP A . n 
A 1 271 CYS 271 270 270 CYS CYS A . n 
A 1 272 LEU 272 271 271 LEU LEU A . n 
A 1 273 ALA 273 272 272 ALA ALA A . n 
A 1 274 LEU 274 273 273 LEU LEU A . n 
A 1 275 ARG 275 274 274 ARG ARG A . n 
A 1 276 PRO 276 275 275 PRO PRO A . n 
A 1 277 SER 277 276 276 SER SER A . n 
A 1 278 ASP 278 277 277 ASP ASP A . n 
A 1 279 ARG 279 278 278 ARG ARG A . n 
A 1 280 PRO 280 279 279 PRO PRO A . n 
A 1 281 THR 281 280 280 THR THR A . n 
A 1 282 PHE 282 281 281 PHE PHE A . n 
A 1 283 GLU 283 282 282 GLU GLU A . n 
A 1 284 GLU 284 283 283 GLU GLU A . n 
A 1 285 ILE 285 284 284 ILE ILE A . n 
A 1 286 GLN 286 285 285 GLN GLN A . n 
A 1 287 ASN 287 286 286 ASN ASN A . n 
A 1 288 HIS 288 287 287 HIS HIS A . n 
A 1 289 PRO 289 288 288 PRO PRO A . n 
A 1 290 TRP 290 289 289 TRP TRP A . n 
A 1 291 MET 291 290 290 MET MET A . n 
A 1 292 GLN 292 291 291 GLN GLN A . n 
A 1 293 ASP 293 292 292 ASP ASP A . n 
A 1 294 VAL 294 293 293 VAL VAL A . n 
A 1 295 LEU 295 294 294 LEU LEU A . n 
A 1 296 LEU 296 295 295 LEU LEU A . n 
A 1 297 PRO 297 296 296 PRO PRO A . n 
A 1 298 GLN 298 297 297 GLN GLN A . n 
A 1 299 GLU 299 298 298 GLU GLU A . n 
A 1 300 THR 300 299 299 THR THR A . n 
A 1 301 ALA 301 300 300 ALA ALA A . n 
A 1 302 GLU 302 301 301 GLU GLU A . n 
A 1 303 ILE 303 302 302 ILE ILE A . n 
A 1 304 HIS 304 303 303 HIS HIS A . n 
A 1 305 LEU 305 304 304 LEU LEU A . n 
A 1 306 HIS 306 305 305 HIS HIS A . n 
A 1 307 SER 307 306 ?   ?   ?   A . n 
A 1 308 LEU 308 307 ?   ?   ?   A . n 
A 1 309 SER 309 308 ?   ?   ?   A . n 
A 1 310 PRO 310 309 ?   ?   ?   A . n 
A 1 311 GLY 311 310 ?   ?   ?   A . n 
A 1 312 PRO 312 311 ?   ?   ?   A . n 
A 1 313 SER 313 312 ?   ?   ?   A . n 
A 1 314 LYS 314 313 ?   ?   ?   A . n 
B 2 1   ALA 1   1   ?   ?   ?   B . n 
B 2 2   ARG 2   2   2   ARG ARG B . n 
B 2 3   LYS 3   3   3   LYS LYS B . n 
B 2 4   ARG 4   4   4   ARG ARG B . n 
B 2 5   ARG 5   5   5   ARG ARG B . n 
B 2 6   ARG 6   6   6   ARG ARG B . n 
B 2 7   HIS 7   7   7   HIS HIS B . n 
B 2 8   PRO 8   8   8   PRO PRO B . n 
B 2 9   SER 9   9   9   SER SER B . n 
B 2 10  GLY 10  10  10  GLY GLY B . n 
B 2 11  PRO 11  11  ?   ?   ?   B . n 
B 2 12  PRO 12  12  ?   ?   ?   B . n 
B 2 13  THR 13  13  ?   ?   ?   B . n 
B 2 14  ALA 14  14  ?   ?   ?   B . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 CL  1   401 401 CL  CL  A . 
D 4 MB9 1   501 501 MB9 MB9 A . 
E 5 EDO 1   551 551 EDO EDO A . 
F 6 HOH 1   601 601 HOH HOH A . 
F 6 HOH 2   602 2   HOH HOH A . 
F 6 HOH 3   603 3   HOH HOH A . 
F 6 HOH 4   604 4   HOH HOH A . 
F 6 HOH 5   605 5   HOH HOH A . 
F 6 HOH 6   606 6   HOH HOH A . 
F 6 HOH 7   607 7   HOH HOH A . 
F 6 HOH 8   608 8   HOH HOH A . 
F 6 HOH 9   609 9   HOH HOH A . 
F 6 HOH 10  610 10  HOH HOH A . 
F 6 HOH 11  611 11  HOH HOH A . 
F 6 HOH 12  612 12  HOH HOH A . 
F 6 HOH 13  613 13  HOH HOH A . 
F 6 HOH 14  614 14  HOH HOH A . 
F 6 HOH 15  615 15  HOH HOH A . 
F 6 HOH 16  616 16  HOH HOH A . 
F 6 HOH 17  617 17  HOH HOH A . 
F 6 HOH 18  618 18  HOH HOH A . 
F 6 HOH 19  619 19  HOH HOH A . 
F 6 HOH 20  620 20  HOH HOH A . 
F 6 HOH 21  621 22  HOH HOH A . 
F 6 HOH 22  622 23  HOH HOH A . 
F 6 HOH 23  623 24  HOH HOH A . 
F 6 HOH 24  624 25  HOH HOH A . 
F 6 HOH 25  625 26  HOH HOH A . 
F 6 HOH 26  626 27  HOH HOH A . 
F 6 HOH 27  627 28  HOH HOH A . 
F 6 HOH 28  628 29  HOH HOH A . 
F 6 HOH 29  629 30  HOH HOH A . 
F 6 HOH 30  630 31  HOH HOH A . 
F 6 HOH 31  631 32  HOH HOH A . 
F 6 HOH 32  632 33  HOH HOH A . 
F 6 HOH 33  633 34  HOH HOH A . 
F 6 HOH 34  634 36  HOH HOH A . 
F 6 HOH 35  635 37  HOH HOH A . 
F 6 HOH 36  636 38  HOH HOH A . 
F 6 HOH 37  637 39  HOH HOH A . 
F 6 HOH 38  638 40  HOH HOH A . 
F 6 HOH 39  639 41  HOH HOH A . 
F 6 HOH 40  640 42  HOH HOH A . 
F 6 HOH 41  641 43  HOH HOH A . 
F 6 HOH 42  642 44  HOH HOH A . 
F 6 HOH 43  643 45  HOH HOH A . 
F 6 HOH 44  644 46  HOH HOH A . 
F 6 HOH 45  645 48  HOH HOH A . 
F 6 HOH 46  646 49  HOH HOH A . 
F 6 HOH 47  647 50  HOH HOH A . 
F 6 HOH 48  648 51  HOH HOH A . 
F 6 HOH 49  649 52  HOH HOH A . 
F 6 HOH 50  650 53  HOH HOH A . 
F 6 HOH 51  651 54  HOH HOH A . 
F 6 HOH 52  652 55  HOH HOH A . 
F 6 HOH 53  653 56  HOH HOH A . 
F 6 HOH 54  654 57  HOH HOH A . 
F 6 HOH 55  655 58  HOH HOH A . 
F 6 HOH 56  656 59  HOH HOH A . 
F 6 HOH 57  657 60  HOH HOH A . 
F 6 HOH 58  658 61  HOH HOH A . 
F 6 HOH 59  659 62  HOH HOH A . 
F 6 HOH 60  660 63  HOH HOH A . 
F 6 HOH 61  661 64  HOH HOH A . 
F 6 HOH 62  662 65  HOH HOH A . 
F 6 HOH 63  663 66  HOH HOH A . 
F 6 HOH 64  664 67  HOH HOH A . 
F 6 HOH 65  665 68  HOH HOH A . 
F 6 HOH 66  666 69  HOH HOH A . 
F 6 HOH 67  667 70  HOH HOH A . 
F 6 HOH 68  668 72  HOH HOH A . 
F 6 HOH 69  669 73  HOH HOH A . 
F 6 HOH 70  670 74  HOH HOH A . 
F 6 HOH 71  671 75  HOH HOH A . 
F 6 HOH 72  672 76  HOH HOH A . 
F 6 HOH 73  673 77  HOH HOH A . 
F 6 HOH 74  674 78  HOH HOH A . 
F 6 HOH 75  675 79  HOH HOH A . 
F 6 HOH 76  676 80  HOH HOH A . 
F 6 HOH 77  677 81  HOH HOH A . 
F 6 HOH 78  678 82  HOH HOH A . 
F 6 HOH 79  679 83  HOH HOH A . 
F 6 HOH 80  680 84  HOH HOH A . 
F 6 HOH 81  681 85  HOH HOH A . 
F 6 HOH 82  682 87  HOH HOH A . 
F 6 HOH 83  683 88  HOH HOH A . 
F 6 HOH 84  684 89  HOH HOH A . 
F 6 HOH 85  685 90  HOH HOH A . 
F 6 HOH 86  686 91  HOH HOH A . 
F 6 HOH 87  687 93  HOH HOH A . 
F 6 HOH 88  688 94  HOH HOH A . 
F 6 HOH 89  689 95  HOH HOH A . 
F 6 HOH 90  690 96  HOH HOH A . 
F 6 HOH 91  691 97  HOH HOH A . 
F 6 HOH 92  692 98  HOH HOH A . 
F 6 HOH 93  693 99  HOH HOH A . 
F 6 HOH 94  694 100 HOH HOH A . 
F 6 HOH 95  695 102 HOH HOH A . 
F 6 HOH 96  696 103 HOH HOH A . 
F 6 HOH 97  697 104 HOH HOH A . 
F 6 HOH 98  698 105 HOH HOH A . 
F 6 HOH 99  699 107 HOH HOH A . 
F 6 HOH 100 700 108 HOH HOH A . 
F 6 HOH 101 701 109 HOH HOH A . 
F 6 HOH 102 702 110 HOH HOH A . 
F 6 HOH 103 703 111 HOH HOH A . 
F 6 HOH 104 704 112 HOH HOH A . 
F 6 HOH 105 705 113 HOH HOH A . 
F 6 HOH 106 706 114 HOH HOH A . 
F 6 HOH 107 707 115 HOH HOH A . 
F 6 HOH 108 708 116 HOH HOH A . 
F 6 HOH 109 709 117 HOH HOH A . 
F 6 HOH 110 710 118 HOH HOH A . 
F 6 HOH 111 711 119 HOH HOH A . 
F 6 HOH 112 712 120 HOH HOH A . 
F 6 HOH 113 713 121 HOH HOH A . 
F 6 HOH 114 714 122 HOH HOH A . 
F 6 HOH 115 715 123 HOH HOH A . 
F 6 HOH 116 716 126 HOH HOH A . 
F 6 HOH 117 717 127 HOH HOH A . 
F 6 HOH 118 718 128 HOH HOH A . 
F 6 HOH 119 719 129 HOH HOH A . 
F 6 HOH 120 720 130 HOH HOH A . 
F 6 HOH 121 721 131 HOH HOH A . 
F 6 HOH 122 722 132 HOH HOH A . 
F 6 HOH 123 723 133 HOH HOH A . 
F 6 HOH 124 724 138 HOH HOH A . 
F 6 HOH 125 725 139 HOH HOH A . 
F 6 HOH 126 726 140 HOH HOH A . 
F 6 HOH 127 727 143 HOH HOH A . 
F 6 HOH 128 728 144 HOH HOH A . 
F 6 HOH 129 729 145 HOH HOH A . 
F 6 HOH 130 730 146 HOH HOH A . 
F 6 HOH 131 731 147 HOH HOH A . 
F 6 HOH 132 732 148 HOH HOH A . 
F 6 HOH 133 733 149 HOH HOH A . 
F 6 HOH 134 734 150 HOH HOH A . 
F 6 HOH 135 735 151 HOH HOH A . 
F 6 HOH 136 736 152 HOH HOH A . 
F 6 HOH 137 737 153 HOH HOH A . 
F 6 HOH 138 738 154 HOH HOH A . 
F 6 HOH 139 739 155 HOH HOH A . 
F 6 HOH 140 740 156 HOH HOH A . 
F 6 HOH 141 741 157 HOH HOH A . 
F 6 HOH 142 742 158 HOH HOH A . 
F 6 HOH 143 743 160 HOH HOH A . 
F 6 HOH 144 744 161 HOH HOH A . 
F 6 HOH 145 745 162 HOH HOH A . 
F 6 HOH 146 746 163 HOH HOH A . 
F 6 HOH 147 747 164 HOH HOH A . 
F 6 HOH 148 748 165 HOH HOH A . 
F 6 HOH 149 749 166 HOH HOH A . 
F 6 HOH 150 750 167 HOH HOH A . 
F 6 HOH 151 751 168 HOH HOH A . 
F 6 HOH 152 752 169 HOH HOH A . 
F 6 HOH 153 753 170 HOH HOH A . 
F 6 HOH 154 754 171 HOH HOH A . 
F 6 HOH 155 755 172 HOH HOH A . 
F 6 HOH 156 756 173 HOH HOH A . 
F 6 HOH 157 757 174 HOH HOH A . 
F 6 HOH 158 758 175 HOH HOH A . 
F 6 HOH 159 759 176 HOH HOH A . 
F 6 HOH 160 760 178 HOH HOH A . 
F 6 HOH 161 761 181 HOH HOH A . 
F 6 HOH 162 762 183 HOH HOH A . 
F 6 HOH 163 763 184 HOH HOH A . 
F 6 HOH 164 764 186 HOH HOH A . 
F 6 HOH 165 765 187 HOH HOH A . 
F 6 HOH 166 766 188 HOH HOH A . 
F 6 HOH 167 767 189 HOH HOH A . 
F 6 HOH 168 768 190 HOH HOH A . 
F 6 HOH 169 769 191 HOH HOH A . 
F 6 HOH 170 770 193 HOH HOH A . 
F 6 HOH 171 771 196 HOH HOH A . 
F 6 HOH 172 772 197 HOH HOH A . 
F 6 HOH 173 773 198 HOH HOH A . 
F 6 HOH 174 774 199 HOH HOH A . 
F 6 HOH 175 775 200 HOH HOH A . 
F 6 HOH 176 776 201 HOH HOH A . 
F 6 HOH 177 777 202 HOH HOH A . 
F 6 HOH 178 778 203 HOH HOH A . 
F 6 HOH 179 779 204 HOH HOH A . 
F 6 HOH 180 780 205 HOH HOH A . 
F 6 HOH 181 781 206 HOH HOH A . 
F 6 HOH 182 782 207 HOH HOH A . 
F 6 HOH 183 783 208 HOH HOH A . 
F 6 HOH 184 784 209 HOH HOH A . 
F 6 HOH 185 785 210 HOH HOH A . 
F 6 HOH 186 786 211 HOH HOH A . 
F 6 HOH 187 787 212 HOH HOH A . 
F 6 HOH 188 788 213 HOH HOH A . 
F 6 HOH 189 789 214 HOH HOH A . 
F 6 HOH 190 790 215 HOH HOH A . 
F 6 HOH 191 791 216 HOH HOH A . 
F 6 HOH 192 792 217 HOH HOH A . 
F 6 HOH 193 793 218 HOH HOH A . 
F 6 HOH 194 794 219 HOH HOH A . 
F 6 HOH 195 795 220 HOH HOH A . 
F 6 HOH 196 796 222 HOH HOH A . 
F 6 HOH 197 797 223 HOH HOH A . 
F 6 HOH 198 798 224 HOH HOH A . 
F 6 HOH 199 799 225 HOH HOH A . 
F 6 HOH 200 800 226 HOH HOH A . 
G 6 HOH 1   92  92  HOH HOH B . 
G 6 HOH 2   106 106 HOH HOH B . 
G 6 HOH 3   124 124 HOH HOH B . 
G 6 HOH 4   137 137 HOH HOH B . 
G 6 HOH 5   141 141 HOH HOH B . 
G 6 HOH 6   142 142 HOH HOH B . 
G 6 HOH 7   221 221 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1120  ? 
1 MORE         2.7   ? 
1 'SSA (A^2)'  12940 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-07-15 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2012-01-18 
4 'Structure model' 1 3 2013-06-19 
5 'Structure model' 1 4 2017-10-25 
6 'Structure model' 1 5 2021-10-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                     
2 2 'Structure model' 'Version format compliance'  
3 3 'Structure model' 'Database references'        
4 4 'Structure model' 'Database references'        
5 5 'Structure model' 'Author supporting evidence' 
6 6 'Structure model' 'Database references'        
7 6 'Structure model' 'Derived calculations'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 5 'Structure model' pdbx_struct_assembly_auth_evidence 
2 6 'Structure model' database_2                         
3 6 'Structure model' struct_ref_seq_dif                 
4 6 'Structure model' struct_site                        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 6 'Structure model' '_database_2.pdbx_DOI'                
2 6 'Structure model' '_database_2.pdbx_database_accession' 
3 6 'Structure model' '_struct_ref_seq_dif.details'         
4 6 'Structure model' '_struct_site.pdbx_auth_asym_id'      
5 6 'Structure model' '_struct_site.pdbx_auth_comp_id'      
6 6 'Structure model' '_struct_site.pdbx_auth_seq_id'       
# 
_diffrn_reflns.diffrn_id                   1 
_diffrn_reflns.pdbx_d_res_high             1.635 
_diffrn_reflns.pdbx_d_res_low              32.297 
_diffrn_reflns.pdbx_number_obs             29963 
_diffrn_reflns.pdbx_Rmerge_I_obs           0.075 
_diffrn_reflns.pdbx_Rsym_value             0.075 
_diffrn_reflns.pdbx_chi_squared            ? 
_diffrn_reflns.av_sigmaI_over_netI         8.40 
_diffrn_reflns.pdbx_redundancy             5.20 
_diffrn_reflns.pdbx_percent_possible_obs   100.00 
_diffrn_reflns.number                      155741 
_diffrn_reflns.pdbx_observed_criterion     ? 
_diffrn_reflns.limit_h_max                 ? 
_diffrn_reflns.limit_h_min                 ? 
_diffrn_reflns.limit_k_max                 ? 
_diffrn_reflns.limit_k_min                 ? 
_diffrn_reflns.limit_l_max                 ? 
_diffrn_reflns.limit_l_min                 ? 
# 
loop_
_pdbx_diffrn_reflns_shell.diffrn_id 
_pdbx_diffrn_reflns_shell.d_res_high 
_pdbx_diffrn_reflns_shell.d_res_low 
_pdbx_diffrn_reflns_shell.number_obs 
_pdbx_diffrn_reflns_shell.rejects 
_pdbx_diffrn_reflns_shell.Rmerge_I_obs 
_pdbx_diffrn_reflns_shell.Rsym_value 
_pdbx_diffrn_reflns_shell.chi_squared 
_pdbx_diffrn_reflns_shell.redundancy 
_pdbx_diffrn_reflns_shell.percent_possible_obs 
1 6.36 32.30 ? ? 0.033 0.033 ? 4.90 99.30  
1 4.49 6.36  ? ? 0.034 0.034 ? 5.20 100.00 
1 3.67 4.49  ? ? 0.040 0.040 ? 5.30 100.00 
1 3.18 3.67  ? ? 0.051 0.051 ? 5.30 100.00 
1 2.84 3.18  ? ? 0.078 0.078 ? 5.30 100.00 
1 2.59 2.84  ? ? 0.126 0.126 ? 5.20 100.00 
1 2.40 2.59  ? ? 0.194 0.194 ? 5.20 100.00 
1 2.25 2.40  ? ? 0.280 0.280 ? 5.20 100.00 
1 2.12 2.25  ? ? 0.453 0.453 ? 5.20 100.00 
1 2.01 2.12  ? ? 0.704 0.704 ? 5.10 100.00 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined -23.2550 31.0180 5.9130  0.1114  0.1512  -0.0110 -0.1897 -0.0384 0.0307  8.9961 7.0279 6.8020 -0.9528 1.6370  1.5283  
-0.0432 0.0652  -0.0220 -0.3664 -0.3256 0.3863  0.8198  0.9173 -0.4977 'X-RAY DIFFRACTION' 
2 ? refined -17.1180 37.6220 5.5120  -0.0348 0.0536  -0.0266 -0.0812 -0.0384 0.0054  1.5016 1.3242 2.9587 0.8437  -0.4046 -0.3991 
0.1470  -0.0426 -0.1044 -0.1414 -0.0834 0.2243  0.0950  0.4611 -0.4561 'X-RAY DIFFRACTION' 
3 ? refined -1.0590  45.0410 -1.1920 -0.0769 -0.0472 -0.0591 0.0000  -0.0266 -0.0104 0.6165 1.3525 1.6008 0.0457  -0.0453 -0.2527 
0.0346  0.0351  -0.0697 -0.0160 0.0076  -0.0575 -0.0250 0.0606 0.0361  'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A A 81  ? 33  A 34  A 82  'X-RAY DIFFRACTION' ? 
2 2 A A 140 ? 84  A 85  A 141 'X-RAY DIFFRACTION' ? 
3 3 A A 305 ? 141 A 142 A 306 'X-RAY DIFFRACTION' ? 
# 
_pdbx_phasing_MR.entry_id                     3CY2 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                'Phaser MODE: MR_AUTO' 
_pdbx_phasing_MR.R_factor                     ? 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          2.500 
_pdbx_phasing_MR.d_res_low_rotation           29.420 
_pdbx_phasing_MR.d_res_high_translation       2.180 
_pdbx_phasing_MR.d_res_low_translation        29.420 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
_phasing.method   MR 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
SCALA        3.2.25 21/9/2006            other   'Phil Evans'      pre@mrc-lmb.cam.ac.uk       'data scaling'    
http://www.ccp4.ac.uk/dist/html/INDEX.html  Fortran_77 ? 1 
PHASER       .      ?                    other   'R. J. Read'      cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/ ?          ? 2 
REFMAC       .      ?                    program 'Murshudov, G.N.' ccp4@dl.ac.uk               refinement        
http://www.ccp4.ac.uk/main.html             Fortran_77 ? 3 
PDB_EXTRACT  3.005  'September 10, 2007' package PDB               sw-help@rcsb.rutgers.edu    'data extraction' 
http://pdb.rutgers.edu/software/            C++        ? 4 
CrystalClear .      ?                    ?       ?                 ?                           'data collection' ? ?          ? 5 
MOSFLM       .      ?                    ?       ?                 ?                           'data reduction'  ? ?          ? 6 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    618 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    665 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.14 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 SER A 98  ? ? 179.82  165.85 
2 1 ASP A 167 ? ? -147.79 44.94  
3 1 ASP A 176 ? ? -69.99  99.41  
4 1 ASP A 186 ? ? 64.46   78.27  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A SER 36 ? OG  ? A SER 37 OG  
2  1 Y 1 A GLN 39 ? CD  ? A GLN 40 CD  
3  1 Y 1 A GLN 39 ? OE1 ? A GLN 40 OE1 
4  1 Y 1 A GLN 39 ? NE2 ? A GLN 40 NE2 
5  1 Y 1 A ASP 72 ? OD1 ? A ASP 73 OD1 
6  1 Y 1 A ASP 72 ? OD2 ? A ASP 73 OD2 
7  1 Y 1 A ARG 73 ? NH1 ? A ARG 74 NH1 
8  1 Y 1 A ARG 73 ? NH2 ? A ARG 74 NH2 
9  1 Y 1 A GLU 79 ? CG  ? A GLU 80 CG  
10 1 Y 1 A GLU 79 ? CD  ? A GLU 80 CD  
11 1 Y 1 A GLU 79 ? OE1 ? A GLU 80 OE1 
12 1 Y 1 A GLU 79 ? OE2 ? A GLU 80 OE2 
13 1 Y 1 A THR 84 ? OG1 ? A THR 85 OG1 
14 1 Y 1 A THR 84 ? CG2 ? A THR 85 CG2 
15 1 Y 1 A LYS 94 ? CE  ? A LYS 95 CE  
16 1 Y 1 A LYS 94 ? NZ  ? A LYS 95 NZ  
17 1 Y 1 B LYS 3  ? CD  ? B LYS 3  CD  
18 1 Y 1 B LYS 3  ? CE  ? B LYS 3  CE  
19 1 Y 1 B LYS 3  ? NZ  ? B LYS 3  NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 0   ? A SER 1   
2  1 Y 1 A MET 1   ? A MET 2   
3  1 Y 1 A LEU 2   ? A LEU 3   
4  1 Y 1 A LEU 3   ? A LEU 4   
5  1 Y 1 A SER 4   ? A SER 5   
6  1 Y 1 A LYS 5   ? A LYS 6   
7  1 Y 1 A ILE 6   ? A ILE 7   
8  1 Y 1 A ASN 7   ? A ASN 8   
9  1 Y 1 A SER 8   ? A SER 9   
10 1 Y 1 A LEU 9   ? A LEU 10  
11 1 Y 1 A ALA 10  ? A ALA 11  
12 1 Y 1 A HIS 11  ? A HIS 12  
13 1 Y 1 A LEU 12  ? A LEU 13  
14 1 Y 1 A ARG 13  ? A ARG 14  
15 1 Y 1 A ALA 14  ? A ALA 15  
16 1 Y 1 A ALA 15  ? A ALA 16  
17 1 Y 1 A PRO 16  ? A PRO 17  
18 1 Y 1 A CYS 17  ? A CYS 18  
19 1 Y 1 A ASN 18  ? A ASN 19  
20 1 Y 1 A ASP 19  ? A ASP 20  
21 1 Y 1 A LEU 20  ? A LEU 21  
22 1 Y 1 A HIS 21  ? A HIS 22  
23 1 Y 1 A ALA 22  ? A ALA 23  
24 1 Y 1 A THR 23  ? A THR 24  
25 1 Y 1 A LYS 24  ? A LYS 25  
26 1 Y 1 A LEU 25  ? A LEU 26  
27 1 Y 1 A ALA 26  ? A ALA 27  
28 1 Y 1 A PRO 27  ? A PRO 28  
29 1 Y 1 A GLY 28  ? A GLY 29  
30 1 Y 1 A LYS 29  ? A LYS 30  
31 1 Y 1 A GLU 30  ? A GLU 31  
32 1 Y 1 A LYS 31  ? A LYS 32  
33 1 Y 1 A GLU 32  ? A GLU 33  
34 1 Y 1 A ASN 82  ? A ASN 83  
35 1 Y 1 A GLY 83  ? A GLY 84  
36 1 Y 1 A SER 306 ? A SER 307 
37 1 Y 1 A LEU 307 ? A LEU 308 
38 1 Y 1 A SER 308 ? A SER 309 
39 1 Y 1 A PRO 309 ? A PRO 310 
40 1 Y 1 A GLY 310 ? A GLY 311 
41 1 Y 1 A PRO 311 ? A PRO 312 
42 1 Y 1 A SER 312 ? A SER 313 
43 1 Y 1 A LYS 313 ? A LYS 314 
44 1 Y 1 B ALA 1   ? B ALA 1   
45 1 Y 1 B PRO 11  ? B PRO 11  
46 1 Y 1 B PRO 12  ? B PRO 12  
47 1 Y 1 B THR 13  ? B THR 13  
48 1 Y 1 B ALA 14  ? B ALA 14  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'CHLORIDE ION'                                                                                        CL  
4 "(4R)-7-chloro-9-methyl-1-oxo-1,2,4,9-tetrahydrospiro[beta-carboline-3,4'-piperidine]-4-carbonitrile" MB9 
5 1,2-ETHANEDIOL                                                                                        EDO 
6 water                                                                                                 HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#