data_3CY3
# 
_entry.id   3CY3 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.355 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   3CY3         pdb_00003cy3 10.2210/pdb3cy3/pdb 
RCSB  RCSB047354   ?            ?                   
WWPDB D_1000047354 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3CXW 
;Crystal structure of human proto-oncogene serine threonine kinase (PIM1) in complex with a consensus peptide and a beta carboline ligand I
;
unspecified 
PDB 3CY2 
;Crystal structure of human proto-oncogene serine threonine kinase (PIM1) in complex with a consensus peptide and a beta carboline ligand II
;
unspecified 
# 
_pdbx_database_status.entry_id                        3CY3 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2008-04-25 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Filippakopoulos, P.'                  1  
'Bullock, A.'                          2  
'Fedorov, O.'                          3  
'Pike, A.C.W.'                         4  
'von Delft, F.'                        5  
'Arrowsmith, C.H.'                     6  
'Edwards, A.M.'                        7  
'Bountra, C.'                          8  
'Knapp, S.'                            9  
'Structural Genomics Consortium (SGC)' 10 
# 
_citation.id                        primary 
_citation.title                     
'Proto-oncogene serine threonine kinase (PIM1) in complex with a consensus peptide and the JNK inhibitor V.' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Filippakopoulos, P.' 1 ? 
primary 'Bullock, A.'         2 ? 
primary 'Fedorov, O.'         3 ? 
primary 'Pike, A.C.W.'        4 ? 
primary 'von Delft, F.'       5 ? 
primary 'Arrowsmith, C.H.'    6 ? 
primary 'Edwards, A.M.'       7 ? 
primary 'Bountra, C.'         8 ? 
primary 'Knapp, S.'           9 ? 
# 
_cell.length_a           98.239 
_cell.length_b           98.239 
_cell.length_c           80.723 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        120.000 
_cell.entry_id           3CY3 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              6 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 65' 
_symmetry.entry_id                         3CY3 
_symmetry.Int_Tables_number                170 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Serine/threonine-protein kinase pim-1'                                                 35799.656 1   2.7.11.1 
R250G ? ? 
2 polymer     syn 'Pimtide peptide'                                                                       1592.850  1   ?        ? 
? ? 
3 non-polymer syn 1,2-ETHANEDIOL                                                                          62.068    1   ?        ? 
? ? 
4 non-polymer syn '(2S)-1,3-benzothiazol-2-yl{2-[(2-pyridin-3-ylethyl)amino]pyrimidin-4-yl}ethanenitrile' 372.446   1   ?        ? 
? ? 
5 water       nat water                                                                                   18.015    218 ?        ? 
? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no yes 
;SMLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGE
LPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCH
NCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGD
IPFEHDEEIIGGQVFFRQRVS(SEP)ECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK
;
;SMLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGE
LPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCH
NCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGD
IPFEHDEEIIGGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK
;
A ? 
2 'polypeptide(L)' no no  ARKRRRHPSGPPTA ARKRRRHPSGPPTA B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   MET n 
1 3   LEU n 
1 4   LEU n 
1 5   SER n 
1 6   LYS n 
1 7   ILE n 
1 8   ASN n 
1 9   SER n 
1 10  LEU n 
1 11  ALA n 
1 12  HIS n 
1 13  LEU n 
1 14  ARG n 
1 15  ALA n 
1 16  ALA n 
1 17  PRO n 
1 18  CYS n 
1 19  ASN n 
1 20  ASP n 
1 21  LEU n 
1 22  HIS n 
1 23  ALA n 
1 24  THR n 
1 25  LYS n 
1 26  LEU n 
1 27  ALA n 
1 28  PRO n 
1 29  GLY n 
1 30  LYS n 
1 31  GLU n 
1 32  LYS n 
1 33  GLU n 
1 34  PRO n 
1 35  LEU n 
1 36  GLU n 
1 37  SER n 
1 38  GLN n 
1 39  TYR n 
1 40  GLN n 
1 41  VAL n 
1 42  GLY n 
1 43  PRO n 
1 44  LEU n 
1 45  LEU n 
1 46  GLY n 
1 47  SER n 
1 48  GLY n 
1 49  GLY n 
1 50  PHE n 
1 51  GLY n 
1 52  SER n 
1 53  VAL n 
1 54  TYR n 
1 55  SER n 
1 56  GLY n 
1 57  ILE n 
1 58  ARG n 
1 59  VAL n 
1 60  SER n 
1 61  ASP n 
1 62  ASN n 
1 63  LEU n 
1 64  PRO n 
1 65  VAL n 
1 66  ALA n 
1 67  ILE n 
1 68  LYS n 
1 69  HIS n 
1 70  VAL n 
1 71  GLU n 
1 72  LYS n 
1 73  ASP n 
1 74  ARG n 
1 75  ILE n 
1 76  SER n 
1 77  ASP n 
1 78  TRP n 
1 79  GLY n 
1 80  GLU n 
1 81  LEU n 
1 82  PRO n 
1 83  ASN n 
1 84  GLY n 
1 85  THR n 
1 86  ARG n 
1 87  VAL n 
1 88  PRO n 
1 89  MET n 
1 90  GLU n 
1 91  VAL n 
1 92  VAL n 
1 93  LEU n 
1 94  LEU n 
1 95  LYS n 
1 96  LYS n 
1 97  VAL n 
1 98  SER n 
1 99  SER n 
1 100 GLY n 
1 101 PHE n 
1 102 SER n 
1 103 GLY n 
1 104 VAL n 
1 105 ILE n 
1 106 ARG n 
1 107 LEU n 
1 108 LEU n 
1 109 ASP n 
1 110 TRP n 
1 111 PHE n 
1 112 GLU n 
1 113 ARG n 
1 114 PRO n 
1 115 ASP n 
1 116 SER n 
1 117 PHE n 
1 118 VAL n 
1 119 LEU n 
1 120 ILE n 
1 121 LEU n 
1 122 GLU n 
1 123 ARG n 
1 124 PRO n 
1 125 GLU n 
1 126 PRO n 
1 127 VAL n 
1 128 GLN n 
1 129 ASP n 
1 130 LEU n 
1 131 PHE n 
1 132 ASP n 
1 133 PHE n 
1 134 ILE n 
1 135 THR n 
1 136 GLU n 
1 137 ARG n 
1 138 GLY n 
1 139 ALA n 
1 140 LEU n 
1 141 GLN n 
1 142 GLU n 
1 143 GLU n 
1 144 LEU n 
1 145 ALA n 
1 146 ARG n 
1 147 SER n 
1 148 PHE n 
1 149 PHE n 
1 150 TRP n 
1 151 GLN n 
1 152 VAL n 
1 153 LEU n 
1 154 GLU n 
1 155 ALA n 
1 156 VAL n 
1 157 ARG n 
1 158 HIS n 
1 159 CYS n 
1 160 HIS n 
1 161 ASN n 
1 162 CYS n 
1 163 GLY n 
1 164 VAL n 
1 165 LEU n 
1 166 HIS n 
1 167 ARG n 
1 168 ASP n 
1 169 ILE n 
1 170 LYS n 
1 171 ASP n 
1 172 GLU n 
1 173 ASN n 
1 174 ILE n 
1 175 LEU n 
1 176 ILE n 
1 177 ASP n 
1 178 LEU n 
1 179 ASN n 
1 180 ARG n 
1 181 GLY n 
1 182 GLU n 
1 183 LEU n 
1 184 LYS n 
1 185 LEU n 
1 186 ILE n 
1 187 ASP n 
1 188 PHE n 
1 189 GLY n 
1 190 SER n 
1 191 GLY n 
1 192 ALA n 
1 193 LEU n 
1 194 LEU n 
1 195 LYS n 
1 196 ASP n 
1 197 THR n 
1 198 VAL n 
1 199 TYR n 
1 200 THR n 
1 201 ASP n 
1 202 PHE n 
1 203 ASP n 
1 204 GLY n 
1 205 THR n 
1 206 ARG n 
1 207 VAL n 
1 208 TYR n 
1 209 SER n 
1 210 PRO n 
1 211 PRO n 
1 212 GLU n 
1 213 TRP n 
1 214 ILE n 
1 215 ARG n 
1 216 TYR n 
1 217 HIS n 
1 218 ARG n 
1 219 TYR n 
1 220 HIS n 
1 221 GLY n 
1 222 ARG n 
1 223 SER n 
1 224 ALA n 
1 225 ALA n 
1 226 VAL n 
1 227 TRP n 
1 228 SER n 
1 229 LEU n 
1 230 GLY n 
1 231 ILE n 
1 232 LEU n 
1 233 LEU n 
1 234 TYR n 
1 235 ASP n 
1 236 MET n 
1 237 VAL n 
1 238 CYS n 
1 239 GLY n 
1 240 ASP n 
1 241 ILE n 
1 242 PRO n 
1 243 PHE n 
1 244 GLU n 
1 245 HIS n 
1 246 ASP n 
1 247 GLU n 
1 248 GLU n 
1 249 ILE n 
1 250 ILE n 
1 251 GLY n 
1 252 GLY n 
1 253 GLN n 
1 254 VAL n 
1 255 PHE n 
1 256 PHE n 
1 257 ARG n 
1 258 GLN n 
1 259 ARG n 
1 260 VAL n 
1 261 SER n 
1 262 SEP n 
1 263 GLU n 
1 264 CYS n 
1 265 GLN n 
1 266 HIS n 
1 267 LEU n 
1 268 ILE n 
1 269 ARG n 
1 270 TRP n 
1 271 CYS n 
1 272 LEU n 
1 273 ALA n 
1 274 LEU n 
1 275 ARG n 
1 276 PRO n 
1 277 SER n 
1 278 ASP n 
1 279 ARG n 
1 280 PRO n 
1 281 THR n 
1 282 PHE n 
1 283 GLU n 
1 284 GLU n 
1 285 ILE n 
1 286 GLN n 
1 287 ASN n 
1 288 HIS n 
1 289 PRO n 
1 290 TRP n 
1 291 MET n 
1 292 GLN n 
1 293 ASP n 
1 294 VAL n 
1 295 LEU n 
1 296 LEU n 
1 297 PRO n 
1 298 GLN n 
1 299 GLU n 
1 300 THR n 
1 301 ALA n 
1 302 GLU n 
1 303 ILE n 
1 304 HIS n 
1 305 LEU n 
1 306 HIS n 
1 307 SER n 
1 308 LEU n 
1 309 SER n 
1 310 PRO n 
1 311 GLY n 
1 312 PRO n 
1 313 SER n 
1 314 LYS n 
2 1   ALA n 
2 2   ARG n 
2 3   LYS n 
2 4   ARG n 
2 5   ARG n 
2 6   ARG n 
2 7   HIS n 
2 8   PRO n 
2 9   SER n 
2 10  GLY n 
2 11  PRO n 
2 12  PRO n 
2 13  THR n 
2 14  ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   314 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 PIM1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)-R3' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pNIC28-Bsa4 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       14 
_pdbx_entity_src_syn.organism_scientific    'synthetic construct' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       32630 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP PIM1_HUMAN P11309 ? 1 
;MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGEL
PNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHN
CGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK
;
1 
2 PDB 3CY3       3CY3   ? 2 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3CY3 A 2 ? 314 ? P11309 1 ? 313 ? 1 313 
2 2 3CY3 B 1 ? 14  ? 3CY3   1 ? 14  ? 1 14  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3CY3 SER A 1   ? UNP P11309 ?   ?   'expression tag'      0   1 
1 3CY3 GLY A 251 ? UNP P11309 ARG 250 'engineered mutation' 250 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                                 ? 'C3 H7 N O2' 
89.093  
ARG 'L-peptide linking' y ARGININE                                                                                ? 
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                              ? 'C4 H8 N2 O3' 
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                         ? 'C4 H7 N O4' 
133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                                ? 'C3 H7 N O2 S' 
121.158 
EDO non-polymer         . 1,2-ETHANEDIOL                                                                          
'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE                                                                               ? 'C5 H10 N2 O3' 
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                         ? 'C5 H9 N O4' 
147.129 
GLY 'peptide linking'   y GLYCINE                                                                                 ? 'C2 H5 N O2' 
75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                               ? 
'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                                                   ? 'H2 O' 18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                              ? 'C6 H13 N O2' 
131.173 
JN5 non-polymer         . '(2S)-1,3-benzothiazol-2-yl{2-[(2-pyridin-3-ylethyl)amino]pyrimidin-4-yl}ethanenitrile' ? 'C20 H16 N6 S' 
372.446 
LEU 'L-peptide linking' y LEUCINE                                                                                 ? 'C6 H13 N O2' 
131.173 
LYS 'L-peptide linking' y LYSINE                                                                                  ? 
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                                              ? 
'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                           ? 'C9 H11 N O2' 
165.189 
PRO 'L-peptide linking' y PROLINE                                                                                 ? 'C5 H9 N O2' 
115.130 
SEP 'L-peptide linking' n PHOSPHOSERINE                                                                           PHOSPHONOSERINE 
'C3 H8 N O6 P'   185.072 
SER 'L-peptide linking' y SERINE                                                                                  ? 'C3 H7 N O3' 
105.093 
THR 'L-peptide linking' y THREONINE                                                                               ? 'C4 H9 N O3' 
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                              ? 
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                ? 'C9 H11 N O3' 
181.189 
VAL 'L-peptide linking' y VALINE                                                                                  ? 'C5 H11 N O2' 
117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3CY3 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      3.01 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   59.10 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'9 % PEG 10000, 7.2 % Ethylene glycol, 0.09 M HEPES pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2007-09-13 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54178 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU FR-E+ SUPERBRIGHT' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.54178 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
# 
_reflns.entry_id                     3CY3 
_reflns.d_resolution_high            2.15 
_reflns.d_resolution_low             31.189 
_reflns.number_all                   ? 
_reflns.number_obs                   24190 
_reflns.pdbx_Rmerge_I_obs            0.103 
_reflns.pdbx_netI_over_sigmaI        7.200 
_reflns.pdbx_Rsym_value              0.103 
_reflns.pdbx_redundancy              4.900 
_reflns.percent_possible_obs         100.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.15 
_reflns_shell.d_res_low              2.27 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.Rmerge_I_obs           0.747 
_reflns_shell.meanI_over_sigI_obs    1.0 
_reflns_shell.pdbx_Rsym_value        0.747 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_redundancy        4.80 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      3511 
_reflns_shell.percent_possible_all   100.00 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3CY3 
_refine.ls_d_res_high                            2.150 
_refine.ls_d_res_low                             31.189 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    99.950 
_refine.ls_number_reflns_obs                     24159 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.ls_R_factor_obs                          0.165 
_refine.ls_R_factor_R_work                       0.163 
_refine.ls_R_factor_R_free                       0.205 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  1208 
_refine.B_iso_mean                               28.525 
_refine.aniso_B[1][1]                            0.180 
_refine.aniso_B[2][2]                            0.180 
_refine.aniso_B[3][3]                            -0.280 
_refine.aniso_B[1][2]                            0.090 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.962 
_refine.correlation_coeff_Fo_to_Fc_free          0.941 
_refine.pdbx_overall_ESU_R                       0.158 
_refine.pdbx_overall_ESU_R_Free                  0.149 
_refine.overall_SU_ML                            0.104 
_refine.overall_SU_B                             7.223 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     24159 
_refine.ls_R_factor_all                          0.165 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_starting_model                      'PDB entry 2C3I' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2260 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         31 
_refine_hist.number_atoms_solvent             218 
_refine_hist.number_atoms_total               2509 
_refine_hist.d_res_high                       2.150 
_refine_hist.d_res_low                        31.189 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       2353 0.015  0.021  ? 'X-RAY DIFFRACTION' ? 
r_bond_other_d         1637 0.001  0.020  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    3188 1.464  1.962  ? 'X-RAY DIFFRACTION' ? 
r_angle_other_deg      3920 1.001  3.001  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 276  6.150  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 117  32.524 22.821 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 383  12.729 15.039 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 23   15.981 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr         335  0.090  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   2602 0.006  0.021  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_other     507  0.001  0.020  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it            1388 2.506  3.000  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_other         563  0.788  3.000  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it           2242 3.672  5.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it            965  6.267  8.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it           946  7.909  11.000 ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.150 
_refine_ls_shell.d_res_low                        2.206 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               100.000 
_refine_ls_shell.number_reflns_R_work             1680 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.244 
_refine_ls_shell.R_factor_R_free                  0.311 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             78 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                1758 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3CY3 
_struct.title                     
;Crystal structure of human proto-oncogene serine threonine kinase (PIM1) in complex with a consensus peptide and the JNK inhibitor V
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3CY3 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;oncogene, kinase, serine-threonine, PIM1, Structural Genomics Consortium, SGC, Alternative initiation, ATP-binding, Manganese, Membrane, Metal-binding, Nucleotide-binding, Nucleus, Phosphoprotein, Proto-oncogene, Serine/threonine-protein kinase, Transferase, Host-virus interaction, Viral immunoevasion, Virion, Virulence
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   
;AUTHORS STATE THAT BY GEL FILTRATION THE PROTEIN APPEARS TO BE MONOMERIC. THE BIOLOGICAL ASSEMBLY SHOWN IN REMARK 350 IS A MONOMERIC COMPLEX BETWEEN THE PROTEIN AND THE CONSENSUS PEPTIDE.
;
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 34  ? SER A 37  ? PRO A 33  SER A 36  5 ? 4  
HELX_P HELX_P2  2  ASP A 73  ? ILE A 75  ? ASP A 72  ILE A 74  5 ? 3  
HELX_P HELX_P3  3  MET A 89  ? SER A 98  ? MET A 88  SER A 97  1 ? 10 
HELX_P HELX_P4  4  LEU A 130 ? GLY A 138 ? LEU A 129 GLY A 137 1 ? 9  
HELX_P HELX_P5  5  GLN A 141 ? CYS A 162 ? GLN A 140 CYS A 161 1 ? 22 
HELX_P HELX_P6  6  LYS A 170 ? GLU A 172 ? LYS A 169 GLU A 171 5 ? 3  
HELX_P HELX_P7  7  THR A 205 ? SER A 209 ? THR A 204 SER A 208 5 ? 5  
HELX_P HELX_P8  8  PRO A 210 ? HIS A 217 ? PRO A 209 HIS A 216 1 ? 8  
HELX_P HELX_P9  9  HIS A 220 ? GLY A 239 ? HIS A 219 GLY A 238 1 ? 20 
HELX_P HELX_P10 10 HIS A 245 ? GLY A 252 ? HIS A 244 GLY A 251 1 ? 8  
HELX_P HELX_P11 11 SER A 261 ? LEU A 272 ? SER A 260 LEU A 271 1 ? 12 
HELX_P HELX_P12 12 ARG A 275 ? ARG A 279 ? ARG A 274 ARG A 278 5 ? 5  
HELX_P HELX_P13 13 THR A 281 ? ASN A 287 ? THR A 280 ASN A 286 1 ? 7  
HELX_P HELX_P14 14 HIS A 288 ? GLN A 292 ? HIS A 287 GLN A 291 5 ? 5  
HELX_P HELX_P15 15 LEU A 296 ? LEU A 305 ? LEU A 295 LEU A 304 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1 covale both ? A SER 261 C ? ? ? 1_555 A SEP 262 N ? ? A SER 260 A SEP 261 1_555 ? ? ? ? ? ? ? 1.323 ? ? 
covale2 covale both ? A SEP 262 C ? ? ? 1_555 A GLU 263 N ? ? A SEP 261 A GLU 262 1_555 ? ? ? ? ? ? ? 1.344 ? ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLU 
_struct_mon_prot_cis.label_seq_id           125 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLU 
_struct_mon_prot_cis.auth_seq_id            124 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    126 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     125 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -2.64 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 2 ? 
C ? 3 ? 
D ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 39  ? GLY A 48  ? TYR A 38  GLY A 47  
A 2 GLY A 51  ? ARG A 58  ? GLY A 50  ARG A 57  
A 3 PRO A 64  ? GLU A 71  ? PRO A 63  GLU A 70  
A 4 SER A 116 ? GLU A 122 ? SER A 115 GLU A 121 
A 5 LEU A 107 ? GLU A 112 ? LEU A 106 GLU A 111 
B 1 TRP A 78  ? GLU A 80  ? TRP A 77  GLU A 79  
B 2 ARG A 86  ? PRO A 88  ? ARG A 85  PRO A 87  
C 1 VAL A 127 ? ASP A 129 ? VAL A 126 ASP A 128 
C 2 ILE A 174 ? ASP A 177 ? ILE A 173 ASP A 176 
C 3 GLU A 182 ? LEU A 185 ? GLU A 181 LEU A 184 
D 1 VAL A 164 ? LEU A 165 ? VAL A 163 LEU A 164 
D 2 ALA A 192 ? LEU A 193 ? ALA A 191 LEU A 192 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLY A 42  ? N GLY A 41  O SER A 55  ? O SER A 54  
A 2 3 N TYR A 54  ? N TYR A 53  O ILE A 67  ? O ILE A 66  
A 3 4 N LYS A 68  ? N LYS A 67  O LEU A 119 ? O LEU A 118 
A 4 5 O ILE A 120 ? O ILE A 119 N LEU A 108 ? N LEU A 107 
B 1 2 N GLY A 79  ? N GLY A 78  O VAL A 87  ? O VAL A 86  
C 1 2 N GLN A 128 ? N GLN A 127 O ILE A 176 ? O ILE A 175 
C 2 3 N ASP A 177 ? N ASP A 176 O GLU A 182 ? O GLU A 181 
D 1 2 N LEU A 165 ? N LEU A 164 O ALA A 192 ? O ALA A 191 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A EDO 401 ? 5 'BINDING SITE FOR RESIDUE EDO A 401' 
AC2 Software A JN5 501 ? 7 'BINDING SITE FOR RESIDUE JN5 A 501' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 GLU A 90  ? GLU A 89  . ? 1_555 ? 
2  AC1 5 LEU A 94  ? LEU A 93  . ? 1_555 ? 
3  AC1 5 ILE A 105 ? ILE A 104 . ? 1_555 ? 
4  AC1 5 ASP A 187 ? ASP A 186 . ? 1_555 ? 
5  AC1 5 PHE A 188 ? PHE A 187 . ? 1_555 ? 
6  AC2 7 PHE A 50  ? PHE A 49  . ? 1_555 ? 
7  AC2 7 ALA A 66  ? ALA A 65  . ? 1_555 ? 
8  AC2 7 LYS A 68  ? LYS A 67  . ? 1_555 ? 
9  AC2 7 GLU A 122 ? GLU A 121 . ? 1_555 ? 
10 AC2 7 LEU A 175 ? LEU A 174 . ? 1_555 ? 
11 AC2 7 ILE A 186 ? ILE A 185 . ? 1_555 ? 
12 AC2 7 ASP A 187 ? ASP A 186 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3CY3 
_atom_sites.fract_transf_matrix[1][1]   0.010179 
_atom_sites.fract_transf_matrix[1][2]   0.005877 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011754 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012388 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . PRO A 1 34  ? -32.582 26.341 15.867  1.00 59.67 ? 33  PRO A N   1 
ATOM   2    C CA  . PRO A 1 34  ? -31.873 25.805 14.699  1.00 58.26 ? 33  PRO A CA  1 
ATOM   3    C C   . PRO A 1 34  ? -31.590 26.859 13.631  1.00 57.29 ? 33  PRO A C   1 
ATOM   4    O O   . PRO A 1 34  ? -32.336 27.828 13.513  1.00 58.07 ? 33  PRO A O   1 
ATOM   5    C CB  . PRO A 1 34  ? -32.849 24.754 14.153  1.00 57.92 ? 33  PRO A CB  1 
ATOM   6    C CG  . PRO A 1 34  ? -34.208 25.279 14.527  1.00 57.49 ? 33  PRO A CG  1 
ATOM   7    C CD  . PRO A 1 34  ? -34.028 26.045 15.826  1.00 59.16 ? 33  PRO A CD  1 
ATOM   8    N N   . LEU A 1 35  ? -30.515 26.650 12.870  1.00 55.37 ? 34  LEU A N   1 
ATOM   9    C CA  . LEU A 1 35  ? -30.153 27.467 11.696  1.00 52.06 ? 34  LEU A CA  1 
ATOM   10   C C   . LEU A 1 35  ? -31.345 27.856 10.800  1.00 49.94 ? 34  LEU A C   1 
ATOM   11   O O   . LEU A 1 35  ? -31.489 29.015 10.394  1.00 43.85 ? 34  LEU A O   1 
ATOM   12   C CB  . LEU A 1 35  ? -29.126 26.683 10.851  1.00 53.19 ? 34  LEU A CB  1 
ATOM   13   C CG  . LEU A 1 35  ? -28.209 27.376 9.836   1.00 53.43 ? 34  LEU A CG  1 
ATOM   14   C CD1 . LEU A 1 35  ? -27.066 26.432 9.544   1.00 61.89 ? 34  LEU A CD1 1 
ATOM   15   C CD2 . LEU A 1 35  ? -28.917 27.789 8.541   1.00 57.99 ? 34  LEU A CD2 1 
ATOM   16   N N   . GLU A 1 36  ? -32.201 26.880 10.505  1.00 50.62 ? 35  GLU A N   1 
ATOM   17   C CA  . GLU A 1 36  ? -33.252 27.043 9.504   1.00 51.07 ? 35  GLU A CA  1 
ATOM   18   C C   . GLU A 1 36  ? -34.447 27.939 9.937   1.00 51.73 ? 35  GLU A C   1 
ATOM   19   O O   . GLU A 1 36  ? -35.126 28.517 9.076   1.00 51.07 ? 35  GLU A O   1 
ATOM   20   C CB  . GLU A 1 36  ? -33.733 25.660 9.034   1.00 48.78 ? 35  GLU A CB  1 
ATOM   21   N N   . SER A 1 37  ? -34.703 28.065 11.244  1.00 52.40 ? 36  SER A N   1 
ATOM   22   C CA  . SER A 1 37  ? -35.811 28.916 11.741  1.00 53.78 ? 36  SER A CA  1 
ATOM   23   C C   . SER A 1 37  ? -35.344 30.310 12.233  1.00 52.11 ? 36  SER A C   1 
ATOM   24   O O   . SER A 1 37  ? -36.138 31.075 12.786  1.00 54.43 ? 36  SER A O   1 
ATOM   25   C CB  . SER A 1 37  ? -36.617 28.193 12.841  1.00 50.23 ? 36  SER A CB  1 
ATOM   26   N N   . GLN A 1 38  ? -34.069 30.632 12.028  1.00 49.87 ? 37  GLN A N   1 
ATOM   27   C CA  . GLN A 1 38  ? -33.520 31.925 12.437  1.00 47.25 ? 37  GLN A CA  1 
ATOM   28   C C   . GLN A 1 38  ? -33.159 32.813 11.241  1.00 44.49 ? 37  GLN A C   1 
ATOM   29   O O   . GLN A 1 38  ? -33.189 34.034 11.355  1.00 39.62 ? 37  GLN A O   1 
ATOM   30   C CB  . GLN A 1 38  ? -32.293 31.701 13.318  1.00 48.90 ? 37  GLN A CB  1 
ATOM   31   C CG  . GLN A 1 38  ? -32.046 32.820 14.311  1.00 52.97 ? 37  GLN A CG  1 
ATOM   32   C CD  . GLN A 1 38  ? -31.055 32.448 15.392  1.00 54.37 ? 37  GLN A CD  1 
ATOM   33   O OE1 . GLN A 1 38  ? -30.742 31.266 15.603  1.00 50.30 ? 37  GLN A OE1 1 
ATOM   34   N NE2 . GLN A 1 38  ? -30.558 33.462 16.093  1.00 54.27 ? 37  GLN A NE2 1 
ATOM   35   N N   . TYR A 1 39  ? -32.833 32.197 10.100  1.00 44.98 ? 38  TYR A N   1 
ATOM   36   C CA  . TYR A 1 39  ? -32.383 32.930 8.904   1.00 45.09 ? 38  TYR A CA  1 
ATOM   37   C C   . TYR A 1 39  ? -33.225 32.563 7.703   1.00 44.58 ? 38  TYR A C   1 
ATOM   38   O O   . TYR A 1 39  ? -33.490 31.393 7.455   1.00 47.63 ? 38  TYR A O   1 
ATOM   39   C CB  . TYR A 1 39  ? -30.891 32.675 8.614   1.00 43.33 ? 38  TYR A CB  1 
ATOM   40   C CG  . TYR A 1 39  ? -30.026 33.103 9.766   1.00 37.94 ? 38  TYR A CG  1 
ATOM   41   C CD1 . TYR A 1 39  ? -29.655 34.437 9.920   1.00 33.78 ? 38  TYR A CD1 1 
ATOM   42   C CD2 . TYR A 1 39  ? -29.621 32.188 10.735  1.00 34.14 ? 38  TYR A CD2 1 
ATOM   43   C CE1 . TYR A 1 39  ? -28.887 34.849 10.997  1.00 26.18 ? 38  TYR A CE1 1 
ATOM   44   C CE2 . TYR A 1 39  ? -28.855 32.583 11.815  1.00 30.48 ? 38  TYR A CE2 1 
ATOM   45   C CZ  . TYR A 1 39  ? -28.487 33.922 11.939  1.00 41.54 ? 38  TYR A CZ  1 
ATOM   46   O OH  . TYR A 1 39  ? -27.733 34.333 13.010  1.00 36.89 ? 38  TYR A OH  1 
ATOM   47   N N   . GLN A 1 40  ? -33.672 33.585 6.985   1.00 43.09 ? 39  GLN A N   1 
ATOM   48   C CA  . GLN A 1 40  ? -34.338 33.414 5.714   1.00 38.73 ? 39  GLN A CA  1 
ATOM   49   C C   . GLN A 1 40  ? -33.266 33.441 4.615   1.00 35.67 ? 39  GLN A C   1 
ATOM   50   O O   . GLN A 1 40  ? -32.461 34.359 4.563   1.00 36.29 ? 39  GLN A O   1 
ATOM   51   C CB  . GLN A 1 40  ? -35.347 34.531 5.523   1.00 38.78 ? 39  GLN A CB  1 
ATOM   52   C CG  . GLN A 1 40  ? -36.292 34.300 4.374   1.00 42.32 ? 39  GLN A CG  1 
ATOM   53   C CD  . GLN A 1 40  ? -37.103 35.529 4.040   1.00 45.78 ? 39  GLN A CD  1 
ATOM   54   O OE1 . GLN A 1 40  ? -38.326 35.454 3.921   1.00 56.14 ? 39  GLN A OE1 1 
ATOM   55   N NE2 . GLN A 1 40  ? -36.430 36.674 3.890   1.00 44.74 ? 39  GLN A NE2 1 
ATOM   56   N N   . VAL A 1 41  ? -33.246 32.419 3.762   1.00 29.92 ? 40  VAL A N   1 
ATOM   57   C CA  . VAL A 1 41  ? -32.189 32.255 2.768   1.00 29.70 ? 40  VAL A CA  1 
ATOM   58   C C   . VAL A 1 41  ? -32.602 32.851 1.432   1.00 29.01 ? 40  VAL A C   1 
ATOM   59   O O   . VAL A 1 41  ? -33.687 32.561 0.913   1.00 32.35 ? 40  VAL A O   1 
ATOM   60   C CB  . VAL A 1 41  ? -31.825 30.781 2.540   1.00 29.80 ? 40  VAL A CB  1 
ATOM   61   C CG1 . VAL A 1 41  ? -30.594 30.668 1.625   1.00 25.60 ? 40  VAL A CG1 1 
ATOM   62   C CG2 . VAL A 1 41  ? -31.578 30.090 3.865   1.00 34.18 ? 40  VAL A CG2 1 
ATOM   63   N N   . GLY A 1 42  ? -31.717 33.661 0.861   1.00 25.35 ? 41  GLY A N   1 
ATOM   64   C CA  . GLY A 1 42  ? -31.968 34.285 -0.426  1.00 26.00 ? 41  GLY A CA  1 
ATOM   65   C C   . GLY A 1 42  ? -31.022 33.715 -1.469  1.00 28.84 ? 41  GLY A C   1 
ATOM   66   O O   . GLY A 1 42  ? -30.503 32.603 -1.319  1.00 28.49 ? 41  GLY A O   1 
ATOM   67   N N   . PRO A 1 43  ? -30.771 34.484 -2.527  1.00 30.26 ? 42  PRO A N   1 
ATOM   68   C CA  . PRO A 1 43  ? -29.933 34.017 -3.621  1.00 32.40 ? 42  PRO A CA  1 
ATOM   69   C C   . PRO A 1 43  ? -28.490 33.672 -3.222  1.00 32.17 ? 42  PRO A C   1 
ATOM   70   O O   . PRO A 1 43  ? -27.937 34.243 -2.266  1.00 34.93 ? 42  PRO A O   1 
ATOM   71   C CB  . PRO A 1 43  ? -29.929 35.219 -4.584  1.00 32.36 ? 42  PRO A CB  1 
ATOM   72   C CG  . PRO A 1 43  ? -31.159 35.971 -4.247  1.00 34.22 ? 42  PRO A CG  1 
ATOM   73   C CD  . PRO A 1 43  ? -31.291 35.839 -2.784  1.00 30.73 ? 42  PRO A CD  1 
ATOM   74   N N   . LEU A 1 44  ? -27.922 32.735 -3.970  1.00 26.88 ? 43  LEU A N   1 
ATOM   75   C CA  . LEU A 1 44  ? -26.510 32.460 -3.984  1.00 31.08 ? 43  LEU A CA  1 
ATOM   76   C C   . LEU A 1 44  ? -25.750 33.701 -4.465  1.00 33.52 ? 43  LEU A C   1 
ATOM   77   O O   . LEU A 1 44  ? -26.055 34.233 -5.541  1.00 30.87 ? 43  LEU A O   1 
ATOM   78   C CB  . LEU A 1 44  ? -26.234 31.286 -4.927  1.00 31.67 ? 43  LEU A CB  1 
ATOM   79   C CG  . LEU A 1 44  ? -24.809 30.740 -4.931  1.00 28.25 ? 43  LEU A CG  1 
ATOM   80   C CD1 . LEU A 1 44  ? -24.510 30.113 -3.597  1.00 23.37 ? 43  LEU A CD1 1 
ATOM   81   C CD2 . LEU A 1 44  ? -24.678 29.739 -6.080  1.00 37.01 ? 43  LEU A CD2 1 
ATOM   82   N N   . LEU A 1 45  ? -24.792 34.147 -3.643  1.00 33.10 ? 44  LEU A N   1 
ATOM   83   C CA  . LEU A 1 45  ? -23.906 35.298 -3.917  1.00 35.32 ? 44  LEU A CA  1 
ATOM   84   C C   . LEU A 1 45  ? -22.635 34.849 -4.631  1.00 31.36 ? 44  LEU A C   1 
ATOM   85   O O   . LEU A 1 45  ? -22.122 35.538 -5.501  1.00 33.89 ? 44  LEU A O   1 
ATOM   86   C CB  . LEU A 1 45  ? -23.493 36.027 -2.604  1.00 34.59 ? 44  LEU A CB  1 
ATOM   87   C CG  . LEU A 1 45  ? -24.549 36.721 -1.722  1.00 31.01 ? 44  LEU A CG  1 
ATOM   88   C CD1 . LEU A 1 45  ? -23.841 37.394 -0.534  1.00 29.15 ? 44  LEU A CD1 1 
ATOM   89   C CD2 . LEU A 1 45  ? -25.408 37.727 -2.466  1.00 24.16 ? 44  LEU A CD2 1 
ATOM   90   N N   . GLY A 1 46  ? -22.119 33.691 -4.249  1.00 35.24 ? 45  GLY A N   1 
ATOM   91   C CA  . GLY A 1 46  ? -20.982 33.085 -4.941  1.00 31.19 ? 45  GLY A CA  1 
ATOM   92   C C   . GLY A 1 46  ? -20.692 31.675 -4.466  1.00 33.34 ? 45  GLY A C   1 
ATOM   93   O O   . GLY A 1 46  ? -21.138 31.254 -3.386  1.00 29.03 ? 45  GLY A O   1 
ATOM   94   N N   . SER A 1 47  ? -19.995 30.915 -5.295  1.00 30.41 ? 46  SER A N   1 
ATOM   95   C CA  . SER A 1 47  ? -19.441 29.629 -4.866  1.00 32.57 ? 46  SER A CA  1 
ATOM   96   C C   . SER A 1 47  ? -18.129 29.329 -5.585  1.00 30.58 ? 46  SER A C   1 
ATOM   97   O O   . SER A 1 47  ? -17.871 29.861 -6.658  1.00 29.92 ? 46  SER A O   1 
ATOM   98   C CB  . SER A 1 47  ? -20.433 28.483 -5.103  1.00 34.31 ? 46  SER A CB  1 
ATOM   99   O OG  . SER A 1 47  ? -20.573 28.216 -6.464  1.00 35.46 ? 46  SER A OG  1 
ATOM   100  N N   . GLY A 1 48  ? -17.308 28.477 -4.987  1.00 33.79 ? 47  GLY A N   1 
ATOM   101  C CA  . GLY A 1 48  ? -16.049 28.051 -5.599  1.00 34.28 ? 47  GLY A CA  1 
ATOM   102  C C   . GLY A 1 48  ? -15.234 27.269 -4.589  1.00 34.91 ? 47  GLY A C   1 
ATOM   103  O O   . GLY A 1 48  ? -15.799 26.552 -3.777  1.00 34.20 ? 47  GLY A O   1 
ATOM   104  N N   . GLY A 1 49  ? -13.911 27.432 -4.608  1.00 34.30 ? 48  GLY A N   1 
ATOM   105  C CA  . GLY A 1 49  ? -13.037 26.777 -3.629  1.00 34.51 ? 48  GLY A CA  1 
ATOM   106  C C   . GLY A 1 49  ? -13.381 27.089 -2.180  1.00 35.09 ? 48  GLY A C   1 
ATOM   107  O O   . GLY A 1 49  ? -13.142 26.279 -1.292  1.00 33.44 ? 48  GLY A O   1 
ATOM   108  N N   . PHE A 1 50  ? -13.933 28.275 -1.942  1.00 34.74 ? 49  PHE A N   1 
ATOM   109  C CA  . PHE A 1 50  ? -14.254 28.755 -0.584  1.00 35.05 ? 49  PHE A CA  1 
ATOM   110  C C   . PHE A 1 50  ? -15.541 28.123 -0.027  1.00 37.01 ? 49  PHE A C   1 
ATOM   111  O O   . PHE A 1 50  ? -15.793 28.158 1.178   1.00 38.65 ? 49  PHE A O   1 
ATOM   112  C CB  . PHE A 1 50  ? -14.350 30.290 -0.589  1.00 35.45 ? 49  PHE A CB  1 
ATOM   113  C CG  . PHE A 1 50  ? -15.234 30.833 -1.672  1.00 30.17 ? 49  PHE A CG  1 
ATOM   114  C CD1 . PHE A 1 50  ? -16.584 31.066 -1.434  1.00 32.62 ? 49  PHE A CD1 1 
ATOM   115  C CD2 . PHE A 1 50  ? -14.723 31.108 -2.923  1.00 25.21 ? 49  PHE A CD2 1 
ATOM   116  C CE1 . PHE A 1 50  ? -17.398 31.564 -2.433  1.00 30.26 ? 49  PHE A CE1 1 
ATOM   117  C CE2 . PHE A 1 50  ? -15.550 31.593 -3.940  1.00 35.89 ? 49  PHE A CE2 1 
ATOM   118  C CZ  . PHE A 1 50  ? -16.879 31.833 -3.678  1.00 30.50 ? 49  PHE A CZ  1 
ATOM   119  N N   . GLY A 1 51  ? -16.333 27.516 -0.914  1.00 37.90 ? 50  GLY A N   1 
ATOM   120  C CA  . GLY A 1 51  ? -17.618 26.911 -0.563  1.00 36.24 ? 50  GLY A CA  1 
ATOM   121  C C   . GLY A 1 51  ? -18.724 27.617 -1.334  1.00 34.01 ? 50  GLY A C   1 
ATOM   122  O O   . GLY A 1 51  ? -18.513 28.039 -2.486  1.00 30.08 ? 50  GLY A O   1 
ATOM   123  N N   . SER A 1 52  ? -19.882 27.751 -0.688  1.00 31.99 ? 51  SER A N   1 
ATOM   124  C CA  . SER A 1 52  ? -21.083 28.366 -1.264  1.00 31.72 ? 51  SER A CA  1 
ATOM   125  C C   . SER A 1 52  ? -21.598 29.414 -0.300  1.00 33.80 ? 51  SER A C   1 
ATOM   126  O O   . SER A 1 52  ? -21.802 29.118 0.882   1.00 32.34 ? 51  SER A O   1 
ATOM   127  C CB  . SER A 1 52  ? -22.166 27.323 -1.551  1.00 27.44 ? 51  SER A CB  1 
ATOM   128  O OG  . SER A 1 52  ? -21.752 26.402 -2.581  1.00 30.68 ? 51  SER A OG  1 
ATOM   129  N N   . VAL A 1 53  ? -21.784 30.641 -0.799  1.00 30.83 ? 52  VAL A N   1 
ATOM   130  C CA  . VAL A 1 53  ? -22.224 31.782 0.044   1.00 32.29 ? 52  VAL A CA  1 
ATOM   131  C C   . VAL A 1 53  ? -23.566 32.330 -0.452  1.00 29.09 ? 52  VAL A C   1 
ATOM   132  O O   . VAL A 1 53  ? -23.695 32.689 -1.606  1.00 29.07 ? 52  VAL A O   1 
ATOM   133  C CB  . VAL A 1 53  ? -21.132 32.925 0.128   1.00 33.66 ? 52  VAL A CB  1 
ATOM   134  C CG1 . VAL A 1 53  ? -21.629 34.135 0.977   1.00 26.45 ? 52  VAL A CG1 1 
ATOM   135  C CG2 . VAL A 1 53  ? -19.818 32.369 0.724   1.00 28.29 ? 52  VAL A CG2 1 
ATOM   136  N N   . TYR A 1 54  ? -24.562 32.366 0.432   1.00 30.13 ? 53  TYR A N   1 
ATOM   137  C CA  . TYR A 1 54  ? -25.888 32.888 0.122   1.00 27.67 ? 53  TYR A CA  1 
ATOM   138  C C   . TYR A 1 54  ? -26.156 34.180 0.849   1.00 27.92 ? 53  TYR A C   1 
ATOM   139  O O   . TYR A 1 54  ? -25.603 34.454 1.915   1.00 26.31 ? 53  TYR A O   1 
ATOM   140  C CB  . TYR A 1 54  ? -26.987 31.899 0.518   1.00 29.14 ? 53  TYR A CB  1 
ATOM   141  C CG  . TYR A 1 54  ? -26.905 30.546 -0.178  1.00 27.48 ? 53  TYR A CG  1 
ATOM   142  C CD1 . TYR A 1 54  ? -27.766 30.224 -1.223  1.00 34.36 ? 53  TYR A CD1 1 
ATOM   143  C CD2 . TYR A 1 54  ? -25.951 29.588 0.219   1.00 32.42 ? 53  TYR A CD2 1 
ATOM   144  C CE1 . TYR A 1 54  ? -27.695 28.976 -1.853  1.00 29.03 ? 53  TYR A CE1 1 
ATOM   145  C CE2 . TYR A 1 54  ? -25.860 28.343 -0.419  1.00 28.32 ? 53  TYR A CE2 1 
ATOM   146  C CZ  . TYR A 1 54  ? -26.734 28.039 -1.445  1.00 29.96 ? 53  TYR A CZ  1 
ATOM   147  O OH  . TYR A 1 54  ? -26.641 26.809 -2.078  1.00 28.57 ? 53  TYR A OH  1 
ATOM   148  N N   . SER A 1 55  ? -27.032 34.967 0.248   1.00 27.65 ? 54  SER A N   1 
ATOM   149  C CA  . SER A 1 55  ? -27.624 36.106 0.885   1.00 27.46 ? 54  SER A CA  1 
ATOM   150  C C   . SER A 1 55  ? -28.649 35.577 1.862   1.00 27.94 ? 54  SER A C   1 
ATOM   151  O O   . SER A 1 55  ? -29.313 34.576 1.599   1.00 31.63 ? 54  SER A O   1 
ATOM   152  C CB  . SER A 1 55  ? -28.337 36.967 -0.163  1.00 22.59 ? 54  SER A CB  1 
ATOM   153  O OG  . SER A 1 55  ? -28.742 38.188 0.403   1.00 30.53 ? 54  SER A OG  1 
ATOM   154  N N   . GLY A 1 56  ? -28.803 36.258 2.981   1.00 28.71 ? 55  GLY A N   1 
ATOM   155  C CA  . GLY A 1 56  ? -29.865 35.916 3.903   1.00 28.75 ? 55  GLY A CA  1 
ATOM   156  C C   . GLY A 1 56  ? -30.335 37.109 4.681   1.00 29.97 ? 55  GLY A C   1 
ATOM   157  O O   . GLY A 1 56  ? -29.796 38.209 4.588   1.00 31.77 ? 55  GLY A O   1 
ATOM   158  N N   . ILE A 1 57  ? -31.364 36.875 5.463   1.00 34.38 ? 56  ILE A N   1 
ATOM   159  C CA  . ILE A 1 57  ? -31.884 37.873 6.366   1.00 33.74 ? 56  ILE A CA  1 
ATOM   160  C C   . ILE A 1 57  ? -32.119 37.158 7.682   1.00 33.25 ? 56  ILE A C   1 
ATOM   161  O O   . ILE A 1 57  ? -32.707 36.076 7.698   1.00 36.32 ? 56  ILE A O   1 
ATOM   162  C CB  . ILE A 1 57  ? -33.168 38.479 5.797   1.00 33.75 ? 56  ILE A CB  1 
ATOM   163  C CG1 . ILE A 1 57  ? -32.816 39.649 4.873   1.00 26.55 ? 56  ILE A CG1 1 
ATOM   164  C CG2 . ILE A 1 57  ? -34.104 38.916 6.913   1.00 36.72 ? 56  ILE A CG2 1 
ATOM   165  C CD1 . ILE A 1 57  ? -33.865 39.898 3.813   1.00 40.71 ? 56  ILE A CD1 1 
ATOM   166  N N   . ARG A 1 58  ? -31.613 37.728 8.768   1.00 30.63 ? 57  ARG A N   1 
ATOM   167  C CA  . ARG A 1 58  ? -31.948 37.247 10.095  1.00 31.32 ? 57  ARG A CA  1 
ATOM   168  C C   . ARG A 1 58  ? -33.399 37.593 10.385  1.00 29.03 ? 57  ARG A C   1 
ATOM   169  O O   . ARG A 1 58  ? -33.779 38.753 10.352  1.00 32.74 ? 57  ARG A O   1 
ATOM   170  C CB  . ARG A 1 58  ? -31.051 37.863 11.151  1.00 32.22 ? 57  ARG A CB  1 
ATOM   171  C CG  . ARG A 1 58  ? -31.259 37.244 12.521  1.00 34.55 ? 57  ARG A CG  1 
ATOM   172  C CD  . ARG A 1 58  ? -30.092 37.551 13.439  1.00 43.80 ? 57  ARG A CD  1 
ATOM   173  N NE  . ARG A 1 58  ? -29.945 38.985 13.702  1.00 42.08 ? 57  ARG A NE  1 
ATOM   174  C CZ  . ARG A 1 58  ? -28.887 39.531 14.299  1.00 46.88 ? 57  ARG A CZ  1 
ATOM   175  N NH1 . ARG A 1 58  ? -28.841 40.843 14.491  1.00 43.06 ? 57  ARG A NH1 1 
ATOM   176  N NH2 . ARG A 1 58  ? -27.863 38.774 14.692  1.00 44.55 ? 57  ARG A NH2 1 
ATOM   177  N N   . VAL A 1 59  ? -34.198 36.573 10.671  1.00 26.68 ? 58  VAL A N   1 
ATOM   178  C CA  . VAL A 1 59  ? -35.654 36.709 10.784  1.00 25.46 ? 58  VAL A CA  1 
ATOM   179  C C   . VAL A 1 59  ? -36.133 37.653 11.909  1.00 29.33 ? 58  VAL A C   1 
ATOM   180  O O   . VAL A 1 59  ? -37.186 38.317 11.776  1.00 27.18 ? 58  VAL A O   1 
ATOM   181  C CB  . VAL A 1 59  ? -36.296 35.320 10.991  1.00 23.56 ? 58  VAL A CB  1 
ATOM   182  C CG1 . VAL A 1 59  ? -37.627 35.458 11.633  1.00 16.19 ? 58  VAL A CG1 1 
ATOM   183  C CG2 . VAL A 1 59  ? -36.403 34.566 9.658   1.00 25.27 ? 58  VAL A CG2 1 
ATOM   184  N N   . SER A 1 60  ? -35.352 37.717 12.991  1.00 29.48 ? 59  SER A N   1 
ATOM   185  C CA  . SER A 1 60  ? -35.723 38.436 14.214  1.00 30.11 ? 59  SER A CA  1 
ATOM   186  C C   . SER A 1 60  ? -35.815 39.940 14.037  1.00 30.67 ? 59  SER A C   1 
ATOM   187  O O   . SER A 1 60  ? -36.750 40.564 14.540  1.00 32.60 ? 59  SER A O   1 
ATOM   188  C CB  . SER A 1 60  ? -34.732 38.124 15.337  1.00 27.45 ? 59  SER A CB  1 
ATOM   189  O OG  . SER A 1 60  ? -33.414 38.432 14.951  1.00 36.85 ? 59  SER A OG  1 
ATOM   190  N N   . ASP A 1 61  ? -34.848 40.511 13.325  1.00 32.95 ? 60  ASP A N   1 
ATOM   191  C CA  . ASP A 1 61  ? -34.771 41.963 13.103  1.00 33.52 ? 60  ASP A CA  1 
ATOM   192  C C   . ASP A 1 61  ? -34.480 42.333 11.639  1.00 33.22 ? 60  ASP A C   1 
ATOM   193  O O   . ASP A 1 61  ? -34.074 43.463 11.347  1.00 31.59 ? 60  ASP A O   1 
ATOM   194  C CB  . ASP A 1 61  ? -33.677 42.553 14.000  1.00 34.43 ? 60  ASP A CB  1 
ATOM   195  C CG  . ASP A 1 61  ? -32.324 41.960 13.722  1.00 35.57 ? 60  ASP A CG  1 
ATOM   196  O OD1 . ASP A 1 61  ? -32.274 40.842 13.176  1.00 38.89 ? 60  ASP A OD1 1 
ATOM   197  O OD2 . ASP A 1 61  ? -31.316 42.608 14.048  1.00 42.20 ? 60  ASP A OD2 1 
ATOM   198  N N   . ASN A 1 62  ? -34.664 41.371 10.735  1.00 32.58 ? 61  ASN A N   1 
ATOM   199  C CA  . ASN A 1 62  ? -34.388 41.542 9.304   1.00 30.95 ? 61  ASN A CA  1 
ATOM   200  C C   . ASN A 1 62  ? -32.977 42.037 8.940   1.00 29.36 ? 61  ASN A C   1 
ATOM   201  O O   . ASN A 1 62  ? -32.768 42.570 7.848   1.00 29.88 ? 61  ASN A O   1 
ATOM   202  C CB  . ASN A 1 62  ? -35.493 42.387 8.662   1.00 30.12 ? 61  ASN A CB  1 
ATOM   203  C CG  . ASN A 1 62  ? -36.833 41.699 8.733   1.00 31.93 ? 61  ASN A CG  1 
ATOM   204  O OD1 . ASN A 1 62  ? -37.143 40.833 7.915   1.00 37.93 ? 61  ASN A OD1 1 
ATOM   205  N ND2 . ASN A 1 62  ? -37.627 42.053 9.734   1.00 42.37 ? 61  ASN A ND2 1 
ATOM   206  N N   . LEU A 1 63  ? -32.015 41.826 9.841   1.00 29.21 ? 62  LEU A N   1 
ATOM   207  C CA  . LEU A 1 63  ? -30.622 42.180 9.597   1.00 28.34 ? 62  LEU A CA  1 
ATOM   208  C C   . LEU A 1 63  ? -30.108 41.429 8.377   1.00 31.00 ? 62  LEU A C   1 
ATOM   209  O O   . LEU A 1 63  ? -30.303 40.215 8.305   1.00 31.32 ? 62  LEU A O   1 
ATOM   210  C CB  . LEU A 1 63  ? -29.744 41.799 10.792  1.00 26.84 ? 62  LEU A CB  1 
ATOM   211  C CG  . LEU A 1 63  ? -28.302 42.340 10.711  1.00 29.89 ? 62  LEU A CG  1 
ATOM   212  C CD1 . LEU A 1 63  ? -28.263 43.806 11.154  1.00 21.21 ? 62  LEU A CD1 1 
ATOM   213  C CD2 . LEU A 1 63  ? -27.309 41.473 11.521  1.00 28.30 ? 62  LEU A CD2 1 
ATOM   214  N N   . PRO A 1 64  ? -29.444 42.133 7.425   1.00 31.06 ? 63  PRO A N   1 
ATOM   215  C CA  . PRO A 1 64  ? -28.814 41.425 6.297   1.00 30.58 ? 63  PRO A CA  1 
ATOM   216  C C   . PRO A 1 64  ? -27.616 40.588 6.726   1.00 28.12 ? 63  PRO A C   1 
ATOM   217  O O   . PRO A 1 64  ? -26.741 41.063 7.465   1.00 27.26 ? 63  PRO A O   1 
ATOM   218  C CB  . PRO A 1 64  ? -28.372 42.559 5.358   1.00 33.60 ? 63  PRO A CB  1 
ATOM   219  C CG  . PRO A 1 64  ? -29.190 43.743 5.768   1.00 30.30 ? 63  PRO A CG  1 
ATOM   220  C CD  . PRO A 1 64  ? -29.374 43.593 7.241   1.00 31.33 ? 63  PRO A CD  1 
ATOM   221  N N   . VAL A 1 65  ? -27.603 39.340 6.276   1.00 25.47 ? 64  VAL A N   1 
ATOM   222  C CA  . VAL A 1 65  ? -26.512 38.417 6.550   1.00 25.71 ? 64  VAL A CA  1 
ATOM   223  C C   . VAL A 1 65  ? -26.031 37.699 5.296   1.00 23.38 ? 64  VAL A C   1 
ATOM   224  O O   . VAL A 1 65  ? -26.670 37.730 4.251   1.00 24.34 ? 64  VAL A O   1 
ATOM   225  C CB  . VAL A 1 65  ? -26.894 37.361 7.661   1.00 28.62 ? 64  VAL A CB  1 
ATOM   226  C CG1 . VAL A 1 65  ? -27.275 38.068 8.958   1.00 26.94 ? 64  VAL A CG1 1 
ATOM   227  C CG2 . VAL A 1 65  ? -28.023 36.365 7.187   1.00 20.40 ? 64  VAL A CG2 1 
ATOM   228  N N   . ALA A 1 66  ? -24.857 37.087 5.400   1.00 28.63 ? 65  ALA A N   1 
ATOM   229  C CA  . ALA A 1 66  ? -24.373 36.140 4.393   1.00 29.69 ? 65  ALA A CA  1 
ATOM   230  C C   . ALA A 1 66  ? -24.248 34.800 5.109   1.00 30.10 ? 65  ALA A C   1 
ATOM   231  O O   . ALA A 1 66  ? -23.947 34.752 6.296   1.00 29.74 ? 65  ALA A O   1 
ATOM   232  C CB  . ALA A 1 66  ? -23.042 36.587 3.804   1.00 26.53 ? 65  ALA A CB  1 
ATOM   233  N N   . ILE A 1 67  ? -24.545 33.725 4.401   1.00 32.36 ? 66  ILE A N   1 
ATOM   234  C CA  . ILE A 1 67  ? -24.564 32.385 4.986   1.00 31.00 ? 66  ILE A CA  1 
ATOM   235  C C   . ILE A 1 67  ? -23.607 31.550 4.152   1.00 30.87 ? 66  ILE A C   1 
ATOM   236  O O   . ILE A 1 67  ? -23.885 31.271 2.991   1.00 28.53 ? 66  ILE A O   1 
ATOM   237  C CB  . ILE A 1 67  ? -25.992 31.740 5.001   1.00 33.48 ? 66  ILE A CB  1 
ATOM   238  C CG1 . ILE A 1 67  ? -27.044 32.695 5.593   1.00 33.22 ? 66  ILE A CG1 1 
ATOM   239  C CG2 . ILE A 1 67  ? -25.962 30.400 5.750   1.00 25.16 ? 66  ILE A CG2 1 
ATOM   240  C CD1 . ILE A 1 67  ? -28.478 32.293 5.310   1.00 22.90 ? 66  ILE A CD1 1 
ATOM   241  N N   . LYS A 1 68  ? -22.469 31.197 4.750   1.00 29.19 ? 67  LYS A N   1 
ATOM   242  C CA  . LYS A 1 68  ? -21.399 30.478 4.087   1.00 28.81 ? 67  LYS A CA  1 
ATOM   243  C C   . LYS A 1 68  ? -21.394 29.033 4.557   1.00 30.26 ? 67  LYS A C   1 
ATOM   244  O O   . LYS A 1 68  ? -21.396 28.756 5.763   1.00 29.54 ? 67  LYS A O   1 
ATOM   245  C CB  . LYS A 1 68  ? -20.034 31.124 4.408   1.00 30.36 ? 67  LYS A CB  1 
ATOM   246  C CG  . LYS A 1 68  ? -18.846 30.381 3.800   1.00 33.96 ? 67  LYS A CG  1 
ATOM   247  C CD  . LYS A 1 68  ? -17.543 31.137 4.015   1.00 31.67 ? 67  LYS A CD  1 
ATOM   248  C CE  . LYS A 1 68  ? -16.343 30.290 3.653   1.00 37.42 ? 67  LYS A CE  1 
ATOM   249  N NZ  . LYS A 1 68  ? -15.044 31.026 3.494   1.00 35.15 ? 67  LYS A NZ  1 
ATOM   250  N N   . HIS A 1 69  ? -21.375 28.127 3.585   1.00 28.71 ? 68  HIS A N   1 
ATOM   251  C CA  . HIS A 1 69  ? -21.339 26.699 3.797   1.00 30.13 ? 68  HIS A CA  1 
ATOM   252  C C   . HIS A 1 69  ? -19.994 26.156 3.337   1.00 33.43 ? 68  HIS A C   1 
ATOM   253  O O   . HIS A 1 69  ? -19.574 26.399 2.201   1.00 28.71 ? 68  HIS A O   1 
ATOM   254  C CB  . HIS A 1 69  ? -22.430 25.997 2.964   1.00 28.24 ? 68  HIS A CB  1 
ATOM   255  C CG  . HIS A 1 69  ? -23.808 26.451 3.285   1.00 27.00 ? 68  HIS A CG  1 
ATOM   256  N ND1 . HIS A 1 69  ? -24.661 25.705 4.066   1.00 17.40 ? 68  HIS A ND1 1 
ATOM   257  C CD2 . HIS A 1 69  ? -24.471 27.592 2.981   1.00 26.92 ? 68  HIS A CD2 1 
ATOM   258  C CE1 . HIS A 1 69  ? -25.789 26.370 4.233   1.00 23.48 ? 68  HIS A CE1 1 
ATOM   259  N NE2 . HIS A 1 69  ? -25.705 27.513 3.582   1.00 22.14 ? 68  HIS A NE2 1 
ATOM   260  N N   . VAL A 1 70  ? -19.349 25.386 4.213   1.00 34.69 ? 69  VAL A N   1 
ATOM   261  C CA  . VAL A 1 70  ? -18.096 24.727 3.908   1.00 35.25 ? 69  VAL A CA  1 
ATOM   262  C C   . VAL A 1 70  ? -18.245 23.238 4.265   1.00 35.51 ? 69  VAL A C   1 
ATOM   263  O O   . VAL A 1 70  ? -18.628 22.892 5.391   1.00 35.50 ? 69  VAL A O   1 
ATOM   264  C CB  . VAL A 1 70  ? -16.912 25.334 4.695   1.00 35.02 ? 69  VAL A CB  1 
ATOM   265  C CG1 . VAL A 1 70  ? -15.589 24.805 4.139   1.00 40.47 ? 69  VAL A CG1 1 
ATOM   266  C CG2 . VAL A 1 70  ? -16.943 26.851 4.632   1.00 32.43 ? 69  VAL A CG2 1 
ATOM   267  N N   . GLU A 1 71  ? -17.922 22.378 3.308   1.00 32.10 ? 70  GLU A N   1 
ATOM   268  C CA  . GLU A 1 71  ? -17.970 20.933 3.503   1.00 35.04 ? 70  GLU A CA  1 
ATOM   269  C C   . GLU A 1 71  ? -16.831 20.496 4.401   1.00 30.68 ? 70  GLU A C   1 
ATOM   270  O O   . GLU A 1 71  ? -15.720 20.992 4.256   1.00 28.16 ? 70  GLU A O   1 
ATOM   271  C CB  . GLU A 1 71  ? -17.906 20.212 2.163   1.00 33.79 ? 70  GLU A CB  1 
ATOM   272  C CG  . GLU A 1 71  ? -19.230 20.291 1.395   1.00 49.88 ? 70  GLU A CG  1 
ATOM   273  C CD  . GLU A 1 71  ? -19.170 19.669 -0.002  1.00 64.90 ? 70  GLU A CD  1 
ATOM   274  O OE1 . GLU A 1 71  ? -18.045 19.407 -0.489  1.00 67.28 ? 70  GLU A OE1 1 
ATOM   275  O OE2 . GLU A 1 71  ? -20.247 19.462 -0.617  1.00 56.04 ? 70  GLU A OE2 1 
ATOM   276  N N   . LYS A 1 72  ? -17.123 19.579 5.328   1.00 29.21 ? 71  LYS A N   1 
ATOM   277  C CA  . LYS A 1 72  ? -16.156 19.193 6.350   1.00 31.27 ? 71  LYS A CA  1 
ATOM   278  C C   . LYS A 1 72  ? -14.946 18.549 5.723   1.00 30.00 ? 71  LYS A C   1 
ATOM   279  O O   . LYS A 1 72  ? -13.821 18.855 6.110   1.00 31.10 ? 71  LYS A O   1 
ATOM   280  C CB  . LYS A 1 72  ? -16.757 18.260 7.400   1.00 26.84 ? 71  LYS A CB  1 
ATOM   281  C CG  . LYS A 1 72  ? -17.454 19.002 8.523   1.00 34.86 ? 71  LYS A CG  1 
ATOM   282  C CD  . LYS A 1 72  ? -18.225 18.037 9.409   1.00 30.71 ? 71  LYS A CD  1 
ATOM   283  C CE  . LYS A 1 72  ? -18.849 18.729 10.602  1.00 35.89 ? 71  LYS A CE  1 
ATOM   284  N NZ  . LYS A 1 72  ? -19.691 17.771 11.402  1.00 22.07 ? 71  LYS A NZ  1 
ATOM   285  N N   . ASP A 1 73  ? -15.185 17.698 4.731   1.00 31.92 ? 72  ASP A N   1 
ATOM   286  C CA  . ASP A 1 73  ? -14.114 17.027 3.987   1.00 35.17 ? 72  ASP A CA  1 
ATOM   287  C C   . ASP A 1 73  ? -13.161 17.992 3.267   1.00 35.00 ? 72  ASP A C   1 
ATOM   288  O O   . ASP A 1 73  ? -12.084 17.603 2.833   1.00 34.22 ? 72  ASP A O   1 
ATOM   289  C CB  . ASP A 1 73  ? -14.718 16.036 2.988   1.00 36.30 ? 72  ASP A CB  1 
ATOM   290  C CG  . ASP A 1 73  ? -15.477 14.879 3.679   1.00 51.36 ? 72  ASP A CG  1 
ATOM   291  O OD1 . ASP A 1 73  ? -15.391 14.755 4.928   1.00 57.65 ? 72  ASP A OD1 1 
ATOM   292  O OD2 . ASP A 1 73  ? -16.161 14.091 2.968   1.00 57.79 ? 72  ASP A OD2 1 
ATOM   293  N N   . ARG A 1 74  ? -13.543 19.257 3.168   1.00 38.48 ? 73  ARG A N   1 
ATOM   294  C CA  . ARG A 1 74  ? -12.730 20.257 2.501   1.00 39.78 ? 73  ARG A CA  1 
ATOM   295  C C   . ARG A 1 74  ? -11.980 21.152 3.481   1.00 41.48 ? 73  ARG A C   1 
ATOM   296  O O   . ARG A 1 74  ? -11.136 21.936 3.075   1.00 38.04 ? 73  ARG A O   1 
ATOM   297  C CB  . ARG A 1 74  ? -13.629 21.112 1.625   1.00 38.55 ? 73  ARG A CB  1 
ATOM   298  C CG  . ARG A 1 74  ? -14.459 20.332 0.619   1.00 43.92 ? 73  ARG A CG  1 
ATOM   299  C CD  . ARG A 1 74  ? -13.872 20.409 -0.753  1.00 50.58 ? 73  ARG A CD  1 
ATOM   300  N NE  . ARG A 1 74  ? -13.602 21.794 -1.114  1.00 54.09 ? 73  ARG A NE  1 
ATOM   301  C CZ  . ARG A 1 74  ? -12.770 22.180 -2.079  1.00 62.03 ? 73  ARG A CZ  1 
ATOM   302  N NH1 . ARG A 1 74  ? -12.124 21.288 -2.836  1.00 63.57 ? 73  ARG A NH1 1 
ATOM   303  N NH2 . ARG A 1 74  ? -12.590 23.478 -2.294  1.00 53.71 ? 73  ARG A NH2 1 
ATOM   304  N N   . ILE A 1 75  ? -12.298 21.053 4.767   1.00 44.08 ? 74  ILE A N   1 
ATOM   305  C CA  . ILE A 1 75  ? -11.612 21.848 5.784   1.00 42.68 ? 74  ILE A CA  1 
ATOM   306  C C   . ILE A 1 75  ? -10.317 21.129 6.160   1.00 43.87 ? 74  ILE A C   1 
ATOM   307  O O   . ILE A 1 75  ? -10.339 20.009 6.673   1.00 40.70 ? 74  ILE A O   1 
ATOM   308  C CB  . ILE A 1 75  ? -12.487 22.072 7.043   1.00 43.78 ? 74  ILE A CB  1 
ATOM   309  C CG1 . ILE A 1 75  ? -13.786 22.813 6.679   1.00 38.72 ? 74  ILE A CG1 1 
ATOM   310  C CG2 . ILE A 1 75  ? -11.682 22.830 8.135   1.00 43.44 ? 74  ILE A CG2 1 
ATOM   311  C CD1 . ILE A 1 75  ? -14.880 22.658 7.731   1.00 41.34 ? 74  ILE A CD1 1 
ATOM   312  N N   . SER A 1 76  ? -9.198  21.789 5.884   1.00 46.10 ? 75  SER A N   1 
ATOM   313  C CA  . SER A 1 76  ? -7.856  21.241 6.096   1.00 45.89 ? 75  SER A CA  1 
ATOM   314  C C   . SER A 1 76  ? -7.316  21.590 7.490   1.00 41.76 ? 75  SER A C   1 
ATOM   315  O O   . SER A 1 76  ? -6.675  20.775 8.137   1.00 35.85 ? 75  SER A O   1 
ATOM   316  C CB  . SER A 1 76  ? -6.915  21.811 5.025   1.00 48.24 ? 75  SER A CB  1 
ATOM   317  O OG  . SER A 1 76  ? -5.569  21.429 5.245   1.00 56.26 ? 75  SER A OG  1 
ATOM   318  N N   . ASP A 1 77  ? -7.591  22.812 7.933   1.00 42.06 ? 76  ASP A N   1 
ATOM   319  C CA  . ASP A 1 77  ? -7.029  23.360 9.157   1.00 41.77 ? 76  ASP A CA  1 
ATOM   320  C C   . ASP A 1 77  ? -8.113  23.488 10.216  1.00 37.02 ? 76  ASP A C   1 
ATOM   321  O O   . ASP A 1 77  ? -9.124  24.141 9.997   1.00 34.20 ? 76  ASP A O   1 
ATOM   322  C CB  . ASP A 1 77  ? -6.396  24.737 8.878   1.00 43.56 ? 76  ASP A CB  1 
ATOM   323  C CG  . ASP A 1 77  ? -5.106  24.656 8.033   1.00 49.53 ? 76  ASP A CG  1 
ATOM   324  O OD1 . ASP A 1 77  ? -4.838  23.625 7.374   1.00 58.44 ? 76  ASP A OD1 1 
ATOM   325  O OD2 . ASP A 1 77  ? -4.350  25.651 8.027   1.00 62.16 ? 76  ASP A OD2 1 
ATOM   326  N N   . TRP A 1 78  ? -7.877  22.868 11.365  1.00 38.16 ? 77  TRP A N   1 
ATOM   327  C CA  . TRP A 1 78  ? -8.829  22.844 12.470  1.00 39.70 ? 77  TRP A CA  1 
ATOM   328  C C   . TRP A 1 78  ? -8.255  23.551 13.691  1.00 42.14 ? 77  TRP A C   1 
ATOM   329  O O   . TRP A 1 78  ? -7.064  23.460 13.962  1.00 42.37 ? 77  TRP A O   1 
ATOM   330  C CB  . TRP A 1 78  ? -9.183  21.392 12.818  1.00 38.25 ? 77  TRP A CB  1 
ATOM   331  C CG  . TRP A 1 78  ? -9.951  20.752 11.738  1.00 37.45 ? 77  TRP A CG  1 
ATOM   332  C CD1 . TRP A 1 78  ? -9.450  20.124 10.637  1.00 40.37 ? 77  TRP A CD1 1 
ATOM   333  C CD2 . TRP A 1 78  ? -11.373 20.726 11.605  1.00 39.80 ? 77  TRP A CD2 1 
ATOM   334  N NE1 . TRP A 1 78  ? -10.476 19.686 9.832   1.00 39.50 ? 77  TRP A NE1 1 
ATOM   335  C CE2 . TRP A 1 78  ? -11.668 20.039 10.406  1.00 42.16 ? 77  TRP A CE2 1 
ATOM   336  C CE3 . TRP A 1 78  ? -12.429 21.195 12.394  1.00 37.42 ? 77  TRP A CE3 1 
ATOM   337  C CZ2 . TRP A 1 78  ? -12.973 19.800 9.985   1.00 39.69 ? 77  TRP A CZ2 1 
ATOM   338  C CZ3 . TRP A 1 78  ? -13.727 20.961 11.971  1.00 40.87 ? 77  TRP A CZ3 1 
ATOM   339  C CH2 . TRP A 1 78  ? -13.986 20.274 10.771  1.00 46.14 ? 77  TRP A CH2 1 
ATOM   340  N N   . GLY A 1 79  ? -9.107  24.266 14.413  1.00 44.26 ? 78  GLY A N   1 
ATOM   341  C CA  . GLY A 1 79  ? -8.721  24.873 15.678  1.00 46.77 ? 78  GLY A CA  1 
ATOM   342  C C   . GLY A 1 79  ? -9.642  24.404 16.787  1.00 50.79 ? 78  GLY A C   1 
ATOM   343  O O   . GLY A 1 79  ? -10.526 23.558 16.570  1.00 49.43 ? 78  GLY A O   1 
ATOM   344  N N   . GLU A 1 80  ? -9.406  24.941 17.980  1.00 55.05 ? 79  GLU A N   1 
ATOM   345  C CA  . GLU A 1 80  ? -10.291 24.771 19.130  1.00 58.39 ? 79  GLU A CA  1 
ATOM   346  C C   . GLU A 1 80  ? -10.663 26.179 19.610  1.00 61.95 ? 79  GLU A C   1 
ATOM   347  O O   . GLU A 1 80  ? -9.841  27.115 19.540  1.00 59.76 ? 79  GLU A O   1 
ATOM   348  C CB  . GLU A 1 80  ? -9.607  23.975 20.249  1.00 56.33 ? 79  GLU A CB  1 
ATOM   349  N N   . LEU A 1 81  ? -11.904 26.326 20.078  1.00 65.43 ? 80  LEU A N   1 
ATOM   350  C CA  . LEU A 1 81  ? -12.425 27.625 20.518  1.00 66.96 ? 80  LEU A CA  1 
ATOM   351  C C   . LEU A 1 81  ? -12.221 27.832 22.043  1.00 68.76 ? 80  LEU A C   1 
ATOM   352  O O   . LEU A 1 81  ? -12.389 26.884 22.840  1.00 67.80 ? 80  LEU A O   1 
ATOM   353  C CB  . LEU A 1 81  ? -13.908 27.764 20.129  1.00 66.69 ? 80  LEU A CB  1 
ATOM   354  N N   . PRO A 1 82  ? -11.852 29.071 22.450  1.00 68.43 ? 81  PRO A N   1 
ATOM   355  C CA  . PRO A 1 82  ? -11.654 29.431 23.861  1.00 67.92 ? 81  PRO A CA  1 
ATOM   356  C C   . PRO A 1 82  ? -12.736 28.880 24.795  1.00 66.59 ? 81  PRO A C   1 
ATOM   357  O O   . PRO A 1 82  ? -12.508 27.885 25.479  1.00 63.98 ? 81  PRO A O   1 
ATOM   358  C CB  . PRO A 1 82  ? -11.707 30.964 23.843  1.00 67.89 ? 81  PRO A CB  1 
ATOM   359  C CG  . PRO A 1 82  ? -11.272 31.360 22.484  1.00 66.84 ? 81  PRO A CG  1 
ATOM   360  C CD  . PRO A 1 82  ? -11.555 30.205 21.550  1.00 68.30 ? 81  PRO A CD  1 
ATOM   361  N N   . THR A 1 85  ? -14.498 23.525 21.892  1.00 59.98 ? 84  THR A N   1 
ATOM   362  C CA  . THR A 1 85  ? -15.114 22.879 20.737  1.00 58.83 ? 84  THR A CA  1 
ATOM   363  C C   . THR A 1 85  ? -14.165 22.935 19.532  1.00 58.30 ? 84  THR A C   1 
ATOM   364  O O   . THR A 1 85  ? -13.496 23.944 19.311  1.00 59.08 ? 84  THR A O   1 
ATOM   365  C CB  . THR A 1 85  ? -16.454 23.549 20.366  1.00 57.70 ? 84  THR A CB  1 
ATOM   366  N N   . ARG A 1 86  ? -14.110 21.837 18.775  1.00 56.50 ? 85  ARG A N   1 
ATOM   367  C CA  . ARG A 1 86  ? -13.267 21.717 17.578  1.00 53.54 ? 85  ARG A CA  1 
ATOM   368  C C   . ARG A 1 86  ? -13.966 22.308 16.357  1.00 50.66 ? 85  ARG A C   1 
ATOM   369  O O   . ARG A 1 86  ? -14.969 21.768 15.877  1.00 49.09 ? 85  ARG A O   1 
ATOM   370  C CB  . ARG A 1 86  ? -12.935 20.246 17.309  1.00 54.09 ? 85  ARG A CB  1 
ATOM   371  C CG  . ARG A 1 86  ? -12.308 19.949 15.941  1.00 56.90 ? 85  ARG A CG  1 
ATOM   372  C CD  . ARG A 1 86  ? -11.921 18.483 15.854  1.00 57.15 ? 85  ARG A CD  1 
ATOM   373  N NE  . ARG A 1 86  ? -10.954 18.181 14.795  1.00 50.41 ? 85  ARG A NE  1 
ATOM   374  C CZ  . ARG A 1 86  ? -11.253 17.753 13.567  1.00 58.33 ? 85  ARG A CZ  1 
ATOM   375  N NH1 . ARG A 1 86  ? -12.515 17.585 13.179  1.00 63.11 ? 85  ARG A NH1 1 
ATOM   376  N NH2 . ARG A 1 86  ? -10.273 17.492 12.709  1.00 61.71 ? 85  ARG A NH2 1 
ATOM   377  N N   . VAL A 1 87  ? -13.421 23.412 15.850  1.00 47.99 ? 86  VAL A N   1 
ATOM   378  C CA  . VAL A 1 87  ? -14.026 24.127 14.727  1.00 43.17 ? 86  VAL A CA  1 
ATOM   379  C C   . VAL A 1 87  ? -13.008 24.321 13.604  1.00 40.32 ? 86  VAL A C   1 
ATOM   380  O O   . VAL A 1 87  ? -11.794 24.206 13.809  1.00 38.92 ? 86  VAL A O   1 
ATOM   381  C CB  . VAL A 1 87  ? -14.595 25.516 15.179  1.00 44.01 ? 86  VAL A CB  1 
ATOM   382  C CG1 . VAL A 1 87  ? -15.740 25.334 16.180  1.00 35.25 ? 86  VAL A CG1 1 
ATOM   383  C CG2 . VAL A 1 87  ? -13.500 26.397 15.779  1.00 36.36 ? 86  VAL A CG2 1 
ATOM   384  N N   . PRO A 1 88  ? -13.487 24.637 12.407  1.00 38.28 ? 87  PRO A N   1 
ATOM   385  C CA  . PRO A 1 88  ? -12.510 25.012 11.378  1.00 34.32 ? 87  PRO A CA  1 
ATOM   386  C C   . PRO A 1 88  ? -11.653 26.218 11.797  1.00 30.51 ? 87  PRO A C   1 
ATOM   387  O O   . PRO A 1 88  ? -12.150 27.108 12.473  1.00 28.91 ? 87  PRO A O   1 
ATOM   388  C CB  . PRO A 1 88  ? -13.404 25.360 10.179  1.00 32.45 ? 87  PRO A CB  1 
ATOM   389  C CG  . PRO A 1 88  ? -14.684 24.573 10.416  1.00 31.99 ? 87  PRO A CG  1 
ATOM   390  C CD  . PRO A 1 88  ? -14.872 24.634 11.891  1.00 39.81 ? 87  PRO A CD  1 
ATOM   391  N N   . MET A 1 89  ? -10.387 26.249 11.392  1.00 28.37 ? 88  MET A N   1 
ATOM   392  C CA  . MET A 1 89  ? -9.511  27.390 11.701  1.00 33.67 ? 88  MET A CA  1 
ATOM   393  C C   . MET A 1 89  ? -10.145 28.739 11.307  1.00 29.96 ? 88  MET A C   1 
ATOM   394  O O   . MET A 1 89  ? -9.959  29.709 12.008  1.00 27.49 ? 88  MET A O   1 
ATOM   395  C CB  . MET A 1 89  ? -8.144  27.234 11.007  1.00 37.59 ? 88  MET A CB  1 
ATOM   396  C CG  . MET A 1 89  ? -7.056  28.292 11.366  1.00 39.26 ? 88  MET A CG  1 
ATOM   397  S SD  . MET A 1 89  ? -6.712  28.557 13.125  1.00 41.90 ? 88  MET A SD  1 
ATOM   398  C CE  . MET A 1 89  ? -6.768  26.902 13.765  1.00 21.58 ? 88  MET A CE  1 
ATOM   399  N N   . GLU A 1 90  ? -10.883 28.770 10.195  1.00 33.21 ? 89  GLU A N   1 
ATOM   400  C CA  . GLU A 1 90  ? -11.565 29.967 9.714   1.00 32.78 ? 89  GLU A CA  1 
ATOM   401  C C   . GLU A 1 90  ? -12.454 30.596 10.783  1.00 33.07 ? 89  GLU A C   1 
ATOM   402  O O   . GLU A 1 90  ? -12.491 31.839 10.914  1.00 34.89 ? 89  GLU A O   1 
ATOM   403  C CB  . GLU A 1 90  ? -12.407 29.657 8.451   1.00 31.81 ? 89  GLU A CB  1 
ATOM   404  C CG  . GLU A 1 90  ? -13.064 30.915 7.812   1.00 31.40 ? 89  GLU A CG  1 
ATOM   405  C CD  . GLU A 1 90  ? -13.880 30.653 6.522   1.00 35.75 ? 89  GLU A CD  1 
ATOM   406  O OE1 . GLU A 1 90  ? -14.060 29.489 6.147   1.00 37.32 ? 89  GLU A OE1 1 
ATOM   407  O OE2 . GLU A 1 90  ? -14.327 31.633 5.875   1.00 34.49 ? 89  GLU A OE2 1 
ATOM   408  N N   . VAL A 1 91  ? -13.176 29.754 11.525  1.00 30.01 ? 90  VAL A N   1 
ATOM   409  C CA  . VAL A 1 91  ? -14.025 30.217 12.630  1.00 28.99 ? 90  VAL A CA  1 
ATOM   410  C C   . VAL A 1 91  ? -13.167 30.840 13.754  1.00 30.24 ? 90  VAL A C   1 
ATOM   411  O O   . VAL A 1 91  ? -13.507 31.899 14.263  1.00 31.22 ? 90  VAL A O   1 
ATOM   412  C CB  . VAL A 1 91  ? -14.936 29.062 13.203  1.00 27.09 ? 90  VAL A CB  1 
ATOM   413  C CG1 . VAL A 1 91  ? -15.635 29.505 14.481  1.00 31.67 ? 90  VAL A CG1 1 
ATOM   414  C CG2 . VAL A 1 91  ? -15.982 28.612 12.175  1.00 27.73 ? 90  VAL A CG2 1 
ATOM   415  N N   . VAL A 1 92  ? -12.077 30.167 14.135  1.00 26.67 ? 91  VAL A N   1 
ATOM   416  C CA  . VAL A 1 92  ? -11.125 30.682 15.125  1.00 25.71 ? 91  VAL A CA  1 
ATOM   417  C C   . VAL A 1 92  ? -10.592 32.057 14.711  1.00 26.74 ? 91  VAL A C   1 
ATOM   418  O O   . VAL A 1 92  ? -10.588 33.011 15.505  1.00 25.68 ? 91  VAL A O   1 
ATOM   419  C CB  . VAL A 1 92  ? -9.933  29.681 15.373  1.00 28.67 ? 91  VAL A CB  1 
ATOM   420  C CG1 . VAL A 1 92  ? -8.810  30.328 16.197  1.00 18.08 ? 91  VAL A CG1 1 
ATOM   421  C CG2 . VAL A 1 92  ? -10.427 28.385 16.066  1.00 22.33 ? 91  VAL A CG2 1 
ATOM   422  N N   . LEU A 1 93  ? -10.157 32.165 13.461  1.00 26.14 ? 92  LEU A N   1 
ATOM   423  C CA  . LEU A 1 93  ? -9.587  33.426 12.969  1.00 27.68 ? 92  LEU A CA  1 
ATOM   424  C C   . LEU A 1 93  ? -10.622 34.560 12.962  1.00 26.60 ? 92  LEU A C   1 
ATOM   425  O O   . LEU A 1 93  ? -10.305 35.656 13.354  1.00 28.16 ? 92  LEU A O   1 
ATOM   426  C CB  . LEU A 1 93  ? -8.967  33.235 11.565  1.00 30.60 ? 92  LEU A CB  1 
ATOM   427  C CG  . LEU A 1 93  ? -7.846  32.184 11.435  1.00 23.68 ? 92  LEU A CG  1 
ATOM   428  C CD1 . LEU A 1 93  ? -7.405  32.116 9.981   1.00 25.63 ? 92  LEU A CD1 1 
ATOM   429  C CD2 . LEU A 1 93  ? -6.661  32.427 12.385  1.00 22.24 ? 92  LEU A CD2 1 
ATOM   430  N N   . LEU A 1 94  ? -11.852 34.267 12.526  1.00 28.96 ? 93  LEU A N   1 
ATOM   431  C CA  . LEU A 1 94  ? -12.930 35.252 12.444  1.00 31.65 ? 93  LEU A CA  1 
ATOM   432  C C   . LEU A 1 94  ? -13.359 35.752 13.800  1.00 27.71 ? 93  LEU A C   1 
ATOM   433  O O   . LEU A 1 94  ? -13.654 36.927 13.947  1.00 30.40 ? 93  LEU A O   1 
ATOM   434  C CB  . LEU A 1 94  ? -14.162 34.723 11.661  1.00 30.41 ? 93  LEU A CB  1 
ATOM   435  C CG  . LEU A 1 94  ? -14.096 34.641 10.137  1.00 37.54 ? 93  LEU A CG  1 
ATOM   436  C CD1 . LEU A 1 94  ? -15.245 33.747 9.637   1.00 34.14 ? 93  LEU A CD1 1 
ATOM   437  C CD2 . LEU A 1 94  ? -14.115 35.993 9.435   1.00 30.23 ? 93  LEU A CD2 1 
ATOM   438  N N   . LYS A 1 95  ? -13.369 34.871 14.795  1.00 31.79 ? 94  LYS A N   1 
ATOM   439  C CA  . LYS A 1 95  ? -13.725 35.250 16.148  1.00 33.51 ? 94  LYS A CA  1 
ATOM   440  C C   . LYS A 1 95  ? -12.670 36.178 16.693  1.00 29.97 ? 94  LYS A C   1 
ATOM   441  O O   . LYS A 1 95  ? -12.985 37.102 17.440  1.00 28.95 ? 94  LYS A O   1 
ATOM   442  C CB  . LYS A 1 95  ? -13.846 34.031 17.093  1.00 34.48 ? 94  LYS A CB  1 
ATOM   443  C CG  . LYS A 1 95  ? -15.078 33.159 16.895  1.00 45.49 ? 94  LYS A CG  1 
ATOM   444  C CD  . LYS A 1 95  ? -15.132 32.081 17.979  1.00 46.14 ? 94  LYS A CD  1 
ATOM   445  C CE  . LYS A 1 95  ? -16.228 31.061 17.724  1.00 50.39 ? 94  LYS A CE  1 
ATOM   446  N N   . LYS A 1 96  ? -11.411 35.911 16.339  1.00 28.28 ? 95  LYS A N   1 
ATOM   447  C CA  . LYS A 1 96  ? -10.309 36.740 16.804  1.00 24.90 ? 95  LYS A CA  1 
ATOM   448  C C   . LYS A 1 96  ? -10.385 38.144 16.231  1.00 20.73 ? 95  LYS A C   1 
ATOM   449  O O   . LYS A 1 96  ? -9.936  39.084 16.873  1.00 26.79 ? 95  LYS A O   1 
ATOM   450  C CB  . LYS A 1 96  ? -8.968  36.102 16.464  1.00 25.55 ? 95  LYS A CB  1 
ATOM   451  C CG  . LYS A 1 96  ? -8.567  34.963 17.377  1.00 25.72 ? 95  LYS A CG  1 
ATOM   452  C CD  . LYS A 1 96  ? -7.349  34.239 16.826  1.00 29.71 ? 95  LYS A CD  1 
ATOM   453  C CE  . LYS A 1 96  ? -6.291  34.057 17.866  1.00 38.38 ? 95  LYS A CE  1 
ATOM   454  N NZ  . LYS A 1 96  ? -5.678  35.348 18.302  1.00 40.78 ? 95  LYS A NZ  1 
ATOM   455  N N   . VAL A 1 97  ? -10.945 38.300 15.026  1.00 24.14 ? 96  VAL A N   1 
ATOM   456  C CA  . VAL A 1 97  ? -10.988 39.613 14.385  1.00 26.82 ? 96  VAL A CA  1 
ATOM   457  C C   . VAL A 1 97  ? -12.348 40.320 14.460  1.00 31.59 ? 96  VAL A C   1 
ATOM   458  O O   . VAL A 1 97  ? -12.501 41.433 13.946  1.00 31.42 ? 96  VAL A O   1 
ATOM   459  C CB  . VAL A 1 97  ? -10.487 39.557 12.913  1.00 29.91 ? 96  VAL A CB  1 
ATOM   460  C CG1 . VAL A 1 97  ? -9.003  39.165 12.854  1.00 26.11 ? 96  VAL A CG1 1 
ATOM   461  C CG2 . VAL A 1 97  ? -11.368 38.660 12.043  1.00 28.57 ? 96  VAL A CG2 1 
ATOM   462  N N   . SER A 1 98  ? -13.319 39.685 15.126  1.00 33.25 ? 97  SER A N   1 
ATOM   463  C CA  . SER A 1 98  ? -14.711 40.106 15.077  1.00 35.50 ? 97  SER A CA  1 
ATOM   464  C C   . SER A 1 98  ? -15.045 41.185 16.066  1.00 37.45 ? 97  SER A C   1 
ATOM   465  O O   . SER A 1 98  ? -16.151 41.699 16.021  1.00 41.95 ? 97  SER A O   1 
ATOM   466  C CB  . SER A 1 98  ? -15.649 38.932 15.345  1.00 41.46 ? 97  SER A CB  1 
ATOM   467  O OG  . SER A 1 98  ? -15.558 38.541 16.701  1.00 39.01 ? 97  SER A OG  1 
ATOM   468  N N   . SER A 1 99  ? -14.124 41.531 16.957  1.00 38.03 ? 98  SER A N   1 
ATOM   469  C CA  . SER A 1 99  ? -14.434 42.528 17.972  1.00 46.23 ? 98  SER A CA  1 
ATOM   470  C C   . SER A 1 99  ? -14.304 43.942 17.421  1.00 46.49 ? 98  SER A C   1 
ATOM   471  O O   . SER A 1 99  ? -13.351 44.275 16.704  1.00 48.15 ? 98  SER A O   1 
ATOM   472  C CB  . SER A 1 99  ? -13.565 42.361 19.241  1.00 48.35 ? 98  SER A CB  1 
ATOM   473  O OG  . SER A 1 99  ? -14.044 41.293 20.051  1.00 58.53 ? 98  SER A OG  1 
ATOM   474  N N   . GLY A 1 100 ? -15.279 44.768 17.779  1.00 46.30 ? 99  GLY A N   1 
ATOM   475  C CA  . GLY A 1 100 ? -15.250 46.180 17.461  1.00 44.17 ? 99  GLY A CA  1 
ATOM   476  C C   . GLY A 1 100 ? -15.628 46.436 16.020  1.00 45.31 ? 99  GLY A C   1 
ATOM   477  O O   . GLY A 1 100 ? -16.046 45.523 15.273  1.00 46.54 ? 99  GLY A O   1 
ATOM   478  N N   . PHE A 1 101 ? -15.476 47.700 15.642  1.00 43.75 ? 100 PHE A N   1 
ATOM   479  C CA  . PHE A 1 101 ? -15.696 48.151 14.283  1.00 40.87 ? 100 PHE A CA  1 
ATOM   480  C C   . PHE A 1 101 ? -14.351 48.098 13.524  1.00 38.91 ? 100 PHE A C   1 
ATOM   481  O O   . PHE A 1 101 ? -13.336 48.668 13.971  1.00 38.69 ? 100 PHE A O   1 
ATOM   482  C CB  . PHE A 1 101 ? -16.259 49.572 14.304  1.00 40.94 ? 100 PHE A CB  1 
ATOM   483  C CG  . PHE A 1 101 ? -17.541 49.716 15.094  1.00 49.88 ? 100 PHE A CG  1 
ATOM   484  C CD1 . PHE A 1 101 ? -18.775 49.464 14.499  1.00 54.00 ? 100 PHE A CD1 1 
ATOM   485  C CD2 . PHE A 1 101 ? -17.514 50.107 16.433  1.00 55.84 ? 100 PHE A CD2 1 
ATOM   486  C CE1 . PHE A 1 101 ? -19.958 49.601 15.223  1.00 50.47 ? 100 PHE A CE1 1 
ATOM   487  C CE2 . PHE A 1 101 ? -18.696 50.248 17.159  1.00 52.67 ? 100 PHE A CE2 1 
ATOM   488  C CZ  . PHE A 1 101 ? -19.916 49.992 16.550  1.00 52.00 ? 100 PHE A CZ  1 
ATOM   489  N N   . SER A 1 102 ? -14.347 47.390 12.400  1.00 32.20 ? 101 SER A N   1 
ATOM   490  C CA  . SER A 1 102 ? -13.195 47.357 11.514  1.00 36.00 ? 101 SER A CA  1 
ATOM   491  C C   . SER A 1 102 ? -13.604 47.129 10.026  1.00 34.60 ? 101 SER A C   1 
ATOM   492  O O   . SER A 1 102 ? -14.789 47.003 9.704   1.00 30.58 ? 101 SER A O   1 
ATOM   493  C CB  . SER A 1 102 ? -12.233 46.268 11.974  1.00 34.21 ? 101 SER A CB  1 
ATOM   494  O OG  . SER A 1 102 ? -12.807 44.986 11.768  1.00 32.79 ? 101 SER A OG  1 
ATOM   495  N N   . GLY A 1 103 ? -12.592 47.102 9.152   1.00 29.70 ? 102 GLY A N   1 
ATOM   496  C CA  . GLY A 1 103 ? -12.727 46.750 7.754   1.00 27.04 ? 102 GLY A CA  1 
ATOM   497  C C   . GLY A 1 103 ? -12.595 45.268 7.483   1.00 28.48 ? 102 GLY A C   1 
ATOM   498  O O   . GLY A 1 103 ? -12.265 44.871 6.385   1.00 26.99 ? 102 GLY A O   1 
ATOM   499  N N   . VAL A 1 104 ? -12.857 44.447 8.492   1.00 27.61 ? 103 VAL A N   1 
ATOM   500  C CA  . VAL A 1 104 ? -12.938 43.008 8.340   1.00 31.70 ? 103 VAL A CA  1 
ATOM   501  C C   . VAL A 1 104 ? -14.390 42.579 8.480   1.00 28.51 ? 103 VAL A C   1 
ATOM   502  O O   . VAL A 1 104 ? -15.126 43.119 9.315   1.00 26.35 ? 103 VAL A O   1 
ATOM   503  C CB  . VAL A 1 104 ? -12.034 42.316 9.407   1.00 33.22 ? 103 VAL A CB  1 
ATOM   504  C CG1 . VAL A 1 104 ? -12.155 40.820 9.359   1.00 46.37 ? 103 VAL A CG1 1 
ATOM   505  C CG2 . VAL A 1 104 ? -10.632 42.715 9.160   1.00 29.08 ? 103 VAL A CG2 1 
ATOM   506  N N   . ILE A 1 105 ? -14.803 41.606 7.671   1.00 29.52 ? 104 ILE A N   1 
ATOM   507  C CA  . ILE A 1 105 ? -16.153 41.016 7.790   1.00 35.18 ? 104 ILE A CA  1 
ATOM   508  C C   . ILE A 1 105 ? -16.345 40.354 9.173   1.00 34.96 ? 104 ILE A C   1 
ATOM   509  O O   . ILE A 1 105 ? -15.479 39.609 9.653   1.00 37.60 ? 104 ILE A O   1 
ATOM   510  C CB  . ILE A 1 105 ? -16.430 39.956 6.665   1.00 37.52 ? 104 ILE A CB  1 
ATOM   511  C CG1 . ILE A 1 105 ? -17.922 39.888 6.319   1.00 35.78 ? 104 ILE A CG1 1 
ATOM   512  C CG2 . ILE A 1 105 ? -15.800 38.555 7.040   1.00 39.23 ? 104 ILE A CG2 1 
ATOM   513  C CD1 . ILE A 1 105 ? -18.385 41.080 5.426   1.00 33.71 ? 104 ILE A CD1 1 
ATOM   514  N N   . ARG A 1 106 ? -17.510 40.605 9.780   1.00 33.51 ? 105 ARG A N   1 
ATOM   515  C CA  . ARG A 1 106 ? -17.833 40.137 11.132  1.00 31.75 ? 105 ARG A CA  1 
ATOM   516  C C   . ARG A 1 106 ? -18.601 38.804 11.105  1.00 26.97 ? 105 ARG A C   1 
ATOM   517  O O   . ARG A 1 106 ? -19.633 38.687 10.434  1.00 27.33 ? 105 ARG A O   1 
ATOM   518  C CB  . ARG A 1 106 ? -18.682 41.199 11.854  1.00 29.11 ? 105 ARG A CB  1 
ATOM   519  C CG  . ARG A 1 106 ? -18.858 40.995 13.347  1.00 42.20 ? 105 ARG A CG  1 
ATOM   520  C CD  . ARG A 1 106 ? -19.948 41.896 13.899  1.00 57.34 ? 105 ARG A CD  1 
ATOM   521  N NE  . ARG A 1 106 ? -19.676 43.307 13.615  1.00 75.34 ? 105 ARG A NE  1 
ATOM   522  C CZ  . ARG A 1 106 ? -18.824 44.079 14.291  1.00 79.02 ? 105 ARG A CZ  1 
ATOM   523  N NH1 . ARG A 1 106 ? -18.135 43.596 15.319  1.00 80.62 ? 105 ARG A NH1 1 
ATOM   524  N NH2 . ARG A 1 106 ? -18.664 45.349 13.930  1.00 82.79 ? 105 ARG A NH2 1 
ATOM   525  N N   . LEU A 1 107 ? -18.086 37.822 11.838  1.00 26.24 ? 106 LEU A N   1 
ATOM   526  C CA  . LEU A 1 107 ? -18.776 36.570 12.091  1.00 27.98 ? 106 LEU A CA  1 
ATOM   527  C C   . LEU A 1 107 ? -19.856 36.820 13.143  1.00 29.91 ? 106 LEU A C   1 
ATOM   528  O O   . LEU A 1 107 ? -19.555 37.303 14.204  1.00 28.46 ? 106 LEU A O   1 
ATOM   529  C CB  . LEU A 1 107 ? -17.811 35.495 12.582  1.00 27.86 ? 106 LEU A CB  1 
ATOM   530  C CG  . LEU A 1 107 ? -18.438 34.125 12.930  1.00 32.52 ? 106 LEU A CG  1 
ATOM   531  C CD1 . LEU A 1 107 ? -18.940 33.415 11.654  1.00 29.07 ? 106 LEU A CD1 1 
ATOM   532  C CD2 . LEU A 1 107 ? -17.440 33.258 13.717  1.00 33.73 ? 106 LEU A CD2 1 
ATOM   533  N N   . LEU A 1 108 ? -21.106 36.501 12.816  1.00 29.62 ? 107 LEU A N   1 
ATOM   534  C CA  . LEU A 1 108 ? -22.231 36.674 13.739  1.00 31.84 ? 107 LEU A CA  1 
ATOM   535  C C   . LEU A 1 108 ? -22.548 35.378 14.474  1.00 28.31 ? 107 LEU A C   1 
ATOM   536  O O   . LEU A 1 108 ? -22.960 35.408 15.608  1.00 28.26 ? 107 LEU A O   1 
ATOM   537  C CB  . LEU A 1 108 ? -23.493 37.176 12.994  1.00 27.22 ? 107 LEU A CB  1 
ATOM   538  C CG  . LEU A 1 108 ? -23.385 38.560 12.337  1.00 28.29 ? 107 LEU A CG  1 
ATOM   539  C CD1 . LEU A 1 108 ? -24.648 38.966 11.553  1.00 28.21 ? 107 LEU A CD1 1 
ATOM   540  C CD2 . LEU A 1 108 ? -23.042 39.618 13.412  1.00 28.64 ? 107 LEU A CD2 1 
ATOM   541  N N   . ASP A 1 109 ? -22.384 34.246 13.806  1.00 27.15 ? 108 ASP A N   1 
ATOM   542  C CA  . ASP A 1 109 ? -22.725 32.959 14.382  1.00 27.18 ? 108 ASP A CA  1 
ATOM   543  C C   . ASP A 1 109 ? -22.153 31.851 13.502  1.00 27.70 ? 108 ASP A C   1 
ATOM   544  O O   . ASP A 1 109 ? -21.630 32.114 12.412  1.00 28.95 ? 108 ASP A O   1 
ATOM   545  C CB  . ASP A 1 109 ? -24.247 32.824 14.461  1.00 29.83 ? 108 ASP A CB  1 
ATOM   546  C CG  . ASP A 1 109 ? -24.715 31.925 15.599  1.00 31.42 ? 108 ASP A CG  1 
ATOM   547  O OD1 . ASP A 1 109 ? -23.899 31.542 16.481  1.00 34.15 ? 108 ASP A OD1 1 
ATOM   548  O OD2 . ASP A 1 109 ? -25.926 31.625 15.610  1.00 35.76 ? 108 ASP A OD2 1 
ATOM   549  N N   . TRP A 1 110 ? -22.238 30.618 13.987  1.00 28.97 ? 109 TRP A N   1 
ATOM   550  C CA  . TRP A 1 110 ? -21.848 29.460 13.195  1.00 29.80 ? 109 TRP A CA  1 
ATOM   551  C C   . TRP A 1 110 ? -22.534 28.223 13.761  1.00 28.17 ? 109 TRP A C   1 
ATOM   552  O O   . TRP A 1 110 ? -22.933 28.195 14.934  1.00 27.32 ? 109 TRP A O   1 
ATOM   553  C CB  . TRP A 1 110 ? -20.316 29.272 13.173  1.00 26.29 ? 109 TRP A CB  1 
ATOM   554  C CG  . TRP A 1 110 ? -19.762 29.028 14.549  1.00 27.17 ? 109 TRP A CG  1 
ATOM   555  C CD1 . TRP A 1 110 ? -19.365 29.977 15.439  1.00 26.95 ? 109 TRP A CD1 1 
ATOM   556  C CD2 . TRP A 1 110 ? -19.596 27.761 15.213  1.00 32.64 ? 109 TRP A CD2 1 
ATOM   557  N NE1 . TRP A 1 110 ? -18.939 29.391 16.599  1.00 28.99 ? 109 TRP A NE1 1 
ATOM   558  C CE2 . TRP A 1 110 ? -19.073 28.031 16.493  1.00 32.17 ? 109 TRP A CE2 1 
ATOM   559  C CE3 . TRP A 1 110 ? -19.813 26.430 14.841  1.00 45.26 ? 109 TRP A CE3 1 
ATOM   560  C CZ2 . TRP A 1 110 ? -18.775 27.019 17.413  1.00 39.58 ? 109 TRP A CZ2 1 
ATOM   561  C CZ3 . TRP A 1 110 ? -19.527 25.418 15.769  1.00 51.60 ? 109 TRP A CZ3 1 
ATOM   562  C CH2 . TRP A 1 110 ? -19.007 25.724 17.034  1.00 46.67 ? 109 TRP A CH2 1 
ATOM   563  N N   . PHE A 1 111 ? -22.672 27.217 12.900  1.00 30.21 ? 110 PHE A N   1 
ATOM   564  C CA  . PHE A 1 111 ? -23.391 25.979 13.182  1.00 27.21 ? 110 PHE A CA  1 
ATOM   565  C C   . PHE A 1 111 ? -22.634 24.802 12.582  1.00 26.33 ? 110 PHE A C   1 
ATOM   566  O O   . PHE A 1 111 ? -22.180 24.872 11.454  1.00 32.52 ? 110 PHE A O   1 
ATOM   567  C CB  . PHE A 1 111 ? -24.808 26.010 12.543  1.00 31.88 ? 110 PHE A CB  1 
ATOM   568  C CG  . PHE A 1 111 ? -25.693 27.109 13.066  1.00 36.86 ? 110 PHE A CG  1 
ATOM   569  C CD1 . PHE A 1 111 ? -26.583 26.862 14.109  1.00 40.41 ? 110 PHE A CD1 1 
ATOM   570  C CD2 . PHE A 1 111 ? -25.637 28.394 12.514  1.00 37.23 ? 110 PHE A CD2 1 
ATOM   571  C CE1 . PHE A 1 111 ? -27.396 27.884 14.618  1.00 42.17 ? 110 PHE A CE1 1 
ATOM   572  C CE2 . PHE A 1 111 ? -26.430 29.427 13.018  1.00 41.99 ? 110 PHE A CE2 1 
ATOM   573  C CZ  . PHE A 1 111 ? -27.319 29.168 14.076  1.00 39.91 ? 110 PHE A CZ  1 
ATOM   574  N N   . GLU A 1 112 ? -22.501 23.719 13.326  1.00 31.02 ? 111 GLU A N   1 
ATOM   575  C CA  . GLU A 1 112 ? -21.981 22.481 12.775  1.00 30.20 ? 111 GLU A CA  1 
ATOM   576  C C   . GLU A 1 112 ? -23.128 21.592 12.299  1.00 31.62 ? 111 GLU A C   1 
ATOM   577  O O   . GLU A 1 112 ? -24.129 21.430 12.996  1.00 29.12 ? 111 GLU A O   1 
ATOM   578  C CB  . GLU A 1 112 ? -21.152 21.714 13.812  1.00 26.27 ? 111 GLU A CB  1 
ATOM   579  C CG  . GLU A 1 112 ? -20.529 20.452 13.224  1.00 22.61 ? 111 GLU A CG  1 
ATOM   580  C CD  . GLU A 1 112 ? -19.736 19.641 14.224  1.00 30.43 ? 111 GLU A CD  1 
ATOM   581  O OE1 . GLU A 1 112 ? -19.354 20.163 15.294  1.00 28.00 ? 111 GLU A OE1 1 
ATOM   582  O OE2 . GLU A 1 112 ? -19.479 18.465 13.922  1.00 40.22 ? 111 GLU A OE2 1 
ATOM   583  N N   . ARG A 1 113 ? -22.965 21.011 11.114  1.00 30.12 ? 112 ARG A N   1 
ATOM   584  C CA  . ARG A 1 113 ? -23.900 20.022 10.596  1.00 27.18 ? 112 ARG A CA  1 
ATOM   585  C C   . ARG A 1 113 ? -23.153 18.709 10.387  1.00 27.75 ? 112 ARG A C   1 
ATOM   586  O O   . ARG A 1 113 ? -21.925 18.670 10.463  1.00 28.25 ? 112 ARG A O   1 
ATOM   587  C CB  . ARG A 1 113 ? -24.480 20.501 9.275   1.00 29.02 ? 112 ARG A CB  1 
ATOM   588  C CG  . ARG A 1 113 ? -25.674 21.421 9.392   1.00 28.23 ? 112 ARG A CG  1 
ATOM   589  C CD  . ARG A 1 113 ? -25.905 22.083 8.049   1.00 33.33 ? 112 ARG A CD  1 
ATOM   590  N NE  . ARG A 1 113 ? -27.231 22.683 7.943   1.00 36.90 ? 112 ARG A NE  1 
ATOM   591  C CZ  . ARG A 1 113 ? -27.718 23.275 6.852   1.00 24.96 ? 112 ARG A CZ  1 
ATOM   592  N NH1 . ARG A 1 113 ? -26.991 23.370 5.747   1.00 35.94 ? 112 ARG A NH1 1 
ATOM   593  N NH2 . ARG A 1 113 ? -28.936 23.796 6.877   1.00 36.83 ? 112 ARG A NH2 1 
ATOM   594  N N   . PRO A 1 114 ? -23.887 17.616 10.125  1.00 29.97 ? 113 PRO A N   1 
ATOM   595  C CA  . PRO A 1 114 ? -23.177 16.361 9.901   1.00 32.53 ? 113 PRO A CA  1 
ATOM   596  C C   . PRO A 1 114 ? -21.978 16.482 8.944   1.00 33.42 ? 113 PRO A C   1 
ATOM   597  O O   . PRO A 1 114 ? -20.898 16.011 9.266   1.00 35.10 ? 113 PRO A O   1 
ATOM   598  C CB  . PRO A 1 114 ? -24.265 15.456 9.326   1.00 33.84 ? 113 PRO A CB  1 
ATOM   599  C CG  . PRO A 1 114 ? -25.526 15.962 9.971   1.00 31.58 ? 113 PRO A CG  1 
ATOM   600  C CD  . PRO A 1 114 ? -25.345 17.456 9.965   1.00 25.42 ? 113 PRO A CD  1 
ATOM   601  N N   . ASP A 1 115 ? -22.148 17.153 7.810   1.00 35.17 ? 114 ASP A N   1 
ATOM   602  C CA  . ASP A 1 115 ? -21.137 17.130 6.767   1.00 33.04 ? 114 ASP A CA  1 
ATOM   603  C C   . ASP A 1 115 ? -20.583 18.478 6.409   1.00 32.28 ? 114 ASP A C   1 
ATOM   604  O O   . ASP A 1 115 ? -19.837 18.595 5.440   1.00 32.11 ? 114 ASP A O   1 
ATOM   605  C CB  . ASP A 1 115 ? -21.744 16.493 5.526   1.00 36.87 ? 114 ASP A CB  1 
ATOM   606  C CG  . ASP A 1 115 ? -22.133 15.063 5.763   1.00 35.72 ? 114 ASP A CG  1 
ATOM   607  O OD1 . ASP A 1 115 ? -21.248 14.319 6.227   1.00 42.49 ? 114 ASP A OD1 1 
ATOM   608  O OD2 . ASP A 1 115 ? -23.304 14.691 5.500   1.00 44.47 ? 114 ASP A OD2 1 
ATOM   609  N N   . SER A 1 116 ? -20.922 19.493 7.197   1.00 33.78 ? 115 SER A N   1 
ATOM   610  C CA  . SER A 1 116 ? -20.545 20.865 6.874   1.00 30.93 ? 115 SER A CA  1 
ATOM   611  C C   . SER A 1 116 ? -20.586 21.795 8.101   1.00 30.74 ? 115 SER A C   1 
ATOM   612  O O   . SER A 1 116 ? -21.155 21.465 9.130   1.00 26.27 ? 115 SER A O   1 
ATOM   613  C CB  . SER A 1 116 ? -21.465 21.414 5.776   1.00 29.96 ? 115 SER A CB  1 
ATOM   614  O OG  . SER A 1 116 ? -22.790 21.592 6.259   1.00 30.12 ? 115 SER A OG  1 
ATOM   615  N N   . PHE A 1 117 ? -19.947 22.952 7.957   1.00 31.61 ? 116 PHE A N   1 
ATOM   616  C CA  . PHE A 1 117 ? -20.104 24.070 8.887   1.00 31.39 ? 116 PHE A CA  1 
ATOM   617  C C   . PHE A 1 117 ? -20.783 25.217 8.135   1.00 30.23 ? 116 PHE A C   1 
ATOM   618  O O   . PHE A 1 117 ? -20.505 25.460 6.963   1.00 27.82 ? 116 PHE A O   1 
ATOM   619  C CB  . PHE A 1 117 ? -18.736 24.537 9.464   1.00 27.18 ? 116 PHE A CB  1 
ATOM   620  C CG  . PHE A 1 117 ? -18.267 23.731 10.645  1.00 26.09 ? 116 PHE A CG  1 
ATOM   621  C CD1 . PHE A 1 117 ? -18.509 24.166 11.941  1.00 33.76 ? 116 PHE A CD1 1 
ATOM   622  C CD2 . PHE A 1 117 ? -17.584 22.532 10.460  1.00 22.62 ? 116 PHE A CD2 1 
ATOM   623  C CE1 . PHE A 1 117 ? -18.092 23.435 13.014  1.00 26.07 ? 116 PHE A CE1 1 
ATOM   624  C CE2 . PHE A 1 117 ? -17.168 21.782 11.537  1.00 30.52 ? 116 PHE A CE2 1 
ATOM   625  C CZ  . PHE A 1 117 ? -17.423 22.232 12.823  1.00 35.43 ? 116 PHE A CZ  1 
ATOM   626  N N   . VAL A 1 118 ? -21.688 25.893 8.830   1.00 28.78 ? 117 VAL A N   1 
ATOM   627  C CA  . VAL A 1 118 ? -22.367 27.064 8.330   1.00 29.49 ? 117 VAL A CA  1 
ATOM   628  C C   . VAL A 1 118 ? -21.929 28.273 9.163   1.00 28.30 ? 117 VAL A C   1 
ATOM   629  O O   . VAL A 1 118 ? -22.066 28.278 10.399  1.00 28.84 ? 117 VAL A O   1 
ATOM   630  C CB  . VAL A 1 118 ? -23.930 26.909 8.410   1.00 26.96 ? 117 VAL A CB  1 
ATOM   631  C CG1 . VAL A 1 118 ? -24.606 28.032 7.613   1.00 30.07 ? 117 VAL A CG1 1 
ATOM   632  C CG2 . VAL A 1 118 ? -24.375 25.517 7.917   1.00 23.95 ? 117 VAL A CG2 1 
ATOM   633  N N   . LEU A 1 119 ? -21.442 29.292 8.466   1.00 31.61 ? 118 LEU A N   1 
ATOM   634  C CA  . LEU A 1 119 ? -20.986 30.569 9.037   1.00 30.12 ? 118 LEU A CA  1 
ATOM   635  C C   . LEU A 1 119 ? -21.988 31.661 8.678   1.00 29.07 ? 118 LEU A C   1 
ATOM   636  O O   . LEU A 1 119 ? -22.389 31.788 7.506   1.00 26.75 ? 118 LEU A O   1 
ATOM   637  C CB  . LEU A 1 119 ? -19.600 30.926 8.465   1.00 31.86 ? 118 LEU A CB  1 
ATOM   638  C CG  . LEU A 1 119 ? -18.362 30.199 9.028   1.00 37.30 ? 118 LEU A CG  1 
ATOM   639  C CD1 . LEU A 1 119 ? -18.432 28.711 8.924   1.00 33.58 ? 118 LEU A CD1 1 
ATOM   640  C CD2 . LEU A 1 119 ? -17.137 30.686 8.302   1.00 38.18 ? 118 LEU A CD2 1 
ATOM   641  N N   . ILE A 1 120 ? -22.437 32.416 9.683   1.00 30.33 ? 119 ILE A N   1 
ATOM   642  C CA  . ILE A 1 120 ? -23.328 33.573 9.470   1.00 27.60 ? 119 ILE A CA  1 
ATOM   643  C C   . ILE A 1 120 ? -22.477 34.839 9.621   1.00 28.37 ? 119 ILE A C   1 
ATOM   644  O O   . ILE A 1 120 ? -21.859 35.070 10.664  1.00 28.86 ? 119 ILE A O   1 
ATOM   645  C CB  . ILE A 1 120 ? -24.531 33.605 10.455  1.00 28.12 ? 119 ILE A CB  1 
ATOM   646  C CG1 . ILE A 1 120 ? -25.261 32.250 10.511  1.00 26.49 ? 119 ILE A CG1 1 
ATOM   647  C CG2 . ILE A 1 120 ? -25.463 34.805 10.136  1.00 20.31 ? 119 ILE A CG2 1 
ATOM   648  C CD1 . ILE A 1 120 ? -26.040 31.833 9.222   1.00 27.63 ? 119 ILE A CD1 1 
ATOM   649  N N   . LEU A 1 121 ? -22.422 35.626 8.554   1.00 30.51 ? 120 LEU A N   1 
ATOM   650  C CA  . LEU A 1 121 ? -21.612 36.822 8.492   1.00 31.69 ? 120 LEU A CA  1 
ATOM   651  C C   . LEU A 1 121 ? -22.529 38.022 8.278   1.00 34.51 ? 120 LEU A C   1 
ATOM   652  O O   . LEU A 1 121 ? -23.620 37.881 7.735   1.00 32.89 ? 120 LEU A O   1 
ATOM   653  C CB  . LEU A 1 121 ? -20.529 36.691 7.379   1.00 32.94 ? 120 LEU A CB  1 
ATOM   654  C CG  . LEU A 1 121 ? -19.733 35.383 7.652   1.00 40.75 ? 120 LEU A CG  1 
ATOM   655  C CD1 . LEU A 1 121 ? -19.675 34.433 6.458   1.00 24.16 ? 120 LEU A CD1 1 
ATOM   656  C CD2 . LEU A 1 121 ? -18.392 35.626 8.235   1.00 32.22 ? 120 LEU A CD2 1 
ATOM   657  N N   . GLU A 1 122 ? -22.089 39.196 8.739   1.00 36.57 ? 121 GLU A N   1 
ATOM   658  C CA  . GLU A 1 122 ? -22.725 40.463 8.368   1.00 40.16 ? 121 GLU A CA  1 
ATOM   659  C C   . GLU A 1 122 ? -22.692 40.610 6.843   1.00 39.85 ? 121 GLU A C   1 
ATOM   660  O O   . GLU A 1 122 ? -21.834 40.042 6.167   1.00 43.49 ? 121 GLU A O   1 
ATOM   661  C CB  . GLU A 1 122 ? -21.981 41.653 9.006   1.00 40.75 ? 121 GLU A CB  1 
ATOM   662  C CG  . GLU A 1 122 ? -20.658 41.944 8.294   1.00 45.61 ? 121 GLU A CG  1 
ATOM   663  C CD  . GLU A 1 122 ? -19.903 43.143 8.828   1.00 39.87 ? 121 GLU A CD  1 
ATOM   664  O OE1 . GLU A 1 122 ? -20.521 44.137 9.288   1.00 49.88 ? 121 GLU A OE1 1 
ATOM   665  O OE2 . GLU A 1 122 ? -18.678 43.090 8.737   1.00 43.50 ? 121 GLU A OE2 1 
ATOM   666  N N   . ARG A 1 123 ? -23.623 41.374 6.304   1.00 39.46 ? 122 ARG A N   1 
ATOM   667  C CA  . ARG A 1 123 ? -23.667 41.616 4.878   1.00 39.68 ? 122 ARG A CA  1 
ATOM   668  C C   . ARG A 1 123 ? -23.922 43.101 4.615   1.00 42.19 ? 122 ARG A C   1 
ATOM   669  O O   . ARG A 1 123 ? -25.039 43.585 4.816   1.00 36.09 ? 122 ARG A O   1 
ATOM   670  C CB  . ARG A 1 123 ? -24.743 40.763 4.192   1.00 37.56 ? 122 ARG A CB  1 
ATOM   671  C CG  . ARG A 1 123 ? -24.845 41.019 2.686   1.00 36.27 ? 122 ARG A CG  1 
ATOM   672  C CD  . ARG A 1 123 ? -25.797 40.045 2.001   1.00 26.78 ? 122 ARG A CD  1 
ATOM   673  N NE  . ARG A 1 123 ? -27.141 39.995 2.611   1.00 30.06 ? 122 ARG A NE  1 
ATOM   674  C CZ  . ARG A 1 123 ? -28.186 40.711 2.218   1.00 30.10 ? 122 ARG A CZ  1 
ATOM   675  N NH1 . ARG A 1 123 ? -29.352 40.557 2.829   1.00 21.18 ? 122 ARG A NH1 1 
ATOM   676  N NH2 . ARG A 1 123 ? -28.076 41.586 1.228   1.00 32.23 ? 122 ARG A NH2 1 
ATOM   677  N N   . PRO A 1 124 ? -22.870 43.817 4.173   1.00 44.27 ? 123 PRO A N   1 
ATOM   678  C CA  . PRO A 1 124 ? -22.982 45.136 3.568   1.00 42.50 ? 123 PRO A CA  1 
ATOM   679  C C   . PRO A 1 124 ? -23.954 45.181 2.398   1.00 36.86 ? 123 PRO A C   1 
ATOM   680  O O   . PRO A 1 124 ? -24.000 44.271 1.560   1.00 34.82 ? 123 PRO A O   1 
ATOM   681  C CB  . PRO A 1 124 ? -21.557 45.404 3.044   1.00 44.89 ? 123 PRO A CB  1 
ATOM   682  C CG  . PRO A 1 124 ? -20.682 44.649 3.925   1.00 51.38 ? 123 PRO A CG  1 
ATOM   683  C CD  . PRO A 1 124 ? -21.459 43.433 4.377   1.00 47.27 ? 123 PRO A CD  1 
ATOM   684  N N   . GLU A 1 125 ? -24.679 46.278 2.302   1.00 33.55 ? 124 GLU A N   1 
ATOM   685  C CA  . GLU A 1 125 ? -25.597 46.472 1.196   1.00 38.09 ? 124 GLU A CA  1 
ATOM   686  C C   . GLU A 1 125 ? -25.786 47.999 1.027   1.00 39.04 ? 124 GLU A C   1 
ATOM   687  O O   . GLU A 1 125 ? -25.947 48.708 2.010   1.00 42.77 ? 124 GLU A O   1 
ATOM   688  C CB  . GLU A 1 125 ? -26.913 45.705 1.473   1.00 38.21 ? 124 GLU A CB  1 
ATOM   689  C CG  . GLU A 1 125 ? -28.209 46.229 0.816   1.00 48.64 ? 124 GLU A CG  1 
ATOM   690  C CD  . GLU A 1 125 ? -28.303 46.067 -0.713  1.00 57.05 ? 124 GLU A CD  1 
ATOM   691  O OE1 . GLU A 1 125 ? -27.688 45.135 -1.291  1.00 54.62 ? 124 GLU A OE1 1 
ATOM   692  O OE2 . GLU A 1 125 ? -29.031 46.883 -1.337  1.00 56.27 ? 124 GLU A OE2 1 
ATOM   693  N N   . PRO A 1 126 ? -25.662 48.517 -0.202  1.00 37.22 ? 125 PRO A N   1 
ATOM   694  C CA  . PRO A 1 126 ? -25.311 47.801 -1.416  1.00 35.75 ? 125 PRO A CA  1 
ATOM   695  C C   . PRO A 1 126 ? -23.809 47.586 -1.523  1.00 34.56 ? 125 PRO A C   1 
ATOM   696  O O   . PRO A 1 126 ? -23.027 48.372 -0.997  1.00 31.95 ? 125 PRO A O   1 
ATOM   697  C CB  . PRO A 1 126 ? -25.818 48.720 -2.535  1.00 38.29 ? 125 PRO A CB  1 
ATOM   698  C CG  . PRO A 1 126 ? -25.921 50.080 -1.927  1.00 40.08 ? 125 PRO A CG  1 
ATOM   699  C CD  . PRO A 1 126 ? -25.757 49.964 -0.430  1.00 39.15 ? 125 PRO A CD  1 
ATOM   700  N N   . VAL A 1 127 ? -23.427 46.526 -2.224  1.00 32.47 ? 126 VAL A N   1 
ATOM   701  C CA  . VAL A 1 127 ? -22.048 46.075 -2.235  1.00 33.69 ? 126 VAL A CA  1 
ATOM   702  C C   . VAL A 1 127 ? -21.648 45.649 -3.650  1.00 32.19 ? 126 VAL A C   1 
ATOM   703  O O   . VAL A 1 127 ? -22.478 45.144 -4.416  1.00 31.14 ? 126 VAL A O   1 
ATOM   704  C CB  . VAL A 1 127 ? -21.860 44.918 -1.191  1.00 33.44 ? 126 VAL A CB  1 
ATOM   705  C CG1 . VAL A 1 127 ? -22.182 43.540 -1.803  1.00 41.14 ? 126 VAL A CG1 1 
ATOM   706  C CG2 . VAL A 1 127 ? -20.525 44.937 -0.649  1.00 33.91 ? 126 VAL A CG2 1 
ATOM   707  N N   . GLN A 1 128 ? -20.388 45.892 -3.996  1.00 33.06 ? 127 GLN A N   1 
ATOM   708  C CA  . GLN A 1 128 ? -19.739 45.244 -5.135  1.00 31.51 ? 127 GLN A CA  1 
ATOM   709  C C   . GLN A 1 128 ? -18.372 44.826 -4.690  1.00 33.11 ? 127 GLN A C   1 
ATOM   710  O O   . GLN A 1 128 ? -17.735 45.556 -3.917  1.00 29.90 ? 127 GLN A O   1 
ATOM   711  C CB  . GLN A 1 128 ? -19.586 46.203 -6.328  1.00 33.12 ? 127 GLN A CB  1 
ATOM   712  C CG  . GLN A 1 128 ? -19.214 45.481 -7.639  1.00 31.15 ? 127 GLN A CG  1 
ATOM   713  C CD  . GLN A 1 128 ? -19.225 46.385 -8.832  1.00 27.92 ? 127 GLN A CD  1 
ATOM   714  O OE1 . GLN A 1 128 ? -18.829 47.531 -8.727  1.00 30.16 ? 127 GLN A OE1 1 
ATOM   715  N NE2 . GLN A 1 128 ? -19.694 45.882 -9.970  1.00 27.46 ? 127 GLN A NE2 1 
ATOM   716  N N   . ASP A 1 129 ? -17.896 43.680 -5.183  1.00 29.33 ? 128 ASP A N   1 
ATOM   717  C CA  . ASP A 1 129 ? -16.541 43.276 -4.900  1.00 30.68 ? 128 ASP A CA  1 
ATOM   718  C C   . ASP A 1 129 ? -15.553 44.119 -5.748  1.00 33.12 ? 128 ASP A C   1 
ATOM   719  O O   . ASP A 1 129 ? -15.935 44.728 -6.780  1.00 29.44 ? 128 ASP A O   1 
ATOM   720  C CB  . ASP A 1 129 ? -16.374 41.725 -4.955  1.00 28.09 ? 128 ASP A CB  1 
ATOM   721  C CG  . ASP A 1 129 ? -16.144 41.155 -6.338  1.00 32.71 ? 128 ASP A CG  1 
ATOM   722  O OD1 . ASP A 1 129 ? -15.432 41.751 -7.165  1.00 40.22 ? 128 ASP A OD1 1 
ATOM   723  O OD2 . ASP A 1 129 ? -16.624 40.025 -6.575  1.00 43.71 ? 128 ASP A OD2 1 
ATOM   724  N N   . LEU A 1 130 ? -14.322 44.234 -5.243  1.00 33.50 ? 129 LEU A N   1 
ATOM   725  C CA  . LEU A 1 130 ? -13.327 45.060 -5.873  1.00 34.93 ? 129 LEU A CA  1 
ATOM   726  C C   . LEU A 1 130 ? -12.901 44.502 -7.240  1.00 33.24 ? 129 LEU A C   1 
ATOM   727  O O   . LEU A 1 130 ? -12.589 45.284 -8.120  1.00 36.60 ? 129 LEU A O   1 
ATOM   728  C CB  . LEU A 1 130 ? -12.128 45.292 -4.931  1.00 35.20 ? 129 LEU A CB  1 
ATOM   729  C CG  . LEU A 1 130 ? -11.000 46.238 -5.359  1.00 38.42 ? 129 LEU A CG  1 
ATOM   730  C CD1 . LEU A 1 130 ? -11.504 47.628 -5.729  1.00 28.31 ? 129 LEU A CD1 1 
ATOM   731  C CD2 . LEU A 1 130 ? -9.883  46.333 -4.307  1.00 32.46 ? 129 LEU A CD2 1 
ATOM   732  N N   . PHE A 1 131 ? -12.907 43.183 -7.428  1.00 32.90 ? 130 PHE A N   1 
ATOM   733  C CA  . PHE A 1 131 ? -12.636 42.596 -8.755  1.00 33.14 ? 130 PHE A CA  1 
ATOM   734  C C   . PHE A 1 131 ? -13.579 43.170 -9.821  1.00 33.05 ? 130 PHE A C   1 
ATOM   735  O O   . PHE A 1 131 ? -13.143 43.689 -10.864 1.00 30.79 ? 130 PHE A O   1 
ATOM   736  C CB  . PHE A 1 131 ? -12.681 41.034 -8.775  1.00 32.87 ? 130 PHE A CB  1 
ATOM   737  C CG  . PHE A 1 131 ? -12.251 40.459 -10.104 1.00 35.32 ? 130 PHE A CG  1 
ATOM   738  C CD1 . PHE A 1 131 ? -10.910 40.157 -10.354 1.00 32.38 ? 130 PHE A CD1 1 
ATOM   739  C CD2 . PHE A 1 131 ? -13.162 40.327 -11.139 1.00 32.60 ? 130 PHE A CD2 1 
ATOM   740  C CE1 . PHE A 1 131 ? -10.484 39.702 -11.598 1.00 32.64 ? 130 PHE A CE1 1 
ATOM   741  C CE2 . PHE A 1 131 ? -12.756 39.871 -12.400 1.00 35.07 ? 130 PHE A CE2 1 
ATOM   742  C CZ  . PHE A 1 131 ? -11.413 39.561 -12.632 1.00 36.36 ? 130 PHE A CZ  1 
ATOM   743  N N   . ASP A 1 132 ? -14.880 43.045 -9.584  1.00 31.67 ? 131 ASP A N   1 
ATOM   744  C CA  . ASP A 1 132 ? -15.867 43.514 -10.528 1.00 31.51 ? 131 ASP A CA  1 
ATOM   745  C C   . ASP A 1 132 ? -15.809 45.038 -10.685 1.00 30.84 ? 131 ASP A C   1 
ATOM   746  O O   . ASP A 1 132 ? -16.082 45.574 -11.750 1.00 30.60 ? 131 ASP A O   1 
ATOM   747  C CB  . ASP A 1 132 ? -17.257 43.112 -10.061 1.00 32.39 ? 131 ASP A CB  1 
ATOM   748  C CG  . ASP A 1 132 ? -17.528 41.632 -10.194 1.00 33.12 ? 131 ASP A CG  1 
ATOM   749  O OD1 . ASP A 1 132 ? -16.852 40.908 -10.984 1.00 30.27 ? 131 ASP A OD1 1 
ATOM   750  O OD2 . ASP A 1 132 ? -18.472 41.205 -9.511  1.00 41.80 ? 131 ASP A OD2 1 
ATOM   751  N N   . PHE A 1 133 ? -15.480 45.732 -9.609  1.00 29.75 ? 132 PHE A N   1 
ATOM   752  C CA  . PHE A 1 133 ? -15.366 47.204 -9.618  1.00 30.82 ? 132 PHE A CA  1 
ATOM   753  C C   . PHE A 1 133 ? -14.273 47.637 -10.571 1.00 30.18 ? 132 PHE A C   1 
ATOM   754  O O   . PHE A 1 133 ? -14.507 48.494 -11.392 1.00 30.46 ? 132 PHE A O   1 
ATOM   755  C CB  . PHE A 1 133 ? -15.119 47.737 -8.199  1.00 31.82 ? 132 PHE A CB  1 
ATOM   756  C CG  . PHE A 1 133 ? -15.152 49.247 -8.082  1.00 30.79 ? 132 PHE A CG  1 
ATOM   757  C CD1 . PHE A 1 133 ? -16.371 49.928 -7.934  1.00 28.47 ? 132 PHE A CD1 1 
ATOM   758  C CD2 . PHE A 1 133 ? -13.971 49.992 -8.100  1.00 31.07 ? 132 PHE A CD2 1 
ATOM   759  C CE1 . PHE A 1 133 ? -16.406 51.290 -7.794  1.00 37.21 ? 132 PHE A CE1 1 
ATOM   760  C CE2 . PHE A 1 133 ? -14.009 51.373 -7.999  1.00 32.06 ? 132 PHE A CE2 1 
ATOM   761  C CZ  . PHE A 1 133 ? -15.240 52.027 -7.829  1.00 26.08 ? 132 PHE A CZ  1 
ATOM   762  N N   . ILE A 1 134 ? -13.097 47.015 -10.487 1.00 34.52 ? 133 ILE A N   1 
ATOM   763  C CA  . ILE A 1 134 ? -11.980 47.332 -11.395 1.00 35.39 ? 133 ILE A CA  1 
ATOM   764  C C   . ILE A 1 134 ? -12.259 46.869 -12.858 1.00 34.03 ? 133 ILE A C   1 
ATOM   765  O O   . ILE A 1 134 ? -11.891 47.547 -13.819 1.00 34.90 ? 133 ILE A O   1 
ATOM   766  C CB  . ILE A 1 134 ? -10.617 46.756 -10.878 1.00 36.68 ? 133 ILE A CB  1 
ATOM   767  C CG1 . ILE A 1 134 ? -10.183 47.523 -9.631  1.00 34.28 ? 133 ILE A CG1 1 
ATOM   768  C CG2 . ILE A 1 134 ? -9.538  46.810 -12.033 1.00 29.69 ? 133 ILE A CG2 1 
ATOM   769  C CD1 . ILE A 1 134 ? -9.303  46.783 -8.569  1.00 28.51 ? 133 ILE A CD1 1 
ATOM   770  N N   . THR A 1 135 ? -12.898 45.723 -13.027 1.00 35.54 ? 134 THR A N   1 
ATOM   771  C CA  . THR A 1 135 ? -13.280 45.263 -14.357 1.00 32.12 ? 134 THR A CA  1 
ATOM   772  C C   . THR A 1 135 ? -14.142 46.289 -15.073 1.00 32.27 ? 134 THR A C   1 
ATOM   773  O O   . THR A 1 135 ? -13.903 46.595 -16.238 1.00 35.29 ? 134 THR A O   1 
ATOM   774  C CB  . THR A 1 135 ? -14.043 43.927 -14.333 1.00 31.37 ? 134 THR A CB  1 
ATOM   775  O OG1 . THR A 1 135 ? -13.228 42.937 -13.711 1.00 30.81 ? 134 THR A OG1 1 
ATOM   776  C CG2 . THR A 1 135 ? -14.444 43.467 -15.796 1.00 26.83 ? 134 THR A CG2 1 
ATOM   777  N N   . GLU A 1 136 ? -15.150 46.797 -14.380 1.00 35.58 ? 135 GLU A N   1 
ATOM   778  C CA  . GLU A 1 136 ? -16.105 47.739 -14.957 1.00 36.71 ? 135 GLU A CA  1 
ATOM   779  C C   . GLU A 1 136 ? -15.562 49.167 -15.068 1.00 36.81 ? 135 GLU A C   1 
ATOM   780  O O   . GLU A 1 136 ? -15.820 49.832 -16.033 1.00 32.92 ? 135 GLU A O   1 
ATOM   781  C CB  . GLU A 1 136 ? -17.410 47.721 -14.173 1.00 33.85 ? 135 GLU A CB  1 
ATOM   782  C CG  . GLU A 1 136 ? -18.037 46.311 -14.108 1.00 50.04 ? 135 GLU A CG  1 
ATOM   783  C CD  . GLU A 1 136 ? -19.372 46.288 -13.377 1.00 58.07 ? 135 GLU A CD  1 
ATOM   784  O OE1 . GLU A 1 136 ? -19.773 47.340 -12.827 1.00 49.38 ? 135 GLU A OE1 1 
ATOM   785  O OE2 . GLU A 1 136 ? -20.010 45.215 -13.355 1.00 70.60 ? 135 GLU A OE2 1 
ATOM   786  N N   . ARG A 1 137 ? -14.785 49.625 -14.103 1.00 35.04 ? 136 ARG A N   1 
ATOM   787  C CA  . ARG A 1 137 ? -14.288 50.984 -14.144 1.00 38.50 ? 136 ARG A CA  1 
ATOM   788  C C   . ARG A 1 137 ? -12.905 51.159 -14.834 1.00 37.34 ? 136 ARG A C   1 
ATOM   789  O O   . ARG A 1 137 ? -12.550 52.263 -15.260 1.00 36.17 ? 136 ARG A O   1 
ATOM   790  C CB  . ARG A 1 137 ? -14.404 51.574 -12.716 1.00 34.98 ? 136 ARG A CB  1 
ATOM   791  C CG  . ARG A 1 137 ? -15.930 51.691 -12.453 1.00 52.84 ? 136 ARG A CG  1 
ATOM   792  C CD  . ARG A 1 137 ? -16.404 52.252 -11.175 1.00 45.26 ? 136 ARG A CD  1 
ATOM   793  N NE  . ARG A 1 137 ? -15.742 53.508 -10.861 1.00 57.04 ? 136 ARG A NE  1 
ATOM   794  C CZ  . ARG A 1 137 ? -16.260 54.457 -10.093 1.00 42.11 ? 136 ARG A CZ  1 
ATOM   795  N NH1 . ARG A 1 137 ? -17.469 54.308 -9.549  1.00 47.93 ? 136 ARG A NH1 1 
ATOM   796  N NH2 . ARG A 1 137 ? -15.542 55.546 -9.862  1.00 41.36 ? 136 ARG A NH2 1 
ATOM   797  N N   . GLY A 1 138 ? -12.166 50.075 -15.003 1.00 39.13 ? 137 GLY A N   1 
ATOM   798  C CA  . GLY A 1 138 ? -10.747 50.157 -15.417 1.00 38.91 ? 137 GLY A CA  1 
ATOM   799  C C   . GLY A 1 138 ? -9.804  50.640 -14.310 1.00 35.59 ? 137 GLY A C   1 
ATOM   800  O O   . GLY A 1 138 ? -10.168 50.653 -13.129 1.00 33.32 ? 137 GLY A O   1 
ATOM   801  N N   . ALA A 1 139 ? -8.588  51.055 -14.701 1.00 35.53 ? 138 ALA A N   1 
ATOM   802  C CA  . ALA A 1 139 ? -7.589  51.598 -13.762 1.00 30.24 ? 138 ALA A CA  1 
ATOM   803  C C   . ALA A 1 139 ? -8.248  52.695 -12.934 1.00 31.53 ? 138 ALA A C   1 
ATOM   804  O O   . ALA A 1 139 ? -8.951  53.533 -13.489 1.00 35.47 ? 138 ALA A O   1 
ATOM   805  C CB  . ALA A 1 139 ? -6.381  52.156 -14.521 1.00 26.18 ? 138 ALA A CB  1 
ATOM   806  N N   . LEU A 1 140 ? -8.064  52.662 -11.617 1.00 34.20 ? 139 LEU A N   1 
ATOM   807  C CA  . LEU A 1 140 ? -8.662  53.646 -10.722 1.00 32.41 ? 139 LEU A CA  1 
ATOM   808  C C   . LEU A 1 140 ? -7.796  54.903 -10.650 1.00 33.81 ? 139 LEU A C   1 
ATOM   809  O O   . LEU A 1 140 ? -6.570  54.826 -10.604 1.00 33.15 ? 139 LEU A O   1 
ATOM   810  C CB  . LEU A 1 140 ? -8.845  53.064 -9.304  1.00 33.99 ? 139 LEU A CB  1 
ATOM   811  C CG  . LEU A 1 140 ? -9.588  51.728 -9.099  1.00 38.16 ? 139 LEU A CG  1 
ATOM   812  C CD1 . LEU A 1 140 ? -9.770  51.417 -7.528  1.00 26.50 ? 139 LEU A CD1 1 
ATOM   813  C CD2 . LEU A 1 140 ? -10.929 51.709 -9.910  1.00 33.18 ? 139 LEU A CD2 1 
ATOM   814  N N   . GLN A 1 141 ? -8.443  56.069 -10.628 1.00 35.85 ? 140 GLN A N   1 
ATOM   815  C CA  . GLN A 1 141 ? -7.784  57.302 -10.207 1.00 34.42 ? 140 GLN A CA  1 
ATOM   816  C C   . GLN A 1 141 ? -7.016  57.088 -8.890  1.00 34.56 ? 140 GLN A C   1 
ATOM   817  O O   . GLN A 1 141 ? -7.475  56.338 -7.999  1.00 34.32 ? 140 GLN A O   1 
ATOM   818  C CB  . GLN A 1 141 ? -8.804  58.419 -10.019 1.00 33.78 ? 140 GLN A CB  1 
ATOM   819  C CG  . GLN A 1 141 ? -9.486  58.833 -11.279 1.00 38.84 ? 140 GLN A CG  1 
ATOM   820  C CD  . GLN A 1 141 ? -10.505 59.952 -11.066 1.00 51.63 ? 140 GLN A CD  1 
ATOM   821  O OE1 . GLN A 1 141 ? -10.401 60.776 -10.138 1.00 47.11 ? 140 GLN A OE1 1 
ATOM   822  N NE2 . GLN A 1 141 ? -11.492 59.983 -11.933 1.00 41.91 ? 140 GLN A NE2 1 
ATOM   823  N N   . GLU A 1 142 ? -5.847  57.721 -8.774  1.00 30.12 ? 141 GLU A N   1 
ATOM   824  C CA  . GLU A 1 142 ? -4.963  57.474 -7.632  1.00 34.97 ? 141 GLU A CA  1 
ATOM   825  C C   . GLU A 1 142 ? -5.543  57.862 -6.273  1.00 30.94 ? 141 GLU A C   1 
ATOM   826  O O   . GLU A 1 142 ? -5.225  57.226 -5.275  1.00 36.46 ? 141 GLU A O   1 
ATOM   827  C CB  . GLU A 1 142 ? -3.593  58.131 -7.849  1.00 35.80 ? 141 GLU A CB  1 
ATOM   828  C CG  . GLU A 1 142 ? -2.723  57.227 -8.705  1.00 40.43 ? 141 GLU A CG  1 
ATOM   829  C CD  . GLU A 1 142 ? -1.370  57.796 -9.050  1.00 33.23 ? 141 GLU A CD  1 
ATOM   830  O OE1 . GLU A 1 142 ? -0.712  58.393 -8.166  1.00 34.66 ? 141 GLU A OE1 1 
ATOM   831  O OE2 . GLU A 1 142 ? -0.943  57.572 -10.200 1.00 34.65 ? 141 GLU A OE2 1 
ATOM   832  N N   . GLU A 1 143 ? -6.359  58.910 -6.253  1.00 30.26 ? 142 GLU A N   1 
ATOM   833  C CA  . GLU A 1 143 ? -7.091  59.331 -5.089  1.00 35.22 ? 142 GLU A CA  1 
ATOM   834  C C   . GLU A 1 143 ? -8.010  58.233 -4.555  1.00 34.17 ? 142 GLU A C   1 
ATOM   835  O O   . GLU A 1 143 ? -8.114  58.047 -3.336  1.00 34.51 ? 142 GLU A O   1 
ATOM   836  C CB  . GLU A 1 143 ? -7.957  60.528 -5.441  1.00 38.13 ? 142 GLU A CB  1 
ATOM   837  C CG  . GLU A 1 143 ? -8.725  61.082 -4.280  1.00 39.57 ? 142 GLU A CG  1 
ATOM   838  C CD  . GLU A 1 143 ? -9.575  62.251 -4.695  1.00 38.92 ? 142 GLU A CD  1 
ATOM   839  O OE1 . GLU A 1 143 ? -10.611 62.006 -5.321  1.00 36.40 ? 142 GLU A OE1 1 
ATOM   840  O OE2 . GLU A 1 143 ? -9.208  63.398 -4.389  1.00 35.32 ? 142 GLU A OE2 1 
ATOM   841  N N   . LEU A 1 144 ? -8.654  57.541 -5.493  1.00 34.58 ? 143 LEU A N   1 
ATOM   842  C CA  . LEU A 1 144 ? -9.544  56.429 -5.220  1.00 32.51 ? 143 LEU A CA  1 
ATOM   843  C C   . LEU A 1 144 ? -8.744  55.191 -4.774  1.00 32.28 ? 143 LEU A C   1 
ATOM   844  O O   . LEU A 1 144 ? -9.074  54.592 -3.775  1.00 30.22 ? 143 LEU A O   1 
ATOM   845  C CB  . LEU A 1 144 ? -10.432 56.135 -6.445  1.00 28.98 ? 143 LEU A CB  1 
ATOM   846  C CG  . LEU A 1 144 ? -11.480 54.994 -6.294  1.00 36.42 ? 143 LEU A CG  1 
ATOM   847  C CD1 . LEU A 1 144 ? -12.343 55.209 -5.043  1.00 27.50 ? 143 LEU A CD1 1 
ATOM   848  C CD2 . LEU A 1 144 ? -12.374 54.812 -7.519  1.00 30.81 ? 143 LEU A CD2 1 
ATOM   849  N N   . ALA A 1 145 ? -7.696  54.834 -5.511  1.00 31.90 ? 144 ALA A N   1 
ATOM   850  C CA  . ALA A 1 145 ? -6.780  53.764 -5.120  1.00 31.89 ? 144 ALA A CA  1 
ATOM   851  C C   . ALA A 1 145 ? -6.107  54.057 -3.758  1.00 36.48 ? 144 ALA A C   1 
ATOM   852  O O   . ALA A 1 145 ? -5.944  53.160 -2.961  1.00 31.28 ? 144 ALA A O   1 
ATOM   853  C CB  . ALA A 1 145 ? -5.740  53.509 -6.210  1.00 23.62 ? 144 ALA A CB  1 
ATOM   854  N N   . ARG A 1 146 ? -5.740  55.320 -3.497  1.00 35.45 ? 145 ARG A N   1 
ATOM   855  C CA  . ARG A 1 146 ? -5.197  55.692 -2.197  1.00 35.53 ? 145 ARG A CA  1 
ATOM   856  C C   . ARG A 1 146 ? -6.189  55.391 -1.051  1.00 34.06 ? 145 ARG A C   1 
ATOM   857  O O   . ARG A 1 146 ? -5.809  54.804 -0.046  1.00 31.94 ? 145 ARG A O   1 
ATOM   858  C CB  . ARG A 1 146 ? -4.748  57.154 -2.172  1.00 32.48 ? 145 ARG A CB  1 
ATOM   859  C CG  . ARG A 1 146 ? -4.330  57.657 -0.775  1.00 30.93 ? 145 ARG A CG  1 
ATOM   860  C CD  . ARG A 1 146 ? -3.939  59.120 -0.775  1.00 27.40 ? 145 ARG A CD  1 
ATOM   861  N NE  . ARG A 1 146 ? -2.920  59.294 -1.792  1.00 33.28 ? 145 ARG A NE  1 
ATOM   862  C CZ  . ARG A 1 146 ? -3.059  59.955 -2.940  1.00 35.24 ? 145 ARG A CZ  1 
ATOM   863  N NH1 . ARG A 1 146 ? -4.163  60.616 -3.251  1.00 35.95 ? 145 ARG A NH1 1 
ATOM   864  N NH2 . ARG A 1 146 ? -2.045  59.965 -3.778  1.00 32.13 ? 145 ARG A NH2 1 
ATOM   865  N N   . SER A 1 147 ? -7.444  55.794 -1.210  1.00 35.10 ? 146 SER A N   1 
ATOM   866  C CA  . SER A 1 147 ? -8.473  55.575 -0.189  1.00 31.80 ? 146 SER A CA  1 
ATOM   867  C C   . SER A 1 147 ? -8.745  54.097 0.059   1.00 35.96 ? 146 SER A C   1 
ATOM   868  O O   . SER A 1 147 ? -8.742  53.628 1.224   1.00 34.12 ? 146 SER A O   1 
ATOM   869  C CB  . SER A 1 147 ? -9.742  56.329 -0.578  1.00 33.99 ? 146 SER A CB  1 
ATOM   870  O OG  . SER A 1 147 ? -10.819 56.064 0.303   1.00 29.50 ? 146 SER A OG  1 
ATOM   871  N N   . PHE A 1 148 ? -8.921  53.344 -1.030  1.00 33.69 ? 147 PHE A N   1 
ATOM   872  C CA  . PHE A 1 148 ? -9.135  51.900 -0.962  1.00 32.34 ? 147 PHE A CA  1 
ATOM   873  C C   . PHE A 1 148 ? -7.951  51.167 -0.328  1.00 31.90 ? 147 PHE A C   1 
ATOM   874  O O   . PHE A 1 148 ? -8.115  50.339 0.580   1.00 30.83 ? 147 PHE A O   1 
ATOM   875  C CB  . PHE A 1 148 ? -9.440  51.326 -2.361  1.00 31.67 ? 147 PHE A CB  1 
ATOM   876  C CG  . PHE A 1 148 ? -10.842 51.541 -2.852  1.00 28.84 ? 147 PHE A CG  1 
ATOM   877  C CD1 . PHE A 1 148 ? -11.773 52.319 -2.159  1.00 40.00 ? 147 PHE A CD1 1 
ATOM   878  C CD2 . PHE A 1 148 ? -11.239 50.947 -4.039  1.00 33.25 ? 147 PHE A CD2 1 
ATOM   879  C CE1 . PHE A 1 148 ? -13.055 52.507 -2.669  1.00 34.73 ? 147 PHE A CE1 1 
ATOM   880  C CE2 . PHE A 1 148 ? -12.501 51.111 -4.531  1.00 31.15 ? 147 PHE A CE2 1 
ATOM   881  C CZ  . PHE A 1 148 ? -13.414 51.903 -3.869  1.00 32.45 ? 147 PHE A CZ  1 
ATOM   882  N N   . PHE A 1 149 ? -6.762  51.480 -0.795  1.00 32.34 ? 148 PHE A N   1 
ATOM   883  C CA  . PHE A 1 149 ? -5.541  50.834 -0.314  1.00 33.06 ? 148 PHE A CA  1 
ATOM   884  C C   . PHE A 1 149 ? -5.255  51.122 1.148   1.00 32.09 ? 148 PHE A C   1 
ATOM   885  O O   . PHE A 1 149 ? -4.905  50.197 1.907   1.00 31.60 ? 148 PHE A O   1 
ATOM   886  C CB  . PHE A 1 149 ? -4.339  51.253 -1.185  1.00 26.60 ? 148 PHE A CB  1 
ATOM   887  C CG  . PHE A 1 149 ? -3.107  50.397 -0.967  1.00 28.17 ? 148 PHE A CG  1 
ATOM   888  C CD1 . PHE A 1 149 ? -3.139  49.037 -1.242  1.00 34.87 ? 148 PHE A CD1 1 
ATOM   889  C CD2 . PHE A 1 149 ? -1.911  50.964 -0.518  1.00 32.12 ? 148 PHE A CD2 1 
ATOM   890  C CE1 . PHE A 1 149 ? -2.024  48.266 -1.061  1.00 30.78 ? 148 PHE A CE1 1 
ATOM   891  C CE2 . PHE A 1 149 ? -0.790  50.197 -0.357  1.00 34.07 ? 148 PHE A CE2 1 
ATOM   892  C CZ  . PHE A 1 149 ? -0.834  48.846 -0.634  1.00 32.04 ? 148 PHE A CZ  1 
ATOM   893  N N   . TRP A 1 150 ? -5.416  52.391 1.539   1.00 32.83 ? 149 TRP A N   1 
ATOM   894  C CA  . TRP A 1 150 ? -5.373  52.812 2.953   1.00 29.20 ? 149 TRP A CA  1 
ATOM   895  C C   . TRP A 1 150 ? -6.279  52.005 3.862   1.00 30.35 ? 149 TRP A C   1 
ATOM   896  O O   . TRP A 1 150 ? -5.849  51.524 4.961   1.00 28.46 ? 149 TRP A O   1 
ATOM   897  C CB  . TRP A 1 150 ? -5.740  54.283 3.060   1.00 32.05 ? 149 TRP A CB  1 
ATOM   898  C CG  . TRP A 1 150 ? -5.608  54.780 4.445   1.00 32.92 ? 149 TRP A CG  1 
ATOM   899  C CD1 . TRP A 1 150 ? -6.591  54.816 5.413   1.00 30.60 ? 149 TRP A CD1 1 
ATOM   900  C CD2 . TRP A 1 150 ? -4.429  55.266 5.057   1.00 30.72 ? 149 TRP A CD2 1 
ATOM   901  N NE1 . TRP A 1 150 ? -6.079  55.291 6.576   1.00 30.45 ? 149 TRP A NE1 1 
ATOM   902  C CE2 . TRP A 1 150 ? -4.761  55.600 6.390   1.00 36.52 ? 149 TRP A CE2 1 
ATOM   903  C CE3 . TRP A 1 150 ? -3.121  55.498 4.604   1.00 32.68 ? 149 TRP A CE3 1 
ATOM   904  C CZ2 . TRP A 1 150 ? -3.853  56.158 7.257   1.00 36.96 ? 149 TRP A CZ2 1 
ATOM   905  C CZ3 . TRP A 1 150 ? -2.210  56.029 5.494   1.00 36.87 ? 149 TRP A CZ3 1 
ATOM   906  C CH2 . TRP A 1 150 ? -2.575  56.347 6.797   1.00 37.07 ? 149 TRP A CH2 1 
ATOM   907  N N   . GLN A 1 151 ? -7.545  51.873 3.444   1.00 33.47 ? 150 GLN A N   1 
ATOM   908  C CA  . GLN A 1 151 ? -8.507  51.011 4.161   1.00 31.31 ? 150 GLN A CA  1 
ATOM   909  C C   . GLN A 1 151 ? -8.106  49.524 4.196   1.00 36.47 ? 150 GLN A C   1 
ATOM   910  O O   . GLN A 1 151 ? -8.347  48.880 5.181   1.00 35.41 ? 150 GLN A O   1 
ATOM   911  C CB  . GLN A 1 151 ? -9.926  51.140 3.585   1.00 34.07 ? 150 GLN A CB  1 
ATOM   912  C CG  . GLN A 1 151 ? -10.552 52.518 3.838   1.00 38.92 ? 150 GLN A CG  1 
ATOM   913  C CD  . GLN A 1 151 ? -12.030 52.570 3.502   1.00 38.03 ? 150 GLN A CD  1 
ATOM   914  O OE1 . GLN A 1 151 ? -12.774 51.660 3.827   1.00 31.24 ? 150 GLN A OE1 1 
ATOM   915  N NE2 . GLN A 1 151 ? -12.463 53.663 2.898   1.00 42.10 ? 150 GLN A NE2 1 
ATOM   916  N N   . VAL A 1 152 ? -7.515  48.971 3.126   1.00 35.02 ? 151 VAL A N   1 
ATOM   917  C CA  . VAL A 1 152 ? -7.050  47.580 3.171   1.00 36.41 ? 151 VAL A CA  1 
ATOM   918  C C   . VAL A 1 152 ? -5.912  47.452 4.176   1.00 32.95 ? 151 VAL A C   1 
ATOM   919  O O   . VAL A 1 152 ? -5.863  46.513 4.980   1.00 35.58 ? 151 VAL A O   1 
ATOM   920  C CB  . VAL A 1 152 ? -6.673  47.017 1.734   1.00 36.72 ? 151 VAL A CB  1 
ATOM   921  C CG1 . VAL A 1 152 ? -6.046  45.650 1.843   1.00 38.04 ? 151 VAL A CG1 1 
ATOM   922  C CG2 . VAL A 1 152 ? -7.919  46.953 0.869   1.00 33.00 ? 151 VAL A CG2 1 
ATOM   923  N N   . LEU A 1 153 ? -5.005  48.415 4.161   1.00 34.11 ? 152 LEU A N   1 
ATOM   924  C CA  . LEU A 1 153 ? -3.933  48.455 5.135   1.00 32.01 ? 152 LEU A CA  1 
ATOM   925  C C   . LEU A 1 153 ? -4.405  48.444 6.582   1.00 31.45 ? 152 LEU A C   1 
ATOM   926  O O   . LEU A 1 153 ? -3.894  47.676 7.373   1.00 33.02 ? 152 LEU A O   1 
ATOM   927  C CB  . LEU A 1 153 ? -2.983  49.637 4.886   1.00 32.90 ? 152 LEU A CB  1 
ATOM   928  C CG  . LEU A 1 153 ? -2.118  49.560 3.601   1.00 38.94 ? 152 LEU A CG  1 
ATOM   929  C CD1 . LEU A 1 153 ? -1.549  50.981 3.255   1.00 40.12 ? 152 LEU A CD1 1 
ATOM   930  C CD2 . LEU A 1 153 ? -1.003  48.529 3.676   1.00 41.36 ? 152 LEU A CD2 1 
ATOM   931  N N   . GLU A 1 154 ? -5.370  49.291 6.927   1.00 31.74 ? 153 GLU A N   1 
ATOM   932  C CA  . GLU A 1 154 ? -5.925  49.309 8.254   1.00 29.30 ? 153 GLU A CA  1 
ATOM   933  C C   . GLU A 1 154 ? -6.581  47.990 8.639   1.00 32.11 ? 153 GLU A C   1 
ATOM   934  O O   . GLU A 1 154 ? -6.471  47.577 9.771   1.00 28.53 ? 153 GLU A O   1 
ATOM   935  C CB  . GLU A 1 154 ? -6.913  50.479 8.422   1.00 33.01 ? 153 GLU A CB  1 
ATOM   936  C CG  . GLU A 1 154 ? -6.257  51.880 8.371   1.00 30.03 ? 153 GLU A CG  1 
ATOM   937  C CD  . GLU A 1 154 ? -5.446  52.225 9.632   1.00 37.43 ? 153 GLU A CD  1 
ATOM   938  O OE1 . GLU A 1 154 ? -5.843  51.824 10.727  1.00 39.76 ? 153 GLU A OE1 1 
ATOM   939  O OE2 . GLU A 1 154 ? -4.402  52.902 9.527   1.00 34.87 ? 153 GLU A OE2 1 
ATOM   940  N N   . ALA A 1 155 ? -7.260  47.328 7.685   1.00 31.46 ? 154 ALA A N   1 
ATOM   941  C CA  . ALA A 1 155 ? -7.906  46.053 7.937   1.00 30.30 ? 154 ALA A CA  1 
ATOM   942  C C   . ALA A 1 155 ? -6.895  44.923 8.170   1.00 32.59 ? 154 ALA A C   1 
ATOM   943  O O   . ALA A 1 155 ? -7.074  44.079 9.047   1.00 31.44 ? 154 ALA A O   1 
ATOM   944  C CB  . ALA A 1 155 ? -8.835  45.712 6.817   1.00 23.22 ? 154 ALA A CB  1 
ATOM   945  N N   . VAL A 1 156 ? -5.825  44.928 7.398   1.00 34.93 ? 155 VAL A N   1 
ATOM   946  C CA  . VAL A 1 156 ? -4.763  43.951 7.539   1.00 33.23 ? 155 VAL A CA  1 
ATOM   947  C C   . VAL A 1 156 ? -4.002  44.184 8.832   1.00 34.55 ? 155 VAL A C   1 
ATOM   948  O O   . VAL A 1 156 ? -3.655  43.200 9.477   1.00 36.39 ? 155 VAL A O   1 
ATOM   949  C CB  . VAL A 1 156 ? -3.854  43.910 6.282   1.00 38.08 ? 155 VAL A CB  1 
ATOM   950  C CG1 . VAL A 1 156 ? -2.683  42.926 6.442   1.00 33.12 ? 155 VAL A CG1 1 
ATOM   951  C CG2 . VAL A 1 156 ? -4.708  43.547 5.057   1.00 32.17 ? 155 VAL A CG2 1 
ATOM   952  N N   . ARG A 1 157 ? -3.778  45.455 9.227   1.00 33.94 ? 156 ARG A N   1 
ATOM   953  C CA  . ARG A 1 157 ? -3.165  45.792 10.525  1.00 34.42 ? 156 ARG A CA  1 
ATOM   954  C C   . ARG A 1 157 ? -4.002  45.248 11.680  1.00 32.88 ? 156 ARG A C   1 
ATOM   955  O O   . ARG A 1 157 ? -3.474  44.674 12.621  1.00 32.99 ? 156 ARG A O   1 
ATOM   956  C CB  . ARG A 1 157 ? -2.980  47.303 10.735  1.00 35.45 ? 156 ARG A CB  1 
ATOM   957  C CG  . ARG A 1 157 ? -1.752  47.893 10.099  1.00 40.76 ? 156 ARG A CG  1 
ATOM   958  C CD  . ARG A 1 157 ? -1.700  49.392 10.337  1.00 37.45 ? 156 ARG A CD  1 
ATOM   959  N NE  . ARG A 1 157 ? -1.442  49.717 11.753  1.00 30.75 ? 156 ARG A NE  1 
ATOM   960  C CZ  . ARG A 1 157 ? -1.626  50.912 12.294  1.00 27.26 ? 156 ARG A CZ  1 
ATOM   961  N NH1 . ARG A 1 157 ? -2.110  51.908 11.572  1.00 29.49 ? 156 ARG A NH1 1 
ATOM   962  N NH2 . ARG A 1 157 ? -1.378  51.100 13.587  1.00 29.66 ? 156 ARG A NH2 1 
ATOM   963  N N   . HIS A 1 158 ? -5.311  45.404 11.572  1.00 32.97 ? 157 HIS A N   1 
ATOM   964  C CA  . HIS A 1 158 ? -6.259  44.849 12.540  1.00 32.14 ? 157 HIS A CA  1 
ATOM   965  C C   . HIS A 1 158 ? -6.124  43.341 12.681  1.00 29.95 ? 157 HIS A C   1 
ATOM   966  O O   . HIS A 1 158 ? -6.003  42.819 13.784  1.00 28.03 ? 157 HIS A O   1 
ATOM   967  C CB  . HIS A 1 158 ? -7.702  45.243 12.130  1.00 34.85 ? 157 HIS A CB  1 
ATOM   968  C CG  . HIS A 1 158 ? -8.770  44.593 12.951  1.00 34.22 ? 157 HIS A CG  1 
ATOM   969  N ND1 . HIS A 1 158 ? -9.109  45.027 14.218  1.00 30.88 ? 157 HIS A ND1 1 
ATOM   970  C CD2 . HIS A 1 158 ? -9.559  43.525 12.691  1.00 37.23 ? 157 HIS A CD2 1 
ATOM   971  C CE1 . HIS A 1 158 ? -10.063 44.248 14.696  1.00 34.72 ? 157 HIS A CE1 1 
ATOM   972  N NE2 . HIS A 1 158 ? -10.347 43.325 13.792  1.00 30.32 ? 157 HIS A NE2 1 
ATOM   973  N N   . CYS A 1 159 ? -6.146  42.644 11.555  1.00 32.06 ? 158 CYS A N   1 
ATOM   974  C CA  . CYS A 1 159 ? -5.927  41.211 11.562  1.00 28.90 ? 158 CYS A CA  1 
ATOM   975  C C   . CYS A 1 159 ? -4.647  40.810 12.281  1.00 31.70 ? 158 CYS A C   1 
ATOM   976  O O   . CYS A 1 159 ? -4.685  39.972 13.173  1.00 30.71 ? 158 CYS A O   1 
ATOM   977  C CB  . CYS A 1 159 ? -5.889  40.651 10.153  1.00 27.95 ? 158 CYS A CB  1 
ATOM   978  S SG  . CYS A 1 159 ? -7.465  40.750 9.190   1.00 35.57 ? 158 CYS A SG  1 
ATOM   979  N N   . HIS A 1 160 ? -3.525  41.394 11.864  1.00 32.74 ? 159 HIS A N   1 
ATOM   980  C CA  . HIS A 1 160 ? -2.220  41.080 12.438  1.00 32.11 ? 159 HIS A CA  1 
ATOM   981  C C   . HIS A 1 160 ? -2.167  41.408 13.933  1.00 32.53 ? 159 HIS A C   1 
ATOM   982  O O   . HIS A 1 160 ? -1.691  40.612 14.731  1.00 31.29 ? 159 HIS A O   1 
ATOM   983  C CB  . HIS A 1 160 ? -1.133  41.824 11.686  1.00 29.87 ? 159 HIS A CB  1 
ATOM   984  C CG  . HIS A 1 160 ? -0.954  41.351 10.271  1.00 41.80 ? 159 HIS A CG  1 
ATOM   985  N ND1 . HIS A 1 160 ? 0.064   41.798 9.458   1.00 43.78 ? 159 HIS A ND1 1 
ATOM   986  C CD2 . HIS A 1 160 ? -1.684  40.490 9.514   1.00 41.46 ? 159 HIS A CD2 1 
ATOM   987  C CE1 . HIS A 1 160 ? -0.034  41.223 8.267   1.00 41.86 ? 159 HIS A CE1 1 
ATOM   988  N NE2 . HIS A 1 160 ? -1.077  40.411 8.284   1.00 39.14 ? 159 HIS A NE2 1 
ATOM   989  N N   . ASN A 1 161 ? -2.713  42.557 14.311  1.00 33.74 ? 160 ASN A N   1 
ATOM   990  C CA  . ASN A 1 161 ? -2.877  42.917 15.708  1.00 33.81 ? 160 ASN A CA  1 
ATOM   991  C C   . ASN A 1 161 ? -3.644  41.868 16.551  1.00 33.51 ? 160 ASN A C   1 
ATOM   992  O O   . ASN A 1 161 ? -3.339  41.675 17.722  1.00 32.25 ? 160 ASN A O   1 
ATOM   993  C CB  . ASN A 1 161 ? -3.578  44.277 15.792  1.00 36.14 ? 160 ASN A CB  1 
ATOM   994  C CG  . ASN A 1 161 ? -3.595  44.832 17.195  1.00 37.20 ? 160 ASN A CG  1 
ATOM   995  O OD1 . ASN A 1 161 ? -4.621  44.812 17.856  1.00 45.35 ? 160 ASN A OD1 1 
ATOM   996  N ND2 . ASN A 1 161 ? -2.455  45.308 17.667  1.00 41.82 ? 160 ASN A ND2 1 
ATOM   997  N N   . CYS A 1 162 ? -4.619  41.193 15.938  1.00 32.87 ? 161 CYS A N   1 
ATOM   998  C CA  . CYS A 1 162 ? -5.410  40.108 16.565  1.00 34.56 ? 161 CYS A CA  1 
ATOM   999  C C   . CYS A 1 162 ? -4.791  38.705 16.407  1.00 33.02 ? 161 CYS A C   1 
ATOM   1000 O O   . CYS A 1 162 ? -5.412  37.737 16.794  1.00 31.04 ? 161 CYS A O   1 
ATOM   1001 C CB  . CYS A 1 162 ? -6.831  40.089 15.957  1.00 33.95 ? 161 CYS A CB  1 
ATOM   1002 S SG  . CYS A 1 162 ? -7.764  41.616 16.325  1.00 35.60 ? 161 CYS A SG  1 
ATOM   1003 N N   . GLY A 1 163 ? -3.616  38.605 15.786  1.00 33.43 ? 162 GLY A N   1 
ATOM   1004 C CA  . GLY A 1 163 ? -2.879  37.345 15.656  1.00 30.68 ? 162 GLY A CA  1 
ATOM   1005 C C   . GLY A 1 163 ? -3.383  36.503 14.487  1.00 29.37 ? 162 GLY A C   1 
ATOM   1006 O O   . GLY A 1 163 ? -3.277  35.280 14.495  1.00 24.90 ? 162 GLY A O   1 
ATOM   1007 N N   . VAL A 1 164 ? -3.946  37.176 13.491  1.00 31.07 ? 163 VAL A N   1 
ATOM   1008 C CA  . VAL A 1 164 ? -4.481  36.547 12.295  1.00 27.94 ? 163 VAL A CA  1 
ATOM   1009 C C   . VAL A 1 164 ? -3.745  36.973 11.036  1.00 29.84 ? 163 VAL A C   1 
ATOM   1010 O O   . VAL A 1 164 ? -3.595  38.169 10.767  1.00 30.49 ? 163 VAL A O   1 
ATOM   1011 C CB  . VAL A 1 164 ? -5.972  36.880 12.149  1.00 27.12 ? 163 VAL A CB  1 
ATOM   1012 C CG1 . VAL A 1 164 ? -6.543  36.240 10.887  1.00 27.93 ? 163 VAL A CG1 1 
ATOM   1013 C CG2 . VAL A 1 164 ? -6.717  36.391 13.375  1.00 25.14 ? 163 VAL A CG2 1 
ATOM   1014 N N   . LEU A 1 165 ? -3.312  35.986 10.251  1.00 30.98 ? 164 LEU A N   1 
ATOM   1015 C CA  . LEU A 1 165 ? -2.752  36.202 8.911   1.00 34.78 ? 164 LEU A CA  1 
ATOM   1016 C C   . LEU A 1 165 ? -3.774  35.766 7.831   1.00 32.60 ? 164 LEU A C   1 
ATOM   1017 O O   . LEU A 1 165 ? -4.161  34.617 7.760   1.00 32.30 ? 164 LEU A O   1 
ATOM   1018 C CB  . LEU A 1 165 ? -1.448  35.404 8.789   1.00 36.29 ? 164 LEU A CB  1 
ATOM   1019 C CG  . LEU A 1 165 ? -0.594  35.643 7.550   1.00 36.71 ? 164 LEU A CG  1 
ATOM   1020 C CD1 . LEU A 1 165 ? 0.063   37.013 7.591   1.00 31.03 ? 164 LEU A CD1 1 
ATOM   1021 C CD2 . LEU A 1 165 ? 0.432   34.525 7.400   1.00 29.27 ? 164 LEU A CD2 1 
ATOM   1022 N N   . HIS A 1 166 ? -4.233  36.682 6.997   1.00 36.25 ? 165 HIS A N   1 
ATOM   1023 C CA  . HIS A 1 166 ? -5.297  36.345 6.042   1.00 33.95 ? 165 HIS A CA  1 
ATOM   1024 C C   . HIS A 1 166 ? -4.860  35.349 4.949   1.00 34.35 ? 165 HIS A C   1 
ATOM   1025 O O   . HIS A 1 166 ? -5.586  34.398 4.648   1.00 39.25 ? 165 HIS A O   1 
ATOM   1026 C CB  . HIS A 1 166 ? -5.893  37.648 5.462   1.00 37.03 ? 165 HIS A CB  1 
ATOM   1027 C CG  . HIS A 1 166 ? -7.064  37.458 4.552   1.00 35.62 ? 165 HIS A CG  1 
ATOM   1028 N ND1 . HIS A 1 166 ? -6.937  37.025 3.250   1.00 33.39 ? 165 HIS A ND1 1 
ATOM   1029 C CD2 . HIS A 1 166 ? -8.379  37.704 4.739   1.00 28.07 ? 165 HIS A CD2 1 
ATOM   1030 C CE1 . HIS A 1 166 ? -8.137  36.958 2.698   1.00 30.28 ? 165 HIS A CE1 1 
ATOM   1031 N NE2 . HIS A 1 166 ? -9.022  37.397 3.568   1.00 35.33 ? 165 HIS A NE2 1 
ATOM   1032 N N   . ARG A 1 167 ? -3.691  35.591 4.361   1.00 32.77 ? 166 ARG A N   1 
ATOM   1033 C CA  . ARG A 1 167 ? -3.082  34.765 3.311   1.00 32.69 ? 166 ARG A CA  1 
ATOM   1034 C C   . ARG A 1 167 ? -3.763  34.728 1.912   1.00 32.56 ? 166 ARG A C   1 
ATOM   1035 O O   . ARG A 1 167 ? -3.343  33.985 1.024   1.00 33.90 ? 166 ARG A O   1 
ATOM   1036 C CB  . ARG A 1 167 ? -2.773  33.365 3.827   1.00 37.31 ? 166 ARG A CB  1 
ATOM   1037 C CG  . ARG A 1 167 ? -1.824  33.355 4.997   1.00 32.57 ? 166 ARG A CG  1 
ATOM   1038 C CD  . ARG A 1 167 ? -1.150  32.001 5.149   1.00 33.80 ? 166 ARG A CD  1 
ATOM   1039 N NE  . ARG A 1 167 ? -2.110  30.952 5.498   1.00 30.83 ? 166 ARG A NE  1 
ATOM   1040 C CZ  . ARG A 1 167 ? -1.773  29.689 5.756   1.00 37.32 ? 166 ARG A CZ  1 
ATOM   1041 N NH1 . ARG A 1 167 ? -2.705  28.789 6.094   1.00 31.06 ? 166 ARG A NH1 1 
ATOM   1042 N NH2 . ARG A 1 167 ? -0.501  29.320 5.697   1.00 32.01 ? 166 ARG A NH2 1 
ATOM   1043 N N   . ASP A 1 168 ? -4.777  35.537 1.700   1.00 28.97 ? 167 ASP A N   1 
ATOM   1044 C CA  . ASP A 1 168 ? -5.422  35.616 0.398   1.00 32.75 ? 167 ASP A CA  1 
ATOM   1045 C C   . ASP A 1 168 ? -5.970  37.029 0.124   1.00 33.11 ? 167 ASP A C   1 
ATOM   1046 O O   . ASP A 1 168 ? -7.118  37.188 -0.319  1.00 35.51 ? 167 ASP A O   1 
ATOM   1047 C CB  . ASP A 1 168 ? -6.514  34.556 0.273   1.00 36.08 ? 167 ASP A CB  1 
ATOM   1048 C CG  . ASP A 1 168 ? -6.886  34.222 -1.184  1.00 36.23 ? 167 ASP A CG  1 
ATOM   1049 O OD1 . ASP A 1 168 ? -6.104  34.523 -2.111  1.00 37.73 ? 167 ASP A OD1 1 
ATOM   1050 O OD2 . ASP A 1 168 ? -7.971  33.623 -1.373  1.00 36.04 ? 167 ASP A OD2 1 
ATOM   1051 N N   . ILE A 1 169 ? -5.105  38.034 0.325   1.00 37.97 ? 168 ILE A N   1 
ATOM   1052 C CA  . ILE A 1 169 ? -5.444  39.424 0.029   1.00 35.61 ? 168 ILE A CA  1 
ATOM   1053 C C   . ILE A 1 169 ? -5.443  39.561 -1.487  1.00 36.54 ? 168 ILE A C   1 
ATOM   1054 O O   . ILE A 1 169 ? -4.440  39.270 -2.144  1.00 34.74 ? 168 ILE A O   1 
ATOM   1055 C CB  . ILE A 1 169 ? -4.463  40.450 0.720   1.00 43.55 ? 168 ILE A CB  1 
ATOM   1056 C CG1 . ILE A 1 169 ? -4.471  40.278 2.250   1.00 34.30 ? 168 ILE A CG1 1 
ATOM   1057 C CG2 . ILE A 1 169 ? -4.823  41.900 0.341   1.00 36.50 ? 168 ILE A CG2 1 
ATOM   1058 C CD1 . ILE A 1 169 ? -3.184  40.829 2.982   1.00 30.98 ? 168 ILE A CD1 1 
ATOM   1059 N N   . LYS A 1 170 ? -6.611  39.928 -2.026  1.00 33.96 ? 169 LYS A N   1 
ATOM   1060 C CA  . LYS A 1 170 ? -6.830  40.164 -3.448  1.00 32.91 ? 169 LYS A CA  1 
ATOM   1061 C C   . LYS A 1 170 ? -8.150  40.943 -3.640  1.00 33.02 ? 169 LYS A C   1 
ATOM   1062 O O   . LYS A 1 170 ? -9.009  40.970 -2.749  1.00 32.84 ? 169 LYS A O   1 
ATOM   1063 C CB  . LYS A 1 170 ? -6.879  38.838 -4.246  1.00 31.04 ? 169 LYS A CB  1 
ATOM   1064 C CG  . LYS A 1 170 ? -7.900  37.778 -3.798  1.00 27.33 ? 169 LYS A CG  1 
ATOM   1065 C CD  . LYS A 1 170 ? -7.921  36.710 -4.835  1.00 33.99 ? 169 LYS A CD  1 
ATOM   1066 C CE  . LYS A 1 170 ? -8.714  35.493 -4.451  1.00 35.09 ? 169 LYS A CE  1 
ATOM   1067 N NZ  . LYS A 1 170 ? -8.621  34.446 -5.493  1.00 34.60 ? 169 LYS A NZ  1 
ATOM   1068 N N   . ASP A 1 171 ? -8.305  41.557 -4.802  1.00 31.55 ? 170 ASP A N   1 
ATOM   1069 C CA  . ASP A 1 171 ? -9.534  42.297 -5.127  1.00 30.46 ? 170 ASP A CA  1 
ATOM   1070 C C   . ASP A 1 171 ? -10.813 41.483 -4.973  1.00 31.11 ? 170 ASP A C   1 
ATOM   1071 O O   . ASP A 1 171 ? -11.861 42.011 -4.564  1.00 35.23 ? 170 ASP A O   1 
ATOM   1072 C CB  . ASP A 1 171 ? -9.408  42.990 -6.514  1.00 27.73 ? 170 ASP A CB  1 
ATOM   1073 C CG  . ASP A 1 171 ? -9.108  42.043 -7.698  1.00 33.97 ? 170 ASP A CG  1 
ATOM   1074 O OD1 . ASP A 1 171 ? -9.001  40.795 -7.612  1.00 32.67 ? 170 ASP A OD1 1 
ATOM   1075 O OD2 . ASP A 1 171 ? -8.949  42.613 -8.776  1.00 32.80 ? 170 ASP A OD2 1 
ATOM   1076 N N   . GLU A 1 172 ? -10.732 40.189 -5.284  1.00 30.41 ? 171 GLU A N   1 
ATOM   1077 C CA  . GLU A 1 172 ? -11.880 39.285 -5.150  1.00 33.10 ? 171 GLU A CA  1 
ATOM   1078 C C   . GLU A 1 172 ? -12.352 39.144 -3.702  1.00 32.68 ? 171 GLU A C   1 
ATOM   1079 O O   . GLU A 1 172 ? -13.528 38.878 -3.450  1.00 30.18 ? 171 GLU A O   1 
ATOM   1080 C CB  . GLU A 1 172 ? -11.534 37.903 -5.699  1.00 31.71 ? 171 GLU A CB  1 
ATOM   1081 C CG  . GLU A 1 172 ? -11.059 37.874 -7.165  1.00 28.49 ? 171 GLU A CG  1 
ATOM   1082 C CD  . GLU A 1 172 ? -10.868 36.469 -7.682  1.00 30.93 ? 171 GLU A CD  1 
ATOM   1083 O OE1 . GLU A 1 172 ? -11.872 35.726 -7.705  1.00 31.79 ? 171 GLU A OE1 1 
ATOM   1084 O OE2 . GLU A 1 172 ? -9.722  36.110 -8.069  1.00 36.26 ? 171 GLU A OE2 1 
ATOM   1085 N N   . ASN A 1 173 ? -11.424 39.319 -2.760  1.00 31.93 ? 172 ASN A N   1 
ATOM   1086 C CA  . ASN A 1 173 ? -11.717 39.198 -1.340  1.00 32.86 ? 172 ASN A CA  1 
ATOM   1087 C C   . ASN A 1 173 ? -11.933 40.526 -0.615  1.00 30.23 ? 172 ASN A C   1 
ATOM   1088 O O   . ASN A 1 173 ? -11.781 40.612 0.616   1.00 32.05 ? 172 ASN A O   1 
ATOM   1089 C CB  . ASN A 1 173 ? -10.645 38.312 -0.670  1.00 34.22 ? 172 ASN A CB  1 
ATOM   1090 C CG  . ASN A 1 173 ? -10.713 36.868 -1.163  1.00 30.93 ? 172 ASN A CG  1 
ATOM   1091 O OD1 . ASN A 1 173 ? -11.761 36.431 -1.621  1.00 36.95 ? 172 ASN A OD1 1 
ATOM   1092 N ND2 . ASN A 1 173 ? -9.597  36.117 -1.057  1.00 33.47 ? 172 ASN A ND2 1 
ATOM   1093 N N   . ILE A 1 174 ? -12.327 41.551 -1.379  1.00 33.06 ? 173 ILE A N   1 
ATOM   1094 C CA  . ILE A 1 174 ? -12.614 42.885 -0.840  1.00 35.05 ? 173 ILE A CA  1 
ATOM   1095 C C   . ILE A 1 174 ? -13.991 43.335 -1.336  1.00 32.84 ? 173 ILE A C   1 
ATOM   1096 O O   . ILE A 1 174 ? -14.249 43.401 -2.537  1.00 31.93 ? 173 ILE A O   1 
ATOM   1097 C CB  . ILE A 1 174 ? -11.524 43.930 -1.212  1.00 33.73 ? 173 ILE A CB  1 
ATOM   1098 C CG1 . ILE A 1 174 ? -10.161 43.494 -0.640  1.00 37.03 ? 173 ILE A CG1 1 
ATOM   1099 C CG2 . ILE A 1 174 ? -11.941 45.336 -0.755  1.00 32.47 ? 173 ILE A CG2 1 
ATOM   1100 C CD1 . ILE A 1 174 ? -8.935  44.218 -1.229  1.00 32.38 ? 173 ILE A CD1 1 
ATOM   1101 N N   . LEU A 1 175 ? -14.879 43.632 -0.387  1.00 33.35 ? 174 LEU A N   1 
ATOM   1102 C CA  . LEU A 1 175 ? -16.187 44.181 -0.696  1.00 33.48 ? 174 LEU A CA  1 
ATOM   1103 C C   . LEU A 1 175 ? -16.197 45.658 -0.464  1.00 33.58 ? 174 LEU A C   1 
ATOM   1104 O O   . LEU A 1 175 ? -15.630 46.132 0.500   1.00 30.08 ? 174 LEU A O   1 
ATOM   1105 C CB  . LEU A 1 175 ? -17.262 43.538 0.158   1.00 34.20 ? 174 LEU A CB  1 
ATOM   1106 C CG  . LEU A 1 175 ? -17.356 42.038 0.003   1.00 31.47 ? 174 LEU A CG  1 
ATOM   1107 C CD1 . LEU A 1 175 ? -18.521 41.597 0.879   1.00 32.36 ? 174 LEU A CD1 1 
ATOM   1108 C CD2 . LEU A 1 175 ? -17.511 41.592 -1.444  1.00 25.19 ? 174 LEU A CD2 1 
ATOM   1109 N N   . ILE A 1 176 ? -16.821 46.386 -1.384  1.00 32.57 ? 175 ILE A N   1 
ATOM   1110 C CA  . ILE A 1 176 ? -16.985 47.815 -1.250  1.00 32.93 ? 175 ILE A CA  1 
ATOM   1111 C C   . ILE A 1 176 ? -18.450 48.082 -0.891  1.00 33.93 ? 175 ILE A C   1 
ATOM   1112 O O   . ILE A 1 176 ? -19.347 47.690 -1.625  1.00 34.25 ? 175 ILE A O   1 
ATOM   1113 C CB  . ILE A 1 176 ? -16.682 48.585 -2.588  1.00 31.36 ? 175 ILE A CB  1 
ATOM   1114 C CG1 . ILE A 1 176 ? -15.355 48.148 -3.230  1.00 32.74 ? 175 ILE A CG1 1 
ATOM   1115 C CG2 . ILE A 1 176 ? -16.741 50.083 -2.355  1.00 29.97 ? 175 ILE A CG2 1 
ATOM   1116 C CD1 . ILE A 1 176 ? -15.283 48.560 -4.706  1.00 28.56 ? 175 ILE A CD1 1 
ATOM   1117 N N   . ASP A 1 177 ? -18.667 48.738 0.245   1.00 34.54 ? 176 ASP A N   1 
ATOM   1118 C CA  . ASP A 1 177 ? -19.961 49.285 0.606   1.00 35.26 ? 176 ASP A CA  1 
ATOM   1119 C C   . ASP A 1 177 ? -20.062 50.598 -0.153  1.00 35.43 ? 176 ASP A C   1 
ATOM   1120 O O   . ASP A 1 177 ? -19.374 51.578 0.166   1.00 31.47 ? 176 ASP A O   1 
ATOM   1121 C CB  . ASP A 1 177 ? -20.081 49.483 2.128   1.00 33.86 ? 176 ASP A CB  1 
ATOM   1122 C CG  . ASP A 1 177 ? -21.409 50.086 2.550   1.00 32.62 ? 176 ASP A CG  1 
ATOM   1123 O OD1 . ASP A 1 177 ? -21.962 50.920 1.815   1.00 40.19 ? 176 ASP A OD1 1 
ATOM   1124 O OD2 . ASP A 1 177 ? -21.894 49.729 3.638   1.00 46.26 ? 176 ASP A OD2 1 
ATOM   1125 N N   . LEU A 1 178 ? -20.929 50.581 -1.162  1.00 35.47 ? 177 LEU A N   1 
ATOM   1126 C CA  . LEU A 1 178 ? -21.000 51.602 -2.188  1.00 35.97 ? 177 LEU A CA  1 
ATOM   1127 C C   . LEU A 1 178 ? -21.653 52.895 -1.665  1.00 36.43 ? 177 LEU A C   1 
ATOM   1128 O O   . LEU A 1 178 ? -21.469 53.951 -2.243  1.00 39.42 ? 177 LEU A O   1 
ATOM   1129 C CB  . LEU A 1 178 ? -21.762 51.051 -3.412  1.00 31.59 ? 177 LEU A CB  1 
ATOM   1130 C CG  . LEU A 1 178 ? -21.071 49.980 -4.271  1.00 42.37 ? 177 LEU A CG  1 
ATOM   1131 C CD1 . LEU A 1 178 ? -22.084 49.401 -5.298  1.00 34.47 ? 177 LEU A CD1 1 
ATOM   1132 C CD2 . LEU A 1 178 ? -19.762 50.519 -4.987  1.00 31.23 ? 177 LEU A CD2 1 
ATOM   1133 N N   . ASN A 1 179 ? -22.405 52.797 -0.571  1.00 35.28 ? 178 ASN A N   1 
ATOM   1134 C CA  . ASN A 1 179 ? -23.028 53.951 0.060   1.00 37.33 ? 178 ASN A CA  1 
ATOM   1135 C C   . ASN A 1 179 ? -22.129 54.630 1.087   1.00 36.87 ? 178 ASN A C   1 
ATOM   1136 O O   . ASN A 1 179 ? -22.036 55.852 1.104   1.00 37.12 ? 178 ASN A O   1 
ATOM   1137 C CB  . ASN A 1 179 ? -24.340 53.550 0.734   1.00 39.06 ? 178 ASN A CB  1 
ATOM   1138 C CG  . ASN A 1 179 ? -25.525 53.505 -0.236  1.00 41.37 ? 178 ASN A CG  1 
ATOM   1139 O OD1 . ASN A 1 179 ? -25.412 53.822 -1.423  1.00 43.22 ? 178 ASN A OD1 1 
ATOM   1140 N ND2 . ASN A 1 179 ? -26.680 53.098 0.287   1.00 46.14 ? 178 ASN A ND2 1 
ATOM   1141 N N   . ARG A 1 180 ? -21.463 53.836 1.928   1.00 37.92 ? 179 ARG A N   1 
ATOM   1142 C CA  . ARG A 1 180 ? -20.591 54.364 3.001   1.00 35.16 ? 179 ARG A CA  1 
ATOM   1143 C C   . ARG A 1 180 ? -19.118 54.582 2.576   1.00 33.71 ? 179 ARG A C   1 
ATOM   1144 O O   . ARG A 1 180 ? -18.336 55.185 3.336   1.00 34.28 ? 179 ARG A O   1 
ATOM   1145 C CB  . ARG A 1 180 ? -20.644 53.434 4.239   1.00 34.71 ? 179 ARG A CB  1 
ATOM   1146 C CG  . ARG A 1 180 ? -22.034 53.213 4.862   1.00 31.19 ? 179 ARG A CG  1 
ATOM   1147 C CD  . ARG A 1 180 ? -21.949 52.517 6.256   1.00 30.36 ? 179 ARG A CD  1 
ATOM   1148 N NE  . ARG A 1 180 ? -21.354 53.375 7.306   1.00 51.58 ? 179 ARG A NE  1 
ATOM   1149 C CZ  . ARG A 1 180 ? -21.895 54.517 7.756   1.00 42.69 ? 179 ARG A CZ  1 
ATOM   1150 N N   . GLY A 1 181 ? -18.734 54.079 1.390   1.00 33.45 ? 180 GLY A N   1 
ATOM   1151 C CA  . GLY A 1 181 ? -17.345 54.138 0.920   1.00 31.91 ? 180 GLY A CA  1 
ATOM   1152 C C   . GLY A 1 181 ? -16.344 53.328 1.756   1.00 35.49 ? 180 GLY A C   1 
ATOM   1153 O O   . GLY A 1 181 ? -15.146 53.621 1.761   1.00 34.88 ? 180 GLY A O   1 
ATOM   1154 N N   . GLU A 1 182 ? -16.845 52.301 2.431   1.00 33.56 ? 181 GLU A N   1 
ATOM   1155 C CA  . GLU A 1 182 ? -16.066 51.425 3.307   1.00 34.15 ? 181 GLU A CA  1 
ATOM   1156 C C   . GLU A 1 182 ? -15.791 50.049 2.666   1.00 37.76 ? 181 GLU A C   1 
ATOM   1157 O O   . GLU A 1 182 ? -16.703 49.426 2.082   1.00 35.02 ? 181 GLU A O   1 
ATOM   1158 C CB  . GLU A 1 182 ? -16.811 51.207 4.628   1.00 35.04 ? 181 GLU A CB  1 
ATOM   1159 C CG  . GLU A 1 182 ? -16.720 52.360 5.598   1.00 36.53 ? 181 GLU A CG  1 
ATOM   1160 C CD  . GLU A 1 182 ? -17.727 52.291 6.730   1.00 45.48 ? 181 GLU A CD  1 
ATOM   1161 O OE1 . GLU A 1 182 ? -18.498 51.311 6.813   1.00 59.36 ? 181 GLU A OE1 1 
ATOM   1162 O OE2 . GLU A 1 182 ? -17.757 53.247 7.530   1.00 52.83 ? 181 GLU A OE2 1 
ATOM   1163 N N   . LEU A 1 183 ? -14.541 49.590 2.818   1.00 35.05 ? 182 LEU A N   1 
ATOM   1164 C CA  . LEU A 1 183 ? -14.079 48.289 2.328   1.00 34.57 ? 182 LEU A CA  1 
ATOM   1165 C C   . LEU A 1 183 ? -14.091 47.221 3.443   1.00 32.20 ? 182 LEU A C   1 
ATOM   1166 O O   . LEU A 1 183 ? -13.881 47.545 4.638   1.00 31.87 ? 182 LEU A O   1 
ATOM   1167 C CB  . LEU A 1 183 ? -12.683 48.431 1.696   1.00 33.47 ? 182 LEU A CB  1 
ATOM   1168 C CG  . LEU A 1 183 ? -12.663 48.790 0.199   1.00 34.50 ? 182 LEU A CG  1 
ATOM   1169 C CD1 . LEU A 1 183 ? -13.371 50.091 -0.097  1.00 31.60 ? 182 LEU A CD1 1 
ATOM   1170 C CD2 . LEU A 1 183 ? -11.221 48.791 -0.324  1.00 36.89 ? 182 LEU A CD2 1 
ATOM   1171 N N   . LYS A 1 184 ? -14.413 45.984 3.046   1.00 32.21 ? 183 LYS A N   1 
ATOM   1172 C CA  . LYS A 1 184 ? -14.484 44.801 3.941   1.00 32.69 ? 183 LYS A CA  1 
ATOM   1173 C C   . LYS A 1 184 ? -13.696 43.660 3.334   1.00 30.82 ? 183 LYS A C   1 
ATOM   1174 O O   . LYS A 1 184 ? -13.947 43.242 2.203   1.00 29.14 ? 183 LYS A O   1 
ATOM   1175 C CB  . LYS A 1 184 ? -15.919 44.283 4.186   1.00 37.81 ? 183 LYS A CB  1 
ATOM   1176 C CG  . LYS A 1 184 ? -16.816 45.209 4.955   1.00 43.61 ? 183 LYS A CG  1 
ATOM   1177 C CD  . LYS A 1 184 ? -16.769 44.904 6.438   1.00 41.87 ? 183 LYS A CD  1 
ATOM   1178 C CE  . LYS A 1 184 ? -17.340 46.032 7.304   1.00 37.58 ? 183 LYS A CE  1 
ATOM   1179 N NZ  . LYS A 1 184 ? -16.990 45.707 8.758   1.00 47.13 ? 183 LYS A NZ  1 
ATOM   1180 N N   . LEU A 1 185 ? -12.769 43.149 4.120   1.00 31.64 ? 184 LEU A N   1 
ATOM   1181 C CA  . LEU A 1 185 ? -11.964 42.002 3.796   1.00 33.13 ? 184 LEU A CA  1 
ATOM   1182 C C   . LEU A 1 185 ? -12.774 40.761 4.113   1.00 33.72 ? 184 LEU A C   1 
ATOM   1183 O O   . LEU A 1 185 ? -13.283 40.609 5.222   1.00 30.74 ? 184 LEU A O   1 
ATOM   1184 C CB  . LEU A 1 185 ? -10.667 42.060 4.616   1.00 35.19 ? 184 LEU A CB  1 
ATOM   1185 C CG  . LEU A 1 185 ? -9.492  41.139 4.297   1.00 41.03 ? 184 LEU A CG  1 
ATOM   1186 C CD1 . LEU A 1 185 ? -9.059  41.201 2.820   1.00 36.13 ? 184 LEU A CD1 1 
ATOM   1187 C CD2 . LEU A 1 185 ? -8.331  41.499 5.271   1.00 40.60 ? 184 LEU A CD2 1 
ATOM   1188 N N   . ILE A 1 186 ? -12.917 39.887 3.106   1.00 32.78 ? 185 ILE A N   1 
ATOM   1189 C CA  . ILE A 1 186 ? -13.665 38.642 3.238   1.00 30.93 ? 185 ILE A CA  1 
ATOM   1190 C C   . ILE A 1 186 ? -12.745 37.438 2.969   1.00 31.87 ? 185 ILE A C   1 
ATOM   1191 O O   . ILE A 1 186 ? -11.564 37.580 2.629   1.00 33.21 ? 185 ILE A O   1 
ATOM   1192 C CB  . ILE A 1 186 ? -14.953 38.599 2.311   1.00 30.49 ? 185 ILE A CB  1 
ATOM   1193 C CG1 . ILE A 1 186 ? -14.570 38.787 0.833   1.00 29.73 ? 185 ILE A CG1 1 
ATOM   1194 C CG2 . ILE A 1 186 ? -16.022 39.621 2.810   1.00 27.84 ? 185 ILE A CG2 1 
ATOM   1195 C CD1 . ILE A 1 186 ? -15.619 38.358 -0.160  1.00 28.80 ? 185 ILE A CD1 1 
ATOM   1196 N N   . ASP A 1 187 ? -13.314 36.254 3.166   1.00 34.44 ? 186 ASP A N   1 
ATOM   1197 C CA  . ASP A 1 187 ? -12.690 34.960 2.932   1.00 34.04 ? 186 ASP A CA  1 
ATOM   1198 C C   . ASP A 1 187 ? -11.375 34.709 3.691   1.00 35.78 ? 186 ASP A C   1 
ATOM   1199 O O   . ASP A 1 187 ? -10.269 34.682 3.111   1.00 34.65 ? 186 ASP A O   1 
ATOM   1200 C CB  . ASP A 1 187 ? -12.544 34.665 1.427   1.00 37.93 ? 186 ASP A CB  1 
ATOM   1201 C CG  . ASP A 1 187 ? -12.292 33.170 1.144   1.00 33.70 ? 186 ASP A CG  1 
ATOM   1202 O OD1 . ASP A 1 187 ? -12.293 32.372 2.113   1.00 35.54 ? 186 ASP A OD1 1 
ATOM   1203 O OD2 . ASP A 1 187 ? -12.104 32.804 -0.037  1.00 42.41 ? 186 ASP A OD2 1 
ATOM   1204 N N   . PHE A 1 188 ? -11.540 34.454 4.986   1.00 32.80 ? 187 PHE A N   1 
ATOM   1205 C CA  . PHE A 1 188 ? -10.468 34.000 5.855   1.00 36.97 ? 187 PHE A CA  1 
ATOM   1206 C C   . PHE A 1 188 ? -10.184 32.476 5.795   1.00 35.99 ? 187 PHE A C   1 
ATOM   1207 O O   . PHE A 1 188 ? -9.435  31.959 6.627   1.00 38.30 ? 187 PHE A O   1 
ATOM   1208 C CB  . PHE A 1 188 ? -10.787 34.429 7.295   1.00 35.03 ? 187 PHE A CB  1 
ATOM   1209 C CG  . PHE A 1 188 ? -10.581 35.899 7.529   1.00 34.59 ? 187 PHE A CG  1 
ATOM   1210 C CD1 . PHE A 1 188 ? -9.473  36.342 8.219   1.00 33.02 ? 187 PHE A CD1 1 
ATOM   1211 C CD2 . PHE A 1 188 ? -11.493 36.838 7.038   1.00 32.92 ? 187 PHE A CD2 1 
ATOM   1212 C CE1 . PHE A 1 188 ? -9.253  37.722 8.422   1.00 31.51 ? 187 PHE A CE1 1 
ATOM   1213 C CE2 . PHE A 1 188 ? -11.285 38.215 7.220   1.00 33.02 ? 187 PHE A CE2 1 
ATOM   1214 C CZ  . PHE A 1 188 ? -10.157 38.653 7.919   1.00 34.94 ? 187 PHE A CZ  1 
ATOM   1215 N N   . GLY A 1 189 ? -10.743 31.788 4.803   1.00 30.41 ? 188 GLY A N   1 
ATOM   1216 C CA  . GLY A 1 189 ? -10.603 30.345 4.684   1.00 34.90 ? 188 GLY A CA  1 
ATOM   1217 C C   . GLY A 1 189 ? -9.247  29.805 4.300   1.00 31.82 ? 188 GLY A C   1 
ATOM   1218 O O   . GLY A 1 189 ? -9.066  28.624 4.265   1.00 35.18 ? 188 GLY A O   1 
ATOM   1219 N N   . SER A 1 190 ? -8.309  30.664 3.949   1.00 33.45 ? 189 SER A N   1 
ATOM   1220 C CA  . SER A 1 190 ? -6.932  30.269 3.629   1.00 34.70 ? 189 SER A CA  1 
ATOM   1221 C C   . SER A 1 190 ? -5.980  30.771 4.736   1.00 34.01 ? 189 SER A C   1 
ATOM   1222 O O   . SER A 1 190 ? -4.782  30.644 4.620   1.00 36.54 ? 189 SER A O   1 
ATOM   1223 C CB  . SER A 1 190 ? -6.507  30.871 2.258   1.00 37.93 ? 189 SER A CB  1 
ATOM   1224 O OG  . SER A 1 190 ? -7.307  30.429 1.148   1.00 35.46 ? 189 SER A OG  1 
ATOM   1225 N N   . GLY A 1 191 ? -6.530  31.384 5.787   1.00 31.92 ? 190 GLY A N   1 
ATOM   1226 C CA  . GLY A 1 191 ? -5.729  32.125 6.750   1.00 35.90 ? 190 GLY A CA  1 
ATOM   1227 C C   . GLY A 1 191 ? -5.063  31.232 7.771   1.00 34.13 ? 190 GLY A C   1 
ATOM   1228 O O   . GLY A 1 191 ? -5.319  30.028 7.814   1.00 34.05 ? 190 GLY A O   1 
ATOM   1229 N N   . ALA A 1 192 ? -4.195  31.824 8.590   1.00 30.88 ? 191 ALA A N   1 
ATOM   1230 C CA  . ALA A 1 192 ? -3.542  31.095 9.693   1.00 29.03 ? 191 ALA A CA  1 
ATOM   1231 C C   . ALA A 1 192 ? -3.380  32.006 10.879  1.00 29.37 ? 191 ALA A C   1 
ATOM   1232 O O   . ALA A 1 192 ? -3.467  33.221 10.768  1.00 33.39 ? 191 ALA A O   1 
ATOM   1233 C CB  . ALA A 1 192 ? -2.161  30.574 9.262   1.00 28.32 ? 191 ALA A CB  1 
ATOM   1234 N N   . LEU A 1 193 ? -3.078  31.411 12.020  1.00 31.29 ? 192 LEU A N   1 
ATOM   1235 C CA  . LEU A 1 193 ? -2.575  32.175 13.146  1.00 31.60 ? 192 LEU A CA  1 
ATOM   1236 C C   . LEU A 1 193 ? -1.246  32.797 12.710  1.00 33.80 ? 192 LEU A C   1 
ATOM   1237 O O   . LEU A 1 193 ? -0.438  32.156 12.011  1.00 31.72 ? 192 LEU A O   1 
ATOM   1238 C CB  . LEU A 1 193 ? -2.434  31.291 14.386  1.00 28.87 ? 192 LEU A CB  1 
ATOM   1239 C CG  . LEU A 1 193 ? -3.724  30.697 14.949  1.00 33.64 ? 192 LEU A CG  1 
ATOM   1240 C CD1 . LEU A 1 193 ? -3.370  29.604 15.942  1.00 31.28 ? 192 LEU A CD1 1 
ATOM   1241 C CD2 . LEU A 1 193 ? -4.610  31.777 15.609  1.00 30.68 ? 192 LEU A CD2 1 
ATOM   1242 N N   . LEU A 1 194 ? -1.054  34.067 13.058  1.00 32.84 ? 193 LEU A N   1 
ATOM   1243 C CA  . LEU A 1 194 ? 0.198   34.755 12.779  1.00 35.43 ? 193 LEU A CA  1 
ATOM   1244 C C   . LEU A 1 194 ? 1.280   34.239 13.750  1.00 29.39 ? 193 LEU A C   1 
ATOM   1245 O O   . LEU A 1 194 ? 1.039   34.138 14.935  1.00 34.50 ? 193 LEU A O   1 
ATOM   1246 C CB  . LEU A 1 194 ? 0.006   36.263 12.917  1.00 36.00 ? 193 LEU A CB  1 
ATOM   1247 C CG  . LEU A 1 194 ? 1.103   37.272 12.550  1.00 40.15 ? 193 LEU A CG  1 
ATOM   1248 C CD1 . LEU A 1 194 ? 1.442   37.277 11.089  1.00 30.53 ? 193 LEU A CD1 1 
ATOM   1249 C CD2 . LEU A 1 194 ? 0.680   38.689 13.003  1.00 39.12 ? 193 LEU A CD2 1 
ATOM   1250 N N   . LYS A 1 195 ? 2.449   33.915 13.199  1.00 29.83 ? 194 LYS A N   1 
ATOM   1251 C CA  . LYS A 1 195 ? 3.637   33.468 13.910  1.00 33.78 ? 194 LYS A CA  1 
ATOM   1252 C C   . LYS A 1 195 ? 4.850   34.209 13.343  1.00 34.31 ? 194 LYS A C   1 
ATOM   1253 O O   . LYS A 1 195 ? 4.743   34.840 12.309  1.00 34.54 ? 194 LYS A O   1 
ATOM   1254 C CB  . LYS A 1 195 ? 3.805   31.946 13.741  1.00 32.05 ? 194 LYS A CB  1 
ATOM   1255 C CG  . LYS A 1 195 ? 4.076   31.456 12.335  1.00 33.40 ? 194 LYS A CG  1 
ATOM   1256 C CD  . LYS A 1 195 ? 3.940   29.930 12.282  1.00 33.65 ? 194 LYS A CD  1 
ATOM   1257 C CE  . LYS A 1 195 ? 4.506   29.434 11.014  1.00 30.61 ? 194 LYS A CE  1 
ATOM   1258 N NZ  . LYS A 1 195 ? 4.384   27.985 10.874  1.00 32.64 ? 194 LYS A NZ  1 
ATOM   1259 N N   . ASP A 1 196 ? 6.006   34.099 13.992  1.00 35.67 ? 195 ASP A N   1 
ATOM   1260 C CA  . ASP A 1 196 ? 7.230   34.785 13.524  1.00 33.59 ? 195 ASP A CA  1 
ATOM   1261 C C   . ASP A 1 196 ? 8.187   33.855 12.764  1.00 33.33 ? 195 ASP A C   1 
ATOM   1262 O O   . ASP A 1 196 ? 9.204   34.289 12.226  1.00 34.99 ? 195 ASP A O   1 
ATOM   1263 C CB  . ASP A 1 196 ? 7.936   35.414 14.723  1.00 37.88 ? 195 ASP A CB  1 
ATOM   1264 C CG  . ASP A 1 196 ? 7.143   36.554 15.338  1.00 29.58 ? 195 ASP A CG  1 
ATOM   1265 O OD1 . ASP A 1 196 ? 6.752   37.453 14.593  1.00 42.56 ? 195 ASP A OD1 1 
ATOM   1266 O OD2 . ASP A 1 196 ? 6.939   36.566 16.568  1.00 37.12 ? 195 ASP A OD2 1 
ATOM   1267 N N   . THR A 1 197 ? 7.849   32.571 12.747  1.00 35.27 ? 196 THR A N   1 
ATOM   1268 C CA  . THR A 1 197 ? 8.600   31.537 12.054  1.00 34.38 ? 196 THR A CA  1 
ATOM   1269 C C   . THR A 1 197 ? 8.041   31.336 10.632  1.00 36.45 ? 196 THR A C   1 
ATOM   1270 O O   . THR A 1 197 ? 6.980   31.892 10.268  1.00 32.20 ? 196 THR A O   1 
ATOM   1271 C CB  . THR A 1 197 ? 8.567   30.195 12.844  1.00 36.51 ? 196 THR A CB  1 
ATOM   1272 O OG1 . THR A 1 197 ? 7.220   29.857 13.177  1.00 36.73 ? 196 THR A OG1 1 
ATOM   1273 C CG2 . THR A 1 197 ? 9.382   30.286 14.142  1.00 34.81 ? 196 THR A CG2 1 
ATOM   1274 N N   . VAL A 1 198 ? 8.767   30.547 9.841   1.00 33.47 ? 197 VAL A N   1 
ATOM   1275 C CA  . VAL A 1 198 ? 8.468   30.371 8.426   1.00 37.92 ? 197 VAL A CA  1 
ATOM   1276 C C   . VAL A 1 198 ? 7.189   29.545 8.269   1.00 36.87 ? 197 VAL A C   1 
ATOM   1277 O O   . VAL A 1 198 ? 6.912   28.672 9.070   1.00 36.41 ? 197 VAL A O   1 
ATOM   1278 C CB  . VAL A 1 198 ? 9.693   29.724 7.662   1.00 39.53 ? 197 VAL A CB  1 
ATOM   1279 C CG1 . VAL A 1 198 ? 9.928   28.287 8.105   1.00 44.26 ? 197 VAL A CG1 1 
ATOM   1280 C CG2 . VAL A 1 198 ? 9.516   29.766 6.187   1.00 31.41 ? 197 VAL A CG2 1 
ATOM   1281 N N   . TYR A 1 199 ? 6.400   29.882 7.249   1.00 38.63 ? 198 TYR A N   1 
ATOM   1282 C CA  . TYR A 1 199 ? 5.297   29.054 6.781   1.00 34.24 ? 198 TYR A CA  1 
ATOM   1283 C C   . TYR A 1 199 ? 5.793   28.244 5.598   1.00 36.27 ? 198 TYR A C   1 
ATOM   1284 O O   . TYR A 1 199 ? 6.475   28.782 4.759   1.00 34.80 ? 198 TYR A O   1 
ATOM   1285 C CB  . TYR A 1 199 ? 4.148   29.931 6.290   1.00 35.51 ? 198 TYR A CB  1 
ATOM   1286 C CG  . TYR A 1 199 ? 3.443   30.702 7.366   1.00 27.79 ? 198 TYR A CG  1 
ATOM   1287 C CD1 . TYR A 1 199 ? 2.312   30.165 8.008   1.00 28.73 ? 198 TYR A CD1 1 
ATOM   1288 C CD2 . TYR A 1 199 ? 3.908   31.947 7.765   1.00 28.14 ? 198 TYR A CD2 1 
ATOM   1289 C CE1 . TYR A 1 199 ? 1.669   30.853 9.017   1.00 24.57 ? 198 TYR A CE1 1 
ATOM   1290 C CE2 . TYR A 1 199 ? 3.262   32.669 8.760   1.00 30.43 ? 198 TYR A CE2 1 
ATOM   1291 C CZ  . TYR A 1 199 ? 2.140   32.129 9.368   1.00 31.51 ? 198 TYR A CZ  1 
ATOM   1292 O OH  . TYR A 1 199 ? 1.539   32.832 10.336  1.00 29.36 ? 198 TYR A OH  1 
ATOM   1293 N N   . THR A 1 200 ? 5.432   26.959 5.552   1.00 34.03 ? 199 THR A N   1 
ATOM   1294 C CA  . THR A 1 200 ? 5.750   26.081 4.446   1.00 37.52 ? 199 THR A CA  1 
ATOM   1295 C C   . THR A 1 200 ? 4.500   25.581 3.697   1.00 38.44 ? 199 THR A C   1 
ATOM   1296 O O   . THR A 1 200 ? 4.627   24.821 2.764   1.00 38.97 ? 199 THR A O   1 
ATOM   1297 C CB  . THR A 1 200 ? 6.631   24.899 4.918   1.00 36.10 ? 199 THR A CB  1 
ATOM   1298 O OG1 . THR A 1 200 ? 5.976   24.200 5.987   1.00 38.27 ? 199 THR A OG1 1 
ATOM   1299 C CG2 . THR A 1 200 ? 7.987   25.432 5.396   1.00 38.77 ? 199 THR A CG2 1 
ATOM   1300 N N   . ASP A 1 201 ? 3.313   26.035 4.100   1.00 42.36 ? 200 ASP A N   1 
ATOM   1301 C CA  . ASP A 1 201 ? 2.052   25.659 3.460   1.00 46.18 ? 200 ASP A CA  1 
ATOM   1302 C C   . ASP A 1 201 ? 1.400   26.937 2.939   1.00 43.16 ? 200 ASP A C   1 
ATOM   1303 O O   . ASP A 1 201 ? 1.596   27.989 3.516   1.00 43.16 ? 200 ASP A O   1 
ATOM   1304 C CB  . ASP A 1 201 ? 1.112   24.959 4.463   1.00 50.31 ? 200 ASP A CB  1 
ATOM   1305 C CG  . ASP A 1 201 ? 0.663   25.894 5.636   1.00 61.51 ? 200 ASP A CG  1 
ATOM   1306 O OD1 . ASP A 1 201 ? 1.517   26.330 6.457   1.00 63.13 ? 200 ASP A OD1 1 
ATOM   1307 O OD2 . ASP A 1 201 ? -0.559  26.184 5.742   1.00 60.52 ? 200 ASP A OD2 1 
ATOM   1308 N N   . PHE A 1 202 ? 0.635   26.830 1.852   1.00 41.28 ? 201 PHE A N   1 
ATOM   1309 C CA  . PHE A 1 202 ? -0.103  27.951 1.287   1.00 37.97 ? 201 PHE A CA  1 
ATOM   1310 C C   . PHE A 1 202 ? -1.183  27.477 0.312   1.00 38.58 ? 201 PHE A C   1 
ATOM   1311 O O   . PHE A 1 202 ? -0.888  26.756 -0.613  1.00 40.16 ? 201 PHE A O   1 
ATOM   1312 C CB  . PHE A 1 202 ? 0.873   28.895 0.596   1.00 38.94 ? 201 PHE A CB  1 
ATOM   1313 C CG  . PHE A 1 202 ? 0.232   30.047 -0.126  1.00 35.03 ? 201 PHE A CG  1 
ATOM   1314 C CD1 . PHE A 1 202 ? -0.163  31.184 0.568   1.00 37.30 ? 201 PHE A CD1 1 
ATOM   1315 C CD2 . PHE A 1 202 ? 0.053   30.002 -1.508  1.00 31.10 ? 201 PHE A CD2 1 
ATOM   1316 C CE1 . PHE A 1 202 ? -0.732  32.253 -0.088  1.00 37.82 ? 201 PHE A CE1 1 
ATOM   1317 C CE2 . PHE A 1 202 ? -0.516  31.074 -2.187  1.00 39.47 ? 201 PHE A CE2 1 
ATOM   1318 C CZ  . PHE A 1 202 ? -0.891  32.210 -1.476  1.00 41.89 ? 201 PHE A CZ  1 
ATOM   1319 N N   . ASP A 1 203 ? -2.430  27.889 0.536   1.00 37.37 ? 202 ASP A N   1 
ATOM   1320 C CA  . ASP A 1 203 ? -3.526  27.601 -0.373  1.00 41.52 ? 202 ASP A CA  1 
ATOM   1321 C C   . ASP A 1 203 ? -4.275  28.893 -0.772  1.00 39.03 ? 202 ASP A C   1 
ATOM   1322 O O   . ASP A 1 203 ? -5.446  28.857 -1.111  1.00 40.11 ? 202 ASP A O   1 
ATOM   1323 C CB  . ASP A 1 203 ? -4.475  26.572 0.270   1.00 47.18 ? 202 ASP A CB  1 
ATOM   1324 C CG  . ASP A 1 203 ? -3.763  25.278 0.665   1.00 46.54 ? 202 ASP A CG  1 
ATOM   1325 N N   . GLY A 1 204 ? -3.584  30.033 -0.726  1.00 37.66 ? 203 GLY A N   1 
ATOM   1326 C CA  . GLY A 1 204 ? -4.111  31.284 -1.265  1.00 33.08 ? 203 GLY A CA  1 
ATOM   1327 C C   . GLY A 1 204 ? -3.959  31.335 -2.777  1.00 28.87 ? 203 GLY A C   1 
ATOM   1328 O O   . GLY A 1 204 ? -3.774  30.328 -3.414  1.00 34.50 ? 203 GLY A O   1 
ATOM   1329 N N   . THR A 1 205 ? -4.031  32.528 -3.335  1.00 34.05 ? 204 THR A N   1 
ATOM   1330 C CA  . THR A 1 205 ? -3.996  32.731 -4.771  1.00 34.25 ? 204 THR A CA  1 
ATOM   1331 C C   . THR A 1 205 ? -2.572  32.895 -5.259  1.00 33.38 ? 204 THR A C   1 
ATOM   1332 O O   . THR A 1 205 ? -1.864  33.791 -4.838  1.00 31.35 ? 204 THR A O   1 
ATOM   1333 C CB  . THR A 1 205 ? -4.843  33.956 -5.169  1.00 33.40 ? 204 THR A CB  1 
ATOM   1334 O OG1 . THR A 1 205 ? -6.179  33.775 -4.654  1.00 33.01 ? 204 THR A OG1 1 
ATOM   1335 C CG2 . THR A 1 205 ? -4.865  34.138 -6.700  1.00 28.62 ? 204 THR A CG2 1 
ATOM   1336 N N   . ARG A 1 206 ? -2.174  32.049 -6.206  1.00 32.45 ? 205 ARG A N   1 
ATOM   1337 C CA  . ARG A 1 206 ? -0.763  31.988 -6.621  1.00 34.50 ? 205 ARG A CA  1 
ATOM   1338 C C   . ARG A 1 206 ? -0.194  33.279 -7.232  1.00 32.76 ? 205 ARG A C   1 
ATOM   1339 O O   . ARG A 1 206 ? 0.967   33.660 -6.958  1.00 35.20 ? 205 ARG A O   1 
ATOM   1340 C CB  . ARG A 1 206 ? -0.554  30.833 -7.599  1.00 33.42 ? 205 ARG A CB  1 
ATOM   1341 C CG  . ARG A 1 206 ? 0.862   30.418 -7.699  1.00 36.20 ? 205 ARG A CG  1 
ATOM   1342 C CD  . ARG A 1 206 ? 0.965   29.200 -8.535  1.00 33.25 ? 205 ARG A CD  1 
ATOM   1343 N NE  . ARG A 1 206 ? 2.344   28.909 -8.852  1.00 36.17 ? 205 ARG A NE  1 
ATOM   1344 C CZ  . ARG A 1 206 ? 3.188   28.237 -8.067  1.00 39.50 ? 205 ARG A CZ  1 
ATOM   1345 N NH1 . ARG A 1 206 ? 2.810   27.767 -6.894  1.00 37.83 ? 205 ARG A NH1 1 
ATOM   1346 N NH2 . ARG A 1 206 ? 4.422   28.004 -8.488  1.00 39.38 ? 205 ARG A NH2 1 
ATOM   1347 N N   . VAL A 1 207 ? -1.006  33.940 -8.049  1.00 29.44 ? 206 VAL A N   1 
ATOM   1348 C CA  . VAL A 1 207 ? -0.629  35.229 -8.662  1.00 31.55 ? 206 VAL A CA  1 
ATOM   1349 C C   . VAL A 1 207 ? -0.443  36.378 -7.703  1.00 32.26 ? 206 VAL A C   1 
ATOM   1350 O O   . VAL A 1 207 ? 0.174   37.384 -8.082  1.00 35.67 ? 206 VAL A O   1 
ATOM   1351 C CB  . VAL A 1 207 ? -1.522  35.624 -9.898  1.00 31.64 ? 206 VAL A CB  1 
ATOM   1352 C CG1 . VAL A 1 207 ? -1.291  34.624 -11.039 1.00 24.92 ? 206 VAL A CG1 1 
ATOM   1353 C CG2 . VAL A 1 207 ? -3.001  35.777 -9.526  1.00 29.38 ? 206 VAL A CG2 1 
ATOM   1354 N N   . TYR A 1 208 ? -0.932  36.246 -6.460  1.00 35.00 ? 207 TYR A N   1 
ATOM   1355 C CA  . TYR A 1 208 ? -0.654  37.233 -5.410  1.00 26.46 ? 207 TYR A CA  1 
ATOM   1356 C C   . TYR A 1 208 ? 0.406   36.765 -4.436  1.00 28.00 ? 207 TYR A C   1 
ATOM   1357 O O   . TYR A 1 208 ? 0.672   37.462 -3.463  1.00 26.62 ? 207 TYR A O   1 
ATOM   1358 C CB  . TYR A 1 208 ? -1.920  37.588 -4.609  1.00 32.35 ? 207 TYR A CB  1 
ATOM   1359 C CG  . TYR A 1 208 ? -2.924  38.464 -5.323  1.00 31.19 ? 207 TYR A CG  1 
ATOM   1360 C CD1 . TYR A 1 208 ? -3.082  39.786 -4.948  1.00 32.50 ? 207 TYR A CD1 1 
ATOM   1361 C CD2 . TYR A 1 208 ? -3.732  37.962 -6.363  1.00 31.07 ? 207 TYR A CD2 1 
ATOM   1362 C CE1 . TYR A 1 208 ? -4.010  40.614 -5.585  1.00 33.15 ? 207 TYR A CE1 1 
ATOM   1363 C CE2 . TYR A 1 208 ? -4.660  38.784 -7.006  1.00 36.50 ? 207 TYR A CE2 1 
ATOM   1364 C CZ  . TYR A 1 208 ? -4.803  40.107 -6.587  1.00 36.98 ? 207 TYR A CZ  1 
ATOM   1365 O OH  . TYR A 1 208 ? -5.702  40.974 -7.163  1.00 36.64 ? 207 TYR A OH  1 
ATOM   1366 N N   . SER A 1 209 ? 0.998   35.588 -4.683  1.00 32.29 ? 208 SER A N   1 
ATOM   1367 C CA  . SER A 1 209 ? 1.944   34.941 -3.748  1.00 31.64 ? 208 SER A CA  1 
ATOM   1368 C C   . SER A 1 209 ? 3.383   35.404 -4.074  1.00 34.52 ? 208 SER A C   1 
ATOM   1369 O O   . SER A 1 209 ? 3.666   35.753 -5.213  1.00 32.99 ? 208 SER A O   1 
ATOM   1370 C CB  . SER A 1 209 ? 1.802   33.395 -3.742  1.00 33.10 ? 208 SER A CB  1 
ATOM   1371 O OG  . SER A 1 209 ? 2.419   32.743 -4.857  1.00 31.11 ? 208 SER A OG  1 
ATOM   1372 N N   . PRO A 1 210 ? 4.272   35.446 -3.063  1.00 34.91 ? 209 PRO A N   1 
ATOM   1373 C CA  . PRO A 1 210 ? 5.564   36.057 -3.289  1.00 37.82 ? 209 PRO A CA  1 
ATOM   1374 C C   . PRO A 1 210 ? 6.586   35.090 -3.894  1.00 32.91 ? 209 PRO A C   1 
ATOM   1375 O O   . PRO A 1 210 ? 6.367   33.890 -3.878  1.00 33.29 ? 209 PRO A O   1 
ATOM   1376 C CB  . PRO A 1 210 ? 5.964   36.503 -1.891  1.00 36.83 ? 209 PRO A CB  1 
ATOM   1377 C CG  . PRO A 1 210 ? 5.324   35.523 -0.989  1.00 35.69 ? 209 PRO A CG  1 
ATOM   1378 C CD  . PRO A 1 210 ? 4.147   34.951 -1.681  1.00 35.92 ? 209 PRO A CD  1 
ATOM   1379 N N   . PRO A 1 211 ? 7.704   35.618 -4.419  1.00 33.95 ? 210 PRO A N   1 
ATOM   1380 C CA  . PRO A 1 211 ? 8.660   34.795 -5.128  1.00 34.97 ? 210 PRO A CA  1 
ATOM   1381 C C   . PRO A 1 211 ? 9.336   33.738 -4.268  1.00 34.03 ? 210 PRO A C   1 
ATOM   1382 O O   . PRO A 1 211 ? 9.663   32.677 -4.786  1.00 31.10 ? 210 PRO A O   1 
ATOM   1383 C CB  . PRO A 1 211 ? 9.672   35.821 -5.674  1.00 34.72 ? 210 PRO A CB  1 
ATOM   1384 C CG  . PRO A 1 211 ? 9.468   37.001 -4.903  1.00 37.09 ? 210 PRO A CG  1 
ATOM   1385 C CD  . PRO A 1 211 ? 8.065   37.039 -4.513  1.00 35.40 ? 210 PRO A CD  1 
ATOM   1386 N N   . GLU A 1 212 ? 9.522   34.021 -2.974  1.00 34.57 ? 211 GLU A N   1 
ATOM   1387 C CA  . GLU A 1 212 ? 10.087  33.043 -2.041  1.00 35.16 ? 211 GLU A CA  1 
ATOM   1388 C C   . GLU A 1 212 ? 9.153   31.827 -1.901  1.00 31.34 ? 211 GLU A C   1 
ATOM   1389 O O   . GLU A 1 212 ? 9.612   30.715 -1.695  1.00 29.86 ? 211 GLU A O   1 
ATOM   1390 C CB  . GLU A 1 212 ? 10.451  33.682 -0.665  1.00 29.67 ? 211 GLU A CB  1 
ATOM   1391 C CG  . GLU A 1 212 ? 9.270   34.274 0.148   1.00 37.59 ? 211 GLU A CG  1 
ATOM   1392 C CD  . GLU A 1 212 ? 8.967   35.726 -0.199  1.00 35.52 ? 211 GLU A CD  1 
ATOM   1393 O OE1 . GLU A 1 212 ? 9.358   36.163 -1.301  1.00 31.61 ? 211 GLU A OE1 1 
ATOM   1394 O OE2 . GLU A 1 212 ? 8.338   36.426 0.626   1.00 35.73 ? 211 GLU A OE2 1 
ATOM   1395 N N   . TRP A 1 213 ? 7.848   32.023 -2.062  1.00 32.20 ? 212 TRP A N   1 
ATOM   1396 C CA  . TRP A 1 213 ? 6.929   30.883 -2.069  1.00 29.86 ? 212 TRP A CA  1 
ATOM   1397 C C   . TRP A 1 213 ? 7.114   30.077 -3.374  1.00 32.37 ? 212 TRP A C   1 
ATOM   1398 O O   . TRP A 1 213 ? 7.420   28.884 -3.344  1.00 37.27 ? 212 TRP A O   1 
ATOM   1399 C CB  . TRP A 1 213 ? 5.445   31.322 -1.847  1.00 31.94 ? 212 TRP A CB  1 
ATOM   1400 C CG  . TRP A 1 213 ? 4.481   30.219 -2.205  1.00 32.48 ? 212 TRP A CG  1 
ATOM   1401 C CD1 . TRP A 1 213 ? 3.731   30.130 -3.341  1.00 36.78 ? 212 TRP A CD1 1 
ATOM   1402 C CD2 . TRP A 1 213 ? 4.290   28.971 -1.503  1.00 36.65 ? 212 TRP A CD2 1 
ATOM   1403 N NE1 . TRP A 1 213 ? 3.029   28.945 -3.362  1.00 28.48 ? 212 TRP A NE1 1 
ATOM   1404 C CE2 . TRP A 1 213 ? 3.362   28.212 -2.248  1.00 30.92 ? 212 TRP A CE2 1 
ATOM   1405 C CE3 . TRP A 1 213 ? 4.768   28.453 -0.292  1.00 31.28 ? 212 TRP A CE3 1 
ATOM   1406 C CZ2 . TRP A 1 213 ? 2.914   26.966 -1.825  1.00 33.84 ? 212 TRP A CZ2 1 
ATOM   1407 C CZ3 . TRP A 1 213 ? 4.323   27.212 0.121   1.00 35.01 ? 212 TRP A CZ3 1 
ATOM   1408 C CH2 . TRP A 1 213 ? 3.405   26.485 -0.636  1.00 30.49 ? 212 TRP A CH2 1 
ATOM   1409 N N   . ILE A 1 214 ? 6.963   30.746 -4.510  1.00 35.13 ? 213 ILE A N   1 
ATOM   1410 C CA  . ILE A 1 214 ? 7.158   30.153 -5.847  1.00 34.67 ? 213 ILE A CA  1 
ATOM   1411 C C   . ILE A 1 214 ? 8.483   29.369 -5.897  1.00 36.11 ? 213 ILE A C   1 
ATOM   1412 O O   . ILE A 1 214 ? 8.492   28.185 -6.248  1.00 35.95 ? 213 ILE A O   1 
ATOM   1413 C CB  . ILE A 1 214 ? 7.180   31.247 -6.976  1.00 34.61 ? 213 ILE A CB  1 
ATOM   1414 C CG1 . ILE A 1 214 ? 5.919   32.137 -6.970  1.00 36.40 ? 213 ILE A CG1 1 
ATOM   1415 C CG2 . ILE A 1 214 ? 7.436   30.631 -8.361  1.00 36.01 ? 213 ILE A CG2 1 
ATOM   1416 C CD1 . ILE A 1 214 ? 4.586   31.448 -7.199  1.00 34.46 ? 213 ILE A CD1 1 
ATOM   1417 N N   . ARG A 1 215 ? 9.590   30.015 -5.523  1.00 35.98 ? 214 ARG A N   1 
ATOM   1418 C CA  . ARG A 1 215 ? 10.929  29.381 -5.557  1.00 33.09 ? 214 ARG A CA  1 
ATOM   1419 C C   . ARG A 1 215 ? 11.191  28.341 -4.473  1.00 31.69 ? 214 ARG A C   1 
ATOM   1420 O O   . ARG A 1 215 ? 11.789  27.337 -4.740  1.00 33.72 ? 214 ARG A O   1 
ATOM   1421 C CB  . ARG A 1 215 ? 12.037  30.413 -5.390  1.00 38.44 ? 214 ARG A CB  1 
ATOM   1422 C CG  . ARG A 1 215 ? 12.415  31.262 -6.567  1.00 44.94 ? 214 ARG A CG  1 
ATOM   1423 C CD  . ARG A 1 215 ? 13.764  31.889 -6.245  1.00 51.96 ? 214 ARG A CD  1 
ATOM   1424 N NE  . ARG A 1 215 ? 14.233  32.818 -7.261  1.00 60.73 ? 214 ARG A NE  1 
ATOM   1425 C CZ  . ARG A 1 215 ? 14.774  32.469 -8.424  1.00 71.52 ? 214 ARG A CZ  1 
ATOM   1426 N NH1 . ARG A 1 215 ? 14.916  31.186 -8.760  1.00 72.65 ? 214 ARG A NH1 1 
ATOM   1427 N NH2 . ARG A 1 215 ? 15.166  33.417 -9.271  1.00 76.43 ? 214 ARG A NH2 1 
ATOM   1428 N N   . TYR A 1 216 ? 10.809  28.605 -3.232  1.00 34.79 ? 215 TYR A N   1 
ATOM   1429 C CA  . TYR A 1 216 ? 11.258  27.762 -2.113  1.00 33.87 ? 215 TYR A CA  1 
ATOM   1430 C C   . TYR A 1 216 ? 10.164  27.108 -1.272  1.00 33.95 ? 215 TYR A C   1 
ATOM   1431 O O   . TYR A 1 216 ? 10.479  26.364 -0.343  1.00 35.82 ? 215 TYR A O   1 
ATOM   1432 C CB  . TYR A 1 216 ? 12.155  28.581 -1.171  1.00 35.32 ? 215 TYR A CB  1 
ATOM   1433 C CG  . TYR A 1 216 ? 13.295  29.274 -1.877  1.00 36.56 ? 215 TYR A CG  1 
ATOM   1434 C CD1 . TYR A 1 216 ? 14.278  28.542 -2.555  1.00 38.01 ? 215 TYR A CD1 1 
ATOM   1435 C CD2 . TYR A 1 216 ? 13.406  30.641 -1.855  1.00 32.03 ? 215 TYR A CD2 1 
ATOM   1436 C CE1 . TYR A 1 216 ? 15.319  29.177 -3.199  1.00 42.44 ? 215 TYR A CE1 1 
ATOM   1437 C CE2 . TYR A 1 216 ? 14.455  31.287 -2.513  1.00 37.40 ? 215 TYR A CE2 1 
ATOM   1438 C CZ  . TYR A 1 216 ? 15.398  30.559 -3.167  1.00 38.32 ? 215 TYR A CZ  1 
ATOM   1439 O OH  . TYR A 1 216 ? 16.428  31.226 -3.783  1.00 52.57 ? 215 TYR A OH  1 
ATOM   1440 N N   . HIS A 1 217 ? 8.902   27.397 -1.565  1.00 35.43 ? 216 HIS A N   1 
ATOM   1441 C CA  . HIS A 1 217 ? 7.792   26.976 -0.718  1.00 37.31 ? 216 HIS A CA  1 
ATOM   1442 C C   . HIS A 1 217 ? 7.957   27.349 0.761   1.00 36.29 ? 216 HIS A C   1 
ATOM   1443 O O   . HIS A 1 217 ? 7.636   26.575 1.663   1.00 36.77 ? 216 HIS A O   1 
ATOM   1444 C CB  . HIS A 1 217 ? 7.518   25.476 -0.927  1.00 41.05 ? 216 HIS A CB  1 
ATOM   1445 C CG  . HIS A 1 217 ? 6.693   25.206 -2.155  1.00 54.41 ? 216 HIS A CG  1 
ATOM   1446 N ND1 . HIS A 1 217 ? 6.148   23.972 -2.438  1.00 45.82 ? 216 HIS A ND1 1 
ATOM   1447 C CD2 . HIS A 1 217 ? 6.294   26.035 -3.158  1.00 59.26 ? 216 HIS A CD2 1 
ATOM   1448 C CE1 . HIS A 1 217 ? 5.477   24.046 -3.578  1.00 63.82 ? 216 HIS A CE1 1 
ATOM   1449 N NE2 . HIS A 1 217 ? 5.544   25.289 -4.033  1.00 50.70 ? 216 HIS A NE2 1 
ATOM   1450 N N   . ARG A 1 218 ? 8.456   28.563 0.977   1.00 37.72 ? 217 ARG A N   1 
ATOM   1451 C CA  . ARG A 1 218 ? 8.654   29.135 2.299   1.00 36.34 ? 217 ARG A CA  1 
ATOM   1452 C C   . ARG A 1 218 ? 8.401   30.645 2.220   1.00 38.39 ? 217 ARG A C   1 
ATOM   1453 O O   . ARG A 1 218 ? 8.824   31.291 1.267   1.00 39.34 ? 217 ARG A O   1 
ATOM   1454 C CB  . ARG A 1 218 ? 10.094  28.952 2.757   1.00 31.72 ? 217 ARG A CB  1 
ATOM   1455 C CG  . ARG A 1 218 ? 10.525  27.548 3.030   1.00 36.62 ? 217 ARG A CG  1 
ATOM   1456 C CD  . ARG A 1 218 ? 12.049  27.458 3.007   1.00 44.14 ? 217 ARG A CD  1 
ATOM   1457 N NE  . ARG A 1 218 ? 12.644  28.259 4.085   1.00 51.63 ? 217 ARG A NE  1 
ATOM   1458 C CZ  . ARG A 1 218 ? 12.749  27.865 5.355   1.00 50.71 ? 217 ARG A CZ  1 
ATOM   1459 N NH1 . ARG A 1 218 ? 12.301  26.666 5.735   1.00 44.81 ? 217 ARG A NH1 1 
ATOM   1460 N NH2 . ARG A 1 218 ? 13.303  28.675 6.250   1.00 53.67 ? 217 ARG A NH2 1 
ATOM   1461 N N   . TYR A 1 219 ? 7.733   31.183 3.238   1.00 36.97 ? 218 TYR A N   1 
ATOM   1462 C CA  . TYR A 1 219 ? 7.541   32.625 3.403   1.00 36.26 ? 218 TYR A CA  1 
ATOM   1463 C C   . TYR A 1 219 ? 7.320   32.973 4.881   1.00 34.24 ? 218 TYR A C   1 
ATOM   1464 O O   . TYR A 1 219 ? 6.972   32.135 5.704   1.00 30.06 ? 218 TYR A O   1 
ATOM   1465 C CB  . TYR A 1 219 ? 6.339   33.133 2.564   1.00 34.01 ? 218 TYR A CB  1 
ATOM   1466 C CG  . TYR A 1 219 ? 5.046   32.419 2.907   1.00 33.32 ? 218 TYR A CG  1 
ATOM   1467 C CD1 . TYR A 1 219 ? 4.084   33.020 3.701   1.00 31.63 ? 218 TYR A CD1 1 
ATOM   1468 C CD2 . TYR A 1 219 ? 4.783   31.135 2.409   1.00 30.25 ? 218 TYR A CD2 1 
ATOM   1469 C CE1 . TYR A 1 219 ? 2.917   32.363 4.030   1.00 33.75 ? 218 TYR A CE1 1 
ATOM   1470 C CE2 . TYR A 1 219 ? 3.611   30.479 2.714   1.00 35.91 ? 218 TYR A CE2 1 
ATOM   1471 C CZ  . TYR A 1 219 ? 2.685   31.093 3.537   1.00 32.83 ? 218 TYR A CZ  1 
ATOM   1472 O OH  . TYR A 1 219 ? 1.538   30.437 3.869   1.00 35.26 ? 218 TYR A OH  1 
ATOM   1473 N N   . HIS A 1 220 ? 7.506   34.252 5.189   1.00 37.21 ? 219 HIS A N   1 
ATOM   1474 C CA  . HIS A 1 220 ? 7.159   34.784 6.489   1.00 33.28 ? 219 HIS A CA  1 
ATOM   1475 C C   . HIS A 1 220 ? 5.901   35.588 6.308   1.00 31.64 ? 219 HIS A C   1 
ATOM   1476 O O   . HIS A 1 220 ? 5.649   36.084 5.242   1.00 26.07 ? 219 HIS A O   1 
ATOM   1477 C CB  . HIS A 1 220 ? 8.304   35.600 7.074   1.00 32.77 ? 219 HIS A CB  1 
ATOM   1478 C CG  . HIS A 1 220 ? 9.378   34.751 7.652   1.00 27.22 ? 219 HIS A CG  1 
ATOM   1479 N ND1 . HIS A 1 220 ? 10.335  34.134 6.876   1.00 30.91 ? 219 HIS A ND1 1 
ATOM   1480 C CD2 . HIS A 1 220 ? 9.604   34.348 8.921   1.00 32.63 ? 219 HIS A CD2 1 
ATOM   1481 C CE1 . HIS A 1 220 ? 11.125  33.421 7.648   1.00 29.37 ? 219 HIS A CE1 1 
ATOM   1482 N NE2 . HIS A 1 220 ? 10.708  33.539 8.896   1.00 30.45 ? 219 HIS A NE2 1 
ATOM   1483 N N   . GLY A 1 221 ? 5.089   35.680 7.351   1.00 31.80 ? 220 GLY A N   1 
ATOM   1484 C CA  . GLY A 1 221 ? 3.721   36.174 7.171   1.00 31.06 ? 220 GLY A CA  1 
ATOM   1485 C C   . GLY A 1 221 ? 3.562   37.595 6.662   1.00 30.32 ? 220 GLY A C   1 
ATOM   1486 O O   . GLY A 1 221 ? 2.878   37.826 5.679   1.00 30.50 ? 220 GLY A O   1 
ATOM   1487 N N   . ARG A 1 222 ? 4.160   38.530 7.396   1.00 32.55 ? 221 ARG A N   1 
ATOM   1488 C CA  . ARG A 1 222 ? 4.028   39.944 7.161   1.00 31.35 ? 221 ARG A CA  1 
ATOM   1489 C C   . ARG A 1 222 ? 4.654   40.342 5.854   1.00 32.95 ? 221 ARG A C   1 
ATOM   1490 O O   . ARG A 1 222 ? 4.051   41.096 5.107   1.00 35.35 ? 221 ARG A O   1 
ATOM   1491 C CB  . ARG A 1 222 ? 4.632   40.740 8.314   1.00 32.95 ? 221 ARG A CB  1 
ATOM   1492 C CG  . ARG A 1 222 ? 3.882   40.634 9.647   1.00 42.96 ? 221 ARG A CG  1 
ATOM   1493 C CD  . ARG A 1 222 ? 4.747   41.158 10.806  1.00 56.19 ? 221 ARG A CD  1 
ATOM   1494 N NE  . ARG A 1 222 ? 4.207   40.894 12.157  1.00 57.72 ? 221 ARG A NE  1 
ATOM   1495 C CZ  . ARG A 1 222 ? 3.171   41.540 12.701  1.00 54.32 ? 221 ARG A CZ  1 
ATOM   1496 N NH1 . ARG A 1 222 ? 2.513   42.460 12.020  1.00 56.59 ? 221 ARG A NH1 1 
ATOM   1497 N NH2 . ARG A 1 222 ? 2.768   41.252 13.925  1.00 58.85 ? 221 ARG A NH2 1 
ATOM   1498 N N   . SER A 1 223 ? 5.853   39.830 5.571   1.00 32.04 ? 222 SER A N   1 
ATOM   1499 C CA  . SER A 1 223 ? 6.531   40.150 4.325   1.00 32.25 ? 222 SER A CA  1 
ATOM   1500 C C   . SER A 1 223 ? 5.755   39.625 3.081   1.00 31.85 ? 222 SER A C   1 
ATOM   1501 O O   . SER A 1 223 ? 5.690   40.303 2.052   1.00 32.89 ? 222 SER A O   1 
ATOM   1502 C CB  . SER A 1 223 ? 7.988   39.673 4.374   1.00 32.50 ? 222 SER A CB  1 
ATOM   1503 O OG  . SER A 1 223 ? 8.087   38.257 4.498   1.00 35.40 ? 222 SER A OG  1 
ATOM   1504 N N   . ALA A 1 224 ? 5.174   38.432 3.192   1.00 29.82 ? 223 ALA A N   1 
ATOM   1505 C CA  . ALA A 1 224 ? 4.328   37.862 2.141   1.00 33.92 ? 223 ALA A CA  1 
ATOM   1506 C C   . ALA A 1 224 ? 3.045   38.677 1.952   1.00 31.06 ? 223 ALA A C   1 
ATOM   1507 O O   . ALA A 1 224 ? 2.600   38.880 0.811   1.00 32.70 ? 223 ALA A O   1 
ATOM   1508 C CB  . ALA A 1 224 ? 3.999   36.381 2.455   1.00 29.01 ? 223 ALA A CB  1 
ATOM   1509 N N   . ALA A 1 225 ? 2.472   39.162 3.068   1.00 31.08 ? 224 ALA A N   1 
ATOM   1510 C CA  . ALA A 1 225 ? 1.290   40.048 3.017   1.00 33.47 ? 224 ALA A CA  1 
ATOM   1511 C C   . ALA A 1 225 ? 1.581   41.357 2.285   1.00 31.54 ? 224 ALA A C   1 
ATOM   1512 O O   . ALA A 1 225 ? 0.775   41.812 1.469   1.00 32.34 ? 224 ALA A O   1 
ATOM   1513 C CB  . ALA A 1 225 ? 0.719   40.289 4.395   1.00 30.86 ? 224 ALA A CB  1 
ATOM   1514 N N   . VAL A 1 226 ? 2.765   41.925 2.515   1.00 34.41 ? 225 VAL A N   1 
ATOM   1515 C CA  . VAL A 1 226 ? 3.182   43.172 1.843   1.00 36.54 ? 225 VAL A CA  1 
ATOM   1516 C C   . VAL A 1 226 ? 3.349   42.996 0.322   1.00 32.26 ? 225 VAL A C   1 
ATOM   1517 O O   . VAL A 1 226 ? 2.933   43.865 -0.470  1.00 30.40 ? 225 VAL A O   1 
ATOM   1518 C CB  . VAL A 1 226 ? 4.442   43.796 2.560   1.00 35.94 ? 225 VAL A CB  1 
ATOM   1519 C CG1 . VAL A 1 226 ? 5.136   44.870 1.701   1.00 28.94 ? 225 VAL A CG1 1 
ATOM   1520 C CG2 . VAL A 1 226 ? 4.006   44.308 3.981   1.00 30.95 ? 225 VAL A CG2 1 
ATOM   1521 N N   . TRP A 1 227 ? 3.909   41.862 -0.087  1.00 35.08 ? 226 TRP A N   1 
ATOM   1522 C CA  . TRP A 1 227 ? 3.961   41.496 -1.500  1.00 30.38 ? 226 TRP A CA  1 
ATOM   1523 C C   . TRP A 1 227 ? 2.569   41.438 -2.139  1.00 33.96 ? 226 TRP A C   1 
ATOM   1524 O O   . TRP A 1 227 ? 2.367   42.013 -3.215  1.00 38.95 ? 226 TRP A O   1 
ATOM   1525 C CB  . TRP A 1 227 ? 4.758   40.186 -1.711  1.00 31.37 ? 226 TRP A CB  1 
ATOM   1526 C CG  . TRP A 1 227 ? 4.738   39.748 -3.118  1.00 26.90 ? 226 TRP A CG  1 
ATOM   1527 C CD1 . TRP A 1 227 ? 3.679   39.174 -3.759  1.00 25.75 ? 226 TRP A CD1 1 
ATOM   1528 C CD2 . TRP A 1 227 ? 5.763   39.927 -4.117  1.00 29.93 ? 226 TRP A CD2 1 
ATOM   1529 N NE1 . TRP A 1 227 ? 3.982   38.950 -5.059  1.00 26.41 ? 226 TRP A NE1 1 
ATOM   1530 C CE2 . TRP A 1 227 ? 5.250   39.411 -5.322  1.00 34.10 ? 226 TRP A CE2 1 
ATOM   1531 C CE3 . TRP A 1 227 ? 7.060   40.465 -4.109  1.00 28.48 ? 226 TRP A CE3 1 
ATOM   1532 C CZ2 . TRP A 1 227 ? 5.992   39.406 -6.519  1.00 32.20 ? 226 TRP A CZ2 1 
ATOM   1533 C CZ3 . TRP A 1 227 ? 7.799   40.471 -5.305  1.00 30.25 ? 226 TRP A CZ3 1 
ATOM   1534 C CH2 . TRP A 1 227 ? 7.263   39.933 -6.488  1.00 33.15 ? 226 TRP A CH2 1 
ATOM   1535 N N   . SER A 1 228 ? 1.606   40.758 -1.492  1.00 33.92 ? 227 SER A N   1 
ATOM   1536 C CA  . SER A 1 228 ? 0.240   40.662 -2.030  1.00 30.67 ? 227 SER A CA  1 
ATOM   1537 C C   . SER A 1 228 ? -0.404  42.054 -2.116  1.00 35.17 ? 227 SER A C   1 
ATOM   1538 O O   . SER A 1 228 ? -1.165  42.328 -3.033  1.00 33.44 ? 227 SER A O   1 
ATOM   1539 C CB  . SER A 1 228 ? -0.641  39.680 -1.233  1.00 34.45 ? 227 SER A CB  1 
ATOM   1540 O OG  . SER A 1 228 ? -1.012  40.181 0.062   1.00 30.76 ? 227 SER A OG  1 
ATOM   1541 N N   . LEU A 1 229 ? -0.054  42.920 -1.167  1.00 33.84 ? 228 LEU A N   1 
ATOM   1542 C CA  . LEU A 1 229 ? -0.509  44.303 -1.127  1.00 30.69 ? 228 LEU A CA  1 
ATOM   1543 C C   . LEU A 1 229 ? 0.030   45.150 -2.295  1.00 30.69 ? 228 LEU A C   1 
ATOM   1544 O O   . LEU A 1 229 ? -0.715  45.906 -2.846  1.00 31.69 ? 228 LEU A O   1 
ATOM   1545 C CB  . LEU A 1 229 ? -0.231  44.950 0.241   1.00 32.38 ? 228 LEU A CB  1 
ATOM   1546 C CG  . LEU A 1 229 ? -1.143  44.512 1.407   1.00 34.41 ? 228 LEU A CG  1 
ATOM   1547 C CD1 . LEU A 1 229 ? -0.541  44.958 2.763   1.00 36.08 ? 228 LEU A CD1 1 
ATOM   1548 C CD2 . LEU A 1 229 ? -2.589  44.965 1.258   1.00 31.19 ? 228 LEU A CD2 1 
ATOM   1549 N N   . GLY A 1 230 ? 1.290   44.954 -2.696  1.00 35.18 ? 229 GLY A N   1 
ATOM   1550 C CA  . GLY A 1 230 ? 1.851   45.556 -3.898  1.00 35.13 ? 229 GLY A CA  1 
ATOM   1551 C C   . GLY A 1 230 ? 1.179   45.121 -5.212  1.00 31.94 ? 229 GLY A C   1 
ATOM   1552 O O   . GLY A 1 230 ? 0.994   45.941 -6.120  1.00 30.75 ? 229 GLY A O   1 
ATOM   1553 N N   . ILE A 1 231 ? 0.835   43.835 -5.292  1.00 28.77 ? 230 ILE A N   1 
ATOM   1554 C CA  . ILE A 1 231 ? 0.087   43.259 -6.395  1.00 33.73 ? 230 ILE A CA  1 
ATOM   1555 C C   . ILE A 1 231 ? -1.291  43.921 -6.462  1.00 34.36 ? 230 ILE A C   1 
ATOM   1556 O O   . ILE A 1 231 ? -1.742  44.321 -7.535  1.00 34.33 ? 230 ILE A O   1 
ATOM   1557 C CB  . ILE A 1 231 ? -0.074  41.670 -6.319  1.00 33.04 ? 230 ILE A CB  1 
ATOM   1558 C CG1 . ILE A 1 231 ? 1.285   40.950 -6.266  1.00 31.89 ? 230 ILE A CG1 1 
ATOM   1559 C CG2 . ILE A 1 231 ? -0.889  41.150 -7.545  1.00 27.94 ? 230 ILE A CG2 1 
ATOM   1560 C CD1 . ILE A 1 231 ? 2.101   41.059 -7.563  1.00 28.00 ? 230 ILE A CD1 1 
ATOM   1561 N N   . LEU A 1 232 ? -1.923  44.071 -5.303  1.00 32.86 ? 231 LEU A N   1 
ATOM   1562 C CA  . LEU A 1 232 ? -3.223  44.756 -5.200  1.00 33.13 ? 231 LEU A CA  1 
ATOM   1563 C C   . LEU A 1 232 ? -3.192  46.221 -5.606  1.00 34.40 ? 231 LEU A C   1 
ATOM   1564 O O   . LEU A 1 232 ? -4.104  46.725 -6.260  1.00 28.81 ? 231 LEU A O   1 
ATOM   1565 C CB  . LEU A 1 232 ? -3.749  44.671 -3.756  1.00 36.47 ? 231 LEU A CB  1 
ATOM   1566 C CG  . LEU A 1 232 ? -5.133  45.273 -3.531  1.00 34.36 ? 231 LEU A CG  1 
ATOM   1567 C CD1 . LEU A 1 232 ? -6.216  44.453 -4.286  1.00 31.37 ? 231 LEU A CD1 1 
ATOM   1568 C CD2 . LEU A 1 232 ? -5.403  45.376 -2.035  1.00 28.98 ? 231 LEU A CD2 1 
ATOM   1569 N N   . LEU A 1 233 ? -2.166  46.930 -5.167  1.00 33.72 ? 232 LEU A N   1 
ATOM   1570 C CA  . LEU A 1 233 ? -2.076  48.337 -5.490  1.00 30.60 ? 232 LEU A CA  1 
ATOM   1571 C C   . LEU A 1 233 ? -1.856  48.515 -7.022  1.00 25.39 ? 232 LEU A C   1 
ATOM   1572 O O   . LEU A 1 233 ? -2.461  49.387 -7.646  1.00 30.84 ? 232 LEU A O   1 
ATOM   1573 C CB  . LEU A 1 233 ? -0.969  48.993 -4.642  1.00 29.78 ? 232 LEU A CB  1 
ATOM   1574 C CG  . LEU A 1 233 ? -0.679  50.469 -4.918  1.00 31.07 ? 232 LEU A CG  1 
ATOM   1575 C CD1 . LEU A 1 233 ? -2.028  51.296 -4.934  1.00 32.30 ? 232 LEU A CD1 1 
ATOM   1576 C CD2 . LEU A 1 233 ? 0.333   50.975 -3.906  1.00 27.87 ? 232 LEU A CD2 1 
ATOM   1577 N N   . TYR A 1 234 ? -1.013  47.683 -7.606  1.00 30.81 ? 233 TYR A N   1 
ATOM   1578 C CA  . TYR A 1 234 ? -0.818  47.653 -9.065  1.00 28.04 ? 233 TYR A CA  1 
ATOM   1579 C C   . TYR A 1 234 ? -2.123  47.388 -9.762  1.00 27.65 ? 233 TYR A C   1 
ATOM   1580 O O   . TYR A 1 234 ? -2.468  48.066 -10.697 1.00 30.49 ? 233 TYR A O   1 
ATOM   1581 C CB  . TYR A 1 234 ? 0.189   46.568 -9.454  1.00 29.46 ? 233 TYR A CB  1 
ATOM   1582 C CG  . TYR A 1 234 ? 0.586   46.618 -10.912 1.00 33.29 ? 233 TYR A CG  1 
ATOM   1583 C CD1 . TYR A 1 234 ? 1.767   47.235 -11.312 1.00 32.77 ? 233 TYR A CD1 1 
ATOM   1584 C CD2 . TYR A 1 234 ? -0.243  46.069 -11.899 1.00 26.99 ? 233 TYR A CD2 1 
ATOM   1585 C CE1 . TYR A 1 234 ? 2.128   47.279 -12.671 1.00 30.62 ? 233 TYR A CE1 1 
ATOM   1586 C CE2 . TYR A 1 234 ? 0.084   46.143 -13.235 1.00 29.08 ? 233 TYR A CE2 1 
ATOM   1587 C CZ  . TYR A 1 234 ? 1.271   46.751 -13.618 1.00 32.50 ? 233 TYR A CZ  1 
ATOM   1588 O OH  . TYR A 1 234 ? 1.585   46.831 -14.956 1.00 30.67 ? 233 TYR A OH  1 
ATOM   1589 N N   . ASP A 1 235 ? -2.818  46.338 -9.335  1.00 32.34 ? 234 ASP A N   1 
ATOM   1590 C CA  . ASP A 1 235 ? -4.119  45.990 -9.848  1.00 30.22 ? 234 ASP A CA  1 
ATOM   1591 C C   . ASP A 1 235 ? -5.061  47.214 -9.883  1.00 31.34 ? 234 ASP A C   1 
ATOM   1592 O O   . ASP A 1 235 ? -5.660  47.538 -10.900 1.00 26.86 ? 234 ASP A O   1 
ATOM   1593 C CB  . ASP A 1 235 ? -4.648  44.851 -8.971  1.00 31.20 ? 234 ASP A CB  1 
ATOM   1594 C CG  . ASP A 1 235 ? -6.004  44.366 -9.375  1.00 31.14 ? 234 ASP A CG  1 
ATOM   1595 O OD1 . ASP A 1 235 ? -6.257  44.165 -10.587 1.00 31.08 ? 234 ASP A OD1 1 
ATOM   1596 O OD2 . ASP A 1 235 ? -6.829  44.221 -8.463  1.00 34.81 ? 234 ASP A OD2 1 
ATOM   1597 N N   . MET A 1 236 ? -5.125  47.932 -8.772  1.00 29.64 ? 235 MET A N   1 
ATOM   1598 C CA  . MET A 1 236 ? -5.958  49.123 -8.653  1.00 31.13 ? 235 MET A CA  1 
ATOM   1599 C C   . MET A 1 236 ? -5.553  50.273 -9.608  1.00 29.42 ? 235 MET A C   1 
ATOM   1600 O O   . MET A 1 236 ? -6.390  50.803 -10.332 1.00 31.15 ? 235 MET A O   1 
ATOM   1601 C CB  . MET A 1 236 ? -5.974  49.613 -7.209  1.00 33.20 ? 235 MET A CB  1 
ATOM   1602 C CG  . MET A 1 236 ? -6.819  48.791 -6.222  1.00 39.52 ? 235 MET A CG  1 
ATOM   1603 S SD  . MET A 1 236 ? -6.736  49.653 -4.597  1.00 41.86 ? 235 MET A SD  1 
ATOM   1604 C CE  . MET A 1 236 ? -7.257  48.406 -3.420  1.00 45.40 ? 235 MET A CE  1 
ATOM   1605 N N   . VAL A 1 237 ? -4.281  50.638 -9.650  1.00 31.82 ? 236 VAL A N   1 
ATOM   1606 C CA  . VAL A 1 237 ? -3.839  51.800 -10.476 1.00 30.58 ? 236 VAL A CA  1 
ATOM   1607 C C   . VAL A 1 237 ? -3.616  51.476 -11.980 1.00 31.58 ? 236 VAL A C   1 
ATOM   1608 O O   . VAL A 1 237 ? -3.587  52.374 -12.812 1.00 32.23 ? 236 VAL A O   1 
ATOM   1609 C CB  . VAL A 1 237 ? -2.625  52.521 -9.815  1.00 32.22 ? 236 VAL A CB  1 
ATOM   1610 C CG1 . VAL A 1 237 ? -3.043  53.054 -8.391  1.00 27.06 ? 236 VAL A CG1 1 
ATOM   1611 C CG2 . VAL A 1 237 ? -1.367  51.627 -9.767  1.00 25.28 ? 236 VAL A CG2 1 
ATOM   1612 N N   . CYS A 1 238 ? -3.508  50.190 -12.320 1.00 31.90 ? 237 CYS A N   1 
ATOM   1613 C CA  . CYS A 1 238 ? -3.273  49.744 -13.694 1.00 31.57 ? 237 CYS A CA  1 
ATOM   1614 C C   . CYS A 1 238 ? -4.432  48.976 -14.329 1.00 34.24 ? 237 CYS A C   1 
ATOM   1615 O O   . CYS A 1 238 ? -4.430  48.758 -15.532 1.00 33.84 ? 237 CYS A O   1 
ATOM   1616 C CB  . CYS A 1 238 ? -2.014  48.879 -13.760 1.00 30.75 ? 237 CYS A CB  1 
ATOM   1617 S SG  . CYS A 1 238 ? -0.507  49.811 -13.555 1.00 35.17 ? 237 CYS A SG  1 
ATOM   1618 N N   . GLY A 1 239 ? -5.387  48.499 -13.535 1.00 34.40 ? 238 GLY A N   1 
ATOM   1619 C CA  . GLY A 1 239 ? -6.536  47.807 -14.110 1.00 32.25 ? 238 GLY A CA  1 
ATOM   1620 C C   . GLY A 1 239 ? -6.475  46.286 -14.107 1.00 32.53 ? 238 GLY A C   1 
ATOM   1621 O O   . GLY A 1 239 ? -7.493  45.658 -14.353 1.00 31.38 ? 238 GLY A O   1 
ATOM   1622 N N   . ASP A 1 240 ? -5.295  45.712 -13.848 1.00 28.70 ? 239 ASP A N   1 
ATOM   1623 C CA  . ASP A 1 240 ? -5.104  44.273 -13.702 1.00 29.55 ? 239 ASP A CA  1 
ATOM   1624 C C   . ASP A 1 240 ? -3.780  44.036 -12.991 1.00 33.18 ? 239 ASP A C   1 
ATOM   1625 O O   . ASP A 1 240 ? -2.934  44.916 -12.969 1.00 35.19 ? 239 ASP A O   1 
ATOM   1626 C CB  . ASP A 1 240 ? -5.099  43.547 -15.035 1.00 33.92 ? 239 ASP A CB  1 
ATOM   1627 C CG  . ASP A 1 240 ? -5.523  42.090 -14.930 1.00 30.64 ? 239 ASP A CG  1 
ATOM   1628 O OD1 . ASP A 1 240 ? -5.875  41.581 -13.818 1.00 32.72 ? 239 ASP A OD1 1 
ATOM   1629 O OD2 . ASP A 1 240 ? -5.521  41.456 -16.007 1.00 39.37 ? 239 ASP A OD2 1 
ATOM   1630 N N   . ILE A 1 241 ? -3.644  42.845 -12.394 1.00 34.95 ? 240 ILE A N   1 
ATOM   1631 C CA  . ILE A 1 241 ? -2.450  42.405 -11.697 1.00 33.52 ? 240 ILE A CA  1 
ATOM   1632 C C   . ILE A 1 241 ? -1.253  42.412 -12.660 1.00 33.41 ? 240 ILE A C   1 
ATOM   1633 O O   . ILE A 1 241 ? -1.444  42.309 -13.885 1.00 36.29 ? 240 ILE A O   1 
ATOM   1634 C CB  . ILE A 1 241 ? -2.685  40.998 -11.011 1.00 34.84 ? 240 ILE A CB  1 
ATOM   1635 C CG1 . ILE A 1 241 ? -2.928  39.884 -12.041 1.00 33.46 ? 240 ILE A CG1 1 
ATOM   1636 C CG2 . ILE A 1 241 ? -3.841  41.081 -10.035 1.00 31.56 ? 240 ILE A CG2 1 
ATOM   1637 C CD1 . ILE A 1 241 ? -2.976  38.445 -11.466 1.00 35.56 ? 240 ILE A CD1 1 
ATOM   1638 N N   . PRO A 1 242 ? -0.020  42.610 -12.127 1.00 31.92 ? 241 PRO A N   1 
ATOM   1639 C CA  . PRO A 1 242 ? 1.164   42.675 -12.983 1.00 33.59 ? 241 PRO A CA  1 
ATOM   1640 C C   . PRO A 1 242 ? 1.620   41.320 -13.562 1.00 36.86 ? 241 PRO A C   1 
ATOM   1641 O O   . PRO A 1 242 ? 2.135   41.283 -14.677 1.00 32.56 ? 241 PRO A O   1 
ATOM   1642 C CB  . PRO A 1 242 ? 2.240   43.263 -12.065 1.00 30.68 ? 241 PRO A CB  1 
ATOM   1643 C CG  . PRO A 1 242 ? 1.839   42.876 -10.687 1.00 29.41 ? 241 PRO A CG  1 
ATOM   1644 C CD  . PRO A 1 242 ? 0.322   42.717 -10.702 1.00 33.77 ? 241 PRO A CD  1 
ATOM   1645 N N   . PHE A 1 243 ? 1.432   40.226 -12.810 1.00 35.10 ? 242 PHE A N   1 
ATOM   1646 C CA  . PHE A 1 243 ? 2.048   38.948 -13.147 1.00 33.81 ? 242 PHE A CA  1 
ATOM   1647 C C   . PHE A 1 243 ? 0.984   37.885 -13.261 1.00 34.95 ? 242 PHE A C   1 
ATOM   1648 O O   . PHE A 1 243 ? 0.068   37.862 -12.452 1.00 36.71 ? 242 PHE A O   1 
ATOM   1649 C CB  . PHE A 1 243 ? 3.071   38.491 -12.079 1.00 36.82 ? 242 PHE A CB  1 
ATOM   1650 C CG  . PHE A 1 243 ? 4.041   39.553 -11.649 1.00 31.98 ? 242 PHE A CG  1 
ATOM   1651 C CD1 . PHE A 1 243 ? 4.697   40.352 -12.608 1.00 40.14 ? 242 PHE A CD1 1 
ATOM   1652 C CD2 . PHE A 1 243 ? 4.315   39.749 -10.307 1.00 32.15 ? 242 PHE A CD2 1 
ATOM   1653 C CE1 . PHE A 1 243 ? 5.601   41.340 -12.228 1.00 31.21 ? 242 PHE A CE1 1 
ATOM   1654 C CE2 . PHE A 1 243 ? 5.228   40.735 -9.898  1.00 35.94 ? 242 PHE A CE2 1 
ATOM   1655 C CZ  . PHE A 1 243 ? 5.874   41.531 -10.871 1.00 36.77 ? 242 PHE A CZ  1 
ATOM   1656 N N   . GLU A 1 244 ? 1.124   37.017 -14.275 1.00 35.47 ? 243 GLU A N   1 
ATOM   1657 C CA  . GLU A 1 244 ? 0.320   35.791 -14.430 1.00 35.14 ? 243 GLU A CA  1 
ATOM   1658 C C   . GLU A 1 244 ? 1.160   34.520 -14.224 1.00 37.98 ? 243 GLU A C   1 
ATOM   1659 O O   . GLU A 1 244 ? 0.675   33.510 -13.730 1.00 39.92 ? 243 GLU A O   1 
ATOM   1660 C CB  . GLU A 1 244 ? -0.345  35.724 -15.813 1.00 38.02 ? 243 GLU A CB  1 
ATOM   1661 C CG  . GLU A 1 244 ? -1.413  36.782 -16.081 1.00 35.18 ? 243 GLU A CG  1 
ATOM   1662 C CD  . GLU A 1 244 ? -2.647  36.664 -15.159 1.00 41.27 ? 243 GLU A CD  1 
ATOM   1663 O OE1 . GLU A 1 244 ? -2.983  35.544 -14.688 1.00 35.02 ? 243 GLU A OE1 1 
ATOM   1664 O OE2 . GLU A 1 244 ? -3.301  37.707 -14.933 1.00 49.19 ? 243 GLU A OE2 1 
ATOM   1665 N N   . HIS A 1 245 ? 2.423   34.591 -14.617 1.00 39.19 ? 244 HIS A N   1 
ATOM   1666 C CA  . HIS A 1 245 ? 3.303   33.436 -14.720 1.00 38.96 ? 244 HIS A CA  1 
ATOM   1667 C C   . HIS A 1 245 ? 4.362   33.453 -13.623 1.00 37.58 ? 244 HIS A C   1 
ATOM   1668 O O   . HIS A 1 245 ? 4.793   34.527 -13.185 1.00 32.98 ? 244 HIS A O   1 
ATOM   1669 C CB  . HIS A 1 245 ? 3.950   33.447 -16.106 1.00 38.46 ? 244 HIS A CB  1 
ATOM   1670 C CG  . HIS A 1 245 ? 2.946   33.491 -17.219 1.00 47.82 ? 244 HIS A CG  1 
ATOM   1671 N ND1 . HIS A 1 245 ? 2.079   32.447 -17.476 1.00 52.87 ? 244 HIS A ND1 1 
ATOM   1672 C CD2 . HIS A 1 245 ? 2.644   34.463 -18.113 1.00 49.25 ? 244 HIS A CD2 1 
ATOM   1673 C CE1 . HIS A 1 245 ? 1.302   32.767 -18.495 1.00 49.44 ? 244 HIS A CE1 1 
ATOM   1674 N NE2 . HIS A 1 245 ? 1.616   33.990 -18.892 1.00 47.20 ? 244 HIS A NE2 1 
ATOM   1675 N N   . ASP A 1 246 ? 4.780   32.253 -13.203 1.00 37.38 ? 245 ASP A N   1 
ATOM   1676 C CA  . ASP A 1 246 ? 5.776   32.099 -12.145 1.00 38.11 ? 245 ASP A CA  1 
ATOM   1677 C C   . ASP A 1 246 ? 7.067   32.858 -12.462 1.00 37.12 ? 245 ASP A C   1 
ATOM   1678 O O   . ASP A 1 246 ? 7.709   33.402 -11.569 1.00 34.71 ? 245 ASP A O   1 
ATOM   1679 C CB  . ASP A 1 246 ? 6.113   30.628 -11.931 1.00 36.25 ? 245 ASP A CB  1 
ATOM   1680 C CG  . ASP A 1 246 ? 4.986   29.847 -11.314 1.00 36.70 ? 245 ASP A CG  1 
ATOM   1681 O OD1 . ASP A 1 246 ? 3.989   30.450 -10.881 1.00 33.99 ? 245 ASP A OD1 1 
ATOM   1682 O OD2 . ASP A 1 246 ? 5.090   28.607 -11.288 1.00 32.60 ? 245 ASP A OD2 1 
ATOM   1683 N N   . GLU A 1 247 ? 7.431   32.890 -13.736 1.00 39.62 ? 246 GLU A N   1 
ATOM   1684 C CA  . GLU A 1 247 ? 8.686   33.505 -14.171 1.00 38.63 ? 246 GLU A CA  1 
ATOM   1685 C C   . GLU A 1 247 ? 8.639   35.017 -14.047 1.00 38.41 ? 246 GLU A C   1 
ATOM   1686 O O   . GLU A 1 247 ? 9.664   35.645 -13.714 1.00 35.32 ? 246 GLU A O   1 
ATOM   1687 C CB  . GLU A 1 247 ? 9.110   33.047 -15.595 1.00 41.04 ? 246 GLU A CB  1 
ATOM   1688 C CG  . GLU A 1 247 ? 8.005   32.460 -16.495 1.00 54.06 ? 246 GLU A CG  1 
ATOM   1689 C CD  . GLU A 1 247 ? 7.479   31.095 -16.019 1.00 60.39 ? 246 GLU A CD  1 
ATOM   1690 O OE1 . GLU A 1 247 ? 6.253   30.971 -15.829 1.00 45.57 ? 246 GLU A OE1 1 
ATOM   1691 O OE2 . GLU A 1 247 ? 8.281   30.147 -15.828 1.00 69.67 ? 246 GLU A OE2 1 
ATOM   1692 N N   . GLU A 1 248 ? 7.462   35.602 -14.286 1.00 37.94 ? 247 GLU A N   1 
ATOM   1693 C CA  . GLU A 1 248 ? 7.237   37.038 -14.007 1.00 39.74 ? 247 GLU A CA  1 
ATOM   1694 C C   . GLU A 1 248 ? 7.320   37.355 -12.516 1.00 38.31 ? 247 GLU A C   1 
ATOM   1695 O O   . GLU A 1 248 ? 7.957   38.343 -12.119 1.00 39.00 ? 247 GLU A O   1 
ATOM   1696 C CB  . GLU A 1 248 ? 5.874   37.492 -14.531 1.00 41.22 ? 247 GLU A CB  1 
ATOM   1697 C CG  . GLU A 1 248 ? 5.702   37.359 -16.058 1.00 42.85 ? 247 GLU A CG  1 
ATOM   1698 C CD  . GLU A 1 248 ? 4.273   37.605 -16.467 1.00 44.05 ? 247 GLU A CD  1 
ATOM   1699 O OE1 . GLU A 1 248 ? 3.392   36.859 -16.024 1.00 42.83 ? 247 GLU A OE1 1 
ATOM   1700 O OE2 . GLU A 1 248 ? 4.013   38.562 -17.210 1.00 67.41 ? 247 GLU A OE2 1 
ATOM   1701 N N   . ILE A 1 249 ? 6.666   36.528 -11.700 1.00 36.69 ? 248 ILE A N   1 
ATOM   1702 C CA  . ILE A 1 249 ? 6.694   36.697 -10.230 1.00 36.04 ? 248 ILE A CA  1 
ATOM   1703 C C   . ILE A 1 249 ? 8.137   36.732 -9.731  1.00 32.08 ? 248 ILE A C   1 
ATOM   1704 O O   . ILE A 1 249 ? 8.520   37.634 -8.977  1.00 34.70 ? 248 ILE A O   1 
ATOM   1705 C CB  . ILE A 1 249 ? 5.874   35.575 -9.433  1.00 33.58 ? 248 ILE A CB  1 
ATOM   1706 C CG1 . ILE A 1 249 ? 4.403   35.562 -9.852  1.00 31.58 ? 248 ILE A CG1 1 
ATOM   1707 C CG2 . ILE A 1 249 ? 6.000   35.795 -7.902  1.00 30.92 ? 248 ILE A CG2 1 
ATOM   1708 C CD1 . ILE A 1 249 ? 3.527   34.522 -9.217  1.00 34.19 ? 248 ILE A CD1 1 
ATOM   1709 N N   . ILE A 1 250 ? 8.934   35.740 -10.122 1.00 35.89 ? 249 ILE A N   1 
ATOM   1710 C CA  . ILE A 1 250 ? 10.300  35.660 -9.617  1.00 37.69 ? 249 ILE A CA  1 
ATOM   1711 C C   . ILE A 1 250 ? 11.249  36.679 -10.303 1.00 39.48 ? 249 ILE A C   1 
ATOM   1712 O O   . ILE A 1 250 ? 12.308  37.009 -9.756  1.00 38.04 ? 249 ILE A O   1 
ATOM   1713 C CB  . ILE A 1 250 ? 10.846  34.170 -9.591  1.00 39.51 ? 249 ILE A CB  1 
ATOM   1714 C CG1 . ILE A 1 250 ? 11.177  33.655 -10.986 1.00 40.73 ? 249 ILE A CG1 1 
ATOM   1715 C CG2 . ILE A 1 250 ? 9.830   33.242 -8.873  1.00 38.85 ? 249 ILE A CG2 1 
ATOM   1716 C CD1 . ILE A 1 250 ? 11.836  32.293 -10.989 1.00 41.43 ? 249 ILE A CD1 1 
ATOM   1717 N N   . GLY A 1 251 ? 10.840  37.232 -11.446 1.00 37.42 ? 250 GLY A N   1 
ATOM   1718 C CA  . GLY A 1 251 ? 11.741  38.041 -12.287 1.00 38.72 ? 250 GLY A CA  1 
ATOM   1719 C C   . GLY A 1 251 ? 12.169  39.410 -11.761 1.00 42.80 ? 250 GLY A C   1 
ATOM   1720 O O   . GLY A 1 251 ? 13.255  39.879 -12.072 1.00 45.75 ? 250 GLY A O   1 
ATOM   1721 N N   . GLY A 1 252 ? 11.332  40.064 -10.974 1.00 47.25 ? 251 GLY A N   1 
ATOM   1722 C CA  . GLY A 1 252 ? 11.715  41.346 -10.374 1.00 51.26 ? 251 GLY A CA  1 
ATOM   1723 C C   . GLY A 1 252 ? 11.534  42.589 -11.243 1.00 54.69 ? 251 GLY A C   1 
ATOM   1724 O O   . GLY A 1 252 ? 12.155  43.618 -10.979 1.00 55.61 ? 251 GLY A O   1 
ATOM   1725 N N   . GLN A 1 253 ? 10.694  42.503 -12.277 1.00 50.94 ? 252 GLN A N   1 
ATOM   1726 C CA  . GLN A 1 253 ? 10.527  43.600 -13.220 1.00 45.81 ? 252 GLN A CA  1 
ATOM   1727 C C   . GLN A 1 253 ? 9.054   43.989 -13.226 1.00 38.68 ? 252 GLN A C   1 
ATOM   1728 O O   . GLN A 1 253 ? 8.198   43.174 -13.504 1.00 37.18 ? 252 GLN A O   1 
ATOM   1729 C CB  . GLN A 1 253 ? 11.023  43.168 -14.605 1.00 44.83 ? 252 GLN A CB  1 
ATOM   1730 C CG  . GLN A 1 253 ? 11.162  44.296 -15.639 1.00 63.01 ? 252 GLN A CG  1 
ATOM   1731 C CD  . GLN A 1 253 ? 12.421  45.136 -15.475 1.00 65.16 ? 252 GLN A CD  1 
ATOM   1732 O OE1 . GLN A 1 253 ? 13.523  44.664 -15.729 1.00 68.78 ? 252 GLN A OE1 1 
ATOM   1733 N NE2 . GLN A 1 253 ? 12.252  46.398 -15.076 1.00 65.15 ? 252 GLN A NE2 1 
ATOM   1734 N N   . VAL A 1 254 ? 8.763   45.237 -12.875 1.00 38.08 ? 253 VAL A N   1 
ATOM   1735 C CA  . VAL A 1 254 ? 7.394   45.746 -12.880 1.00 32.24 ? 253 VAL A CA  1 
ATOM   1736 C C   . VAL A 1 254 ? 7.266   46.699 -14.066 1.00 35.04 ? 253 VAL A C   1 
ATOM   1737 O O   . VAL A 1 254 ? 7.853   47.784 -14.081 1.00 36.08 ? 253 VAL A O   1 
ATOM   1738 C CB  . VAL A 1 254 ? 7.007   46.402 -11.531 1.00 34.66 ? 253 VAL A CB  1 
ATOM   1739 C CG1 . VAL A 1 254 ? 5.491   46.792 -11.505 1.00 28.28 ? 253 VAL A CG1 1 
ATOM   1740 C CG2 . VAL A 1 254 ? 7.384   45.446 -10.351 1.00 39.76 ? 253 VAL A CG2 1 
ATOM   1741 N N   . PHE A 1 255 ? 6.543   46.249 -15.091 1.00 33.96 ? 254 PHE A N   1 
ATOM   1742 C CA  . PHE A 1 255 ? 6.205   47.085 -16.216 1.00 31.84 ? 254 PHE A CA  1 
ATOM   1743 C C   . PHE A 1 255 ? 4.872   47.763 -15.897 1.00 29.54 ? 254 PHE A C   1 
ATOM   1744 O O   . PHE A 1 255 ? 3.901   47.111 -15.485 1.00 30.89 ? 254 PHE A O   1 
ATOM   1745 C CB  . PHE A 1 255 ? 6.163   46.260 -17.529 1.00 34.66 ? 254 PHE A CB  1 
ATOM   1746 C CG  . PHE A 1 255 ? 5.573   47.004 -18.706 1.00 35.44 ? 254 PHE A CG  1 
ATOM   1747 C CD1 . PHE A 1 255 ? 6.360   47.842 -19.485 1.00 32.55 ? 254 PHE A CD1 1 
ATOM   1748 C CD2 . PHE A 1 255 ? 4.218   46.868 -19.030 1.00 34.00 ? 254 PHE A CD2 1 
ATOM   1749 C CE1 . PHE A 1 255 ? 5.812   48.524 -20.561 1.00 30.53 ? 254 PHE A CE1 1 
ATOM   1750 C CE2 . PHE A 1 255 ? 3.666   47.564 -20.091 1.00 34.94 ? 254 PHE A CE2 1 
ATOM   1751 C CZ  . PHE A 1 255 ? 4.471   48.389 -20.858 1.00 27.33 ? 254 PHE A CZ  1 
ATOM   1752 N N   . PHE A 1 256 ? 4.847   49.074 -16.076 1.00 28.65 ? 255 PHE A N   1 
ATOM   1753 C CA  . PHE A 1 256 ? 3.636   49.886 -15.930 1.00 31.93 ? 255 PHE A CA  1 
ATOM   1754 C C   . PHE A 1 256 ? 2.896   50.104 -17.231 1.00 28.73 ? 255 PHE A C   1 
ATOM   1755 O O   . PHE A 1 256 ? 3.437   50.660 -18.164 1.00 30.85 ? 255 PHE A O   1 
ATOM   1756 C CB  . PHE A 1 256 ? 3.972   51.207 -15.230 1.00 31.24 ? 255 PHE A CB  1 
ATOM   1757 C CG  . PHE A 1 256 ? 4.092   51.039 -13.760 1.00 35.65 ? 255 PHE A CG  1 
ATOM   1758 C CD1 . PHE A 1 256 ? 5.319   50.765 -13.174 1.00 26.53 ? 255 PHE A CD1 1 
ATOM   1759 C CD2 . PHE A 1 256 ? 2.964   51.070 -12.961 1.00 30.29 ? 255 PHE A CD2 1 
ATOM   1760 C CE1 . PHE A 1 256 ? 5.427   50.560 -11.822 1.00 30.82 ? 255 PHE A CE1 1 
ATOM   1761 C CE2 . PHE A 1 256 ? 3.078   50.851 -11.599 1.00 34.37 ? 255 PHE A CE2 1 
ATOM   1762 C CZ  . PHE A 1 256 ? 4.312   50.610 -11.037 1.00 34.48 ? 255 PHE A CZ  1 
ATOM   1763 N N   . ARG A 1 257 ? 1.661   49.601 -17.285 1.00 34.49 ? 256 ARG A N   1 
ATOM   1764 C CA  . ARG A 1 257 ? 0.849   49.564 -18.529 1.00 41.39 ? 256 ARG A CA  1 
ATOM   1765 C C   . ARG A 1 257 ? -0.059  50.801 -18.678 1.00 39.52 ? 256 ARG A C   1 
ATOM   1766 O O   . ARG A 1 257 ? -0.526  51.102 -19.781 1.00 38.54 ? 256 ARG A O   1 
ATOM   1767 C CB  . ARG A 1 257 ? 0.008   48.260 -18.606 1.00 40.00 ? 256 ARG A CB  1 
ATOM   1768 C CG  . ARG A 1 257 ? -1.007  48.061 -17.429 1.00 38.79 ? 256 ARG A CG  1 
ATOM   1769 C CD  . ARG A 1 257 ? -1.576  46.640 -17.400 1.00 43.77 ? 256 ARG A CD  1 
ATOM   1770 N NE  . ARG A 1 257 ? -0.612  45.658 -16.882 1.00 45.16 ? 256 ARG A NE  1 
ATOM   1771 C CZ  . ARG A 1 257 ? -0.700  44.331 -17.044 1.00 42.78 ? 256 ARG A CZ  1 
ATOM   1772 N NH1 . ARG A 1 257 ? -1.693  43.777 -17.722 1.00 44.48 ? 256 ARG A NH1 1 
ATOM   1773 N NH2 . ARG A 1 257 ? 0.239   43.551 -16.546 1.00 40.29 ? 256 ARG A NH2 1 
ATOM   1774 N N   . GLN A 1 258 ? -0.277  51.482 -17.550 1.00 33.97 ? 257 GLN A N   1 
ATOM   1775 C CA  . GLN A 1 258 ? -0.958  52.762 -17.440 1.00 33.83 ? 257 GLN A CA  1 
ATOM   1776 C C   . GLN A 1 258 ? 0.001   53.830 -16.905 1.00 28.00 ? 257 GLN A C   1 
ATOM   1777 O O   . GLN A 1 258 ? 1.027   53.523 -16.316 1.00 29.99 ? 257 GLN A O   1 
ATOM   1778 C CB  . GLN A 1 258 ? -2.157  52.661 -16.460 1.00 31.44 ? 257 GLN A CB  1 
ATOM   1779 C CG  . GLN A 1 258 ? -3.385  52.019 -17.044 1.00 52.67 ? 257 GLN A CG  1 
ATOM   1780 C CD  . GLN A 1 258 ? -4.216  53.040 -17.756 1.00 38.45 ? 257 GLN A CD  1 
ATOM   1781 O OE1 . GLN A 1 258 ? -4.656  54.029 -17.151 1.00 51.91 ? 257 GLN A OE1 1 
ATOM   1782 N NE2 . GLN A 1 258 ? -4.387  52.857 -19.040 1.00 62.81 ? 257 GLN A NE2 1 
ATOM   1783 N N   . ARG A 1 259 ? -0.362  55.089 -17.148 1.00 27.04 ? 258 ARG A N   1 
ATOM   1784 C CA  . ARG A 1 259 ? 0.280   56.212 -16.519 1.00 30.35 ? 258 ARG A CA  1 
ATOM   1785 C C   . ARG A 1 259 ? 0.045   56.169 -15.020 1.00 33.79 ? 258 ARG A C   1 
ATOM   1786 O O   . ARG A 1 259 ? -1.082  56.243 -14.574 1.00 30.46 ? 258 ARG A O   1 
ATOM   1787 C CB  . ARG A 1 259 ? -0.219  57.522 -17.104 1.00 24.65 ? 258 ARG A CB  1 
ATOM   1788 C CG  . ARG A 1 259 ? 0.167   58.767 -16.293 1.00 28.35 ? 258 ARG A CG  1 
ATOM   1789 C CD  . ARG A 1 259 ? 1.636   59.007 -16.378 1.00 35.26 ? 258 ARG A CD  1 
ATOM   1790 N NE  . ARG A 1 259 ? 2.113   59.890 -15.314 1.00 30.30 ? 258 ARG A NE  1 
ATOM   1791 C CZ  . ARG A 1 259 ? 3.209   60.648 -15.389 1.00 42.98 ? 258 ARG A CZ  1 
ATOM   1792 N NH1 . ARG A 1 259 ? 3.520   61.428 -14.353 1.00 37.41 ? 258 ARG A NH1 1 
ATOM   1793 N NH2 . ARG A 1 259 ? 3.979   60.647 -16.491 1.00 32.49 ? 258 ARG A NH2 1 
ATOM   1794 N N   . VAL A 1 260 ? 1.127   56.010 -14.264 1.00 32.51 ? 259 VAL A N   1 
ATOM   1795 C CA  . VAL A 1 260 ? 1.093   55.919 -12.821 1.00 30.32 ? 259 VAL A CA  1 
ATOM   1796 C C   . VAL A 1 260 ? 2.156   56.928 -12.344 1.00 32.58 ? 259 VAL A C   1 
ATOM   1797 O O   . VAL A 1 260 ? 3.221   57.025 -12.931 1.00 29.60 ? 259 VAL A O   1 
ATOM   1798 C CB  . VAL A 1 260 ? 1.331   54.452 -12.310 1.00 34.29 ? 259 VAL A CB  1 
ATOM   1799 C CG1 . VAL A 1 260 ? 1.590   54.378 -10.753 1.00 26.26 ? 259 VAL A CG1 1 
ATOM   1800 C CG2 . VAL A 1 260 ? 0.165   53.549 -12.726 1.00 26.62 ? 259 VAL A CG2 1 
ATOM   1801 N N   . SER A 1 261 ? 1.822   57.709 -11.321 1.00 32.47 ? 260 SER A N   1 
ATOM   1802 C CA  . SER A 1 261 ? 2.752   58.660 -10.733 1.00 33.11 ? 260 SER A CA  1 
ATOM   1803 C C   . SER A 1 261 ? 4.029   57.981 -10.192 1.00 30.50 ? 260 SER A C   1 
ATOM   1804 O O   . SER A 1 261 ? 4.039   56.811 -9.807  1.00 32.64 ? 260 SER A O   1 
ATOM   1805 C CB  . SER A 1 261 ? 2.062   59.468 -9.627  1.00 33.79 ? 260 SER A CB  1 
ATOM   1806 O OG  . SER A 1 261 ? 1.897   58.706 -8.437  1.00 31.24 ? 260 SER A OG  1 
HETATM 1807 N N   . SEP A 1 262 ? 5.122   58.725 -10.226 1.00 32.64 ? 261 SEP A N   1 
HETATM 1808 C CA  . SEP A 1 262 ? 6.411   58.225 -9.775  1.00 31.64 ? 261 SEP A CA  1 
HETATM 1809 C CB  . SEP A 1 262 ? 7.481   59.275 -10.063 1.00 30.20 ? 261 SEP A CB  1 
HETATM 1810 O OG  . SEP A 1 262 ? 7.229   59.714 -11.381 1.00 36.93 ? 261 SEP A OG  1 
HETATM 1811 C C   . SEP A 1 262 ? 6.359   57.783 -8.308  1.00 31.90 ? 261 SEP A C   1 
HETATM 1812 O O   . SEP A 1 262 ? 6.911   56.746 -7.983  1.00 30.54 ? 261 SEP A O   1 
HETATM 1813 P P   . SEP A 1 262 ? 7.824   61.120 -11.846 1.00 35.51 ? 261 SEP A P   1 
HETATM 1814 O O1P . SEP A 1 262 ? 7.668   61.189 -13.466 1.00 37.37 ? 261 SEP A O1P 1 
HETATM 1815 O O2P . SEP A 1 262 ? 7.102   62.409 -11.272 1.00 40.09 ? 261 SEP A O2P 1 
HETATM 1816 O O3P . SEP A 1 262 ? 9.368   61.225 -11.360 1.00 62.89 ? 261 SEP A O3P 1 
ATOM   1817 N N   . GLU A 1 263 ? 5.628   58.515 -7.450  1.00 33.44 ? 262 GLU A N   1 
ATOM   1818 C CA  . GLU A 1 263 ? 5.507   58.137 -6.025  1.00 35.90 ? 262 GLU A CA  1 
ATOM   1819 C C   . GLU A 1 263 ? 4.756   56.820 -5.845  1.00 35.02 ? 262 GLU A C   1 
ATOM   1820 O O   . GLU A 1 263 ? 5.146   55.985 -5.047  1.00 29.49 ? 262 GLU A O   1 
ATOM   1821 C CB  . GLU A 1 263 ? 4.813   59.236 -5.196  1.00 37.25 ? 262 GLU A CB  1 
ATOM   1822 C CG  . GLU A 1 263 ? 5.635   60.543 -4.996  1.00 41.13 ? 262 GLU A CG  1 
ATOM   1823 C CD  . GLU A 1 263 ? 6.737   60.480 -3.929  1.00 66.72 ? 262 GLU A CD  1 
ATOM   1824 O OE1 . GLU A 1 263 ? 7.083   59.376 -3.408  1.00 66.56 ? 262 GLU A OE1 1 
ATOM   1825 O OE2 . GLU A 1 263 ? 7.283   61.572 -3.628  1.00 66.94 ? 262 GLU A OE2 1 
ATOM   1826 N N   . CYS A 1 264 ? 3.682   56.639 -6.601  1.00 32.69 ? 263 CYS A N   1 
ATOM   1827 C CA  . CYS A 1 264 ? 2.971   55.379 -6.593  1.00 31.93 ? 263 CYS A CA  1 
ATOM   1828 C C   . CYS A 1 264 ? 3.787   54.205 -7.179  1.00 31.10 ? 263 CYS A C   1 
ATOM   1829 O O   . CYS A 1 264 ? 3.798   53.138 -6.582  1.00 32.52 ? 263 CYS A O   1 
ATOM   1830 C CB  . CYS A 1 264 ? 1.651   55.528 -7.317  1.00 33.43 ? 263 CYS A CB  1 
ATOM   1831 S SG  . CYS A 1 264 ? 0.608   54.095 -7.223  1.00 33.40 ? 263 CYS A SG  1 
ATOM   1832 N N   . GLN A 1 265 ? 4.457   54.393 -8.321  1.00 29.95 ? 264 GLN A N   1 
ATOM   1833 C CA  . GLN A 1 265 ? 5.330   53.356 -8.876  1.00 33.97 ? 264 GLN A CA  1 
ATOM   1834 C C   . GLN A 1 265 ? 6.390   52.921 -7.857  1.00 31.35 ? 264 GLN A C   1 
ATOM   1835 O O   . GLN A 1 265 ? 6.732   51.753 -7.770  1.00 28.98 ? 264 GLN A O   1 
ATOM   1836 C CB  . GLN A 1 265 ? 6.075   53.829 -10.151 1.00 31.65 ? 264 GLN A CB  1 
ATOM   1837 C CG  . GLN A 1 265 ? 5.250   54.019 -11.406 1.00 27.21 ? 264 GLN A CG  1 
ATOM   1838 C CD  . GLN A 1 265 ? 6.109   54.287 -12.625 1.00 24.83 ? 264 GLN A CD  1 
ATOM   1839 O OE1 . GLN A 1 265 ? 7.329   54.228 -12.552 1.00 36.87 ? 264 GLN A OE1 1 
ATOM   1840 N NE2 . GLN A 1 265 ? 5.476   54.522 -13.765 1.00 30.24 ? 264 GLN A NE2 1 
ATOM   1841 N N   . HIS A 1 266 ? 6.958   53.901 -7.162  1.00 33.08 ? 265 HIS A N   1 
ATOM   1842 C CA  . HIS A 1 266 ? 7.965   53.653 -6.142  1.00 33.52 ? 265 HIS A CA  1 
ATOM   1843 C C   . HIS A 1 266 ? 7.413   52.784 -5.002  1.00 30.01 ? 265 HIS A C   1 
ATOM   1844 O O   . HIS A 1 266 ? 8.032   51.793 -4.659  1.00 34.01 ? 265 HIS A O   1 
ATOM   1845 C CB  . HIS A 1 266 ? 8.536   54.983 -5.613  1.00 31.16 ? 265 HIS A CB  1 
ATOM   1846 C CG  . HIS A 1 266 ? 9.506   54.818 -4.489  1.00 35.06 ? 265 HIS A CG  1 
ATOM   1847 N ND1 . HIS A 1 266 ? 9.102   54.680 -3.177  1.00 34.22 ? 265 HIS A ND1 1 
ATOM   1848 C CD2 . HIS A 1 266 ? 10.865  54.761 -4.475  1.00 30.29 ? 265 HIS A CD2 1 
ATOM   1849 C CE1 . HIS A 1 266 ? 10.166  54.542 -2.404  1.00 34.17 ? 265 HIS A CE1 1 
ATOM   1850 N NE2 . HIS A 1 266 ? 11.246  54.587 -3.168  1.00 31.53 ? 265 HIS A NE2 1 
ATOM   1851 N N   . LEU A 1 267 ? 6.228   53.110 -4.464  1.00 32.98 ? 266 LEU A N   1 
ATOM   1852 C CA  . LEU A 1 267 ? 5.609   52.277 -3.426  1.00 33.19 ? 266 LEU A CA  1 
ATOM   1853 C C   . LEU A 1 267 ? 5.348   50.840 -3.897  1.00 30.33 ? 266 LEU A C   1 
ATOM   1854 O O   . LEU A 1 267 ? 5.690   49.880 -3.202  1.00 29.24 ? 266 LEU A O   1 
ATOM   1855 C CB  . LEU A 1 267 ? 4.335   52.908 -2.860  1.00 31.72 ? 266 LEU A CB  1 
ATOM   1856 C CG  . LEU A 1 267 ? 3.623   52.192 -1.683  1.00 35.71 ? 266 LEU A CG  1 
ATOM   1857 C CD1 . LEU A 1 267 ? 4.533   51.893 -0.393  1.00 29.20 ? 266 LEU A CD1 1 
ATOM   1858 C CD2 . LEU A 1 267 ? 2.367   52.995 -1.297  1.00 33.52 ? 266 LEU A CD2 1 
ATOM   1859 N N   . ILE A 1 268 ? 4.773   50.706 -5.081  1.00 31.85 ? 267 ILE A N   1 
ATOM   1860 C CA  . ILE A 1 268 ? 4.505   49.408 -5.674  1.00 33.35 ? 267 ILE A CA  1 
ATOM   1861 C C   . ILE A 1 268 ? 5.784   48.582 -5.706  1.00 32.70 ? 267 ILE A C   1 
ATOM   1862 O O   . ILE A 1 268 ? 5.835   47.476 -5.193  1.00 33.94 ? 267 ILE A O   1 
ATOM   1863 C CB  . ILE A 1 268 ? 3.847   49.543 -7.080  1.00 33.74 ? 267 ILE A CB  1 
ATOM   1864 C CG1 . ILE A 1 268 ? 2.403   50.026 -6.916  1.00 34.46 ? 267 ILE A CG1 1 
ATOM   1865 C CG2 . ILE A 1 268 ? 3.875   48.180 -7.848  1.00 32.69 ? 267 ILE A CG2 1 
ATOM   1866 C CD1 . ILE A 1 268 ? 1.712   50.529 -8.187  1.00 24.79 ? 267 ILE A CD1 1 
ATOM   1867 N N   . ARG A 1 269 ? 6.828   49.154 -6.282  1.00 36.26 ? 268 ARG A N   1 
ATOM   1868 C CA  . ARG A 1 269 ? 8.098   48.455 -6.464  1.00 32.62 ? 268 ARG A CA  1 
ATOM   1869 C C   . ARG A 1 269 ? 8.810   48.101 -5.173  1.00 32.00 ? 268 ARG A C   1 
ATOM   1870 O O   . ARG A 1 269 ? 9.523   47.129 -5.126  1.00 29.79 ? 268 ARG A O   1 
ATOM   1871 C CB  . ARG A 1 269 ? 9.030   49.334 -7.288  1.00 34.18 ? 268 ARG A CB  1 
ATOM   1872 C CG  . ARG A 1 269 ? 8.627   49.390 -8.757  1.00 36.33 ? 268 ARG A CG  1 
ATOM   1873 C CD  . ARG A 1 269 ? 9.802   49.807 -9.577  1.00 39.98 ? 268 ARG A CD  1 
ATOM   1874 N NE  . ARG A 1 269 ? 9.452   49.675 -10.975 1.00 54.44 ? 268 ARG A NE  1 
ATOM   1875 C CZ  . ARG A 1 269 ? 9.115   50.684 -11.765 1.00 49.04 ? 268 ARG A CZ  1 
ATOM   1876 N NH1 . ARG A 1 269 ? 9.118   51.943 -11.306 1.00 35.92 ? 268 ARG A NH1 1 
ATOM   1877 N NH2 . ARG A 1 269 ? 8.783   50.417 -13.025 1.00 35.70 ? 268 ARG A NH2 1 
ATOM   1878 N N   . TRP A 1 270 ? 8.623   48.920 -4.145  1.00 32.57 ? 269 TRP A N   1 
ATOM   1879 C CA  . TRP A 1 270 ? 9.126   48.643 -2.818  1.00 31.60 ? 269 TRP A CA  1 
ATOM   1880 C C   . TRP A 1 270 ? 8.372   47.458 -2.198  1.00 32.50 ? 269 TRP A C   1 
ATOM   1881 O O   . TRP A 1 270 ? 8.985   46.548 -1.624  1.00 30.48 ? 269 TRP A O   1 
ATOM   1882 C CB  . TRP A 1 270 ? 9.023   49.927 -1.976  1.00 31.37 ? 269 TRP A CB  1 
ATOM   1883 C CG  . TRP A 1 270 ? 9.762   49.895 -0.663  1.00 29.38 ? 269 TRP A CG  1 
ATOM   1884 C CD1 . TRP A 1 270 ? 10.715  49.005 -0.274  1.00 33.50 ? 269 TRP A CD1 1 
ATOM   1885 C CD2 . TRP A 1 270 ? 9.639   50.845 0.407   1.00 30.00 ? 269 TRP A CD2 1 
ATOM   1886 N NE1 . TRP A 1 270 ? 11.188  49.327 0.974   1.00 32.28 ? 269 TRP A NE1 1 
ATOM   1887 C CE2 . TRP A 1 270 ? 10.539  50.447 1.422   1.00 33.29 ? 269 TRP A CE2 1 
ATOM   1888 C CE3 . TRP A 1 270 ? 8.843   51.980 0.610   1.00 33.36 ? 269 TRP A CE3 1 
ATOM   1889 C CZ2 . TRP A 1 270 ? 10.675  51.143 2.618   1.00 28.00 ? 269 TRP A CZ2 1 
ATOM   1890 C CZ3 . TRP A 1 270 ? 8.971   52.680 1.807   1.00 36.26 ? 269 TRP A CZ3 1 
ATOM   1891 C CH2 . TRP A 1 270 ? 9.866   52.249 2.800   1.00 38.33 ? 269 TRP A CH2 1 
ATOM   1892 N N   . CYS A 1 271 ? 7.046   47.435 -2.365  1.00 33.71 ? 270 CYS A N   1 
ATOM   1893 C CA  . CYS A 1 271 ? 6.246   46.294 -1.917  1.00 30.36 ? 270 CYS A CA  1 
ATOM   1894 C C   . CYS A 1 271 ? 6.572   44.971 -2.590  1.00 31.83 ? 270 CYS A C   1 
ATOM   1895 O O   . CYS A 1 271 ? 6.463   43.919 -1.958  1.00 31.94 ? 270 CYS A O   1 
ATOM   1896 C CB  . CYS A 1 271 ? 4.751   46.563 -2.065  1.00 30.30 ? 270 CYS A CB  1 
ATOM   1897 S SG  . CYS A 1 271 ? 4.126   47.799 -0.950  1.00 33.67 ? 270 CYS A SG  1 
ATOM   1898 N N   . LEU A 1 272 ? 6.939   45.056 -3.875  1.00 34.36 ? 271 LEU A N   1 
ATOM   1899 C CA  . LEU A 1 272 ? 7.332   43.909 -4.695  1.00 32.91 ? 271 LEU A CA  1 
ATOM   1900 C C   . LEU A 1 272 ? 8.852   43.729 -4.828  1.00 31.35 ? 271 LEU A C   1 
ATOM   1901 O O   . LEU A 1 272 ? 9.312   43.170 -5.793  1.00 32.59 ? 271 LEU A O   1 
ATOM   1902 C CB  . LEU A 1 272 ? 6.711   44.031 -6.083  1.00 32.17 ? 271 LEU A CB  1 
ATOM   1903 C CG  . LEU A 1 272 ? 5.198   44.251 -6.152  1.00 32.27 ? 271 LEU A CG  1 
ATOM   1904 C CD1 . LEU A 1 272 ? 4.706   44.449 -7.572  1.00 25.89 ? 271 LEU A CD1 1 
ATOM   1905 C CD2 . LEU A 1 272 ? 4.471   43.103 -5.504  1.00 28.31 ? 271 LEU A CD2 1 
ATOM   1906 N N   . ALA A 1 273 ? 9.611   44.191 -3.846  1.00 28.07 ? 272 ALA A N   1 
ATOM   1907 C CA  . ALA A 1 273 ? 11.022  43.845 -3.703  1.00 31.14 ? 272 ALA A CA  1 
ATOM   1908 C C   . ALA A 1 273 ? 11.171  42.333 -3.659  1.00 33.69 ? 272 ALA A C   1 
ATOM   1909 O O   . ALA A 1 273 ? 10.498  41.679 -2.884  1.00 34.25 ? 272 ALA A O   1 
ATOM   1910 C CB  . ALA A 1 273 ? 11.626  44.495 -2.439  1.00 27.33 ? 272 ALA A CB  1 
ATOM   1911 N N   . LEU A 1 274 ? 12.050  41.780 -4.501  1.00 31.45 ? 273 LEU A N   1 
ATOM   1912 C CA  . LEU A 1 274 ? 12.298  40.342 -4.521  1.00 33.99 ? 273 LEU A CA  1 
ATOM   1913 C C   . LEU A 1 274 ? 12.779  39.786 -3.166  1.00 33.46 ? 273 LEU A C   1 
ATOM   1914 O O   . LEU A 1 274 ? 12.384  38.691 -2.765  1.00 35.83 ? 273 LEU A O   1 
ATOM   1915 C CB  . LEU A 1 274 ? 13.292  39.977 -5.628  1.00 32.61 ? 273 LEU A CB  1 
ATOM   1916 C CG  . LEU A 1 274 ? 12.778  39.943 -7.072  1.00 38.47 ? 273 LEU A CG  1 
ATOM   1917 C CD1 . LEU A 1 274 ? 13.914  39.589 -8.029  1.00 27.36 ? 273 LEU A CD1 1 
ATOM   1918 C CD2 . LEU A 1 274 ? 11.629  38.938 -7.178  1.00 29.06 ? 273 LEU A CD2 1 
ATOM   1919 N N   . ARG A 1 275 ? 13.617  40.531 -2.456  1.00 33.79 ? 274 ARG A N   1 
ATOM   1920 C CA  . ARG A 1 275 ? 14.068  40.072 -1.140  1.00 35.00 ? 274 ARG A CA  1 
ATOM   1921 C C   . ARG A 1 275 ? 13.050  40.545 -0.106  1.00 33.08 ? 274 ARG A C   1 
ATOM   1922 O O   . ARG A 1 275 ? 12.765  41.734 -0.031  1.00 33.81 ? 274 ARG A O   1 
ATOM   1923 C CB  . ARG A 1 275 ? 15.500  40.539 -0.831  1.00 35.83 ? 274 ARG A CB  1 
ATOM   1924 C CG  . ARG A 1 275 ? 15.937  40.315 0.640   1.00 39.40 ? 274 ARG A CG  1 
ATOM   1925 C CD  . ARG A 1 275 ? 17.474  40.364 0.847   1.00 56.51 ? 274 ARG A CD  1 
ATOM   1926 N NE  . ARG A 1 275 ? 18.178  41.189 -0.137  1.00 58.65 ? 274 ARG A NE  1 
ATOM   1927 N N   . PRO A 1 276 ? 12.443  39.603 0.651   1.00 31.03 ? 275 PRO A N   1 
ATOM   1928 C CA  . PRO A 1 276 ? 11.424  39.965 1.638   1.00 34.05 ? 275 PRO A CA  1 
ATOM   1929 C C   . PRO A 1 276 ? 11.846  41.086 2.605   1.00 34.52 ? 275 PRO A C   1 
ATOM   1930 O O   . PRO A 1 276 ? 11.050  41.973 2.887   1.00 37.54 ? 275 PRO A O   1 
ATOM   1931 C CB  . PRO A 1 276 ? 11.171  38.655 2.384   1.00 32.27 ? 275 PRO A CB  1 
ATOM   1932 C CG  . PRO A 1 276 ? 11.566  37.600 1.445   1.00 33.42 ? 275 PRO A CG  1 
ATOM   1933 C CD  . PRO A 1 276 ? 12.621  38.141 0.547   1.00 33.40 ? 275 PRO A CD  1 
ATOM   1934 N N   . SER A 1 277 ? 13.092  41.036 3.084   1.00 38.44 ? 276 SER A N   1 
ATOM   1935 C CA  . SER A 1 277 ? 13.645  42.059 4.001   1.00 39.27 ? 276 SER A CA  1 
ATOM   1936 C C   . SER A 1 277 ? 13.791  43.448 3.341   1.00 36.21 ? 276 SER A C   1 
ATOM   1937 O O   . SER A 1 277 ? 13.943  44.434 4.029   1.00 41.33 ? 276 SER A O   1 
ATOM   1938 C CB  . SER A 1 277 ? 14.996  41.599 4.604   1.00 42.15 ? 276 SER A CB  1 
ATOM   1939 O OG  . SER A 1 277 ? 16.036  41.523 3.626   1.00 39.36 ? 276 SER A OG  1 
ATOM   1940 N N   . ASP A 1 278 ? 13.740  43.522 2.017   1.00 36.34 ? 277 ASP A N   1 
ATOM   1941 C CA  . ASP A 1 278 ? 13.732  44.802 1.321   1.00 34.61 ? 277 ASP A CA  1 
ATOM   1942 C C   . ASP A 1 278 ? 12.323  45.414 1.232   1.00 35.45 ? 277 ASP A C   1 
ATOM   1943 O O   . ASP A 1 278 ? 12.191  46.542 0.814   1.00 36.21 ? 277 ASP A O   1 
ATOM   1944 C CB  . ASP A 1 278 ? 14.312  44.667 -0.085  1.00 37.67 ? 277 ASP A CB  1 
ATOM   1945 C CG  . ASP A 1 278 ? 15.832  44.540 -0.105  1.00 35.49 ? 277 ASP A CG  1 
ATOM   1946 O OD1 . ASP A 1 278 ? 16.509  44.817 0.894   1.00 33.38 ? 277 ASP A OD1 1 
ATOM   1947 O OD2 . ASP A 1 278 ? 16.359  44.168 -1.157  1.00 38.04 ? 277 ASP A OD2 1 
ATOM   1948 N N   . ARG A 1 279 ? 11.280  44.657 1.586   1.00 38.33 ? 278 ARG A N   1 
ATOM   1949 C CA  . ARG A 1 279 ? 9.912   45.171 1.569   1.00 37.51 ? 278 ARG A CA  1 
ATOM   1950 C C   . ARG A 1 279 ? 9.637   46.081 2.782   1.00 36.13 ? 278 ARG A C   1 
ATOM   1951 O O   . ARG A 1 279 ? 10.234  45.908 3.857   1.00 39.25 ? 278 ARG A O   1 
ATOM   1952 C CB  . ARG A 1 279 ? 8.899   44.034 1.460   1.00 33.16 ? 278 ARG A CB  1 
ATOM   1953 C CG  . ARG A 1 279 ? 9.132   43.223 0.217   1.00 29.70 ? 278 ARG A CG  1 
ATOM   1954 C CD  . ARG A 1 279 ? 8.165   42.095 0.052   1.00 35.35 ? 278 ARG A CD  1 
ATOM   1955 N NE  . ARG A 1 279 ? 8.778   41.105 -0.828  1.00 34.07 ? 278 ARG A NE  1 
ATOM   1956 C CZ  . ARG A 1 279 ? 8.643   39.783 -0.729  1.00 32.58 ? 278 ARG A CZ  1 
ATOM   1957 N NH1 . ARG A 1 279 ? 7.824   39.250 0.157   1.00 27.89 ? 278 ARG A NH1 1 
ATOM   1958 N NH2 . ARG A 1 279 ? 9.322   38.993 -1.555  1.00 30.57 ? 278 ARG A NH2 1 
ATOM   1959 N N   . PRO A 1 280 ? 8.761   47.088 2.594   1.00 33.10 ? 279 PRO A N   1 
ATOM   1960 C CA  . PRO A 1 280 ? 8.434   47.997 3.679   1.00 35.41 ? 279 PRO A CA  1 
ATOM   1961 C C   . PRO A 1 280 ? 7.596   47.283 4.730   1.00 31.26 ? 279 PRO A C   1 
ATOM   1962 O O   . PRO A 1 280 ? 6.906   46.322 4.419   1.00 36.81 ? 279 PRO A O   1 
ATOM   1963 C CB  . PRO A 1 280 ? 7.595   49.093 2.977   1.00 29.83 ? 279 PRO A CB  1 
ATOM   1964 C CG  . PRO A 1 280 ? 6.993   48.405 1.842   1.00 33.68 ? 279 PRO A CG  1 
ATOM   1965 C CD  . PRO A 1 280 ? 8.015   47.421 1.368   1.00 32.70 ? 279 PRO A CD  1 
ATOM   1966 N N   . THR A 1 281 ? 7.696   47.762 5.963   1.00 39.32 ? 280 THR A N   1 
ATOM   1967 C CA  . THR A 1 281 ? 6.752   47.430 7.030   1.00 37.61 ? 280 THR A CA  1 
ATOM   1968 C C   . THR A 1 281 ? 5.409   48.154 6.772   1.00 38.51 ? 280 THR A C   1 
ATOM   1969 O O   . THR A 1 281 ? 5.327   49.056 5.930   1.00 37.79 ? 280 THR A O   1 
ATOM   1970 C CB  . THR A 1 281 ? 7.325   47.880 8.369   1.00 41.74 ? 280 THR A CB  1 
ATOM   1971 O OG1 . THR A 1 281 ? 7.477   49.309 8.360   1.00 39.48 ? 280 THR A OG1 1 
ATOM   1972 C CG2 . THR A 1 281 ? 8.725   47.190 8.657   1.00 33.25 ? 280 THR A CG2 1 
ATOM   1973 N N   . PHE A 1 282 ? 4.361   47.784 7.499   1.00 38.83 ? 281 PHE A N   1 
ATOM   1974 C CA  . PHE A 1 282 ? 3.059   48.489 7.357   1.00 41.61 ? 281 PHE A CA  1 
ATOM   1975 C C   . PHE A 1 282 ? 3.177   49.959 7.687   1.00 39.56 ? 281 PHE A C   1 
ATOM   1976 O O   . PHE A 1 282 ? 2.584   50.792 7.013   1.00 33.51 ? 281 PHE A O   1 
ATOM   1977 C CB  . PHE A 1 282 ? 1.966   47.823 8.173   1.00 40.16 ? 281 PHE A CB  1 
ATOM   1978 C CG  . PHE A 1 282 ? 1.447   46.594 7.522   1.00 44.78 ? 281 PHE A CG  1 
ATOM   1979 C CD1 . PHE A 1 282 ? 0.269   46.622 6.799   1.00 56.97 ? 281 PHE A CD1 1 
ATOM   1980 C CD2 . PHE A 1 282 ? 2.190   45.432 7.524   1.00 57.30 ? 281 PHE A CD2 1 
ATOM   1981 C CE1 . PHE A 1 282 ? -0.187  45.479 6.158   1.00 62.99 ? 281 PHE A CE1 1 
ATOM   1982 C CE2 . PHE A 1 282 ? 1.732   44.290 6.875   1.00 46.70 ? 281 PHE A CE2 1 
ATOM   1983 C CZ  . PHE A 1 282 ? 0.567   44.317 6.199   1.00 45.04 ? 281 PHE A CZ  1 
ATOM   1984 N N   . GLU A 1 283 ? 4.009   50.268 8.670   1.00 35.39 ? 282 GLU A N   1 
ATOM   1985 C CA  . GLU A 1 283 ? 4.292   51.645 9.049   1.00 33.44 ? 282 GLU A CA  1 
ATOM   1986 C C   . GLU A 1 283 ? 4.919   52.449 7.937   1.00 32.47 ? 282 GLU A C   1 
ATOM   1987 O O   . GLU A 1 283 ? 4.502   53.581 7.677   1.00 31.37 ? 282 GLU A O   1 
ATOM   1988 C CB  . GLU A 1 283 ? 5.212   51.640 10.246  1.00 33.34 ? 282 GLU A CB  1 
ATOM   1989 C CG  . GLU A 1 283 ? 5.544   52.985 10.775  1.00 36.74 ? 282 GLU A CG  1 
ATOM   1990 C CD  . GLU A 1 283 ? 6.415   52.907 11.995  1.00 43.37 ? 282 GLU A CD  1 
ATOM   1991 O OE1 . GLU A 1 283 ? 7.133   51.912 12.161  1.00 52.86 ? 282 GLU A OE1 1 
ATOM   1992 O OE2 . GLU A 1 283 ? 6.393   53.856 12.776  1.00 36.25 ? 282 GLU A OE2 1 
ATOM   1993 N N   . GLU A 1 284 ? 5.940   51.876 7.313   1.00 32.48 ? 283 GLU A N   1 
ATOM   1994 C CA  . GLU A 1 284 ? 6.593   52.484 6.160   1.00 34.85 ? 283 GLU A CA  1 
ATOM   1995 C C   . GLU A 1 284 ? 5.680   52.721 4.946   1.00 31.82 ? 283 GLU A C   1 
ATOM   1996 O O   . GLU A 1 284 ? 5.777   53.743 4.301   1.00 33.01 ? 283 GLU A O   1 
ATOM   1997 C CB  . GLU A 1 284 ? 7.817   51.671 5.769   1.00 34.16 ? 283 GLU A CB  1 
ATOM   1998 C CG  . GLU A 1 284 ? 8.971   51.858 6.759   1.00 36.74 ? 283 GLU A CG  1 
ATOM   1999 C CD  . GLU A 1 284 ? 10.155  51.014 6.390   1.00 37.61 ? 283 GLU A CD  1 
ATOM   2000 O OE1 . GLU A 1 284 ? 9.957   49.807 6.160   1.00 30.80 ? 283 GLU A OE1 1 
ATOM   2001 O OE2 . GLU A 1 284 ? 11.266  51.580 6.289   1.00 40.88 ? 283 GLU A OE2 1 
ATOM   2002 N N   . ILE A 1 285 ? 4.795   51.773 4.662   1.00 33.60 ? 284 ILE A N   1 
ATOM   2003 C CA  . ILE A 1 285 ? 3.760   51.924 3.633   1.00 32.43 ? 284 ILE A CA  1 
ATOM   2004 C C   . ILE A 1 285 ? 2.877   53.137 3.929   1.00 33.28 ? 284 ILE A C   1 
ATOM   2005 O O   . ILE A 1 285 ? 2.728   54.033 3.103   1.00 31.75 ? 284 ILE A O   1 
ATOM   2006 C CB  . ILE A 1 285 ? 2.881   50.631 3.503   1.00 36.63 ? 284 ILE A CB  1 
ATOM   2007 C CG1 . ILE A 1 285 ? 3.742   49.490 2.942   1.00 31.24 ? 284 ILE A CG1 1 
ATOM   2008 C CG2 . ILE A 1 285 ? 1.606   50.893 2.624   1.00 28.36 ? 284 ILE A CG2 1 
ATOM   2009 C CD1 . ILE A 1 285 ? 3.047   48.109 2.878   1.00 27.55 ? 284 ILE A CD1 1 
ATOM   2010 N N   . GLN A 1 286 ? 2.351   53.184 5.140   1.00 34.38 ? 285 GLN A N   1 
ATOM   2011 C CA  . GLN A 1 286 ? 1.423   54.233 5.551   1.00 35.50 ? 285 GLN A CA  1 
ATOM   2012 C C   . GLN A 1 286 ? 2.076   55.615 5.751   1.00 31.43 ? 285 GLN A C   1 
ATOM   2013 O O   . GLN A 1 286 ? 1.413   56.650 5.614   1.00 31.94 ? 285 GLN A O   1 
ATOM   2014 C CB  . GLN A 1 286 ? 0.676   53.773 6.807   1.00 30.79 ? 285 GLN A CB  1 
ATOM   2015 C CG  . GLN A 1 286 ? -0.238  52.582 6.561   1.00 32.15 ? 285 GLN A CG  1 
ATOM   2016 C CD  . GLN A 1 286 ? -1.291  52.463 7.638   1.00 31.75 ? 285 GLN A CD  1 
ATOM   2017 O OE1 . GLN A 1 286 ? -0.972  52.129 8.780   1.00 32.87 ? 285 GLN A OE1 1 
ATOM   2018 N NE2 . GLN A 1 286 ? -2.547  52.790 7.303   1.00 32.89 ? 285 GLN A NE2 1 
ATOM   2019 N N   . ASN A 1 287 ? 3.379   55.622 6.016   1.00 31.29 ? 286 ASN A N   1 
ATOM   2020 C CA  . ASN A 1 287 ? 4.176   56.858 6.014   1.00 27.52 ? 286 ASN A CA  1 
ATOM   2021 C C   . ASN A 1 287 ? 4.719   57.240 4.659   1.00 31.10 ? 286 ASN A C   1 
ATOM   2022 O O   . ASN A 1 287 ? 5.335   58.305 4.542   1.00 30.71 ? 286 ASN A O   1 
ATOM   2023 C CB  . ASN A 1 287 ? 5.330   56.793 7.039   1.00 24.70 ? 286 ASN A CB  1 
ATOM   2024 C CG  . ASN A 1 287 ? 4.828   56.865 8.479   1.00 38.56 ? 286 ASN A CG  1 
ATOM   2025 O OD1 . ASN A 1 287 ? 3.786   57.449 8.749   1.00 34.30 ? 286 ASN A OD1 1 
ATOM   2026 N ND2 . ASN A 1 287 ? 5.550   56.238 9.391   1.00 37.61 ? 286 ASN A ND2 1 
ATOM   2027 N N   . HIS A 1 288 ? 4.490   56.413 3.633   1.00 32.66 ? 287 HIS A N   1 
ATOM   2028 C CA  . HIS A 1 288 ? 4.958   56.745 2.269   1.00 31.04 ? 287 HIS A CA  1 
ATOM   2029 C C   . HIS A 1 288 ? 4.266   58.014 1.758   1.00 30.98 ? 287 HIS A C   1 
ATOM   2030 O O   . HIS A 1 288 ? 3.068   58.207 2.013   1.00 36.05 ? 287 HIS A O   1 
ATOM   2031 C CB  . HIS A 1 288 ? 4.692   55.590 1.281   1.00 30.47 ? 287 HIS A CB  1 
ATOM   2032 C CG  . HIS A 1 288 ? 5.471   55.674 -0.012  1.00 31.11 ? 287 HIS A CG  1 
ATOM   2033 N ND1 . HIS A 1 288 ? 5.058   56.433 -1.089  1.00 29.51 ? 287 HIS A ND1 1 
ATOM   2034 C CD2 . HIS A 1 288 ? 6.648   55.107 -0.389  1.00 34.30 ? 287 HIS A CD2 1 
ATOM   2035 C CE1 . HIS A 1 288 ? 5.932   56.317 -2.075  1.00 31.00 ? 287 HIS A CE1 1 
ATOM   2036 N NE2 . HIS A 1 288 ? 6.905   55.513 -1.680  1.00 29.85 ? 287 HIS A NE2 1 
ATOM   2037 N N   . PRO A 1 289 ? 5.013   58.887 1.042   1.00 30.65 ? 288 PRO A N   1 
ATOM   2038 C CA  . PRO A 1 289 ? 4.475   60.128 0.475   1.00 33.53 ? 288 PRO A CA  1 
ATOM   2039 C C   . PRO A 1 289 ? 3.220   59.952 -0.405  1.00 34.99 ? 288 PRO A C   1 
ATOM   2040 O O   . PRO A 1 289 ? 2.318   60.806 -0.370  1.00 33.26 ? 288 PRO A O   1 
ATOM   2041 C CB  . PRO A 1 289 ? 5.632   60.646 -0.392  1.00 33.38 ? 288 PRO A CB  1 
ATOM   2042 C CG  . PRO A 1 289 ? 6.845   60.075 0.204   1.00 34.44 ? 288 PRO A CG  1 
ATOM   2043 C CD  . PRO A 1 289 ? 6.484   58.803 0.874   1.00 29.19 ? 288 PRO A CD  1 
ATOM   2044 N N   . TRP A 1 290 ? 3.167   58.857 -1.170  1.00 32.95 ? 289 TRP A N   1 
ATOM   2045 C CA  . TRP A 1 290 ? 1.995   58.542 -1.970  1.00 32.25 ? 289 TRP A CA  1 
ATOM   2046 C C   . TRP A 1 290 ? 0.708   58.339 -1.119  1.00 35.14 ? 289 TRP A C   1 
ATOM   2047 O O   . TRP A 1 290 ? -0.379  58.620 -1.577  1.00 31.77 ? 289 TRP A O   1 
ATOM   2048 C CB  . TRP A 1 290 ? 2.240   57.341 -2.897  1.00 33.32 ? 289 TRP A CB  1 
ATOM   2049 C CG  . TRP A 1 290 ? 1.081   57.184 -3.819  1.00 35.48 ? 289 TRP A CG  1 
ATOM   2050 C CD1 . TRP A 1 290 ? 0.777   57.979 -4.893  1.00 29.47 ? 289 TRP A CD1 1 
ATOM   2051 C CD2 . TRP A 1 290 ? -0.008  56.271 -3.679  1.00 35.10 ? 289 TRP A CD2 1 
ATOM   2052 N NE1 . TRP A 1 290 ? -0.395  57.578 -5.452  1.00 33.38 ? 289 TRP A NE1 1 
ATOM   2053 C CE2 . TRP A 1 290 ? -0.902  56.528 -4.742  1.00 30.70 ? 289 TRP A CE2 1 
ATOM   2054 C CE3 . TRP A 1 290 ? -0.301  55.243 -2.782  1.00 32.60 ? 289 TRP A CE3 1 
ATOM   2055 C CZ2 . TRP A 1 290 ? -2.088  55.816 -4.916  1.00 32.51 ? 289 TRP A CZ2 1 
ATOM   2056 C CZ3 . TRP A 1 290 ? -1.461  54.550 -2.942  1.00 25.05 ? 289 TRP A CZ3 1 
ATOM   2057 C CH2 . TRP A 1 290 ? -2.332  54.799 -4.032  1.00 23.28 ? 289 TRP A CH2 1 
ATOM   2058 N N   . MET A 1 291 ? 0.856   57.901 0.126   1.00 34.82 ? 290 MET A N   1 
ATOM   2059 C CA  . MET A 1 291 ? -0.258  57.587 1.011   1.00 36.14 ? 290 MET A CA  1 
ATOM   2060 C C   . MET A 1 291 ? -0.817  58.784 1.813   1.00 37.97 ? 290 MET A C   1 
ATOM   2061 O O   . MET A 1 291 ? -1.744  58.614 2.620   1.00 39.48 ? 290 MET A O   1 
ATOM   2062 C CB  . MET A 1 291 ? 0.173   56.466 1.986   1.00 34.96 ? 290 MET A CB  1 
ATOM   2063 C CG  . MET A 1 291 ? 0.394   55.125 1.334   1.00 37.11 ? 290 MET A CG  1 
ATOM   2064 S SD  . MET A 1 291 ? -0.953  53.939 1.456   1.00 40.21 ? 290 MET A SD  1 
ATOM   2065 C CE  . MET A 1 291 ? -2.296  54.783 0.673   1.00 26.58 ? 290 MET A CE  1 
ATOM   2066 N N   . GLN A 1 292 ? -0.274  59.985 1.604   1.00 38.59 ? 291 GLN A N   1 
ATOM   2067 C CA  . GLN A 1 292 ? -0.674  61.133 2.403   1.00 37.66 ? 291 GLN A CA  1 
ATOM   2068 C C   . GLN A 1 292 ? -1.986  61.768 1.884   1.00 36.91 ? 291 GLN A C   1 
ATOM   2069 O O   . GLN A 1 292 ? -2.420  61.532 0.729   1.00 36.03 ? 291 GLN A O   1 
ATOM   2070 C CB  . GLN A 1 292 ? 0.484   62.136 2.563   1.00 41.19 ? 291 GLN A CB  1 
ATOM   2071 C CG  . GLN A 1 292 ? 1.837   61.502 3.155   1.00 45.32 ? 291 GLN A CG  1 
ATOM   2072 C CD  . GLN A 1 292 ? 1.679   60.507 4.374   1.00 53.54 ? 291 GLN A CD  1 
ATOM   2073 O OE1 . GLN A 1 292 ? 1.383   60.931 5.486   1.00 47.06 ? 291 GLN A OE1 1 
ATOM   2074 N NE2 . GLN A 1 292 ? 1.909   59.188 4.147   1.00 30.59 ? 291 GLN A NE2 1 
ATOM   2075 N N   . ASP A 1 293 ? -2.646  62.510 2.781   1.00 36.33 ? 292 ASP A N   1 
ATOM   2076 C CA  . ASP A 1 293 ? -3.933  63.197 2.498   1.00 38.35 ? 292 ASP A CA  1 
ATOM   2077 C C   . ASP A 1 293 ? -5.045  62.258 1.974   1.00 34.98 ? 292 ASP A C   1 
ATOM   2078 O O   . ASP A 1 293 ? -5.727  62.563 0.990   1.00 37.21 ? 292 ASP A O   1 
ATOM   2079 C CB  . ASP A 1 293 ? -3.722  64.353 1.508   1.00 41.89 ? 292 ASP A CB  1 
ATOM   2080 C CG  . ASP A 1 293 ? -2.676  65.329 1.974   1.00 51.01 ? 292 ASP A CG  1 
ATOM   2081 O OD1 . ASP A 1 293 ? -2.901  65.950 3.034   1.00 70.92 ? 292 ASP A OD1 1 
ATOM   2082 O OD2 . ASP A 1 293 ? -1.641  65.482 1.277   1.00 66.83 ? 292 ASP A OD2 1 
ATOM   2083 N N   . VAL A 1 294 ? -5.203  61.114 2.625   1.00 33.12 ? 293 VAL A N   1 
ATOM   2084 C CA  . VAL A 1 294 ? -6.218  60.157 2.257   1.00 33.93 ? 293 VAL A CA  1 
ATOM   2085 C C   . VAL A 1 294 ? -7.626  60.757 2.442   1.00 32.19 ? 293 VAL A C   1 
ATOM   2086 O O   . VAL A 1 294 ? -7.881  61.534 3.373   1.00 34.96 ? 293 VAL A O   1 
ATOM   2087 C CB  . VAL A 1 294 ? -6.080  58.771 3.024   1.00 33.68 ? 293 VAL A CB  1 
ATOM   2088 C CG1 . VAL A 1 294 ? -6.506  58.891 4.502   1.00 35.27 ? 293 VAL A CG1 1 
ATOM   2089 C CG2 . VAL A 1 294 ? -6.912  57.710 2.325   1.00 28.85 ? 293 VAL A CG2 1 
ATOM   2090 N N   . LEU A 1 295 ? -8.533  60.378 1.545   1.00 32.01 ? 294 LEU A N   1 
ATOM   2091 C CA  . LEU A 1 295 ? -9.957  60.698 1.695   1.00 31.36 ? 294 LEU A CA  1 
ATOM   2092 C C   . LEU A 1 295 ? -10.575 59.901 2.849   1.00 30.51 ? 294 LEU A C   1 
ATOM   2093 O O   . LEU A 1 295 ? -10.186 58.753 3.113   1.00 34.75 ? 294 LEU A O   1 
ATOM   2094 C CB  . LEU A 1 295 ? -10.732 60.429 0.388   1.00 27.98 ? 294 LEU A CB  1 
ATOM   2095 C CG  . LEU A 1 295 ? -10.478 61.254 -0.866  1.00 27.08 ? 294 LEU A CG  1 
ATOM   2096 C CD1 . LEU A 1 295 ? -11.453 60.765 -2.013  1.00 29.89 ? 294 LEU A CD1 1 
ATOM   2097 C CD2 . LEU A 1 295 ? -10.627 62.761 -0.643  1.00 23.19 ? 294 LEU A CD2 1 
ATOM   2098 N N   . LEU A 1 296 ? -11.539 60.522 3.538   1.00 29.96 ? 295 LEU A N   1 
ATOM   2099 C CA  . LEU A 1 296 ? -12.418 59.819 4.454   1.00 28.19 ? 295 LEU A CA  1 
ATOM   2100 C C   . LEU A 1 296 ? -13.322 58.893 3.641   1.00 32.00 ? 295 LEU A C   1 
ATOM   2101 O O   . LEU A 1 296 ? -13.507 59.114 2.434   1.00 30.77 ? 295 LEU A O   1 
ATOM   2102 C CB  . LEU A 1 296 ? -13.249 60.793 5.293   1.00 34.40 ? 295 LEU A CB  1 
ATOM   2103 C CG  . LEU A 1 296 ? -12.489 61.860 6.060   1.00 31.38 ? 295 LEU A CG  1 
ATOM   2104 C CD1 . LEU A 1 296 ? -13.534 62.612 6.924   1.00 33.69 ? 295 LEU A CD1 1 
ATOM   2105 C CD2 . LEU A 1 296 ? -11.305 61.324 6.892   1.00 34.56 ? 295 LEU A CD2 1 
ATOM   2106 N N   . PRO A 1 297 ? -13.804 57.800 4.257   1.00 33.89 ? 296 PRO A N   1 
ATOM   2107 C CA  . PRO A 1 297 ? -14.718 56.893 3.544   1.00 35.26 ? 296 PRO A CA  1 
ATOM   2108 C C   . PRO A 1 297 ? -15.949 57.602 2.913   1.00 32.29 ? 296 PRO A C   1 
ATOM   2109 O O   . PRO A 1 297 ? -16.249 57.411 1.720   1.00 31.75 ? 296 PRO A O   1 
ATOM   2110 C CB  . PRO A 1 297 ? -15.141 55.900 4.644   1.00 35.96 ? 296 PRO A CB  1 
ATOM   2111 C CG  . PRO A 1 297 ? -13.919 55.793 5.514   1.00 32.99 ? 296 PRO A CG  1 
ATOM   2112 C CD  . PRO A 1 297 ? -13.367 57.224 5.551   1.00 36.98 ? 296 PRO A CD  1 
ATOM   2113 N N   . GLN A 1 298 ? -16.604 58.467 3.674   1.00 35.22 ? 297 GLN A N   1 
ATOM   2114 C CA  . GLN A 1 298 ? -17.759 59.207 3.140   1.00 36.07 ? 297 GLN A CA  1 
ATOM   2115 C C   . GLN A 1 298 ? -17.434 60.122 1.965   1.00 31.28 ? 297 GLN A C   1 
ATOM   2116 O O   . GLN A 1 298 ? -18.227 60.222 1.053   1.00 35.85 ? 297 GLN A O   1 
ATOM   2117 C CB  . GLN A 1 298 ? -18.501 59.978 4.246   1.00 38.59 ? 297 GLN A CB  1 
ATOM   2118 C CG  . GLN A 1 298 ? -19.886 60.604 3.816   1.00 45.47 ? 297 GLN A CG  1 
ATOM   2119 C CD  . GLN A 1 298 ? -20.893 59.637 3.110   1.00 59.68 ? 297 GLN A CD  1 
ATOM   2120 O OE1 . GLN A 1 298 ? -20.836 58.396 3.245   1.00 52.51 ? 297 GLN A OE1 1 
ATOM   2121 N NE2 . GLN A 1 298 ? -21.841 60.231 2.366   1.00 64.33 ? 297 GLN A NE2 1 
ATOM   2122 N N   . GLU A 1 299 ? -16.274 60.771 1.979   1.00 33.52 ? 298 GLU A N   1 
ATOM   2123 C CA  . GLU A 1 299 ? -15.797 61.577 0.840   1.00 32.79 ? 298 GLU A CA  1 
ATOM   2124 C C   . GLU A 1 299 ? -15.541 60.700 -0.387  1.00 34.85 ? 298 GLU A C   1 
ATOM   2125 O O   . GLU A 1 299 ? -15.876 61.066 -1.511  1.00 38.70 ? 298 GLU A O   1 
ATOM   2126 C CB  . GLU A 1 299 ? -14.494 62.309 1.203   1.00 32.15 ? 298 GLU A CB  1 
ATOM   2127 C CG  . GLU A 1 299 ? -14.636 63.456 2.210   1.00 34.69 ? 298 GLU A CG  1 
ATOM   2128 C CD  . GLU A 1 299 ? -13.298 63.906 2.792   1.00 42.91 ? 298 GLU A CD  1 
ATOM   2129 O OE1 . GLU A 1 299 ? -12.300 63.163 2.677   1.00 37.24 ? 298 GLU A OE1 1 
ATOM   2130 O OE2 . GLU A 1 299 ? -13.246 64.998 3.392   1.00 46.24 ? 298 GLU A OE2 1 
ATOM   2131 N N   . THR A 1 300 ? -14.894 59.557 -0.165  1.00 28.91 ? 299 THR A N   1 
ATOM   2132 C CA  . THR A 1 300 ? -14.705 58.554 -1.197  1.00 31.03 ? 299 THR A CA  1 
ATOM   2133 C C   . THR A 1 300 ? -16.043 58.160 -1.849  1.00 33.39 ? 299 THR A C   1 
ATOM   2134 O O   . THR A 1 300 ? -16.136 58.124 -3.069  1.00 31.44 ? 299 THR A O   1 
ATOM   2135 C CB  . THR A 1 300 ? -14.010 57.300 -0.630  1.00 31.61 ? 299 THR A CB  1 
ATOM   2136 O OG1 . THR A 1 300 ? -12.813 57.675 0.083   1.00 34.67 ? 299 THR A OG1 1 
ATOM   2137 C CG2 . THR A 1 300 ? -13.676 56.333 -1.736  1.00 25.91 ? 299 THR A CG2 1 
ATOM   2138 N N   . ALA A 1 301 ? -17.058 57.864 -1.028  1.00 34.53 ? 300 ALA A N   1 
ATOM   2139 C CA  . ALA A 1 301 ? -18.381 57.489 -1.521  1.00 32.78 ? 300 ALA A CA  1 
ATOM   2140 C C   . ALA A 1 301 ? -19.017 58.638 -2.303  1.00 34.75 ? 300 ALA A C   1 
ATOM   2141 O O   . ALA A 1 301 ? -19.476 58.424 -3.407  1.00 34.41 ? 300 ALA A O   1 
ATOM   2142 C CB  . ALA A 1 301 ? -19.312 57.023 -0.362  1.00 30.94 ? 300 ALA A CB  1 
ATOM   2143 N N   . GLU A 1 302 ? -18.992 59.859 -1.754  1.00 34.50 ? 301 GLU A N   1 
ATOM   2144 C CA  . GLU A 1 302 ? -19.572 61.030 -2.423  1.00 33.97 ? 301 GLU A CA  1 
ATOM   2145 C C   . GLU A 1 302 ? -18.907 61.372 -3.754  1.00 35.85 ? 301 GLU A C   1 
ATOM   2146 O O   . GLU A 1 302 ? -19.601 61.647 -4.753  1.00 34.80 ? 301 GLU A O   1 
ATOM   2147 C CB  . GLU A 1 302 ? -19.577 62.247 -1.498  1.00 31.29 ? 301 GLU A CB  1 
ATOM   2148 C CG  . GLU A 1 302 ? -20.552 62.091 -0.312  1.00 50.38 ? 301 GLU A CG  1 
ATOM   2149 C CD  . GLU A 1 302 ? -20.321 63.074 0.840   1.00 57.28 ? 301 GLU A CD  1 
ATOM   2150 O OE1 . GLU A 1 302 ? -19.271 63.764 0.884   1.00 66.26 ? 301 GLU A OE1 1 
ATOM   2151 O OE2 . GLU A 1 302 ? -21.208 63.135 1.720   1.00 61.81 ? 301 GLU A OE2 1 
ATOM   2152 N N   . ILE A 1 303 ? -17.580 61.344 -3.775  1.00 32.35 ? 302 ILE A N   1 
ATOM   2153 C CA  . ILE A 1 303 ? -16.811 61.684 -4.986  1.00 32.71 ? 302 ILE A CA  1 
ATOM   2154 C C   . ILE A 1 303 ? -16.809 60.575 -6.039  1.00 31.11 ? 302 ILE A C   1 
ATOM   2155 O O   . ILE A 1 303 ? -16.937 60.842 -7.238  1.00 34.68 ? 302 ILE A O   1 
ATOM   2156 C CB  . ILE A 1 303 ? -15.340 62.048 -4.650  1.00 32.27 ? 302 ILE A CB  1 
ATOM   2157 C CG1 . ILE A 1 303 ? -15.277 63.232 -3.648  1.00 38.38 ? 302 ILE A CG1 1 
ATOM   2158 C CG2 . ILE A 1 303 ? -14.607 62.445 -5.887  1.00 33.53 ? 302 ILE A CG2 1 
ATOM   2159 C CD1 . ILE A 1 303 ? -13.886 63.496 -3.072  1.00 35.46 ? 302 ILE A CD1 1 
ATOM   2160 N N   . HIS A 1 304 ? -16.626 59.333 -5.615  1.00 31.70 ? 303 HIS A N   1 
ATOM   2161 C CA  . HIS A 1 304 ? -16.259 58.293 -6.572  1.00 33.20 ? 303 HIS A CA  1 
ATOM   2162 C C   . HIS A 1 304 ? -17.299 57.194 -6.730  1.00 36.81 ? 303 HIS A C   1 
ATOM   2163 O O   . HIS A 1 304 ? -17.229 56.436 -7.717  1.00 32.42 ? 303 HIS A O   1 
ATOM   2164 C CB  . HIS A 1 304 ? -14.925 57.648 -6.197  1.00 35.44 ? 303 HIS A CB  1 
ATOM   2165 C CG  . HIS A 1 304 ? -13.734 58.545 -6.346  1.00 30.99 ? 303 HIS A CG  1 
ATOM   2166 N ND1 . HIS A 1 304 ? -13.180 58.859 -7.570  1.00 29.70 ? 303 HIS A ND1 1 
ATOM   2167 C CD2 . HIS A 1 304 ? -12.969 59.162 -5.418  1.00 28.33 ? 303 HIS A CD2 1 
ATOM   2168 C CE1 . HIS A 1 304 ? -12.132 59.644 -7.383  1.00 29.73 ? 303 HIS A CE1 1 
ATOM   2169 N NE2 . HIS A 1 304 ? -11.982 59.842 -6.087  1.00 30.98 ? 303 HIS A NE2 1 
ATOM   2170 N N   . LEU A 1 305 ? -18.244 57.095 -5.783  1.00 37.24 ? 304 LEU A N   1 
ATOM   2171 C CA  . LEU A 1 305 ? -19.169 55.962 -5.733  1.00 37.74 ? 304 LEU A CA  1 
ATOM   2172 C C   . LEU A 1 305 ? -20.646 56.355 -5.910  1.00 41.40 ? 304 LEU A C   1 
ATOM   2173 O O   . LEU A 1 305 ? -21.383 55.603 -6.530  1.00 46.80 ? 304 LEU A O   1 
ATOM   2174 C CB  . LEU A 1 305 ? -18.961 55.139 -4.435  1.00 38.95 ? 304 LEU A CB  1 
ATOM   2175 C CG  . LEU A 1 305 ? -17.563 54.640 -3.997  1.00 37.53 ? 304 LEU A CG  1 
ATOM   2176 C CD1 . LEU A 1 305 ? -17.671 53.800 -2.733  1.00 30.68 ? 304 LEU A CD1 1 
ATOM   2177 C CD2 . LEU A 1 305 ? -16.804 53.842 -5.062  1.00 35.26 ? 304 LEU A CD2 1 
ATOM   2178 N N   . HIS A 1 306 ? -21.101 57.501 -5.388  1.00 46.72 ? 305 HIS A N   1 
ATOM   2179 C CA  . HIS A 1 306 ? -22.522 57.892 -5.540  1.00 51.65 ? 305 HIS A CA  1 
ATOM   2180 C C   . HIS A 1 306 ? -22.709 58.491 -6.929  1.00 54.11 ? 305 HIS A C   1 
ATOM   2181 O O   . HIS A 1 306 ? -23.402 57.912 -7.770  1.00 56.83 ? 305 HIS A O   1 
ATOM   2182 C CB  . HIS A 1 306 ? -23.024 58.896 -4.475  1.00 50.41 ? 305 HIS A CB  1 
ATOM   2183 C CG  . HIS A 1 306 ? -22.867 58.434 -3.056  1.00 53.36 ? 305 HIS A CG  1 
ATOM   2184 N ND1 . HIS A 1 306 ? -22.852 59.311 -1.989  1.00 40.15 ? 305 HIS A ND1 1 
ATOM   2185 C CD2 . HIS A 1 306 ? -22.691 57.197 -2.528  1.00 47.99 ? 305 HIS A CD2 1 
ATOM   2186 C CE1 . HIS A 1 306 ? -22.683 58.633 -0.867  1.00 49.12 ? 305 HIS A CE1 1 
ATOM   2187 N NE2 . HIS A 1 306 ? -22.584 57.349 -1.168  1.00 49.08 ? 305 HIS A NE2 1 
ATOM   2188 N N   . ARG B 2 2   ? -6.800  43.227 -23.676 1.00 58.08 ? 2   ARG B N   1 
ATOM   2189 C CA  . ARG B 2 2   ? -6.111  42.104 -22.944 1.00 57.27 ? 2   ARG B CA  1 
ATOM   2190 C C   . ARG B 2 2   ? -7.003  41.496 -21.862 1.00 55.46 ? 2   ARG B C   1 
ATOM   2191 O O   . ARG B 2 2   ? -7.740  42.227 -21.173 1.00 55.64 ? 2   ARG B O   1 
ATOM   2192 C CB  . ARG B 2 2   ? -4.801  42.585 -22.303 1.00 59.09 ? 2   ARG B CB  1 
ATOM   2193 C CG  . ARG B 2 2   ? -4.016  41.508 -21.513 1.00 49.99 ? 2   ARG B CG  1 
ATOM   2194 C CD  . ARG B 2 2   ? -2.800  42.127 -20.821 1.00 57.71 ? 2   ARG B CD  1 
ATOM   2195 N NE  . ARG B 2 2   ? -1.959  42.900 -21.745 1.00 52.37 ? 2   ARG B NE  1 
ATOM   2196 C CZ  . ARG B 2 2   ? -1.944  44.231 -21.863 1.00 44.86 ? 2   ARG B CZ  1 
ATOM   2197 N NH1 . ARG B 2 2   ? -2.681  45.010 -21.081 1.00 44.68 ? 2   ARG B NH1 1 
ATOM   2198 N NH2 . ARG B 2 2   ? -1.148  44.798 -22.759 1.00 33.51 ? 2   ARG B NH2 1 
ATOM   2199 N N   . LYS B 2 3   ? -6.874  40.174 -21.672 1.00 51.70 ? 3   LYS B N   1 
ATOM   2200 C CA  . LYS B 2 3   ? -7.816  39.422 -20.840 1.00 48.44 ? 3   LYS B CA  1 
ATOM   2201 C C   . LYS B 2 3   ? -7.504  39.409 -19.319 1.00 41.07 ? 3   LYS B C   1 
ATOM   2202 O O   . LYS B 2 3   ? -6.527  38.842 -18.865 1.00 44.85 ? 3   LYS B O   1 
ATOM   2203 C CB  . LYS B 2 3   ? -7.991  37.991 -21.362 1.00 46.53 ? 3   LYS B CB  1 
ATOM   2204 C CG  . LYS B 2 3   ? -9.386  37.442 -21.093 1.00 47.77 ? 3   LYS B CG  1 
ATOM   2205 N N   . ARG B 2 4   ? -8.405  40.022 -18.569 1.00 33.36 ? 4   ARG B N   1 
ATOM   2206 C CA  . ARG B 2 4   ? -8.428  40.008 -17.115 1.00 32.21 ? 4   ARG B CA  1 
ATOM   2207 C C   . ARG B 2 4   ? -9.284  38.844 -16.634 1.00 32.66 ? 4   ARG B C   1 
ATOM   2208 O O   . ARG B 2 4   ? -10.381 38.601 -17.150 1.00 33.62 ? 4   ARG B O   1 
ATOM   2209 C CB  . ARG B 2 4   ? -9.015  41.336 -16.630 1.00 32.75 ? 4   ARG B CB  1 
ATOM   2210 C CG  . ARG B 2 4   ? -9.165  41.504 -15.146 1.00 23.88 ? 4   ARG B CG  1 
ATOM   2211 C CD  . ARG B 2 4   ? -9.658  42.904 -14.839 1.00 22.29 ? 4   ARG B CD  1 
ATOM   2212 N NE  . ARG B 2 4   ? -10.255 43.017 -13.491 1.00 31.56 ? 4   ARG B NE  1 
ATOM   2213 C CZ  . ARG B 2 4   ? -9.570  43.072 -12.347 1.00 19.16 ? 4   ARG B CZ  1 
ATOM   2214 N NH1 . ARG B 2 4   ? -10.233 43.176 -11.193 1.00 15.89 ? 4   ARG B NH1 1 
ATOM   2215 N NH2 . ARG B 2 4   ? -8.236  43.007 -12.330 1.00 25.36 ? 4   ARG B NH2 1 
ATOM   2216 N N   . ARG B 2 5   ? -8.770  38.106 -15.653 1.00 32.68 ? 5   ARG B N   1 
ATOM   2217 C CA  . ARG B 2 5   ? -9.471  36.940 -15.139 1.00 28.22 ? 5   ARG B CA  1 
ATOM   2218 C C   . ARG B 2 5   ? -9.363  36.821 -13.626 1.00 27.34 ? 5   ARG B C   1 
ATOM   2219 O O   . ARG B 2 5   ? -8.491  37.409 -13.007 1.00 33.54 ? 5   ARG B O   1 
ATOM   2220 C CB  . ARG B 2 5   ? -8.951  35.678 -15.819 1.00 26.12 ? 5   ARG B CB  1 
ATOM   2221 C CG  . ARG B 2 5   ? -7.475  35.341 -15.624 1.00 39.69 ? 5   ARG B CG  1 
ATOM   2222 C CD  . ARG B 2 5   ? -7.198  34.005 -16.311 1.00 53.02 ? 5   ARG B CD  1 
ATOM   2223 N NE  . ARG B 2 5   ? -6.090  33.221 -15.773 1.00 51.39 ? 5   ARG B NE  1 
ATOM   2224 C CZ  . ARG B 2 5   ? -6.170  32.319 -14.781 1.00 66.58 ? 5   ARG B CZ  1 
ATOM   2225 N NH1 . ARG B 2 5   ? -7.308  32.060 -14.103 1.00 43.80 ? 5   ARG B NH1 1 
ATOM   2226 N NH2 . ARG B 2 5   ? -5.058  31.677 -14.437 1.00 81.00 ? 5   ARG B NH2 1 
ATOM   2227 N N   . ARG B 2 6   ? -10.298 36.090 -13.051 1.00 26.13 ? 6   ARG B N   1 
ATOM   2228 C CA  . ARG B 2 6   ? -10.256 35.731 -11.667 1.00 25.88 ? 6   ARG B CA  1 
ATOM   2229 C C   . ARG B 2 6   ? -9.268  34.600 -11.560 1.00 24.47 ? 6   ARG B C   1 
ATOM   2230 O O   . ARG B 2 6   ? -8.876  34.028 -12.570 1.00 26.43 ? 6   ARG B O   1 
ATOM   2231 C CB  . ARG B 2 6   ? -11.639 35.333 -11.154 1.00 22.62 ? 6   ARG B CB  1 
ATOM   2232 C CG  . ARG B 2 6   ? -12.593 36.501 -11.040 1.00 23.02 ? 6   ARG B CG  1 
ATOM   2233 C CD  . ARG B 2 6   ? -13.934 36.026 -10.574 1.00 20.35 ? 6   ARG B CD  1 
ATOM   2234 N NE  . ARG B 2 6   ? -14.837 37.113 -10.294 1.00 25.14 ? 6   ARG B NE  1 
ATOM   2235 C CZ  . ARG B 2 6   ? -15.000 37.701 -9.112  1.00 28.77 ? 6   ARG B CZ  1 
ATOM   2236 N NH1 . ARG B 2 6   ? -14.326 37.312 -8.042  1.00 31.32 ? 6   ARG B NH1 1 
ATOM   2237 N NH2 . ARG B 2 6   ? -15.844 38.710 -9.020  1.00 26.53 ? 6   ARG B NH2 1 
ATOM   2238 N N   . HIS B 2 7   ? -8.797  34.357 -10.338 1.00 28.77 ? 7   HIS B N   1 
ATOM   2239 C CA  . HIS B 2 7   ? -7.835  33.298 -10.036 1.00 27.69 ? 7   HIS B CA  1 
ATOM   2240 C C   . HIS B 2 7   ? -8.237  32.555 -8.744  1.00 31.18 ? 7   HIS B C   1 
ATOM   2241 O O   . HIS B 2 7   ? -8.201  33.130 -7.658  1.00 33.78 ? 7   HIS B O   1 
ATOM   2242 C CB  . HIS B 2 7   ? -6.441  33.866 -9.863  1.00 30.78 ? 7   HIS B CB  1 
ATOM   2243 C CG  . HIS B 2 7   ? -5.936  34.619 -11.051 1.00 16.15 ? 7   HIS B CG  1 
ATOM   2244 N ND1 . HIS B 2 7   ? -6.230  35.947 -11.266 1.00 20.42 ? 7   HIS B ND1 1 
ATOM   2245 C CD2 . HIS B 2 7   ? -5.124  34.240 -12.061 1.00 21.20 ? 7   HIS B CD2 1 
ATOM   2246 C CE1 . HIS B 2 7   ? -5.627  36.348 -12.366 1.00 21.83 ? 7   HIS B CE1 1 
ATOM   2247 N NE2 . HIS B 2 7   ? -4.932  35.336 -12.853 1.00 21.15 ? 7   HIS B NE2 1 
ATOM   2248 N N   . PRO B 2 8   ? -8.631  31.280 -8.859  1.00 34.09 ? 8   PRO B N   1 
ATOM   2249 C CA  . PRO B 2 8   ? -9.015  30.524 -7.657  1.00 35.44 ? 8   PRO B CA  1 
ATOM   2250 C C   . PRO B 2 8   ? -7.876  30.371 -6.648  1.00 30.82 ? 8   PRO B C   1 
ATOM   2251 O O   . PRO B 2 8   ? -6.722  30.414 -7.010  1.00 31.46 ? 8   PRO B O   1 
ATOM   2252 C CB  . PRO B 2 8   ? -9.424  29.142 -8.214  1.00 34.32 ? 8   PRO B CB  1 
ATOM   2253 C CG  . PRO B 2 8   ? -9.940  29.436 -9.602  1.00 43.50 ? 8   PRO B CG  1 
ATOM   2254 C CD  . PRO B 2 8   ? -9.007  30.569 -10.102 1.00 40.62 ? 8   PRO B CD  1 
ATOM   2255 N N   . SER B 2 9   ? -8.221  30.144 -5.393  1.00 35.06 ? 9   SER B N   1 
ATOM   2256 C CA  . SER B 2 9   ? -7.225  30.023 -4.327  1.00 39.23 ? 9   SER B CA  1 
ATOM   2257 C C   . SER B 2 9   ? -6.400  28.729 -4.341  1.00 42.54 ? 9   SER B C   1 
ATOM   2258 O O   . SER B 2 9   ? -6.764  27.760 -4.987  1.00 46.71 ? 9   SER B O   1 
ATOM   2259 C CB  . SER B 2 9   ? -7.915  30.184 -2.982  1.00 35.69 ? 9   SER B CB  1 
ATOM   2260 O OG  . SER B 2 9   ? -8.502  31.469 -2.918  1.00 39.81 ? 9   SER B OG  1 
HETATM 2261 C C1  . EDO C 3 .   ? -15.919 35.728 5.382   1.00 42.13 ? 401 EDO A C1  1 
HETATM 2262 O O1  . EDO C 3 .   ? -16.235 35.422 4.045   1.00 28.01 ? 401 EDO A O1  1 
HETATM 2263 C C2  . EDO C 3 .   ? -15.554 34.448 6.078   1.00 29.18 ? 401 EDO A C2  1 
HETATM 2264 O O2  . EDO C 3 .   ? -14.159 34.126 5.981   1.00 25.06 ? 401 EDO A O2  1 
HETATM 2265 C C1W . JN5 D 4 .   ? -20.404 39.446 -2.172  1.00 33.62 ? 501 JN5 A C1W 1 
HETATM 2266 C C1X . JN5 D 4 .   ? -21.570 40.138 -1.892  1.00 35.87 ? 501 JN5 A C1X 1 
HETATM 2267 C C1Y . JN5 D 4 .   ? -22.450 40.391 -2.936  1.00 41.03 ? 501 JN5 A C1Y 1 
HETATM 2268 N N1Z . JN5 D 4 .   ? -22.172 39.971 -4.168  1.00 52.10 ? 501 JN5 A N1Z 1 
HETATM 2269 C C2A . JN5 D 4 .   ? -21.051 39.309 -4.467  1.00 45.20 ? 501 JN5 A C2A 1 
HETATM 2270 C C1V . JN5 D 4 .   ? -20.135 39.040 -3.468  1.00 26.08 ? 501 JN5 A C1V 1 
HETATM 2271 C C1U . JN5 D 4 .   ? -18.856 38.296 -3.754  1.00 33.52 ? 501 JN5 A C1U 1 
HETATM 2272 C C1T . JN5 D 4 .   ? -19.028 36.792 -3.736  1.00 25.84 ? 501 JN5 A C1T 1 
HETATM 2273 N N1S . JN5 D 4 .   ? -17.766 36.190 -4.141  1.00 27.75 ? 501 JN5 A N1S 1 
HETATM 2274 C C2  . JN5 D 4 .   ? -16.949 35.593 -3.260  1.00 27.33 ? 501 JN5 A C2  1 
HETATM 2275 N N3  . JN5 D 4 .   ? -17.329 35.492 -1.973  1.00 26.58 ? 501 JN5 A N3  1 
HETATM 2276 N N1  . JN5 D 4 .   ? -15.754 35.107 -3.678  1.00 30.55 ? 501 JN5 A N1  1 
HETATM 2277 C C6  . JN5 D 4 .   ? -14.937 34.499 -2.828  1.00 36.75 ? 501 JN5 A C6  1 
HETATM 2278 C C5  . JN5 D 4 .   ? -15.314 34.372 -1.491  1.00 31.50 ? 501 JN5 A C5  1 
HETATM 2279 C C4  . JN5 D 4 .   ? -16.539 34.884 -1.066  1.00 32.91 ? 501 JN5 A C4  1 
HETATM 2280 C C1J . JN5 D 4 .   ? -16.928 34.813 0.276   1.00 21.71 ? 501 JN5 A C1J 1 
HETATM 2281 C C1K . JN5 D 4 .   ? -16.226 33.931 1.139   1.00 26.66 ? 501 JN5 A C1K 1 
HETATM 2282 N N1L . JN5 D 4 .   ? -15.653 33.187 1.764   1.00 29.10 ? 501 JN5 A N1L 1 
HETATM 2283 C C1I . JN5 D 4 .   ? -17.845 35.720 0.777   1.00 25.73 ? 501 JN5 A C1I 1 
HETATM 2284 N N1G . JN5 D 4 .   ? -18.010 36.006 2.133   1.00 20.49 ? 501 JN5 A N1G 1 
HETATM 2285 C C1E . JN5 D 4 .   ? -18.989 36.979 2.385   1.00 18.44 ? 501 JN5 A C1E 1 
HETATM 2286 C C1C . JN5 D 4 .   ? -19.423 37.509 3.606   1.00 21.56 ? 501 JN5 A C1C 1 
HETATM 2287 C C1A . JN5 D 4 .   ? -20.403 38.501 3.624   1.00 22.56 ? 501 JN5 A C1A 1 
HETATM 2288 C C1B . JN5 D 4 .   ? -20.996 38.953 2.434   1.00 29.15 ? 501 JN5 A C1B 1 
HETATM 2289 C C1D . JN5 D 4 .   ? -20.589 38.421 1.201   1.00 31.26 ? 501 JN5 A C1D 1 
HETATM 2290 C C1F . JN5 D 4 .   ? -19.582 37.442 1.194   1.00 23.26 ? 501 JN5 A C1F 1 
HETATM 2291 S S1H . JN5 D 4 .   ? -18.953 36.693 -0.206  1.00 26.41 ? 501 JN5 A S1H 1 
HETATM 2292 O O   . HOH E 5 .   ? -4.366  36.582 -2.781  1.00 17.04 ? 502 HOH A O   1 
HETATM 2293 O O   . HOH E 5 .   ? 1.335   44.592 10.833  1.00 34.93 ? 503 HOH A O   1 
HETATM 2294 O O   . HOH E 5 .   ? 3.364   54.833 -15.690 1.00 15.87 ? 504 HOH A O   1 
HETATM 2295 O O   . HOH E 5 .   ? 6.150   34.514 9.764   1.00 21.81 ? 505 HOH A O   1 
HETATM 2296 O O   . HOH E 5 .   ? 0.207   39.396 -10.220 1.00 16.23 ? 506 HOH A O   1 
HETATM 2297 O O   . HOH E 5 .   ? -3.260  32.311 -9.120  1.00 23.20 ? 507 HOH A O   1 
HETATM 2298 O O   . HOH E 5 .   ? -2.827  39.212 6.459   1.00 13.39 ? 508 HOH A O   1 
HETATM 2299 O O   . HOH E 5 .   ? 8.520   36.167 3.273   1.00 16.48 ? 509 HOH A O   1 
HETATM 2300 O O   . HOH E 5 .   ? -7.894  33.520 3.686   1.00 20.69 ? 510 HOH A O   1 
HETATM 2301 O O   . HOH E 5 .   ? -1.618  37.758 4.091   1.00 25.85 ? 511 HOH A O   1 
HETATM 2302 O O   . HOH E 5 .   ? -7.466  59.416 -1.096  1.00 20.50 ? 512 HOH A O   1 
HETATM 2303 O O   . HOH E 5 .   ? -11.794 29.836 1.560   1.00 28.18 ? 513 HOH A O   1 
HETATM 2304 O O   . HOH E 5 .   ? -9.791  46.642 -15.380 1.00 27.23 ? 514 HOH A O   1 
HETATM 2305 O O   . HOH E 5 .   ? 2.809   37.301 -7.343  1.00 21.32 ? 515 HOH A O   1 
HETATM 2306 O O   . HOH E 5 .   ? -2.009  37.949 1.279   1.00 18.50 ? 516 HOH A O   1 
HETATM 2307 O O   . HOH E 5 .   ? 0.802   36.265 4.337   1.00 23.69 ? 517 HOH A O   1 
HETATM 2308 O O   . HOH E 5 .   ? 4.739   61.260 -7.717  1.00 25.72 ? 518 HOH A O   1 
HETATM 2309 O O   . HOH E 5 .   ? -15.312 38.302 12.441  1.00 28.09 ? 519 HOH A O   1 
HETATM 2310 O O   . HOH E 5 .   ? -2.803  59.617 4.831   1.00 29.90 ? 520 HOH A O   1 
HETATM 2311 O O   . HOH E 5 .   ? -3.179  29.162 2.707   1.00 25.95 ? 521 HOH A O   1 
HETATM 2312 O O   . HOH E 5 .   ? -6.279  61.628 -1.490  1.00 20.70 ? 522 HOH A O   1 
HETATM 2313 O O   . HOH E 5 .   ? -8.168  50.885 -17.565 1.00 28.56 ? 523 HOH A O   1 
HETATM 2314 O O   . HOH E 5 .   ? -10.147 48.132 9.738   1.00 28.33 ? 524 HOH A O   1 
HETATM 2315 O O   . HOH E 5 .   ? -10.694 56.080 3.001   1.00 21.34 ? 525 HOH A O   1 
HETATM 2316 O O   . HOH E 5 .   ? -7.127  39.840 -9.299  1.00 21.88 ? 526 HOH A O   1 
HETATM 2317 O O   . HOH E 5 .   ? -2.454  35.005 -1.959  1.00 19.97 ? 527 HOH A O   1 
HETATM 2318 O O   . HOH E 5 .   ? 9.016   40.318 -9.938  1.00 30.13 ? 528 HOH A O   1 
HETATM 2319 O O   . HOH E 5 .   ? -11.669 33.904 -2.375  1.00 22.77 ? 529 HOH A O   1 
HETATM 2320 O O   . HOH E 5 .   ? 9.442   42.636 -8.399  1.00 38.94 ? 530 HOH A O   1 
HETATM 2321 O O   . HOH E 5 .   ? 8.009   54.982 8.585   1.00 34.05 ? 531 HOH A O   1 
HETATM 2322 O O   . HOH E 5 .   ? -10.432 53.742 -15.806 1.00 30.63 ? 532 HOH A O   1 
HETATM 2323 O O   . HOH E 5 .   ? 0.536   34.568 2.328   1.00 21.25 ? 533 HOH A O   1 
HETATM 2324 O O   . HOH E 5 .   ? -10.249 49.563 7.059   1.00 17.42 ? 534 HOH A O   1 
HETATM 2325 O O   . HOH E 5 .   ? -6.752  39.645 -12.112 1.00 21.90 ? 535 HOH A O   1 
HETATM 2326 O O   . HOH E 5 .   ? 5.086   45.441 9.485   1.00 26.35 ? 536 HOH A O   1 
HETATM 2327 O O   . HOH E 5 .   ? 7.455   43.567 4.900   1.00 26.69 ? 537 HOH A O   1 
HETATM 2328 O O   . HOH E 5 .   ? -24.518 23.122 4.833   1.00 27.27 ? 538 HOH A O   1 
HETATM 2329 O O   . HOH E 5 .   ? -15.731 41.308 -13.347 1.00 31.04 ? 539 HOH A O   1 
HETATM 2330 O O   . HOH E 5 .   ? 3.369   26.180 7.966   1.00 32.45 ? 540 HOH A O   1 
HETATM 2331 O O   . HOH E 5 .   ? 0.555   40.017 -16.963 1.00 39.96 ? 541 HOH A O   1 
HETATM 2332 O O   . HOH E 5 .   ? -4.027  44.809 -18.299 1.00 28.75 ? 542 HOH A O   1 
HETATM 2333 O O   . HOH E 5 .   ? 11.560  52.732 -7.309  1.00 41.77 ? 543 HOH A O   1 
HETATM 2334 O O   . HOH E 5 .   ? 12.505  39.595 5.711   1.00 42.60 ? 544 HOH A O   1 
HETATM 2335 O O   . HOH E 5 .   ? -19.853 24.623 -2.589  1.00 25.74 ? 545 HOH A O   1 
HETATM 2336 O O   . HOH E 5 .   ? 10.904  51.268 -4.925  1.00 29.14 ? 546 HOH A O   1 
HETATM 2337 O O   . HOH E 5 .   ? 8.827   39.994 -13.669 1.00 35.79 ? 547 HOH A O   1 
HETATM 2338 O O   . HOH E 5 .   ? -7.526  37.311 -8.910  1.00 21.82 ? 548 HOH A O   1 
HETATM 2339 O O   . HOH E 5 .   ? 11.619  47.684 5.305   1.00 27.42 ? 549 HOH A O   1 
HETATM 2340 O O   . HOH E 5 .   ? -16.136 58.994 6.532   1.00 31.23 ? 550 HOH A O   1 
HETATM 2341 O O   . HOH E 5 .   ? -11.816 33.098 -8.464  1.00 34.00 ? 551 HOH A O   1 
HETATM 2342 O O   . HOH E 5 .   ? -6.254  61.159 -8.334  1.00 33.29 ? 552 HOH A O   1 
HETATM 2343 O O   . HOH E 5 .   ? 1.623   36.941 -1.007  1.00 24.72 ? 553 HOH A O   1 
HETATM 2344 O O   . HOH E 5 .   ? 0.077   29.500 12.239  1.00 26.54 ? 554 HOH A O   1 
HETATM 2345 O O   . HOH E 5 .   ? -13.477 28.799 2.710   1.00 29.24 ? 555 HOH A O   1 
HETATM 2346 O O   . HOH E 5 .   ? -4.925  58.858 -11.333 1.00 31.03 ? 556 HOH A O   1 
HETATM 2347 O O   . HOH E 5 .   ? 3.270   30.046 -14.407 1.00 42.34 ? 557 HOH A O   1 
HETATM 2348 O O   . HOH E 5 .   ? -11.422 41.608 17.160  1.00 38.78 ? 558 HOH A O   1 
HETATM 2349 O O   . HOH E 5 .   ? 10.415  38.273 6.090   1.00 27.35 ? 559 HOH A O   1 
HETATM 2350 O O   . HOH E 5 .   ? -2.625  26.463 3.671   1.00 32.97 ? 560 HOH A O   1 
HETATM 2351 O O   . HOH E 5 .   ? 9.286   58.408 -2.808  1.00 41.50 ? 561 HOH A O   1 
HETATM 2352 O O   . HOH E 5 .   ? 14.698  38.318 3.809   1.00 33.72 ? 562 HOH A O   1 
HETATM 2353 O O   . HOH E 5 .   ? -17.820 42.850 -14.192 1.00 45.06 ? 563 HOH A O   1 
HETATM 2354 O O   . HOH E 5 .   ? -12.674 49.617 5.846   1.00 24.46 ? 564 HOH A O   1 
HETATM 2355 O O   . HOH E 5 .   ? -12.873 29.124 -7.049  1.00 40.21 ? 565 HOH A O   1 
HETATM 2356 O O   . HOH E 5 .   ? -19.962 49.231 5.353   1.00 40.18 ? 566 HOH A O   1 
HETATM 2357 O O   . HOH E 5 .   ? 10.173  43.323 4.920   1.00 26.89 ? 567 HOH A O   1 
HETATM 2358 O O   . HOH E 5 .   ? 0.516   43.461 14.367  1.00 26.74 ? 568 HOH A O   1 
HETATM 2359 O O   . HOH E 5 .   ? -13.296 57.580 -9.871  1.00 29.28 ? 569 HOH A O   1 
HETATM 2360 O O   . HOH E 5 .   ? -10.912 32.348 18.292  1.00 39.63 ? 570 HOH A O   1 
HETATM 2361 O O   . HOH E 5 .   ? -2.014  40.355 -15.518 1.00 35.99 ? 571 HOH A O   1 
HETATM 2362 O O   . HOH E 5 .   ? -10.809 26.522 8.074   1.00 31.47 ? 572 HOH A O   1 
HETATM 2363 O O   . HOH E 5 .   ? 7.910   55.348 4.149   1.00 22.56 ? 573 HOH A O   1 
HETATM 2364 O O   . HOH E 5 .   ? 9.196   24.278 2.345   1.00 37.15 ? 574 HOH A O   1 
HETATM 2365 O O   . HOH E 5 .   ? -8.049  52.037 11.554  1.00 29.20 ? 575 HOH A O   1 
HETATM 2366 O O   . HOH E 5 .   ? 14.979  43.081 -3.188  1.00 24.63 ? 576 HOH A O   1 
HETATM 2367 O O   . HOH E 5 .   ? 6.328   43.587 7.549   1.00 36.41 ? 577 HOH A O   1 
HETATM 2368 O O   . HOH E 5 .   ? -9.068  32.281 0.562   1.00 32.53 ? 578 HOH A O   1 
HETATM 2369 O O   . HOH E 5 .   ? -14.547 24.741 0.707   1.00 41.49 ? 579 HOH A O   1 
HETATM 2370 O O   . HOH E 5 .   ? 2.813   63.505 0.577   1.00 40.04 ? 580 HOH A O   1 
HETATM 2371 O O   . HOH E 5 .   ? 1.206   28.729 14.893  1.00 37.56 ? 581 HOH A O   1 
HETATM 2372 O O   . HOH E 5 .   ? 7.843   39.026 7.806   1.00 31.63 ? 582 HOH A O   1 
HETATM 2373 O O   . HOH E 5 .   ? 6.050   32.715 16.454  1.00 29.06 ? 583 HOH A O   1 
HETATM 2374 O O   . HOH E 5 .   ? -29.575 31.696 -6.125  1.00 31.18 ? 584 HOH A O   1 
HETATM 2375 O O   . HOH E 5 .   ? -11.382 34.217 19.937  1.00 37.91 ? 585 HOH A O   1 
HETATM 2376 O O   . HOH E 5 .   ? -0.613  45.134 12.875  1.00 25.95 ? 586 HOH A O   1 
HETATM 2377 O O   . HOH E 5 .   ? -0.814  35.983 0.178   1.00 31.30 ? 587 HOH A O   1 
HETATM 2378 O O   . HOH E 5 .   ? -1.657  28.663 -4.701  1.00 28.28 ? 588 HOH A O   1 
HETATM 2379 O O   . HOH E 5 .   ? -17.401 36.214 16.492  1.00 48.27 ? 589 HOH A O   1 
HETATM 2380 O O   . HOH E 5 .   ? -2.113  55.861 -19.311 1.00 38.03 ? 590 HOH A O   1 
HETATM 2381 O O   . HOH E 5 .   ? -24.626 51.139 3.363   1.00 40.18 ? 591 HOH A O   1 
HETATM 2382 O O   . HOH E 5 .   ? -17.936 25.202 -4.443  1.00 32.08 ? 592 HOH A O   1 
HETATM 2383 O O   . HOH E 5 .   ? 8.795   50.435 10.359  1.00 34.68 ? 593 HOH A O   1 
HETATM 2384 O O   . HOH E 5 .   ? -5.280  47.218 -17.717 1.00 38.68 ? 594 HOH A O   1 
HETATM 2385 O O   . HOH E 5 .   ? 0.870   23.923 0.849   1.00 37.08 ? 595 HOH A O   1 
HETATM 2386 O O   . HOH E 5 .   ? 11.666  54.155 6.082   1.00 37.12 ? 596 HOH A O   1 
HETATM 2387 O O   . HOH E 5 .   ? -5.804  38.718 -14.910 1.00 24.97 ? 597 HOH A O   1 
HETATM 2388 O O   . HOH E 5 .   ? -6.465  63.089 5.292   1.00 37.29 ? 598 HOH A O   1 
HETATM 2389 O O   . HOH E 5 .   ? 5.343   56.420 12.341  1.00 41.04 ? 599 HOH A O   1 
HETATM 2390 O O   . HOH E 5 .   ? 10.923  35.475 4.300   1.00 38.82 ? 600 HOH A O   1 
HETATM 2391 O O   . HOH E 5 .   ? -20.805 43.086 -10.235 1.00 29.24 ? 601 HOH A O   1 
HETATM 2392 O O   . HOH E 5 .   ? 12.153  47.245 -4.466  1.00 37.03 ? 602 HOH A O   1 
HETATM 2393 O O   . HOH E 5 .   ? 0.338   40.133 16.560  1.00 34.20 ? 603 HOH A O   1 
HETATM 2394 O O   . HOH E 5 .   ? -10.862 65.460 -4.112  1.00 44.85 ? 604 HOH A O   1 
HETATM 2395 O O   . HOH E 5 .   ? 2.137   60.930 -4.298  1.00 44.26 ? 605 HOH A O   1 
HETATM 2396 O O   . HOH E 5 .   ? 9.034   55.550 6.399   1.00 44.66 ? 606 HOH A O   1 
HETATM 2397 O O   . HOH E 5 .   ? -1.793  62.961 -1.499  1.00 35.34 ? 607 HOH A O   1 
HETATM 2398 O O   . HOH E 5 .   ? 5.560   37.468 9.901   1.00 36.47 ? 608 HOH A O   1 
HETATM 2399 O O   . HOH E 5 .   ? 2.768   26.616 -11.605 1.00 43.41 ? 609 HOH A O   1 
HETATM 2400 O O   . HOH E 5 .   ? -23.222 45.986 -7.492  1.00 50.56 ? 610 HOH A O   1 
HETATM 2401 O O   . HOH E 5 .   ? -35.251 29.689 4.230   1.00 46.12 ? 611 HOH A O   1 
HETATM 2402 O O   . HOH E 5 .   ? -4.517  54.984 -12.122 1.00 38.83 ? 612 HOH A O   1 
HETATM 2403 O O   . HOH E 5 .   ? 1.410   38.399 -18.344 1.00 40.70 ? 613 HOH A O   1 
HETATM 2404 O O   . HOH E 5 .   ? -4.331  62.162 -5.991  1.00 40.23 ? 614 HOH A O   1 
HETATM 2405 O O   . HOH E 5 .   ? -22.416 28.581 18.166  1.00 50.17 ? 615 HOH A O   1 
HETATM 2406 O O   . HOH E 5 .   ? -31.309 30.450 -2.074  1.00 32.68 ? 616 HOH A O   1 
HETATM 2407 O O   . HOH E 5 .   ? -13.426 62.360 -9.784  1.00 52.01 ? 617 HOH A O   1 
HETATM 2408 O O   . HOH E 5 .   ? -12.953 31.512 -6.212  1.00 36.34 ? 618 HOH A O   1 
HETATM 2409 O O   . HOH E 5 .   ? -19.682 41.868 -6.886  1.00 29.79 ? 619 HOH A O   1 
HETATM 2410 O O   . HOH E 5 .   ? 1.752   31.930 -11.446 1.00 27.91 ? 620 HOH A O   1 
HETATM 2411 O O   . HOH E 5 .   ? -14.578 50.105 7.991   1.00 42.60 ? 621 HOH A O   1 
HETATM 2412 O O   . HOH E 5 .   ? 4.630   48.215 10.859  1.00 28.38 ? 622 HOH A O   1 
HETATM 2413 O O   . HOH E 5 .   ? 4.854   43.775 -14.978 1.00 44.54 ? 623 HOH A O   1 
HETATM 2414 O O   . HOH E 5 .   ? 3.020   44.172 -16.295 1.00 34.29 ? 624 HOH A O   1 
HETATM 2415 O O   . HOH E 5 .   ? 0.476   28.208 -4.853  1.00 27.38 ? 625 HOH A O   1 
HETATM 2416 O O   . HOH E 5 .   ? -7.397  63.692 -2.860  1.00 32.05 ? 626 HOH A O   1 
HETATM 2417 O O   . HOH E 5 .   ? -2.821  28.521 12.009  1.00 31.44 ? 627 HOH A O   1 
HETATM 2418 O O   . HOH E 5 .   ? -5.448  42.768 -18.211 1.00 32.66 ? 628 HOH A O   1 
HETATM 2419 O O   . HOH E 5 .   ? 13.655  35.616 3.935   1.00 32.15 ? 629 HOH A O   1 
HETATM 2420 O O   . HOH E 5 .   ? -24.424 33.316 -7.879  1.00 41.99 ? 630 HOH A O   1 
HETATM 2421 O O   . HOH E 5 .   ? 6.398   26.692 -6.603  1.00 32.23 ? 631 HOH A O   1 
HETATM 2422 O O   . HOH E 5 .   ? 12.240  34.909 -14.248 1.00 45.91 ? 632 HOH A O   1 
HETATM 2423 O O   . HOH E 5 .   ? -1.898  32.978 -13.982 1.00 32.65 ? 633 HOH A O   1 
HETATM 2424 O O   . HOH E 5 .   ? -10.569 48.441 14.353  1.00 47.53 ? 634 HOH A O   1 
HETATM 2425 O O   . HOH E 5 .   ? -7.968  64.714 0.906   1.00 50.69 ? 635 HOH A O   1 
HETATM 2426 O O   . HOH E 5 .   ? -15.353 37.826 -5.431  1.00 26.05 ? 636 HOH A O   1 
HETATM 2427 O O   . HOH E 5 .   ? -17.787 16.691 3.861   1.00 39.50 ? 637 HOH A O   1 
HETATM 2428 O O   . HOH E 5 .   ? 12.639  36.030 -3.345  1.00 44.44 ? 638 HOH A O   1 
HETATM 2429 O O   . HOH E 5 .   ? 6.115   62.099 -15.368 1.00 22.00 ? 639 HOH A O   1 
HETATM 2430 O O   . HOH E 5 .   ? -11.368 55.868 -10.908 1.00 21.67 ? 640 HOH A O   1 
HETATM 2431 O O   . HOH E 5 .   ? -15.062 54.327 8.662   1.00 34.35 ? 641 HOH A O   1 
HETATM 2432 O O   . HOH E 5 .   ? -23.269 24.273 16.433  1.00 46.72 ? 642 HOH A O   1 
HETATM 2433 O O   . HOH E 5 .   ? -3.381  39.190 19.527  1.00 35.93 ? 643 HOH A O   1 
HETATM 2434 O O   . HOH E 5 .   ? 13.563  43.515 -6.415  1.00 30.74 ? 644 HOH A O   1 
HETATM 2435 O O   . HOH E 5 .   ? -24.982 53.014 -4.443  1.00 56.95 ? 645 HOH A O   1 
HETATM 2436 O O   . HOH E 5 .   ? -0.672  60.974 -7.704  1.00 50.15 ? 646 HOH A O   1 
HETATM 2437 O O   . HOH E 5 .   ? 10.806  47.109 -11.976 1.00 34.85 ? 647 HOH A O   1 
HETATM 2438 O O   . HOH E 5 .   ? 14.326  48.217 -0.630  1.00 52.25 ? 648 HOH A O   1 
HETATM 2439 O O   . HOH E 5 .   ? 4.898   39.161 15.289  1.00 46.08 ? 649 HOH A O   1 
HETATM 2440 O O   . HOH E 5 .   ? 15.808  38.846 -10.852 1.00 62.50 ? 650 HOH A O   1 
HETATM 2441 O O   . HOH E 5 .   ? 10.460  45.990 -7.851  1.00 41.44 ? 651 HOH A O   1 
HETATM 2442 O O   . HOH E 5 .   ? -1.375  63.078 5.468   1.00 40.86 ? 652 HOH A O   1 
HETATM 2443 O O   . HOH E 5 .   ? -8.819  24.671 5.943   1.00 42.93 ? 653 HOH A O   1 
HETATM 2444 O O   . HOH E 5 .   ? -15.167 42.226 12.124  1.00 42.67 ? 654 HOH A O   1 
HETATM 2445 O O   . HOH E 5 .   ? 2.653   59.624 7.881   1.00 36.34 ? 655 HOH A O   1 
HETATM 2446 O O   . HOH E 5 .   ? -31.661 42.734 2.510   1.00 45.06 ? 656 HOH A O   1 
HETATM 2447 O O   . HOH E 5 .   ? 9.986   53.422 -9.158  1.00 37.79 ? 657 HOH A O   1 
HETATM 2448 O O   . HOH E 5 .   ? -2.162  34.368 16.654  1.00 40.17 ? 658 HOH A O   1 
HETATM 2449 O O   . HOH E 5 .   ? 1.245   31.898 16.620  1.00 36.87 ? 659 HOH A O   1 
HETATM 2450 O O   . HOH E 5 .   ? -23.676 38.116 17.162  1.00 51.13 ? 660 HOH A O   1 
HETATM 2451 O O   . HOH E 5 .   ? -24.281 18.627 6.409   1.00 54.48 ? 661 HOH A O   1 
HETATM 2452 O O   . HOH E 5 .   ? -18.875 56.265 5.710   1.00 49.12 ? 662 HOH A O   1 
HETATM 2453 O O   . HOH E 5 .   ? -25.293 42.987 8.445   1.00 38.24 ? 663 HOH A O   1 
HETATM 2454 O O   . HOH E 5 .   ? 11.687  51.200 9.527   1.00 49.53 ? 664 HOH A O   1 
HETATM 2455 O O   . HOH E 5 .   ? -34.015 35.241 13.939  1.00 55.13 ? 665 HOH A O   1 
HETATM 2456 O O   . HOH E 5 .   ? 4.455   61.903 -11.008 1.00 31.29 ? 666 HOH A O   1 
HETATM 2457 O O   . HOH E 5 .   ? 1.991   61.443 -6.813  1.00 55.72 ? 667 HOH A O   1 
HETATM 2458 O O   . HOH E 5 .   ? -16.130 18.907 14.168  1.00 51.47 ? 668 HOH A O   1 
HETATM 2459 O O   . HOH E 5 .   ? 13.176  48.666 3.161   1.00 42.27 ? 669 HOH A O   1 
HETATM 2460 O O   . HOH E 5 .   ? -13.909 43.743 13.856  1.00 37.47 ? 670 HOH A O   1 
HETATM 2461 O O   . HOH E 5 .   ? 16.968  47.617 -2.196  1.00 58.28 ? 671 HOH A O   1 
HETATM 2462 O O   . HOH E 5 .   ? -28.167 39.909 -1.630  1.00 44.91 ? 672 HOH A O   1 
HETATM 2463 O O   . HOH E 5 .   ? -7.852  64.969 -7.060  1.00 54.38 ? 673 HOH A O   1 
HETATM 2464 O O   . HOH E 5 .   ? 3.932   25.288 -5.622  1.00 40.88 ? 674 HOH A O   1 
HETATM 2465 O O   . HOH E 5 .   ? 0.391   62.178 -2.555  1.00 44.63 ? 675 HOH A O   1 
HETATM 2466 O O   . HOH E 5 .   ? -22.583 42.797 -6.434  1.00 41.90 ? 676 HOH A O   1 
HETATM 2467 O O   . HOH E 5 .   ? -13.822 34.736 -5.847  1.00 45.59 ? 677 HOH A O   1 
HETATM 2468 O O   . HOH E 5 .   ? -24.395 55.298 -9.460  1.00 61.16 ? 678 HOH A O   1 
HETATM 2469 O O   . HOH E 5 .   ? -31.379 37.924 0.732   1.00 39.51 ? 679 HOH A O   1 
HETATM 2470 O O   . HOH E 5 .   ? 10.573  47.999 -16.317 1.00 45.00 ? 680 HOH A O   1 
HETATM 2471 O O   . HOH E 5 .   ? -11.601 29.830 -4.502  1.00 49.88 ? 681 HOH A O   1 
HETATM 2472 O O   . HOH E 5 .   ? -1.521  42.717 19.718  1.00 44.77 ? 682 HOH A O   1 
HETATM 2473 O O   . HOH E 5 .   ? -21.740 45.715 6.904   1.00 55.81 ? 683 HOH A O   1 
HETATM 2474 O O   . HOH E 5 .   ? -10.846 32.942 -4.471  1.00 36.21 ? 684 HOH A O   1 
HETATM 2475 O O   . HOH E 5 .   ? -7.173  45.734 15.961  1.00 51.22 ? 685 HOH A O   1 
HETATM 2476 O O   . HOH E 5 .   ? 15.397  28.909 -7.189  1.00 51.19 ? 686 HOH A O   1 
HETATM 2477 O O   . HOH E 5 .   ? -19.761 47.165 9.370   1.00 59.93 ? 687 HOH A O   1 
HETATM 2478 O O   . HOH E 5 .   ? 14.144  35.324 -1.406  1.00 48.04 ? 688 HOH A O   1 
HETATM 2479 O O   . HOH E 5 .   ? 14.282  45.488 -4.760  1.00 35.04 ? 689 HOH A O   1 
HETATM 2480 O O   . HOH E 5 .   ? -11.541 47.758 16.744  1.00 54.97 ? 690 HOH A O   1 
HETATM 2481 O O   . HOH E 5 .   ? -28.054 28.929 2.981   1.00 39.01 ? 691 HOH A O   1 
HETATM 2482 O O   . HOH E 5 .   ? -33.001 36.289 2.121   1.00 42.92 ? 692 HOH A O   1 
HETATM 2483 O O   . HOH E 5 .   ? -21.578 29.842 -8.203  1.00 36.84 ? 693 HOH A O   1 
HETATM 2484 O O   . HOH E 5 .   ? -24.063 43.292 10.922  1.00 49.43 ? 694 HOH A O   1 
HETATM 2485 O O   . HOH E 5 .   ? -7.129  56.364 -14.189 1.00 44.22 ? 695 HOH A O   1 
HETATM 2486 O O   . HOH E 5 .   ? 3.253   36.333 16.253  1.00 43.14 ? 696 HOH A O   1 
HETATM 2487 O O   . HOH E 5 .   ? 3.919   33.633 17.828  1.00 43.96 ? 697 HOH A O   1 
HETATM 2488 O O   . HOH E 5 .   ? -12.356 31.964 -10.831 1.00 45.23 ? 698 HOH A O   1 
HETATM 2489 O O   . HOH E 5 .   ? 9.440   56.091 -8.782  1.00 35.95 ? 699 HOH A O   1 
HETATM 2490 O O   . HOH E 5 .   ? 9.140   56.522 2.140   1.00 37.94 ? 700 HOH A O   1 
HETATM 2491 O O   . HOH E 5 .   ? -8.855  53.573 9.914   1.00 24.90 ? 701 HOH A O   1 
HETATM 2492 O O   . HOH E 5 .   ? -10.123 52.252 7.831   1.00 35.27 ? 702 HOH A O   1 
HETATM 2493 O O   . HOH E 5 .   ? -25.900 44.856 -3.047  1.00 50.30 ? 703 HOH A O   1 
HETATM 2494 O O   . HOH E 5 .   ? -25.638 43.055 -0.112  1.00 39.79 ? 704 HOH A O   1 
HETATM 2495 O O   . HOH E 5 .   ? 9.527   55.136 -14.832 1.00 36.79 ? 705 HOH A O   1 
HETATM 2496 O O   . HOH E 5 .   ? 11.685  32.695 2.661   1.00 37.80 ? 706 HOH A O   1 
HETATM 2497 O O   . HOH E 5 .   ? -14.780 58.923 -11.283 1.00 47.63 ? 707 HOH A O   1 
HETATM 2498 O O   . HOH E 5 .   ? 6.536   41.004 -15.876 1.00 42.63 ? 708 HOH A O   1 
HETATM 2499 O O   . HOH E 5 .   ? -7.205  44.737 -18.138 1.00 50.63 ? 709 HOH A O   1 
HETATM 2500 O O   . HOH E 5 .   ? -12.603 41.669 -17.974 1.00 48.97 ? 710 HOH A O   1 
HETATM 2501 O O   . HOH E 5 .   ? -16.235 34.507 -7.224  1.00 47.89 ? 711 HOH A O   1 
HETATM 2502 O O   . HOH E 5 .   ? -10.700 30.308 -1.519  1.00 42.37 ? 712 HOH A O   1 
HETATM 2503 O O   . HOH F 5 .   ? -4.160  30.404 -7.239  1.00 24.35 ? 43  HOH B O   1 
HETATM 2504 O O   . HOH F 5 .   ? -2.896  31.405 -11.940 1.00 31.13 ? 78  HOH B O   1 
HETATM 2505 O O   . HOH F 5 .   ? -12.833 35.372 -14.566 1.00 36.88 ? 139 HOH B O   1 
HETATM 2506 O O   . HOH F 5 .   ? -5.467  30.684 -11.840 1.00 49.65 ? 141 HOH B O   1 
HETATM 2507 O O   . HOH F 5 .   ? -10.943 36.382 -18.649 1.00 54.77 ? 173 HOH B O   1 
HETATM 2508 O O   . HOH F 5 .   ? -11.646 32.334 -13.777 1.00 55.14 ? 192 HOH B O   1 
HETATM 2509 O O   . HOH F 5 .   ? -16.421 37.640 -12.860 1.00 39.79 ? 213 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   0   ?   ?   ?   A . n 
A 1 2   MET 2   1   ?   ?   ?   A . n 
A 1 3   LEU 3   2   ?   ?   ?   A . n 
A 1 4   LEU 4   3   ?   ?   ?   A . n 
A 1 5   SER 5   4   ?   ?   ?   A . n 
A 1 6   LYS 6   5   ?   ?   ?   A . n 
A 1 7   ILE 7   6   ?   ?   ?   A . n 
A 1 8   ASN 8   7   ?   ?   ?   A . n 
A 1 9   SER 9   8   ?   ?   ?   A . n 
A 1 10  LEU 10  9   ?   ?   ?   A . n 
A 1 11  ALA 11  10  ?   ?   ?   A . n 
A 1 12  HIS 12  11  ?   ?   ?   A . n 
A 1 13  LEU 13  12  ?   ?   ?   A . n 
A 1 14  ARG 14  13  ?   ?   ?   A . n 
A 1 15  ALA 15  14  ?   ?   ?   A . n 
A 1 16  ALA 16  15  ?   ?   ?   A . n 
A 1 17  PRO 17  16  ?   ?   ?   A . n 
A 1 18  CYS 18  17  ?   ?   ?   A . n 
A 1 19  ASN 19  18  ?   ?   ?   A . n 
A 1 20  ASP 20  19  ?   ?   ?   A . n 
A 1 21  LEU 21  20  ?   ?   ?   A . n 
A 1 22  HIS 22  21  ?   ?   ?   A . n 
A 1 23  ALA 23  22  ?   ?   ?   A . n 
A 1 24  THR 24  23  ?   ?   ?   A . n 
A 1 25  LYS 25  24  ?   ?   ?   A . n 
A 1 26  LEU 26  25  ?   ?   ?   A . n 
A 1 27  ALA 27  26  ?   ?   ?   A . n 
A 1 28  PRO 28  27  ?   ?   ?   A . n 
A 1 29  GLY 29  28  ?   ?   ?   A . n 
A 1 30  LYS 30  29  ?   ?   ?   A . n 
A 1 31  GLU 31  30  ?   ?   ?   A . n 
A 1 32  LYS 32  31  ?   ?   ?   A . n 
A 1 33  GLU 33  32  ?   ?   ?   A . n 
A 1 34  PRO 34  33  33  PRO PRO A . n 
A 1 35  LEU 35  34  34  LEU LEU A . n 
A 1 36  GLU 36  35  35  GLU GLU A . n 
A 1 37  SER 37  36  36  SER SER A . n 
A 1 38  GLN 38  37  37  GLN GLN A . n 
A 1 39  TYR 39  38  38  TYR TYR A . n 
A 1 40  GLN 40  39  39  GLN GLN A . n 
A 1 41  VAL 41  40  40  VAL VAL A . n 
A 1 42  GLY 42  41  41  GLY GLY A . n 
A 1 43  PRO 43  42  42  PRO PRO A . n 
A 1 44  LEU 44  43  43  LEU LEU A . n 
A 1 45  LEU 45  44  44  LEU LEU A . n 
A 1 46  GLY 46  45  45  GLY GLY A . n 
A 1 47  SER 47  46  46  SER SER A . n 
A 1 48  GLY 48  47  47  GLY GLY A . n 
A 1 49  GLY 49  48  48  GLY GLY A . n 
A 1 50  PHE 50  49  49  PHE PHE A . n 
A 1 51  GLY 51  50  50  GLY GLY A . n 
A 1 52  SER 52  51  51  SER SER A . n 
A 1 53  VAL 53  52  52  VAL VAL A . n 
A 1 54  TYR 54  53  53  TYR TYR A . n 
A 1 55  SER 55  54  54  SER SER A . n 
A 1 56  GLY 56  55  55  GLY GLY A . n 
A 1 57  ILE 57  56  56  ILE ILE A . n 
A 1 58  ARG 58  57  57  ARG ARG A . n 
A 1 59  VAL 59  58  58  VAL VAL A . n 
A 1 60  SER 60  59  59  SER SER A . n 
A 1 61  ASP 61  60  60  ASP ASP A . n 
A 1 62  ASN 62  61  61  ASN ASN A . n 
A 1 63  LEU 63  62  62  LEU LEU A . n 
A 1 64  PRO 64  63  63  PRO PRO A . n 
A 1 65  VAL 65  64  64  VAL VAL A . n 
A 1 66  ALA 66  65  65  ALA ALA A . n 
A 1 67  ILE 67  66  66  ILE ILE A . n 
A 1 68  LYS 68  67  67  LYS LYS A . n 
A 1 69  HIS 69  68  68  HIS HIS A . n 
A 1 70  VAL 70  69  69  VAL VAL A . n 
A 1 71  GLU 71  70  70  GLU GLU A . n 
A 1 72  LYS 72  71  71  LYS LYS A . n 
A 1 73  ASP 73  72  72  ASP ASP A . n 
A 1 74  ARG 74  73  73  ARG ARG A . n 
A 1 75  ILE 75  74  74  ILE ILE A . n 
A 1 76  SER 76  75  75  SER SER A . n 
A 1 77  ASP 77  76  76  ASP ASP A . n 
A 1 78  TRP 78  77  77  TRP TRP A . n 
A 1 79  GLY 79  78  78  GLY GLY A . n 
A 1 80  GLU 80  79  79  GLU GLU A . n 
A 1 81  LEU 81  80  80  LEU LEU A . n 
A 1 82  PRO 82  81  81  PRO PRO A . n 
A 1 83  ASN 83  82  ?   ?   ?   A . n 
A 1 84  GLY 84  83  ?   ?   ?   A . n 
A 1 85  THR 85  84  84  THR THR A . n 
A 1 86  ARG 86  85  85  ARG ARG A . n 
A 1 87  VAL 87  86  86  VAL VAL A . n 
A 1 88  PRO 88  87  87  PRO PRO A . n 
A 1 89  MET 89  88  88  MET MET A . n 
A 1 90  GLU 90  89  89  GLU GLU A . n 
A 1 91  VAL 91  90  90  VAL VAL A . n 
A 1 92  VAL 92  91  91  VAL VAL A . n 
A 1 93  LEU 93  92  92  LEU LEU A . n 
A 1 94  LEU 94  93  93  LEU LEU A . n 
A 1 95  LYS 95  94  94  LYS LYS A . n 
A 1 96  LYS 96  95  95  LYS LYS A . n 
A 1 97  VAL 97  96  96  VAL VAL A . n 
A 1 98  SER 98  97  97  SER SER A . n 
A 1 99  SER 99  98  98  SER SER A . n 
A 1 100 GLY 100 99  99  GLY GLY A . n 
A 1 101 PHE 101 100 100 PHE PHE A . n 
A 1 102 SER 102 101 101 SER SER A . n 
A 1 103 GLY 103 102 102 GLY GLY A . n 
A 1 104 VAL 104 103 103 VAL VAL A . n 
A 1 105 ILE 105 104 104 ILE ILE A . n 
A 1 106 ARG 106 105 105 ARG ARG A . n 
A 1 107 LEU 107 106 106 LEU LEU A . n 
A 1 108 LEU 108 107 107 LEU LEU A . n 
A 1 109 ASP 109 108 108 ASP ASP A . n 
A 1 110 TRP 110 109 109 TRP TRP A . n 
A 1 111 PHE 111 110 110 PHE PHE A . n 
A 1 112 GLU 112 111 111 GLU GLU A . n 
A 1 113 ARG 113 112 112 ARG ARG A . n 
A 1 114 PRO 114 113 113 PRO PRO A . n 
A 1 115 ASP 115 114 114 ASP ASP A . n 
A 1 116 SER 116 115 115 SER SER A . n 
A 1 117 PHE 117 116 116 PHE PHE A . n 
A 1 118 VAL 118 117 117 VAL VAL A . n 
A 1 119 LEU 119 118 118 LEU LEU A . n 
A 1 120 ILE 120 119 119 ILE ILE A . n 
A 1 121 LEU 121 120 120 LEU LEU A . n 
A 1 122 GLU 122 121 121 GLU GLU A . n 
A 1 123 ARG 123 122 122 ARG ARG A . n 
A 1 124 PRO 124 123 123 PRO PRO A . n 
A 1 125 GLU 125 124 124 GLU GLU A . n 
A 1 126 PRO 126 125 125 PRO PRO A . n 
A 1 127 VAL 127 126 126 VAL VAL A . n 
A 1 128 GLN 128 127 127 GLN GLN A . n 
A 1 129 ASP 129 128 128 ASP ASP A . n 
A 1 130 LEU 130 129 129 LEU LEU A . n 
A 1 131 PHE 131 130 130 PHE PHE A . n 
A 1 132 ASP 132 131 131 ASP ASP A . n 
A 1 133 PHE 133 132 132 PHE PHE A . n 
A 1 134 ILE 134 133 133 ILE ILE A . n 
A 1 135 THR 135 134 134 THR THR A . n 
A 1 136 GLU 136 135 135 GLU GLU A . n 
A 1 137 ARG 137 136 136 ARG ARG A . n 
A 1 138 GLY 138 137 137 GLY GLY A . n 
A 1 139 ALA 139 138 138 ALA ALA A . n 
A 1 140 LEU 140 139 139 LEU LEU A . n 
A 1 141 GLN 141 140 140 GLN GLN A . n 
A 1 142 GLU 142 141 141 GLU GLU A . n 
A 1 143 GLU 143 142 142 GLU GLU A . n 
A 1 144 LEU 144 143 143 LEU LEU A . n 
A 1 145 ALA 145 144 144 ALA ALA A . n 
A 1 146 ARG 146 145 145 ARG ARG A . n 
A 1 147 SER 147 146 146 SER SER A . n 
A 1 148 PHE 148 147 147 PHE PHE A . n 
A 1 149 PHE 149 148 148 PHE PHE A . n 
A 1 150 TRP 150 149 149 TRP TRP A . n 
A 1 151 GLN 151 150 150 GLN GLN A . n 
A 1 152 VAL 152 151 151 VAL VAL A . n 
A 1 153 LEU 153 152 152 LEU LEU A . n 
A 1 154 GLU 154 153 153 GLU GLU A . n 
A 1 155 ALA 155 154 154 ALA ALA A . n 
A 1 156 VAL 156 155 155 VAL VAL A . n 
A 1 157 ARG 157 156 156 ARG ARG A . n 
A 1 158 HIS 158 157 157 HIS HIS A . n 
A 1 159 CYS 159 158 158 CYS CYS A . n 
A 1 160 HIS 160 159 159 HIS HIS A . n 
A 1 161 ASN 161 160 160 ASN ASN A . n 
A 1 162 CYS 162 161 161 CYS CYS A . n 
A 1 163 GLY 163 162 162 GLY GLY A . n 
A 1 164 VAL 164 163 163 VAL VAL A . n 
A 1 165 LEU 165 164 164 LEU LEU A . n 
A 1 166 HIS 166 165 165 HIS HIS A . n 
A 1 167 ARG 167 166 166 ARG ARG A . n 
A 1 168 ASP 168 167 167 ASP ASP A . n 
A 1 169 ILE 169 168 168 ILE ILE A . n 
A 1 170 LYS 170 169 169 LYS LYS A . n 
A 1 171 ASP 171 170 170 ASP ASP A . n 
A 1 172 GLU 172 171 171 GLU GLU A . n 
A 1 173 ASN 173 172 172 ASN ASN A . n 
A 1 174 ILE 174 173 173 ILE ILE A . n 
A 1 175 LEU 175 174 174 LEU LEU A . n 
A 1 176 ILE 176 175 175 ILE ILE A . n 
A 1 177 ASP 177 176 176 ASP ASP A . n 
A 1 178 LEU 178 177 177 LEU LEU A . n 
A 1 179 ASN 179 178 178 ASN ASN A . n 
A 1 180 ARG 180 179 179 ARG ARG A . n 
A 1 181 GLY 181 180 180 GLY GLY A . n 
A 1 182 GLU 182 181 181 GLU GLU A . n 
A 1 183 LEU 183 182 182 LEU LEU A . n 
A 1 184 LYS 184 183 183 LYS LYS A . n 
A 1 185 LEU 185 184 184 LEU LEU A . n 
A 1 186 ILE 186 185 185 ILE ILE A . n 
A 1 187 ASP 187 186 186 ASP ASP A . n 
A 1 188 PHE 188 187 187 PHE PHE A . n 
A 1 189 GLY 189 188 188 GLY GLY A . n 
A 1 190 SER 190 189 189 SER SER A . n 
A 1 191 GLY 191 190 190 GLY GLY A . n 
A 1 192 ALA 192 191 191 ALA ALA A . n 
A 1 193 LEU 193 192 192 LEU LEU A . n 
A 1 194 LEU 194 193 193 LEU LEU A . n 
A 1 195 LYS 195 194 194 LYS LYS A . n 
A 1 196 ASP 196 195 195 ASP ASP A . n 
A 1 197 THR 197 196 196 THR THR A . n 
A 1 198 VAL 198 197 197 VAL VAL A . n 
A 1 199 TYR 199 198 198 TYR TYR A . n 
A 1 200 THR 200 199 199 THR THR A . n 
A 1 201 ASP 201 200 200 ASP ASP A . n 
A 1 202 PHE 202 201 201 PHE PHE A . n 
A 1 203 ASP 203 202 202 ASP ASP A . n 
A 1 204 GLY 204 203 203 GLY GLY A . n 
A 1 205 THR 205 204 204 THR THR A . n 
A 1 206 ARG 206 205 205 ARG ARG A . n 
A 1 207 VAL 207 206 206 VAL VAL A . n 
A 1 208 TYR 208 207 207 TYR TYR A . n 
A 1 209 SER 209 208 208 SER SER A . n 
A 1 210 PRO 210 209 209 PRO PRO A . n 
A 1 211 PRO 211 210 210 PRO PRO A . n 
A 1 212 GLU 212 211 211 GLU GLU A . n 
A 1 213 TRP 213 212 212 TRP TRP A . n 
A 1 214 ILE 214 213 213 ILE ILE A . n 
A 1 215 ARG 215 214 214 ARG ARG A . n 
A 1 216 TYR 216 215 215 TYR TYR A . n 
A 1 217 HIS 217 216 216 HIS HIS A . n 
A 1 218 ARG 218 217 217 ARG ARG A . n 
A 1 219 TYR 219 218 218 TYR TYR A . n 
A 1 220 HIS 220 219 219 HIS HIS A . n 
A 1 221 GLY 221 220 220 GLY GLY A . n 
A 1 222 ARG 222 221 221 ARG ARG A . n 
A 1 223 SER 223 222 222 SER SER A . n 
A 1 224 ALA 224 223 223 ALA ALA A . n 
A 1 225 ALA 225 224 224 ALA ALA A . n 
A 1 226 VAL 226 225 225 VAL VAL A . n 
A 1 227 TRP 227 226 226 TRP TRP A . n 
A 1 228 SER 228 227 227 SER SER A . n 
A 1 229 LEU 229 228 228 LEU LEU A . n 
A 1 230 GLY 230 229 229 GLY GLY A . n 
A 1 231 ILE 231 230 230 ILE ILE A . n 
A 1 232 LEU 232 231 231 LEU LEU A . n 
A 1 233 LEU 233 232 232 LEU LEU A . n 
A 1 234 TYR 234 233 233 TYR TYR A . n 
A 1 235 ASP 235 234 234 ASP ASP A . n 
A 1 236 MET 236 235 235 MET MET A . n 
A 1 237 VAL 237 236 236 VAL VAL A . n 
A 1 238 CYS 238 237 237 CYS CYS A . n 
A 1 239 GLY 239 238 238 GLY GLY A . n 
A 1 240 ASP 240 239 239 ASP ASP A . n 
A 1 241 ILE 241 240 240 ILE ILE A . n 
A 1 242 PRO 242 241 241 PRO PRO A . n 
A 1 243 PHE 243 242 242 PHE PHE A . n 
A 1 244 GLU 244 243 243 GLU GLU A . n 
A 1 245 HIS 245 244 244 HIS HIS A . n 
A 1 246 ASP 246 245 245 ASP ASP A . n 
A 1 247 GLU 247 246 246 GLU GLU A . n 
A 1 248 GLU 248 247 247 GLU GLU A . n 
A 1 249 ILE 249 248 248 ILE ILE A . n 
A 1 250 ILE 250 249 249 ILE ILE A . n 
A 1 251 GLY 251 250 250 GLY GLY A . n 
A 1 252 GLY 252 251 251 GLY GLY A . n 
A 1 253 GLN 253 252 252 GLN GLN A . n 
A 1 254 VAL 254 253 253 VAL VAL A . n 
A 1 255 PHE 255 254 254 PHE PHE A . n 
A 1 256 PHE 256 255 255 PHE PHE A . n 
A 1 257 ARG 257 256 256 ARG ARG A . n 
A 1 258 GLN 258 257 257 GLN GLN A . n 
A 1 259 ARG 259 258 258 ARG ARG A . n 
A 1 260 VAL 260 259 259 VAL VAL A . n 
A 1 261 SER 261 260 260 SER SER A . n 
A 1 262 SEP 262 261 261 SEP SEP A . n 
A 1 263 GLU 263 262 262 GLU GLU A . n 
A 1 264 CYS 264 263 263 CYS CYS A . n 
A 1 265 GLN 265 264 264 GLN GLN A . n 
A 1 266 HIS 266 265 265 HIS HIS A . n 
A 1 267 LEU 267 266 266 LEU LEU A . n 
A 1 268 ILE 268 267 267 ILE ILE A . n 
A 1 269 ARG 269 268 268 ARG ARG A . n 
A 1 270 TRP 270 269 269 TRP TRP A . n 
A 1 271 CYS 271 270 270 CYS CYS A . n 
A 1 272 LEU 272 271 271 LEU LEU A . n 
A 1 273 ALA 273 272 272 ALA ALA A . n 
A 1 274 LEU 274 273 273 LEU LEU A . n 
A 1 275 ARG 275 274 274 ARG ARG A . n 
A 1 276 PRO 276 275 275 PRO PRO A . n 
A 1 277 SER 277 276 276 SER SER A . n 
A 1 278 ASP 278 277 277 ASP ASP A . n 
A 1 279 ARG 279 278 278 ARG ARG A . n 
A 1 280 PRO 280 279 279 PRO PRO A . n 
A 1 281 THR 281 280 280 THR THR A . n 
A 1 282 PHE 282 281 281 PHE PHE A . n 
A 1 283 GLU 283 282 282 GLU GLU A . n 
A 1 284 GLU 284 283 283 GLU GLU A . n 
A 1 285 ILE 285 284 284 ILE ILE A . n 
A 1 286 GLN 286 285 285 GLN GLN A . n 
A 1 287 ASN 287 286 286 ASN ASN A . n 
A 1 288 HIS 288 287 287 HIS HIS A . n 
A 1 289 PRO 289 288 288 PRO PRO A . n 
A 1 290 TRP 290 289 289 TRP TRP A . n 
A 1 291 MET 291 290 290 MET MET A . n 
A 1 292 GLN 292 291 291 GLN GLN A . n 
A 1 293 ASP 293 292 292 ASP ASP A . n 
A 1 294 VAL 294 293 293 VAL VAL A . n 
A 1 295 LEU 295 294 294 LEU LEU A . n 
A 1 296 LEU 296 295 295 LEU LEU A . n 
A 1 297 PRO 297 296 296 PRO PRO A . n 
A 1 298 GLN 298 297 297 GLN GLN A . n 
A 1 299 GLU 299 298 298 GLU GLU A . n 
A 1 300 THR 300 299 299 THR THR A . n 
A 1 301 ALA 301 300 300 ALA ALA A . n 
A 1 302 GLU 302 301 301 GLU GLU A . n 
A 1 303 ILE 303 302 302 ILE ILE A . n 
A 1 304 HIS 304 303 303 HIS HIS A . n 
A 1 305 LEU 305 304 304 LEU LEU A . n 
A 1 306 HIS 306 305 305 HIS HIS A . n 
A 1 307 SER 307 306 ?   ?   ?   A . n 
A 1 308 LEU 308 307 ?   ?   ?   A . n 
A 1 309 SER 309 308 ?   ?   ?   A . n 
A 1 310 PRO 310 309 ?   ?   ?   A . n 
A 1 311 GLY 311 310 ?   ?   ?   A . n 
A 1 312 PRO 312 311 ?   ?   ?   A . n 
A 1 313 SER 313 312 ?   ?   ?   A . n 
A 1 314 LYS 314 313 ?   ?   ?   A . n 
B 2 1   ALA 1   1   ?   ?   ?   B . n 
B 2 2   ARG 2   2   2   ARG ARG B . n 
B 2 3   LYS 3   3   3   LYS LYS B . n 
B 2 4   ARG 4   4   4   ARG ARG B . n 
B 2 5   ARG 5   5   5   ARG ARG B . n 
B 2 6   ARG 6   6   6   ARG ARG B . n 
B 2 7   HIS 7   7   7   HIS HIS B . n 
B 2 8   PRO 8   8   8   PRO PRO B . n 
B 2 9   SER 9   9   9   SER SER B . n 
B 2 10  GLY 10  10  ?   ?   ?   B . n 
B 2 11  PRO 11  11  ?   ?   ?   B . n 
B 2 12  PRO 12  12  ?   ?   ?   B . n 
B 2 13  THR 13  13  ?   ?   ?   B . n 
B 2 14  ALA 14  14  ?   ?   ?   B . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 EDO 1   401 401 EDO EDO A . 
D 4 JN5 1   501 501 JN5 JN5 A . 
E 5 HOH 1   502 1   HOH HOH A . 
E 5 HOH 2   503 2   HOH HOH A . 
E 5 HOH 3   504 3   HOH HOH A . 
E 5 HOH 4   505 4   HOH HOH A . 
E 5 HOH 5   506 5   HOH HOH A . 
E 5 HOH 6   507 6   HOH HOH A . 
E 5 HOH 7   508 7   HOH HOH A . 
E 5 HOH 8   509 8   HOH HOH A . 
E 5 HOH 9   510 9   HOH HOH A . 
E 5 HOH 10  511 10  HOH HOH A . 
E 5 HOH 11  512 11  HOH HOH A . 
E 5 HOH 12  513 12  HOH HOH A . 
E 5 HOH 13  514 13  HOH HOH A . 
E 5 HOH 14  515 14  HOH HOH A . 
E 5 HOH 15  516 15  HOH HOH A . 
E 5 HOH 16  517 16  HOH HOH A . 
E 5 HOH 17  518 17  HOH HOH A . 
E 5 HOH 18  519 18  HOH HOH A . 
E 5 HOH 19  520 19  HOH HOH A . 
E 5 HOH 20  521 20  HOH HOH A . 
E 5 HOH 21  522 23  HOH HOH A . 
E 5 HOH 22  523 24  HOH HOH A . 
E 5 HOH 23  524 25  HOH HOH A . 
E 5 HOH 24  525 26  HOH HOH A . 
E 5 HOH 25  526 27  HOH HOH A . 
E 5 HOH 26  527 28  HOH HOH A . 
E 5 HOH 27  528 29  HOH HOH A . 
E 5 HOH 28  529 30  HOH HOH A . 
E 5 HOH 29  530 31  HOH HOH A . 
E 5 HOH 30  531 32  HOH HOH A . 
E 5 HOH 31  532 33  HOH HOH A . 
E 5 HOH 32  533 34  HOH HOH A . 
E 5 HOH 33  534 35  HOH HOH A . 
E 5 HOH 34  535 36  HOH HOH A . 
E 5 HOH 35  536 37  HOH HOH A . 
E 5 HOH 36  537 38  HOH HOH A . 
E 5 HOH 37  538 39  HOH HOH A . 
E 5 HOH 38  539 40  HOH HOH A . 
E 5 HOH 39  540 41  HOH HOH A . 
E 5 HOH 40  541 42  HOH HOH A . 
E 5 HOH 41  542 44  HOH HOH A . 
E 5 HOH 42  543 45  HOH HOH A . 
E 5 HOH 43  544 46  HOH HOH A . 
E 5 HOH 44  545 47  HOH HOH A . 
E 5 HOH 45  546 48  HOH HOH A . 
E 5 HOH 46  547 49  HOH HOH A . 
E 5 HOH 47  548 50  HOH HOH A . 
E 5 HOH 48  549 51  HOH HOH A . 
E 5 HOH 49  550 52  HOH HOH A . 
E 5 HOH 50  551 53  HOH HOH A . 
E 5 HOH 51  552 54  HOH HOH A . 
E 5 HOH 52  553 55  HOH HOH A . 
E 5 HOH 53  554 56  HOH HOH A . 
E 5 HOH 54  555 57  HOH HOH A . 
E 5 HOH 55  556 58  HOH HOH A . 
E 5 HOH 56  557 59  HOH HOH A . 
E 5 HOH 57  558 60  HOH HOH A . 
E 5 HOH 58  559 61  HOH HOH A . 
E 5 HOH 59  560 62  HOH HOH A . 
E 5 HOH 60  561 63  HOH HOH A . 
E 5 HOH 61  562 64  HOH HOH A . 
E 5 HOH 62  563 65  HOH HOH A . 
E 5 HOH 63  564 66  HOH HOH A . 
E 5 HOH 64  565 67  HOH HOH A . 
E 5 HOH 65  566 68  HOH HOH A . 
E 5 HOH 66  567 69  HOH HOH A . 
E 5 HOH 67  568 70  HOH HOH A . 
E 5 HOH 68  569 71  HOH HOH A . 
E 5 HOH 69  570 72  HOH HOH A . 
E 5 HOH 70  571 73  HOH HOH A . 
E 5 HOH 71  572 74  HOH HOH A . 
E 5 HOH 72  573 75  HOH HOH A . 
E 5 HOH 73  574 76  HOH HOH A . 
E 5 HOH 74  575 77  HOH HOH A . 
E 5 HOH 75  576 79  HOH HOH A . 
E 5 HOH 76  577 80  HOH HOH A . 
E 5 HOH 77  578 81  HOH HOH A . 
E 5 HOH 78  579 82  HOH HOH A . 
E 5 HOH 79  580 83  HOH HOH A . 
E 5 HOH 80  581 84  HOH HOH A . 
E 5 HOH 81  582 85  HOH HOH A . 
E 5 HOH 82  583 86  HOH HOH A . 
E 5 HOH 83  584 87  HOH HOH A . 
E 5 HOH 84  585 88  HOH HOH A . 
E 5 HOH 85  586 89  HOH HOH A . 
E 5 HOH 86  587 90  HOH HOH A . 
E 5 HOH 87  588 91  HOH HOH A . 
E 5 HOH 88  589 92  HOH HOH A . 
E 5 HOH 89  590 93  HOH HOH A . 
E 5 HOH 90  591 94  HOH HOH A . 
E 5 HOH 91  592 95  HOH HOH A . 
E 5 HOH 92  593 96  HOH HOH A . 
E 5 HOH 93  594 97  HOH HOH A . 
E 5 HOH 94  595 98  HOH HOH A . 
E 5 HOH 95  596 99  HOH HOH A . 
E 5 HOH 96  597 100 HOH HOH A . 
E 5 HOH 97  598 101 HOH HOH A . 
E 5 HOH 98  599 102 HOH HOH A . 
E 5 HOH 99  600 103 HOH HOH A . 
E 5 HOH 100 601 104 HOH HOH A . 
E 5 HOH 101 602 105 HOH HOH A . 
E 5 HOH 102 603 106 HOH HOH A . 
E 5 HOH 103 604 107 HOH HOH A . 
E 5 HOH 104 605 108 HOH HOH A . 
E 5 HOH 105 606 109 HOH HOH A . 
E 5 HOH 106 607 110 HOH HOH A . 
E 5 HOH 107 608 111 HOH HOH A . 
E 5 HOH 108 609 112 HOH HOH A . 
E 5 HOH 109 610 113 HOH HOH A . 
E 5 HOH 110 611 114 HOH HOH A . 
E 5 HOH 111 612 115 HOH HOH A . 
E 5 HOH 112 613 116 HOH HOH A . 
E 5 HOH 113 614 117 HOH HOH A . 
E 5 HOH 114 615 118 HOH HOH A . 
E 5 HOH 115 616 119 HOH HOH A . 
E 5 HOH 116 617 120 HOH HOH A . 
E 5 HOH 117 618 121 HOH HOH A . 
E 5 HOH 118 619 122 HOH HOH A . 
E 5 HOH 119 620 123 HOH HOH A . 
E 5 HOH 120 621 124 HOH HOH A . 
E 5 HOH 121 622 125 HOH HOH A . 
E 5 HOH 122 623 126 HOH HOH A . 
E 5 HOH 123 624 127 HOH HOH A . 
E 5 HOH 124 625 128 HOH HOH A . 
E 5 HOH 125 626 129 HOH HOH A . 
E 5 HOH 126 627 130 HOH HOH A . 
E 5 HOH 127 628 131 HOH HOH A . 
E 5 HOH 128 629 132 HOH HOH A . 
E 5 HOH 129 630 133 HOH HOH A . 
E 5 HOH 130 631 134 HOH HOH A . 
E 5 HOH 131 632 135 HOH HOH A . 
E 5 HOH 132 633 136 HOH HOH A . 
E 5 HOH 133 634 137 HOH HOH A . 
E 5 HOH 134 635 138 HOH HOH A . 
E 5 HOH 135 636 142 HOH HOH A . 
E 5 HOH 136 637 143 HOH HOH A . 
E 5 HOH 137 638 144 HOH HOH A . 
E 5 HOH 138 639 145 HOH HOH A . 
E 5 HOH 139 640 146 HOH HOH A . 
E 5 HOH 140 641 147 HOH HOH A . 
E 5 HOH 141 642 148 HOH HOH A . 
E 5 HOH 142 643 149 HOH HOH A . 
E 5 HOH 143 644 150 HOH HOH A . 
E 5 HOH 144 645 151 HOH HOH A . 
E 5 HOH 145 646 153 HOH HOH A . 
E 5 HOH 146 647 154 HOH HOH A . 
E 5 HOH 147 648 155 HOH HOH A . 
E 5 HOH 148 649 156 HOH HOH A . 
E 5 HOH 149 650 157 HOH HOH A . 
E 5 HOH 150 651 158 HOH HOH A . 
E 5 HOH 151 652 159 HOH HOH A . 
E 5 HOH 152 653 160 HOH HOH A . 
E 5 HOH 153 654 161 HOH HOH A . 
E 5 HOH 154 655 162 HOH HOH A . 
E 5 HOH 155 656 163 HOH HOH A . 
E 5 HOH 156 657 164 HOH HOH A . 
E 5 HOH 157 658 165 HOH HOH A . 
E 5 HOH 158 659 166 HOH HOH A . 
E 5 HOH 159 660 167 HOH HOH A . 
E 5 HOH 160 661 168 HOH HOH A . 
E 5 HOH 161 662 169 HOH HOH A . 
E 5 HOH 162 663 170 HOH HOH A . 
E 5 HOH 163 664 171 HOH HOH A . 
E 5 HOH 164 665 172 HOH HOH A . 
E 5 HOH 165 666 174 HOH HOH A . 
E 5 HOH 166 667 175 HOH HOH A . 
E 5 HOH 167 668 176 HOH HOH A . 
E 5 HOH 168 669 177 HOH HOH A . 
E 5 HOH 169 670 178 HOH HOH A . 
E 5 HOH 170 671 179 HOH HOH A . 
E 5 HOH 171 672 180 HOH HOH A . 
E 5 HOH 172 673 181 HOH HOH A . 
E 5 HOH 173 674 182 HOH HOH A . 
E 5 HOH 174 675 183 HOH HOH A . 
E 5 HOH 175 676 184 HOH HOH A . 
E 5 HOH 176 677 185 HOH HOH A . 
E 5 HOH 177 678 188 HOH HOH A . 
E 5 HOH 178 679 189 HOH HOH A . 
E 5 HOH 179 680 191 HOH HOH A . 
E 5 HOH 180 681 194 HOH HOH A . 
E 5 HOH 181 682 195 HOH HOH A . 
E 5 HOH 182 683 196 HOH HOH A . 
E 5 HOH 183 684 197 HOH HOH A . 
E 5 HOH 184 685 198 HOH HOH A . 
E 5 HOH 185 686 199 HOH HOH A . 
E 5 HOH 186 687 200 HOH HOH A . 
E 5 HOH 187 688 203 HOH HOH A . 
E 5 HOH 188 689 204 HOH HOH A . 
E 5 HOH 189 690 205 HOH HOH A . 
E 5 HOH 190 691 206 HOH HOH A . 
E 5 HOH 191 692 207 HOH HOH A . 
E 5 HOH 192 693 209 HOH HOH A . 
E 5 HOH 193 694 212 HOH HOH A . 
E 5 HOH 194 695 214 HOH HOH A . 
E 5 HOH 195 696 215 HOH HOH A . 
E 5 HOH 196 697 216 HOH HOH A . 
E 5 HOH 197 698 217 HOH HOH A . 
E 5 HOH 198 699 219 HOH HOH A . 
E 5 HOH 199 700 221 HOH HOH A . 
E 5 HOH 200 701 222 HOH HOH A . 
E 5 HOH 201 702 223 HOH HOH A . 
E 5 HOH 202 703 224 HOH HOH A . 
E 5 HOH 203 704 225 HOH HOH A . 
E 5 HOH 204 705 226 HOH HOH A . 
E 5 HOH 205 706 227 HOH HOH A . 
E 5 HOH 206 707 228 HOH HOH A . 
E 5 HOH 207 708 229 HOH HOH A . 
E 5 HOH 208 709 230 HOH HOH A . 
E 5 HOH 209 710 140 HOH HOH A . 
E 5 HOH 210 711 152 HOH HOH A . 
E 5 HOH 211 712 193 HOH HOH A . 
F 5 HOH 1   43  43  HOH HOH B . 
F 5 HOH 2   78  78  HOH HOH B . 
F 5 HOH 3   139 139 HOH HOH B . 
F 5 HOH 4   141 141 HOH HOH B . 
F 5 HOH 5   173 173 HOH HOH B . 
F 5 HOH 6   192 192 HOH HOH B . 
F 5 HOH 7   213 213 HOH HOH B . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    SEP 
_pdbx_struct_mod_residue.label_seq_id     262 
_pdbx_struct_mod_residue.auth_asym_id     A 
_pdbx_struct_mod_residue.auth_comp_id     SEP 
_pdbx_struct_mod_residue.auth_seq_id      261 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   SER 
_pdbx_struct_mod_residue.details          'modified residue' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1100  ? 
1 MORE         2.8   ? 
1 'SSA (A^2)'  13120 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-07-15 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-10-25 
4 'Structure model' 1 3 2021-10-20 
5 'Structure model' 1 4 2022-02-16 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                     
2 2 'Structure model' 'Version format compliance'  
3 3 'Structure model' 'Author supporting evidence' 
4 4 'Structure model' 'Database references'        
5 4 'Structure model' 'Derived calculations'       
6 5 'Structure model' 'Database references'        
7 5 'Structure model' 'Derived calculations'       
8 5 'Structure model' 'Source and taxonomy'        
9 5 'Structure model' 'Structure summary'          
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  3 'Structure model' pdbx_struct_assembly_auth_evidence 
2  4 'Structure model' database_2                         
3  4 'Structure model' struct_conn                        
4  4 'Structure model' struct_ref_seq_dif                 
5  4 'Structure model' struct_site                        
6  5 'Structure model' entity                             
7  5 'Structure model' entity_src_gen                     
8  5 'Structure model' pdbx_entity_src_syn                
9  5 'Structure model' pdbx_struct_mod_residue            
10 5 'Structure model' struct_ref                         
11 5 'Structure model' struct_ref_seq                     
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_database_2.pdbx_DOI'                           
2  4 'Structure model' '_database_2.pdbx_database_accession'            
3  4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'            
4  4 'Structure model' '_struct_ref_seq_dif.details'                    
5  4 'Structure model' '_struct_site.pdbx_auth_asym_id'                 
6  4 'Structure model' '_struct_site.pdbx_auth_comp_id'                 
7  4 'Structure model' '_struct_site.pdbx_auth_seq_id'                  
8  5 'Structure model' '_entity.pdbx_description'                       
9  5 'Structure model' '_entity.pdbx_mutation'                          
10 5 'Structure model' '_entity_src_gen.gene_src_common_name'           
11 5 'Structure model' '_entity_src_gen.pdbx_beg_seq_num'               
12 5 'Structure model' '_entity_src_gen.pdbx_end_seq_num'               
13 5 'Structure model' '_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id' 
14 5 'Structure model' '_entity_src_gen.pdbx_seq_type'                  
15 5 'Structure model' '_pdbx_entity_src_syn.details'                   
16 5 'Structure model' '_pdbx_entity_src_syn.ncbi_taxonomy_id'          
17 5 'Structure model' '_pdbx_entity_src_syn.organism_scientific'       
18 5 'Structure model' '_pdbx_entity_src_syn.pdbx_beg_seq_num'          
19 5 'Structure model' '_pdbx_entity_src_syn.pdbx_end_seq_num'          
20 5 'Structure model' '_pdbx_struct_mod_residue.details'               
21 5 'Structure model' '_struct_ref.db_code'                            
22 5 'Structure model' '_struct_ref.pdbx_db_accession'                  
23 5 'Structure model' '_struct_ref.pdbx_seq_one_letter_code'           
24 5 'Structure model' '_struct_ref_seq.pdbx_db_accession'              
# 
_diffrn_reflns.diffrn_id                   1 
_diffrn_reflns.pdbx_d_res_high             1.735 
_diffrn_reflns.pdbx_d_res_low              31.189 
_diffrn_reflns.pdbx_number_obs             24190 
_diffrn_reflns.pdbx_Rmerge_I_obs           0.103 
_diffrn_reflns.pdbx_Rsym_value             0.103 
_diffrn_reflns.pdbx_chi_squared            ? 
_diffrn_reflns.av_sigmaI_over_netI         7.20 
_diffrn_reflns.pdbx_redundancy             4.90 
_diffrn_reflns.pdbx_percent_possible_obs   100.00 
_diffrn_reflns.number                      118479 
_diffrn_reflns.pdbx_observed_criterion     ? 
_diffrn_reflns.limit_h_max                 ? 
_diffrn_reflns.limit_h_min                 ? 
_diffrn_reflns.limit_k_max                 ? 
_diffrn_reflns.limit_k_min                 ? 
_diffrn_reflns.limit_l_max                 ? 
_diffrn_reflns.limit_l_min                 ? 
# 
loop_
_pdbx_diffrn_reflns_shell.diffrn_id 
_pdbx_diffrn_reflns_shell.d_res_high 
_pdbx_diffrn_reflns_shell.d_res_low 
_pdbx_diffrn_reflns_shell.number_obs 
_pdbx_diffrn_reflns_shell.rejects 
_pdbx_diffrn_reflns_shell.Rmerge_I_obs 
_pdbx_diffrn_reflns_shell.Rsym_value 
_pdbx_diffrn_reflns_shell.chi_squared 
_pdbx_diffrn_reflns_shell.redundancy 
_pdbx_diffrn_reflns_shell.percent_possible_obs 
1 6.80 31.19 ? ? 0.021 0.021 ? 4.80 99.00  
1 4.81 6.80  ? ? 0.031 0.031 ? 5.00 100.00 
1 3.93 4.81  ? ? 0.033 0.033 ? 5.00 100.00 
1 3.40 3.93  ? ? 0.057 0.057 ? 4.90 100.00 
1 3.04 3.40  ? ? 0.095 0.095 ? 5.00 100.00 
1 2.78 3.04  ? ? 0.153 0.153 ? 4.90 100.00 
1 2.57 2.78  ? ? 0.248 0.248 ? 4.90 100.00 
1 2.40 2.57  ? ? 0.344 0.344 ? 4.90 100.00 
1 2.27 2.40  ? ? 0.468 0.468 ? 4.80 100.00 
1 2.15 2.27  ? ? 0.747 0.747 ? 4.80 100.00 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined -20.4430 30.7830 8.8450  -0.0478 0.0286  -0.1102 -0.1224 0.0206  0.0490  4.1476 4.9808 3.8823 2.1117 1.6615 1.7474  
0.2052 -0.2434 0.0382  -0.4878 -0.1040 0.3712 0.4639  0.3709 -0.4669 'X-RAY DIFFRACTION' 
2 ? refined -2.9560  44.7820 -1.7270 -0.1681 -0.1503 -0.2504 0.0055  -0.0186 -0.0104 0.9602 1.5764 2.0846 0.0322 0.0749 -0.3111 
0.0356 0.0105  -0.0461 0.0146  -0.0160 0.0100 -0.0868 0.0731 -0.0155 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A A 119 ? 33  A 34  A 120 'X-RAY DIFFRACTION' ? 
2 2 A A 305 ? 120 A 121 A 306 'X-RAY DIFFRACTION' ? 
# 
_pdbx_phasing_MR.entry_id                     3CY3 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                'Phaser MODE: MR_AUTO' 
_pdbx_phasing_MR.R_factor                     ? 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          2.500 
_pdbx_phasing_MR.d_res_low_rotation           29.420 
_pdbx_phasing_MR.d_res_high_translation       2.180 
_pdbx_phasing_MR.d_res_low_translation        29.420 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
_phasing.method   MR 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
SCALA        3.2.25 21/9/2006            other   'Phil Evans'      pre@mrc-lmb.cam.ac.uk       'data scaling'    
http://www.ccp4.ac.uk/dist/html/INDEX.html  Fortran_77 ? 1 
PHASER       .      ?                    other   'R. J. Read'      cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/ ?          ? 2 
REFMAC       .      ?                    program 'Murshudov, G.N.' ccp4@dl.ac.uk               refinement        
http://www.ccp4.ac.uk/main.html             Fortran_77 ? 3 
PDB_EXTRACT  3.005  'September 10, 2007' package PDB               sw-help@rcsb.rutgers.edu    'data extraction' 
http://pdb.rutgers.edu/software/            C++        ? 4 
CrystalClear .      ?                    ?       ?                 ?                           'data collection' ? ?          ? 5 
MOSFLM       .      ?                    ?       ?                 ?                           'data reduction'  ? ?          ? 6 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    588 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    625 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.19 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A ASP 170 ? ? CG A ASP 170 ? ? OD1 A ASP 170 ? ? 124.97 118.30 6.67 0.90 N 
2 1 NE B ARG 5   ? ? CZ B ARG 5   ? ? NH1 B ARG 5   ? ? 123.37 120.30 3.07 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 167 ? ? -148.45 50.18 
2 1 ASP A 186 ? ? 56.83   74.92 
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    C1J 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    A 
_pdbx_validate_chiral.auth_comp_id    JN5 
_pdbx_validate_chiral.auth_seq_id     501 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         PLANAR 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 35  ? CG  ? A GLU 36  CG  
2  1 Y 1 A GLU 35  ? CD  ? A GLU 36  CD  
3  1 Y 1 A GLU 35  ? OE1 ? A GLU 36  OE1 
4  1 Y 1 A GLU 35  ? OE2 ? A GLU 36  OE2 
5  1 Y 1 A SER 36  ? OG  ? A SER 37  OG  
6  1 Y 1 A GLU 79  ? CG  ? A GLU 80  CG  
7  1 Y 1 A GLU 79  ? CD  ? A GLU 80  CD  
8  1 Y 1 A GLU 79  ? OE1 ? A GLU 80  OE1 
9  1 Y 1 A GLU 79  ? OE2 ? A GLU 80  OE2 
10 1 Y 1 A LEU 80  ? CG  ? A LEU 81  CG  
11 1 Y 1 A LEU 80  ? CD1 ? A LEU 81  CD1 
12 1 Y 1 A LEU 80  ? CD2 ? A LEU 81  CD2 
13 1 Y 1 A THR 84  ? OG1 ? A THR 85  OG1 
14 1 Y 1 A THR 84  ? CG2 ? A THR 85  CG2 
15 1 Y 1 A LYS 94  ? NZ  ? A LYS 95  NZ  
16 1 Y 1 A ARG 179 ? NH1 ? A ARG 180 NH1 
17 1 Y 1 A ARG 179 ? NH2 ? A ARG 180 NH2 
18 1 Y 1 A ASP 202 ? OD1 ? A ASP 203 OD1 
19 1 Y 1 A ASP 202 ? OD2 ? A ASP 203 OD2 
20 1 Y 1 A ARG 274 ? CZ  ? A ARG 275 CZ  
21 1 Y 1 A ARG 274 ? NH1 ? A ARG 275 NH1 
22 1 Y 1 A ARG 274 ? NH2 ? A ARG 275 NH2 
23 1 Y 1 B LYS 3   ? CD  ? B LYS 3   CD  
24 1 Y 1 B LYS 3   ? CE  ? B LYS 3   CE  
25 1 Y 1 B LYS 3   ? NZ  ? B LYS 3   NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 0   ? A SER 1   
2  1 Y 1 A MET 1   ? A MET 2   
3  1 Y 1 A LEU 2   ? A LEU 3   
4  1 Y 1 A LEU 3   ? A LEU 4   
5  1 Y 1 A SER 4   ? A SER 5   
6  1 Y 1 A LYS 5   ? A LYS 6   
7  1 Y 1 A ILE 6   ? A ILE 7   
8  1 Y 1 A ASN 7   ? A ASN 8   
9  1 Y 1 A SER 8   ? A SER 9   
10 1 Y 1 A LEU 9   ? A LEU 10  
11 1 Y 1 A ALA 10  ? A ALA 11  
12 1 Y 1 A HIS 11  ? A HIS 12  
13 1 Y 1 A LEU 12  ? A LEU 13  
14 1 Y 1 A ARG 13  ? A ARG 14  
15 1 Y 1 A ALA 14  ? A ALA 15  
16 1 Y 1 A ALA 15  ? A ALA 16  
17 1 Y 1 A PRO 16  ? A PRO 17  
18 1 Y 1 A CYS 17  ? A CYS 18  
19 1 Y 1 A ASN 18  ? A ASN 19  
20 1 Y 1 A ASP 19  ? A ASP 20  
21 1 Y 1 A LEU 20  ? A LEU 21  
22 1 Y 1 A HIS 21  ? A HIS 22  
23 1 Y 1 A ALA 22  ? A ALA 23  
24 1 Y 1 A THR 23  ? A THR 24  
25 1 Y 1 A LYS 24  ? A LYS 25  
26 1 Y 1 A LEU 25  ? A LEU 26  
27 1 Y 1 A ALA 26  ? A ALA 27  
28 1 Y 1 A PRO 27  ? A PRO 28  
29 1 Y 1 A GLY 28  ? A GLY 29  
30 1 Y 1 A LYS 29  ? A LYS 30  
31 1 Y 1 A GLU 30  ? A GLU 31  
32 1 Y 1 A LYS 31  ? A LYS 32  
33 1 Y 1 A GLU 32  ? A GLU 33  
34 1 Y 1 A ASN 82  ? A ASN 83  
35 1 Y 1 A GLY 83  ? A GLY 84  
36 1 Y 1 A SER 306 ? A SER 307 
37 1 Y 1 A LEU 307 ? A LEU 308 
38 1 Y 1 A SER 308 ? A SER 309 
39 1 Y 1 A PRO 309 ? A PRO 310 
40 1 Y 1 A GLY 310 ? A GLY 311 
41 1 Y 1 A PRO 311 ? A PRO 312 
42 1 Y 1 A SER 312 ? A SER 313 
43 1 Y 1 A LYS 313 ? A LYS 314 
44 1 Y 1 B ALA 1   ? B ALA 1   
45 1 Y 1 B GLY 10  ? B GLY 10  
46 1 Y 1 B PRO 11  ? B PRO 11  
47 1 Y 1 B PRO 12  ? B PRO 12  
48 1 Y 1 B THR 13  ? B THR 13  
49 1 Y 1 B ALA 14  ? B ALA 14  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 1,2-ETHANEDIOL                                                                          EDO 
4 '(2S)-1,3-benzothiazol-2-yl{2-[(2-pyridin-3-ylethyl)amino]pyrimidin-4-yl}ethanenitrile' JN5 
5 water                                                                                   HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#