data_3D10
# 
_entry.id   3D10 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3D10         
RCSB  RCSB047455   
WWPDB D_1000047455 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3CZT 'Crystal Structure of S100B in the Calcium and Zinc Loaded State at pH 9.0' unspecified 
PDB 3DOY 'Crystal Structure of S100B in the Calcium and Zinc Loaded State at pH 6.5' unspecified 
PDB 2H61 'X-Ray Structure Of Human Ca2+-Loaded S100B'                                unspecified 
PDB 1XYD 'Nmr Solution Structure Of Rat Zinc-Calcium-S100B'                          unspecified 
# 
_pdbx_database_status.entry_id                        3D10 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2008-05-02 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ostendorp, T.'  1 
'Diez, J.'       2 
'Heizmann, C.W.' 3 
'Fritz, G.'      4 
# 
_citation.id                        primary 
_citation.title                     
'The crystal structures of human S100B in the zinc- and calcium-loaded state at three pH values reveal zinc ligand swapping.' 
_citation.journal_abbrev            Biochim.Biophys.Acta 
_citation.journal_volume            1813 
_citation.page_first                1083 
_citation.page_last                 1091 
_citation.year                      2011 
_citation.journal_id_ASTM           BBACAQ 
_citation.country                   NE 
_citation.journal_id_ISSN           0006-3002 
_citation.journal_id_CSD            0113 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20950652 
_citation.pdbx_database_id_DOI      10.1016/j.bbamcr.2010.10.006 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ostendorp, T.'  1 
primary 'Diez, J.'       2 
primary 'Heizmann, C.W.' 3 
primary 'Fritz, G.'      4 
# 
_cell.length_a           34.750 
_cell.length_b           58.180 
_cell.length_c           47.850 
_cell.angle_alpha        90.000 
_cell.angle_beta         111.080 
_cell.angle_gamma        90.000 
_cell.entry_id           3D10 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              4 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.entry_id                         3D10 
_symmetry.Int_Tables_number                4 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Protein S100-B'     10727.037 2   ? ? ? ? 
2 non-polymer syn 'CALCIUM ION'        40.078    4   ? ? ? ? 
3 non-polymer syn 'ZINC ION'           65.409    2   ? ? ? ? 
4 non-polymer syn 'TRIETHYLENE GLYCOL' 150.173   1   ? ? ? ? 
5 water       nat water                18.015    152 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'S100 calcium-binding protein B, S-100 protein subunit beta, S-100 protein beta chain' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAM
VTTACHEFFEHE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAM
VTTACHEFFEHE
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  SER n 
1 3  GLU n 
1 4  LEU n 
1 5  GLU n 
1 6  LYS n 
1 7  ALA n 
1 8  MET n 
1 9  VAL n 
1 10 ALA n 
1 11 LEU n 
1 12 ILE n 
1 13 ASP n 
1 14 VAL n 
1 15 PHE n 
1 16 HIS n 
1 17 GLN n 
1 18 TYR n 
1 19 SER n 
1 20 GLY n 
1 21 ARG n 
1 22 GLU n 
1 23 GLY n 
1 24 ASP n 
1 25 LYS n 
1 26 HIS n 
1 27 LYS n 
1 28 LEU n 
1 29 LYS n 
1 30 LYS n 
1 31 SER n 
1 32 GLU n 
1 33 LEU n 
1 34 LYS n 
1 35 GLU n 
1 36 LEU n 
1 37 ILE n 
1 38 ASN n 
1 39 ASN n 
1 40 GLU n 
1 41 LEU n 
1 42 SER n 
1 43 HIS n 
1 44 PHE n 
1 45 LEU n 
1 46 GLU n 
1 47 GLU n 
1 48 ILE n 
1 49 LYS n 
1 50 GLU n 
1 51 GLN n 
1 52 GLU n 
1 53 VAL n 
1 54 VAL n 
1 55 ASP n 
1 56 LYS n 
1 57 VAL n 
1 58 MET n 
1 59 GLU n 
1 60 THR n 
1 61 LEU n 
1 62 ASP n 
1 63 ASN n 
1 64 ASP n 
1 65 GLY n 
1 66 ASP n 
1 67 GLY n 
1 68 GLU n 
1 69 CYS n 
1 70 ASP n 
1 71 PHE n 
1 72 GLN n 
1 73 GLU n 
1 74 PHE n 
1 75 MET n 
1 76 ALA n 
1 77 PHE n 
1 78 VAL n 
1 79 ALA n 
1 80 MET n 
1 81 VAL n 
1 82 THR n 
1 83 THR n 
1 84 ALA n 
1 85 CYS n 
1 86 HIS n 
1 87 GLU n 
1 88 PHE n 
1 89 PHE n 
1 90 GLU n 
1 91 HIS n 
1 92 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 S100B 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEMEX-2 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    S100B_HUMAN 
_struct_ref.pdbx_db_accession          P04271 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAM
VTTACHEFFEHE
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3D10 A 1 ? 92 ? P04271 1 ? 92 ? 0 91 
2 1 3D10 B 1 ? 92 ? P04271 1 ? 92 ? 0 91 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE              ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE             ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE           ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'      ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'        ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE             ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE            ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'      ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE              ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE            ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE           ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE              ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE               ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE           ? 'C5 H11 N O2 S'  149.211 
PGE non-polymer         . 'TRIETHYLENE GLYCOL' ? 'C6 H14 O4'      150.173 
PHE 'L-peptide linking' y PHENYLALANINE        ? 'C9 H11 N O2'    165.189 
SER 'L-peptide linking' y SERINE               ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE            ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE             ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE               ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'           ? 'Zn 2'           65.409  
# 
_exptl.crystals_number   1 
_exptl.entry_id          3D10 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.10 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   41.53 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              10.0 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    '0.02 M CAPS pH 10.0, 23% PEG5000MME, VAPOR DIFFUSION, HANGING DROP, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2005-02-03 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0089 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0089 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
# 
_reflns.entry_id                     3D10 
_reflns.d_resolution_high            1.550 
_reflns.number_obs                   25152 
_reflns.pdbx_Rmerge_I_obs            0.134 
_reflns.pdbx_netI_over_sigmaI        5.340 
_reflns.percent_possible_obs         98.600 
_reflns.B_iso_Wilson_estimate        31.619 
_reflns.observed_criterion_sigma_I   -3.00 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             10 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_redundancy              3.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.55 
_reflns_shell.d_res_low              1.60 
_reflns_shell.number_measured_obs    5373 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_unique_obs      2236 
_reflns_shell.Rmerge_I_obs           0.440 
_reflns_shell.meanI_over_sigI_obs    2.0 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.percent_possible_all   95.80 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3D10 
_refine.ls_d_res_high                            1.650 
_refine.ls_d_res_low                             10 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    96.880 
_refine.ls_number_reflns_obs                     20791 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.ls_R_factor_obs                          0.212 
_refine.ls_R_factor_R_work                       0.209 
_refine.ls_R_factor_R_free                       0.275 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  1058 
_refine.B_iso_mean                               18.549 
_refine.aniso_B[1][1]                            1.390 
_refine.aniso_B[2][2]                            0.390 
_refine.aniso_B[3][3]                            -2.060 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            -0.400 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.952 
_refine.correlation_coeff_Fo_to_Fc_free          0.916 
_refine.pdbx_overall_ESU_R                       0.127 
_refine.pdbx_overall_ESU_R_Free                  0.136 
_refine.overall_SU_ML                            0.117 
_refine.overall_SU_B                             6.627 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_starting_model                      'pdb entry 2H61 chain A and B' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1488 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         16 
_refine_hist.number_atoms_solvent             152 
_refine_hist.number_atoms_total               1656 
_refine_hist.d_res_high                       1.650 
_refine_hist.d_res_low                        10 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         1534 0.021  0.021  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      2050 1.907  1.952  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   185  5.371  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   85   35.069 26.471 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   300  16.433 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   2    14.505 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           219  0.151  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     1152 0.010  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            829  0.246  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          1048 0.314  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    114  0.195  0.200  ? 'X-RAY DIFFRACTION' ? 
r_metal_ion_refined      20   0.177  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   75   0.271  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 28   0.291  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              955  1.325  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             1469 1.708  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              642  2.873  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             580  4.012  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       1.650 
_refine_ls_shell.d_res_low                        1.693 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               98.130 
_refine_ls_shell.number_reflns_R_work             1456 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.247 
_refine_ls_shell.R_factor_R_free                  0.330 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             64 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                1520 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3D10 
_struct.title                     'Crystal Structure of S100B in the Calcium and Zinc Loaded State at pH 10.0' 
_struct.pdbx_descriptor           'Protein S100-B' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3D10 
_struct_keywords.pdbx_keywords   'METAL BINDING PROTEIN' 
_struct_keywords.text            'S100B, S100, EF-hand, Metal-binding, Nucleus, METAL BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 2 ? 
H N N 2 ? 
I N N 4 ? 
J N N 5 ? 
K N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   . 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 2  ? GLY A 20 ? SER A 1  GLY A 19 1 ? 19 
HELX_P HELX_P2 2 LYS A 29 ? LEU A 41 ? LYS A 28 LEU A 40 1 ? 13 
HELX_P HELX_P3 3 GLU A 50 ? ASP A 62 ? GLU A 49 ASP A 61 1 ? 13 
HELX_P HELX_P4 4 ASP A 70 ? PHE A 89 ? ASP A 69 PHE A 88 1 ? 20 
HELX_P HELX_P5 5 SER B 2  ? GLY B 20 ? SER B 1  GLY B 19 1 ? 19 
HELX_P HELX_P6 6 LYS B 29 ? LEU B 41 ? LYS B 28 LEU B 40 1 ? 13 
HELX_P HELX_P7 7 GLU B 50 ? ASP B 62 ? GLU B 49 ASP B 61 1 ? 13 
HELX_P HELX_P8 8 ASP B 70 ? PHE B 89 ? ASP B 69 PHE B 88 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A HIS 16 NE2 ? ? ? 1_555 E ZN  . ZN ? ? A HIS 15 A ZN  94  1_555 ? ? ? ? ? ? ? 2.174 ? 
metalc2  metalc ? ? A SER 19 O   ? ? ? 1_555 D CA  . CA ? ? A SER 18 A CA  93  1_555 ? ? ? ? ? ? ? 2.311 ? 
metalc3  metalc ? ? A GLU 22 O   ? ? ? 1_555 D CA  . CA ? ? A GLU 21 A CA  93  1_555 ? ? ? ? ? ? ? 2.309 ? 
metalc4  metalc ? ? A ASP 24 O   ? ? ? 1_555 D CA  . CA ? ? A ASP 23 A CA  93  1_555 ? ? ? ? ? ? ? 2.668 ? 
metalc5  metalc ? ? A HIS 26 NE2 ? ? ? 1_555 E ZN  . ZN ? ? A HIS 25 A ZN  94  1_555 ? ? ? ? ? ? ? 1.936 ? 
metalc6  metalc ? ? A LYS 27 O   ? ? ? 1_555 D CA  . CA ? ? A LYS 26 A CA  93  1_555 ? ? ? ? ? ? ? 2.479 ? 
metalc7  metalc ? ? A GLU 32 OE1 ? ? ? 1_555 D CA  . CA ? ? A GLU 31 A CA  93  1_555 ? ? ? ? ? ? ? 2.760 ? 
metalc8  metalc ? ? A GLU 32 OE2 ? ? ? 1_555 D CA  . CA ? ? A GLU 31 A CA  93  1_555 ? ? ? ? ? ? ? 2.725 ? 
metalc9  metalc ? ? A ASP 62 OD1 ? ? ? 1_555 C CA  . CA ? ? A ASP 61 A CA  92  1_555 ? ? ? ? ? ? ? 2.267 ? 
metalc10 metalc ? ? A ASP 64 OD2 ? ? ? 1_555 C CA  . CA ? ? A ASP 63 A CA  92  1_555 ? ? ? ? ? ? ? 2.266 ? 
metalc11 metalc ? ? A ASP 66 OD1 ? ? ? 1_555 C CA  . CA ? ? A ASP 65 A CA  92  1_555 ? ? ? ? ? ? ? 2.392 ? 
metalc12 metalc ? ? A GLU 68 O   ? ? ? 1_555 C CA  . CA ? ? A GLU 67 A CA  92  1_555 ? ? ? ? ? ? ? 2.241 ? 
metalc13 metalc ? ? A GLU 73 OE1 ? ? ? 1_555 C CA  . CA ? ? A GLU 72 A CA  92  1_555 ? ? ? ? ? ? ? 2.440 ? 
metalc14 metalc ? ? A GLU 73 OE2 ? ? ? 1_555 C CA  . CA ? ? A GLU 72 A CA  92  1_555 ? ? ? ? ? ? ? 2.653 ? 
metalc15 metalc ? ? A HIS 86 NE2 ? ? ? 1_555 F ZN  . ZN ? ? A HIS 85 A ZN  95  1_555 ? ? ? ? ? ? ? 2.121 ? 
metalc16 metalc ? ? A GLU 90 OE2 ? ? ? 1_555 F ZN  . ZN ? ? A GLU 89 A ZN  95  1_555 ? ? ? ? ? ? ? 2.283 ? 
metalc17 metalc ? ? B HIS 16 NE2 ? ? ? 1_555 F ZN  . ZN ? ? B HIS 15 A ZN  95  1_555 ? ? ? ? ? ? ? 2.047 ? 
metalc18 metalc ? ? B SER 19 O   ? ? ? 1_555 G CA  . CA ? ? B SER 18 B CA  92  1_555 ? ? ? ? ? ? ? 2.305 ? 
metalc19 metalc ? ? B GLU 22 O   ? ? ? 1_555 G CA  . CA ? ? B GLU 21 B CA  92  1_555 ? ? ? ? ? ? ? 2.288 ? 
metalc20 metalc ? ? B ASP 24 O   ? ? ? 1_555 G CA  . CA ? ? B ASP 23 B CA  92  1_555 ? ? ? ? ? ? ? 2.389 ? 
metalc21 metalc ? ? B HIS 26 NE2 ? ? ? 1_555 F ZN  . ZN ? ? B HIS 25 A ZN  95  1_555 ? ? ? ? ? ? ? 1.854 ? 
metalc22 metalc ? ? B LYS 27 O   ? ? ? 1_555 G CA  . CA ? ? B LYS 26 B CA  92  1_555 ? ? ? ? ? ? ? 2.498 ? 
metalc23 metalc ? ? B GLU 32 OE1 ? ? ? 1_555 G CA  . CA ? ? B GLU 31 B CA  92  1_555 ? ? ? ? ? ? ? 2.243 ? 
metalc24 metalc ? ? B GLU 32 OE2 ? ? ? 1_555 G CA  . CA ? ? B GLU 31 B CA  92  1_555 ? ? ? ? ? ? ? 2.762 ? 
metalc25 metalc ? ? B ASP 64 OD2 ? ? ? 1_555 H CA  . CA ? ? B ASP 63 B CA  93  1_555 ? ? ? ? ? ? ? 2.240 ? 
metalc26 metalc ? ? B ASP 66 OD1 ? ? ? 1_555 H CA  . CA ? ? B ASP 65 B CA  93  1_555 ? ? ? ? ? ? ? 2.664 ? 
metalc27 metalc ? ? B GLU 68 O   ? ? ? 1_555 H CA  . CA ? ? B GLU 67 B CA  93  1_555 ? ? ? ? ? ? ? 2.342 ? 
metalc28 metalc ? ? B GLU 73 OE1 ? ? ? 1_555 H CA  . CA ? ? B GLU 72 B CA  93  1_555 ? ? ? ? ? ? ? 2.388 ? 
metalc29 metalc ? ? B GLU 73 OE2 ? ? ? 1_555 H CA  . CA ? ? B GLU 72 B CA  93  1_555 ? ? ? ? ? ? ? 2.448 ? 
metalc30 metalc ? ? B HIS 86 NE2 ? ? ? 1_555 E ZN  . ZN ? ? B HIS 85 A ZN  94  1_555 ? ? ? ? ? ? ? 2.198 ? 
metalc31 metalc ? ? C CA  .  CA  ? ? ? 1_555 J HOH . O  ? ? A CA  92 A HOH 98  1_555 ? ? ? ? ? ? ? 2.304 ? 
metalc32 metalc ? ? D CA  .  CA  ? ? ? 1_555 J HOH . O  ? ? A CA  93 A HOH 123 1_555 ? ? ? ? ? ? ? 2.371 ? 
metalc33 metalc ? ? G CA  .  CA  ? ? ? 1_555 K HOH . O  ? ? B CA  92 B HOH 132 1_555 ? ? ? ? ? ? ? 2.395 ? 
metalc34 metalc ? ? H CA  .  CA  ? ? ? 1_555 K HOH . O  ? ? B CA  93 B HOH 152 1_555 ? ? ? ? ? ? ? 2.739 ? 
metalc35 metalc ? ? A GLU 90 OE1 ? ? ? 1_555 F ZN  . ZN ? ? A GLU 89 A ZN  95  1_555 ? ? ? ? ? ? ? 2.630 ? 
metalc36 metalc ? ? B GLU 90 OE1 ? ? ? 1_555 E ZN  . ZN ? ? B GLU 89 A ZN  94  1_555 ? ? ? ? ? ? ? 2.638 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLU 
_struct_mon_prot_cis.label_seq_id           90 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLU 
_struct_mon_prot_cis.auth_seq_id            89 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   HIS 
_struct_mon_prot_cis.pdbx_label_seq_id_2    91 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    HIS 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     90 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -1.54 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CA A 92' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CA A 93' 
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CA B 92' 
AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CA B 93' 
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 94' 
AC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 95' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 ASP A 62 ? ASP A 61 . ? 1_555 ? 
2  AC1 5 ASP A 64 ? ASP A 63 . ? 1_555 ? 
3  AC1 5 ASP A 66 ? ASP A 65 . ? 1_555 ? 
4  AC1 5 GLU A 68 ? GLU A 67 . ? 1_555 ? 
5  AC1 5 GLU A 73 ? GLU A 72 . ? 1_555 ? 
6  AC2 5 SER A 19 ? SER A 18 . ? 1_555 ? 
7  AC2 5 GLU A 22 ? GLU A 21 . ? 1_555 ? 
8  AC2 5 ASP A 24 ? ASP A 23 . ? 1_555 ? 
9  AC2 5 LYS A 27 ? LYS A 26 . ? 1_555 ? 
10 AC2 5 GLU A 32 ? GLU A 31 . ? 1_555 ? 
11 AC3 5 SER B 19 ? SER B 18 . ? 1_555 ? 
12 AC3 5 GLU B 22 ? GLU B 21 . ? 1_555 ? 
13 AC3 5 ASP B 24 ? ASP B 23 . ? 1_555 ? 
14 AC3 5 LYS B 27 ? LYS B 26 . ? 1_555 ? 
15 AC3 5 GLU B 32 ? GLU B 31 . ? 1_555 ? 
16 AC4 5 ASP B 62 ? ASP B 61 . ? 1_555 ? 
17 AC4 5 ASP B 64 ? ASP B 63 . ? 1_555 ? 
18 AC4 5 ASP B 66 ? ASP B 65 . ? 1_555 ? 
19 AC4 5 GLU B 68 ? GLU B 67 . ? 1_555 ? 
20 AC4 5 GLU B 73 ? GLU B 72 . ? 1_555 ? 
21 AC5 4 HIS A 16 ? HIS A 15 . ? 1_555 ? 
22 AC5 4 HIS A 26 ? HIS A 25 . ? 1_555 ? 
23 AC5 4 HIS B 86 ? HIS B 85 . ? 1_555 ? 
24 AC5 4 GLU B 90 ? GLU B 89 . ? 1_555 ? 
25 AC6 4 HIS A 86 ? HIS A 85 . ? 1_555 ? 
26 AC6 4 GLU A 90 ? GLU A 89 . ? 1_555 ? 
27 AC6 4 HIS B 16 ? HIS B 15 . ? 1_555 ? 
28 AC6 4 HIS B 26 ? HIS B 25 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3D10 
_atom_sites.fract_transf_matrix[1][1]   0.028777 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.011092 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017188 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.022397 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . MET A 1 1  ? -7.134  5.073   -6.539  1.00 22.55 ? 0   MET A N   1 
ATOM   2    C  CA  . MET A 1 1  ? -5.760  4.421   -6.519  1.00 19.39 ? 0   MET A CA  1 
ATOM   3    C  C   . MET A 1 1  ? -5.788  2.913   -6.854  1.00 19.02 ? 0   MET A C   1 
ATOM   4    O  O   . MET A 1 1  ? -6.714  2.190   -6.435  1.00 20.06 ? 0   MET A O   1 
ATOM   5    C  CB  . MET A 1 1  ? -5.155  4.549   -5.124  1.00 19.12 ? 0   MET A CB  1 
ATOM   6    C  CG  . MET A 1 1  ? -4.743  5.994   -4.701  1.00 20.70 ? 0   MET A CG  1 
ATOM   7    S  SD  . MET A 1 1  ? -3.591  5.951   -3.220  1.00 24.91 ? 0   MET A SD  1 
ATOM   8    C  CE  . MET A 1 1  ? -4.799  5.589   -1.912  1.00 25.86 ? 0   MET A CE  1 
ATOM   9    N  N   . SER A 1 2  ? -4.742  2.427   -7.522  1.00 17.05 ? 1   SER A N   1 
ATOM   10   C  CA  . SER A 1 2  ? -4.579  0.985   -7.700  1.00 14.63 ? 1   SER A CA  1 
ATOM   11   C  C   . SER A 1 2  ? -4.303  0.296   -6.346  1.00 13.62 ? 1   SER A C   1 
ATOM   12   O  O   . SER A 1 2  ? -3.980  0.982   -5.343  1.00 12.43 ? 1   SER A O   1 
ATOM   13   C  CB  . SER A 1 2  ? -3.383  0.748   -8.651  1.00 14.72 ? 1   SER A CB  1 
ATOM   14   O  OG  . SER A 1 2  ? -2.120  1.011   -7.959  1.00 15.56 ? 1   SER A OG  1 
ATOM   15   N  N   . GLU A 1 3  ? -4.334  -1.050  -6.334  1.00 13.98 ? 2   GLU A N   1 
ATOM   16   C  CA  . GLU A 1 3  ? -3.932  -1.821  -5.142  1.00 14.48 ? 2   GLU A CA  1 
ATOM   17   C  C   . GLU A 1 3  ? -2.505  -1.555  -4.687  1.00 16.52 ? 2   GLU A C   1 
ATOM   18   O  O   . GLU A 1 3  ? -2.252  -1.327  -3.448  1.00 19.41 ? 2   GLU A O   1 
ATOM   19   C  CB  . GLU A 1 3  ? -4.166  -3.291  -5.388  1.00 17.28 ? 2   GLU A CB  1 
ATOM   20   C  CG  . GLU A 1 3  ? -5.621  -3.618  -5.607  1.00 19.71 ? 2   GLU A CG  1 
ATOM   21   C  CD  . GLU A 1 3  ? -6.505  -3.603  -4.368  1.00 27.77 ? 2   GLU A CD  1 
ATOM   22   O  OE1 . GLU A 1 3  ? -7.707  -3.938  -4.535  1.00 32.01 ? 2   GLU A OE1 1 
ATOM   23   O  OE2 . GLU A 1 3  ? -6.071  -3.284  -3.235  1.00 24.49 ? 2   GLU A OE2 1 
ATOM   24   N  N   . LEU A 1 4  ? -1.598  -1.427  -5.665  1.00 14.29 ? 3   LEU A N   1 
ATOM   25   C  CA  . LEU A 1 4  ? -0.149  -1.119  -5.301  1.00 14.81 ? 3   LEU A CA  1 
ATOM   26   C  C   . LEU A 1 4  ? 0.001   0.265   -4.646  1.00 13.94 ? 3   LEU A C   1 
ATOM   27   O  O   . LEU A 1 4  ? 0.740   0.478   -3.647  1.00 14.02 ? 3   LEU A O   1 
ATOM   28   C  CB  . LEU A 1 4  ? 0.731   -1.129  -6.552  1.00 13.78 ? 3   LEU A CB  1 
ATOM   29   C  CG  . LEU A 1 4  ? 2.237   -0.936  -6.330  1.00 12.41 ? 3   LEU A CG  1 
ATOM   30   C  CD1 . LEU A 1 4  ? 2.782   -1.826  -5.204  1.00 16.22 ? 3   LEU A CD1 1 
ATOM   31   C  CD2 . LEU A 1 4  ? 2.925   -1.171  -7.733  1.00 14.77 ? 3   LEU A CD2 1 
ATOM   32   N  N   . GLU A 1 5  ? -0.620  1.249   -5.299  1.00 12.80 ? 4   GLU A N   1 
ATOM   33   C  CA  . GLU A 1 5  ? -0.629  2.608   -4.799  1.00 13.75 ? 4   GLU A CA  1 
ATOM   34   C  C   . GLU A 1 5  ? -1.247  2.691   -3.377  1.00 15.28 ? 4   GLU A C   1 
ATOM   35   O  O   . GLU A 1 5  ? -0.674  3.352   -2.455  1.00 17.67 ? 4   GLU A O   1 
ATOM   36   C  CB  . GLU A 1 5  ? -1.391  3.533   -5.769  1.00 14.91 ? 4   GLU A CB  1 
ATOM   37   C  CG  . GLU A 1 5  ? -0.537  3.888   -7.016  1.00 12.03 ? 4   GLU A CG  1 
ATOM   38   C  CD  . GLU A 1 5  ? -1.352  4.484   -8.164  1.00 12.45 ? 4   GLU A CD  1 
ATOM   39   O  OE1 . GLU A 1 5  ? -0.705  5.020   -9.078  1.00 15.98 ? 4   GLU A OE1 1 
ATOM   40   O  OE2 . GLU A 1 5  ? -2.616  4.511   -8.125  1.00 18.55 ? 4   GLU A OE2 1 
ATOM   41   N  N   . LYS A 1 6  ? -2.371  1.989   -3.191  1.00 14.74 ? 5   LYS A N   1 
ATOM   42   C  CA  . LYS A 1 6  ? -2.988  1.926   -1.876  1.00 16.68 ? 5   LYS A CA  1 
ATOM   43   C  C   . LYS A 1 6  ? -2.027  1.271   -0.856  1.00 16.37 ? 5   LYS A C   1 
ATOM   44   O  O   . LYS A 1 6  ? -1.962  1.708   0.307   1.00 16.55 ? 5   LYS A O   1 
ATOM   45   C  CB  . LYS A 1 6  ? -4.354  1.169   -1.932  1.00 18.68 ? 5   LYS A CB  1 
ATOM   46   C  CG  . LYS A 1 6  ? -5.421  1.786   -2.710  1.00 21.23 ? 5   LYS A CG  1 
ATOM   47   C  CD  . LYS A 1 6  ? -6.678  1.018   -2.440  1.00 21.81 ? 5   LYS A CD  1 
ATOM   48   C  CE  . LYS A 1 6  ? -6.455  -0.497  -2.296  1.00 26.20 ? 5   LYS A CE  1 
ATOM   49   N  NZ  . LYS A 1 6  ? -7.835  -1.094  -2.549  1.00 31.57 ? 5   LYS A NZ  1 
ATOM   50   N  N   . ALA A 1 7  ? -1.341  0.224   -1.266  1.00 16.46 ? 6   ALA A N   1 
ATOM   51   C  CA  . ALA A 1 7  ? -0.356  -0.418  -0.393  1.00 17.31 ? 6   ALA A CA  1 
ATOM   52   C  C   . ALA A 1 7  ? 0.724   0.552   0.023   1.00 19.31 ? 6   ALA A C   1 
ATOM   53   O  O   . ALA A 1 7  ? 1.083   0.624   1.216   1.00 19.48 ? 6   ALA A O   1 
ATOM   54   C  CB  . ALA A 1 7  ? 0.283   -1.673  -1.054  1.00 19.35 ? 6   ALA A CB  1 
ATOM   55   N  N   . MET A 1 8  ? 1.184   1.371   -0.932  1.00 18.45 ? 7   MET A N   1 
ATOM   56   C  CA  . MET A 1 8  ? 2.257   2.313   -0.613  1.00 17.87 ? 7   MET A CA  1 
ATOM   57   C  C   . MET A 1 8  ? 1.754   3.339   0.385   1.00 17.17 ? 7   MET A C   1 
ATOM   58   O  O   . MET A 1 8  ? 2.443   3.683   1.371   1.00 19.07 ? 7   MET A O   1 
ATOM   59   C  CB  . MET A 1 8  ? 2.761   3.025   -1.874  1.00 17.52 ? 7   MET A CB  1 
ATOM   60   C  CG  . MET A 1 8  ? 3.547   1.993   -2.753  1.00 19.11 ? 7   MET A CG  1 
ATOM   61   S  SD  . MET A 1 8  ? 3.979   2.744   -4.333  1.00 19.39 ? 7   MET A SD  1 
ATOM   62   C  CE  . MET A 1 8  ? 4.905   1.400   -4.977  1.00 22.60 ? 7   MET A CE  1 
ATOM   63   N  N   . VAL A 1 9  ? 0.545   3.838   0.140   1.00 15.74 ? 8   VAL A N   1 
ATOM   64   C  CA  . VAL A 1 9  ? 0.030   4.845   1.006   1.00 15.13 ? 8   VAL A CA  1 
ATOM   65   C  C   . VAL A 1 9  ? -0.146  4.212   2.417   1.00 15.57 ? 8   VAL A C   1 
ATOM   66   O  O   . VAL A 1 9  ? 0.096   4.858   3.399   1.00 15.65 ? 8   VAL A O   1 
ATOM   67   C  CB  . VAL A 1 9  ? -1.299  5.420   0.403   1.00 14.05 ? 8   VAL A CB  1 
ATOM   68   C  CG1 . VAL A 1 9  ? -2.076  6.191   1.420   1.00 15.67 ? 8   VAL A CG1 1 
ATOM   69   C  CG2 . VAL A 1 9  ? -0.981  6.357   -0.728  1.00 17.57 ? 8   VAL A CG2 1 
ATOM   70   N  N   . ALA A 1 10 ? -0.505  2.940   2.497   1.00 15.22 ? 9   ALA A N   1 
ATOM   71   C  CA  . ALA A 1 10 ? -0.762  2.274   3.783   1.00 16.06 ? 9   ALA A CA  1 
ATOM   72   C  C   . ALA A 1 10 ? 0.521   2.090   4.592   1.00 17.43 ? 9   ALA A C   1 
ATOM   73   O  O   . ALA A 1 10 ? 0.490   2.227   5.859   1.00 18.29 ? 9   ALA A O   1 
ATOM   74   C  CB  . ALA A 1 10 ? -1.416  0.933   3.574   1.00 15.62 ? 9   ALA A CB  1 
ATOM   75   N  N   . LEU A 1 11 ? 1.645   1.833   3.887   1.00 17.14 ? 10  LEU A N   1 
ATOM   76   C  CA  . LEU A 1 11 ? 2.926   1.829   4.553   1.00 17.68 ? 10  LEU A CA  1 
ATOM   77   C  C   . LEU A 1 11 ? 3.218   3.176   5.203   1.00 18.05 ? 10  LEU A C   1 
ATOM   78   O  O   . LEU A 1 11 ? 3.677   3.213   6.339   1.00 19.16 ? 10  LEU A O   1 
ATOM   79   C  CB  . LEU A 1 11 ? 4.090   1.447   3.639   1.00 16.10 ? 10  LEU A CB  1 
ATOM   80   C  CG  . LEU A 1 11 ? 3.919   0.205   2.824   1.00 19.05 ? 10  LEU A CG  1 
ATOM   81   C  CD1 . LEU A 1 11 ? 5.210   0.064   1.958   1.00 19.00 ? 10  LEU A CD1 1 
ATOM   82   C  CD2 . LEU A 1 11 ? 3.788   -0.983  3.712   1.00 20.56 ? 10  LEU A CD2 1 
ATOM   83   N  N   . ILE A 1 12 ? 2.988   4.283   4.475   1.00 15.95 ? 11  ILE A N   1 
ATOM   84   C  CA  . ILE A 1 12 ? 3.333   5.591   4.960   1.00 16.26 ? 11  ILE A CA  1 
ATOM   85   C  C   . ILE A 1 12 ? 2.430   5.950   6.123   1.00 17.06 ? 11  ILE A C   1 
ATOM   86   O  O   . ILE A 1 12 ? 2.886   6.460   7.127   1.00 18.46 ? 11  ILE A O   1 
ATOM   87   C  CB  . ILE A 1 12 ? 3.115   6.635   3.901   1.00 13.73 ? 11  ILE A CB  1 
ATOM   88   C  CG1 . ILE A 1 12 ? 4.150   6.514   2.740   1.00 14.04 ? 11  ILE A CG1 1 
ATOM   89   C  CG2 . ILE A 1 12 ? 3.127   8.070   4.564   1.00 16.16 ? 11  ILE A CG2 1 
ATOM   90   C  CD1 . ILE A 1 12 ? 3.818   7.513   1.636   1.00 19.69 ? 11  ILE A CD1 1 
ATOM   91   N  N   . ASP A 1 13 ? 1.167   5.581   5.975   1.00 17.55 ? 12  ASP A N   1 
ATOM   92   C  CA  . ASP A 1 13 ? 0.180   5.813   7.048   1.00 17.95 ? 12  ASP A CA  1 
ATOM   93   C  C   . ASP A 1 13 ? 0.478   5.054   8.338   1.00 16.18 ? 12  ASP A C   1 
ATOM   94   O  O   . ASP A 1 13 ? 0.466   5.666   9.410   1.00 16.61 ? 12  ASP A O   1 
ATOM   95   C  CB  . ASP A 1 13 ? -1.242  5.517   6.613   1.00 20.31 ? 12  ASP A CB  1 
ATOM   96   C  CG  . ASP A 1 13 ? -1.766  6.512   5.589   1.00 22.88 ? 12  ASP A CG  1 
ATOM   97   O  OD1 . ASP A 1 13 ? -2.849  6.175   5.020   1.00 28.65 ? 12  ASP A OD1 1 
ATOM   98   O  OD2 . ASP A 1 13 ? -1.151  7.615   5.353   1.00 20.47 ? 12  ASP A OD2 1 
ATOM   99   N  N   . VAL A 1 14 ? 0.797   3.780   8.243   1.00 15.78 ? 13  VAL A N   1 
ATOM   100  C  CA  . VAL A 1 14 ? 1.078   3.014   9.479   1.00 16.90 ? 13  VAL A CA  1 
ATOM   101  C  C   . VAL A 1 14 ? 2.348   3.520   10.186  1.00 16.24 ? 13  VAL A C   1 
ATOM   102  O  O   . VAL A 1 14 ? 2.389   3.612   11.416  1.00 16.45 ? 13  VAL A O   1 
ATOM   103  C  CB  . VAL A 1 14 ? 1.138   1.474   9.240   1.00 17.62 ? 13  VAL A CB  1 
ATOM   104  C  CG1 . VAL A 1 14 ? 2.376   1.087   8.371   1.00 16.99 ? 13  VAL A CG1 1 
ATOM   105  C  CG2 . VAL A 1 14 ? 1.259   0.725   10.596  1.00 16.11 ? 13  VAL A CG2 1 
ATOM   106  N  N   . PHE A 1 15 ? 3.380   3.859   9.411   1.00 16.75 ? 14  PHE A N   1 
ATOM   107  C  CA  . PHE A 1 15 ? 4.591   4.473   9.991   1.00 15.43 ? 14  PHE A CA  1 
ATOM   108  C  C   . PHE A 1 15 ? 4.243   5.719   10.851  1.00 16.52 ? 14  PHE A C   1 
ATOM   109  O  O   . PHE A 1 15 ? 4.794   5.959   11.944  1.00 16.12 ? 14  PHE A O   1 
ATOM   110  C  CB  . PHE A 1 15 ? 5.613   4.911   8.905   1.00 16.44 ? 14  PHE A CB  1 
ATOM   111  C  CG  . PHE A 1 15 ? 6.873   5.536   9.472   1.00 14.48 ? 14  PHE A CG  1 
ATOM   112  C  CD1 . PHE A 1 15 ? 7.873   4.722   10.072  1.00 16.19 ? 14  PHE A CD1 1 
ATOM   113  C  CD2 . PHE A 1 15 ? 7.089   6.911   9.446   1.00 13.49 ? 14  PHE A CD2 1 
ATOM   114  C  CE1 . PHE A 1 15 ? 9.033   5.305   10.593  1.00 15.21 ? 14  PHE A CE1 1 
ATOM   115  C  CE2 . PHE A 1 15 ? 8.209   7.465   9.986   1.00 20.79 ? 14  PHE A CE2 1 
ATOM   116  C  CZ  . PHE A 1 15 ? 9.200   6.680   10.563  1.00 16.33 ? 14  PHE A CZ  1 
ATOM   117  N  N   . HIS A 1 16 ? 3.376   6.593   10.317  1.00 16.62 ? 15  HIS A N   1 
ATOM   118  C  CA  . HIS A 1 16 ? 3.158   7.861   10.941  1.00 17.35 ? 15  HIS A CA  1 
ATOM   119  C  C   . HIS A 1 16 ? 2.274   7.688   12.174  1.00 16.71 ? 15  HIS A C   1 
ATOM   120  O  O   . HIS A 1 16 ? 2.381   8.430   13.141  1.00 17.35 ? 15  HIS A O   1 
ATOM   121  C  CB  . HIS A 1 16 ? 2.403   8.785   9.973   1.00 17.92 ? 15  HIS A CB  1 
ATOM   122  C  CG  . HIS A 1 16 ? 3.253   9.432   8.924   1.00 23.99 ? 15  HIS A CG  1 
ATOM   123  N  ND1 . HIS A 1 16 ? 2.734   9.824   7.701   1.00 28.91 ? 15  HIS A ND1 1 
ATOM   124  C  CD2 . HIS A 1 16 ? 4.551   9.826   8.929   1.00 25.83 ? 15  HIS A CD2 1 
ATOM   125  C  CE1 . HIS A 1 16 ? 3.690   10.391  6.986   1.00 32.01 ? 15  HIS A CE1 1 
ATOM   126  N  NE2 . HIS A 1 16 ? 4.795   10.425  7.715   1.00 30.41 ? 15  HIS A NE2 1 
ATOM   127  N  N   . GLN A 1 17 ? 1.384   6.692   12.097  1.00 16.29 ? 16  GLN A N   1 
ATOM   128  C  CA  . GLN A 1 17 ? 0.497   6.399   13.196  1.00 17.32 ? 16  GLN A CA  1 
ATOM   129  C  C   . GLN A 1 17 ? 1.332   6.104   14.438  1.00 17.89 ? 16  GLN A C   1 
ATOM   130  O  O   . GLN A 1 17 ? 1.046   6.668   15.541  1.00 17.71 ? 16  GLN A O   1 
ATOM   131  C  CB  . GLN A 1 17 ? -0.444  5.259   12.833  1.00 16.92 ? 16  GLN A CB  1 
ATOM   132  C  CG  . GLN A 1 17 ? -1.564  5.771   11.992  1.00 19.64 ? 16  GLN A CG  1 
ATOM   133  C  CD  . GLN A 1 17 ? -2.264  4.743   11.156  1.00 20.54 ? 16  GLN A CD  1 
ATOM   134  O  OE1 . GLN A 1 17 ? -2.117  3.531   11.349  1.00 21.01 ? 16  GLN A OE1 1 
ATOM   135  N  NE2 . GLN A 1 17 ? -3.032  5.231   10.184  1.00 18.52 ? 16  GLN A NE2 1 
ATOM   136  N  N   . TYR A 1 18 ? 2.369   5.275   14.232  1.00 18.32 ? 17  TYR A N   1 
ATOM   137  C  CA  . TYR A 1 18 ? 3.231   4.834   15.340  1.00 15.55 ? 17  TYR A CA  1 
ATOM   138  C  C   . TYR A 1 18 ? 4.363   5.769   15.678  1.00 16.28 ? 17  TYR A C   1 
ATOM   139  O  O   . TYR A 1 18 ? 4.677   5.915   16.864  1.00 15.13 ? 17  TYR A O   1 
ATOM   140  C  CB  . TYR A 1 18 ? 3.707   3.372   15.160  1.00 14.89 ? 17  TYR A CB  1 
ATOM   141  C  CG  . TYR A 1 18 ? 2.521   2.416   15.336  1.00 13.39 ? 17  TYR A CG  1 
ATOM   142  C  CD1 . TYR A 1 18 ? 1.767   2.014   14.268  1.00 15.28 ? 17  TYR A CD1 1 
ATOM   143  C  CD2 . TYR A 1 18 ? 2.200   1.935   16.607  1.00 14.34 ? 17  TYR A CD2 1 
ATOM   144  C  CE1 . TYR A 1 18 ? 0.591   1.193   14.484  1.00 17.65 ? 17  TYR A CE1 1 
ATOM   145  C  CE2 . TYR A 1 18 ? 1.092   1.123   16.823  1.00 15.64 ? 17  TYR A CE2 1 
ATOM   146  C  CZ  . TYR A 1 18 ? 0.317   0.732   15.770  1.00 14.00 ? 17  TYR A CZ  1 
ATOM   147  O  OH  . TYR A 1 18 ? -0.777  -0.090  16.075  1.00 16.92 ? 17  TYR A OH  1 
ATOM   148  N  N   . SER A 1 19 ? 4.982   6.390   14.663  1.00 15.01 ? 18  SER A N   1 
ATOM   149  C  CA  . SER A 1 19 ? 6.096   7.335   14.930  1.00 16.72 ? 18  SER A CA  1 
ATOM   150  C  C   . SER A 1 19 ? 5.718   8.670   15.645  1.00 16.75 ? 18  SER A C   1 
ATOM   151  O  O   . SER A 1 19 ? 6.519   9.232   16.389  1.00 13.82 ? 18  SER A O   1 
ATOM   152  C  CB  . SER A 1 19 ? 6.879   7.591   13.631  1.00 18.78 ? 18  SER A CB  1 
ATOM   153  O  OG  . SER A 1 19 ? 6.150   8.451   12.753  1.00 19.46 ? 18  SER A OG  1 
ATOM   154  N  N   . GLY A 1 20 ? 4.534   9.208   15.358  1.00 17.22 ? 19  GLY A N   1 
ATOM   155  C  CA  . GLY A 1 20 ? 4.084   10.434  15.972  1.00 18.46 ? 19  GLY A CA  1 
ATOM   156  C  C   . GLY A 1 20 ? 3.550   10.284  17.391  1.00 19.20 ? 19  GLY A C   1 
ATOM   157  O  O   . GLY A 1 20 ? 2.979   11.210  17.916  1.00 20.39 ? 19  GLY A O   1 
ATOM   158  N  N   . ARG A 1 21 ? 3.717   9.114   18.000  1.00 19.43 ? 20  ARG A N   1 
ATOM   159  C  CA  . ARG A 1 21 ? 3.175   8.895   19.349  1.00 19.36 ? 20  ARG A CA  1 
ATOM   160  C  C   . ARG A 1 21 ? 3.980   9.597   20.418  1.00 18.59 ? 20  ARG A C   1 
ATOM   161  O  O   . ARG A 1 21 ? 3.414   10.241  21.316  1.00 19.49 ? 20  ARG A O   1 
ATOM   162  C  CB  . ARG A 1 21 ? 3.086   7.395   19.649  1.00 19.65 ? 20  ARG A CB  1 
ATOM   163  C  CG  . ARG A 1 21 ? 1.890   6.695   19.013  1.00 19.01 ? 20  ARG A CG  1 
ATOM   164  C  CD  . ARG A 1 21 ? 1.901   5.201   19.344  1.00 20.53 ? 20  ARG A CD  1 
ATOM   165  N  NE  . ARG A 1 21 ? 0.727   4.541   18.819  1.00 20.63 ? 20  ARG A NE  1 
ATOM   166  C  CZ  . ARG A 1 21 ? 0.257   3.357   19.219  1.00 23.57 ? 20  ARG A CZ  1 
ATOM   167  N  NH1 . ARG A 1 21 ? -0.852  2.850   18.661  1.00 17.18 ? 20  ARG A NH1 1 
ATOM   168  N  NH2 . ARG A 1 21 ? 0.844   2.710   20.212  1.00 23.91 ? 20  ARG A NH2 1 
ATOM   169  N  N   . GLU A 1 22 ? 5.299   9.489   20.340  1.00 18.34 ? 21  GLU A N   1 
ATOM   170  C  CA  . GLU A 1 22 ? 6.174   10.202  21.279  1.00 18.18 ? 21  GLU A CA  1 
ATOM   171  C  C   . GLU A 1 22 ? 7.515   10.586  20.666  1.00 16.99 ? 21  GLU A C   1 
ATOM   172  O  O   . GLU A 1 22 ? 7.950   10.015  19.657  1.00 13.49 ? 21  GLU A O   1 
ATOM   173  C  CB  . GLU A 1 22 ? 6.427   9.381   22.546  1.00 18.42 ? 21  GLU A CB  1 
ATOM   174  C  CG  . GLU A 1 22 ? 5.588   8.132   22.743  1.00 19.50 ? 21  GLU A CG  1 
ATOM   175  C  CD  . GLU A 1 22 ? 6.143   7.254   23.861  1.00 21.24 ? 21  GLU A CD  1 
ATOM   176  O  OE1 . GLU A 1 22 ? 5.374   6.888   24.780  1.00 24.79 ? 21  GLU A OE1 1 
ATOM   177  O  OE2 . GLU A 1 22 ? 7.371   6.948   23.827  1.00 27.21 ? 21  GLU A OE2 1 
ATOM   178  N  N   . GLY A 1 23 ? 8.190   11.549  21.302  1.00 16.47 ? 22  GLY A N   1 
ATOM   179  C  CA  . GLY A 1 23 ? 9.495   11.991  20.849  1.00 18.27 ? 22  GLY A CA  1 
ATOM   180  C  C   . GLY A 1 23 ? 9.484   12.580  19.452  1.00 19.34 ? 22  GLY A C   1 
ATOM   181  O  O   . GLY A 1 23 ? 8.587   13.357  19.118  1.00 19.27 ? 22  GLY A O   1 
ATOM   182  N  N   . ASP A 1 24 ? 10.496  12.207  18.655  1.00 20.63 ? 23  ASP A N   1 
ATOM   183  C  CA  . ASP A 1 24 ? 10.606  12.573  17.241  1.00 21.05 ? 23  ASP A CA  1 
ATOM   184  C  C   . ASP A 1 24 ? 9.377   12.034  16.580  1.00 21.05 ? 23  ASP A C   1 
ATOM   185  O  O   . ASP A 1 24 ? 9.206   10.815  16.494  1.00 20.90 ? 23  ASP A O   1 
ATOM   186  C  CB  . ASP A 1 24 ? 11.839  11.909  16.581  1.00 21.09 ? 23  ASP A CB  1 
ATOM   187  C  CG  . ASP A 1 24 ? 12.155  12.481  15.205  1.00 21.27 ? 23  ASP A CG  1 
ATOM   188  O  OD1 . ASP A 1 24 ? 11.258  12.609  14.389  1.00 18.80 ? 23  ASP A OD1 1 
ATOM   189  O  OD2 . ASP A 1 24 ? 13.316  12.884  14.940  1.00 23.08 ? 23  ASP A OD2 1 
ATOM   190  N  N   . LYS A 1 25 ? 8.495   12.918  16.130  1.00 20.88 ? 24  LYS A N   1 
ATOM   191  C  CA  . LYS A 1 25 ? 7.267   12.417  15.513  1.00 20.52 ? 24  LYS A CA  1 
ATOM   192  C  C   . LYS A 1 25 ? 7.470   11.630  14.208  1.00 20.79 ? 24  LYS A C   1 
ATOM   193  O  O   . LYS A 1 25 ? 6.508   11.104  13.659  1.00 19.91 ? 24  LYS A O   1 
ATOM   194  C  CB  . LYS A 1 25 ? 6.246   13.525  15.300  1.00 21.06 ? 24  LYS A CB  1 
ATOM   195  C  CG  . LYS A 1 25 ? 5.642   13.973  16.601  1.00 22.46 ? 24  LYS A CG  1 
ATOM   196  C  CD  . LYS A 1 25 ? 4.398   14.810  16.381  1.00 25.17 ? 24  LYS A CD  1 
ATOM   197  C  CE  . LYS A 1 25 ? 3.688   15.050  17.699  1.00 26.30 ? 24  LYS A CE  1 
ATOM   198  N  NZ  . LYS A 1 25 ? 4.427   15.879  18.700  1.00 28.78 ? 24  LYS A NZ  1 
ATOM   199  N  N   . HIS A 1 26 ? 8.697   11.596  13.704  1.00 21.40 ? 25  HIS A N   1 
ATOM   200  C  CA  . HIS A 1 26 ? 9.022   10.989  12.410  1.00 21.25 ? 25  HIS A CA  1 
ATOM   201  C  C   . HIS A 1 26 ? 9.980   9.791   12.577  1.00 20.30 ? 25  HIS A C   1 
ATOM   202  O  O   . HIS A 1 26 ? 10.615  9.349   11.622  1.00 20.51 ? 25  HIS A O   1 
ATOM   203  C  CB  . HIS A 1 26 ? 9.671   12.048  11.511  1.00 23.68 ? 25  HIS A CB  1 
ATOM   204  C  CG  . HIS A 1 26 ? 9.111   12.120  10.118  1.00 26.88 ? 25  HIS A CG  1 
ATOM   205  N  ND1 . HIS A 1 26 ? 9.797   12.712  9.077   1.00 29.81 ? 25  HIS A ND1 1 
ATOM   206  C  CD2 . HIS A 1 26 ? 7.933   11.699  9.603   1.00 27.09 ? 25  HIS A CD2 1 
ATOM   207  C  CE1 . HIS A 1 26 ? 9.065   12.636  7.978   1.00 32.27 ? 25  HIS A CE1 1 
ATOM   208  N  NE2 . HIS A 1 26 ? 7.937   12.014  8.266   1.00 30.52 ? 25  HIS A NE2 1 
ATOM   209  N  N   . LYS A 1 27 ? 10.127  9.291   13.802  1.00 17.58 ? 26  LYS A N   1 
ATOM   210  C  CA  . LYS A 1 27 ? 10.921  8.105   14.039  1.00 15.95 ? 26  LYS A CA  1 
ATOM   211  C  C   . LYS A 1 27 ? 10.217  7.189   15.008  1.00 15.26 ? 26  LYS A C   1 
ATOM   212  O  O   . LYS A 1 27 ? 9.578   7.723   15.925  1.00 15.44 ? 26  LYS A O   1 
ATOM   213  C  CB  . LYS A 1 27 ? 12.321  8.437   14.571  1.00 17.36 ? 26  LYS A CB  1 
ATOM   214  C  CG  . LYS A 1 27 ? 13.214  9.340   13.672  1.00 15.95 ? 26  LYS A CG  1 
ATOM   215  C  CD  . LYS A 1 27 ? 14.667  9.122   14.102  1.00 20.37 ? 26  LYS A CD  1 
ATOM   216  C  CE  . LYS A 1 27 ? 15.484  10.400  14.075  1.00 26.63 ? 26  LYS A CE  1 
ATOM   217  N  NZ  . LYS A 1 27 ? 15.721  10.945  12.715  1.00 28.06 ? 26  LYS A NZ  1 
ATOM   218  N  N   . LEU A 1 28 ? 10.386  5.860   14.844  1.00 14.39 ? 27  LEU A N   1 
ATOM   219  C  CA  . LEU A 1 28 ? 9.897   4.836   15.792  1.00 15.83 ? 27  LEU A CA  1 
ATOM   220  C  C   . LEU A 1 28 ? 10.897  4.600   16.912  1.00 14.83 ? 27  LEU A C   1 
ATOM   221  O  O   . LEU A 1 28 ? 11.978  4.145   16.655  1.00 14.27 ? 27  LEU A O   1 
ATOM   222  C  CB  . LEU A 1 28 ? 9.664   3.468   15.100  1.00 16.28 ? 27  LEU A CB  1 
ATOM   223  C  CG  . LEU A 1 28 ? 8.573   3.487   14.038  1.00 16.26 ? 27  LEU A CG  1 
ATOM   224  C  CD1 . LEU A 1 28 ? 8.650   2.265   13.076  1.00 19.20 ? 27  LEU A CD1 1 
ATOM   225  C  CD2 . LEU A 1 28 ? 7.119   3.716   14.553  1.00 16.85 ? 27  LEU A CD2 1 
ATOM   226  N  N   . LYS A 1 29 ? 10.540  4.939   18.141  1.00 14.89 ? 28  LYS A N   1 
ATOM   227  C  CA  . LYS A 1 29 ? 11.322  4.436   19.253  1.00 14.70 ? 28  LYS A CA  1 
ATOM   228  C  C   . LYS A 1 29 ? 10.873  3.003   19.602  1.00 15.98 ? 28  LYS A C   1 
ATOM   229  O  O   . LYS A 1 29 ? 9.823   2.476   19.073  1.00 15.41 ? 28  LYS A O   1 
ATOM   230  C  CB  . LYS A 1 29 ? 11.289  5.391   20.467  1.00 15.38 ? 28  LYS A CB  1 
ATOM   231  C  CG  . LYS A 1 29 ? 9.929   5.490   21.156  1.00 17.71 ? 28  LYS A CG  1 
ATOM   232  C  CD  . LYS A 1 29 ? 9.813   6.721   22.128  1.00 14.56 ? 28  LYS A CD  1 
ATOM   233  C  CE  . LYS A 1 29 ? 10.972  6.853   23.052  1.00 21.99 ? 28  LYS A CE  1 
ATOM   234  N  NZ  . LYS A 1 29 ? 12.084  7.636   22.461  1.00 23.46 ? 28  LYS A NZ  1 
ATOM   235  N  N   . LYS A 1 30 ? 11.619  2.365   20.515  1.00 15.49 ? 29  LYS A N   1 
ATOM   236  C  CA  . LYS A 1 30 ? 11.415  0.961   20.806  1.00 16.24 ? 29  LYS A CA  1 
ATOM   237  C  C   . LYS A 1 30 ? 9.974   0.644   21.190  1.00 15.92 ? 29  LYS A C   1 
ATOM   238  O  O   . LYS A 1 30 ? 9.379   -0.328  20.693  1.00 16.70 ? 29  LYS A O   1 
ATOM   239  C  CB  . LYS A 1 30 ? 12.336  0.497   21.910  1.00 16.74 ? 29  LYS A CB  1 
ATOM   240  C  CG  . LYS A 1 30 ? 13.756  0.693   21.545  1.00 19.79 ? 29  LYS A CG  1 
ATOM   241  C  CD  . LYS A 1 30 ? 14.605  -0.105  22.473  1.00 23.84 ? 29  LYS A CD  1 
ATOM   242  C  CE  . LYS A 1 30 ? 15.855  -0.486  21.723  1.00 24.10 ? 29  LYS A CE  1 
ATOM   243  N  NZ  . LYS A 1 30 ? 16.830  -1.052  22.694  1.00 24.05 ? 29  LYS A NZ  1 
ATOM   244  N  N   . SER A 1 31 ? 9.384   1.477   22.019  1.00 17.00 ? 30  SER A N   1 
ATOM   245  C  CA  . SER A 1 31 ? 8.036   1.193   22.399  1.00 15.83 ? 30  SER A CA  1 
ATOM   246  C  C   . SER A 1 31 ? 7.029   1.334   21.226  1.00 15.65 ? 30  SER A C   1 
ATOM   247  O  O   . SER A 1 31 ? 6.082   0.578   21.164  1.00 15.40 ? 30  SER A O   1 
ATOM   248  C  CB  . SER A 1 31 ? 7.586   2.015   23.623  1.00 15.15 ? 30  SER A CB  1 
ATOM   249  O  OG  . SER A 1 31 ? 7.580   3.377   23.311  1.00 13.89 ? 30  SER A OG  1 
ATOM   250  N  N   . GLU A 1 32 ? 7.253   2.285   20.322  1.00 15.31 ? 31  GLU A N   1 
ATOM   251  C  CA  . GLU A 1 32 ? 6.326   2.451   19.194  1.00 14.78 ? 31  GLU A CA  1 
ATOM   252  C  C   . GLU A 1 32 ? 6.474   1.311   18.225  1.00 15.18 ? 31  GLU A C   1 
ATOM   253  O  O   . GLU A 1 32 ? 5.530   0.798   17.616  1.00 13.31 ? 31  GLU A O   1 
ATOM   254  C  CB  . GLU A 1 32 ? 6.585   3.777   18.498  1.00 14.51 ? 31  GLU A CB  1 
ATOM   255  C  CG  . GLU A 1 32 ? 6.133   4.977   19.296  1.00 15.15 ? 31  GLU A CG  1 
ATOM   256  C  CD  . GLU A 1 32 ? 6.833   6.169   18.856  1.00 13.43 ? 31  GLU A CD  1 
ATOM   257  O  OE1 . GLU A 1 32 ? 7.838   5.975   18.106  1.00 19.91 ? 31  GLU A OE1 1 
ATOM   258  O  OE2 . GLU A 1 32 ? 6.443   7.290   19.263  1.00 17.22 ? 31  GLU A OE2 1 
ATOM   259  N  N   . LEU A 1 33 ? 7.722   0.942   18.011  1.00 14.64 ? 32  LEU A N   1 
ATOM   260  C  CA  . LEU A 1 33 ? 8.046   -0.219  17.201  1.00 13.63 ? 32  LEU A CA  1 
ATOM   261  C  C   . LEU A 1 33 ? 7.370   -1.492  17.747  1.00 12.99 ? 32  LEU A C   1 
ATOM   262  O  O   . LEU A 1 33 ? 6.747   -2.211  16.988  1.00 15.74 ? 32  LEU A O   1 
ATOM   263  C  CB  . LEU A 1 33 ? 9.563   -0.390  17.174  1.00 14.43 ? 32  LEU A CB  1 
ATOM   264  C  CG  . LEU A 1 33 ? 10.109  -1.457  16.216  1.00 14.49 ? 32  LEU A CG  1 
ATOM   265  C  CD1 . LEU A 1 33 ? 9.471   -1.528  14.785  1.00 18.79 ? 32  LEU A CD1 1 
ATOM   266  C  CD2 . LEU A 1 33 ? 11.664  -1.353  16.100  1.00 13.88 ? 32  LEU A CD2 1 
ATOM   267  N  N   . LYS A 1 34 ? 7.472   -1.756  19.040  1.00 11.01 ? 33  LYS A N   1 
ATOM   268  C  CA  . LYS A 1 34 ? 6.921   -2.965  19.617  1.00 12.76 ? 33  LYS A CA  1 
ATOM   269  C  C   . LYS A 1 34 ? 5.387   -2.927  19.402  1.00 12.48 ? 33  LYS A C   1 
ATOM   270  O  O   . LYS A 1 34 ? 4.804   -3.960  19.047  1.00 12.76 ? 33  LYS A O   1 
ATOM   271  C  CB  . LYS A 1 34 ? 7.206   -3.017  21.119  1.00 13.98 ? 33  LYS A CB  1 
ATOM   272  C  CG  . LYS A 1 34 ? 6.526   -4.115  21.895  1.00 13.61 ? 33  LYS A CG  1 
ATOM   273  C  CD  . LYS A 1 34 ? 6.363   -3.726  23.371  1.00 15.43 ? 33  LYS A CD  1 
ATOM   274  C  CE  . LYS A 1 34 ? 5.307   -4.538  24.109  1.00 21.04 ? 33  LYS A CE  1 
ATOM   275  N  NZ  . LYS A 1 34 ? 5.358   -4.341  25.594  1.00 19.81 ? 33  LYS A NZ  1 
ATOM   276  N  N   . GLU A 1 35 ? 4.758   -1.755  19.608  1.00 14.25 ? 34  GLU A N   1 
ATOM   277  C  CA  . GLU A 1 35 ? 3.290   -1.650  19.457  1.00 14.56 ? 34  GLU A CA  1 
ATOM   278  C  C   . GLU A 1 35 ? 2.885   -1.789  17.974  1.00 16.14 ? 34  GLU A C   1 
ATOM   279  O  O   . GLU A 1 35 ? 1.865   -2.386  17.647  1.00 16.98 ? 34  GLU A O   1 
ATOM   280  C  CB  . GLU A 1 35 ? 2.698   -0.338  20.026  1.00 14.85 ? 34  GLU A CB  1 
ATOM   281  C  CG  . GLU A 1 35 ? 2.870   -0.124  21.511  1.00 15.33 ? 34  GLU A CG  1 
ATOM   282  C  CD  . GLU A 1 35 ? 2.278   -1.232  22.398  1.00 19.12 ? 34  GLU A CD  1 
ATOM   283  O  OE1 . GLU A 1 35 ? 2.527   -1.160  23.615  1.00 20.79 ? 34  GLU A OE1 1 
ATOM   284  O  OE2 . GLU A 1 35 ? 1.575   -2.162  21.897  1.00 18.36 ? 34  GLU A OE2 1 
ATOM   285  N  N   . LEU A 1 36 ? 3.693   -1.222  17.084  1.00 13.80 ? 35  LEU A N   1 
ATOM   286  C  CA  . LEU A 1 36 ? 3.429   -1.399  15.653  1.00 13.52 ? 35  LEU A CA  1 
ATOM   287  C  C   . LEU A 1 36 ? 3.481   -2.907  15.318  1.00 12.87 ? 35  LEU A C   1 
ATOM   288  O  O   . LEU A 1 36 ? 2.582   -3.442  14.642  1.00 14.00 ? 35  LEU A O   1 
ATOM   289  C  CB  . LEU A 1 36 ? 4.499   -0.670  14.841  1.00 12.74 ? 35  LEU A CB  1 
ATOM   290  C  CG  . LEU A 1 36 ? 4.225   -0.775  13.346  1.00 13.46 ? 35  LEU A CG  1 
ATOM   291  C  CD1 . LEU A 1 36 ? 4.637   0.484   12.549  1.00 16.66 ? 35  LEU A CD1 1 
ATOM   292  C  CD2 . LEU A 1 36 ? 4.837   -2.081  12.772  1.00 13.27 ? 35  LEU A CD2 1 
ATOM   293  N  N   . ILE A 1 37 ? 4.519   -3.610  15.758  1.00 11.01 ? 36  ILE A N   1 
ATOM   294  C  CA  . ILE A 1 37 ? 4.643   -5.039  15.443  1.00 11.77 ? 36  ILE A CA  1 
ATOM   295  C  C   . ILE A 1 37 ? 3.478   -5.890  16.045  1.00 13.27 ? 36  ILE A C   1 
ATOM   296  O  O   . ILE A 1 37 ? 2.815   -6.690  15.361  1.00 15.23 ? 36  ILE A O   1 
ATOM   297  C  CB  . ILE A 1 37 ? 6.017   -5.685  15.820  1.00 13.30 ? 36  ILE A CB  1 
ATOM   298  C  CG1 . ILE A 1 37 ? 7.120   -5.125  14.911  1.00 13.13 ? 36  ILE A CG1 1 
ATOM   299  C  CG2 . ILE A 1 37 ? 5.925   -7.267  15.729  1.00 11.32 ? 36  ILE A CG2 1 
ATOM   300  C  CD1 . ILE A 1 37 ? 8.555   -5.322  15.500  1.00 13.54 ? 36  ILE A CD1 1 
ATOM   301  N  N   . ASN A 1 38 ? 3.232   -5.654  17.326  1.00 12.72 ? 37  ASN A N   1 
ATOM   302  C  CA  . ASN A 1 38 ? 2.163   -6.318  18.043  1.00 11.78 ? 37  ASN A CA  1 
ATOM   303  C  C   . ASN A 1 38 ? 0.756   -6.145  17.517  1.00 12.41 ? 37  ASN A C   1 
ATOM   304  O  O   . ASN A 1 38 ? 0.012   -7.117  17.476  1.00 13.69 ? 37  ASN A O   1 
ATOM   305  C  CB  . ASN A 1 38 ? 2.241   -5.978  19.541  1.00 12.17 ? 37  ASN A CB  1 
ATOM   306  C  CG  . ASN A 1 38 ? 3.419   -6.676  20.240  1.00 10.04 ? 37  ASN A CG  1 
ATOM   307  O  OD1 . ASN A 1 38 ? 3.587   -6.579  21.463  1.00 13.72 ? 37  ASN A OD1 1 
ATOM   308  N  ND2 . ASN A 1 38 ? 4.100   -7.526  19.497  1.00 10.40 ? 37  ASN A ND2 1 
ATOM   309  N  N   . ASN A 1 39 ? 0.415   -4.924  17.107  1.00 12.92 ? 38  ASN A N   1 
ATOM   310  C  CA  . ASN A 1 39 ? -0.950  -4.623  16.631  1.00 13.07 ? 38  ASN A CA  1 
ATOM   311  C  C   . ASN A 1 39 ? -1.154  -4.858  15.139  1.00 13.67 ? 38  ASN A C   1 
ATOM   312  O  O   . ASN A 1 39 ? -2.296  -5.250  14.714  1.00 15.48 ? 38  ASN A O   1 
ATOM   313  C  CB  . ASN A 1 39 ? -1.301  -3.188  16.991  1.00 10.43 ? 38  ASN A CB  1 
ATOM   314  C  CG  . ASN A 1 39 ? -1.201  -2.925  18.482  1.00 10.83 ? 38  ASN A CG  1 
ATOM   315  O  OD1 . ASN A 1 39 ? -1.001  -1.759  18.910  1.00 13.88 ? 38  ASN A OD1 1 
ATOM   316  N  ND2 . ASN A 1 39 ? -1.452  -3.983  19.303  1.00 7.74  ? 38  ASN A ND2 1 
ATOM   317  N  N   . GLU A 1 40 ? -0.090  -4.588  14.362  1.00 14.61 ? 39  GLU A N   1 
ATOM   318  C  CA  . GLU A 1 40 ? -0.203  -4.522  12.907  1.00 14.80 ? 39  GLU A CA  1 
ATOM   319  C  C   . GLU A 1 40 ? 0.494   -5.690  12.158  1.00 15.15 ? 39  GLU A C   1 
ATOM   320  O  O   . GLU A 1 40 ? 0.274   -5.846  10.962  1.00 16.81 ? 39  GLU A O   1 
ATOM   321  C  CB  . GLU A 1 40 ? 0.291   -3.151  12.380  1.00 16.11 ? 39  GLU A CB  1 
ATOM   322  C  CG  . GLU A 1 40 ? -0.128  -1.949  13.183  1.00 15.51 ? 39  GLU A CG  1 
ATOM   323  C  CD  . GLU A 1 40 ? -1.624  -1.760  13.345  1.00 19.38 ? 39  GLU A CD  1 
ATOM   324  O  OE1 . GLU A 1 40 ? -2.069  -1.096  14.360  1.00 20.05 ? 39  GLU A OE1 1 
ATOM   325  O  OE2 . GLU A 1 40 ? -2.356  -2.247  12.443  1.00 19.51 ? 39  GLU A OE2 1 
ATOM   326  N  N   . LEU A 1 41 ? 1.339   -6.448  12.835  1.00 14.20 ? 40  LEU A N   1 
ATOM   327  C  CA  . LEU A 1 41 ? 1.914   -7.654  12.255  1.00 14.80 ? 40  LEU A CA  1 
ATOM   328  C  C   . LEU A 1 41 ? 1.628   -8.946  12.976  1.00 16.04 ? 40  LEU A C   1 
ATOM   329  O  O   . LEU A 1 41 ? 2.400   -9.892  12.952  1.00 15.61 ? 40  LEU A O   1 
ATOM   330  C  CB  . LEU A 1 41 ? 3.432   -7.430  11.974  1.00 13.60 ? 40  LEU A CB  1 
ATOM   331  C  CG  . LEU A 1 41 ? 3.806   -6.364  10.968  1.00 15.34 ? 40  LEU A CG  1 
ATOM   332  C  CD1 . LEU A 1 41 ? 5.349   -6.257  11.037  1.00 15.07 ? 40  LEU A CD1 1 
ATOM   333  C  CD2 . LEU A 1 41 ? 3.389   -6.851  9.578   1.00 19.31 ? 40  LEU A CD2 1 
ATOM   334  N  N   . SER A 1 42 ? 0.421   -9.054  13.583  1.00 14.90 ? 41  SER A N   1 
ATOM   335  C  CA  . SER A 1 42 ? 0.069   -10.232 14.377  1.00 16.81 ? 41  SER A CA  1 
ATOM   336  C  C   . SER A 1 42 ? 0.062   -11.546 13.573  1.00 16.84 ? 41  SER A C   1 
ATOM   337  O  O   . SER A 1 42 ? 0.240   -12.632 14.140  1.00 16.94 ? 41  SER A O   1 
ATOM   338  C  CB  . SER A 1 42 ? -1.302  -10.059 15.075  1.00 14.08 ? 41  SER A CB  1 
ATOM   339  O  OG  . SER A 1 42 ? -2.380  -10.126 14.139  1.00 20.13 ? 41  SER A OG  1 
ATOM   340  N  N   . HIS A 1 43 ? -0.138  -11.432 12.262  1.00 18.87 ? 42  HIS A N   1 
ATOM   341  C  CA  . HIS A 1 43 ? -0.350  -12.629 11.441  1.00 21.11 ? 42  HIS A CA  1 
ATOM   342  C  C   . HIS A 1 43 ? 0.915   -13.106 10.764  1.00 21.23 ? 42  HIS A C   1 
ATOM   343  O  O   . HIS A 1 43 ? 0.957   -14.224 10.275  1.00 23.14 ? 42  HIS A O   1 
ATOM   344  C  CB  . HIS A 1 43 ? -1.436  -12.402 10.410  1.00 21.73 ? 42  HIS A CB  1 
ATOM   345  C  CG  . HIS A 1 43 ? -2.759  -12.103 11.020  1.00 21.91 ? 42  HIS A CG  1 
ATOM   346  N  ND1 . HIS A 1 43 ? -3.373  -10.876 10.915  1.00 21.93 ? 42  HIS A ND1 1 
ATOM   347  C  CD2 . HIS A 1 43 ? -3.576  -12.867 11.787  1.00 22.53 ? 42  HIS A CD2 1 
ATOM   348  C  CE1 . HIS A 1 43 ? -4.518  -10.900 11.582  1.00 24.04 ? 42  HIS A CE1 1 
ATOM   349  N  NE2 . HIS A 1 43 ? -4.665  -12.098 12.110  1.00 23.76 ? 42  HIS A NE2 1 
ATOM   350  N  N   . PHE A 1 44 ? 1.937   -12.253 10.769  1.00 22.08 ? 43  PHE A N   1 
ATOM   351  C  CA  . PHE A 1 44 ? 3.200   -12.554 10.095  1.00 20.99 ? 43  PHE A CA  1 
ATOM   352  C  C   . PHE A 1 44 ? 4.333   -12.662 11.090  1.00 20.85 ? 43  PHE A C   1 
ATOM   353  O  O   . PHE A 1 44 ? 5.356   -13.315 10.803  1.00 21.91 ? 43  PHE A O   1 
ATOM   354  C  CB  . PHE A 1 44 ? 3.530   -11.498 9.063   1.00 20.12 ? 43  PHE A CB  1 
ATOM   355  C  CG  . PHE A 1 44 ? 2.560   -11.400 7.913   1.00 23.23 ? 43  PHE A CG  1 
ATOM   356  C  CD1 . PHE A 1 44 ? 1.621   -12.386 7.619   1.00 23.96 ? 43  PHE A CD1 1 
ATOM   357  C  CD2 . PHE A 1 44 ? 2.598   -10.288 7.107   1.00 24.05 ? 43  PHE A CD2 1 
ATOM   358  C  CE1 . PHE A 1 44 ? 0.741   -12.234 6.488   1.00 24.17 ? 43  PHE A CE1 1 
ATOM   359  C  CE2 . PHE A 1 44 ? 1.752   -10.140 6.008   1.00 23.96 ? 43  PHE A CE2 1 
ATOM   360  C  CZ  . PHE A 1 44 ? 0.820   -11.101 5.707   1.00 24.62 ? 43  PHE A CZ  1 
ATOM   361  N  N   . LEU A 1 45 ? 4.171   -12.067 12.271  1.00 19.70 ? 44  LEU A N   1 
ATOM   362  C  CA  . LEU A 1 45 ? 5.252   -12.049 13.273  1.00 18.42 ? 44  LEU A CA  1 
ATOM   363  C  C   . LEU A 1 45 ? 4.721   -12.446 14.632  1.00 19.79 ? 44  LEU A C   1 
ATOM   364  O  O   . LEU A 1 45 ? 3.645   -11.966 15.049  1.00 19.95 ? 44  LEU A O   1 
ATOM   365  C  CB  . LEU A 1 45 ? 5.930   -10.696 13.390  1.00 20.30 ? 44  LEU A CB  1 
ATOM   366  C  CG  . LEU A 1 45 ? 6.936   -10.222 12.305  1.00 22.03 ? 44  LEU A CG  1 
ATOM   367  C  CD1 . LEU A 1 45 ? 6.366   -10.261 10.909  1.00 22.58 ? 44  LEU A CD1 1 
ATOM   368  C  CD2 . LEU A 1 45 ? 7.393   -8.853  12.605  1.00 18.43 ? 44  LEU A CD2 1 
ATOM   369  N  N   . GLU A 1 46 ? 5.481   -13.302 15.309  1.00 18.01 ? 45  GLU A N   1 
ATOM   370  C  CA  . GLU A 1 46 ? 5.198   -13.649 16.705  1.00 20.50 ? 45  GLU A CA  1 
ATOM   371  C  C   . GLU A 1 46 ? 5.146   -12.391 17.609  1.00 20.00 ? 45  GLU A C   1 
ATOM   372  O  O   . GLU A 1 46 ? 6.049   -11.527 17.580  1.00 18.87 ? 45  GLU A O   1 
ATOM   373  C  CB  . GLU A 1 46 ? 6.215   -14.665 17.225  1.00 21.16 ? 45  GLU A CB  1 
ATOM   374  C  CG  . GLU A 1 46 ? 5.711   -15.488 18.422  1.00 25.40 ? 45  GLU A CG  1 
ATOM   375  C  CD  . GLU A 1 46 ? 6.382   -16.847 18.548  1.00 29.30 ? 45  GLU A CD  1 
ATOM   376  O  OE1 . GLU A 1 46 ? 7.598   -16.937 18.266  1.00 32.09 ? 45  GLU A OE1 1 
ATOM   377  O  OE2 . GLU A 1 46 ? 5.699   -17.841 18.937  1.00 34.83 ? 45  GLU A OE2 1 
ATOM   378  N  N   . GLU A 1 47 ? 4.058   -12.290 18.376  1.00 19.75 ? 46  GLU A N   1 
ATOM   379  C  CA  . GLU A 1 47 ? 3.916   -11.217 19.352  1.00 18.74 ? 46  GLU A CA  1 
ATOM   380  C  C   . GLU A 1 47 ? 5.144   -11.085 20.236  1.00 18.16 ? 46  GLU A C   1 
ATOM   381  O  O   . GLU A 1 47 ? 5.696   -12.080 20.731  1.00 18.20 ? 46  GLU A O   1 
ATOM   382  C  CB  . GLU A 1 47 ? 2.669   -11.471 20.227  1.00 19.43 ? 46  GLU A CB  1 
ATOM   383  C  CG  . GLU A 1 47 ? 2.156   -10.219 20.954  1.00 19.52 ? 46  GLU A CG  1 
ATOM   384  C  CD  . GLU A 1 47 ? 1.402   -10.546 22.236  1.00 21.34 ? 46  GLU A CD  1 
ATOM   385  O  OE1 . GLU A 1 47 ? 0.315   -9.975  22.418  1.00 21.07 ? 46  GLU A OE1 1 
ATOM   386  O  OE2 . GLU A 1 47 ? 1.893   -11.361 23.053  1.00 23.17 ? 46  GLU A OE2 1 
ATOM   387  N  N   . ILE A 1 48 ? 5.582   -9.842  20.393  1.00 15.77 ? 47  ILE A N   1 
ATOM   388  C  CA  . ILE A 1 48 ? 6.664   -9.472  21.276  1.00 16.27 ? 47  ILE A CA  1 
ATOM   389  C  C   . ILE A 1 48 ? 6.170   -9.184  22.704  1.00 16.44 ? 47  ILE A C   1 
ATOM   390  O  O   . ILE A 1 48 ? 5.260   -8.349  22.943  1.00 16.86 ? 47  ILE A O   1 
ATOM   391  C  CB  . ILE A 1 48 ? 7.356   -8.215  20.736  1.00 16.03 ? 47  ILE A CB  1 
ATOM   392  C  CG1 . ILE A 1 48 ? 7.853   -8.445  19.286  1.00 13.38 ? 47  ILE A CG1 1 
ATOM   393  C  CG2 . ILE A 1 48 ? 8.427   -7.813  21.671  1.00 15.33 ? 47  ILE A CG2 1 
ATOM   394  C  CD1 . ILE A 1 48 ? 8.682   -7.250  18.678  1.00 19.40 ? 47  ILE A CD1 1 
ATOM   395  N  N   . LYS A 1 49 ? 6.770   -9.901  23.645  1.00 18.10 ? 48  LYS A N   1 
ATOM   396  C  CA  . LYS A 1 49 ? 6.389   -9.867  25.045  1.00 18.58 ? 48  LYS A CA  1 
ATOM   397  C  C   . LYS A 1 49 ? 7.603   -9.762  25.928  1.00 19.16 ? 48  LYS A C   1 
ATOM   398  O  O   . LYS A 1 49 ? 7.475   -9.842  27.143  1.00 19.72 ? 48  LYS A O   1 
ATOM   399  C  CB  . LYS A 1 49 ? 5.720   -11.165 25.406  1.00 18.87 ? 48  LYS A CB  1 
ATOM   400  C  CG  . LYS A 1 49 ? 4.270   -11.272 25.054  1.00 18.49 ? 48  LYS A CG  1 
ATOM   401  C  CD  . LYS A 1 49 ? 3.743   -12.643 25.457  1.00 22.42 ? 48  LYS A CD  1 
ATOM   402  C  CE  . LYS A 1 49 ? 3.749   -13.623 24.289  1.00 22.95 ? 48  LYS A CE  1 
ATOM   403  N  NZ  . LYS A 1 49 ? 2.552   -13.380 23.410  1.00 23.84 ? 48  LYS A NZ  1 
ATOM   404  N  N   . GLU A 1 50 ? 8.779   -9.664  25.323  1.00 18.59 ? 49  GLU A N   1 
ATOM   405  C  CA  . GLU A 1 50 ? 10.017  -9.567  26.079  1.00 19.01 ? 49  GLU A CA  1 
ATOM   406  C  C   . GLU A 1 50 ? 10.859  -8.383  25.590  1.00 19.09 ? 49  GLU A C   1 
ATOM   407  O  O   . GLU A 1 50 ? 11.099  -8.233  24.360  1.00 18.41 ? 49  GLU A O   1 
ATOM   408  C  CB  . GLU A 1 50 ? 10.834  -10.875 25.922  1.00 19.04 ? 49  GLU A CB  1 
ATOM   409  C  CG  . GLU A 1 50 ? 10.241  -12.118 26.559  1.00 22.49 ? 49  GLU A CG  1 
ATOM   410  C  CD  . GLU A 1 50 ? 10.228  -12.030 28.082  1.00 22.41 ? 49  GLU A CD  1 
ATOM   411  O  OE1 . GLU A 1 50 ? 11.090  -11.300 28.659  1.00 21.89 ? 49  GLU A OE1 1 
ATOM   412  O  OE2 . GLU A 1 50 ? 9.330   -12.667 28.690  1.00 23.73 ? 49  GLU A OE2 1 
ATOM   413  N  N   . GLN A 1 51 ? 11.307  -7.543  26.538  1.00 18.43 ? 50  GLN A N   1 
ATOM   414  C  CA  . GLN A 1 51 ? 12.281  -6.471  26.255  1.00 19.47 ? 50  GLN A CA  1 
ATOM   415  C  C   . GLN A 1 51 ? 13.470  -6.877  25.336  1.00 18.61 ? 50  GLN A C   1 
ATOM   416  O  O   . GLN A 1 51 ? 13.920  -6.117  24.477  1.00 20.04 ? 50  GLN A O   1 
ATOM   417  C  CB  . GLN A 1 51 ? 12.864  -5.948  27.564  1.00 19.35 ? 50  GLN A CB  1 
ATOM   418  C  CG  . GLN A 1 51 ? 13.560  -4.625  27.403  1.00 22.02 ? 50  GLN A CG  1 
ATOM   419  C  CD  . GLN A 1 51 ? 12.686  -3.600  26.710  1.00 25.15 ? 50  GLN A CD  1 
ATOM   420  O  OE1 . GLN A 1 51 ? 11.515  -3.396  27.074  1.00 24.44 ? 50  GLN A OE1 1 
ATOM   421  N  NE2 . GLN A 1 51 ? 13.252  -2.929  25.716  1.00 21.19 ? 50  GLN A NE2 1 
ATOM   422  N  N   . GLU A 1 52 ? 14.017  -8.047  25.535  1.00 18.77 ? 51  GLU A N   1 
ATOM   423  C  CA  . GLU A 1 52 ? 15.171  -8.392  24.703  1.00 18.21 ? 51  GLU A CA  1 
ATOM   424  C  C   . GLU A 1 52 ? 14.845  -8.580  23.208  1.00 17.81 ? 51  GLU A C   1 
ATOM   425  O  O   . GLU A 1 52 ? 15.678  -8.360  22.331  1.00 18.34 ? 51  GLU A O   1 
ATOM   426  C  CB  . GLU A 1 52 ? 15.923  -9.567  25.309  1.00 19.19 ? 51  GLU A CB  1 
ATOM   427  C  CG  . GLU A 1 52 ? 15.267  -10.875 25.229  1.00 21.99 ? 51  GLU A CG  1 
ATOM   428  C  CD  . GLU A 1 52 ? 16.166  -11.940 25.812  1.00 26.45 ? 51  GLU A CD  1 
ATOM   429  O  OE1 . GLU A 1 52 ? 17.092  -12.432 25.102  1.00 28.83 ? 51  GLU A OE1 1 
ATOM   430  O  OE2 . GLU A 1 52 ? 15.963  -12.243 27.005  1.00 27.57 ? 51  GLU A OE2 1 
ATOM   431  N  N   . VAL A 1 53 ? 13.594  -8.948  22.921  1.00 16.45 ? 52  VAL A N   1 
ATOM   432  C  CA  . VAL A 1 53 ? 13.132  -9.080  21.540  1.00 16.74 ? 52  VAL A CA  1 
ATOM   433  C  C   . VAL A 1 53 ? 12.919  -7.732  20.860  1.00 17.04 ? 52  VAL A C   1 
ATOM   434  O  O   . VAL A 1 53 ? 13.341  -7.571  19.768  1.00 16.80 ? 52  VAL A O   1 
ATOM   435  C  CB  . VAL A 1 53 ? 11.872  -9.983  21.424  1.00 17.28 ? 52  VAL A CB  1 
ATOM   436  C  CG1 . VAL A 1 53 ? 11.171  -9.842  20.055  1.00 13.86 ? 52  VAL A CG1 1 
ATOM   437  C  CG2 . VAL A 1 53 ? 12.290  -11.415 21.700  1.00 14.51 ? 52  VAL A CG2 1 
ATOM   438  N  N   . VAL A 1 54 ? 12.254  -6.789  21.525  1.00 17.64 ? 53  VAL A N   1 
ATOM   439  C  CA  . VAL A 1 54 ? 12.191  -5.376  21.122  1.00 17.62 ? 53  VAL A CA  1 
ATOM   440  C  C   . VAL A 1 54 ? 13.649  -4.882  20.830  1.00 16.30 ? 53  VAL A C   1 
ATOM   441  O  O   . VAL A 1 54 ? 13.934  -4.363  19.762  1.00 15.46 ? 53  VAL A O   1 
ATOM   442  C  CB  . VAL A 1 54 ? 11.596  -4.543  22.280  1.00 17.09 ? 53  VAL A CB  1 
ATOM   443  C  CG1 . VAL A 1 54 ? 11.671  -3.089  21.957  1.00 20.78 ? 53  VAL A CG1 1 
ATOM   444  C  CG2 . VAL A 1 54 ? 10.118  -4.955  22.516  1.00 19.07 ? 53  VAL A CG2 1 
ATOM   445  N  N   . ASP A 1 55 ? 14.544  -5.142  21.754  1.00 18.44 ? 54  ASP A N   1 
ATOM   446  C  CA  . ASP A 1 55 ? 15.898  -4.607  21.667  1.00 16.67 ? 54  ASP A CA  1 
ATOM   447  C  C   . ASP A 1 55 ? 16.628  -5.118  20.412  1.00 18.81 ? 54  ASP A C   1 
ATOM   448  O  O   . ASP A 1 55 ? 17.381  -4.375  19.737  1.00 18.80 ? 54  ASP A O   1 
ATOM   449  C  CB  . ASP A 1 55 ? 16.697  -5.072  22.914  1.00 16.75 ? 54  ASP A CB  1 
ATOM   450  C  CG  . ASP A 1 55 ? 16.289  -4.322  24.206  1.00 20.06 ? 54  ASP A CG  1 
ATOM   451  O  OD1 . ASP A 1 55 ? 15.670  -3.239  24.086  1.00 22.98 ? 54  ASP A OD1 1 
ATOM   452  O  OD2 . ASP A 1 55 ? 16.611  -4.786  25.313  1.00 19.26 ? 54  ASP A OD2 1 
ATOM   453  N  N   . LYS A 1 56 ? 16.497  -6.416  20.173  1.00 17.04 ? 55  LYS A N   1 
ATOM   454  C  CA  . LYS A 1 56 ? 17.167  -7.078  19.075  1.00 17.45 ? 55  LYS A CA  1 
ATOM   455  C  C   . LYS A 1 56 ? 16.554  -6.626  17.753  1.00 16.73 ? 55  LYS A C   1 
ATOM   456  O  O   . LYS A 1 56 ? 17.278  -6.432  16.781  1.00 17.23 ? 55  LYS A O   1 
ATOM   457  C  CB  . LYS A 1 56 ? 17.074  -8.589  19.220  1.00 17.34 ? 55  LYS A CB  1 
ATOM   458  C  CG  . LYS A 1 56 ? 17.874  -9.454  18.151  1.00 20.33 ? 55  LYS A CG  1 
ATOM   459  C  CD  . LYS A 1 56 ? 19.410  -9.215  18.152  1.00 20.56 ? 55  LYS A CD  1 
ATOM   460  C  CE  . LYS A 1 56 ? 19.799  -8.185  17.100  1.00 24.60 ? 55  LYS A CE  1 
ATOM   461  N  NZ  . LYS A 1 56 ? 21.211  -8.202  16.696  1.00 24.04 ? 55  LYS A NZ  1 
ATOM   462  N  N   . VAL A 1 57 ? 15.233  -6.454  17.703  1.00 16.57 ? 56  VAL A N   1 
ATOM   463  C  CA  . VAL A 1 57 ? 14.609  -6.006  16.458  1.00 15.86 ? 56  VAL A CA  1 
ATOM   464  C  C   . VAL A 1 57 ? 15.062  -4.574  16.058  1.00 14.54 ? 56  VAL A C   1 
ATOM   465  O  O   . VAL A 1 57 ? 15.434  -4.346  14.903  1.00 13.60 ? 56  VAL A O   1 
ATOM   466  C  CB  . VAL A 1 57 ? 13.062  -6.088  16.472  1.00 16.05 ? 56  VAL A CB  1 
ATOM   467  C  CG1 . VAL A 1 57 ? 12.543  -5.578  15.153  1.00 17.60 ? 56  VAL A CG1 1 
ATOM   468  C  CG2 . VAL A 1 57 ? 12.574  -7.555  16.745  1.00 17.04 ? 56  VAL A CG2 1 
ATOM   469  N  N   . MET A 1 58 ? 15.022  -3.647  17.005  1.00 15.09 ? 57  MET A N   1 
ATOM   470  C  CA  . MET A 1 58 ? 15.646  -2.341  16.842  1.00 16.23 ? 57  MET A CA  1 
ATOM   471  C  C   . MET A 1 58 ? 17.101  -2.427  16.394  1.00 16.34 ? 57  MET A C   1 
ATOM   472  O  O   . MET A 1 58 ? 17.394  -1.859  15.390  1.00 16.64 ? 57  MET A O   1 
ATOM   473  C  CB  . MET A 1 58 ? 15.532  -1.482  18.095  1.00 17.59 ? 57  MET A CB  1 
ATOM   474  C  CG  . MET A 1 58 ? 15.941  -0.022  17.805  1.00 16.27 ? 57  MET A CG  1 
ATOM   475  S  SD  . MET A 1 58 ? 14.815  0.758   16.637  1.00 21.81 ? 57  MET A SD  1 
ATOM   476  C  CE  . MET A 1 58 ? 13.453  1.295   17.691  1.00 17.33 ? 57  MET A CE  1 
ATOM   477  N  N   . GLU A 1 59 ? 17.984  -3.122  17.132  1.00 16.50 ? 58  GLU A N   1 
ATOM   478  C  CA  . GLU A 1 59 ? 19.431  -3.256  16.801  1.00 16.84 ? 58  GLU A CA  1 
ATOM   479  C  C   . GLU A 1 59 ? 19.585  -3.666  15.333  1.00 17.03 ? 58  GLU A C   1 
ATOM   480  O  O   . GLU A 1 59 ? 20.474  -3.197  14.598  1.00 14.64 ? 58  GLU A O   1 
ATOM   481  C  CB  . GLU A 1 59 ? 19.999  -4.374  17.652  1.00 15.31 ? 58  GLU A CB  1 
ATOM   482  C  CG  . GLU A 1 59 ? 21.509  -4.545  17.623  1.00 15.04 ? 58  GLU A CG  1 
ATOM   483  C  CD  . GLU A 1 59 ? 21.964  -5.636  18.578  1.00 18.61 ? 58  GLU A CD  1 
ATOM   484  O  OE1 . GLU A 1 59 ? 23.187  -5.708  18.781  1.00 19.77 ? 58  GLU A OE1 1 
ATOM   485  O  OE2 . GLU A 1 59 ? 21.126  -6.413  19.130  1.00 21.06 ? 58  GLU A OE2 1 
ATOM   486  N  N   . THR A 1 60 ? 18.691  -4.551  14.913  1.00 17.49 ? 59  THR A N   1 
ATOM   487  C  CA  . THR A 1 60 ? 18.714  -5.059  13.569  1.00 18.09 ? 59  THR A CA  1 
ATOM   488  C  C   . THR A 1 60 ? 18.360  -4.020  12.528  1.00 17.95 ? 59  THR A C   1 
ATOM   489  O  O   . THR A 1 60 ? 19.085  -3.884  11.508  1.00 17.06 ? 59  THR A O   1 
ATOM   490  C  CB  . THR A 1 60 ? 17.887  -6.331  13.422  1.00 19.38 ? 59  THR A CB  1 
ATOM   491  O  OG1 . THR A 1 60 ? 18.329  -7.283  14.397  1.00 19.90 ? 59  THR A OG1 1 
ATOM   492  C  CG2 . THR A 1 60 ? 18.073  -6.921  12.038  1.00 18.93 ? 59  THR A CG2 1 
ATOM   493  N  N   . LEU A 1 61 ? 17.275  -3.275  12.734  1.00 18.41 ? 60  LEU A N   1 
ATOM   494  C  CA  . LEU A 1 61 ? 16.881  -2.357  11.674  1.00 19.05 ? 60  LEU A CA  1 
ATOM   495  C  C   . LEU A 1 61 ? 17.575  -0.984  11.716  1.00 19.15 ? 60  LEU A C   1 
ATOM   496  O  O   . LEU A 1 61 ? 17.550  -0.227  10.725  1.00 17.94 ? 60  LEU A O   1 
ATOM   497  C  CB  . LEU A 1 61 ? 15.337  -2.267  11.528  1.00 21.11 ? 60  LEU A CB  1 
ATOM   498  C  CG  . LEU A 1 61 ? 14.479  -1.966  12.728  1.00 18.69 ? 60  LEU A CG  1 
ATOM   499  C  CD1 . LEU A 1 61 ? 14.823  -0.579  13.306  1.00 23.47 ? 60  LEU A CD1 1 
ATOM   500  C  CD2 . LEU A 1 61 ? 12.972  -2.133  12.389  1.00 18.33 ? 60  LEU A CD2 1 
ATOM   501  N  N   . ASP A 1 62 ? 18.201  -0.675  12.843  1.00 18.41 ? 61  ASP A N   1 
ATOM   502  C  CA  . ASP A 1 62 ? 18.755  0.650   13.070  1.00 19.53 ? 61  ASP A CA  1 
ATOM   503  C  C   . ASP A 1 62 ? 20.137  0.827   12.457  1.00 19.76 ? 61  ASP A C   1 
ATOM   504  O  O   . ASP A 1 62 ? 21.168  0.596   13.103  1.00 19.69 ? 61  ASP A O   1 
ATOM   505  C  CB  . ASP A 1 62 ? 18.749  1.017   14.571  1.00 20.09 ? 61  ASP A CB  1 
ATOM   506  C  CG  . ASP A 1 62 ? 19.367  2.375   14.848  1.00 20.05 ? 61  ASP A CG  1 
ATOM   507  O  OD1 . ASP A 1 62 ? 19.302  3.259   13.944  1.00 18.44 ? 61  ASP A OD1 1 
ATOM   508  O  OD2 . ASP A 1 62 ? 19.904  2.571   15.979  1.00 16.32 ? 61  ASP A OD2 1 
ATOM   509  N  N   . ASN A 1 63 ? 20.159  1.348   11.238  1.00 18.95 ? 62  ASN A N   1 
ATOM   510  C  CA  . ASN A 1 63 ? 21.391  1.426   10.477  1.00 19.69 ? 62  ASN A CA  1 
ATOM   511  C  C   . ASN A 1 63 ? 22.251  2.635   10.783  1.00 19.16 ? 62  ASN A C   1 
ATOM   512  O  O   . ASN A 1 63 ? 23.455  2.609   10.567  1.00 20.62 ? 62  ASN A O   1 
ATOM   513  C  CB  . ASN A 1 63 ? 21.040  1.377   8.998   1.00 19.62 ? 62  ASN A CB  1 
ATOM   514  C  CG  . ASN A 1 63 ? 20.541  0.020   8.582   1.00 21.50 ? 62  ASN A CG  1 
ATOM   515  O  OD1 . ASN A 1 63 ? 19.706  -0.095  7.677   1.00 23.12 ? 62  ASN A OD1 1 
ATOM   516  N  ND2 . ASN A 1 63 ? 21.042  -1.039  9.252   1.00 23.70 ? 62  ASN A ND2 1 
ATOM   517  N  N   . ASP A 1 64 ? 21.632  3.706   11.248  1.00 19.32 ? 63  ASP A N   1 
ATOM   518  C  CA  . ASP A 1 64 ? 22.364  4.928   11.591  1.00 19.22 ? 63  ASP A CA  1 
ATOM   519  C  C   . ASP A 1 64 ? 22.644  5.064   13.108  1.00 19.43 ? 63  ASP A C   1 
ATOM   520  O  O   . ASP A 1 64 ? 23.203  6.068   13.572  1.00 19.76 ? 63  ASP A O   1 
ATOM   521  C  CB  . ASP A 1 64 ? 21.670  6.173   11.024  1.00 18.28 ? 63  ASP A CB  1 
ATOM   522  C  CG  . ASP A 1 64 ? 20.325  6.421   11.650  1.00 19.68 ? 63  ASP A CG  1 
ATOM   523  O  OD1 . ASP A 1 64 ? 19.659  7.390   11.267  1.00 23.49 ? 63  ASP A OD1 1 
ATOM   524  O  OD2 . ASP A 1 64 ? 19.916  5.642   12.515  1.00 15.11 ? 63  ASP A OD2 1 
ATOM   525  N  N   . GLY A 1 65 ? 22.238  4.048   13.862  1.00 20.52 ? 64  GLY A N   1 
ATOM   526  C  CA  . GLY A 1 65 ? 22.571  3.949   15.277  1.00 20.68 ? 64  GLY A CA  1 
ATOM   527  C  C   . GLY A 1 65 ? 22.040  5.000   16.244  1.00 21.26 ? 64  GLY A C   1 
ATOM   528  O  O   . GLY A 1 65 ? 22.588  5.145   17.340  1.00 20.92 ? 64  GLY A O   1 
ATOM   529  N  N   . ASP A 1 66 ? 20.996  5.740   15.874  1.00 19.93 ? 65  ASP A N   1 
ATOM   530  C  CA  . ASP A 1 66 ? 20.379  6.697   16.813  1.00 19.34 ? 65  ASP A CA  1 
ATOM   531  C  C   . ASP A 1 66 ? 19.359  5.979   17.746  1.00 18.35 ? 65  ASP A C   1 
ATOM   532  O  O   . ASP A 1 66 ? 18.604  6.601   18.495  1.00 19.26 ? 65  ASP A O   1 
ATOM   533  C  CB  . ASP A 1 66 ? 19.748  7.901   16.050  1.00 19.32 ? 65  ASP A CB  1 
ATOM   534  C  CG  . ASP A 1 66 ? 18.511  7.500   15.214  1.00 18.60 ? 65  ASP A CG  1 
ATOM   535  O  OD1 . ASP A 1 66 ? 18.295  6.293   15.029  1.00 12.17 ? 65  ASP A OD1 1 
ATOM   536  O  OD2 . ASP A 1 66 ? 17.769  8.387   14.723  1.00 17.65 ? 65  ASP A OD2 1 
ATOM   537  N  N   . GLY A 1 67 ? 19.360  4.662   17.735  1.00 17.51 ? 66  GLY A N   1 
ATOM   538  C  CA  . GLY A 1 67 ? 18.424  3.925   18.579  1.00 15.85 ? 66  GLY A CA  1 
ATOM   539  C  C   . GLY A 1 67 ? 16.964  4.062   18.195  1.00 16.80 ? 66  GLY A C   1 
ATOM   540  O  O   . GLY A 1 67 ? 16.079  3.659   18.959  1.00 15.92 ? 66  GLY A O   1 
ATOM   541  N  N   . GLU A 1 68 ? 16.703  4.574   16.996  1.00 14.35 ? 67  GLU A N   1 
ATOM   542  C  CA  . GLU A 1 68 ? 15.328  4.699   16.527  1.00 12.44 ? 67  GLU A CA  1 
ATOM   543  C  C   . GLU A 1 68 ? 15.216  4.205   15.085  1.00 12.30 ? 67  GLU A C   1 
ATOM   544  O  O   . GLU A 1 68 ? 16.190  4.027   14.362  1.00 10.23 ? 67  GLU A O   1 
ATOM   545  C  CB  . GLU A 1 68 ? 14.821  6.151   16.622  1.00 13.51 ? 67  GLU A CB  1 
ATOM   546  C  CG  . GLU A 1 68 ? 14.952  6.767   18.015  1.00 13.53 ? 67  GLU A CG  1 
ATOM   547  C  CD  . GLU A 1 68 ? 13.730  7.536   18.470  1.00 20.88 ? 67  GLU A CD  1 
ATOM   548  O  OE1 . GLU A 1 68 ? 12.648  7.500   17.809  1.00 22.71 ? 67  GLU A OE1 1 
ATOM   549  O  OE2 . GLU A 1 68 ? 13.855  8.153   19.556  1.00 23.20 ? 67  GLU A OE2 1 
ATOM   550  N  N   . CYS A 1 69 ? 14.016  3.950   14.659  1.00 11.17 ? 68  CYS A N   1 
ATOM   551  C  CA  . CYS A 1 69 ? 13.785  3.508   13.277  1.00 11.86 ? 68  CYS A CA  1 
ATOM   552  C  C   . CYS A 1 69 ? 13.188  4.667   12.496  1.00 11.93 ? 68  CYS A C   1 
ATOM   553  O  O   . CYS A 1 69 ? 12.064  5.089   12.816  1.00 13.31 ? 68  CYS A O   1 
ATOM   554  C  CB  . CYS A 1 69 ? 12.720  2.408   13.269  1.00 11.59 ? 68  CYS A CB  1 
ATOM   555  S  SG  . CYS A 1 69 ? 12.471  1.639   11.681  1.00 13.73 ? 68  CYS A SG  1 
ATOM   556  N  N   . ASP A 1 70 ? 13.881  5.170   11.482  1.00 12.45 ? 69  ASP A N   1 
ATOM   557  C  CA  . ASP A 1 70 ? 13.283  6.268   10.693  1.00 14.76 ? 69  ASP A CA  1 
ATOM   558  C  C   . ASP A 1 70 ? 12.516  5.730   9.505   1.00 14.32 ? 69  ASP A C   1 
ATOM   559  O  O   . ASP A 1 70 ? 12.349  4.523   9.384   1.00 14.39 ? 69  ASP A O   1 
ATOM   560  C  CB  . ASP A 1 70 ? 14.329  7.316   10.293  1.00 15.31 ? 69  ASP A CB  1 
ATOM   561  C  CG  . ASP A 1 70 ? 15.427  6.746   9.397   1.00 13.54 ? 69  ASP A CG  1 
ATOM   562  O  OD1 . ASP A 1 70 ? 15.311  5.633   8.819   1.00 13.27 ? 69  ASP A OD1 1 
ATOM   563  O  OD2 . ASP A 1 70 ? 16.439  7.462   9.234   1.00 17.17 ? 69  ASP A OD2 1 
ATOM   564  N  N   . PHE A 1 71 ? 11.950  6.591   8.664   1.00 14.13 ? 70  PHE A N   1 
ATOM   565  C  CA  . PHE A 1 71 ? 11.220  6.037   7.516   1.00 13.71 ? 70  PHE A CA  1 
ATOM   566  C  C   . PHE A 1 71 ? 12.022  5.070   6.604   1.00 12.02 ? 70  PHE A C   1 
ATOM   567  O  O   . PHE A 1 71 ? 11.557  4.010   6.229   1.00 12.80 ? 70  PHE A O   1 
ATOM   568  C  CB  . PHE A 1 71 ? 10.604  7.194   6.672   1.00 13.60 ? 70  PHE A CB  1 
ATOM   569  C  CG  . PHE A 1 71 ? 9.796   6.702   5.554   1.00 14.10 ? 70  PHE A CG  1 
ATOM   570  C  CD1 . PHE A 1 71 ? 8.494   6.255   5.778   1.00 21.96 ? 70  PHE A CD1 1 
ATOM   571  C  CD2 . PHE A 1 71 ? 10.323  6.611   4.266   1.00 14.99 ? 70  PHE A CD2 1 
ATOM   572  C  CE1 . PHE A 1 71 ? 7.719   5.734   4.723   1.00 24.18 ? 70  PHE A CE1 1 
ATOM   573  C  CE2 . PHE A 1 71 ? 9.561   6.092   3.223   1.00 20.87 ? 70  PHE A CE2 1 
ATOM   574  C  CZ  . PHE A 1 71 ? 8.259   5.655   3.452   1.00 20.53 ? 70  PHE A CZ  1 
ATOM   575  N  N   . GLN A 1 72 ? 13.280  5.425   6.300   1.00 14.07 ? 71  GLN A N   1 
ATOM   576  C  CA  . GLN A 1 72 ? 14.050  4.588   5.417   1.00 13.99 ? 71  GLN A CA  1 
ATOM   577  C  C   . GLN A 1 72 ? 14.372  3.266   6.049   1.00 13.80 ? 71  GLN A C   1 
ATOM   578  O  O   . GLN A 1 72 ? 14.348  2.211   5.405   1.00 13.50 ? 71  GLN A O   1 
ATOM   579  C  CB  . GLN A 1 72 ? 15.313  5.291   4.968   1.00 14.08 ? 71  GLN A CB  1 
ATOM   580  C  CG  . GLN A 1 72 ? 15.648  4.909   3.525   1.00 19.88 ? 71  GLN A CG  1 
ATOM   581  C  CD  . GLN A 1 72 ? 14.385  4.793   2.579   1.00 20.66 ? 71  GLN A CD  1 
ATOM   582  O  OE1 . GLN A 1 72 ? 14.203  3.778   1.888   1.00 25.87 ? 71  GLN A OE1 1 
ATOM   583  N  NE2 . GLN A 1 72 ? 13.563  5.873   2.520   1.00 17.91 ? 71  GLN A NE2 1 
ATOM   584  N  N   . GLU A 1 73 ? 14.607  3.292   7.343   1.00 12.95 ? 72  GLU A N   1 
ATOM   585  C  CA  . GLU A 1 73 ? 14.758  2.021   8.056   1.00 13.64 ? 72  GLU A CA  1 
ATOM   586  C  C   . GLU A 1 73 ? 13.479  1.181   8.173   1.00 11.71 ? 72  GLU A C   1 
ATOM   587  O  O   . GLU A 1 73 ? 13.492  -0.072  8.075   1.00 14.48 ? 72  GLU A O   1 
ATOM   588  C  CB  . GLU A 1 73 ? 15.325  2.320   9.447   1.00 12.46 ? 72  GLU A CB  1 
ATOM   589  C  CG  . GLU A 1 73 ? 16.800  2.762   9.412   1.00 12.38 ? 72  GLU A CG  1 
ATOM   590  C  CD  . GLU A 1 73 ? 17.197  3.524   10.639  1.00 13.77 ? 72  GLU A CD  1 
ATOM   591  O  OE1 . GLU A 1 73 ? 16.367  3.966   11.477  1.00 11.89 ? 72  GLU A OE1 1 
ATOM   592  O  OE2 . GLU A 1 73 ? 18.378  3.812   10.771  1.00 10.25 ? 72  GLU A OE2 1 
ATOM   593  N  N   . PHE A 1 74 ? 12.346  1.864   8.323   1.00 11.94 ? 73  PHE A N   1 
ATOM   594  C  CA  . PHE A 1 74 ? 11.110  1.199   8.266   1.00 14.46 ? 73  PHE A CA  1 
ATOM   595  C  C   . PHE A 1 74 ? 10.830  0.529   6.896   1.00 13.74 ? 73  PHE A C   1 
ATOM   596  O  O   . PHE A 1 74 ? 10.379  -0.622  6.813   1.00 14.79 ? 73  PHE A O   1 
ATOM   597  C  CB  . PHE A 1 74 ? 10.003  2.193   8.603   1.00 11.83 ? 73  PHE A CB  1 
ATOM   598  C  CG  . PHE A 1 74 ? 8.580   1.538   8.681   1.00 11.41 ? 73  PHE A CG  1 
ATOM   599  C  CD1 . PHE A 1 74 ? 8.327   0.543   9.636   1.00 12.24 ? 73  PHE A CD1 1 
ATOM   600  C  CD2 . PHE A 1 74 ? 7.601   1.839   7.758   1.00 13.24 ? 73  PHE A CD2 1 
ATOM   601  C  CE1 . PHE A 1 74 ? 7.051   -0.046  9.691   1.00 11.74 ? 73  PHE A CE1 1 
ATOM   602  C  CE2 . PHE A 1 74 ? 6.323   1.261   7.814   1.00 14.03 ? 73  PHE A CE2 1 
ATOM   603  C  CZ  . PHE A 1 74 ? 6.035   0.310   8.767   1.00 11.85 ? 73  PHE A CZ  1 
ATOM   604  N  N   . MET A 1 75 ? 11.139  1.244   5.834   1.00 13.03 ? 74  MET A N   1 
ATOM   605  C  CA  . MET A 1 75 ? 11.038  0.623   4.523   1.00 14.19 ? 74  MET A CA  1 
ATOM   606  C  C   . MET A 1 75 ? 11.838  -0.681  4.425   1.00 14.48 ? 74  MET A C   1 
ATOM   607  O  O   . MET A 1 75 ? 11.379  -1.677  3.893   1.00 12.67 ? 74  MET A O   1 
ATOM   608  C  CB  . MET A 1 75 ? 11.404  1.619   3.420   1.00 13.97 ? 74  MET A CB  1 
ATOM   609  C  CG  . MET A 1 75 ? 10.544  2.832   3.258   1.00 20.16 ? 74  MET A CG  1 
ATOM   610  S  SD  . MET A 1 75 ? 8.970   2.481   2.406   1.00 24.85 ? 74  MET A SD  1 
ATOM   611  C  CE  . MET A 1 75 ? 7.907   1.744   3.632   1.00 16.27 ? 74  MET A CE  1 
ATOM   612  N  N   . ALA A 1 76 ? 13.119  -0.631  4.859   1.00 11.88 ? 75  ALA A N   1 
ATOM   613  C  CA  . ALA A 1 76 ? 13.857  -1.880  4.884   1.00 12.49 ? 75  ALA A CA  1 
ATOM   614  C  C   . ALA A 1 76 ? 13.237  -2.990  5.725   1.00 11.54 ? 75  ALA A C   1 
ATOM   615  O  O   . ALA A 1 76 ? 13.241  -4.115  5.353   1.00 12.37 ? 75  ALA A O   1 
ATOM   616  C  CB  . ALA A 1 76 ? 15.356  -1.686  5.219   1.00 11.48 ? 75  ALA A CB  1 
ATOM   617  N  N   . PHE A 1 77 ? 12.741  -2.619  6.898   1.00 13.33 ? 76  PHE A N   1 
ATOM   618  C  CA  . PHE A 1 77 ? 11.923  -3.515  7.675   1.00 13.47 ? 76  PHE A CA  1 
ATOM   619  C  C   . PHE A 1 77 ? 10.756  -4.155  6.932   1.00 11.83 ? 76  PHE A C   1 
ATOM   620  O  O   . PHE A 1 77 ? 10.637  -5.375  6.993   1.00 11.57 ? 76  PHE A O   1 
ATOM   621  C  CB  . PHE A 1 77 ? 11.494  -2.836  8.937   1.00 12.21 ? 76  PHE A CB  1 
ATOM   622  C  CG  . PHE A 1 77 ? 10.785  -3.727  9.881   1.00 15.62 ? 76  PHE A CG  1 
ATOM   623  C  CD1 . PHE A 1 77 ? 11.425  -4.776  10.520  1.00 16.98 ? 76  PHE A CD1 1 
ATOM   624  C  CD2 . PHE A 1 77 ? 9.453   -3.494  10.119  1.00 17.00 ? 76  PHE A CD2 1 
ATOM   625  C  CE1 . PHE A 1 77 ? 10.689  -5.610  11.406  1.00 18.67 ? 76  PHE A CE1 1 
ATOM   626  C  CE2 . PHE A 1 77 ? 8.729   -4.284  10.999  1.00 19.84 ? 76  PHE A CE2 1 
ATOM   627  C  CZ  . PHE A 1 77 ? 9.366   -5.343  11.636  1.00 17.00 ? 76  PHE A CZ  1 
ATOM   628  N  N   . VAL A 1 78 ? 9.901   -3.357  6.276   1.00 14.66 ? 77  VAL A N   1 
ATOM   629  C  CA  . VAL A 1 78 ? 8.781   -3.873  5.471   1.00 14.89 ? 77  VAL A CA  1 
ATOM   630  C  C   . VAL A 1 78 ? 9.333   -4.803  4.390   1.00 14.39 ? 77  VAL A C   1 
ATOM   631  O  O   . VAL A 1 78 ? 8.827   -5.899  4.260   1.00 13.40 ? 77  VAL A O   1 
ATOM   632  C  CB  . VAL A 1 78 ? 7.951   -2.704  4.817   1.00 13.46 ? 77  VAL A CB  1 
ATOM   633  C  CG1 . VAL A 1 78 ? 6.817   -3.229  3.934   1.00 17.67 ? 77  VAL A CG1 1 
ATOM   634  C  CG2 . VAL A 1 78 ? 7.431   -1.750  5.878   1.00 16.85 ? 77  VAL A CG2 1 
ATOM   635  N  N   . ALA A 1 79 ? 10.441  -4.408  3.734   1.00 13.62 ? 78  ALA A N   1 
ATOM   636  C  CA  . ALA A 1 79 ? 11.026  -5.311  2.718   1.00 13.24 ? 78  ALA A CA  1 
ATOM   637  C  C   . ALA A 1 79 ? 11.451  -6.677  3.322   1.00 15.09 ? 78  ALA A C   1 
ATOM   638  O  O   . ALA A 1 79 ? 11.296  -7.740  2.676   1.00 13.24 ? 78  ALA A O   1 
ATOM   639  C  CB  . ALA A 1 79 ? 12.162  -4.639  1.964   1.00 14.17 ? 78  ALA A CB  1 
ATOM   640  N  N   . MET A 1 80 ? 12.050  -6.685  4.530   1.00 13.44 ? 79  MET A N   1 
ATOM   641  C  CA  A MET A 1 80 ? 12.489  -7.954  5.083   0.60 15.80 ? 79  MET A CA  1 
ATOM   642  C  CA  B MET A 1 80 ? 12.479  -7.932  5.166   0.40 13.25 ? 79  MET A CA  1 
ATOM   643  C  C   . MET A 1 80 ? 11.309  -8.847  5.509   1.00 12.80 ? 79  MET A C   1 
ATOM   644  O  O   . MET A 1 80 ? 11.292  -10.031 5.234   1.00 13.42 ? 79  MET A O   1 
ATOM   645  C  CB  A MET A 1 80 ? 13.644  -7.702  6.078   0.60 16.26 ? 79  MET A CB  1 
ATOM   646  C  CB  B MET A 1 80 ? 13.291  -7.592  6.405   0.40 14.00 ? 79  MET A CB  1 
ATOM   647  C  CG  A MET A 1 80 ? 13.655  -8.412  7.414   0.60 18.03 ? 79  MET A CG  1 
ATOM   648  C  CG  B MET A 1 80 ? 14.035  -8.767  6.969   0.40 13.07 ? 79  MET A CG  1 
ATOM   649  S  SD  A MET A 1 80 ? 14.029  -7.153  8.696   0.60 24.17 ? 79  MET A SD  1 
ATOM   650  S  SD  B MET A 1 80 ? 13.091  -9.552  8.261   0.40 11.07 ? 79  MET A SD  1 
ATOM   651  C  CE  A MET A 1 80 ? 15.243  -6.092  7.908   0.60 16.65 ? 79  MET A CE  1 
ATOM   652  C  CE  B MET A 1 80 ? 13.930  -11.146 8.408   0.40 15.35 ? 79  MET A CE  1 
ATOM   653  N  N   . VAL A 1 81 ? 10.294  -8.255  6.083   1.00 13.41 ? 80  VAL A N   1 
ATOM   654  C  CA  . VAL A 1 81 ? 9.134   -9.007  6.458   1.00 12.06 ? 80  VAL A CA  1 
ATOM   655  C  C   . VAL A 1 81 ? 8.402   -9.527  5.241   1.00 13.67 ? 80  VAL A C   1 
ATOM   656  O  O   . VAL A 1 81 ? 8.018   -10.664 5.236   1.00 12.28 ? 80  VAL A O   1 
ATOM   657  C  CB  . VAL A 1 81 ? 8.160   -8.176  7.279   1.00 12.91 ? 80  VAL A CB  1 
ATOM   658  C  CG1 . VAL A 1 81 ? 6.862   -8.998  7.609   1.00 10.40 ? 80  VAL A CG1 1 
ATOM   659  C  CG2 . VAL A 1 81 ? 8.779   -7.674  8.555   1.00 13.05 ? 80  VAL A CG2 1 
ATOM   660  N  N   . THR A 1 82 ? 8.173   -8.664  4.252   1.00 13.17 ? 81  THR A N   1 
ATOM   661  C  CA  . THR A 1 82 ? 7.536   -9.085  3.006   1.00 14.09 ? 81  THR A CA  1 
ATOM   662  C  C   . THR A 1 82 ? 8.302   -10.161 2.309   1.00 13.02 ? 81  THR A C   1 
ATOM   663  O  O   . THR A 1 82 ? 7.741   -11.158 1.839   1.00 11.83 ? 81  THR A O   1 
ATOM   664  C  CB  . THR A 1 82 ? 7.298   -7.868  2.057   1.00 13.12 ? 81  THR A CB  1 
ATOM   665  O  OG1 . THR A 1 82 ? 6.646   -6.832  2.786   1.00 13.90 ? 81  THR A OG1 1 
ATOM   666  C  CG2 . THR A 1 82 ? 6.486   -8.264  0.891   1.00 12.62 ? 81  THR A CG2 1 
ATOM   667  N  N   . THR A 1 83 ? 9.642   -10.013 2.279   1.00 14.30 ? 82  THR A N   1 
ATOM   668  C  CA  . THR A 1 83 ? 10.486  -11.022 1.593   1.00 13.31 ? 82  THR A CA  1 
ATOM   669  C  C   . THR A 1 83 ? 10.460  -12.350 2.255   1.00 13.27 ? 82  THR A C   1 
ATOM   670  O  O   . THR A 1 83 ? 10.446  -13.347 1.571   1.00 13.61 ? 82  THR A O   1 
ATOM   671  C  CB  . THR A 1 83 ? 11.939  -10.512 1.499   1.00 11.81 ? 82  THR A CB  1 
ATOM   672  O  OG1 . THR A 1 83 ? 11.929  -9.329  0.698   1.00 16.02 ? 82  THR A OG1 1 
ATOM   673  C  CG2 . THR A 1 83 ? 12.836  -11.559 0.929   1.00 15.90 ? 82  THR A CG2 1 
ATOM   674  N  N   . ALA A 1 84 ? 10.387  -12.346 3.595   1.00 13.16 ? 83  ALA A N   1 
ATOM   675  C  CA  . ALA A 1 84 ? 10.354  -13.531 4.413   1.00 14.41 ? 83  ALA A CA  1 
ATOM   676  C  C   . ALA A 1 84 ? 9.031   -14.216 4.177   1.00 15.05 ? 83  ALA A C   1 
ATOM   677  O  O   . ALA A 1 84 ? 8.988   -15.425 4.037   1.00 15.18 ? 83  ALA A O   1 
ATOM   678  C  CB  . ALA A 1 84 ? 10.569  -13.215 5.901   1.00 14.04 ? 83  ALA A CB  1 
ATOM   679  N  N   A CYS A 1 85 ? 7.968   -13.437 4.131   0.70 15.74 ? 84  CYS A N   1 
ATOM   680  N  N   B CYS A 1 85 ? 7.966   -13.427 4.068   0.30 14.98 ? 84  CYS A N   1 
ATOM   681  C  CA  A CYS A 1 85 ? 6.657   -14.000 3.829   0.70 15.77 ? 84  CYS A CA  1 
ATOM   682  C  CA  B CYS A 1 85 ? 6.614   -13.941 3.781   0.30 14.99 ? 84  CYS A CA  1 
ATOM   683  C  C   A CYS A 1 85 ? 6.626   -14.591 2.401   0.70 16.01 ? 84  CYS A C   1 
ATOM   684  C  C   B CYS A 1 85 ? 6.441   -14.490 2.364   0.30 15.36 ? 84  CYS A C   1 
ATOM   685  O  O   A CYS A 1 85 ? 6.253   -15.752 2.239   0.70 15.92 ? 84  CYS A O   1 
ATOM   686  O  O   B CYS A 1 85 ? 5.748   -15.480 2.159   0.30 15.67 ? 84  CYS A O   1 
ATOM   687  C  CB  A CYS A 1 85 ? 5.530   -13.004 4.048   0.70 15.37 ? 84  CYS A CB  1 
ATOM   688  C  CB  B CYS A 1 85 ? 5.570   -12.870 4.015   0.30 14.87 ? 84  CYS A CB  1 
ATOM   689  S  SG  A CYS A 1 85 ? 3.890   -13.566 3.452   0.70 17.62 ? 84  CYS A SG  1 
ATOM   690  S  SG  B CYS A 1 85 ? 5.307   -12.538 5.724   0.30 14.22 ? 84  CYS A SG  1 
ATOM   691  N  N   . HIS A 1 86 ? 7.037   -13.810 1.393   1.00 15.06 ? 85  HIS A N   1 
ATOM   692  C  CA  . HIS A 1 86 ? 7.175   -14.346 0.037   1.00 14.70 ? 85  HIS A CA  1 
ATOM   693  C  C   . HIS A 1 86 ? 7.861   -15.720 0.037   1.00 13.22 ? 85  HIS A C   1 
ATOM   694  O  O   . HIS A 1 86 ? 7.296   -16.679 -0.471  1.00 13.66 ? 85  HIS A O   1 
ATOM   695  C  CB  . HIS A 1 86 ? 7.940   -13.333 -0.824  1.00 14.84 ? 85  HIS A CB  1 
ATOM   696  C  CG  . HIS A 1 86 ? 8.167   -13.772 -2.241  1.00 14.92 ? 85  HIS A CG  1 
ATOM   697  N  ND1 . HIS A 1 86 ? 9.417   -13.715 -2.834  1.00 13.53 ? 85  HIS A ND1 1 
ATOM   698  C  CD2 . HIS A 1 86 ? 7.327   -14.265 -3.176  1.00 15.35 ? 85  HIS A CD2 1 
ATOM   699  C  CE1 . HIS A 1 86 ? 9.323   -14.129 -4.079  1.00 12.90 ? 85  HIS A CE1 1 
ATOM   700  N  NE2 . HIS A 1 86 ? 8.065   -14.464 -4.312  1.00 18.26 ? 85  HIS A NE2 1 
ATOM   701  N  N   . GLU A 1 87 ? 9.075   -15.823 0.577   1.00 12.46 ? 86  GLU A N   1 
ATOM   702  C  CA  . GLU A 1 87 ? 9.801   -17.100 0.470   1.00 11.00 ? 86  GLU A CA  1 
ATOM   703  C  C   . GLU A 1 87 ? 9.140   -18.247 1.269   1.00 11.32 ? 86  GLU A C   1 
ATOM   704  O  O   . GLU A 1 87 ? 9.186   -19.415 0.848   1.00 12.06 ? 86  GLU A O   1 
ATOM   705  C  CB  . GLU A 1 87 ? 11.252  -17.014 0.929   1.00 13.10 ? 86  GLU A CB  1 
ATOM   706  C  CG  . GLU A 1 87 ? 11.975  -15.706 0.794   1.00 16.88 ? 86  GLU A CG  1 
ATOM   707  C  CD  . GLU A 1 87 ? 12.811  -15.504 -0.464  1.00 24.48 ? 86  GLU A CD  1 
ATOM   708  O  OE1 . GLU A 1 87 ? 12.678  -16.269 -1.420  1.00 25.89 ? 86  GLU A OE1 1 
ATOM   709  O  OE2 . GLU A 1 87 ? 13.562  -14.491 -0.515  1.00 24.86 ? 86  GLU A OE2 1 
ATOM   710  N  N   . PHE A 1 88 ? 8.593   -17.897 2.432   1.00 11.94 ? 87  PHE A N   1 
ATOM   711  C  CA  . PHE A 1 88 ? 8.061   -18.881 3.364   1.00 13.99 ? 87  PHE A CA  1 
ATOM   712  C  C   . PHE A 1 88 ? 7.067   -19.738 2.595   1.00 14.44 ? 87  PHE A C   1 
ATOM   713  O  O   . PHE A 1 88 ? 6.881   -20.919 2.912   1.00 13.80 ? 87  PHE A O   1 
ATOM   714  C  CB  . PHE A 1 88 ? 7.458   -18.176 4.606   1.00 13.27 ? 87  PHE A CB  1 
ATOM   715  C  CG  . PHE A 1 88 ? 7.102   -19.124 5.715   1.00 15.75 ? 87  PHE A CG  1 
ATOM   716  C  CD1 . PHE A 1 88 ? 5.795   -19.490 5.902   1.00 14.84 ? 87  PHE A CD1 1 
ATOM   717  C  CD2 . PHE A 1 88 ? 8.096   -19.655 6.574   1.00 14.20 ? 87  PHE A CD2 1 
ATOM   718  C  CE1 . PHE A 1 88 ? 5.450   -20.402 6.928   1.00 19.12 ? 87  PHE A CE1 1 
ATOM   719  C  CE2 . PHE A 1 88 ? 7.788   -20.539 7.598   1.00 15.36 ? 87  PHE A CE2 1 
ATOM   720  C  CZ  . PHE A 1 88 ? 6.456   -20.922 7.791   1.00 16.69 ? 87  PHE A CZ  1 
ATOM   721  N  N   . PHE A 1 89 ? 6.438   -19.136 1.575   1.00 16.78 ? 88  PHE A N   1 
ATOM   722  C  CA  . PHE A 1 89 ? 5.389   -19.838 0.777   1.00 19.03 ? 88  PHE A CA  1 
ATOM   723  C  C   . PHE A 1 89 ? 5.820   -20.546 -0.494  1.00 20.81 ? 88  PHE A C   1 
ATOM   724  O  O   . PHE A 1 89 ? 5.055   -21.335 -1.069  1.00 21.80 ? 88  PHE A O   1 
ATOM   725  C  CB  . PHE A 1 89 ? 4.194   -18.931 0.532   1.00 19.63 ? 88  PHE A CB  1 
ATOM   726  C  CG  . PHE A 1 89 ? 3.300   -18.807 1.729   1.00 18.70 ? 88  PHE A CG  1 
ATOM   727  C  CD1 . PHE A 1 89 ? 3.698   -18.086 2.826   1.00 22.32 ? 88  PHE A CD1 1 
ATOM   728  C  CD2 . PHE A 1 89 ? 2.072   -19.459 1.759   1.00 20.85 ? 88  PHE A CD2 1 
ATOM   729  C  CE1 . PHE A 1 89 ? 2.877   -17.986 3.949   1.00 23.71 ? 88  PHE A CE1 1 
ATOM   730  C  CE2 . PHE A 1 89 ? 1.223   -19.376 2.880   1.00 20.35 ? 88  PHE A CE2 1 
ATOM   731  C  CZ  . PHE A 1 89 ? 1.634   -18.631 3.977   1.00 23.02 ? 88  PHE A CZ  1 
ATOM   732  N  N   . GLU A 1 90 ? 7.081   -20.364 -0.870  1.00 23.14 ? 89  GLU A N   1 
ATOM   733  C  CA  . GLU A 1 90 ? 7.625   -21.069 -2.029  1.00 25.53 ? 89  GLU A CA  1 
ATOM   734  C  C   . GLU A 1 90 ? 8.757   -22.088 -1.727  1.00 26.72 ? 89  GLU A C   1 
ATOM   735  O  O   . GLU A 1 90 ? 9.548   -21.871 -0.817  1.00 27.80 ? 89  GLU A O   1 
ATOM   736  C  CB  . GLU A 1 90 ? 7.966   -20.041 -3.089  1.00 25.31 ? 89  GLU A CB  1 
ATOM   737  C  CG  . GLU A 1 90 ? 6.692   -19.224 -3.441  1.00 24.52 ? 89  GLU A CG  1 
ATOM   738  C  CD  . GLU A 1 90 ? 6.990   -17.930 -4.139  1.00 22.48 ? 89  GLU A CD  1 
ATOM   739  O  OE1 . GLU A 1 90 ? 8.200   -17.618 -4.269  1.00 20.53 ? 89  GLU A OE1 1 
ATOM   740  O  OE2 . GLU A 1 90 ? 6.011   -17.237 -4.544  1.00 18.88 ? 89  GLU A OE2 1 
ATOM   741  N  N   . HIS A 1 91 ? 8.817   -23.210 -2.448  1.00 28.79 ? 90  HIS A N   1 
ATOM   742  C  CA  . HIS A 1 91 ? 7.854   -23.558 -3.494  1.00 30.58 ? 90  HIS A CA  1 
ATOM   743  C  C   . HIS A 1 91 ? 6.707   -24.464 -3.002  1.00 30.96 ? 90  HIS A C   1 
ATOM   744  O  O   . HIS A 1 91 ? 6.773   -25.056 -1.915  1.00 31.60 ? 90  HIS A O   1 
ATOM   745  C  CB  . HIS A 1 91 ? 8.570   -24.128 -4.741  1.00 30.53 ? 90  HIS A CB  1 
ATOM   746  C  CG  . HIS A 1 91 ? 8.419   -25.605 -4.924  1.00 32.23 ? 90  HIS A CG  1 
ATOM   747  N  ND1 . HIS A 1 91 ? 9.038   -26.531 -4.112  1.00 32.60 ? 90  HIS A ND1 1 
ATOM   748  C  CD2 . HIS A 1 91 ? 7.737   -26.316 -5.853  1.00 32.21 ? 90  HIS A CD2 1 
ATOM   749  C  CE1 . HIS A 1 91 ? 8.729   -27.748 -4.522  1.00 34.55 ? 90  HIS A CE1 1 
ATOM   750  N  NE2 . HIS A 1 91 ? 7.941   -27.646 -5.576  1.00 34.65 ? 90  HIS A NE2 1 
ATOM   751  N  N   . GLU A 1 92 ? 5.646   -24.500 -3.813  1.00 31.73 ? 91  GLU A N   1 
ATOM   752  C  CA  . GLU A 1 92 ? 4.468   -25.381 -3.686  1.00 31.70 ? 91  GLU A CA  1 
ATOM   753  C  C   . GLU A 1 92 ? 4.414   -26.320 -2.474  1.00 31.97 ? 91  GLU A C   1 
ATOM   754  O  O   . GLU A 1 92 ? 3.930   -25.909 -1.426  1.00 32.06 ? 91  GLU A O   1 
ATOM   755  C  CB  . GLU A 1 92 ? 4.285   -26.211 -4.957  1.00 31.82 ? 91  GLU A CB  1 
ATOM   756  C  CG  . GLU A 1 92 ? 4.256   -25.463 -6.272  1.00 31.83 ? 91  GLU A CG  1 
ATOM   757  C  CD  . GLU A 1 92 ? 4.208   -26.431 -7.438  1.00 32.70 ? 91  GLU A CD  1 
ATOM   758  O  OE1 . GLU A 1 92 ? 4.543   -27.605 -7.197  1.00 32.62 ? 91  GLU A OE1 1 
ATOM   759  O  OE2 . GLU A 1 92 ? 3.822   -26.046 -8.570  1.00 32.90 ? 91  GLU A OE2 1 
ATOM   760  O  OXT . GLU A 1 92 ? 4.812   -27.501 -2.516  1.00 32.66 ? 91  GLU A OXT 1 
ATOM   761  N  N   . MET B 1 1  ? -6.803  -9.095  8.878   1.00 8.05  ? 0   MET B N   1 
ATOM   762  C  CA  . MET B 1 1  ? -5.611  -8.413  8.321   1.00 9.15  ? 0   MET B CA  1 
ATOM   763  C  C   . MET B 1 1  ? -5.700  -6.928  8.538   1.00 6.38  ? 0   MET B C   1 
ATOM   764  O  O   . MET B 1 1  ? -6.684  -6.273  8.141   1.00 7.02  ? 0   MET B O   1 
ATOM   765  C  CB  . MET B 1 1  ? -5.514  -8.629  6.836   1.00 8.78  ? 0   MET B CB  1 
ATOM   766  C  CG  . MET B 1 1  ? -4.451  -9.547  6.382   1.00 11.33 ? 0   MET B CG  1 
ATOM   767  S  SD  . MET B 1 1  ? -4.263  -9.106  4.626   1.00 14.12 ? 0   MET B SD  1 
ATOM   768  C  CE  . MET B 1 1  ? -5.815  -9.688  4.009   1.00 10.74 ? 0   MET B CE  1 
ATOM   769  N  N   . SER B 1 2  ? -4.680  -6.471  9.229   1.00 3.44  ? 1   SER B N   1 
ATOM   770  C  CA  . SER B 1 2  ? -4.288  -5.079  9.455   1.00 2.00  ? 1   SER B CA  1 
ATOM   771  C  C   . SER B 1 2  ? -4.011  -4.390  8.100   1.00 2.00  ? 1   SER B C   1 
ATOM   772  O  O   . SER B 1 2  ? -3.789  -5.046  7.107   1.00 2.00  ? 1   SER B O   1 
ATOM   773  C  CB  . SER B 1 2  ? -3.039  -5.125  10.297  1.00 2.00  ? 1   SER B CB  1 
ATOM   774  O  OG  . SER B 1 2  ? -1.933  -5.346  9.424   1.00 2.00  ? 1   SER B OG  1 
ATOM   775  N  N   . GLU B 1 3  ? -4.061  -3.079  8.037   1.00 2.00  ? 2   GLU B N   1 
ATOM   776  C  CA  . GLU B 1 3  ? -3.819  -2.463  6.746   1.00 2.00  ? 2   GLU B CA  1 
ATOM   777  C  C   . GLU B 1 3  ? -2.338  -2.662  6.253   1.00 2.00  ? 2   GLU B C   1 
ATOM   778  O  O   . GLU B 1 3  ? -2.069  -2.876  5.068   1.00 2.49  ? 2   GLU B O   1 
ATOM   779  C  CB  . GLU B 1 3  ? -4.189  -1.011  6.831   1.00 2.00  ? 2   GLU B CB  1 
ATOM   780  C  CG  . GLU B 1 3  ? -5.723  -0.826  7.009   1.00 2.00  ? 2   GLU B CG  1 
ATOM   781  C  CD  . GLU B 1 3  ? -6.552  -1.149  5.739   1.00 2.00  ? 2   GLU B CD  1 
ATOM   782  O  OE1 . GLU B 1 3  ? -7.772  -1.489  5.873   1.00 2.62  ? 2   GLU B OE1 1 
ATOM   783  O  OE2 . GLU B 1 3  ? -6.050  -0.995  4.606   1.00 2.00  ? 2   GLU B OE2 1 
ATOM   784  N  N   . LEU B 1 4  ? -1.449  -2.769  7.210   1.00 2.00  ? 3   LEU B N   1 
ATOM   785  C  CA  . LEU B 1 4  ? -0.025  -3.161  6.898   1.00 2.00  ? 3   LEU B CA  1 
ATOM   786  C  C   . LEU B 1 4  ? 0.114   -4.506  6.289   1.00 2.00  ? 3   LEU B C   1 
ATOM   787  O  O   . LEU B 1 4  ? 0.694   -4.652  5.201   1.00 4.62  ? 3   LEU B O   1 
ATOM   788  C  CB  . LEU B 1 4  ? 0.892   -3.026  8.121   1.00 2.00  ? 3   LEU B CB  1 
ATOM   789  C  CG  . LEU B 1 4  ? 2.376   -3.366  7.925   1.00 2.00  ? 3   LEU B CG  1 
ATOM   790  C  CD1 . LEU B 1 4  ? 3.019   -2.442  6.849   1.00 2.00  ? 3   LEU B CD1 1 
ATOM   791  C  CD2 . LEU B 1 4  ? 2.962   -3.148  9.252   1.00 2.00  ? 3   LEU B CD2 1 
ATOM   792  N  N   . GLU B 1 5  ? -0.454  -5.539  6.924   1.00 2.23  ? 4   GLU B N   1 
ATOM   793  C  CA  . GLU B 1 5  ? -0.442  -6.876  6.347   1.00 3.34  ? 4   GLU B CA  1 
ATOM   794  C  C   . GLU B 1 5  ? -1.154  -6.902  4.980   1.00 6.11  ? 4   GLU B C   1 
ATOM   795  O  O   . GLU B 1 5  ? -0.671  -7.586  4.053   1.00 7.47  ? 4   GLU B O   1 
ATOM   796  C  CB  . GLU B 1 5  ? -1.121  -7.846  7.332   1.00 4.40  ? 4   GLU B CB  1 
ATOM   797  C  CG  . GLU B 1 5  ? -0.231  -8.031  8.545   1.00 2.00  ? 4   GLU B CG  1 
ATOM   798  C  CD  . GLU B 1 5  ? -0.915  -8.637  9.732   1.00 3.45  ? 4   GLU B CD  1 
ATOM   799  O  OE1 . GLU B 1 5  ? -0.216  -9.313  10.516  1.00 2.00  ? 4   GLU B OE1 1 
ATOM   800  O  OE2 . GLU B 1 5  ? -2.162  -8.482  9.898   1.00 5.12  ? 4   GLU B OE2 1 
ATOM   801  N  N   . LYS B 1 6  ? -2.292  -6.172  4.858   1.00 3.62  ? 5   LYS B N   1 
ATOM   802  C  CA  . LYS B 1 6  ? -2.963  -6.006  3.558   1.00 5.21  ? 5   LYS B CA  1 
ATOM   803  C  C   . LYS B 1 6  ? -2.002  -5.491  2.464   1.00 2.73  ? 5   LYS B C   1 
ATOM   804  O  O   . LYS B 1 6  ? -1.930  -6.038  1.344   1.00 3.68  ? 5   LYS B O   1 
ATOM   805  C  CB  . LYS B 1 6  ? -4.143  -5.042  3.697   1.00 4.19  ? 5   LYS B CB  1 
ATOM   806  C  CG  . LYS B 1 6  ? -5.446  -5.738  3.855   1.00 7.30  ? 5   LYS B CG  1 
ATOM   807  C  CD  . LYS B 1 6  ? -6.596  -4.760  3.832   1.00 7.68  ? 5   LYS B CD  1 
ATOM   808  C  CE  . LYS B 1 6  ? -7.274  -4.684  2.427   1.00 15.47 ? 5   LYS B CE  1 
ATOM   809  N  NZ  . LYS B 1 6  ? -6.449  -4.137  1.288   1.00 15.99 ? 5   LYS B NZ  1 
ATOM   810  N  N   . ALA B 1 7  ? -1.262  -4.490  2.833   1.00 4.84  ? 6   ALA B N   1 
ATOM   811  C  CA  . ALA B 1 7  ? -0.293  -3.803  1.930   1.00 4.86  ? 6   ALA B CA  1 
ATOM   812  C  C   . ALA B 1 7  ? 0.828   -4.752  1.541   1.00 6.96  ? 6   ALA B C   1 
ATOM   813  O  O   . ALA B 1 7  ? 1.189   -4.871  0.337   1.00 8.05  ? 6   ALA B O   1 
ATOM   814  C  CB  . ALA B 1 7  ? 0.224   -2.538  2.586   1.00 5.47  ? 6   ALA B CB  1 
ATOM   815  N  N   . MET B 1 8  ? 1.321   -5.518  2.511   1.00 7.25  ? 7   MET B N   1 
ATOM   816  C  CA  . MET B 1 8  ? 2.358   -6.526  2.170   1.00 9.51  ? 7   MET B CA  1 
ATOM   817  C  C   . MET B 1 8  ? 1.869   -7.550  1.159   1.00 10.83 ? 7   MET B C   1 
ATOM   818  O  O   . MET B 1 8  ? 2.599   -7.974  0.247   1.00 12.40 ? 7   MET B O   1 
ATOM   819  C  CB  . MET B 1 8  ? 2.942   -7.102  3.428   1.00 6.87  ? 7   MET B CB  1 
ATOM   820  C  CG  . MET B 1 8  ? 3.784   -6.093  4.258   1.00 7.55  ? 7   MET B CG  1 
ATOM   821  S  SD  . MET B 1 8  ? 4.146   -6.965  5.784   1.00 9.41  ? 7   MET B SD  1 
ATOM   822  C  CE  . MET B 1 8  ? 5.366   -5.897  6.595   1.00 5.99  ? 7   MET B CE  1 
ATOM   823  N  N   . VAL B 1 9  ? 0.630   -8.016  1.319   1.00 10.78 ? 8   VAL B N   1 
ATOM   824  C  CA  . VAL B 1 9  ? 0.134   -9.076  0.451   1.00 10.00 ? 8   VAL B CA  1 
ATOM   825  C  C   . VAL B 1 9  ? -0.072  -8.454  -0.931  1.00 9.49  ? 8   VAL B C   1 
ATOM   826  O  O   . VAL B 1 9  ? 0.166   -9.089  -1.937  1.00 8.56  ? 8   VAL B O   1 
ATOM   827  C  CB  . VAL B 1 9  ? -1.128  -9.710  1.094   1.00 9.01  ? 8   VAL B CB  1 
ATOM   828  C  CG1 . VAL B 1 9  ? -1.847  -10.763 0.212   1.00 7.86  ? 8   VAL B CG1 1 
ATOM   829  C  CG2 . VAL B 1 9  ? -0.699  -10.390 2.390   1.00 8.72  ? 8   VAL B CG2 1 
ATOM   830  N  N   . ALA B 1 10 ? -0.560  -7.246  -0.978  1.00 9.54  ? 9   ALA B N   1 
ATOM   831  C  CA  . ALA B 1 10 ? -0.744  -6.558  -2.254  1.00 11.35 ? 9   ALA B CA  1 
ATOM   832  C  C   . ALA B 1 10 ? 0.604   -6.496  -2.996  1.00 12.53 ? 9   ALA B C   1 
ATOM   833  O  O   . ALA B 1 10 ? 0.641   -6.672  -4.210  1.00 12.49 ? 9   ALA B O   1 
ATOM   834  C  CB  . ALA B 1 10 ? -1.300  -5.186  -2.056  1.00 9.87  ? 9   ALA B CB  1 
ATOM   835  N  N   . LEU B 1 11 ? 1.701   -6.211  -2.279  1.00 11.61 ? 10  LEU B N   1 
ATOM   836  C  CA  . LEU B 1 11 ? 3.019   -6.064  -2.987  1.00 9.97  ? 10  LEU B CA  1 
ATOM   837  C  C   . LEU B 1 11 ? 3.349   -7.388  -3.674  1.00 9.84  ? 10  LEU B C   1 
ATOM   838  O  O   . LEU B 1 11 ? 3.819   -7.360  -4.845  1.00 9.46  ? 10  LEU B O   1 
ATOM   839  C  CB  . LEU B 1 11 ? 4.179   -5.734  -2.053  1.00 8.31  ? 10  LEU B CB  1 
ATOM   840  C  CG  . LEU B 1 11 ? 4.081   -4.387  -1.360  1.00 8.70  ? 10  LEU B CG  1 
ATOM   841  C  CD1 . LEU B 1 11 ? 5.173   -4.104  -0.275  1.00 8.40  ? 10  LEU B CD1 1 
ATOM   842  C  CD2 . LEU B 1 11 ? 3.978   -3.277  -2.409  1.00 10.78 ? 10  LEU B CD2 1 
ATOM   843  N  N   . ILE B 1 12 ? 3.203   -8.510  -2.942  1.00 10.57 ? 11  ILE B N   1 
ATOM   844  C  CA  . ILE B 1 12 ? 3.566   -9.874  -3.419  1.00 11.39 ? 11  ILE B CA  1 
ATOM   845  C  C   . ILE B 1 12 ? 2.647   -10.174 -4.579  1.00 12.56 ? 11  ILE B C   1 
ATOM   846  O  O   . ILE B 1 12 ? 3.115   -10.569 -5.610  1.00 11.56 ? 11  ILE B O   1 
ATOM   847  C  CB  . ILE B 1 12 ? 3.434   -10.970 -2.337  1.00 11.45 ? 11  ILE B CB  1 
ATOM   848  C  CG1 . ILE B 1 12 ? 4.415   -10.594 -1.189  1.00 11.76 ? 11  ILE B CG1 1 
ATOM   849  C  CG2 . ILE B 1 12 ? 3.674   -12.345 -2.929  1.00 12.43 ? 11  ILE B CG2 1 
ATOM   850  C  CD1 . ILE B 1 12 ? 4.199   -11.374 0.078   1.00 12.22 ? 11  ILE B CD1 1 
ATOM   851  N  N   . ASP B 1 13 ? 1.366   -9.839  -4.416  1.00 11.30 ? 12  ASP B N   1 
ATOM   852  C  CA  . ASP B 1 13 ? 0.361   -10.208 -5.422  1.00 11.87 ? 12  ASP B CA  1 
ATOM   853  C  C   . ASP B 1 13 ? 0.572   -9.419  -6.749  1.00 9.55  ? 12  ASP B C   1 
ATOM   854  O  O   . ASP B 1 13 ? 0.552   -10.057 -7.834  1.00 10.45 ? 12  ASP B O   1 
ATOM   855  C  CB  . ASP B 1 13 ? -1.033  -9.928  -4.862  1.00 11.96 ? 12  ASP B CB  1 
ATOM   856  C  CG  . ASP B 1 13 ? -2.177  -10.345 -5.801  1.00 13.04 ? 12  ASP B CG  1 
ATOM   857  O  OD1 . ASP B 1 13 ? -3.153  -9.568  -5.852  1.00 20.91 ? 12  ASP B OD1 1 
ATOM   858  O  OD2 . ASP B 1 13 ? -2.153  -11.397 -6.471  1.00 12.60 ? 12  ASP B OD2 1 
ATOM   859  N  N   . VAL B 1 14 ? 0.737   -8.101  -6.674  1.00 11.61 ? 13  VAL B N   1 
ATOM   860  C  CA  . VAL B 1 14 ? 0.943   -7.290  -7.881  1.00 9.72  ? 13  VAL B CA  1 
ATOM   861  C  C   . VAL B 1 14 ? 2.218   -7.765  -8.602  1.00 11.27 ? 13  VAL B C   1 
ATOM   862  O  O   . VAL B 1 14 ? 2.199   -8.012  -9.816  1.00 10.11 ? 13  VAL B O   1 
ATOM   863  C  CB  . VAL B 1 14 ? 0.989   -5.777  -7.619  1.00 8.92  ? 13  VAL B CB  1 
ATOM   864  C  CG1 . VAL B 1 14 ? 1.185   -5.043  -8.933  1.00 9.65  ? 13  VAL B CG1 1 
ATOM   865  C  CG2 . VAL B 1 14 ? -0.268  -5.343  -6.996  1.00 13.50 ? 13  VAL B CG2 1 
ATOM   866  N  N   . PHE B 1 15 ? 3.289   -8.035  -7.845  1.00 11.58 ? 14  PHE B N   1 
ATOM   867  C  CA  . PHE B 1 15 ? 4.537   -8.544  -8.477  1.00 8.30  ? 14  PHE B CA  1 
ATOM   868  C  C   . PHE B 1 15 ? 4.325   -9.823  -9.311  1.00 10.53 ? 14  PHE B C   1 
ATOM   869  O  O   . PHE B 1 15 ? 4.832   -9.925  -10.426 1.00 12.55 ? 14  PHE B O   1 
ATOM   870  C  CB  . PHE B 1 15 ? 5.598   -8.807  -7.414  1.00 7.90  ? 14  PHE B CB  1 
ATOM   871  C  CG  . PHE B 1 15 ? 6.908   -9.393  -7.991  1.00 4.76  ? 14  PHE B CG  1 
ATOM   872  C  CD1 . PHE B 1 15 ? 7.863   -8.524  -8.546  1.00 5.01  ? 14  PHE B CD1 1 
ATOM   873  C  CD2 . PHE B 1 15 ? 7.166   -10.754 -7.977  1.00 2.55  ? 14  PHE B CD2 1 
ATOM   874  C  CE1 . PHE B 1 15 ? 9.058   -8.990  -9.107  1.00 3.04  ? 14  PHE B CE1 1 
ATOM   875  C  CE2 . PHE B 1 15 ? 8.361   -11.234 -8.501  1.00 4.43  ? 14  PHE B CE2 1 
ATOM   876  C  CZ  . PHE B 1 15 ? 9.301   -10.351 -9.083  1.00 4.23  ? 14  PHE B CZ  1 
ATOM   877  N  N   . HIS B 1 16 ? 3.656   -10.820 -8.756  1.00 8.53  ? 15  HIS B N   1 
ATOM   878  C  CA  . HIS B 1 16 ? 3.494   -12.089 -9.452  1.00 8.58  ? 15  HIS B CA  1 
ATOM   879  C  C   . HIS B 1 16 ? 2.532   -11.942 -10.626 1.00 8.41  ? 15  HIS B C   1 
ATOM   880  O  O   . HIS B 1 16 ? 2.610   -12.673 -11.637 1.00 7.90  ? 15  HIS B O   1 
ATOM   881  C  CB  . HIS B 1 16 ? 2.966   -13.157 -8.474  1.00 10.00 ? 15  HIS B CB  1 
ATOM   882  C  CG  . HIS B 1 16 ? 3.987   -13.637 -7.487  1.00 11.56 ? 15  HIS B CG  1 
ATOM   883  N  ND1 . HIS B 1 16 ? 4.487   -12.816 -6.487  1.00 20.12 ? 15  HIS B ND1 1 
ATOM   884  C  CD2 . HIS B 1 16 ? 4.668   -14.792 -7.403  1.00 18.33 ? 15  HIS B CD2 1 
ATOM   885  C  CE1 . HIS B 1 16 ? 5.374   -13.497 -5.780  1.00 20.62 ? 15  HIS B CE1 1 
ATOM   886  N  NE2 . HIS B 1 16 ? 5.497   -14.694 -6.316  1.00 22.38 ? 15  HIS B NE2 1 
ATOM   887  N  N   . GLN B 1 17 ? 1.599   -11.000 -10.479 1.00 7.71  ? 16  GLN B N   1 
ATOM   888  C  CA  . GLN B 1 17 ? 0.631   -10.751 -11.540 1.00 9.14  ? 16  GLN B CA  1 
ATOM   889  C  C   . GLN B 1 17 ? 1.411   -10.410 -12.813 1.00 9.42  ? 16  GLN B C   1 
ATOM   890  O  O   . GLN B 1 17 ? 1.093   -10.903 -13.909 1.00 8.78  ? 16  GLN B O   1 
ATOM   891  C  CB  . GLN B 1 17 ? -0.291  -9.583  -11.139 1.00 8.53  ? 16  GLN B CB  1 
ATOM   892  C  CG  . GLN B 1 17 ? -1.588  -9.949  -10.405 1.00 8.30  ? 16  GLN B CG  1 
ATOM   893  C  CD  . GLN B 1 17 ? -2.282  -8.723  -9.718  1.00 11.10 ? 16  GLN B CD  1 
ATOM   894  O  OE1 . GLN B 1 17 ? -2.209  -7.553  -10.179 1.00 11.72 ? 16  GLN B OE1 1 
ATOM   895  N  NE2 . GLN B 1 17 ? -2.974  -9.007  -8.620  1.00 10.64 ? 16  GLN B NE2 1 
ATOM   896  N  N   . TYR B 1 18 ? 2.443   -9.575  -12.643 1.00 11.66 ? 17  TYR B N   1 
ATOM   897  C  CA  . TYR B 1 18 ? 3.193   -9.054  -13.772 1.00 12.17 ? 17  TYR B CA  1 
ATOM   898  C  C   . TYR B 1 18 ? 4.356   -9.928  -14.144 1.00 12.25 ? 17  TYR B C   1 
ATOM   899  O  O   . TYR B 1 18 ? 4.639   -10.204 -15.354 1.00 12.62 ? 17  TYR B O   1 
ATOM   900  C  CB  . TYR B 1 18 ? 3.603   -7.594  -13.527 1.00 12.58 ? 17  TYR B CB  1 
ATOM   901  C  CG  . TYR B 1 18 ? 2.474   -6.685  -13.758 1.00 13.21 ? 17  TYR B CG  1 
ATOM   902  C  CD1 . TYR B 1 18 ? 1.537   -6.446  -12.774 1.00 15.15 ? 17  TYR B CD1 1 
ATOM   903  C  CD2 . TYR B 1 18 ? 2.256   -6.141  -15.036 1.00 17.44 ? 17  TYR B CD2 1 
ATOM   904  C  CE1 . TYR B 1 18 ? 0.422   -5.587  -13.032 1.00 14.51 ? 17  TYR B CE1 1 
ATOM   905  C  CE2 . TYR B 1 18 ? 1.144   -5.338  -15.311 1.00 14.93 ? 17  TYR B CE2 1 
ATOM   906  C  CZ  . TYR B 1 18 ? 0.236   -5.090  -14.309 1.00 13.93 ? 17  TYR B CZ  1 
ATOM   907  O  OH  . TYR B 1 18 ? -0.791  -4.271  -14.599 1.00 15.90 ? 17  TYR B OH  1 
ATOM   908  N  N   . SER B 1 19 ? 5.005   -10.473 -13.136 1.00 12.48 ? 18  SER B N   1 
ATOM   909  C  CA  . SER B 1 19 ? 6.211   -11.306 -13.440 1.00 13.39 ? 18  SER B CA  1 
ATOM   910  C  C   . SER B 1 19 ? 5.874   -12.628 -14.191 1.00 12.10 ? 18  SER B C   1 
ATOM   911  O  O   . SER B 1 19 ? 6.682   -13.161 -14.986 1.00 15.07 ? 18  SER B O   1 
ATOM   912  C  CB  . SER B 1 19 ? 7.062   -11.591 -12.164 1.00 13.20 ? 18  SER B CB  1 
ATOM   913  O  OG  . SER B 1 19 ? 6.366   -12.428 -11.237 1.00 16.33 ? 18  SER B OG  1 
ATOM   914  N  N   . GLY B 1 20 ? 4.681   -13.161 -13.931 1.00 12.51 ? 19  GLY B N   1 
ATOM   915  C  CA  . GLY B 1 20 ? 4.242   -14.437 -14.564 1.00 14.51 ? 19  GLY B CA  1 
ATOM   916  C  C   . GLY B 1 20 ? 3.624   -14.270 -15.954 1.00 15.36 ? 19  GLY B C   1 
ATOM   917  O  O   . GLY B 1 20 ? 2.984   -15.182 -16.464 1.00 16.80 ? 19  GLY B O   1 
ATOM   918  N  N   . ARG B 1 21 ? 3.759   -13.084 -16.556 1.00 16.12 ? 20  ARG B N   1 
ATOM   919  C  CA  . ARG B 1 21 ? 3.227   -12.911 -17.933 1.00 15.93 ? 20  ARG B CA  1 
ATOM   920  C  C   . ARG B 1 21 ? 4.040   -13.669 -18.994 1.00 14.91 ? 20  ARG B C   1 
ATOM   921  O  O   . ARG B 1 21 ? 3.485   -14.373 -19.875 1.00 15.38 ? 20  ARG B O   1 
ATOM   922  C  CB  . ARG B 1 21 ? 3.109   -11.423 -18.255 1.00 14.84 ? 20  ARG B CB  1 
ATOM   923  C  CG  . ARG B 1 21 ? 1.999   -10.777 -17.445 1.00 13.85 ? 20  ARG B CG  1 
ATOM   924  C  CD  . ARG B 1 21 ? 1.820   -9.358  -17.847 1.00 17.44 ? 20  ARG B CD  1 
ATOM   925  N  NE  . ARG B 1 21 ? 0.617   -8.744  -17.323 1.00 17.32 ? 20  ARG B NE  1 
ATOM   926  C  CZ  . ARG B 1 21 ? 0.209   -7.545  -17.699 1.00 16.38 ? 20  ARG B CZ  1 
ATOM   927  N  NH1 . ARG B 1 21 ? -0.891  -7.007  -17.206 1.00 19.41 ? 20  ARG B NH1 1 
ATOM   928  N  NH2 . ARG B 1 21 ? 0.888   -6.897  -18.619 1.00 21.09 ? 20  ARG B NH2 1 
ATOM   929  N  N   . GLU B 1 22 ? 5.353   -13.596 -18.854 1.00 15.91 ? 21  GLU B N   1 
ATOM   930  C  CA  . GLU B 1 22 ? 6.262   -14.017 -19.891 1.00 18.93 ? 21  GLU B CA  1 
ATOM   931  C  C   . GLU B 1 22 ? 7.606   -14.429 -19.280 1.00 17.90 ? 21  GLU B C   1 
ATOM   932  O  O   . GLU B 1 22 ? 7.974   -13.976 -18.199 1.00 15.24 ? 21  GLU B O   1 
ATOM   933  C  CB  . GLU B 1 22 ? 6.477   -12.870 -20.889 1.00 19.74 ? 21  GLU B CB  1 
ATOM   934  C  CG  . GLU B 1 22 ? 5.231   -12.469 -21.703 1.00 22.29 ? 21  GLU B CG  1 
ATOM   935  C  CD  . GLU B 1 22 ? 5.574   -11.580 -22.909 1.00 24.00 ? 21  GLU B CD  1 
ATOM   936  O  OE1 . GLU B 1 22 ? 4.990   -10.450 -23.039 1.00 28.19 ? 21  GLU B OE1 1 
ATOM   937  O  OE2 . GLU B 1 22 ? 6.440   -12.023 -23.713 1.00 30.31 ? 21  GLU B OE2 1 
ATOM   938  N  N   . GLY B 1 23 ? 8.334   -15.301 -19.978 1.00 17.73 ? 22  GLY B N   1 
ATOM   939  C  CA  . GLY B 1 23 ? 9.702   -15.643 -19.606 1.00 18.80 ? 22  GLY B CA  1 
ATOM   940  C  C   . GLY B 1 23 ? 9.716   -16.249 -18.224 1.00 18.56 ? 22  GLY B C   1 
ATOM   941  O  O   . GLY B 1 23 ? 8.776   -16.951 -17.834 1.00 20.16 ? 22  GLY B O   1 
ATOM   942  N  N   . ASP B 1 24 ? 10.766  -15.959 -17.462 1.00 17.88 ? 23  ASP B N   1 
ATOM   943  C  CA  . ASP B 1 24 ? 10.808  -16.371 -16.070 1.00 16.85 ? 23  ASP B CA  1 
ATOM   944  C  C   . ASP B 1 24 ? 9.510   -15.936 -15.419 1.00 16.91 ? 23  ASP B C   1 
ATOM   945  O  O   . ASP B 1 24 ? 9.178   -14.781 -15.504 1.00 13.39 ? 23  ASP B O   1 
ATOM   946  C  CB  . ASP B 1 24 ? 12.011  -15.718 -15.395 1.00 16.86 ? 23  ASP B CB  1 
ATOM   947  C  CG  . ASP B 1 24 ? 12.273  -16.249 -14.003 1.00 16.73 ? 23  ASP B CG  1 
ATOM   948  O  OD1 . ASP B 1 24 ? 11.335  -16.559 -13.251 1.00 19.00 ? 23  ASP B OD1 1 
ATOM   949  O  OD2 . ASP B 1 24 ? 13.444  -16.337 -13.626 1.00 20.60 ? 23  ASP B OD2 1 
ATOM   950  N  N   . LYS B 1 25 ? 8.763   -16.847 -14.800 1.00 17.63 ? 24  LYS B N   1 
ATOM   951  C  CA  . LYS B 1 25 ? 7.503   -16.445 -14.132 1.00 17.18 ? 24  LYS B CA  1 
ATOM   952  C  C   . LYS B 1 25 ? 7.710   -15.740 -12.787 1.00 17.38 ? 24  LYS B C   1 
ATOM   953  O  O   . LYS B 1 25 ? 6.765   -15.314 -12.132 1.00 17.56 ? 24  LYS B O   1 
ATOM   954  C  CB  . LYS B 1 25 ? 6.586   -17.659 -13.988 1.00 19.28 ? 24  LYS B CB  1 
ATOM   955  C  CG  . LYS B 1 25 ? 6.043   -18.115 -15.339 1.00 18.74 ? 24  LYS B CG  1 
ATOM   956  C  CD  . LYS B 1 25 ? 5.196   -19.352 -15.218 1.00 21.48 ? 24  LYS B CD  1 
ATOM   957  C  CE  . LYS B 1 25 ? 4.029   -19.272 -16.189 1.00 23.12 ? 24  LYS B CE  1 
ATOM   958  N  NZ  . LYS B 1 25 ? 4.439   -19.160 -17.606 1.00 23.30 ? 24  LYS B NZ  1 
ATOM   959  N  N   . HIS B 1 26 ? 8.954   -15.549 -12.399 1.00 17.42 ? 25  HIS B N   1 
ATOM   960  C  CA  . HIS B 1 26 ? 9.246   -15.037 -11.078 1.00 17.41 ? 25  HIS B CA  1 
ATOM   961  C  C   . HIS B 1 26 ? 10.131  -13.814 -11.151 1.00 18.16 ? 25  HIS B C   1 
ATOM   962  O  O   . HIS B 1 26 ? 10.673  -13.351 -10.143 1.00 18.88 ? 25  HIS B O   1 
ATOM   963  C  CB  . HIS B 1 26 ? 9.869   -16.160 -10.244 1.00 18.41 ? 25  HIS B CB  1 
ATOM   964  C  CG  . HIS B 1 26 ? 9.537   -16.083 -8.790  1.00 19.24 ? 25  HIS B CG  1 
ATOM   965  N  ND1 . HIS B 1 26 ? 10.241  -16.779 -7.828  1.00 25.13 ? 25  HIS B ND1 1 
ATOM   966  C  CD2 . HIS B 1 26 ? 8.585   -15.384 -8.133  1.00 23.16 ? 25  HIS B CD2 1 
ATOM   967  C  CE1 . HIS B 1 26 ? 9.728   -16.511 -6.640  1.00 22.83 ? 25  HIS B CE1 1 
ATOM   968  N  NE2 . HIS B 1 26 ? 8.734   -15.651 -6.797  1.00 20.55 ? 25  HIS B NE2 1 
ATOM   969  N  N   . LYS B 1 27 ? 10.228  -13.232 -12.347 1.00 17.28 ? 26  LYS B N   1 
ATOM   970  C  CA  . LYS B 1 27 ? 10.955  -11.990 -12.502 1.00 16.58 ? 26  LYS B CA  1 
ATOM   971  C  C   . LYS B 1 27 ? 10.261  -11.140 -13.537 1.00 15.90 ? 26  LYS B C   1 
ATOM   972  O  O   . LYS B 1 27 ? 9.668   -11.697 -14.426 1.00 15.80 ? 26  LYS B O   1 
ATOM   973  C  CB  . LYS B 1 27 ? 12.417  -12.254 -12.891 1.00 16.76 ? 26  LYS B CB  1 
ATOM   974  C  CG  . LYS B 1 27 ? 13.167  -13.178 -11.911 1.00 13.79 ? 26  LYS B CG  1 
ATOM   975  C  CD  . LYS B 1 27 ? 14.571  -13.480 -12.297 1.00 18.51 ? 26  LYS B CD  1 
ATOM   976  C  CE  . LYS B 1 27 ? 15.182  -14.388 -11.216 1.00 17.67 ? 26  LYS B CE  1 
ATOM   977  N  NZ  . LYS B 1 27 ? 14.622  -15.804 -11.166 1.00 21.17 ? 26  LYS B NZ  1 
ATOM   978  N  N   . LEU B 1 28 ? 10.303  -9.805  -13.395 1.00 15.45 ? 27  LEU B N   1 
ATOM   979  C  CA  . LEU B 1 28 ? 9.763   -8.894  -14.420 1.00 15.69 ? 27  LEU B CA  1 
ATOM   980  C  C   . LEU B 1 28 ? 10.774  -8.616  -15.521 1.00 16.43 ? 27  LEU B C   1 
ATOM   981  O  O   . LEU B 1 28 ? 11.909  -8.221  -15.200 1.00 15.59 ? 27  LEU B O   1 
ATOM   982  C  CB  . LEU B 1 28 ? 9.357   -7.560  -13.807 1.00 16.72 ? 27  LEU B CB  1 
ATOM   983  C  CG  . LEU B 1 28 ? 8.425   -7.687  -12.620 1.00 13.39 ? 27  LEU B CG  1 
ATOM   984  C  CD1 . LEU B 1 28 ? 8.477   -6.334  -11.782 1.00 19.21 ? 27  LEU B CD1 1 
ATOM   985  C  CD2 . LEU B 1 28 ? 7.000   -7.914  -13.126 1.00 13.76 ? 27  LEU B CD2 1 
ATOM   986  N  N   . LYS B 1 29 ? 10.405  -8.861  -16.772 1.00 16.09 ? 28  LYS B N   1 
ATOM   987  C  CA  . LYS B 1 29 ? 11.258  -8.379  -17.854 1.00 17.17 ? 28  LYS B CA  1 
ATOM   988  C  C   . LYS B 1 29 ? 10.822  -6.964  -18.169 1.00 17.50 ? 28  LYS B C   1 
ATOM   989  O  O   . LYS B 1 29 ? 9.826   -6.461  -17.578 1.00 16.92 ? 28  LYS B O   1 
ATOM   990  C  CB  . LYS B 1 29 ? 11.253  -9.309  -19.070 1.00 16.62 ? 28  LYS B CB  1 
ATOM   991  C  CG  . LYS B 1 29 ? 9.893   -9.766  -19.600 1.00 17.91 ? 28  LYS B CG  1 
ATOM   992  C  CD  . LYS B 1 29 ? 10.034  -10.704 -20.771 1.00 18.46 ? 28  LYS B CD  1 
ATOM   993  C  CE  . LYS B 1 29 ? 11.399  -11.467 -20.816 1.00 19.68 ? 28  LYS B CE  1 
ATOM   994  N  NZ  . LYS B 1 29 ? 11.745  -12.635 -19.865 1.00 18.73 ? 28  LYS B NZ  1 
ATOM   995  N  N   . LYS B 1 30 ? 11.534  -6.300  -19.091 1.00 17.73 ? 29  LYS B N   1 
ATOM   996  C  CA  . LYS B 1 30 ? 11.248  -4.890  -19.363 1.00 18.06 ? 29  LYS B CA  1 
ATOM   997  C  C   . LYS B 1 30 ? 9.761   -4.660  -19.693 1.00 17.85 ? 29  LYS B C   1 
ATOM   998  O  O   . LYS B 1 30 ? 9.143   -3.720  -19.150 1.00 17.08 ? 29  LYS B O   1 
ATOM   999  C  CB  . LYS B 1 30 ? 12.139  -4.341  -20.476 1.00 18.54 ? 29  LYS B CB  1 
ATOM   1000 C  CG  . LYS B 1 30 ? 13.551  -4.218  -20.080 1.00 21.21 ? 29  LYS B CG  1 
ATOM   1001 C  CD  . LYS B 1 30 ? 14.415  -3.909  -21.315 1.00 22.33 ? 29  LYS B CD  1 
ATOM   1002 C  CE  . LYS B 1 30 ? 15.876  -4.053  -21.014 1.00 26.84 ? 29  LYS B CE  1 
ATOM   1003 N  NZ  . LYS B 1 30 ? 16.622  -2.956  -21.694 1.00 25.63 ? 29  LYS B NZ  1 
ATOM   1004 N  N   . SER B 1 31 ? 9.197   -5.515  -20.528 1.00 17.25 ? 30  SER B N   1 
ATOM   1005 C  CA  . SER B 1 31 ? 7.798   -5.258  -20.932 1.00 17.25 ? 30  SER B CA  1 
ATOM   1006 C  C   . SER B 1 31 ? 6.849   -5.407  -19.755 1.00 16.06 ? 30  SER B C   1 
ATOM   1007 O  O   . SER B 1 31 ? 5.921   -4.632  -19.583 1.00 17.02 ? 30  SER B O   1 
ATOM   1008 C  CB  . SER B 1 31 ? 7.373   -6.122  -22.139 1.00 17.78 ? 30  SER B CB  1 
ATOM   1009 O  OG  . SER B 1 31 ? 7.441   -7.513  -21.875 1.00 18.73 ? 30  SER B OG  1 
ATOM   1010 N  N   . GLU B 1 32 ? 7.127   -6.377  -18.907 1.00 15.27 ? 31  GLU B N   1 
ATOM   1011 C  CA  . GLU B 1 32 ? 6.308   -6.604  -17.697 1.00 14.17 ? 31  GLU B CA  1 
ATOM   1012 C  C   . GLU B 1 32 ? 6.468   -5.460  -16.695 1.00 16.23 ? 31  GLU B C   1 
ATOM   1013 O  O   . GLU B 1 32 ? 5.519   -4.979  -16.138 1.00 14.81 ? 31  GLU B O   1 
ATOM   1014 C  CB  . GLU B 1 32 ? 6.689   -7.943  -17.034 1.00 13.32 ? 31  GLU B CB  1 
ATOM   1015 C  CG  . GLU B 1 32 ? 6.407   -9.141  -17.880 1.00 14.11 ? 31  GLU B CG  1 
ATOM   1016 C  CD  . GLU B 1 32 ? 6.913   -10.469 -17.311 1.00 15.20 ? 31  GLU B CD  1 
ATOM   1017 O  OE1 . GLU B 1 32 ? 7.940   -10.507 -16.609 1.00 14.90 ? 31  GLU B OE1 1 
ATOM   1018 O  OE2 . GLU B 1 32 ? 6.257   -11.499 -17.564 1.00 17.21 ? 31  GLU B OE2 1 
ATOM   1019 N  N   . LEU B 1 33 ? 7.690   -5.018  -16.465 1.00 13.35 ? 32  LEU B N   1 
ATOM   1020 C  CA  . LEU B 1 33 ? 7.961   -3.817  -15.679 1.00 15.17 ? 32  LEU B CA  1 
ATOM   1021 C  C   . LEU B 1 33 ? 7.227   -2.571  -16.228 1.00 16.32 ? 32  LEU B C   1 
ATOM   1022 O  O   . LEU B 1 33 ? 6.630   -1.790  -15.458 1.00 15.22 ? 32  LEU B O   1 
ATOM   1023 C  CB  . LEU B 1 33 ? 9.506   -3.619  -15.645 1.00 14.99 ? 32  LEU B CB  1 
ATOM   1024 C  CG  . LEU B 1 33 ? 10.037  -2.479  -14.767 1.00 14.98 ? 32  LEU B CG  1 
ATOM   1025 C  CD1 . LEU B 1 33 ? 9.507   -2.459  -13.269 1.00 20.71 ? 32  LEU B CD1 1 
ATOM   1026 C  CD2 . LEU B 1 33 ? 11.530  -2.389  -14.845 1.00 17.37 ? 32  LEU B CD2 1 
ATOM   1027 N  N   . LYS B 1 34 ? 7.248   -2.370  -17.549 1.00 16.65 ? 33  LYS B N   1 
ATOM   1028 C  CA  . LYS B 1 34 ? 6.620   -1.201  -18.169 1.00 16.05 ? 33  LYS B CA  1 
ATOM   1029 C  C   . LYS B 1 34 ? 5.124   -1.149  -17.886 1.00 16.56 ? 33  LYS B C   1 
ATOM   1030 O  O   . LYS B 1 34 ? 4.555   -0.107  -17.470 1.00 16.63 ? 33  LYS B O   1 
ATOM   1031 C  CB  . LYS B 1 34 ? 6.846   -1.259  -19.694 1.00 16.92 ? 33  LYS B CB  1 
ATOM   1032 C  CG  . LYS B 1 34 ? 6.097   -0.157  -20.414 1.00 16.41 ? 33  LYS B CG  1 
ATOM   1033 C  CD  . LYS B 1 34 ? 6.096   -0.216  -21.879 1.00 18.68 ? 33  LYS B CD  1 
ATOM   1034 C  CE  . LYS B 1 34 ? 5.822   1.238   -22.350 1.00 19.96 ? 33  LYS B CE  1 
ATOM   1035 N  NZ  . LYS B 1 34 ? 5.873   1.464   -23.842 1.00 24.67 ? 33  LYS B NZ  1 
ATOM   1036 N  N   . GLU B 1 35 ? 4.485   -2.286  -18.129 1.00 15.52 ? 34  GLU B N   1 
ATOM   1037 C  CA  . GLU B 1 35 ? 3.069   -2.377  -17.896 1.00 16.70 ? 34  GLU B CA  1 
ATOM   1038 C  C   . GLU B 1 35 ? 2.722   -2.294  -16.407 1.00 16.72 ? 34  GLU B C   1 
ATOM   1039 O  O   . GLU B 1 35 ? 1.701   -1.726  -16.057 1.00 15.10 ? 34  GLU B O   1 
ATOM   1040 C  CB  . GLU B 1 35 ? 2.499   -3.600  -18.584 1.00 17.84 ? 34  GLU B CB  1 
ATOM   1041 C  CG  . GLU B 1 35 ? 2.889   -3.731  -20.075 1.00 19.73 ? 34  GLU B CG  1 
ATOM   1042 C  CD  . GLU B 1 35 ? 2.229   -2.738  -21.046 1.00 25.09 ? 34  GLU B CD  1 
ATOM   1043 O  OE1 . GLU B 1 35 ? 2.468   -2.911  -22.274 1.00 24.66 ? 34  GLU B OE1 1 
ATOM   1044 O  OE2 . GLU B 1 35 ? 1.506   -1.803  -20.617 1.00 22.53 ? 34  GLU B OE2 1 
ATOM   1045 N  N   . LEU B 1 36 ? 3.530   -2.879  -15.541 1.00 15.88 ? 35  LEU B N   1 
ATOM   1046 C  CA  . LEU B 1 36 ? 3.330   -2.666  -14.107 1.00 15.31 ? 35  LEU B CA  1 
ATOM   1047 C  C   . LEU B 1 36 ? 3.266   -1.142  -13.761 1.00 14.68 ? 35  LEU B C   1 
ATOM   1048 O  O   . LEU B 1 36 ? 2.346   -0.670  -13.057 1.00 15.02 ? 35  LEU B O   1 
ATOM   1049 C  CB  . LEU B 1 36 ? 4.483   -3.357  -13.320 1.00 14.19 ? 35  LEU B CB  1 
ATOM   1050 C  CG  . LEU B 1 36 ? 4.188   -3.349  -11.828 1.00 17.06 ? 35  LEU B CG  1 
ATOM   1051 C  CD1 . LEU B 1 36 ? 4.612   -4.675  -11.118 1.00 22.34 ? 35  LEU B CD1 1 
ATOM   1052 C  CD2 . LEU B 1 36 ? 4.804   -2.086  -11.183 1.00 16.99 ? 35  LEU B CD2 1 
ATOM   1053 N  N   . ILE B 1 37 ? 4.251   -0.340  -14.170 1.00 14.14 ? 36  ILE B N   1 
ATOM   1054 C  CA  . ILE B 1 37 ? 4.309   1.067   -13.844 1.00 14.64 ? 36  ILE B CA  1 
ATOM   1055 C  C   . ILE B 1 37 ? 3.166   1.823   -14.490 1.00 15.73 ? 36  ILE B C   1 
ATOM   1056 O  O   . ILE B 1 37 ? 2.485   2.642   -13.827 1.00 16.25 ? 36  ILE B O   1 
ATOM   1057 C  CB  . ILE B 1 37 ? 5.677   1.637   -14.291 1.00 14.21 ? 36  ILE B CB  1 
ATOM   1058 C  CG1 . ILE B 1 37 ? 6.745   1.083   -13.367 1.00 16.77 ? 36  ILE B CG1 1 
ATOM   1059 C  CG2 . ILE B 1 37 ? 5.733   3.236   -14.488 1.00 15.47 ? 36  ILE B CG2 1 
ATOM   1060 C  CD1 . ILE B 1 37 ? 8.137   1.216   -13.966 1.00 15.09 ? 36  ILE B CD1 1 
ATOM   1061 N  N   . ASN B 1 38 ? 2.912   1.508   -15.753 1.00 16.78 ? 37  ASN B N   1 
ATOM   1062 C  CA  . ASN B 1 38 ? 1.830   2.167   -16.505 1.00 15.87 ? 37  ASN B CA  1 
ATOM   1063 C  C   . ASN B 1 38 ? 0.410   1.895   -16.011 1.00 14.57 ? 37  ASN B C   1 
ATOM   1064 O  O   . ASN B 1 38 ? -0.418  2.802   -15.954 1.00 14.38 ? 37  ASN B O   1 
ATOM   1065 C  CB  . ASN B 1 38 ? 1.953   1.869   -17.996 1.00 16.53 ? 37  ASN B CB  1 
ATOM   1066 C  CG  . ASN B 1 38 ? 3.103   2.616   -18.622 1.00 18.07 ? 37  ASN B CG  1 
ATOM   1067 O  OD1 . ASN B 1 38 ? 3.750   3.426   -17.950 1.00 15.63 ? 37  ASN B OD1 1 
ATOM   1068 N  ND2 . ASN B 1 38 ? 3.360   2.380   -19.932 1.00 18.06 ? 37  ASN B ND2 1 
ATOM   1069 N  N   . ASN B 1 39 ? 0.168   0.683   -15.549 1.00 13.87 ? 38  ASN B N   1 
ATOM   1070 C  CA  . ASN B 1 39 ? -1.168  0.340   -15.096 1.00 12.71 ? 38  ASN B CA  1 
ATOM   1071 C  C   . ASN B 1 39 ? -1.352  0.515   -13.603 1.00 14.09 ? 38  ASN B C   1 
ATOM   1072 O  O   . ASN B 1 39 ? -2.534  0.803   -13.142 1.00 15.61 ? 38  ASN B O   1 
ATOM   1073 C  CB  . ASN B 1 39 ? -1.542  -1.083  -15.480 1.00 10.77 ? 38  ASN B CB  1 
ATOM   1074 C  CG  . ASN B 1 39 ? -1.331  -1.390  -16.982 1.00 15.41 ? 38  ASN B CG  1 
ATOM   1075 O  OD1 . ASN B 1 39 ? -1.417  -0.490  -17.850 1.00 17.99 ? 38  ASN B OD1 1 
ATOM   1076 N  ND2 . ASN B 1 39 ? -1.061  -2.646  -17.289 1.00 13.67 ? 38  ASN B ND2 1 
ATOM   1077 N  N   . GLU B 1 40 ? -0.316  0.272   -12.835 1.00 15.51 ? 39  GLU B N   1 
ATOM   1078 C  CA  . GLU B 1 40 ? -0.442  0.235   -11.379 1.00 14.77 ? 39  GLU B CA  1 
ATOM   1079 C  C   . GLU B 1 40 ? 0.163   1.400   -10.639 1.00 14.64 ? 39  GLU B C   1 
ATOM   1080 O  O   . GLU B 1 40 ? -0.071  1.544   -9.413  1.00 14.06 ? 39  GLU B O   1 
ATOM   1081 C  CB  . GLU B 1 40 ? 0.156   -1.108  -10.837 1.00 13.96 ? 39  GLU B CB  1 
ATOM   1082 C  CG  . GLU B 1 40 ? -0.199  -2.356  -11.691 1.00 14.11 ? 39  GLU B CG  1 
ATOM   1083 C  CD  . GLU B 1 40 ? -1.754  -2.544  -11.889 1.00 13.16 ? 39  GLU B CD  1 
ATOM   1084 O  OE1 . GLU B 1 40 ? -2.219  -3.305  -12.840 1.00 14.78 ? 39  GLU B OE1 1 
ATOM   1085 O  OE2 . GLU B 1 40 ? -2.520  -2.006  -11.045 1.00 19.08 ? 39  GLU B OE2 1 
ATOM   1086 N  N   . LEU B 1 41 ? 1.022   2.166   -11.324 1.00 12.20 ? 40  LEU B N   1 
ATOM   1087 C  CA  . LEU B 1 41 ? 1.534   3.357   -10.748 1.00 11.88 ? 40  LEU B CA  1 
ATOM   1088 C  C   . LEU B 1 41 ? 1.155   4.583   -11.570 1.00 14.79 ? 40  LEU B C   1 
ATOM   1089 O  O   . LEU B 1 41 ? 1.837   5.603   -11.521 1.00 16.01 ? 40  LEU B O   1 
ATOM   1090 C  CB  . LEU B 1 41 ? 3.092   3.227   -10.545 1.00 11.88 ? 40  LEU B CB  1 
ATOM   1091 C  CG  . LEU B 1 41 ? 3.463   2.112   -9.538  1.00 11.54 ? 40  LEU B CG  1 
ATOM   1092 C  CD1 . LEU B 1 41 ? 5.042   1.955   -9.688  1.00 13.89 ? 40  LEU B CD1 1 
ATOM   1093 C  CD2 . LEU B 1 41 ? 3.075   2.505   -8.075  1.00 16.71 ? 40  LEU B CD2 1 
ATOM   1094 N  N   . SER B 1 42 ? -0.064  4.557   -12.180 1.00 14.37 ? 41  SER B N   1 
ATOM   1095 C  CA  . SER B 1 42 ? -0.478  5.639   -13.046 1.00 15.99 ? 41  SER B CA  1 
ATOM   1096 C  C   . SER B 1 42 ? -0.624  7.019   -12.278 1.00 14.79 ? 41  SER B C   1 
ATOM   1097 O  O   . SER B 1 42 ? -0.574  8.138   -12.913 1.00 17.57 ? 41  SER B O   1 
ATOM   1098 C  CB  . SER B 1 42 ? -1.747  5.233   -13.759 1.00 16.26 ? 41  SER B CB  1 
ATOM   1099 O  OG  . SER B 1 42 ? -2.872  5.454   -12.870 1.00 18.56 ? 41  SER B OG  1 
ATOM   1100 N  N   . HIS B 1 43 ? -0.777  6.987   -10.952 1.00 13.03 ? 42  HIS B N   1 
ATOM   1101 C  CA  . HIS B 1 43 ? -1.046  8.224   -10.228 1.00 15.67 ? 42  HIS B CA  1 
ATOM   1102 C  C   . HIS B 1 43 ? 0.196   8.747   -9.544  1.00 16.09 ? 42  HIS B C   1 
ATOM   1103 O  O   . HIS B 1 43 ? 0.212   9.864   -9.062  1.00 17.26 ? 42  HIS B O   1 
ATOM   1104 C  CB  . HIS B 1 43 ? -2.180  7.980   -9.210  1.00 16.47 ? 42  HIS B CB  1 
ATOM   1105 C  CG  . HIS B 1 43 ? -3.463  7.514   -9.832  1.00 14.54 ? 42  HIS B CG  1 
ATOM   1106 N  ND1 . HIS B 1 43 ? -3.967  6.236   -9.677  1.00 19.20 ? 42  HIS B ND1 1 
ATOM   1107 C  CD2 . HIS B 1 43 ? -4.367  8.179   -10.594 1.00 18.72 ? 42  HIS B CD2 1 
ATOM   1108 C  CE1 . HIS B 1 43 ? -5.114  6.133   -10.332 1.00 18.17 ? 42  HIS B CE1 1 
ATOM   1109 N  NE2 . HIS B 1 43 ? -5.376  7.299   -10.892 1.00 18.04 ? 42  HIS B NE2 1 
ATOM   1110 N  N   . PHE B 1 44 ? 1.209   7.864   -9.433  1.00 16.15 ? 43  PHE B N   1 
ATOM   1111 C  CA  . PHE B 1 44 ? 2.458   8.221   -8.782  1.00 16.41 ? 43  PHE B CA  1 
ATOM   1112 C  C   . PHE B 1 44 ? 3.605   8.505   -9.764  1.00 16.96 ? 43  PHE B C   1 
ATOM   1113 O  O   . PHE B 1 44 ? 4.502   9.313   -9.464  1.00 18.23 ? 43  PHE B O   1 
ATOM   1114 C  CB  . PHE B 1 44 ? 2.879   7.067   -7.890  1.00 15.90 ? 43  PHE B CB  1 
ATOM   1115 C  CG  . PHE B 1 44 ? 2.018   6.870   -6.653  1.00 18.59 ? 43  PHE B CG  1 
ATOM   1116 C  CD1 . PHE B 1 44 ? 0.843   7.635   -6.407  1.00 21.00 ? 43  PHE B CD1 1 
ATOM   1117 C  CD2 . PHE B 1 44 ? 2.413   5.939   -5.699  1.00 19.46 ? 43  PHE B CD2 1 
ATOM   1118 C  CE1 . PHE B 1 44 ? 0.120   7.442   -5.200  1.00 19.84 ? 43  PHE B CE1 1 
ATOM   1119 C  CE2 . PHE B 1 44 ? 1.664   5.715   -4.516  1.00 18.63 ? 43  PHE B CE2 1 
ATOM   1120 C  CZ  . PHE B 1 44 ? 0.548   6.503   -4.263  1.00 19.84 ? 43  PHE B CZ  1 
ATOM   1121 N  N   . LEU B 1 45 ? 3.597   7.873   -10.925 1.00 18.08 ? 44  LEU B N   1 
ATOM   1122 C  CA  . LEU B 1 45 ? 4.690   8.036   -11.876 1.00 18.12 ? 44  LEU B CA  1 
ATOM   1123 C  C   . LEU B 1 45 ? 4.132   8.379   -13.252 1.00 17.83 ? 44  LEU B C   1 
ATOM   1124 O  O   . LEU B 1 45 ? 3.077   7.847   -13.642 1.00 17.26 ? 44  LEU B O   1 
ATOM   1125 C  CB  . LEU B 1 45 ? 5.508   6.737   -12.006 1.00 18.62 ? 44  LEU B CB  1 
ATOM   1126 C  CG  . LEU B 1 45 ? 6.152   6.079   -10.769 1.00 18.71 ? 44  LEU B CG  1 
ATOM   1127 C  CD1 . LEU B 1 45 ? 6.763   4.731   -11.160 1.00 19.90 ? 44  LEU B CD1 1 
ATOM   1128 C  CD2 . LEU B 1 45 ? 7.170   6.896   -9.959  1.00 23.72 ? 44  LEU B CD2 1 
ATOM   1129 N  N   . GLU B 1 46 ? 4.913   9.154   -14.003 1.00 18.32 ? 45  GLU B N   1 
ATOM   1130 C  CA  . GLU B 1 46 ? 4.583   9.489   -15.387 1.00 18.72 ? 45  GLU B CA  1 
ATOM   1131 C  C   . GLU B 1 46 ? 4.534   8.217   -16.250 1.00 16.66 ? 45  GLU B C   1 
ATOM   1132 O  O   . GLU B 1 46 ? 5.341   7.267   -16.100 1.00 18.53 ? 45  GLU B O   1 
ATOM   1133 C  CB  . GLU B 1 46 ? 5.547   10.511  -15.992 1.00 17.90 ? 45  GLU B CB  1 
ATOM   1134 C  CG  . GLU B 1 46 ? 5.290   10.664  -17.495 1.00 23.93 ? 45  GLU B CG  1 
ATOM   1135 C  CD  . GLU B 1 46 ? 5.527   12.041  -18.012 1.00 28.87 ? 45  GLU B CD  1 
ATOM   1136 O  OE1 . GLU B 1 46 ? 6.372   12.186  -18.927 1.00 31.16 ? 45  GLU B OE1 1 
ATOM   1137 O  OE2 . GLU B 1 46 ? 4.872   12.989  -17.512 1.00 34.48 ? 45  GLU B OE2 1 
ATOM   1138 N  N   . GLU B 1 47 ? 3.541   8.169   -17.120 1.00 16.84 ? 46  GLU B N   1 
ATOM   1139 C  CA  . GLU B 1 47 ? 3.384   7.033   -17.994 1.00 16.30 ? 46  GLU B CA  1 
ATOM   1140 C  C   . GLU B 1 47 ? 4.678   6.836   -18.819 1.00 15.88 ? 46  GLU B C   1 
ATOM   1141 O  O   . GLU B 1 47 ? 5.300   7.843   -19.282 1.00 16.06 ? 46  GLU B O   1 
ATOM   1142 C  CB  . GLU B 1 47 ? 2.169   7.273   -18.918 1.00 17.29 ? 46  GLU B CB  1 
ATOM   1143 C  CG  . GLU B 1 47 ? 1.954   6.122   -19.841 1.00 18.32 ? 46  GLU B CG  1 
ATOM   1144 C  CD  . GLU B 1 47 ? 0.771   6.291   -20.774 1.00 22.22 ? 46  GLU B CD  1 
ATOM   1145 O  OE1 . GLU B 1 47 ? -0.093  7.176   -20.551 1.00 24.92 ? 46  GLU B OE1 1 
ATOM   1146 O  OE2 . GLU B 1 47 ? 0.707   5.479   -21.718 1.00 26.75 ? 46  GLU B OE2 1 
ATOM   1147 N  N   . ILE B 1 48 ? 5.071   5.572   -18.967 1.00 15.42 ? 47  ILE B N   1 
ATOM   1148 C  CA  . ILE B 1 48 ? 6.209   5.196   -19.844 1.00 17.38 ? 47  ILE B CA  1 
ATOM   1149 C  C   . ILE B 1 48 ? 5.757   4.969   -21.265 1.00 16.83 ? 47  ILE B C   1 
ATOM   1150 O  O   . ILE B 1 48 ? 5.001   4.026   -21.549 1.00 17.95 ? 47  ILE B O   1 
ATOM   1151 C  CB  . ILE B 1 48 ? 7.033   3.945   -19.344 1.00 16.17 ? 47  ILE B CB  1 
ATOM   1152 C  CG1 . ILE B 1 48 ? 7.380   4.130   -17.882 1.00 16.58 ? 47  ILE B CG1 1 
ATOM   1153 C  CG2 . ILE B 1 48 ? 8.311   3.750   -20.246 1.00 16.03 ? 47  ILE B CG2 1 
ATOM   1154 C  CD1 . ILE B 1 48 ? 8.284   3.045   -17.277 1.00 19.32 ? 47  ILE B CD1 1 
ATOM   1155 N  N   . LYS B 1 49 ? 6.283   5.802   -22.152 1.00 18.75 ? 48  LYS B N   1 
ATOM   1156 C  CA  . LYS B 1 49 ? 5.977   5.756   -23.580 1.00 19.46 ? 48  LYS B CA  1 
ATOM   1157 C  C   . LYS B 1 49 ? 7.227   5.541   -24.443 1.00 19.25 ? 48  LYS B C   1 
ATOM   1158 O  O   . LYS B 1 49 ? 7.104   5.452   -25.661 1.00 20.67 ? 48  LYS B O   1 
ATOM   1159 C  CB  . LYS B 1 49 ? 5.267   7.047   -24.029 1.00 19.16 ? 48  LYS B CB  1 
ATOM   1160 C  CG  . LYS B 1 49 ? 3.925   7.338   -23.343 1.00 19.75 ? 48  LYS B CG  1 
ATOM   1161 C  CD  . LYS B 1 49 ? 3.286   8.568   -23.909 1.00 20.92 ? 48  LYS B CD  1 
ATOM   1162 C  CE  . LYS B 1 49 ? 1.901   8.778   -23.271 1.00 22.00 ? 48  LYS B CE  1 
ATOM   1163 N  NZ  . LYS B 1 49 ? 1.260   10.053  -23.617 1.00 24.22 ? 48  LYS B NZ  1 
ATOM   1164 N  N   . GLU B 1 50 ? 8.417   5.465   -23.843 1.00 19.47 ? 49  GLU B N   1 
ATOM   1165 C  CA  . GLU B 1 50 ? 9.661   5.509   -24.637 1.00 18.88 ? 49  GLU B CA  1 
ATOM   1166 C  C   . GLU B 1 50 ? 10.543  4.362   -24.228 1.00 17.97 ? 49  GLU B C   1 
ATOM   1167 O  O   . GLU B 1 50 ? 10.653  4.055   -23.032 1.00 17.51 ? 49  GLU B O   1 
ATOM   1168 C  CB  . GLU B 1 50 ? 10.437  6.815   -24.413 1.00 18.01 ? 49  GLU B CB  1 
ATOM   1169 C  CG  . GLU B 1 50 ? 9.888   8.031   -25.152 1.00 20.24 ? 49  GLU B CG  1 
ATOM   1170 C  CD  . GLU B 1 50 ? 9.921   7.884   -26.671 1.00 24.38 ? 49  GLU B CD  1 
ATOM   1171 O  OE1 . GLU B 1 50 ? 10.923  7.333   -27.212 1.00 27.57 ? 49  GLU B OE1 1 
ATOM   1172 O  OE2 . GLU B 1 50 ? 8.960   8.343   -27.337 1.00 25.74 ? 49  GLU B OE2 1 
ATOM   1173 N  N   . GLN B 1 51 ? 11.188  3.727   -25.207 1.00 16.89 ? 50  GLN B N   1 
ATOM   1174 C  CA  . GLN B 1 51 ? 12.081  2.608   -24.884 1.00 16.65 ? 50  GLN B CA  1 
ATOM   1175 C  C   . GLN B 1 51 ? 13.257  3.043   -24.005 1.00 15.50 ? 50  GLN B C   1 
ATOM   1176 O  O   . GLN B 1 51 ? 13.677  2.272   -23.154 1.00 16.02 ? 50  GLN B O   1 
ATOM   1177 C  CB  . GLN B 1 51 ? 12.603  1.933   -26.176 1.00 16.97 ? 50  GLN B CB  1 
ATOM   1178 C  CG  . GLN B 1 51 ? 13.480  0.705   -25.957 1.00 18.84 ? 50  GLN B CG  1 
ATOM   1179 C  CD  . GLN B 1 51 ? 12.721  -0.486  -25.410 1.00 20.66 ? 50  GLN B CD  1 
ATOM   1180 O  OE1 . GLN B 1 51 ? 13.098  -1.088  -24.368 1.00 18.97 ? 50  GLN B OE1 1 
ATOM   1181 N  NE2 . GLN B 1 51 ? 11.663  -0.865  -26.111 1.00 20.19 ? 50  GLN B NE2 1 
ATOM   1182 N  N   . GLU B 1 52 ? 13.751  4.271   -24.163 1.00 14.21 ? 51  GLU B N   1 
ATOM   1183 C  CA  . GLU B 1 52 ? 14.898  4.691   -23.326 1.00 14.79 ? 51  GLU B CA  1 
ATOM   1184 C  C   . GLU B 1 52 ? 14.566  4.789   -21.848 1.00 14.92 ? 51  GLU B C   1 
ATOM   1185 O  O   . GLU B 1 52 ? 15.441  4.629   -20.990 1.00 15.64 ? 51  GLU B O   1 
ATOM   1186 C  CB  . GLU B 1 52 ? 15.527  5.976   -23.784 1.00 14.70 ? 51  GLU B CB  1 
ATOM   1187 C  CG  . GLU B 1 52 ? 14.657  7.051   -24.326 1.00 18.39 ? 51  GLU B CG  1 
ATOM   1188 C  CD  . GLU B 1 52 ? 15.536  8.209   -24.831 1.00 20.27 ? 51  GLU B CD  1 
ATOM   1189 O  OE1 . GLU B 1 52 ? 15.537  8.533   -26.043 1.00 22.79 ? 51  GLU B OE1 1 
ATOM   1190 O  OE2 . GLU B 1 52 ? 16.273  8.776   -23.993 1.00 23.60 ? 51  GLU B OE2 1 
ATOM   1191 N  N   . VAL B 1 53 ? 13.290  5.033   -21.560 1.00 14.68 ? 52  VAL B N   1 
ATOM   1192 C  CA  . VAL B 1 53 ? 12.820  5.154   -20.206 1.00 14.62 ? 52  VAL B CA  1 
ATOM   1193 C  C   . VAL B 1 53 ? 12.690  3.783   -19.570 1.00 14.37 ? 52  VAL B C   1 
ATOM   1194 O  O   . VAL B 1 53 ? 13.074  3.632   -18.424 1.00 15.63 ? 52  VAL B O   1 
ATOM   1195 C  CB  . VAL B 1 53 ? 11.490  6.029   -20.128 1.00 14.30 ? 52  VAL B CB  1 
ATOM   1196 C  CG1 . VAL B 1 53 ? 10.916  6.138   -18.695 1.00 14.70 ? 52  VAL B CG1 1 
ATOM   1197 C  CG2 . VAL B 1 53 ? 11.790  7.418   -20.649 1.00 14.28 ? 52  VAL B CG2 1 
ATOM   1198 N  N   . VAL B 1 54 ? 12.124  2.795   -20.265 1.00 14.07 ? 53  VAL B N   1 
ATOM   1199 C  CA  . VAL B 1 54 ? 12.021  1.497   -19.642 1.00 15.03 ? 53  VAL B CA  1 
ATOM   1200 C  C   . VAL B 1 54 ? 13.416  0.925   -19.457 1.00 13.52 ? 53  VAL B C   1 
ATOM   1201 O  O   . VAL B 1 54 ? 13.686  0.388   -18.390 1.00 13.94 ? 53  VAL B O   1 
ATOM   1202 C  CB  . VAL B 1 54 ? 11.004  0.478   -20.305 1.00 15.65 ? 53  VAL B CB  1 
ATOM   1203 C  CG1 . VAL B 1 54 ? 11.357  0.082   -21.674 1.00 15.66 ? 53  VAL B CG1 1 
ATOM   1204 C  CG2 . VAL B 1 54 ? 10.751  -0.707  -19.401 1.00 20.35 ? 53  VAL B CG2 1 
ATOM   1205 N  N   . ASP B 1 55 ? 14.276  1.126   -20.445 1.00 13.45 ? 54  ASP B N   1 
ATOM   1206 C  CA  . ASP B 1 55 ? 15.651  0.659   -20.330 1.00 13.02 ? 54  ASP B CA  1 
ATOM   1207 C  C   . ASP B 1 55 ? 16.311  1.240   -19.064 1.00 13.64 ? 54  ASP B C   1 
ATOM   1208 O  O   . ASP B 1 55 ? 17.019  0.519   -18.333 1.00 11.92 ? 54  ASP B O   1 
ATOM   1209 C  CB  . ASP B 1 55 ? 16.485  1.047   -21.586 1.00 12.72 ? 54  ASP B CB  1 
ATOM   1210 C  CG  . ASP B 1 55 ? 16.085  0.273   -22.845 1.00 13.36 ? 54  ASP B CG  1 
ATOM   1211 O  OD1 . ASP B 1 55 ? 15.217  -0.670  -22.787 1.00 15.78 ? 54  ASP B OD1 1 
ATOM   1212 O  OD2 . ASP B 1 55 ? 16.608  0.641   -23.928 1.00 11.74 ? 54  ASP B OD2 1 
ATOM   1213 N  N   . LYS B 1 56 ? 16.188  2.568   -18.890 1.00 11.97 ? 55  LYS B N   1 
ATOM   1214 C  CA  . LYS B 1 56 ? 16.843  3.229   -17.775 1.00 12.66 ? 55  LYS B CA  1 
ATOM   1215 C  C   . LYS B 1 56 ? 16.294  2.737   -16.437 1.00 12.56 ? 55  LYS B C   1 
ATOM   1216 O  O   . LYS B 1 56 ? 17.065  2.484   -15.498 1.00 13.58 ? 55  LYS B O   1 
ATOM   1217 C  CB  . LYS B 1 56 ? 16.920  4.768   -17.907 1.00 12.64 ? 55  LYS B CB  1 
ATOM   1218 C  CG  . LYS B 1 56 ? 15.628  5.562   -18.185 1.00 19.16 ? 55  LYS B CG  1 
ATOM   1219 C  CD  . LYS B 1 56 ? 16.038  6.860   -18.920 1.00 20.06 ? 55  LYS B CD  1 
ATOM   1220 C  CE  . LYS B 1 56 ? 15.069  8.032   -18.773 1.00 20.01 ? 55  LYS B CE  1 
ATOM   1221 N  NZ  . LYS B 1 56 ? 15.287  9.028   -19.879 1.00 20.30 ? 55  LYS B NZ  1 
ATOM   1222 N  N   . VAL B 1 57 ? 14.955  2.561   -16.377 1.00 13.53 ? 56  VAL B N   1 
ATOM   1223 C  CA  . VAL B 1 57 ? 14.343  2.100   -15.158 1.00 14.05 ? 56  VAL B CA  1 
ATOM   1224 C  C   . VAL B 1 57 ? 14.885  0.710   -14.832 1.00 13.22 ? 56  VAL B C   1 
ATOM   1225 O  O   . VAL B 1 57 ? 15.274  0.437   -13.689 1.00 13.20 ? 56  VAL B O   1 
ATOM   1226 C  CB  . VAL B 1 57 ? 12.790  2.144   -15.239 1.00 15.20 ? 56  VAL B CB  1 
ATOM   1227 C  CG1 . VAL B 1 57 ? 12.189  1.464   -13.940 1.00 17.07 ? 56  VAL B CG1 1 
ATOM   1228 C  CG2 . VAL B 1 57 ? 12.325  3.589   -15.338 1.00 16.47 ? 56  VAL B CG2 1 
ATOM   1229 N  N   . MET B 1 58 ? 14.901  -0.199  -15.810 1.00 13.26 ? 57  MET B N   1 
ATOM   1230 C  CA  . MET B 1 58 ? 15.376  -1.539  -15.506 1.00 12.08 ? 57  MET B CA  1 
ATOM   1231 C  C   . MET B 1 58 ? 16.842  -1.533  -15.097 1.00 12.07 ? 57  MET B C   1 
ATOM   1232 O  O   . MET B 1 58 ? 17.231  -2.214  -14.153 1.00 13.03 ? 57  MET B O   1 
ATOM   1233 C  CB  . MET B 1 58 ? 15.204  -2.439  -16.727 1.00 13.54 ? 57  MET B CB  1 
ATOM   1234 C  CG  . MET B 1 58 ? 15.658  -3.883  -16.483 1.00 15.24 ? 57  MET B CG  1 
ATOM   1235 S  SD  . MET B 1 58 ? 14.704  -4.760  -15.212 1.00 17.75 ? 57  MET B SD  1 
ATOM   1236 C  CE  . MET B 1 58 ? 13.244  -5.189  -16.216 1.00 15.32 ? 57  MET B CE  1 
ATOM   1237 N  N   . GLU B 1 59 ? 17.637  -0.771  -15.823 1.00 13.77 ? 58  GLU B N   1 
ATOM   1238 C  CA  . GLU B 1 59 ? 19.066  -0.651  -15.471 1.00 10.69 ? 58  GLU B CA  1 
ATOM   1239 C  C   . GLU B 1 59 ? 19.245  -0.151  -14.038 1.00 12.64 ? 58  GLU B C   1 
ATOM   1240 O  O   . GLU B 1 59 ? 20.147  -0.624  -13.279 1.00 11.18 ? 58  GLU B O   1 
ATOM   1241 C  CB  . GLU B 1 59 ? 19.778  0.319   -16.382 1.00 12.21 ? 58  GLU B CB  1 
ATOM   1242 C  CG  . GLU B 1 59 ? 21.318  0.381   -16.225 1.00 12.42 ? 58  GLU B CG  1 
ATOM   1243 C  CD  . GLU B 1 59 ? 21.968  1.389   -17.161 1.00 12.16 ? 58  GLU B CD  1 
ATOM   1244 O  OE1 . GLU B 1 59 ? 21.249  2.005   -17.981 1.00 15.40 ? 58  GLU B OE1 1 
ATOM   1245 O  OE2 . GLU B 1 59 ? 23.222  1.577   -17.114 1.00 14.07 ? 58  GLU B OE2 1 
ATOM   1246 N  N   . THR B 1 60 ? 18.443  0.835   -13.691 1.00 13.68 ? 59  THR B N   1 
ATOM   1247 C  CA  . THR B 1 60 ? 18.481  1.421   -12.365 1.00 14.51 ? 59  THR B CA  1 
ATOM   1248 C  C   . THR B 1 60 ? 18.113  0.417   -11.281 1.00 15.16 ? 59  THR B C   1 
ATOM   1249 O  O   . THR B 1 60 ? 18.807  0.357   -10.268 1.00 17.56 ? 59  THR B O   1 
ATOM   1250 C  CB  . THR B 1 60 ? 17.656  2.713   -12.352 1.00 15.70 ? 59  THR B CB  1 
ATOM   1251 O  OG1 . THR B 1 60 ? 18.272  3.632   -13.258 1.00 15.72 ? 59  THR B OG1 1 
ATOM   1252 C  CG2 . THR B 1 60 ? 17.507  3.319   -10.944 1.00 15.53 ? 59  THR B CG2 1 
ATOM   1253 N  N   . LEU B 1 61 ? 17.023  -0.358  -11.451 1.00 14.42 ? 60  LEU B N   1 
ATOM   1254 C  CA  . LEU B 1 61 ? 16.699  -1.292  -10.402 1.00 16.20 ? 60  LEU B CA  1 
ATOM   1255 C  C   . LEU B 1 61 ? 17.322  -2.719  -10.455 1.00 15.01 ? 60  LEU B C   1 
ATOM   1256 O  O   . LEU B 1 61 ? 17.207  -3.452  -9.504  1.00 15.16 ? 60  LEU B O   1 
ATOM   1257 C  CB  . LEU B 1 61 ? 15.191  -1.369  -10.222 1.00 17.75 ? 60  LEU B CB  1 
ATOM   1258 C  CG  . LEU B 1 61 ? 14.352  -1.764  -11.397 1.00 19.54 ? 60  LEU B CG  1 
ATOM   1259 C  CD1 . LEU B 1 61 ? 14.460  -3.261  -11.543 1.00 24.12 ? 60  LEU B CD1 1 
ATOM   1260 C  CD2 . LEU B 1 61 ? 12.869  -1.273  -11.228 1.00 18.94 ? 60  LEU B CD2 1 
ATOM   1261 N  N   . ASP B 1 62 ? 17.963  -3.102  -11.557 1.00 14.81 ? 61  ASP B N   1 
ATOM   1262 C  CA  . ASP B 1 62 ? 18.603  -4.424  -11.677 1.00 14.98 ? 61  ASP B CA  1 
ATOM   1263 C  C   . ASP B 1 62 ? 19.988  -4.526  -11.002 1.00 15.88 ? 61  ASP B C   1 
ATOM   1264 O  O   . ASP B 1 62 ? 21.046  -4.598  -11.665 1.00 16.94 ? 61  ASP B O   1 
ATOM   1265 C  CB  . ASP B 1 62 ? 18.724  -4.776  -13.166 1.00 15.46 ? 61  ASP B CB  1 
ATOM   1266 C  CG  . ASP B 1 62 ? 19.238  -6.169  -13.396 1.00 13.91 ? 61  ASP B CG  1 
ATOM   1267 O  OD1 . ASP B 1 62 ? 18.985  -7.053  -12.500 1.00 12.87 ? 61  ASP B OD1 1 
ATOM   1268 O  OD2 . ASP B 1 62 ? 19.846  -6.353  -14.494 1.00 17.74 ? 61  ASP B OD2 1 
ATOM   1269 N  N   . ASN B 1 63 ? 19.995  -4.661  -9.687  1.00 15.13 ? 62  ASN B N   1 
ATOM   1270 C  CA  . ASN B 1 63 ? 21.238  -4.545  -8.970  1.00 16.96 ? 62  ASN B CA  1 
ATOM   1271 C  C   . ASN B 1 63 ? 22.174  -5.720  -9.187  1.00 15.69 ? 62  ASN B C   1 
ATOM   1272 O  O   . ASN B 1 63 ? 23.419  -5.604  -9.024  1.00 15.81 ? 62  ASN B O   1 
ATOM   1273 C  CB  . ASN B 1 63 ? 20.945  -4.284  -7.503  1.00 16.90 ? 62  ASN B CB  1 
ATOM   1274 C  CG  . ASN B 1 63 ? 21.135  -2.840  -7.155  1.00 21.09 ? 62  ASN B CG  1 
ATOM   1275 O  OD1 . ASN B 1 63 ? 20.300  -1.997  -7.510  1.00 20.49 ? 62  ASN B OD1 1 
ATOM   1276 N  ND2 . ASN B 1 63 ? 22.253  -2.526  -6.499  1.00 21.70 ? 62  ASN B ND2 1 
ATOM   1277 N  N   . ASP B 1 64 ? 21.614  -6.855  -9.600  1.00 16.26 ? 63  ASP B N   1 
ATOM   1278 C  CA  . ASP B 1 64 ? 22.464  -7.987  -9.936  1.00 16.34 ? 63  ASP B CA  1 
ATOM   1279 C  C   . ASP B 1 64 ? 22.991  -7.954  -11.364 1.00 16.81 ? 63  ASP B C   1 
ATOM   1280 O  O   . ASP B 1 64 ? 24.192  -8.017  -11.558 1.00 15.52 ? 63  ASP B O   1 
ATOM   1281 C  CB  . ASP B 1 64 ? 21.991  -9.377  -9.430  1.00 16.23 ? 63  ASP B CB  1 
ATOM   1282 C  CG  . ASP B 1 64 ? 20.613  -9.809  -9.948  1.00 17.55 ? 63  ASP B CG  1 
ATOM   1283 O  OD1 . ASP B 1 64 ? 20.089  -10.789 -9.378  1.00 21.92 ? 63  ASP B OD1 1 
ATOM   1284 O  OD2 . ASP B 1 64 ? 20.035  -9.247  -10.900 1.00 10.97 ? 63  ASP B OD2 1 
ATOM   1285 N  N   . GLY B 1 65 ? 22.122  -7.789  -12.335 1.00 17.11 ? 64  GLY B N   1 
ATOM   1286 C  CA  . GLY B 1 65 ? 22.515  -7.507  -13.700 1.00 17.84 ? 64  GLY B CA  1 
ATOM   1287 C  C   . GLY B 1 65 ? 22.019  -8.558  -14.670 1.00 18.09 ? 64  GLY B C   1 
ATOM   1288 O  O   . GLY B 1 65 ? 22.648  -8.770  -15.694 1.00 19.23 ? 64  GLY B O   1 
ATOM   1289 N  N   . ASP B 1 66 ? 20.918  -9.240  -14.340 1.00 17.28 ? 65  ASP B N   1 
ATOM   1290 C  CA  . ASP B 1 66 ? 20.425  -10.363 -15.165 1.00 17.17 ? 65  ASP B CA  1 
ATOM   1291 C  C   . ASP B 1 66 ? 19.449  -9.889  -16.210 1.00 17.43 ? 65  ASP B C   1 
ATOM   1292 O  O   . ASP B 1 66 ? 18.881  -10.693 -16.955 1.00 19.42 ? 65  ASP B O   1 
ATOM   1293 C  CB  . ASP B 1 66 ? 19.913  -11.574 -14.320 1.00 17.58 ? 65  ASP B CB  1 
ATOM   1294 C  CG  . ASP B 1 66 ? 18.530  -11.352 -13.685 1.00 18.22 ? 65  ASP B CG  1 
ATOM   1295 O  OD1 . ASP B 1 66 ? 18.110  -10.211 -13.578 1.00 16.64 ? 65  ASP B OD1 1 
ATOM   1296 O  OD2 . ASP B 1 66 ? 17.893  -12.348 -13.283 1.00 21.02 ? 65  ASP B OD2 1 
ATOM   1297 N  N   . GLY B 1 67 ? 19.319  -8.573  -16.275 1.00 15.54 ? 66  GLY B N   1 
ATOM   1298 C  CA  . GLY B 1 67 ? 18.441  -7.904  -17.183 1.00 16.43 ? 66  GLY B CA  1 
ATOM   1299 C  C   . GLY B 1 67 ? 17.011  -7.990  -16.722 1.00 15.79 ? 66  GLY B C   1 
ATOM   1300 O  O   . GLY B 1 67 ? 16.092  -7.511  -17.401 1.00 18.62 ? 66  GLY B O   1 
ATOM   1301 N  N   . GLU B 1 68 ? 16.785  -8.601  -15.564 1.00 14.05 ? 67  GLU B N   1 
ATOM   1302 C  CA  . GLU B 1 68 ? 15.400  -8.637  -15.061 1.00 12.67 ? 67  GLU B CA  1 
ATOM   1303 C  C   . GLU B 1 68 ? 15.236  -8.130  -13.622 1.00 11.24 ? 67  GLU B C   1 
ATOM   1304 O  O   . GLU B 1 68 ? 16.186  -7.918  -12.898 1.00 9.11  ? 67  GLU B O   1 
ATOM   1305 C  CB  . GLU B 1 68 ? 14.806  -10.041 -15.242 1.00 13.47 ? 67  GLU B CB  1 
ATOM   1306 C  CG  . GLU B 1 68 ? 14.879  -10.532 -16.710 1.00 13.83 ? 67  GLU B CG  1 
ATOM   1307 C  CD  . GLU B 1 68 ? 13.804  -11.544 -17.058 1.00 18.07 ? 67  GLU B CD  1 
ATOM   1308 O  OE1 . GLU B 1 68 ? 12.894  -11.794 -16.219 1.00 18.47 ? 67  GLU B OE1 1 
ATOM   1309 O  OE2 . GLU B 1 68 ? 13.845  -12.049 -18.206 1.00 15.54 ? 67  GLU B OE2 1 
ATOM   1310 N  N   . CYS B 1 69 ? 14.014  -7.975  -13.201 1.00 10.48 ? 68  CYS B N   1 
ATOM   1311 C  CA  . CYS B 1 69 ? 13.763  -7.457  -11.846 1.00 10.16 ? 68  CYS B CA  1 
ATOM   1312 C  C   . CYS B 1 69 ? 13.126  -8.592  -11.028 1.00 10.10 ? 68  CYS B C   1 
ATOM   1313 O  O   . CYS B 1 69 ? 11.980  -9.015  -11.331 1.00 10.36 ? 68  CYS B O   1 
ATOM   1314 C  CB  . CYS B 1 69 ? 12.788  -6.213  -11.877 1.00 10.27 ? 68  CYS B CB  1 
ATOM   1315 S  SG  . CYS B 1 69 ? 12.420  -5.541  -10.210 1.00 11.07 ? 68  CYS B SG  1 
ATOM   1316 N  N   . ASP B 1 70 ? 13.827  -9.028  -9.994  1.00 11.06 ? 69  ASP B N   1 
ATOM   1317 C  CA  . ASP B 1 70 ? 13.366  -10.176 -9.184  1.00 10.84 ? 69  ASP B CA  1 
ATOM   1318 C  C   . ASP B 1 70 ? 12.548  -9.599  -7.984  1.00 10.42 ? 69  ASP B C   1 
ATOM   1319 O  O   . ASP B 1 70 ? 12.285  -8.379  -7.924  1.00 10.71 ? 69  ASP B O   1 
ATOM   1320 C  CB  . ASP B 1 70 ? 14.533  -11.105 -8.792  1.00 11.67 ? 69  ASP B CB  1 
ATOM   1321 C  CG  . ASP B 1 70 ? 15.644  -10.358 -8.072  1.00 12.23 ? 69  ASP B CG  1 
ATOM   1322 O  OD1 . ASP B 1 70 ? 15.346  -9.417  -7.363  1.00 11.67 ? 69  ASP B OD1 1 
ATOM   1323 O  OD2 . ASP B 1 70 ? 16.839  -10.717 -8.178  1.00 15.92 ? 69  ASP B OD2 1 
ATOM   1324 N  N   . PHE B 1 71 ? 12.038  -10.440 -7.084  1.00 10.18 ? 70  PHE B N   1 
ATOM   1325 C  CA  . PHE B 1 71 ? 11.245  -9.870  -6.000  1.00 12.52 ? 70  PHE B CA  1 
ATOM   1326 C  C   . PHE B 1 71 ? 12.025  -8.862  -5.100  1.00 11.23 ? 70  PHE B C   1 
ATOM   1327 O  O   . PHE B 1 71 ? 11.503  -7.787  -4.798  1.00 9.76  ? 70  PHE B O   1 
ATOM   1328 C  CB  . PHE B 1 71 ? 10.428  -10.941 -5.222  1.00 13.15 ? 70  PHE B CB  1 
ATOM   1329 C  CG  . PHE B 1 71 ? 9.387   -10.335 -4.324  1.00 12.17 ? 70  PHE B CG  1 
ATOM   1330 C  CD1 . PHE B 1 71 ? 8.330   -9.558  -4.860  1.00 15.57 ? 70  PHE B CD1 1 
ATOM   1331 C  CD2 . PHE B 1 71 ? 9.515   -10.409 -2.919  1.00 14.78 ? 70  PHE B CD2 1 
ATOM   1332 C  CE1 . PHE B 1 71 ? 7.402   -8.905  -4.021  1.00 16.73 ? 70  PHE B CE1 1 
ATOM   1333 C  CE2 . PHE B 1 71 ? 8.600   -9.806  -2.093  1.00 15.22 ? 70  PHE B CE2 1 
ATOM   1334 C  CZ  . PHE B 1 71 ? 7.526   -9.033  -2.629  1.00 17.65 ? 70  PHE B CZ  1 
ATOM   1335 N  N   . GLN B 1 72 ? 13.258  -9.205  -4.668  1.00 12.81 ? 71  GLN B N   1 
ATOM   1336 C  CA  . GLN B 1 72 ? 14.150  -8.240  -3.926  1.00 12.88 ? 71  GLN B CA  1 
ATOM   1337 C  C   . GLN B 1 72 ? 14.343  -6.864  -4.603  1.00 11.53 ? 71  GLN B C   1 
ATOM   1338 O  O   . GLN B 1 72 ? 14.225  -5.806  -3.960  1.00 11.42 ? 71  GLN B O   1 
ATOM   1339 C  CB  . GLN B 1 72 ? 15.512  -8.872  -3.607  1.00 13.35 ? 71  GLN B CB  1 
ATOM   1340 C  CG  . GLN B 1 72 ? 16.421  -8.026  -2.719  1.00 16.02 ? 71  GLN B CG  1 
ATOM   1341 C  CD  . GLN B 1 72 ? 17.875  -8.483  -2.754  1.00 15.02 ? 71  GLN B CD  1 
ATOM   1342 O  OE1 . GLN B 1 72 ? 18.645  -8.269  -1.802  1.00 20.01 ? 71  GLN B OE1 1 
ATOM   1343 N  NE2 . GLN B 1 72 ? 18.264  -9.123  -3.856  1.00 22.03 ? 71  GLN B NE2 1 
ATOM   1344 N  N   . GLU B 1 73 ? 14.661  -6.881  -5.899  1.00 9.69  ? 72  GLU B N   1 
ATOM   1345 C  CA  . GLU B 1 73 ? 14.793  -5.669  -6.687  1.00 8.34  ? 72  GLU B CA  1 
ATOM   1346 C  C   . GLU B 1 73 ? 13.492  -4.862  -6.747  1.00 8.06  ? 72  GLU B C   1 
ATOM   1347 O  O   . GLU B 1 73 ? 13.445  -3.598  -6.633  1.00 9.73  ? 72  GLU B O   1 
ATOM   1348 C  CB  . GLU B 1 73 ? 15.204  -6.077  -8.083  1.00 7.77  ? 72  GLU B CB  1 
ATOM   1349 C  CG  . GLU B 1 73 ? 16.714  -6.555  -8.016  1.00 7.01  ? 72  GLU B CG  1 
ATOM   1350 C  CD  . GLU B 1 73 ? 17.200  -7.338  -9.228  1.00 7.66  ? 72  GLU B CD  1 
ATOM   1351 O  OE1 . GLU B 1 73 ? 16.385  -7.814  -10.068 1.00 8.04  ? 72  GLU B OE1 1 
ATOM   1352 O  OE2 . GLU B 1 73 ? 18.442  -7.496  -9.379  1.00 12.14 ? 72  GLU B OE2 1 
ATOM   1353 N  N   . PHE B 1 74 ? 12.430  -5.627  -6.905  1.00 11.58 ? 73  PHE B N   1 
ATOM   1354 C  CA  . PHE B 1 74 ? 11.117  -5.004  -6.894  1.00 8.68  ? 73  PHE B CA  1 
ATOM   1355 C  C   . PHE B 1 74 ? 10.806  -4.306  -5.562  1.00 9.90  ? 73  PHE B C   1 
ATOM   1356 O  O   . PHE B 1 74 ? 10.343  -3.182  -5.521  1.00 11.47 ? 73  PHE B O   1 
ATOM   1357 C  CB  . PHE B 1 74 ? 10.034  -6.014  -7.243  1.00 9.49  ? 73  PHE B CB  1 
ATOM   1358 C  CG  . PHE B 1 74 ? 8.639   -5.433  -7.201  1.00 7.85  ? 73  PHE B CG  1 
ATOM   1359 C  CD1 . PHE B 1 74 ? 8.255   -4.455  -8.161  1.00 10.50 ? 73  PHE B CD1 1 
ATOM   1360 C  CD2 . PHE B 1 74 ? 7.702   -5.805  -6.204  1.00 8.24  ? 73  PHE B CD2 1 
ATOM   1361 C  CE1 . PHE B 1 74 ? 6.958   -3.932  -8.190  1.00 11.11 ? 73  PHE B CE1 1 
ATOM   1362 C  CE2 . PHE B 1 74 ? 6.382   -5.240  -6.209  1.00 8.92  ? 73  PHE B CE2 1 
ATOM   1363 C  CZ  . PHE B 1 74 ? 6.031   -4.292  -7.194  1.00 7.71  ? 73  PHE B CZ  1 
ATOM   1364 N  N   . MET B 1 75 ? 11.159  -4.940  -4.462  1.00 9.03  ? 74  MET B N   1 
ATOM   1365 C  CA  . MET B 1 75 ? 10.968  -4.340  -3.132  1.00 9.13  ? 74  MET B CA  1 
ATOM   1366 C  C   . MET B 1 75 ? 11.743  -3.040  -2.975  1.00 8.70  ? 74  MET B C   1 
ATOM   1367 O  O   . MET B 1 75 ? 11.259  -2.084  -2.443  1.00 9.85  ? 74  MET B O   1 
ATOM   1368 C  CB  . MET B 1 75 ? 11.261  -5.410  -2.042  1.00 10.92 ? 74  MET B CB  1 
ATOM   1369 C  CG  . MET B 1 75 ? 10.088  -6.427  -1.827  1.00 12.59 ? 74  MET B CG  1 
ATOM   1370 S  SD  . MET B 1 75 ? 8.423   -5.682  -1.560  1.00 16.87 ? 74  MET B SD  1 
ATOM   1371 C  CE  . MET B 1 75 ? 8.670   -4.709  -0.088  1.00 17.76 ? 74  MET B CE  1 
ATOM   1372 N  N   . ALA B 1 76 ? 12.985  -2.988  -3.485  1.00 8.11  ? 75  ALA B N   1 
ATOM   1373 C  CA  . ALA B 1 76 ? 13.655  -1.676  -3.476  1.00 7.13  ? 75  ALA B CA  1 
ATOM   1374 C  C   . ALA B 1 76 ? 13.075  -0.603  -4.342  1.00 7.84  ? 75  ALA B C   1 
ATOM   1375 O  O   . ALA B 1 76 ? 13.099  0.640   -3.986  1.00 8.65  ? 75  ALA B O   1 
ATOM   1376 C  CB  . ALA B 1 76 ? 15.227  -1.866  -3.764  1.00 4.46  ? 75  ALA B CB  1 
ATOM   1377 N  N   . PHE B 1 77 ? 12.475  -1.020  -5.471  1.00 9.74  ? 76  PHE B N   1 
ATOM   1378 C  CA  . PHE B 1 77 ? 11.683  -0.065  -6.297  1.00 6.92  ? 76  PHE B CA  1 
ATOM   1379 C  C   . PHE B 1 77 ? 10.427  0.492   -5.588  1.00 7.43  ? 76  PHE B C   1 
ATOM   1380 O  O   . PHE B 1 77 ? 10.158  1.681   -5.609  1.00 8.75  ? 76  PHE B O   1 
ATOM   1381 C  CB  . PHE B 1 77 ? 11.245  -0.773  -7.575  1.00 8.81  ? 76  PHE B CB  1 
ATOM   1382 C  CG  . PHE B 1 77 ? 10.384  0.080   -8.496  1.00 9.29  ? 76  PHE B CG  1 
ATOM   1383 C  CD1 . PHE B 1 77 ? 10.879  1.258   -9.051  1.00 11.91 ? 76  PHE B CD1 1 
ATOM   1384 C  CD2 . PHE B 1 77 ? 9.066   -0.321  -8.824  1.00 12.99 ? 76  PHE B CD2 1 
ATOM   1385 C  CE1 . PHE B 1 77 ? 10.133  1.990   -9.963  1.00 13.36 ? 76  PHE B CE1 1 
ATOM   1386 C  CE2 . PHE B 1 77 ? 8.310   0.389   -9.688  1.00 13.17 ? 76  PHE B CE2 1 
ATOM   1387 C  CZ  . PHE B 1 77 ? 8.818   1.579   -10.258 1.00 10.60 ? 76  PHE B CZ  1 
ATOM   1388 N  N   . VAL B 1 78 ? 9.777   -0.400  -4.875  1.00 8.04  ? 77  VAL B N   1 
ATOM   1389 C  CA  . VAL B 1 78 ? 8.529   0.019   -4.097  1.00 9.44  ? 77  VAL B CA  1 
ATOM   1390 C  C   . VAL B 1 78 ? 9.057   0.988   -3.027  1.00 10.79 ? 77  VAL B C   1 
ATOM   1391 O  O   . VAL B 1 78 ? 8.432   2.001   -2.835  1.00 10.51 ? 77  VAL B O   1 
ATOM   1392 C  CB  . VAL B 1 78 ? 7.900   -1.177  -3.482  1.00 8.53  ? 77  VAL B CB  1 
ATOM   1393 C  CG1 . VAL B 1 78 ? 6.947   -0.781  -2.271  1.00 6.76  ? 77  VAL B CG1 1 
ATOM   1394 C  CG2 . VAL B 1 78 ? 7.087   -1.996  -4.606  1.00 10.88 ? 77  VAL B CG2 1 
ATOM   1395 N  N   . ALA B 1 79 ? 10.202  0.704   -2.364  1.00 10.51 ? 78  ALA B N   1 
ATOM   1396 C  CA  . ALA B 1 79 ? 10.719  1.648   -1.348  1.00 10.14 ? 78  ALA B CA  1 
ATOM   1397 C  C   . ALA B 1 79 ? 11.010  3.014   -1.929  1.00 13.18 ? 78  ALA B C   1 
ATOM   1398 O  O   . ALA B 1 79 ? 10.757  4.014   -1.286  1.00 11.93 ? 78  ALA B O   1 
ATOM   1399 C  CB  . ALA B 1 79 ? 11.976  1.116   -0.683  1.00 10.74 ? 78  ALA B CB  1 
ATOM   1400 N  N   . MET B 1 80 ? 11.606  3.051   -3.137  1.00 10.99 ? 79  MET B N   1 
ATOM   1401 C  CA  . MET B 1 80 ? 11.910  4.328   -3.795  1.00 13.14 ? 79  MET B CA  1 
ATOM   1402 C  C   . MET B 1 80 ? 10.645  5.136   -4.154  1.00 10.28 ? 79  MET B C   1 
ATOM   1403 O  O   . MET B 1 80 ? 10.581  6.333   -3.854  1.00 10.62 ? 79  MET B O   1 
ATOM   1404 C  CB  . MET B 1 80 ? 12.894  4.061   -4.968  1.00 13.66 ? 79  MET B CB  1 
ATOM   1405 C  CG  . MET B 1 80 ? 13.145  5.185   -5.926  1.00 19.06 ? 79  MET B CG  1 
ATOM   1406 S  SD  . MET B 1 80 ? 13.581  4.335   -7.471  1.00 25.24 ? 79  MET B SD  1 
ATOM   1407 C  CE  . MET B 1 80 ? 14.731  3.052   -6.858  1.00 13.50 ? 79  MET B CE  1 
ATOM   1408 N  N   . VAL B 1 81 ? 9.663   4.448   -4.719  1.00 10.69 ? 80  VAL B N   1 
ATOM   1409 C  CA  . VAL B 1 81 ? 8.442   5.079   -5.074  1.00 9.40  ? 80  VAL B CA  1 
ATOM   1410 C  C   . VAL B 1 81 ? 7.696   5.524   -3.782  1.00 11.33 ? 80  VAL B C   1 
ATOM   1411 O  O   . VAL B 1 81 ? 7.178   6.662   -3.701  1.00 10.08 ? 80  VAL B O   1 
ATOM   1412 C  CB  . VAL B 1 81 ? 7.599   4.183   -5.994  1.00 10.43 ? 80  VAL B CB  1 
ATOM   1413 C  CG1 . VAL B 1 81 ? 6.259   4.859   -6.329  1.00 7.73  ? 80  VAL B CG1 1 
ATOM   1414 C  CG2 . VAL B 1 81 ? 8.320   3.950   -7.326  1.00 10.19 ? 80  VAL B CG2 1 
ATOM   1415 N  N   . THR B 1 82 ? 7.643   4.642   -2.788  1.00 10.76 ? 81  THR B N   1 
ATOM   1416 C  CA  . THR B 1 82 ? 6.993   5.027   -1.480  1.00 10.37 ? 81  THR B CA  1 
ATOM   1417 C  C   . THR B 1 82 ? 7.645   6.240   -0.839  1.00 10.61 ? 81  THR B C   1 
ATOM   1418 O  O   . THR B 1 82 ? 6.977   7.141   -0.351  1.00 8.70  ? 81  THR B O   1 
ATOM   1419 C  CB  . THR B 1 82 ? 6.936   3.828   -0.521  1.00 9.65  ? 81  THR B CB  1 
ATOM   1420 O  OG1 . THR B 1 82 ? 6.314   2.727   -1.211  1.00 8.29  ? 81  THR B OG1 1 
ATOM   1421 C  CG2 . THR B 1 82 ? 6.180   4.172   0.770   1.00 9.23  ? 81  THR B CG2 1 
ATOM   1422 N  N   . THR B 1 83 ? 8.954   6.293   -0.870  1.00 10.71 ? 82  THR B N   1 
ATOM   1423 C  CA  . THR B 1 83 ? 9.634   7.439   -0.317  1.00 11.24 ? 82  THR B CA  1 
ATOM   1424 C  C   . THR B 1 83 ? 9.279   8.689   -1.068  1.00 10.96 ? 82  THR B C   1 
ATOM   1425 O  O   . THR B 1 83 ? 9.188   9.755   -0.465  1.00 9.92  ? 82  THR B O   1 
ATOM   1426 C  CB  . THR B 1 83 ? 11.186  7.187   -0.333  1.00 8.80  ? 82  THR B CB  1 
ATOM   1427 O  OG1 . THR B 1 83 ? 11.456  5.968   0.389   1.00 11.01 ? 82  THR B OG1 1 
ATOM   1428 C  CG2 . THR B 1 83 ? 12.036  8.402   0.268   1.00 12.18 ? 82  THR B CG2 1 
ATOM   1429 N  N   . ALA B 1 84 ? 9.208   8.626   -2.394  1.00 10.94 ? 83  ALA B N   1 
ATOM   1430 C  CA  . ALA B 1 84 ? 8.942   9.879   -3.148  1.00 11.13 ? 83  ALA B CA  1 
ATOM   1431 C  C   . ALA B 1 84 ? 7.498   10.375  -2.847  1.00 11.87 ? 83  ALA B C   1 
ATOM   1432 O  O   . ALA B 1 84 ? 7.224   11.582  -2.768  1.00 12.22 ? 83  ALA B O   1 
ATOM   1433 C  CB  . ALA B 1 84 ? 9.122   9.647   -4.604  1.00 11.68 ? 83  ALA B CB  1 
ATOM   1434 N  N   . CYS B 1 85 ? 6.591   9.444   -2.673  1.00 11.66 ? 84  CYS B N   1 
ATOM   1435 C  CA  . CYS B 1 85 ? 5.159   9.793   -2.366  1.00 12.47 ? 84  CYS B CA  1 
ATOM   1436 C  C   . CYS B 1 85 ? 5.131   10.450  -1.011  1.00 12.06 ? 84  CYS B C   1 
ATOM   1437 O  O   . CYS B 1 85 ? 4.492   11.493  -0.816  1.00 11.81 ? 84  CYS B O   1 
ATOM   1438 C  CB  . CYS B 1 85 ? 4.223   8.564   -2.478  1.00 10.76 ? 84  CYS B CB  1 
ATOM   1439 S  SG  . CYS B 1 85 ? 2.513   8.756   -1.956  1.00 17.14 ? 84  CYS B SG  1 
ATOM   1440 N  N   . HIS B 1 86 ? 5.881   9.888   -0.083  1.00 12.37 ? 85  HIS B N   1 
ATOM   1441 C  CA  . HIS B 1 86 ? 6.001   10.461  1.246   1.00 13.09 ? 85  HIS B CA  1 
ATOM   1442 C  C   . HIS B 1 86 ? 6.509   11.902  1.293   1.00 12.72 ? 85  HIS B C   1 
ATOM   1443 O  O   . HIS B 1 86 ? 5.908   12.808  1.904   1.00 10.13 ? 85  HIS B O   1 
ATOM   1444 C  CB  . HIS B 1 86 ? 6.856   9.515   2.066   1.00 12.85 ? 85  HIS B CB  1 
ATOM   1445 C  CG  . HIS B 1 86 ? 7.256   10.071  3.381   1.00 13.79 ? 85  HIS B CG  1 
ATOM   1446 N  ND1 . HIS B 1 86 ? 8.563   10.094  3.815   1.00 12.00 ? 85  HIS B ND1 1 
ATOM   1447 C  CD2 . HIS B 1 86 ? 6.507   10.563  4.395   1.00 15.96 ? 85  HIS B CD2 1 
ATOM   1448 C  CE1 . HIS B 1 86 ? 8.599   10.591  5.036   1.00 14.45 ? 85  HIS B CE1 1 
ATOM   1449 N  NE2 . HIS B 1 86 ? 7.371   10.921  5.396   1.00 16.22 ? 85  HIS B NE2 1 
ATOM   1450 N  N   . GLU B 1 87 ? 7.583   12.159  0.582   1.00 12.07 ? 86  GLU B N   1 
ATOM   1451 C  CA  . GLU B 1 87 ? 8.087   13.494  0.466   1.00 12.49 ? 86  GLU B CA  1 
ATOM   1452 C  C   . GLU B 1 87 ? 7.174   14.451  -0.299  1.00 12.23 ? 86  GLU B C   1 
ATOM   1453 O  O   . GLU B 1 87 ? 7.113   15.661  -0.005  1.00 12.60 ? 86  GLU B O   1 
ATOM   1454 C  CB  . GLU B 1 87 ? 9.422   13.440  -0.251  1.00 13.01 ? 86  GLU B CB  1 
ATOM   1455 C  CG  . GLU B 1 87 ? 10.554  12.890  0.604   1.00 19.68 ? 86  GLU B CG  1 
ATOM   1456 C  CD  . GLU B 1 87 ? 11.735  12.481  -0.238  1.00 24.03 ? 86  GLU B CD  1 
ATOM   1457 O  OE1 . GLU B 1 87 ? 11.786  12.933  -1.406  1.00 27.09 ? 86  GLU B OE1 1 
ATOM   1458 O  OE2 . GLU B 1 87 ? 12.586  11.679  0.245   1.00 27.67 ? 86  GLU B OE2 1 
ATOM   1459 N  N   . PHE B 1 88 ? 6.492   13.927  -1.319  1.00 12.05 ? 87  PHE B N   1 
ATOM   1460 C  CA  . PHE B 1 88 ? 5.652   14.802  -2.138  1.00 11.62 ? 87  PHE B CA  1 
ATOM   1461 C  C   . PHE B 1 88 ? 4.643   15.504  -1.224  1.00 10.10 ? 87  PHE B C   1 
ATOM   1462 O  O   . PHE B 1 88 ? 4.372   16.671  -1.380  1.00 10.77 ? 87  PHE B O   1 
ATOM   1463 C  CB  . PHE B 1 88 ? 4.907   13.975  -3.209  1.00 10.48 ? 87  PHE B CB  1 
ATOM   1464 C  CG  . PHE B 1 88 ? 4.197   14.818  -4.223  1.00 12.66 ? 87  PHE B CG  1 
ATOM   1465 C  CD1 . PHE B 1 88 ? 4.860   15.211  -5.380  1.00 13.42 ? 87  PHE B CD1 1 
ATOM   1466 C  CD2 . PHE B 1 88 ? 2.879   15.280  -4.008  1.00 11.09 ? 87  PHE B CD2 1 
ATOM   1467 C  CE1 . PHE B 1 88 ? 4.228   16.001  -6.309  1.00 13.45 ? 87  PHE B CE1 1 
ATOM   1468 C  CE2 . PHE B 1 88 ? 2.249   16.083  -4.920  1.00 16.53 ? 87  PHE B CE2 1 
ATOM   1469 C  CZ  . PHE B 1 88 ? 2.910   16.464  -6.076  1.00 16.21 ? 87  PHE B CZ  1 
ATOM   1470 N  N   . PHE B 1 89 ? 4.098   14.767  -0.248  1.00 10.56 ? 88  PHE B N   1 
ATOM   1471 C  CA  . PHE B 1 89 ? 2.979   15.318  0.547   1.00 11.27 ? 88  PHE B CA  1 
ATOM   1472 C  C   . PHE B 1 89 ? 3.380   15.980  1.837   1.00 11.75 ? 88  PHE B C   1 
ATOM   1473 O  O   . PHE B 1 89 ? 2.521   16.390  2.657   1.00 12.97 ? 88  PHE B O   1 
ATOM   1474 C  CB  . PHE B 1 89 ? 1.878   14.277  0.755   1.00 11.56 ? 88  PHE B CB  1 
ATOM   1475 C  CG  . PHE B 1 89 ? 1.128   13.981  -0.487  1.00 12.63 ? 88  PHE B CG  1 
ATOM   1476 C  CD1 . PHE B 1 89 ? -0.005  14.733  -0.816  1.00 15.52 ? 88  PHE B CD1 1 
ATOM   1477 C  CD2 . PHE B 1 89 ? 1.563   12.964  -1.342  1.00 16.42 ? 88  PHE B CD2 1 
ATOM   1478 C  CE1 . PHE B 1 89 ? -0.693  14.460  -1.981  1.00 17.29 ? 88  PHE B CE1 1 
ATOM   1479 C  CE2 . PHE B 1 89 ? 0.867   12.694  -2.515  1.00 19.66 ? 88  PHE B CE2 1 
ATOM   1480 C  CZ  . PHE B 1 89 ? -0.263  13.447  -2.826  1.00 16.82 ? 88  PHE B CZ  1 
ATOM   1481 N  N   . GLU B 1 90 ? 4.687   16.201  1.934   1.00 13.82 ? 89  GLU B N   1 
ATOM   1482 C  CA  . GLU B 1 90 ? 5.354   16.862  3.071   1.00 15.03 ? 89  GLU B CA  1 
ATOM   1483 C  C   . GLU B 1 90 ? 6.103   18.101  2.628   1.00 16.20 ? 89  GLU B C   1 
ATOM   1484 O  O   . GLU B 1 90 ? 6.546   18.207  1.474   1.00 15.63 ? 89  GLU B O   1 
ATOM   1485 C  CB  . GLU B 1 90 ? 6.364   15.911  3.676   1.00 16.02 ? 89  GLU B CB  1 
ATOM   1486 C  CG  . GLU B 1 90 ? 6.314   15.813  5.152   1.00 17.27 ? 89  GLU B CG  1 
ATOM   1487 C  CD  . GLU B 1 90 ? 6.372   14.377  5.558   1.00 16.99 ? 89  GLU B CD  1 
ATOM   1488 O  OE1 . GLU B 1 90 ? 5.304   13.792  5.775   1.00 17.23 ? 89  GLU B OE1 1 
ATOM   1489 O  OE2 . GLU B 1 90 ? 7.483   13.832  5.636   1.00 14.55 ? 89  GLU B OE2 1 
ATOM   1490 N  N   . HIS B 1 91 ? 6.265   19.025  3.566   1.00 17.36 ? 90  HIS B N   1 
ATOM   1491 C  CA  . HIS B 1 91 ? 6.665   20.372  3.225   1.00 18.73 ? 90  HIS B CA  1 
ATOM   1492 C  C   . HIS B 1 91 ? 5.475   20.895  2.397   1.00 18.94 ? 90  HIS B C   1 
ATOM   1493 O  O   . HIS B 1 91 ? 4.471   20.157  2.191   1.00 18.72 ? 90  HIS B O   1 
ATOM   1494 C  CB  . HIS B 1 91 ? 7.992   20.362  2.436   1.00 19.09 ? 90  HIS B CB  1 
ATOM   1495 C  CG  . HIS B 1 91 ? 8.586   21.717  2.209   1.00 19.97 ? 90  HIS B CG  1 
ATOM   1496 N  ND1 . HIS B 1 91 ? 9.104   22.111  0.992   1.00 20.98 ? 90  HIS B ND1 1 
ATOM   1497 C  CD2 . HIS B 1 91 ? 8.743   22.773  3.042   1.00 20.82 ? 90  HIS B CD2 1 
ATOM   1498 C  CE1 . HIS B 1 91 ? 9.547   23.354  1.085   1.00 21.09 ? 90  HIS B CE1 1 
ATOM   1499 N  NE2 . HIS B 1 91 ? 9.341   23.777  2.319   1.00 20.94 ? 90  HIS B NE2 1 
HETATM 1500 CA CA  . CA  C 2 .  ? 17.893  4.853   13.162  1.00 30.21 ? 92  CA  A CA  1 
HETATM 1501 CA CA  . CA  D 2 .  ? 8.268   8.684   17.797  1.00 33.41 ? 93  CA  A CA  1 
HETATM 1502 ZN ZN  . ZN  E 3 .  ? 6.374   11.806  7.143   1.00 35.09 ? 94  ZN  A ZN  1 
HETATM 1503 ZN ZN  . ZN  F 3 .  ? 7.186   -15.718 -5.779  1.00 35.09 ? 95  ZN  A ZN  1 
HETATM 1504 CA CA  . CA  G 2 .  ? 8.455   -12.678 -16.377 1.00 31.73 ? 92  CA  B CA  1 
HETATM 1505 CA CA  . CA  H 2 .  ? 18.096  -8.395  -11.629 1.00 35.74 ? 93  CA  B CA  1 
HETATM 1506 C  C1  . PGE I 4 .  ? 2.589   12.107  -11.118 1.00 50.29 ? 94  PGE B C1  1 
HETATM 1507 O  O1  . PGE I 4 .  ? 2.885   12.941  -12.247 1.00 51.25 ? 94  PGE B O1  1 
HETATM 1508 C  C2  . PGE I 4 .  ? 3.114   12.761  -9.850  1.00 50.63 ? 94  PGE B C2  1 
HETATM 1509 O  O2  . PGE I 4 .  ? 2.059   12.886  -8.888  1.00 52.38 ? 94  PGE B O2  1 
HETATM 1510 C  C3  . PGE I 4 .  ? 2.466   12.559  -7.557  1.00 53.22 ? 94  PGE B C3  1 
HETATM 1511 C  C4  . PGE I 4 .  ? 1.244   12.396  -6.661  1.00 52.58 ? 94  PGE B C4  1 
HETATM 1512 O  O4  . PGE I 4 .  ? -2.336  11.922  -8.540  1.00 54.81 ? 94  PGE B O4  1 
HETATM 1513 C  C6  . PGE I 4 .  ? -2.246  12.015  -7.111  1.00 53.78 ? 94  PGE B C6  1 
HETATM 1514 C  C5  . PGE I 4 .  ? -1.090  12.928  -6.709  1.00 54.62 ? 94  PGE B C5  1 
HETATM 1515 O  O3  . PGE I 4 .  ? 0.080   12.589  -7.466  1.00 53.63 ? 94  PGE B O3  1 
HETATM 1516 O  O   . HOH J 5 .  ? -2.663  2.772   14.178  1.00 36.58 ? 96  HOH A O   1 
HETATM 1517 O  O   . HOH J 5 .  ? 21.736  3.345   19.543  1.00 34.93 ? 97  HOH A O   1 
HETATM 1518 O  O   . HOH J 5 .  ? 17.066  6.858   12.384  1.00 32.68 ? 98  HOH A O   1 
HETATM 1519 O  O   . HOH J 5 .  ? -11.719 9.341   -4.166  1.00 45.23 ? 99  HOH A O   1 
HETATM 1520 O  O   . HOH J 5 .  ? 0.705   -2.022  25.133  1.00 32.48 ? 100 HOH A O   1 
HETATM 1521 O  O   . HOH J 5 .  ? 17.111  -5.168  5.800   1.00 39.31 ? 101 HOH A O   1 
HETATM 1522 O  O   . HOH J 5 .  ? 0.797   11.641  20.435  1.00 45.17 ? 102 HOH A O   1 
HETATM 1523 O  O   . HOH J 5 .  ? -5.401  -2.325  -8.937  1.00 38.76 ? 103 HOH A O   1 
HETATM 1524 O  O   . HOH J 5 .  ? 11.739  9.406   9.230   1.00 34.20 ? 104 HOH A O   1 
HETATM 1525 O  O   . HOH J 5 .  ? 9.470   -1.514  1.714   1.00 36.96 ? 105 HOH A O   1 
HETATM 1526 O  O   . HOH J 5 .  ? 13.719  -9.897  28.027  1.00 32.04 ? 106 HOH A O   1 
HETATM 1527 O  O   . HOH J 5 .  ? 16.130  -0.960  8.474   1.00 35.77 ? 107 HOH A O   1 
HETATM 1528 O  O   . HOH J 5 .  ? -8.381  6.583   -4.464  1.00 30.80 ? 108 HOH A O   1 
HETATM 1529 O  O   . HOH J 5 .  ? 8.538   -11.465 16.781  1.00 36.96 ? 109 HOH A O   1 
HETATM 1530 O  O   . HOH J 5 .  ? 15.542  -9.787  3.666   1.00 34.86 ? 110 HOH A O   1 
HETATM 1531 O  O   . HOH J 5 .  ? 3.000   -9.570  16.328  1.00 33.16 ? 111 HOH A O   1 
HETATM 1532 O  O   . HOH J 5 .  ? -0.963  6.417   17.235  1.00 33.85 ? 112 HOH A O   1 
HETATM 1533 O  O   . HOH J 5 .  ? 3.057   -8.364  24.557  1.00 43.84 ? 113 HOH A O   1 
HETATM 1534 O  O   . HOH J 5 .  ? 3.951   4.419   25.901  1.00 39.21 ? 114 HOH A O   1 
HETATM 1535 O  O   . HOH J 5 .  ? -0.347  10.343  18.022  1.00 31.82 ? 115 HOH A O   1 
HETATM 1536 O  O   . HOH J 5 .  ? 1.852   -27.207 -6.974  1.00 32.13 ? 116 HOH A O   1 
HETATM 1537 O  O   . HOH J 5 .  ? -0.789  1.428   12.167  1.00 57.52 ? 117 HOH A O   1 
HETATM 1538 O  O   . HOH J 5 .  ? 8.480   -13.101 20.329  1.00 37.23 ? 118 HOH A O   1 
HETATM 1539 O  O   . HOH J 5 .  ? 22.994  8.423   14.497  1.00 33.89 ? 119 HOH A O   1 
HETATM 1540 O  O   . HOH J 5 .  ? 13.492  8.135   3.746   1.00 32.31 ? 120 HOH A O   1 
HETATM 1541 O  O   . HOH J 5 .  ? 7.794   -7.442  28.829  1.00 47.74 ? 121 HOH A O   1 
HETATM 1542 O  O   . HOH J 5 .  ? 18.084  -1.380  3.054   1.00 46.52 ? 122 HOH A O   1 
HETATM 1543 O  O   . HOH J 5 .  ? 10.360  8.364   18.865  1.00 33.16 ? 123 HOH A O   1 
HETATM 1544 O  O   . HOH J 5 .  ? 3.638   -16.840 10.199  1.00 43.27 ? 124 HOH A O   1 
HETATM 1545 O  O   . HOH J 5 .  ? 0.584   -16.990 9.797   1.00 38.95 ? 125 HOH A O   1 
HETATM 1546 O  O   . HOH J 5 .  ? -1.887  -1.578  9.831   1.00 22.13 ? 126 HOH A O   1 
HETATM 1547 O  O   . HOH J 5 .  ? -1.963  -2.785  -8.026  1.00 27.31 ? 127 HOH A O   1 
HETATM 1548 O  O   . HOH J 5 .  ? 13.680  -11.293 4.862   1.00 30.64 ? 128 HOH A O   1 
HETATM 1549 O  O   . HOH J 5 .  ? 14.904  -7.473  2.691   1.00 37.98 ? 129 HOH A O   1 
HETATM 1550 O  O   . HOH J 5 .  ? 14.891  1.429   2.646   1.00 30.45 ? 130 HOH A O   1 
HETATM 1551 O  O   . HOH J 5 .  ? -2.241  1.362   9.949   1.00 28.96 ? 131 HOH A O   1 
HETATM 1552 O  O   . HOH J 5 .  ? 0.292   9.387   6.786   1.00 42.11 ? 132 HOH A O   1 
HETATM 1553 O  O   . HOH J 5 .  ? 18.348  -2.974  7.640   1.00 51.60 ? 133 HOH A O   1 
HETATM 1554 O  O   . HOH J 5 .  ? -2.061  4.003   16.536  1.00 40.65 ? 134 HOH A O   1 
HETATM 1555 O  O   . HOH J 5 .  ? 15.904  8.756   21.030  1.00 43.71 ? 135 HOH A O   1 
HETATM 1556 O  O   . HOH J 5 .  ? 11.133  -17.242 4.828   1.00 36.67 ? 136 HOH A O   1 
HETATM 1557 O  O   . HOH J 5 .  ? 0.816   -10.002 18.072  1.00 37.80 ? 137 HOH A O   1 
HETATM 1558 O  O   . HOH J 5 .  ? 15.383  -4.925  3.889   1.00 28.72 ? 138 HOH A O   1 
HETATM 1559 O  O   . HOH J 5 .  ? 14.299  8.223   6.593   1.00 34.65 ? 139 HOH A O   1 
HETATM 1560 O  O   . HOH J 5 .  ? 8.633   -12.057 23.006  1.00 32.95 ? 140 HOH A O   1 
HETATM 1561 O  O   . HOH J 5 .  ? 20.139  -5.814  21.565  1.00 37.51 ? 141 HOH A O   1 
HETATM 1562 O  O   . HOH J 5 .  ? 10.241  -7.399  29.144  1.00 44.53 ? 142 HOH A O   1 
HETATM 1563 O  O   . HOH J 5 .  ? 8.839   -13.828 30.797  1.00 51.78 ? 143 HOH A O   1 
HETATM 1564 O  O   . HOH J 5 .  ? -4.739  -3.619  12.594  1.00 36.17 ? 144 HOH A O   1 
HETATM 1565 O  O   . HOH J 5 .  ? 0.988   9.517   15.863  1.00 40.11 ? 145 HOH A O   1 
HETATM 1566 O  O   . HOH J 5 .  ? 16.172  -3.092  1.956   1.00 29.56 ? 146 HOH A O   1 
HETATM 1567 O  O   . HOH J 5 .  ? 17.854  -14.048 27.353  1.00 47.03 ? 147 HOH A O   1 
HETATM 1568 O  O   . HOH J 5 .  ? 14.408  3.955   -1.275  1.00 33.50 ? 148 HOH A O   1 
HETATM 1569 O  O   . HOH J 5 .  ? -7.496  4.681   -8.738  1.00 40.22 ? 149 HOH A O   1 
HETATM 1570 O  O   . HOH J 5 .  ? -5.031  0.938   10.815  1.00 40.64 ? 150 HOH A O   1 
HETATM 1571 O  O   . HOH J 5 .  ? -4.612  7.996   11.350  1.00 59.94 ? 151 HOH A O   1 
HETATM 1572 O  O   . HOH J 5 .  ? 11.472  9.675   21.110  1.00 42.20 ? 152 HOH A O   1 
HETATM 1573 O  O   . HOH J 5 .  ? 7.169   3.759   26.981  1.00 55.73 ? 153 HOH A O   1 
HETATM 1574 O  O   . HOH J 5 .  ? 10.893  3.005   24.146  1.00 37.48 ? 154 HOH A O   1 
HETATM 1575 O  O   . HOH J 5 .  ? -4.634  -6.384  13.044  1.00 32.69 ? 155 HOH A O   1 
HETATM 1576 O  O   . HOH J 5 .  ? -10.675 7.176   -5.774  1.00 39.85 ? 156 HOH A O   1 
HETATM 1577 O  O   . HOH J 5 .  ? 1.777   -4.844  22.478  1.00 46.01 ? 157 HOH A O   1 
HETATM 1578 O  O   . HOH J 5 .  ? 25.568  6.465   11.318  1.00 35.58 ? 158 HOH A O   1 
HETATM 1579 O  O   . HOH J 5 .  ? 17.548  -10.257 15.009  1.00 42.97 ? 159 HOH A O   1 
HETATM 1580 O  O   . HOH J 5 .  ? -2.068  -7.999  12.670  1.00 33.89 ? 160 HOH A O   1 
HETATM 1581 O  O   . HOH J 5 .  ? 18.131  11.410  11.462  1.00 39.23 ? 161 HOH A O   1 
HETATM 1582 O  O   . HOH J 5 .  ? 13.947  -9.311  -0.944  1.00 29.80 ? 162 HOH A O   1 
HETATM 1583 O  O   . HOH J 5 .  ? 17.558  -8.107  9.273   1.00 60.54 ? 163 HOH A O   1 
HETATM 1584 O  O   . HOH J 5 .  ? 11.883  -13.305 -2.208  1.00 38.62 ? 164 HOH A O   1 
HETATM 1585 O  O   . HOH J 5 .  ? -5.393  -4.624  -8.759  1.00 46.29 ? 165 HOH A O   1 
HETATM 1586 O  O   . HOH J 5 .  ? 15.694  -9.947  11.291  1.00 42.12 ? 166 HOH A O   1 
HETATM 1587 O  O   . HOH J 5 .  ? -0.181  12.476  18.495  1.00 30.00 ? 167 HOH A O   1 
HETATM 1588 O  O   . HOH J 5 .  ? -0.789  -6.538  21.481  1.00 39.51 ? 168 HOH A O   1 
HETATM 1589 O  O   . HOH K 5 .  ? -4.114  5.301   -17.048 1.00 46.28 ? 107 HOH B O   1 
HETATM 1590 O  O   . HOH K 5 .  ? 14.095  -6.820  -23.119 1.00 50.80 ? 108 HOH B O   1 
HETATM 1591 O  O   . HOH K 5 .  ? -6.231  6.591   -17.812 1.00 47.35 ? 109 HOH B O   1 
HETATM 1592 O  O   . HOH K 5 .  ? -9.014  7.630   -16.007 1.00 46.82 ? 110 HOH B O   1 
HETATM 1593 O  O   . HOH K 5 .  ? 24.094  -0.621  -19.015 1.00 36.88 ? 111 HOH B O   1 
HETATM 1594 O  O   . HOH K 5 .  ? 4.561   10.097  -20.403 1.00 34.87 ? 112 HOH B O   1 
HETATM 1595 O  O   . HOH K 5 .  ? 20.167  1.122   -20.402 1.00 43.38 ? 113 HOH B O   1 
HETATM 1596 O  O   . HOH K 5 .  ? -8.527  -2.106  3.642   1.00 41.62 ? 114 HOH B O   1 
HETATM 1597 O  O   . HOH K 5 .  ? -2.132  -8.166  -15.285 1.00 39.08 ? 115 HOH B O   1 
HETATM 1598 O  O   . HOH K 5 .  ? 8.099   8.283   -18.649 1.00 50.55 ? 116 HOH B O   1 
HETATM 1599 O  O   . HOH K 5 .  ? 13.702  9.072   -17.066 1.00 44.24 ? 117 HOH B O   1 
HETATM 1600 O  O   . HOH K 5 .  ? 17.847  9.635   -19.426 1.00 50.87 ? 118 HOH B O   1 
HETATM 1601 O  O   . HOH K 5 .  ? 19.612  4.488   -16.353 1.00 38.12 ? 119 HOH B O   1 
HETATM 1602 O  O   . HOH K 5 .  ? -1.610  7.435   -16.964 1.00 41.04 ? 120 HOH B O   1 
HETATM 1603 O  O   . HOH K 5 .  ? -6.095  -10.224 -6.750  1.00 41.27 ? 121 HOH B O   1 
HETATM 1604 O  O   . HOH K 5 .  ? 3.348   11.770  3.368   1.00 36.05 ? 122 HOH B O   1 
HETATM 1605 O  O   . HOH K 5 .  ? 7.747   10.023  -13.169 1.00 37.48 ? 123 HOH B O   1 
HETATM 1606 O  O   . HOH K 5 .  ? 8.022   -15.823 -22.600 1.00 47.76 ? 124 HOH B O   1 
HETATM 1607 O  O   . HOH K 5 .  ? 6.493   10.328  -9.952  1.00 42.62 ? 125 HOH B O   1 
HETATM 1608 O  O   . HOH K 5 .  ? 11.058  5.029   -11.874 1.00 39.67 ? 126 HOH B O   1 
HETATM 1609 O  O   . HOH K 5 .  ? 8.926   13.578  -4.114  1.00 39.29 ? 127 HOH B O   1 
HETATM 1610 O  O   . HOH K 5 .  ? -5.536  -2.518  10.374  1.00 37.35 ? 128 HOH B O   1 
HETATM 1611 O  O   . HOH K 5 .  ? 1.997   0.477   -21.075 1.00 46.85 ? 129 HOH B O   1 
HETATM 1612 O  O   . HOH K 5 .  ? -3.759  -9.308  2.021   1.00 54.89 ? 130 HOH B O   1 
HETATM 1613 O  O   . HOH K 5 .  ? -0.918  14.905  3.301   1.00 40.78 ? 131 HOH B O   1 
HETATM 1614 O  O   . HOH K 5 .  ? 10.654  -12.377 -17.276 1.00 39.85 ? 132 HOH B O   1 
HETATM 1615 O  O   . HOH K 5 .  ? 7.971   6.685   -15.667 1.00 42.00 ? 133 HOH B O   1 
HETATM 1616 O  O   . HOH K 5 .  ? -2.444  3.266   -11.061 1.00 26.40 ? 134 HOH B O   1 
HETATM 1617 O  O   . HOH K 5 .  ? 2.817   4.088   -22.929 1.00 28.97 ? 135 HOH B O   1 
HETATM 1618 O  O   . HOH K 5 .  ? -4.955  -0.903  -11.529 1.00 33.94 ? 136 HOH B O   1 
HETATM 1619 O  O   . HOH K 5 .  ? 0.297   8.446   -15.368 1.00 35.58 ? 137 HOH B O   1 
HETATM 1620 O  O   . HOH K 5 .  ? 0.331   5.403   -16.629 1.00 30.77 ? 138 HOH B O   1 
HETATM 1621 O  O   . HOH K 5 .  ? 2.453   5.388   -14.953 1.00 20.99 ? 139 HOH B O   1 
HETATM 1622 O  O   . HOH K 5 .  ? 12.719  8.062   -3.695  1.00 25.72 ? 140 HOH B O   1 
HETATM 1623 O  O   . HOH K 5 .  ? 8.099   7.941   -21.574 1.00 32.01 ? 141 HOH B O   1 
HETATM 1624 O  O   . HOH K 5 .  ? 10.680  3.763   -27.863 1.00 34.30 ? 142 HOH B O   1 
HETATM 1625 O  O   . HOH K 5 .  ? -4.112  -12.996 -8.092  1.00 42.40 ? 143 HOH B O   1 
HETATM 1626 O  O   . HOH K 5 .  ? 18.219  4.229   -21.333 1.00 39.00 ? 144 HOH B O   1 
HETATM 1627 O  O   . HOH K 5 .  ? -3.116  -6.642  -5.126  1.00 41.44 ? 145 HOH B O   1 
HETATM 1628 O  O   . HOH K 5 .  ? 15.783  -2.691  -7.100  1.00 30.93 ? 146 HOH B O   1 
HETATM 1629 O  O   . HOH K 5 .  ? -4.319  -6.958  -0.067  1.00 31.35 ? 147 HOH B O   1 
HETATM 1630 O  O   . HOH K 5 .  ? -7.791  -3.357  7.565   1.00 36.89 ? 148 HOH B O   1 
HETATM 1631 O  O   . HOH K 5 .  ? -0.053  16.827  2.009   1.00 28.95 ? 149 HOH B O   1 
HETATM 1632 O  O   . HOH K 5 .  ? 7.266   -0.359  -25.590 1.00 57.80 ? 150 HOH B O   1 
HETATM 1633 O  O   . HOH K 5 .  ? 11.211  10.232  3.319   1.00 32.14 ? 151 HOH B O   1 
HETATM 1634 O  O   . HOH K 5 .  ? 16.928  -10.742 -10.836 1.00 38.45 ? 152 HOH B O   1 
HETATM 1635 O  O   . HOH K 5 .  ? 10.976  -6.741  -22.547 1.00 30.93 ? 153 HOH B O   1 
HETATM 1636 O  O   . HOH K 5 .  ? 0.676   -2.012  -23.951 1.00 29.30 ? 154 HOH B O   1 
HETATM 1637 O  O   . HOH K 5 .  ? 14.489  6.652   -2.114  1.00 28.68 ? 155 HOH B O   1 
HETATM 1638 O  O   . HOH K 5 .  ? -4.679  1.218   -14.543 1.00 39.14 ? 156 HOH B O   1 
HETATM 1639 O  O   . HOH K 5 .  ? -0.729  2.434   -20.717 1.00 39.97 ? 157 HOH B O   1 
HETATM 1640 O  O   . HOH K 5 .  ? 13.943  -7.646  -20.005 1.00 47.64 ? 158 HOH B O   1 
HETATM 1641 O  O   . HOH K 5 .  ? 9.582   -0.271  -24.827 1.00 43.93 ? 159 HOH B O   1 
HETATM 1642 O  O   . HOH K 5 .  ? -3.806  -1.797  3.147   1.00 36.80 ? 160 HOH B O   1 
HETATM 1643 O  O   . HOH K 5 .  ? -8.532  -9.116  11.039  1.00 48.06 ? 161 HOH B O   1 
HETATM 1644 O  O   . HOH K 5 .  ? 1.823   -11.163 -21.894 1.00 44.94 ? 162 HOH B O   1 
HETATM 1645 O  O   . HOH K 5 .  ? 1.068   -8.628  -21.803 1.00 38.55 ? 163 HOH B O   1 
HETATM 1646 O  O   . HOH K 5 .  ? 14.800  -4.992  -1.468  1.00 36.21 ? 164 HOH B O   1 
HETATM 1647 O  O   . HOH K 5 .  ? 17.597  -4.718  -2.565  1.00 44.84 ? 165 HOH B O   1 
HETATM 1648 O  O   . HOH K 5 .  ? 16.627  6.323   -4.300  1.00 39.68 ? 166 HOH B O   1 
HETATM 1649 O  O   . HOH K 5 .  ? 5.857   11.047  -6.577  1.00 59.84 ? 167 HOH B O   1 
HETATM 1650 O  O   . HOH K 5 .  ? 3.458   10.275  -5.664  1.00 43.04 ? 168 HOH B O   1 
HETATM 1651 O  O   . HOH K 5 .  ? 12.016  -14.304 -5.720  1.00 42.07 ? 169 HOH B O   1 
HETATM 1652 O  O   . HOH K 5 .  ? 12.122  -12.913 -7.588  1.00 37.92 ? 170 HOH B O   1 
HETATM 1653 O  O   . HOH K 5 .  ? 17.967  7.516   -20.761 1.00 39.14 ? 171 HOH B O   1 
HETATM 1654 O  O   . HOH K 5 .  ? 15.210  5.248   -14.307 1.00 33.08 ? 172 HOH B O   1 
HETATM 1655 O  O   . HOH K 5 .  ? 6.316   18.189  -1.056  1.00 48.12 ? 173 HOH B O   1 
HETATM 1656 O  O   . HOH K 5 .  ? 7.906   5.085   -28.011 1.00 45.51 ? 174 HOH B O   1 
HETATM 1657 O  O   . HOH K 5 .  ? 11.557  12.231  -3.631  1.00 38.91 ? 175 HOH B O   1 
HETATM 1658 O  O   . HOH K 5 .  ? -3.346  2.933   -16.492 1.00 37.91 ? 176 HOH B O   1 
HETATM 1659 O  O   . HOH K 5 .  ? -0.300  10.752  1.024   1.00 40.45 ? 177 HOH B O   1 
HETATM 1660 O  O   . HOH K 5 .  ? 12.629  -18.320 -9.352  1.00 46.51 ? 178 HOH B O   1 
HETATM 1661 O  O   . HOH K 5 .  ? -0.862  12.545  2.811   1.00 46.35 ? 179 HOH B O   1 
HETATM 1662 O  O   . HOH K 5 .  ? -2.335  -5.253  -8.243  1.00 35.87 ? 180 HOH B O   1 
HETATM 1663 O  O   . HOH K 5 .  ? 11.220  -9.577  -25.179 1.00 39.93 ? 181 HOH B O   1 
HETATM 1664 O  O   . HOH K 5 .  ? 15.463  0.450   -6.519  1.00 45.02 ? 182 HOH B O   1 
HETATM 1665 O  O   . HOH K 5 .  ? 10.748  20.533  -0.155  1.00 55.69 ? 183 HOH B O   1 
HETATM 1666 O  O   . HOH K 5 .  ? 16.678  -14.800 -14.859 1.00 30.00 ? 184 HOH B O   1 
HETATM 1667 O  O   . HOH K 5 .  ? 11.363  -0.258  -28.768 1.00 30.00 ? 185 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  0  0  MET MET A . n 
A 1 2  SER 2  1  1  SER SER A . n 
A 1 3  GLU 3  2  2  GLU GLU A . n 
A 1 4  LEU 4  3  3  LEU LEU A . n 
A 1 5  GLU 5  4  4  GLU GLU A . n 
A 1 6  LYS 6  5  5  LYS LYS A . n 
A 1 7  ALA 7  6  6  ALA ALA A . n 
A 1 8  MET 8  7  7  MET MET A . n 
A 1 9  VAL 9  8  8  VAL VAL A . n 
A 1 10 ALA 10 9  9  ALA ALA A . n 
A 1 11 LEU 11 10 10 LEU LEU A . n 
A 1 12 ILE 12 11 11 ILE ILE A . n 
A 1 13 ASP 13 12 12 ASP ASP A . n 
A 1 14 VAL 14 13 13 VAL VAL A . n 
A 1 15 PHE 15 14 14 PHE PHE A . n 
A 1 16 HIS 16 15 15 HIS HIS A . n 
A 1 17 GLN 17 16 16 GLN GLN A . n 
A 1 18 TYR 18 17 17 TYR TYR A . n 
A 1 19 SER 19 18 18 SER SER A . n 
A 1 20 GLY 20 19 19 GLY GLY A . n 
A 1 21 ARG 21 20 20 ARG ARG A . n 
A 1 22 GLU 22 21 21 GLU GLU A . n 
A 1 23 GLY 23 22 22 GLY GLY A . n 
A 1 24 ASP 24 23 23 ASP ASP A . n 
A 1 25 LYS 25 24 24 LYS LYS A . n 
A 1 26 HIS 26 25 25 HIS HIS A . n 
A 1 27 LYS 27 26 26 LYS LYS A . n 
A 1 28 LEU 28 27 27 LEU LEU A . n 
A 1 29 LYS 29 28 28 LYS LYS A . n 
A 1 30 LYS 30 29 29 LYS LYS A . n 
A 1 31 SER 31 30 30 SER SER A . n 
A 1 32 GLU 32 31 31 GLU GLU A . n 
A 1 33 LEU 33 32 32 LEU LEU A . n 
A 1 34 LYS 34 33 33 LYS LYS A . n 
A 1 35 GLU 35 34 34 GLU GLU A . n 
A 1 36 LEU 36 35 35 LEU LEU A . n 
A 1 37 ILE 37 36 36 ILE ILE A . n 
A 1 38 ASN 38 37 37 ASN ASN A . n 
A 1 39 ASN 39 38 38 ASN ASN A . n 
A 1 40 GLU 40 39 39 GLU GLU A . n 
A 1 41 LEU 41 40 40 LEU LEU A . n 
A 1 42 SER 42 41 41 SER SER A . n 
A 1 43 HIS 43 42 42 HIS HIS A . n 
A 1 44 PHE 44 43 43 PHE PHE A . n 
A 1 45 LEU 45 44 44 LEU LEU A . n 
A 1 46 GLU 46 45 45 GLU GLU A . n 
A 1 47 GLU 47 46 46 GLU GLU A . n 
A 1 48 ILE 48 47 47 ILE ILE A . n 
A 1 49 LYS 49 48 48 LYS LYS A . n 
A 1 50 GLU 50 49 49 GLU GLU A . n 
A 1 51 GLN 51 50 50 GLN GLN A . n 
A 1 52 GLU 52 51 51 GLU GLU A . n 
A 1 53 VAL 53 52 52 VAL VAL A . n 
A 1 54 VAL 54 53 53 VAL VAL A . n 
A 1 55 ASP 55 54 54 ASP ASP A . n 
A 1 56 LYS 56 55 55 LYS LYS A . n 
A 1 57 VAL 57 56 56 VAL VAL A . n 
A 1 58 MET 58 57 57 MET MET A . n 
A 1 59 GLU 59 58 58 GLU GLU A . n 
A 1 60 THR 60 59 59 THR THR A . n 
A 1 61 LEU 61 60 60 LEU LEU A . n 
A 1 62 ASP 62 61 61 ASP ASP A . n 
A 1 63 ASN 63 62 62 ASN ASN A . n 
A 1 64 ASP 64 63 63 ASP ASP A . n 
A 1 65 GLY 65 64 64 GLY GLY A . n 
A 1 66 ASP 66 65 65 ASP ASP A . n 
A 1 67 GLY 67 66 66 GLY GLY A . n 
A 1 68 GLU 68 67 67 GLU GLU A . n 
A 1 69 CYS 69 68 68 CYS CYS A . n 
A 1 70 ASP 70 69 69 ASP ASP A . n 
A 1 71 PHE 71 70 70 PHE PHE A . n 
A 1 72 GLN 72 71 71 GLN GLN A . n 
A 1 73 GLU 73 72 72 GLU GLU A . n 
A 1 74 PHE 74 73 73 PHE PHE A . n 
A 1 75 MET 75 74 74 MET MET A . n 
A 1 76 ALA 76 75 75 ALA ALA A . n 
A 1 77 PHE 77 76 76 PHE PHE A . n 
A 1 78 VAL 78 77 77 VAL VAL A . n 
A 1 79 ALA 79 78 78 ALA ALA A . n 
A 1 80 MET 80 79 79 MET MET A . n 
A 1 81 VAL 81 80 80 VAL VAL A . n 
A 1 82 THR 82 81 81 THR THR A . n 
A 1 83 THR 83 82 82 THR THR A . n 
A 1 84 ALA 84 83 83 ALA ALA A . n 
A 1 85 CYS 85 84 84 CYS CYS A . n 
A 1 86 HIS 86 85 85 HIS HIS A . n 
A 1 87 GLU 87 86 86 GLU GLU A . n 
A 1 88 PHE 88 87 87 PHE PHE A . n 
A 1 89 PHE 89 88 88 PHE PHE A . n 
A 1 90 GLU 90 89 89 GLU GLU A . n 
A 1 91 HIS 91 90 90 HIS HIS A . n 
A 1 92 GLU 92 91 91 GLU GLU A . n 
B 1 1  MET 1  0  0  MET MET B . n 
B 1 2  SER 2  1  1  SER SER B . n 
B 1 3  GLU 3  2  2  GLU GLU B . n 
B 1 4  LEU 4  3  3  LEU LEU B . n 
B 1 5  GLU 5  4  4  GLU GLU B . n 
B 1 6  LYS 6  5  5  LYS LYS B . n 
B 1 7  ALA 7  6  6  ALA ALA B . n 
B 1 8  MET 8  7  7  MET MET B . n 
B 1 9  VAL 9  8  8  VAL VAL B . n 
B 1 10 ALA 10 9  9  ALA ALA B . n 
B 1 11 LEU 11 10 10 LEU LEU B . n 
B 1 12 ILE 12 11 11 ILE ILE B . n 
B 1 13 ASP 13 12 12 ASP ASP B . n 
B 1 14 VAL 14 13 13 VAL VAL B . n 
B 1 15 PHE 15 14 14 PHE PHE B . n 
B 1 16 HIS 16 15 15 HIS HIS B . n 
B 1 17 GLN 17 16 16 GLN GLN B . n 
B 1 18 TYR 18 17 17 TYR TYR B . n 
B 1 19 SER 19 18 18 SER SER B . n 
B 1 20 GLY 20 19 19 GLY GLY B . n 
B 1 21 ARG 21 20 20 ARG ARG B . n 
B 1 22 GLU 22 21 21 GLU GLU B . n 
B 1 23 GLY 23 22 22 GLY GLY B . n 
B 1 24 ASP 24 23 23 ASP ASP B . n 
B 1 25 LYS 25 24 24 LYS LYS B . n 
B 1 26 HIS 26 25 25 HIS HIS B . n 
B 1 27 LYS 27 26 26 LYS LYS B . n 
B 1 28 LEU 28 27 27 LEU LEU B . n 
B 1 29 LYS 29 28 28 LYS LYS B . n 
B 1 30 LYS 30 29 29 LYS LYS B . n 
B 1 31 SER 31 30 30 SER SER B . n 
B 1 32 GLU 32 31 31 GLU GLU B . n 
B 1 33 LEU 33 32 32 LEU LEU B . n 
B 1 34 LYS 34 33 33 LYS LYS B . n 
B 1 35 GLU 35 34 34 GLU GLU B . n 
B 1 36 LEU 36 35 35 LEU LEU B . n 
B 1 37 ILE 37 36 36 ILE ILE B . n 
B 1 38 ASN 38 37 37 ASN ASN B . n 
B 1 39 ASN 39 38 38 ASN ASN B . n 
B 1 40 GLU 40 39 39 GLU GLU B . n 
B 1 41 LEU 41 40 40 LEU LEU B . n 
B 1 42 SER 42 41 41 SER SER B . n 
B 1 43 HIS 43 42 42 HIS HIS B . n 
B 1 44 PHE 44 43 43 PHE PHE B . n 
B 1 45 LEU 45 44 44 LEU LEU B . n 
B 1 46 GLU 46 45 45 GLU GLU B . n 
B 1 47 GLU 47 46 46 GLU GLU B . n 
B 1 48 ILE 48 47 47 ILE ILE B . n 
B 1 49 LYS 49 48 48 LYS LYS B . n 
B 1 50 GLU 50 49 49 GLU GLU B . n 
B 1 51 GLN 51 50 50 GLN GLN B . n 
B 1 52 GLU 52 51 51 GLU GLU B . n 
B 1 53 VAL 53 52 52 VAL VAL B . n 
B 1 54 VAL 54 53 53 VAL VAL B . n 
B 1 55 ASP 55 54 54 ASP ASP B . n 
B 1 56 LYS 56 55 55 LYS LYS B . n 
B 1 57 VAL 57 56 56 VAL VAL B . n 
B 1 58 MET 58 57 57 MET MET B . n 
B 1 59 GLU 59 58 58 GLU GLU B . n 
B 1 60 THR 60 59 59 THR THR B . n 
B 1 61 LEU 61 60 60 LEU LEU B . n 
B 1 62 ASP 62 61 61 ASP ASP B . n 
B 1 63 ASN 63 62 62 ASN ASN B . n 
B 1 64 ASP 64 63 63 ASP ASP B . n 
B 1 65 GLY 65 64 64 GLY GLY B . n 
B 1 66 ASP 66 65 65 ASP ASP B . n 
B 1 67 GLY 67 66 66 GLY GLY B . n 
B 1 68 GLU 68 67 67 GLU GLU B . n 
B 1 69 CYS 69 68 68 CYS CYS B . n 
B 1 70 ASP 70 69 69 ASP ASP B . n 
B 1 71 PHE 71 70 70 PHE PHE B . n 
B 1 72 GLN 72 71 71 GLN GLN B . n 
B 1 73 GLU 73 72 72 GLU GLU B . n 
B 1 74 PHE 74 73 73 PHE PHE B . n 
B 1 75 MET 75 74 74 MET MET B . n 
B 1 76 ALA 76 75 75 ALA ALA B . n 
B 1 77 PHE 77 76 76 PHE PHE B . n 
B 1 78 VAL 78 77 77 VAL VAL B . n 
B 1 79 ALA 79 78 78 ALA ALA B . n 
B 1 80 MET 80 79 79 MET MET B . n 
B 1 81 VAL 81 80 80 VAL VAL B . n 
B 1 82 THR 82 81 81 THR THR B . n 
B 1 83 THR 83 82 82 THR THR B . n 
B 1 84 ALA 84 83 83 ALA ALA B . n 
B 1 85 CYS 85 84 84 CYS CYS B . n 
B 1 86 HIS 86 85 85 HIS HIS B . n 
B 1 87 GLU 87 86 86 GLU GLU B . n 
B 1 88 PHE 88 87 87 PHE PHE B . n 
B 1 89 PHE 89 88 88 PHE PHE B . n 
B 1 90 GLU 90 89 89 GLU GLU B . n 
B 1 91 HIS 91 90 90 HIS HIS B . n 
B 1 92 GLU 92 91 ?  ?   ?   B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3630  ? 
1 MORE         -158  ? 
1 'SSA (A^2)'  10120 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? A HIS 16 ? A HIS 15 ? 1_555 ZN ? E ZN . ? A ZN 94 ? 1_555 NE2 ? A HIS 26 ? A HIS 25  ? 1_555 120.1 ? 
2  NE2 ? A HIS 16 ? A HIS 15 ? 1_555 ZN ? E ZN . ? A ZN 94 ? 1_555 NE2 ? B HIS 86 ? B HIS 85  ? 1_555 106.4 ? 
3  NE2 ? A HIS 26 ? A HIS 25 ? 1_555 ZN ? E ZN . ? A ZN 94 ? 1_555 NE2 ? B HIS 86 ? B HIS 85  ? 1_555 97.9  ? 
4  NE2 ? A HIS 16 ? A HIS 15 ? 1_555 ZN ? E ZN . ? A ZN 94 ? 1_555 OE1 ? B GLU 90 ? B GLU 89  ? 1_555 108.7 ? 
5  NE2 ? A HIS 26 ? A HIS 25 ? 1_555 ZN ? E ZN . ? A ZN 94 ? 1_555 OE1 ? B GLU 90 ? B GLU 89  ? 1_555 123.2 ? 
6  NE2 ? B HIS 86 ? B HIS 85 ? 1_555 ZN ? E ZN . ? A ZN 94 ? 1_555 OE1 ? B GLU 90 ? B GLU 89  ? 1_555 94.3  ? 
7  O   ? A SER 19 ? A SER 18 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 O   ? A GLU 22 ? A GLU 21  ? 1_555 104.5 ? 
8  O   ? A SER 19 ? A SER 18 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 O   ? A ASP 24 ? A ASP 23  ? 1_555 77.2  ? 
9  O   ? A GLU 22 ? A GLU 21 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 O   ? A ASP 24 ? A ASP 23  ? 1_555 88.9  ? 
10 O   ? A SER 19 ? A SER 18 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 O   ? A LYS 27 ? A LYS 26  ? 1_555 91.8  ? 
11 O   ? A GLU 22 ? A GLU 21 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 O   ? A LYS 27 ? A LYS 26  ? 1_555 154.8 ? 
12 O   ? A ASP 24 ? A ASP 23 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 O   ? A LYS 27 ? A LYS 26  ? 1_555 75.8  ? 
13 O   ? A SER 19 ? A SER 18 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OE1 ? A GLU 32 ? A GLU 31  ? 1_555 100.5 ? 
14 O   ? A GLU 22 ? A GLU 21 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OE1 ? A GLU 32 ? A GLU 31  ? 1_555 117.0 ? 
15 O   ? A ASP 24 ? A ASP 23 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OE1 ? A GLU 32 ? A GLU 31  ? 1_555 153.3 ? 
16 O   ? A LYS 27 ? A LYS 26 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OE1 ? A GLU 32 ? A GLU 31  ? 1_555 77.7  ? 
17 O   ? A SER 19 ? A SER 18 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OE2 ? A GLU 32 ? A GLU 31  ? 1_555 86.7  ? 
18 O   ? A GLU 22 ? A GLU 21 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OE2 ? A GLU 32 ? A GLU 31  ? 1_555 76.7  ? 
19 O   ? A ASP 24 ? A ASP 23 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OE2 ? A GLU 32 ? A GLU 31  ? 1_555 155.1 ? 
20 O   ? A LYS 27 ? A LYS 26 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OE2 ? A GLU 32 ? A GLU 31  ? 1_555 124.2 ? 
21 OE1 ? A GLU 32 ? A GLU 31 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OE2 ? A GLU 32 ? A GLU 31  ? 1_555 48.2  ? 
22 O   ? A SER 19 ? A SER 18 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 O   ? J HOH .  ? A HOH 123 ? 1_555 167.0 ? 
23 O   ? A GLU 22 ? A GLU 21 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 O   ? J HOH .  ? A HOH 123 ? 1_555 80.6  ? 
24 O   ? A ASP 24 ? A ASP 23 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 O   ? J HOH .  ? A HOH 123 ? 1_555 91.0  ? 
25 O   ? A LYS 27 ? A LYS 26 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 O   ? J HOH .  ? A HOH 123 ? 1_555 79.7  ? 
26 OE1 ? A GLU 32 ? A GLU 31 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 O   ? J HOH .  ? A HOH 123 ? 1_555 87.4  ? 
27 OE2 ? A GLU 32 ? A GLU 31 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 O   ? J HOH .  ? A HOH 123 ? 1_555 106.2 ? 
28 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 OD2 ? A ASP 64 ? A ASP 63  ? 1_555 77.8  ? 
29 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 OD1 ? A ASP 66 ? A ASP 65  ? 1_555 92.8  ? 
30 OD2 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 OD1 ? A ASP 66 ? A ASP 65  ? 1_555 82.1  ? 
31 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 O   ? A GLU 68 ? A GLU 67  ? 1_555 91.6  ? 
32 OD2 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 O   ? A GLU 68 ? A GLU 67  ? 1_555 163.7 ? 
33 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 O   ? A GLU 68 ? A GLU 67  ? 1_555 86.1  ? 
34 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 OE1 ? A GLU 73 ? A GLU 72  ? 1_555 111.8 ? 
35 OD2 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 OE1 ? A GLU 73 ? A GLU 72  ? 1_555 119.2 ? 
36 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 OE1 ? A GLU 73 ? A GLU 72  ? 1_555 149.6 ? 
37 O   ? A GLU 68 ? A GLU 67 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 OE1 ? A GLU 73 ? A GLU 72  ? 1_555 76.1  ? 
38 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 OE2 ? A GLU 73 ? A GLU 72  ? 1_555 85.5  ? 
39 OD2 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 OE2 ? A GLU 73 ? A GLU 72  ? 1_555 73.5  ? 
40 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 OE2 ? A GLU 73 ? A GLU 72  ? 1_555 155.4 ? 
41 O   ? A GLU 68 ? A GLU 67 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 OE2 ? A GLU 73 ? A GLU 72  ? 1_555 118.5 ? 
42 OE1 ? A GLU 73 ? A GLU 72 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 OE2 ? A GLU 73 ? A GLU 72  ? 1_555 49.4  ? 
43 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 O   ? J HOH .  ? A HOH 98  ? 1_555 162.1 ? 
44 OD2 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 O   ? J HOH .  ? A HOH 98  ? 1_555 85.5  ? 
45 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 O   ? J HOH .  ? A HOH 98  ? 1_555 78.5  ? 
46 O   ? A GLU 68 ? A GLU 67 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 O   ? J HOH .  ? A HOH 98  ? 1_555 103.2 ? 
47 OE1 ? A GLU 73 ? A GLU 72 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 O   ? J HOH .  ? A HOH 98  ? 1_555 81.9  ? 
48 OE2 ? A GLU 73 ? A GLU 72 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 O   ? J HOH .  ? A HOH 98  ? 1_555 95.9  ? 
49 NE2 ? A HIS 86 ? A HIS 85 ? 1_555 ZN ? F ZN . ? A ZN 95 ? 1_555 OE2 ? A GLU 90 ? A GLU 89  ? 1_555 103.4 ? 
50 NE2 ? A HIS 86 ? A HIS 85 ? 1_555 ZN ? F ZN . ? A ZN 95 ? 1_555 NE2 ? B HIS 16 ? B HIS 15  ? 1_555 103.2 ? 
51 OE2 ? A GLU 90 ? A GLU 89 ? 1_555 ZN ? F ZN . ? A ZN 95 ? 1_555 NE2 ? B HIS 16 ? B HIS 15  ? 1_555 92.9  ? 
52 NE2 ? A HIS 86 ? A HIS 85 ? 1_555 ZN ? F ZN . ? A ZN 95 ? 1_555 NE2 ? B HIS 26 ? B HIS 25  ? 1_555 90.7  ? 
53 OE2 ? A GLU 90 ? A GLU 89 ? 1_555 ZN ? F ZN . ? A ZN 95 ? 1_555 NE2 ? B HIS 26 ? B HIS 25  ? 1_555 138.7 ? 
54 NE2 ? B HIS 16 ? B HIS 15 ? 1_555 ZN ? F ZN . ? A ZN 95 ? 1_555 NE2 ? B HIS 26 ? B HIS 25  ? 1_555 121.8 ? 
55 NE2 ? A HIS 86 ? A HIS 85 ? 1_555 ZN ? F ZN . ? A ZN 95 ? 1_555 OE1 ? A GLU 90 ? A GLU 89  ? 1_555 82.5  ? 
56 OE2 ? A GLU 90 ? A GLU 89 ? 1_555 ZN ? F ZN . ? A ZN 95 ? 1_555 OE1 ? A GLU 90 ? A GLU 89  ? 1_555 53.7  ? 
57 NE2 ? B HIS 16 ? B HIS 15 ? 1_555 ZN ? F ZN . ? A ZN 95 ? 1_555 OE1 ? A GLU 90 ? A GLU 89  ? 1_555 146.1 ? 
58 NE2 ? B HIS 26 ? B HIS 25 ? 1_555 ZN ? F ZN . ? A ZN 95 ? 1_555 OE1 ? A GLU 90 ? A GLU 89  ? 1_555 91.1  ? 
59 O   ? B SER 19 ? B SER 18 ? 1_555 CA ? G CA . ? B CA 92 ? 1_555 O   ? B GLU 22 ? B GLU 21  ? 1_555 101.5 ? 
60 O   ? B SER 19 ? B SER 18 ? 1_555 CA ? G CA . ? B CA 92 ? 1_555 O   ? B ASP 24 ? B ASP 23  ? 1_555 80.1  ? 
61 O   ? B GLU 22 ? B GLU 21 ? 1_555 CA ? G CA . ? B CA 92 ? 1_555 O   ? B ASP 24 ? B ASP 23  ? 1_555 81.7  ? 
62 O   ? B SER 19 ? B SER 18 ? 1_555 CA ? G CA . ? B CA 92 ? 1_555 O   ? B LYS 27 ? B LYS 26  ? 1_555 89.1  ? 
63 O   ? B GLU 22 ? B GLU 21 ? 1_555 CA ? G CA . ? B CA 92 ? 1_555 O   ? B LYS 27 ? B LYS 26  ? 1_555 161.2 ? 
64 O   ? B ASP 24 ? B ASP 23 ? 1_555 CA ? G CA . ? B CA 92 ? 1_555 O   ? B LYS 27 ? B LYS 26  ? 1_555 85.0  ? 
65 O   ? B SER 19 ? B SER 18 ? 1_555 CA ? G CA . ? B CA 92 ? 1_555 OE1 ? B GLU 32 ? B GLU 31  ? 1_555 95.1  ? 
66 O   ? B GLU 22 ? B GLU 21 ? 1_555 CA ? G CA . ? B CA 92 ? 1_555 OE1 ? B GLU 32 ? B GLU 31  ? 1_555 114.7 ? 
67 O   ? B ASP 24 ? B ASP 23 ? 1_555 CA ? G CA . ? B CA 92 ? 1_555 OE1 ? B GLU 32 ? B GLU 31  ? 1_555 163.6 ? 
68 O   ? B LYS 27 ? B LYS 26 ? 1_555 CA ? G CA . ? B CA 92 ? 1_555 OE1 ? B GLU 32 ? B GLU 31  ? 1_555 79.2  ? 
69 O   ? B SER 19 ? B SER 18 ? 1_555 CA ? G CA . ? B CA 92 ? 1_555 OE2 ? B GLU 32 ? B GLU 31  ? 1_555 74.7  ? 
70 O   ? B GLU 22 ? B GLU 21 ? 1_555 CA ? G CA . ? B CA 92 ? 1_555 OE2 ? B GLU 32 ? B GLU 31  ? 1_555 74.5  ? 
71 O   ? B ASP 24 ? B ASP 23 ? 1_555 CA ? G CA . ? B CA 92 ? 1_555 OE2 ? B GLU 32 ? B GLU 31  ? 1_555 140.7 ? 
72 O   ? B LYS 27 ? B LYS 26 ? 1_555 CA ? G CA . ? B CA 92 ? 1_555 OE2 ? B GLU 32 ? B GLU 31  ? 1_555 123.7 ? 
73 OE1 ? B GLU 32 ? B GLU 31 ? 1_555 CA ? G CA . ? B CA 92 ? 1_555 OE2 ? B GLU 32 ? B GLU 31  ? 1_555 50.2  ? 
74 O   ? B SER 19 ? B SER 18 ? 1_555 CA ? G CA . ? B CA 92 ? 1_555 O   ? K HOH .  ? B HOH 132 ? 1_555 163.6 ? 
75 O   ? B GLU 22 ? B GLU 21 ? 1_555 CA ? G CA . ? B CA 92 ? 1_555 O   ? K HOH .  ? B HOH 132 ? 1_555 88.0  ? 
76 O   ? B ASP 24 ? B ASP 23 ? 1_555 CA ? G CA . ? B CA 92 ? 1_555 O   ? K HOH .  ? B HOH 132 ? 1_555 88.3  ? 
77 O   ? B LYS 27 ? B LYS 26 ? 1_555 CA ? G CA . ? B CA 92 ? 1_555 O   ? K HOH .  ? B HOH 132 ? 1_555 78.3  ? 
78 OE1 ? B GLU 32 ? B GLU 31 ? 1_555 CA ? G CA . ? B CA 92 ? 1_555 O   ? K HOH .  ? B HOH 132 ? 1_555 92.9  ? 
79 OE2 ? B GLU 32 ? B GLU 31 ? 1_555 CA ? G CA . ? B CA 92 ? 1_555 O   ? K HOH .  ? B HOH 132 ? 1_555 121.0 ? 
80 OD2 ? B ASP 64 ? B ASP 63 ? 1_555 CA ? H CA . ? B CA 93 ? 1_555 OD1 ? B ASP 66 ? B ASP 65  ? 1_555 88.5  ? 
81 OD2 ? B ASP 64 ? B ASP 63 ? 1_555 CA ? H CA . ? B CA 93 ? 1_555 O   ? B GLU 68 ? B GLU 67  ? 1_555 163.7 ? 
82 OD1 ? B ASP 66 ? B ASP 65 ? 1_555 CA ? H CA . ? B CA 93 ? 1_555 O   ? B GLU 68 ? B GLU 67  ? 1_555 75.3  ? 
83 OD2 ? B ASP 64 ? B ASP 63 ? 1_555 CA ? H CA . ? B CA 93 ? 1_555 OE1 ? B GLU 73 ? B GLU 72  ? 1_555 120.0 ? 
84 OD1 ? B ASP 66 ? B ASP 65 ? 1_555 CA ? H CA . ? B CA 93 ? 1_555 OE1 ? B GLU 73 ? B GLU 72  ? 1_555 130.4 ? 
85 O   ? B GLU 68 ? B GLU 67 ? 1_555 CA ? H CA . ? B CA 93 ? 1_555 OE1 ? B GLU 73 ? B GLU 72  ? 1_555 73.8  ? 
86 OD2 ? B ASP 64 ? B ASP 63 ? 1_555 CA ? H CA . ? B CA 93 ? 1_555 OE2 ? B GLU 73 ? B GLU 72  ? 1_555 73.6  ? 
87 OD1 ? B ASP 66 ? B ASP 65 ? 1_555 CA ? H CA . ? B CA 93 ? 1_555 OE2 ? B GLU 73 ? B GLU 72  ? 1_555 157.3 ? 
88 O   ? B GLU 68 ? B GLU 67 ? 1_555 CA ? H CA . ? B CA 93 ? 1_555 OE2 ? B GLU 73 ? B GLU 72  ? 1_555 122.6 ? 
89 OE1 ? B GLU 73 ? B GLU 72 ? 1_555 CA ? H CA . ? B CA 93 ? 1_555 OE2 ? B GLU 73 ? B GLU 72  ? 1_555 53.9  ? 
90 OD2 ? B ASP 64 ? B ASP 63 ? 1_555 CA ? H CA . ? B CA 93 ? 1_555 O   ? K HOH .  ? B HOH 152 ? 1_555 87.1  ? 
91 OD1 ? B ASP 66 ? B ASP 65 ? 1_555 CA ? H CA . ? B CA 93 ? 1_555 O   ? K HOH .  ? B HOH 152 ? 1_555 68.3  ? 
92 O   ? B GLU 68 ? B GLU 67 ? 1_555 CA ? H CA . ? B CA 93 ? 1_555 O   ? K HOH .  ? B HOH 152 ? 1_555 89.1  ? 
93 OE1 ? B GLU 73 ? B GLU 72 ? 1_555 CA ? H CA . ? B CA 93 ? 1_555 O   ? K HOH .  ? B HOH 152 ? 1_555 73.4  ? 
94 OE2 ? B GLU 73 ? B GLU 72 ? 1_555 CA ? H CA . ? B CA 93 ? 1_555 O   ? K HOH .  ? B HOH 152 ? 1_555 96.3  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-04-14 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 3.4909  1.3063  11.2172  0.0213 0.0611 0.1645 0.0316  0.0476  -0.0331 3.5060 1.3062  3.7077  0.1347  0.9526  -0.5408 
-0.0327 -0.0902 0.1229  -0.6434 0.1232  0.1279  0.2013  -0.1913 -0.1825 'X-RAY DIFFRACTION' 
2 ? refined 14.8559 -4.2781 18.8157  0.0044 0.1605 0.1323 0.0186  -0.0149 -0.0492 2.8770 9.6249  8.0327  1.4541  1.3019  -3.6117 
-0.0309 0.0166  0.0143  0.1136  -0.0777 -0.0879 0.0439  0.0469  0.2555  'X-RAY DIFFRACTION' 
3 ? refined 9.8553  -8.1853 4.4109   0.0235 0.0323 0.2200 0.0146  -0.0024 0.0402  3.7703 11.7509 6.6904  4.0985  1.1978  4.9513  
-0.0956 0.1228  -0.0272 -0.2749 -0.4316 -0.1249 -0.1076 0.3973  0.1502  'X-RAY DIFFRACTION' 
4 ? refined 0.2938  -7.4914 -0.5663  0.2099 0.0019 0.3431 -0.0456 0.0019  0.0139  7.3622 4.6720  34.1955 -0.9621 -4.1894 10.4515 
0.0774  -0.4770 0.3997  -0.2335 -0.0793 0.3899  -0.0363 0.5034  -1.2512 'X-RAY DIFFRACTION' 
5 ? refined 8.9521  -2.3873 -15.9526 0.0474 0.0826 0.1284 0.0473  -0.0083 -0.0264 4.0894 2.9747  6.2308  -0.9737 -1.3903 0.4139  
0.0877  -0.0523 -0.0354 0.3216  -0.1056 -0.0893 -0.2321 0.3046  0.4635  'X-RAY DIFFRACTION' 
6 ? refined 9.4895  3.2555  -3.6774  0.0457 0.0800 0.1958 0.0000  0.0140  0.0245  4.4574 16.4952 8.7640  -4.4098 -0.9959 7.4894  
0.1671  -0.3580 0.1909  0.1796  0.2994  -0.0908 0.2350  -0.0367 0.1575  'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A A 45 ? 0  A 1  A 46 'X-RAY DIFFRACTION' ? 
2 2 A A 66 ? 46 A 47 A 67 'X-RAY DIFFRACTION' ? 
3 3 A A 91 ? 67 A 68 A 92 'X-RAY DIFFRACTION' ? 
4 4 B B 16 ? 0  B 1  B 17 'X-RAY DIFFRACTION' ? 
5 5 B B 66 ? 17 B 18 B 67 'X-RAY DIFFRACTION' ? 
6 6 B B 90 ? 67 B 68 B 91 'X-RAY DIFFRACTION' ? 
# 
_phasing.method   MR 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
XSCALE      .     ?                    package 'Wolfgang Kabsch' ?                        'data scaling'    
http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/xscale_program.html ?          ? 1 
MOLREP      .     ?                    other   'A. Vagin'        alexei@ysbl.york.ac.uk   phasing           
http://www.ccp4.ac.uk/dist/html/molrep.html                        Fortran_77 ? 2 
REFMAC      .     ?                    program 'Murshudov, G.N.' ccp4@dl.ac.uk            refinement        
http://www.ccp4.ac.uk/main.html                                    Fortran_77 ? 3 
PDB_EXTRACT 3.005 'September 10, 2007' package PDB               sw-help@rcsb.rutgers.edu 'data extraction' 
http://pdb.rutgers.edu/software/                                   C++        ? 4 
XDS         .     ?                    ?       ?                 ?                        'data reduction'  ? ?          ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OE2 A GLU 46  ? ? NZ A LYS 48  ? ? 2.15 
2 1 O   A HOH 115 ? ? O  A HOH 167 ? ? 2.19 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O4 B PGE 94 ? ? 1_555 O A HOH 124 ? ? 2_555 2.13 
2 1 O4 B PGE 94 ? ? 1_555 O A HOH 125 ? ? 2_555 2.16 
# 
_pdbx_unobs_or_zero_occ_residues.id               1 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_residues.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id     B 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id     GLU 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id      91 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_residues.label_asym_id    B 
_pdbx_unobs_or_zero_occ_residues.label_comp_id    GLU 
_pdbx_unobs_or_zero_occ_residues.label_seq_id     92 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CALCIUM ION'        CA  
3 'ZINC ION'           ZN  
4 'TRIETHYLENE GLYCOL' PGE 
5 water                HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 CA  1  92  1   CA  CA  A . 
D 2 CA  1  93  2   CA  CA  A . 
E 3 ZN  1  94  5   ZN  ZN  A . 
F 3 ZN  1  95  6   ZN  ZN  A . 
G 2 CA  1  92  3   CA  CA  B . 
H 2 CA  1  93  4   CA  CA  B . 
I 4 PGE 1  94  1   PGE PGE B . 
J 5 HOH 1  96  1   HOH HOH A . 
J 5 HOH 2  97  2   HOH HOH A . 
J 5 HOH 3  98  4   HOH HOH A . 
J 5 HOH 4  99  5   HOH HOH A . 
J 5 HOH 5  100 7   HOH HOH A . 
J 5 HOH 6  101 8   HOH HOH A . 
J 5 HOH 7  102 10  HOH HOH A . 
J 5 HOH 8  103 11  HOH HOH A . 
J 5 HOH 9  104 13  HOH HOH A . 
J 5 HOH 10 105 15  HOH HOH A . 
J 5 HOH 11 106 16  HOH HOH A . 
J 5 HOH 12 107 20  HOH HOH A . 
J 5 HOH 13 108 21  HOH HOH A . 
J 5 HOH 14 109 23  HOH HOH A . 
J 5 HOH 15 110 24  HOH HOH A . 
J 5 HOH 16 111 25  HOH HOH A . 
J 5 HOH 17 112 30  HOH HOH A . 
J 5 HOH 18 113 31  HOH HOH A . 
J 5 HOH 19 114 32  HOH HOH A . 
J 5 HOH 20 115 40  HOH HOH A . 
J 5 HOH 21 116 41  HOH HOH A . 
J 5 HOH 22 117 42  HOH HOH A . 
J 5 HOH 23 118 46  HOH HOH A . 
J 5 HOH 24 119 47  HOH HOH A . 
J 5 HOH 25 120 48  HOH HOH A . 
J 5 HOH 26 121 50  HOH HOH A . 
J 5 HOH 27 122 51  HOH HOH A . 
J 5 HOH 28 123 53  HOH HOH A . 
J 5 HOH 29 124 54  HOH HOH A . 
J 5 HOH 30 125 55  HOH HOH A . 
J 5 HOH 31 126 56  HOH HOH A . 
J 5 HOH 32 127 58  HOH HOH A . 
J 5 HOH 33 128 61  HOH HOH A . 
J 5 HOH 34 129 67  HOH HOH A . 
J 5 HOH 35 130 68  HOH HOH A . 
J 5 HOH 36 131 73  HOH HOH A . 
J 5 HOH 37 132 75  HOH HOH A . 
J 5 HOH 38 133 81  HOH HOH A . 
J 5 HOH 39 134 82  HOH HOH A . 
J 5 HOH 40 135 83  HOH HOH A . 
J 5 HOH 41 136 85  HOH HOH A . 
J 5 HOH 42 137 86  HOH HOH A . 
J 5 HOH 43 138 87  HOH HOH A . 
J 5 HOH 44 139 88  HOH HOH A . 
J 5 HOH 45 140 89  HOH HOH A . 
J 5 HOH 46 141 90  HOH HOH A . 
J 5 HOH 47 142 91  HOH HOH A . 
J 5 HOH 48 143 92  HOH HOH A . 
J 5 HOH 49 144 95  HOH HOH A . 
J 5 HOH 50 145 96  HOH HOH A . 
J 5 HOH 51 146 97  HOH HOH A . 
J 5 HOH 52 147 99  HOH HOH A . 
J 5 HOH 53 148 102 HOH HOH A . 
J 5 HOH 54 149 106 HOH HOH A . 
J 5 HOH 55 150 108 HOH HOH A . 
J 5 HOH 56 151 109 HOH HOH A . 
J 5 HOH 57 152 110 HOH HOH A . 
J 5 HOH 58 153 112 HOH HOH A . 
J 5 HOH 59 154 113 HOH HOH A . 
J 5 HOH 60 155 114 HOH HOH A . 
J 5 HOH 61 156 123 HOH HOH A . 
J 5 HOH 62 157 124 HOH HOH A . 
J 5 HOH 63 158 125 HOH HOH A . 
J 5 HOH 64 159 130 HOH HOH A . 
J 5 HOH 65 160 132 HOH HOH A . 
J 5 HOH 66 161 134 HOH HOH A . 
J 5 HOH 67 162 136 HOH HOH A . 
J 5 HOH 68 163 137 HOH HOH A . 
J 5 HOH 69 164 140 HOH HOH A . 
J 5 HOH 70 165 141 HOH HOH A . 
J 5 HOH 71 166 147 HOH HOH A . 
J 5 HOH 72 167 152 HOH HOH A . 
J 5 HOH 73 168 72  HOH HOH A . 
K 5 HOH 1  107 17  HOH HOH B . 
K 5 HOH 2  108 36  HOH HOH B . 
K 5 HOH 3  109 111 HOH HOH B . 
K 5 HOH 4  110 139 HOH HOH B . 
K 5 HOH 5  111 3   HOH HOH B . 
K 5 HOH 6  112 6   HOH HOH B . 
K 5 HOH 7  113 9   HOH HOH B . 
K 5 HOH 8  114 12  HOH HOH B . 
K 5 HOH 9  115 14  HOH HOH B . 
K 5 HOH 10 116 18  HOH HOH B . 
K 5 HOH 11 117 19  HOH HOH B . 
K 5 HOH 12 118 22  HOH HOH B . 
K 5 HOH 13 119 26  HOH HOH B . 
K 5 HOH 14 120 27  HOH HOH B . 
K 5 HOH 15 121 28  HOH HOH B . 
K 5 HOH 16 122 29  HOH HOH B . 
K 5 HOH 17 123 33  HOH HOH B . 
K 5 HOH 18 124 34  HOH HOH B . 
K 5 HOH 19 125 35  HOH HOH B . 
K 5 HOH 20 126 37  HOH HOH B . 
K 5 HOH 21 127 38  HOH HOH B . 
K 5 HOH 22 128 39  HOH HOH B . 
K 5 HOH 23 129 43  HOH HOH B . 
K 5 HOH 24 130 44  HOH HOH B . 
K 5 HOH 25 131 45  HOH HOH B . 
K 5 HOH 26 132 49  HOH HOH B . 
K 5 HOH 27 133 52  HOH HOH B . 
K 5 HOH 28 134 57  HOH HOH B . 
K 5 HOH 29 135 59  HOH HOH B . 
K 5 HOH 30 136 60  HOH HOH B . 
K 5 HOH 31 137 62  HOH HOH B . 
K 5 HOH 32 138 63  HOH HOH B . 
K 5 HOH 33 139 64  HOH HOH B . 
K 5 HOH 34 140 65  HOH HOH B . 
K 5 HOH 35 141 66  HOH HOH B . 
K 5 HOH 36 142 69  HOH HOH B . 
K 5 HOH 37 143 70  HOH HOH B . 
K 5 HOH 38 144 71  HOH HOH B . 
K 5 HOH 39 145 74  HOH HOH B . 
K 5 HOH 40 146 76  HOH HOH B . 
K 5 HOH 41 147 77  HOH HOH B . 
K 5 HOH 42 148 78  HOH HOH B . 
K 5 HOH 43 149 79  HOH HOH B . 
K 5 HOH 44 150 80  HOH HOH B . 
K 5 HOH 45 151 84  HOH HOH B . 
K 5 HOH 46 152 93  HOH HOH B . 
K 5 HOH 47 153 94  HOH HOH B . 
K 5 HOH 48 154 98  HOH HOH B . 
K 5 HOH 49 155 100 HOH HOH B . 
K 5 HOH 50 156 101 HOH HOH B . 
K 5 HOH 51 157 103 HOH HOH B . 
K 5 HOH 52 158 104 HOH HOH B . 
K 5 HOH 53 159 105 HOH HOH B . 
K 5 HOH 54 160 107 HOH HOH B . 
K 5 HOH 55 161 115 HOH HOH B . 
K 5 HOH 56 162 116 HOH HOH B . 
K 5 HOH 57 163 117 HOH HOH B . 
K 5 HOH 58 164 118 HOH HOH B . 
K 5 HOH 59 165 119 HOH HOH B . 
K 5 HOH 60 166 120 HOH HOH B . 
K 5 HOH 61 167 121 HOH HOH B . 
K 5 HOH 62 168 122 HOH HOH B . 
K 5 HOH 63 169 126 HOH HOH B . 
K 5 HOH 64 170 127 HOH HOH B . 
K 5 HOH 65 171 128 HOH HOH B . 
K 5 HOH 66 172 129 HOH HOH B . 
K 5 HOH 67 173 131 HOH HOH B . 
K 5 HOH 68 174 133 HOH HOH B . 
K 5 HOH 69 175 135 HOH HOH B . 
K 5 HOH 70 176 138 HOH HOH B . 
K 5 HOH 71 177 142 HOH HOH B . 
K 5 HOH 72 178 143 HOH HOH B . 
K 5 HOH 73 179 144 HOH HOH B . 
K 5 HOH 74 180 145 HOH HOH B . 
K 5 HOH 75 181 146 HOH HOH B . 
K 5 HOH 76 182 148 HOH HOH B . 
K 5 HOH 77 183 149 HOH HOH B . 
K 5 HOH 78 184 150 HOH HOH B . 
K 5 HOH 79 185 151 HOH HOH B . 
#