data_3D77
# 
_entry.id   3D77 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3D77         
RCSB  RCSB047678   
WWPDB D_1000047678 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2H8V 'The apo form of the same native protein at pH 5.5'                                                               
unspecified 
PDB 3CDN 'The apo form of the same native protein soaked at pH 4.0'                                                        
unspecified 
PDB 3BJH 'The same native protein in complex with the n-butyl benzene sulfonamide at pH 5.5'                               
unspecified 
PDB 3CAB 'The same native protein in complex with the n-butyl benzene sulfonamide soaked at pH 7.0'                        
unspecified 
PDB 3BFA 'The same native protein in complex with the queen mandibular pheromone at pH 5.5'                                
unspecified 
PDB 3BFB 'The same native protein in complex with the 9-keto-2(E)-decenoic acid at pH 5.5'                                 
unspecified 
PDB 3BFH 'The same native protein in complex with the hexadecanoic acid at pH 5.5'                                         
unspecified 
PDB 3CYZ 'The same native protein in complex with the 9-keto-2(E)-decenoic acid at pH 7.0'                                 
unspecified 
PDB 3CZ0 'The same native protein in complex with the queen mandibular pheromone at pH 7.0'                                
unspecified 
PDB 3CZ1 'The same native protein in complex with the n-butyl benzene sulfonamide at pH 7.0'                               
unspecified 
PDB 3CZ2 'The apo form of the same native protein at pH 7.0'                                                               
unspecified 
PDB 3D73 'The D35A mutant protein in complex with the n-butyl benzene sulfonamide at pH 7.0'                               
unspecified 
PDB 3D74 'The D35A mutant protein in complex with the n-butyl benzene sulfonamide soaked at pH 5.5'                        
unspecified 
PDB 3D75 'The same mutant D35N protein in complex with the n-butyl benzene sulfonamide at pH 5.5'                          
unspecified 
PDB 3D76 'The same mutant D35N protein in complex with the n-butyl benzene sulfonamide soaked at pH 7.0'                   
unspecified 
PDB 3D78 'The dimeric structure of the same mutant D35N protein in complex with the n-butyl benzene sulfonamide at pH 7.0' 
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3D77 
_pdbx_database_status.recvd_initial_deposition_date   2008-05-20 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pesenti, M.E.'   1 
'Spinelli, S.'    2 
'Bezirard, V.'    3 
'Briand, L.'      4 
'Pernollet, J.C.' 5 
'Tegoni, M.'      6 
'Cambillau, C.'   7 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Queen bee pheromone binding protein pH-induced domain swapping favors pheromone release' J.Mol.Biol.       390 981 990 
2009 JMOBAK UK 0022-2836 0070 ? 19481550 10.1016/j.jmb.2009.05.067 
1       'The pH Driven Domain-swapping Dimerization of Queen Bee ASP1 Favours Pheromone Release'  'To be Published' ?   ?   ?   ? 
?      ?  ?         0353 ? ?        ?                         
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Pesenti, M.E.'   1  
primary 'Spinelli, S.'    2  
primary 'Bezirard, V.'    3  
primary 'Briand, L.'      4  
primary 'Pernollet, J.C.' 5  
primary 'Campanacci, V.'  6  
primary 'Tegoni, M.'      7  
primary 'Cambillau, C.'   8  
1       'Pesenti, M.E.'   9  
1       'Spinelli, S.'    10 
1       'Bezirard, V.'    11 
1       'Briand, L.'      12 
1       'Pernollet, J.C.' 13 
1       'Tegoni, M.'      14 
1       'Cambillau, C.'   15 
# 
_cell.entry_id           3D77 
_cell.length_a           79.215 
_cell.length_b           83.999 
_cell.length_c           47.540 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3D77 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Pheromone-binding protein ASP1' 13193.804 1   ? D35N 'UNP residues 26-144' ? 
2 non-polymer syn 'SODIUM ION'                     22.990    1   ? ?    ?                     ? 
3 non-polymer syn N-BUTYL-BENZENESULFONAMIDE       213.297   1   ? ?    ?                     ? 
4 non-polymer syn 1,2-ETHANEDIOL                   62.068    6   ? ?    ?                     ? 
5 water       nat water                            18.015    115 ? ?    ?                     ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;APDWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVNKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQE
RAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
;
_entity_poly.pdbx_seq_one_letter_code_can   
;APDWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVNKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQE
RAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   PRO n 
1 3   ASP n 
1 4   TRP n 
1 5   VAL n 
1 6   PRO n 
1 7   PRO n 
1 8   GLU n 
1 9   VAL n 
1 10  PHE n 
1 11  ASP n 
1 12  LEU n 
1 13  VAL n 
1 14  ALA n 
1 15  GLU n 
1 16  ASP n 
1 17  LYS n 
1 18  ALA n 
1 19  ARG n 
1 20  CYS n 
1 21  MET n 
1 22  SER n 
1 23  GLU n 
1 24  HIS n 
1 25  GLY n 
1 26  THR n 
1 27  THR n 
1 28  GLN n 
1 29  ALA n 
1 30  GLN n 
1 31  ILE n 
1 32  ASP n 
1 33  ASP n 
1 34  VAL n 
1 35  ASN n 
1 36  LYS n 
1 37  GLY n 
1 38  ASN n 
1 39  LEU n 
1 40  VAL n 
1 41  ASN n 
1 42  GLU n 
1 43  PRO n 
1 44  SER n 
1 45  ILE n 
1 46  THR n 
1 47  CYS n 
1 48  TYR n 
1 49  MET n 
1 50  TYR n 
1 51  CYS n 
1 52  LEU n 
1 53  LEU n 
1 54  GLU n 
1 55  ALA n 
1 56  PHE n 
1 57  SER n 
1 58  LEU n 
1 59  VAL n 
1 60  ASP n 
1 61  ASP n 
1 62  GLU n 
1 63  ALA n 
1 64  ASN n 
1 65  VAL n 
1 66  ASP n 
1 67  GLU n 
1 68  ASP n 
1 69  ILE n 
1 70  MET n 
1 71  LEU n 
1 72  GLY n 
1 73  LEU n 
1 74  LEU n 
1 75  PRO n 
1 76  ASP n 
1 77  GLN n 
1 78  LEU n 
1 79  GLN n 
1 80  GLU n 
1 81  ARG n 
1 82  ALA n 
1 83  GLN n 
1 84  SER n 
1 85  VAL n 
1 86  MET n 
1 87  GLY n 
1 88  LYS n 
1 89  CYS n 
1 90  LEU n 
1 91  PRO n 
1 92  THR n 
1 93  SER n 
1 94  GLY n 
1 95  SER n 
1 96  ASP n 
1 97  ASN n 
1 98  CYS n 
1 99  ASN n 
1 100 LYS n 
1 101 ILE n 
1 102 TYR n 
1 103 ASN n 
1 104 LEU n 
1 105 ALA n 
1 106 LYS n 
1 107 CYS n 
1 108 VAL n 
1 109 GLN n 
1 110 GLU n 
1 111 SER n 
1 112 ALA n 
1 113 PRO n 
1 114 ASP n 
1 115 VAL n 
1 116 TRP n 
1 117 PHE n 
1 118 VAL n 
1 119 ILE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               honeybee 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Apis mellifera' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     7460 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Pichia pastoris' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     4922 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pHIL-D2 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q9U9J6_APIME 
_struct_ref.pdbx_db_accession          Q9U9J6 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;APDWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVDKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQE
RAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
;
_struct_ref.pdbx_align_begin           26 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3D77 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 119 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9U9J6 
_struct_ref_seq.db_align_beg                  26 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  144 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       119 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             3D77 
_struct_ref_seq_dif.mon_id                       ASN 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      35 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   Q9U9J6 
_struct_ref_seq_dif.db_mon_id                    ASP 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          60 
_struct_ref_seq_dif.details                      ENGINEERED 
_struct_ref_seq_dif.pdbx_auth_seq_num            35 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                    ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                   ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                 ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'            ?                 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                   ?                 'C3 H7 N O2 S'   121.158 
EDO non-polymer         . 1,2-ETHANEDIOL             'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE                  ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'            ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                    ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                  ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                      ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                 ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                    ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                     ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                 ?                 'C5 H11 N O2 S'  149.211 
NA  non-polymer         . 'SODIUM ION'               ?                 'Na 1'           22.990  
NBB non-polymer         . N-BUTYL-BENZENESULFONAMIDE ?                 'C10 H15 N O2 S' 213.297 
PHE 'L-peptide linking' y PHENYLALANINE              ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                    ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                     ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                  ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                 ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                   ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                     ?                 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3D77 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.00 
_exptl_crystal.density_percent_sol   58.96 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.0 
_exptl_crystal_grow.pdbx_details    
;1.3M ammonium sulfate, 67mM sodium citrate, 33mM SPG buffer, 8.3% PEG1500, pH5.5, crystal was soaked in the same condition at pH4.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2008-02-07 
_diffrn_detector.details                'Tiroidal mirror' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si 111' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID29' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID29 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.979 
# 
_reflns.entry_id                     3D77 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            1.70 
_reflns.d_resolution_low             57.64 
_reflns.number_all                   17650 
_reflns.number_obs                   17650 
_reflns.percent_possible_obs         99.1 
_reflns.pdbx_Rmerge_I_obs            0.047 
_reflns.pdbx_Rsym_value              0.047 
_reflns.pdbx_netI_over_sigmaI        26.4 
_reflns.B_iso_Wilson_estimate        24.53 
_reflns.pdbx_redundancy              6.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.70 
_reflns_shell.d_res_low              1.79 
_reflns_shell.percent_possible_all   99.6 
_reflns_shell.Rmerge_I_obs           0.349 
_reflns_shell.pdbx_Rsym_value        0.349 
_reflns_shell.meanI_over_sigI_obs    4.5 
_reflns_shell.pdbx_redundancy        7.0 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2545 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3D77 
_refine.ls_number_reflns_obs                     16595 
_refine.ls_number_reflns_all                     16595 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.00 
_refine.ls_d_res_high                            1.70 
_refine.ls_percent_reflns_obs                    98.96 
_refine.ls_R_factor_obs                          0.16309 
_refine.ls_R_factor_all                          0.16309 
_refine.ls_R_factor_R_work                       0.16133 
_refine.ls_R_factor_R_free                       0.19131 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.9 
_refine.ls_number_reflns_R_free                  1044 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.964 
_refine.correlation_coeff_Fo_to_Fc_free          0.955 
_refine.B_iso_mean                               24.694 
_refine.aniso_B[1][1]                            -0.63 
_refine.aniso_B[2][2]                            0.44 
_refine.aniso_B[3][3]                            0.19 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 3D75' 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.115 
_refine.pdbx_overall_ESU_R_Free                  0.086 
_refine.overall_SU_ML                            0.051 
_refine.overall_SU_B                             3.339 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3D77 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   0.086 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        947 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         39 
_refine_hist.number_atoms_solvent             115 
_refine_hist.number_atoms_total               1101 
_refine_hist.d_res_high                       1.70 
_refine_hist.d_res_low                        30.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.014  0.022  ? 1009 'X-RAY DIFFRACTION' ? 
r_bond_other_d           0.002  0.020  ? 683  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      2.211  2.001  ? 1379 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        1.918  3.007  ? 1685 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   13.982 5.000  ? 134  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   35.677 26.809 ? 47   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   14.449 15.000 ? 171  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   7.465  15.000 ? 3    'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.104  0.200  ? 156  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.013  0.020  ? 1119 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       0.001  0.020  ? 174  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.269  0.200  ? 259  'X-RAY DIFFRACTION' ? 
r_nbd_other              0.207  0.200  ? 683  'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.192  0.200  ? 492  'X-RAY DIFFRACTION' ? 
r_nbtor_other            0.096  0.200  ? 491  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.232  0.200  ? 66   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.394  0.200  ? 19   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     0.258  0.200  ? 30   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.284  0.200  ? 14   'X-RAY DIFFRACTION' ? 
r_mcbond_it              1.346  1.500  ? 612  'X-RAY DIFFRACTION' ? 
r_mcbond_other           0.635  1.500  ? 240  'X-RAY DIFFRACTION' ? 
r_mcangle_it             2.086  2.000  ? 1006 'X-RAY DIFFRACTION' ? 
r_scbond_it              3.086  3.000  ? 409  'X-RAY DIFFRACTION' ? 
r_scangle_it             3.928  4.500  ? 363  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr       3.941  3.000  ? 1763 'X-RAY DIFFRACTION' ? 
r_sphericity_free        7.750  3.000  ? 120  'X-RAY DIFFRACTION' ? 
r_sphericity_bonded      3.807  3.000  ? 1668 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.700 
_refine_ls_shell.d_res_low                        1.744 
_refine_ls_shell.number_reflns_R_work             1206 
_refine_ls_shell.R_factor_R_work                  0.162 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.212 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             85 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                1204 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3D77 
_struct.title                     
'Crystal structure of a pheromone binding protein mutant D35N, from Apis mellifera, soaked at pH 4.0' 
_struct.pdbx_descriptor           'Pheromone Binding Protein ASP1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3D77 
_struct_keywords.pdbx_keywords   'Pheromone binding protein' 
_struct_keywords.text            
'Pheromone binding protein, Honey bee, Apis mellifera, signal transduction, queen mandibular protein, pH' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PRO A 6  ? GLY A 25  ? PRO A 6  GLY A 25  1 ? 20 
HELX_P HELX_P2 2 THR A 27 ? LYS A 36  ? THR A 27 LYS A 36  1 ? 10 
HELX_P HELX_P3 3 GLU A 42 ? PHE A 56  ? GLU A 42 PHE A 56  1 ? 15 
HELX_P HELX_P4 4 ASP A 66 ? GLY A 72  ? ASP A 66 GLY A 72  1 ? 7  
HELX_P HELX_P5 5 LEU A 78 ? LEU A 90  ? LEU A 78 LEU A 90  1 ? 13 
HELX_P HELX_P6 6 ASP A 96 ? ALA A 112 ? ASP A 96 ALA A 112 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 20 SG  ? ? ? 1_555 A CYS 51  SG ? ? A CYS 20 A CYS 51  1_555 ? ? ? ? ? ? ? 2.065 ? 
disulf2 disulf ? ? A CYS 47 SG  ? ? ? 1_555 A CYS 98  SG ? ? A CYS 47 A CYS 98  1_555 ? ? ? ? ? ? ? 2.068 ? 
disulf3 disulf ? ? A CYS 89 SG  ? ? ? 1_555 A CYS 107 SG ? ? A CYS 89 A CYS 107 1_555 ? ? ? ? ? ? ? 2.037 ? 
metalc1 metalc ? ? A GLU 42 OE1 ? ? ? 1_555 B NA  .   NA ? ? A GLU 42 A NA  120 1_555 ? ? ? ? ? ? ? 2.756 ? 
metalc2 metalc ? ? A SER 44 OG  ? ? ? 1_555 B NA  .   NA ? ? A SER 44 A NA  120 1_555 ? ? ? ? ? ? ? 2.749 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          LEU 
_struct_mon_prot_cis.label_seq_id           90 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           LEU 
_struct_mon_prot_cis.auth_seq_id            90 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    91 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     91 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.76 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 120'  
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NBB A 121' 
AC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE EDO A 122' 
AC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE EDO A 123' 
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE EDO A 124' 
AC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE EDO A 125' 
AC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE EDO A 126' 
AC8 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE EDO A 127' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 GLY A 25  ? GLY A 25  . ? 3_554 ? 
2  AC1 5 GLU A 42  ? GLU A 42  . ? 1_555 ? 
3  AC1 5 PRO A 43  ? PRO A 43  . ? 1_555 ? 
4  AC1 5 SER A 44  ? SER A 44  . ? 1_555 ? 
5  AC1 5 HOH J .   ? HOH A 145 . ? 3_554 ? 
6  AC2 6 TRP A 4   ? TRP A 4   . ? 1_555 ? 
7  AC2 6 LEU A 52  ? LEU A 52  . ? 1_555 ? 
8  AC2 6 LEU A 53  ? LEU A 53  . ? 1_555 ? 
9  AC2 6 PHE A 56  ? PHE A 56  . ? 1_555 ? 
10 AC2 6 PHE A 117 ? PHE A 117 . ? 1_555 ? 
11 AC2 6 ILE A 119 ? ILE A 119 . ? 1_555 ? 
12 AC3 2 ASP A 96  ? ASP A 96  . ? 1_555 ? 
13 AC3 2 EDO E .   ? EDO A 123 . ? 1_555 ? 
14 AC4 6 SER A 22  ? SER A 22  . ? 3_554 ? 
15 AC4 6 PRO A 43  ? PRO A 43  . ? 1_555 ? 
16 AC4 6 EDO D .   ? EDO A 122 . ? 1_555 ? 
17 AC4 6 HOH J .   ? HOH A 129 . ? 3_554 ? 
18 AC4 6 HOH J .   ? HOH A 212 . ? 3_554 ? 
19 AC4 6 HOH J .   ? HOH A 240 . ? 1_555 ? 
20 AC5 4 ASN A 41  ? ASN A 41  . ? 1_555 ? 
21 AC5 4 PRO A 43  ? PRO A 43  . ? 1_555 ? 
22 AC5 4 HOH J .   ? HOH A 231 . ? 1_555 ? 
23 AC5 4 HOH J .   ? HOH A 236 . ? 1_555 ? 
24 AC6 4 GLU A 15  ? GLU A 15  . ? 1_555 ? 
25 AC6 4 ALA A 18  ? ALA A 18  . ? 1_555 ? 
26 AC6 4 ARG A 19  ? ARG A 19  . ? 1_555 ? 
27 AC6 4 HOH J .   ? HOH A 219 . ? 1_555 ? 
28 AC7 6 ALA A 14  ? ALA A 14  . ? 1_555 ? 
29 AC7 6 LYS A 17  ? LYS A 17  . ? 1_555 ? 
30 AC7 6 GLN A 77  ? GLN A 77  . ? 6_554 ? 
31 AC7 6 ARG A 81  ? ARG A 81  . ? 6_554 ? 
32 AC7 6 HOH J .   ? HOH A 157 . ? 1_555 ? 
33 AC7 6 HOH J .   ? HOH A 235 . ? 1_555 ? 
34 AC8 3 TRP A 4   ? TRP A 4   . ? 1_555 ? 
35 AC8 3 PHE A 117 ? PHE A 117 . ? 1_555 ? 
36 AC8 3 HOH J .   ? HOH A 205 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3D77 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3D77 
_atom_sites.fract_transf_matrix[1][1]   0.012624 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011905 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.021035 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
NA 
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . TRP A 1 4   ? 20.555 22.653 -2.347  1.00 55.13 ? 4   TRP A N   1 
ATOM   2    C  CA  . TRP A 1 4   ? 21.922 22.324 -1.829  1.00 54.95 ? 4   TRP A CA  1 
ATOM   3    C  C   . TRP A 1 4   ? 22.438 21.009 -2.396  1.00 54.10 ? 4   TRP A C   1 
ATOM   4    O  O   . TRP A 1 4   ? 23.530 20.574 -2.045  1.00 54.91 ? 4   TRP A O   1 
ATOM   5    C  CB  . TRP A 1 4   ? 21.901 22.242 -0.291  1.00 55.64 ? 4   TRP A CB  1 
ATOM   6    C  CG  . TRP A 1 4   ? 20.678 21.546 0.205   1.00 55.10 ? 4   TRP A CG  1 
ATOM   7    C  CD1 . TRP A 1 4   ? 19.513 22.133 0.616   1.00 58.92 ? 4   TRP A CD1 1 
ATOM   8    C  CD2 . TRP A 1 4   ? 20.465 20.134 0.282   1.00 55.44 ? 4   TRP A CD2 1 
ATOM   9    N  NE1 . TRP A 1 4   ? 18.595 21.172 0.967   1.00 57.15 ? 4   TRP A NE1 1 
ATOM   10   C  CE2 . TRP A 1 4   ? 19.152 19.937 0.768   1.00 55.61 ? 4   TRP A CE2 1 
ATOM   11   C  CE3 . TRP A 1 4   ? 21.255 19.018 -0.001  1.00 54.49 ? 4   TRP A CE3 1 
ATOM   12   C  CZ2 . TRP A 1 4   ? 18.615 18.669 0.978   1.00 55.66 ? 4   TRP A CZ2 1 
ATOM   13   C  CZ3 . TRP A 1 4   ? 20.731 17.764 0.204   1.00 56.65 ? 4   TRP A CZ3 1 
ATOM   14   C  CH2 . TRP A 1 4   ? 19.414 17.595 0.690   1.00 56.08 ? 4   TRP A CH2 1 
ATOM   15   N  N   . VAL A 1 5   ? 21.665 20.358 -3.262  1.00 52.93 ? 5   VAL A N   1 
ATOM   16   C  CA  . VAL A 1 5   ? 22.046 19.033 -3.726  1.00 51.96 ? 5   VAL A CA  1 
ATOM   17   C  C   . VAL A 1 5   ? 23.229 19.136 -4.697  1.00 51.82 ? 5   VAL A C   1 
ATOM   18   O  O   . VAL A 1 5   ? 23.106 19.834 -5.705  1.00 51.27 ? 5   VAL A O   1 
ATOM   19   C  CB  . VAL A 1 5   ? 20.867 18.334 -4.401  1.00 51.85 ? 5   VAL A CB  1 
ATOM   20   C  CG1 . VAL A 1 5   ? 21.312 17.023 -5.005  1.00 51.43 ? 5   VAL A CG1 1 
ATOM   21   C  CG2 . VAL A 1 5   ? 19.734 18.106 -3.381  1.00 51.77 ? 5   VAL A CG2 1 
ATOM   22   N  N   . PRO A 1 6   ? 24.333 18.460 -4.395  1.00 51.60 ? 6   PRO A N   1 
ATOM   23   C  CA  . PRO A 1 6   ? 25.482 18.416 -5.304  1.00 51.88 ? 6   PRO A CA  1 
ATOM   24   C  C   . PRO A 1 6   ? 25.109 17.827 -6.660  1.00 52.06 ? 6   PRO A C   1 
ATOM   25   O  O   . PRO A 1 6   ? 24.041 17.231 -6.801  1.00 52.90 ? 6   PRO A O   1 
ATOM   26   C  CB  . PRO A 1 6   ? 26.460 17.489 -4.579  1.00 52.04 ? 6   PRO A CB  1 
ATOM   27   C  CG  . PRO A 1 6   ? 25.591 16.599 -3.763  1.00 51.99 ? 6   PRO A CG  1 
ATOM   28   C  CD  . PRO A 1 6   ? 24.428 17.446 -3.330  1.00 51.82 ? 6   PRO A CD  1 
ATOM   29   N  N   . PRO A 1 7   ? 25.986 17.996 -7.645  1.00 51.92 ? 7   PRO A N   1 
ATOM   30   C  CA  . PRO A 1 7   ? 25.784 17.396 -8.968  1.00 52.16 ? 7   PRO A CA  1 
ATOM   31   C  C   . PRO A 1 7   ? 25.788 15.872 -8.905  1.00 52.48 ? 7   PRO A C   1 
ATOM   32   O  O   . PRO A 1 7   ? 25.167 15.219 -9.744  1.00 53.73 ? 7   PRO A O   1 
ATOM   33   C  CB  . PRO A 1 7   ? 26.994 17.892 -9.760  1.00 52.29 ? 7   PRO A CB  1 
ATOM   34   C  CG  . PRO A 1 7   ? 27.355 19.183 -9.115  1.00 51.92 ? 7   PRO A CG  1 
ATOM   35   C  CD  . PRO A 1 7   ? 27.055 19.009 -7.653  1.00 52.02 ? 7   PRO A CD  1 
ATOM   36   N  N   . GLU A 1 8   ? 26.483 15.318 -7.917  0.50 52.35 ? 8   GLU A N   1 
ATOM   37   C  CA  . GLU A 1 8   ? 26.866 13.911 -7.946  0.50 52.19 ? 8   GLU A CA  1 
ATOM   38   C  C   . GLU A 1 8   ? 25.689 13.011 -7.586  0.50 52.06 ? 8   GLU A C   1 
ATOM   39   O  O   . GLU A 1 8   ? 25.710 11.809 -7.851  0.50 52.04 ? 8   GLU A O   1 
ATOM   40   C  CB  . GLU A 1 8   ? 28.035 13.655 -6.992  0.50 52.18 ? 8   GLU A CB  1 
ATOM   41   C  CG  . GLU A 1 8   ? 27.902 14.350 -5.647  0.50 52.61 ? 8   GLU A CG  1 
ATOM   42   C  CD  . GLU A 1 8   ? 28.791 15.573 -5.532  0.50 52.46 ? 8   GLU A CD  1 
ATOM   43   O  OE1 . GLU A 1 8   ? 29.258 15.867 -4.412  0.50 54.17 ? 8   GLU A OE1 1 
ATOM   44   O  OE2 . GLU A 1 8   ? 29.022 16.240 -6.562  0.50 53.15 ? 8   GLU A OE2 1 
ATOM   45   N  N   . VAL A 1 9   ? 24.663 13.601 -6.981  1.00 52.01 ? 9   VAL A N   1 
ATOM   46   C  CA  . VAL A 1 9   ? 23.370 12.934 -6.835  1.00 52.06 ? 9   VAL A CA  1 
ATOM   47   C  C   . VAL A 1 9   ? 22.626 12.758 -8.161  1.00 51.57 ? 9   VAL A C   1 
ATOM   48   O  O   . VAL A 1 9   ? 22.086 11.689 -8.431  1.00 51.88 ? 9   VAL A O   1 
ATOM   49   C  CB  . VAL A 1 9   ? 22.443 13.758 -5.939  1.00 52.22 ? 9   VAL A CB  1 
ATOM   50   C  CG1 . VAL A 1 9   ? 23.183 14.230 -4.692  1.00 53.15 ? 9   VAL A CG1 1 
ATOM   51   C  CG2 . VAL A 1 9   ? 21.901 14.946 -6.716  1.00 53.06 ? 9   VAL A CG2 1 
ATOM   52   N  N   . PHE A 1 10  ? 22.584 13.801 -8.987  1.00 50.52 ? 10  PHE A N   1 
ATOM   53   C  CA  . PHE A 1 10  ? 21.556 13.878 -10.032 1.00 49.93 ? 10  PHE A CA  1 
ATOM   54   C  C   . PHE A 1 10  ? 21.699 12.768 -11.077 1.00 51.04 ? 10  PHE A C   1 
ATOM   55   O  O   . PHE A 1 10  ? 20.705 12.281 -11.660 1.00 51.44 ? 10  PHE A O   1 
ATOM   56   C  CB  . PHE A 1 10  ? 21.528 15.273 -10.675 1.00 48.41 ? 10  PHE A CB  1 
ATOM   57   C  CG  . PHE A 1 10  ? 20.783 16.291 -9.861  1.00 45.45 ? 10  PHE A CG  1 
ATOM   58   C  CD1 . PHE A 1 10  ? 21.443 17.107 -8.959  1.00 42.68 ? 10  PHE A CD1 1 
ATOM   59   C  CD2 . PHE A 1 10  ? 19.414 16.423 -9.984  1.00 41.76 ? 10  PHE A CD2 1 
ATOM   60   C  CE1 . PHE A 1 10  ? 20.758 18.024 -8.204  1.00 42.36 ? 10  PHE A CE1 1 
ATOM   61   C  CE2 . PHE A 1 10  ? 18.721 17.353 -9.227  1.00 40.49 ? 10  PHE A CE2 1 
ATOM   62   C  CZ  . PHE A 1 10  ? 19.390 18.156 -8.340  1.00 41.32 ? 10  PHE A CZ  1 
ATOM   63   N  N   . ASP A 1 11  ? 22.918 12.336 -11.298 1.00 51.83 ? 11  ASP A N   1 
ATOM   64   C  CA  . ASP A 1 11  ? 23.106 11.250 -12.218 1.00 52.17 ? 11  ASP A CA  1 
ATOM   65   C  C   . ASP A 1 11  ? 23.066 9.871  -11.593 1.00 51.16 ? 11  ASP A C   1 
ATOM   66   O  O   . ASP A 1 11  ? 22.677 8.933  -12.258 1.00 52.42 ? 11  ASP A O   1 
ATOM   67   C  CB  . ASP A 1 11  ? 24.270 11.504 -13.199 1.00 52.68 ? 11  ASP A CB  1 
ATOM   68   C  CG  . ASP A 1 11  ? 23.953 11.051 -14.626 1.00 53.72 ? 11  ASP A CG  1 
ATOM   69   O  OD1 . ASP A 1 11  ? 22.794 10.683 -14.932 1.00 55.84 ? 11  ASP A OD1 1 
ATOM   70   O  OD2 . ASP A 1 11  ? 24.870 11.032 -15.456 1.00 55.33 ? 11  ASP A OD2 1 
ATOM   71   N  N   . LEU A 1 12  ? 23.390 9.755  -10.310 1.00 49.24 ? 12  LEU A N   1 
ATOM   72   C  CA  . LEU A 1 12  ? 23.083 8.550  -9.560  1.00 47.84 ? 12  LEU A CA  1 
ATOM   73   C  C   . LEU A 1 12  ? 21.585 8.255  -9.534  1.00 45.63 ? 12  LEU A C   1 
ATOM   74   O  O   . LEU A 1 12  ? 21.178 7.097  -9.549  1.00 46.75 ? 12  LEU A O   1 
ATOM   75   C  CB  . LEU A 1 12  ? 23.544 8.687  -8.101  0.50 48.02 ? 12  LEU A CB  1 
ATOM   76   C  CG  . LEU A 1 12  ? 25.032 8.771  -7.739  0.50 48.54 ? 12  LEU A CG  1 
ATOM   77   C  CD1 . LEU A 1 12  ? 25.173 8.551  -6.231  0.50 49.22 ? 12  LEU A CD1 1 
ATOM   78   C  CD2 . LEU A 1 12  ? 25.878 7.778  -8.514  0.50 48.57 ? 12  LEU A CD2 1 
ATOM   79   N  N   . VAL A 1 13  ? 20.785 9.318  -9.529  1.00 43.09 ? 13  VAL A N   1 
ATOM   80   C  CA  A VAL A 1 13  ? 19.350 9.263  -9.221  0.50 41.44 ? 13  VAL A CA  1 
ATOM   81   C  CA  B VAL A 1 13  ? 19.356 9.213  -9.228  0.50 41.17 ? 13  VAL A CA  1 
ATOM   82   C  C   . VAL A 1 13  ? 18.452 9.223  -10.458 1.00 39.73 ? 13  VAL A C   1 
ATOM   83   O  O   . VAL A 1 13  ? 17.251 8.977  -10.350 1.00 37.16 ? 13  VAL A O   1 
ATOM   84   C  CB  A VAL A 1 13  ? 18.969 10.496 -8.337  0.50 41.59 ? 13  VAL A CB  1 
ATOM   85   C  CB  B VAL A 1 13  ? 18.930 10.374 -8.320  0.50 41.18 ? 13  VAL A CB  1 
ATOM   86   C  CG1 A VAL A 1 13  ? 17.465 10.758 -8.312  0.50 42.03 ? 13  VAL A CG1 1 
ATOM   87   C  CG1 B VAL A 1 13  ? 18.731 11.634 -9.147  0.50 40.46 ? 13  VAL A CG1 1 
ATOM   88   C  CG2 A VAL A 1 13  ? 19.503 10.310 -6.917  0.50 42.46 ? 13  VAL A CG2 1 
ATOM   89   C  CG2 B VAL A 1 13  ? 17.675 10.008 -7.530  0.50 41.26 ? 13  VAL A CG2 1 
ATOM   90   N  N   . ALA A 1 14  ? 19.017 9.477  -11.631 1.00 37.23 ? 14  ALA A N   1 
ATOM   91   C  CA  . ALA A 1 14  ? 18.206 9.671  -12.837 1.00 35.46 ? 14  ALA A CA  1 
ATOM   92   C  C   . ALA A 1 14  ? 17.265 8.528  -13.154 1.00 33.61 ? 14  ALA A C   1 
ATOM   93   O  O   . ALA A 1 14  ? 16.100 8.735  -13.512 1.00 32.27 ? 14  ALA A O   1 
ATOM   94   C  CB  . ALA A 1 14  ? 19.114 9.962  -14.047 1.00 35.93 ? 14  ALA A CB  1 
ATOM   95   N  N   . GLU A 1 15  ? 17.784 7.306  -13.059 1.00 31.53 ? 15  GLU A N   1 
ATOM   96   C  CA  . GLU A 1 15  ? 17.007 6.140  -13.393 1.00 29.92 ? 15  GLU A CA  1 
ATOM   97   C  C   . GLU A 1 15  ? 15.849 6.016  -12.399 1.00 28.00 ? 15  GLU A C   1 
ATOM   98   O  O   . GLU A 1 15  ? 14.712 5.730  -12.800 1.00 25.90 ? 15  GLU A O   1 
ATOM   99   C  CB  . GLU A 1 15  ? 17.891 4.894  -13.329 0.50 30.14 ? 15  GLU A CB  1 
ATOM   100  C  CG  . GLU A 1 15  ? 17.215 3.605  -13.702 0.50 32.53 ? 15  GLU A CG  1 
ATOM   101  C  CD  . GLU A 1 15  ? 18.214 2.470  -13.876 0.50 36.06 ? 15  GLU A CD  1 
ATOM   102  O  OE1 . GLU A 1 15  ? 18.638 1.865  -12.862 0.50 38.47 ? 15  GLU A OE1 1 
ATOM   103  O  OE2 . GLU A 1 15  ? 18.576 2.181  -15.036 0.50 39.52 ? 15  GLU A OE2 1 
ATOM   104  N  N   . ASP A 1 16  ? 16.156 6.210  -11.124 1.00 26.74 ? 16  ASP A N   1 
ATOM   105  C  CA  . ASP A 1 16  ? 15.104 6.066  -10.101 1.00 25.66 ? 16  ASP A CA  1 
ATOM   106  C  C   . ASP A 1 16  ? 14.105 7.208  -10.232 1.00 24.70 ? 16  ASP A C   1 
ATOM   107  O  O   . ASP A 1 16  ? 12.898 6.991  -10.076 1.00 23.81 ? 16  ASP A O   1 
ATOM   108  C  CB  . ASP A 1 16  ? 15.671 5.999  -8.699  1.00 26.96 ? 16  ASP A CB  1 
ATOM   109  C  CG  . ASP A 1 16  ? 16.289 4.642  -8.386  1.00 29.33 ? 16  ASP A CG  1 
ATOM   110  O  OD1 . ASP A 1 16  ? 15.584 3.590  -8.400  1.00 32.49 ? 16  ASP A OD1 1 
ATOM   111  O  OD2 . ASP A 1 16  ? 17.485 4.652  -8.103  1.00 33.56 ? 16  ASP A OD2 1 
ATOM   112  N  N   . LYS A 1 17  ? 14.580 8.404  -10.547 1.00 23.44 ? 17  LYS A N   1 
ATOM   113  C  CA  . LYS A 1 17  ? 13.635 9.533  -10.759 1.00 22.83 ? 17  LYS A CA  1 
ATOM   114  C  C   . LYS A 1 17  ? 12.658 9.189  -11.885 1.00 22.33 ? 17  LYS A C   1 
ATOM   115  O  O   . LYS A 1 17  ? 11.427 9.355  -11.744 1.00 21.19 ? 17  LYS A O   1 
ATOM   116  C  CB  . LYS A 1 17  ? 14.382 10.849 -11.018 1.00 22.74 ? 17  LYS A CB  1 
ATOM   117  C  CG  . LYS A 1 17  ? 13.490 11.967 -11.556 1.00 24.24 ? 17  LYS A CG  1 
ATOM   118  C  CD  . LYS A 1 17  ? 14.078 13.374 -11.341 1.00 26.02 ? 17  LYS A CD  1 
ATOM   119  C  CE  . LYS A 1 17  ? 13.117 14.462 -11.837 1.00 27.80 ? 17  LYS A CE  1 
ATOM   120  N  NZ  . LYS A 1 17  ? 13.638 15.823 -11.563 1.00 30.98 ? 17  LYS A NZ  1 
ATOM   121  N  N   . ALA A 1 18  ? 13.174 8.703  -13.018 1.00 22.29 ? 18  ALA A N   1 
ATOM   122  C  CA  . ALA A 1 18  ? 12.321 8.394  -14.161 1.00 22.42 ? 18  ALA A CA  1 
ATOM   123  C  C   . ALA A 1 18  ? 11.313 7.308  -13.815 1.00 21.94 ? 18  ALA A C   1 
ATOM   124  O  O   . ALA A 1 18  ? 10.135 7.384  -14.163 1.00 20.80 ? 18  ALA A O   1 
ATOM   125  C  CB  . ALA A 1 18  ? 13.187 7.928  -15.368 1.00 23.87 ? 18  ALA A CB  1 
ATOM   126  N  N   . ARG A 1 19  ? 11.794 6.275  -13.147 1.00 20.83 ? 19  ARG A N   1 
ATOM   127  C  CA  . ARG A 1 19  ? 10.905 5.186  -12.741 1.00 19.78 ? 19  ARG A CA  1 
ATOM   128  C  C   . ARG A 1 19  ? 9.816  5.687  -11.806 1.00 18.85 ? 19  ARG A C   1 
ATOM   129  O  O   . ARG A 1 19  ? 8.635  5.386  -11.987 1.00 18.23 ? 19  ARG A O   1 
ATOM   130  C  CB  . ARG A 1 19  ? 11.704 4.101  -12.030 1.00 19.85 ? 19  ARG A CB  1 
ATOM   131  C  CG  . ARG A 1 19  ? 10.840 2.989  -11.486 1.00 20.71 ? 19  ARG A CG  1 
ATOM   132  C  CD  . ARG A 1 19  ? 11.636 1.860  -10.803 1.00 21.45 ? 19  ARG A CD  1 
ATOM   133  N  NE  . ARG A 1 19  ? 12.470 2.330  -9.713  1.00 22.38 ? 19  ARG A NE  1 
ATOM   134  C  CZ  . ARG A 1 19  ? 12.005 2.616  -8.492  1.00 23.09 ? 19  ARG A CZ  1 
ATOM   135  N  NH1 . ARG A 1 19  ? 10.710 2.449  -8.196  1.00 21.09 ? 19  ARG A NH1 1 
ATOM   136  N  NH2 . ARG A 1 19  ? 12.843 3.036  -7.568  1.00 24.29 ? 19  ARG A NH2 1 
ATOM   137  N  N   . CYS A 1 20  ? 10.226 6.411  -10.797 1.00 18.43 ? 20  CYS A N   1 
ATOM   138  C  CA  . CYS A 1 20  ? 9.255  6.895  -9.773  1.00 18.34 ? 20  CYS A CA  1 
ATOM   139  C  C   . CYS A 1 20  ? 8.228  7.840  -10.393 1.00 18.04 ? 20  CYS A C   1 
ATOM   140  O  O   . CYS A 1 20  ? 7.051  7.759  -10.047 1.00 17.75 ? 20  CYS A O   1 
ATOM   141  C  CB  . CYS A 1 20  ? 9.981  7.583  -8.600  1.00 19.26 ? 20  CYS A CB  1 
ATOM   142  S  SG  . CYS A 1 20  ? 10.900 6.453  -7.596  1.00 20.15 ? 20  CYS A SG  1 
ATOM   143  N  N   . MET A 1 21  ? 8.648  8.731  -11.288 1.00 17.66 ? 21  MET A N   1 
ATOM   144  C  CA  A MET A 1 21  ? 7.657  9.523  -12.020 0.70 17.20 ? 21  MET A CA  1 
ATOM   145  C  CA  B MET A 1 21  ? 7.663  9.526  -12.017 0.30 17.71 ? 21  MET A CA  1 
ATOM   146  C  C   . MET A 1 21  ? 6.658  8.739  -12.847 1.00 18.06 ? 21  MET A C   1 
ATOM   147  O  O   . MET A 1 21  ? 5.511  8.965  -12.874 1.00 18.17 ? 21  MET A O   1 
ATOM   148  C  CB  A MET A 1 21  ? 8.305  10.622 -12.884 0.70 17.91 ? 21  MET A CB  1 
ATOM   149  C  CB  B MET A 1 21  ? 8.315  10.636 -12.869 0.30 18.13 ? 21  MET A CB  1 
ATOM   150  C  CG  A MET A 1 21  ? 9.148  11.559 -12.105 0.70 19.17 ? 21  MET A CG  1 
ATOM   151  C  CG  B MET A 1 21  ? 9.166  11.566 -12.072 0.30 19.45 ? 21  MET A CG  1 
ATOM   152  S  SD  A MET A 1 21  ? 9.969  12.805 -13.129 0.70 21.95 ? 21  MET A SD  1 
ATOM   153  S  SD  B MET A 1 21  ? 9.939  12.867 -13.068 0.30 18.07 ? 21  MET A SD  1 
ATOM   154  C  CE  A MET A 1 21  ? 8.646  13.869 -13.539 0.70 19.58 ? 21  MET A CE  1 
ATOM   155  C  CE  B MET A 1 21  ? 9.982  12.052 -14.541 0.30 21.24 ? 21  MET A CE  1 
ATOM   156  N  N   . SER A 1 22  ? 7.167  7.754  -13.549 1.00 18.65 ? 22  SER A N   1 
ATOM   157  C  CA  A SER A 1 22  ? 6.341  6.917  -14.372 0.70 18.72 ? 22  SER A CA  1 
ATOM   158  C  CA  B SER A 1 22  ? 6.309  6.938  -14.382 0.30 18.67 ? 22  SER A CA  1 
ATOM   159  C  C   . SER A 1 22  ? 5.334  6.128  -13.533 1.00 18.67 ? 22  SER A C   1 
ATOM   160  O  O   . SER A 1 22  ? 4.163  6.058  -13.849 1.00 18.46 ? 22  SER A O   1 
ATOM   161  C  CB  A SER A 1 22  ? 7.206  5.939  -15.177 0.70 20.07 ? 22  SER A CB  1 
ATOM   162  C  CB  B SER A 1 22  ? 7.141  6.041  -15.295 0.30 19.36 ? 22  SER A CB  1 
ATOM   163  O  OG  A SER A 1 22  ? 6.357  5.180  -16.006 0.70 23.01 ? 22  SER A OG  1 
ATOM   164  O  OG  B SER A 1 22  ? 7.846  6.850  -16.212 0.30 20.26 ? 22  SER A OG  1 
ATOM   165  N  N   . GLU A 1 23  ? 5.818  5.562  -12.430 1.00 18.14 ? 23  GLU A N   1 
ATOM   166  C  CA  . GLU A 1 23  ? 4.972  4.709  -11.592 1.00 17.27 ? 23  GLU A CA  1 
ATOM   167  C  C   . GLU A 1 23  ? 3.774  5.470  -11.030 1.00 17.18 ? 23  GLU A C   1 
ATOM   168  O  O   . GLU A 1 23  ? 2.683  4.901  -10.876 1.00 18.29 ? 23  GLU A O   1 
ATOM   169  C  CB  . GLU A 1 23  ? 5.783  4.130  -10.413 1.00 18.03 ? 23  GLU A CB  1 
ATOM   170  C  CG  . GLU A 1 23  ? 6.759  3.041  -10.780 1.00 18.59 ? 23  GLU A CG  1 
ATOM   171  C  CD  . GLU A 1 23  ? 7.512  2.507  -9.590  1.00 18.01 ? 23  GLU A CD  1 
ATOM   172  O  OE1 . GLU A 1 23  ? 7.306  3.012  -8.448  1.00 20.38 ? 23  GLU A OE1 1 
ATOM   173  O  OE2 . GLU A 1 23  ? 8.341  1.576  -9.771  1.00 20.94 ? 23  GLU A OE2 1 
ATOM   174  N  N   . HIS A 1 24  ? 3.991  6.745  -10.710 1.00 16.84 ? 24  HIS A N   1 
ATOM   175  C  CA  . HIS A 1 24  ? 3.028  7.529  -9.901  1.00 15.99 ? 24  HIS A CA  1 
ATOM   176  C  C   . HIS A 1 24  ? 2.299  8.622  -10.624 1.00 16.16 ? 24  HIS A C   1 
ATOM   177  O  O   . HIS A 1 24  ? 1.407  9.244  -10.066 1.00 15.00 ? 24  HIS A O   1 
ATOM   178  C  CB  . HIS A 1 24  ? 3.725  8.000  -8.631  1.00 16.94 ? 24  HIS A CB  1 
ATOM   179  C  CG  . HIS A 1 24  ? 4.274  6.846  -7.848  1.00 15.67 ? 24  HIS A CG  1 
ATOM   180  N  ND1 . HIS A 1 24  ? 3.444  5.896  -7.283  1.00 17.71 ? 24  HIS A ND1 1 
ATOM   181  C  CD2 . HIS A 1 24  ? 5.540  6.418  -7.636  1.00 18.06 ? 24  HIS A CD2 1 
ATOM   182  C  CE1 . HIS A 1 24  ? 4.193  4.952  -6.720  1.00 18.67 ? 24  HIS A CE1 1 
ATOM   183  N  NE2 . HIS A 1 24  ? 5.464  5.244  -6.916  1.00 17.66 ? 24  HIS A NE2 1 
ATOM   184  N  N   . GLY A 1 25  ? 2.650  8.844  -11.879 1.00 16.44 ? 25  GLY A N   1 
ATOM   185  C  CA  . GLY A 1 25  ? 2.002  9.904  -12.675 1.00 16.36 ? 25  GLY A CA  1 
ATOM   186  C  C   . GLY A 1 25  ? 2.512  11.321 -12.374 1.00 16.17 ? 25  GLY A C   1 
ATOM   187  O  O   . GLY A 1 25  ? 1.825  12.303 -12.610 1.00 17.61 ? 25  GLY A O   1 
ATOM   188  N  N   . THR A 1 26  ? 3.699  11.414 -11.808 1.00 16.33 ? 26  THR A N   1 
ATOM   189  C  CA  . THR A 1 26  ? 4.275  12.667 -11.320 1.00 15.71 ? 26  THR A CA  1 
ATOM   190  C  C   . THR A 1 26  ? 4.775  13.499 -12.499 1.00 16.63 ? 26  THR A C   1 
ATOM   191  O  O   . THR A 1 26  ? 5.350  12.946 -13.461 1.00 17.29 ? 26  THR A O   1 
ATOM   192  C  CB  . THR A 1 26  ? 5.507  12.368 -10.454 1.00 16.67 ? 26  THR A CB  1 
ATOM   193  O  OG1 . THR A 1 26  ? 5.255  11.206 -9.640  1.00 16.59 ? 26  THR A OG1 1 
ATOM   194  C  CG2 . THR A 1 26  ? 5.913  13.602 -9.583  1.00 19.09 ? 26  THR A CG2 1 
ATOM   195  N  N   . THR A 1 27  ? 4.499  14.792 -12.458 1.00 16.51 ? 27  THR A N   1 
ATOM   196  C  CA  . THR A 1 27  ? 5.063  15.725 -13.414 1.00 17.99 ? 27  THR A CA  1 
ATOM   197  C  C   . THR A 1 27  ? 6.206  16.521 -12.820 1.00 18.93 ? 27  THR A C   1 
ATOM   198  O  O   . THR A 1 27  ? 6.284  16.735 -11.621 1.00 19.58 ? 27  THR A O   1 
ATOM   199  C  CB  . THR A 1 27  ? 4.018  16.712 -13.944 1.00 18.44 ? 27  THR A CB  1 
ATOM   200  O  OG1 . THR A 1 27  ? 3.720  17.657 -12.935 1.00 19.96 ? 27  THR A OG1 1 
ATOM   201  C  CG2 . THR A 1 27  ? 2.758  16.005 -14.413 1.00 18.89 ? 27  THR A CG2 1 
ATOM   202  N  N   . GLN A 1 28  ? 7.105  17.013 -13.683 1.00 20.29 ? 28  GLN A N   1 
ATOM   203  C  CA  . GLN A 1 28  ? 8.159  17.897 -13.189 1.00 22.00 ? 28  GLN A CA  1 
ATOM   204  C  C   . GLN A 1 28  ? 7.604  19.156 -12.555 1.00 22.01 ? 28  GLN A C   1 
ATOM   205  O  O   . GLN A 1 28  ? 8.166  19.655 -11.583 1.00 24.07 ? 28  GLN A O   1 
ATOM   206  C  CB  . GLN A 1 28  ? 9.128  18.254 -14.289 1.00 23.61 ? 28  GLN A CB  1 
ATOM   207  C  CG  . GLN A 1 28  ? 10.265 19.151 -13.778 1.00 22.58 ? 28  GLN A CG  1 
ATOM   208  C  CD  . GLN A 1 28  ? 11.163 18.515 -12.776 1.00 24.24 ? 28  GLN A CD  1 
ATOM   209  O  OE1 . GLN A 1 28  ? 11.607 17.379 -12.960 1.00 28.14 ? 28  GLN A OE1 1 
ATOM   210  N  NE2 . GLN A 1 28  ? 11.431 19.221 -11.673 1.00 27.10 ? 28  GLN A NE2 1 
ATOM   211  N  N   . ALA A 1 29  ? 6.482  19.652 -13.061 1.00 21.99 ? 29  ALA A N   1 
ATOM   212  C  CA  . ALA A 1 29  ? 5.827  20.807 -12.463 1.00 21.96 ? 29  ALA A CA  1 
ATOM   213  C  C   . ALA A 1 29  ? 5.424  20.569 -11.019 1.00 22.12 ? 29  ALA A C   1 
ATOM   214  O  O   . ALA A 1 29  ? 5.513  21.473 -10.177 1.00 22.73 ? 29  ALA A O   1 
ATOM   215  C  CB  . ALA A 1 29  ? 4.626  21.213 -13.321 1.00 23.06 ? 29  ALA A CB  1 
ATOM   216  N  N   . GLN A 1 30  ? 4.946  19.357 -10.690 1.00 20.72 ? 30  GLN A N   1 
ATOM   217  C  CA  . GLN A 1 30  ? 4.627  19.062 -9.293  1.00 20.21 ? 30  GLN A CA  1 
ATOM   218  C  C   . GLN A 1 30  ? 5.885  19.102 -8.424  1.00 20.83 ? 30  GLN A C   1 
ATOM   219  O  O   . GLN A 1 30  ? 5.810  19.497 -7.266  1.00 22.93 ? 30  GLN A O   1 
ATOM   220  C  CB  . GLN A 1 30  ? 3.954  17.680 -9.142  1.00 19.73 ? 30  GLN A CB  1 
ATOM   221  C  CG  . GLN A 1 30  ? 2.561  17.597 -9.735  1.00 20.44 ? 30  GLN A CG  1 
ATOM   222  C  CD  . GLN A 1 30  ? 1.997  16.204 -9.652  1.00 18.45 ? 30  GLN A CD  1 
ATOM   223  O  OE1 . GLN A 1 30  ? 2.444  15.306 -10.376 1.00 17.95 ? 30  GLN A OE1 1 
ATOM   224  N  NE2 . GLN A 1 30  ? 1.001  16.000 -8.765  1.00 16.67 ? 30  GLN A NE2 1 
ATOM   225  N  N   . ILE A 1 31  ? 7.011  18.602 -8.942  1.00 21.55 ? 31  ILE A N   1 
ATOM   226  C  CA  . ILE A 1 31  ? 8.280  18.587 -8.204  1.00 22.57 ? 31  ILE A CA  1 
ATOM   227  C  C   . ILE A 1 31  ? 8.671  20.061 -7.965  1.00 23.54 ? 31  ILE A C   1 
ATOM   228  O  O   . ILE A 1 31  ? 8.973  20.454 -6.834  1.00 24.48 ? 31  ILE A O   1 
ATOM   229  C  CB  . ILE A 1 31  ? 9.374  17.785 -8.970  1.00 22.56 ? 31  ILE A CB  1 
ATOM   230  C  CG1 . ILE A 1 31  ? 8.981  16.297 -9.040  1.00 21.36 ? 31  ILE A CG1 1 
ATOM   231  C  CG2 . ILE A 1 31  ? 10.788 17.924 -8.327  1.00 23.55 ? 31  ILE A CG2 1 
ATOM   232  C  CD1 . ILE A 1 31  ? 9.932  15.407 -9.831  1.00 22.07 ? 31  ILE A CD1 1 
ATOM   233  N  N   . ASP A 1 32  ? 8.580  20.866 -9.013  1.00 24.76 ? 32  ASP A N   1 
ATOM   234  C  CA  . ASP A 1 32  ? 8.925  22.322 -8.906  1.00 25.41 ? 32  ASP A CA  1 
ATOM   235  C  C   . ASP A 1 32  ? 8.072  22.963 -7.805  1.00 26.70 ? 32  ASP A C   1 
ATOM   236  O  O   . ASP A 1 32  ? 8.542  23.760 -6.992  1.00 27.55 ? 32  ASP A O   1 
ATOM   237  C  CB  . ASP A 1 32  ? 8.644  23.012 -10.228 1.00 25.83 ? 32  ASP A CB  1 
ATOM   238  C  CG  . ASP A 1 32  ? 9.605  22.610 -11.334 1.00 26.88 ? 32  ASP A CG  1 
ATOM   239  O  OD1 . ASP A 1 32  ? 10.629 21.967 -11.053 1.00 27.60 ? 32  ASP A OD1 1 
ATOM   240  O  OD2 . ASP A 1 32  ? 9.319  22.950 -12.506 1.00 30.82 ? 32  ASP A OD2 1 
ATOM   241  N  N   . ASP A 1 33  ? 6.795  22.575 -7.754  1.00 26.94 ? 33  ASP A N   1 
ATOM   242  C  CA  A ASP A 1 33  ? 5.871  23.149 -6.796  0.60 27.57 ? 33  ASP A CA  1 
ATOM   243  C  CA  B ASP A 1 33  ? 5.858  23.139 -6.783  0.40 27.48 ? 33  ASP A CA  1 
ATOM   244  C  C   . ASP A 1 33  ? 6.262  22.814 -5.360  1.00 28.17 ? 33  ASP A C   1 
ATOM   245  O  O   . ASP A 1 33  ? 6.200  23.668 -4.490  1.00 29.25 ? 33  ASP A O   1 
ATOM   246  C  CB  A ASP A 1 33  ? 4.453  22.659 -7.097  0.60 28.02 ? 33  ASP A CB  1 
ATOM   247  C  CB  B ASP A 1 33  ? 4.434  22.621 -7.003  0.40 27.69 ? 33  ASP A CB  1 
ATOM   248  C  CG  A ASP A 1 33  ? 3.394  23.704 -6.859  0.60 30.05 ? 33  ASP A CG  1 
ATOM   249  C  CG  B ASP A 1 33  ? 3.649  23.417 -8.028  0.40 27.92 ? 33  ASP A CG  1 
ATOM   250  O  OD1 A ASP A 1 33  ? 3.690  24.918 -6.959  0.60 31.94 ? 33  ASP A OD1 1 
ATOM   251  O  OD1 B ASP A 1 33  ? 4.199  24.284 -8.736  0.40 29.79 ? 33  ASP A OD1 1 
ATOM   252  O  OD2 A ASP A 1 33  ? 2.239  23.288 -6.611  0.60 32.77 ? 33  ASP A OD2 1 
ATOM   253  O  OD2 B ASP A 1 33  ? 2.438  23.162 -8.113  0.40 29.58 ? 33  ASP A OD2 1 
ATOM   254  N  N   . VAL A 1 34  ? 6.670  21.565 -5.091  1.00 27.43 ? 34  VAL A N   1 
ATOM   255  C  CA  . VAL A 1 34  ? 7.094  21.204 -3.752  1.00 28.11 ? 34  VAL A CA  1 
ATOM   256  C  C   . VAL A 1 34  ? 8.309  22.004 -3.358  1.00 28.75 ? 34  VAL A C   1 
ATOM   257  O  O   . VAL A 1 34  ? 8.394  22.493 -2.233  1.00 28.73 ? 34  VAL A O   1 
ATOM   258  C  CB  . VAL A 1 34  ? 7.432  19.700 -3.619  1.00 28.98 ? 34  VAL A CB  1 
ATOM   259  C  CG1 . VAL A 1 34  ? 8.013  19.396 -2.218  1.00 29.03 ? 34  VAL A CG1 1 
ATOM   260  C  CG2 . VAL A 1 34  ? 6.171  18.907 -3.838  1.00 30.97 ? 34  VAL A CG2 1 
ATOM   261  N  N   . ASN A 1 35  ? 9.225  22.150 -4.296  1.00 29.62 ? 35  ASN A N   1 
ATOM   262  C  CA  . ASN A 1 35  ? 10.468 22.902 -4.020  1.00 30.99 ? 35  ASN A CA  1 
ATOM   263  C  C   . ASN A 1 35  ? 10.223 24.386 -3.767  1.00 32.28 ? 35  ASN A C   1 
ATOM   264  O  O   . ASN A 1 35  ? 11.088 25.069 -3.160  1.00 33.01 ? 35  ASN A O   1 
ATOM   265  C  CB  . ASN A 1 35  ? 11.481 22.658 -5.125  1.00 31.30 ? 35  ASN A CB  1 
ATOM   266  C  CG  . ASN A 1 35  ? 12.064 21.266 -5.065  1.00 31.06 ? 35  ASN A CG  1 
ATOM   267  O  OD1 . ASN A 1 35  ? 12.195 20.736 -3.941  1.00 33.90 ? 35  ASN A OD1 1 
ATOM   268  N  ND2 . ASN A 1 35  ? 12.369 20.683 -6.133  1.00 32.25 ? 35  ASN A ND2 1 
ATOM   269  N  N   . LYS A 1 36  ? 9.072  24.889 -4.187  1.00 32.68 ? 36  LYS A N   1 
ATOM   270  C  CA  . LYS A 1 36  ? 8.645  26.280 -3.896  1.00 34.00 ? 36  LYS A CA  1 
ATOM   271  C  C   . LYS A 1 36  ? 7.831  26.382 -2.623  1.00 34.88 ? 36  LYS A C   1 
ATOM   272  O  O   . LYS A 1 36  ? 7.382  27.483 -2.256  1.00 35.93 ? 36  LYS A O   1 
ATOM   273  C  CB  . LYS A 1 36  ? 7.841  26.859 -5.074  1.00 34.26 ? 36  LYS A CB  1 
ATOM   274  C  CG  . LYS A 1 36  ? 8.674  27.078 -6.315  0.50 34.61 ? 36  LYS A CG  1 
ATOM   275  C  CD  . LYS A 1 36  ? 7.814  27.507 -7.472  0.50 36.09 ? 36  LYS A CD  1 
ATOM   276  C  CE  . LYS A 1 36  ? 8.661  27.822 -8.690  0.50 37.96 ? 36  LYS A CE  1 
ATOM   277  N  NZ  . LYS A 1 36  ? 7.812  28.288 -9.808  0.50 39.05 ? 36  LYS A NZ  1 
ATOM   278  N  N   . GLY A 1 37  ? 7.635  25.246 -1.948  1.00 34.27 ? 37  GLY A N   1 
ATOM   279  C  CA  . GLY A 1 37  ? 6.890  25.174 -0.703  1.00 34.66 ? 37  GLY A CA  1 
ATOM   280  C  C   . GLY A 1 37  ? 5.400  24.935 -0.865  1.00 34.50 ? 37  GLY A C   1 
ATOM   281  O  O   . GLY A 1 37  ? 4.638  25.175 0.062   1.00 36.35 ? 37  GLY A O   1 
ATOM   282  N  N   . ASN A 1 38  ? 4.970  24.505 -2.042  1.00 33.22 ? 38  ASN A N   1 
ATOM   283  C  CA  . ASN A 1 38  ? 3.562  24.283 -2.302  1.00 32.68 ? 38  ASN A CA  1 
ATOM   284  C  C   . ASN A 1 38  ? 3.358  22.772 -2.395  1.00 32.55 ? 38  ASN A C   1 
ATOM   285  O  O   . ASN A 1 38  ? 3.799  22.154 -3.360  1.00 33.23 ? 38  ASN A O   1 
ATOM   286  C  CB  . ASN A 1 38  ? 3.149  24.910 -3.617  1.00 33.46 ? 38  ASN A CB  1 
ATOM   287  C  CG  . ASN A 1 38  ? 3.283  26.434 -3.619  1.00 33.66 ? 38  ASN A CG  1 
ATOM   288  O  OD1 . ASN A 1 38  ? 3.762  27.024 -4.592  0.70 36.61 ? 38  ASN A OD1 1 
ATOM   289  N  ND2 . ASN A 1 38  ? 2.895  27.053 -2.529  0.70 31.80 ? 38  ASN A ND2 1 
ATOM   290  N  N   . LEU A 1 39  ? 2.704  22.201 -1.404  1.00 31.61 ? 39  LEU A N   1 
ATOM   291  C  CA  . LEU A 1 39  ? 2.431  20.776 -1.450  1.00 30.26 ? 39  LEU A CA  1 
ATOM   292  C  C   . LEU A 1 39  ? 1.027  20.437 -1.005  1.00 29.95 ? 39  LEU A C   1 
ATOM   293  O  O   . LEU A 1 39  ? 0.549  20.877 0.049   1.00 34.01 ? 39  LEU A O   1 
ATOM   294  C  CB  . LEU A 1 39  ? 3.453  20.025 -0.641  1.00 29.83 ? 39  LEU A CB  1 
ATOM   295  C  CG  . LEU A 1 39  ? 3.283  18.514 -0.444  0.70 25.64 ? 39  LEU A CG  1 
ATOM   296  C  CD1 . LEU A 1 39  ? 3.320  17.678 -1.782  0.70 22.44 ? 39  LEU A CD1 1 
ATOM   297  C  CD2 . LEU A 1 39  ? 4.321  18.067 0.534   0.70 24.82 ? 39  LEU A CD2 1 
ATOM   298  N  N   . VAL A 1 40  ? 0.350  19.635 -1.796  1.00 28.65 ? 40  VAL A N   1 
ATOM   299  C  CA  . VAL A 1 40  ? -0.944 19.104 -1.407  1.00 27.38 ? 40  VAL A CA  1 
ATOM   300  C  C   . VAL A 1 40  ? -0.853 17.595 -1.362  1.00 25.58 ? 40  VAL A C   1 
ATOM   301  O  O   . VAL A 1 40  ? 0.133  17.001 -1.852  1.00 24.32 ? 40  VAL A O   1 
ATOM   302  C  CB  . VAL A 1 40  ? -2.076 19.590 -2.352  0.70 27.89 ? 40  VAL A CB  1 
ATOM   303  C  CG1 . VAL A 1 40  ? -2.184 21.114 -2.287  0.70 28.96 ? 40  VAL A CG1 1 
ATOM   304  C  CG2 . VAL A 1 40  ? -1.841 19.145 -3.758  0.70 28.72 ? 40  VAL A CG2 1 
ATOM   305  N  N   . ASN A 1 41  ? -1.863 16.977 -0.744  1.00 24.72 ? 41  ASN A N   1 
ATOM   306  C  CA  . ASN A 1 41  ? -1.898 15.557 -0.473  1.00 23.70 ? 41  ASN A CA  1 
ATOM   307  C  C   . ASN A 1 41  ? -2.409 14.816 -1.689  1.00 22.67 ? 41  ASN A C   1 
ATOM   308  O  O   . ASN A 1 41  ? -3.440 14.138 -1.644  1.00 24.26 ? 41  ASN A O   1 
ATOM   309  C  CB  . ASN A 1 41  ? -2.790 15.284 0.774   1.00 23.50 ? 41  ASN A CB  1 
ATOM   310  C  CG  . ASN A 1 41  ? -2.770 13.862 1.226   1.00 22.78 ? 41  ASN A CG  1 
ATOM   311  O  OD1 . ASN A 1 41  ? -1.736 13.164 1.187   1.00 24.32 ? 41  ASN A OD1 1 
ATOM   312  N  ND2 . ASN A 1 41  ? -3.922 13.413 1.753   1.00 26.65 ? 41  ASN A ND2 1 
ATOM   313  N  N   . GLU A 1 42  ? -1.648 14.906 -2.771  1.00 21.42 ? 42  GLU A N   1 
ATOM   314  C  CA  . GLU A 1 42  ? -1.993 14.266 -4.055  1.00 19.87 ? 42  GLU A CA  1 
ATOM   315  C  C   . GLU A 1 42  ? -1.020 13.091 -4.245  1.00 18.10 ? 42  GLU A C   1 
ATOM   316  O  O   . GLU A 1 42  ? 0.185  13.314 -4.265  1.00 17.04 ? 42  GLU A O   1 
ATOM   317  C  CB  . GLU A 1 42  ? -1.792 15.243 -5.207  1.00 20.32 ? 42  GLU A CB  1 
ATOM   318  C  CG  . GLU A 1 42  ? -2.960 16.208 -5.441  1.00 22.03 ? 42  GLU A CG  1 
ATOM   319  C  CD  . GLU A 1 42  ? -4.226 15.568 -5.970  1.00 23.78 ? 42  GLU A CD  1 
ATOM   320  O  OE1 . GLU A 1 42  ? -4.238 14.346 -6.287  1.00 22.40 ? 42  GLU A OE1 1 
ATOM   321  O  OE2 . GLU A 1 42  ? -5.255 16.312 -5.997  1.00 27.10 ? 42  GLU A OE2 1 
ATOM   322  N  N   . PRO A 1 43  ? -1.523 11.831 -4.320  1.00 17.14 ? 43  PRO A N   1 
ATOM   323  C  CA  A PRO A 1 43  ? -0.633 10.685 -4.441  0.50 16.42 ? 43  PRO A CA  1 
ATOM   324  C  CA  B PRO A 1 43  ? -0.632 10.675 -4.444  0.50 16.75 ? 43  PRO A CA  1 
ATOM   325  C  C   . PRO A 1 43  ? 0.413  10.796 -5.550  1.00 16.56 ? 43  PRO A C   1 
ATOM   326  O  O   . PRO A 1 43  ? 1.504  10.294 -5.387  1.00 16.31 ? 43  PRO A O   1 
ATOM   327  C  CB  A PRO A 1 43  ? -1.603 9.524  -4.642  0.50 16.36 ? 43  PRO A CB  1 
ATOM   328  C  CB  B PRO A 1 43  ? -1.580 9.498  -4.715  0.50 16.87 ? 43  PRO A CB  1 
ATOM   329  C  CG  A PRO A 1 43  ? -2.787 9.947  -3.792  0.50 15.90 ? 43  PRO A CG  1 
ATOM   330  C  CG  B PRO A 1 43  ? -2.899 10.079 -4.975  0.50 17.94 ? 43  PRO A CG  1 
ATOM   331  C  CD  A PRO A 1 43  ? -2.925 11.395 -4.150  0.50 17.88 ? 43  PRO A CD  1 
ATOM   332  C  CD  B PRO A 1 43  ? -2.935 11.411 -4.304  0.50 18.24 ? 43  PRO A CD  1 
ATOM   333  N  N   . SER A 1 44  ? 0.090  11.457 -6.659  1.00 15.97 ? 44  SER A N   1 
ATOM   334  C  CA  . SER A 1 44  ? 1.076  11.533 -7.745  1.00 16.31 ? 44  SER A CA  1 
ATOM   335  C  C   . SER A 1 44  ? 2.355  12.241 -7.309  1.00 16.65 ? 44  SER A C   1 
ATOM   336  O  O   . SER A 1 44  ? 3.422  11.954 -7.826  1.00 18.98 ? 44  SER A O   1 
ATOM   337  C  CB  . SER A 1 44  ? 0.470  12.153 -9.004  1.00 16.44 ? 44  SER A CB  1 
ATOM   338  O  OG  . SER A 1 44  ? -0.195 13.403 -8.762  1.00 15.84 ? 44  SER A OG  1 
ATOM   339  N  N   . ILE A 1 45  ? 2.279  13.144 -6.323  1.00 16.18 ? 45  ILE A N   1 
ATOM   340  C  CA  . ILE A 1 45  ? 3.496  13.745 -5.772  1.00 15.65 ? 45  ILE A CA  1 
ATOM   341  C  C   . ILE A 1 45  ? 3.928  13.130 -4.438  1.00 16.74 ? 45  ILE A C   1 
ATOM   342  O  O   . ILE A 1 45  ? 5.099  12.920 -4.217  1.00 17.09 ? 45  ILE A O   1 
ATOM   343  C  CB  . ILE A 1 45  ? 3.409  15.311 -5.698  1.00 16.51 ? 45  ILE A CB  1 
ATOM   344  C  CG1 . ILE A 1 45  ? 4.770  15.939 -5.317  1.00 15.97 ? 45  ILE A CG1 1 
ATOM   345  C  CG2 . ILE A 1 45  ? 2.252  15.810 -4.804  1.00 16.44 ? 45  ILE A CG2 1 
ATOM   346  C  CD1 . ILE A 1 45  ? 5.930  15.591 -6.230  1.00 17.27 ? 45  ILE A CD1 1 
ATOM   347  N  N   . THR A 1 46  ? 2.985  12.810 -3.567  1.00 16.05 ? 46  THR A N   1 
ATOM   348  C  CA  . THR A 1 46  ? 3.381  12.232 -2.279  1.00 16.16 ? 46  THR A CA  1 
ATOM   349  C  C   . THR A 1 46  ? 3.981  10.834 -2.464  1.00 15.76 ? 46  THR A C   1 
ATOM   350  O  O   . THR A 1 46  ? 4.943  10.481 -1.799  1.00 16.73 ? 46  THR A O   1 
ATOM   351  C  CB  . THR A 1 46  ? 2.236  12.220 -1.299  1.00 16.37 ? 46  THR A CB  1 
ATOM   352  O  OG1 . THR A 1 46  ? 1.187  11.358 -1.772  1.00 15.53 ? 46  THR A OG1 1 
ATOM   353  C  CG2 . THR A 1 46  ? 1.700  13.685 -1.095  1.00 17.76 ? 46  THR A CG2 1 
ATOM   354  N  N   . CYS A 1 47  ? 3.389  10.005 -3.325  1.00 15.48 ? 47  CYS A N   1 
ATOM   355  C  CA  . CYS A 1 47  ? 3.985  8.697  -3.588  1.00 15.78 ? 47  CYS A CA  1 
ATOM   356  C  C   . CYS A 1 47  ? 5.329  8.767  -4.320  1.00 15.99 ? 47  CYS A C   1 
ATOM   357  O  O   . CYS A 1 47  ? 6.170  7.852  -4.202  1.00 16.62 ? 47  CYS A O   1 
ATOM   358  C  CB  . CYS A 1 47  ? 3.020  7.805  -4.350  1.00 16.65 ? 47  CYS A CB  1 
ATOM   359  S  SG  . CYS A 1 47  ? 1.488  7.379  -3.473  1.00 18.97 ? 47  CYS A SG  1 
ATOM   360  N  N   . TYR A 1 48  ? 5.532  9.815  -5.108  1.00 15.78 ? 48  TYR A N   1 
ATOM   361  C  CA  . TYR A 1 48  ? 6.823  10.067 -5.756  1.00 16.78 ? 48  TYR A CA  1 
ATOM   362  C  C   . TYR A 1 48  ? 7.888  10.305 -4.686  1.00 16.45 ? 48  TYR A C   1 
ATOM   363  O  O   . TYR A 1 48  ? 8.956  9.711  -4.707  1.00 16.61 ? 48  TYR A O   1 
ATOM   364  C  CB  . TYR A 1 48  ? 6.727  11.270 -6.708  1.00 16.94 ? 48  TYR A CB  1 
ATOM   365  C  CG  . TYR A 1 48  ? 8.085  11.647 -7.256  1.00 17.49 ? 48  TYR A CG  1 
ATOM   366  C  CD1 . TYR A 1 48  ? 8.658  10.920 -8.296  1.00 20.23 ? 48  TYR A CD1 1 
ATOM   367  C  CD2 . TYR A 1 48  ? 8.836  12.672 -6.686  1.00 18.68 ? 48  TYR A CD2 1 
ATOM   368  C  CE1 . TYR A 1 48  ? 9.927  11.240 -8.777  1.00 20.34 ? 48  TYR A CE1 1 
ATOM   369  C  CE2 . TYR A 1 48  ? 10.085 13.001 -7.179  1.00 21.05 ? 48  TYR A CE2 1 
ATOM   370  C  CZ  . TYR A 1 48  ? 10.630 12.260 -8.193  1.00 22.01 ? 48  TYR A CZ  1 
ATOM   371  O  OH  . TYR A 1 48  ? 11.913 12.578 -8.680  1.00 25.63 ? 48  TYR A OH  1 
ATOM   372  N  N   . MET A 1 49  ? 7.591  11.143 -3.705  1.00 17.81 ? 49  MET A N   1 
ATOM   373  C  CA  . MET A 1 49  ? 8.564  11.386 -2.616  1.00 18.20 ? 49  MET A CA  1 
ATOM   374  C  C   . MET A 1 49  ? 8.874  10.109 -1.836  1.00 18.35 ? 49  MET A C   1 
ATOM   375  O  O   . MET A 1 49  ? 10.031 9.813  -1.562  1.00 18.61 ? 49  MET A O   1 
ATOM   376  C  CB  . MET A 1 49  ? 8.065  12.491 -1.709  1.00 18.48 ? 49  MET A CB  1 
ATOM   377  C  CG  . MET A 1 49  ? 7.926  13.850 -2.418  1.00 19.26 ? 49  MET A CG  1 
ATOM   378  S  SD  . MET A 1 49  ? 7.533  15.236 -1.298  1.00 22.06 ? 49  MET A SD  1 
ATOM   379  C  CE  . MET A 1 49  ? 5.861  14.796 -0.773  1.00 21.44 ? 49  MET A CE  1 
ATOM   380  N  N   . TYR A 1 50  ? 7.855  9.319  -1.485  1.00 16.68 ? 50  TYR A N   1 
ATOM   381  C  CA  . TYR A 1 50  ? 8.132  8.052  -0.839  1.00 16.56 ? 50  TYR A CA  1 
ATOM   382  C  C   . TYR A 1 50  ? 9.005  7.160  -1.756  1.00 16.68 ? 50  TYR A C   1 
ATOM   383  O  O   . TYR A 1 50  ? 9.942  6.499  -1.290  1.00 18.10 ? 50  TYR A O   1 
ATOM   384  C  CB  . TYR A 1 50  ? 6.838  7.304  -0.398  1.00 17.28 ? 50  TYR A CB  1 
ATOM   385  C  CG  . TYR A 1 50  ? 7.156  5.907  0.120   1.00 16.55 ? 50  TYR A CG  1 
ATOM   386  C  CD1 . TYR A 1 50  ? 7.630  5.717  1.407   1.00 16.03 ? 50  TYR A CD1 1 
ATOM   387  C  CD2 . TYR A 1 50  ? 7.069  4.793  -0.703  1.00 19.69 ? 50  TYR A CD2 1 
ATOM   388  C  CE1 . TYR A 1 50  ? 7.997  4.479  1.877   1.00 17.88 ? 50  TYR A CE1 1 
ATOM   389  C  CE2 . TYR A 1 50  ? 7.438  3.528  -0.246  1.00 17.80 ? 50  TYR A CE2 1 
ATOM   390  C  CZ  . TYR A 1 50  ? 7.891  3.372  1.044   1.00 19.54 ? 50  TYR A CZ  1 
ATOM   391  O  OH  . TYR A 1 50  ? 8.286  2.112  1.431   1.00 20.21 ? 50  TYR A OH  1 
ATOM   392  N  N   . CYS A 1 51  ? 8.642  7.089  -3.036  1.00 17.40 ? 51  CYS A N   1 
ATOM   393  C  CA  . CYS A 1 51  ? 9.368  6.270  -4.018  1.00 18.71 ? 51  CYS A CA  1 
ATOM   394  C  C   . CYS A 1 51  ? 10.863 6.590  -4.059  1.00 19.96 ? 51  CYS A C   1 
ATOM   395  O  O   . CYS A 1 51  ? 11.710 5.682  -4.011  1.00 20.95 ? 51  CYS A O   1 
ATOM   396  C  CB  . CYS A 1 51  ? 8.727  6.444  -5.394  1.00 19.10 ? 51  CYS A CB  1 
ATOM   397  S  SG  . CYS A 1 51  ? 9.390  5.362  -6.704  1.00 19.62 ? 51  CYS A SG  1 
ATOM   398  N  N   . LEU A 1 52  ? 11.184 7.872  -4.097  1.00 20.89 ? 52  LEU A N   1 
ATOM   399  C  CA  A LEU A 1 52  ? 12.580 8.267  -4.193  0.50 21.31 ? 52  LEU A CA  1 
ATOM   400  C  CA  B LEU A 1 52  ? 12.577 8.368  -4.142  0.50 21.75 ? 52  LEU A CA  1 
ATOM   401  C  C   . LEU A 1 52  ? 13.324 8.062  -2.858  1.00 21.55 ? 52  LEU A C   1 
ATOM   402  O  O   . LEU A 1 52  ? 14.474 7.601  -2.863  1.00 22.09 ? 52  LEU A O   1 
ATOM   403  C  CB  A LEU A 1 52  ? 12.674 9.690  -4.717  0.50 21.68 ? 52  LEU A CB  1 
ATOM   404  C  CB  B LEU A 1 52  ? 12.605 9.888  -4.323  0.50 22.79 ? 52  LEU A CB  1 
ATOM   405  C  CG  A LEU A 1 52  ? 13.936 10.023 -5.503  0.50 22.63 ? 52  LEU A CG  1 
ATOM   406  C  CG  B LEU A 1 52  ? 12.512 10.549 -5.693  0.50 24.44 ? 52  LEU A CG  1 
ATOM   407  C  CD1 A LEU A 1 52  ? 13.960 9.354  -6.855  0.50 23.76 ? 52  LEU A CD1 1 
ATOM   408  C  CD1 B LEU A 1 52  ? 12.929 12.007 -5.534  0.50 26.00 ? 52  LEU A CD1 1 
ATOM   409  C  CD2 A LEU A 1 52  ? 13.983 11.539 -5.634  0.50 23.59 ? 52  LEU A CD2 1 
ATOM   410  C  CD2 B LEU A 1 52  ? 13.353 9.867  -6.760  0.50 24.50 ? 52  LEU A CD2 1 
ATOM   411  N  N   . LEU A 1 53  ? 12.671 8.328  -1.721  1.00 20.54 ? 53  LEU A N   1 
ATOM   412  C  CA  . LEU A 1 53  ? 13.274 8.009  -0.409  1.00 21.16 ? 53  LEU A CA  1 
ATOM   413  C  C   . LEU A 1 53  ? 13.584 6.514  -0.320  1.00 21.59 ? 53  LEU A C   1 
ATOM   414  O  O   . LEU A 1 53  ? 14.640 6.116  0.178   1.00 23.26 ? 53  LEU A O   1 
ATOM   415  C  CB  . LEU A 1 53  ? 12.376 8.482  0.738   1.00 20.99 ? 53  LEU A CB  1 
ATOM   416  C  CG  . LEU A 1 53  ? 12.192 9.973  0.934   1.00 21.53 ? 53  LEU A CG  1 
ATOM   417  C  CD1 . LEU A 1 53  ? 11.028 10.306 1.890   1.00 21.45 ? 53  LEU A CD1 1 
ATOM   418  C  CD2 . LEU A 1 53  ? 13.513 10.613 1.416   1.00 24.12 ? 53  LEU A CD2 1 
ATOM   419  N  N   . GLU A 1 54  ? 12.669 5.667  -0.786  1.00 21.34 ? 54  GLU A N   1 
ATOM   420  C  CA  . GLU A 1 54  ? 12.862 4.236  -0.712  1.00 23.31 ? 54  GLU A CA  1 
ATOM   421  C  C   . GLU A 1 54  ? 14.037 3.862  -1.593  1.00 24.97 ? 54  GLU A C   1 
ATOM   422  O  O   . GLU A 1 54  ? 14.866 3.030  -1.181  1.00 25.88 ? 54  GLU A O   1 
ATOM   423  C  CB  . GLU A 1 54  ? 11.601 3.502  -1.134  1.00 22.76 ? 54  GLU A CB  1 
ATOM   424  C  CG  . GLU A 1 54  ? 11.603 2.003  -0.832  1.00 24.32 ? 54  GLU A CG  1 
ATOM   425  C  CD  . GLU A 1 54  ? 12.464 1.184  -1.749  1.00 28.00 ? 54  GLU A CD  1 
ATOM   426  O  OE1 . GLU A 1 54  ? 12.581 1.518  -2.950  1.00 27.13 ? 54  GLU A OE1 1 
ATOM   427  O  OE2 . GLU A 1 54  ? 13.008 0.145  -1.273  1.00 30.71 ? 54  GLU A OE2 1 
ATOM   428  N  N   . ALA A 1 55  ? 14.139 4.487  -2.772  1.00 25.69 ? 55  ALA A N   1 
ATOM   429  C  CA  . ALA A 1 55  ? 15.255 4.210  -3.710  1.00 27.47 ? 55  ALA A CA  1 
ATOM   430  C  C   . ALA A 1 55  ? 16.618 4.512  -3.087  1.00 28.68 ? 55  ALA A C   1 
ATOM   431  O  O   . ALA A 1 55  ? 17.620 3.829  -3.407  1.00 30.63 ? 55  ALA A O   1 
ATOM   432  C  CB  . ALA A 1 55  ? 15.089 5.020  -4.993  1.00 27.77 ? 55  ALA A CB  1 
ATOM   433  N  N   . PHE A 1 56  ? 16.666 5.527  -2.227  1.00 28.48 ? 56  PHE A N   1 
ATOM   434  C  CA  . PHE A 1 56  ? 17.915 5.948  -1.559  1.00 28.99 ? 56  PHE A CA  1 
ATOM   435  C  C   . PHE A 1 56  ? 18.127 5.263  -0.196  1.00 28.77 ? 56  PHE A C   1 
ATOM   436  O  O   . PHE A 1 56  ? 19.023 5.665  0.572   1.00 29.44 ? 56  PHE A O   1 
ATOM   437  C  CB  . PHE A 1 56  ? 17.897 7.460  -1.334  1.00 29.28 ? 56  PHE A CB  1 
ATOM   438  C  CG  . PHE A 1 56  ? 17.631 8.290  -2.576  0.50 29.49 ? 56  PHE A CG  1 
ATOM   439  C  CD1 . PHE A 1 56  ? 17.875 7.792  -3.857  0.50 29.83 ? 56  PHE A CD1 1 
ATOM   440  C  CD2 . PHE A 1 56  ? 17.137 9.585  -2.441  0.50 29.23 ? 56  PHE A CD2 1 
ATOM   441  C  CE1 . PHE A 1 56  ? 17.645 8.584  -4.969  0.50 29.63 ? 56  PHE A CE1 1 
ATOM   442  C  CE2 . PHE A 1 56  ? 16.895 10.376 -3.549  0.50 29.44 ? 56  PHE A CE2 1 
ATOM   443  C  CZ  . PHE A 1 56  ? 17.150 9.866  -4.817  0.50 29.47 ? 56  PHE A CZ  1 
ATOM   444  N  N   . SER A 1 57  ? 17.291 4.269  0.109   1.00 28.40 ? 57  SER A N   1 
ATOM   445  C  CA  . SER A 1 57  ? 17.330 3.530  1.383   1.00 27.93 ? 57  SER A CA  1 
ATOM   446  C  C   . SER A 1 57  ? 17.110 4.396  2.616   1.00 26.99 ? 57  SER A C   1 
ATOM   447  O  O   . SER A 1 57  ? 17.628 4.104  3.690   1.00 28.59 ? 57  SER A O   1 
ATOM   448  C  CB  . SER A 1 57  ? 18.655 2.761  1.510   0.50 28.11 ? 57  SER A CB  1 
ATOM   449  O  OG  . SER A 1 57  ? 18.911 2.053  0.319   0.50 29.69 ? 57  SER A OG  1 
ATOM   450  N  N   . LEU A 1 58  ? 16.305 5.439  2.478   1.00 24.66 ? 58  LEU A N   1 
ATOM   451  C  CA  . LEU A 1 58  ? 16.056 6.360  3.548   1.00 24.44 ? 58  LEU A CA  1 
ATOM   452  C  C   . LEU A 1 58  ? 14.783 6.070  4.313   1.00 22.95 ? 58  LEU A C   1 
ATOM   453  O  O   . LEU A 1 58  ? 14.560 6.641  5.385   1.00 22.42 ? 58  LEU A O   1 
ATOM   454  C  CB  . LEU A 1 58  ? 15.964 7.770  2.979   1.00 25.18 ? 58  LEU A CB  1 
ATOM   455  C  CG  . LEU A 1 58  ? 17.267 8.318  2.378   1.00 27.42 ? 58  LEU A CG  1 
ATOM   456  C  CD1 . LEU A 1 58  ? 17.035 9.743  1.965   1.00 31.47 ? 58  LEU A CD1 1 
ATOM   457  C  CD2 . LEU A 1 58  ? 18.432 8.212  3.358   1.00 32.19 ? 58  LEU A CD2 1 
ATOM   458  N  N   . VAL A 1 59  ? 13.940 5.201  3.752   1.00 22.13 ? 59  VAL A N   1 
ATOM   459  C  CA  . VAL A 1 59  ? 12.704 4.747  4.397   1.00 21.06 ? 59  VAL A CA  1 
ATOM   460  C  C   . VAL A 1 59  ? 12.563 3.239  4.177   1.00 21.49 ? 59  VAL A C   1 
ATOM   461  O  O   . VAL A 1 59  ? 13.126 2.656  3.224   1.00 20.95 ? 59  VAL A O   1 
ATOM   462  C  CB  . VAL A 1 59  ? 11.404 5.456  3.881   1.00 21.39 ? 59  VAL A CB  1 
ATOM   463  C  CG1 . VAL A 1 59  ? 11.355 6.920  4.358   1.00 20.81 ? 59  VAL A CG1 1 
ATOM   464  C  CG2 . VAL A 1 59  ? 11.285 5.325  2.343   1.00 22.05 ? 59  VAL A CG2 1 
ATOM   465  N  N   . ASP A 1 60  ? 11.836 2.613  5.083   1.00 20.32 ? 60  ASP A N   1 
ATOM   466  C  CA  . ASP A 1 60  ? 11.514 1.178  4.994   1.00 20.60 ? 60  ASP A CA  1 
ATOM   467  C  C   . ASP A 1 60  ? 10.097 0.984  4.463   1.00 20.23 ? 60  ASP A C   1 
ATOM   468  O  O   . ASP A 1 60  ? 9.431  1.949  4.070   1.00 21.23 ? 60  ASP A O   1 
ATOM   469  C  CB  . ASP A 1 60  ? 11.668 0.491  6.368   1.00 20.42 ? 60  ASP A CB  1 
ATOM   470  C  CG  . ASP A 1 60  ? 10.704 0.989  7.400   1.00 21.52 ? 60  ASP A CG  1 
ATOM   471  O  OD1 . ASP A 1 60  ? 9.725  1.699  7.053   1.00 22.36 ? 60  ASP A OD1 1 
ATOM   472  O  OD2 . ASP A 1 60  ? 10.938 0.663  8.607   1.00 24.42 ? 60  ASP A OD2 1 
ATOM   473  N  N   . ASP A 1 61  ? 9.627  -0.272 4.467   1.00 19.29 ? 61  ASP A N   1 
ATOM   474  C  CA  . ASP A 1 61  ? 8.316  -0.625 3.942   1.00 19.47 ? 61  ASP A CA  1 
ATOM   475  C  C   . ASP A 1 61  ? 7.079  0.056  4.577   1.00 19.76 ? 61  ASP A C   1 
ATOM   476  O  O   . ASP A 1 61  ? 5.969  -0.038 4.005   1.00 21.74 ? 61  ASP A O   1 
ATOM   477  C  CB  . ASP A 1 61  ? 8.132  -2.136 3.960   1.00 19.28 ? 61  ASP A CB  1 
ATOM   478  C  CG  . ASP A 1 61  ? 7.821  -2.688 5.337   1.00 20.38 ? 61  ASP A CG  1 
ATOM   479  O  OD1 . ASP A 1 61  ? 8.295  -2.111 6.359   1.00 21.61 ? 61  ASP A OD1 1 
ATOM   480  O  OD2 . ASP A 1 61  ? 7.052  -3.687 5.387   1.00 19.43 ? 61  ASP A OD2 1 
ATOM   481  N  N   . GLU A 1 62  ? 7.193  0.692  5.739   1.00 20.04 ? 62  GLU A N   1 
ATOM   482  C  CA  . GLU A 1 62  ? 6.188  1.579  6.315   1.00 20.27 ? 62  GLU A CA  1 
ATOM   483  C  C   . GLU A 1 62  ? 6.669  3.011  6.529   1.00 20.52 ? 62  GLU A C   1 
ATOM   484  O  O   . GLU A 1 62  ? 6.096  3.749  7.325   1.00 20.21 ? 62  GLU A O   1 
ATOM   485  C  CB  . GLU A 1 62  ? 5.634  0.959  7.621   1.00 21.77 ? 62  GLU A CB  1 
ATOM   486  C  CG  . GLU A 1 62  ? 4.843  -0.280 7.301   1.00 23.35 ? 62  GLU A CG  1 
ATOM   487  C  CD  . GLU A 1 62  ? 4.284  -1.021 8.464   1.00 22.90 ? 62  GLU A CD  1 
ATOM   488  O  OE1 . GLU A 1 62  ? 4.536  -0.606 9.606   1.00 24.43 ? 62  GLU A OE1 1 
ATOM   489  O  OE2 . GLU A 1 62  ? 3.623  -2.065 8.201   1.00 21.51 ? 62  GLU A OE2 1 
ATOM   490  N  N   . ALA A 1 63  ? 7.514  3.494  5.735   1.00 19.07 ? 63  ALA A N   1 
ATOM   491  C  CA  . ALA A 1 63  ? 7.894  4.891  5.698   1.00 19.68 ? 63  ALA A CA  1 
ATOM   492  C  C   . ALA A 1 63  ? 8.457  5.355  7.017   1.00 20.68 ? 63  ALA A C   1 
ATOM   493  O  O   . ALA A 1 63  ? 8.343  6.529  7.361   1.00 22.57 ? 63  ALA A O   1 
ATOM   494  C  CB  . ALA A 1 63  ? 6.735  5.770  5.264   1.00 19.15 ? 63  ALA A CB  1 
ATOM   495  N  N   . ASN A 1 64  ? 9.116  4.451  7.735   1.00 21.81 ? 64  ASN A N   1 
ATOM   496  C  CA  . ASN A 1 64  ? 9.962  4.857  8.860   1.00 23.66 ? 64  ASN A CA  1 
ATOM   497  C  C   . ASN A 1 64  ? 11.280 5.385  8.345   1.00 25.10 ? 64  ASN A C   1 
ATOM   498  O  O   . ASN A 1 64  ? 11.948 4.703  7.557   1.00 23.16 ? 64  ASN A O   1 
ATOM   499  C  CB  . ASN A 1 64  ? 10.193 3.681  9.811   1.00 24.61 ? 64  ASN A CB  1 
ATOM   500  C  CG  . ASN A 1 64  ? 8.899  3.106  10.335  1.00 25.62 ? 64  ASN A CG  1 
ATOM   501  O  OD1 . ASN A 1 64  ? 8.067  3.835  10.882  1.00 29.69 ? 64  ASN A OD1 1 
ATOM   502  N  ND2 . ASN A 1 64  ? 8.716  1.795  10.176  1.00 27.47 ? 64  ASN A ND2 1 
ATOM   503  N  N   . VAL A 1 65  ? 11.669 6.582  8.797   1.00 26.66 ? 65  VAL A N   1 
ATOM   504  C  CA  . VAL A 1 65  ? 12.854 7.247  8.264   1.00 28.11 ? 65  VAL A CA  1 
ATOM   505  C  C   . VAL A 1 65  ? 14.143 6.791  8.967   1.00 30.00 ? 65  VAL A C   1 
ATOM   506  O  O   . VAL A 1 65  ? 14.177 6.693  10.192  1.00 30.44 ? 65  VAL A O   1 
ATOM   507  C  CB  . VAL A 1 65  ? 12.719 8.779  8.359   1.00 28.40 ? 65  VAL A CB  1 
ATOM   508  C  CG1 . VAL A 1 65  ? 14.065 9.473  8.042   1.00 29.22 ? 65  VAL A CG1 1 
ATOM   509  C  CG2 . VAL A 1 65  ? 11.594 9.295  7.463   1.00 28.68 ? 65  VAL A CG2 1 
ATOM   510  N  N   . ASP A 1 66  ? 15.153 6.431  8.185   1.00 30.88 ? 66  ASP A N   1 
ATOM   511  C  CA  . ASP A 1 66  ? 16.514 6.177  8.708   1.00 32.11 ? 66  ASP A CA  1 
ATOM   512  C  C   . ASP A 1 66  ? 17.202 7.535  8.828   1.00 33.95 ? 66  ASP A C   1 
ATOM   513  O  O   . ASP A 1 66  ? 17.783 8.027  7.856   1.00 34.08 ? 66  ASP A O   1 
ATOM   514  C  CB  . ASP A 1 66  ? 17.298 5.261  7.781   1.00 31.80 ? 66  ASP A CB  1 
ATOM   515  C  CG  . ASP A 1 66  ? 18.615 4.790  8.389   0.60 33.29 ? 66  ASP A CG  1 
ATOM   516  O  OD1 . ASP A 1 66  ? 19.201 5.516  9.229   0.60 32.09 ? 66  ASP A OD1 1 
ATOM   517  O  OD2 . ASP A 1 66  ? 19.060 3.686  8.019   0.60 34.81 ? 66  ASP A OD2 1 
ATOM   518  N  N   . GLU A 1 67  ? 17.119 8.133  10.018  1.00 36.10 ? 67  GLU A N   1 
ATOM   519  C  CA  . GLU A 1 67  ? 17.489 9.543  10.193  1.00 38.24 ? 67  GLU A CA  1 
ATOM   520  C  C   . GLU A 1 67  ? 18.991 9.734  10.012  1.00 39.47 ? 67  GLU A C   1 
ATOM   521  O  O   . GLU A 1 67  ? 19.412 10.723 9.430   1.00 39.60 ? 67  GLU A O   1 
ATOM   522  C  CB  . GLU A 1 67  ? 17.039 10.103 11.556  1.00 38.74 ? 67  GLU A CB  1 
ATOM   523  C  CG  . GLU A 1 67  ? 17.561 11.528 11.806  1.00 40.76 ? 67  GLU A CG  1 
ATOM   524  C  CD  . GLU A 1 67  ? 17.020 12.145 13.072  1.00 43.47 ? 67  GLU A CD  1 
ATOM   525  O  OE1 . GLU A 1 67  ? 16.371 11.439 13.870  1.00 45.51 ? 67  GLU A OE1 1 
ATOM   526  O  OE2 . GLU A 1 67  ? 17.255 13.350 13.269  1.00 45.63 ? 67  GLU A OE2 1 
ATOM   527  N  N   . ASP A 1 68  ? 19.788 8.776  10.473  1.00 40.93 ? 68  ASP A N   1 
ATOM   528  C  CA  . ASP A 1 68  ? 21.238 8.869  10.316  1.00 41.99 ? 68  ASP A CA  1 
ATOM   529  C  C   . ASP A 1 68  ? 21.664 8.838  8.851   1.00 42.59 ? 68  ASP A C   1 
ATOM   530  O  O   . ASP A 1 68  ? 22.499 9.666  8.443   1.00 43.21 ? 68  ASP A O   1 
ATOM   531  C  CB  . ASP A 1 68  ? 21.958 7.757  11.074  1.00 42.50 ? 68  ASP A CB  1 
ATOM   532  C  CG  . ASP A 1 68  ? 22.005 7.991  12.567  0.50 42.10 ? 68  ASP A CG  1 
ATOM   533  O  OD1 . ASP A 1 68  ? 21.638 9.090  13.037  0.50 42.03 ? 68  ASP A OD1 1 
ATOM   534  O  OD2 . ASP A 1 68  ? 22.418 7.052  13.277  0.50 43.76 ? 68  ASP A OD2 1 
ATOM   535  N  N   . ILE A 1 69  ? 21.127 7.899  8.064   1.00 42.40 ? 69  ILE A N   1 
ATOM   536  C  CA  . ILE A 1 69  ? 21.412 7.867  6.620   1.00 42.38 ? 69  ILE A CA  1 
ATOM   537  C  C   . ILE A 1 69  ? 20.948 9.160  5.940   1.00 41.30 ? 69  ILE A C   1 
ATOM   538  O  O   . ILE A 1 69  ? 21.615 9.667  5.031   1.00 41.25 ? 69  ILE A O   1 
ATOM   539  C  CB  . ILE A 1 69  ? 20.727 6.674  5.873   1.00 42.88 ? 69  ILE A CB  1 
ATOM   540  C  CG1 . ILE A 1 69  ? 21.239 5.323  6.331   1.00 44.62 ? 69  ILE A CG1 1 
ATOM   541  C  CG2 . ILE A 1 69  ? 20.997 6.747  4.370   1.00 43.79 ? 69  ILE A CG2 1 
ATOM   542  C  CD1 . ILE A 1 69  ? 20.643 4.185  5.497   1.00 45.55 ? 69  ILE A CD1 1 
ATOM   543  N  N   . MET A 1 70  ? 19.785 9.667  6.342   1.00 40.06 ? 70  MET A N   1 
ATOM   544  C  CA  . MET A 1 70  ? 19.267 10.907 5.791   1.00 39.88 ? 70  MET A CA  1 
ATOM   545  C  C   . MET A 1 70  ? 20.232 12.040 6.115   1.00 40.59 ? 70  MET A C   1 
ATOM   546  O  O   . MET A 1 70  ? 20.591 12.805 5.248   1.00 40.43 ? 70  MET A O   1 
ATOM   547  C  CB  . MET A 1 70  ? 17.897 11.244 6.351   1.00 39.67 ? 70  MET A CB  1 
ATOM   548  C  CG  . MET A 1 70  ? 17.233 12.420 5.655   1.00 39.91 ? 70  MET A CG  1 
ATOM   549  S  SD  . MET A 1 70  ? 15.562 12.759 6.258   0.50 38.26 ? 70  MET A SD  1 
ATOM   550  C  CE  . MET A 1 70  ? 14.618 11.831 5.056   0.80 35.91 ? 70  MET A CE  1 
ATOM   551  N  N   . LEU A 1 71  ? 20.656 12.137 7.368   1.00 41.15 ? 71  LEU A N   1 
ATOM   552  C  CA  . LEU A 1 71  ? 21.562 13.232 7.740   1.00 42.22 ? 71  LEU A CA  1 
ATOM   553  C  C   . LEU A 1 71  ? 22.861 13.187 6.958   1.00 42.56 ? 71  LEU A C   1 
ATOM   554  O  O   . LEU A 1 71  ? 23.349 14.226 6.502   1.00 43.66 ? 71  LEU A O   1 
ATOM   555  C  CB  . LEU A 1 71  ? 21.872 13.173 9.227   1.00 42.72 ? 71  LEU A CB  1 
ATOM   556  C  CG  . LEU A 1 71  ? 20.700 13.529 10.119  1.00 43.95 ? 71  LEU A CG  1 
ATOM   557  C  CD1 . LEU A 1 71  ? 21.124 13.230 11.546  1.00 46.05 ? 71  LEU A CD1 1 
ATOM   558  C  CD2 . LEU A 1 71  ? 20.263 14.982 9.929   1.00 44.93 ? 71  LEU A CD2 1 
ATOM   559  N  N   . GLY A 1 72  ? 23.416 11.991 6.799   1.00 42.82 ? 72  GLY A N   1 
ATOM   560  C  CA  . GLY A 1 72  ? 24.665 11.792 6.057   1.00 42.88 ? 72  GLY A CA  1 
ATOM   561  C  C   . GLY A 1 72  ? 24.681 12.158 4.582   1.00 42.64 ? 72  GLY A C   1 
ATOM   562  O  O   . GLY A 1 72  ? 25.751 12.215 3.970   1.00 43.39 ? 72  GLY A O   1 
ATOM   563  N  N   . LEU A 1 73  ? 23.513 12.367 3.986   1.00 41.39 ? 73  LEU A N   1 
ATOM   564  C  CA  . LEU A 1 73  ? 23.420 12.874 2.618   1.00 40.97 ? 73  LEU A CA  1 
ATOM   565  C  C   . LEU A 1 73  ? 23.253 14.405 2.510   1.00 39.77 ? 73  LEU A C   1 
ATOM   566  O  O   . LEU A 1 73  ? 23.188 14.935 1.404   1.00 40.25 ? 73  LEU A O   1 
ATOM   567  C  CB  . LEU A 1 73  ? 22.259 12.174 1.889   1.00 41.52 ? 73  LEU A CB  1 
ATOM   568  C  CG  . LEU A 1 73  ? 22.418 10.656 1.739   1.00 42.50 ? 73  LEU A CG  1 
ATOM   569  C  CD1 . LEU A 1 73  ? 21.155 10.009 1.194   1.00 42.27 ? 73  LEU A CD1 1 
ATOM   570  C  CD2 . LEU A 1 73  ? 23.604 10.379 0.819   1.00 42.97 ? 73  LEU A CD2 1 
ATOM   571  N  N   . LEU A 1 74  ? 23.171 15.106 3.643   1.00 38.23 ? 74  LEU A N   1 
ATOM   572  C  CA  A LEU A 1 74  ? 22.976 16.548 3.660   0.50 37.39 ? 74  LEU A CA  1 
ATOM   573  C  CA  B LEU A 1 74  ? 22.982 16.557 3.657   0.50 37.54 ? 74  LEU A CA  1 
ATOM   574  C  C   . LEU A 1 74  ? 24.331 17.239 3.861   1.00 37.18 ? 74  LEU A C   1 
ATOM   575  O  O   . LEU A 1 74  ? 25.223 16.662 4.474   1.00 36.17 ? 74  LEU A O   1 
ATOM   576  C  CB  A LEU A 1 74  ? 22.032 16.927 4.799   0.50 37.26 ? 74  LEU A CB  1 
ATOM   577  C  CB  B LEU A 1 74  ? 22.039 16.983 4.785   0.50 37.51 ? 74  LEU A CB  1 
ATOM   578  C  CG  A LEU A 1 74  ? 20.630 16.321 4.739   0.50 37.31 ? 74  LEU A CG  1 
ATOM   579  C  CG  B LEU A 1 74  ? 20.561 17.098 4.433   0.50 38.07 ? 74  LEU A CG  1 
ATOM   580  C  CD1 A LEU A 1 74  ? 19.949 16.408 6.083   0.50 36.30 ? 74  LEU A CD1 1 
ATOM   581  C  CD1 B LEU A 1 74  ? 20.089 15.783 3.839   0.50 37.71 ? 74  LEU A CD1 1 
ATOM   582  C  CD2 A LEU A 1 74  ? 19.813 17.036 3.670   0.50 37.54 ? 74  LEU A CD2 1 
ATOM   583  C  CD2 B LEU A 1 74  ? 19.750 17.485 5.664   0.50 37.56 ? 74  LEU A CD2 1 
ATOM   584  N  N   . PRO A 1 75  ? 24.486 18.458 3.325   1.00 37.21 ? 75  PRO A N   1 
ATOM   585  C  CA  . PRO A 1 75  ? 25.752 19.134 3.605   1.00 36.78 ? 75  PRO A CA  1 
ATOM   586  C  C   . PRO A 1 75  ? 25.934 19.475 5.075   1.00 36.22 ? 75  PRO A C   1 
ATOM   587  O  O   . PRO A 1 75  ? 24.971 19.666 5.803   1.00 34.83 ? 75  PRO A O   1 
ATOM   588  C  CB  . PRO A 1 75  ? 25.665 20.420 2.789   1.00 37.41 ? 75  PRO A CB  1 
ATOM   589  C  CG  . PRO A 1 75  ? 24.251 20.614 2.477   1.00 37.95 ? 75  PRO A CG  1 
ATOM   590  C  CD  . PRO A 1 75  ? 23.643 19.248 2.408   1.00 37.10 ? 75  PRO A CD  1 
ATOM   591  N  N   . ASP A 1 76  ? 27.191 19.606 5.470   1.00 35.74 ? 76  ASP A N   1 
ATOM   592  C  CA  . ASP A 1 76  ? 27.561 19.806 6.859   1.00 35.65 ? 76  ASP A CA  1 
ATOM   593  C  C   . ASP A 1 76  ? 26.807 20.989 7.490   1.00 35.25 ? 76  ASP A C   1 
ATOM   594  O  O   . ASP A 1 76  ? 26.384 20.931 8.650   1.00 34.44 ? 76  ASP A O   1 
ATOM   595  C  CB  . ASP A 1 76  ? 29.076 20.050 6.902   1.00 36.11 ? 76  ASP A CB  1 
ATOM   596  C  CG  . ASP A 1 76  ? 29.680 19.799 8.250   1.00 36.88 ? 76  ASP A CG  1 
ATOM   597  O  OD1 . ASP A 1 76  ? 28.974 19.293 9.144   1.00 37.60 ? 76  ASP A OD1 1 
ATOM   598  O  OD2 . ASP A 1 76  ? 30.887 20.109 8.419   1.00 36.49 ? 76  ASP A OD2 1 
ATOM   599  N  N   . GLN A 1 77  ? 26.668 22.063 6.758   1.00 35.91 ? 77  GLN A N   1 
ATOM   600  C  CA  A GLN A 1 77  ? 26.002 23.182 7.321   0.30 36.84 ? 77  GLN A CA  1 
ATOM   601  C  CA  B GLN A 1 77  ? 25.994 23.229 7.346   0.70 37.10 ? 77  GLN A CA  1 
ATOM   602  C  C   . GLN A 1 77  ? 24.496 23.193 7.385   1.00 37.15 ? 77  GLN A C   1 
ATOM   603  O  O   . GLN A 1 77  ? 23.943 24.097 7.932   1.00 37.42 ? 77  GLN A O   1 
ATOM   604  C  CB  A GLN A 1 77  ? 26.551 24.484 6.799   0.30 37.35 ? 77  GLN A CB  1 
ATOM   605  C  CB  B GLN A 1 77  ? 26.409 24.528 6.688   0.70 38.12 ? 77  GLN A CB  1 
ATOM   606  C  CG  A GLN A 1 77  ? 26.124 24.830 5.433   0.30 38.27 ? 77  GLN A CG  1 
ATOM   607  C  CG  B GLN A 1 77  ? 26.819 25.538 7.749   0.70 40.10 ? 77  GLN A CG  1 
ATOM   608  C  CD  A GLN A 1 77  ? 26.567 23.854 4.375   0.30 38.60 ? 77  GLN A CD  1 
ATOM   609  C  CD  B GLN A 1 77  ? 25.813 26.650 8.062   0.70 41.65 ? 77  GLN A CD  1 
ATOM   610  O  OE1 A GLN A 1 77  ? 25.942 23.785 3.335   0.30 40.03 ? 77  GLN A OE1 1 
ATOM   611  O  OE1 B GLN A 1 77  ? 24.850 26.461 8.819   0.70 41.71 ? 77  GLN A OE1 1 
ATOM   612  N  NE2 A GLN A 1 77  ? 27.648 23.100 4.622   0.30 37.30 ? 77  GLN A NE2 1 
ATOM   613  N  NE2 B GLN A 1 77  ? 26.099 27.841 7.553   0.70 40.48 ? 77  GLN A NE2 1 
ATOM   614  N  N   . LEU A 1 78  ? 23.881 22.153 6.846   1.00 36.50 ? 78  LEU A N   1 
ATOM   615  C  CA  . LEU A 1 78  ? 22.413 21.961 6.936   1.00 36.93 ? 78  LEU A CA  1 
ATOM   616  C  C   . LEU A 1 78  ? 22.051 20.963 8.038   1.00 36.35 ? 78  LEU A C   1 
ATOM   617  O  O   . LEU A 1 78  ? 20.904 20.923 8.518   1.00 35.88 ? 78  LEU A O   1 
ATOM   618  C  CB  . LEU A 1 78  ? 21.891 21.445 5.597   1.00 37.89 ? 78  LEU A CB  1 
ATOM   619  C  CG  . LEU A 1 78  ? 20.583 21.955 4.981   0.70 41.11 ? 78  LEU A CG  1 
ATOM   620  C  CD1 . LEU A 1 78  ? 19.901 20.811 4.188   0.70 42.67 ? 78  LEU A CD1 1 
ATOM   621  C  CD2 . LEU A 1 78  ? 19.632 22.605 5.988   0.70 43.58 ? 78  LEU A CD2 1 
ATOM   622  N  N   . GLN A 1 79  ? 23.027 20.157 8.452   1.00 35.76 ? 79  GLN A N   1 
ATOM   623  C  CA  . GLN A 1 79  ? 22.760 19.033 9.337   1.00 35.44 ? 79  GLN A CA  1 
ATOM   624  C  C   . GLN A 1 79  ? 22.233 19.340 10.744  1.00 35.50 ? 79  GLN A C   1 
ATOM   625  O  O   . GLN A 1 79  ? 21.392 18.586 11.252  1.00 34.57 ? 79  GLN A O   1 
ATOM   626  C  CB  . GLN A 1 79  ? 23.962 18.107 9.438   1.00 35.83 ? 79  GLN A CB  1 
ATOM   627  C  CG  . GLN A 1 79  ? 24.216 17.300 8.161   1.00 36.22 ? 79  GLN A CG  1 
ATOM   628  C  CD  . GLN A 1 79  ? 25.406 16.387 8.292   0.60 36.51 ? 79  GLN A CD  1 
ATOM   629  O  OE1 . GLN A 1 79  ? 25.944 16.196 9.382   0.60 38.09 ? 79  GLN A OE1 1 
ATOM   630  N  NE2 . GLN A 1 79  ? 25.834 15.825 7.185   0.60 35.36 ? 79  GLN A NE2 1 
ATOM   631  N  N   . GLU A 1 80  ? 22.707 20.406 11.400  1.00 34.19 ? 80  GLU A N   1 
ATOM   632  C  CA  . GLU A 1 80  ? 22.154 20.712 12.716  1.00 34.58 ? 80  GLU A CA  1 
ATOM   633  C  C   . GLU A 1 80  ? 20.694 21.058 12.615  1.00 34.65 ? 80  GLU A C   1 
ATOM   634  O  O   . GLU A 1 80  ? 19.887 20.559 13.382  1.00 34.86 ? 80  GLU A O   1 
ATOM   635  C  CB  . GLU A 1 80  ? 22.847 21.908 13.379  1.00 34.68 ? 80  GLU A CB  1 
ATOM   636  C  CG  . GLU A 1 80  ? 24.290 21.710 13.660  1.00 35.04 ? 80  GLU A CG  1 
ATOM   637  C  CD  . GLU A 1 80  ? 24.956 23.049 13.898  1.00 36.52 ? 80  GLU A CD  1 
ATOM   638  O  OE1 . GLU A 1 80  ? 25.645 23.540 12.991  1.00 33.64 ? 80  GLU A OE1 1 
ATOM   639  O  OE2 . GLU A 1 80  ? 24.696 23.633 14.960  1.00 38.95 ? 80  GLU A OE2 1 
ATOM   640  N  N   . ARG A 1 81  ? 20.362 21.911 11.675  1.00 35.68 ? 81  ARG A N   1 
ATOM   641  C  CA  A ARG A 1 81  ? 19.011 22.375 11.498  0.50 36.36 ? 81  ARG A CA  1 
ATOM   642  C  CA  B ARG A 1 81  ? 18.991 22.388 11.495  0.50 36.37 ? 81  ARG A CA  1 
ATOM   643  C  C   . ARG A 1 81  ? 18.135 21.211 11.055  1.00 36.30 ? 81  ARG A C   1 
ATOM   644  O  O   . ARG A 1 81  ? 17.009 21.121 11.459  1.00 36.14 ? 81  ARG A O   1 
ATOM   645  C  CB  A ARG A 1 81  ? 18.985 23.479 10.473  0.50 36.96 ? 81  ARG A CB  1 
ATOM   646  C  CB  B ARG A 1 81  ? 18.938 23.496 10.440  0.50 36.99 ? 81  ARG A CB  1 
ATOM   647  C  CG  A ARG A 1 81  ? 17.674 24.129 10.322  0.50 39.23 ? 81  ARG A CG  1 
ATOM   648  C  CG  B ARG A 1 81  ? 17.619 24.234 10.404  0.50 39.22 ? 81  ARG A CG  1 
ATOM   649  C  CD  A ARG A 1 81  ? 17.828 25.580 10.125  0.50 41.90 ? 81  ARG A CD  1 
ATOM   650  C  CD  B ARG A 1 81  ? 17.678 25.516 9.578   0.50 41.79 ? 81  ARG A CD  1 
ATOM   651  N  NE  A ARG A 1 81  ? 17.906 25.989 8.745   0.50 44.27 ? 81  ARG A NE  1 
ATOM   652  N  NE  B ARG A 1 81  ? 16.527 26.372 9.865   0.50 43.87 ? 81  ARG A NE  1 
ATOM   653  C  CZ  A ARG A 1 81  ? 19.006 26.085 7.996   0.50 45.53 ? 81  ARG A CZ  1 
ATOM   654  C  CZ  B ARG A 1 81  ? 16.278 27.537 9.273   0.50 45.70 ? 81  ARG A CZ  1 
ATOM   655  N  NH1 A ARG A 1 81  ? 18.878 26.493 6.743   0.50 45.99 ? 81  ARG A NH1 1 
ATOM   656  N  NH1 B ARG A 1 81  ? 17.093 28.021 8.341   0.50 45.93 ? 81  ARG A NH1 1 
ATOM   657  N  NH2 A ARG A 1 81  ? 20.221 25.783 8.451   0.50 45.94 ? 81  ARG A NH2 1 
ATOM   658  N  NH2 B ARG A 1 81  ? 15.197 28.228 9.619   0.50 47.19 ? 81  ARG A NH2 1 
ATOM   659  N  N   . ALA A 1 82  ? 18.680 20.338 10.229  1.00 36.06 ? 82  ALA A N   1 
ATOM   660  C  CA  . ALA A 1 82  ? 17.959 19.147 9.758   1.00 36.45 ? 82  ALA A CA  1 
ATOM   661  C  C   . ALA A 1 82  ? 17.709 18.179 10.894  1.00 36.64 ? 82  ALA A C   1 
ATOM   662  O  O   . ALA A 1 82  ? 16.591 17.652 11.039  1.00 36.76 ? 82  ALA A O   1 
ATOM   663  C  CB  . ALA A 1 82  ? 18.729 18.441 8.619   1.00 36.26 ? 82  ALA A CB  1 
ATOM   664  N  N   . GLN A 1 83  ? 18.743 17.920 11.700  1.00 36.91 ? 83  GLN A N   1 
ATOM   665  C  CA  . GLN A 1 83  ? 18.574 17.086 12.902  1.00 37.41 ? 83  GLN A CA  1 
ATOM   666  C  C   . GLN A 1 83  ? 17.518 17.680 13.847  1.00 37.48 ? 83  GLN A C   1 
ATOM   667  O  O   . GLN A 1 83  ? 16.706 16.958 14.418  1.00 37.22 ? 83  GLN A O   1 
ATOM   668  C  CB  . GLN A 1 83  ? 19.900 16.866 13.634  1.00 37.61 ? 83  GLN A CB  1 
ATOM   669  C  CG  . GLN A 1 83  ? 19.847 15.782 14.711  0.50 38.50 ? 83  GLN A CG  1 
ATOM   670  C  CD  . GLN A 1 83  ? 21.223 15.319 15.144  0.50 40.49 ? 83  GLN A CD  1 
ATOM   671  O  OE1 . GLN A 1 83  ? 22.168 16.096 15.175  0.50 41.51 ? 83  GLN A OE1 1 
ATOM   672  N  NE2 . GLN A 1 83  ? 21.340 14.040 15.478  0.50 42.28 ? 83  GLN A NE2 1 
ATOM   673  N  N   . SER A 1 84  ? 17.535 18.999 13.999  1.00 37.79 ? 84  SER A N   1 
ATOM   674  C  CA  . SER A 1 84  ? 16.566 19.696 14.835  1.00 38.43 ? 84  SER A CA  1 
ATOM   675  C  C   . SER A 1 84  ? 15.126 19.479 14.323  1.00 38.38 ? 84  SER A C   1 
ATOM   676  O  O   . SER A 1 84  ? 14.228 19.077 15.082  1.00 37.36 ? 84  SER A O   1 
ATOM   677  C  CB  . SER A 1 84  ? 16.903 21.183 14.859  1.00 39.21 ? 84  SER A CB  1 
ATOM   678  O  OG  . SER A 1 84  ? 15.942 21.918 15.585  1.00 40.69 ? 84  SER A OG  1 
ATOM   679  N  N   . VAL A 1 85  ? 14.910 19.730 13.037  1.00 38.28 ? 85  VAL A N   1 
ATOM   680  C  CA  . VAL A 1 85  ? 13.555 19.593 12.494  1.00 38.48 ? 85  VAL A CA  1 
ATOM   681  C  C   . VAL A 1 85  ? 13.101 18.122 12.534  1.00 37.98 ? 85  VAL A C   1 
ATOM   682  O  O   . VAL A 1 85  ? 11.922 17.840 12.821  1.00 39.17 ? 85  VAL A O   1 
ATOM   683  C  CB  . VAL A 1 85  ? 13.393 20.221 11.099  1.00 38.86 ? 85  VAL A CB  1 
ATOM   684  C  CG1 . VAL A 1 85  ? 13.973 19.317 10.012  1.00 40.05 ? 85  VAL A CG1 1 
ATOM   685  C  CG2 . VAL A 1 85  ? 11.904 20.480 10.850  1.00 39.82 ? 85  VAL A CG2 1 
ATOM   686  N  N   . MET A 1 86  ? 14.008 17.198 12.311  1.00 36.73 ? 86  MET A N   1 
ATOM   687  C  CA  . MET A 1 86  ? 13.672 15.806 12.391  1.00 36.49 ? 86  MET A CA  1 
ATOM   688  C  C   . MET A 1 86  ? 13.353 15.310 13.794  1.00 36.94 ? 86  MET A C   1 
ATOM   689  O  O   . MET A 1 86  ? 12.614 14.376 13.976  1.00 37.26 ? 86  MET A O   1 
ATOM   690  C  CB  . MET A 1 86  ? 14.727 14.943 11.706  1.00 36.56 ? 86  MET A CB  1 
ATOM   691  C  CG  . MET A 1 86  ? 14.851 15.168 10.211  1.00 34.81 ? 86  MET A CG  1 
ATOM   692  S  SD  . MET A 1 86  ? 13.377 14.699 9.267   0.60 36.08 ? 86  MET A SD  1 
ATOM   693  C  CE  . MET A 1 86  ? 13.669 15.515 7.748   0.60 34.59 ? 86  MET A CE  1 
ATOM   694  N  N   . GLY A 1 87  ? 13.898 15.963 14.799  1.00 36.40 ? 87  GLY A N   1 
ATOM   695  C  CA  . GLY A 1 87  ? 13.519 15.649 16.158  1.00 36.38 ? 87  GLY A CA  1 
ATOM   696  C  C   . GLY A 1 87  ? 12.077 16.007 16.422  1.00 35.97 ? 87  GLY A C   1 
ATOM   697  O  O   . GLY A 1 87  ? 11.412 15.369 17.186  1.00 37.36 ? 87  GLY A O   1 
ATOM   698  N  N   . LYS A 1 88  ? 11.613 17.031 15.751  1.00 34.57 ? 88  LYS A N   1 
ATOM   699  C  CA  . LYS A 1 88  ? 10.275 17.478 15.874  1.00 34.15 ? 88  LYS A CA  1 
ATOM   700  C  C   . LYS A 1 88  ? 9.344  16.629 15.032  1.00 33.82 ? 88  LYS A C   1 
ATOM   701  O  O   . LYS A 1 88  ? 8.268  16.315 15.422  1.00 34.36 ? 88  LYS A O   1 
ATOM   702  C  CB  . LYS A 1 88  ? 10.183 18.879 15.358  1.00 34.45 ? 88  LYS A CB  1 
ATOM   703  C  CG  . LYS A 1 88  ? 8.836  19.432 15.505  1.00 35.89 ? 88  LYS A CG  1 
ATOM   704  C  CD  . LYS A 1 88  ? 8.734  20.706 14.807  0.50 37.42 ? 88  LYS A CD  1 
ATOM   705  C  CE  . LYS A 1 88  ? 7.339  21.212 14.807  0.50 38.53 ? 88  LYS A CE  1 
ATOM   706  N  NZ  . LYS A 1 88  ? 7.281  22.535 14.171  0.50 39.21 ? 88  LYS A NZ  1 
ATOM   707  N  N   . CYS A 1 89  ? 9.780  16.319 13.832  1.00 32.28 ? 89  CYS A N   1 
ATOM   708  C  CA  . CYS A 1 89  ? 8.853  15.811 12.785  1.00 32.01 ? 89  CYS A CA  1 
ATOM   709  C  C   . CYS A 1 89  ? 8.811  14.286 12.632  1.00 31.48 ? 89  CYS A C   1 
ATOM   710  O  O   . CYS A 1 89  ? 7.972  13.736 11.848  1.00 32.32 ? 89  CYS A O   1 
ATOM   711  C  CB  . CYS A 1 89  ? 9.205  16.474 11.458  1.00 32.07 ? 89  CYS A CB  1 
ATOM   712  S  SG  . CYS A 1 89  ? 8.834  18.224 11.349  1.00 32.10 ? 89  CYS A SG  1 
ATOM   713  N  N   . LEU A 1 90  ? 9.698  13.593 13.331  1.00 30.06 ? 90  LEU A N   1 
ATOM   714  C  CA  . LEU A 1 90  ? 9.724  12.129 13.405  1.00 29.91 ? 90  LEU A CA  1 
ATOM   715  C  C   . LEU A 1 90  ? 9.301  11.656 14.789  1.00 30.62 ? 90  LEU A C   1 
ATOM   716  O  O   . LEU A 1 90  ? 9.482  12.416 15.769  1.00 32.40 ? 90  LEU A O   1 
ATOM   717  C  CB  . LEU A 1 90  ? 11.123 11.590 13.089  1.00 29.79 ? 90  LEU A CB  1 
ATOM   718  C  CG  . LEU A 1 90  ? 11.676 11.865 11.705  1.00 28.35 ? 90  LEU A CG  1 
ATOM   719  C  CD1 . LEU A 1 90  ? 13.114 11.314 11.642  1.00 27.96 ? 90  LEU A CD1 1 
ATOM   720  C  CD2 . LEU A 1 90  ? 10.786 11.147 10.667  1.00 27.86 ? 90  LEU A CD2 1 
ATOM   721  N  N   . PRO A 1 91  ? 8.762  10.428 14.902  1.00 30.15 ? 91  PRO A N   1 
ATOM   722  C  CA  . PRO A 1 91  ? 8.524  9.486  13.788  1.00 28.99 ? 91  PRO A CA  1 
ATOM   723  C  C   . PRO A 1 91  ? 7.353  9.871  12.865  1.00 27.51 ? 91  PRO A C   1 
ATOM   724  O  O   . PRO A 1 91  ? 6.498  10.656 13.214  1.00 26.10 ? 91  PRO A O   1 
ATOM   725  C  CB  . PRO A 1 91  ? 8.221  8.175  14.501  1.00 29.87 ? 91  PRO A CB  1 
ATOM   726  C  CG  . PRO A 1 91  ? 7.587  8.613  15.785  1.00 30.72 ? 91  PRO A CG  1 
ATOM   727  C  CD  . PRO A 1 91  ? 8.350  9.834  16.189  1.00 31.01 ? 91  PRO A CD  1 
ATOM   728  N  N   . THR A 1 92  ? 7.354  9.301  11.660  1.00 25.64 ? 92  THR A N   1 
ATOM   729  C  CA  . THR A 1 92  ? 6.325  9.596  10.693  1.00 24.25 ? 92  THR A CA  1 
ATOM   730  C  C   . THR A 1 92  ? 5.018  8.954  11.120  1.00 25.17 ? 92  THR A C   1 
ATOM   731  O  O   . THR A 1 92  ? 5.004  7.914  11.787  1.00 26.66 ? 92  THR A O   1 
ATOM   732  C  CB  . THR A 1 92  ? 6.682  9.020  9.289   1.00 23.37 ? 92  THR A CB  1 
ATOM   733  O  OG1 . THR A 1 92  ? 6.931  7.618  9.402   1.00 22.55 ? 92  THR A OG1 1 
ATOM   734  C  CG2 . THR A 1 92  ? 7.915  9.719  8.692   1.00 22.40 ? 92  THR A CG2 1 
ATOM   735  N  N   . SER A 1 93  ? 3.922  9.559  10.697  1.00 25.66 ? 93  SER A N   1 
ATOM   736  C  CA  . SER A 1 93  ? 2.626  8.883  10.829  1.00 26.66 ? 93  SER A CA  1 
ATOM   737  C  C   . SER A 1 93  ? 1.676  9.352  9.735   1.00 25.42 ? 93  SER A C   1 
ATOM   738  O  O   . SER A 1 93  ? 1.882  10.394 9.091   1.00 25.10 ? 93  SER A O   1 
ATOM   739  C  CB  . SER A 1 93  ? 2.036  9.137  12.210  1.00 28.55 ? 93  SER A CB  1 
ATOM   740  O  OG  . SER A 1 93  ? 1.748  10.508 12.345  1.00 31.08 ? 93  SER A OG  1 
ATOM   741  N  N   . GLY A 1 94  ? 0.660  8.533  9.487   1.00 25.19 ? 94  GLY A N   1 
ATOM   742  C  CA  . GLY A 1 94  ? -0.262 8.792  8.385   1.00 24.38 ? 94  GLY A CA  1 
ATOM   743  C  C   . GLY A 1 94  ? -1.009 7.547  7.983   1.00 24.60 ? 94  GLY A C   1 
ATOM   744  O  O   . GLY A 1 94  ? -0.789 6.467  8.564   1.00 25.83 ? 94  GLY A O   1 
ATOM   745  N  N   . SER A 1 95  ? -1.808 7.671  6.921   1.00 24.51 ? 95  SER A N   1 
ATOM   746  C  CA  A SER A 1 95  ? -2.758 6.624  6.496   0.60 24.55 ? 95  SER A CA  1 
ATOM   747  C  CA  B SER A 1 95  ? -2.751 6.614  6.512   0.40 24.97 ? 95  SER A CA  1 
ATOM   748  C  C   . SER A 1 95  ? -2.124 5.528  5.659   1.00 24.50 ? 95  SER A C   1 
ATOM   749  O  O   . SER A 1 95  ? -2.683 4.431  5.527   1.00 25.51 ? 95  SER A O   1 
ATOM   750  C  CB  A SER A 1 95  ? -3.885 7.255  5.681   0.60 24.59 ? 95  SER A CB  1 
ATOM   751  C  CB  B SER A 1 95  ? -3.907 7.226  5.729   0.40 25.28 ? 95  SER A CB  1 
ATOM   752  O  OG  A SER A 1 95  ? -3.374 7.886  4.517   0.60 24.09 ? 95  SER A OG  1 
ATOM   753  O  OG  B SER A 1 95  ? -4.371 8.392  6.372   0.40 27.55 ? 95  SER A OG  1 
ATOM   754  N  N   . ASP A 1 96  ? -0.998 5.855  5.029   1.00 21.95 ? 96  ASP A N   1 
ATOM   755  C  CA  . ASP A 1 96  ? -0.289 4.932  4.149   1.00 20.96 ? 96  ASP A CA  1 
ATOM   756  C  C   . ASP A 1 96  ? 1.080  5.571  3.903   1.00 19.78 ? 96  ASP A C   1 
ATOM   757  O  O   . ASP A 1 96  ? 1.356  6.656  4.423   1.00 19.34 ? 96  ASP A O   1 
ATOM   758  C  CB  . ASP A 1 96  ? -1.072 4.761  2.835   1.00 20.97 ? 96  ASP A CB  1 
ATOM   759  C  CG  . ASP A 1 96  ? -1.306 6.090  2.139   1.00 23.54 ? 96  ASP A CG  1 
ATOM   760  O  OD1 . ASP A 1 96  ? -0.307 6.756  1.787   1.00 23.17 ? 96  ASP A OD1 1 
ATOM   761  O  OD2 . ASP A 1 96  ? -2.489 6.493  1.971   1.00 29.33 ? 96  ASP A OD2 1 
ATOM   762  N  N   . ASN A 1 97  ? 1.945  4.885  3.165   1.00 19.21 ? 97  ASN A N   1 
ATOM   763  C  CA  . ASN A 1 97  ? 3.321  5.378  3.007   1.00 18.47 ? 97  ASN A CA  1 
ATOM   764  C  C   . ASN A 1 97  ? 3.392  6.743  2.347   1.00 18.30 ? 97  ASN A C   1 
ATOM   765  O  O   . ASN A 1 97  ? 4.223  7.587  2.715   1.00 18.94 ? 97  ASN A O   1 
ATOM   766  C  CB  . ASN A 1 97  ? 4.149  4.372  2.236   1.00 19.23 ? 97  ASN A CB  1 
ATOM   767  C  CG  . ASN A 1 97  ? 4.468  3.132  3.039   1.00 20.25 ? 97  ASN A CG  1 
ATOM   768  O  OD1 . ASN A 1 97  ? 4.408  3.131  4.283   1.00 21.78 ? 97  ASN A OD1 1 
ATOM   769  N  ND2 . ASN A 1 97  ? 4.826  2.072  2.334   1.00 21.09 ? 97  ASN A ND2 1 
ATOM   770  N  N   . CYS A 1 98  ? 2.541  6.996  1.365   1.00 18.60 ? 98  CYS A N   1 
ATOM   771  C  CA  . CYS A 1 98  ? 2.565  8.278  0.690   1.00 18.06 ? 98  CYS A CA  1 
ATOM   772  C  C   . CYS A 1 98  ? 2.128  9.402  1.645   1.00 17.90 ? 98  CYS A C   1 
ATOM   773  O  O   . CYS A 1 98  ? 2.778  10.457 1.727   1.00 17.23 ? 98  CYS A O   1 
ATOM   774  C  CB  . CYS A 1 98  ? 1.667  8.207  -0.558  1.00 19.78 ? 98  CYS A CB  1 
ATOM   775  S  SG  . CYS A 1 98  ? 2.125  6.784  -1.598  1.00 20.30 ? 98  CYS A SG  1 
ATOM   776  N  N   . ASN A 1 99  ? 1.049  9.169  2.392   1.00 17.58 ? 99  ASN A N   1 
ATOM   777  C  CA  . ASN A 1 99  ? 0.517  10.182 3.299   1.00 18.90 ? 99  ASN A CA  1 
ATOM   778  C  C   . ASN A 1 99  ? 1.449  10.423 4.479   1.00 18.13 ? 99  ASN A C   1 
ATOM   779  O  O   . ASN A 1 99  ? 1.569  11.550 4.932   1.00 19.72 ? 99  ASN A O   1 
ATOM   780  C  CB  . ASN A 1 99  ? -0.855 9.765  3.784   1.00 19.97 ? 99  ASN A CB  1 
ATOM   781  C  CG  . ASN A 1 99  ? -1.470 10.767 4.715   1.00 20.86 ? 99  ASN A CG  1 
ATOM   782  O  OD1 . ASN A 1 99  ? -1.711 10.452 5.886   1.00 22.29 ? 99  ASN A OD1 1 
ATOM   783  N  ND2 . ASN A 1 99  ? -1.747 11.969 4.220   1.00 21.20 ? 99  ASN A ND2 1 
ATOM   784  N  N   . LYS A 1 100 ? 2.196  9.396  4.887   1.00 17.80 ? 100 LYS A N   1 
ATOM   785  C  CA  . LYS A 1 100 ? 3.236  9.562  5.923   1.00 18.35 ? 100 LYS A CA  1 
ATOM   786  C  C   . LYS A 1 100 ? 4.293  10.566 5.426   1.00 18.92 ? 100 LYS A C   1 
ATOM   787  O  O   . LYS A 1 100 ? 4.703  11.465 6.163   1.00 19.67 ? 100 LYS A O   1 
ATOM   788  C  CB  . LYS A 1 100 ? 3.883  8.237  6.267   1.00 19.19 ? 100 LYS A CB  1 
ATOM   789  C  CG  . LYS A 1 100 ? 3.027  7.323  7.168   1.00 21.00 ? 100 LYS A CG  1 
ATOM   790  C  CD  . LYS A 1 100 ? 3.631  5.948  7.368   1.00 22.80 ? 100 LYS A CD  1 
ATOM   791  C  CE  . LYS A 1 100 ? 2.827  5.139  8.437   1.00 26.28 ? 100 LYS A CE  1 
ATOM   792  N  NZ  . LYS A 1 100 ? 3.356  3.741  8.593   1.00 29.91 ? 100 LYS A NZ  1 
ATOM   793  N  N   . ILE A 1 101 ? 4.722  10.431 4.161   1.00 17.74 ? 101 ILE A N   1 
ATOM   794  C  CA  . ILE A 1 101 ? 5.723  11.366 3.643   1.00 17.53 ? 101 ILE A CA  1 
ATOM   795  C  C   . ILE A 1 101 ? 5.131  12.758 3.378   1.00 19.42 ? 101 ILE A C   1 
ATOM   796  O  O   . ILE A 1 101 ? 5.825  13.781 3.589   1.00 19.25 ? 101 ILE A O   1 
ATOM   797  C  CB  . ILE A 1 101 ? 6.458  10.762 2.408   1.00 17.33 ? 101 ILE A CB  1 
ATOM   798  C  CG1 . ILE A 1 101 ? 7.164  9.437  2.789   1.00 16.71 ? 101 ILE A CG1 1 
ATOM   799  C  CG2 . ILE A 1 101 ? 7.478  11.768 1.819   1.00 16.94 ? 101 ILE A CG2 1 
ATOM   800  C  CD1 . ILE A 1 101 ? 8.019  9.442  4.066   1.00 17.31 ? 101 ILE A CD1 1 
ATOM   801  N  N   . TYR A 1 102 ? 3.853  12.837 2.970   1.00 19.26 ? 102 TYR A N   1 
ATOM   802  C  CA  . TYR A 1 102 ? 3.183  14.129 2.874   1.00 19.53 ? 102 TYR A CA  1 
ATOM   803  C  C   . TYR A 1 102 ? 3.265  14.840 4.242   1.00 20.62 ? 102 TYR A C   1 
ATOM   804  O  O   . TYR A 1 102 ? 3.661  16.024 4.306   1.00 22.19 ? 102 TYR A O   1 
ATOM   805  C  CB  . TYR A 1 102 ? 1.733  13.971 2.465   1.00 20.32 ? 102 TYR A CB  1 
ATOM   806  C  CG  . TYR A 1 102 ? 0.897  15.228 2.626   1.00 20.31 ? 102 TYR A CG  1 
ATOM   807  C  CD1 . TYR A 1 102 ? 1.009  16.283 1.743   1.00 22.63 ? 102 TYR A CD1 1 
ATOM   808  C  CD2 . TYR A 1 102 ? 0.024  15.358 3.707   1.00 22.54 ? 102 TYR A CD2 1 
ATOM   809  C  CE1 . TYR A 1 102 ? 0.237  17.428 1.902   1.00 24.89 ? 102 TYR A CE1 1 
ATOM   810  C  CE2 . TYR A 1 102 ? -0.728 16.495 3.887   1.00 23.60 ? 102 TYR A CE2 1 
ATOM   811  C  CZ  . TYR A 1 102 ? -0.613 17.528 2.976   1.00 25.31 ? 102 TYR A CZ  1 
ATOM   812  O  OH  . TYR A 1 102 ? -1.356 18.690 3.087   1.00 29.86 ? 102 TYR A OH  1 
ATOM   813  N  N   . ASN A 1 103 ? 2.907  14.118 5.294   1.00 20.30 ? 103 ASN A N   1 
ATOM   814  C  CA  . ASN A 1 103 ? 2.864  14.735 6.639   1.00 21.86 ? 103 ASN A CA  1 
ATOM   815  C  C   . ASN A 1 103 ? 4.263  15.186 7.077   1.00 22.70 ? 103 ASN A C   1 
ATOM   816  O  O   . ASN A 1 103 ? 4.432  16.253 7.713   1.00 24.86 ? 103 ASN A O   1 
ATOM   817  C  CB  . ASN A 1 103 ? 2.246  13.781 7.660   1.00 22.38 ? 103 ASN A CB  1 
ATOM   818  C  CG  . ASN A 1 103 ? 0.742  13.640 7.496   1.00 22.40 ? 103 ASN A CG  1 
ATOM   819  O  OD1 . ASN A 1 103 ? 0.063  14.565 7.038   1.00 24.35 ? 103 ASN A OD1 1 
ATOM   820  N  ND2 . ASN A 1 103 ? 0.217  12.487 7.893   1.00 23.96 ? 103 ASN A ND2 1 
ATOM   821  N  N   . LEU A 1 104 ? 5.259  14.368 6.783   1.00 22.34 ? 104 LEU A N   1 
ATOM   822  C  CA  . LEU A 1 104 ? 6.670  14.727 7.065   1.00 21.88 ? 104 LEU A CA  1 
ATOM   823  C  C   . LEU A 1 104 ? 7.104  15.967 6.299   1.00 23.08 ? 104 LEU A C   1 
ATOM   824  O  O   . LEU A 1 104 ? 7.691  16.913 6.894   1.00 24.15 ? 104 LEU A O   1 
ATOM   825  C  CB  . LEU A 1 104 ? 7.608  13.574 6.724   1.00 22.22 ? 104 LEU A CB  1 
ATOM   826  C  CG  . LEU A 1 104 ? 9.104  13.816 6.892   1.00 19.96 ? 104 LEU A CG  1 
ATOM   827  C  CD1 . LEU A 1 104 ? 9.389  14.263 8.356   1.00 23.31 ? 104 LEU A CD1 1 
ATOM   828  C  CD2 . LEU A 1 104 ? 9.900  12.555 6.552   1.00 21.13 ? 104 LEU A CD2 1 
ATOM   829  N  N   . ALA A 1 105 ? 6.827  16.002 4.998   1.00 22.93 ? 105 ALA A N   1 
ATOM   830  C  CA  . ALA A 1 105 ? 7.202  17.150 4.182   1.00 24.73 ? 105 ALA A CA  1 
ATOM   831  C  C   . ALA A 1 105 ? 6.567  18.432 4.715   1.00 26.09 ? 105 ALA A C   1 
ATOM   832  O  O   . ALA A 1 105 ? 7.224  19.473 4.829   1.00 26.47 ? 105 ALA A O   1 
ATOM   833  C  CB  . ALA A 1 105 ? 6.828  16.929 2.718   1.00 24.75 ? 105 ALA A CB  1 
ATOM   834  N  N   . LYS A 1 106 ? 5.290  18.335 5.076   1.00 27.29 ? 106 LYS A N   1 
ATOM   835  C  CA  . LYS A 1 106 ? 4.562  19.463 5.621   1.00 28.91 ? 106 LYS A CA  1 
ATOM   836  C  C   . LYS A 1 106 ? 5.198  19.961 6.910   1.00 29.15 ? 106 LYS A C   1 
ATOM   837  O  O   . LYS A 1 106 ? 5.416  21.169 7.066   1.00 31.98 ? 106 LYS A O   1 
ATOM   838  C  CB  . LYS A 1 106 ? 3.100  19.077 5.858   1.00 29.38 ? 106 LYS A CB  1 
ATOM   839  C  CG  . LYS A 1 106 ? 2.229  19.319 4.630   1.00 31.39 ? 106 LYS A CG  1 
ATOM   840  C  CD  . LYS A 1 106 ? 1.955  20.831 4.465   0.50 33.08 ? 106 LYS A CD  1 
ATOM   841  C  CE  . LYS A 1 106 ? 1.005  21.121 3.330   0.50 32.92 ? 106 LYS A CE  1 
ATOM   842  N  NZ  . LYS A 1 106 ? 1.415  22.322 2.565   0.50 32.31 ? 106 LYS A NZ  1 
ATOM   843  N  N   . CYS A 1 107 ? 5.529  19.039 7.796   1.00 29.93 ? 107 CYS A N   1 
ATOM   844  C  CA  . CYS A 1 107 ? 6.084  19.365 9.101   1.00 30.65 ? 107 CYS A CA  1 
ATOM   845  C  C   . CYS A 1 107 ? 7.423  20.062 8.887   1.00 31.25 ? 107 CYS A C   1 
ATOM   846  O  O   . CYS A 1 107 ? 7.708  21.121 9.495   1.00 32.16 ? 107 CYS A O   1 
ATOM   847  C  CB  . CYS A 1 107 ? 6.226  18.096 9.923   1.00 30.11 ? 107 CYS A CB  1 
ATOM   848  S  SG  . CYS A 1 107 ? 6.814  18.308 11.594  1.00 32.20 ? 107 CYS A SG  1 
ATOM   849  N  N   . VAL A 1 108 ? 8.236  19.510 7.995   1.00 31.39 ? 108 VAL A N   1 
ATOM   850  C  CA  . VAL A 1 108 ? 9.559  20.077 7.734   1.00 31.98 ? 108 VAL A CA  1 
ATOM   851  C  C   . VAL A 1 108 ? 9.459  21.462 7.096   1.00 33.71 ? 108 VAL A C   1 
ATOM   852  O  O   . VAL A 1 108 ? 10.114 22.410 7.558   1.00 33.74 ? 108 VAL A O   1 
ATOM   853  C  CB  . VAL A 1 108 ? 10.419 19.136 6.860   1.00 31.08 ? 108 VAL A CB  1 
ATOM   854  C  CG1 . VAL A 1 108 ? 11.736 19.822 6.461   1.00 31.93 ? 108 VAL A CG1 1 
ATOM   855  C  CG2 . VAL A 1 108 ? 10.670 17.843 7.580   1.00 29.18 ? 108 VAL A CG2 1 
ATOM   856  N  N   . GLN A 1 109 ? 8.650  21.604 6.052   1.00 35.23 ? 109 GLN A N   1 
ATOM   857  C  CA  . GLN A 1 109 ? 8.515  22.894 5.371   1.00 36.85 ? 109 GLN A CA  1 
ATOM   858  C  C   . GLN A 1 109 ? 7.972  23.996 6.307   1.00 38.87 ? 109 GLN A C   1 
ATOM   859  O  O   . GLN A 1 109 ? 8.385  25.161 6.195   1.00 39.90 ? 109 GLN A O   1 
ATOM   860  C  CB  . GLN A 1 109 ? 7.710  22.749 4.059   1.00 37.00 ? 109 GLN A CB  1 
ATOM   861  C  CG  . GLN A 1 109 ? 8.498  21.914 3.014   1.00 36.65 ? 109 GLN A CG  1 
ATOM   862  C  CD  . GLN A 1 109 ? 7.968  21.950 1.585   0.60 36.37 ? 109 GLN A CD  1 
ATOM   863  O  OE1 . GLN A 1 109 ? 6.757  21.915 1.345   0.60 36.66 ? 109 GLN A OE1 1 
ATOM   864  N  NE2 . GLN A 1 109 ? 8.898  21.978 0.617   0.60 34.87 ? 109 GLN A NE2 1 
ATOM   865  N  N   . GLU A 1 110 ? 7.122  23.634 7.262   1.00 40.22 ? 110 GLU A N   1 
ATOM   866  C  CA  . GLU A 1 110 ? 6.578  24.624 8.200   1.00 41.93 ? 110 GLU A CA  1 
ATOM   867  C  C   . GLU A 1 110 ? 7.603  25.062 9.253   1.00 43.26 ? 110 GLU A C   1 
ATOM   868  O  O   . GLU A 1 110 ? 7.468  26.148 9.815   1.00 44.17 ? 110 GLU A O   1 
ATOM   869  C  CB  . GLU A 1 110 ? 5.329  24.081 8.887   1.00 42.06 ? 110 GLU A CB  1 
ATOM   870  C  CG  . GLU A 1 110 ? 4.113  24.017 7.964   0.50 42.61 ? 110 GLU A CG  1 
ATOM   871  C  CD  . GLU A 1 110 ? 2.971  23.154 8.496   0.50 42.92 ? 110 GLU A CD  1 
ATOM   872  O  OE1 . GLU A 1 110 ? 3.083  22.612 9.617   0.50 44.39 ? 110 GLU A OE1 1 
ATOM   873  O  OE2 . GLU A 1 110 ? 1.955  23.016 7.778   0.50 42.92 ? 110 GLU A OE2 1 
ATOM   874  N  N   . SER A 1 111 ? 8.604  24.224 9.506   1.00 44.17 ? 111 SER A N   1 
ATOM   875  C  CA  . SER A 1 111 ? 9.481  24.404 10.656  1.00 44.83 ? 111 SER A CA  1 
ATOM   876  C  C   . SER A 1 111 ? 10.875 24.846 10.223  1.00 44.89 ? 111 SER A C   1 
ATOM   877  O  O   . SER A 1 111 ? 11.629 25.415 11.012  1.00 45.37 ? 111 SER A O   1 
ATOM   878  C  CB  . SER A 1 111 ? 9.569  23.111 11.469  1.00 45.28 ? 111 SER A CB  1 
ATOM   879  O  OG  . SER A 1 111 ? 8.280  22.583 11.729  0.50 44.79 ? 111 SER A OG  1 
ATOM   880  N  N   . ALA A 1 112 ? 11.475 24.445 9.130   1.00 43.57 ? 112 ALA A N   1 
ATOM   881  C  CA  . ALA A 1 112 ? 12.769 24.656 8.492   1.00 41.93 ? 112 ALA A CA  1 
ATOM   882  C  C   . ALA A 1 112 ? 12.659 24.552 6.975   1.00 39.39 ? 112 ALA A C   1 
ATOM   883  O  O   . ALA A 1 112 ? 12.865 23.484 6.399   1.00 41.44 ? 112 ALA A O   1 
ATOM   884  C  CB  . ALA A 1 112 ? 13.790 23.661 9.022   1.00 42.07 ? 112 ALA A CB  1 
ATOM   885  N  N   . PRO A 1 113 ? 12.439 25.635 6.237   1.00 45.37 ? 113 PRO A N   1 
ATOM   886  C  CA  . PRO A 1 113 ? 12.142 25.544 4.804   1.00 45.34 ? 113 PRO A CA  1 
ATOM   887  C  C   . PRO A 1 113 ? 13.366 25.856 3.950   1.00 45.27 ? 113 PRO A C   1 
ATOM   888  O  O   . PRO A 1 113 ? 13.242 26.493 2.904   1.00 45.91 ? 113 PRO A O   1 
ATOM   889  C  CB  . PRO A 1 113 ? 11.073 26.619 4.604   1.00 45.38 ? 113 PRO A CB  1 
ATOM   890  C  CG  . PRO A 1 113 ? 11.350 27.619 5.669   1.00 45.60 ? 113 PRO A CG  1 
ATOM   891  C  CD  . PRO A 1 113 ? 11.843 26.834 6.851   1.00 45.40 ? 113 PRO A CD  1 
ATOM   892  N  N   . ASP A 1 114 ? 14.535 25.410 4.398   1.00 39.61 ? 114 ASP A N   1 
ATOM   893  C  CA  . ASP A 1 114 ? 15.634 25.118 3.499   1.00 41.73 ? 114 ASP A CA  1 
ATOM   894  C  C   . ASP A 1 114 ? 15.947 23.650 3.377   1.00 41.54 ? 114 ASP A C   1 
ATOM   895  O  O   . ASP A 1 114 ? 16.751 23.265 2.597   1.00 43.96 ? 114 ASP A O   1 
ATOM   896  C  CB  . ASP A 1 114 ? 16.901 25.889 3.880   0.50 42.39 ? 114 ASP A CB  1 
ATOM   897  C  CG  . ASP A 1 114 ? 16.809 27.360 3.575   0.50 44.25 ? 114 ASP A CG  1 
ATOM   898  O  OD1 . ASP A 1 114 ? 15.894 27.768 2.866   0.50 45.01 ? 114 ASP A OD1 1 
ATOM   899  O  OD2 . ASP A 1 114 ? 17.664 28.120 4.047   0.50 46.49 ? 114 ASP A OD2 1 
ATOM   900  N  N   . VAL A 1 115 ? 15.316 22.842 4.191   1.00 39.75 ? 115 VAL A N   1 
ATOM   901  C  CA  . VAL A 1 115 ? 15.699 21.446 4.371   1.00 38.10 ? 115 VAL A CA  1 
ATOM   902  C  C   . VAL A 1 115 ? 15.030 20.540 3.339   1.00 35.79 ? 115 VAL A C   1 
ATOM   903  O  O   . VAL A 1 115 ? 15.676 19.692 2.768   1.00 35.35 ? 115 VAL A O   1 
ATOM   904  C  CB  . VAL A 1 115 ? 15.372 20.952 5.784   1.00 37.68 ? 115 VAL A CB  1 
ATOM   905  C  CG1 . VAL A 1 115 ? 15.761 19.498 5.937   1.00 39.26 ? 115 VAL A CG1 1 
ATOM   906  C  CG2 . VAL A 1 115 ? 16.116 21.825 6.833   1.00 39.06 ? 115 VAL A CG2 1 
ATOM   907  N  N   . TRP A 1 116 ? 13.744 20.733 3.102   1.00 33.77 ? 116 TRP A N   1 
ATOM   908  C  CA  . TRP A 1 116 ? 13.001 19.763 2.273   1.00 32.46 ? 116 TRP A CA  1 
ATOM   909  C  C   . TRP A 1 116 ? 13.083 20.056 0.783   1.00 32.86 ? 116 TRP A C   1 
ATOM   910  O  O   . TRP A 1 116 ? 12.315 20.854 0.242   1.00 35.70 ? 116 TRP A O   1 
ATOM   911  C  CB  . TRP A 1 116 ? 11.544 19.644 2.729   1.00 29.90 ? 116 TRP A CB  1 
ATOM   912  C  CG  . TRP A 1 116 ? 10.904 18.396 2.173   1.00 28.76 ? 116 TRP A CG  1 
ATOM   913  C  CD1 . TRP A 1 116 ? 10.195 18.290 1.007   1.00 28.15 ? 116 TRP A CD1 1 
ATOM   914  C  CD2 . TRP A 1 116 ? 10.936 17.097 2.746   1.00 25.82 ? 116 TRP A CD2 1 
ATOM   915  N  NE1 . TRP A 1 116 ? 9.776  16.988 0.827   1.00 27.70 ? 116 TRP A NE1 1 
ATOM   916  C  CE2 . TRP A 1 116 ? 10.217 16.230 1.871   1.00 27.22 ? 116 TRP A CE2 1 
ATOM   917  C  CE3 . TRP A 1 116 ? 11.491 16.558 3.908   1.00 26.77 ? 116 TRP A CE3 1 
ATOM   918  C  CZ2 . TRP A 1 116 ? 10.060 14.874 2.135   1.00 26.37 ? 116 TRP A CZ2 1 
ATOM   919  C  CZ3 . TRP A 1 116 ? 11.324 15.211 4.172   1.00 28.14 ? 116 TRP A CZ3 1 
ATOM   920  C  CH2 . TRP A 1 116 ? 10.612 14.379 3.281   1.00 28.12 ? 116 TRP A CH2 1 
ATOM   921  N  N   . PHE A 1 117 ? 13.990 19.375 0.108   1.00 32.67 ? 117 PHE A N   1 
ATOM   922  C  CA  . PHE A 1 117 ? 14.146 19.510 -1.325  1.00 32.18 ? 117 PHE A CA  1 
ATOM   923  C  C   . PHE A 1 117 ? 13.852 18.189 -1.954  1.00 32.11 ? 117 PHE A C   1 
ATOM   924  O  O   . PHE A 1 117 ? 14.305 17.142 -1.454  1.00 33.63 ? 117 PHE A O   1 
ATOM   925  C  CB  . PHE A 1 117 ? 15.583 19.907 -1.683  1.00 31.96 ? 117 PHE A CB  1 
ATOM   926  C  CG  . PHE A 1 117 ? 15.810 20.079 -3.170  0.60 31.29 ? 117 PHE A CG  1 
ATOM   927  C  CD1 . PHE A 1 117 ? 15.349 21.214 -3.827  0.60 31.09 ? 117 PHE A CD1 1 
ATOM   928  C  CD2 . PHE A 1 117 ? 16.460 19.102 -3.912  0.60 31.74 ? 117 PHE A CD2 1 
ATOM   929  C  CE1 . PHE A 1 117 ? 15.546 21.383 -5.197  0.60 29.63 ? 117 PHE A CE1 1 
ATOM   930  C  CE2 . PHE A 1 117 ? 16.646 19.263 -5.287  0.60 30.67 ? 117 PHE A CE2 1 
ATOM   931  C  CZ  . PHE A 1 117 ? 16.173 20.402 -5.918  0.60 30.48 ? 117 PHE A CZ  1 
ATOM   932  N  N   . VAL A 1 118 ? 13.136 18.223 -3.066  1.00 30.73 ? 118 VAL A N   1 
ATOM   933  C  CA  . VAL A 1 118 ? 12.798 17.007 -3.752  1.00 30.72 ? 118 VAL A CA  1 
ATOM   934  C  C   . VAL A 1 118 ? 13.497 16.995 -5.094  1.00 30.27 ? 118 VAL A C   1 
ATOM   935  O  O   . VAL A 1 118 ? 13.356 17.928 -5.880  1.00 31.99 ? 118 VAL A O   1 
ATOM   936  C  CB  . VAL A 1 118 ? 11.268 16.925 -3.939  1.00 30.51 ? 118 VAL A CB  1 
ATOM   937  C  CG1 . VAL A 1 118 ? 10.894 15.760 -4.863  1.00 29.46 ? 118 VAL A CG1 1 
ATOM   938  C  CG2 . VAL A 1 118 ? 10.616 16.863 -2.562  1.00 31.52 ? 118 VAL A CG2 1 
ATOM   939  N  N   . ILE A 1 119 ? 14.269 15.951 -5.352  1.00 30.31 ? 119 ILE A N   1 
ATOM   940  C  CA  . ILE A 1 119 ? 14.933 15.821 -6.662  1.00 30.37 ? 119 ILE A CA  1 
ATOM   941  C  C   . ILE A 1 119 ? 13.941 15.428 -7.718  1.00 30.26 ? 119 ILE A C   1 
ATOM   942  O  O   . ILE A 1 119 ? 13.159 14.501 -7.500  1.00 29.00 ? 119 ILE A O   1 
ATOM   943  C  CB  . ILE A 1 119 ? 16.039 14.766 -6.614  1.00 30.76 ? 119 ILE A CB  1 
ATOM   944  C  CG1 . ILE A 1 119 ? 17.228 15.296 -5.793  1.00 32.26 ? 119 ILE A CG1 1 
ATOM   945  C  CG2 . ILE A 1 119 ? 16.417 14.313 -8.035  1.00 31.74 ? 119 ILE A CG2 1 
ATOM   946  C  CD1 . ILE A 1 119 ? 18.198 14.198 -5.360  1.00 35.21 ? 119 ILE A CD1 1 
ATOM   947  O  OXT . ILE A 1 119 ? 13.922 15.978 -8.837  1.00 29.12 ? 119 ILE A OXT 1 
HETATM 948  NA NA  . NA  B 2 .   ? -2.547 12.600 -7.587  1.00 25.49 ? 120 NA  A NA  1 
HETATM 949  O  O1S . NBB C 3 .   ? 14.910 13.952 -3.190  1.00 45.29 ? 121 NBB A O1S 1 
HETATM 950  S  S   . NBB C 3 .   ? 14.919 13.571 -1.754  1.00 41.48 ? 121 NBB A S   1 
HETATM 951  O  O2S . NBB C 3 .   ? 14.369 12.202 -1.668  1.00 44.14 ? 121 NBB A O2S 1 
HETATM 952  N  N10 . NBB C 3 .   ? 14.073 14.618 -1.015  1.00 43.42 ? 121 NBB A N10 1 
HETATM 953  C  C11 . NBB C 3 .   ? 13.256 14.365 0.178   1.00 42.39 ? 121 NBB A C11 1 
HETATM 954  C  C12 . NBB C 3 .   ? 14.181 14.384 1.401   1.00 42.33 ? 121 NBB A C12 1 
HETATM 955  C  C13 . NBB C 3 .   ? 14.756 15.755 1.688   1.00 42.98 ? 121 NBB A C13 1 
HETATM 956  C  C14 . NBB C 3 .   ? 15.440 15.830 3.043   1.00 44.09 ? 121 NBB A C14 1 
HETATM 957  C  C4  . NBB C 3 .   ? 16.438 13.637 -1.224  1.00 45.86 ? 121 NBB A C4  1 
HETATM 958  C  C5  . NBB C 3 .   ? 16.972 12.658 -0.382  1.00 48.16 ? 121 NBB A C5  1 
HETATM 959  C  C6  . NBB C 3 .   ? 18.293 12.757 0.084   1.00 42.53 ? 121 NBB A C6  1 
HETATM 960  C  C1  . NBB C 3 .   ? 19.091 13.839 -0.280  1.00 47.05 ? 121 NBB A C1  1 
HETATM 961  C  C2  . NBB C 3 .   ? 18.561 14.817 -1.114  1.00 45.01 ? 121 NBB A C2  1 
HETATM 962  C  C3  . NBB C 3 .   ? 17.244 14.723 -1.575  1.00 50.51 ? 121 NBB A C3  1 
HETATM 963  C  C1  . EDO D 4 .   ? -1.863 5.129  -2.629  1.00 51.28 ? 122 EDO A C1  1 
HETATM 964  O  O1  . EDO D 4 .   ? -2.342 6.479  -2.574  1.00 52.88 ? 122 EDO A O1  1 
HETATM 965  C  C2  . EDO D 4 .   ? -1.467 4.698  -1.229  1.00 51.50 ? 122 EDO A C2  1 
HETATM 966  O  O2  . EDO D 4 .   ? -0.503 3.640  -1.283  1.00 52.12 ? 122 EDO A O2  1 
HETATM 967  C  C1  . EDO E 4 .   ? -3.379 5.956  -5.344  1.00 57.46 ? 123 EDO A C1  1 
HETATM 968  O  O1  . EDO E 4 .   ? -4.148 6.890  -6.115  1.00 56.51 ? 123 EDO A O1  1 
HETATM 969  C  C2  . EDO E 4 .   ? -3.493 4.541  -5.913  1.00 57.83 ? 123 EDO A C2  1 
HETATM 970  O  O2  . EDO E 4 .   ? -2.832 4.380  -7.177  1.00 59.06 ? 123 EDO A O2  1 
HETATM 971  C  C1  . EDO F 4 .   ? -6.180 12.007 -2.227  1.00 61.31 ? 124 EDO A C1  1 
HETATM 972  O  O1  . EDO F 4 .   ? -5.885 10.600 -2.173  1.00 60.96 ? 124 EDO A O1  1 
HETATM 973  C  C2  . EDO F 4 .   ? -7.031 12.292 -3.467  1.00 60.94 ? 124 EDO A C2  1 
HETATM 974  O  O2  . EDO F 4 .   ? -7.550 13.643 -3.502  1.00 61.47 ? 124 EDO A O2  1 
HETATM 975  C  C1  . EDO G 4 .   ? 11.813 3.636  -15.895 0.70 50.13 ? 125 EDO A C1  1 
HETATM 976  O  O1  . EDO G 4 .   ? 10.782 4.507  -16.387 0.70 49.91 ? 125 EDO A O1  1 
HETATM 977  C  C2  . EDO G 4 .   ? 13.175 4.269  -16.181 0.70 49.37 ? 125 EDO A C2  1 
HETATM 978  O  O2  . EDO G 4 .   ? 14.063 4.343  -15.053 0.70 46.34 ? 125 EDO A O2  1 
HETATM 979  C  C1  . EDO H 4 .   ? 15.887 12.001 -14.198 0.70 41.39 ? 126 EDO A C1  1 
HETATM 980  O  O1  . EDO H 4 .   ? 15.383 10.947 -15.013 0.70 35.63 ? 126 EDO A O1  1 
HETATM 981  C  C2  . EDO H 4 .   ? 16.598 13.094 -14.993 0.70 43.30 ? 126 EDO A C2  1 
HETATM 982  O  O2  . EDO H 4 .   ? 17.991 12.841 -15.230 0.70 45.89 ? 126 EDO A O2  1 
HETATM 983  C  C1  . EDO I 4 .   ? 17.339 24.471 -2.489  1.00 62.52 ? 127 EDO A C1  1 
HETATM 984  O  O1  . EDO I 4 .   ? 16.882 25.801 -2.220  1.00 63.14 ? 127 EDO A O1  1 
HETATM 985  C  C2  . EDO I 4 .   ? 17.519 24.319 -3.996  1.00 61.93 ? 127 EDO A C2  1 
HETATM 986  O  O2  . EDO I 4 .   ? 18.402 23.230 -4.290  1.00 62.18 ? 127 EDO A O2  1 
HETATM 987  O  O   . HOH J 5 .   ? -0.004 4.878  -11.884 0.50 34.27 ? 128 HOH A O   1 
HETATM 988  O  O   . HOH J 5 .   ? 3.098  8.109  -15.461 1.00 20.33 ? 129 HOH A O   1 
HETATM 989  O  O   . HOH J 5 .   ? 1.364  2.287  2.176   1.00 31.70 ? 130 HOH A O   1 
HETATM 990  O  O   . HOH J 5 .   ? 11.459 2.943  -4.967  1.00 21.55 ? 131 HOH A O   1 
HETATM 991  O  O   . HOH J 5 .   ? -6.407 13.220 -7.643  1.00 31.39 ? 132 HOH A O   1 
HETATM 992  O  O   . HOH J 5 .   ? 14.214 3.058  7.911   1.00 31.46 ? 133 HOH A O   1 
HETATM 993  O  O   . HOH J 5 .   ? 0.000  14.335 -11.885 0.50 18.14 ? 134 HOH A O   1 
HETATM 994  O  O   . HOH J 5 .   ? 5.441  19.055 -16.101 1.00 28.81 ? 135 HOH A O   1 
HETATM 995  O  O   . HOH J 5 .   ? -0.127 18.404 -7.197  1.00 29.08 ? 136 HOH A O   1 
HETATM 996  O  O   . HOH J 5 .   ? -0.371 8.242  -8.119  1.00 21.76 ? 137 HOH A O   1 
HETATM 997  O  O   . HOH J 5 .   ? -2.209 8.573  -0.004  1.00 30.12 ? 138 HOH A O   1 
HETATM 998  O  O   . HOH J 5 .   ? -0.727 11.022 0.057   1.00 22.69 ? 139 HOH A O   1 
HETATM 999  O  O   . HOH J 5 .   ? 5.473  -5.121 3.683   1.00 22.97 ? 140 HOH A O   1 
HETATM 1000 O  O   . HOH J 5 .   ? -2.620 19.533 -7.349  1.00 33.28 ? 141 HOH A O   1 
HETATM 1001 O  O   . HOH J 5 .   ? 0.694  6.061  -7.009  1.00 27.48 ? 142 HOH A O   1 
HETATM 1002 O  O   . HOH J 5 .   ? 4.867  11.871 9.071   1.00 26.79 ? 143 HOH A O   1 
HETATM 1003 O  O   . HOH J 5 .   ? -3.939 18.654 0.381   1.00 34.21 ? 144 HOH A O   1 
HETATM 1004 O  O   . HOH J 5 .   ? 4.336  10.745 -15.173 1.00 20.01 ? 145 HOH A O   1 
HETATM 1005 O  O   . HOH J 5 .   ? 5.892  14.131 10.238  1.00 30.80 ? 146 HOH A O   1 
HETATM 1006 O  O   . HOH J 5 .   ? -0.028 17.214 -11.864 0.50 19.28 ? 147 HOH A O   1 
HETATM 1007 O  O   . HOH J 5 .   ? 14.211 18.985 17.959  1.00 51.35 ? 148 HOH A O   1 
HETATM 1008 O  O   . HOH J 5 .   ? 7.271  15.971 -16.349 1.00 30.58 ? 149 HOH A O   1 
HETATM 1009 O  O   . HOH J 5 .   ? 9.802  7.540  11.221  1.00 28.07 ? 150 HOH A O   1 
HETATM 1010 O  O   . HOH J 5 .   ? 15.086 2.447  -10.975 1.00 38.04 ? 151 HOH A O   1 
HETATM 1011 O  O   . HOH J 5 .   ? 6.526  10.153 -16.886 1.00 36.01 ? 152 HOH A O   1 
HETATM 1012 O  O   . HOH J 5 .   ? 3.448  19.478 -5.656  1.00 39.04 ? 153 HOH A O   1 
HETATM 1013 O  O   . HOH J 5 .   ? 7.357  0.032  -0.052  0.50 33.62 ? 154 HOH A O   1 
HETATM 1014 O  O   . HOH J 5 .   ? 26.747 19.722 11.125  1.00 37.87 ? 155 HOH A O   1 
HETATM 1015 O  O   . HOH J 5 .   ? 1.617  20.825 -8.152  1.00 39.55 ? 156 HOH A O   1 
HETATM 1016 O  O   . HOH J 5 .   ? 12.862 11.641 -15.687 1.00 39.77 ? 157 HOH A O   1 
HETATM 1017 O  O   . HOH J 5 .   ? 2.638  2.715  6.150   1.00 31.72 ? 158 HOH A O   1 
HETATM 1018 O  O   . HOH J 5 .   ? 12.386 21.763 -8.872  1.00 40.89 ? 159 HOH A O   1 
HETATM 1019 O  O   . HOH J 5 .   ? 3.341  -3.812 2.985   1.00 38.44 ? 160 HOH A O   1 
HETATM 1020 O  O   . HOH J 5 .   ? 4.101  1.826  -0.532  1.00 39.48 ? 161 HOH A O   1 
HETATM 1021 O  O   . HOH J 5 .   ? 9.322  9.044  -16.350 1.00 32.34 ? 162 HOH A O   1 
HETATM 1022 O  O   . HOH J 5 .   ? -4.685 5.400  2.053   1.00 55.04 ? 163 HOH A O   1 
HETATM 1023 O  O   . HOH J 5 .   ? -2.508 14.059 6.099   1.00 30.47 ? 164 HOH A O   1 
HETATM 1024 O  O   . HOH J 5 .   ? 24.739 22.394 10.538  1.00 34.47 ? 165 HOH A O   1 
HETATM 1025 O  O   . HOH J 5 .   ? -1.503 19.070 -10.400 1.00 22.31 ? 166 HOH A O   1 
HETATM 1026 O  O   . HOH J 5 .   ? 0.445  22.363 -5.183  1.00 35.07 ? 167 HOH A O   1 
HETATM 1027 O  O   . HOH J 5 .   ? 18.946 5.875  -10.232 1.00 37.48 ? 168 HOH A O   1 
HETATM 1028 O  O   . HOH J 5 .   ? 5.739  5.016  10.231  1.00 34.63 ? 169 HOH A O   1 
HETATM 1029 O  O   . HOH J 5 .   ? 5.971  0.889  11.112  1.00 40.25 ? 170 HOH A O   1 
HETATM 1030 O  O   . HOH J 5 .   ? 1.122  19.383 -4.709  1.00 32.42 ? 171 HOH A O   1 
HETATM 1031 O  O   . HOH J 5 .   ? 4.215  23.004 2.181   1.00 56.16 ? 172 HOH A O   1 
HETATM 1032 O  O   . HOH J 5 .   ? 22.131 23.930 10.196  1.00 36.96 ? 173 HOH A O   1 
HETATM 1033 O  O   . HOH J 5 .   ? 8.524  -0.357 12.345  1.00 32.98 ? 174 HOH A O   1 
HETATM 1034 O  O   . HOH J 5 .   ? 13.269 1.021  9.645   1.00 33.82 ? 175 HOH A O   1 
HETATM 1035 O  O   . HOH J 5 .   ? 15.619 1.192  -7.127  1.00 41.83 ? 176 HOH A O   1 
HETATM 1036 O  O   . HOH J 5 .   ? -4.229 10.311 2.217   1.00 39.30 ? 177 HOH A O   1 
HETATM 1037 O  O   . HOH J 5 .   ? 5.652  2.688  -14.831 1.00 44.64 ? 178 HOH A O   1 
HETATM 1038 O  O   . HOH J 5 .   ? -5.566 10.537 4.926   1.00 50.59 ? 179 HOH A O   1 
HETATM 1039 O  O   . HOH J 5 .   ? 3.500  15.785 11.008  1.00 44.19 ? 180 HOH A O   1 
HETATM 1040 O  O   . HOH J 5 .   ? 8.447  5.939  12.201  1.00 39.89 ? 181 HOH A O   1 
HETATM 1041 O  O   . HOH J 5 .   ? 20.795 6.826  -12.692 1.00 42.54 ? 182 HOH A O   1 
HETATM 1042 O  O   . HOH J 5 .   ? -4.321 7.465  9.360   1.00 46.77 ? 183 HOH A O   1 
HETATM 1043 O  O   . HOH J 5 .   ? 0.845  5.262  -13.613 1.00 40.06 ? 184 HOH A O   1 
HETATM 1044 O  O   . HOH J 5 .   ? 1.118  5.829  11.195  0.50 22.97 ? 185 HOH A O   1 
HETATM 1045 O  O   . HOH J 5 .   ? 14.685 0.677  -4.675  1.00 39.90 ? 186 HOH A O   1 
HETATM 1046 O  O   . HOH J 5 .   ? 16.818 14.362 15.605  1.00 54.37 ? 187 HOH A O   1 
HETATM 1047 O  O   . HOH J 5 .   ? 0.394  17.409 7.489   1.00 52.52 ? 188 HOH A O   1 
HETATM 1048 O  O   . HOH J 5 .   ? 20.614 20.053 15.983  1.00 44.19 ? 189 HOH A O   1 
HETATM 1049 O  O   . HOH J 5 .   ? 16.677 0.704  -1.553  1.00 56.13 ? 190 HOH A O   1 
HETATM 1050 O  O   . HOH J 5 .   ? 1.679  2.336  10.533  1.00 62.59 ? 191 HOH A O   1 
HETATM 1051 O  O   . HOH J 5 .   ? 18.873 6.732  12.435  1.00 54.79 ? 192 HOH A O   1 
HETATM 1052 O  O   . HOH J 5 .   ? 6.398  23.865 -15.396 1.00 50.17 ? 193 HOH A O   1 
HETATM 1053 O  O   . HOH J 5 .   ? -2.720 11.618 7.984   1.00 41.73 ? 194 HOH A O   1 
HETATM 1054 O  O   . HOH J 5 .   ? 14.465 1.444  -13.647 1.00 52.95 ? 195 HOH A O   1 
HETATM 1055 O  O   . HOH J 5 .   ? -0.128 24.018 -3.188  1.00 48.66 ? 196 HOH A O   1 
HETATM 1056 O  O   . HOH J 5 .   ? 16.474 16.084 -11.870 1.00 39.16 ? 197 HOH A O   1 
HETATM 1057 O  O   . HOH J 5 .   ? 15.576 2.104  5.896   1.00 42.85 ? 198 HOH A O   1 
HETATM 1058 O  O   . HOH J 5 .   ? 25.931 17.234 0.534   1.00 66.27 ? 199 HOH A O   1 
HETATM 1059 O  O   . HOH J 5 .   ? -6.055 12.884 5.192   1.00 68.18 ? 200 HOH A O   1 
HETATM 1060 O  O   . HOH J 5 .   ? 32.478 21.218 6.635   1.00 45.21 ? 201 HOH A O   1 
HETATM 1061 O  O   . HOH J 5 .   ? 10.550 0.966  13.202  1.00 42.16 ? 202 HOH A O   1 
HETATM 1062 O  O   . HOH J 5 .   ? 2.515  17.528 9.184   1.00 39.78 ? 203 HOH A O   1 
HETATM 1063 O  O   . HOH J 5 .   ? 2.667  19.970 10.571  1.00 62.21 ? 204 HOH A O   1 
HETATM 1064 O  O   . HOH J 5 .   ? 20.748 24.103 -4.062  1.00 51.25 ? 205 HOH A O   1 
HETATM 1065 O  O   . HOH J 5 .   ? 4.167  1.353  -13.181 1.00 56.16 ? 206 HOH A O   1 
HETATM 1066 O  O   . HOH J 5 .   ? -5.076 3.482  6.379   1.00 45.90 ? 207 HOH A O   1 
HETATM 1067 O  O   . HOH J 5 .   ? 29.444 19.089 3.473   1.00 67.05 ? 208 HOH A O   1 
HETATM 1068 O  O   . HOH J 5 .   ? 18.207 2.763  -6.014  1.00 56.78 ? 209 HOH A O   1 
HETATM 1069 O  O   . HOH J 5 .   ? 12.766 4.664  12.600  1.00 60.84 ? 210 HOH A O   1 
HETATM 1070 O  O   . HOH J 5 .   ? 12.896 1.832  12.064  1.00 59.47 ? 211 HOH A O   1 
HETATM 1071 O  O   . HOH J 5 .   ? 0.842  3.328  -14.861 1.00 43.25 ? 212 HOH A O   1 
HETATM 1072 O  O   . HOH J 5 .   ? 21.857 6.232  0.247   1.00 59.42 ? 213 HOH A O   1 
HETATM 1073 O  O   . HOH J 5 .   ? -6.130 5.538  8.049   1.00 47.07 ? 214 HOH A O   1 
HETATM 1074 O  O   . HOH J 5 .   ? 16.228 6.939  12.495  1.00 49.34 ? 215 HOH A O   1 
HETATM 1075 O  O   . HOH J 5 .   ? 29.735 21.771 3.152   1.00 58.25 ? 216 HOH A O   1 
HETATM 1076 O  O   . HOH J 5 .   ? -1.190 3.719  8.725   1.00 56.16 ? 217 HOH A O   1 
HETATM 1077 O  O   . HOH J 5 .   ? 17.951 2.153  5.327   1.00 50.33 ? 218 HOH A O   1 
HETATM 1078 O  O   . HOH J 5 .   ? 15.614 5.490  -17.253 1.00 51.71 ? 219 HOH A O   1 
HETATM 1079 O  O   . HOH J 5 .   ? 30.371 23.569 5.505   1.00 50.00 ? 220 HOH A O   1 
HETATM 1080 O  O   . HOH J 5 .   ? 1.728  2.486  -10.505 1.00 42.06 ? 221 HOH A O   1 
HETATM 1081 O  O   . HOH J 5 .   ? -0.724 4.173  -18.686 1.00 44.48 ? 222 HOH A O   1 
HETATM 1082 O  O   . HOH J 5 .   ? 19.587 0.392  4.614   1.00 61.66 ? 223 HOH A O   1 
HETATM 1083 O  O   . HOH J 5 .   ? 10.968 25.105 -7.962  1.00 42.54 ? 224 HOH A O   1 
HETATM 1084 O  O   . HOH J 5 .   ? 19.852 5.603  -5.685  1.00 61.51 ? 225 HOH A O   1 
HETATM 1085 O  O   . HOH J 5 .   ? 24.756 10.643 9.722   1.00 62.85 ? 226 HOH A O   1 
HETATM 1086 O  O   . HOH J 5 .   ? 23.989 8.578  4.023   1.00 55.18 ? 227 HOH A O   1 
HETATM 1087 O  O   . HOH J 5 .   ? -5.538 16.780 2.690   1.00 53.45 ? 228 HOH A O   1 
HETATM 1088 O  O   . HOH J 5 .   ? -2.774 18.903 5.354   1.00 54.58 ? 229 HOH A O   1 
HETATM 1089 O  O   . HOH J 5 .   ? -4.218 16.457 5.540   1.00 46.22 ? 230 HOH A O   1 
HETATM 1090 O  O   . HOH J 5 .   ? -6.039 10.769 0.530   1.00 51.50 ? 231 HOH A O   1 
HETATM 1091 O  O   . HOH J 5 .   ? 12.412 12.215 16.869  1.00 59.06 ? 232 HOH A O   1 
HETATM 1092 O  O   . HOH J 5 .   ? 0.832  24.117 -0.167  1.00 43.35 ? 233 HOH A O   1 
HETATM 1093 O  O   . HOH J 5 .   ? 10.877 26.174 -10.384 1.00 57.56 ? 234 HOH A O   1 
HETATM 1094 O  O   . HOH J 5 .   ? 17.847 13.320 -12.394 1.00 48.85 ? 235 HOH A O   1 
HETATM 1095 O  O   . HOH J 5 .   ? -6.272 15.515 -1.678  1.00 55.62 ? 236 HOH A O   1 
HETATM 1096 O  O   . HOH J 5 .   ? 8.329  2.158  -14.457 1.00 51.19 ? 237 HOH A O   1 
HETATM 1097 O  O   . HOH J 5 .   ? 4.965  24.135 -11.082 1.00 38.64 ? 238 HOH A O   1 
HETATM 1098 O  O   . HOH J 5 .   ? -6.920 14.229 1.683   1.00 57.63 ? 239 HOH A O   1 
HETATM 1099 O  O   . HOH J 5 .   ? -6.168 8.298  -4.568  1.00 59.26 ? 240 HOH A O   1 
HETATM 1100 O  O   . HOH J 5 .   ? -6.150 17.793 -3.834  1.00 43.38 ? 241 HOH A O   1 
HETATM 1101 O  O   . HOH J 5 .   ? 7.054  24.254 -13.166 1.00 30.00 ? 242 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . TRP A 4   ? 0.6998 0.7045 0.6903 -0.0029 -0.0016 0.0042  4   TRP A N   
2    C  CA  . TRP A 4   ? 0.6954 0.7033 0.6891 -0.0014 -0.0017 0.0025  4   TRP A CA  
3    C  C   . TRP A 4   ? 0.6832 0.6908 0.6814 -0.0036 -0.0023 0.0026  4   TRP A C   
4    O  O   . TRP A 4   ? 0.6887 0.7002 0.6973 -0.0025 -0.0058 0.0032  4   TRP A O   
5    C  CB  . TRP A 4   ? 0.7061 0.7148 0.6930 0.0018  -0.0035 0.0000  4   TRP A CB  
6    C  CG  . TRP A 4   ? 0.7007 0.7015 0.6913 -0.0013 0.0029  0.0028  4   TRP A CG  
7    C  CD1 . TRP A 4   ? 0.7241 0.8148 0.6995 -0.0123 -0.0067 0.0068  4   TRP A CD1 
8    C  CD2 . TRP A 4   ? 0.7077 0.7188 0.6797 0.0002  -0.0049 0.0006  4   TRP A CD2 
9    N  NE1 . TRP A 4   ? 0.7368 0.7342 0.7001 -0.0122 -0.0135 0.0124  4   TRP A NE1 
10   C  CE2 . TRP A 4   ? 0.7175 0.7065 0.6887 0.0001  -0.0036 0.0021  4   TRP A CE2 
11   C  CE3 . TRP A 4   ? 0.6869 0.7045 0.6787 0.0014  0.0003  0.0020  4   TRP A CE3 
12   C  CZ2 . TRP A 4   ? 0.7052 0.7148 0.6945 -0.0020 -0.0016 0.0002  4   TRP A CZ2 
13   C  CZ3 . TRP A 4   ? 0.7294 0.7298 0.6929 -0.0162 -0.0088 0.0059  4   TRP A CZ3 
14   C  CH2 . TRP A 4   ? 0.7141 0.7179 0.6987 -0.0033 -0.0003 0.0028  4   TRP A CH2 
15   N  N   . VAL A 5   ? 0.6700 0.6763 0.6646 -0.0026 0.0012  0.0055  5   VAL A N   
16   C  CA  . VAL A 5   ? 0.6567 0.6656 0.6519 -0.0044 0.0017  0.0042  5   VAL A CA  
17   C  C   . VAL A 5   ? 0.6558 0.6609 0.6520 -0.0043 0.0008  0.0038  5   VAL A C   
18   O  O   . VAL A 5   ? 0.6451 0.6571 0.6457 -0.0092 0.0039  0.0045  5   VAL A O   
19   C  CB  . VAL A 5   ? 0.6563 0.6635 0.6501 -0.0035 0.0018  0.0039  5   VAL A CB  
20   C  CG1 . VAL A 5   ? 0.6456 0.6597 0.6485 -0.0062 0.0026  0.0066  5   VAL A CG1 
21   C  CG2 . VAL A 5   ? 0.6516 0.6672 0.6483 -0.0036 -0.0020 -0.0005 5   VAL A CG2 
22   N  N   . PRO A 6   ? 0.6521 0.6580 0.6503 -0.0030 0.0002  0.0043  6   PRO A N   
23   C  CA  . PRO A 6   ? 0.6571 0.6607 0.6533 -0.0019 -0.0001 0.0032  6   PRO A CA  
24   C  C   . PRO A 6   ? 0.6555 0.6664 0.6560 -0.0048 -0.0023 0.0034  6   PRO A C   
25   O  O   . PRO A 6   ? 0.6715 0.6764 0.6618 -0.0123 -0.0014 0.0054  6   PRO A O   
26   C  CB  . PRO A 6   ? 0.6558 0.6653 0.6561 -0.0020 -0.0006 0.0035  6   PRO A CB  
27   C  CG  . PRO A 6   ? 0.6618 0.6621 0.6513 -0.0008 0.0013  0.0062  6   PRO A CG  
28   C  CD  . PRO A 6   ? 0.6576 0.6581 0.6532 -0.0014 -0.0004 0.0055  6   PRO A CD  
29   N  N   . PRO A 7   ? 0.6547 0.6613 0.6565 -0.0059 0.0013  0.0009  7   PRO A N   
30   C  CA  . PRO A 7   ? 0.6574 0.6618 0.6623 -0.0041 0.0008  0.0007  7   PRO A CA  
31   C  C   . PRO A 7   ? 0.6634 0.6643 0.6662 -0.0039 -0.0033 0.0018  7   PRO A C   
32   O  O   . PRO A 7   ? 0.6786 0.6821 0.6806 -0.0090 -0.0037 0.0008  7   PRO A O   
33   C  CB  . PRO A 7   ? 0.6588 0.6630 0.6649 -0.0032 0.0017  0.0000  7   PRO A CB  
34   C  CG  . PRO A 7   ? 0.6527 0.6593 0.6606 -0.0029 0.0038  0.0027  7   PRO A CG  
35   C  CD  . PRO A 7   ? 0.6561 0.6623 0.6578 -0.0043 0.0000  0.0006  7   PRO A CD  
36   N  N   . GLU A 8   ? 0.6627 0.6607 0.6656 -0.0029 -0.0015 0.0014  8   GLU A N   
37   C  CA  . GLU A 8   ? 0.6590 0.6593 0.6646 -0.0016 -0.0007 0.0016  8   GLU A CA  
38   C  C   . GLU A 8   ? 0.6570 0.6563 0.6645 -0.0020 -0.0014 0.0021  8   GLU A C   
39   O  O   . GLU A 8   ? 0.6586 0.6535 0.6652 -0.0046 -0.0029 0.0037  8   GLU A O   
40   C  CB  . GLU A 8   ? 0.6590 0.6595 0.6639 -0.0014 -0.0008 0.0001  8   GLU A CB  
41   C  CG  . GLU A 8   ? 0.6649 0.6674 0.6665 -0.0001 0.0000  0.0013  8   GLU A CG  
42   C  CD  . GLU A 8   ? 0.6659 0.6723 0.6548 -0.0066 -0.0036 0.0005  8   GLU A CD  
43   O  OE1 . GLU A 8   ? 0.6742 0.6883 0.6955 -0.0014 0.0023  0.0000  8   GLU A OE1 
44   O  OE2 . GLU A 8   ? 0.6569 0.6776 0.6848 -0.0051 -0.0065 -0.0076 8   GLU A OE2 
45   N  N   . VAL A 9   ? 0.6552 0.6551 0.6659 -0.0037 -0.0025 0.0052  9   VAL A N   
46   C  CA  . VAL A 9   ? 0.6565 0.6559 0.6655 -0.0022 -0.0033 0.0034  9   VAL A CA  
47   C  C   . VAL A 9   ? 0.6500 0.6471 0.6620 -0.0036 -0.0045 0.0029  9   VAL A C   
48   O  O   . VAL A 9   ? 0.6542 0.6433 0.6738 -0.0110 -0.0025 0.0026  9   VAL A O   
49   C  CB  . VAL A 9   ? 0.6606 0.6585 0.6647 0.0011  -0.0029 0.0031  9   VAL A CB  
50   C  CG1 . VAL A 9   ? 0.6717 0.6666 0.6812 -0.0059 -0.0085 0.0015  9   VAL A CG1 
51   C  CG2 . VAL A 9   ? 0.6688 0.6677 0.6794 -0.0047 -0.0029 0.0076  9   VAL A CG2 
52   N  N   . PHE A 10  ? 0.6351 0.6353 0.6491 -0.0080 -0.0016 0.0055  10  PHE A N   
53   C  CA  . PHE A 10  ? 0.6299 0.6299 0.6372 -0.0051 0.0007  0.0034  10  PHE A CA  
54   C  C   . PHE A 10  ? 0.6413 0.6459 0.6520 -0.0020 0.0018  0.0001  10  PHE A C   
55   O  O   . PHE A 10  ? 0.6454 0.6578 0.6513 -0.0043 0.0027  0.0001  10  PHE A O   
56   C  CB  . PHE A 10  ? 0.6101 0.6095 0.6195 -0.0028 0.0070  -0.0004 10  PHE A CB  
57   C  CG  . PHE A 10  ? 0.5734 0.5708 0.5825 -0.0133 -0.0026 0.0136  10  PHE A CG  
58   C  CD1 . PHE A 10  ? 0.5368 0.5409 0.5437 -0.0078 0.0027  0.0124  10  PHE A CD1 
59   C  CD2 . PHE A 10  ? 0.5386 0.5125 0.5356 -0.0152 0.0055  0.0194  10  PHE A CD2 
60   C  CE1 . PHE A 10  ? 0.5363 0.5407 0.5324 -0.0102 0.0025  0.0198  10  PHE A CE1 
61   C  CE2 . PHE A 10  ? 0.5171 0.5062 0.5149 -0.0307 0.0141  0.0254  10  PHE A CE2 
62   C  CZ  . PHE A 10  ? 0.5295 0.5387 0.5015 -0.0147 0.0066  0.0196  10  PHE A CZ  
63   N  N   . ASP A 11  ? 0.6455 0.6597 0.6640 -0.0032 0.0029  -0.0018 11  ASP A N   
64   C  CA  . ASP A 11  ? 0.6515 0.6621 0.6685 -0.0006 0.0020  -0.0036 11  ASP A CA  
65   C  C   . ASP A 11  ? 0.6340 0.6516 0.6580 -0.0008 0.0018  -0.0053 11  ASP A C   
66   O  O   . ASP A 11  ? 0.6416 0.6660 0.6839 -0.0045 0.0000  -0.0126 11  ASP A O   
67   C  CB  . ASP A 11  ? 0.6567 0.6699 0.6749 -0.0005 0.0035  -0.0016 11  ASP A CB  
68   C  CG  . ASP A 11  ? 0.6748 0.6855 0.6807 -0.0053 0.0011  -0.0017 11  ASP A CG  
69   O  OD1 . ASP A 11  ? 0.7045 0.7131 0.7039 0.0033  0.0043  0.0014  11  ASP A OD1 
70   O  OD2 . ASP A 11  ? 0.6977 0.7048 0.6998 -0.0005 -0.0002 0.0044  11  ASP A OD2 
71   N  N   . LEU A 12  ? 0.6078 0.6233 0.6395 0.0003  0.0019  -0.0007 12  LEU A N   
72   C  CA  . LEU A 12  ? 0.5915 0.6049 0.6212 0.0018  0.0014  -0.0012 12  LEU A CA  
73   C  C   . LEU A 12  ? 0.5621 0.5704 0.6009 0.0039  0.0005  0.0012  12  LEU A C   
74   O  O   . LEU A 12  ? 0.5726 0.5786 0.6249 0.0043  0.0016  0.0013  12  LEU A O   
75   C  CB  . LEU A 12  ? 0.5971 0.6069 0.6205 0.0010  -0.0009 -0.0012 12  LEU A CB  
76   C  CG  . LEU A 12  ? 0.6056 0.6148 0.6237 0.0004  -0.0016 0.0002  12  LEU A CG  
77   C  CD1 . LEU A 12  ? 0.6182 0.6293 0.6226 0.0019  -0.0108 0.0016  12  LEU A CD1 
78   C  CD2 . LEU A 12  ? 0.6047 0.6163 0.6242 0.0022  -0.0017 -0.0008 12  LEU A CD2 
79   N  N   . VAL A 13  ? 0.5297 0.5431 0.5643 0.0010  0.0041  0.0024  13  VAL A N   
80   C  CA  A VAL A 13  ? 0.5116 0.5250 0.5379 0.0006  0.0032  0.0040  13  VAL A CA  
81   C  CA  B VAL A 13  ? 0.5067 0.5217 0.5355 0.0013  0.0033  0.0034  13  VAL A CA  
82   C  C   . VAL A 13  ? 0.4912 0.5038 0.5143 0.0031  0.0092  0.0068  13  VAL A C   
83   O  O   . VAL A 13  ? 0.4366 0.4820 0.4931 0.0041  0.0169  0.0135  13  VAL A O   
84   C  CB  A VAL A 13  ? 0.5162 0.5276 0.5362 0.0001  0.0024  0.0019  13  VAL A CB  
85   C  CB  B VAL A 13  ? 0.5090 0.5235 0.5322 0.0014  0.0020  0.0016  13  VAL A CB  
86   C  CG1 A VAL A 13  ? 0.5239 0.5346 0.5385 -0.0044 0.0014  0.0040  13  VAL A CG1 
87   C  CG1 B VAL A 13  ? 0.4939 0.5122 0.5311 -0.0045 0.0011  0.0004  13  VAL A CG1 
88   C  CG2 A VAL A 13  ? 0.5353 0.5338 0.5441 -0.0044 -0.0042 0.0059  13  VAL A CG2 
89   C  CG2 B VAL A 13  ? 0.5121 0.5265 0.5288 0.0018  -0.0018 0.0029  13  VAL A CG2 
90   N  N   . ALA A 14  ? 0.4473 0.4809 0.4862 0.0086  0.0180  0.0082  14  ALA A N   
91   C  CA  . ALA A 14  ? 0.4402 0.4566 0.4502 0.0050  0.0264  0.0048  14  ALA A CA  
92   C  C   . ALA A 14  ? 0.4144 0.4376 0.4249 0.0113  0.0292  0.0121  14  ALA A C   
93   O  O   . ALA A 14  ? 0.3957 0.4223 0.4078 0.0150  0.0408  0.0233  14  ALA A O   
94   C  CB  . ALA A 14  ? 0.4478 0.4647 0.4524 0.0068  0.0296  0.0038  14  ALA A CB  
95   N  N   . GLU A 15  ? 0.3865 0.4120 0.3993 0.0117  0.0337  0.0105  15  GLU A N   
96   C  CA  . GLU A 15  ? 0.3561 0.4020 0.3787 0.0092  0.0317  0.0098  15  GLU A CA  
97   C  C   . GLU A 15  ? 0.3298 0.3822 0.3517 0.0203  0.0326  0.0019  15  GLU A C   
98   O  O   . GLU A 15  ? 0.2958 0.3644 0.3237 0.0240  0.0612  0.0082  15  GLU A O   
99   C  CB  . GLU A 15  ? 0.3653 0.3951 0.3847 0.0107  0.0252  0.0072  15  GLU A CB  
100  C  CG  . GLU A 15  ? 0.4022 0.4271 0.4065 -0.0005 0.0133  0.0001  15  GLU A CG  
101  C  CD  . GLU A 15  ? 0.4565 0.4582 0.4553 0.0130  0.0090  0.0017  15  GLU A CD  
102  O  OE1 . GLU A 15  ? 0.4855 0.4923 0.4838 0.0180  0.0002  -0.0009 15  GLU A OE1 
103  O  OE2 . GLU A 15  ? 0.5082 0.5140 0.4794 0.0140  0.0056  -0.0025 15  GLU A OE2 
104  N  N   . ASP A 16  ? 0.3048 0.3582 0.3528 0.0227  0.0266  0.0080  16  ASP A N   
105  C  CA  . ASP A 16  ? 0.2998 0.3378 0.3373 0.0220  0.0227  0.0095  16  ASP A CA  
106  C  C   . ASP A 16  ? 0.2942 0.3158 0.3284 0.0183  0.0194  0.0176  16  ASP A C   
107  O  O   . ASP A 16  ? 0.2717 0.3098 0.3232 0.0366  0.0162  0.0285  16  ASP A O   
108  C  CB  . ASP A 16  ? 0.3100 0.3506 0.3635 0.0182  0.0167  0.0058  16  ASP A CB  
109  C  CG  . ASP A 16  ? 0.3492 0.3711 0.3941 0.0153  -0.0019 0.0112  16  ASP A CG  
110  O  OD1 . ASP A 16  ? 0.4036 0.3661 0.4645 0.0561  0.0065  -0.0071 16  ASP A OD1 
111  O  OD2 . ASP A 16  ? 0.3570 0.4481 0.4700 0.0401  0.0135  0.0292  16  ASP A OD2 
112  N  N   . LYS A 17  ? 0.2729 0.3007 0.3170 0.0167  0.0204  0.0107  17  LYS A N   
113  C  CA  . LYS A 17  ? 0.2732 0.2930 0.3011 0.0101  0.0269  0.0170  17  LYS A CA  
114  C  C   . LYS A 17  ? 0.2783 0.2795 0.2904 0.0060  0.0336  0.0080  17  LYS A C   
115  O  O   . LYS A 17  ? 0.2542 0.2780 0.2726 0.0097  0.0491  0.0280  17  LYS A O   
116  C  CB  . LYS A 17  ? 0.2741 0.2895 0.3003 0.0051  0.0227  0.0110  17  LYS A CB  
117  C  CG  . LYS A 17  ? 0.2926 0.3019 0.3263 0.0028  0.0165  0.0151  17  LYS A CG  
118  C  CD  . LYS A 17  ? 0.3003 0.3273 0.3609 -0.0032 0.0028  -0.0040 17  LYS A CD  
119  C  CE  . LYS A 17  ? 0.3627 0.3160 0.3774 -0.0111 -0.0209 0.0238  17  LYS A CE  
120  N  NZ  . LYS A 17  ? 0.3918 0.3640 0.4213 -0.0218 -0.0027 0.0192  17  LYS A NZ  
121  N  N   . ALA A 18  ? 0.2718 0.2865 0.2886 0.0108  0.0445  0.0129  18  ALA A N   
122  C  CA  . ALA A 18  ? 0.2808 0.2865 0.2844 0.0121  0.0484  -0.0008 18  ALA A CA  
123  C  C   . ALA A 18  ? 0.2770 0.2850 0.2715 0.0182  0.0434  0.0079  18  ALA A C   
124  O  O   . ALA A 18  ? 0.2520 0.2689 0.2691 0.0104  0.0524  0.0157  18  ALA A O   
125  C  CB  . ALA A 18  ? 0.2952 0.3310 0.2806 0.0115  0.0591  0.0017  18  ALA A CB  
126  N  N   . ARG A 19  ? 0.2654 0.2682 0.2577 0.0292  0.0470  0.0030  19  ARG A N   
127  C  CA  . ARG A 19  ? 0.2479 0.2587 0.2447 0.0226  0.0344  -0.0003 19  ARG A CA  
128  C  C   . ARG A 19  ? 0.2383 0.2439 0.2338 0.0238  0.0275  0.0085  19  ARG A C   
129  O  O   . ARG A 19  ? 0.2242 0.2467 0.2217 0.0254  0.0255  0.0056  19  ARG A O   
130  C  CB  . ARG A 19  ? 0.2544 0.2572 0.2425 0.0318  0.0335  -0.0038 19  ARG A CB  
131  C  CG  . ARG A 19  ? 0.2566 0.2605 0.2697 0.0270  0.0278  0.0027  19  ARG A CG  
132  C  CD  . ARG A 19  ? 0.2741 0.2729 0.2678 0.0422  0.0175  0.0018  19  ARG A CD  
133  N  NE  . ARG A 19  ? 0.2867 0.2887 0.2748 0.0552  0.0201  0.0060  19  ARG A NE  
134  C  CZ  . ARG A 19  ? 0.2877 0.3048 0.2846 0.0325  0.0087  -0.0070 19  ARG A CZ  
135  N  NH1 . ARG A 19  ? 0.2866 0.2615 0.2529 0.0211  0.0272  0.0150  19  ARG A NH1 
136  N  NH2 . ARG A 19  ? 0.2988 0.3288 0.2951 0.0345  0.0302  -0.0206 19  ARG A NH2 
137  N  N   . CYS A 20  ? 0.2255 0.2461 0.2285 0.0224  0.0225  0.0115  20  CYS A N   
138  C  CA  . CYS A 20  ? 0.2330 0.2410 0.2228 0.0143  0.0224  0.0124  20  CYS A CA  
139  C  C   . CYS A 20  ? 0.2322 0.2288 0.2243 0.0119  0.0272  0.0259  20  CYS A C   
140  O  O   . CYS A 20  ? 0.2231 0.2239 0.2272 0.0122  0.0113  0.0355  20  CYS A O   
141  C  CB  . CYS A 20  ? 0.2425 0.2548 0.2342 0.0125  0.0150  0.0207  20  CYS A CB  
142  S  SG  . CYS A 20  ? 0.2546 0.2574 0.2534 0.0328  0.0303  0.0247  20  CYS A SG  
143  N  N   . MET A 21  ? 0.2227 0.2268 0.2213 0.0057  0.0299  0.0224  21  MET A N   
144  C  CA  A MET A 21  ? 0.2281 0.2111 0.2143 0.0008  0.0281  0.0247  21  MET A CA  
145  C  CA  B MET A 21  ? 0.2304 0.2216 0.2207 0.0035  0.0218  0.0186  21  MET A CA  
146  C  C   . MET A 21  ? 0.2386 0.2311 0.2164 0.0108  0.0221  0.0190  21  MET A C   
147  O  O   . MET A 21  ? 0.2392 0.2268 0.2241 0.0037  0.0376  0.0117  21  MET A O   
148  C  CB  A MET A 21  ? 0.2423 0.2220 0.2160 0.0043  0.0261  0.0271  21  MET A CB  
149  C  CB  B MET A 21  ? 0.2369 0.2291 0.2229 0.0038  0.0181  0.0167  21  MET A CB  
150  C  CG  A MET A 21  ? 0.2624 0.2185 0.2472 -0.0092 0.0280  0.0272  21  MET A CG  
151  C  CG  B MET A 21  ? 0.2583 0.2382 0.2425 -0.0058 0.0166  0.0151  21  MET A CG  
152  S  SD  A MET A 21  ? 0.2796 0.2610 0.2931 -0.0300 0.0599  0.0812  21  MET A SD  
153  S  SD  B MET A 21  ? 0.2319 0.2309 0.2237 -0.0405 0.0323  0.0438  21  MET A SD  
154  C  CE  A MET A 21  ? 0.2200 0.2516 0.2723 -0.0215 0.0317  0.0546  21  MET A CE  
155  C  CE  B MET A 21  ? 0.2769 0.2349 0.2952 -0.0300 -0.0079 0.0326  21  MET A CE  
156  N  N   . SER A 22  ? 0.2440 0.2423 0.2220 0.0127  0.0214  0.0147  22  SER A N   
157  C  CA  A SER A 22  ? 0.2456 0.2380 0.2276 0.0101  0.0193  0.0075  22  SER A CA  
158  C  CA  B SER A 22  ? 0.2447 0.2387 0.2260 0.0084  0.0160  0.0114  22  SER A CA  
159  C  C   . SER A 22  ? 0.2491 0.2385 0.2218 0.0120  0.0160  0.0109  22  SER A C   
160  O  O   . SER A 22  ? 0.2697 0.2381 0.1933 -0.0056 0.0226  0.0236  22  SER A O   
161  C  CB  A SER A 22  ? 0.2558 0.2648 0.2417 0.0019  0.0224  0.0028  22  SER A CB  
162  C  CB  B SER A 22  ? 0.2488 0.2514 0.2352 0.0034  0.0156  0.0065  22  SER A CB  
163  O  OG  A SER A 22  ? 0.3001 0.3059 0.2682 0.0166  0.0061  -0.0303 22  SER A OG  
164  O  OG  B SER A 22  ? 0.2602 0.2671 0.2425 0.0071  0.0154  0.0215  22  SER A OG  
165  N  N   . GLU A 23  ? 0.2464 0.2289 0.2136 0.0197  0.0120  0.0139  23  GLU A N   
166  C  CA  . GLU A 23  ? 0.2250 0.2152 0.2160 0.0080  0.0137  0.0057  23  GLU A CA  
167  C  C   . GLU A 23  ? 0.2307 0.2158 0.2060 0.0064  0.0184  -0.0020 23  GLU A C   
168  O  O   . GLU A 23  ? 0.2401 0.2240 0.2306 0.0085  0.0217  -0.0177 23  GLU A O   
169  C  CB  . GLU A 23  ? 0.2362 0.2223 0.2262 0.0215  0.0136  0.0109  23  GLU A CB  
170  C  CG  . GLU A 23  ? 0.2495 0.2273 0.2295 0.0104  0.0183  -0.0176 23  GLU A CG  
171  C  CD  . GLU A 23  ? 0.2642 0.1946 0.2253 0.0270  0.0295  0.0026  23  GLU A CD  
172  O  OE1 . GLU A 23  ? 0.3215 0.2314 0.2212 0.0252  0.0119  -0.0349 23  GLU A OE1 
173  O  OE2 . GLU A 23  ? 0.3042 0.2135 0.2777 0.0639  0.0404  0.0016  23  GLU A OE2 
174  N  N   . HIS A 24  ? 0.2247 0.2069 0.2081 0.0005  0.0259  0.0104  24  HIS A N   
175  C  CA  . HIS A 24  ? 0.2177 0.1947 0.1951 0.0028  0.0133  0.0015  24  HIS A CA  
176  C  C   . HIS A 24  ? 0.2169 0.2035 0.1935 -0.0041 0.0130  0.0017  24  HIS A C   
177  O  O   . HIS A 24  ? 0.2104 0.1860 0.1732 0.0105  0.0142  0.0051  24  HIS A O   
178  C  CB  . HIS A 24  ? 0.2289 0.2115 0.2032 0.0059  0.0213  0.0029  24  HIS A CB  
179  C  CG  . HIS A 24  ? 0.2325 0.1887 0.1739 0.0060  0.0153  0.0189  24  HIS A CG  
180  N  ND1 . HIS A 24  ? 0.2951 0.2063 0.1712 0.0123  0.0283  0.0350  24  HIS A ND1 
181  C  CD2 . HIS A 24  ? 0.2573 0.2239 0.2050 -0.0149 0.0187  0.0217  24  HIS A CD2 
182  C  CE1 . HIS A 24  ? 0.2791 0.2377 0.1924 0.0001  0.0049  0.0286  24  HIS A CE1 
183  N  NE2 . HIS A 24  ? 0.2750 0.2205 0.1753 0.0278  0.0066  0.0104  24  HIS A NE2 
184  N  N   . GLY A 25  ? 0.2224 0.2156 0.1866 -0.0022 0.0148  0.0044  25  GLY A N   
185  C  CA  . GLY A 25  ? 0.2219 0.2047 0.1949 0.0025  0.0134  0.0045  25  GLY A CA  
186  C  C   . GLY A 25  ? 0.2210 0.2072 0.1863 -0.0046 0.0175  0.0081  25  GLY A C   
187  O  O   . GLY A 25  ? 0.2265 0.2186 0.2241 0.0021  0.0036  0.0066  25  GLY A O   
188  N  N   . THR A 26  ? 0.2202 0.2119 0.1881 -0.0024 0.0251  0.0095  26  THR A N   
189  C  CA  . THR A 26  ? 0.2182 0.1940 0.1845 -0.0072 0.0360  0.0109  26  THR A CA  
190  C  C   . THR A 26  ? 0.2347 0.2019 0.1952 -0.0003 0.0385  0.0143  26  THR A C   
191  O  O   . THR A 26  ? 0.2626 0.1973 0.1967 0.0105  0.0428  0.0147  26  THR A O   
192  C  CB  . THR A 26  ? 0.2366 0.2011 0.1955 -0.0102 0.0282  0.0152  26  THR A CB  
193  O  OG1 . THR A 26  ? 0.2276 0.2012 0.2013 -0.0075 0.0423  0.0148  26  THR A OG1 
194  C  CG2 . THR A 26  ? 0.2614 0.2424 0.2213 -0.0246 0.0257  -0.0005 26  THR A CG2 
195  N  N   . THR A 27  ? 0.2276 0.2026 0.1969 -0.0012 0.0395  0.0125  27  THR A N   
196  C  CA  . THR A 27  ? 0.2373 0.2200 0.2262 -0.0059 0.0248  0.0204  27  THR A CA  
197  C  C   . THR A 27  ? 0.2455 0.2425 0.2310 -0.0063 0.0251  0.0183  27  THR A C   
198  O  O   . THR A 27  ? 0.2480 0.2430 0.2529 -0.0218 0.0218  0.0113  27  THR A O   
199  C  CB  . THR A 27  ? 0.2272 0.2346 0.2387 -0.0058 0.0264  0.0136  27  THR A CB  
200  O  OG1 . THR A 27  ? 0.2733 0.2337 0.2513 -0.0072 -0.0020 0.0170  27  THR A OG1 
201  C  CG2 . THR A 27  ? 0.2346 0.2422 0.2408 -0.0069 -0.0107 0.0221  27  THR A CG2 
202  N  N   . GLN A 28  ? 0.2516 0.2636 0.2557 -0.0224 0.0287  0.0284  28  GLN A N   
203  C  CA  . GLN A 28  ? 0.2785 0.2788 0.2783 -0.0200 0.0279  0.0197  28  GLN A CA  
204  C  C   . GLN A 28  ? 0.2786 0.2744 0.2829 -0.0266 0.0235  0.0303  28  GLN A C   
205  O  O   . GLN A 28  ? 0.3012 0.3020 0.3114 -0.0314 0.0310  0.0278  28  GLN A O   
206  C  CB  . GLN A 28  ? 0.2974 0.2930 0.3065 -0.0134 0.0253  0.0224  28  GLN A CB  
207  C  CG  . GLN A 28  ? 0.2629 0.2802 0.3145 -0.0456 0.0460  0.0271  28  GLN A CG  
208  C  CD  . GLN A 28  ? 0.2661 0.3044 0.3505 -0.0337 0.0390  0.0110  28  GLN A CD  
209  O  OE1 . GLN A 28  ? 0.3142 0.3332 0.4215 -0.0351 0.0454  0.0112  28  GLN A OE1 
210  N  NE2 . GLN A 28  ? 0.3307 0.3193 0.3796 -0.0215 0.0304  0.0215  28  GLN A NE2 
211  N  N   . ALA A 29  ? 0.2838 0.2607 0.2910 -0.0210 0.0228  0.0283  29  ALA A N   
212  C  CA  . ALA A 29  ? 0.2774 0.2571 0.2996 -0.0254 0.0166  0.0157  29  ALA A CA  
213  C  C   . ALA A 29  ? 0.2874 0.2482 0.3048 -0.0200 0.0144  0.0100  29  ALA A C   
214  O  O   . ALA A 29  ? 0.2991 0.2364 0.3279 -0.0550 0.0130  0.0047  29  ALA A O   
215  C  CB  . ALA A 29  ? 0.2931 0.2699 0.3130 -0.0095 0.0119  0.0222  29  ALA A CB  
216  N  N   . GLN A 30  ? 0.2712 0.2187 0.2970 -0.0211 0.0093  0.0075  30  GLN A N   
217  C  CA  . GLN A 30  ? 0.2719 0.2193 0.2767 -0.0171 0.0118  0.0072  30  GLN A CA  
218  C  C   . GLN A 30  ? 0.2834 0.2281 0.2797 -0.0199 0.0121  0.0098  30  GLN A C   
219  O  O   . GLN A 30  ? 0.3157 0.2564 0.2991 -0.0207 0.0181  0.0044  30  GLN A O   
220  C  CB  . GLN A 30  ? 0.2623 0.2212 0.2661 -0.0147 0.0116  0.0015  30  GLN A CB  
221  C  CG  . GLN A 30  ? 0.2789 0.2407 0.2568 -0.0200 0.0113  -0.0020 30  GLN A CG  
222  C  CD  . GLN A 30  ? 0.2396 0.2273 0.2340 -0.0131 0.0116  0.0034  30  GLN A CD  
223  O  OE1 . GLN A 30  ? 0.2442 0.1889 0.2487 -0.0188 0.0410  0.0255  30  GLN A OE1 
224  N  NE2 . GLN A 30  ? 0.2297 0.2048 0.1988 -0.0222 0.0231  0.0210  30  GLN A NE2 
225  N  N   . ILE A 31  ? 0.2862 0.2369 0.2956 -0.0262 0.0044  0.0223  31  ILE A N   
226  C  CA  . ILE A 31  ? 0.2873 0.2529 0.3172 -0.0262 0.0024  0.0044  31  ILE A CA  
227  C  C   . ILE A 31  ? 0.2962 0.2685 0.3295 -0.0333 0.0045  0.0013  31  ILE A C   
228  O  O   . ILE A 31  ? 0.3103 0.2784 0.3411 -0.0422 0.0056  -0.0091 31  ILE A O   
229  C  CB  . ILE A 31  ? 0.2717 0.2584 0.3269 -0.0234 -0.0025 0.0075  31  ILE A CB  
230  C  CG1 . ILE A 31  ? 0.2652 0.2356 0.3106 -0.0125 -0.0012 0.0053  31  ILE A CG1 
231  C  CG2 . ILE A 31  ? 0.2655 0.2794 0.3497 -0.0330 -0.0042 0.0185  31  ILE A CG2 
232  C  CD1 . ILE A 31  ? 0.2590 0.2530 0.3266 -0.0087 0.0171  0.0018  31  ILE A CD1 
233  N  N   . ASP A 32  ? 0.3139 0.2704 0.3563 -0.0266 -0.0016 -0.0016 32  ASP A N   
234  C  CA  . ASP A 32  ? 0.3150 0.2835 0.3667 -0.0289 -0.0007 0.0024  32  ASP A CA  
235  C  C   . ASP A 32  ? 0.3417 0.2983 0.3743 -0.0197 -0.0045 -0.0020 32  ASP A C   
236  O  O   . ASP A 32  ? 0.3493 0.3109 0.3866 -0.0351 -0.0054 0.0060  32  ASP A O   
237  C  CB  . ASP A 32  ? 0.3251 0.2835 0.3727 -0.0285 0.0042  0.0037  32  ASP A CB  
238  C  CG  . ASP A 32  ? 0.3349 0.2949 0.3912 -0.0317 0.0005  0.0062  32  ASP A CG  
239  O  OD1 . ASP A 32  ? 0.3208 0.2980 0.4295 -0.0452 0.0175  0.0250  32  ASP A OD1 
240  O  OD2 . ASP A 32  ? 0.4053 0.3407 0.4248 -0.0567 0.0286  0.0303  32  ASP A OD2 
241  N  N   . ASP A 33  ? 0.3385 0.3048 0.3801 -0.0176 0.0023  0.0026  33  ASP A N   
242  C  CA  A ASP A 33  ? 0.3546 0.3127 0.3802 -0.0111 0.0020  -0.0033 33  ASP A CA  
243  C  CA  B ASP A 33  ? 0.3526 0.3147 0.3767 -0.0105 0.0010  -0.0027 33  ASP A CA  
244  C  C   . ASP A 33  ? 0.3612 0.3235 0.3855 -0.0098 0.0000  -0.0075 33  ASP A C   
245  O  O   . ASP A 33  ? 0.3868 0.3068 0.4177 -0.0103 0.0001  -0.0181 33  ASP A O   
246  C  CB  A ASP A 33  ? 0.3560 0.3275 0.3810 -0.0075 0.0001  -0.0046 33  ASP A CB  
247  C  CB  B ASP A 33  ? 0.3510 0.3262 0.3748 -0.0069 -0.0002 -0.0032 33  ASP A CB  
248  C  CG  A ASP A 33  ? 0.3774 0.3576 0.4068 -0.0015 0.0064  -0.0096 33  ASP A CG  
249  C  CG  B ASP A 33  ? 0.3519 0.3413 0.3676 -0.0048 0.0028  0.0026  33  ASP A CG  
250  O  OD1 A ASP A 33  ? 0.4141 0.3757 0.4237 0.0127  -0.0003 -0.0146 33  ASP A OD1 
251  O  OD1 B ASP A 33  ? 0.3799 0.3611 0.3909 0.0045  -0.0007 0.0121  33  ASP A OD1 
252  O  OD2 A ASP A 33  ? 0.4017 0.3988 0.4444 0.0065  0.0169  -0.0242 33  ASP A OD2 
253  O  OD2 B ASP A 33  ? 0.3725 0.3831 0.3681 0.0001  -0.0264 0.0037  33  ASP A OD2 
254  N  N   . VAL A 34  ? 0.3513 0.3090 0.3817 -0.0179 -0.0021 -0.0044 34  VAL A N   
255  C  CA  . VAL A 34  ? 0.3566 0.3265 0.3848 -0.0272 -0.0082 -0.0066 34  VAL A CA  
256  C  C   . VAL A 34  ? 0.3620 0.3393 0.3910 -0.0256 -0.0112 -0.0106 34  VAL A C   
257  O  O   . VAL A 34  ? 0.3597 0.3365 0.3952 -0.0445 -0.0228 -0.0185 34  VAL A O   
258  C  CB  . VAL A 34  ? 0.3671 0.3433 0.3906 -0.0201 -0.0167 0.0003  34  VAL A CB  
259  C  CG1 . VAL A 34  ? 0.4060 0.3194 0.3773 -0.0219 -0.0201 -0.0090 34  VAL A CG1 
260  C  CG2 . VAL A 34  ? 0.3834 0.3675 0.4256 -0.0337 -0.0105 -0.0002 34  VAL A CG2 
261  N  N   . ASN A 35  ? 0.3660 0.3525 0.4070 -0.0370 -0.0149 -0.0135 35  ASN A N   
262  C  CA  . ASN A 35  ? 0.3767 0.3773 0.4234 -0.0318 -0.0144 -0.0107 35  ASN A CA  
263  C  C   . ASN A 35  ? 0.4006 0.3877 0.4382 -0.0280 -0.0165 -0.0141 35  ASN A C   
264  O  O   . ASN A 35  ? 0.3997 0.3861 0.4685 -0.0511 -0.0273 -0.0281 35  ASN A O   
265  C  CB  . ASN A 35  ? 0.3796 0.3848 0.4246 -0.0328 -0.0135 -0.0129 35  ASN A CB  
266  C  CG  . ASN A 35  ? 0.3578 0.3973 0.4249 -0.0275 -0.0053 -0.0011 35  ASN A CG  
267  O  OD1 . ASN A 35  ? 0.3691 0.4547 0.4642 -0.0154 -0.0136 -0.0003 35  ASN A OD1 
268  N  ND2 . ASN A 35  ? 0.3688 0.4205 0.4358 -0.0446 0.0119  0.0012  35  ASN A ND2 
269  N  N   . LYS A 36  ? 0.4029 0.3879 0.4507 -0.0265 -0.0142 -0.0112 36  LYS A N   
270  C  CA  . LYS A 36  ? 0.4299 0.4062 0.4556 -0.0131 -0.0063 -0.0107 36  LYS A CA  
271  C  C   . LYS A 36  ? 0.4496 0.4106 0.4648 -0.0089 -0.0025 -0.0095 36  LYS A C   
272  O  O   . LYS A 36  ? 0.4645 0.4075 0.4931 -0.0036 -0.0006 -0.0058 36  LYS A O   
273  C  CB  . LYS A 36  ? 0.4371 0.4048 0.4598 -0.0120 -0.0043 -0.0101 36  LYS A CB  
274  C  CG  . LYS A 36  ? 0.4443 0.4174 0.4532 -0.0079 0.0000  -0.0054 36  LYS A CG  
275  C  CD  . LYS A 36  ? 0.4634 0.4444 0.4634 -0.0024 -0.0017 -0.0062 36  LYS A CD  
276  C  CE  . LYS A 36  ? 0.4899 0.4714 0.4808 0.0004  -0.0013 0.0018  36  LYS A CE  
277  N  NZ  . LYS A 36  ? 0.5015 0.4945 0.4877 0.0078  -0.0107 -0.0007 36  LYS A NZ  
278  N  N   . GLY A 37  ? 0.4466 0.3997 0.4559 -0.0100 -0.0017 -0.0063 37  GLY A N   
279  C  CA  . GLY A 37  ? 0.4503 0.4087 0.4576 -0.0080 -0.0007 -0.0090 37  GLY A CA  
280  C  C   . GLY A 37  ? 0.4507 0.4073 0.4528 -0.0095 0.0085  -0.0056 37  GLY A C   
281  O  O   . GLY A 37  ? 0.4763 0.4314 0.4731 -0.0147 0.0162  -0.0094 37  GLY A O   
282  N  N   . ASN A 38  ? 0.4410 0.3688 0.4525 -0.0165 0.0066  -0.0102 38  ASN A N   
283  C  CA  . ASN A 38  ? 0.4397 0.3548 0.4469 -0.0085 0.0077  -0.0118 38  ASN A CA  
284  C  C   . ASN A 38  ? 0.4417 0.3540 0.4410 -0.0085 0.0125  -0.0114 38  ASN A C   
285  O  O   . ASN A 38  ? 0.4643 0.3356 0.4626 -0.0123 0.0068  -0.0129 38  ASN A O   
286  C  CB  . ASN A 38  ? 0.4510 0.3627 0.4573 -0.0118 0.0083  -0.0152 38  ASN A CB  
287  C  CG  . ASN A 38  ? 0.4620 0.3619 0.4548 -0.0121 0.0139  0.0022  38  ASN A CG  
288  O  OD1 . ASN A 38  ? 0.5076 0.3986 0.4848 -0.0117 0.0001  0.0146  38  ASN A OD1 
289  N  ND2 . ASN A 38  ? 0.4272 0.3092 0.4716 -0.0186 0.0156  -0.0107 38  ASN A ND2 
290  N  N   . LEU A 39  ? 0.4198 0.3472 0.4340 -0.0074 0.0068  -0.0176 39  LEU A N   
291  C  CA  . LEU A 39  ? 0.4006 0.3471 0.4020 -0.0064 0.0023  -0.0187 39  LEU A CA  
292  C  C   . LEU A 39  ? 0.3896 0.3594 0.3887 -0.0088 0.0063  -0.0228 39  LEU A C   
293  O  O   . LEU A 39  ? 0.4263 0.4242 0.4415 -0.0172 0.0055  -0.0370 39  LEU A O   
294  C  CB  . LEU A 39  ? 0.3868 0.3458 0.4008 -0.0149 -0.0029 -0.0224 39  LEU A CB  
295  C  CG  . LEU A 39  ? 0.3479 0.2936 0.3324 0.0011  0.0001  -0.0216 39  LEU A CG  
296  C  CD1 . LEU A 39  ? 0.2639 0.3043 0.2841 -0.0018 0.0207  -0.0371 39  LEU A CD1 
297  C  CD2 . LEU A 39  ? 0.2937 0.2934 0.3556 -0.0111 0.0016  -0.0275 39  LEU A CD2 
298  N  N   . VAL A 40  ? 0.3861 0.3414 0.3610 -0.0029 0.0123  -0.0295 40  VAL A N   
299  C  CA  . VAL A 40  ? 0.3592 0.3326 0.3485 -0.0009 0.0044  -0.0258 40  VAL A CA  
300  C  C   . VAL A 40  ? 0.3286 0.3193 0.3237 -0.0104 0.0088  -0.0243 40  VAL A C   
301  O  O   . VAL A 40  ? 0.3108 0.2986 0.3146 -0.0314 0.0060  -0.0547 40  VAL A O   
302  C  CB  . VAL A 40  ? 0.3741 0.3326 0.3528 0.0029  0.0013  -0.0168 40  VAL A CB  
303  C  CG1 . VAL A 40  ? 0.3780 0.3441 0.3779 0.0051  -0.0116 -0.0131 40  VAL A CG1 
304  C  CG2 . VAL A 40  ? 0.4039 0.3317 0.3555 0.0025  0.0023  -0.0058 40  VAL A CG2 
305  N  N   . ASN A 41  ? 0.3142 0.3176 0.3074 -0.0044 0.0102  -0.0283 41  ASN A N   
306  C  CA  . ASN A 41  ? 0.2962 0.3197 0.2843 -0.0048 0.0108  -0.0183 41  ASN A CA  
307  C  C   . ASN A 41  ? 0.2778 0.3068 0.2767 -0.0106 0.0100  -0.0242 41  ASN A C   
308  O  O   . ASN A 41  ? 0.2855 0.3480 0.2881 -0.0236 0.0273  -0.0494 41  ASN A O   
309  C  CB  . ASN A 41  ? 0.2802 0.3225 0.2899 -0.0097 0.0129  -0.0169 41  ASN A CB  
310  C  CG  . ASN A 41  ? 0.2641 0.3365 0.2647 -0.0066 0.0034  -0.0131 41  ASN A CG  
311  O  OD1 . ASN A 41  ? 0.2707 0.3555 0.2977 -0.0183 0.0050  -0.0405 41  ASN A OD1 
312  N  ND2 . ASN A 41  ? 0.2844 0.4040 0.3241 -0.0256 0.0027  0.0127  41  ASN A ND2 
313  N  N   . GLU A 42  ? 0.2691 0.2808 0.2639 -0.0064 0.0099  -0.0208 42  GLU A N   
314  C  CA  . GLU A 42  ? 0.2536 0.2540 0.2471 -0.0020 -0.0023 -0.0165 42  GLU A CA  
315  C  C   . GLU A 42  ? 0.2302 0.2335 0.2239 -0.0028 0.0054  -0.0174 42  GLU A C   
316  O  O   . GLU A 42  ? 0.2320 0.2076 0.2079 -0.0256 -0.0034 -0.0198 42  GLU A O   
317  C  CB  . GLU A 42  ? 0.2578 0.2544 0.2597 0.0014  -0.0030 -0.0180 42  GLU A CB  
318  C  CG  . GLU A 42  ? 0.2757 0.2742 0.2871 0.0136  0.0063  -0.0134 42  GLU A CG  
319  C  CD  . GLU A 42  ? 0.2852 0.2935 0.3247 0.0258  -0.0091 -0.0139 42  GLU A CD  
320  O  OE1 . GLU A 42  ? 0.2621 0.2820 0.3069 -0.0144 0.0249  -0.0219 42  GLU A OE1 
321  O  OE2 . GLU A 42  ? 0.3003 0.3399 0.3891 0.0524  -0.0079 -0.0470 42  GLU A OE2 
322  N  N   . PRO A 43  ? 0.2125 0.2218 0.2169 -0.0095 0.0086  -0.0096 43  PRO A N   
323  C  CA  A PRO A 43  ? 0.2107 0.2098 0.2033 -0.0105 0.0080  -0.0080 43  PRO A CA  
324  C  CA  B PRO A 43  ? 0.2145 0.2124 0.2094 -0.0093 0.0081  -0.0072 43  PRO A CA  
325  C  C   . PRO A 43  ? 0.2155 0.2076 0.2059 -0.0097 0.0092  -0.0109 43  PRO A C   
326  O  O   . PRO A 43  ? 0.2038 0.2168 0.1990 -0.0129 0.0193  -0.0039 43  PRO A O   
327  C  CB  A PRO A 43  ? 0.2050 0.2111 0.2054 -0.0054 0.0044  -0.0119 43  PRO A CB  
328  C  CB  B PRO A 43  ? 0.2121 0.2152 0.2134 -0.0051 0.0058  -0.0104 43  PRO A CB  
329  C  CG  A PRO A 43  ? 0.2077 0.2092 0.1869 -0.0142 0.0034  -0.0108 43  PRO A CG  
330  C  CG  B PRO A 43  ? 0.2273 0.2188 0.2354 -0.0039 -0.0019 -0.0045 43  PRO A CG  
331  C  CD  A PRO A 43  ? 0.2185 0.2332 0.2275 -0.0058 0.0013  -0.0157 43  PRO A CD  
332  C  CD  B PRO A 43  ? 0.2225 0.2379 0.2325 -0.0046 0.0010  -0.0160 43  PRO A CD  
333  N  N   . SER A 44  ? 0.2049 0.1993 0.2023 -0.0085 0.0097  -0.0087 44  SER A N   
334  C  CA  . SER A 44  ? 0.2252 0.2029 0.1916 -0.0109 0.0117  -0.0101 44  SER A CA  
335  C  C   . SER A 44  ? 0.2098 0.2160 0.2068 -0.0071 0.0204  -0.0121 44  SER A C   
336  O  O   . SER A 44  ? 0.2363 0.2482 0.2364 -0.0241 0.0219  -0.0351 44  SER A O   
337  C  CB  . SER A 44  ? 0.2134 0.2048 0.2062 0.0030  0.0049  -0.0041 44  SER A CB  
338  O  OG  . SER A 44  ? 0.2313 0.1800 0.1905 0.0119  0.0284  -0.0130 44  SER A OG  
339  N  N   . ILE A 45  ? 0.2068 0.2123 0.1954 -0.0096 0.0327  -0.0166 45  ILE A N   
340  C  CA  . ILE A 45  ? 0.2020 0.1947 0.1976 -0.0089 0.0182  -0.0046 45  ILE A CA  
341  C  C   . ILE A 45  ? 0.2119 0.2119 0.2121 -0.0100 0.0187  -0.0039 45  ILE A C   
342  O  O   . ILE A 45  ? 0.2142 0.2270 0.2078 -0.0195 0.0127  0.0045  45  ILE A O   
343  C  CB  . ILE A 45  ? 0.2036 0.2009 0.2227 -0.0099 0.0257  -0.0100 45  ILE A CB  
344  C  CG1 . ILE A 45  ? 0.2235 0.1776 0.2057 -0.0129 0.0094  -0.0184 45  ILE A CG1 
345  C  CG2 . ILE A 45  ? 0.2071 0.1763 0.2412 -0.0039 0.0323  -0.0088 45  ILE A CG2 
346  C  CD1 . ILE A 45  ? 0.2230 0.1918 0.2415 -0.0193 0.0307  0.0075  45  ILE A CD1 
347  N  N   . THR A 46  ? 0.1976 0.2113 0.2007 -0.0192 0.0163  0.0032  46  THR A N   
348  C  CA  . THR A 46  ? 0.2109 0.2081 0.1949 -0.0143 0.0170  -0.0040 46  THR A CA  
349  C  C   . THR A 46  ? 0.1993 0.2067 0.1925 -0.0201 0.0151  0.0058  46  THR A C   
350  O  O   . THR A 46  ? 0.2287 0.2267 0.1801 -0.0329 0.0128  0.0024  46  THR A O   
351  C  CB  . THR A 46  ? 0.2029 0.2149 0.2041 -0.0097 0.0126  -0.0075 46  THR A CB  
352  O  OG1 . THR A 46  ? 0.2007 0.2014 0.1876 -0.0092 0.0244  -0.0193 46  THR A OG1 
353  C  CG2 . THR A 46  ? 0.2392 0.2270 0.2086 0.0093  0.0250  -0.0413 46  THR A CG2 
354  N  N   . CYS A 47  ? 0.2160 0.2010 0.1710 -0.0112 0.0195  0.0004  47  CYS A N   
355  C  CA  . CYS A 47  ? 0.2202 0.1934 0.1857 -0.0083 0.0054  0.0005  47  CYS A CA  
356  C  C   . CYS A 47  ? 0.2209 0.1835 0.2029 -0.0043 0.0000  -0.0051 47  CYS A C   
357  O  O   . CYS A 47  ? 0.2044 0.2071 0.2198 0.0036  0.0060  0.0077  47  CYS A O   
358  C  CB  . CYS A 47  ? 0.2193 0.1969 0.2164 -0.0077 0.0050  -0.0043 47  CYS A CB  
359  S  SG  . CYS A 47  ? 0.2579 0.2426 0.2203 -0.0491 0.0131  -0.0054 47  CYS A SG  
360  N  N   . TYR A 48  ? 0.2188 0.1855 0.1952 -0.0098 0.0101  0.0056  48  TYR A N   
361  C  CA  . TYR A 48  ? 0.2234 0.2011 0.2129 -0.0045 0.0141  0.0025  48  TYR A CA  
362  C  C   . TYR A 48  ? 0.2253 0.1971 0.2025 -0.0103 0.0202  0.0094  48  TYR A C   
363  O  O   . TYR A 48  ? 0.2468 0.1896 0.1947 -0.0108 0.0327  0.0068  48  TYR A O   
364  C  CB  . TYR A 48  ? 0.2287 0.2067 0.2079 -0.0115 0.0073  0.0046  48  TYR A CB  
365  C  CG  . TYR A 48  ? 0.2297 0.2218 0.2129 -0.0141 0.0288  0.0020  48  TYR A CG  
366  C  CD1 . TYR A 48  ? 0.2608 0.2437 0.2640 -0.0097 0.0236  -0.0114 48  TYR A CD1 
367  C  CD2 . TYR A 48  ? 0.2440 0.2401 0.2254 0.0031  0.0141  0.0041  48  TYR A CD2 
368  C  CE1 . TYR A 48  ? 0.2419 0.2645 0.2664 0.0013  0.0103  0.0253  48  TYR A CE1 
369  C  CE2 . TYR A 48  ? 0.2529 0.2700 0.2769 -0.0160 0.0237  0.0100  48  TYR A CE2 
370  C  CZ  . TYR A 48  ? 0.2699 0.2813 0.2849 -0.0192 0.0218  0.0141  48  TYR A CZ  
371  O  OH  . TYR A 48  ? 0.2565 0.3564 0.3609 -0.0365 0.0452  0.0292  48  TYR A OH  
372  N  N   . MET A 49  ? 0.2404 0.2142 0.2218 -0.0089 0.0142  -0.0010 49  MET A N   
373  C  CA  . MET A 49  ? 0.2315 0.2271 0.2329 -0.0115 0.0141  0.0028  49  MET A CA  
374  C  C   . MET A 49  ? 0.2261 0.2402 0.2308 -0.0026 0.0105  0.0018  49  MET A C   
375  O  O   . MET A 49  ? 0.2188 0.2434 0.2446 -0.0145 0.0202  0.0075  49  MET A O   
376  C  CB  . MET A 49  ? 0.2308 0.2285 0.2427 -0.0074 0.0032  -0.0015 49  MET A CB  
377  C  CG  . MET A 49  ? 0.2588 0.2505 0.2223 -0.0254 0.0268  0.0162  49  MET A CG  
378  S  SD  . MET A 49  ? 0.3048 0.2642 0.2689 -0.0558 -0.0026 -0.0158 49  MET A SD  
379  C  CE  . MET A 49  ? 0.2925 0.2735 0.2486 -0.0446 0.0245  -0.0224 49  MET A CE  
380  N  N   . TYR A 50  ? 0.1951 0.2197 0.2190 -0.0083 0.0102  -0.0050 50  TYR A N   
381  C  CA  . TYR A 50  ? 0.2060 0.2161 0.2071 -0.0058 0.0067  -0.0030 50  TYR A CA  
382  C  C   . TYR A 50  ? 0.1977 0.2206 0.2155 0.0008  0.0089  0.0076  50  TYR A C   
383  O  O   . TYR A 50  ? 0.2141 0.2513 0.2223 -0.0022 0.0044  0.0166  50  TYR A O   
384  C  CB  . TYR A 50  ? 0.2148 0.2197 0.2219 -0.0160 -0.0046 -0.0080 50  TYR A CB  
385  C  CG  . TYR A 50  ? 0.2284 0.2069 0.1933 -0.0011 0.0007  -0.0030 50  TYR A CG  
386  C  CD1 . TYR A 50  ? 0.2043 0.2177 0.1870 -0.0188 -0.0108 -0.0170 50  TYR A CD1 
387  C  CD2 . TYR A 50  ? 0.2903 0.2389 0.2189 -0.0113 0.0094  0.0113  50  TYR A CD2 
388  C  CE1 . TYR A 50  ? 0.2543 0.2285 0.1962 -0.0123 0.0178  -0.0041 50  TYR A CE1 
389  C  CE2 . TYR A 50  ? 0.2632 0.2094 0.2035 0.0036  -0.0065 -0.0148 50  TYR A CE2 
390  C  CZ  . TYR A 50  ? 0.3031 0.2118 0.2275 -0.0160 -0.0011 0.0017  50  TYR A CZ  
391  O  OH  . TYR A 50  ? 0.2913 0.2270 0.2495 -0.0015 -0.0184 0.0163  50  TYR A OH  
392  N  N   . CYS A 51  ? 0.2126 0.2219 0.2267 0.0001  0.0148  -0.0060 51  CYS A N   
393  C  CA  . CYS A 51  ? 0.2353 0.2428 0.2326 0.0009  0.0182  -0.0055 51  CYS A CA  
394  C  C   . CYS A 51  ? 0.2542 0.2648 0.2392 0.0023  0.0155  0.0005  51  CYS A C   
395  O  O   . CYS A 51  ? 0.2465 0.2853 0.2641 0.0073  0.0344  0.0208  51  CYS A O   
396  C  CB  . CYS A 51  ? 0.2437 0.2402 0.2418 0.0012  0.0195  -0.0099 51  CYS A CB  
397  S  SG  . CYS A 51  ? 0.2734 0.2296 0.2425 0.0314  0.0286  -0.0080 51  CYS A SG  
398  N  N   . LEU A 52  ? 0.2600 0.2750 0.2584 -0.0028 0.0070  0.0055  52  LEU A N   
399  C  CA  A LEU A 52  ? 0.2636 0.2824 0.2637 -0.0018 0.0096  0.0074  52  LEU A CA  
400  C  CA  B LEU A 52  ? 0.2667 0.2898 0.2696 -0.0016 0.0090  0.0066  52  LEU A CA  
401  C  C   . LEU A 52  ? 0.2553 0.2929 0.2705 -0.0024 0.0069  0.0039  52  LEU A C   
402  O  O   . LEU A 52  ? 0.2542 0.3112 0.2736 0.0034  0.0318  0.0158  52  LEU A O   
403  C  CB  A LEU A 52  ? 0.2702 0.2832 0.2702 -0.0052 0.0061  0.0065  52  LEU A CB  
404  C  CB  B LEU A 52  ? 0.2757 0.3011 0.2890 -0.0058 0.0073  0.0056  52  LEU A CB  
405  C  CG  A LEU A 52  ? 0.2770 0.2860 0.2965 -0.0014 0.0046  0.0024  52  LEU A CG  
406  C  CG  B LEU A 52  ? 0.2955 0.3209 0.3122 0.0013  -0.0066 0.0034  52  LEU A CG  
407  C  CD1 A LEU A 52  ? 0.3150 0.2955 0.2922 -0.0132 0.0143  0.0073  52  LEU A CD1 
408  C  CD1 B LEU A 52  ? 0.3240 0.3213 0.3425 -0.0112 0.0096  0.0067  52  LEU A CD1 
409  C  CD2 A LEU A 52  ? 0.2930 0.2775 0.3259 -0.0095 0.0094  0.0273  52  LEU A CD2 
410  C  CD2 B LEU A 52  ? 0.3129 0.3183 0.2996 0.0041  0.0154  0.0050  52  LEU A CD2 
411  N  N   . LEU A 53  ? 0.2383 0.2884 0.2535 -0.0049 0.0055  0.0088  53  LEU A N   
412  C  CA  . LEU A 53  ? 0.2455 0.2956 0.2629 -0.0100 0.0061  0.0065  53  LEU A CA  
413  C  C   . LEU A 53  ? 0.2554 0.3049 0.2597 -0.0003 -0.0007 0.0132  53  LEU A C   
414  O  O   . LEU A 53  ? 0.2532 0.3311 0.2996 -0.0047 -0.0034 -0.0030 53  LEU A O   
415  C  CB  . LEU A 53  ? 0.2526 0.2937 0.2512 -0.0096 -0.0015 0.0037  53  LEU A CB  
416  C  CG  . LEU A 53  ? 0.2525 0.2998 0.2656 -0.0153 0.0112  -0.0006 53  LEU A CG  
417  C  CD1 . LEU A 53  ? 0.2762 0.2809 0.2576 -0.0137 0.0367  -0.0052 53  LEU A CD1 
418  C  CD2 . LEU A 53  ? 0.2659 0.3168 0.3337 -0.0092 0.0029  -0.0139 53  LEU A CD2 
419  N  N   . GLU A 54  ? 0.2643 0.2908 0.2557 0.0013  -0.0048 0.0114  54  GLU A N   
420  C  CA  . GLU A 54  ? 0.2848 0.3170 0.2838 0.0094  0.0012  0.0053  54  GLU A CA  
421  C  C   . GLU A 54  ? 0.3014 0.3377 0.3093 0.0184  -0.0002 0.0033  54  GLU A C   
422  O  O   . GLU A 54  ? 0.3026 0.3558 0.3247 0.0330  -0.0226 0.0053  54  GLU A O   
423  C  CB  . GLU A 54  ? 0.2926 0.2968 0.2751 0.0000  0.0015  0.0053  54  GLU A CB  
424  C  CG  . GLU A 54  ? 0.3144 0.3017 0.3078 -0.0003 0.0090  0.0108  54  GLU A CG  
425  C  CD  . GLU A 54  ? 0.3762 0.3349 0.3525 0.0098  0.0083  0.0063  54  GLU A CD  
426  O  OE1 . GLU A 54  ? 0.3716 0.3063 0.3527 0.0246  0.0059  0.0550  54  GLU A OE1 
427  O  OE2 . GLU A 54  ? 0.3911 0.3952 0.3802 0.0284  -0.0022 0.0518  54  GLU A OE2 
428  N  N   . ALA A 55  ? 0.2989 0.3626 0.3145 0.0201  0.0021  0.0046  55  ALA A N   
429  C  CA  . ALA A 55  ? 0.3191 0.3886 0.3360 0.0197  0.0076  0.0015  55  ALA A CA  
430  C  C   . ALA A 55  ? 0.3311 0.4029 0.3556 0.0175  0.0051  -0.0021 55  ALA A C   
431  O  O   . ALA A 55  ? 0.3398 0.4451 0.3788 0.0341  0.0103  -0.0052 55  ALA A O   
432  C  CB  . ALA A 55  ? 0.3309 0.3938 0.3301 0.0197  0.0147  0.0033  55  ALA A CB  
433  N  N   . PHE A 56  ? 0.3268 0.4020 0.3531 0.0000  0.0037  0.0020  56  PHE A N   
434  C  CA  . PHE A 56  ? 0.3424 0.4031 0.3560 0.0027  0.0011  0.0048  56  PHE A CA  
435  C  C   . PHE A 56  ? 0.3401 0.3917 0.3610 -0.0025 -0.0044 0.0129  56  PHE A C   
436  O  O   . PHE A 56  ? 0.3371 0.4088 0.3727 0.0048  0.0018  0.0101  56  PHE A O   
437  C  CB  . PHE A 56  ? 0.3479 0.4033 0.3610 -0.0100 0.0017  0.0116  56  PHE A CB  
438  C  CG  . PHE A 56  ? 0.3649 0.3931 0.3623 0.0029  0.0038  0.0068  56  PHE A CG  
439  C  CD1 . PHE A 56  ? 0.3635 0.4092 0.3606 -0.0041 0.0031  0.0110  56  PHE A CD1 
440  C  CD2 . PHE A 56  ? 0.3672 0.3906 0.3527 -0.0085 0.0051  0.0116  56  PHE A CD2 
441  C  CE1 . PHE A 56  ? 0.3668 0.3888 0.3702 -0.0052 0.0013  0.0129  56  PHE A CE1 
442  C  CE2 . PHE A 56  ? 0.3573 0.3863 0.3749 0.0039  -0.0024 0.0024  56  PHE A CE2 
443  C  CZ  . PHE A 56  ? 0.3648 0.3906 0.3642 -0.0021 0.0086  0.0067  56  PHE A CZ  
444  N  N   . SER A 57  ? 0.3299 0.3872 0.3619 0.0031  -0.0031 0.0128  57  SER A N   
445  C  CA  . SER A 57  ? 0.3323 0.3697 0.3590 0.0036  -0.0059 0.0114  57  SER A CA  
446  C  C   . SER A 57  ? 0.3213 0.3610 0.3430 -0.0055 -0.0060 0.0163  57  SER A C   
447  O  O   . SER A 57  ? 0.3479 0.3854 0.3529 -0.0003 -0.0273 0.0158  57  SER A O   
448  C  CB  . SER A 57  ? 0.3321 0.3736 0.3624 0.0060  -0.0050 0.0092  57  SER A CB  
449  O  OG  . SER A 57  ? 0.3488 0.3899 0.3891 0.0185  -0.0049 0.0090  57  SER A OG  
450  N  N   . LEU A 58  ? 0.2851 0.3321 0.3195 -0.0162 0.0018  0.0127  58  LEU A N   
451  C  CA  . LEU A 58  ? 0.2858 0.3238 0.3187 -0.0215 -0.0010 0.0098  58  LEU A CA  
452  C  C   . LEU A 58  ? 0.2852 0.3005 0.2863 -0.0321 0.0078  0.0074  58  LEU A C   
453  O  O   . LEU A 58  ? 0.2756 0.2850 0.2912 -0.0715 0.0013  0.0028  58  LEU A O   
454  C  CB  . LEU A 58  ? 0.3021 0.3305 0.3241 -0.0213 0.0039  0.0171  58  LEU A CB  
455  C  CG  . LEU A 58  ? 0.2905 0.3665 0.3848 -0.0204 -0.0048 0.0255  58  LEU A CG  
456  C  CD1 . LEU A 58  ? 0.3404 0.3930 0.4623 -0.0314 0.0035  0.0263  58  LEU A CD1 
457  C  CD2 . LEU A 58  ? 0.3786 0.4335 0.4109 -0.0258 -0.0210 0.0253  58  LEU A CD2 
458  N  N   . VAL A 59  ? 0.2836 0.2977 0.2595 -0.0273 0.0074  0.0046  59  VAL A N   
459  C  CA  . VAL A 59  ? 0.2707 0.2704 0.2590 -0.0201 0.0103  0.0034  59  VAL A CA  
460  C  C   . VAL A 59  ? 0.2820 0.2661 0.2685 -0.0211 0.0132  -0.0097 59  VAL A C   
461  O  O   . VAL A 59  ? 0.2639 0.2626 0.2692 -0.0373 0.0250  -0.0270 59  VAL A O   
462  C  CB  . VAL A 59  ? 0.2780 0.2741 0.2603 -0.0203 0.0100  -0.0023 59  VAL A CB  
463  C  CG1 . VAL A 59  ? 0.2593 0.2590 0.2720 -0.0059 0.0141  0.0097  59  VAL A CG1 
464  C  CG2 . VAL A 59  ? 0.2903 0.2904 0.2568 -0.0092 -0.0001 0.0163  59  VAL A CG2 
465  N  N   . ASP A 60  ? 0.2705 0.2460 0.2555 -0.0231 0.0099  -0.0077 60  ASP A N   
466  C  CA  . ASP A 60  ? 0.2761 0.2440 0.2623 -0.0207 -0.0024 -0.0005 60  ASP A CA  
467  C  C   . ASP A 60  ? 0.2680 0.2360 0.2643 -0.0136 -0.0062 0.0047  60  ASP A C   
468  O  O   . ASP A 60  ? 0.2901 0.2412 0.2753 -0.0373 -0.0204 0.0169  60  ASP A O   
469  C  CB  . ASP A 60  ? 0.2736 0.2358 0.2664 -0.0270 -0.0133 -0.0030 60  ASP A CB  
470  C  CG  . ASP A 60  ? 0.2896 0.2569 0.2710 -0.0266 -0.0162 0.0005  60  ASP A CG  
471  O  OD1 . ASP A 60  ? 0.3257 0.2389 0.2847 -0.0313 -0.0114 0.0183  60  ASP A OD1 
472  O  OD2 . ASP A 60  ? 0.3483 0.2804 0.2992 -0.0642 -0.0384 0.0104  60  ASP A OD2 
473  N  N   . ASP A 61  ? 0.2642 0.2188 0.2499 -0.0119 -0.0019 0.0198  61  ASP A N   
474  C  CA  . ASP A 61  ? 0.2693 0.2275 0.2429 -0.0106 -0.0066 0.0101  61  ASP A CA  
475  C  C   . ASP A 61  ? 0.2596 0.2370 0.2541 -0.0145 -0.0034 0.0188  61  ASP A C   
476  O  O   . ASP A 61  ? 0.2835 0.2517 0.2905 -0.0357 -0.0128 0.0226  61  ASP A O   
477  C  CB  . ASP A 61  ? 0.2708 0.2265 0.2351 -0.0088 -0.0007 0.0138  61  ASP A CB  
478  C  CG  . ASP A 61  ? 0.2934 0.2327 0.2480 -0.0114 -0.0098 0.0046  61  ASP A CG  
479  O  OD1 . ASP A 61  ? 0.3301 0.2468 0.2441 -0.0295 -0.0314 0.0124  61  ASP A OD1 
480  O  OD2 . ASP A 61  ? 0.2649 0.2399 0.2331 -0.0529 -0.0162 0.0085  61  ASP A OD2 
481  N  N   . GLU A 62  ? 0.2595 0.2506 0.2511 -0.0205 -0.0075 0.0309  62  GLU A N   
482  C  CA  . GLU A 62  ? 0.2807 0.2500 0.2392 -0.0176 0.0014  0.0160  62  GLU A CA  
483  C  C   . GLU A 62  ? 0.2729 0.2656 0.2411 -0.0177 0.0051  0.0123  62  GLU A C   
484  O  O   . GLU A 62  ? 0.2710 0.2622 0.2344 -0.0294 0.0187  0.0323  62  GLU A O   
485  C  CB  . GLU A 62  ? 0.2849 0.2740 0.2681 -0.0180 0.0071  0.0123  62  GLU A CB  
486  C  CG  . GLU A 62  ? 0.3283 0.2692 0.2894 -0.0002 -0.0067 0.0282  62  GLU A CG  
487  C  CD  . GLU A 62  ? 0.2773 0.2887 0.3038 0.0033  0.0090  0.0020  62  GLU A CD  
488  O  OE1 . GLU A 62  ? 0.3281 0.3038 0.2961 0.0380  -0.0129 0.0528  62  GLU A OE1 
489  O  OE2 . GLU A 62  ? 0.2696 0.2259 0.3215 0.0175  0.0163  0.0328  62  GLU A OE2 
490  N  N   . ALA A 63  ? 0.2531 0.2481 0.2230 -0.0222 0.0091  0.0123  63  ALA A N   
491  C  CA  . ALA A 63  ? 0.2622 0.2518 0.2336 -0.0227 0.0112  0.0048  63  ALA A CA  
492  C  C   . ALA A 63  ? 0.2727 0.2633 0.2497 -0.0253 0.0070  0.0006  63  ALA A C   
493  O  O   . ALA A 63  ? 0.3160 0.2815 0.2600 -0.0287 0.0035  0.0053  63  ALA A O   
494  C  CB  . ALA A 63  ? 0.2519 0.2517 0.2238 -0.0279 0.0141  0.0014  63  ALA A CB  
495  N  N   . ASN A 64  ? 0.2953 0.2696 0.2635 -0.0312 0.0034  0.0014  64  ASN A N   
496  C  CA  . ASN A 64  ? 0.3101 0.3082 0.2807 -0.0195 0.0006  -0.0008 64  ASN A CA  
497  C  C   . ASN A 64  ? 0.3291 0.3199 0.3045 -0.0262 0.0040  -0.0050 64  ASN A C   
498  O  O   . ASN A 64  ? 0.2989 0.3077 0.2734 -0.0483 0.0165  -0.0093 64  ASN A O   
499  C  CB  . ASN A 64  ? 0.3289 0.3165 0.2894 -0.0167 -0.0032 -0.0020 64  ASN A CB  
500  C  CG  . ASN A 64  ? 0.3386 0.3385 0.2960 -0.0027 0.0009  0.0055  64  ASN A CG  
501  O  OD1 . ASN A 64  ? 0.3742 0.4290 0.3248 0.0155  0.0119  -0.0002 64  ASN A OD1 
502  N  ND2 . ASN A 64  ? 0.3800 0.3605 0.3031 -0.0280 0.0077  0.0156  64  ASN A ND2 
503  N  N   . VAL A 65  ? 0.3526 0.3453 0.3150 -0.0188 0.0025  -0.0094 65  VAL A N   
504  C  CA  . VAL A 65  ? 0.3627 0.3643 0.3409 -0.0191 -0.0061 -0.0023 65  VAL A CA  
505  C  C   . VAL A 65  ? 0.3828 0.3916 0.3654 -0.0173 -0.0077 0.0010  65  VAL A C   
506  O  O   . VAL A 65  ? 0.3862 0.4211 0.3493 -0.0244 -0.0208 -0.0121 65  VAL A O   
507  C  CB  . VAL A 65  ? 0.3650 0.3662 0.3479 -0.0159 -0.0012 -0.0062 65  VAL A CB  
508  C  CG1 . VAL A 65  ? 0.3682 0.3680 0.3739 -0.0297 -0.0025 -0.0072 65  VAL A CG1 
509  C  CG2 . VAL A 65  ? 0.3791 0.3525 0.3581 -0.0262 -0.0050 0.0054  65  VAL A CG2 
510  N  N   . ASP A 66  ? 0.3940 0.3975 0.3816 -0.0133 -0.0084 0.0027  66  ASP A N   
511  C  CA  . ASP A 66  ? 0.4020 0.4120 0.4058 -0.0158 -0.0098 0.0020  66  ASP A CA  
512  C  C   . ASP A 66  ? 0.4251 0.4347 0.4301 -0.0195 -0.0090 -0.0004 66  ASP A C   
513  O  O   . ASP A 66  ? 0.4278 0.4431 0.4239 -0.0276 -0.0136 -0.0017 66  ASP A O   
514  C  CB  . ASP A 66  ? 0.3967 0.4049 0.4066 -0.0172 -0.0162 0.0027  66  ASP A CB  
515  C  CG  . ASP A 66  ? 0.4074 0.4259 0.4314 -0.0069 -0.0101 0.0007  66  ASP A CG  
516  O  OD1 . ASP A 66  ? 0.3693 0.4324 0.4175 -0.0070 -0.0329 0.0118  66  ASP A OD1 
517  O  OD2 . ASP A 66  ? 0.4102 0.4429 0.4693 0.0000  -0.0189 0.0047  66  ASP A OD2 
518  N  N   . GLU A 67  ? 0.4537 0.4650 0.4527 -0.0158 -0.0071 -0.0024 67  GLU A N   
519  C  CA  . GLU A 67  ? 0.4841 0.4869 0.4816 -0.0140 -0.0062 -0.0016 67  GLU A CA  
520  C  C   . GLU A 67  ? 0.4934 0.5044 0.5018 -0.0146 -0.0100 0.0000  67  GLU A C   
521  O  O   . GLU A 67  ? 0.4926 0.5090 0.5027 -0.0284 -0.0147 -0.0002 67  GLU A O   
522  C  CB  . GLU A 67  ? 0.4901 0.4907 0.4909 -0.0115 -0.0050 -0.0011 67  GLU A CB  
523  C  CG  . GLU A 67  ? 0.5287 0.5140 0.5058 -0.0125 -0.0109 -0.0088 67  GLU A CG  
524  C  CD  . GLU A 67  ? 0.5623 0.5611 0.5280 -0.0060 -0.0060 -0.0083 67  GLU A CD  
525  O  OE1 . GLU A 67  ? 0.5954 0.6054 0.5282 -0.0224 -0.0135 -0.0074 67  GLU A OE1 
526  O  OE2 . GLU A 67  ? 0.6208 0.5766 0.5361 -0.0065 -0.0077 -0.0131 67  GLU A OE2 
527  N  N   . ASP A 68  ? 0.5098 0.5203 0.5250 -0.0118 -0.0087 0.0015  68  ASP A N   
528  C  CA  . ASP A 68  ? 0.5209 0.5349 0.5393 -0.0093 -0.0019 0.0039  68  ASP A CA  
529  C  C   . ASP A 68  ? 0.5319 0.5433 0.5429 -0.0102 -0.0045 0.0043  68  ASP A C   
530  O  O   . ASP A 68  ? 0.5304 0.5541 0.5572 -0.0156 -0.0072 0.0132  68  ASP A O   
531  C  CB  . ASP A 68  ? 0.5238 0.5437 0.5472 -0.0069 -0.0007 0.0075  68  ASP A CB  
532  C  CG  . ASP A 68  ? 0.5257 0.5344 0.5394 -0.0040 -0.0039 0.0006  68  ASP A CG  
533  O  OD1 . ASP A 68  ? 0.5153 0.5350 0.5464 -0.0146 -0.0072 0.0093  68  ASP A OD1 
534  O  OD2 . ASP A 68  ? 0.5467 0.5561 0.5597 -0.0033 -0.0024 0.0064  68  ASP A OD2 
535  N  N   . ILE A 69  ? 0.5282 0.5361 0.5464 -0.0091 -0.0036 0.0022  69  ILE A N   
536  C  CA  . ILE A 69  ? 0.5293 0.5378 0.5431 -0.0074 -0.0042 -0.0012 69  ILE A CA  
537  C  C   . ILE A 69  ? 0.5188 0.5220 0.5282 -0.0136 -0.0026 -0.0055 69  ILE A C   
538  O  O   . ILE A 69  ? 0.5117 0.5289 0.5267 -0.0189 -0.0010 -0.0080 69  ILE A O   
539  C  CB  . ILE A 69  ? 0.5395 0.5382 0.5516 -0.0023 -0.0040 -0.0015 69  ILE A CB  
540  C  CG1 . ILE A 69  ? 0.5610 0.5593 0.5747 -0.0016 -0.0002 -0.0005 69  ILE A CG1 
541  C  CG2 . ILE A 69  ? 0.5460 0.5531 0.5646 -0.0016 0.0022  -0.0022 69  ILE A CG2 
542  C  CD1 . ILE A 69  ? 0.5760 0.5659 0.5887 -0.0050 0.0013  -0.0035 69  ILE A CD1 
543  N  N   . MET A 70  ? 0.5077 0.5070 0.5074 -0.0193 -0.0032 -0.0091 70  MET A N   
544  C  CA  . MET A 70  ? 0.5062 0.5051 0.5040 -0.0162 -0.0043 -0.0058 70  MET A CA  
545  C  C   . MET A 70  ? 0.5199 0.5115 0.5107 -0.0154 -0.0019 -0.0040 70  MET A C   
546  O  O   . MET A 70  ? 0.5235 0.5120 0.5005 -0.0222 0.0022  -0.0033 70  MET A O   
547  C  CB  . MET A 70  ? 0.5058 0.4993 0.5022 -0.0127 -0.0046 -0.0023 70  MET A CB  
548  C  CG  . MET A 70  ? 0.5010 0.4958 0.5195 -0.0136 0.0049  -0.0050 70  MET A CG  
549  S  SD  . MET A 70  ? 0.5018 0.4694 0.4825 0.0041  0.0273  0.0080  70  MET A SD  
550  C  CE  . MET A 70  ? 0.4618 0.4406 0.4618 -0.0060 0.0123  0.0018  70  MET A CE  
551  N  N   . LEU A 71  ? 0.5224 0.5239 0.5170 -0.0181 -0.0053 -0.0057 71  LEU A N   
552  C  CA  . LEU A 71  ? 0.5359 0.5362 0.5319 -0.0165 -0.0047 -0.0039 71  LEU A CA  
553  C  C   . LEU A 71  ? 0.5388 0.5406 0.5375 -0.0143 -0.0039 -0.0047 71  LEU A C   
554  O  O   . LEU A 71  ? 0.5504 0.5575 0.5509 -0.0178 -0.0022 -0.0012 71  LEU A O   
555  C  CB  . LEU A 71  ? 0.5420 0.5435 0.5375 -0.0172 -0.0046 -0.0045 71  LEU A CB  
556  C  CG  . LEU A 71  ? 0.5582 0.5592 0.5524 -0.0103 0.0044  -0.0017 71  LEU A CG  
557  C  CD1 . LEU A 71  ? 0.5888 0.5939 0.5668 -0.0147 -0.0075 -0.0017 71  LEU A CD1 
558  C  CD2 . LEU A 71  ? 0.5754 0.5716 0.5600 -0.0090 0.0099  0.0005  71  LEU A CD2 
559  N  N   . GLY A 72  ? 0.5335 0.5481 0.5450 -0.0102 -0.0048 -0.0027 72  GLY A N   
560  C  CA  . GLY A 72  ? 0.5354 0.5524 0.5412 -0.0090 -0.0026 -0.0014 72  GLY A CA  
561  C  C   . GLY A 72  ? 0.5294 0.5499 0.5406 -0.0085 -0.0009 0.0001  72  GLY A C   
562  O  O   . GLY A 72  ? 0.5291 0.5666 0.5529 -0.0119 -0.0003 -0.0015 72  GLY A O   
563  N  N   . LEU A 73  ? 0.5091 0.5363 0.5271 -0.0049 -0.0010 0.0001  73  LEU A N   
564  C  CA  . LEU A 73  ? 0.5126 0.5245 0.5196 -0.0078 -0.0003 -0.0039 73  LEU A CA  
565  C  C   . LEU A 73  ? 0.5040 0.5088 0.4982 -0.0090 0.0002  -0.0064 73  LEU A C   
566  O  O   . LEU A 73  ? 0.5300 0.5011 0.4980 -0.0146 -0.0008 -0.0126 73  LEU A O   
567  C  CB  . LEU A 73  ? 0.5194 0.5321 0.5259 -0.0060 -0.0013 -0.0036 73  LEU A CB  
568  C  CG  . LEU A 73  ? 0.5263 0.5397 0.5487 -0.0049 0.0024  -0.0133 73  LEU A CG  
569  C  CD1 . LEU A 73  ? 0.5205 0.5469 0.5387 -0.0222 0.0114  -0.0127 73  LEU A CD1 
570  C  CD2 . LEU A 73  ? 0.5307 0.5577 0.5442 -0.0074 0.0116  -0.0198 73  LEU A CD2 
571  N  N   . LEU A 74  ? 0.4787 0.4920 0.4817 -0.0124 -0.0035 -0.0053 74  LEU A N   
572  C  CA  A LEU A 74  ? 0.4632 0.4840 0.4733 -0.0111 -0.0039 -0.0059 74  LEU A CA  
573  C  CA  B LEU A 74  ? 0.4649 0.4858 0.4754 -0.0111 -0.0041 -0.0064 74  LEU A CA  
574  C  C   . LEU A 74  ? 0.4596 0.4809 0.4721 -0.0122 -0.0048 -0.0058 74  LEU A C   
575  O  O   . LEU A 74  ? 0.4353 0.4795 0.4593 -0.0221 -0.0076 -0.0170 74  LEU A O   
576  C  CB  A LEU A 74  ? 0.4612 0.4819 0.4723 -0.0093 -0.0045 -0.0054 74  LEU A CB  
577  C  CB  B LEU A 74  ? 0.4642 0.4849 0.4758 -0.0095 -0.0043 -0.0060 74  LEU A CB  
578  C  CG  A LEU A 74  ? 0.4652 0.4807 0.4714 -0.0051 0.0011  -0.0016 74  LEU A CG  
579  C  CG  B LEU A 74  ? 0.4731 0.4910 0.4824 -0.0038 -0.0016 -0.0063 74  LEU A CG  
580  C  CD1 A LEU A 74  ? 0.4562 0.4678 0.4552 -0.0019 0.0021  0.0011  74  LEU A CD1 
581  C  CD1 B LEU A 74  ? 0.4697 0.4789 0.4839 -0.0102 -0.0062 -0.0040 74  LEU A CD1 
582  C  CD2 A LEU A 74  ? 0.4661 0.4861 0.4740 0.0011  -0.0058 -0.0010 74  LEU A CD2 
583  C  CD2 B LEU A 74  ? 0.4699 0.4867 0.4705 0.0000  0.0010  -0.0043 74  LEU A CD2 
584  N  N   . PRO A 75  ? 0.4573 0.4807 0.4755 -0.0148 -0.0085 -0.0075 75  PRO A N   
585  C  CA  . PRO A 75  ? 0.4489 0.4807 0.4679 -0.0152 -0.0058 -0.0087 75  PRO A CA  
586  C  C   . PRO A 75  ? 0.4357 0.4777 0.4625 -0.0156 -0.0049 -0.0129 75  PRO A C   
587  O  O   . PRO A 75  ? 0.4038 0.4699 0.4496 -0.0331 -0.0034 -0.0173 75  PRO A O   
588  C  CB  . PRO A 75  ? 0.4609 0.4828 0.4776 -0.0112 -0.0081 -0.0080 75  PRO A CB  
589  C  CG  . PRO A 75  ? 0.4640 0.4858 0.4919 -0.0048 0.0001  -0.0031 75  PRO A CG  
590  C  CD  . PRO A 75  ? 0.4541 0.4751 0.4803 -0.0133 -0.0093 -0.0035 75  PRO A CD  
591  N  N   . ASP A 76  ? 0.4248 0.4719 0.4612 -0.0182 -0.0017 -0.0153 76  ASP A N   
592  C  CA  . ASP A 76  ? 0.4240 0.4698 0.4607 -0.0183 -0.0050 -0.0104 76  ASP A CA  
593  C  C   . ASP A 76  ? 0.4140 0.4641 0.4611 -0.0249 -0.0109 -0.0136 76  ASP A C   
594  O  O   . ASP A 76  ? 0.3847 0.4579 0.4658 -0.0525 -0.0179 -0.0229 76  ASP A O   
595  C  CB  . ASP A 76  ? 0.4256 0.4790 0.4674 -0.0125 -0.0030 -0.0095 76  ASP A CB  
596  C  CG  . ASP A 76  ? 0.4536 0.4738 0.4737 -0.0067 0.0047  -0.0137 76  ASP A CG  
597  O  OD1 . ASP A 76  ? 0.4675 0.4548 0.5064 -0.0224 0.0217  -0.0086 76  ASP A OD1 
598  O  OD2 . ASP A 76  ? 0.4377 0.4506 0.4982 -0.0266 -0.0039 -0.0531 76  ASP A OD2 
599  N  N   . GLN A 77  ? 0.4237 0.4750 0.4655 -0.0171 -0.0105 -0.0140 77  GLN A N   
600  C  CA  A GLN A 77  ? 0.4486 0.4749 0.4760 -0.0106 -0.0056 -0.0095 77  GLN A CA  
601  C  CA  B GLN A 77  ? 0.4500 0.4788 0.4809 -0.0119 -0.0077 -0.0107 77  GLN A CA  
602  C  C   . GLN A 77  ? 0.4502 0.4775 0.4835 -0.0084 -0.0013 -0.0106 77  GLN A C   
603  O  O   . GLN A 77  ? 0.4529 0.4749 0.4940 -0.0145 -0.0055 -0.0192 77  GLN A O   
604  C  CB  A GLN A 77  ? 0.4589 0.4805 0.4797 -0.0077 -0.0036 -0.0067 77  GLN A CB  
605  C  CB  B GLN A 77  ? 0.4665 0.4914 0.4903 -0.0091 -0.0030 -0.0051 77  GLN A CB  
606  C  CG  A GLN A 77  ? 0.4807 0.4879 0.4852 -0.0046 -0.0004 -0.0029 77  GLN A CG  
607  C  CG  B GLN A 77  ? 0.5033 0.5098 0.5106 -0.0024 0.0016  -0.0090 77  GLN A CG  
608  C  CD  A GLN A 77  ? 0.4883 0.4909 0.4871 0.0001  -0.0004 -0.0014 77  GLN A CD  
609  C  CD  B GLN A 77  ? 0.5259 0.5287 0.5277 0.0056  0.0016  -0.0042 77  GLN A CD  
610  O  OE1 A GLN A 77  ? 0.5129 0.5064 0.5016 -0.0042 -0.0096 -0.0070 77  GLN A OE1 
611  O  OE1 B GLN A 77  ? 0.4952 0.5428 0.5466 -0.0128 0.0009  -0.0096 77  GLN A OE1 
612  N  NE2 A GLN A 77  ? 0.4716 0.4672 0.4782 -0.0151 -0.0088 0.0059  77  GLN A NE2 
613  N  NE2 B GLN A 77  ? 0.5160 0.5032 0.5187 -0.0053 -0.0038 -0.0095 77  GLN A NE2 
614  N  N   . LEU A 78  ? 0.4445 0.4725 0.4695 -0.0145 -0.0078 -0.0177 78  LEU A N   
615  C  CA  . LEU A 78  ? 0.4558 0.4758 0.4713 -0.0072 -0.0033 -0.0143 78  LEU A CA  
616  C  C   . LEU A 78  ? 0.4469 0.4696 0.4645 -0.0119 -0.0061 -0.0178 78  LEU A C   
617  O  O   . LEU A 78  ? 0.4365 0.4770 0.4495 -0.0131 -0.0036 -0.0293 78  LEU A O   
618  C  CB  . LEU A 78  ? 0.4717 0.4853 0.4826 -0.0100 -0.0091 -0.0115 78  LEU A CB  
619  C  CG  . LEU A 78  ? 0.5096 0.5223 0.5297 -0.0009 -0.0059 -0.0088 78  LEU A CG  
620  C  CD1 . LEU A 78  ? 0.5375 0.5464 0.5373 -0.0104 -0.0125 -0.0137 78  LEU A CD1 
621  C  CD2 . LEU A 78  ? 0.5409 0.5713 0.5436 0.0047  -0.0007 -0.0136 78  LEU A CD2 
622  N  N   . GLN A 79  ? 0.4403 0.4568 0.4614 -0.0135 -0.0040 -0.0158 79  GLN A N   
623  C  CA  . GLN A 79  ? 0.4413 0.4482 0.4571 -0.0196 -0.0041 -0.0143 79  GLN A CA  
624  C  C   . GLN A 79  ? 0.4442 0.4454 0.4590 -0.0210 -0.0025 -0.0164 79  GLN A C   
625  O  O   . GLN A 79  ? 0.4258 0.4270 0.4606 -0.0352 -0.0126 -0.0227 79  GLN A O   
626  C  CB  . GLN A 79  ? 0.4498 0.4475 0.4641 -0.0200 -0.0015 -0.0133 79  GLN A CB  
627  C  CG  . GLN A 79  ? 0.4560 0.4618 0.4583 -0.0134 0.0074  -0.0060 79  GLN A CG  
628  C  CD  . GLN A 79  ? 0.4571 0.4672 0.4628 -0.0054 0.0002  -0.0001 79  GLN A CD  
629  O  OE1 . GLN A 79  ? 0.4925 0.4899 0.4647 -0.0063 0.0027  -0.0041 79  GLN A OE1 
630  N  NE2 . GLN A 79  ? 0.4377 0.4604 0.4452 0.0018  -0.0107 -0.0150 79  GLN A NE2 
631  N  N   . GLU A 80  ? 0.4226 0.4299 0.4464 -0.0294 -0.0094 -0.0233 80  GLU A N   
632  C  CA  . GLU A 80  ? 0.4294 0.4375 0.4470 -0.0221 -0.0076 -0.0178 80  GLU A CA  
633  C  C   . GLU A 80  ? 0.4308 0.4399 0.4459 -0.0227 -0.0082 -0.0201 80  GLU A C   
634  O  O   . GLU A 80  ? 0.4284 0.4518 0.4441 -0.0286 -0.0102 -0.0268 80  GLU A O   
635  C  CB  . GLU A 80  ? 0.4352 0.4375 0.4447 -0.0166 -0.0079 -0.0216 80  GLU A CB  
636  C  CG  . GLU A 80  ? 0.4317 0.4418 0.4577 -0.0187 -0.0089 -0.0118 80  GLU A CG  
637  C  CD  . GLU A 80  ? 0.4604 0.4587 0.4682 -0.0269 -0.0046 -0.0215 80  GLU A CD  
638  O  OE1 . GLU A 80  ? 0.4080 0.4117 0.4584 -0.0522 -0.0184 -0.0380 80  GLU A OE1 
639  O  OE2 . GLU A 80  ? 0.4913 0.4974 0.4911 -0.0376 -0.0027 -0.0483 80  GLU A OE2 
640  N  N   . ARG A 81  ? 0.4366 0.4551 0.4639 -0.0209 -0.0081 -0.0187 81  ARG A N   
641  C  CA  A ARG A 81  ? 0.4489 0.4637 0.4686 -0.0118 -0.0034 -0.0151 81  ARG A CA  
642  C  CA  B ARG A 81  ? 0.4492 0.4637 0.4688 -0.0119 -0.0035 -0.0149 81  ARG A CA  
643  C  C   . ARG A 81  ? 0.4450 0.4650 0.4691 -0.0153 -0.0025 -0.0192 81  ARG A C   
644  O  O   . ARG A 81  ? 0.4397 0.4669 0.4665 -0.0165 0.0038  -0.0335 81  ARG A O   
645  C  CB  A ARG A 81  ? 0.4582 0.4688 0.4772 -0.0126 -0.0050 -0.0117 81  ARG A CB  
646  C  CB  B ARG A 81  ? 0.4587 0.4689 0.4776 -0.0129 -0.0052 -0.0117 81  ARG A CB  
647  C  CG  A ARG A 81  ? 0.4857 0.4976 0.5072 -0.0039 -0.0008 -0.0084 81  ARG A CG  
648  C  CG  B ARG A 81  ? 0.4850 0.4985 0.5066 -0.0044 -0.0015 -0.0087 81  ARG A CG  
649  C  CD  A ARG A 81  ? 0.5287 0.5337 0.5293 0.0002  -0.0051 0.0013  81  ARG A CD  
650  C  CD  B ARG A 81  ? 0.5246 0.5307 0.5324 -0.0015 -0.0059 0.0007  81  ARG A CD  
651  N  NE  A ARG A 81  ? 0.5572 0.5657 0.5591 -0.0047 0.0011  -0.0012 81  ARG A NE  
652  N  NE  B ARG A 81  ? 0.5486 0.5585 0.5597 0.0000  -0.0027 -0.0076 81  ARG A NE  
653  C  CZ  A ARG A 81  ? 0.5747 0.5806 0.5745 -0.0025 0.0042  0.0025  81  ARG A CZ  
654  C  CZ  B ARG A 81  ? 0.5785 0.5766 0.5814 0.0004  -0.0018 -0.0002 81  ARG A CZ  
655  N  NH1 A ARG A 81  ? 0.5751 0.5887 0.5835 0.0021  -0.0026 0.0080  81  ARG A NH1 
656  N  NH1 B ARG A 81  ? 0.5841 0.5839 0.5769 -0.0019 0.0038  -0.0014 81  ARG A NH1 
657  N  NH2 A ARG A 81  ? 0.5748 0.5767 0.5940 -0.0052 -0.0014 -0.0069 81  ARG A NH2 
658  N  NH2 B ARG A 81  ? 0.5925 0.5996 0.6007 0.0046  0.0007  -0.0015 81  ARG A NH2 
659  N  N   . ALA A 82  ? 0.4369 0.4685 0.4647 -0.0163 0.0008  -0.0202 82  ALA A N   
660  C  CA  . ALA A 82  ? 0.4484 0.4729 0.4634 -0.0141 -0.0043 -0.0217 82  ALA A CA  
661  C  C   . ALA A 82  ? 0.4537 0.4753 0.4632 -0.0150 -0.0038 -0.0190 82  ALA A C   
662  O  O   . ALA A 82  ? 0.4402 0.4966 0.4596 -0.0188 -0.0144 -0.0359 82  ALA A O   
663  C  CB  . ALA A 82  ? 0.4467 0.4679 0.4630 -0.0118 -0.0046 -0.0251 82  ALA A CB  
664  N  N   . GLN A 83  ? 0.4547 0.4786 0.4690 -0.0185 -0.0075 -0.0142 83  GLN A N   
665  C  CA  . GLN A 83  ? 0.4669 0.4797 0.4746 -0.0139 -0.0086 -0.0105 83  GLN A CA  
666  C  C   . GLN A 83  ? 0.4668 0.4873 0.4700 -0.0154 -0.0100 -0.0125 83  GLN A C   
667  O  O   . GLN A 83  ? 0.4669 0.4908 0.4562 -0.0245 -0.0112 -0.0244 83  GLN A O   
668  C  CB  . GLN A 83  ? 0.4696 0.4810 0.4782 -0.0160 -0.0060 -0.0086 83  GLN A CB  
669  C  CG  . GLN A 83  ? 0.4871 0.4841 0.4914 -0.0086 -0.0079 -0.0026 83  GLN A CG  
670  C  CD  . GLN A 83  ? 0.5065 0.5081 0.5237 -0.0058 -0.0051 0.0008  83  GLN A CD  
671  O  OE1 . GLN A 83  ? 0.5171 0.5231 0.5366 -0.0132 -0.0170 -0.0072 83  GLN A OE1 
672  N  NE2 . GLN A 83  ? 0.5392 0.5232 0.5441 0.0048  -0.0073 0.0035  83  GLN A NE2 
673  N  N   . SER A 84  ? 0.4621 0.4940 0.4796 -0.0129 -0.0107 -0.0116 84  SER A N   
674  C  CA  . SER A 84  ? 0.4681 0.5057 0.4862 -0.0118 -0.0112 -0.0130 84  SER A CA  
675  C  C   . SER A 84  ? 0.4654 0.5103 0.4824 -0.0130 -0.0099 -0.0108 84  SER A C   
676  O  O   . SER A 84  ? 0.4456 0.5084 0.4654 -0.0262 -0.0193 -0.0217 84  SER A O   
677  C  CB  . SER A 84  ? 0.4800 0.5129 0.4967 -0.0089 -0.0067 -0.0131 84  SER A CB  
678  O  OG  . SER A 84  ? 0.4993 0.5353 0.5111 -0.0118 -0.0118 -0.0374 84  SER A OG  
679  N  N   . VAL A 85  ? 0.4608 0.5073 0.4862 -0.0154 -0.0097 -0.0082 85  VAL A N   
680  C  CA  . VAL A 85  ? 0.4646 0.5090 0.4884 -0.0123 -0.0090 -0.0083 85  VAL A CA  
681  C  C   . VAL A 85  ? 0.4582 0.5011 0.4837 -0.0149 -0.0098 -0.0135 85  VAL A C   
682  O  O   . VAL A 85  ? 0.4636 0.5205 0.5040 -0.0228 -0.0072 -0.0228 85  VAL A O   
683  C  CB  . VAL A 85  ? 0.4706 0.5122 0.4937 -0.0086 -0.0083 -0.0062 85  VAL A CB  
684  C  CG1 . VAL A 85  ? 0.4883 0.5284 0.5049 -0.0108 -0.0007 -0.0149 85  VAL A CG1 
685  C  CG2 . VAL A 85  ? 0.4764 0.5368 0.4997 -0.0059 -0.0040 0.0025  85  VAL A CG2 
686  N  N   . MET A 86  ? 0.4428 0.4871 0.4653 -0.0219 -0.0117 -0.0157 86  MET A N   
687  C  CA  . MET A 86  ? 0.4459 0.4816 0.4589 -0.0178 -0.0071 -0.0113 86  MET A CA  
688  C  C   . MET A 86  ? 0.4570 0.4872 0.4592 -0.0220 -0.0055 -0.0159 86  MET A C   
689  O  O   . MET A 86  ? 0.4589 0.4967 0.4599 -0.0290 -0.0025 -0.0226 86  MET A O   
690  C  CB  . MET A 86  ? 0.4406 0.4839 0.4645 -0.0214 -0.0102 -0.0108 86  MET A CB  
691  C  CG  . MET A 86  ? 0.4035 0.4749 0.4439 -0.0213 -0.0078 -0.0153 86  MET A CG  
692  S  SD  . MET A 86  ? 0.4115 0.5140 0.4452 -0.0383 -0.0133 -0.0451 86  MET A SD  
693  C  CE  . MET A 86  ? 0.4116 0.4563 0.4463 -0.0090 -0.0072 -0.0120 86  MET A CE  
694  N  N   . GLY A 87  ? 0.4435 0.4873 0.4521 -0.0276 -0.0080 -0.0148 87  GLY A N   
695  C  CA  . GLY A 87  ? 0.4478 0.4843 0.4501 -0.0252 -0.0075 -0.0170 87  GLY A CA  
696  C  C   . GLY A 87  ? 0.4496 0.4752 0.4417 -0.0235 -0.0038 -0.0160 87  GLY A C   
697  O  O   . GLY A 87  ? 0.4582 0.5117 0.4496 -0.0274 0.0041  -0.0147 87  GLY A O   
698  N  N   . LYS A 88  ? 0.4314 0.4647 0.4171 -0.0253 -0.0117 -0.0264 88  LYS A N   
699  C  CA  . LYS A 88  ? 0.4292 0.4589 0.4092 -0.0240 -0.0080 -0.0264 88  LYS A CA  
700  C  C   . LYS A 88  ? 0.4123 0.4684 0.4043 -0.0322 -0.0035 -0.0257 88  LYS A C   
701  O  O   . LYS A 88  ? 0.4155 0.4984 0.3912 -0.0343 0.0206  -0.0318 88  LYS A O   
702  C  CB  . LYS A 88  ? 0.4311 0.4612 0.4166 -0.0216 -0.0098 -0.0243 88  LYS A CB  
703  C  CG  . LYS A 88  ? 0.4452 0.4682 0.4503 -0.0120 -0.0061 -0.0193 88  LYS A CG  
704  C  CD  . LYS A 88  ? 0.4714 0.4818 0.4683 -0.0047 -0.0022 -0.0066 88  LYS A CD  
705  C  CE  . LYS A 88  ? 0.4827 0.4953 0.4860 -0.0003 -0.0006 -0.0052 88  LYS A CE  
706  N  NZ  . LYS A 88  ? 0.4997 0.5001 0.4897 -0.0025 -0.0039 -0.0031 88  LYS A NZ  
707  N  N   . CYS A 89  ? 0.3908 0.4516 0.3838 -0.0298 -0.0066 -0.0320 89  CYS A N   
708  C  CA  . CYS A 89  ? 0.3912 0.4458 0.3790 -0.0280 -0.0133 -0.0305 89  CYS A CA  
709  C  C   . CYS A 89  ? 0.3860 0.4356 0.3744 -0.0277 -0.0173 -0.0249 89  CYS A C   
710  O  O   . CYS A 89  ? 0.3860 0.4594 0.3824 -0.0525 -0.0313 -0.0334 89  CYS A O   
711  C  CB  . CYS A 89  ? 0.3932 0.4439 0.3812 -0.0220 -0.0132 -0.0242 89  CYS A CB  
712  S  SG  . CYS A 89  ? 0.4108 0.4409 0.3676 -0.0610 -0.0223 -0.1016 89  CYS A SG  
713  N  N   . LEU A 90  ? 0.3723 0.4194 0.3503 -0.0314 -0.0253 -0.0295 90  LEU A N   
714  C  CA  . LEU A 90  ? 0.3715 0.4155 0.3493 -0.0179 -0.0201 -0.0283 90  LEU A CA  
715  C  C   . LEU A 90  ? 0.3900 0.4182 0.3551 -0.0156 -0.0130 -0.0290 90  LEU A C   
716  O  O   . LEU A 90  ? 0.4249 0.4659 0.3400 -0.0161 -0.0090 -0.0462 90  LEU A O   
717  C  CB  . LEU A 90  ? 0.3661 0.4130 0.3526 -0.0244 -0.0223 -0.0288 90  LEU A CB  
718  C  CG  . LEU A 90  ? 0.3266 0.3897 0.3607 -0.0237 -0.0189 -0.0361 90  LEU A CG  
719  C  CD1 . LEU A 90  ? 0.3055 0.3776 0.3791 -0.0176 -0.0306 -0.0354 90  LEU A CD1 
720  C  CD2 . LEU A 90  ? 0.3307 0.4053 0.3225 -0.0434 -0.0256 -0.0445 90  LEU A CD2 
721  N  N   . PRO A 91  ? 0.3850 0.4116 0.3488 -0.0100 -0.0043 -0.0200 91  PRO A N   
722  C  CA  . PRO A 91  ? 0.3710 0.3993 0.3309 -0.0098 -0.0072 -0.0179 91  PRO A CA  
723  C  C   . PRO A 91  ? 0.3467 0.3819 0.3166 -0.0021 -0.0002 -0.0190 91  PRO A C   
724  O  O   . PRO A 91  ? 0.3310 0.3899 0.2706 -0.0048 0.0051  -0.0268 91  PRO A O   
725  C  CB  . PRO A 91  ? 0.3855 0.4034 0.3459 -0.0028 -0.0134 -0.0179 91  PRO A CB  
726  C  CG  . PRO A 91  ? 0.3914 0.4139 0.3618 -0.0074 0.0080  -0.0057 91  PRO A CG  
727  C  CD  . PRO A 91  ? 0.3975 0.4171 0.3637 -0.0056 -0.0091 -0.0166 91  PRO A CD  
728  N  N   . THR A 92  ? 0.3171 0.3726 0.2843 -0.0079 -0.0037 -0.0206 92  THR A N   
729  C  CA  . THR A 92  ? 0.2807 0.3591 0.2814 -0.0152 0.0041  -0.0103 92  THR A CA  
730  C  C   . THR A 92  ? 0.3009 0.3609 0.2944 -0.0215 0.0018  -0.0029 92  THR A C   
731  O  O   . THR A 92  ? 0.2888 0.4192 0.3047 -0.0183 -0.0073 0.0062  92  THR A O   
732  C  CB  . THR A 92  ? 0.2739 0.3424 0.2715 -0.0176 0.0058  -0.0126 92  THR A CB  
733  O  OG1 . THR A 92  ? 0.2636 0.3352 0.2578 -0.0569 0.0032  -0.0057 92  THR A OG1 
734  C  CG2 . THR A 92  ? 0.2494 0.3283 0.2734 -0.0327 0.0057  -0.0183 92  THR A CG2 
735  N  N   . SER A 93  ? 0.3022 0.3793 0.2931 -0.0241 0.0031  -0.0033 93  SER A N   
736  C  CA  . SER A 93  ? 0.3205 0.3872 0.3050 -0.0143 0.0063  -0.0088 93  SER A CA  
737  C  C   . SER A 93  ? 0.3068 0.3668 0.2922 -0.0138 0.0049  -0.0054 93  SER A C   
738  O  O   . SER A 93  ? 0.2838 0.3841 0.2858 -0.0288 0.0073  -0.0230 93  SER A O   
739  C  CB  . SER A 93  ? 0.3551 0.4021 0.3272 -0.0085 0.0033  -0.0046 93  SER A CB  
740  O  OG  . SER A 93  ? 0.4384 0.4027 0.3395 -0.0037 0.0174  -0.0308 93  SER A OG  
741  N  N   . GLY A 94  ? 0.2926 0.3753 0.2889 -0.0106 0.0226  0.0002  94  GLY A N   
742  C  CA  . GLY A 94  ? 0.2918 0.3565 0.2780 -0.0070 0.0231  0.0032  94  GLY A CA  
743  C  C   . GLY A 94  ? 0.2997 0.3396 0.2951 -0.0067 0.0257  0.0053  94  GLY A C   
744  O  O   . GLY A 94  ? 0.3070 0.3677 0.3064 -0.0124 0.0254  0.0185  94  GLY A O   
745  N  N   . SER A 95  ? 0.2929 0.3276 0.3108 -0.0131 0.0138  0.0029  95  SER A N   
746  C  CA  A SER A 95  ? 0.3038 0.3197 0.3091 -0.0130 0.0141  0.0037  95  SER A CA  
747  C  CA  B SER A 95  ? 0.3084 0.3246 0.3157 -0.0107 0.0138  0.0028  95  SER A CA  
748  C  C   . SER A 95  ? 0.3053 0.3125 0.3127 -0.0167 0.0157  0.0014  95  SER A C   
749  O  O   . SER A 95  ? 0.3087 0.3326 0.3279 -0.0328 0.0326  0.0138  95  SER A O   
750  C  CB  A SER A 95  ? 0.3033 0.3218 0.3092 -0.0154 0.0079  -0.0009 95  SER A CB  
751  C  CB  B SER A 95  ? 0.3109 0.3298 0.3197 -0.0116 0.0075  0.0004  95  SER A CB  
752  O  OG  A SER A 95  ? 0.3044 0.3117 0.2990 -0.0288 -0.0021 0.0011  95  SER A OG  
753  O  OG  B SER A 95  ? 0.3450 0.3526 0.3490 -0.0003 0.0038  -0.0054 95  SER A OG  
754  N  N   . ASP A 96  ? 0.2648 0.2810 0.2881 -0.0216 0.0175  0.0064  96  ASP A N   
755  C  CA  . ASP A 96  ? 0.2495 0.2803 0.2664 -0.0222 0.0090  0.0092  96  ASP A CA  
756  C  C   . ASP A 96  ? 0.2449 0.2597 0.2469 -0.0225 0.0103  0.0097  96  ASP A C   
757  O  O   . ASP A 96  ? 0.2419 0.2653 0.2274 -0.0353 0.0211  0.0290  96  ASP A O   
758  C  CB  . ASP A 96  ? 0.2444 0.2790 0.2731 -0.0285 0.0080  0.0024  96  ASP A CB  
759  C  CG  . ASP A 96  ? 0.2551 0.3313 0.3079 -0.0105 -0.0106 0.0271  96  ASP A CG  
760  O  OD1 . ASP A 96  ? 0.3019 0.2954 0.2829 -0.0483 -0.0209 0.0169  96  ASP A OD1 
761  O  OD2 . ASP A 96  ? 0.2852 0.4004 0.4287 -0.0156 -0.0108 0.0434  96  ASP A OD2 
762  N  N   . ASN A 97  ? 0.2320 0.2495 0.2484 -0.0283 0.0053  0.0101  97  ASN A N   
763  C  CA  . ASN A 97  ? 0.2288 0.2468 0.2262 -0.0173 -0.0037 0.0114  97  ASN A CA  
764  C  C   . ASN A 97  ? 0.2372 0.2378 0.2201 -0.0256 -0.0059 0.0039  97  ASN A C   
765  O  O   . ASN A 97  ? 0.2454 0.2426 0.2315 -0.0374 -0.0227 0.0048  97  ASN A O   
766  C  CB  . ASN A 97  ? 0.2504 0.2445 0.2357 -0.0198 -0.0040 0.0148  97  ASN A CB  
767  C  CG  . ASN A 97  ? 0.2683 0.2542 0.2465 0.0044  -0.0027 0.0162  97  ASN A CG  
768  O  OD1 . ASN A 97  ? 0.2929 0.2702 0.2640 -0.0262 0.0089  0.0339  97  ASN A OD1 
769  N  ND2 . ASN A 97  ? 0.2742 0.2531 0.2739 -0.0354 -0.0058 0.0000  97  ASN A ND2 
770  N  N   . CYS A 98  ? 0.2491 0.2382 0.2193 -0.0233 0.0009  -0.0024 98  CYS A N   
771  C  CA  . CYS A 98  ? 0.2478 0.2375 0.2007 -0.0181 0.0049  0.0037  98  CYS A CA  
772  C  C   . CYS A 98  ? 0.2397 0.2273 0.2132 -0.0168 0.0076  0.0046  98  CYS A C   
773  O  O   . CYS A 98  ? 0.2382 0.2342 0.1822 -0.0400 0.0342  -0.0028 98  CYS A O   
774  C  CB  . CYS A 98  ? 0.2860 0.2527 0.2126 -0.0081 0.0041  0.0122  98  CYS A CB  
775  S  SG  . CYS A 98  ? 0.3065 0.2421 0.2226 -0.0310 0.0228  -0.0003 98  CYS A SG  
776  N  N   . ASN A 99  ? 0.2322 0.2258 0.2098 -0.0189 0.0131  -0.0017 99  ASN A N   
777  C  CA  . ASN A 99  ? 0.2295 0.2581 0.2303 -0.0102 0.0118  -0.0018 99  ASN A CA  
778  C  C   . ASN A 99  ? 0.2179 0.2529 0.2179 -0.0127 0.0132  -0.0093 99  ASN A C   
779  O  O   . ASN A 99  ? 0.2073 0.2990 0.2426 -0.0046 0.0245  -0.0238 99  ASN A O   
780  C  CB  . ASN A 99  ? 0.2399 0.2715 0.2473 -0.0051 0.0191  -0.0020 99  ASN A CB  
781  C  CG  . ASN A 99  ? 0.2504 0.2934 0.2488 -0.0108 0.0087  -0.0108 99  ASN A CG  
782  O  OD1 . ASN A 99  ? 0.2315 0.3867 0.2286 -0.0184 0.0273  -0.0223 99  ASN A OD1 
783  N  ND2 . ASN A 99  ? 0.2324 0.3124 0.2605 -0.0083 -0.0064 -0.0046 99  ASN A ND2 
784  N  N   . LYS A 100 ? 0.2201 0.2559 0.2000 -0.0228 0.0175  -0.0112 100 LYS A N   
785  C  CA  . LYS A 100 ? 0.2251 0.2625 0.2094 -0.0243 0.0178  -0.0081 100 LYS A CA  
786  C  C   . LYS A 100 ? 0.2430 0.2678 0.2080 -0.0363 0.0202  -0.0165 100 LYS A C   
787  O  O   . LYS A 100 ? 0.2553 0.2891 0.2030 -0.0384 0.0273  -0.0278 100 LYS A O   
788  C  CB  . LYS A 100 ? 0.2360 0.2711 0.2217 -0.0280 0.0136  -0.0046 100 LYS A CB  
789  C  CG  . LYS A 100 ? 0.2727 0.2928 0.2321 -0.0216 0.0283  0.0131  100 LYS A CG  
790  C  CD  . LYS A 100 ? 0.2766 0.3098 0.2797 -0.0102 0.0280  0.0123  100 LYS A CD  
791  C  CE  . LYS A 100 ? 0.3376 0.3425 0.3185 -0.0076 0.0170  0.0261  100 LYS A CE  
792  N  NZ  . LYS A 100 ? 0.3655 0.3751 0.3955 -0.0012 0.0394  0.0467  100 LYS A NZ  
793  N  N   . ILE A 101 ? 0.2188 0.2632 0.1918 -0.0315 0.0144  -0.0127 101 ILE A N   
794  C  CA  . ILE A 101 ? 0.2207 0.2401 0.2052 -0.0306 0.0140  -0.0121 101 ILE A CA  
795  C  C   . ILE A 101 ? 0.2450 0.2565 0.2362 -0.0259 0.0170  -0.0213 101 ILE A C   
796  O  O   . ILE A 101 ? 0.2460 0.2374 0.2480 -0.0476 0.0243  -0.0442 101 ILE A O   
797  C  CB  . ILE A 101 ? 0.2123 0.2378 0.2081 -0.0238 0.0150  -0.0113 101 ILE A CB  
798  C  CG1 . ILE A 101 ? 0.2036 0.2339 0.1971 -0.0348 0.0046  -0.0062 101 ILE A CG1 
799  C  CG2 . ILE A 101 ? 0.2075 0.2184 0.2175 -0.0440 0.0407  0.0051  101 ILE A CG2 
800  C  CD1 . ILE A 101 ? 0.2247 0.2401 0.1928 -0.0228 -0.0054 0.0061  101 ILE A CD1 
801  N  N   . TYR A 102 ? 0.2515 0.2481 0.2319 -0.0214 0.0082  -0.0241 102 TYR A N   
802  C  CA  . TYR A 102 ? 0.2597 0.2565 0.2258 -0.0126 0.0096  -0.0345 102 TYR A CA  
803  C  C   . TYR A 102 ? 0.2741 0.2673 0.2420 -0.0211 -0.0005 -0.0373 102 TYR A C   
804  O  O   . TYR A 102 ? 0.2975 0.2862 0.2592 -0.0282 0.0089  -0.0512 102 TYR A O   
805  C  CB  . TYR A 102 ? 0.2675 0.2637 0.2408 -0.0088 0.0013  -0.0361 102 TYR A CB  
806  C  CG  . TYR A 102 ? 0.2700 0.2570 0.2445 -0.0037 0.0008  -0.0225 102 TYR A CG  
807  C  CD1 . TYR A 102 ? 0.3135 0.2646 0.2818 0.0134  -0.0070 -0.0248 102 TYR A CD1 
808  C  CD2 . TYR A 102 ? 0.2854 0.2886 0.2824 -0.0074 0.0085  -0.0123 102 TYR A CD2 
809  C  CE1 . TYR A 102 ? 0.3147 0.3050 0.3257 0.0160  0.0021  -0.0081 102 TYR A CE1 
810  C  CE2 . TYR A 102 ? 0.2940 0.2962 0.3063 0.0145  0.0089  -0.0151 102 TYR A CE2 
811  C  CZ  . TYR A 102 ? 0.3223 0.2943 0.3450 0.0062  0.0026  -0.0104 102 TYR A CZ  
812  O  OH  . TYR A 102 ? 0.3600 0.3459 0.4285 0.0458  0.0220  -0.0444 102 TYR A OH  
813  N  N   . ASN A 103 ? 0.2602 0.2822 0.2289 -0.0220 -0.0064 -0.0464 103 ASN A N   
814  C  CA  . ASN A 103 ? 0.2781 0.2986 0.2539 -0.0135 -0.0068 -0.0367 103 ASN A CA  
815  C  C   . ASN A 103 ? 0.2843 0.3032 0.2749 -0.0125 -0.0090 -0.0416 103 ASN A C   
816  O  O   . ASN A 103 ? 0.3324 0.3078 0.3042 -0.0246 -0.0041 -0.0527 103 ASN A O   
817  C  CB  . ASN A 103 ? 0.2714 0.3122 0.2666 -0.0141 -0.0072 -0.0372 103 ASN A CB  
818  C  CG  . ASN A 103 ? 0.2646 0.3158 0.2707 -0.0006 0.0026  -0.0172 103 ASN A CG  
819  O  OD1 . ASN A 103 ? 0.2570 0.3611 0.3070 0.0147  0.0303  -0.0297 103 ASN A OD1 
820  N  ND2 . ASN A 103 ? 0.3039 0.3342 0.2721 -0.0013 0.0206  -0.0435 103 ASN A ND2 
821  N  N   . LEU A 104 ? 0.2861 0.2962 0.2662 -0.0114 -0.0047 -0.0463 104 LEU A N   
822  C  CA  . LEU A 104 ? 0.2678 0.2911 0.2725 -0.0112 -0.0103 -0.0303 104 LEU A CA  
823  C  C   . LEU A 104 ? 0.2790 0.3005 0.2975 -0.0126 -0.0068 -0.0305 104 LEU A C   
824  O  O   . LEU A 104 ? 0.2937 0.3099 0.3138 -0.0234 -0.0207 -0.0489 104 LEU A O   
825  C  CB  . LEU A 104 ? 0.2733 0.2990 0.2717 -0.0173 -0.0069 -0.0307 104 LEU A CB  
826  C  CG  . LEU A 104 ? 0.2475 0.2811 0.2296 -0.0095 -0.0001 -0.0185 104 LEU A CG  
827  C  CD1 . LEU A 104 ? 0.2991 0.3314 0.2549 -0.0385 -0.0318 -0.0146 104 LEU A CD1 
828  C  CD2 . LEU A 104 ? 0.2588 0.2725 0.2712 0.0053  -0.0078 -0.0156 104 LEU A CD2 
829  N  N   . ALA A 105 ? 0.2778 0.2952 0.2981 -0.0185 -0.0040 -0.0288 105 ALA A N   
830  C  CA  . ALA A 105 ? 0.3011 0.3177 0.3206 -0.0107 0.0020  -0.0201 105 ALA A CA  
831  C  C   . ALA A 105 ? 0.3209 0.3273 0.3429 -0.0147 -0.0013 -0.0224 105 ALA A C   
832  O  O   . ALA A 105 ? 0.3256 0.3296 0.3503 -0.0246 -0.0033 -0.0201 105 ALA A O   
833  C  CB  . ALA A 105 ? 0.3054 0.3155 0.3193 -0.0051 -0.0076 -0.0195 105 ALA A CB  
834  N  N   . LYS A 106 ? 0.3251 0.3472 0.3644 -0.0113 0.0018  -0.0335 106 LYS A N   
835  C  CA  . LYS A 106 ? 0.3532 0.3627 0.3826 -0.0109 0.0002  -0.0268 106 LYS A CA  
836  C  C   . LYS A 106 ? 0.3592 0.3671 0.3809 -0.0112 -0.0013 -0.0278 106 LYS A C   
837  O  O   . LYS A 106 ? 0.3949 0.3900 0.4301 -0.0067 -0.0067 -0.0420 106 LYS A O   
838  C  CB  . LYS A 106 ? 0.3534 0.3764 0.3863 -0.0090 0.0050  -0.0252 106 LYS A CB  
839  C  CG  . LYS A 106 ? 0.3926 0.3913 0.4087 -0.0057 -0.0032 -0.0070 106 LYS A CG  
840  C  CD  . LYS A 106 ? 0.4141 0.4054 0.4371 -0.0018 -0.0002 0.0000  106 LYS A CD  
841  C  CE  . LYS A 106 ? 0.4215 0.4145 0.4144 -0.0039 0.0010  -0.0041 106 LYS A CE  
842  N  NZ  . LYS A 106 ? 0.4139 0.4018 0.4119 0.0017  -0.0019 -0.0174 106 LYS A NZ  
843  N  N   . CYS A 107 ? 0.3713 0.3829 0.3827 -0.0202 -0.0023 -0.0385 107 CYS A N   
844  C  CA  . CYS A 107 ? 0.3881 0.3984 0.3780 -0.0180 -0.0010 -0.0393 107 CYS A CA  
845  C  C   . CYS A 107 ? 0.3907 0.4038 0.3928 -0.0196 -0.0033 -0.0443 107 CYS A C   
846  O  O   . CYS A 107 ? 0.4269 0.3935 0.4012 -0.0215 -0.0042 -0.0662 107 CYS A O   
847  C  CB  . CYS A 107 ? 0.3795 0.4004 0.3639 -0.0145 -0.0070 -0.0395 107 CYS A CB  
848  S  SG  . CYS A 107 ? 0.4163 0.4525 0.3546 -0.0372 0.0092  -0.0986 107 CYS A SG  
849  N  N   . VAL A 108 ? 0.3932 0.4054 0.3939 -0.0181 -0.0014 -0.0423 108 VAL A N   
850  C  CA  . VAL A 108 ? 0.3977 0.4119 0.4054 -0.0183 -0.0008 -0.0300 108 VAL A CA  
851  C  C   . VAL A 108 ? 0.4217 0.4236 0.4353 -0.0133 -0.0009 -0.0244 108 VAL A C   
852  O  O   . VAL A 108 ? 0.4228 0.4090 0.4500 -0.0272 -0.0092 -0.0381 108 VAL A O   
853  C  CB  . VAL A 108 ? 0.3820 0.4065 0.3923 -0.0144 -0.0027 -0.0299 108 VAL A CB  
854  C  CG1 . VAL A 108 ? 0.4072 0.4183 0.3874 -0.0277 0.0066  -0.0268 108 VAL A CG1 
855  C  CG2 . VAL A 108 ? 0.3491 0.4024 0.3569 -0.0327 -0.0125 -0.0344 108 VAL A CG2 
856  N  N   . GLN A 109 ? 0.4466 0.4357 0.4564 -0.0141 -0.0040 -0.0206 109 GLN A N   
857  C  CA  . GLN A 109 ? 0.4724 0.4523 0.4753 -0.0070 -0.0015 -0.0102 109 GLN A CA  
858  C  C   . GLN A 109 ? 0.5005 0.4740 0.5023 -0.0063 -0.0003 -0.0119 109 GLN A C   
859  O  O   . GLN A 109 ? 0.5224 0.4660 0.5276 -0.0056 0.0025  -0.0172 109 GLN A O   
860  C  CB  . GLN A 109 ? 0.4708 0.4532 0.4816 -0.0065 -0.0010 -0.0080 109 GLN A CB  
861  C  CG  . GLN A 109 ? 0.4719 0.4518 0.4687 -0.0132 -0.0004 -0.0092 109 GLN A CG  
862  C  CD  . GLN A 109 ? 0.4636 0.4458 0.4725 -0.0038 -0.0062 0.0015  109 GLN A CD  
863  O  OE1 . GLN A 109 ? 0.4644 0.4338 0.4945 -0.0097 -0.0139 -0.0057 109 GLN A OE1 
864  N  NE2 . GLN A 109 ? 0.4681 0.4145 0.4422 -0.0049 -0.0166 -0.0148 109 GLN A NE2 
865  N  N   . GLU A 110 ? 0.5141 0.4948 0.5193 -0.0072 -0.0004 -0.0147 110 GLU A N   
866  C  CA  . GLU A 110 ? 0.5367 0.5181 0.5382 -0.0006 -0.0027 -0.0114 110 GLU A CA  
867  C  C   . GLU A 110 ? 0.5528 0.5336 0.5571 -0.0019 -0.0053 -0.0149 110 GLU A C   
868  O  O   . GLU A 110 ? 0.5638 0.5373 0.5770 -0.0016 -0.0075 -0.0190 110 GLU A O   
869  C  CB  . GLU A 110 ? 0.5370 0.5208 0.5401 0.0008  -0.0004 -0.0110 110 GLU A CB  
870  C  CG  . GLU A 110 ? 0.5470 0.5297 0.5420 0.0009  -0.0032 -0.0057 110 GLU A CG  
871  C  CD  . GLU A 110 ? 0.5458 0.5426 0.5423 0.0016  -0.0011 -0.0007 110 GLU A CD  
872  O  OE1 . GLU A 110 ? 0.5718 0.5517 0.5631 0.0069  0.0062  -0.0071 110 GLU A OE1 
873  O  OE2 . GLU A 110 ? 0.5500 0.5258 0.5549 0.0040  0.0001  -0.0166 110 GLU A OE2 
874  N  N   . SER A 111 ? 0.5617 0.5496 0.5670 -0.0029 -0.0065 -0.0135 111 SER A N   
875  C  CA  . SER A 111 ? 0.5697 0.5615 0.5720 -0.0055 -0.0039 -0.0091 111 SER A CA  
876  C  C   . SER A 111 ? 0.5703 0.5656 0.5697 -0.0069 -0.0040 -0.0096 111 SER A C   
877  O  O   . SER A 111 ? 0.5791 0.5665 0.5780 -0.0082 -0.0126 -0.0134 111 SER A O   
878  C  CB  . SER A 111 ? 0.5754 0.5700 0.5747 -0.0025 -0.0035 -0.0062 111 SER A CB  
879  O  OG  . SER A 111 ? 0.5715 0.5580 0.5719 -0.0032 0.0022  -0.0108 111 SER A OG  
880  N  N   . ALA A 112 ? 0.5541 0.5452 0.5561 -0.0125 -0.0027 -0.0130 112 ALA A N   
881  C  CA  . ALA A 112 ? 0.5388 0.5273 0.5269 -0.0085 -0.0037 -0.0089 112 ALA A CA  
882  C  C   . ALA A 112 ? 0.5104 0.4845 0.5016 -0.0122 0.0025  -0.0053 112 ALA A C   
883  O  O   . ALA A 112 ? 0.5348 0.5166 0.5229 -0.0305 -0.0044 -0.0216 112 ALA A O   
884  C  CB  . ALA A 112 ? 0.5361 0.5235 0.5387 -0.0071 -0.0004 -0.0117 112 ALA A CB  
885  N  N   . PRO A 113 ? 0.5715 0.5752 0.5769 0.0000  -0.0013 -0.0010 113 PRO A N   
886  C  CA  . PRO A 113 ? 0.5725 0.5742 0.5761 -0.0002 0.0000  -0.0001 113 PRO A CA  
887  C  C   . PRO A 113 ? 0.5714 0.5698 0.5787 -0.0003 -0.0004 -0.0003 113 PRO A C   
888  O  O   . PRO A 113 ? 0.5808 0.5737 0.5898 0.0005  -0.0016 0.0016  113 PRO A O   
889  C  CB  . PRO A 113 ? 0.5739 0.5749 0.5752 0.0009  0.0000  0.0004  113 PRO A CB  
890  C  CG  . PRO A 113 ? 0.5759 0.5784 0.5781 0.0003  -0.0010 -0.0021 113 PRO A CG  
891  C  CD  . PRO A 113 ? 0.5720 0.5749 0.5780 -0.0004 -0.0014 -0.0007 113 PRO A CD  
892  N  N   . ASP A 114 ? 0.4910 0.5109 0.5030 0.0032  -0.0088 -0.0033 114 ASP A N   
893  C  CA  . ASP A 114 ? 0.5248 0.5306 0.5301 -0.0026 0.0023  -0.0037 114 ASP A CA  
894  C  C   . ASP A 114 ? 0.5246 0.5264 0.5272 -0.0054 0.0020  -0.0059 114 ASP A C   
895  O  O   . ASP A 114 ? 0.5584 0.5579 0.5537 -0.0059 0.0047  -0.0085 114 ASP A O   
896  C  CB  . ASP A 114 ? 0.5305 0.5392 0.5407 -0.0024 -0.0034 -0.0029 114 ASP A CB  
897  C  CG  . ASP A 114 ? 0.5604 0.5632 0.5573 0.0019  -0.0009 -0.0025 114 ASP A CG  
898  O  OD1 . ASP A 114 ? 0.5662 0.5758 0.5680 -0.0137 -0.0032 -0.0001 114 ASP A OD1 
899  O  OD2 . ASP A 114 ? 0.5908 0.5841 0.5914 -0.0117 -0.0029 -0.0067 114 ASP A OD2 
900  N  N   . VAL A 115 ? 0.4967 0.5011 0.5125 -0.0123 -0.0075 -0.0135 115 VAL A N   
901  C  CA  . VAL A 115 ? 0.4720 0.4869 0.4887 -0.0180 -0.0105 -0.0174 115 VAL A CA  
902  C  C   . VAL A 115 ? 0.4418 0.4528 0.4649 -0.0184 -0.0080 -0.0188 115 VAL A C   
903  O  O   . VAL A 115 ? 0.4219 0.4543 0.4667 -0.0378 -0.0096 -0.0268 115 VAL A O   
904  C  CB  . VAL A 115 ? 0.4660 0.4835 0.4819 -0.0180 -0.0159 -0.0153 115 VAL A CB  
905  C  CG1 . VAL A 115 ? 0.4877 0.4996 0.5042 -0.0099 -0.0148 -0.0200 115 VAL A CG1 
906  C  CG2 . VAL A 115 ? 0.4844 0.5041 0.4953 -0.0171 -0.0061 -0.0303 115 VAL A CG2 
907  N  N   . TRP A 116 ? 0.4191 0.4237 0.4401 -0.0222 -0.0083 -0.0152 116 TRP A N   
908  C  CA  . TRP A 116 ? 0.4101 0.4053 0.4178 -0.0119 -0.0046 -0.0110 116 TRP A CA  
909  C  C   . TRP A 116 ? 0.4127 0.4087 0.4269 -0.0097 -0.0042 -0.0034 116 TRP A C   
910  O  O   . TRP A 116 ? 0.4600 0.4394 0.4570 -0.0006 -0.0029 0.0073  116 TRP A O   
911  C  CB  . TRP A 116 ? 0.3894 0.3545 0.3919 -0.0234 -0.0094 -0.0080 116 TRP A CB  
912  C  CG  . TRP A 116 ? 0.3766 0.3563 0.3597 -0.0168 -0.0071 -0.0088 116 TRP A CG  
913  C  CD1 . TRP A 116 ? 0.3816 0.3393 0.3483 -0.0180 -0.0033 -0.0047 116 TRP A CD1 
914  C  CD2 . TRP A 116 ? 0.3360 0.3256 0.3191 -0.0311 -0.0123 -0.0345 116 TRP A CD2 
915  N  NE1 . TRP A 116 ? 0.3624 0.3592 0.3307 -0.0325 -0.0205 -0.0251 116 TRP A NE1 
916  C  CE2 . TRP A 116 ? 0.3461 0.3560 0.3321 -0.0224 -0.0043 -0.0287 116 TRP A CE2 
917  C  CE3 . TRP A 116 ? 0.3388 0.3450 0.3329 -0.0195 -0.0074 -0.0285 116 TRP A CE3 
918  C  CZ2 . TRP A 116 ? 0.3247 0.3457 0.3314 -0.0146 -0.0003 -0.0289 116 TRP A CZ2 
919  C  CZ3 . TRP A 116 ? 0.3676 0.3644 0.3371 -0.0125 -0.0087 -0.0189 116 TRP A CZ3 
920  C  CH2 . TRP A 116 ? 0.3524 0.3574 0.3585 -0.0239 -0.0015 -0.0195 116 TRP A CH2 
921  N  N   . PHE A 117 ? 0.4091 0.4089 0.4233 -0.0177 0.0011  0.0030  117 PHE A N   
922  C  CA  . PHE A 117 ? 0.4027 0.4089 0.4107 -0.0129 0.0025  0.0013  117 PHE A CA  
923  C  C   . PHE A 117 ? 0.3995 0.4109 0.4093 -0.0121 0.0082  0.0064  117 PHE A C   
924  O  O   . PHE A 117 ? 0.4308 0.4167 0.4300 -0.0084 0.0089  0.0045  117 PHE A O   
925  C  CB  . PHE A 117 ? 0.3978 0.4127 0.4036 -0.0160 0.0054  0.0031  117 PHE A CB  
926  C  CG  . PHE A 117 ? 0.3852 0.4013 0.4023 -0.0153 -0.0012 -0.0053 117 PHE A CG  
927  C  CD1 . PHE A 117 ? 0.3773 0.4036 0.4001 -0.0329 -0.0075 -0.0006 117 PHE A CD1 
928  C  CD2 . PHE A 117 ? 0.3854 0.4055 0.4151 -0.0135 0.0020  0.0011  117 PHE A CD2 
929  C  CE1 . PHE A 117 ? 0.3501 0.3941 0.3815 -0.0256 -0.0015 -0.0001 117 PHE A CE1 
930  C  CE2 . PHE A 117 ? 0.3772 0.3931 0.3948 -0.0102 0.0064  -0.0042 117 PHE A CE2 
931  C  CZ  . PHE A 117 ? 0.3703 0.4008 0.3868 -0.0118 0.0074  0.0015  117 PHE A CZ  
932  N  N   . VAL A 118 ? 0.3758 0.3984 0.3932 -0.0195 0.0159  0.0063  118 VAL A N   
933  C  CA  . VAL A 118 ? 0.3760 0.4037 0.3874 -0.0133 0.0146  0.0027  118 VAL A CA  
934  C  C   . VAL A 118 ? 0.3703 0.3960 0.3836 -0.0154 0.0191  0.0085  118 VAL A C   
935  O  O   . VAL A 118 ? 0.3866 0.4245 0.4044 -0.0077 0.0113  0.0074  118 VAL A O   
936  C  CB  . VAL A 118 ? 0.3729 0.3989 0.3873 -0.0254 0.0185  0.0035  118 VAL A CB  
937  C  CG1 . VAL A 118 ? 0.3585 0.3833 0.3773 -0.0194 0.0215  0.0088  118 VAL A CG1 
938  C  CG2 . VAL A 118 ? 0.3768 0.4220 0.3987 -0.0187 0.0229  -0.0013 118 VAL A CG2 
939  N  N   . ILE A 119 ? 0.3713 0.3966 0.3834 -0.0222 0.0214  0.0160  119 ILE A N   
940  C  CA  . ILE A 119 ? 0.3804 0.3959 0.3776 -0.0153 0.0174  0.0102  119 ILE A CA  
941  C  C   . ILE A 119 ? 0.3705 0.3978 0.3815 -0.0132 0.0181  0.0176  119 ILE A C   
942  O  O   . ILE A 119 ? 0.3518 0.3907 0.3591 -0.0285 0.0324  0.0266  119 ILE A O   
943  C  CB  . ILE A 119 ? 0.3762 0.4017 0.3906 -0.0134 0.0144  0.0095  119 ILE A CB  
944  C  CG1 . ILE A 119 ? 0.4001 0.4166 0.4089 -0.0089 0.0098  0.0099  119 ILE A CG1 
945  C  CG2 . ILE A 119 ? 0.3894 0.4130 0.4036 -0.0137 0.0121  0.0174  119 ILE A CG2 
946  C  CD1 . ILE A 119 ? 0.4117 0.4700 0.4559 0.0019  -0.0018 0.0162  119 ILE A CD1 
947  O  OXT . ILE A 119 ? 0.3556 0.3747 0.3761 -0.0238 0.0228  0.0335  119 ILE A OXT 
948  NA NA  . NA  B .   ? 0.3343 0.2990 0.3349 -0.0182 0.0241  0.0094  120 NA  A NA  
949  O  O1S . NBB C .   ? 0.6161 0.5673 0.5374 -0.0035 0.0130  0.0023  121 NBB A O1S 
950  S  S   . NBB C .   ? 0.5491 0.5184 0.5084 0.0026  -0.0056 0.0404  121 NBB A S   
951  O  O2S . NBB C .   ? 0.5859 0.5726 0.5185 -0.0422 -0.0055 -0.0089 121 NBB A O2S 
952  N  N10 . NBB C .   ? 0.5858 0.5473 0.5165 -0.0051 0.0097  0.0207  121 NBB A N10 
953  C  C11 . NBB C .   ? 0.5414 0.5327 0.5364 -0.0019 0.0132  0.0108  121 NBB A C11 
954  C  C12 . NBB C .   ? 0.5478 0.5308 0.5296 0.0032  -0.0003 0.0129  121 NBB A C12 
955  C  C13 . NBB C .   ? 0.5435 0.5506 0.5388 0.0005  -0.0022 0.0044  121 NBB A C13 
956  C  C14 . NBB C .   ? 0.5583 0.5699 0.5468 0.0090  -0.0007 0.0047  121 NBB A C14 
957  C  C4  . NBB C .   ? 0.5922 0.5701 0.5801 -0.0126 0.0086  0.0192  121 NBB A C4  
958  C  C5  . NBB C .   ? 0.6133 0.6041 0.6121 0.0186  -0.0017 0.0097  121 NBB A C5  
959  C  C6  . NBB C .   ? 0.5654 0.4962 0.5542 0.0227  -0.0345 0.0713  121 NBB A C6  
960  C  C1  . NBB C .   ? 0.5861 0.6062 0.5954 0.0049  -0.0025 0.0034  121 NBB A C1  
961  C  C2  . NBB C .   ? 0.5427 0.5682 0.5990 -0.0170 -0.0008 0.0149  121 NBB A C2  
962  C  C3  . NBB C .   ? 0.6006 0.6646 0.6539 -0.0318 0.0369  -0.0586 121 NBB A C3  
963  C  C1  . EDO D .   ? 0.6423 0.6452 0.6609 -0.0046 0.0052  -0.0007 122 EDO A C1  
964  O  O1  . EDO D .   ? 0.6702 0.6520 0.6869 -0.0033 0.0065  0.0173  122 EDO A O1  
965  C  C2  . EDO D .   ? 0.6498 0.6479 0.6591 -0.0043 0.0020  0.0045  122 EDO A C2  
966  O  O2  . EDO D .   ? 0.6595 0.6657 0.6549 0.0004  0.0087  -0.0035 122 EDO A O2  
967  C  C1  . EDO E .   ? 0.7319 0.7251 0.7263 -0.0063 0.0056  0.0004  123 EDO A C1  
968  O  O1  . EDO E .   ? 0.7205 0.7286 0.6977 -0.0108 0.0052  -0.0055 123 EDO A O1  
969  C  C2  . EDO E .   ? 0.7361 0.7267 0.7345 -0.0039 0.0034  0.0040  123 EDO A C2  
970  O  O2  . EDO E .   ? 0.7441 0.7505 0.7493 -0.0052 0.0016  0.0059  123 EDO A O2  
971  C  C1  . EDO F .   ? 0.7768 0.7779 0.7746 0.0007  0.0084  0.0062  124 EDO A C1  
972  O  O1  . EDO F .   ? 0.7663 0.7757 0.7739 0.0057  0.0113  0.0085  124 EDO A O1  
973  C  C2  . EDO F .   ? 0.7664 0.7813 0.7675 0.0001  0.0003  0.0034  124 EDO A C2  
974  O  O2  . EDO F .   ? 0.7795 0.7839 0.7722 -0.0005 0.0029  -0.0021 124 EDO A O2  
975  C  C1  . EDO G .   ? 0.6373 0.6409 0.6262 0.0023  0.0026  -0.0077 125 EDO A C1  
976  O  O1  . EDO G .   ? 0.6448 0.6385 0.6129 0.0107  0.0009  -0.0051 125 EDO A O1  
977  C  C2  . EDO G .   ? 0.6289 0.6290 0.6178 0.0028  0.0035  -0.0033 125 EDO A C2  
978  O  O2  . EDO G .   ? 0.5872 0.5934 0.5800 0.0068  0.0202  -0.0096 125 EDO A O2  
979  C  C1  . EDO H .   ? 0.5257 0.5284 0.5184 0.0062  0.0019  -0.0014 126 EDO A C1  
980  O  O1  . EDO H .   ? 0.4682 0.4578 0.4276 -0.0104 0.0362  0.0272  126 EDO A O1  
981  C  C2  . EDO H .   ? 0.5493 0.5463 0.5495 -0.0020 0.0046  0.0040  126 EDO A C2  
982  O  O2  . EDO H .   ? 0.5767 0.5764 0.5903 0.0121  -0.0138 0.0033  126 EDO A O2  
983  C  C1  . EDO I .   ? 0.7922 0.7921 0.7910 -0.0009 -0.0002 -0.0047 127 EDO A C1  
984  O  O1  . EDO I .   ? 0.8057 0.7954 0.7977 0.0072  0.0009  0.0000  127 EDO A O1  
985  C  C2  . EDO I .   ? 0.7873 0.7836 0.7819 -0.0002 0.0015  0.0006  127 EDO A C2  
986  O  O2  . EDO I .   ? 0.7837 0.7888 0.7898 0.0031  0.0037  0.0027  127 EDO A O2  
987  O  O   . HOH J .   ? 0.3617 0.5273 0.4128 -0.0001 -0.0321 0.0002  128 HOH A O   
988  O  O   . HOH J .   ? 0.2709 0.2795 0.2217 -0.0031 0.0264  0.0108  129 HOH A O   
989  O  O   . HOH J .   ? 0.3735 0.3709 0.4600 -0.0306 -0.0303 -0.0477 130 HOH A O   
990  O  O   . HOH J .   ? 0.3035 0.2961 0.2190 0.0379  0.0262  0.0131  131 HOH A O   
991  O  O   . HOH J .   ? 0.3962 0.4129 0.3832 0.0156  0.0207  0.0022  132 HOH A O   
992  O  O   . HOH J .   ? 0.3864 0.3609 0.4479 -0.0662 -0.0198 0.0184  133 HOH A O   
993  O  O   . HOH J .   ? 0.2563 0.2250 0.2077 0.0000  0.0108  0.0000  134 HOH A O   
994  O  O   . HOH J .   ? 0.4402 0.2995 0.3549 -0.0089 0.0524  0.0692  135 HOH A O   
995  O  O   . HOH J .   ? 0.4306 0.2711 0.4029 0.0004  0.0559  -0.0902 136 HOH A O   
996  O  O   . HOH J .   ? 0.2816 0.2830 0.2621 0.0216  0.0173  0.0255  137 HOH A O   
997  O  O   . HOH J .   ? 0.3680 0.3872 0.3890 -0.0239 -0.0169 0.0396  138 HOH A O   
998  O  O   . HOH J .   ? 0.2940 0.2818 0.2861 -0.0162 0.0503  -0.0205 139 HOH A O   
999  O  O   . HOH J .   ? 0.3338 0.3008 0.2381 -0.0091 -0.0056 -0.0071 140 HOH A O   
1000 O  O   . HOH J .   ? 0.4497 0.3607 0.4540 0.0004  -0.0487 0.0067  141 HOH A O   
1001 O  O   . HOH J .   ? 0.2803 0.3925 0.3714 -0.0372 0.0370  0.0476  142 HOH A O   
1002 O  O   . HOH J .   ? 0.3286 0.4420 0.2470 -0.0224 -0.0006 -0.0186 143 HOH A O   
1003 O  O   . HOH J .   ? 0.4693 0.3624 0.4679 0.0669  0.0385  -0.0766 144 HOH A O   
1004 O  O   . HOH J .   ? 0.2804 0.2592 0.2205 0.0132  0.0204  0.0371  145 HOH A O   
1005 O  O   . HOH J .   ? 0.3882 0.4952 0.2867 -0.0706 0.0061  -0.0401 146 HOH A O   
1006 O  O   . HOH J .   ? 0.2714 0.2138 0.2473 -0.0023 -0.0023 0.0039  147 HOH A O   
1007 O  O   . HOH J .   ? 0.6323 0.6696 0.6489 -0.0175 -0.0188 -0.0160 148 HOH A O   
1008 O  O   . HOH J .   ? 0.3036 0.5562 0.3021 -0.0367 0.0574  -0.0076 149 HOH A O   
1009 O  O   . HOH J .   ? 0.4146 0.4229 0.2288 -0.0029 -0.0047 -0.0215 150 HOH A O   
1010 O  O   . HOH J .   ? 0.4336 0.5221 0.4895 0.0262  0.0681  0.0006  151 HOH A O   
1011 O  O   . HOH J .   ? 0.4875 0.4832 0.3976 0.0149  0.0456  -0.0023 152 HOH A O   
1012 O  O   . HOH J .   ? 0.4618 0.4582 0.5630 0.0236  0.0816  0.0390  153 HOH A O   
1013 O  O   . HOH J .   ? 0.4327 0.3973 0.4471 0.0007  -0.0001 -0.0341 154 HOH A O   
1014 O  O   . HOH J .   ? 0.3972 0.5277 0.5140 -0.0639 -0.0154 -0.0270 155 HOH A O   
1015 O  O   . HOH J .   ? 0.4429 0.4043 0.6554 0.0374  -0.0155 -0.0207 156 HOH A O   
1016 O  O   . HOH J .   ? 0.5010 0.5189 0.4910 0.0218  0.0184  0.0393  157 HOH A O   
1017 O  O   . HOH J .   ? 0.4143 0.4298 0.3611 -0.0616 0.0652  0.0849  158 HOH A O   
1018 O  O   . HOH J .   ? 0.4711 0.5363 0.5460 0.0018  0.0197  0.0591  159 HOH A O   
1019 O  O   . HOH J .   ? 0.5205 0.4082 0.5318 0.0059  -0.0371 -0.0326 160 HOH A O   
1020 O  O   . HOH J .   ? 0.5595 0.5068 0.4337 -0.0679 -0.0331 -0.0456 161 HOH A O   
1021 O  O   . HOH J .   ? 0.4127 0.4940 0.3218 -0.0647 0.0645  0.0559  162 HOH A O   
1022 O  O   . HOH J .   ? 0.6732 0.7045 0.7134 -0.0261 0.0011  0.0353  163 HOH A O   
1023 O  O   . HOH J .   ? 0.3957 0.4109 0.3510 -0.0123 -0.0004 -0.0505 164 HOH A O   
1024 O  O   . HOH J .   ? 0.3917 0.4289 0.4889 -0.0730 0.0167  -0.0388 165 HOH A O   
1025 O  O   . HOH J .   ? 0.3087 0.2216 0.3171 0.0130  0.0048  -0.0355 166 HOH A O   
1026 O  O   . HOH J .   ? 0.4803 0.3662 0.4859 -0.0021 0.0101  -0.0457 167 HOH A O   
1027 O  O   . HOH J .   ? 0.4471 0.4460 0.5306 0.0574  -0.0017 0.0234  168 HOH A O   
1028 O  O   . HOH J .   ? 0.4115 0.5208 0.3832 -0.0314 -0.0079 -0.0024 169 HOH A O   
1029 O  O   . HOH J .   ? 0.5215 0.5110 0.4967 -0.0257 0.0294  0.0068  170 HOH A O   
1030 O  O   . HOH J .   ? 0.4621 0.3680 0.4015 0.0213  -0.0074 -0.0375 171 HOH A O   
1031 O  O   . HOH J .   ? 0.7267 0.7077 0.6993 -0.0277 0.0028  -0.0061 172 HOH A O   
1032 O  O   . HOH J .   ? 0.4506 0.4568 0.4965 -0.0531 -0.0205 -0.0580 173 HOH A O   
1033 O  O   . HOH J .   ? 0.4766 0.3849 0.3913 -0.0266 0.0065  -0.0459 174 HOH A O   
1034 O  O   . HOH J .   ? 0.4554 0.3953 0.4344 -0.0307 -0.0906 0.0510  175 HOH A O   
1035 O  O   . HOH J .   ? 0.5271 0.5081 0.5541 0.0404  0.0198  0.0445  176 HOH A O   
1036 O  O   . HOH J .   ? 0.4815 0.4639 0.5477 0.0028  -0.0280 0.0030  177 HOH A O   
1037 O  O   . HOH J .   ? 0.5996 0.5545 0.5418 -0.0049 0.0023  -0.0025 178 HOH A O   
1038 O  O   . HOH J .   ? 0.6033 0.6759 0.6430 0.0058  0.0131  -0.0038 179 HOH A O   
1039 O  O   . HOH J .   ? 0.5818 0.5816 0.5154 -0.0388 0.0362  -0.0280 180 HOH A O   
1040 O  O   . HOH J .   ? 0.5411 0.5083 0.4663 -0.0179 0.0446  0.0232  181 HOH A O   
1041 O  O   . HOH J .   ? 0.4772 0.5494 0.5897 0.0379  0.0272  -0.0018 182 HOH A O   
1042 O  O   . HOH J .   ? 0.5814 0.6374 0.5580 0.0517  0.0154  -0.0123 183 HOH A O   
1043 O  O   . HOH J .   ? 0.4950 0.5114 0.5156 -0.0641 -0.0494 0.0654  184 HOH A O   
1044 O  O   . HOH J .   ? 0.2746 0.3034 0.2946 0.0006  0.0550  0.0005  185 HOH A O   
1045 O  O   . HOH J .   ? 0.5186 0.4804 0.5168 -0.0138 0.0185  0.0036  186 HOH A O   
1046 O  O   . HOH J .   ? 0.6906 0.7093 0.6656 -0.0127 -0.0069 -0.0117 187 HOH A O   
1047 O  O   . HOH J .   ? 0.6615 0.6418 0.6921 0.0043  -0.0089 -0.0146 188 HOH A O   
1048 O  O   . HOH J .   ? 0.4858 0.5846 0.6083 -0.0444 -0.0302 -0.0197 189 HOH A O   
1049 O  O   . HOH J .   ? 0.7136 0.6819 0.7370 -0.0117 -0.0031 0.0000  190 HOH A O   
1050 O  O   . HOH J .   ? 0.8030 0.7986 0.7762 -0.0188 0.0056  0.0061  191 HOH A O   
1051 O  O   . HOH J .   ? 0.7021 0.7102 0.6693 -0.0197 0.0075  -0.0007 192 HOH A O   
1052 O  O   . HOH J .   ? 0.6361 0.5920 0.6778 -0.0415 0.0302  0.0154  193 HOH A O   
1053 O  O   . HOH J .   ? 0.4716 0.6013 0.5126 -0.0123 0.0226  0.0128  194 HOH A O   
1054 O  O   . HOH J .   ? 0.6700 0.6856 0.6562 0.0221  0.0364  -0.0275 195 HOH A O   
1055 O  O   . HOH J .   ? 0.6218 0.5899 0.6370 -0.0016 -0.0040 -0.0095 196 HOH A O   
1056 O  O   . HOH J .   ? 0.4860 0.4771 0.5247 -0.0304 0.0128  0.0201  197 HOH A O   
1057 O  O   . HOH J .   ? 0.5259 0.5558 0.5462 0.0425  -0.0210 0.0381  198 HOH A O   
1058 O  O   . HOH J .   ? 0.8584 0.8510 0.8083 -0.0001 -0.0056 -0.0027 199 HOH A O   
1059 O  O   . HOH J .   ? 0.8626 0.8640 0.8638 -0.0132 0.0075  -0.0112 200 HOH A O   
1060 O  O   . HOH J .   ? 0.5449 0.6009 0.5716 -0.0452 -0.0070 -0.0355 201 HOH A O   
1061 O  O   . HOH J .   ? 0.5570 0.5356 0.5091 -0.0075 -0.0189 -0.0406 202 HOH A O   
1062 O  O   . HOH J .   ? 0.4989 0.5197 0.4927 -0.0201 -0.0097 -0.0472 203 HOH A O   
1063 O  O   . HOH J .   ? 0.7818 0.7655 0.8163 0.0062  0.0073  -0.0150 204 HOH A O   
1064 O  O   . HOH J .   ? 0.6358 0.6464 0.6650 -0.0113 -0.0055 0.0045  205 HOH A O   
1065 O  O   . HOH J .   ? 0.7079 0.6767 0.7492 -0.0159 -0.0182 -0.0045 206 HOH A O   
1066 O  O   . HOH J .   ? 0.5975 0.5342 0.6122 -0.0149 0.0466  -0.0044 207 HOH A O   
1067 O  O   . HOH J .   ? 0.8430 0.8727 0.8318 -0.0090 -0.0013 -0.0067 208 HOH A O   
1068 O  O   . HOH J .   ? 0.7313 0.7112 0.7148 0.0199  -0.0081 -0.0069 209 HOH A O   
1069 O  O   . HOH J .   ? 0.7605 0.7751 0.7759 -0.0076 -0.0217 -0.0060 210 HOH A O   
1070 O  O   . HOH J .   ? 0.7407 0.7527 0.7659 -0.0087 -0.0030 -0.0076 211 HOH A O   
1071 O  O   . HOH J .   ? 0.5913 0.5743 0.4777 -0.0124 0.0251  0.0175  212 HOH A O   
1072 O  O   . HOH J .   ? 0.7315 0.7556 0.7705 -0.0136 -0.0057 -0.0191 213 HOH A O   
1073 O  O   . HOH J .   ? 0.5761 0.5950 0.6170 -0.0015 0.0588  0.0129  214 HOH A O   
1074 O  O   . HOH J .   ? 0.6163 0.6511 0.6073 -0.0048 -0.0074 -0.0065 215 HOH A O   
1075 O  O   . HOH J .   ? 0.7549 0.7277 0.7304 -0.0097 -0.0014 0.0095  216 HOH A O   
1076 O  O   . HOH J .   ? 0.7240 0.7083 0.7012 -0.0087 0.0282  0.0191  217 HOH A O   
1077 O  O   . HOH J .   ? 0.6507 0.6151 0.6463 0.0055  -0.0199 0.0022  218 HOH A O   
1078 O  O   . HOH J .   ? 0.6714 0.6953 0.5978 0.0074  0.0043  -0.0095 219 HOH A O   
1079 O  O   . HOH J .   ? 0.6298 0.6619 0.6080 0.0018  0.0021  -0.0129 220 HOH A O   
1080 O  O   . HOH J .   ? 0.5518 0.4275 0.6186 -0.0302 -0.0496 -0.0003 221 HOH A O   
1081 O  O   . HOH J .   ? 0.6108 0.5370 0.5422 0.0355  0.0012  0.0368  222 HOH A O   
1082 O  O   . HOH J .   ? 0.7849 0.7629 0.7947 0.0019  -0.0035 -0.0103 223 HOH A O   
1083 O  O   . HOH J .   ? 0.5138 0.5013 0.6010 -0.0278 -0.0182 -0.0252 224 HOH A O   
1084 O  O   . HOH J .   ? 0.7758 0.7905 0.7706 -0.0087 0.0161  0.0002  225 HOH A O   
1085 O  O   . HOH J .   ? 0.7847 0.7940 0.8094 -0.0179 -0.0032 0.0002  226 HOH A O   
1086 O  O   . HOH J .   ? 0.6721 0.6905 0.7339 0.0044  0.0082  -0.0088 227 HOH A O   
1087 O  O   . HOH J .   ? 0.6570 0.7252 0.6486 0.0161  0.0237  -0.0169 228 HOH A O   
1088 O  O   . HOH J .   ? 0.6898 0.6837 0.7004 0.0084  0.0231  0.0053  229 HOH A O   
1089 O  O   . HOH J .   ? 0.5520 0.5935 0.6105 0.0129  0.0271  -0.0276 230 HOH A O   
1090 O  O   . HOH J .   ? 0.7092 0.6357 0.6119 -0.0155 0.0180  -0.0016 231 HOH A O   
1091 O  O   . HOH J .   ? 0.7485 0.7600 0.7352 -0.0233 -0.0211 -0.0051 232 HOH A O   
1092 O  O   . HOH J .   ? 0.5783 0.4817 0.5870 0.0239  0.0324  -0.0094 233 HOH A O   
1093 O  O   . HOH J .   ? 0.7272 0.6905 0.7691 -0.0321 -0.0032 0.0063  234 HOH A O   
1094 O  O   . HOH J .   ? 0.6024 0.6068 0.6469 -0.0042 0.0213  0.0243  235 HOH A O   
1095 O  O   . HOH J .   ? 0.6777 0.7117 0.7239 0.0106  0.0243  -0.0026 236 HOH A O   
1096 O  O   . HOH J .   ? 0.6625 0.6685 0.6139 0.0024  0.0000  0.0115  237 HOH A O   
1097 O  O   . HOH J .   ? 0.5143 0.4214 0.5324 -0.0044 -0.0141 -0.0024 238 HOH A O   
1098 O  O   . HOH J .   ? 0.7346 0.7387 0.7163 0.0223  0.0192  -0.0012 239 HOH A O   
1099 O  O   . HOH J .   ? 0.7194 0.7575 0.7744 -0.0169 0.0165  0.0013  240 HOH A O   
1100 O  O   . HOH J .   ? 0.5747 0.5267 0.5466 0.0365  0.0324  -0.0726 241 HOH A O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1   ?   ?   ?   A . n 
A 1 2   PRO 2   2   ?   ?   ?   A . n 
A 1 3   ASP 3   3   ?   ?   ?   A . n 
A 1 4   TRP 4   4   4   TRP TRP A . n 
A 1 5   VAL 5   5   5   VAL VAL A . n 
A 1 6   PRO 6   6   6   PRO PRO A . n 
A 1 7   PRO 7   7   7   PRO PRO A . n 
A 1 8   GLU 8   8   8   GLU GLU A . n 
A 1 9   VAL 9   9   9   VAL VAL A . n 
A 1 10  PHE 10  10  10  PHE PHE A . n 
A 1 11  ASP 11  11  11  ASP ASP A . n 
A 1 12  LEU 12  12  12  LEU LEU A . n 
A 1 13  VAL 13  13  13  VAL VAL A . n 
A 1 14  ALA 14  14  14  ALA ALA A . n 
A 1 15  GLU 15  15  15  GLU GLU A . n 
A 1 16  ASP 16  16  16  ASP ASP A . n 
A 1 17  LYS 17  17  17  LYS LYS A . n 
A 1 18  ALA 18  18  18  ALA ALA A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  CYS 20  20  20  CYS CYS A . n 
A 1 21  MET 21  21  21  MET MET A . n 
A 1 22  SER 22  22  22  SER SER A . n 
A 1 23  GLU 23  23  23  GLU GLU A . n 
A 1 24  HIS 24  24  24  HIS HIS A . n 
A 1 25  GLY 25  25  25  GLY GLY A . n 
A 1 26  THR 26  26  26  THR THR A . n 
A 1 27  THR 27  27  27  THR THR A . n 
A 1 28  GLN 28  28  28  GLN GLN A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  GLN 30  30  30  GLN GLN A . n 
A 1 31  ILE 31  31  31  ILE ILE A . n 
A 1 32  ASP 32  32  32  ASP ASP A . n 
A 1 33  ASP 33  33  33  ASP ASP A . n 
A 1 34  VAL 34  34  34  VAL VAL A . n 
A 1 35  ASN 35  35  35  ASN ASN A . n 
A 1 36  LYS 36  36  36  LYS LYS A . n 
A 1 37  GLY 37  37  37  GLY GLY A . n 
A 1 38  ASN 38  38  38  ASN ASN A . n 
A 1 39  LEU 39  39  39  LEU LEU A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  ASN 41  41  41  ASN ASN A . n 
A 1 42  GLU 42  42  42  GLU GLU A . n 
A 1 43  PRO 43  43  43  PRO PRO A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  ILE 45  45  45  ILE ILE A . n 
A 1 46  THR 46  46  46  THR THR A . n 
A 1 47  CYS 47  47  47  CYS CYS A . n 
A 1 48  TYR 48  48  48  TYR TYR A . n 
A 1 49  MET 49  49  49  MET MET A . n 
A 1 50  TYR 50  50  50  TYR TYR A . n 
A 1 51  CYS 51  51  51  CYS CYS A . n 
A 1 52  LEU 52  52  52  LEU LEU A . n 
A 1 53  LEU 53  53  53  LEU LEU A . n 
A 1 54  GLU 54  54  54  GLU GLU A . n 
A 1 55  ALA 55  55  55  ALA ALA A . n 
A 1 56  PHE 56  56  56  PHE PHE A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  VAL 59  59  59  VAL VAL A . n 
A 1 60  ASP 60  60  60  ASP ASP A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  GLU 62  62  62  GLU GLU A . n 
A 1 63  ALA 63  63  63  ALA ALA A . n 
A 1 64  ASN 64  64  64  ASN ASN A . n 
A 1 65  VAL 65  65  65  VAL VAL A . n 
A 1 66  ASP 66  66  66  ASP ASP A . n 
A 1 67  GLU 67  67  67  GLU GLU A . n 
A 1 68  ASP 68  68  68  ASP ASP A . n 
A 1 69  ILE 69  69  69  ILE ILE A . n 
A 1 70  MET 70  70  70  MET MET A . n 
A 1 71  LEU 71  71  71  LEU LEU A . n 
A 1 72  GLY 72  72  72  GLY GLY A . n 
A 1 73  LEU 73  73  73  LEU LEU A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  PRO 75  75  75  PRO PRO A . n 
A 1 76  ASP 76  76  76  ASP ASP A . n 
A 1 77  GLN 77  77  77  GLN GLN A . n 
A 1 78  LEU 78  78  78  LEU LEU A . n 
A 1 79  GLN 79  79  79  GLN GLN A . n 
A 1 80  GLU 80  80  80  GLU GLU A . n 
A 1 81  ARG 81  81  81  ARG ARG A . n 
A 1 82  ALA 82  82  82  ALA ALA A . n 
A 1 83  GLN 83  83  83  GLN GLN A . n 
A 1 84  SER 84  84  84  SER SER A . n 
A 1 85  VAL 85  85  85  VAL VAL A . n 
A 1 86  MET 86  86  86  MET MET A . n 
A 1 87  GLY 87  87  87  GLY GLY A . n 
A 1 88  LYS 88  88  88  LYS LYS A . n 
A 1 89  CYS 89  89  89  CYS CYS A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  PRO 91  91  91  PRO PRO A . n 
A 1 92  THR 92  92  92  THR THR A . n 
A 1 93  SER 93  93  93  SER SER A . n 
A 1 94  GLY 94  94  94  GLY GLY A . n 
A 1 95  SER 95  95  95  SER SER A . n 
A 1 96  ASP 96  96  96  ASP ASP A . n 
A 1 97  ASN 97  97  97  ASN ASN A . n 
A 1 98  CYS 98  98  98  CYS CYS A . n 
A 1 99  ASN 99  99  99  ASN ASN A . n 
A 1 100 LYS 100 100 100 LYS LYS A . n 
A 1 101 ILE 101 101 101 ILE ILE A . n 
A 1 102 TYR 102 102 102 TYR TYR A . n 
A 1 103 ASN 103 103 103 ASN ASN A . n 
A 1 104 LEU 104 104 104 LEU LEU A . n 
A 1 105 ALA 105 105 105 ALA ALA A . n 
A 1 106 LYS 106 106 106 LYS LYS A . n 
A 1 107 CYS 107 107 107 CYS CYS A . n 
A 1 108 VAL 108 108 108 VAL VAL A . n 
A 1 109 GLN 109 109 109 GLN GLN A . n 
A 1 110 GLU 110 110 110 GLU GLU A . n 
A 1 111 SER 111 111 111 SER SER A . n 
A 1 112 ALA 112 112 112 ALA ALA A . n 
A 1 113 PRO 113 113 113 PRO PRO A . n 
A 1 114 ASP 114 114 114 ASP ASP A . n 
A 1 115 VAL 115 115 115 VAL VAL A . n 
A 1 116 TRP 116 116 116 TRP TRP A . n 
A 1 117 PHE 117 117 117 PHE PHE A . n 
A 1 118 VAL 118 118 118 VAL VAL A . n 
A 1 119 ILE 119 119 119 ILE ILE A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 NA  1   120 1   NA  NA  A . 
C 3 NBB 1   121 1   NBB NBB A . 
D 4 EDO 1   122 1   EDO EDO A . 
E 4 EDO 1   123 2   EDO EDO A . 
F 4 EDO 1   124 3   EDO EDO A . 
G 4 EDO 1   125 4   EDO EDO A . 
H 4 EDO 1   126 5   EDO EDO A . 
I 4 EDO 1   127 6   EDO EDO A . 
J 5 HOH 1   128 2   HOH HOH A . 
J 5 HOH 2   129 3   HOH HOH A . 
J 5 HOH 3   130 4   HOH HOH A . 
J 5 HOH 4   131 5   HOH HOH A . 
J 5 HOH 5   132 6   HOH HOH A . 
J 5 HOH 6   133 7   HOH HOH A . 
J 5 HOH 7   134 8   HOH HOH A . 
J 5 HOH 8   135 9   HOH HOH A . 
J 5 HOH 9   136 10  HOH HOH A . 
J 5 HOH 10  137 11  HOH HOH A . 
J 5 HOH 11  138 12  HOH HOH A . 
J 5 HOH 12  139 13  HOH HOH A . 
J 5 HOH 13  140 14  HOH HOH A . 
J 5 HOH 14  141 15  HOH HOH A . 
J 5 HOH 15  142 16  HOH HOH A . 
J 5 HOH 16  143 17  HOH HOH A . 
J 5 HOH 17  144 18  HOH HOH A . 
J 5 HOH 18  145 19  HOH HOH A . 
J 5 HOH 19  146 20  HOH HOH A . 
J 5 HOH 20  147 21  HOH HOH A . 
J 5 HOH 21  148 22  HOH HOH A . 
J 5 HOH 22  149 23  HOH HOH A . 
J 5 HOH 23  150 24  HOH HOH A . 
J 5 HOH 24  151 25  HOH HOH A . 
J 5 HOH 25  152 26  HOH HOH A . 
J 5 HOH 26  153 27  HOH HOH A . 
J 5 HOH 27  154 29  HOH HOH A . 
J 5 HOH 28  155 30  HOH HOH A . 
J 5 HOH 29  156 31  HOH HOH A . 
J 5 HOH 30  157 32  HOH HOH A . 
J 5 HOH 31  158 33  HOH HOH A . 
J 5 HOH 32  159 34  HOH HOH A . 
J 5 HOH 33  160 35  HOH HOH A . 
J 5 HOH 34  161 36  HOH HOH A . 
J 5 HOH 35  162 38  HOH HOH A . 
J 5 HOH 36  163 40  HOH HOH A . 
J 5 HOH 37  164 42  HOH HOH A . 
J 5 HOH 38  165 43  HOH HOH A . 
J 5 HOH 39  166 44  HOH HOH A . 
J 5 HOH 40  167 45  HOH HOH A . 
J 5 HOH 41  168 47  HOH HOH A . 
J 5 HOH 42  169 49  HOH HOH A . 
J 5 HOH 43  170 51  HOH HOH A . 
J 5 HOH 44  171 52  HOH HOH A . 
J 5 HOH 45  172 54  HOH HOH A . 
J 5 HOH 46  173 56  HOH HOH A . 
J 5 HOH 47  174 57  HOH HOH A . 
J 5 HOH 48  175 59  HOH HOH A . 
J 5 HOH 49  176 63  HOH HOH A . 
J 5 HOH 50  177 64  HOH HOH A . 
J 5 HOH 51  178 65  HOH HOH A . 
J 5 HOH 52  179 66  HOH HOH A . 
J 5 HOH 53  180 67  HOH HOH A . 
J 5 HOH 54  181 68  HOH HOH A . 
J 5 HOH 55  182 69  HOH HOH A . 
J 5 HOH 56  183 70  HOH HOH A . 
J 5 HOH 57  184 71  HOH HOH A . 
J 5 HOH 58  185 72  HOH HOH A . 
J 5 HOH 59  186 74  HOH HOH A . 
J 5 HOH 60  187 76  HOH HOH A . 
J 5 HOH 61  188 77  HOH HOH A . 
J 5 HOH 62  189 79  HOH HOH A . 
J 5 HOH 63  190 80  HOH HOH A . 
J 5 HOH 64  191 84  HOH HOH A . 
J 5 HOH 65  192 86  HOH HOH A . 
J 5 HOH 66  193 89  HOH HOH A . 
J 5 HOH 67  194 98  HOH HOH A . 
J 5 HOH 68  195 104 HOH HOH A . 
J 5 HOH 69  196 107 HOH HOH A . 
J 5 HOH 70  197 108 HOH HOH A . 
J 5 HOH 71  198 109 HOH HOH A . 
J 5 HOH 72  199 113 HOH HOH A . 
J 5 HOH 73  200 115 HOH HOH A . 
J 5 HOH 74  201 116 HOH HOH A . 
J 5 HOH 75  202 117 HOH HOH A . 
J 5 HOH 76  203 121 HOH HOH A . 
J 5 HOH 77  204 128 HOH HOH A . 
J 5 HOH 78  205 130 HOH HOH A . 
J 5 HOH 79  206 131 HOH HOH A . 
J 5 HOH 80  207 136 HOH HOH A . 
J 5 HOH 81  208 149 HOH HOH A . 
J 5 HOH 82  209 155 HOH HOH A . 
J 5 HOH 83  210 161 HOH HOH A . 
J 5 HOH 84  211 177 HOH HOH A . 
J 5 HOH 85  212 180 HOH HOH A . 
J 5 HOH 86  213 187 HOH HOH A . 
J 5 HOH 87  214 225 HOH HOH A . 
J 5 HOH 88  215 238 HOH HOH A . 
J 5 HOH 89  216 247 HOH HOH A . 
J 5 HOH 90  217 251 HOH HOH A . 
J 5 HOH 91  218 290 HOH HOH A . 
J 5 HOH 92  219 295 HOH HOH A . 
J 5 HOH 93  220 297 HOH HOH A . 
J 5 HOH 94  221 298 HOH HOH A . 
J 5 HOH 95  222 299 HOH HOH A . 
J 5 HOH 96  223 300 HOH HOH A . 
J 5 HOH 97  224 301 HOH HOH A . 
J 5 HOH 98  225 304 HOH HOH A . 
J 5 HOH 99  226 305 HOH HOH A . 
J 5 HOH 100 227 306 HOH HOH A . 
J 5 HOH 101 228 307 HOH HOH A . 
J 5 HOH 102 229 308 HOH HOH A . 
J 5 HOH 103 230 309 HOH HOH A . 
J 5 HOH 104 231 311 HOH HOH A . 
J 5 HOH 105 232 322 HOH HOH A . 
J 5 HOH 106 233 335 HOH HOH A . 
J 5 HOH 107 234 336 HOH HOH A . 
J 5 HOH 108 235 339 HOH HOH A . 
J 5 HOH 109 236 340 HOH HOH A . 
J 5 HOH 110 237 341 HOH HOH A . 
J 5 HOH 111 238 342 HOH HOH A . 
J 5 HOH 112 239 346 HOH HOH A . 
J 5 HOH 113 240 347 HOH HOH A . 
J 5 HOH 114 241 348 HOH HOH A . 
J 5 HOH 115 242 349 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 128 ? J HOH . 
2 1 A HOH 134 ? J HOH . 
3 1 A HOH 147 ? J HOH . 
4 1 A HOH 154 ? J HOH . 
# 
_pdbx_struct_conn_angle.id                    1 
_pdbx_struct_conn_angle.ptnr1_label_atom_id   OE1 
_pdbx_struct_conn_angle.ptnr1_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr1_label_asym_id   A 
_pdbx_struct_conn_angle.ptnr1_label_comp_id   GLU 
_pdbx_struct_conn_angle.ptnr1_label_seq_id    42 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id    A 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id    GLU 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id     42 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr1_symmetry        1_555 
_pdbx_struct_conn_angle.ptnr2_label_atom_id   NA 
_pdbx_struct_conn_angle.ptnr2_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr2_label_asym_id   B 
_pdbx_struct_conn_angle.ptnr2_label_comp_id   NA 
_pdbx_struct_conn_angle.ptnr2_label_seq_id    . 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id    A 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id    NA 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id     120 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr2_symmetry        1_555 
_pdbx_struct_conn_angle.ptnr3_label_atom_id   OG 
_pdbx_struct_conn_angle.ptnr3_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr3_label_asym_id   A 
_pdbx_struct_conn_angle.ptnr3_label_comp_id   SER 
_pdbx_struct_conn_angle.ptnr3_label_seq_id    44 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id    A 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id    SER 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id     44 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr3_symmetry        1_555 
_pdbx_struct_conn_angle.value                 122.8 
_pdbx_struct_conn_angle.value_esd             ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-05-26 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement        5.2.0019 ? 1 
ADSC   'data collection' Quantum  ? 2 
MOSFLM 'data reduction'  .        ? 3 
SCALA  'data scaling'    .        ? 4 
REFMAC phasing           5.2.0019 ? 5 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ALA 1 ? A ALA 1 
2 1 Y 1 A PRO 2 ? A PRO 2 
3 1 Y 1 A ASP 3 ? A ASP 3 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SODIUM ION'               NA  
3 N-BUTYL-BENZENESULFONAMIDE NBB 
4 1,2-ETHANEDIOL             EDO 
5 water                      HOH 
#