data_3D9L
# 
_entry.id   3D9L 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3D9L         
RCSB  RCSB047764   
WWPDB D_1000047764 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB  1sz9 'The RNA polymerase II CTD in mRNA processing: beta-turn recognition and beta-spiral model' unspecified 
PDB  1sza 'The RNA polymerase II CTD in mRNA processing: beta-turn recognition and beta-spiral model' unspecified 
PDB  2bf0 'CRYSTAL STRUCTURE OF THE RPR OF PCF11' unspecified 
PDB  3clj 'Structure of the RNA polymerase II CTD-interacting domain of Nrd1' unspecified 
BMRB 6404 'Backbone assignment of PCF11 CTD binding domain' unspecified 
PDB  3D9I 
;Snapshots of the RNA processing factor SCAF8 bound to
different phosphorylated forms of the carboxy-terminal
domain of RNA-POLYMERASE II
;
unspecified 
PDB  3D9J 
;Snapshots of the RNA processing factor SCAF8 bound to different 
phosphorylated forms of the carboxy-terminal domain of RNA-POLYMERASE II
;
unspecified 
PDB  3D9K 
;Snapshots of the RNA processing factor SCAF8 bound to different phosphorylated 
forms of the carboxy-terminal domain of RNA-POLYMERASE II (CTD phosphorylated at 
SER2 AND SER5)
;
unspecified 
PDB  3D9M 
;Snapshots of the RNA processing factor SCAF8 bound to different phosphorylated 
forms of the carboxy-terminal domain of RNA-POLYMERASE II (CTD phosphorylated at 
SER5)
;
unspecified 
PDB  3D9N 
;Snapshots of the RNA processing factor SCAF8 bound to different phosphorylated 
forms of the carboxy-terminal domain of RNA-POLYMERASE II (CTD phosphorylated at
SER2 and SER7)
;
unspecified 
PDB  3D9O 
;Snapshots of the RNA processing factor SCAF8 bound to different phosphorylated 
forms of the carboxy-terminal domain of RNA-POLYMERASE II (CTD unphosphorylated)
;
unspecified 
PDB  3D9P 
;Snapshots of the RNA processing factor SCAF8 bound to
different phosphorylated forms of the carboxy-terminal
domain of RNA-POLYMERASE II (CTD PHOSPHORYLATED AT 
SER2 AND SER5)
;
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3D9L 
_pdbx_database_status.recvd_initial_deposition_date   2008-05-27 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Becker, R.'   1 
'Loll, B.'     2 
'Meinhart, A.' 3 
# 
_citation.id                        primary 
_citation.title                     
;Snapshots of the RNA Processing Factor SCAF8 Bound to Different Phosphorylated Forms of the Carboxyl-terminal Domain of RNA Polymerase II.
;
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            283 
_citation.page_first                22659 
_citation.page_last                 22669 
_citation.year                      2008 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18550522 
_citation.pdbx_database_id_DOI      10.1074/jbc.M803540200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Becker, R.'   1 
primary 'Loll, B.'     2 
primary 'Meinhart, A.' 3 
# 
_cell.entry_id           3D9L 
_cell.length_a           56.296 
_cell.length_b           56.296 
_cell.length_c           106.739 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3D9L 
_symmetry.space_group_name_H-M             'P 43' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                78 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'RNA-binding protein 16' 16940.648 2  ? ? 'CTD INTERACTING DOMAIN OF SCAF8,UNP residues 1-136' ? 
2 polymer     syn CTD-PEPTIDE              1843.750  2  ? ? ?                                                    ? 
3 non-polymer syn 'ACETATE ION'            59.044    1  ? ? ?                                                    ? 
4 non-polymer syn GLYCEROL                 92.094    1  ? ? ?                                                    ? 
5 water       nat water                    18.015    57 ? ? ?                                                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RNA-binding motif protein 16' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;MEAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKVPGLYVIDSIVRQSRHQFGQE
KDVFAPRFSNNIISTFQNLYRCPGDDKSKIVRVLNLWQKNNVFKSEIIQPLLDMAAALEHHHHHH
;
;MEAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKVPGLYVIDSIVRQSRHQFGQE
KDVFAPRFSNNIISTFQNLYRCPGDDKSKIVRVLNLWQKNNVFKSEIIQPLLDMAAALEHHHHHH
;
A,B ? 
2 'polypeptide(L)' no yes '(BTN)Y(SEP)PTSPSY(SEP)PTSPS' XYSPTSPSYSPTSPS Y,Z ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLU n 
1 3   ALA n 
1 4   VAL n 
1 5   LYS n 
1 6   THR n 
1 7   PHE n 
1 8   ASN n 
1 9   SER n 
1 10  GLU n 
1 11  LEU n 
1 12  TYR n 
1 13  SER n 
1 14  LEU n 
1 15  ASN n 
1 16  ASP n 
1 17  TYR n 
1 18  LYS n 
1 19  PRO n 
1 20  PRO n 
1 21  ILE n 
1 22  SER n 
1 23  LYS n 
1 24  ALA n 
1 25  LYS n 
1 26  MET n 
1 27  THR n 
1 28  GLN n 
1 29  ILE n 
1 30  THR n 
1 31  LYS n 
1 32  ALA n 
1 33  ALA n 
1 34  ILE n 
1 35  LYS n 
1 36  ALA n 
1 37  ILE n 
1 38  LYS n 
1 39  PHE n 
1 40  TYR n 
1 41  LYS n 
1 42  HIS n 
1 43  VAL n 
1 44  VAL n 
1 45  GLN n 
1 46  SER n 
1 47  VAL n 
1 48  GLU n 
1 49  LYS n 
1 50  PHE n 
1 51  ILE n 
1 52  GLN n 
1 53  LYS n 
1 54  CYS n 
1 55  LYS n 
1 56  PRO n 
1 57  GLU n 
1 58  TYR n 
1 59  LYS n 
1 60  VAL n 
1 61  PRO n 
1 62  GLY n 
1 63  LEU n 
1 64  TYR n 
1 65  VAL n 
1 66  ILE n 
1 67  ASP n 
1 68  SER n 
1 69  ILE n 
1 70  VAL n 
1 71  ARG n 
1 72  GLN n 
1 73  SER n 
1 74  ARG n 
1 75  HIS n 
1 76  GLN n 
1 77  PHE n 
1 78  GLY n 
1 79  GLN n 
1 80  GLU n 
1 81  LYS n 
1 82  ASP n 
1 83  VAL n 
1 84  PHE n 
1 85  ALA n 
1 86  PRO n 
1 87  ARG n 
1 88  PHE n 
1 89  SER n 
1 90  ASN n 
1 91  ASN n 
1 92  ILE n 
1 93  ILE n 
1 94  SER n 
1 95  THR n 
1 96  PHE n 
1 97  GLN n 
1 98  ASN n 
1 99  LEU n 
1 100 TYR n 
1 101 ARG n 
1 102 CYS n 
1 103 PRO n 
1 104 GLY n 
1 105 ASP n 
1 106 ASP n 
1 107 LYS n 
1 108 SER n 
1 109 LYS n 
1 110 ILE n 
1 111 VAL n 
1 112 ARG n 
1 113 VAL n 
1 114 LEU n 
1 115 ASN n 
1 116 LEU n 
1 117 TRP n 
1 118 GLN n 
1 119 LYS n 
1 120 ASN n 
1 121 ASN n 
1 122 VAL n 
1 123 PHE n 
1 124 LYS n 
1 125 SER n 
1 126 GLU n 
1 127 ILE n 
1 128 ILE n 
1 129 GLN n 
1 130 PRO n 
1 131 LEU n 
1 132 LEU n 
1 133 ASP n 
1 134 MET n 
1 135 ALA n 
1 136 ALA n 
1 137 ALA n 
1 138 LEU n 
1 139 GLU n 
1 140 HIS n 
1 141 HIS n 
1 142 HIS n 
1 143 HIS n 
1 144 HIS n 
1 145 HIS n 
2 1   BTN n 
2 2   TYR n 
2 3   SEP n 
2 4   PRO n 
2 5   THR n 
2 6   SER n 
2 7   PRO n 
2 8   SER n 
2 9   TYR n 
2 10  SEP n 
2 11  PRO n 
2 12  THR n 
2 13  SER n 
2 14  PRO n 
2 15  SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               man 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'RBM16, KIAA1116' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)-RIL' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'PEPTIDE DERIVED FROM THE CONSERVED REPEAT SEQUENCE IN RNA POLYMERASE II CTD' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP RBM16_HUMAN Q9UPN6 1 
;MEAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKVPGLYVIDSIVRQSRHQFGQE
KDVFAPRFSNNIISTFQNLYRCPGDDKSKIVRVLNLWQKNNVFKSEIIQPLLDMAA
;
1 ? 
2 PDB 3D9L        3D9L   2 XYSPTSPSYSPTSPS 1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3D9L A 1 ? 136 ? Q9UPN6 1 ? 136 ? 1  136 
2 1 3D9L B 1 ? 136 ? Q9UPN6 1 ? 136 ? 1  136 
3 2 3D9L Y 1 ? 15  ? 3D9K   0 ? 14  ? 0  14  
4 2 3D9L Z 1 ? 15  ? 3D9K   0 ? 14  ? -7 7   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3D9L ALA A 137 ? UNP Q9UPN6 ? ? 'EXPRESSION TAG' 137 1  
1 3D9L LEU A 138 ? UNP Q9UPN6 ? ? 'EXPRESSION TAG' 138 2  
1 3D9L GLU A 139 ? UNP Q9UPN6 ? ? 'EXPRESSION TAG' 139 3  
1 3D9L HIS A 140 ? UNP Q9UPN6 ? ? 'EXPRESSION TAG' 140 4  
1 3D9L HIS A 141 ? UNP Q9UPN6 ? ? 'EXPRESSION TAG' 141 5  
1 3D9L HIS A 142 ? UNP Q9UPN6 ? ? 'EXPRESSION TAG' 142 6  
1 3D9L HIS A 143 ? UNP Q9UPN6 ? ? 'EXPRESSION TAG' 143 7  
1 3D9L HIS A 144 ? UNP Q9UPN6 ? ? 'EXPRESSION TAG' 144 8  
1 3D9L HIS A 145 ? UNP Q9UPN6 ? ? 'EXPRESSION TAG' 145 9  
2 3D9L ALA B 137 ? UNP Q9UPN6 ? ? 'EXPRESSION TAG' 137 10 
2 3D9L LEU B 138 ? UNP Q9UPN6 ? ? 'EXPRESSION TAG' 138 11 
2 3D9L GLU B 139 ? UNP Q9UPN6 ? ? 'EXPRESSION TAG' 139 12 
2 3D9L HIS B 140 ? UNP Q9UPN6 ? ? 'EXPRESSION TAG' 140 13 
2 3D9L HIS B 141 ? UNP Q9UPN6 ? ? 'EXPRESSION TAG' 141 14 
2 3D9L HIS B 142 ? UNP Q9UPN6 ? ? 'EXPRESSION TAG' 142 15 
2 3D9L HIS B 143 ? UNP Q9UPN6 ? ? 'EXPRESSION TAG' 143 16 
2 3D9L HIS B 144 ? UNP Q9UPN6 ? ? 'EXPRESSION TAG' 144 17 
2 3D9L HIS B 145 ? UNP Q9UPN6 ? ? 'EXPRESSION TAG' 145 18 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACT non-polymer         . 'ACETATE ION'   ?                               'C2 H3 O2 -1'     59.044  
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'      133.103 
BTN non-polymer         . BIOTIN          ?                               'C10 H16 N2 O3 S' 244.311 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'      75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'        92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER           ?                               'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'      115.130 
SEP 'L-peptide linking' n PHOSPHOSERINE   PHOSPHONOSERINE                 'C3 H8 N O6 P'    185.072 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          3D9L 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.28 
_exptl_crystal.density_percent_sol   46.02 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_details    
'0.1 M potassium thiocyanate, 30% (w/v) PEG2000MME, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2007-12-06 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9786 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9786 
# 
_reflns.entry_id                     3D9L 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            2.2 
_reflns.d_resolution_low             20 
_reflns.number_all                   ? 
_reflns.number_obs                   16293 
_reflns.percent_possible_obs         96.4 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.06 
_reflns.pdbx_netI_over_sigmaI        18.2 
_reflns.B_iso_Wilson_estimate        42.0 
_reflns.pdbx_redundancy              4.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.2 
_reflns_shell.d_res_low              2.3 
_reflns_shell.percent_possible_all   90.5 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.33 
_reflns_shell.meanI_over_sigI_obs    4.8 
_reflns_shell.pdbx_redundancy        4.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1890 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3D9L 
_refine.ls_number_reflns_obs                     16012 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.90 
_refine.ls_d_res_high                            2.20 
_refine.ls_percent_reflns_obs                    99.95 
_refine.ls_R_factor_obs                          0.19028 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.18811 
_refine.ls_R_factor_R_free                       0.23102 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  848 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.953 
_refine.correlation_coeff_Fo_to_Fc_free          0.923 
_refine.B_iso_mean                               39.344 
_refine.aniso_B[1][1]                            1.92 
_refine.aniso_B[2][2]                            1.92 
_refine.aniso_B[3][3]                            -3.84 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB entry 3D9J' 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.276 
_refine.pdbx_overall_ESU_R_Free                  0.206 
_refine.overall_SU_ML                            0.151 
_refine.overall_SU_B                             11.963 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2439 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         10 
_refine_hist.number_atoms_solvent             57 
_refine_hist.number_atoms_total               2506 
_refine_hist.d_res_high                       2.20 
_refine_hist.d_res_low                        19.90 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.011  0.022  ? 2530 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.227  1.976  ? 3420 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   5.121  5.000  ? 295  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   37.770 24.779 ? 113  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   14.501 15.095 ? 472  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   24.717 15.000 ? 10   'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.086  0.200  ? 378  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.004  0.020  ? 1847 'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.204  0.200  ? 1242 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.305  0.200  ? 1773 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.164  0.200  ? 120  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.219  0.200  ? 41   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.011  0.200  ? 1    'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.589  1.500  ? 1549 'X-RAY DIFFRACTION' ? 
r_mcangle_it             0.954  2.000  ? 2476 'X-RAY DIFFRACTION' ? 
r_scbond_it              1.571  3.000  ? 1102 'X-RAY DIFFRACTION' ? 
r_scangle_it             2.474  4.500  ? 943  'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.200 
_refine_ls_shell.d_res_low                        2.256 
_refine_ls_shell.number_reflns_R_work             1192 
_refine_ls_shell.R_factor_R_work                  0.205 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.304 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             67 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                1192 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3D9L 
_struct.title                     
;Snapshots of the RNA processing factor SCAF8 bound to different phosphorylated forms of the Carboxy-Terminal Domain of RNA-Polymerase II
;
_struct.pdbx_descriptor           'RNA-binding protein 16, CTD-PEPTIDE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3D9L 
_struct_keywords.pdbx_keywords   Transcription/peptide 
_struct_keywords.text            
;SCAF8, RNA POLYMERASE II CTD INTERACTING DOMAIN, ARM REPEATS, PHOSPHO-CTD, Phosphoprotein, RNA-binding, Transcription-peptide complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 5 ? 
H N N 5 ? 
I N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU A 2   ? SER A 13  ? GLU A 2   SER A 13  1 ? 12 
HELX_P HELX_P2  2  LEU A 14  ? TYR A 17  ? LEU A 14  TYR A 17  5 ? 4  
HELX_P HELX_P3  3  SER A 22  ? ALA A 36  ? SER A 22  ALA A 36  1 ? 15 
HELX_P HELX_P4  4  PHE A 39  ? CYS A 54  ? PHE A 39  CYS A 54  1 ? 16 
HELX_P HELX_P5  5  LYS A 55  ? GLU A 57  ? LYS A 55  GLU A 57  5 ? 3  
HELX_P HELX_P6  6  TYR A 58  ? GLY A 78  ? TYR A 58  GLY A 78  1 ? 21 
HELX_P HELX_P7  7  VAL A 83  ? ASN A 90  ? VAL A 83  ASN A 90  1 ? 8  
HELX_P HELX_P8  8  ASN A 91  ? TYR A 100 ? ASN A 91  TYR A 100 1 ? 10 
HELX_P HELX_P9  9  PRO A 103 ? ASP A 105 ? PRO A 103 ASP A 105 5 ? 3  
HELX_P HELX_P10 10 ASP A 106 ? ASN A 120 ? ASP A 106 ASN A 120 1 ? 15 
HELX_P HELX_P11 11 LYS A 124 ? HIS A 141 ? LYS A 124 HIS A 141 1 ? 18 
HELX_P HELX_P12 12 MET B 1   ? SER B 13  ? MET B 1   SER B 13  1 ? 13 
HELX_P HELX_P13 13 LEU B 14  ? TYR B 17  ? LEU B 14  TYR B 17  5 ? 4  
HELX_P HELX_P14 14 SER B 22  ? ALA B 36  ? SER B 22  ALA B 36  1 ? 15 
HELX_P HELX_P15 15 PHE B 39  ? CYS B 54  ? PHE B 39  CYS B 54  1 ? 16 
HELX_P HELX_P16 16 LYS B 55  ? GLU B 57  ? LYS B 55  GLU B 57  5 ? 3  
HELX_P HELX_P17 17 TYR B 58  ? GLY B 78  ? TYR B 58  GLY B 78  1 ? 21 
HELX_P HELX_P18 18 VAL B 83  ? ASN B 90  ? VAL B 83  ASN B 90  1 ? 8  
HELX_P HELX_P19 19 ASN B 91  ? TYR B 100 ? ASN B 91  TYR B 100 1 ? 10 
HELX_P HELX_P20 20 ARG B 101 ? CYS B 102 ? ARG B 101 CYS B 102 5 ? 2  
HELX_P HELX_P21 21 PRO B 103 ? ASP B 105 ? PRO B 103 ASP B 105 5 ? 3  
HELX_P HELX_P22 22 ASP B 106 ? ASN B 120 ? ASP B 106 ASN B 120 1 ? 15 
HELX_P HELX_P23 23 LYS B 124 ? GLU B 139 ? LYS B 124 GLU B 139 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? C TYR 2  C ? ? ? 1_555 C SEP 3  N   ? ? Y TYR 1 Y SEP 2  1_555 ? ? ? ? ? ? ? 1.325 ? 
covale2 covale ? ? C SEP 3  C ? ? ? 1_555 C PRO 4  N   ? ? Y SEP 2 Y PRO 3  1_555 ? ? ? ? ? ? ? 1.347 ? 
covale3 covale ? ? C TYR 9  C ? ? ? 1_555 C SEP 10 N   ? ? Y TYR 8 Y SEP 9  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale4 covale ? ? C SEP 10 C ? ? ? 1_555 C PRO 11 N   ? ? Y SEP 9 Y PRO 10 1_555 ? ? ? ? ? ? ? 1.355 ? 
covale5 covale ? ? D TYR 9  C ? ? ? 1_555 D SEP 10 N   ? ? Z TYR 1 Z SEP 2  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale6 covale ? ? D SEP 10 C ? ? ? 1_555 D PRO 11 N   ? ? Z SEP 2 Z PRO 3  1_555 ? ? ? ? ? ? ? 1.349 ? 
covale7 covale ? ? C TYR 2  N ? ? ? 1_555 C BTN 1  C11 ? ? Y TYR 1 Y BTN 0  1_555 ? ? ? ? ? ? ? 1.262 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 19 A . ? PRO 19 A PRO 20 A ? PRO 20 A 1 6.57 
2 PRO 19 B . ? PRO 19 B PRO 20 B ? PRO 20 B 1 2.36 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE ACT A 501'      
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE GOL B 503'      
AC3 Software ? ? ? ? 24 'BINDING SITE FOR CHAIN Y OF CTD-PEPTIDE' 
AC4 Software ? ? ? ? 11 'BINDING SITE FOR CHAIN Z OF CTD-PEPTIDE' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6  PRO A 20  ? PRO A 20  . ? 1_555 ? 
2  AC1 6  ILE A 21  ? ILE A 21  . ? 1_555 ? 
3  AC1 6  PRO A 61  ? PRO A 61  . ? 1_555 ? 
4  AC1 6  TYR A 64  ? TYR A 64  . ? 1_555 ? 
5  AC1 6  HOH G .   ? HOH A 502 . ? 1_555 ? 
6  AC1 6  TYR C 2   ? TYR Y 1   . ? 1_555 ? 
7  AC2 5  TYR B 40  ? TYR B 40  . ? 1_555 ? 
8  AC2 5  VAL B 83  ? VAL B 83  . ? 1_555 ? 
9  AC2 5  PRO B 86  ? PRO B 86  . ? 1_555 ? 
10 AC2 5  ARG B 87  ? ARG B 87  . ? 1_555 ? 
11 AC2 5  ASN B 90  ? ASN B 90  . ? 1_555 ? 
12 AC3 24 PRO A 20  ? PRO A 20  . ? 1_555 ? 
13 AC3 24 ILE A 21  ? ILE A 21  . ? 1_555 ? 
14 AC3 24 LYS A 23  ? LYS A 23  . ? 1_555 ? 
15 AC3 24 MET A 26  ? MET A 26  . ? 1_555 ? 
16 AC3 24 LYS A 31  ? LYS A 31  . ? 1_555 ? 
17 AC3 24 TYR A 64  ? TYR A 64  . ? 1_555 ? 
18 AC3 24 ASP A 67  ? ASP A 67  . ? 1_555 ? 
19 AC3 24 SER A 68  ? SER A 68  . ? 1_555 ? 
20 AC3 24 ARG A 71  ? ARG A 71  . ? 1_555 ? 
21 AC3 24 GLN A 72  ? GLN A 72  . ? 1_555 ? 
22 AC3 24 HIS A 75  ? HIS A 75  . ? 1_555 ? 
23 AC3 24 GLN A 76  ? GLN A 76  . ? 1_555 ? 
24 AC3 24 GLN A 97  ? GLN A 97  . ? 3_644 ? 
25 AC3 24 TYR A 100 ? TYR A 100 . ? 3_644 ? 
26 AC3 24 ARG A 101 ? ARG A 101 . ? 3_644 ? 
27 AC3 24 ARG A 112 ? ARG A 112 . ? 1_555 ? 
28 AC3 24 LEU A 138 ? LEU A 138 . ? 3_644 ? 
29 AC3 24 ACT E .   ? ACT A 501 . ? 1_555 ? 
30 AC3 24 HOH G .   ? HOH A 517 . ? 1_555 ? 
31 AC3 24 SER B 9   ? SER B 9   . ? 1_555 ? 
32 AC3 24 GLU B 10  ? GLU B 10  . ? 1_555 ? 
33 AC3 24 SER B 13  ? SER B 13  . ? 1_555 ? 
34 AC3 24 HOH I .   ? HOH Y 65  . ? 1_555 ? 
35 AC3 24 HOH I .   ? HOH Y 109 . ? 1_555 ? 
36 AC4 11 PRO B 20  ? PRO B 20  . ? 1_555 ? 
37 AC4 11 ILE B 21  ? ILE B 21  . ? 1_555 ? 
38 AC4 11 SER B 22  ? SER B 22  . ? 1_555 ? 
39 AC4 11 LYS B 23  ? LYS B 23  . ? 1_555 ? 
40 AC4 11 MET B 26  ? MET B 26  . ? 1_555 ? 
41 AC4 11 TYR B 64  ? TYR B 64  . ? 1_555 ? 
42 AC4 11 ASP B 67  ? ASP B 67  . ? 1_555 ? 
43 AC4 11 SER B 68  ? SER B 68  . ? 1_555 ? 
44 AC4 11 ARG B 71  ? ARG B 71  . ? 1_555 ? 
45 AC4 11 ARG B 112 ? ARG B 112 . ? 1_555 ? 
46 AC4 11 HOH H .   ? HOH B 527 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3D9L 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3D9L 
_atom_sites.fract_transf_matrix[1][1]   0.017763 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017763 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009369 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 2   ? 55.533 7.149   0.068   1.00 51.22 ? 2   GLU A N   1 
ATOM   2    C CA  . GLU A 1 2   ? 54.486 7.079   -1.000  1.00 51.21 ? 2   GLU A CA  1 
ATOM   3    C C   . GLU A 1 2   ? 53.312 6.184   -0.592  1.00 50.45 ? 2   GLU A C   1 
ATOM   4    O O   . GLU A 1 2   ? 52.154 6.511   -0.858  1.00 50.52 ? 2   GLU A O   1 
ATOM   5    C CB  . GLU A 1 2   ? 55.090 6.633   -2.338  1.00 51.26 ? 2   GLU A CB  1 
ATOM   6    C CG  . GLU A 1 2   ? 54.063 6.381   -3.438  1.00 53.04 ? 2   GLU A CG  1 
ATOM   7    C CD  . GLU A 1 2   ? 53.363 7.650   -3.918  1.00 55.62 ? 2   GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 2   ? 54.060 8.644   -4.238  1.00 56.50 ? 2   GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 2   ? 52.113 7.645   -3.996  1.00 56.36 ? 2   GLU A OE2 1 
ATOM   10   N N   . ALA A 1 3   ? 53.615 5.050   0.034   1.00 49.68 ? 3   ALA A N   1 
ATOM   11   C CA  . ALA A 1 3   ? 52.603 4.295   0.753   1.00 48.93 ? 3   ALA A CA  1 
ATOM   12   C C   . ALA A 1 3   ? 52.159 5.160   1.924   1.00 48.35 ? 3   ALA A C   1 
ATOM   13   O O   . ALA A 1 3   ? 50.981 5.171   2.286   1.00 48.46 ? 3   ALA A O   1 
ATOM   14   C CB  . ALA A 1 3   ? 53.164 2.984   1.252   1.00 48.94 ? 3   ALA A CB  1 
ATOM   15   N N   . VAL A 1 4   ? 53.123 5.888   2.491   1.00 47.43 ? 4   VAL A N   1 
ATOM   16   C CA  . VAL A 1 4   ? 52.911 6.747   3.650   1.00 46.99 ? 4   VAL A CA  1 
ATOM   17   C C   . VAL A 1 4   ? 52.186 8.023   3.241   1.00 46.67 ? 4   VAL A C   1 
ATOM   18   O O   . VAL A 1 4   ? 51.290 8.485   3.950   1.00 46.27 ? 4   VAL A O   1 
ATOM   19   C CB  . VAL A 1 4   ? 54.252 7.074   4.385   1.00 47.10 ? 4   VAL A CB  1 
ATOM   20   C CG1 . VAL A 1 4   ? 54.048 8.118   5.489   1.00 46.32 ? 4   VAL A CG1 1 
ATOM   21   C CG2 . VAL A 1 4   ? 54.851 5.803   4.983   1.00 47.12 ? 4   VAL A CG2 1 
ATOM   22   N N   . LYS A 1 5   ? 52.581 8.585   2.100   1.00 45.90 ? 5   LYS A N   1 
ATOM   23   C CA  . LYS A 1 5   ? 51.902 9.736   1.524   1.00 45.73 ? 5   LYS A CA  1 
ATOM   24   C C   . LYS A 1 5   ? 50.424 9.428   1.337   1.00 44.93 ? 5   LYS A C   1 
ATOM   25   O O   . LYS A 1 5   ? 49.577 10.215  1.740   1.00 45.06 ? 5   LYS A O   1 
ATOM   26   C CB  . LYS A 1 5   ? 52.545 10.135  0.187   1.00 46.19 ? 5   LYS A CB  1 
ATOM   27   C CG  . LYS A 1 5   ? 51.897 11.329  -0.520  1.00 48.09 ? 5   LYS A CG  1 
ATOM   28   C CD  . LYS A 1 5   ? 52.283 12.664  0.123   1.00 50.09 ? 5   LYS A CD  1 
ATOM   29   C CE  . LYS A 1 5   ? 51.641 13.839  -0.605  1.00 50.33 ? 5   LYS A CE  1 
ATOM   30   N NZ  . LYS A 1 5   ? 52.404 14.272  -1.822  1.00 51.49 ? 5   LYS A NZ  1 
ATOM   31   N N   . THR A 1 6   ? 50.121 8.271   0.755   1.00 43.91 ? 6   THR A N   1 
ATOM   32   C CA  . THR A 1 6   ? 48.737 7.871   0.532   1.00 43.16 ? 6   THR A CA  1 
ATOM   33   C C   . THR A 1 6   ? 47.970 7.778   1.858   1.00 42.56 ? 6   THR A C   1 
ATOM   34   O O   . THR A 1 6   ? 46.889 8.363   1.992   1.00 42.62 ? 6   THR A O   1 
ATOM   35   C CB  . THR A 1 6   ? 48.638 6.548   -0.246  1.00 43.06 ? 6   THR A CB  1 
ATOM   36   O OG1 . THR A 1 6   ? 49.386 6.652   -1.463  1.00 43.81 ? 6   THR A OG1 1 
ATOM   37   C CG2 . THR A 1 6   ? 47.190 6.238   -0.584  1.00 43.60 ? 6   THR A CG2 1 
ATOM   38   N N   . PHE A 1 7   ? 48.541 7.068   2.833   1.00 41.03 ? 7   PHE A N   1 
ATOM   39   C CA  . PHE A 1 7   ? 47.922 6.958   4.134   1.00 40.01 ? 7   PHE A CA  1 
ATOM   40   C C   . PHE A 1 7   ? 47.674 8.326   4.755   1.00 39.84 ? 7   PHE A C   1 
ATOM   41   O O   . PHE A 1 7   ? 46.580 8.594   5.260   1.00 38.74 ? 7   PHE A O   1 
ATOM   42   C CB  . PHE A 1 7   ? 48.740 6.097   5.109   1.00 39.52 ? 7   PHE A CB  1 
ATOM   43   C CG  . PHE A 1 7   ? 48.156 6.070   6.480   1.00 38.03 ? 7   PHE A CG  1 
ATOM   44   C CD1 . PHE A 1 7   ? 47.046 5.288   6.750   1.00 37.32 ? 7   PHE A CD1 1 
ATOM   45   C CD2 . PHE A 1 7   ? 48.663 6.886   7.486   1.00 36.44 ? 7   PHE A CD2 1 
ATOM   46   C CE1 . PHE A 1 7   ? 46.471 5.285   8.006   1.00 35.83 ? 7   PHE A CE1 1 
ATOM   47   C CE2 . PHE A 1 7   ? 48.095 6.895   8.734   1.00 36.13 ? 7   PHE A CE2 1 
ATOM   48   C CZ  . PHE A 1 7   ? 46.991 6.097   8.999   1.00 37.05 ? 7   PHE A CZ  1 
ATOM   49   N N   . ASN A 1 8   ? 48.711 9.166   4.743   1.00 39.64 ? 8   ASN A N   1 
ATOM   50   C CA  . ASN A 1 8   ? 48.606 10.540  5.211   1.00 39.61 ? 8   ASN A CA  1 
ATOM   51   C C   . ASN A 1 8   ? 47.476 11.286  4.553   1.00 39.38 ? 8   ASN A C   1 
ATOM   52   O O   . ASN A 1 8   ? 46.770 12.022  5.236   1.00 39.87 ? 8   ASN A O   1 
ATOM   53   C CB  . ASN A 1 8   ? 49.913 11.309  4.994   1.00 39.47 ? 8   ASN A CB  1 
ATOM   54   C CG  . ASN A 1 8   ? 50.981 10.899  5.971   1.00 40.35 ? 8   ASN A CG  1 
ATOM   55   O OD1 . ASN A 1 8   ? 50.715 10.134  6.911   1.00 41.50 ? 8   ASN A OD1 1 
ATOM   56   N ND2 . ASN A 1 8   ? 52.196 11.389  5.763   1.00 40.41 ? 8   ASN A ND2 1 
ATOM   57   N N   . SER A 1 9   ? 47.315 11.093  3.241   1.00 38.91 ? 9   SER A N   1 
ATOM   58   C CA  . SER A 1 9   ? 46.235 11.718  2.475   1.00 39.14 ? 9   SER A CA  1 
ATOM   59   C C   . SER A 1 9   ? 44.846 11.204  2.874   1.00 39.46 ? 9   SER A C   1 
ATOM   60   O O   . SER A 1 9   ? 43.905 12.000  2.983   1.00 39.87 ? 9   SER A O   1 
ATOM   61   C CB  A SER A 1 9   ? 46.458 11.515  0.972   0.50 39.30 ? 9   SER A CB  1 
ATOM   62   C CB  B SER A 1 9   ? 46.462 11.552  0.967   0.50 39.20 ? 9   SER A CB  1 
ATOM   63   O OG  A SER A 1 9   ? 45.368 12.014  0.216   0.50 39.48 ? 9   SER A OG  1 
ATOM   64   O OG  B SER A 1 9   ? 47.491 12.414  0.503   0.50 38.49 ? 9   SER A OG  1 
ATOM   65   N N   . GLU A 1 10  ? 44.711 9.898   3.105   1.00 39.31 ? 10  GLU A N   1 
ATOM   66   C CA  . GLU A 1 10  ? 43.428 9.352   3.572   1.00 40.07 ? 10  GLU A CA  1 
ATOM   67   C C   . GLU A 1 10  ? 43.125 9.830   4.988   1.00 39.51 ? 10  GLU A C   1 
ATOM   68   O O   . GLU A 1 10  ? 42.000 10.223  5.284   1.00 39.27 ? 10  GLU A O   1 
ATOM   69   C CB  . GLU A 1 10  ? 43.379 7.811   3.529   1.00 39.81 ? 10  GLU A CB  1 
ATOM   70   C CG  . GLU A 1 10  ? 43.261 7.194   2.139   1.00 43.32 ? 10  GLU A CG  1 
ATOM   71   C CD  . GLU A 1 10  ? 41.941 7.482   1.418   1.00 45.69 ? 10  GLU A CD  1 
ATOM   72   O OE1 . GLU A 1 10  ? 40.914 7.831   2.057   1.00 46.41 ? 10  GLU A OE1 1 
ATOM   73   O OE2 . GLU A 1 10  ? 41.936 7.344   0.184   1.00 47.67 ? 10  GLU A OE2 1 
ATOM   74   N N   . LEU A 1 11  ? 44.139 9.806   5.850   1.00 39.20 ? 11  LEU A N   1 
ATOM   75   C CA  . LEU A 1 11  ? 43.948 10.188  7.232   1.00 38.74 ? 11  LEU A CA  1 
ATOM   76   C C   . LEU A 1 11  ? 43.492 11.632  7.345   1.00 38.89 ? 11  LEU A C   1 
ATOM   77   O O   . LEU A 1 11  ? 42.494 11.910  8.000   1.00 38.44 ? 11  LEU A O   1 
ATOM   78   C CB  . LEU A 1 11  ? 45.210 9.947   8.061   1.00 38.76 ? 11  LEU A CB  1 
ATOM   79   C CG  . LEU A 1 11  ? 45.219 10.421  9.524   1.00 39.10 ? 11  LEU A CG  1 
ATOM   80   C CD1 . LEU A 1 11  ? 44.145 9.711   10.360  1.00 37.83 ? 11  LEU A CD1 1 
ATOM   81   C CD2 . LEU A 1 11  ? 46.605 10.162  10.092  1.00 38.43 ? 11  LEU A CD2 1 
ATOM   82   N N   . TYR A 1 12  ? 44.222 12.544  6.708   1.00 39.09 ? 12  TYR A N   1 
ATOM   83   C CA  . TYR A 1 12  ? 43.943 13.959  6.842   1.00 39.89 ? 12  TYR A CA  1 
ATOM   84   C C   . TYR A 1 12  ? 42.705 14.433  6.070   1.00 39.29 ? 12  TYR A C   1 
ATOM   85   O O   . TYR A 1 12  ? 42.199 15.519  6.342   1.00 39.38 ? 12  TYR A O   1 
ATOM   86   C CB  . TYR A 1 12  ? 45.204 14.801  6.544   1.00 41.35 ? 12  TYR A CB  1 
ATOM   87   C CG  . TYR A 1 12  ? 46.203 14.758  7.706   1.00 43.26 ? 12  TYR A CG  1 
ATOM   88   C CD1 . TYR A 1 12  ? 46.256 15.792  8.646   1.00 45.84 ? 12  TYR A CD1 1 
ATOM   89   C CD2 . TYR A 1 12  ? 47.068 13.663  7.884   1.00 45.16 ? 12  TYR A CD2 1 
ATOM   90   C CE1 . TYR A 1 12  ? 47.162 15.748  9.735   1.00 46.85 ? 12  TYR A CE1 1 
ATOM   91   C CE2 . TYR A 1 12  ? 47.970 13.608  8.960   1.00 44.88 ? 12  TYR A CE2 1 
ATOM   92   C CZ  . TYR A 1 12  ? 48.010 14.659  9.881   1.00 45.75 ? 12  TYR A CZ  1 
ATOM   93   O OH  . TYR A 1 12  ? 48.894 14.631  10.944  1.00 44.71 ? 12  TYR A OH  1 
ATOM   94   N N   . SER A 1 13  ? 42.205 13.617  5.138   1.00 38.46 ? 13  SER A N   1 
ATOM   95   C CA  . SER A 1 13  ? 40.943 13.925  4.465   1.00 37.77 ? 13  SER A CA  1 
ATOM   96   C C   . SER A 1 13  ? 39.749 13.786  5.420   1.00 36.91 ? 13  SER A C   1 
ATOM   97   O O   . SER A 1 13  ? 38.654 14.179  5.077   1.00 36.18 ? 13  SER A O   1 
ATOM   98   C CB  . SER A 1 13  ? 40.739 13.082  3.195   1.00 37.92 ? 13  SER A CB  1 
ATOM   99   O OG  . SER A 1 13  ? 40.390 11.745  3.519   1.00 39.53 ? 13  SER A OG  1 
ATOM   100  N N   . LEU A 1 14  ? 39.959 13.248  6.625   1.00 36.40 ? 14  LEU A N   1 
ATOM   101  C CA  . LEU A 1 14  ? 38.907 13.301  7.651   1.00 35.74 ? 14  LEU A CA  1 
ATOM   102  C C   . LEU A 1 14  ? 38.366 14.713  7.859   1.00 35.71 ? 14  LEU A C   1 
ATOM   103  O O   . LEU A 1 14  ? 37.177 14.895  8.130   1.00 35.17 ? 14  LEU A O   1 
ATOM   104  C CB  . LEU A 1 14  ? 39.405 12.743  8.974   1.00 36.37 ? 14  LEU A CB  1 
ATOM   105  C CG  . LEU A 1 14  ? 39.637 11.232  9.053   1.00 35.06 ? 14  LEU A CG  1 
ATOM   106  C CD1 . LEU A 1 14  ? 40.322 10.871  10.349  1.00 34.70 ? 14  LEU A CD1 1 
ATOM   107  C CD2 . LEU A 1 14  ? 38.352 10.474  8.918   1.00 37.00 ? 14  LEU A CD2 1 
ATOM   108  N N   . ASN A 1 15  ? 39.245 15.709  7.706   1.00 35.59 ? 15  ASN A N   1 
ATOM   109  C CA  . ASN A 1 15  ? 38.880 17.104  7.842   1.00 36.22 ? 15  ASN A CA  1 
ATOM   110  C C   . ASN A 1 15  ? 37.849 17.568  6.817   1.00 35.99 ? 15  ASN A C   1 
ATOM   111  O O   . ASN A 1 15  ? 37.321 18.667  6.944   1.00 35.94 ? 15  ASN A O   1 
ATOM   112  C CB  . ASN A 1 15  ? 40.137 17.996  7.803   1.00 36.75 ? 15  ASN A CB  1 
ATOM   113  C CG  . ASN A 1 15  ? 40.981 17.861  9.063   1.00 37.87 ? 15  ASN A CG  1 
ATOM   114  O OD1 . ASN A 1 15  ? 40.602 18.353  10.116  1.00 40.88 ? 15  ASN A OD1 1 
ATOM   115  N ND2 . ASN A 1 15  ? 42.122 17.179  8.961   1.00 38.69 ? 15  ASN A ND2 1 
ATOM   116  N N   . ASP A 1 16  ? 37.557 16.735  5.814   1.00 35.78 ? 16  ASP A N   1 
ATOM   117  C CA  . ASP A 1 16  ? 36.504 17.050  4.831   1.00 36.09 ? 16  ASP A CA  1 
ATOM   118  C C   . ASP A 1 16  ? 35.104 16.661  5.326   1.00 35.23 ? 16  ASP A C   1 
ATOM   119  O O   . ASP A 1 16  ? 34.119 17.020  4.713   1.00 34.06 ? 16  ASP A O   1 
ATOM   120  C CB  . ASP A 1 16  ? 36.744 16.306  3.503   1.00 36.89 ? 16  ASP A CB  1 
ATOM   121  C CG  . ASP A 1 16  ? 37.967 16.796  2.748   1.00 38.50 ? 16  ASP A CG  1 
ATOM   122  O OD1 . ASP A 1 16  ? 38.272 18.010  2.786   1.00 38.22 ? 16  ASP A OD1 1 
ATOM   123  O OD2 . ASP A 1 16  ? 38.612 15.942  2.093   1.00 40.89 ? 16  ASP A OD2 1 
ATOM   124  N N   . TYR A 1 17  ? 35.035 15.896  6.416   1.00 34.87 ? 17  TYR A N   1 
ATOM   125  C CA  . TYR A 1 17  ? 33.792 15.229  6.810   1.00 34.64 ? 17  TYR A CA  1 
ATOM   126  C C   . TYR A 1 17  ? 33.311 15.611  8.201   1.00 34.34 ? 17  TYR A C   1 
ATOM   127  O O   . TYR A 1 17  ? 34.106 15.777  9.103   1.00 33.05 ? 17  TYR A O   1 
ATOM   128  C CB  . TYR A 1 17  ? 33.974 13.707  6.710   1.00 35.36 ? 17  TYR A CB  1 
ATOM   129  C CG  . TYR A 1 17  ? 34.383 13.278  5.319   1.00 35.45 ? 17  TYR A CG  1 
ATOM   130  C CD1 . TYR A 1 17  ? 35.701 12.915  5.038   1.00 35.12 ? 17  TYR A CD1 1 
ATOM   131  C CD2 . TYR A 1 17  ? 33.457 13.269  4.281   1.00 35.93 ? 17  TYR A CD2 1 
ATOM   132  C CE1 . TYR A 1 17  ? 36.083 12.529  3.755   1.00 35.50 ? 17  TYR A CE1 1 
ATOM   133  C CE2 . TYR A 1 17  ? 33.823 12.905  2.992   1.00 36.89 ? 17  TYR A CE2 1 
ATOM   134  C CZ  . TYR A 1 17  ? 35.137 12.521  2.739   1.00 37.13 ? 17  TYR A CZ  1 
ATOM   135  O OH  . TYR A 1 17  ? 35.497 12.166  1.453   1.00 37.60 ? 17  TYR A OH  1 
ATOM   136  N N   . LYS A 1 18  ? 31.999 15.777  8.354   1.00 34.40 ? 18  LYS A N   1 
ATOM   137  C CA  . LYS A 1 18  ? 31.411 15.929  9.681   1.00 34.37 ? 18  LYS A CA  1 
ATOM   138  C C   . LYS A 1 18  ? 31.258 14.531  10.290  1.00 34.03 ? 18  LYS A C   1 
ATOM   139  O O   . LYS A 1 18  ? 30.597 13.674  9.692   1.00 33.60 ? 18  LYS A O   1 
ATOM   140  C CB  . LYS A 1 18  ? 30.052 16.634  9.612   1.00 34.54 ? 18  LYS A CB  1 
ATOM   141  C CG  . LYS A 1 18  ? 29.606 17.295  10.917  1.00 36.39 ? 18  LYS A CG  1 
ATOM   142  C CD  . LYS A 1 18  ? 30.653 18.302  11.386  1.00 38.97 ? 18  LYS A CD  1 
ATOM   143  C CE  . LYS A 1 18  ? 30.102 19.241  12.434  1.00 41.95 ? 18  LYS A CE  1 
ATOM   144  N NZ  . LYS A 1 18  ? 30.781 20.574  12.409  1.00 42.43 ? 18  LYS A NZ  1 
ATOM   145  N N   . PRO A 1 19  ? 31.891 14.281  11.457  1.00 33.78 ? 19  PRO A N   1 
ATOM   146  C CA  . PRO A 1 19  ? 31.616 13.019  12.147  1.00 34.09 ? 19  PRO A CA  1 
ATOM   147  C C   . PRO A 1 19  ? 30.137 12.893  12.538  1.00 34.27 ? 19  PRO A C   1 
ATOM   148  O O   . PRO A 1 19  ? 29.483 13.906  12.788  1.00 34.97 ? 19  PRO A O   1 
ATOM   149  C CB  . PRO A 1 19  ? 32.532 13.084  13.385  1.00 33.71 ? 19  PRO A CB  1 
ATOM   150  C CG  . PRO A 1 19  ? 33.637 13.994  12.983  1.00 33.68 ? 19  PRO A CG  1 
ATOM   151  C CD  . PRO A 1 19  ? 32.919 15.062  12.172  1.00 33.75 ? 19  PRO A CD  1 
ATOM   152  N N   . PRO A 1 20  ? 29.603 11.661  12.595  1.00 34.64 ? 20  PRO A N   1 
ATOM   153  C CA  . PRO A 1 20  ? 30.304 10.373  12.453  1.00 34.94 ? 20  PRO A CA  1 
ATOM   154  C C   . PRO A 1 20  ? 30.883 10.129  11.057  1.00 35.08 ? 20  PRO A C   1 
ATOM   155  O O   . PRO A 1 20  ? 30.279 10.495  10.042  1.00 34.95 ? 20  PRO A O   1 
ATOM   156  C CB  . PRO A 1 20  ? 29.221 9.321   12.768  1.00 34.68 ? 20  PRO A CB  1 
ATOM   157  C CG  . PRO A 1 20  ? 28.050 10.055  13.262  1.00 35.06 ? 20  PRO A CG  1 
ATOM   158  C CD  . PRO A 1 20  ? 28.160 11.487  12.822  1.00 34.63 ? 20  PRO A CD  1 
ATOM   159  N N   . ILE A 1 21  ? 32.055 9.518   11.038  1.00 35.64 ? 21  ILE A N   1 
ATOM   160  C CA  . ILE A 1 21  ? 32.743 9.115   9.817   1.00 36.17 ? 21  ILE A CA  1 
ATOM   161  C C   . ILE A 1 21  ? 32.206 7.766   9.337   1.00 36.84 ? 21  ILE A C   1 
ATOM   162  O O   . ILE A 1 21  ? 31.994 6.860   10.149  1.00 36.25 ? 21  ILE A O   1 
ATOM   163  C CB  . ILE A 1 21  ? 34.292 8.972   10.050  1.00 35.77 ? 21  ILE A CB  1 
ATOM   164  C CG1 . ILE A 1 21  ? 34.898 10.243  10.675  1.00 35.99 ? 21  ILE A CG1 1 
ATOM   165  C CG2 . ILE A 1 21  ? 35.009 8.558   8.736   1.00 34.78 ? 21  ILE A CG2 1 
ATOM   166  C CD1 . ILE A 1 21  ? 34.752 11.530  9.854   1.00 35.63 ? 21  ILE A CD1 1 
ATOM   167  N N   . SER A 1 22  ? 32.041 7.635   8.020   1.00 37.38 ? 22  SER A N   1 
ATOM   168  C CA  . SER A 1 22  ? 31.501 6.424   7.403   1.00 38.81 ? 22  SER A CA  1 
ATOM   169  C C   . SER A 1 22  ? 32.439 5.233   7.590   1.00 39.02 ? 22  SER A C   1 
ATOM   170  O O   . SER A 1 22  ? 33.656 5.394   7.723   1.00 39.16 ? 22  SER A O   1 
ATOM   171  C CB  . SER A 1 22  ? 31.308 6.645   5.915   1.00 38.77 ? 22  SER A CB  1 
ATOM   172  O OG  . SER A 1 22  ? 32.576 6.600   5.277   1.00 41.89 ? 22  SER A OG  1 
ATOM   173  N N   . LYS A 1 23  ? 31.853 4.044   7.593   1.00 39.10 ? 23  LYS A N   1 
ATOM   174  C CA  . LYS A 1 23  ? 32.596 2.787   7.621   1.00 39.65 ? 23  LYS A CA  1 
ATOM   175  C C   . LYS A 1 23  ? 33.567 2.726   6.447   1.00 38.74 ? 23  LYS A C   1 
ATOM   176  O O   . LYS A 1 23  ? 34.714 2.366   6.624   1.00 38.56 ? 23  LYS A O   1 
ATOM   177  C CB  . LYS A 1 23  ? 31.618 1.591   7.588   1.00 40.27 ? 23  LYS A CB  1 
ATOM   178  C CG  . LYS A 1 23  ? 32.281 0.214   7.621   1.00 42.93 ? 23  LYS A CG  1 
ATOM   179  C CD  . LYS A 1 23  ? 32.997 -0.079  8.965   1.00 44.83 ? 23  LYS A CD  1 
ATOM   180  C CE  . LYS A 1 23  ? 33.594 -1.497  9.010   1.00 45.29 ? 23  LYS A CE  1 
ATOM   181  N NZ  . LYS A 1 23  ? 32.683 -2.576  8.470   1.00 48.69 ? 23  LYS A NZ  1 
ATOM   182  N N   . ALA A 1 24  ? 33.098 3.119   5.264   1.00 38.24 ? 24  ALA A N   1 
ATOM   183  C CA  . ALA A 1 24  ? 33.899 3.143   4.049   1.00 38.47 ? 24  ALA A CA  1 
ATOM   184  C C   . ALA A 1 24  ? 35.182 3.956   4.182   1.00 38.96 ? 24  ALA A C   1 
ATOM   185  O O   . ALA A 1 24  ? 36.266 3.469   3.841   1.00 39.82 ? 24  ALA A O   1 
ATOM   186  C CB  . ALA A 1 24  ? 33.051 3.638   2.851   1.00 38.80 ? 24  ALA A CB  1 
ATOM   187  N N   . LYS A 1 25  ? 35.077 5.172   4.712   1.00 39.49 ? 25  LYS A N   1 
ATOM   188  C CA  . LYS A 1 25  ? 36.249 6.023   4.901   1.00 39.90 ? 25  LYS A CA  1 
ATOM   189  C C   . LYS A 1 25  ? 37.246 5.425   5.879   1.00 40.00 ? 25  LYS A C   1 
ATOM   190  O O   . LYS A 1 25  ? 38.451 5.434   5.616   1.00 40.70 ? 25  LYS A O   1 
ATOM   191  C CB  . LYS A 1 25  ? 35.853 7.461   5.295   1.00 40.06 ? 25  LYS A CB  1 
ATOM   192  C CG  . LYS A 1 25  ? 37.008 8.340   5.821   1.00 40.11 ? 25  LYS A CG  1 
ATOM   193  C CD  . LYS A 1 25  ? 38.144 8.573   4.820   1.00 41.60 ? 25  LYS A CD  1 
ATOM   194  C CE  . LYS A 1 25  ? 37.656 9.158   3.515   1.00 43.70 ? 25  LYS A CE  1 
ATOM   195  N NZ  . LYS A 1 25  ? 38.763 9.823   2.773   1.00 45.73 ? 25  LYS A NZ  1 
ATOM   196  N N   . MET A 1 26  ? 36.756 4.896   6.998   1.00 40.00 ? 26  MET A N   1 
ATOM   197  C CA  . MET A 1 26  ? 37.624 4.216   7.966   1.00 39.85 ? 26  MET A CA  1 
ATOM   198  C C   . MET A 1 26  ? 38.325 2.990   7.368   1.00 39.13 ? 26  MET A C   1 
ATOM   199  O O   . MET A 1 26  ? 39.497 2.753   7.614   1.00 38.50 ? 26  MET A O   1 
ATOM   200  C CB  . MET A 1 26  ? 36.847 3.808   9.226   1.00 40.51 ? 26  MET A CB  1 
ATOM   201  C CG  . MET A 1 26  ? 36.405 4.968   10.115  1.00 44.18 ? 26  MET A CG  1 
ATOM   202  S SD  . MET A 1 26  ? 37.750 5.861   10.917  1.00 50.85 ? 26  MET A SD  1 
ATOM   203  C CE  . MET A 1 26  ? 38.804 4.502   11.296  1.00 51.93 ? 26  MET A CE  1 
ATOM   204  N N   . THR A 1 27  ? 37.591 2.219   6.588   1.00 38.92 ? 27  THR A N   1 
ATOM   205  C CA  . THR A 1 27  ? 38.132 1.064   5.852   1.00 38.86 ? 27  THR A CA  1 
ATOM   206  C C   . THR A 1 27  ? 39.213 1.501   4.863   1.00 38.56 ? 27  THR A C   1 
ATOM   207  O O   . THR A 1 27  ? 40.241 0.836   4.752   1.00 38.78 ? 27  THR A O   1 
ATOM   208  C CB  . THR A 1 27  ? 36.990 0.327   5.119   1.00 39.31 ? 27  THR A CB  1 
ATOM   209  O OG1 . THR A 1 27  ? 36.011 -0.065  6.089   1.00 39.62 ? 27  THR A OG1 1 
ATOM   210  C CG2 . THR A 1 27  ? 37.486 -0.923  4.340   1.00 39.38 ? 27  THR A CG2 1 
ATOM   211  N N   . GLN A 1 28  ? 38.989 2.624   4.169   1.00 38.33 ? 28  GLN A N   1 
ATOM   212  C CA  . GLN A 1 28  ? 39.990 3.194   3.246   1.00 38.29 ? 28  GLN A CA  1 
ATOM   213  C C   . GLN A 1 28  ? 41.286 3.583   3.949   1.00 37.70 ? 28  GLN A C   1 
ATOM   214  O O   . GLN A 1 28  ? 42.375 3.229   3.492   1.00 37.65 ? 28  GLN A O   1 
ATOM   215  C CB  . GLN A 1 28  ? 39.425 4.390   2.464   1.00 38.29 ? 28  GLN A CB  1 
ATOM   216  C CG  . GLN A 1 28  ? 38.473 3.960   1.366   1.00 40.99 ? 28  GLN A CG  1 
ATOM   217  C CD  . GLN A 1 28  ? 39.126 2.995   0.392   1.00 44.01 ? 28  GLN A CD  1 
ATOM   218  O OE1 . GLN A 1 28  ? 39.882 3.416   -0.484  1.00 45.38 ? 28  GLN A OE1 1 
ATOM   219  N NE2 . GLN A 1 28  ? 38.840 1.691   0.541   1.00 42.87 ? 28  GLN A NE2 1 
ATOM   220  N N   . ILE A 1 29  ? 41.152 4.291   5.069   1.00 37.09 ? 29  ILE A N   1 
ATOM   221  C CA  . ILE A 1 29  ? 42.280 4.657   5.913   1.00 36.89 ? 29  ILE A CA  1 
ATOM   222  C C   . ILE A 1 29  ? 43.056 3.430   6.419   1.00 36.98 ? 29  ILE A C   1 
ATOM   223  O O   . ILE A 1 29  ? 44.287 3.445   6.452   1.00 36.75 ? 29  ILE A O   1 
ATOM   224  C CB  . ILE A 1 29  ? 41.802 5.508   7.120   1.00 37.11 ? 29  ILE A CB  1 
ATOM   225  C CG1 . ILE A 1 29  ? 41.269 6.874   6.633   1.00 37.47 ? 29  ILE A CG1 1 
ATOM   226  C CG2 . ILE A 1 29  ? 42.916 5.637   8.194   1.00 37.31 ? 29  ILE A CG2 1 
ATOM   227  C CD1 . ILE A 1 29  ? 40.531 7.665   7.710   1.00 37.79 ? 29  ILE A CD1 1 
ATOM   228  N N   . THR A 1 30  ? 42.311 2.404   6.838   1.00 37.00 ? 30  THR A N   1 
ATOM   229  C CA  . THR A 1 30  ? 42.827 1.148   7.369   1.00 36.78 ? 30  THR A CA  1 
ATOM   230  C C   . THR A 1 30  ? 43.607 0.371   6.324   1.00 37.07 ? 30  THR A C   1 
ATOM   231  O O   . THR A 1 30  ? 44.724 -0.069  6.595   1.00 37.03 ? 30  THR A O   1 
ATOM   232  C CB  . THR A 1 30  ? 41.659 0.272   7.894   1.00 37.76 ? 30  THR A CB  1 
ATOM   233  O OG1 . THR A 1 30  ? 40.966 0.993   8.924   1.00 36.58 ? 30  THR A OG1 1 
ATOM   234  C CG2 . THR A 1 30  ? 42.155 -1.082  8.451   1.00 34.88 ? 30  THR A CG2 1 
ATOM   235  N N   . LYS A 1 31  ? 43.002 0.204   5.140   1.00 37.59 ? 31  LYS A N   1 
ATOM   236  C CA  . LYS A 1 31  ? 43.639 -0.432  3.992   1.00 37.82 ? 31  LYS A CA  1 
ATOM   237  C C   . LYS A 1 31  ? 44.921 0.307   3.603   1.00 37.53 ? 31  LYS A C   1 
ATOM   238  O O   . LYS A 1 31  ? 45.928 -0.323  3.341   1.00 37.59 ? 31  LYS A O   1 
ATOM   239  C CB  . LYS A 1 31  ? 42.669 -0.538  2.803   1.00 37.77 ? 31  LYS A CB  1 
ATOM   240  C CG  . LYS A 1 31  ? 41.708 -1.723  2.935   1.00 38.67 ? 31  LYS A CG  1 
ATOM   241  C CD  . LYS A 1 31  ? 40.781 -1.911  1.733   1.00 38.98 ? 31  LYS A CD  1 
ATOM   242  C CE  . LYS A 1 31  ? 39.808 -3.078  2.023   1.00 40.49 ? 31  LYS A CE  1 
ATOM   243  N NZ  . LYS A 1 31  ? 38.869 -3.399  0.904   1.00 40.18 ? 31  LYS A NZ  1 
ATOM   244  N N   . ALA A 1 32  ? 44.899 1.639   3.602   1.00 36.66 ? 32  ALA A N   1 
ATOM   245  C CA  . ALA A 1 32  ? 46.126 2.387   3.370   1.00 35.95 ? 32  ALA A CA  1 
ATOM   246  C C   . ALA A 1 32  ? 47.185 2.119   4.456   1.00 35.74 ? 32  ALA A C   1 
ATOM   247  O O   . ALA A 1 32  ? 48.375 2.049   4.159   1.00 35.46 ? 32  ALA A O   1 
ATOM   248  C CB  . ALA A 1 32  ? 45.854 3.851   3.217   1.00 35.48 ? 32  ALA A CB  1 
ATOM   249  N N   . ALA A 1 33  ? 46.763 1.957   5.703   1.00 35.73 ? 33  ALA A N   1 
ATOM   250  C CA  . ALA A 1 33  ? 47.704 1.645   6.768   1.00 35.58 ? 33  ALA A CA  1 
ATOM   251  C C   . ALA A 1 33  ? 48.251 0.227   6.613   1.00 36.27 ? 33  ALA A C   1 
ATOM   252  O O   . ALA A 1 33  ? 49.463 0.022   6.704   1.00 35.83 ? 33  ALA A O   1 
ATOM   253  C CB  . ALA A 1 33  ? 47.044 1.787   8.103   1.00 35.85 ? 33  ALA A CB  1 
ATOM   254  N N   . ILE A 1 34  ? 47.346 -0.734  6.389   1.00 37.26 ? 34  ILE A N   1 
ATOM   255  C CA  . ILE A 1 34  ? 47.676 -2.172  6.342   1.00 38.73 ? 34  ILE A CA  1 
ATOM   256  C C   . ILE A 1 34  ? 48.495 -2.494  5.130   1.00 38.83 ? 34  ILE A C   1 
ATOM   257  O O   . ILE A 1 34  ? 49.265 -3.437  5.145   1.00 39.27 ? 34  ILE A O   1 
ATOM   258  C CB  . ILE A 1 34  ? 46.423 -3.106  6.345   1.00 38.85 ? 34  ILE A CB  1 
ATOM   259  C CG1 . ILE A 1 34  ? 45.629 -2.994  7.650   1.00 39.54 ? 34  ILE A CG1 1 
ATOM   260  C CG2 . ILE A 1 34  ? 46.823 -4.580  6.146   1.00 40.38 ? 34  ILE A CG2 1 
ATOM   261  C CD1 . ILE A 1 34  ? 46.365 -3.433  8.888   1.00 43.36 ? 34  ILE A CD1 1 
ATOM   262  N N   . LYS A 1 35  ? 48.306 -1.708  4.075   1.00 40.05 ? 35  LYS A N   1 
ATOM   263  C CA  . LYS A 1 35  ? 49.092 -1.827  2.864   1.00 40.58 ? 35  LYS A CA  1 
ATOM   264  C C   . LYS A 1 35  ? 50.448 -1.123  3.035   1.00 40.70 ? 35  LYS A C   1 
ATOM   265  O O   . LYS A 1 35  ? 51.426 -1.461  2.338   1.00 40.44 ? 35  LYS A O   1 
ATOM   266  C CB  . LYS A 1 35  ? 48.318 -1.270  1.657   1.00 40.97 ? 35  LYS A CB  1 
ATOM   267  C CG  . LYS A 1 35  ? 47.095 -2.120  1.203   1.00 41.38 ? 35  LYS A CG  1 
ATOM   268  C CD  . LYS A 1 35  ? 46.269 -1.408  0.078   1.00 41.44 ? 35  LYS A CD  1 
ATOM   269  C CE  . LYS A 1 35  ? 47.055 -1.326  -1.229  1.00 41.98 ? 35  LYS A CE  1 
ATOM   270  N NZ  . LYS A 1 35  ? 46.301 -0.710  -2.359  1.00 43.62 ? 35  LYS A NZ  1 
ATOM   271  N N   . ALA A 1 36  ? 50.497 -0.151  3.953   1.00 40.30 ? 36  ALA A N   1 
ATOM   272  C CA  . ALA A 1 36  ? 51.751 0.517   4.349   1.00 40.09 ? 36  ALA A CA  1 
ATOM   273  C C   . ALA A 1 36  ? 52.435 -0.153  5.566   1.00 40.18 ? 36  ALA A C   1 
ATOM   274  O O   . ALA A 1 36  ? 53.189 0.500   6.301   1.00 40.00 ? 36  ALA A O   1 
ATOM   275  C CB  . ALA A 1 36  ? 51.492 1.989   4.627   1.00 39.56 ? 36  ALA A CB  1 
ATOM   276  N N   . ILE A 1 37  ? 52.192 -1.451  5.765   1.00 40.39 ? 37  ILE A N   1 
ATOM   277  C CA  . ILE A 1 37  ? 52.643 -2.156  6.986   1.00 40.79 ? 37  ILE A CA  1 
ATOM   278  C C   . ILE A 1 37  ? 54.173 -2.222  7.143   1.00 41.40 ? 37  ILE A C   1 
ATOM   279  O O   . ILE A 1 37  ? 54.698 -2.373  8.253   1.00 41.72 ? 37  ILE A O   1 
ATOM   280  C CB  . ILE A 1 37  ? 52.054 -3.595  7.084   1.00 40.99 ? 37  ILE A CB  1 
ATOM   281  C CG1 . ILE A 1 37  ? 52.275 -4.167  8.491   1.00 40.88 ? 37  ILE A CG1 1 
ATOM   282  C CG2 . ILE A 1 37  ? 52.660 -4.521  6.004   1.00 39.64 ? 37  ILE A CG2 1 
ATOM   283  C CD1 . ILE A 1 37  ? 51.407 -5.342  8.826   1.00 40.56 ? 37  ILE A CD1 1 
ATOM   284  N N   . LYS A 1 38  ? 54.874 -2.130  6.020   1.00 41.14 ? 38  LYS A N   1 
ATOM   285  C CA  . LYS A 1 38  ? 56.321 -2.040  5.998   1.00 41.24 ? 38  LYS A CA  1 
ATOM   286  C C   . LYS A 1 38  ? 56.791 -0.786  6.744   1.00 40.91 ? 38  LYS A C   1 
ATOM   287  O O   . LYS A 1 38  ? 57.862 -0.781  7.360   1.00 41.19 ? 38  LYS A O   1 
ATOM   288  C CB  . LYS A 1 38  ? 56.786 -1.999  4.543   1.00 41.10 ? 38  LYS A CB  1 
ATOM   289  C CG  . LYS A 1 38  ? 58.259 -1.919  4.349   1.00 42.53 ? 38  LYS A CG  1 
ATOM   290  C CD  . LYS A 1 38  ? 58.588 -1.607  2.898   1.00 44.51 ? 38  LYS A CD  1 
ATOM   291  C CE  . LYS A 1 38  ? 60.094 -1.551  2.668   1.00 46.38 ? 38  LYS A CE  1 
ATOM   292  N NZ  . LYS A 1 38  ? 60.816 -0.815  3.753   1.00 47.15 ? 38  LYS A NZ  1 
ATOM   293  N N   . PHE A 1 39  ? 55.989 0.272   6.665   1.00 40.21 ? 39  PHE A N   1 
ATOM   294  C CA  . PHE A 1 39  ? 56.322 1.558   7.269   1.00 39.77 ? 39  PHE A CA  1 
ATOM   295  C C   . PHE A 1 39  ? 55.408 1.861   8.463   1.00 39.00 ? 39  PHE A C   1 
ATOM   296  O O   . PHE A 1 39  ? 55.037 3.016   8.706   1.00 39.00 ? 39  PHE A O   1 
ATOM   297  C CB  . PHE A 1 39  ? 56.205 2.672   6.225   1.00 40.04 ? 39  PHE A CB  1 
ATOM   298  C CG  . PHE A 1 39  ? 57.105 2.491   5.024   1.00 40.41 ? 39  PHE A CG  1 
ATOM   299  C CD1 . PHE A 1 39  ? 58.413 2.962   5.039   1.00 40.68 ? 39  PHE A CD1 1 
ATOM   300  C CD2 . PHE A 1 39  ? 56.632 1.867   3.874   1.00 41.25 ? 39  PHE A CD2 1 
ATOM   301  C CE1 . PHE A 1 39  ? 59.242 2.799   3.938   1.00 41.09 ? 39  PHE A CE1 1 
ATOM   302  C CE2 . PHE A 1 39  ? 57.449 1.702   2.763   1.00 40.88 ? 39  PHE A CE2 1 
ATOM   303  C CZ  . PHE A 1 39  ? 58.757 2.171   2.796   1.00 41.24 ? 39  PHE A CZ  1 
ATOM   304  N N   . TYR A 1 40  ? 55.064 0.815   9.209   1.00 38.12 ? 40  TYR A N   1 
ATOM   305  C CA  . TYR A 1 40  ? 54.131 0.906   10.333  1.00 37.47 ? 40  TYR A CA  1 
ATOM   306  C C   . TYR A 1 40  ? 54.486 1.969   11.378  1.00 36.56 ? 40  TYR A C   1 
ATOM   307  O O   . TYR A 1 40  ? 53.592 2.561   11.982  1.00 36.99 ? 40  TYR A O   1 
ATOM   308  C CB  . TYR A 1 40  ? 53.922 -0.468  10.977  1.00 37.51 ? 40  TYR A CB  1 
ATOM   309  C CG  . TYR A 1 40  ? 55.085 -0.978  11.809  1.00 37.98 ? 40  TYR A CG  1 
ATOM   310  C CD1 . TYR A 1 40  ? 56.194 -1.572  11.215  1.00 36.78 ? 40  TYR A CD1 1 
ATOM   311  C CD2 . TYR A 1 40  ? 55.046 -0.899  13.205  1.00 38.80 ? 40  TYR A CD2 1 
ATOM   312  C CE1 . TYR A 1 40  ? 57.250 -2.052  11.998  1.00 37.94 ? 40  TYR A CE1 1 
ATOM   313  C CE2 . TYR A 1 40  ? 56.084 -1.375  13.991  1.00 37.20 ? 40  TYR A CE2 1 
ATOM   314  C CZ  . TYR A 1 40  ? 57.176 -1.946  13.388  1.00 38.15 ? 40  TYR A CZ  1 
ATOM   315  O OH  . TYR A 1 40  ? 58.194 -2.406  14.180  1.00 38.72 ? 40  TYR A OH  1 
ATOM   316  N N   . LYS A 1 41  ? 55.776 2.245   11.543  1.00 35.61 ? 41  LYS A N   1 
ATOM   317  C CA  . LYS A 1 41  ? 56.249 3.247   12.501  1.00 34.68 ? 41  LYS A CA  1 
ATOM   318  C C   . LYS A 1 41  ? 55.848 4.652   12.085  1.00 35.20 ? 41  LYS A C   1 
ATOM   319  O O   . LYS A 1 41  ? 55.534 5.485   12.936  1.00 34.99 ? 41  LYS A O   1 
ATOM   320  C CB  . LYS A 1 41  ? 57.776 3.170   12.692  1.00 33.84 ? 41  LYS A CB  1 
ATOM   321  C CG  . LYS A 1 41  ? 58.255 1.943   13.422  1.00 31.85 ? 41  LYS A CG  1 
ATOM   322  C CD  . LYS A 1 41  ? 59.783 1.906   13.526  1.00 33.72 ? 41  LYS A CD  1 
ATOM   323  C CE  . LYS A 1 41  ? 60.251 0.624   14.204  1.00 32.36 ? 41  LYS A CE  1 
ATOM   324  N NZ  . LYS A 1 41  ? 61.754 0.477   14.184  1.00 32.33 ? 41  LYS A NZ  1 
ATOM   325  N N   . HIS A 1 42  ? 55.865 4.904   10.777  1.00 35.62 ? 42  HIS A N   1 
ATOM   326  C CA  . HIS A 1 42  ? 55.417 6.178   10.222  1.00 36.31 ? 42  HIS A CA  1 
ATOM   327  C C   . HIS A 1 42  ? 53.913 6.307   10.270  1.00 35.99 ? 42  HIS A C   1 
ATOM   328  O O   . HIS A 1 42  ? 53.390 7.395   10.542  1.00 37.06 ? 42  HIS A O   1 
ATOM   329  C CB  . HIS A 1 42  ? 55.898 6.339   8.781   1.00 36.58 ? 42  HIS A CB  1 
ATOM   330  C CG  . HIS A 1 42  ? 57.356 6.628   8.668   1.00 39.33 ? 42  HIS A CG  1 
ATOM   331  N ND1 . HIS A 1 42  ? 58.304 5.634   8.536   1.00 41.44 ? 42  HIS A ND1 1 
ATOM   332  C CD2 . HIS A 1 42  ? 58.034 7.800   8.662   1.00 41.90 ? 42  HIS A CD2 1 
ATOM   333  C CE1 . HIS A 1 42  ? 59.504 6.181   8.455   1.00 42.83 ? 42  HIS A CE1 1 
ATOM   334  N NE2 . HIS A 1 42  ? 59.369 7.495   8.529   1.00 43.71 ? 42  HIS A NE2 1 
ATOM   335  N N   . VAL A 1 43  ? 53.213 5.209   9.998   1.00 35.46 ? 43  VAL A N   1 
ATOM   336  C CA  . VAL A 1 43  ? 51.741 5.164   10.138  1.00 35.00 ? 43  VAL A CA  1 
ATOM   337  C C   . VAL A 1 43  ? 51.309 5.523   11.563  1.00 34.79 ? 43  VAL A C   1 
ATOM   338  O O   . VAL A 1 43  ? 50.436 6.378   11.759  1.00 34.72 ? 43  VAL A O   1 
ATOM   339  C CB  . VAL A 1 43  ? 51.155 3.787   9.721   1.00 34.85 ? 43  VAL A CB  1 
ATOM   340  C CG1 . VAL A 1 43  ? 49.654 3.682   10.051  1.00 35.46 ? 43  VAL A CG1 1 
ATOM   341  C CG2 . VAL A 1 43  ? 51.397 3.525   8.219   1.00 36.12 ? 43  VAL A CG2 1 
ATOM   342  N N   . VAL A 1 44  ? 51.916 4.875   12.557  1.00 34.93 ? 44  VAL A N   1 
ATOM   343  C CA  . VAL A 1 44  ? 51.604 5.174   13.956  1.00 34.25 ? 44  VAL A CA  1 
ATOM   344  C C   . VAL A 1 44  ? 51.924 6.649   14.228  1.00 35.17 ? 44  VAL A C   1 
ATOM   345  O O   . VAL A 1 44  ? 51.120 7.366   14.822  1.00 34.97 ? 44  VAL A O   1 
ATOM   346  C CB  . VAL A 1 44  ? 52.364 4.223   14.933  1.00 34.53 ? 44  VAL A CB  1 
ATOM   347  C CG1 . VAL A 1 44  ? 52.244 4.691   16.372  1.00 33.24 ? 44  VAL A CG1 1 
ATOM   348  C CG2 . VAL A 1 44  ? 51.870 2.737   14.780  1.00 32.89 ? 44  VAL A CG2 1 
ATOM   349  N N   . GLN A 1 45  ? 53.096 7.100   13.781  1.00 35.50 ? 45  GLN A N   1 
ATOM   350  C CA  . GLN A 1 45  ? 53.505 8.482   13.987  1.00 36.52 ? 45  GLN A CA  1 
ATOM   351  C C   . GLN A 1 45  ? 52.493 9.492   13.418  1.00 36.69 ? 45  GLN A C   1 
ATOM   352  O O   . GLN A 1 45  ? 52.154 10.472  14.089  1.00 36.98 ? 45  GLN A O   1 
ATOM   353  C CB  . GLN A 1 45  ? 54.892 8.718   13.394  1.00 36.27 ? 45  GLN A CB  1 
ATOM   354  C CG  . GLN A 1 45  ? 55.464 10.077  13.692  1.00 39.41 ? 45  GLN A CG  1 
ATOM   355  C CD  . GLN A 1 45  ? 56.858 10.248  13.114  1.00 43.35 ? 45  GLN A CD  1 
ATOM   356  O OE1 . GLN A 1 45  ? 57.027 10.476  11.909  1.00 44.21 ? 45  GLN A OE1 1 
ATOM   357  N NE2 . GLN A 1 45  ? 57.872 10.122  13.972  1.00 44.44 ? 45  GLN A NE2 1 
ATOM   358  N N   . SER A 1 46  ? 52.035 9.248   12.190  1.00 36.66 ? 46  SER A N   1 
ATOM   359  C CA  . SER A 1 46  ? 51.023 10.082  11.533  1.00 37.54 ? 46  SER A CA  1 
ATOM   360  C C   . SER A 1 46  ? 49.680 10.104  12.248  1.00 37.47 ? 46  SER A C   1 
ATOM   361  O O   . SER A 1 46  ? 49.055 11.165  12.380  1.00 37.48 ? 46  SER A O   1 
ATOM   362  C CB  . SER A 1 46  ? 50.797 9.619   10.092  1.00 37.71 ? 46  SER A CB  1 
ATOM   363  O OG  . SER A 1 46  ? 51.985 9.723   9.349   1.00 38.22 ? 46  SER A OG  1 
ATOM   364  N N   . VAL A 1 47  ? 49.217 8.934   12.679  1.00 37.46 ? 47  VAL A N   1 
ATOM   365  C CA  . VAL A 1 47  ? 47.997 8.864   13.483  1.00 37.57 ? 47  VAL A CA  1 
ATOM   366  C C   . VAL A 1 47  ? 48.110 9.654   14.803  1.00 37.85 ? 47  VAL A C   1 
ATOM   367  O O   . VAL A 1 47  ? 47.196 10.408  15.161  1.00 37.78 ? 47  VAL A O   1 
ATOM   368  C CB  . VAL A 1 47  ? 47.565 7.417   13.770  1.00 37.80 ? 47  VAL A CB  1 
ATOM   369  C CG1 . VAL A 1 47  ? 46.374 7.390   14.745  1.00 37.86 ? 47  VAL A CG1 1 
ATOM   370  C CG2 . VAL A 1 47  ? 47.145 6.711   12.476  1.00 37.67 ? 47  VAL A CG2 1 
ATOM   371  N N   . GLU A 1 48  ? 49.220 9.478   15.518  1.00 37.33 ? 48  GLU A N   1 
ATOM   372  C CA  . GLU A 1 48  ? 49.487 10.228  16.758  1.00 37.45 ? 48  GLU A CA  1 
ATOM   373  C C   . GLU A 1 48  ? 49.608 11.747  16.524  1.00 37.95 ? 48  GLU A C   1 
ATOM   374  O O   . GLU A 1 48  ? 49.087 12.546  17.314  1.00 37.40 ? 48  GLU A O   1 
ATOM   375  C CB  . GLU A 1 48  ? 50.754 9.694   17.428  1.00 37.21 ? 48  GLU A CB  1 
ATOM   376  C CG  . GLU A 1 48  ? 50.538 8.308   17.975  1.00 38.30 ? 48  GLU A CG  1 
ATOM   377  C CD  . GLU A 1 48  ? 51.779 7.622   18.513  1.00 39.10 ? 48  GLU A CD  1 
ATOM   378  O OE1 . GLU A 1 48  ? 52.899 8.166   18.402  1.00 39.95 ? 48  GLU A OE1 1 
ATOM   379  O OE2 . GLU A 1 48  ? 51.614 6.508   19.070  1.00 39.76 ? 48  GLU A OE2 1 
ATOM   380  N N   . LYS A 1 49  ? 50.289 12.133  15.442  1.00 37.59 ? 49  LYS A N   1 
ATOM   381  C CA  . LYS A 1 49  ? 50.378 13.535  15.060  1.00 38.03 ? 49  LYS A CA  1 
ATOM   382  C C   . LYS A 1 49  ? 48.984 14.123  14.805  1.00 37.61 ? 49  LYS A C   1 
ATOM   383  O O   . LYS A 1 49  ? 48.638 15.158  15.365  1.00 37.97 ? 49  LYS A O   1 
ATOM   384  C CB  . LYS A 1 49  ? 51.305 13.730  13.854  1.00 37.88 ? 49  LYS A CB  1 
ATOM   385  C CG  . LYS A 1 49  ? 51.347 15.175  13.368  1.00 39.51 ? 49  LYS A CG  1 
ATOM   386  C CD  . LYS A 1 49  ? 52.202 15.373  12.117  1.00 39.31 ? 49  LYS A CD  1 
ATOM   387  C CE  . LYS A 1 49  ? 52.035 16.806  11.613  1.00 42.59 ? 49  LYS A CE  1 
ATOM   388  N NZ  . LYS A 1 49  ? 53.274 17.376  10.973  1.00 42.15 ? 49  LYS A NZ  1 
ATOM   389  N N   . PHE A 1 50  ? 48.182 13.434  13.995  1.00 37.35 ? 50  PHE A N   1 
ATOM   390  C CA  . PHE A 1 50  ? 46.802 13.819  13.727  1.00 37.16 ? 50  PHE A CA  1 
ATOM   391  C C   . PHE A 1 50  ? 45.990 14.019  15.014  1.00 37.04 ? 50  PHE A C   1 
ATOM   392  O O   . PHE A 1 50  ? 45.299 15.028  15.187  1.00 36.84 ? 50  PHE A O   1 
ATOM   393  C CB  . PHE A 1 50  ? 46.107 12.792  12.806  1.00 36.95 ? 50  PHE A CB  1 
ATOM   394  C CG  . PHE A 1 50  ? 44.643 13.095  12.554  1.00 36.59 ? 50  PHE A CG  1 
ATOM   395  C CD1 . PHE A 1 50  ? 44.259 13.945  11.520  1.00 35.82 ? 50  PHE A CD1 1 
ATOM   396  C CD2 . PHE A 1 50  ? 43.651 12.543  13.364  1.00 36.16 ? 50  PHE A CD2 1 
ATOM   397  C CE1 . PHE A 1 50  ? 42.912 14.249  11.299  1.00 35.95 ? 50  PHE A CE1 1 
ATOM   398  C CE2 . PHE A 1 50  ? 42.298 12.833  13.141  1.00 34.69 ? 50  PHE A CE2 1 
ATOM   399  C CZ  . PHE A 1 50  ? 41.933 13.686  12.109  1.00 35.35 ? 50  PHE A CZ  1 
ATOM   400  N N   . ILE A 1 51  ? 46.070 13.045  15.902  1.00 37.04 ? 51  ILE A N   1 
ATOM   401  C CA  . ILE A 1 51  ? 45.411 13.124  17.206  1.00 37.12 ? 51  ILE A CA  1 
ATOM   402  C C   . ILE A 1 51  ? 45.900 14.295  18.064  1.00 37.10 ? 51  ILE A C   1 
ATOM   403  O O   . ILE A 1 51  ? 45.110 14.907  18.790  1.00 37.10 ? 51  ILE A O   1 
ATOM   404  C CB  . ILE A 1 51  ? 45.500 11.779  17.955  1.00 36.95 ? 51  ILE A CB  1 
ATOM   405  C CG1 . ILE A 1 51  ? 44.589 10.762  17.261  1.00 37.78 ? 51  ILE A CG1 1 
ATOM   406  C CG2 . ILE A 1 51  ? 45.135 11.937  19.449  1.00 36.13 ? 51  ILE A CG2 1 
ATOM   407  C CD1 . ILE A 1 51  ? 44.773 9.319   17.700  1.00 35.62 ? 51  ILE A CD1 1 
ATOM   408  N N   . GLN A 1 52  ? 47.185 14.629  17.952  1.00 37.13 ? 52  GLN A N   1 
ATOM   409  C CA  . GLN A 1 52  ? 47.735 15.765  18.660  1.00 37.86 ? 52  GLN A CA  1 
ATOM   410  C C   . GLN A 1 52  ? 47.170 17.102  18.128  1.00 37.47 ? 52  GLN A C   1 
ATOM   411  O O   . GLN A 1 52  ? 46.867 18.014  18.905  1.00 36.75 ? 52  GLN A O   1 
ATOM   412  C CB  . GLN A 1 52  ? 49.272 15.765  18.570  1.00 37.25 ? 52  GLN A CB  1 
ATOM   413  C CG  . GLN A 1 52  ? 49.965 16.817  19.448  1.00 38.79 ? 52  GLN A CG  1 
ATOM   414  C CD  . GLN A 1 52  ? 51.396 17.165  18.985  1.00 41.05 ? 52  GLN A CD  1 
ATOM   415  O OE1 . GLN A 1 52  ? 51.922 16.587  18.023  1.00 45.65 ? 52  GLN A OE1 1 
ATOM   416  N NE2 . GLN A 1 52  ? 52.022 18.131  19.669  1.00 43.22 ? 52  GLN A NE2 1 
ATOM   417  N N   . LYS A 1 53  ? 47.035 17.209  16.809  1.00 37.70 ? 53  LYS A N   1 
ATOM   418  C CA  . LYS A 1 53  ? 46.736 18.491  16.181  1.00 38.76 ? 53  LYS A CA  1 
ATOM   419  C C   . LYS A 1 53  ? 45.268 18.732  15.863  1.00 38.56 ? 53  LYS A C   1 
ATOM   420  O O   . LYS A 1 53  ? 44.826 19.881  15.803  1.00 38.67 ? 53  LYS A O   1 
ATOM   421  C CB  . LYS A 1 53  ? 47.554 18.667  14.895  1.00 39.43 ? 53  LYS A CB  1 
ATOM   422  C CG  . LYS A 1 53  ? 49.039 18.398  15.035  1.00 41.39 ? 53  LYS A CG  1 
ATOM   423  C CD  . LYS A 1 53  ? 49.750 19.530  15.720  1.00 44.79 ? 53  LYS A CD  1 
ATOM   424  C CE  . LYS A 1 53  ? 51.251 19.341  15.628  1.00 46.93 ? 53  LYS A CE  1 
ATOM   425  N NZ  . LYS A 1 53  ? 51.956 20.652  15.433  1.00 47.95 ? 53  LYS A NZ  1 
ATOM   426  N N   . CYS A 1 54  ? 44.509 17.665  15.638  1.00 38.16 ? 54  CYS A N   1 
ATOM   427  C CA  . CYS A 1 54  ? 43.158 17.843  15.125  1.00 37.89 ? 54  CYS A CA  1 
ATOM   428  C C   . CYS A 1 54  ? 42.245 18.644  16.068  1.00 38.56 ? 54  CYS A C   1 
ATOM   429  O O   . CYS A 1 54  ? 42.522 18.775  17.274  1.00 38.32 ? 54  CYS A O   1 
ATOM   430  C CB  . CYS A 1 54  ? 42.536 16.495  14.753  1.00 37.65 ? 54  CYS A CB  1 
ATOM   431  S SG  . CYS A 1 54  ? 42.162 15.420  16.147  1.00 35.28 ? 54  CYS A SG  1 
ATOM   432  N N   . LYS A 1 55  ? 41.184 19.201  15.487  1.00 38.48 ? 55  LYS A N   1 
ATOM   433  C CA  . LYS A 1 55  ? 40.087 19.830  16.222  1.00 39.18 ? 55  LYS A CA  1 
ATOM   434  C C   . LYS A 1 55  ? 39.409 18.806  17.129  1.00 38.53 ? 55  LYS A C   1 
ATOM   435  O O   . LYS A 1 55  ? 39.405 17.627  16.814  1.00 38.75 ? 55  LYS A O   1 
ATOM   436  C CB  . LYS A 1 55  ? 39.042 20.356  15.238  1.00 39.01 ? 55  LYS A CB  1 
ATOM   437  C CG  . LYS A 1 55  ? 39.527 21.436  14.274  1.00 40.70 ? 55  LYS A CG  1 
ATOM   438  C CD  . LYS A 1 55  ? 38.357 21.960  13.421  1.00 41.15 ? 55  LYS A CD  1 
ATOM   439  C CE  . LYS A 1 55  ? 38.811 22.400  12.029  1.00 43.83 ? 55  LYS A CE  1 
ATOM   440  N NZ  . LYS A 1 55  ? 39.277 21.219  11.224  1.00 46.18 ? 55  LYS A NZ  1 
ATOM   441  N N   . PRO A 1 56  ? 38.805 19.261  18.246  1.00 38.52 ? 56  PRO A N   1 
ATOM   442  C CA  . PRO A 1 56  ? 38.135 18.376  19.207  1.00 37.90 ? 56  PRO A CA  1 
ATOM   443  C C   . PRO A 1 56  ? 37.172 17.345  18.598  1.00 37.56 ? 56  PRO A C   1 
ATOM   444  O O   . PRO A 1 56  ? 37.148 16.205  19.069  1.00 38.07 ? 56  PRO A O   1 
ATOM   445  C CB  . PRO A 1 56  ? 37.380 19.358  20.108  1.00 37.27 ? 56  PRO A CB  1 
ATOM   446  C CG  . PRO A 1 56  ? 38.199 20.569  20.062  1.00 38.50 ? 56  PRO A CG  1 
ATOM   447  C CD  . PRO A 1 56  ? 38.723 20.672  18.669  1.00 38.06 ? 56  PRO A CD  1 
ATOM   448  N N   . GLU A 1 57  ? 36.409 17.721  17.564  1.00 37.18 ? 57  GLU A N   1 
ATOM   449  C CA  . GLU A 1 57  ? 35.445 16.803  16.930  1.00 37.20 ? 57  GLU A CA  1 
ATOM   450  C C   . GLU A 1 57  ? 36.067 15.587  16.245  1.00 36.29 ? 57  GLU A C   1 
ATOM   451  O O   . GLU A 1 57  ? 35.369 14.613  15.969  1.00 37.24 ? 57  GLU A O   1 
ATOM   452  C CB  . GLU A 1 57  ? 34.522 17.535  15.939  1.00 37.83 ? 57  GLU A CB  1 
ATOM   453  C CG  . GLU A 1 57  ? 35.231 18.269  14.806  1.00 39.51 ? 57  GLU A CG  1 
ATOM   454  C CD  . GLU A 1 57  ? 35.321 19.753  15.066  1.00 44.39 ? 57  GLU A CD  1 
ATOM   455  O OE1 . GLU A 1 57  ? 35.867 20.158  16.124  1.00 45.66 ? 57  GLU A OE1 1 
ATOM   456  O OE2 . GLU A 1 57  ? 34.821 20.522  14.213  1.00 46.02 ? 57  GLU A OE2 1 
ATOM   457  N N   . TYR A 1 58  ? 37.369 15.644  15.960  1.00 35.57 ? 58  TYR A N   1 
ATOM   458  C CA  . TYR A 1 58  ? 38.062 14.543  15.268  1.00 34.61 ? 58  TYR A CA  1 
ATOM   459  C C   . TYR A 1 58  ? 38.831 13.612  16.184  1.00 34.83 ? 58  TYR A C   1 
ATOM   460  O O   . TYR A 1 58  ? 39.453 12.671  15.701  1.00 35.43 ? 58  TYR A O   1 
ATOM   461  C CB  . TYR A 1 58  ? 39.000 15.074  14.171  1.00 34.33 ? 58  TYR A CB  1 
ATOM   462  C CG  . TYR A 1 58  ? 38.266 15.744  13.013  1.00 33.30 ? 58  TYR A CG  1 
ATOM   463  C CD1 . TYR A 1 58  ? 37.524 14.992  12.114  1.00 32.08 ? 58  TYR A CD1 1 
ATOM   464  C CD2 . TYR A 1 58  ? 38.315 17.127  12.839  1.00 31.14 ? 58  TYR A CD2 1 
ATOM   465  C CE1 . TYR A 1 58  ? 36.828 15.595  11.071  1.00 31.65 ? 58  TYR A CE1 1 
ATOM   466  C CE2 . TYR A 1 58  ? 37.641 17.747  11.784  1.00 31.86 ? 58  TYR A CE2 1 
ATOM   467  C CZ  . TYR A 1 58  ? 36.889 16.969  10.908  1.00 32.28 ? 58  TYR A CZ  1 
ATOM   468  O OH  . TYR A 1 58  ? 36.220 17.551  9.862   1.00 31.56 ? 58  TYR A OH  1 
ATOM   469  N N   . LYS A 1 59  ? 38.792 13.862  17.495  1.00 35.50 ? 59  LYS A N   1 
ATOM   470  C CA  . LYS A 1 59  ? 39.508 13.030  18.471  1.00 35.93 ? 59  LYS A CA  1 
ATOM   471  C C   . LYS A 1 59  ? 38.950 11.608  18.442  1.00 36.70 ? 59  LYS A C   1 
ATOM   472  O O   . LYS A 1 59  ? 39.710 10.633  18.318  1.00 37.21 ? 59  LYS A O   1 
ATOM   473  C CB  . LYS A 1 59  ? 39.440 13.616  19.889  1.00 35.55 ? 59  LYS A CB  1 
ATOM   474  C CG  . LYS A 1 59  ? 40.036 15.036  20.058  1.00 35.66 ? 59  LYS A CG  1 
ATOM   475  C CD  . LYS A 1 59  ? 41.518 15.133  19.676  1.00 35.64 ? 59  LYS A CD  1 
ATOM   476  C CE  . LYS A 1 59  ? 42.066 16.522  20.073  1.00 35.17 ? 59  LYS A CE  1 
ATOM   477  N NZ  . LYS A 1 59  ? 43.223 16.941  19.237  1.00 34.55 ? 59  LYS A NZ  1 
ATOM   478  N N   . VAL A 1 60  ? 37.628 11.481  18.519  1.00 36.70 ? 60  VAL A N   1 
ATOM   479  C CA  . VAL A 1 60  ? 37.001 10.145  18.448  1.00 37.39 ? 60  VAL A CA  1 
ATOM   480  C C   . VAL A 1 60  ? 37.263 9.462   17.085  1.00 37.38 ? 60  VAL A C   1 
ATOM   481  O O   . VAL A 1 60  ? 37.710 8.317   17.057  1.00 38.34 ? 60  VAL A O   1 
ATOM   482  C CB  . VAL A 1 60  ? 35.510 10.163  18.868  1.00 37.51 ? 60  VAL A CB  1 
ATOM   483  C CG1 . VAL A 1 60  ? 34.833 8.816   18.605  1.00 37.88 ? 60  VAL A CG1 1 
ATOM   484  C CG2 . VAL A 1 60  ? 35.379 10.518  20.349  1.00 38.72 ? 60  VAL A CG2 1 
ATOM   485  N N   . PRO A 1 61  ? 37.007 10.156  15.951  1.00 37.42 ? 61  PRO A N   1 
ATOM   486  C CA  . PRO A 1 61  ? 37.497 9.638   14.660  1.00 37.57 ? 61  PRO A CA  1 
ATOM   487  C C   . PRO A 1 61  ? 38.948 9.152   14.670  1.00 37.52 ? 61  PRO A C   1 
ATOM   488  O O   . PRO A 1 61  ? 39.220 8.061   14.169  1.00 38.59 ? 61  PRO A O   1 
ATOM   489  C CB  . PRO A 1 61  ? 37.330 10.842  13.729  1.00 36.95 ? 61  PRO A CB  1 
ATOM   490  C CG  . PRO A 1 61  ? 36.112 11.466  14.230  1.00 36.82 ? 61  PRO A CG  1 
ATOM   491  C CD  . PRO A 1 61  ? 36.203 11.371  15.742  1.00 36.87 ? 61  PRO A CD  1 
ATOM   492  N N   . GLY A 1 62  ? 39.857 9.931   15.252  1.00 37.38 ? 62  GLY A N   1 
ATOM   493  C CA  . GLY A 1 62  ? 41.267 9.543   15.327  1.00 37.28 ? 62  GLY A CA  1 
ATOM   494  C C   . GLY A 1 62  ? 41.491 8.279   16.165  1.00 37.62 ? 62  GLY A C   1 
ATOM   495  O O   . GLY A 1 62  ? 42.288 7.402   15.793  1.00 35.99 ? 62  GLY A O   1 
ATOM   496  N N   . LEU A 1 63  ? 40.797 8.190   17.301  1.00 37.69 ? 63  LEU A N   1 
ATOM   497  C CA  . LEU A 1 63  ? 40.764 6.931   18.079  1.00 38.53 ? 63  LEU A CA  1 
ATOM   498  C C   . LEU A 1 63  ? 40.192 5.738   17.292  1.00 38.44 ? 63  LEU A C   1 
ATOM   499  O O   . LEU A 1 63  ? 40.682 4.624   17.414  1.00 39.20 ? 63  LEU A O   1 
ATOM   500  C CB  . LEU A 1 63  ? 39.960 7.102   19.374  1.00 38.31 ? 63  LEU A CB  1 
ATOM   501  C CG  . LEU A 1 63  ? 39.706 5.871   20.257  1.00 38.04 ? 63  LEU A CG  1 
ATOM   502  C CD1 . LEU A 1 63  ? 41.018 5.172   20.695  1.00 36.86 ? 63  LEU A CD1 1 
ATOM   503  C CD2 . LEU A 1 63  ? 38.947 6.326   21.448  1.00 38.00 ? 63  LEU A CD2 1 
ATOM   504  N N   . TYR A 1 64  ? 39.129 5.963   16.526  1.00 38.45 ? 64  TYR A N   1 
ATOM   505  C CA  . TYR A 1 64  ? 38.564 4.906   15.677  1.00 37.67 ? 64  TYR A CA  1 
ATOM   506  C C   . TYR A 1 64  ? 39.537 4.445   14.582  1.00 37.99 ? 64  TYR A C   1 
ATOM   507  O O   . TYR A 1 64  ? 39.498 3.282   14.153  1.00 38.09 ? 64  TYR A O   1 
ATOM   508  C CB  . TYR A 1 64  ? 37.252 5.369   15.040  1.00 37.77 ? 64  TYR A CB  1 
ATOM   509  C CG  . TYR A 1 64  ? 36.081 5.432   16.001  1.00 37.95 ? 64  TYR A CG  1 
ATOM   510  C CD1 . TYR A 1 64  ? 36.133 4.778   17.235  1.00 37.45 ? 64  TYR A CD1 1 
ATOM   511  C CD2 . TYR A 1 64  ? 34.901 6.104   15.658  1.00 36.73 ? 64  TYR A CD2 1 
ATOM   512  C CE1 . TYR A 1 64  ? 35.076 4.817   18.101  1.00 37.26 ? 64  TYR A CE1 1 
ATOM   513  C CE2 . TYR A 1 64  ? 33.825 6.139   16.535  1.00 35.59 ? 64  TYR A CE2 1 
ATOM   514  C CZ  . TYR A 1 64  ? 33.930 5.495   17.759  1.00 36.28 ? 64  TYR A CZ  1 
ATOM   515  O OH  . TYR A 1 64  ? 32.906 5.513   18.664  1.00 37.58 ? 64  TYR A OH  1 
ATOM   516  N N   . VAL A 1 65  ? 40.412 5.353   14.140  1.00 37.59 ? 65  VAL A N   1 
ATOM   517  C CA  . VAL A 1 65  ? 41.489 4.997   13.216  1.00 36.85 ? 65  VAL A CA  1 
ATOM   518  C C   . VAL A 1 65  ? 42.395 4.020   13.928  1.00 37.15 ? 65  VAL A C   1 
ATOM   519  O O   . VAL A 1 65  ? 42.707 2.983   13.380  1.00 37.94 ? 65  VAL A O   1 
ATOM   520  C CB  . VAL A 1 65  ? 42.295 6.258   12.721  1.00 37.28 ? 65  VAL A CB  1 
ATOM   521  C CG1 . VAL A 1 65  ? 43.589 5.858   11.977  1.00 35.47 ? 65  VAL A CG1 1 
ATOM   522  C CG2 . VAL A 1 65  ? 41.406 7.166   11.858  1.00 35.33 ? 65  VAL A CG2 1 
ATOM   523  N N   . ILE A 1 66  ? 42.805 4.332   15.157  1.00 36.86 ? 66  ILE A N   1 
ATOM   524  C CA  . ILE A 1 66  ? 43.666 3.404   15.905  1.00 36.06 ? 66  ILE A CA  1 
ATOM   525  C C   . ILE A 1 66  ? 42.946 2.068   16.070  1.00 35.81 ? 66  ILE A C   1 
ATOM   526  O O   . ILE A 1 66  ? 43.511 1.033   15.769  1.00 36.20 ? 66  ILE A O   1 
ATOM   527  C CB  . ILE A 1 66  ? 44.036 3.915   17.318  1.00 36.16 ? 66  ILE A CB  1 
ATOM   528  C CG1 . ILE A 1 66  ? 44.832 5.225   17.260  1.00 35.94 ? 66  ILE A CG1 1 
ATOM   529  C CG2 . ILE A 1 66  ? 44.790 2.797   18.105  1.00 34.16 ? 66  ILE A CG2 1 
ATOM   530  C CD1 . ILE A 1 66  ? 45.163 5.808   18.674  1.00 34.89 ? 66  ILE A CD1 1 
ATOM   531  N N   . ASP A 1 67  ? 41.707 2.102   16.559  1.00 34.83 ? 67  ASP A N   1 
ATOM   532  C CA  . ASP A 1 67  ? 40.898 0.872   16.722  1.00 35.45 ? 67  ASP A CA  1 
ATOM   533  C C   . ASP A 1 67  ? 40.820 0.042   15.442  1.00 35.39 ? 67  ASP A C   1 
ATOM   534  O O   . ASP A 1 67  ? 41.064 -1.165  15.440  1.00 35.92 ? 67  ASP A O   1 
ATOM   535  C CB  . ASP A 1 67  ? 39.480 1.239   17.177  1.00 34.48 ? 67  ASP A CB  1 
ATOM   536  C CG  . ASP A 1 67  ? 38.615 0.055   17.412  1.00 35.42 ? 67  ASP A CG  1 
ATOM   537  O OD1 . ASP A 1 67  ? 38.870 -0.685  18.404  1.00 37.86 ? 67  ASP A OD1 1 
ATOM   538  O OD2 . ASP A 1 67  ? 37.663 -0.149  16.614  1.00 36.45 ? 67  ASP A OD2 1 
ATOM   539  N N   . SER A 1 68  ? 40.445 0.702   14.356  1.00 35.54 ? 68  SER A N   1 
ATOM   540  C CA  . SER A 1 68  ? 40.228 0.018   13.086  1.00 35.28 ? 68  SER A CA  1 
ATOM   541  C C   . SER A 1 68  ? 41.494 -0.658  12.578  1.00 35.11 ? 68  SER A C   1 
ATOM   542  O O   . SER A 1 68  ? 41.445 -1.784  12.124  1.00 34.85 ? 68  SER A O   1 
ATOM   543  C CB  . SER A 1 68  ? 39.736 1.002   12.042  1.00 34.24 ? 68  SER A CB  1 
ATOM   544  O OG  . SER A 1 68  ? 39.482 0.309   10.848  1.00 36.41 ? 68  SER A OG  1 
ATOM   545  N N   . ILE A 1 69  ? 42.612 0.062   12.636  1.00 35.77 ? 69  ILE A N   1 
ATOM   546  C CA  . ILE A 1 69  ? 43.893 -0.437  12.168  1.00 35.78 ? 69  ILE A CA  1 
ATOM   547  C C   . ILE A 1 69  ? 44.308 -1.612  13.026  1.00 36.21 ? 69  ILE A C   1 
ATOM   548  O O   . ILE A 1 69  ? 44.589 -2.676  12.501  1.00 36.75 ? 69  ILE A O   1 
ATOM   549  C CB  . ILE A 1 69  ? 44.988 0.683   12.215  1.00 36.24 ? 69  ILE A CB  1 
ATOM   550  C CG1 . ILE A 1 69  ? 44.791 1.695   11.088  1.00 35.11 ? 69  ILE A CG1 1 
ATOM   551  C CG2 . ILE A 1 69  ? 46.392 0.073   12.166  1.00 36.70 ? 69  ILE A CG2 1 
ATOM   552  C CD1 . ILE A 1 69  ? 45.661 2.958   11.227  1.00 35.18 ? 69  ILE A CD1 1 
ATOM   553  N N   . VAL A 1 70  ? 44.305 -1.445  14.353  1.00 36.52 ? 70  VAL A N   1 
ATOM   554  C CA  . VAL A 1 70  ? 44.808 -2.511  15.236  1.00 36.55 ? 70  VAL A CA  1 
ATOM   555  C C   . VAL A 1 70  ? 43.923 -3.765  15.177  1.00 36.33 ? 70  VAL A C   1 
ATOM   556  O O   . VAL A 1 70  ? 44.429 -4.874  15.097  1.00 36.31 ? 70  VAL A O   1 
ATOM   557  C CB  A VAL A 1 70  ? 44.953 -2.003  16.694  0.50 36.72 ? 70  VAL A CB  1 
ATOM   558  C CB  B VAL A 1 70  ? 45.031 -2.061  16.725  0.50 36.67 ? 70  VAL A CB  1 
ATOM   559  C CG1 A VAL A 1 70  ? 45.279 -3.138  17.623  0.50 36.34 ? 70  VAL A CG1 1 
ATOM   560  C CG1 B VAL A 1 70  ? 45.976 -0.869  16.802  0.50 36.46 ? 70  VAL A CG1 1 
ATOM   561  C CG2 A VAL A 1 70  ? 46.026 -0.928  16.784  0.50 36.53 ? 70  VAL A CG2 1 
ATOM   562  C CG2 B VAL A 1 70  ? 43.704 -1.774  17.452  0.50 36.06 ? 70  VAL A CG2 1 
ATOM   563  N N   . ARG A 1 71  ? 42.606 -3.598  15.176  1.00 36.13 ? 71  ARG A N   1 
ATOM   564  C CA  . ARG A 1 71  ? 41.722 -4.768  15.079  1.00 35.90 ? 71  ARG A CA  1 
ATOM   565  C C   . ARG A 1 71  ? 41.798 -5.470  13.714  1.00 35.33 ? 71  ARG A C   1 
ATOM   566  O O   . ARG A 1 71  ? 41.700 -6.681  13.637  1.00 35.32 ? 71  ARG A O   1 
ATOM   567  C CB  . ARG A 1 71  ? 40.274 -4.398  15.391  1.00 35.75 ? 71  ARG A CB  1 
ATOM   568  C CG  . ARG A 1 71  ? 40.011 -4.091  16.894  1.00 36.24 ? 71  ARG A CG  1 
ATOM   569  C CD  . ARG A 1 71  ? 38.642 -3.401  17.061  1.00 38.08 ? 71  ARG A CD  1 
ATOM   570  N NE  . ARG A 1 71  ? 37.580 -4.234  16.541  1.00 42.54 ? 71  ARG A NE  1 
ATOM   571  C CZ  . ARG A 1 71  ? 36.721 -3.909  15.575  1.00 42.56 ? 71  ARG A CZ  1 
ATOM   572  N NH1 . ARG A 1 71  ? 36.712 -2.710  15.006  1.00 42.26 ? 71  ARG A NH1 1 
ATOM   573  N NH2 . ARG A 1 71  ? 35.842 -4.813  15.200  1.00 39.22 ? 71  ARG A NH2 1 
ATOM   574  N N   . GLN A 1 72  ? 41.933 -4.703  12.635  1.00 35.35 ? 72  GLN A N   1 
ATOM   575  C CA  . GLN A 1 72  ? 42.048 -5.307  11.305  1.00 34.73 ? 72  GLN A CA  1 
ATOM   576  C C   . GLN A 1 72  ? 43.337 -6.106  11.220  1.00 34.03 ? 72  GLN A C   1 
ATOM   577  O O   . GLN A 1 72  ? 43.344 -7.249  10.802  1.00 33.52 ? 72  GLN A O   1 
ATOM   578  C CB  . GLN A 1 72  ? 42.003 -4.241  10.197  1.00 34.66 ? 72  GLN A CB  1 
ATOM   579  C CG  . GLN A 1 72  ? 42.186 -4.839  8.770   1.00 36.21 ? 72  GLN A CG  1 
ATOM   580  C CD  . GLN A 1 72  ? 41.099 -5.828  8.407   1.00 36.44 ? 72  GLN A CD  1 
ATOM   581  O OE1 . GLN A 1 72  ? 39.931 -5.626  8.736   1.00 37.97 ? 72  GLN A OE1 1 
ATOM   582  N NE2 . GLN A 1 72  ? 41.477 -6.914  7.743   1.00 38.26 ? 72  GLN A NE2 1 
ATOM   583  N N   . SER A 1 73  ? 44.416 -5.476  11.660  1.00 34.25 ? 73  SER A N   1 
ATOM   584  C CA  . SER A 1 73  ? 45.752 -6.052  11.658  1.00 34.83 ? 73  SER A CA  1 
ATOM   585  C C   . SER A 1 73  ? 45.853 -7.343  12.472  1.00 34.73 ? 73  SER A C   1 
ATOM   586  O O   . SER A 1 73  ? 46.470 -8.323  12.031  1.00 34.48 ? 73  SER A O   1 
ATOM   587  C CB  . SER A 1 73  ? 46.726 -5.003  12.204  1.00 34.87 ? 73  SER A CB  1 
ATOM   588  O OG  . SER A 1 73  ? 48.062 -5.441  12.135  1.00 36.83 ? 73  SER A OG  1 
ATOM   589  N N   . ARG A 1 74  ? 45.266 -7.324  13.670  1.00 34.59 ? 74  ARG A N   1 
ATOM   590  C CA  . ARG A 1 74  ? 45.184 -8.499  14.533  1.00 34.93 ? 74  ARG A CA  1 
ATOM   591  C C   . ARG A 1 74  ? 44.410 -9.639  13.867  1.00 33.95 ? 74  ARG A C   1 
ATOM   592  O O   . ARG A 1 74  ? 44.785 -10.789 13.970  1.00 33.93 ? 74  ARG A O   1 
ATOM   593  C CB  . ARG A 1 74  ? 44.559 -8.130  15.892  1.00 34.95 ? 74  ARG A CB  1 
ATOM   594  C CG  . ARG A 1 74  ? 45.475 -7.275  16.761  1.00 35.60 ? 74  ARG A CG  1 
ATOM   595  C CD  . ARG A 1 74  ? 44.757 -6.723  17.980  1.00 36.18 ? 74  ARG A CD  1 
ATOM   596  N NE  . ARG A 1 74  ? 44.206 -7.798  18.809  1.00 37.85 ? 74  ARG A NE  1 
ATOM   597  C CZ  . ARG A 1 74  ? 44.901 -8.469  19.715  1.00 39.45 ? 74  ARG A CZ  1 
ATOM   598  N NH1 . ARG A 1 74  ? 46.182 -8.196  19.918  1.00 41.67 ? 74  ARG A NH1 1 
ATOM   599  N NH2 . ARG A 1 74  ? 44.319 -9.428  20.408  1.00 41.32 ? 74  ARG A NH2 1 
ATOM   600  N N   . HIS A 1 75  ? 43.331 -9.296  13.176  1.00 33.45 ? 75  HIS A N   1 
ATOM   601  C CA  . HIS A 1 75  ? 42.536 -10.277 12.470  1.00 32.75 ? 75  HIS A CA  1 
ATOM   602  C C   . HIS A 1 75  ? 43.266 -10.754 11.219  1.00 32.38 ? 75  HIS A C   1 
ATOM   603  O O   . HIS A 1 75  ? 43.250 -11.938 10.911  1.00 32.33 ? 75  HIS A O   1 
ATOM   604  C CB  . HIS A 1 75  ? 41.203 -9.636  12.082  1.00 32.97 ? 75  HIS A CB  1 
ATOM   605  C CG  . HIS A 1 75  ? 40.254 -10.571 11.404  1.00 33.44 ? 75  HIS A CG  1 
ATOM   606  N ND1 . HIS A 1 75  ? 39.560 -11.545 12.087  1.00 34.47 ? 75  HIS A ND1 1 
ATOM   607  C CD2 . HIS A 1 75  ? 39.862 -10.666 10.110  1.00 34.99 ? 75  HIS A CD2 1 
ATOM   608  C CE1 . HIS A 1 75  ? 38.796 -12.214 11.241  1.00 34.48 ? 75  HIS A CE1 1 
ATOM   609  N NE2 . HIS A 1 75  ? 38.959 -11.700 10.034  1.00 35.73 ? 75  HIS A NE2 1 
ATOM   610  N N   . GLN A 1 76  ? 43.895 -9.831  10.490  1.00 31.75 ? 76  GLN A N   1 
ATOM   611  C CA  . GLN A 1 76  ? 44.515 -10.163 9.192   1.00 31.36 ? 76  GLN A CA  1 
ATOM   612  C C   . GLN A 1 76  ? 45.831 -10.951 9.366   1.00 30.86 ? 76  GLN A C   1 
ATOM   613  O O   . GLN A 1 76  ? 46.103 -11.914 8.642   1.00 30.43 ? 76  GLN A O   1 
ATOM   614  C CB  . GLN A 1 76  ? 44.724 -8.873  8.387   1.00 31.33 ? 76  GLN A CB  1 
ATOM   615  C CG  . GLN A 1 76  ? 45.171 -9.079  6.950   1.00 32.01 ? 76  GLN A CG  1 
ATOM   616  C CD  . GLN A 1 76  ? 44.885 -7.875  6.081   1.00 32.65 ? 76  GLN A CD  1 
ATOM   617  O OE1 . GLN A 1 76  ? 44.065 -7.020  6.423   1.00 32.62 ? 76  GLN A OE1 1 
ATOM   618  N NE2 . GLN A 1 76  ? 45.534 -7.817  4.934   1.00 32.64 ? 76  GLN A NE2 1 
ATOM   619  N N   . PHE A 1 77  ? 46.620 -10.540 10.354  1.00 30.92 ? 77  PHE A N   1 
ATOM   620  C CA  . PHE A 1 77  ? 47.967 -11.052 10.565  1.00 31.03 ? 77  PHE A CA  1 
ATOM   621  C C   . PHE A 1 77  ? 48.090 -11.922 11.801  1.00 31.67 ? 77  PHE A C   1 
ATOM   622  O O   . PHE A 1 77  ? 49.075 -12.628 11.948  1.00 31.44 ? 77  PHE A O   1 
ATOM   623  C CB  . PHE A 1 77  ? 48.975 -9.893  10.622  1.00 30.31 ? 77  PHE A CB  1 
ATOM   624  C CG  . PHE A 1 77  ? 48.981 -9.063  9.388   1.00 30.10 ? 77  PHE A CG  1 
ATOM   625  C CD1 . PHE A 1 77  ? 48.412 -7.800  9.385   1.00 28.78 ? 77  PHE A CD1 1 
ATOM   626  C CD2 . PHE A 1 77  ? 49.499 -9.579  8.194   1.00 28.04 ? 77  PHE A CD2 1 
ATOM   627  C CE1 . PHE A 1 77  ? 48.385 -7.047  8.235   1.00 29.23 ? 77  PHE A CE1 1 
ATOM   628  C CE2 . PHE A 1 77  ? 49.489 -8.827  7.044   1.00 28.26 ? 77  PHE A CE2 1 
ATOM   629  C CZ  . PHE A 1 77  ? 48.924 -7.557  7.046   1.00 26.51 ? 77  PHE A CZ  1 
ATOM   630  N N   . GLY A 1 78  ? 47.085 -11.891 12.668  1.00 32.71 ? 78  GLY A N   1 
ATOM   631  C CA  . GLY A 1 78  ? 47.140 -12.640 13.928  1.00 34.62 ? 78  GLY A CA  1 
ATOM   632  C C   . GLY A 1 78  ? 47.504 -11.759 15.111  1.00 35.93 ? 78  GLY A C   1 
ATOM   633  O O   . GLY A 1 78  ? 48.332 -10.842 14.991  1.00 35.20 ? 78  GLY A O   1 
ATOM   634  N N   . GLN A 1 79  ? 46.882 -12.032 16.261  1.00 37.81 ? 79  GLN A N   1 
ATOM   635  C CA  . GLN A 1 79  ? 47.140 -11.249 17.481  1.00 39.50 ? 79  GLN A CA  1 
ATOM   636  C C   . GLN A 1 79  ? 48.623 -11.274 17.828  1.00 39.97 ? 79  GLN A C   1 
ATOM   637  O O   . GLN A 1 79  ? 49.206 -10.230 18.156  1.00 40.41 ? 79  GLN A O   1 
ATOM   638  C CB  . GLN A 1 79  ? 46.358 -11.800 18.670  1.00 40.23 ? 79  GLN A CB  1 
ATOM   639  C CG  . GLN A 1 79  ? 44.956 -12.302 18.372  1.00 43.36 ? 79  GLN A CG  1 
ATOM   640  C CD  . GLN A 1 79  ? 44.423 -13.144 19.509  1.00 46.58 ? 79  GLN A CD  1 
ATOM   641  O OE1 . GLN A 1 79  ? 44.350 -12.686 20.652  1.00 48.52 ? 79  GLN A OE1 1 
ATOM   642  N NE2 . GLN A 1 79  ? 44.066 -14.392 19.210  1.00 49.39 ? 79  GLN A NE2 1 
ATOM   643  N N   . GLU A 1 80  ? 49.214 -12.473 17.746  1.00 40.16 ? 80  GLU A N   1 
ATOM   644  C CA  . GLU A 1 80  ? 50.640 -12.707 18.012  1.00 40.87 ? 80  GLU A CA  1 
ATOM   645  C C   . GLU A 1 80  ? 51.520 -11.810 17.136  1.00 39.89 ? 80  GLU A C   1 
ATOM   646  O O   . GLU A 1 80  ? 52.566 -11.331 17.568  1.00 40.13 ? 80  GLU A O   1 
ATOM   647  C CB  . GLU A 1 80  ? 51.033 -14.182 17.744  1.00 40.74 ? 80  GLU A CB  1 
ATOM   648  C CG  . GLU A 1 80  ? 50.230 -15.281 18.490  1.00 42.52 ? 80  GLU A CG  1 
ATOM   649  C CD  . GLU A 1 80  ? 50.995 -16.657 18.528  1.00 43.11 ? 80  GLU A CD  1 
ATOM   650  O OE1 . GLU A 1 80  ? 51.130 -17.331 17.457  1.00 45.71 ? 80  GLU A OE1 1 
ATOM   651  O OE2 . GLU A 1 80  ? 51.451 -17.079 19.640  1.00 45.35 ? 80  GLU A OE2 1 
ATOM   652  N N   . LYS A 1 81  ? 51.083 -11.577 15.902  1.00 39.31 ? 81  LYS A N   1 
ATOM   653  C CA  . LYS A 1 81  ? 51.967 -11.041 14.877  1.00 38.30 ? 81  LYS A CA  1 
ATOM   654  C C   . LYS A 1 81  ? 51.761 -9.576  14.536  1.00 38.05 ? 81  LYS A C   1 
ATOM   655  O O   . LYS A 1 81  ? 52.617 -8.969  13.892  1.00 37.79 ? 81  LYS A O   1 
ATOM   656  C CB  . LYS A 1 81  ? 51.868 -11.905 13.631  1.00 38.57 ? 81  LYS A CB  1 
ATOM   657  C CG  . LYS A 1 81  ? 52.524 -13.264 13.809  1.00 37.91 ? 81  LYS A CG  1 
ATOM   658  C CD  . LYS A 1 81  ? 54.048 -13.088 13.858  1.00 39.57 ? 81  LYS A CD  1 
ATOM   659  C CE  . LYS A 1 81  ? 54.706 -14.502 13.822  1.00 40.02 ? 81  LYS A CE  1 
ATOM   660  N NZ  . LYS A 1 81  ? 56.040 -14.333 13.088  1.00 42.42 ? 81  LYS A NZ  1 
ATOM   661  N N   . ASP A 1 82  ? 50.625 -9.025  14.968  1.00 37.29 ? 82  ASP A N   1 
ATOM   662  C CA  . ASP A 1 82  ? 50.287 -7.623  14.768  1.00 36.67 ? 82  ASP A CA  1 
ATOM   663  C C   . ASP A 1 82  ? 51.363 -6.676  15.303  1.00 36.46 ? 82  ASP A C   1 
ATOM   664  O O   . ASP A 1 82  ? 51.702 -6.716  16.478  1.00 36.19 ? 82  ASP A O   1 
ATOM   665  C CB  . ASP A 1 82  ? 48.959 -7.330  15.464  1.00 36.33 ? 82  ASP A CB  1 
ATOM   666  C CG  . ASP A 1 82  ? 48.710 -5.855  15.640  1.00 38.63 ? 82  ASP A CG  1 
ATOM   667  O OD1 . ASP A 1 82  ? 48.662 -5.107  14.634  1.00 36.65 ? 82  ASP A OD1 1 
ATOM   668  O OD2 . ASP A 1 82  ? 48.565 -5.445  16.797  1.00 40.63 ? 82  ASP A OD2 1 
ATOM   669  N N   . VAL A 1 83  ? 51.880 -5.819  14.429  1.00 36.13 ? 83  VAL A N   1 
ATOM   670  C CA  . VAL A 1 83  ? 52.865 -4.793  14.791  1.00 35.89 ? 83  VAL A CA  1 
ATOM   671  C C   . VAL A 1 83  ? 52.211 -3.466  15.220  1.00 36.00 ? 83  VAL A C   1 
ATOM   672  O O   . VAL A 1 83  ? 52.872 -2.591  15.791  1.00 35.57 ? 83  VAL A O   1 
ATOM   673  C CB  . VAL A 1 83  ? 53.841 -4.521  13.625  1.00 35.51 ? 83  VAL A CB  1 
ATOM   674  C CG1 . VAL A 1 83  ? 54.633 -5.804  13.262  1.00 35.76 ? 83  VAL A CG1 1 
ATOM   675  C CG2 . VAL A 1 83  ? 53.090 -3.986  12.409  1.00 36.59 ? 83  VAL A CG2 1 
ATOM   676  N N   . PHE A 1 84  ? 50.919 -3.305  14.938  1.00 36.23 ? 84  PHE A N   1 
ATOM   677  C CA  . PHE A 1 84  ? 50.269 -2.015  15.198  1.00 36.58 ? 84  PHE A CA  1 
ATOM   678  C C   . PHE A 1 84  ? 49.990 -1.715  16.679  1.00 36.90 ? 84  PHE A C   1 
ATOM   679  O O   . PHE A 1 84  ? 50.422 -0.681  17.166  1.00 37.92 ? 84  PHE A O   1 
ATOM   680  C CB  . PHE A 1 84  ? 49.050 -1.782  14.299  1.00 36.38 ? 84  PHE A CB  1 
ATOM   681  C CG  . PHE A 1 84  ? 49.411 -1.413  12.871  1.00 36.58 ? 84  PHE A CG  1 
ATOM   682  C CD1 . PHE A 1 84  ? 49.939 -0.154  12.572  1.00 36.84 ? 84  PHE A CD1 1 
ATOM   683  C CD2 . PHE A 1 84  ? 49.225 -2.328  11.835  1.00 36.54 ? 84  PHE A CD2 1 
ATOM   684  C CE1 . PHE A 1 84  ? 50.261 0.198   11.251  1.00 37.73 ? 84  PHE A CE1 1 
ATOM   685  C CE2 . PHE A 1 84  ? 49.552 -2.005  10.506  1.00 36.41 ? 84  PHE A CE2 1 
ATOM   686  C CZ  . PHE A 1 84  ? 50.071 -0.734  10.207  1.00 37.23 ? 84  PHE A CZ  1 
ATOM   687  N N   . ALA A 1 85  ? 49.310 -2.612  17.388  1.00 37.18 ? 85  ALA A N   1 
ATOM   688  C CA  . ALA A 1 85  ? 49.008 -2.397  18.804  1.00 37.43 ? 85  ALA A CA  1 
ATOM   689  C C   . ALA A 1 85  ? 50.270 -2.218  19.667  1.00 37.50 ? 85  ALA A C   1 
ATOM   690  O O   . ALA A 1 85  ? 50.326 -1.279  20.444  1.00 37.82 ? 85  ALA A O   1 
ATOM   691  C CB  . ALA A 1 85  ? 48.100 -3.506  19.360  1.00 37.49 ? 85  ALA A CB  1 
ATOM   692  N N   . PRO A 1 86  ? 51.286 -3.114  19.539  1.00 37.13 ? 86  PRO A N   1 
ATOM   693  C CA  . PRO A 1 86  ? 52.550 -2.860  20.267  1.00 36.42 ? 86  PRO A CA  1 
ATOM   694  C C   . PRO A 1 86  ? 53.215 -1.495  19.996  1.00 35.87 ? 86  PRO A C   1 
ATOM   695  O O   . PRO A 1 86  ? 53.716 -0.857  20.924  1.00 35.66 ? 86  PRO A O   1 
ATOM   696  C CB  . PRO A 1 86  ? 53.472 -4.016  19.821  1.00 36.61 ? 86  PRO A CB  1 
ATOM   697  C CG  . PRO A 1 86  ? 52.538 -5.099  19.340  1.00 36.77 ? 86  PRO A CG  1 
ATOM   698  C CD  . PRO A 1 86  ? 51.317 -4.390  18.799  1.00 36.84 ? 86  PRO A CD  1 
ATOM   699  N N   . ARG A 1 87  ? 53.255 -1.067  18.742  1.00 35.08 ? 87  ARG A N   1 
ATOM   700  C CA  . ARG A 1 87  ? 53.833 0.234   18.403  1.00 34.87 ? 87  ARG A CA  1 
ATOM   701  C C   . ARG A 1 87  ? 52.980 1.427   18.925  1.00 35.00 ? 87  ARG A C   1 
ATOM   702  O O   . ARG A 1 87  ? 53.534 2.416   19.436  1.00 34.46 ? 87  ARG A O   1 
ATOM   703  C CB  . ARG A 1 87  ? 54.061 0.347   16.884  1.00 34.59 ? 87  ARG A CB  1 
ATOM   704  C CG  . ARG A 1 87  ? 54.764 1.609   16.446  1.00 33.57 ? 87  ARG A CG  1 
ATOM   705  C CD  . ARG A 1 87  ? 56.219 1.636   16.897  1.00 34.78 ? 87  ARG A CD  1 
ATOM   706  N NE  . ARG A 1 87  ? 56.864 2.904   16.558  1.00 34.64 ? 87  ARG A NE  1 
ATOM   707  C CZ  . ARG A 1 87  ? 58.154 3.175   16.763  1.00 35.05 ? 87  ARG A CZ  1 
ATOM   708  N NH1 . ARG A 1 87  ? 58.974 2.264   17.280  1.00 34.72 ? 87  ARG A NH1 1 
ATOM   709  N NH2 . ARG A 1 87  ? 58.627 4.365   16.433  1.00 35.96 ? 87  ARG A NH2 1 
ATOM   710  N N   . PHE A 1 88  ? 51.657 1.334   18.771  1.00 35.34 ? 88  PHE A N   1 
ATOM   711  C CA  . PHE A 1 88  ? 50.728 2.308   19.370  1.00 36.17 ? 88  PHE A CA  1 
ATOM   712  C C   . PHE A 1 88  ? 50.874 2.367   20.906  1.00 36.50 ? 88  PHE A C   1 
ATOM   713  O O   . PHE A 1 88  ? 50.595 3.408   21.524  1.00 36.95 ? 88  PHE A O   1 
ATOM   714  C CB  . PHE A 1 88  ? 49.257 2.020   18.995  1.00 36.27 ? 88  PHE A CB  1 
ATOM   715  C CG  . PHE A 1 88  ? 48.815 2.608   17.654  1.00 37.43 ? 88  PHE A CG  1 
ATOM   716  C CD1 . PHE A 1 88  ? 48.805 3.988   17.432  1.00 36.41 ? 88  PHE A CD1 1 
ATOM   717  C CD2 . PHE A 1 88  ? 48.379 1.772   16.623  1.00 38.66 ? 88  PHE A CD2 1 
ATOM   718  C CE1 . PHE A 1 88  ? 48.401 4.517   16.207  1.00 38.25 ? 88  PHE A CE1 1 
ATOM   719  C CE2 . PHE A 1 88  ? 47.966 2.290   15.383  1.00 39.15 ? 88  PHE A CE2 1 
ATOM   720  C CZ  . PHE A 1 88  ? 47.983 3.668   15.170  1.00 38.32 ? 88  PHE A CZ  1 
ATOM   721  N N   . SER A 1 89  ? 51.320 1.273   21.518  1.00 36.69 ? 89  SER A N   1 
ATOM   722  C CA  . SER A 1 89  ? 51.437 1.206   22.982  1.00 36.89 ? 89  SER A CA  1 
ATOM   723  C C   . SER A 1 89  ? 52.504 2.112   23.572  1.00 36.88 ? 89  SER A C   1 
ATOM   724  O O   . SER A 1 89  ? 52.335 2.611   24.690  1.00 37.47 ? 89  SER A O   1 
ATOM   725  C CB  A SER A 1 89  ? 51.641 -0.239  23.466  0.50 36.60 ? 89  SER A CB  1 
ATOM   726  C CB  B SER A 1 89  ? 51.671 -0.235  23.432  0.50 37.01 ? 89  SER A CB  1 
ATOM   727  O OG  A SER A 1 89  ? 52.989 -0.650  23.358  0.50 34.48 ? 89  SER A OG  1 
ATOM   728  O OG  B SER A 1 89  ? 50.527 -1.014  23.137  0.50 38.46 ? 89  SER A OG  1 
ATOM   729  N N   . ASN A 1 90  ? 53.589 2.330   22.831  1.00 36.86 ? 90  ASN A N   1 
ATOM   730  C CA  . ASN A 1 90  ? 54.673 3.212   23.257  1.00 36.68 ? 90  ASN A CA  1 
ATOM   731  C C   . ASN A 1 90  ? 54.227 4.582   23.774  1.00 36.26 ? 90  ASN A C   1 
ATOM   732  O O   . ASN A 1 90  ? 54.615 4.993   24.865  1.00 36.05 ? 90  ASN A O   1 
ATOM   733  C CB  . ASN A 1 90  ? 55.656 3.411   22.106  1.00 37.00 ? 90  ASN A CB  1 
ATOM   734  C CG  . ASN A 1 90  ? 56.410 2.140   21.758  1.00 38.91 ? 90  ASN A CG  1 
ATOM   735  O OD1 . ASN A 1 90  ? 56.202 1.095   22.375  1.00 40.67 ? 90  ASN A OD1 1 
ATOM   736  N ND2 . ASN A 1 90  ? 57.290 2.223   20.761  1.00 39.89 ? 90  ASN A ND2 1 
ATOM   737  N N   . ASN A 1 91  ? 53.401 5.271   22.996  1.00 35.79 ? 91  ASN A N   1 
ATOM   738  C CA  . ASN A 1 91  ? 53.009 6.650   23.299  1.00 35.94 ? 91  ASN A CA  1 
ATOM   739  C C   . ASN A 1 91  ? 51.548 6.760   23.726  1.00 36.02 ? 91  ASN A C   1 
ATOM   740  O O   . ASN A 1 91  ? 51.019 7.865   23.871  1.00 35.25 ? 91  ASN A O   1 
ATOM   741  C CB  . ASN A 1 91  ? 53.279 7.550   22.088  1.00 36.03 ? 91  ASN A CB  1 
ATOM   742  C CG  . ASN A 1 91  ? 54.766 7.736   21.824  1.00 36.69 ? 91  ASN A CG  1 
ATOM   743  O OD1 . ASN A 1 91  ? 55.575 7.580   22.726  1.00 38.45 ? 91  ASN A OD1 1 
ATOM   744  N ND2 . ASN A 1 91  ? 55.129 8.079   20.593  1.00 37.53 ? 91  ASN A ND2 1 
ATOM   745  N N   . ILE A 1 92  ? 50.908 5.613   23.958  1.00 35.70 ? 92  ILE A N   1 
ATOM   746  C CA  . ILE A 1 92  ? 49.446 5.573   24.087  1.00 36.12 ? 92  ILE A CA  1 
ATOM   747  C C   . ILE A 1 92  ? 48.882 6.453   25.212  1.00 36.07 ? 92  ILE A C   1 
ATOM   748  O O   . ILE A 1 92  ? 47.815 7.029   25.069  1.00 35.71 ? 92  ILE A O   1 
ATOM   749  C CB  . ILE A 1 92  ? 48.913 4.137   24.184  1.00 36.34 ? 92  ILE A CB  1 
ATOM   750  C CG1 . ILE A 1 92  ? 47.426 4.118   23.817  1.00 38.46 ? 92  ILE A CG1 1 
ATOM   751  C CG2 . ILE A 1 92  ? 49.271 3.492   25.570  1.00 36.89 ? 92  ILE A CG2 1 
ATOM   752  C CD1 . ILE A 1 92  ? 46.916 2.784   23.256  1.00 43.09 ? 92  ILE A CD1 1 
ATOM   753  N N   . ILE A 1 93  ? 49.627 6.597   26.302  1.00 36.56 ? 93  ILE A N   1 
ATOM   754  C CA  . ILE A 1 93  ? 49.183 7.452   27.401  1.00 37.17 ? 93  ILE A CA  1 
ATOM   755  C C   . ILE A 1 93  ? 49.077 8.901   26.927  1.00 37.12 ? 93  ILE A C   1 
ATOM   756  O O   . ILE A 1 93  ? 48.060 9.541   27.133  1.00 37.53 ? 93  ILE A O   1 
ATOM   757  C CB  . ILE A 1 93  ? 50.098 7.359   28.635  1.00 37.11 ? 93  ILE A CB  1 
ATOM   758  C CG1 . ILE A 1 93  ? 50.246 5.900   29.119  1.00 37.00 ? 93  ILE A CG1 1 
ATOM   759  C CG2 . ILE A 1 93  ? 49.612 8.324   29.741  1.00 37.89 ? 93  ILE A CG2 1 
ATOM   760  C CD1 . ILE A 1 93  ? 49.045 5.298   29.760  1.00 38.31 ? 93  ILE A CD1 1 
ATOM   761  N N   . SER A 1 94  ? 50.121 9.392   26.282  1.00 37.19 ? 94  SER A N   1 
ATOM   762  C CA  . SER A 1 94  ? 50.125 10.730  25.694  1.00 37.83 ? 94  SER A CA  1 
ATOM   763  C C   . SER A 1 94  ? 49.012 10.872  24.643  1.00 38.21 ? 94  SER A C   1 
ATOM   764  O O   . SER A 1 94  ? 48.323 11.898  24.579  1.00 39.50 ? 94  SER A O   1 
ATOM   765  C CB  A SER A 1 94  ? 51.492 10.988  25.056  0.50 37.77 ? 94  SER A CB  1 
ATOM   766  C CB  B SER A 1 94  ? 51.502 11.074  25.113  0.50 37.54 ? 94  SER A CB  1 
ATOM   767  O OG  A SER A 1 94  ? 51.832 12.361  25.094  0.50 39.31 ? 94  SER A OG  1 
ATOM   768  O OG  B SER A 1 94  ? 51.758 10.388  23.903  0.50 36.88 ? 94  SER A OG  1 
ATOM   769  N N   . THR A 1 95  ? 48.811 9.832   23.846  1.00 37.57 ? 95  THR A N   1 
ATOM   770  C CA  . THR A 1 95  ? 47.768 9.825   22.811  1.00 37.98 ? 95  THR A CA  1 
ATOM   771  C C   . THR A 1 95  ? 46.382 10.050  23.415  1.00 37.53 ? 95  THR A C   1 
ATOM   772  O O   . THR A 1 95  ? 45.588 10.811  22.895  1.00 37.62 ? 95  THR A O   1 
ATOM   773  C CB  . THR A 1 95  ? 47.780 8.489   22.040  1.00 37.37 ? 95  THR A CB  1 
ATOM   774  O OG1 . THR A 1 95  ? 49.064 8.345   21.430  1.00 39.13 ? 95  THR A OG1 1 
ATOM   775  C CG2 . THR A 1 95  ? 46.700 8.459   20.971  1.00 36.98 ? 95  THR A CG2 1 
ATOM   776  N N   . PHE A 1 96  ? 46.116 9.397   24.537  1.00 37.28 ? 96  PHE A N   1 
ATOM   777  C CA  . PHE A 1 96  ? 44.859 9.573   25.229  1.00 36.98 ? 96  PHE A CA  1 
ATOM   778  C C   . PHE A 1 96  ? 44.729 10.914  25.918  1.00 36.88 ? 96  PHE A C   1 
ATOM   779  O O   . PHE A 1 96  ? 43.622 11.441  26.017  1.00 37.86 ? 96  PHE A O   1 
ATOM   780  C CB  . PHE A 1 96  ? 44.569 8.382   26.137  1.00 36.50 ? 96  PHE A CB  1 
ATOM   781  C CG  . PHE A 1 96  ? 43.915 7.257   25.407  1.00 37.61 ? 96  PHE A CG  1 
ATOM   782  C CD1 . PHE A 1 96  ? 44.614 6.530   24.453  1.00 37.22 ? 96  PHE A CD1 1 
ATOM   783  C CD2 . PHE A 1 96  ? 42.571 6.971   25.614  1.00 38.09 ? 96  PHE A CD2 1 
ATOM   784  C CE1 . PHE A 1 96  ? 43.979 5.500   23.740  1.00 38.65 ? 96  PHE A CE1 1 
ATOM   785  C CE2 . PHE A 1 96  ? 41.947 5.949   24.906  1.00 37.80 ? 96  PHE A CE2 1 
ATOM   786  C CZ  . PHE A 1 96  ? 42.660 5.216   23.972  1.00 35.99 ? 96  PHE A CZ  1 
ATOM   787  N N   . GLN A 1 97  ? 45.843 11.490  26.364  1.00 36.46 ? 97  GLN A N   1 
ATOM   788  C CA  . GLN A 1 97  ? 45.806 12.840  26.910  1.00 36.82 ? 97  GLN A CA  1 
ATOM   789  C C   . GLN A 1 97  ? 45.235 13.799  25.851  1.00 36.32 ? 97  GLN A C   1 
ATOM   790  O O   . GLN A 1 97  ? 44.466 14.706  26.171  1.00 35.93 ? 97  GLN A O   1 
ATOM   791  C CB  . GLN A 1 97  ? 47.198 13.309  27.384  1.00 36.19 ? 97  GLN A CB  1 
ATOM   792  C CG  . GLN A 1 97  ? 47.546 13.008  28.866  1.00 38.39 ? 97  GLN A CG  1 
ATOM   793  C CD  . GLN A 1 97  ? 46.879 13.949  29.903  1.00 41.60 ? 97  GLN A CD  1 
ATOM   794  O OE1 . GLN A 1 97  ? 46.517 15.100  29.606  1.00 43.91 ? 97  GLN A OE1 1 
ATOM   795  N NE2 . GLN A 1 97  ? 46.750 13.462  31.131  1.00 41.92 ? 97  GLN A NE2 1 
ATOM   796  N N   . ASN A 1 98  ? 45.622 13.575  24.599  1.00 35.89 ? 98  ASN A N   1 
ATOM   797  C CA  . ASN A 1 98  ? 45.154 14.373  23.474  1.00 36.16 ? 98  ASN A CA  1 
ATOM   798  C C   . ASN A 1 98  ? 43.713 14.036  23.101  1.00 36.68 ? 98  ASN A C   1 
ATOM   799  O O   . ASN A 1 98  ? 42.923 14.935  22.836  1.00 36.89 ? 98  ASN A O   1 
ATOM   800  C CB  . ASN A 1 98  ? 46.082 14.174  22.275  1.00 36.21 ? 98  ASN A CB  1 
ATOM   801  C CG  . ASN A 1 98  ? 47.420 14.861  22.461  1.00 37.45 ? 98  ASN A CG  1 
ATOM   802  O OD1 . ASN A 1 98  ? 47.486 15.956  22.999  1.00 38.96 ? 98  ASN A OD1 1 
ATOM   803  N ND2 . ASN A 1 98  ? 48.494 14.217  22.023  1.00 39.55 ? 98  ASN A ND2 1 
ATOM   804  N N   . LEU A 1 99  ? 43.373 12.744  23.095  1.00 36.21 ? 99  LEU A N   1 
ATOM   805  C CA  . LEU A 1 99  ? 42.018 12.303  22.785  1.00 36.42 ? 99  LEU A CA  1 
ATOM   806  C C   . LEU A 1 99  ? 40.972 12.929  23.695  1.00 36.80 ? 99  LEU A C   1 
ATOM   807  O O   . LEU A 1 99  ? 39.872 13.243  23.241  1.00 36.44 ? 99  LEU A O   1 
ATOM   808  C CB  . LEU A 1 99  ? 41.913 10.771  22.812  1.00 35.84 ? 99  LEU A CB  1 
ATOM   809  C CG  . LEU A 1 99  ? 42.595 10.019  21.652  1.00 37.42 ? 99  LEU A CG  1 
ATOM   810  C CD1 . LEU A 1 99  ? 42.634 8.507   21.909  1.00 36.31 ? 99  LEU A CD1 1 
ATOM   811  C CD2 . LEU A 1 99  ? 41.870 10.320  20.301  1.00 34.97 ? 99  LEU A CD2 1 
ATOM   812  N N   . TYR A 1 100 ? 41.328 13.114  24.968  1.00 37.14 ? 100 TYR A N   1 
ATOM   813  C CA  . TYR A 1 100 ? 40.412 13.633  25.973  1.00 37.81 ? 100 TYR A CA  1 
ATOM   814  C C   . TYR A 1 100 ? 40.229 15.155  25.928  1.00 38.07 ? 100 TYR A C   1 
ATOM   815  O O   . TYR A 1 100 ? 39.478 15.693  26.735  1.00 37.29 ? 100 TYR A O   1 
ATOM   816  C CB  . TYR A 1 100 ? 40.813 13.179  27.395  1.00 38.04 ? 100 TYR A CB  1 
ATOM   817  C CG  . TYR A 1 100 ? 40.554 11.706  27.722  1.00 38.70 ? 100 TYR A CG  1 
ATOM   818  C CD1 . TYR A 1 100 ? 41.573 10.904  28.224  1.00 40.11 ? 100 TYR A CD1 1 
ATOM   819  C CD2 . TYR A 1 100 ? 39.295 11.125  27.547  1.00 39.48 ? 100 TYR A CD2 1 
ATOM   820  C CE1 . TYR A 1 100 ? 41.367 9.568   28.535  1.00 39.93 ? 100 TYR A CE1 1 
ATOM   821  C CE2 . TYR A 1 100 ? 39.067 9.780   27.861  1.00 39.69 ? 100 TYR A CE2 1 
ATOM   822  C CZ  . TYR A 1 100 ? 40.114 9.011   28.351  1.00 40.99 ? 100 TYR A CZ  1 
ATOM   823  O OH  . TYR A 1 100 ? 39.933 7.682   28.666  1.00 41.86 ? 100 TYR A OH  1 
ATOM   824  N N   . ARG A 1 101 ? 40.912 15.837  25.007  1.00 39.01 ? 101 ARG A N   1 
ATOM   825  C CA  . ARG A 1 101 ? 40.572 17.224  24.653  1.00 41.27 ? 101 ARG A CA  1 
ATOM   826  C C   . ARG A 1 101 ? 39.450 17.200  23.612  1.00 41.83 ? 101 ARG A C   1 
ATOM   827  O O   . ARG A 1 101 ? 39.559 17.801  22.547  1.00 42.78 ? 101 ARG A O   1 
ATOM   828  C CB  . ARG A 1 101 ? 41.783 17.988  24.099  1.00 41.49 ? 101 ARG A CB  1 
ATOM   829  C CG  . ARG A 1 101 ? 42.983 18.050  25.041  1.00 45.08 ? 101 ARG A CG  1 
ATOM   830  C CD  . ARG A 1 101 ? 44.286 18.326  24.287  1.00 50.52 ? 101 ARG A CD  1 
ATOM   831  N NE  . ARG A 1 101 ? 44.572 19.753  24.138  1.00 54.36 ? 101 ARG A NE  1 
ATOM   832  C CZ  . ARG A 1 101 ? 45.682 20.245  23.581  1.00 57.31 ? 101 ARG A CZ  1 
ATOM   833  N NH1 . ARG A 1 101 ? 46.624 19.428  23.111  1.00 59.30 ? 101 ARG A NH1 1 
ATOM   834  N NH2 . ARG A 1 101 ? 45.862 21.560  23.500  1.00 57.20 ? 101 ARG A NH2 1 
ATOM   835  N N   . CYS A 1 102 ? 38.378 16.488  23.927  1.00 42.39 ? 102 CYS A N   1 
ATOM   836  C CA  . CYS A 1 102 ? 37.259 16.305  23.022  1.00 42.82 ? 102 CYS A CA  1 
ATOM   837  C C   . CYS A 1 102 ? 36.018 16.863  23.702  1.00 43.03 ? 102 CYS A C   1 
ATOM   838  O O   . CYS A 1 102 ? 36.053 17.117  24.900  1.00 43.11 ? 102 CYS A O   1 
ATOM   839  C CB  . CYS A 1 102 ? 37.063 14.815  22.722  1.00 42.25 ? 102 CYS A CB  1 
ATOM   840  S SG  . CYS A 1 102 ? 36.665 13.807  24.165  1.00 41.94 ? 102 CYS A SG  1 
ATOM   841  N N   . PRO A 1 103 ? 34.915 17.036  22.947  1.00 43.62 ? 103 PRO A N   1 
ATOM   842  C CA  . PRO A 1 103 ? 33.642 17.415  23.574  1.00 44.24 ? 103 PRO A CA  1 
ATOM   843  C C   . PRO A 1 103 ? 33.255 16.414  24.667  1.00 44.55 ? 103 PRO A C   1 
ATOM   844  O O   . PRO A 1 103 ? 33.456 15.215  24.494  1.00 44.80 ? 103 PRO A O   1 
ATOM   845  C CB  . PRO A 1 103 ? 32.638 17.334  22.420  1.00 44.47 ? 103 PRO A CB  1 
ATOM   846  C CG  . PRO A 1 103 ? 33.449 17.417  21.176  1.00 43.99 ? 103 PRO A CG  1 
ATOM   847  C CD  . PRO A 1 103 ? 34.799 16.877  21.485  1.00 43.67 ? 103 PRO A CD  1 
ATOM   848  N N   . GLY A 1 104 ? 32.727 16.904  25.783  1.00 44.85 ? 104 GLY A N   1 
ATOM   849  C CA  . GLY A 1 104 ? 32.287 16.040  26.887  1.00 45.45 ? 104 GLY A CA  1 
ATOM   850  C C   . GLY A 1 104 ? 31.352 14.913  26.467  1.00 45.71 ? 104 GLY A C   1 
ATOM   851  O O   . GLY A 1 104 ? 31.449 13.790  26.981  1.00 46.02 ? 104 GLY A O   1 
ATOM   852  N N   . ASP A 1 105 ? 30.458 15.210  25.523  1.00 45.67 ? 105 ASP A N   1 
ATOM   853  C CA  . ASP A 1 105 ? 29.563 14.210  24.933  1.00 46.10 ? 105 ASP A CA  1 
ATOM   854  C C   . ASP A 1 105 ? 30.299 13.033  24.265  1.00 45.92 ? 105 ASP A C   1 
ATOM   855  O O   . ASP A 1 105 ? 29.691 12.000  23.976  1.00 46.68 ? 105 ASP A O   1 
ATOM   856  C CB  . ASP A 1 105 ? 28.647 14.878  23.901  1.00 46.23 ? 105 ASP A CB  1 
ATOM   857  C CG  . ASP A 1 105 ? 27.415 15.515  24.523  1.00 47.46 ? 105 ASP A CG  1 
ATOM   858  O OD1 . ASP A 1 105 ? 27.533 16.196  25.569  1.00 48.29 ? 105 ASP A OD1 1 
ATOM   859  O OD2 . ASP A 1 105 ? 26.318 15.339  23.947  1.00 47.88 ? 105 ASP A OD2 1 
ATOM   860  N N   . ASP A 1 106 ? 31.597 13.194  24.023  1.00 45.35 ? 106 ASP A N   1 
ATOM   861  C CA  . ASP A 1 106 ? 32.399 12.217  23.272  1.00 44.63 ? 106 ASP A CA  1 
ATOM   862  C C   . ASP A 1 106 ? 33.308 11.336  24.137  1.00 43.97 ? 106 ASP A C   1 
ATOM   863  O O   . ASP A 1 106 ? 33.904 10.385  23.638  1.00 43.95 ? 106 ASP A O   1 
ATOM   864  C CB  . ASP A 1 106 ? 33.249 12.947  22.236  1.00 44.82 ? 106 ASP A CB  1 
ATOM   865  C CG  . ASP A 1 106 ? 32.483 13.288  20.968  1.00 46.74 ? 106 ASP A CG  1 
ATOM   866  O OD1 . ASP A 1 106 ? 31.227 13.299  20.968  1.00 48.44 ? 106 ASP A OD1 1 
ATOM   867  O OD2 . ASP A 1 106 ? 33.160 13.565  19.952  1.00 49.02 ? 106 ASP A OD2 1 
ATOM   868  N N   . LYS A 1 107 ? 33.407 11.649  25.426  1.00 43.06 ? 107 LYS A N   1 
ATOM   869  C CA  . LYS A 1 107 ? 34.195 10.862  26.375  1.00 42.62 ? 107 LYS A CA  1 
ATOM   870  C C   . LYS A 1 107 ? 33.642 9.455   26.584  1.00 41.67 ? 107 LYS A C   1 
ATOM   871  O O   . LYS A 1 107 ? 34.401 8.509   26.778  1.00 40.89 ? 107 LYS A O   1 
ATOM   872  C CB  . LYS A 1 107 ? 34.319 11.598  27.719  1.00 43.17 ? 107 LYS A CB  1 
ATOM   873  C CG  . LYS A 1 107 ? 35.140 10.872  28.800  1.00 45.68 ? 107 LYS A CG  1 
ATOM   874  C CD  . LYS A 1 107 ? 34.218 10.132  29.812  1.00 49.09 ? 107 LYS A CD  1 
ATOM   875  C CE  . LYS A 1 107 ? 34.901 9.891   31.176  1.00 48.78 ? 107 LYS A CE  1 
ATOM   876  N NZ  . LYS A 1 107 ? 34.093 8.975   32.046  1.00 46.67 ? 107 LYS A NZ  1 
ATOM   877  N N   . SER A 1 108 ? 32.321 9.319   26.553  1.00 40.70 ? 108 SER A N   1 
ATOM   878  C CA  . SER A 1 108 ? 31.707 8.015   26.709  1.00 40.49 ? 108 SER A CA  1 
ATOM   879  C C   . SER A 1 108 ? 32.129 7.073   25.571  1.00 39.94 ? 108 SER A C   1 
ATOM   880  O O   . SER A 1 108 ? 32.223 5.870   25.763  1.00 39.66 ? 108 SER A O   1 
ATOM   881  C CB  . SER A 1 108 ? 30.178 8.144   26.814  1.00 40.94 ? 108 SER A CB  1 
ATOM   882  O OG  . SER A 1 108 ? 29.637 8.733   25.639  1.00 41.37 ? 108 SER A OG  1 
ATOM   883  N N   . LYS A 1 109 ? 32.427 7.643   24.406  1.00 39.65 ? 109 LYS A N   1 
ATOM   884  C CA  . LYS A 1 109 ? 32.835 6.873   23.232  1.00 39.80 ? 109 LYS A CA  1 
ATOM   885  C C   . LYS A 1 109 ? 34.262 6.338   23.372  1.00 39.22 ? 109 LYS A C   1 
ATOM   886  O O   . LYS A 1 109 ? 34.546 5.192   23.011  1.00 38.68 ? 109 LYS A O   1 
ATOM   887  C CB  . LYS A 1 109 ? 32.690 7.719   21.966  1.00 39.80 ? 109 LYS A CB  1 
ATOM   888  C CG  . LYS A 1 109 ? 31.257 8.143   21.687  1.00 42.36 ? 109 LYS A CG  1 
ATOM   889  C CD  . LYS A 1 109 ? 31.187 9.109   20.524  1.00 45.90 ? 109 LYS A CD  1 
ATOM   890  C CE  . LYS A 1 109 ? 29.753 9.500   20.223  1.00 48.77 ? 109 LYS A CE  1 
ATOM   891  N NZ  . LYS A 1 109 ? 29.554 9.668   18.739  1.00 51.31 ? 109 LYS A NZ  1 
ATOM   892  N N   . ILE A 1 110 ? 35.143 7.181   23.900  1.00 38.83 ? 110 ILE A N   1 
ATOM   893  C CA  . ILE A 1 110 ? 36.504 6.802   24.233  1.00 39.19 ? 110 ILE A CA  1 
ATOM   894  C C   . ILE A 1 110 ? 36.534 5.640   25.253  1.00 38.58 ? 110 ILE A C   1 
ATOM   895  O O   . ILE A 1 110 ? 37.200 4.634   25.029  1.00 38.42 ? 110 ILE A O   1 
ATOM   896  C CB  . ILE A 1 110 ? 37.310 8.023   24.751  1.00 39.31 ? 110 ILE A CB  1 
ATOM   897  C CG1 . ILE A 1 110 ? 37.276 9.156   23.712  1.00 39.99 ? 110 ILE A CG1 1 
ATOM   898  C CG2 . ILE A 1 110 ? 38.771 7.641   25.039  1.00 39.17 ? 110 ILE A CG2 1 
ATOM   899  C CD1 . ILE A 1 110 ? 37.859 10.468  24.226  1.00 39.76 ? 110 ILE A CD1 1 
ATOM   900  N N   . VAL A 1 111 ? 35.793 5.782   26.346  1.00 38.45 ? 111 VAL A N   1 
ATOM   901  C CA  . VAL A 1 111 ? 35.726 4.757   27.394  1.00 38.43 ? 111 VAL A CA  1 
ATOM   902  C C   . VAL A 1 111 ? 35.146 3.454   26.850  1.00 38.65 ? 111 VAL A C   1 
ATOM   903  O O   . VAL A 1 111 ? 35.582 2.358   27.225  1.00 38.97 ? 111 VAL A O   1 
ATOM   904  C CB  . VAL A 1 111 ? 34.917 5.249   28.612  1.00 38.57 ? 111 VAL A CB  1 
ATOM   905  C CG1 . VAL A 1 111 ? 34.831 4.183   29.692  1.00 39.06 ? 111 VAL A CG1 1 
ATOM   906  C CG2 . VAL A 1 111 ? 35.531 6.535   29.187  1.00 37.26 ? 111 VAL A CG2 1 
ATOM   907  N N   . ARG A 1 112 ? 34.167 3.570   25.957  1.00 38.22 ? 112 ARG A N   1 
ATOM   908  C CA  . ARG A 1 112 ? 33.586 2.397   25.336  1.00 37.87 ? 112 ARG A CA  1 
ATOM   909  C C   . ARG A 1 112 ? 34.623 1.587   24.543  1.00 37.21 ? 112 ARG A C   1 
ATOM   910  O O   . ARG A 1 112 ? 34.646 0.359   24.657  1.00 37.38 ? 112 ARG A O   1 
ATOM   911  C CB  . ARG A 1 112 ? 32.408 2.781   24.451  1.00 37.98 ? 112 ARG A CB  1 
ATOM   912  C CG  . ARG A 1 112 ? 31.674 1.585   23.922  1.00 39.00 ? 112 ARG A CG  1 
ATOM   913  C CD  . ARG A 1 112 ? 30.583 1.964   22.967  1.00 41.54 ? 112 ARG A CD  1 
ATOM   914  N NE  . ARG A 1 112 ? 29.950 0.753   22.459  1.00 44.57 ? 112 ARG A NE  1 
ATOM   915  C CZ  . ARG A 1 112 ? 29.603 0.555   21.192  1.00 43.96 ? 112 ARG A CZ  1 
ATOM   916  N NH1 . ARG A 1 112 ? 29.818 1.493   20.282  1.00 43.90 ? 112 ARG A NH1 1 
ATOM   917  N NH2 . ARG A 1 112 ? 29.041 -0.591  20.844  1.00 45.29 ? 112 ARG A NH2 1 
ATOM   918  N N   . VAL A 1 113 ? 35.460 2.269   23.752  1.00 36.48 ? 113 VAL A N   1 
ATOM   919  C CA  . VAL A 1 113 ? 36.552 1.623   23.002  1.00 35.89 ? 113 VAL A CA  1 
ATOM   920  C C   . VAL A 1 113 ? 37.573 0.968   23.978  1.00 35.83 ? 113 VAL A C   1 
ATOM   921  O O   . VAL A 1 113 ? 37.982 -0.183  23.790  1.00 35.55 ? 113 VAL A O   1 
ATOM   922  C CB  . VAL A 1 113 ? 37.265 2.616   22.027  1.00 36.28 ? 113 VAL A CB  1 
ATOM   923  C CG1 . VAL A 1 113 ? 38.514 1.996   21.426  1.00 36.09 ? 113 VAL A CG1 1 
ATOM   924  C CG2 . VAL A 1 113 ? 36.345 3.070   20.884  1.00 35.03 ? 113 VAL A CG2 1 
ATOM   925  N N   . LEU A 1 114 ? 37.967 1.696   25.024  1.00 34.78 ? 114 LEU A N   1 
ATOM   926  C CA  . LEU A 1 114 ? 38.861 1.130   26.044  1.00 34.25 ? 114 LEU A CA  1 
ATOM   927  C C   . LEU A 1 114 ? 38.310 -0.156  26.630  1.00 34.23 ? 114 LEU A C   1 
ATOM   928  O O   . LEU A 1 114 ? 39.042 -1.139  26.729  1.00 34.34 ? 114 LEU A O   1 
ATOM   929  C CB  . LEU A 1 114 ? 39.128 2.106   27.176  1.00 33.82 ? 114 LEU A CB  1 
ATOM   930  C CG  . LEU A 1 114 ? 39.999 3.306   26.827  1.00 32.08 ? 114 LEU A CG  1 
ATOM   931  C CD1 . LEU A 1 114 ? 40.044 4.244   28.011  1.00 30.82 ? 114 LEU A CD1 1 
ATOM   932  C CD2 . LEU A 1 114 ? 41.378 2.796   26.458  1.00 31.46 ? 114 LEU A CD2 1 
ATOM   933  N N   . ASN A 1 115 ? 37.031 -0.131  27.009  1.00 33.46 ? 115 ASN A N   1 
ATOM   934  C CA  . ASN A 1 115 ? 36.303 -1.308  27.495  1.00 33.47 ? 115 ASN A CA  1 
ATOM   935  C C   . ASN A 1 115 ? 36.327 -2.490  26.517  1.00 32.96 ? 115 ASN A C   1 
ATOM   936  O O   . ASN A 1 115 ? 36.552 -3.639  26.906  1.00 32.51 ? 115 ASN A O   1 
ATOM   937  C CB  . ASN A 1 115 ? 34.869 -0.914  27.844  1.00 32.88 ? 115 ASN A CB  1 
ATOM   938  C CG  . ASN A 1 115 ? 34.716 -0.476  29.288  1.00 35.10 ? 115 ASN A CG  1 
ATOM   939  O OD1 . ASN A 1 115 ? 34.548 -1.308  30.170  1.00 38.90 ? 115 ASN A OD1 1 
ATOM   940  N ND2 . ASN A 1 115 ? 34.757 0.824   29.534  1.00 35.57 ? 115 ASN A ND2 1 
ATOM   941  N N   . LEU A 1 116 ? 36.102 -2.199  25.243  1.00 33.08 ? 116 LEU A N   1 
ATOM   942  C CA  . LEU A 1 116 ? 36.123 -3.224  24.187  1.00 33.45 ? 116 LEU A CA  1 
ATOM   943  C C   . LEU A 1 116 ? 37.522 -3.804  23.974  1.00 33.57 ? 116 LEU A C   1 
ATOM   944  O O   . LEU A 1 116 ? 37.688 -5.014  23.808  1.00 33.61 ? 116 LEU A O   1 
ATOM   945  C CB  . LEU A 1 116 ? 35.585 -2.642  22.873  1.00 33.28 ? 116 LEU A CB  1 
ATOM   946  C CG  . LEU A 1 116 ? 34.060 -2.538  22.820  1.00 33.63 ? 116 LEU A CG  1 
ATOM   947  C CD1 . LEU A 1 116 ? 33.639 -1.602  21.701  1.00 34.49 ? 116 LEU A CD1 1 
ATOM   948  C CD2 . LEU A 1 116 ? 33.432 -3.935  22.642  1.00 33.17 ? 116 LEU A CD2 1 
ATOM   949  N N   . TRP A 1 117 ? 38.511 -2.919  23.967  1.00 33.35 ? 117 TRP A N   1 
ATOM   950  C CA  . TRP A 1 117 ? 39.932 -3.281  23.923  1.00 33.95 ? 117 TRP A CA  1 
ATOM   951  C C   . TRP A 1 117 ? 40.341 -4.225  25.057  1.00 34.08 ? 117 TRP A C   1 
ATOM   952  O O   . TRP A 1 117 ? 41.077 -5.190  24.834  1.00 34.75 ? 117 TRP A O   1 
ATOM   953  C CB  . TRP A 1 117 ? 40.771 -2.005  24.006  1.00 33.70 ? 117 TRP A CB  1 
ATOM   954  C CG  . TRP A 1 117 ? 40.893 -1.263  22.740  1.00 33.87 ? 117 TRP A CG  1 
ATOM   955  C CD1 . TRP A 1 117 ? 40.287 -1.556  21.553  1.00 33.96 ? 117 TRP A CD1 1 
ATOM   956  C CD2 . TRP A 1 117 ? 41.643 -0.053  22.523  1.00 33.63 ? 117 TRP A CD2 1 
ATOM   957  N NE1 . TRP A 1 117 ? 40.641 -0.632  20.603  1.00 34.23 ? 117 TRP A NE1 1 
ATOM   958  C CE2 . TRP A 1 117 ? 41.479 0.297   21.166  1.00 33.52 ? 117 TRP A CE2 1 
ATOM   959  C CE3 . TRP A 1 117 ? 42.466 0.743   23.340  1.00 34.21 ? 117 TRP A CE3 1 
ATOM   960  C CZ2 . TRP A 1 117 ? 42.087 1.428   20.596  1.00 34.14 ? 117 TRP A CZ2 1 
ATOM   961  C CZ3 . TRP A 1 117 ? 43.065 1.867   22.792  1.00 33.22 ? 117 TRP A CZ3 1 
ATOM   962  C CH2 . TRP A 1 117 ? 42.878 2.198   21.421  1.00 35.71 ? 117 TRP A CH2 1 
ATOM   963  N N   . GLN A 1 118 ? 39.886 -3.939  26.276  1.00 33.88 ? 118 GLN A N   1 
ATOM   964  C CA  . GLN A 1 118 ? 40.125 -4.831  27.413  1.00 33.54 ? 118 GLN A CA  1 
ATOM   965  C C   . GLN A 1 118 ? 39.432 -6.192  27.231  1.00 33.95 ? 118 GLN A C   1 
ATOM   966  O O   . GLN A 1 118 ? 40.037 -7.263  27.458  1.00 33.63 ? 118 GLN A O   1 
ATOM   967  C CB  . GLN A 1 118 ? 39.655 -4.188  28.727  1.00 33.01 ? 118 GLN A CB  1 
ATOM   968  C CG  . GLN A 1 118 ? 40.313 -4.845  29.966  1.00 33.00 ? 118 GLN A CG  1 
ATOM   969  C CD  . GLN A 1 118 ? 39.665 -4.496  31.302  1.00 33.50 ? 118 GLN A CD  1 
ATOM   970  O OE1 . GLN A 1 118 ? 38.498 -4.096  31.379  1.00 32.60 ? 118 GLN A OE1 1 
ATOM   971  N NE2 . GLN A 1 118 ? 40.435 -4.662  32.371  1.00 33.73 ? 118 GLN A NE2 1 
ATOM   972  N N   . LYS A 1 119 ? 38.157 -6.158  26.853  1.00 34.50 ? 119 LYS A N   1 
ATOM   973  C CA  . LYS A 1 119 ? 37.389 -7.402  26.703  1.00 36.11 ? 119 LYS A CA  1 
ATOM   974  C C   . LYS A 1 119 ? 38.025 -8.292  25.637  1.00 36.83 ? 119 LYS A C   1 
ATOM   975  O O   . LYS A 1 119 ? 38.146 -9.503  25.818  1.00 37.48 ? 119 LYS A O   1 
ATOM   976  C CB  . LYS A 1 119 ? 35.909 -7.122  26.392  1.00 35.84 ? 119 LYS A CB  1 
ATOM   977  C CG  . LYS A 1 119 ? 35.092 -8.357  26.056  1.00 37.45 ? 119 LYS A CG  1 
ATOM   978  C CD  . LYS A 1 119 ? 35.081 -8.633  24.560  1.00 39.04 ? 119 LYS A CD  1 
ATOM   979  C CE  . LYS A 1 119 ? 34.855 -10.097 24.248  1.00 41.17 ? 119 LYS A CE  1 
ATOM   980  N NZ  . LYS A 1 119 ? 34.919 -10.318 22.764  1.00 41.59 ? 119 LYS A NZ  1 
ATOM   981  N N   . ASN A 1 120 ? 38.457 -7.674  24.544  1.00 38.06 ? 120 ASN A N   1 
ATOM   982  C CA  . ASN A 1 120 ? 39.046 -8.384  23.419  1.00 39.34 ? 120 ASN A CA  1 
ATOM   983  C C   . ASN A 1 120 ? 40.549 -8.580  23.511  1.00 40.00 ? 120 ASN A C   1 
ATOM   984  O O   . ASN A 1 120 ? 41.171 -9.089  22.579  1.00 39.75 ? 120 ASN A O   1 
ATOM   985  C CB  . ASN A 1 120 ? 38.674 -7.669  22.116  1.00 39.10 ? 120 ASN A CB  1 
ATOM   986  C CG  . ASN A 1 120 ? 37.207 -7.812  21.794  1.00 40.09 ? 120 ASN A CG  1 
ATOM   987  O OD1 . ASN A 1 120 ? 36.680 -8.924  21.772  1.00 42.80 ? 120 ASN A OD1 1 
ATOM   988  N ND2 . ASN A 1 120 ? 36.530 -6.695  21.563  1.00 39.69 ? 120 ASN A ND2 1 
ATOM   989  N N   . ASN A 1 121 ? 41.127 -8.159  24.636  1.00 41.30 ? 121 ASN A N   1 
ATOM   990  C CA  . ASN A 1 121 ? 42.565 -8.284  24.888  1.00 42.02 ? 121 ASN A CA  1 
ATOM   991  C C   . ASN A 1 121 ? 43.407 -7.680  23.757  1.00 42.42 ? 121 ASN A C   1 
ATOM   992  O O   . ASN A 1 121 ? 44.484 -8.182  23.422  1.00 42.40 ? 121 ASN A O   1 
ATOM   993  C CB  . ASN A 1 121 ? 42.940 -9.745  25.186  1.00 42.15 ? 121 ASN A CB  1 
ATOM   994  C CG  . ASN A 1 121 ? 42.554 -10.166 26.595  1.00 43.79 ? 121 ASN A CG  1 
ATOM   995  O OD1 . ASN A 1 121 ? 43.069 -9.625  27.576  1.00 44.25 ? 121 ASN A OD1 1 
ATOM   996  N ND2 . ASN A 1 121 ? 41.644 -11.143 26.706  1.00 45.69 ? 121 ASN A ND2 1 
ATOM   997  N N   . VAL A 1 122 ? 42.903 -6.580  23.199  1.00 42.46 ? 122 VAL A N   1 
ATOM   998  C CA  . VAL A 1 122 ? 43.611 -5.821  22.179  1.00 43.48 ? 122 VAL A CA  1 
ATOM   999  C C   . VAL A 1 122 ? 44.952 -5.288  22.694  1.00 44.18 ? 122 VAL A C   1 
ATOM   1000 O O   . VAL A 1 122 ? 45.940 -5.275  21.966  1.00 44.45 ? 122 VAL A O   1 
ATOM   1001 C CB  . VAL A 1 122 ? 42.739 -4.683  21.603  1.00 42.78 ? 122 VAL A CB  1 
ATOM   1002 C CG1 . VAL A 1 122 ? 43.530 -3.858  20.634  1.00 43.74 ? 122 VAL A CG1 1 
ATOM   1003 C CG2 . VAL A 1 122 ? 41.530 -5.250  20.908  1.00 42.26 ? 122 VAL A CG2 1 
ATOM   1004 N N   . PHE A 1 123 ? 44.976 -4.849  23.946  1.00 45.21 ? 123 PHE A N   1 
ATOM   1005 C CA  . PHE A 1 123 ? 46.201 -4.381  24.579  1.00 46.07 ? 123 PHE A CA  1 
ATOM   1006 C C   . PHE A 1 123 ? 46.283 -5.134  25.883  1.00 47.03 ? 123 PHE A C   1 
ATOM   1007 O O   . PHE A 1 123 ? 45.248 -5.442  26.472  1.00 47.69 ? 123 PHE A O   1 
ATOM   1008 C CB  . PHE A 1 123 ? 46.140 -2.873  24.865  1.00 45.56 ? 123 PHE A CB  1 
ATOM   1009 C CG  . PHE A 1 123 ? 46.251 -2.010  23.643  1.00 45.71 ? 123 PHE A CG  1 
ATOM   1010 C CD1 . PHE A 1 123 ? 47.489 -1.547  23.215  1.00 46.39 ? 123 PHE A CD1 1 
ATOM   1011 C CD2 . PHE A 1 123 ? 45.119 -1.640  22.927  1.00 45.81 ? 123 PHE A CD2 1 
ATOM   1012 C CE1 . PHE A 1 123 ? 47.595 -0.733  22.089  1.00 44.94 ? 123 PHE A CE1 1 
ATOM   1013 C CE2 . PHE A 1 123 ? 45.212 -0.838  21.785  1.00 44.37 ? 123 PHE A CE2 1 
ATOM   1014 C CZ  . PHE A 1 123 ? 46.459 -0.384  21.367  1.00 45.30 ? 123 PHE A CZ  1 
ATOM   1015 N N   . LYS A 1 124 ? 47.491 -5.425  26.357  1.00 48.06 ? 124 LYS A N   1 
ATOM   1016 C CA  . LYS A 1 124 ? 47.608 -6.120  27.636  1.00 49.35 ? 124 LYS A CA  1 
ATOM   1017 C C   . LYS A 1 124 ? 47.179 -5.180  28.765  1.00 49.70 ? 124 LYS A C   1 
ATOM   1018 O O   . LYS A 1 124 ? 47.212 -3.957  28.591  1.00 49.19 ? 124 LYS A O   1 
ATOM   1019 C CB  . LYS A 1 124 ? 49.014 -6.691  27.836  1.00 49.67 ? 124 LYS A CB  1 
ATOM   1020 C CG  . LYS A 1 124 ? 49.057 -7.870  28.814  1.00 51.14 ? 124 LYS A CG  1 
ATOM   1021 C CD  . LYS A 1 124 ? 50.132 -8.872  28.421  1.00 53.17 ? 124 LYS A CD  1 
ATOM   1022 C CE  . LYS A 1 124 ? 50.637 -9.644  29.620  1.00 54.01 ? 124 LYS A CE  1 
ATOM   1023 N NZ  . LYS A 1 124 ? 51.552 -8.803  30.446  1.00 55.86 ? 124 LYS A NZ  1 
ATOM   1024 N N   . SER A 1 125 ? 46.760 -5.744  29.899  1.00 50.19 ? 125 SER A N   1 
ATOM   1025 C CA  . SER A 1 125 ? 46.080 -4.975  30.949  1.00 50.84 ? 125 SER A CA  1 
ATOM   1026 C C   . SER A 1 125 ? 46.951 -3.900  31.607  1.00 50.93 ? 125 SER A C   1 
ATOM   1027 O O   . SER A 1 125 ? 46.433 -2.959  32.228  1.00 51.04 ? 125 SER A O   1 
ATOM   1028 C CB  . SER A 1 125 ? 45.497 -5.910  32.004  1.00 51.44 ? 125 SER A CB  1 
ATOM   1029 O OG  . SER A 1 125 ? 44.817 -5.184  33.028  1.00 53.24 ? 125 SER A OG  1 
ATOM   1030 N N   . GLU A 1 126 ? 48.267 -4.037  31.462  1.00 50.64 ? 126 GLU A N   1 
ATOM   1031 C CA  . GLU A 1 126 ? 49.209 -3.041  31.973  1.00 50.63 ? 126 GLU A CA  1 
ATOM   1032 C C   . GLU A 1 126 ? 49.123 -1.732  31.166  1.00 49.79 ? 126 GLU A C   1 
ATOM   1033 O O   . GLU A 1 126 ? 49.541 -0.677  31.635  1.00 49.65 ? 126 GLU A O   1 
ATOM   1034 C CB  . GLU A 1 126 ? 50.634 -3.614  31.987  1.00 51.15 ? 126 GLU A CB  1 
ATOM   1035 C CG  . GLU A 1 126 ? 51.168 -4.004  30.603  1.00 53.06 ? 126 GLU A CG  1 
ATOM   1036 C CD  . GLU A 1 126 ? 51.539 -5.480  30.481  1.00 56.18 ? 126 GLU A CD  1 
ATOM   1037 O OE1 . GLU A 1 126 ? 51.103 -6.297  31.326  1.00 57.20 ? 126 GLU A OE1 1 
ATOM   1038 O OE2 . GLU A 1 126 ? 52.255 -5.828  29.512  1.00 58.37 ? 126 GLU A OE2 1 
ATOM   1039 N N   . ILE A 1 127 ? 48.573 -1.832  29.957  1.00 48.86 ? 127 ILE A N   1 
ATOM   1040 C CA  . ILE A 1 127 ? 48.275 -0.686  29.093  1.00 48.08 ? 127 ILE A CA  1 
ATOM   1041 C C   . ILE A 1 127 ? 46.850 -0.174  29.367  1.00 47.02 ? 127 ILE A C   1 
ATOM   1042 O O   . ILE A 1 127 ? 46.633 0.985   29.720  1.00 46.40 ? 127 ILE A O   1 
ATOM   1043 C CB  . ILE A 1 127 ? 48.361 -1.078  27.587  1.00 48.19 ? 127 ILE A CB  1 
ATOM   1044 C CG1 . ILE A 1 127 ? 49.690 -1.778  27.234  1.00 48.87 ? 127 ILE A CG1 1 
ATOM   1045 C CG2 . ILE A 1 127 ? 48.079 0.118   26.687  1.00 49.38 ? 127 ILE A CG2 1 
ATOM   1046 C CD1 . ILE A 1 127 ? 50.969 -1.003  27.604  1.00 49.74 ? 127 ILE A CD1 1 
ATOM   1047 N N   . ILE A 1 128 ? 45.881 -1.065  29.209  1.00 46.10 ? 128 ILE A N   1 
ATOM   1048 C CA  . ILE A 1 128 ? 44.477 -0.699  29.259  1.00 45.13 ? 128 ILE A CA  1 
ATOM   1049 C C   . ILE A 1 128 ? 44.052 -0.090  30.588  1.00 43.82 ? 128 ILE A C   1 
ATOM   1050 O O   . ILE A 1 128 ? 43.371 0.932   30.602  1.00 43.51 ? 128 ILE A O   1 
ATOM   1051 C CB  . ILE A 1 128 ? 43.565 -1.895  28.816  1.00 45.59 ? 128 ILE A CB  1 
ATOM   1052 C CG1 . ILE A 1 128 ? 43.400 -1.886  27.312  1.00 45.68 ? 128 ILE A CG1 1 
ATOM   1053 C CG2 . ILE A 1 128 ? 42.190 -1.807  29.427  1.00 46.53 ? 128 ILE A CG2 1 
ATOM   1054 C CD1 . ILE A 1 128 ? 42.810 -0.597  26.777  1.00 48.11 ? 128 ILE A CD1 1 
ATOM   1055 N N   . GLN A 1 129 ? 44.474 -0.687  31.704  1.00 43.17 ? 129 GLN A N   1 
ATOM   1056 C CA  . GLN A 1 129 ? 43.998 -0.221  32.997  1.00 42.29 ? 129 GLN A CA  1 
ATOM   1057 C C   . GLN A 1 129 ? 44.363 1.239   33.309  1.00 41.64 ? 129 GLN A C   1 
ATOM   1058 O O   . GLN A 1 129 ? 43.496 1.991   33.761  1.00 41.31 ? 129 GLN A O   1 
ATOM   1059 C CB  . GLN A 1 129 ? 44.421 -1.163  34.125  1.00 43.04 ? 129 GLN A CB  1 
ATOM   1060 C CG  . GLN A 1 129 ? 43.311 -1.407  35.153  1.00 43.85 ? 129 GLN A CG  1 
ATOM   1061 C CD  . GLN A 1 129 ? 42.179 -2.292  34.609  1.00 43.83 ? 129 GLN A CD  1 
ATOM   1062 O OE1 . GLN A 1 129 ? 42.339 -2.995  33.600  1.00 43.68 ? 129 GLN A OE1 1 
ATOM   1063 N NE2 . GLN A 1 129 ? 41.028 -2.261  35.286  1.00 45.95 ? 129 GLN A NE2 1 
ATOM   1064 N N   . PRO A 1 130 ? 45.640 1.649   33.089  1.00 40.81 ? 130 PRO A N   1 
ATOM   1065 C CA  . PRO A 1 130 ? 45.991 3.074   33.224  1.00 40.20 ? 130 PRO A CA  1 
ATOM   1066 C C   . PRO A 1 130 ? 45.116 3.983   32.373  1.00 39.03 ? 130 PRO A C   1 
ATOM   1067 O O   . PRO A 1 130 ? 44.687 5.037   32.829  1.00 39.33 ? 130 PRO A O   1 
ATOM   1068 C CB  . PRO A 1 130 ? 47.437 3.123   32.730  1.00 40.13 ? 130 PRO A CB  1 
ATOM   1069 C CG  . PRO A 1 130 ? 47.968 1.790   33.089  1.00 41.31 ? 130 PRO A CG  1 
ATOM   1070 C CD  . PRO A 1 130 ? 46.835 0.844   32.774  1.00 40.92 ? 130 PRO A CD  1 
ATOM   1071 N N   . LEU A 1 131 ? 44.836 3.565   31.147  1.00 38.45 ? 131 LEU A N   1 
ATOM   1072 C CA  . LEU A 1 131 ? 43.974 4.339   30.274  1.00 37.46 ? 131 LEU A CA  1 
ATOM   1073 C C   . LEU A 1 131 ? 42.580 4.432   30.864  1.00 37.92 ? 131 LEU A C   1 
ATOM   1074 O O   . LEU A 1 131 ? 41.983 5.512   30.846  1.00 38.27 ? 131 LEU A O   1 
ATOM   1075 C CB  . LEU A 1 131 ? 43.946 3.741   28.876  1.00 36.71 ? 131 LEU A CB  1 
ATOM   1076 C CG  . LEU A 1 131 ? 45.270 3.725   28.100  1.00 35.05 ? 131 LEU A CG  1 
ATOM   1077 C CD1 . LEU A 1 131 ? 45.088 2.995   26.791  1.00 33.54 ? 131 LEU A CD1 1 
ATOM   1078 C CD2 . LEU A 1 131 ? 45.822 5.139   27.875  1.00 32.58 ? 131 LEU A CD2 1 
ATOM   1079 N N   . LEU A 1 132 ? 42.085 3.311   31.410  1.00 37.87 ? 132 LEU A N   1 
ATOM   1080 C CA  . LEU A 1 132 ? 40.778 3.275   32.075  1.00 38.22 ? 132 LEU A CA  1 
ATOM   1081 C C   . LEU A 1 132 ? 40.796 4.145   33.325  1.00 38.17 ? 132 LEU A C   1 
ATOM   1082 O O   . LEU A 1 132 ? 39.885 4.945   33.538  1.00 37.98 ? 132 LEU A O   1 
ATOM   1083 C CB  . LEU A 1 132 ? 40.349 1.836   32.401  1.00 37.91 ? 132 LEU A CB  1 
ATOM   1084 C CG  . LEU A 1 132 ? 39.824 1.001   31.219  1.00 38.99 ? 132 LEU A CG  1 
ATOM   1085 C CD1 . LEU A 1 132 ? 39.878 -0.458  31.546  1.00 40.96 ? 132 LEU A CD1 1 
ATOM   1086 C CD2 . LEU A 1 132 ? 38.416 1.399   30.849  1.00 38.43 ? 132 LEU A CD2 1 
ATOM   1087 N N   . ASP A 1 133 ? 41.850 4.006   34.130  1.00 38.49 ? 133 ASP A N   1 
ATOM   1088 C CA  . ASP A 1 133 ? 42.085 4.910   35.274  1.00 39.23 ? 133 ASP A CA  1 
ATOM   1089 C C   . ASP A 1 133 ? 42.026 6.377   34.869  1.00 38.92 ? 133 ASP A C   1 
ATOM   1090 O O   . ASP A 1 133 ? 41.466 7.197   35.589  1.00 38.37 ? 133 ASP A O   1 
ATOM   1091 C CB  . ASP A 1 133 ? 43.426 4.610   35.962  1.00 39.49 ? 133 ASP A CB  1 
ATOM   1092 C CG  . ASP A 1 133 ? 43.471 3.221   36.584  1.00 41.09 ? 133 ASP A CG  1 
ATOM   1093 O OD1 . ASP A 1 133 ? 42.390 2.669   36.880  1.00 42.85 ? 133 ASP A OD1 1 
ATOM   1094 O OD2 . ASP A 1 133 ? 44.584 2.676   36.774  1.00 43.12 ? 133 ASP A OD2 1 
ATOM   1095 N N   . MET A 1 134 ? 42.580 6.697   33.699  1.00 39.00 ? 134 MET A N   1 
ATOM   1096 C CA  . MET A 1 134 ? 42.637 8.085   33.229  1.00 39.41 ? 134 MET A CA  1 
ATOM   1097 C C   . MET A 1 134 ? 41.256 8.678   32.952  1.00 39.70 ? 134 MET A C   1 
ATOM   1098 O O   . MET A 1 134 ? 40.989 9.834   33.293  1.00 39.67 ? 134 MET A O   1 
ATOM   1099 C CB  . MET A 1 134 ? 43.514 8.170   31.980  1.00 39.72 ? 134 MET A CB  1 
ATOM   1100 C CG  . MET A 1 134 ? 44.616 9.193   32.028  1.00 39.03 ? 134 MET A CG  1 
ATOM   1101 S SD  . MET A 1 134 ? 45.670 8.978   30.567  1.00 39.08 ? 134 MET A SD  1 
ATOM   1102 C CE  . MET A 1 134 ? 44.991 10.213  29.467  1.00 39.78 ? 134 MET A CE  1 
ATOM   1103 N N   . ALA A 1 135 ? 40.386 7.878   32.333  1.00 40.34 ? 135 ALA A N   1 
ATOM   1104 C CA  . ALA A 1 135 ? 38.986 8.259   32.100  1.00 41.31 ? 135 ALA A CA  1 
ATOM   1105 C C   . ALA A 1 135 ? 38.217 8.503   33.391  1.00 41.58 ? 135 ALA A C   1 
ATOM   1106 O O   . ALA A 1 135 ? 37.564 9.548   33.548  1.00 41.89 ? 135 ALA A O   1 
ATOM   1107 C CB  . ALA A 1 135 ? 38.279 7.203   31.260  1.00 41.50 ? 135 ALA A CB  1 
ATOM   1108 N N   . ALA A 1 136 ? 38.303 7.547   34.320  1.00 42.20 ? 136 ALA A N   1 
ATOM   1109 C CA  . ALA A 1 136 ? 37.696 7.694   35.654  1.00 42.59 ? 136 ALA A CA  1 
ATOM   1110 C C   . ALA A 1 136 ? 38.109 9.005   36.328  1.00 43.19 ? 136 ALA A C   1 
ATOM   1111 O O   . ALA A 1 136 ? 37.274 9.704   36.907  1.00 42.88 ? 136 ALA A O   1 
ATOM   1112 C CB  . ALA A 1 136 ? 38.054 6.507   36.542  1.00 42.40 ? 136 ALA A CB  1 
ATOM   1113 N N   . ALA A 1 137 ? 39.395 9.349   36.230  1.00 44.14 ? 137 ALA A N   1 
ATOM   1114 C CA  . ALA A 1 137 ? 39.923 10.521  36.935  1.00 44.94 ? 137 ALA A CA  1 
ATOM   1115 C C   . ALA A 1 137 ? 39.404 11.852  36.389  1.00 45.69 ? 137 ALA A C   1 
ATOM   1116 O O   . ALA A 1 137 ? 39.394 12.845  37.103  1.00 45.64 ? 137 ALA A O   1 
ATOM   1117 C CB  . ALA A 1 137 ? 41.454 10.495  36.967  1.00 44.75 ? 137 ALA A CB  1 
ATOM   1118 N N   . LEU A 1 138 ? 38.942 11.862  35.142  1.00 47.29 ? 138 LEU A N   1 
ATOM   1119 C CA  . LEU A 1 138 ? 38.489 13.101  34.489  1.00 48.80 ? 138 LEU A CA  1 
ATOM   1120 C C   . LEU A 1 138 ? 37.130 13.645  34.938  1.00 50.09 ? 138 LEU A C   1 
ATOM   1121 O O   . LEU A 1 138 ? 36.976 14.857  35.115  1.00 50.42 ? 138 LEU A O   1 
ATOM   1122 C CB  . LEU A 1 138 ? 38.505 12.945  32.967  1.00 48.82 ? 138 LEU A CB  1 
ATOM   1123 C CG  . LEU A 1 138 ? 39.859 13.022  32.258  1.00 48.32 ? 138 LEU A CG  1 
ATOM   1124 C CD1 . LEU A 1 138 ? 39.597 12.915  30.799  1.00 47.53 ? 138 LEU A CD1 1 
ATOM   1125 C CD2 . LEU A 1 138 ? 40.592 14.335  32.561  1.00 49.19 ? 138 LEU A CD2 1 
ATOM   1126 N N   . GLU A 1 139 ? 36.148 12.761  35.107  1.00 51.56 ? 139 GLU A N   1 
ATOM   1127 C CA  . GLU A 1 139 ? 34.813 13.163  35.558  1.00 53.00 ? 139 GLU A CA  1 
ATOM   1128 C C   . GLU A 1 139 ? 34.837 13.699  36.982  1.00 53.63 ? 139 GLU A C   1 
ATOM   1129 O O   . GLU A 1 139 ? 34.006 14.537  37.355  1.00 54.01 ? 139 GLU A O   1 
ATOM   1130 C CB  . GLU A 1 139 ? 33.828 11.997  35.437  1.00 53.35 ? 139 GLU A CB  1 
ATOM   1131 C CG  . GLU A 1 139 ? 33.285 11.780  34.018  1.00 54.10 ? 139 GLU A CG  1 
ATOM   1132 C CD  . GLU A 1 139 ? 31.881 12.356  33.808  1.00 56.32 ? 139 GLU A CD  1 
ATOM   1133 O OE1 . GLU A 1 139 ? 31.271 12.877  34.778  1.00 56.43 ? 139 GLU A OE1 1 
ATOM   1134 O OE2 . GLU A 1 139 ? 31.382 12.272  32.659  1.00 56.77 ? 139 GLU A OE2 1 
ATOM   1135 N N   . HIS A 1 140 ? 35.801 13.214  37.763  1.00 54.39 ? 140 HIS A N   1 
ATOM   1136 C CA  . HIS A 1 140 ? 36.034 13.676  39.131  1.00 54.90 ? 140 HIS A CA  1 
ATOM   1137 C C   . HIS A 1 140 ? 36.462 15.141  39.191  1.00 55.08 ? 140 HIS A C   1 
ATOM   1138 O O   . HIS A 1 140 ? 36.025 15.882  40.078  1.00 55.26 ? 140 HIS A O   1 
ATOM   1139 C CB  . HIS A 1 140 ? 37.090 12.803  39.820  1.00 55.08 ? 140 HIS A CB  1 
ATOM   1140 C CG  . HIS A 1 140 ? 36.578 11.466  40.261  1.00 56.29 ? 140 HIS A CG  1 
ATOM   1141 N ND1 . HIS A 1 140 ? 36.386 10.416  39.388  1.00 57.61 ? 140 HIS A ND1 1 
ATOM   1142 C CD2 . HIS A 1 140 ? 36.222 11.007  41.485  1.00 57.42 ? 140 HIS A CD2 1 
ATOM   1143 C CE1 . HIS A 1 140 ? 35.930 9.368   40.053  1.00 57.76 ? 140 HIS A CE1 1 
ATOM   1144 N NE2 . HIS A 1 140 ? 35.821 9.701   41.328  1.00 57.61 ? 140 HIS A NE2 1 
ATOM   1145 N N   . HIS A 1 141 ? 37.314 15.554  38.252  1.00 55.17 ? 141 HIS A N   1 
ATOM   1146 C CA  . HIS A 1 141 ? 37.878 16.907  38.272  1.00 55.24 ? 141 HIS A CA  1 
ATOM   1147 C C   . HIS A 1 141 ? 36.921 17.939  37.674  1.00 55.21 ? 141 HIS A C   1 
ATOM   1148 O O   . HIS A 1 141 ? 36.668 18.988  38.279  1.00 54.98 ? 141 HIS A O   1 
ATOM   1149 C CB  . HIS A 1 141 ? 39.241 16.954  37.563  1.00 55.31 ? 141 HIS A CB  1 
ATOM   1150 C CG  . HIS A 1 141 ? 40.246 15.978  38.102  1.00 55.46 ? 141 HIS A CG  1 
ATOM   1151 N ND1 . HIS A 1 141 ? 40.869 15.036  37.309  1.00 55.04 ? 141 HIS A ND1 1 
ATOM   1152 C CD2 . HIS A 1 141 ? 40.733 15.796  39.354  1.00 55.14 ? 141 HIS A CD2 1 
ATOM   1153 C CE1 . HIS A 1 141 ? 41.696 14.318  38.050  1.00 54.89 ? 141 HIS A CE1 1 
ATOM   1154 N NE2 . HIS A 1 141 ? 41.629 14.755  39.294  1.00 54.34 ? 141 HIS A NE2 1 
ATOM   1155 N N   . MET B 1 1   ? 33.485 24.545  6.547   1.00 51.07 ? 1   MET B N   1 
ATOM   1156 C CA  . MET B 1 1   ? 32.043 24.902  6.695   1.00 50.73 ? 1   MET B CA  1 
ATOM   1157 C C   . MET B 1 1   ? 31.261 23.663  7.135   1.00 49.32 ? 1   MET B C   1 
ATOM   1158 O O   . MET B 1 1   ? 31.279 22.655  6.444   1.00 49.38 ? 1   MET B O   1 
ATOM   1159 C CB  . MET B 1 1   ? 31.482 25.456  5.374   1.00 51.60 ? 1   MET B CB  1 
ATOM   1160 C CG  . MET B 1 1   ? 32.234 26.680  4.799   1.00 54.37 ? 1   MET B CG  1 
ATOM   1161 S SD  . MET B 1 1   ? 33.625 26.332  3.671   1.00 60.76 ? 1   MET B SD  1 
ATOM   1162 C CE  . MET B 1 1   ? 32.808 25.573  2.295   1.00 55.71 ? 1   MET B CE  1 
ATOM   1163 N N   . GLU B 1 2   ? 30.589 23.748  8.285   1.00 47.92 ? 2   GLU B N   1 
ATOM   1164 C CA  . GLU B 1 2   ? 29.860 22.614  8.864   1.00 46.63 ? 2   GLU B CA  1 
ATOM   1165 C C   . GLU B 1 2   ? 28.882 22.008  7.861   1.00 44.51 ? 2   GLU B C   1 
ATOM   1166 O O   . GLU B 1 2   ? 28.882 20.796  7.649   1.00 44.07 ? 2   GLU B O   1 
ATOM   1167 C CB  . GLU B 1 2   ? 29.136 23.012  10.163  1.00 46.88 ? 2   GLU B CB  1 
ATOM   1168 C CG  . GLU B 1 2   ? 28.131 21.963  10.690  1.00 48.34 ? 2   GLU B CG  1 
ATOM   1169 C CD  . GLU B 1 2   ? 27.798 22.109  12.178  1.00 49.15 ? 2   GLU B CD  1 
ATOM   1170 O OE1 . GLU B 1 2   ? 27.483 23.239  12.628  1.00 52.61 ? 2   GLU B OE1 1 
ATOM   1171 O OE2 . GLU B 1 2   ? 27.835 21.079  12.901  1.00 52.07 ? 2   GLU B OE2 1 
ATOM   1172 N N   . ALA B 1 3   ? 28.079 22.858  7.232   1.00 42.03 ? 3   ALA B N   1 
ATOM   1173 C CA  . ALA B 1 3   ? 27.056 22.422  6.285   1.00 39.84 ? 3   ALA B CA  1 
ATOM   1174 C C   . ALA B 1 3   ? 27.640 21.641  5.114   1.00 38.73 ? 3   ALA B C   1 
ATOM   1175 O O   . ALA B 1 3   ? 27.037 20.678  4.651   1.00 37.18 ? 3   ALA B O   1 
ATOM   1176 C CB  . ALA B 1 3   ? 26.249 23.610  5.780   1.00 39.57 ? 3   ALA B CB  1 
ATOM   1177 N N   . VAL B 1 4   ? 28.797 22.080  4.630   1.00 37.44 ? 4   VAL B N   1 
ATOM   1178 C CA  . VAL B 1 4   ? 29.491 21.369  3.565   1.00 37.60 ? 4   VAL B CA  1 
ATOM   1179 C C   . VAL B 1 4   ? 30.043 20.018  4.025   1.00 36.82 ? 4   VAL B C   1 
ATOM   1180 O O   . VAL B 1 4   ? 29.918 19.030  3.315   1.00 37.44 ? 4   VAL B O   1 
ATOM   1181 C CB  . VAL B 1 4   ? 30.618 22.217  2.926   1.00 37.74 ? 4   VAL B CB  1 
ATOM   1182 C CG1 . VAL B 1 4   ? 31.243 21.475  1.749   1.00 37.35 ? 4   VAL B CG1 1 
ATOM   1183 C CG2 . VAL B 1 4   ? 30.055 23.550  2.461   1.00 37.86 ? 4   VAL B CG2 1 
ATOM   1184 N N   . LYS B 1 5   ? 30.637 19.972  5.207   1.00 36.36 ? 5   LYS B N   1 
ATOM   1185 C CA  . LYS B 1 5   ? 31.206 18.717  5.723   1.00 35.74 ? 5   LYS B CA  1 
ATOM   1186 C C   . LYS B 1 5   ? 30.107 17.717  6.093   1.00 35.45 ? 5   LYS B C   1 
ATOM   1187 O O   . LYS B 1 5   ? 30.292 16.497  5.981   1.00 34.95 ? 5   LYS B O   1 
ATOM   1188 C CB  . LYS B 1 5   ? 32.085 18.987  6.937   1.00 35.52 ? 5   LYS B CB  1 
ATOM   1189 C CG  . LYS B 1 5   ? 33.239 19.951  6.712   1.00 35.22 ? 5   LYS B CG  1 
ATOM   1190 C CD  . LYS B 1 5   ? 34.063 19.999  7.996   1.00 35.32 ? 5   LYS B CD  1 
ATOM   1191 C CE  . LYS B 1 5   ? 35.362 20.750  7.809   1.00 36.37 ? 5   LYS B CE  1 
ATOM   1192 N NZ  . LYS B 1 5   ? 36.247 20.532  8.973   1.00 37.27 ? 5   LYS B NZ  1 
ATOM   1193 N N   . THR B 1 6   ? 28.970 18.244  6.540   1.00 35.11 ? 6   THR B N   1 
ATOM   1194 C CA  . THR B 1 6   ? 27.782 17.428  6.740   1.00 35.63 ? 6   THR B CA  1 
ATOM   1195 C C   . THR B 1 6   ? 27.329 16.810  5.409   1.00 35.48 ? 6   THR B C   1 
ATOM   1196 O O   . THR B 1 6   ? 27.107 15.607  5.342   1.00 35.41 ? 6   THR B O   1 
ATOM   1197 C CB  . THR B 1 6   ? 26.648 18.204  7.436   1.00 35.56 ? 6   THR B CB  1 
ATOM   1198 O OG1 . THR B 1 6   ? 27.060 18.542  8.767   1.00 35.98 ? 6   THR B OG1 1 
ATOM   1199 C CG2 . THR B 1 6   ? 25.379 17.347  7.518   1.00 35.72 ? 6   THR B CG2 1 
ATOM   1200 N N   . PHE B 1 7   ? 27.236 17.624  4.356   1.00 35.31 ? 7   PHE B N   1 
ATOM   1201 C CA  . PHE B 1 7   ? 26.965 17.107  3.012   1.00 35.58 ? 7   PHE B CA  1 
ATOM   1202 C C   . PHE B 1 7   ? 27.991 16.079  2.529   1.00 35.03 ? 7   PHE B C   1 
ATOM   1203 O O   . PHE B 1 7   ? 27.616 15.000  2.093   1.00 35.25 ? 7   PHE B O   1 
ATOM   1204 C CB  . PHE B 1 7   ? 26.842 18.210  1.955   1.00 36.00 ? 7   PHE B CB  1 
ATOM   1205 C CG  . PHE B 1 7   ? 26.653 17.651  0.566   1.00 37.08 ? 7   PHE B CG  1 
ATOM   1206 C CD1 . PHE B 1 7   ? 25.447 17.050  0.213   1.00 36.11 ? 7   PHE B CD1 1 
ATOM   1207 C CD2 . PHE B 1 7   ? 27.697 17.638  -0.342  1.00 36.08 ? 7   PHE B CD2 1 
ATOM   1208 C CE1 . PHE B 1 7   ? 25.274 16.487  -1.036  1.00 38.71 ? 7   PHE B CE1 1 
ATOM   1209 C CE2 . PHE B 1 7   ? 27.526 17.082  -1.610  1.00 37.84 ? 7   PHE B CE2 1 
ATOM   1210 C CZ  . PHE B 1 7   ? 26.307 16.516  -1.955  1.00 37.40 ? 7   PHE B CZ  1 
ATOM   1211 N N   . ASN B 1 8   ? 29.277 16.413  2.609   1.00 34.68 ? 8   ASN B N   1 
ATOM   1212 C CA  . ASN B 1 8   ? 30.336 15.479  2.223   1.00 34.35 ? 8   ASN B CA  1 
ATOM   1213 C C   . ASN B 1 8   ? 30.188 14.123  2.909   1.00 34.51 ? 8   ASN B C   1 
ATOM   1214 O O   . ASN B 1 8   ? 30.436 13.095  2.287   1.00 34.45 ? 8   ASN B O   1 
ATOM   1215 C CB  . ASN B 1 8   ? 31.740 16.053  2.542   1.00 34.29 ? 8   ASN B CB  1 
ATOM   1216 C CG  . ASN B 1 8   ? 32.118 17.243  1.656   1.00 35.61 ? 8   ASN B CG  1 
ATOM   1217 O OD1 . ASN B 1 8   ? 31.459 17.514  0.646   1.00 38.03 ? 8   ASN B OD1 1 
ATOM   1218 N ND2 . ASN B 1 8   ? 33.190 17.951  2.028   1.00 32.97 ? 8   ASN B ND2 1 
ATOM   1219 N N   . SER B 1 9   ? 29.859 14.129  4.209   1.00 34.55 ? 9   SER B N   1 
ATOM   1220 C CA  . SER B 1 9   ? 29.585 12.892  4.969   1.00 34.93 ? 9   SER B CA  1 
ATOM   1221 C C   . SER B 1 9   ? 28.411 12.090  4.407   1.00 35.14 ? 9   SER B C   1 
ATOM   1222 O O   . SER B 1 9   ? 28.518 10.888  4.238   1.00 35.13 ? 9   SER B O   1 
ATOM   1223 C CB  . SER B 1 9   ? 29.311 13.208  6.437   1.00 34.13 ? 9   SER B CB  1 
ATOM   1224 O OG  . SER B 1 9   ? 30.512 13.587  7.068   1.00 34.97 ? 9   SER B OG  1 
ATOM   1225 N N   . GLU B 1 10  ? 27.291 12.771  4.144   1.00 35.53 ? 10  GLU B N   1 
ATOM   1226 C CA  . GLU B 1 10  ? 26.104 12.146  3.565   1.00 36.55 ? 10  GLU B CA  1 
ATOM   1227 C C   . GLU B 1 10  ? 26.393 11.542  2.199   1.00 36.57 ? 10  GLU B C   1 
ATOM   1228 O O   . GLU B 1 10  ? 26.018 10.415  1.936   1.00 37.75 ? 10  GLU B O   1 
ATOM   1229 C CB  . GLU B 1 10  ? 24.935 13.145  3.456   1.00 36.07 ? 10  GLU B CB  1 
ATOM   1230 C CG  . GLU B 1 10  ? 24.207 13.393  4.771   1.00 38.19 ? 10  GLU B CG  1 
ATOM   1231 C CD  . GLU B 1 10  ? 23.538 12.142  5.379   1.00 40.97 ? 10  GLU B CD  1 
ATOM   1232 O OE1 . GLU B 1 10  ? 23.116 11.213  4.646   1.00 40.65 ? 10  GLU B OE1 1 
ATOM   1233 O OE2 . GLU B 1 10  ? 23.415 12.108  6.619   1.00 42.38 ? 10  GLU B OE2 1 
ATOM   1234 N N   . LEU B 1 11  ? 27.071 12.292  1.343   1.00 37.10 ? 11  LEU B N   1 
ATOM   1235 C CA  . LEU B 1 11  ? 27.382 11.832  0.002   1.00 37.56 ? 11  LEU B CA  1 
ATOM   1236 C C   . LEU B 1 11  ? 28.376 10.673  0.020   1.00 38.06 ? 11  LEU B C   1 
ATOM   1237 O O   . LEU B 1 11  ? 28.155 9.667   -0.631  1.00 38.30 ? 11  LEU B O   1 
ATOM   1238 C CB  . LEU B 1 11  ? 27.922 12.995  -0.840  1.00 37.81 ? 11  LEU B CB  1 
ATOM   1239 C CG  . LEU B 1 11  ? 28.406 12.705  -2.266  1.00 38.00 ? 11  LEU B CG  1 
ATOM   1240 C CD1 . LEU B 1 11  ? 27.252 12.317  -3.182  1.00 39.02 ? 11  LEU B CD1 1 
ATOM   1241 C CD2 . LEU B 1 11  ? 29.147 13.910  -2.827  1.00 37.55 ? 11  LEU B CD2 1 
ATOM   1242 N N   . TYR B 1 12  ? 29.475 10.813  0.755   1.00 37.99 ? 12  TYR B N   1 
ATOM   1243 C CA  . TYR B 1 12  ? 30.501 9.772   0.750   1.00 38.58 ? 12  TYR B CA  1 
ATOM   1244 C C   . TYR B 1 12  ? 30.006 8.455   1.371   1.00 38.25 ? 12  TYR B C   1 
ATOM   1245 O O   . TYR B 1 12  ? 30.490 7.375   1.006   1.00 38.66 ? 12  TYR B O   1 
ATOM   1246 C CB  . TYR B 1 12  ? 31.809 10.243  1.434   1.00 38.78 ? 12  TYR B CB  1 
ATOM   1247 C CG  . TYR B 1 12  ? 32.957 9.246   1.316   1.00 38.98 ? 12  TYR B CG  1 
ATOM   1248 C CD1 . TYR B 1 12  ? 33.085 8.183   2.216   1.00 39.07 ? 12  TYR B CD1 1 
ATOM   1249 C CD2 . TYR B 1 12  ? 33.914 9.363   0.295   1.00 40.73 ? 12  TYR B CD2 1 
ATOM   1250 C CE1 . TYR B 1 12  ? 34.126 7.236   2.089   1.00 37.89 ? 12  TYR B CE1 1 
ATOM   1251 C CE2 . TYR B 1 12  ? 34.976 8.428   0.169   1.00 39.34 ? 12  TYR B CE2 1 
ATOM   1252 C CZ  . TYR B 1 12  ? 35.063 7.375   1.069   1.00 38.52 ? 12  TYR B CZ  1 
ATOM   1253 O OH  . TYR B 1 12  ? 36.096 6.470   0.970   1.00 40.65 ? 12  TYR B OH  1 
ATOM   1254 N N   . SER B 1 13  ? 29.070 8.537   2.316   1.00 37.76 ? 13  SER B N   1 
ATOM   1255 C CA  . SER B 1 13  ? 28.586 7.327   3.005   1.00 37.39 ? 13  SER B CA  1 
ATOM   1256 C C   . SER B 1 13  ? 27.672 6.499   2.099   1.00 36.81 ? 13  SER B C   1 
ATOM   1257 O O   . SER B 1 13  ? 27.230 5.429   2.488   1.00 36.57 ? 13  SER B O   1 
ATOM   1258 C CB  . SER B 1 13  ? 27.873 7.673   4.316   1.00 37.42 ? 13  SER B CB  1 
ATOM   1259 O OG  . SER B 1 13  ? 26.661 8.377   4.059   1.00 39.70 ? 13  SER B OG  1 
ATOM   1260 N N   . LEU B 1 14  ? 27.395 6.991   0.892   1.00 36.58 ? 14  LEU B N   1 
ATOM   1261 C CA  . LEU B 1 14  ? 26.869 6.123   -0.183  1.00 36.76 ? 14  LEU B CA  1 
ATOM   1262 C C   . LEU B 1 14  ? 27.706 4.853   -0.309  1.00 36.08 ? 14  LEU B C   1 
ATOM   1263 O O   . LEU B 1 14  ? 27.166 3.776   -0.612  1.00 36.31 ? 14  LEU B O   1 
ATOM   1264 C CB  . LEU B 1 14  ? 26.860 6.846   -1.537  1.00 37.15 ? 14  LEU B CB  1 
ATOM   1265 C CG  . LEU B 1 14  ? 25.807 7.886   -1.922  1.00 37.96 ? 14  LEU B CG  1 
ATOM   1266 C CD1 . LEU B 1 14  ? 26.168 8.446   -3.272  1.00 38.94 ? 14  LEU B CD1 1 
ATOM   1267 C CD2 . LEU B 1 14  ? 24.411 7.295   -1.947  1.00 37.53 ? 14  LEU B CD2 1 
ATOM   1268 N N   . ASN B 1 15  ? 29.018 4.972   -0.068  1.00 35.67 ? 15  ASN B N   1 
ATOM   1269 C CA  . ASN B 1 15  ? 29.940 3.815   -0.099  1.00 35.53 ? 15  ASN B CA  1 
ATOM   1270 C C   . ASN B 1 15  ? 29.707 2.780   1.019   1.00 36.04 ? 15  ASN B C   1 
ATOM   1271 O O   . ASN B 1 15  ? 30.274 1.685   0.995   1.00 36.01 ? 15  ASN B O   1 
ATOM   1272 C CB  . ASN B 1 15  ? 31.404 4.276   -0.098  1.00 35.15 ? 15  ASN B CB  1 
ATOM   1273 C CG  . ASN B 1 15  ? 31.781 5.056   -1.354  1.00 35.50 ? 15  ASN B CG  1 
ATOM   1274 O OD1 . ASN B 1 15  ? 32.021 4.474   -2.397  1.00 34.75 ? 15  ASN B OD1 1 
ATOM   1275 N ND2 . ASN B 1 15  ? 31.846 6.386   -1.246  1.00 35.38 ? 15  ASN B ND2 1 
ATOM   1276 N N   . ASP B 1 16  ? 28.892 3.134   2.007   1.00 36.87 ? 16  ASP B N   1 
ATOM   1277 C CA  . ASP B 1 16  ? 28.516 2.204   3.067   1.00 38.08 ? 16  ASP B CA  1 
ATOM   1278 C C   . ASP B 1 16  ? 27.394 1.271   2.622   1.00 38.17 ? 16  ASP B C   1 
ATOM   1279 O O   . ASP B 1 16  ? 27.105 0.303   3.301   1.00 38.11 ? 16  ASP B O   1 
ATOM   1280 C CB  . ASP B 1 16  ? 28.059 2.953   4.330   1.00 38.57 ? 16  ASP B CB  1 
ATOM   1281 C CG  . ASP B 1 16  ? 29.204 3.630   5.091   1.00 40.38 ? 16  ASP B CG  1 
ATOM   1282 O OD1 . ASP B 1 16  ? 30.381 3.305   4.863   1.00 41.65 ? 16  ASP B OD1 1 
ATOM   1283 O OD2 . ASP B 1 16  ? 28.904 4.487   5.958   1.00 43.17 ? 16  ASP B OD2 1 
ATOM   1284 N N   . TYR B 1 17  ? 26.765 1.573   1.488   1.00 38.82 ? 17  TYR B N   1 
ATOM   1285 C CA  . TYR B 1 17  ? 25.563 0.858   1.031   1.00 39.47 ? 17  TYR B CA  1 
ATOM   1286 C C   . TYR B 1 17  ? 25.762 0.250   -0.353  1.00 39.19 ? 17  TYR B C   1 
ATOM   1287 O O   . TYR B 1 17  ? 26.397 0.847   -1.221  1.00 39.40 ? 17  TYR B O   1 
ATOM   1288 C CB  . TYR B 1 17  ? 24.350 1.810   0.972   1.00 40.09 ? 17  TYR B CB  1 
ATOM   1289 C CG  . TYR B 1 17  ? 24.035 2.528   2.266   1.00 41.46 ? 17  TYR B CG  1 
ATOM   1290 C CD1 . TYR B 1 17  ? 23.032 2.063   3.115   1.00 42.41 ? 17  TYR B CD1 1 
ATOM   1291 C CD2 . TYR B 1 17  ? 24.741 3.678   2.642   1.00 41.46 ? 17  TYR B CD2 1 
ATOM   1292 C CE1 . TYR B 1 17  ? 22.746 2.718   4.312   1.00 44.12 ? 17  TYR B CE1 1 
ATOM   1293 C CE2 . TYR B 1 17  ? 24.465 4.340   3.827   1.00 42.30 ? 17  TYR B CE2 1 
ATOM   1294 C CZ  . TYR B 1 17  ? 23.467 3.860   4.661   1.00 43.63 ? 17  TYR B CZ  1 
ATOM   1295 O OH  . TYR B 1 17  ? 23.185 4.517   5.842   1.00 43.29 ? 17  TYR B OH  1 
ATOM   1296 N N   . LYS B 1 18  ? 25.198 -0.934  -0.560  1.00 38.88 ? 18  LYS B N   1 
ATOM   1297 C CA  . LYS B 1 18  ? 25.187 -1.557  -1.874  1.00 38.43 ? 18  LYS B CA  1 
ATOM   1298 C C   . LYS B 1 18  ? 24.001 -0.991  -2.655  1.00 37.95 ? 18  LYS B C   1 
ATOM   1299 O O   . LYS B 1 18  ? 22.883 -0.971  -2.135  1.00 38.65 ? 18  LYS B O   1 
ATOM   1300 C CB  . LYS B 1 18  ? 25.066 -3.084  -1.733  1.00 38.59 ? 18  LYS B CB  1 
ATOM   1301 C CG  . LYS B 1 18  ? 25.427 -3.868  -2.983  1.00 38.44 ? 18  LYS B CG  1 
ATOM   1302 C CD  . LYS B 1 18  ? 25.218 -5.378  -2.779  1.00 38.62 ? 18  LYS B CD  1 
ATOM   1303 C CE  . LYS B 1 18  ? 25.743 -6.198  -3.962  1.00 38.03 ? 18  LYS B CE  1 
ATOM   1304 N NZ  . LYS B 1 18  ? 25.557 -7.683  -3.758  1.00 39.06 ? 18  LYS B NZ  1 
ATOM   1305 N N   . PRO B 1 19  ? 24.232 -0.511  -3.891  1.00 37.14 ? 19  PRO B N   1 
ATOM   1306 C CA  . PRO B 1 19  ? 23.120 -0.054  -4.717  1.00 36.93 ? 19  PRO B CA  1 
ATOM   1307 C C   . PRO B 1 19  ? 22.221 -1.221  -5.145  1.00 36.98 ? 19  PRO B C   1 
ATOM   1308 O O   . PRO B 1 19  ? 22.698 -2.352  -5.197  1.00 36.79 ? 19  PRO B O   1 
ATOM   1309 C CB  . PRO B 1 19  ? 23.823 0.559   -5.941  1.00 36.84 ? 19  PRO B CB  1 
ATOM   1310 C CG  . PRO B 1 19  ? 25.237 0.830   -5.485  1.00 36.93 ? 19  PRO B CG  1 
ATOM   1311 C CD  . PRO B 1 19  ? 25.514 -0.355  -4.597  1.00 37.25 ? 19  PRO B CD  1 
ATOM   1312 N N   . PRO B 1 20  ? 20.936 -0.955  -5.478  1.00 37.25 ? 20  PRO B N   1 
ATOM   1313 C CA  . PRO B 1 20  ? 20.246 0.342   -5.540  1.00 37.13 ? 20  PRO B CA  1 
ATOM   1314 C C   . PRO B 1 20  ? 20.198 1.041   -4.194  1.00 37.33 ? 20  PRO B C   1 
ATOM   1315 O O   . PRO B 1 20  ? 19.981 0.403   -3.163  1.00 37.79 ? 20  PRO B O   1 
ATOM   1316 C CB  . PRO B 1 20  ? 18.825 -0.024  -5.978  1.00 37.34 ? 20  PRO B CB  1 
ATOM   1317 C CG  . PRO B 1 20  ? 18.674 -1.495  -5.626  1.00 37.24 ? 20  PRO B CG  1 
ATOM   1318 C CD  . PRO B 1 20  ? 20.035 -2.064  -5.862  1.00 37.32 ? 20  PRO B CD  1 
ATOM   1319 N N   . ILE B 1 21  ? 20.404 2.348   -4.218  1.00 37.16 ? 21  ILE B N   1 
ATOM   1320 C CA  . ILE B 1 21  ? 20.363 3.160   -3.005  1.00 37.44 ? 21  ILE B CA  1 
ATOM   1321 C C   . ILE B 1 21  ? 18.912 3.475   -2.663  1.00 37.74 ? 21  ILE B C   1 
ATOM   1322 O O   . ILE B 1 21  ? 18.124 3.832   -3.553  1.00 37.55 ? 21  ILE B O   1 
ATOM   1323 C CB  . ILE B 1 21  ? 21.215 4.470   -3.191  1.00 36.92 ? 21  ILE B CB  1 
ATOM   1324 C CG1 . ILE B 1 21  ? 22.693 4.116   -3.460  1.00 36.52 ? 21  ILE B CG1 1 
ATOM   1325 C CG2 . ILE B 1 21  ? 21.065 5.427   -2.010  1.00 36.97 ? 21  ILE B CG2 1 
ATOM   1326 C CD1 . ILE B 1 21  ? 23.389 3.266   -2.351  1.00 34.59 ? 21  ILE B CD1 1 
ATOM   1327 N N   . SER B 1 22  ? 18.556 3.329   -1.387  1.00 38.03 ? 22  SER B N   1 
ATOM   1328 C CA  . SER B 1 22  ? 17.191 3.612   -0.934  1.00 38.88 ? 22  SER B CA  1 
ATOM   1329 C C   . SER B 1 22  ? 16.798 5.085   -1.146  1.00 39.09 ? 22  SER B C   1 
ATOM   1330 O O   . SER B 1 22  ? 17.654 5.957   -1.286  1.00 38.44 ? 22  SER B O   1 
ATOM   1331 C CB  . SER B 1 22  ? 16.993 3.194   0.531   1.00 38.86 ? 22  SER B CB  1 
ATOM   1332 O OG  . SER B 1 22  ? 17.759 4.003   1.424   1.00 40.84 ? 22  SER B OG  1 
ATOM   1333 N N   . LYS B 1 23  ? 15.491 5.329   -1.202  1.00 39.73 ? 23  LYS B N   1 
ATOM   1334 C CA  . LYS B 1 23  ? 14.925 6.666   -1.247  1.00 40.36 ? 23  LYS B CA  1 
ATOM   1335 C C   . LYS B 1 23  ? 15.241 7.436   0.044   1.00 40.26 ? 23  LYS B C   1 
ATOM   1336 O O   . LYS B 1 23  ? 15.500 8.641   0.010   1.00 40.16 ? 23  LYS B O   1 
ATOM   1337 C CB  . LYS B 1 23  ? 13.410 6.564   -1.480  1.00 41.09 ? 23  LYS B CB  1 
ATOM   1338 C CG  . LYS B 1 23  ? 12.638 7.889   -1.477  1.00 43.68 ? 23  LYS B CG  1 
ATOM   1339 C CD  . LYS B 1 23  ? 13.125 8.855   -2.565  1.00 47.45 ? 23  LYS B CD  1 
ATOM   1340 C CE  . LYS B 1 23  ? 12.101 9.969   -2.793  1.00 49.33 ? 23  LYS B CE  1 
ATOM   1341 N NZ  . LYS B 1 23  ? 12.714 11.101  -3.562  1.00 50.78 ? 23  LYS B NZ  1 
ATOM   1342 N N   . ALA B 1 24  ? 15.238 6.728   1.172   1.00 40.21 ? 24  ALA B N   1 
ATOM   1343 C CA  . ALA B 1 24  ? 15.485 7.342   2.478   1.00 40.36 ? 24  ALA B CA  1 
ATOM   1344 C C   . ALA B 1 24  ? 16.880 7.950   2.532   1.00 40.46 ? 24  ALA B C   1 
ATOM   1345 O O   . ALA B 1 24  ? 17.038 9.109   2.904   1.00 40.88 ? 24  ALA B O   1 
ATOM   1346 C CB  . ALA B 1 24  ? 15.269 6.327   3.618   1.00 40.32 ? 24  ALA B CB  1 
ATOM   1347 N N   . LYS B 1 25  ? 17.872 7.173   2.107   1.00 40.28 ? 25  LYS B N   1 
ATOM   1348 C CA  . LYS B 1 25  ? 19.252 7.619   2.029   1.00 40.49 ? 25  LYS B CA  1 
ATOM   1349 C C   . LYS B 1 25  ? 19.430 8.764   1.020   1.00 40.73 ? 25  LYS B C   1 
ATOM   1350 O O   . LYS B 1 25  ? 20.142 9.737   1.294   1.00 40.51 ? 25  LYS B O   1 
ATOM   1351 C CB  . LYS B 1 25  ? 20.174 6.400   1.779   1.00 40.33 ? 25  LYS B CB  1 
ATOM   1352 C CG  . LYS B 1 25  ? 21.582 6.634   1.198   1.00 41.40 ? 25  LYS B CG  1 
ATOM   1353 C CD  . LYS B 1 25  ? 22.358 7.800   1.792   1.00 42.23 ? 25  LYS B CD  1 
ATOM   1354 C CE  . LYS B 1 25  ? 23.155 7.470   3.009   1.00 42.75 ? 25  LYS B CE  1 
ATOM   1355 N NZ  . LYS B 1 25  ? 24.008 8.657   3.371   1.00 44.20 ? 25  LYS B NZ  1 
ATOM   1356 N N   . MET B 1 26  ? 18.769 8.678   -0.129  1.00 41.07 ? 26  MET B N   1 
ATOM   1357 C CA  . MET B 1 26  ? 18.856 9.768   -1.108  1.00 41.48 ? 26  MET B CA  1 
ATOM   1358 C C   . MET B 1 26  ? 18.294 11.075  -0.545  1.00 40.88 ? 26  MET B C   1 
ATOM   1359 O O   . MET B 1 26  ? 18.856 12.142  -0.777  1.00 41.15 ? 26  MET B O   1 
ATOM   1360 C CB  . MET B 1 26  ? 18.160 9.401   -2.424  1.00 41.88 ? 26  MET B CB  1 
ATOM   1361 C CG  . MET B 1 26  ? 18.733 10.131  -3.643  1.00 45.21 ? 26  MET B CG  1 
ATOM   1362 S SD  . MET B 1 26  ? 20.480 9.745   -3.978  1.00 51.52 ? 26  MET B SD  1 
ATOM   1363 C CE  . MET B 1 26  ? 20.375 8.021   -4.432  1.00 50.15 ? 26  MET B CE  1 
ATOM   1364 N N   . THR B 1 27  ? 17.207 10.976  0.217   1.00 40.90 ? 27  THR B N   1 
ATOM   1365 C CA  . THR B 1 27  ? 16.582 12.125  0.878   1.00 40.94 ? 27  THR B CA  1 
ATOM   1366 C C   . THR B 1 27  ? 17.520 12.783  1.908   1.00 40.87 ? 27  THR B C   1 
ATOM   1367 O O   . THR B 1 27  ? 17.514 14.008  2.069   1.00 40.43 ? 27  THR B O   1 
ATOM   1368 C CB  . THR B 1 27  ? 15.249 11.714  1.563   1.00 40.99 ? 27  THR B CB  1 
ATOM   1369 O OG1 . THR B 1 27  ? 14.324 11.245  0.571   1.00 42.01 ? 27  THR B OG1 1 
ATOM   1370 C CG2 . THR B 1 27  ? 14.624 12.888  2.302   1.00 40.76 ? 27  THR B CG2 1 
ATOM   1371 N N   . GLN B 1 28  ? 18.295 11.952  2.606   1.00 41.01 ? 28  GLN B N   1 
ATOM   1372 C CA  . GLN B 1 28  ? 19.273 12.401  3.600   1.00 41.68 ? 28  GLN B CA  1 
ATOM   1373 C C   . GLN B 1 28  ? 20.353 13.243  2.934   1.00 40.44 ? 28  GLN B C   1 
ATOM   1374 O O   . GLN B 1 28  ? 20.645 14.352  3.375   1.00 40.67 ? 28  GLN B O   1 
ATOM   1375 C CB  . GLN B 1 28  ? 19.933 11.204  4.302   1.00 41.28 ? 28  GLN B CB  1 
ATOM   1376 C CG  . GLN B 1 28  ? 19.129 10.519  5.384   1.00 43.06 ? 28  GLN B CG  1 
ATOM   1377 C CD  . GLN B 1 28  ? 19.953 9.444   6.118   1.00 44.62 ? 28  GLN B CD  1 
ATOM   1378 O OE1 . GLN B 1 28  ? 21.137 9.231   5.812   1.00 48.53 ? 28  GLN B OE1 1 
ATOM   1379 N NE2 . GLN B 1 28  ? 19.332 8.777   7.095   1.00 46.30 ? 28  GLN B NE2 1 
ATOM   1380 N N   . ILE B 1 29  ? 20.931 12.707  1.861   1.00 39.29 ? 29  ILE B N   1 
ATOM   1381 C CA  . ILE B 1 29  ? 21.912 13.426  1.057   1.00 37.97 ? 29  ILE B CA  1 
ATOM   1382 C C   . ILE B 1 29  ? 21.331 14.750  0.537   1.00 37.85 ? 29  ILE B C   1 
ATOM   1383 O O   . ILE B 1 29  ? 21.991 15.794  0.581   1.00 37.98 ? 29  ILE B O   1 
ATOM   1384 C CB  . ILE B 1 29  ? 22.384 12.557  -0.125  1.00 37.75 ? 29  ILE B CB  1 
ATOM   1385 C CG1 . ILE B 1 29  ? 23.194 11.356  0.386   1.00 37.88 ? 29  ILE B CG1 1 
ATOM   1386 C CG2 . ILE B 1 29  ? 23.192 13.381  -1.150  1.00 36.90 ? 29  ILE B CG2 1 
ATOM   1387 C CD1 . ILE B 1 29  ? 23.323 10.253  -0.632  1.00 37.82 ? 29  ILE B CD1 1 
ATOM   1388 N N   . THR B 1 30  ? 20.098 14.695  0.050   1.00 37.57 ? 30  THR B N   1 
ATOM   1389 C CA  . THR B 1 30  ? 19.429 15.866  -0.514  1.00 37.94 ? 30  THR B CA  1 
ATOM   1390 C C   . THR B 1 30  ? 19.123 16.932  0.531   1.00 37.39 ? 30  THR B C   1 
ATOM   1391 O O   . THR B 1 30  ? 19.325 18.118  0.266   1.00 37.76 ? 30  THR B O   1 
ATOM   1392 C CB  . THR B 1 30  ? 18.164 15.450  -1.247  1.00 38.09 ? 30  THR B CB  1 
ATOM   1393 O OG1 . THR B 1 30  ? 18.529 14.503  -2.255  1.00 38.74 ? 30  THR B OG1 1 
ATOM   1394 C CG2 . THR B 1 30  ? 17.486 16.648  -1.889  1.00 37.96 ? 30  THR B CG2 1 
ATOM   1395 N N   . LYS B 1 31  ? 18.645 16.518  1.709   1.00 36.76 ? 31  LYS B N   1 
ATOM   1396 C CA  . LYS B 1 31  ? 18.398 17.460  2.800   1.00 36.63 ? 31  LYS B CA  1 
ATOM   1397 C C   . LYS B 1 31  ? 19.687 18.200  3.200   1.00 35.37 ? 31  LYS B C   1 
ATOM   1398 O O   . LYS B 1 31  ? 19.658 19.418  3.396   1.00 34.19 ? 31  LYS B O   1 
ATOM   1399 C CB  . LYS B 1 31  ? 17.753 16.769  4.012   1.00 37.06 ? 31  LYS B CB  1 
ATOM   1400 C CG  . LYS B 1 31  ? 16.240 16.547  3.855   1.00 38.42 ? 31  LYS B CG  1 
ATOM   1401 C CD  . LYS B 1 31  ? 15.639 15.894  5.097   1.00 38.77 ? 31  LYS B CD  1 
ATOM   1402 C CE  . LYS B 1 31  ? 14.178 15.487  4.862   1.00 41.51 ? 31  LYS B CE  1 
ATOM   1403 N NZ  . LYS B 1 31  ? 13.521 14.915  6.093   1.00 42.73 ? 31  LYS B NZ  1 
ATOM   1404 N N   . ALA B 1 32  ? 20.802 17.464  3.287   1.00 34.14 ? 32  ALA B N   1 
ATOM   1405 C CA  . ALA B 1 32  ? 22.121 18.044  3.565   1.00 33.83 ? 32  ALA B CA  1 
ATOM   1406 C C   . ALA B 1 32  ? 22.562 19.056  2.492   1.00 33.85 ? 32  ALA B C   1 
ATOM   1407 O O   . ALA B 1 32  ? 23.107 20.101  2.832   1.00 33.03 ? 32  ALA B O   1 
ATOM   1408 C CB  . ALA B 1 32  ? 23.180 16.952  3.753   1.00 33.24 ? 32  ALA B CB  1 
ATOM   1409 N N   . ALA B 1 33  ? 22.329 18.749  1.210   1.00 34.39 ? 33  ALA B N   1 
ATOM   1410 C CA  . ALA B 1 33  ? 22.637 19.699  0.127   1.00 35.18 ? 33  ALA B CA  1 
ATOM   1411 C C   . ALA B 1 33  ? 21.850 20.997  0.233   1.00 35.55 ? 33  ALA B C   1 
ATOM   1412 O O   . ALA B 1 33  ? 22.398 22.084  0.074   1.00 35.99 ? 33  ALA B O   1 
ATOM   1413 C CB  . ALA B 1 33  ? 22.402 19.066  -1.242  1.00 35.53 ? 33  ALA B CB  1 
ATOM   1414 N N   . ILE B 1 34  ? 20.557 20.875  0.490   1.00 35.80 ? 34  ILE B N   1 
ATOM   1415 C CA  . ILE B 1 34  ? 19.661 22.030  0.585   1.00 36.06 ? 34  ILE B CA  1 
ATOM   1416 C C   . ILE B 1 34  ? 20.037 22.889  1.796   1.00 36.15 ? 34  ILE B C   1 
ATOM   1417 O O   . ILE B 1 34  ? 20.039 24.123  1.720   1.00 35.88 ? 34  ILE B O   1 
ATOM   1418 C CB  . ILE B 1 34  ? 18.180 21.586  0.683   1.00 35.64 ? 34  ILE B CB  1 
ATOM   1419 C CG1 . ILE B 1 34  ? 17.728 20.843  -0.601  1.00 36.42 ? 34  ILE B CG1 1 
ATOM   1420 C CG2 . ILE B 1 34  ? 17.258 22.774  1.033   1.00 37.07 ? 34  ILE B CG2 1 
ATOM   1421 C CD1 . ILE B 1 34  ? 17.779 21.618  -1.885  1.00 34.07 ? 34  ILE B CD1 1 
ATOM   1422 N N   . LYS B 1 35  ? 20.375 22.232  2.902   1.00 35.88 ? 35  LYS B N   1 
ATOM   1423 C CA  . LYS B 1 35  ? 20.821 22.945  4.092   1.00 36.41 ? 35  LYS B CA  1 
ATOM   1424 C C   . LYS B 1 35  ? 22.123 23.682  3.828   1.00 36.10 ? 35  LYS B C   1 
ATOM   1425 O O   . LYS B 1 35  ? 22.398 24.721  4.439   1.00 36.02 ? 35  LYS B O   1 
ATOM   1426 C CB  . LYS B 1 35  ? 20.956 21.995  5.282   1.00 36.23 ? 35  LYS B CB  1 
ATOM   1427 C CG  . LYS B 1 35  ? 19.612 21.558  5.825   1.00 38.39 ? 35  LYS B CG  1 
ATOM   1428 C CD  . LYS B 1 35  ? 19.748 20.525  6.929   1.00 42.55 ? 35  LYS B CD  1 
ATOM   1429 C CE  . LYS B 1 35  ? 18.447 19.717  7.052   1.00 45.54 ? 35  LYS B CE  1 
ATOM   1430 N NZ  . LYS B 1 35  ? 18.571 18.596  8.047   1.00 46.93 ? 35  LYS B NZ  1 
ATOM   1431 N N   . ALA B 1 36  ? 22.897 23.163  2.884   1.00 36.39 ? 36  ALA B N   1 
ATOM   1432 C CA  . ALA B 1 36  ? 24.160 23.781  2.490   1.00 37.25 ? 36  ALA B CA  1 
ATOM   1433 C C   . ALA B 1 36  ? 24.022 24.782  1.329   1.00 37.80 ? 36  ALA B C   1 
ATOM   1434 O O   . ALA B 1 36  ? 25.028 25.123  0.712   1.00 38.46 ? 36  ALA B O   1 
ATOM   1435 C CB  . ALA B 1 36  ? 25.197 22.690  2.149   1.00 36.95 ? 36  ALA B CB  1 
ATOM   1436 N N   . ILE B 1 37  ? 22.802 25.267  1.071   1.00 37.77 ? 37  ILE B N   1 
ATOM   1437 C CA  . ILE B 1 37  ? 22.490 26.174  -0.067  1.00 38.72 ? 37  ILE B CA  1 
ATOM   1438 C C   . ILE B 1 37  ? 23.389 27.412  -0.261  1.00 38.78 ? 37  ILE B C   1 
ATOM   1439 O O   . ILE B 1 37  ? 23.669 27.802  -1.396  1.00 39.26 ? 37  ILE B O   1 
ATOM   1440 C CB  . ILE B 1 37  ? 20.972 26.593  -0.090  1.00 38.65 ? 37  ILE B CB  1 
ATOM   1441 C CG1 . ILE B 1 37  ? 20.603 27.331  -1.385  1.00 39.99 ? 37  ILE B CG1 1 
ATOM   1442 C CG2 . ILE B 1 37  ? 20.590 27.465  1.101   1.00 39.14 ? 37  ILE B CG2 1 
ATOM   1443 C CD1 . ILE B 1 37  ? 20.245 26.428  -2.503  1.00 40.14 ? 37  ILE B CD1 1 
ATOM   1444 N N   . LYS B 1 38  ? 23.828 28.042  0.824   1.00 39.20 ? 38  LYS B N   1 
ATOM   1445 C CA  . LYS B 1 38  ? 24.747 29.188  0.710   1.00 39.00 ? 38  LYS B CA  1 
ATOM   1446 C C   . LYS B 1 38  ? 26.046 28.717  0.051   1.00 39.09 ? 38  LYS B C   1 
ATOM   1447 O O   . LYS B 1 38  ? 26.689 29.452  -0.696  1.00 38.92 ? 38  LYS B O   1 
ATOM   1448 C CB  . LYS B 1 38  ? 25.028 29.795  2.086   1.00 39.01 ? 38  LYS B CB  1 
ATOM   1449 C CG  . LYS B 1 38  ? 26.086 30.892  2.101   1.00 39.45 ? 38  LYS B CG  1 
ATOM   1450 C CD  . LYS B 1 38  ? 26.125 31.605  3.430   1.00 41.26 ? 38  LYS B CD  1 
ATOM   1451 C CE  . LYS B 1 38  ? 27.442 32.339  3.629   1.00 42.72 ? 38  LYS B CE  1 
ATOM   1452 N NZ  . LYS B 1 38  ? 27.273 33.568  4.465   1.00 44.91 ? 38  LYS B NZ  1 
ATOM   1453 N N   . PHE B 1 39  ? 26.407 27.474  0.332   1.00 38.38 ? 39  PHE B N   1 
ATOM   1454 C CA  . PHE B 1 39  ? 27.617 26.880  -0.210  1.00 38.75 ? 39  PHE B CA  1 
ATOM   1455 C C   . PHE B 1 39  ? 27.318 25.932  -1.383  1.00 38.24 ? 39  PHE B C   1 
ATOM   1456 O O   . PHE B 1 39  ? 27.976 24.921  -1.548  1.00 39.05 ? 39  PHE B O   1 
ATOM   1457 C CB  . PHE B 1 39  ? 28.383 26.178  0.913   1.00 37.88 ? 39  PHE B CB  1 
ATOM   1458 C CG  . PHE B 1 39  ? 28.687 27.089  2.094   1.00 39.47 ? 39  PHE B CG  1 
ATOM   1459 C CD1 . PHE B 1 39  ? 29.664 28.074  1.994   1.00 38.51 ? 39  PHE B CD1 1 
ATOM   1460 C CD2 . PHE B 1 39  ? 27.970 26.975  3.286   1.00 38.55 ? 39  PHE B CD2 1 
ATOM   1461 C CE1 . PHE B 1 39  ? 29.936 28.936  3.062   1.00 40.99 ? 39  PHE B CE1 1 
ATOM   1462 C CE2 . PHE B 1 39  ? 28.233 27.823  4.366   1.00 40.04 ? 39  PHE B CE2 1 
ATOM   1463 C CZ  . PHE B 1 39  ? 29.222 28.810  4.256   1.00 39.97 ? 39  PHE B CZ  1 
ATOM   1464 N N   . TYR B 1 40  ? 26.326 26.269  -2.199  1.00 38.17 ? 40  TYR B N   1 
ATOM   1465 C CA  . TYR B 1 40  ? 25.925 25.395  -3.318  1.00 37.64 ? 40  TYR B CA  1 
ATOM   1466 C C   . TYR B 1 40  ? 27.074 25.103  -4.283  1.00 37.10 ? 40  TYR B C   1 
ATOM   1467 O O   . TYR B 1 40  ? 27.126 24.038  -4.873  1.00 37.35 ? 40  TYR B O   1 
ATOM   1468 C CB  . TYR B 1 40  ? 24.708 25.954  -4.061  1.00 38.02 ? 40  TYR B CB  1 
ATOM   1469 C CG  . TYR B 1 40  ? 25.008 27.166  -4.923  1.00 38.64 ? 40  TYR B CG  1 
ATOM   1470 C CD1 . TYR B 1 40  ? 25.303 27.022  -6.282  1.00 37.64 ? 40  TYR B CD1 1 
ATOM   1471 C CD2 . TYR B 1 40  ? 25.014 28.452  -4.379  1.00 38.02 ? 40  TYR B CD2 1 
ATOM   1472 C CE1 . TYR B 1 40  ? 25.596 28.130  -7.076  1.00 37.86 ? 40  TYR B CE1 1 
ATOM   1473 C CE2 . TYR B 1 40  ? 25.307 29.569  -5.173  1.00 39.09 ? 40  TYR B CE2 1 
ATOM   1474 C CZ  . TYR B 1 40  ? 25.596 29.386  -6.522  1.00 38.69 ? 40  TYR B CZ  1 
ATOM   1475 O OH  . TYR B 1 40  ? 25.889 30.468  -7.317  1.00 40.86 ? 40  TYR B OH  1 
ATOM   1476 N N   . LYS B 1 41  ? 28.002 26.042  -4.439  1.00 36.96 ? 41  LYS B N   1 
ATOM   1477 C CA  . LYS B 1 41  ? 29.157 25.820  -5.319  1.00 36.70 ? 41  LYS B CA  1 
ATOM   1478 C C   . LYS B 1 41  ? 30.072 24.686  -4.823  1.00 36.69 ? 41  LYS B C   1 
ATOM   1479 O O   . LYS B 1 41  ? 30.641 23.955  -5.635  1.00 36.67 ? 41  LYS B O   1 
ATOM   1480 C CB  . LYS B 1 41  ? 29.953 27.111  -5.542  1.00 36.06 ? 41  LYS B CB  1 
ATOM   1481 C CG  . LYS B 1 41  ? 29.209 28.188  -6.320  1.00 34.99 ? 41  LYS B CG  1 
ATOM   1482 C CD  . LYS B 1 41  ? 30.038 29.486  -6.396  1.00 36.70 ? 41  LYS B CD  1 
ATOM   1483 C CE  . LYS B 1 41  ? 29.457 30.465  -7.414  1.00 37.36 ? 41  LYS B CE  1 
ATOM   1484 N NZ  . LYS B 1 41  ? 30.372 31.635  -7.668  1.00 37.65 ? 41  LYS B NZ  1 
ATOM   1485 N N   . HIS B 1 42  ? 30.194 24.557  -3.502  1.00 36.64 ? 42  HIS B N   1 
ATOM   1486 C CA  . HIS B 1 42  ? 30.940 23.475  -2.846  1.00 36.95 ? 42  HIS B CA  1 
ATOM   1487 C C   . HIS B 1 42  ? 30.211 22.125  -2.921  1.00 36.55 ? 42  HIS B C   1 
ATOM   1488 O O   . HIS B 1 42  ? 30.832 21.095  -3.196  1.00 36.87 ? 42  HIS B O   1 
ATOM   1489 C CB  . HIS B 1 42  ? 31.196 23.832  -1.380  1.00 37.07 ? 42  HIS B CB  1 
ATOM   1490 C CG  . HIS B 1 42  ? 32.171 24.952  -1.186  1.00 39.54 ? 42  HIS B CG  1 
ATOM   1491 N ND1 . HIS B 1 42  ? 31.789 26.279  -1.155  1.00 42.00 ? 42  HIS B ND1 1 
ATOM   1492 C CD2 . HIS B 1 42  ? 33.513 24.944  -0.999  1.00 40.22 ? 42  HIS B CD2 1 
ATOM   1493 C CE1 . HIS B 1 42  ? 32.854 27.038  -0.962  1.00 41.47 ? 42  HIS B CE1 1 
ATOM   1494 N NE2 . HIS B 1 42  ? 33.913 26.251  -0.869  1.00 40.48 ? 42  HIS B NE2 1 
ATOM   1495 N N   . VAL B 1 43  ? 28.905 22.130  -2.657  1.00 36.10 ? 43  VAL B N   1 
ATOM   1496 C CA  . VAL B 1 43  ? 28.051 20.935  -2.848  1.00 36.79 ? 43  VAL B CA  1 
ATOM   1497 C C   . VAL B 1 43  ? 28.235 20.358  -4.250  1.00 37.10 ? 43  VAL B C   1 
ATOM   1498 O O   . VAL B 1 43  ? 28.451 19.151  -4.409  1.00 37.61 ? 43  VAL B O   1 
ATOM   1499 C CB  . VAL B 1 43  ? 26.532 21.256  -2.588  1.00 36.31 ? 43  VAL B CB  1 
ATOM   1500 C CG1 . VAL B 1 43  ? 25.621 20.065  -2.914  1.00 36.57 ? 43  VAL B CG1 1 
ATOM   1501 C CG2 . VAL B 1 43  ? 26.319 21.720  -1.147  1.00 36.11 ? 43  VAL B CG2 1 
ATOM   1502 N N   . VAL B 1 44  ? 28.165 21.225  -5.260  1.00 36.98 ? 44  VAL B N   1 
ATOM   1503 C CA  . VAL B 1 44  ? 28.289 20.805  -6.667  1.00 37.04 ? 44  VAL B CA  1 
ATOM   1504 C C   . VAL B 1 44  ? 29.679 20.194  -6.920  1.00 37.42 ? 44  VAL B C   1 
ATOM   1505 O O   . VAL B 1 44  ? 29.802 19.121  -7.530  1.00 36.73 ? 44  VAL B O   1 
ATOM   1506 C CB  . VAL B 1 44  ? 27.978 21.992  -7.643  1.00 37.57 ? 44  VAL B CB  1 
ATOM   1507 C CG1 . VAL B 1 44  ? 28.480 21.709  -9.084  1.00 37.75 ? 44  VAL B CG1 1 
ATOM   1508 C CG2 . VAL B 1 44  ? 26.467 22.347  -7.618  1.00 34.87 ? 44  VAL B CG2 1 
ATOM   1509 N N   . GLN B 1 45  ? 30.707 20.863  -6.408  1.00 37.33 ? 45  GLN B N   1 
ATOM   1510 C CA  . GLN B 1 45  ? 32.078 20.374  -6.521  1.00 38.18 ? 45  GLN B CA  1 
ATOM   1511 C C   . GLN B 1 45  ? 32.217 19.006  -5.890  1.00 37.87 ? 45  GLN B C   1 
ATOM   1512 O O   . GLN B 1 45  ? 32.804 18.111  -6.492  1.00 38.79 ? 45  GLN B O   1 
ATOM   1513 C CB  A GLN B 1 45  ? 33.066 21.355  -5.873  0.50 38.17 ? 45  GLN B CB  1 
ATOM   1514 C CB  B GLN B 1 45  ? 33.060 21.352  -5.874  0.50 37.95 ? 45  GLN B CB  1 
ATOM   1515 C CG  A GLN B 1 45  ? 34.518 20.888  -5.890  0.50 39.07 ? 45  GLN B CG  1 
ATOM   1516 C CG  B GLN B 1 45  ? 34.504 20.897  -5.948  0.50 38.02 ? 45  GLN B CG  1 
ATOM   1517 C CD  A GLN B 1 45  ? 35.236 21.220  -7.188  0.50 40.22 ? 45  GLN B CD  1 
ATOM   1518 C CD  B GLN B 1 45  ? 35.452 21.835  -5.234  0.50 37.62 ? 45  GLN B CD  1 
ATOM   1519 O OE1 A GLN B 1 45  ? 35.619 22.370  -7.423  0.50 40.26 ? 45  GLN B OE1 1 
ATOM   1520 O OE1 B GLN B 1 45  ? 35.244 22.186  -4.073  0.50 37.71 ? 45  GLN B OE1 1 
ATOM   1521 N NE2 A GLN B 1 45  ? 35.434 20.210  -8.034  0.50 40.23 ? 45  GLN B NE2 1 
ATOM   1522 N NE2 B GLN B 1 45  ? 36.509 22.234  -5.923  0.50 37.06 ? 45  GLN B NE2 1 
ATOM   1523 N N   . SER B 1 46  ? 31.681 18.849  -4.677  1.00 37.58 ? 46  SER B N   1 
ATOM   1524 C CA  . SER B 1 46  ? 31.712 17.566  -3.988  1.00 37.36 ? 46  SER B CA  1 
ATOM   1525 C C   . SER B 1 46  ? 31.007 16.493  -4.773  1.00 36.47 ? 46  SER B C   1 
ATOM   1526 O O   . SER B 1 46  ? 31.484 15.387  -4.830  1.00 36.91 ? 46  SER B O   1 
ATOM   1527 C CB  . SER B 1 46  ? 31.105 17.656  -2.593  1.00 36.79 ? 46  SER B CB  1 
ATOM   1528 O OG  . SER B 1 46  ? 31.903 18.477  -1.784  1.00 39.35 ? 46  SER B OG  1 
ATOM   1529 N N   . VAL B 1 47  ? 29.859 16.797  -5.358  1.00 37.02 ? 47  VAL B N   1 
ATOM   1530 C CA  . VAL B 1 47  ? 29.131 15.762  -6.121  1.00 36.61 ? 47  VAL B CA  1 
ATOM   1531 C C   . VAL B 1 47  ? 29.968 15.362  -7.336  1.00 37.07 ? 47  VAL B C   1 
ATOM   1532 O O   . VAL B 1 47  ? 30.110 14.172  -7.658  1.00 37.43 ? 47  VAL B O   1 
ATOM   1533 C CB  . VAL B 1 47  ? 27.727 16.226  -6.556  1.00 36.57 ? 47  VAL B CB  1 
ATOM   1534 C CG1 . VAL B 1 47  ? 27.098 15.218  -7.552  1.00 34.94 ? 47  VAL B CG1 1 
ATOM   1535 C CG2 . VAL B 1 47  ? 26.837 16.419  -5.356  1.00 35.75 ? 47  VAL B CG2 1 
ATOM   1536 N N   . GLU B 1 48  ? 30.557 16.361  -7.979  1.00 37.36 ? 48  GLU B N   1 
ATOM   1537 C CA  . GLU B 1 48  ? 31.397 16.125  -9.157  1.00 38.28 ? 48  GLU B CA  1 
ATOM   1538 C C   . GLU B 1 48  ? 32.660 15.279  -8.884  1.00 38.28 ? 48  GLU B C   1 
ATOM   1539 O O   . GLU B 1 48  ? 33.004 14.420  -9.696  1.00 38.14 ? 48  GLU B O   1 
ATOM   1540 C CB  . GLU B 1 48  ? 31.741 17.447  -9.843  1.00 37.78 ? 48  GLU B CB  1 
ATOM   1541 C CG  . GLU B 1 48  ? 30.541 18.064  -10.554 1.00 38.39 ? 48  GLU B CG  1 
ATOM   1542 C CD  . GLU B 1 48  ? 30.829 19.443  -11.128 1.00 38.68 ? 48  GLU B CD  1 
ATOM   1543 O OE1 . GLU B 1 48  ? 31.964 19.956  -11.000 1.00 38.22 ? 48  GLU B OE1 1 
ATOM   1544 O OE2 . GLU B 1 48  ? 29.901 20.015  -11.714 1.00 40.17 ? 48  GLU B OE2 1 
ATOM   1545 N N   . LYS B 1 49  ? 33.323 15.522  -7.748  1.00 38.34 ? 49  LYS B N   1 
ATOM   1546 C CA  . LYS B 1 49  ? 34.504 14.744  -7.314  1.00 39.13 ? 49  LYS B CA  1 
ATOM   1547 C C   . LYS B 1 49  ? 34.108 13.314  -6.961  1.00 38.38 ? 49  LYS B C   1 
ATOM   1548 O O   . LYS B 1 49  ? 34.827 12.380  -7.272  1.00 37.98 ? 49  LYS B O   1 
ATOM   1549 C CB  . LYS B 1 49  ? 35.213 15.427  -6.114  1.00 39.12 ? 49  LYS B CB  1 
ATOM   1550 C CG  . LYS B 1 49  ? 36.435 14.691  -5.557  1.00 40.76 ? 49  LYS B CG  1 
ATOM   1551 C CD  . LYS B 1 49  ? 36.888 15.290  -4.199  1.00 41.75 ? 49  LYS B CD  1 
ATOM   1552 C CE  . LYS B 1 49  ? 38.079 14.552  -3.573  1.00 44.59 ? 49  LYS B CE  1 
ATOM   1553 N NZ  . LYS B 1 49  ? 37.712 13.193  -2.974  1.00 47.62 ? 49  LYS B NZ  1 
ATOM   1554 N N   . PHE B 1 50  ? 32.953 13.152  -6.315  1.00 38.23 ? 50  PHE B N   1 
ATOM   1555 C CA  . PHE B 1 50  ? 32.422 11.832  -6.042  1.00 37.99 ? 50  PHE B CA  1 
ATOM   1556 C C   . PHE B 1 50  ? 32.230 11.023  -7.330  1.00 37.81 ? 50  PHE B C   1 
ATOM   1557 O O   . PHE B 1 50  ? 32.666 9.869   -7.413  1.00 37.89 ? 50  PHE B O   1 
ATOM   1558 C CB  . PHE B 1 50  ? 31.095 11.903  -5.275  1.00 38.24 ? 50  PHE B CB  1 
ATOM   1559 C CG  . PHE B 1 50  ? 30.520 10.538  -4.958  1.00 39.36 ? 50  PHE B CG  1 
ATOM   1560 C CD1 . PHE B 1 50  ? 30.923 9.849   -3.803  1.00 38.89 ? 50  PHE B CD1 1 
ATOM   1561 C CD2 . PHE B 1 50  ? 29.622 9.918   -5.833  1.00 38.34 ? 50  PHE B CD2 1 
ATOM   1562 C CE1 . PHE B 1 50  ? 30.423 8.590   -3.510  1.00 37.30 ? 50  PHE B CE1 1 
ATOM   1563 C CE2 . PHE B 1 50  ? 29.118 8.639   -5.559  1.00 37.14 ? 50  PHE B CE2 1 
ATOM   1564 C CZ  . PHE B 1 50  ? 29.522 7.977   -4.390  1.00 37.76 ? 50  PHE B CZ  1 
ATOM   1565 N N   . ILE B 1 51  ? 31.559 11.619  -8.314  1.00 37.15 ? 51  ILE B N   1 
ATOM   1566 C CA  . ILE B 1 51  ? 31.324 10.984  -9.620  1.00 36.77 ? 51  ILE B CA  1 
ATOM   1567 C C   . ILE B 1 51  ? 32.643 10.716  -10.375 1.00 36.94 ? 51  ILE B C   1 
ATOM   1568 O O   . ILE B 1 51  ? 32.735 9.787   -11.165 1.00 36.37 ? 51  ILE B O   1 
ATOM   1569 C CB  . ILE B 1 51  ? 30.323 11.831  -10.465 1.00 36.94 ? 51  ILE B CB  1 
ATOM   1570 C CG1 . ILE B 1 51  ? 28.930 11.757  -9.830  1.00 35.22 ? 51  ILE B CG1 1 
ATOM   1571 C CG2 . ILE B 1 51  ? 30.295 11.397  -11.943 1.00 35.93 ? 51  ILE B CG2 1 
ATOM   1572 C CD1 . ILE B 1 51  ? 27.949 12.757  -10.362 1.00 35.64 ? 51  ILE B CD1 1 
ATOM   1573 N N   . GLN B 1 52  ? 33.655 11.539  -10.119 1.00 37.15 ? 52  GLN B N   1 
ATOM   1574 C CA  . GLN B 1 52  ? 34.969 11.353  -10.722 1.00 38.07 ? 52  GLN B CA  1 
ATOM   1575 C C   . GLN B 1 52  ? 35.736 10.239  -10.017 1.00 37.89 ? 52  GLN B C   1 
ATOM   1576 O O   . GLN B 1 52  ? 36.429 9.463   -10.656 1.00 38.31 ? 52  GLN B O   1 
ATOM   1577 C CB  . GLN B 1 52  ? 35.773 12.660  -10.650 1.00 37.88 ? 52  GLN B CB  1 
ATOM   1578 C CG  . GLN B 1 52  ? 37.134 12.649  -11.377 1.00 38.69 ? 52  GLN B CG  1 
ATOM   1579 C CD  . GLN B 1 52  ? 38.056 13.756  -10.886 1.00 39.74 ? 52  GLN B CD  1 
ATOM   1580 O OE1 . GLN B 1 52  ? 37.738 14.470  -9.923  1.00 42.65 ? 52  GLN B OE1 1 
ATOM   1581 N NE2 . GLN B 1 52  ? 39.213 13.889  -11.525 1.00 39.36 ? 52  GLN B NE2 1 
ATOM   1582 N N   . LYS B 1 53  ? 35.619 10.153  -8.699  1.00 38.01 ? 53  LYS B N   1 
ATOM   1583 C CA  . LYS B 1 53  ? 36.451 9.212   -7.946  1.00 38.30 ? 53  LYS B CA  1 
ATOM   1584 C C   . LYS B 1 53  ? 35.776 7.877   -7.564  1.00 38.40 ? 53  LYS B C   1 
ATOM   1585 O O   . LYS B 1 53  ? 36.449 6.946   -7.144  1.00 38.64 ? 53  LYS B O   1 
ATOM   1586 C CB  . LYS B 1 53  ? 36.996 9.902   -6.692  1.00 38.27 ? 53  LYS B CB  1 
ATOM   1587 C CG  . LYS B 1 53  ? 37.992 11.034  -6.975  1.00 38.58 ? 53  LYS B CG  1 
ATOM   1588 C CD  . LYS B 1 53  ? 38.852 11.369  -5.748  1.00 39.05 ? 53  LYS B CD  1 
ATOM   1589 C CE  . LYS B 1 53  ? 40.067 10.458  -5.665  1.00 41.68 ? 53  LYS B CE  1 
ATOM   1590 N NZ  . LYS B 1 53  ? 41.117 10.985  -4.751  1.00 43.00 ? 53  LYS B NZ  1 
ATOM   1591 N N   . CYS B 1 54  ? 34.457 7.785   -7.693  1.00 38.53 ? 54  CYS B N   1 
ATOM   1592 C CA  . CYS B 1 54  ? 33.736 6.626   -7.160  1.00 39.03 ? 54  CYS B CA  1 
ATOM   1593 C C   . CYS B 1 54  ? 33.898 5.365   -8.001  1.00 38.88 ? 54  CYS B C   1 
ATOM   1594 O O   . CYS B 1 54  ? 34.330 5.420   -9.151  1.00 39.33 ? 54  CYS B O   1 
ATOM   1595 C CB  . CYS B 1 54  ? 32.253 6.944   -6.925  1.00 38.36 ? 54  CYS B CB  1 
ATOM   1596 S SG  . CYS B 1 54  ? 31.279 7.196   -8.429  1.00 38.66 ? 54  CYS B SG  1 
ATOM   1597 N N   . LYS B 1 55  ? 33.580 4.227   -7.393  1.00 38.79 ? 55  LYS B N   1 
ATOM   1598 C CA  . LYS B 1 55  ? 33.541 2.946   -8.081  1.00 38.85 ? 55  LYS B CA  1 
ATOM   1599 C C   . LYS B 1 55  ? 32.449 2.957   -9.176  1.00 38.39 ? 55  LYS B C   1 
ATOM   1600 O O   . LYS B 1 55  ? 31.475 3.700   -9.065  1.00 38.67 ? 55  LYS B O   1 
ATOM   1601 C CB  . LYS B 1 55  ? 33.290 1.829   -7.065  1.00 39.16 ? 55  LYS B CB  1 
ATOM   1602 C CG  . LYS B 1 55  ? 34.439 1.584   -6.081  1.00 39.91 ? 55  LYS B CG  1 
ATOM   1603 C CD  . LYS B 1 55  ? 34.060 0.518   -5.053  1.00 39.70 ? 55  LYS B CD  1 
ATOM   1604 C CE  . LYS B 1 55  ? 35.243 0.093   -4.204  1.00 42.89 ? 55  LYS B CE  1 
ATOM   1605 N NZ  . LYS B 1 55  ? 35.591 1.118   -3.166  1.00 44.66 ? 55  LYS B NZ  1 
ATOM   1606 N N   . PRO B 1 56  ? 32.625 2.168   -10.256 1.00 38.25 ? 56  PRO B N   1 
ATOM   1607 C CA  . PRO B 1 56  ? 31.655 2.149   -11.369 1.00 38.15 ? 56  PRO B CA  1 
ATOM   1608 C C   . PRO B 1 56  ? 30.183 1.969   -10.955 1.00 38.13 ? 56  PRO B C   1 
ATOM   1609 O O   . PRO B 1 56  ? 29.282 2.535   -11.598 1.00 38.04 ? 56  PRO B O   1 
ATOM   1610 C CB  . PRO B 1 56  ? 32.108 0.945   -12.194 1.00 38.61 ? 56  PRO B CB  1 
ATOM   1611 C CG  . PRO B 1 56  ? 33.572 0.848   -11.937 1.00 38.22 ? 56  PRO B CG  1 
ATOM   1612 C CD  . PRO B 1 56  ? 33.767 1.272   -10.511 1.00 37.98 ? 56  PRO B CD  1 
ATOM   1613 N N   . GLU B 1 57  ? 29.944 1.212   -9.885  1.00 37.27 ? 57  GLU B N   1 
ATOM   1614 C CA  . GLU B 1 57  ? 28.585 0.919   -9.451  1.00 37.11 ? 57  GLU B CA  1 
ATOM   1615 C C   . GLU B 1 57  ? 27.945 2.097   -8.725  1.00 36.20 ? 57  GLU B C   1 
ATOM   1616 O O   . GLU B 1 57  ? 26.763 2.048   -8.392  1.00 36.17 ? 57  GLU B O   1 
ATOM   1617 C CB  . GLU B 1 57  ? 28.523 -0.347  -8.582  1.00 37.10 ? 57  GLU B CB  1 
ATOM   1618 C CG  . GLU B 1 57  ? 29.240 -0.243  -7.241  1.00 39.17 ? 57  GLU B CG  1 
ATOM   1619 C CD  . GLU B 1 57  ? 30.652 -0.821  -7.259  1.00 43.23 ? 57  GLU B CD  1 
ATOM   1620 O OE1 . GLU B 1 57  ? 31.321 -0.804  -8.325  1.00 43.67 ? 57  GLU B OE1 1 
ATOM   1621 O OE2 . GLU B 1 57  ? 31.094 -1.307  -6.190  1.00 45.74 ? 57  GLU B OE2 1 
ATOM   1622 N N   . TYR B 1 58  ? 28.723 3.149   -8.479  1.00 35.17 ? 58  TYR B N   1 
ATOM   1623 C CA  . TYR B 1 58  ? 28.207 4.305   -7.783  1.00 34.24 ? 58  TYR B CA  1 
ATOM   1624 C C   . TYR B 1 58  ? 28.010 5.483   -8.732  1.00 34.18 ? 58  TYR B C   1 
ATOM   1625 O O   . TYR B 1 58  ? 27.620 6.555   -8.300  1.00 34.01 ? 58  TYR B O   1 
ATOM   1626 C CB  . TYR B 1 58  ? 29.087 4.676   -6.572  1.00 34.38 ? 58  TYR B CB  1 
ATOM   1627 C CG  . TYR B 1 58  ? 28.975 3.714   -5.398  1.00 32.37 ? 58  TYR B CG  1 
ATOM   1628 C CD1 . TYR B 1 58  ? 27.875 3.745   -4.541  1.00 29.63 ? 58  TYR B CD1 1 
ATOM   1629 C CD2 . TYR B 1 58  ? 29.976 2.779   -5.150  1.00 32.76 ? 58  TYR B CD2 1 
ATOM   1630 C CE1 . TYR B 1 58  ? 27.780 2.876   -3.462  1.00 32.42 ? 58  TYR B CE1 1 
ATOM   1631 C CE2 . TYR B 1 58  ? 29.883 1.878   -4.081  1.00 33.69 ? 58  TYR B CE2 1 
ATOM   1632 C CZ  . TYR B 1 58  ? 28.784 1.924   -3.241  1.00 33.28 ? 58  TYR B CZ  1 
ATOM   1633 O OH  . TYR B 1 58  ? 28.703 1.022   -2.192  1.00 32.74 ? 58  TYR B OH  1 
ATOM   1634 N N   . LYS B 1 59  ? 28.259 5.272   -10.027 1.00 34.45 ? 59  LYS B N   1 
ATOM   1635 C CA  . LYS B 1 59  ? 28.021 6.319   -11.044 1.00 34.57 ? 59  LYS B CA  1 
ATOM   1636 C C   . LYS B 1 59  ? 26.536 6.697   -11.093 1.00 34.64 ? 59  LYS B C   1 
ATOM   1637 O O   . LYS B 1 59  ? 26.181 7.873   -10.957 1.00 35.55 ? 59  LYS B O   1 
ATOM   1638 C CB  . LYS B 1 59  ? 28.515 5.910   -12.453 1.00 34.04 ? 59  LYS B CB  1 
ATOM   1639 C CG  . LYS B 1 59  ? 29.986 5.506   -12.580 1.00 32.06 ? 59  LYS B CG  1 
ATOM   1640 C CD  . LYS B 1 59  ? 30.924 6.595   -12.140 1.00 32.69 ? 59  LYS B CD  1 
ATOM   1641 C CE  . LYS B 1 59  ? 32.356 6.112   -12.222 1.00 30.78 ? 59  LYS B CE  1 
ATOM   1642 N NZ  . LYS B 1 59  ? 33.235 7.196   -11.727 1.00 31.98 ? 59  LYS B NZ  1 
ATOM   1643 N N   . VAL B 1 60  ? 25.675 5.699   -11.254 1.00 34.92 ? 60  VAL B N   1 
ATOM   1644 C CA  . VAL B 1 60  ? 24.226 5.935   -11.289 1.00 35.61 ? 60  VAL B CA  1 
ATOM   1645 C C   . VAL B 1 60  ? 23.694 6.563   -9.968  1.00 35.73 ? 60  VAL B C   1 
ATOM   1646 O O   . VAL B 1 60  ? 23.020 7.577   -10.015 1.00 36.17 ? 60  VAL B O   1 
ATOM   1647 C CB  . VAL B 1 60  ? 23.433 4.675   -11.775 1.00 35.45 ? 60  VAL B CB  1 
ATOM   1648 C CG1 . VAL B 1 60  ? 21.953 4.835   -11.534 1.00 35.26 ? 60  VAL B CG1 1 
ATOM   1649 C CG2 . VAL B 1 60  ? 23.689 4.425   -13.277 1.00 36.09 ? 60  VAL B CG2 1 
ATOM   1650 N N   . PRO B 1 61  ? 24.011 5.982   -8.792  1.00 36.19 ? 61  PRO B N   1 
ATOM   1651 C CA  . PRO B 1 61  ? 23.681 6.722   -7.553  1.00 36.62 ? 61  PRO B CA  1 
ATOM   1652 C C   . PRO B 1 61  ? 24.167 8.186   -7.527  1.00 37.12 ? 61  PRO B C   1 
ATOM   1653 O O   . PRO B 1 61  ? 23.445 9.065   -7.047  1.00 37.41 ? 61  PRO B O   1 
ATOM   1654 C CB  . PRO B 1 61  ? 24.376 5.894   -6.457  1.00 36.29 ? 61  PRO B CB  1 
ATOM   1655 C CG  . PRO B 1 61  ? 24.364 4.483   -7.016  1.00 36.96 ? 61  PRO B CG  1 
ATOM   1656 C CD  . PRO B 1 61  ? 24.586 4.647   -8.508  1.00 36.07 ? 61  PRO B CD  1 
ATOM   1657 N N   . GLY B 1 62  ? 25.377 8.441   -8.026  1.00 37.66 ? 62  GLY B N   1 
ATOM   1658 C CA  . GLY B 1 62  ? 25.890 9.797   -8.169  1.00 38.47 ? 62  GLY B CA  1 
ATOM   1659 C C   . GLY B 1 62  ? 25.059 10.666  -9.108  1.00 38.98 ? 62  GLY B C   1 
ATOM   1660 O O   . GLY B 1 62  ? 24.831 11.840  -8.830  1.00 39.74 ? 62  GLY B O   1 
ATOM   1661 N N   . LEU B 1 63  ? 24.602 10.106  -10.225 1.00 38.92 ? 63  LEU B N   1 
ATOM   1662 C CA  . LEU B 1 63  ? 23.650 10.830  -11.072 1.00 38.40 ? 63  LEU B CA  1 
ATOM   1663 C C   . LEU B 1 63  ? 22.337 11.070  -10.330 1.00 38.31 ? 63  LEU B C   1 
ATOM   1664 O O   . LEU B 1 63  ? 21.760 12.144  -10.447 1.00 38.21 ? 63  LEU B O   1 
ATOM   1665 C CB  . LEU B 1 63  ? 23.379 10.092  -12.386 1.00 38.08 ? 63  LEU B CB  1 
ATOM   1666 C CG  . LEU B 1 63  ? 22.339 10.722  -13.324 1.00 37.63 ? 63  LEU B CG  1 
ATOM   1667 C CD1 . LEU B 1 63  ? 22.589 12.222  -13.537 1.00 34.84 ? 63  LEU B CD1 1 
ATOM   1668 C CD2 . LEU B 1 63  ? 22.343 9.997   -14.633 1.00 35.66 ? 63  LEU B CD2 1 
ATOM   1669 N N   . TYR B 1 64  ? 21.871 10.074  -9.577  1.00 37.98 ? 64  TYR B N   1 
ATOM   1670 C CA  . TYR B 1 64  ? 20.650 10.224  -8.790  1.00 38.65 ? 64  TYR B CA  1 
ATOM   1671 C C   . TYR B 1 64  ? 20.765 11.323  -7.733  1.00 38.94 ? 64  TYR B C   1 
ATOM   1672 O O   . TYR B 1 64  ? 19.784 12.030  -7.448  1.00 39.47 ? 64  TYR B O   1 
ATOM   1673 C CB  . TYR B 1 64  ? 20.236 8.902   -8.148  1.00 38.97 ? 64  TYR B CB  1 
ATOM   1674 C CG  . TYR B 1 64  ? 19.651 7.894   -9.118  1.00 39.33 ? 64  TYR B CG  1 
ATOM   1675 C CD1 . TYR B 1 64  ? 19.295 8.261   -10.422 1.00 39.11 ? 64  TYR B CD1 1 
ATOM   1676 C CD2 . TYR B 1 64  ? 19.449 6.575   -8.725  1.00 39.68 ? 64  TYR B CD2 1 
ATOM   1677 C CE1 . TYR B 1 64  ? 18.763 7.323   -11.316 1.00 38.98 ? 64  TYR B CE1 1 
ATOM   1678 C CE2 . TYR B 1 64  ? 18.906 5.640   -9.590  1.00 41.00 ? 64  TYR B CE2 1 
ATOM   1679 C CZ  . TYR B 1 64  ? 18.570 6.016   -10.888 1.00 40.30 ? 64  TYR B CZ  1 
ATOM   1680 O OH  . TYR B 1 64  ? 18.032 5.074   -11.734 1.00 38.80 ? 64  TYR B OH  1 
ATOM   1681 N N   . VAL B 1 65  ? 21.963 11.495  -7.179  1.00 38.31 ? 65  VAL B N   1 
ATOM   1682 C CA  . VAL B 1 65  ? 22.198 12.619  -6.262  1.00 38.09 ? 65  VAL B CA  1 
ATOM   1683 C C   . VAL B 1 65  ? 21.957 13.968  -6.949  1.00 38.00 ? 65  VAL B C   1 
ATOM   1684 O O   . VAL B 1 65  ? 21.251 14.818  -6.399  1.00 38.09 ? 65  VAL B O   1 
ATOM   1685 C CB  . VAL B 1 65  ? 23.586 12.537  -5.556  1.00 37.77 ? 65  VAL B CB  1 
ATOM   1686 C CG1 . VAL B 1 65  ? 23.932 13.866  -4.846  1.00 38.25 ? 65  VAL B CG1 1 
ATOM   1687 C CG2 . VAL B 1 65  ? 23.602 11.370  -4.559  1.00 35.78 ? 65  VAL B CG2 1 
ATOM   1688 N N   . ILE B 1 66  ? 22.509 14.149  -8.153  1.00 38.16 ? 66  ILE B N   1 
ATOM   1689 C CA  . ILE B 1 66  ? 22.293 15.376  -8.936  1.00 37.48 ? 66  ILE B CA  1 
ATOM   1690 C C   . ILE B 1 66  ? 20.812 15.546  -9.204  1.00 37.94 ? 66  ILE B C   1 
ATOM   1691 O O   . ILE B 1 66  ? 20.263 16.632  -9.037  1.00 38.81 ? 66  ILE B O   1 
ATOM   1692 C CB  . ILE B 1 66  ? 23.030 15.365  -10.318 1.00 37.25 ? 66  ILE B CB  1 
ATOM   1693 C CG1 . ILE B 1 66  ? 24.552 15.195  -10.146 1.00 37.18 ? 66  ILE B CG1 1 
ATOM   1694 C CG2 . ILE B 1 66  ? 22.677 16.637  -11.139 1.00 36.45 ? 66  ILE B CG2 1 
ATOM   1695 C CD1 . ILE B 1 66  ? 25.332 15.181  -11.457 1.00 37.22 ? 66  ILE B CD1 1 
ATOM   1696 N N   . ASP B 1 67  ? 20.174 14.479  -9.650  1.00 37.64 ? 67  ASP B N   1 
ATOM   1697 C CA  . ASP B 1 67  ? 18.747 14.509  -9.974  1.00 37.42 ? 67  ASP B CA  1 
ATOM   1698 C C   . ASP B 1 67  ? 17.910 14.912  -8.752  1.00 37.65 ? 67  ASP B C   1 
ATOM   1699 O O   . ASP B 1 67  ? 17.042 15.800  -8.831  1.00 37.66 ? 67  ASP B O   1 
ATOM   1700 C CB  . ASP B 1 67  ? 18.313 13.146  -10.518 1.00 36.39 ? 67  ASP B CB  1 
ATOM   1701 C CG  . ASP B 1 67  ? 16.845 13.094  -10.863 1.00 37.87 ? 67  ASP B CG  1 
ATOM   1702 O OD1 . ASP B 1 67  ? 16.419 13.720  -11.869 1.00 38.68 ? 67  ASP B OD1 1 
ATOM   1703 O OD2 . ASP B 1 67  ? 16.104 12.425  -10.123 1.00 37.00 ? 67  ASP B OD2 1 
ATOM   1704 N N   . SER B 1 68  ? 18.169 14.245  -7.632  1.00 37.45 ? 68  SER B N   1 
ATOM   1705 C CA  . SER B 1 68  ? 17.379 14.447  -6.421  1.00 38.23 ? 68  SER B CA  1 
ATOM   1706 C C   . SER B 1 68  ? 17.536 15.880  -5.887  1.00 37.48 ? 68  SER B C   1 
ATOM   1707 O O   . SER B 1 68  ? 16.556 16.516  -5.506  1.00 37.89 ? 68  SER B O   1 
ATOM   1708 C CB  . SER B 1 68  ? 17.779 13.418  -5.352  1.00 38.26 ? 68  SER B CB  1 
ATOM   1709 O OG  . SER B 1 68  ? 17.019 13.601  -4.174  1.00 39.86 ? 68  SER B OG  1 
ATOM   1710 N N   . ILE B 1 69  ? 18.775 16.364  -5.875  1.00 37.27 ? 69  ILE B N   1 
ATOM   1711 C CA  . ILE B 1 69  ? 19.118 17.725  -5.429  1.00 36.40 ? 69  ILE B CA  1 
ATOM   1712 C C   . ILE B 1 69  ? 18.461 18.775  -6.314  1.00 36.28 ? 69  ILE B C   1 
ATOM   1713 O O   . ILE B 1 69  ? 17.843 19.720  -5.822  1.00 35.82 ? 69  ILE B O   1 
ATOM   1714 C CB  . ILE B 1 69  ? 20.661 17.935  -5.401  1.00 36.62 ? 69  ILE B CB  1 
ATOM   1715 C CG1 . ILE B 1 69  ? 21.322 17.079  -4.294  1.00 35.35 ? 69  ILE B CG1 1 
ATOM   1716 C CG2 . ILE B 1 69  ? 21.034 19.435  -5.236  1.00 35.74 ? 69  ILE B CG2 1 
ATOM   1717 C CD1 . ILE B 1 69  ? 22.868 17.181  -4.262  1.00 36.39 ? 69  ILE B CD1 1 
ATOM   1718 N N   . VAL B 1 70  ? 18.601 18.612  -7.628  1.00 36.21 ? 70  VAL B N   1 
ATOM   1719 C CA  . VAL B 1 70  ? 18.016 19.552  -8.569  1.00 35.70 ? 70  VAL B CA  1 
ATOM   1720 C C   . VAL B 1 70  ? 16.496 19.545  -8.454  1.00 35.69 ? 70  VAL B C   1 
ATOM   1721 O O   . VAL B 1 70  ? 15.882 20.597  -8.309  1.00 36.36 ? 70  VAL B O   1 
ATOM   1722 C CB  . VAL B 1 70  ? 18.502 19.299  -10.027 1.00 36.29 ? 70  VAL B CB  1 
ATOM   1723 C CG1 . VAL B 1 70  ? 17.695 20.124  -11.017 1.00 36.15 ? 70  VAL B CG1 1 
ATOM   1724 C CG2 . VAL B 1 70  ? 20.003 19.622  -10.155 1.00 34.41 ? 70  VAL B CG2 1 
ATOM   1725 N N   . ARG B 1 71  ? 15.878 18.371  -8.487  1.00 35.92 ? 71  ARG B N   1 
ATOM   1726 C CA  . ARG B 1 71  ? 14.423 18.324  -8.399  1.00 36.55 ? 71  ARG B CA  1 
ATOM   1727 C C   . ARG B 1 71  ? 13.934 18.869  -7.053  1.00 36.24 ? 71  ARG B C   1 
ATOM   1728 O O   . ARG B 1 71  ? 12.969 19.640  -7.012  1.00 36.25 ? 71  ARG B O   1 
ATOM   1729 C CB  . ARG B 1 71  ? 13.882 16.910  -8.662  1.00 36.79 ? 71  ARG B CB  1 
ATOM   1730 C CG  . ARG B 1 71  ? 13.974 16.485  -10.140 1.00 39.18 ? 71  ARG B CG  1 
ATOM   1731 C CD  . ARG B 1 71  ? 13.797 14.993  -10.310 1.00 42.20 ? 71  ARG B CD  1 
ATOM   1732 N NE  . ARG B 1 71  ? 12.487 14.587  -9.845  1.00 46.66 ? 71  ARG B NE  1 
ATOM   1733 C CZ  . ARG B 1 71  ? 12.251 13.663  -8.921  1.00 47.15 ? 71  ARG B CZ  1 
ATOM   1734 N NH1 . ARG B 1 71  ? 13.237 12.969  -8.373  1.00 47.07 ? 71  ARG B NH1 1 
ATOM   1735 N NH2 . ARG B 1 71  ? 11.001 13.413  -8.584  1.00 48.39 ? 71  ARG B NH2 1 
ATOM   1736 N N   . GLN B 1 72  ? 14.612 18.497  -5.968  1.00 35.89 ? 72  GLN B N   1 
ATOM   1737 C CA  . GLN B 1 72  ? 14.179 18.944  -4.643  1.00 35.81 ? 72  GLN B CA  1 
ATOM   1738 C C   . GLN B 1 72  ? 14.376 20.444  -4.465  1.00 35.34 ? 72  GLN B C   1 
ATOM   1739 O O   . GLN B 1 72  ? 13.552 21.094  -3.838  1.00 35.43 ? 72  GLN B O   1 
ATOM   1740 C CB  . GLN B 1 72  ? 14.844 18.157  -3.522  1.00 35.43 ? 72  GLN B CB  1 
ATOM   1741 C CG  . GLN B 1 72  ? 14.421 18.602  -2.105  1.00 36.86 ? 72  GLN B CG  1 
ATOM   1742 C CD  . GLN B 1 72  ? 12.940 18.429  -1.844  1.00 40.17 ? 72  GLN B CD  1 
ATOM   1743 O OE1 . GLN B 1 72  ? 12.308 17.508  -2.363  1.00 41.12 ? 72  GLN B OE1 1 
ATOM   1744 N NE2 . GLN B 1 72  ? 12.377 19.317  -1.040  1.00 40.34 ? 72  GLN B NE2 1 
ATOM   1745 N N   . SER B 1 73  ? 15.441 20.986  -5.047  1.00 34.71 ? 73  SER B N   1 
ATOM   1746 C CA  . SER B 1 73  ? 15.666 22.435  -5.028  1.00 34.69 ? 73  SER B CA  1 
ATOM   1747 C C   . SER B 1 73  ? 14.644 23.213  -5.848  1.00 34.12 ? 73  SER B C   1 
ATOM   1748 O O   . SER B 1 73  ? 14.145 24.229  -5.385  1.00 34.03 ? 73  SER B O   1 
ATOM   1749 C CB  . SER B 1 73  ? 17.095 22.787  -5.476  1.00 34.91 ? 73  SER B CB  1 
ATOM   1750 O OG  . SER B 1 73  ? 17.228 24.195  -5.658  1.00 35.18 ? 73  SER B OG  1 
ATOM   1751 N N   . ARG B 1 74  ? 14.332 22.741  -7.064  1.00 34.21 ? 74  ARG B N   1 
ATOM   1752 C CA  . ARG B 1 74  ? 13.295 23.375  -7.893  1.00 33.91 ? 74  ARG B CA  1 
ATOM   1753 C C   . ARG B 1 74  ? 11.957 23.307  -7.173  1.00 33.59 ? 74  ARG B C   1 
ATOM   1754 O O   . ARG B 1 74  ? 11.133 24.211  -7.283  1.00 33.95 ? 74  ARG B O   1 
ATOM   1755 C CB  . ARG B 1 74  ? 13.178 22.701  -9.268  1.00 33.35 ? 74  ARG B CB  1 
ATOM   1756 C CG  . ARG B 1 74  ? 14.333 22.978  -10.211 1.00 34.18 ? 74  ARG B CG  1 
ATOM   1757 C CD  . ARG B 1 74  ? 14.431 21.968  -11.369 1.00 34.96 ? 74  ARG B CD  1 
ATOM   1758 N NE  . ARG B 1 74  ? 13.240 21.949  -12.222 1.00 35.60 ? 74  ARG B NE  1 
ATOM   1759 C CZ  . ARG B 1 74  ? 13.048 22.758  -13.261 1.00 36.88 ? 74  ARG B CZ  1 
ATOM   1760 N NH1 . ARG B 1 74  ? 13.970 23.657  -13.592 1.00 37.02 ? 74  ARG B NH1 1 
ATOM   1761 N NH2 . ARG B 1 74  ? 11.936 22.663  -13.981 1.00 37.28 ? 74  ARG B NH2 1 
ATOM   1762 N N   . HIS B 1 75  ? 11.742 22.222  -6.446  1.00 33.45 ? 75  HIS B N   1 
ATOM   1763 C CA  . HIS B 1 75  ? 10.515 22.032  -5.707  1.00 34.00 ? 75  HIS B CA  1 
ATOM   1764 C C   . HIS B 1 75  ? 10.505 22.910  -4.462  1.00 34.32 ? 75  HIS B C   1 
ATOM   1765 O O   . HIS B 1 75  ? 9.473  23.495  -4.113  1.00 33.64 ? 75  HIS B O   1 
ATOM   1766 C CB  . HIS B 1 75  ? 10.365 20.566  -5.302  1.00 34.14 ? 75  HIS B CB  1 
ATOM   1767 C CG  . HIS B 1 75  ? 9.116  20.277  -4.536  1.00 34.96 ? 75  HIS B CG  1 
ATOM   1768 N ND1 . HIS B 1 75  ? 7.891  20.122  -5.147  1.00 35.85 ? 75  HIS B ND1 1 
ATOM   1769 C CD2 . HIS B 1 75  ? 8.901  20.119  -3.209  1.00 35.75 ? 75  HIS B CD2 1 
ATOM   1770 C CE1 . HIS B 1 75  ? 6.974  19.878  -4.228  1.00 37.20 ? 75  HIS B CE1 1 
ATOM   1771 N NE2 . HIS B 1 75  ? 7.562  19.868  -3.043  1.00 37.47 ? 75  HIS B NE2 1 
ATOM   1772 N N   . GLN B 1 76  ? 11.649 22.988  -3.790  1.00 34.40 ? 76  GLN B N   1 
ATOM   1773 C CA  . GLN B 1 76  ? 11.718 23.710  -2.520  1.00 35.22 ? 76  GLN B CA  1 
ATOM   1774 C C   . GLN B 1 76  ? 11.779 25.226  -2.693  1.00 35.02 ? 76  GLN B C   1 
ATOM   1775 O O   . GLN B 1 76  ? 11.152 25.953  -1.948  1.00 34.96 ? 76  GLN B O   1 
ATOM   1776 C CB  . GLN B 1 76  ? 12.885 23.208  -1.673  1.00 35.23 ? 76  GLN B CB  1 
ATOM   1777 C CG  . GLN B 1 76  ? 12.950 23.853  -0.325  1.00 36.90 ? 76  GLN B CG  1 
ATOM   1778 C CD  . GLN B 1 76  ? 13.493 22.942  0.728   1.00 39.19 ? 76  GLN B CD  1 
ATOM   1779 O OE1 . GLN B 1 76  ? 13.929 21.818  0.441   1.00 39.03 ? 76  GLN B OE1 1 
ATOM   1780 N NE2 . GLN B 1 76  ? 13.463 23.409  1.974   1.00 39.92 ? 76  GLN B NE2 1 
ATOM   1781 N N   . PHE B 1 77  ? 12.523 25.692  -3.690  1.00 35.54 ? 77  PHE B N   1 
ATOM   1782 C CA  . PHE B 1 77  ? 12.754 27.120  -3.864  1.00 35.82 ? 77  PHE B CA  1 
ATOM   1783 C C   . PHE B 1 77  ? 12.051 27.753  -5.062  1.00 35.77 ? 77  PHE B C   1 
ATOM   1784 O O   . PHE B 1 77  ? 12.022 28.973  -5.180  1.00 35.61 ? 77  PHE B O   1 
ATOM   1785 C CB  . PHE B 1 77  ? 14.256 27.409  -3.900  1.00 35.29 ? 77  PHE B CB  1 
ATOM   1786 C CG  . PHE B 1 77  ? 14.976 26.945  -2.674  1.00 36.27 ? 77  PHE B CG  1 
ATOM   1787 C CD1 . PHE B 1 77  ? 14.826 27.626  -1.461  1.00 34.29 ? 77  PHE B CD1 1 
ATOM   1788 C CD2 . PHE B 1 77  ? 15.790 25.815  -2.717  1.00 36.10 ? 77  PHE B CD2 1 
ATOM   1789 C CE1 . PHE B 1 77  ? 15.475 27.192  -0.319  1.00 34.89 ? 77  PHE B CE1 1 
ATOM   1790 C CE2 . PHE B 1 77  ? 16.455 25.372  -1.568  1.00 35.68 ? 77  PHE B CE2 1 
ATOM   1791 C CZ  . PHE B 1 77  ? 16.292 26.061  -0.368  1.00 35.85 ? 77  PHE B CZ  1 
ATOM   1792 N N   . GLY B 1 78  ? 11.468 26.931  -5.927  1.00 36.27 ? 78  GLY B N   1 
ATOM   1793 C CA  . GLY B 1 78  ? 10.911 27.418  -7.180  1.00 37.12 ? 78  GLY B CA  1 
ATOM   1794 C C   . GLY B 1 78  ? 11.858 27.128  -8.329  1.00 38.06 ? 78  GLY B C   1 
ATOM   1795 O O   . GLY B 1 78  ? 13.072 27.275  -8.199  1.00 37.51 ? 78  GLY B O   1 
ATOM   1796 N N   . GLN B 1 79  ? 11.297 26.722  -9.464  1.00 39.30 ? 79  GLN B N   1 
ATOM   1797 C CA  . GLN B 1 79  ? 12.088 26.318  -10.625 1.00 40.59 ? 79  GLN B CA  1 
ATOM   1798 C C   . GLN B 1 79  ? 13.041 27.423  -11.086 1.00 40.64 ? 79  GLN B C   1 
ATOM   1799 O O   . GLN B 1 79  ? 14.204 27.160  -11.388 1.00 41.10 ? 79  GLN B O   1 
ATOM   1800 C CB  . GLN B 1 79  ? 11.173 25.880  -11.775 1.00 41.11 ? 79  GLN B CB  1 
ATOM   1801 C CG  . GLN B 1 79  ? 9.977  25.035  -11.334 1.00 43.97 ? 79  GLN B CG  1 
ATOM   1802 C CD  . GLN B 1 79  ? 9.385  24.206  -12.464 1.00 47.27 ? 79  GLN B CD  1 
ATOM   1803 O OE1 . GLN B 1 79  ? 8.880  24.739  -13.452 1.00 47.59 ? 79  GLN B OE1 1 
ATOM   1804 N NE2 . GLN B 1 79  ? 9.441  22.884  -12.312 1.00 49.73 ? 79  GLN B NE2 1 
ATOM   1805 N N   . GLU B 1 80  ? 12.555 28.660  -11.103 1.00 41.06 ? 80  GLU B N   1 
ATOM   1806 C CA  . GLU B 1 80  ? 13.358 29.792  -11.572 1.00 41.22 ? 80  GLU B CA  1 
ATOM   1807 C C   . GLU B 1 80  ? 14.384 30.262  -10.539 1.00 40.50 ? 80  GLU B C   1 
ATOM   1808 O O   . GLU B 1 80  ? 15.252 31.084  -10.841 1.00 40.76 ? 80  GLU B O   1 
ATOM   1809 C CB  . GLU B 1 80  ? 12.464 30.942  -12.045 1.00 41.27 ? 80  GLU B CB  1 
ATOM   1810 C CG  . GLU B 1 80  ? 11.580 30.557  -13.238 1.00 43.91 ? 80  GLU B CG  1 
ATOM   1811 C CD  . GLU B 1 80  ? 11.401 31.679  -14.256 1.00 47.05 ? 80  GLU B CD  1 
ATOM   1812 O OE1 . GLU B 1 80  ? 11.115 32.837  -13.858 1.00 47.50 ? 80  GLU B OE1 1 
ATOM   1813 O OE2 . GLU B 1 80  ? 11.535 31.388  -15.468 1.00 48.98 ? 80  GLU B OE2 1 
ATOM   1814 N N   . LYS B 1 81  ? 14.293 29.727  -9.327  1.00 39.93 ? 81  LYS B N   1 
ATOM   1815 C CA  . LYS B 1 81  ? 15.196 30.117  -8.240  1.00 39.14 ? 81  LYS B CA  1 
ATOM   1816 C C   . LYS B 1 81  ? 16.300 29.110  -8.023  1.00 38.74 ? 81  LYS B C   1 
ATOM   1817 O O   . LYS B 1 81  ? 17.327 29.424  -7.428  1.00 38.75 ? 81  LYS B O   1 
ATOM   1818 C CB  . LYS B 1 81  ? 14.419 30.311  -6.940  1.00 39.16 ? 81  LYS B CB  1 
ATOM   1819 C CG  . LYS B 1 81  ? 13.435 31.463  -6.996  1.00 39.08 ? 81  LYS B CG  1 
ATOM   1820 C CD  . LYS B 1 81  ? 14.169 32.783  -7.142  1.00 39.88 ? 81  LYS B CD  1 
ATOM   1821 C CE  . LYS B 1 81  ? 13.207 33.959  -6.795  1.00 40.87 ? 81  LYS B CE  1 
ATOM   1822 N NZ  . LYS B 1 81  ? 11.925 33.826  -7.607  1.00 41.76 ? 81  LYS B NZ  1 
ATOM   1823 N N   . ASP B 1 82  ? 16.072 27.889  -8.487  1.00 38.08 ? 82  ASP B N   1 
ATOM   1824 C CA  . ASP B 1 82  ? 17.042 26.829  -8.312  1.00 37.87 ? 82  ASP B CA  1 
ATOM   1825 C C   . ASP B 1 82  ? 18.407 27.288  -8.819  1.00 37.76 ? 82  ASP B C   1 
ATOM   1826 O O   . ASP B 1 82  ? 18.518 27.791  -9.956  1.00 38.12 ? 82  ASP B O   1 
ATOM   1827 C CB  . ASP B 1 82  ? 16.601 25.558  -9.037  1.00 36.76 ? 82  ASP B CB  1 
ATOM   1828 C CG  . ASP B 1 82  ? 17.678 24.509  -9.048  1.00 37.50 ? 82  ASP B CG  1 
ATOM   1829 O OD1 . ASP B 1 82  ? 18.209 24.197  -7.955  1.00 34.22 ? 82  ASP B OD1 1 
ATOM   1830 O OD2 . ASP B 1 82  ? 18.017 24.015  -10.150 1.00 37.35 ? 82  ASP B OD2 1 
ATOM   1831 N N   . VAL B 1 83  ? 19.424 27.131  -7.967  1.00 37.00 ? 83  VAL B N   1 
ATOM   1832 C CA  . VAL B 1 83  ? 20.804 27.479  -8.325  1.00 36.78 ? 83  VAL B CA  1 
ATOM   1833 C C   . VAL B 1 83  ? 21.642 26.252  -8.677  1.00 37.02 ? 83  VAL B C   1 
ATOM   1834 O O   . VAL B 1 83  ? 22.741 26.385  -9.216  1.00 37.45 ? 83  VAL B O   1 
ATOM   1835 C CB  . VAL B 1 83  ? 21.528 28.315  -7.219  1.00 36.43 ? 83  VAL B CB  1 
ATOM   1836 C CG1 . VAL B 1 83  ? 20.858 29.660  -7.046  1.00 36.90 ? 83  VAL B CG1 1 
ATOM   1837 C CG2 . VAL B 1 83  ? 21.555 27.580  -5.894  1.00 36.67 ? 83  VAL B CG2 1 
ATOM   1838 N N   . PHE B 1 84  ? 21.138 25.063  -8.368  1.00 36.58 ? 84  PHE B N   1 
ATOM   1839 C CA  . PHE B 1 84  ? 21.919 23.858  -8.580  1.00 36.79 ? 84  PHE B CA  1 
ATOM   1840 C C   . PHE B 1 84  ? 21.993 23.412  -10.051 1.00 36.94 ? 84  PHE B C   1 
ATOM   1841 O O   . PHE B 1 84  ? 23.079 23.079  -10.544 1.00 36.74 ? 84  PHE B O   1 
ATOM   1842 C CB  . PHE B 1 84  ? 21.419 22.716  -7.693  1.00 37.06 ? 84  PHE B CB  1 
ATOM   1843 C CG  . PHE B 1 84  ? 21.753 22.871  -6.224  1.00 37.34 ? 84  PHE B CG  1 
ATOM   1844 C CD1 . PHE B 1 84  ? 23.011 22.526  -5.743  1.00 39.50 ? 84  PHE B CD1 1 
ATOM   1845 C CD2 . PHE B 1 84  ? 20.788 23.298  -5.321  1.00 37.82 ? 84  PHE B CD2 1 
ATOM   1846 C CE1 . PHE B 1 84  ? 23.311 22.633  -4.382  1.00 40.84 ? 84  PHE B CE1 1 
ATOM   1847 C CE2 . PHE B 1 84  ? 21.072 23.417  -3.962  1.00 38.97 ? 84  PHE B CE2 1 
ATOM   1848 C CZ  . PHE B 1 84  ? 22.338 23.090  -3.487  1.00 39.22 ? 84  PHE B CZ  1 
ATOM   1849 N N   . ALA B 1 85  ? 20.857 23.386  -10.748 1.00 36.73 ? 85  ALA B N   1 
ATOM   1850 C CA  . ALA B 1 85  ? 20.869 23.010  -12.170 1.00 36.79 ? 85  ALA B CA  1 
ATOM   1851 C C   . ALA B 1 85  ? 21.813 23.886  -12.990 1.00 36.79 ? 85  ALA B C   1 
ATOM   1852 O O   . ALA B 1 85  ? 22.669 23.356  -13.683 1.00 37.08 ? 85  ALA B O   1 
ATOM   1853 C CB  . ALA B 1 85  ? 19.484 23.014  -12.764 1.00 37.31 ? 85  ALA B CB  1 
ATOM   1854 N N   . PRO B 1 86  ? 21.684 25.222  -12.895 1.00 36.45 ? 86  PRO B N   1 
ATOM   1855 C CA  . PRO B 1 86  ? 22.656 26.040  -13.614 1.00 36.93 ? 86  PRO B CA  1 
ATOM   1856 C C   . PRO B 1 86  ? 24.119 25.747  -13.254 1.00 37.32 ? 86  PRO B C   1 
ATOM   1857 O O   . PRO B 1 86  ? 24.963 25.735  -14.142 1.00 37.96 ? 86  PRO B O   1 
ATOM   1858 C CB  . PRO B 1 86  ? 22.271 27.480  -13.212 1.00 37.10 ? 86  PRO B CB  1 
ATOM   1859 C CG  . PRO B 1 86  ? 20.818 27.392  -12.887 1.00 36.44 ? 86  PRO B CG  1 
ATOM   1860 C CD  . PRO B 1 86  ? 20.681 26.059  -12.206 1.00 36.35 ? 86  PRO B CD  1 
ATOM   1861 N N   . ARG B 1 87  ? 24.416 25.518  -11.975 1.00 37.03 ? 87  ARG B N   1 
ATOM   1862 C CA  . ARG B 1 87  ? 25.792 25.270  -11.560 1.00 37.01 ? 87  ARG B CA  1 
ATOM   1863 C C   . ARG B 1 87  ? 26.339 23.888  -11.999 1.00 36.82 ? 87  ARG B C   1 
ATOM   1864 O O   . ARG B 1 87  ? 27.460 23.793  -12.490 1.00 37.14 ? 87  ARG B O   1 
ATOM   1865 C CB  . ARG B 1 87  ? 25.941 25.491  -10.050 1.00 36.96 ? 87  ARG B CB  1 
ATOM   1866 C CG  . ARG B 1 87  ? 27.363 25.372  -9.547  1.00 36.96 ? 87  ARG B CG  1 
ATOM   1867 C CD  . ARG B 1 87  ? 28.199 26.558  -9.961  1.00 36.51 ? 87  ARG B CD  1 
ATOM   1868 N NE  . ARG B 1 87  ? 29.595 26.350  -9.594  1.00 38.30 ? 87  ARG B NE  1 
ATOM   1869 C CZ  . ARG B 1 87  ? 30.571 27.233  -9.802  1.00 37.60 ? 87  ARG B CZ  1 
ATOM   1870 N NH1 . ARG B 1 87  ? 30.310 28.404  -10.369 1.00 37.81 ? 87  ARG B NH1 1 
ATOM   1871 N NH2 . ARG B 1 87  ? 31.811 26.934  -9.439  1.00 37.75 ? 87  ARG B NH2 1 
ATOM   1872 N N   . PHE B 1 88  ? 25.552 22.830  -11.831 1.00 36.50 ? 88  PHE B N   1 
ATOM   1873 C CA  . PHE B 1 88  ? 25.913 21.524  -12.373 1.00 37.33 ? 88  PHE B CA  1 
ATOM   1874 C C   . PHE B 1 88  ? 26.164 21.559  -13.899 1.00 38.09 ? 88  PHE B C   1 
ATOM   1875 O O   . PHE B 1 88  ? 26.856 20.691  -14.446 1.00 38.84 ? 88  PHE B O   1 
ATOM   1876 C CB  . PHE B 1 88  ? 24.824 20.479  -12.073 1.00 36.62 ? 88  PHE B CB  1 
ATOM   1877 C CG  . PHE B 1 88  ? 24.893 19.886  -10.677 1.00 36.78 ? 88  PHE B CG  1 
ATOM   1878 C CD1 . PHE B 1 88  ? 25.965 19.099  -10.291 1.00 33.75 ? 88  PHE B CD1 1 
ATOM   1879 C CD2 . PHE B 1 88  ? 23.858 20.081  -9.773  1.00 36.90 ? 88  PHE B CD2 1 
ATOM   1880 C CE1 . PHE B 1 88  ? 26.016 18.556  -9.038  1.00 35.18 ? 88  PHE B CE1 1 
ATOM   1881 C CE2 . PHE B 1 88  ? 23.893 19.527  -8.511  1.00 35.65 ? 88  PHE B CE2 1 
ATOM   1882 C CZ  . PHE B 1 88  ? 24.982 18.770  -8.137  1.00 36.97 ? 88  PHE B CZ  1 
ATOM   1883 N N   . SER B 1 89  ? 25.585 22.529  -14.599 1.00 38.71 ? 89  SER B N   1 
ATOM   1884 C CA  . SER B 1 89  ? 25.685 22.550  -16.062 1.00 39.28 ? 89  SER B CA  1 
ATOM   1885 C C   . SER B 1 89  ? 27.055 23.028  -16.546 1.00 39.61 ? 89  SER B C   1 
ATOM   1886 O O   . SER B 1 89  ? 27.454 22.744  -17.676 1.00 39.90 ? 89  SER B O   1 
ATOM   1887 C CB  . SER B 1 89  ? 24.556 23.381  -16.673 1.00 39.09 ? 89  SER B CB  1 
ATOM   1888 O OG  . SER B 1 89  ? 24.792 24.759  -16.441 1.00 40.68 ? 89  SER B OG  1 
ATOM   1889 N N   . ASN B 1 90  ? 27.763 23.776  -15.697 1.00 39.99 ? 90  ASN B N   1 
ATOM   1890 C CA  . ASN B 1 90  ? 29.120 24.232  -16.007 1.00 40.22 ? 90  ASN B CA  1 
ATOM   1891 C C   . ASN B 1 90  ? 30.042 23.098  -16.458 1.00 39.84 ? 90  ASN B C   1 
ATOM   1892 O O   . ASN B 1 90  ? 30.639 23.165  -17.539 1.00 39.30 ? 90  ASN B O   1 
ATOM   1893 C CB  . ASN B 1 90  ? 29.750 24.963  -14.805 1.00 40.62 ? 90  ASN B CB  1 
ATOM   1894 C CG  . ASN B 1 90  ? 29.212 26.375  -14.622 1.00 42.10 ? 90  ASN B CG  1 
ATOM   1895 O OD1 . ASN B 1 90  ? 28.150 26.729  -15.145 1.00 43.44 ? 90  ASN B OD1 1 
ATOM   1896 N ND2 . ASN B 1 90  ? 29.944 27.190  -13.859 1.00 42.12 ? 90  ASN B ND2 1 
ATOM   1897 N N   . ASN B 1 91  ? 30.144 22.055  -15.632 1.00 39.43 ? 91  ASN B N   1 
ATOM   1898 C CA  . ASN B 1 91  ? 31.049 20.938  -15.921 1.00 38.91 ? 91  ASN B CA  1 
ATOM   1899 C C   . ASN B 1 91  ? 30.325 19.684  -16.351 1.00 38.12 ? 91  ASN B C   1 
ATOM   1900 O O   . ASN B 1 91  ? 30.872 18.587  -16.253 1.00 38.68 ? 91  ASN B O   1 
ATOM   1901 C CB  . ASN B 1 91  ? 31.913 20.624  -14.706 1.00 38.54 ? 91  ASN B CB  1 
ATOM   1902 C CG  . ASN B 1 91  ? 32.939 21.688  -14.431 1.00 39.93 ? 91  ASN B CG  1 
ATOM   1903 O OD1 . ASN B 1 91  ? 33.668 22.116  -15.325 1.00 40.41 ? 91  ASN B OD1 1 
ATOM   1904 N ND2 . ASN B 1 91  ? 33.018 22.113  -13.177 1.00 41.24 ? 91  ASN B ND2 1 
ATOM   1905 N N   . ILE B 1 92  ? 29.111 19.836  -16.858 1.00 37.30 ? 92  ILE B N   1 
ATOM   1906 C CA  . ILE B 1 92  ? 28.250 18.674  -17.075 1.00 36.41 ? 92  ILE B CA  1 
ATOM   1907 C C   . ILE B 1 92  ? 28.806 17.685  -18.099 1.00 36.19 ? 92  ILE B C   1 
ATOM   1908 O O   . ILE B 1 92  ? 28.591 16.488  -17.963 1.00 35.48 ? 92  ILE B O   1 
ATOM   1909 C CB  . ILE B 1 92  ? 26.778 19.082  -17.389 1.00 36.46 ? 92  ILE B CB  1 
ATOM   1910 C CG1 . ILE B 1 92  ? 25.802 17.957  -16.970 1.00 36.49 ? 92  ILE B CG1 1 
ATOM   1911 C CG2 . ILE B 1 92  ? 26.612 19.574  -18.856 1.00 36.24 ? 92  ILE B CG2 1 
ATOM   1912 C CD1 . ILE B 1 92  ? 24.328 18.260  -17.233 1.00 36.56 ? 92  ILE B CD1 1 
ATOM   1913 N N   . ILE B 1 93  ? 29.542 18.185  -19.097 1.00 36.50 ? 93  ILE B N   1 
ATOM   1914 C CA  . ILE B 1 93  ? 30.114 17.319  -20.135 1.00 36.63 ? 93  ILE B CA  1 
ATOM   1915 C C   . ILE B 1 93  ? 31.097 16.356  -19.479 1.00 36.76 ? 93  ILE B C   1 
ATOM   1916 O O   . ILE B 1 93  ? 30.961 15.153  -19.620 1.00 36.90 ? 93  ILE B O   1 
ATOM   1917 C CB  . ILE B 1 93  ? 30.765 18.124  -21.317 1.00 36.68 ? 93  ILE B CB  1 
ATOM   1918 C CG1 . ILE B 1 93  ? 29.700 18.896  -22.107 1.00 36.41 ? 93  ILE B CG1 1 
ATOM   1919 C CG2 . ILE B 1 93  ? 31.584 17.199  -22.273 1.00 36.51 ? 93  ILE B CG2 1 
ATOM   1920 C CD1 . ILE B 1 93  ? 28.714 18.004  -22.866 1.00 37.00 ? 93  ILE B CD1 1 
ATOM   1921 N N   . SER B 1 94  ? 32.051 16.905  -18.729 1.00 37.08 ? 94  SER B N   1 
ATOM   1922 C CA  A SER B 1 94  ? 33.024 16.131  -17.975 0.50 37.39 ? 94  SER B CA  1 
ATOM   1923 C CA  B SER B 1 94  ? 33.021 16.093  -18.009 0.50 37.29 ? 94  SER B CA  1 
ATOM   1924 C C   . SER B 1 94  ? 32.336 15.168  -16.997 1.00 37.60 ? 94  SER B C   1 
ATOM   1925 O O   . SER B 1 94  ? 32.719 13.994  -16.873 1.00 38.17 ? 94  SER B O   1 
ATOM   1926 C CB  A SER B 1 94  ? 33.962 17.088  -17.236 0.50 37.34 ? 94  SER B CB  1 
ATOM   1927 C CB  B SER B 1 94  ? 34.122 16.956  -17.369 0.50 37.20 ? 94  SER B CB  1 
ATOM   1928 O OG  A SER B 1 94  ? 35.108 16.419  -16.757 0.50 38.15 ? 94  SER B OG  1 
ATOM   1929 O OG  B SER B 1 94  ? 33.667 17.674  -16.237 0.50 37.50 ? 94  SER B OG  1 
ATOM   1930 N N   . THR B 1 95  ? 31.307 15.666  -16.307 1.00 37.73 ? 95  THR B N   1 
ATOM   1931 C CA  . THR B 1 95  ? 30.539 14.855  -15.344 1.00 38.00 ? 95  THR B CA  1 
ATOM   1932 C C   . THR B 1 95  ? 30.003 13.578  -15.991 1.00 37.56 ? 95  THR B C   1 
ATOM   1933 O O   . THR B 1 95  ? 30.157 12.484  -15.440 1.00 37.66 ? 95  THR B O   1 
ATOM   1934 C CB  . THR B 1 95  ? 29.382 15.677  -14.716 1.00 38.90 ? 95  THR B CB  1 
ATOM   1935 O OG1 . THR B 1 95  ? 29.929 16.812  -14.028 1.00 38.18 ? 95  THR B OG1 1 
ATOM   1936 C CG2 . THR B 1 95  ? 28.510 14.827  -13.749 1.00 38.44 ? 95  THR B CG2 1 
ATOM   1937 N N   . PHE B 1 96  ? 29.403 13.719  -17.169 1.00 37.02 ? 96  PHE B N   1 
ATOM   1938 C CA  . PHE B 1 96  ? 28.816 12.581  -17.882 1.00 36.79 ? 96  PHE B CA  1 
ATOM   1939 C C   . PHE B 1 96  ? 29.840 11.663  -18.551 1.00 36.94 ? 96  PHE B C   1 
ATOM   1940 O O   . PHE B 1 96  ? 29.573 10.475  -18.733 1.00 36.89 ? 96  PHE B O   1 
ATOM   1941 C CB  . PHE B 1 96  ? 27.713 13.033  -18.854 1.00 36.07 ? 96  PHE B CB  1 
ATOM   1942 C CG  . PHE B 1 96  ? 26.389 13.197  -18.185 1.00 35.51 ? 96  PHE B CG  1 
ATOM   1943 C CD1 . PHE B 1 96  ? 26.143 14.291  -17.352 1.00 35.50 ? 96  PHE B CD1 1 
ATOM   1944 C CD2 . PHE B 1 96  ? 25.386 12.236  -18.345 1.00 32.93 ? 96  PHE B CD2 1 
ATOM   1945 C CE1 . PHE B 1 96  ? 24.914 14.416  -16.696 1.00 34.05 ? 96  PHE B CE1 1 
ATOM   1946 C CE2 . PHE B 1 96  ? 24.189 12.355  -17.683 1.00 32.87 ? 96  PHE B CE2 1 
ATOM   1947 C CZ  . PHE B 1 96  ? 23.947 13.436  -16.863 1.00 31.98 ? 96  PHE B CZ  1 
ATOM   1948 N N   . GLN B 1 97  ? 30.997 12.221  -18.905 1.00 36.91 ? 97  GLN B N   1 
ATOM   1949 C CA  . GLN B 1 97  ? 32.140 11.445  -19.350 1.00 37.75 ? 97  GLN B CA  1 
ATOM   1950 C C   . GLN B 1 97  ? 32.576 10.485  -18.255 1.00 37.79 ? 97  GLN B C   1 
ATOM   1951 O O   . GLN B 1 97  ? 32.945 9.348   -18.546 1.00 38.05 ? 97  GLN B O   1 
ATOM   1952 C CB  . GLN B 1 97  ? 33.325 12.357  -19.709 1.00 38.02 ? 97  GLN B CB  1 
ATOM   1953 C CG  . GLN B 1 97  ? 33.387 12.734  -21.177 1.00 38.38 ? 97  GLN B CG  1 
ATOM   1954 C CD  . GLN B 1 97  ? 34.291 13.916  -21.459 1.00 39.76 ? 97  GLN B CD  1 
ATOM   1955 O OE1 . GLN B 1 97  ? 34.975 14.446  -20.566 1.00 39.18 ? 97  GLN B OE1 1 
ATOM   1956 N NE2 . GLN B 1 97  ? 34.305 14.340  -22.717 1.00 38.52 ? 97  GLN B NE2 1 
ATOM   1957 N N   . ASN B 1 98  ? 32.560 10.970  -17.013 1.00 37.53 ? 98  ASN B N   1 
ATOM   1958 C CA  . ASN B 1 98  ? 32.800 10.145  -15.828 1.00 37.31 ? 98  ASN B CA  1 
ATOM   1959 C C   . ASN B 1 98  ? 31.651 9.187   -15.538 1.00 36.88 ? 98  ASN B C   1 
ATOM   1960 O O   . ASN B 1 98  ? 31.886 8.014   -15.233 1.00 36.58 ? 98  ASN B O   1 
ATOM   1961 C CB  . ASN B 1 98  ? 33.058 11.018  -14.599 1.00 37.10 ? 98  ASN B CB  1 
ATOM   1962 C CG  . ASN B 1 98  ? 34.338 11.811  -14.707 1.00 38.09 ? 98  ASN B CG  1 
ATOM   1963 O OD1 . ASN B 1 98  ? 35.229 11.470  -15.468 1.00 41.02 ? 98  ASN B OD1 1 
ATOM   1964 N ND2 . ASN B 1 98  ? 34.435 12.872  -13.938 1.00 39.50 ? 98  ASN B ND2 1 
ATOM   1965 N N   . LEU B 1 99  ? 30.415 9.677   -15.645 1.00 37.02 ? 99  LEU B N   1 
ATOM   1966 C CA  . LEU B 1 99  ? 29.231 8.819   -15.435 1.00 37.10 ? 99  LEU B CA  1 
ATOM   1967 C C   . LEU B 1 99  ? 29.194 7.632   -16.396 1.00 37.76 ? 99  LEU B C   1 
ATOM   1968 O O   . LEU B 1 99  ? 28.810 6.520   -16.000 1.00 37.90 ? 99  LEU B O   1 
ATOM   1969 C CB  . LEU B 1 99  ? 27.921 9.611   -15.540 1.00 36.84 ? 99  LEU B CB  1 
ATOM   1970 C CG  . LEU B 1 99  ? 27.540 10.606  -14.431 1.00 36.78 ? 99  LEU B CG  1 
ATOM   1971 C CD1 . LEU B 1 99  ? 26.288 11.424  -14.827 1.00 34.72 ? 99  LEU B CD1 1 
ATOM   1972 C CD2 . LEU B 1 99  ? 27.340 9.895   -13.104 1.00 35.14 ? 99  LEU B CD2 1 
ATOM   1973 N N   . TYR B 1 100 ? 29.574 7.867   -17.653 1.00 37.71 ? 100 TYR B N   1 
ATOM   1974 C CA  . TYR B 1 100 ? 29.583 6.813   -18.669 1.00 38.64 ? 100 TYR B CA  1 
ATOM   1975 C C   . TYR B 1 100 ? 30.716 5.772   -18.482 1.00 39.10 ? 100 TYR B C   1 
ATOM   1976 O O   . TYR B 1 100 ? 30.908 4.899   -19.326 1.00 39.08 ? 100 TYR B O   1 
ATOM   1977 C CB  . TYR B 1 100 ? 29.590 7.408   -20.100 1.00 38.72 ? 100 TYR B CB  1 
ATOM   1978 C CG  . TYR B 1 100 ? 28.279 8.076   -20.511 1.00 39.56 ? 100 TYR B CG  1 
ATOM   1979 C CD1 . TYR B 1 100 ? 27.054 7.431   -20.319 1.00 39.33 ? 100 TYR B CD1 1 
ATOM   1980 C CD2 . TYR B 1 100 ? 28.268 9.344   -21.116 1.00 38.70 ? 100 TYR B CD2 1 
ATOM   1981 C CE1 . TYR B 1 100 ? 25.848 8.038   -20.691 1.00 41.03 ? 100 TYR B CE1 1 
ATOM   1982 C CE2 . TYR B 1 100 ? 27.061 9.963   -21.489 1.00 36.78 ? 100 TYR B CE2 1 
ATOM   1983 C CZ  . TYR B 1 100 ? 25.865 9.314   -21.275 1.00 40.60 ? 100 TYR B CZ  1 
ATOM   1984 O OH  . TYR B 1 100 ? 24.670 9.911   -21.657 1.00 40.36 ? 100 TYR B OH  1 
ATOM   1985 N N   . ARG B 1 101 ? 31.454 5.872   -17.380 1.00 39.63 ? 101 ARG B N   1 
ATOM   1986 C CA  . ARG B 1 101 ? 32.414 4.841   -17.010 1.00 41.00 ? 101 ARG B CA  1 
ATOM   1987 C C   . ARG B 1 101 ? 31.739 3.828   -16.099 1.00 41.01 ? 101 ARG B C   1 
ATOM   1988 O O   . ARG B 1 101 ? 32.398 3.054   -15.413 1.00 41.98 ? 101 ARG B O   1 
ATOM   1989 C CB  . ARG B 1 101 ? 33.646 5.445   -16.345 1.00 41.23 ? 101 ARG B CB  1 
ATOM   1990 C CG  . ARG B 1 101 ? 34.574 6.135   -17.307 1.00 44.26 ? 101 ARG B CG  1 
ATOM   1991 C CD  . ARG B 1 101 ? 35.614 6.962   -16.557 1.00 51.30 ? 101 ARG B CD  1 
ATOM   1992 N NE  . ARG B 1 101 ? 36.532 7.641   -17.476 1.00 55.70 ? 101 ARG B NE  1 
ATOM   1993 C CZ  . ARG B 1 101 ? 37.115 8.815   -17.232 1.00 57.50 ? 101 ARG B CZ  1 
ATOM   1994 N NH1 . ARG B 1 101 ? 36.881 9.458   -16.091 1.00 58.31 ? 101 ARG B NH1 1 
ATOM   1995 N NH2 . ARG B 1 101 ? 37.935 9.348   -18.134 1.00 57.73 ? 101 ARG B NH2 1 
ATOM   1996 N N   . CYS B 1 102 ? 30.412 3.827   -16.130 1.00 40.60 ? 102 CYS B N   1 
ATOM   1997 C CA  . CYS B 1 102 ? 29.604 2.912   -15.356 1.00 40.31 ? 102 CYS B CA  1 
ATOM   1998 C C   . CYS B 1 102 ? 29.644 1.510   -15.993 1.00 40.72 ? 102 CYS B C   1 
ATOM   1999 O O   . CYS B 1 102 ? 30.189 1.340   -17.091 1.00 40.99 ? 102 CYS B O   1 
ATOM   2000 C CB  . CYS B 1 102 ? 28.167 3.441   -15.280 1.00 39.88 ? 102 CYS B CB  1 
ATOM   2001 S SG  . CYS B 1 102 ? 27.313 3.451   -16.857 1.00 39.09 ? 102 CYS B SG  1 
ATOM   2002 N N   . PRO B 1 103 ? 29.093 0.494   -15.302 1.00 40.91 ? 103 PRO B N   1 
ATOM   2003 C CA  . PRO B 1 103 ? 28.952 -0.793  -15.992 1.00 41.22 ? 103 PRO B CA  1 
ATOM   2004 C C   . PRO B 1 103 ? 27.989 -0.668  -17.181 1.00 41.81 ? 103 PRO B C   1 
ATOM   2005 O O   . PRO B 1 103 ? 27.003 0.069   -17.093 1.00 41.68 ? 103 PRO B O   1 
ATOM   2006 C CB  . PRO B 1 103 ? 28.372 -1.707  -14.906 1.00 40.75 ? 103 PRO B CB  1 
ATOM   2007 C CG  . PRO B 1 103 ? 28.711 -1.023  -13.591 1.00 40.63 ? 103 PRO B CG  1 
ATOM   2008 C CD  . PRO B 1 103 ? 28.631 0.426   -13.901 1.00 40.77 ? 103 PRO B CD  1 
ATOM   2009 N N   . GLY B 1 104 ? 28.293 -1.365  -18.280 1.00 42.42 ? 104 GLY B N   1 
ATOM   2010 C CA  . GLY B 1 104 ? 27.479 -1.344  -19.511 1.00 43.39 ? 104 GLY B CA  1 
ATOM   2011 C C   . GLY B 1 104 ? 25.964 -1.431  -19.328 1.00 43.74 ? 104 GLY B C   1 
ATOM   2012 O O   . GLY B 1 104 ? 25.199 -0.826  -20.079 1.00 44.42 ? 104 GLY B O   1 
ATOM   2013 N N   . ASP B 1 105 ? 25.543 -2.163  -18.304 1.00 43.87 ? 105 ASP B N   1 
ATOM   2014 C CA  . ASP B 1 105 ? 24.142 -2.379  -17.973 1.00 43.68 ? 105 ASP B CA  1 
ATOM   2015 C C   . ASP B 1 105 ? 23.486 -1.168  -17.309 1.00 43.42 ? 105 ASP B C   1 
ATOM   2016 O O   . ASP B 1 105 ? 22.252 -1.079  -17.236 1.00 43.26 ? 105 ASP B O   1 
ATOM   2017 C CB  . ASP B 1 105 ? 24.040 -3.579  -17.033 1.00 44.49 ? 105 ASP B CB  1 
ATOM   2018 C CG  . ASP B 1 105 ? 25.076 -4.667  -17.348 1.00 45.80 ? 105 ASP B CG  1 
ATOM   2019 O OD1 . ASP B 1 105 ? 26.263 -4.515  -16.961 1.00 47.83 ? 105 ASP B OD1 1 
ATOM   2020 O OD2 . ASP B 1 105 ? 24.699 -5.671  -17.978 1.00 47.18 ? 105 ASP B OD2 1 
ATOM   2021 N N   . ASP B 1 106 ? 24.314 -0.257  -16.797 1.00 42.38 ? 106 ASP B N   1 
ATOM   2022 C CA  . ASP B 1 106 ? 23.831 0.947   -16.127 1.00 41.83 ? 106 ASP B CA  1 
ATOM   2023 C C   . ASP B 1 106 ? 23.673 2.115   -17.095 1.00 41.23 ? 106 ASP B C   1 
ATOM   2024 O O   . ASP B 1 106 ? 23.114 3.148   -16.730 1.00 40.34 ? 106 ASP B O   1 
ATOM   2025 C CB  . ASP B 1 106 ? 24.775 1.347   -14.984 1.00 42.09 ? 106 ASP B CB  1 
ATOM   2026 C CG  . ASP B 1 106 ? 24.570 0.514   -13.717 1.00 43.58 ? 106 ASP B CG  1 
ATOM   2027 O OD1 . ASP B 1 106 ? 23.752 -0.433  -13.709 1.00 45.04 ? 106 ASP B OD1 1 
ATOM   2028 O OD2 . ASP B 1 106 ? 25.238 0.815   -12.715 1.00 45.54 ? 106 ASP B OD2 1 
ATOM   2029 N N   . LYS B 1 107 ? 24.153 1.948   -18.328 1.00 40.52 ? 107 LYS B N   1 
ATOM   2030 C CA  . LYS B 1 107 ? 24.158 3.052   -19.291 1.00 40.79 ? 107 LYS B CA  1 
ATOM   2031 C C   . LYS B 1 107 ? 22.741 3.513   -19.615 1.00 39.46 ? 107 LYS B C   1 
ATOM   2032 O O   . LYS B 1 107 ? 22.496 4.701   -19.772 1.00 39.48 ? 107 LYS B O   1 
ATOM   2033 C CB  . LYS B 1 107 ? 24.924 2.683   -20.573 1.00 40.87 ? 107 LYS B CB  1 
ATOM   2034 C CG  . LYS B 1 107 ? 25.434 3.890   -21.389 1.00 42.52 ? 107 LYS B CG  1 
ATOM   2035 C CD  . LYS B 1 107 ? 25.885 3.462   -22.810 1.00 43.17 ? 107 LYS B CD  1 
ATOM   2036 C CE  . LYS B 1 107 ? 27.359 3.046   -22.835 1.00 46.55 ? 107 LYS B CE  1 
ATOM   2037 N NZ  . LYS B 1 107 ? 27.670 2.035   -23.909 1.00 48.90 ? 107 LYS B NZ  1 
ATOM   2038 N N   . SER B 1 108 ? 21.810 2.566   -19.676 1.00 38.38 ? 108 SER B N   1 
ATOM   2039 C CA  . SER B 1 108 ? 20.423 2.868   -19.991 1.00 37.55 ? 108 SER B CA  1 
ATOM   2040 C C   . SER B 1 108 ? 19.725 3.648   -18.879 1.00 37.38 ? 108 SER B C   1 
ATOM   2041 O O   . SER B 1 108 ? 18.766 4.369   -19.140 1.00 37.02 ? 108 SER B O   1 
ATOM   2042 C CB  . SER B 1 108 ? 19.656 1.582   -20.324 1.00 37.53 ? 108 SER B CB  1 
ATOM   2043 O OG  . SER B 1 108 ? 19.473 0.773   -19.176 1.00 37.40 ? 108 SER B OG  1 
ATOM   2044 N N   . LYS B 1 109 ? 20.213 3.512   -17.645 1.00 37.27 ? 109 LYS B N   1 
ATOM   2045 C CA  . LYS B 1 109 ? 19.701 4.296   -16.509 1.00 37.44 ? 109 LYS B CA  1 
ATOM   2046 C C   . LYS B 1 109 ? 20.091 5.785   -16.561 1.00 37.67 ? 109 LYS B C   1 
ATOM   2047 O O   . LYS B 1 109 ? 19.316 6.656   -16.149 1.00 38.28 ? 109 LYS B O   1 
ATOM   2048 C CB  . LYS B 1 109 ? 20.159 3.689   -15.176 1.00 37.72 ? 109 LYS B CB  1 
ATOM   2049 C CG  . LYS B 1 109 ? 19.722 2.240   -14.932 1.00 36.74 ? 109 LYS B CG  1 
ATOM   2050 C CD  . LYS B 1 109 ? 20.375 1.742   -13.650 1.00 39.53 ? 109 LYS B CD  1 
ATOM   2051 C CE  . LYS B 1 109 ? 19.895 0.363   -13.232 1.00 41.15 ? 109 LYS B CE  1 
ATOM   2052 N NZ  . LYS B 1 109 ? 20.661 -0.717  -13.906 1.00 42.67 ? 109 LYS B NZ  1 
ATOM   2053 N N   . ILE B 1 110 ? 21.301 6.072   -17.030 1.00 36.93 ? 110 ILE B N   1 
ATOM   2054 C CA  . ILE B 1 110 ? 21.730 7.447   -17.267 1.00 36.49 ? 110 ILE B CA  1 
ATOM   2055 C C   . ILE B 1 110 ? 20.853 8.140   -18.321 1.00 36.10 ? 110 ILE B C   1 
ATOM   2056 O O   . ILE B 1 110 ? 20.363 9.249   -18.095 1.00 35.97 ? 110 ILE B O   1 
ATOM   2057 C CB  . ILE B 1 110 ? 23.210 7.490   -17.705 1.00 36.66 ? 110 ILE B CB  1 
ATOM   2058 C CG1 . ILE B 1 110 ? 24.114 6.894   -16.615 1.00 36.57 ? 110 ILE B CG1 1 
ATOM   2059 C CG2 . ILE B 1 110 ? 23.646 8.910   -18.015 1.00 36.56 ? 110 ILE B CG2 1 
ATOM   2060 C CD1 . ILE B 1 110 ? 25.526 6.658   -17.072 1.00 38.05 ? 110 ILE B CD1 1 
ATOM   2061 N N   . VAL B 1 111 ? 20.659 7.465   -19.454 1.00 35.38 ? 111 VAL B N   1 
ATOM   2062 C CA  . VAL B 1 111 ? 19.864 7.968   -20.580 1.00 35.09 ? 111 VAL B CA  1 
ATOM   2063 C C   . VAL B 1 111 ? 18.413 8.219   -20.158 1.00 35.83 ? 111 VAL B C   1 
ATOM   2064 O O   . VAL B 1 111 ? 17.818 9.238   -20.513 1.00 36.18 ? 111 VAL B O   1 
ATOM   2065 C CB  . VAL B 1 111 ? 19.968 7.000   -21.814 1.00 34.28 ? 111 VAL B CB  1 
ATOM   2066 C CG1 . VAL B 1 111 ? 18.945 7.320   -22.885 1.00 33.24 ? 111 VAL B CG1 1 
ATOM   2067 C CG2 . VAL B 1 111 ? 21.372 7.042   -22.398 1.00 33.34 ? 111 VAL B CG2 1 
ATOM   2068 N N   . ARG B 1 112 ? 17.855 7.304   -19.375 1.00 35.80 ? 112 ARG B N   1 
ATOM   2069 C CA  . ARG B 1 112 ? 16.527 7.511   -18.831 1.00 36.34 ? 112 ARG B CA  1 
ATOM   2070 C C   . ARG B 1 112 ? 16.421 8.826   -18.063 1.00 36.13 ? 112 ARG B C   1 
ATOM   2071 O O   . ARG B 1 112 ? 15.455 9.563   -18.244 1.00 36.43 ? 112 ARG B O   1 
ATOM   2072 C CB  . ARG B 1 112 ? 16.131 6.359   -17.935 1.00 36.43 ? 112 ARG B CB  1 
ATOM   2073 C CG  . ARG B 1 112 ? 14.653 6.311   -17.698 1.00 40.07 ? 112 ARG B CG  1 
ATOM   2074 C CD  . ARG B 1 112 ? 14.341 5.455   -16.512 1.00 43.83 ? 112 ARG B CD  1 
ATOM   2075 N NE  . ARG B 1 112 ? 12.969 5.638   -16.061 1.00 44.99 ? 112 ARG B NE  1 
ATOM   2076 C CZ  . ARG B 1 112 ? 12.610 5.559   -14.785 1.00 47.02 ? 112 ARG B CZ  1 
ATOM   2077 N NH1 . ARG B 1 112 ? 13.532 5.307   -13.856 1.00 46.84 ? 112 ARG B NH1 1 
ATOM   2078 N NH2 . ARG B 1 112 ? 11.343 5.738   -14.438 1.00 47.39 ? 112 ARG B NH2 1 
ATOM   2079 N N   . VAL B 1 113 ? 17.421 9.133   -17.233 1.00 35.96 ? 113 VAL B N   1 
ATOM   2080 C CA  . VAL B 1 113 ? 17.426 10.365  -16.452 1.00 35.78 ? 113 VAL B CA  1 
ATOM   2081 C C   . VAL B 1 113 ? 17.501 11.584  -17.377 1.00 35.89 ? 113 VAL B C   1 
ATOM   2082 O O   . VAL B 1 113 ? 16.792 12.565  -17.157 1.00 36.36 ? 113 VAL B O   1 
ATOM   2083 C CB  . VAL B 1 113 ? 18.586 10.414  -15.365 1.00 36.02 ? 113 VAL B CB  1 
ATOM   2084 C CG1 . VAL B 1 113 ? 18.730 11.800  -14.786 1.00 34.65 ? 113 VAL B CG1 1 
ATOM   2085 C CG2 . VAL B 1 113 ? 18.332 9.433   -14.232 1.00 35.28 ? 113 VAL B CG2 1 
ATOM   2086 N N   . LEU B 1 114 ? 18.359 11.522  -18.394 1.00 35.58 ? 114 LEU B N   1 
ATOM   2087 C CA  . LEU B 1 114 ? 18.483 12.596  -19.386 1.00 35.73 ? 114 LEU B CA  1 
ATOM   2088 C C   . LEU B 1 114 ? 17.201 12.880  -20.133 1.00 35.97 ? 114 LEU B C   1 
ATOM   2089 O O   . LEU B 1 114 ? 16.877 14.041  -20.399 1.00 36.54 ? 114 LEU B O   1 
ATOM   2090 C CB  . LEU B 1 114 ? 19.576 12.269  -20.407 1.00 36.19 ? 114 LEU B CB  1 
ATOM   2091 C CG  . LEU B 1 114 ? 21.012 12.271  -19.880 1.00 35.79 ? 114 LEU B CG  1 
ATOM   2092 C CD1 . LEU B 1 114 ? 21.939 11.552  -20.853 1.00 34.27 ? 114 LEU B CD1 1 
ATOM   2093 C CD2 . LEU B 1 114 ? 21.468 13.692  -19.607 1.00 35.26 ? 114 LEU B CD2 1 
ATOM   2094 N N   . ASN B 1 115 ? 16.492 11.817  -20.503 1.00 35.90 ? 115 ASN B N   1 
ATOM   2095 C CA  . ASN B 1 115 ? 15.224 11.938  -21.184 1.00 35.70 ? 115 ASN B CA  1 
ATOM   2096 C C   . ASN B 1 115 ? 14.148 12.539  -20.286 1.00 35.86 ? 115 ASN B C   1 
ATOM   2097 O O   . ASN B 1 115 ? 13.313 13.314  -20.748 1.00 35.00 ? 115 ASN B O   1 
ATOM   2098 C CB  . ASN B 1 115 ? 14.763 10.581  -21.711 1.00 35.97 ? 115 ASN B CB  1 
ATOM   2099 C CG  . ASN B 1 115 ? 15.381 10.221  -23.062 1.00 36.20 ? 115 ASN B CG  1 
ATOM   2100 O OD1 . ASN B 1 115 ? 15.911 11.070  -23.776 1.00 38.56 ? 115 ASN B OD1 1 
ATOM   2101 N ND2 . ASN B 1 115 ? 15.291 8.953   -23.421 1.00 35.31 ? 115 ASN B ND2 1 
ATOM   2102 N N   . LEU B 1 116 ? 14.172 12.181  -19.003 1.00 36.18 ? 116 LEU B N   1 
ATOM   2103 C CA  . LEU B 1 116 ? 13.222 12.746  -18.042 1.00 36.45 ? 116 LEU B CA  1 
ATOM   2104 C C   . LEU B 1 116 ? 13.546 14.227  -17.805 1.00 36.79 ? 116 LEU B C   1 
ATOM   2105 O O   . LEU B 1 116 ? 12.640 15.062  -17.752 1.00 37.20 ? 116 LEU B O   1 
ATOM   2106 C CB  . LEU B 1 116 ? 13.233 11.965  -16.729 1.00 36.14 ? 116 LEU B CB  1 
ATOM   2107 C CG  . LEU B 1 116 ? 12.525 10.607  -16.692 1.00 36.72 ? 116 LEU B CG  1 
ATOM   2108 C CD1 . LEU B 1 116 ? 13.008 9.826   -15.492 1.00 38.50 ? 116 LEU B CD1 1 
ATOM   2109 C CD2 . LEU B 1 116 ? 11.002 10.752  -16.649 1.00 36.77 ? 116 LEU B CD2 1 
ATOM   2110 N N   . TRP B 1 117 ? 14.836 14.544  -17.729 1.00 36.73 ? 117 TRP B N   1 
ATOM   2111 C CA  . TRP B 1 117 ? 15.302 15.921  -17.572 1.00 37.46 ? 117 TRP B CA  1 
ATOM   2112 C C   . TRP B 1 117 ? 14.874 16.810  -18.727 1.00 38.17 ? 117 TRP B C   1 
ATOM   2113 O O   . TRP B 1 117 ? 14.502 17.972  -18.527 1.00 37.56 ? 117 TRP B O   1 
ATOM   2114 C CB  . TRP B 1 117 ? 16.821 15.963  -17.458 1.00 36.96 ? 117 TRP B CB  1 
ATOM   2115 C CG  . TRP B 1 117 ? 17.373 15.632  -16.114 1.00 37.42 ? 117 TRP B CG  1 
ATOM   2116 C CD1 . TRP B 1 117 ? 16.671 15.383  -14.969 1.00 35.83 ? 117 TRP B CD1 1 
ATOM   2117 C CD2 . TRP B 1 117 ? 18.768 15.555  -15.763 1.00 36.01 ? 117 TRP B CD2 1 
ATOM   2118 N NE1 . TRP B 1 117 ? 17.550 15.139  -13.928 1.00 38.63 ? 117 TRP B NE1 1 
ATOM   2119 C CE2 . TRP B 1 117 ? 18.837 15.257  -14.386 1.00 36.46 ? 117 TRP B CE2 1 
ATOM   2120 C CE3 . TRP B 1 117 ? 19.959 15.722  -16.479 1.00 36.94 ? 117 TRP B CE3 1 
ATOM   2121 C CZ2 . TRP B 1 117 ? 20.055 15.103  -13.708 1.00 36.98 ? 117 TRP B CZ2 1 
ATOM   2122 C CZ3 . TRP B 1 117 ? 21.180 15.585  -15.798 1.00 36.04 ? 117 TRP B CZ3 1 
ATOM   2123 C CH2 . TRP B 1 117 ? 21.213 15.277  -14.431 1.00 37.19 ? 117 TRP B CH2 1 
ATOM   2124 N N   . GLN B 1 118 ? 14.927 16.260  -19.939 1.00 39.07 ? 118 GLN B N   1 
ATOM   2125 C CA  . GLN B 1 118 ? 14.522 17.002  -21.136 1.00 40.28 ? 118 GLN B CA  1 
ATOM   2126 C C   . GLN B 1 118 ? 13.003 17.112  -21.214 1.00 40.67 ? 118 GLN B C   1 
ATOM   2127 O O   . GLN B 1 118 ? 12.462 18.156  -21.604 1.00 40.96 ? 118 GLN B O   1 
ATOM   2128 C CB  . GLN B 1 118 ? 15.075 16.324  -22.392 1.00 40.12 ? 118 GLN B CB  1 
ATOM   2129 C CG  . GLN B 1 118 ? 15.151 17.235  -23.605 1.00 41.08 ? 118 GLN B CG  1 
ATOM   2130 C CD  . GLN B 1 118 ? 15.766 16.560  -24.821 1.00 42.01 ? 118 GLN B CD  1 
ATOM   2131 O OE1 . GLN B 1 118 ? 16.678 17.111  -25.442 1.00 45.47 ? 118 GLN B OE1 1 
ATOM   2132 N NE2 . GLN B 1 118 ? 15.262 15.367  -25.178 1.00 42.33 ? 118 GLN B NE2 1 
ATOM   2133 N N   . LYS B 1 119 ? 12.329 16.024  -20.850 1.00 41.24 ? 119 LYS B N   1 
ATOM   2134 C CA  . LYS B 1 119 ? 10.873 15.959  -20.792 1.00 41.98 ? 119 LYS B CA  1 
ATOM   2135 C C   . LYS B 1 119 ? 10.318 17.009  -19.829 1.00 42.24 ? 119 LYS B C   1 
ATOM   2136 O O   . LYS B 1 119 ? 9.410  17.754  -20.175 1.00 42.25 ? 119 LYS B O   1 
ATOM   2137 C CB  . LYS B 1 119 ? 10.434 14.560  -20.359 1.00 41.74 ? 119 LYS B CB  1 
ATOM   2138 C CG  . LYS B 1 119 ? 8.952  14.253  -20.532 1.00 44.40 ? 119 LYS B CG  1 
ATOM   2139 C CD  . LYS B 1 119 ? 8.690  12.777  -20.214 1.00 47.59 ? 119 LYS B CD  1 
ATOM   2140 C CE  . LYS B 1 119 ? 7.911  12.584  -18.910 1.00 48.58 ? 119 LYS B CE  1 
ATOM   2141 N NZ  . LYS B 1 119 ? 6.441  12.460  -19.215 1.00 48.79 ? 119 LYS B NZ  1 
ATOM   2142 N N   . ASN B 1 120 ? 10.887 17.071  -18.631 1.00 43.19 ? 120 ASN B N   1 
ATOM   2143 C CA  . ASN B 1 120 ? 10.388 17.954  -17.586 1.00 44.06 ? 120 ASN B CA  1 
ATOM   2144 C C   . ASN B 1 120 ? 11.046 19.327  -17.549 1.00 44.48 ? 120 ASN B C   1 
ATOM   2145 O O   . ASN B 1 120 ? 10.807 20.095  -16.624 1.00 44.87 ? 120 ASN B O   1 
ATOM   2146 C CB  . ASN B 1 120 ? 10.473 17.256  -16.228 1.00 44.12 ? 120 ASN B CB  1 
ATOM   2147 C CG  . ASN B 1 120 ? 9.706  15.944  -16.211 1.00 44.63 ? 120 ASN B CG  1 
ATOM   2148 O OD1 . ASN B 1 120 ? 10.239 14.904  -15.844 1.00 45.68 ? 120 ASN B OD1 1 
ATOM   2149 N ND2 . ASN B 1 120 ? 8.458  15.988  -16.650 1.00 44.40 ? 120 ASN B ND2 1 
ATOM   2150 N N   . ASN B 1 121 ? 11.850 19.631  -18.568 1.00 44.77 ? 121 ASN B N   1 
ATOM   2151 C CA  . ASN B 1 121 ? 12.535 20.925  -18.698 1.00 45.17 ? 121 ASN B CA  1 
ATOM   2152 C C   . ASN B 1 121 ? 13.456 21.263  -17.514 1.00 45.16 ? 121 ASN B C   1 
ATOM   2153 O O   . ASN B 1 121 ? 13.535 22.411  -17.087 1.00 44.86 ? 121 ASN B O   1 
ATOM   2154 C CB  . ASN B 1 121 ? 11.532 22.065  -18.996 1.00 45.47 ? 121 ASN B CB  1 
ATOM   2155 C CG  . ASN B 1 121 ? 10.736 21.833  -20.287 1.00 46.62 ? 121 ASN B CG  1 
ATOM   2156 O OD1 . ASN B 1 121 ? 11.287 21.414  -21.314 1.00 47.83 ? 121 ASN B OD1 1 
ATOM   2157 N ND2 . ASN B 1 121 ? 9.432  22.112  -20.239 1.00 48.39 ? 121 ASN B ND2 1 
ATOM   2158 N N   . VAL B 1 122 ? 14.159 20.250  -17.010 1.00 45.10 ? 122 VAL B N   1 
ATOM   2159 C CA  . VAL B 1 122 ? 15.141 20.418  -15.933 1.00 45.68 ? 122 VAL B CA  1 
ATOM   2160 C C   . VAL B 1 122 ? 16.461 21.010  -16.460 1.00 46.21 ? 122 VAL B C   1 
ATOM   2161 O O   . VAL B 1 122 ? 17.175 21.698  -15.723 1.00 46.72 ? 122 VAL B O   1 
ATOM   2162 C CB  . VAL B 1 122 ? 15.403 19.084  -15.204 1.00 45.51 ? 122 VAL B CB  1 
ATOM   2163 C CG1 . VAL B 1 122 ? 16.266 19.299  -13.984 1.00 46.03 ? 122 VAL B CG1 1 
ATOM   2164 C CG2 . VAL B 1 122 ? 14.097 18.432  -14.789 1.00 44.84 ? 122 VAL B CG2 1 
ATOM   2165 N N   . PHE B 1 123 ? 16.771 20.721  -17.729 1.00 46.25 ? 123 PHE B N   1 
ATOM   2166 C CA  . PHE B 1 123 ? 17.890 21.307  -18.485 1.00 46.00 ? 123 PHE B CA  1 
ATOM   2167 C C   . PHE B 1 123 ? 17.375 21.470  -19.915 1.00 46.27 ? 123 PHE B C   1 
ATOM   2168 O O   . PHE B 1 123 ? 16.499 20.718  -20.343 1.00 46.38 ? 123 PHE B O   1 
ATOM   2169 C CB  . PHE B 1 123 ? 19.119 20.363  -18.515 1.00 45.65 ? 123 PHE B CB  1 
ATOM   2170 C CG  . PHE B 1 123 ? 19.841 20.202  -17.192 1.00 44.64 ? 123 PHE B CG  1 
ATOM   2171 C CD1 . PHE B 1 123 ? 19.498 19.183  -16.314 1.00 43.39 ? 123 PHE B CD1 1 
ATOM   2172 C CD2 . PHE B 1 123 ? 20.914 21.028  -16.860 1.00 45.76 ? 123 PHE B CD2 1 
ATOM   2173 C CE1 . PHE B 1 123 ? 20.174 19.014  -15.106 1.00 43.82 ? 123 PHE B CE1 1 
ATOM   2174 C CE2 . PHE B 1 123 ? 21.608 20.865  -15.640 1.00 43.89 ? 123 PHE B CE2 1 
ATOM   2175 C CZ  . PHE B 1 123 ? 21.234 19.856  -14.769 1.00 44.08 ? 123 PHE B CZ  1 
ATOM   2176 N N   . LYS B 1 124 ? 17.907 22.435  -20.661 1.00 46.76 ? 124 LYS B N   1 
ATOM   2177 C CA  . LYS B 1 124 ? 17.492 22.636  -22.051 1.00 47.13 ? 124 LYS B CA  1 
ATOM   2178 C C   . LYS B 1 124 ? 18.142 21.603  -22.981 1.00 46.89 ? 124 LYS B C   1 
ATOM   2179 O O   . LYS B 1 124 ? 19.098 20.922  -22.596 1.00 46.93 ? 124 LYS B O   1 
ATOM   2180 C CB  . LYS B 1 124 ? 17.788 24.069  -22.526 1.00 47.75 ? 124 LYS B CB  1 
ATOM   2181 C CG  . LYS B 1 124 ? 16.949 25.181  -21.839 1.00 48.50 ? 124 LYS B CG  1 
ATOM   2182 C CD  . LYS B 1 124 ? 17.077 26.544  -22.544 1.00 48.24 ? 124 LYS B CD  1 
ATOM   2183 C CE  . LYS B 1 124 ? 16.247 26.609  -23.820 1.00 49.89 ? 124 LYS B CE  1 
ATOM   2184 N NZ  . LYS B 1 124 ? 16.238 27.969  -24.446 1.00 50.56 ? 124 LYS B NZ  1 
ATOM   2185 N N   . SER B 1 125 ? 17.610 21.492  -24.197 1.00 46.23 ? 125 SER B N   1 
ATOM   2186 C CA  . SER B 1 125 ? 18.104 20.540  -25.193 1.00 46.20 ? 125 SER B CA  1 
ATOM   2187 C C   . SER B 1 125 ? 19.544 20.813  -25.659 1.00 45.95 ? 125 SER B C   1 
ATOM   2188 O O   . SER B 1 125 ? 20.220 19.914  -26.167 1.00 45.74 ? 125 SER B O   1 
ATOM   2189 C CB  A SER B 1 125 ? 17.165 20.495  -26.407 0.50 46.23 ? 125 SER B CB  1 
ATOM   2190 C CB  B SER B 1 125 ? 17.156 20.489  -26.397 0.50 46.25 ? 125 SER B CB  1 
ATOM   2191 O OG  A SER B 1 125 ? 17.287 21.664  -27.197 0.50 45.98 ? 125 SER B OG  1 
ATOM   2192 O OG  B SER B 1 125 ? 15.918 19.904  -26.032 0.50 46.11 ? 125 SER B OG  1 
ATOM   2193 N N   . GLU B 1 126 ? 19.995 22.056  -25.496 1.00 45.44 ? 126 GLU B N   1 
ATOM   2194 C CA  . GLU B 1 126 ? 21.365 22.440  -25.817 1.00 45.15 ? 126 GLU B CA  1 
ATOM   2195 C C   . GLU B 1 126 ? 22.306 21.697  -24.882 1.00 44.09 ? 126 GLU B C   1 
ATOM   2196 O O   . GLU B 1 126 ? 23.407 21.304  -25.268 1.00 44.09 ? 126 GLU B O   1 
ATOM   2197 C CB  . GLU B 1 126 ? 21.560 23.956  -25.656 1.00 45.39 ? 126 GLU B CB  1 
ATOM   2198 C CG  . GLU B 1 126 ? 20.951 24.806  -26.770 1.00 48.16 ? 126 GLU B CG  1 
ATOM   2199 C CD  . GLU B 1 126 ? 19.427 24.938  -26.684 1.00 50.81 ? 126 GLU B CD  1 
ATOM   2200 O OE1 . GLU B 1 126 ? 18.824 24.460  -25.698 1.00 52.99 ? 126 GLU B OE1 1 
ATOM   2201 O OE2 . GLU B 1 126 ? 18.831 25.522  -27.614 1.00 51.74 ? 126 GLU B OE2 1 
ATOM   2202 N N   . ILE B 1 127 ? 21.857 21.519  -23.644 1.00 42.93 ? 127 ILE B N   1 
ATOM   2203 C CA  . ILE B 1 127 ? 22.622 20.795  -22.644 1.00 42.10 ? 127 ILE B CA  1 
ATOM   2204 C C   . ILE B 1 127 ? 22.425 19.284  -22.775 1.00 41.36 ? 127 ILE B C   1 
ATOM   2205 O O   . ILE B 1 127 ? 23.399 18.535  -22.756 1.00 41.68 ? 127 ILE B O   1 
ATOM   2206 C CB  . ILE B 1 127 ? 22.279 21.286  -21.222 1.00 42.03 ? 127 ILE B CB  1 
ATOM   2207 C CG1 . ILE B 1 127 ? 22.784 22.727  -21.029 1.00 43.05 ? 127 ILE B CG1 1 
ATOM   2208 C CG2 . ILE B 1 127 ? 22.856 20.351  -20.166 1.00 42.32 ? 127 ILE B CG2 1 
ATOM   2209 C CD1 . ILE B 1 127 ? 22.337 23.370  -19.714 1.00 42.61 ? 127 ILE B CD1 1 
ATOM   2210 N N   . ILE B 1 128 ? 21.178 18.836  -22.927 1.00 39.52 ? 128 ILE B N   1 
ATOM   2211 C CA  . ILE B 1 128 ? 20.879 17.405  -22.862 1.00 38.36 ? 128 ILE B CA  1 
ATOM   2212 C C   . ILE B 1 128 ? 21.321 16.632  -24.101 1.00 37.66 ? 128 ILE B C   1 
ATOM   2213 O O   . ILE B 1 128 ? 21.836 15.520  -23.988 1.00 37.15 ? 128 ILE B O   1 
ATOM   2214 C CB  A ILE B 1 128 ? 19.405 17.146  -22.481 0.50 38.40 ? 128 ILE B CB  1 
ATOM   2215 C CB  B ILE B 1 128 ? 19.357 17.158  -22.617 0.50 38.12 ? 128 ILE B CB  1 
ATOM   2216 C CG1 A ILE B 1 128 ? 19.271 17.217  -20.959 0.50 38.49 ? 128 ILE B CG1 1 
ATOM   2217 C CG1 B ILE B 1 128 ? 18.925 17.696  -21.246 0.50 37.78 ? 128 ILE B CG1 1 
ATOM   2218 C CG2 A ILE B 1 128 ? 18.927 15.780  -22.983 0.50 38.89 ? 128 ILE B CG2 1 
ATOM   2219 C CG2 B ILE B 1 128 ? 18.989 15.668  -22.771 0.50 38.68 ? 128 ILE B CG2 1 
ATOM   2220 C CD1 A ILE B 1 128 ? 17.926 17.657  -20.488 0.50 39.88 ? 128 ILE B CD1 1 
ATOM   2221 C CD1 B ILE B 1 128 ? 19.547 16.987  -20.045 0.50 35.70 ? 128 ILE B CD1 1 
ATOM   2222 N N   . GLN B 1 129 ? 21.148 17.230  -25.273 1.00 36.59 ? 129 GLN B N   1 
ATOM   2223 C CA  . GLN B 1 129 ? 21.383 16.519  -26.519 1.00 36.05 ? 129 GLN B CA  1 
ATOM   2224 C C   . GLN B 1 129 ? 22.813 15.978  -26.683 1.00 35.26 ? 129 GLN B C   1 
ATOM   2225 O O   . GLN B 1 129 ? 22.983 14.824  -27.090 1.00 34.75 ? 129 GLN B O   1 
ATOM   2226 C CB  . GLN B 1 129 ? 20.957 17.361  -27.732 1.00 36.21 ? 129 GLN B CB  1 
ATOM   2227 C CG  . GLN B 1 129 ? 20.638 16.538  -28.969 1.00 39.12 ? 129 GLN B CG  1 
ATOM   2228 C CD  . GLN B 1 129 ? 19.531 15.509  -28.734 1.00 41.29 ? 129 GLN B CD  1 
ATOM   2229 O OE1 . GLN B 1 129 ? 18.528 15.786  -28.064 1.00 42.84 ? 129 GLN B OE1 1 
ATOM   2230 N NE2 . GLN B 1 129 ? 19.723 14.310  -29.274 1.00 42.07 ? 129 GLN B NE2 1 
ATOM   2231 N N   . PRO B 1 130 ? 23.844 16.808  -26.402 1.00 34.68 ? 130 PRO B N   1 
ATOM   2232 C CA  . PRO B 1 130 ? 25.218 16.279  -26.446 1.00 34.57 ? 130 PRO B CA  1 
ATOM   2233 C C   . PRO B 1 130 ? 25.439 15.130  -25.465 1.00 33.87 ? 130 PRO B C   1 
ATOM   2234 O O   . PRO B 1 130 ? 26.235 14.240  -25.726 1.00 34.22 ? 130 PRO B O   1 
ATOM   2235 C CB  . PRO B 1 130 ? 26.084 17.487  -26.034 1.00 34.40 ? 130 PRO B CB  1 
ATOM   2236 C CG  . PRO B 1 130 ? 25.244 18.676  -26.301 1.00 34.29 ? 130 PRO B CG  1 
ATOM   2237 C CD  . PRO B 1 130 ? 23.827 18.249  -26.089 1.00 34.67 ? 130 PRO B CD  1 
ATOM   2238 N N   . LEU B 1 131 ? 24.742 15.159  -24.345 1.00 34.05 ? 131 LEU B N   1 
ATOM   2239 C CA  . LEU B 1 131 ? 24.899 14.127  -23.324 1.00 34.73 ? 131 LEU B CA  1 
ATOM   2240 C C   . LEU B 1 131 ? 24.319 12.791  -23.791 1.00 35.59 ? 131 LEU B C   1 
ATOM   2241 O O   . LEU B 1 131 ? 24.940 11.741  -23.577 1.00 36.52 ? 131 LEU B O   1 
ATOM   2242 C CB  . LEU B 1 131 ? 24.281 14.579  -22.001 1.00 34.52 ? 131 LEU B CB  1 
ATOM   2243 C CG  . LEU B 1 131 ? 24.827 15.874  -21.383 1.00 34.61 ? 131 LEU B CG  1 
ATOM   2244 C CD1 . LEU B 1 131 ? 24.010 16.220  -20.131 1.00 33.75 ? 131 LEU B CD1 1 
ATOM   2245 C CD2 . LEU B 1 131 ? 26.323 15.764  -21.053 1.00 33.64 ? 131 LEU B CD2 1 
ATOM   2246 N N   . LEU B 1 132 ? 23.153 12.840  -24.452 1.00 35.66 ? 132 LEU B N   1 
ATOM   2247 C CA  . LEU B 1 132 ? 22.574 11.682  -25.136 1.00 35.61 ? 132 LEU B CA  1 
ATOM   2248 C C   . LEU B 1 132 ? 23.452 11.197  -26.278 1.00 36.22 ? 132 LEU B C   1 
ATOM   2249 O O   . LEU B 1 132 ? 23.667 9.988   -26.443 1.00 35.87 ? 132 LEU B O   1 
ATOM   2250 C CB  . LEU B 1 132 ? 21.179 12.017  -25.688 1.00 35.41 ? 132 LEU B CB  1 
ATOM   2251 C CG  . LEU B 1 132 ? 20.071 12.256  -24.658 1.00 34.66 ? 132 LEU B CG  1 
ATOM   2252 C CD1 . LEU B 1 132 ? 18.839 12.782  -25.368 1.00 32.39 ? 132 LEU B CD1 1 
ATOM   2253 C CD2 . LEU B 1 132 ? 19.768 10.965  -23.910 1.00 34.28 ? 132 LEU B CD2 1 
ATOM   2254 N N   . ASP B 1 133 ? 23.949 12.149  -27.072 1.00 36.73 ? 133 ASP B N   1 
ATOM   2255 C CA  . ASP B 1 133 ? 24.803 11.840  -28.208 1.00 36.93 ? 133 ASP B CA  1 
ATOM   2256 C C   . ASP B 1 133 ? 26.106 11.142  -27.795 1.00 37.20 ? 133 ASP B C   1 
ATOM   2257 O O   . ASP B 1 133 ? 26.586 10.251  -28.501 1.00 36.96 ? 133 ASP B O   1 
ATOM   2258 C CB  . ASP B 1 133 ? 25.049 13.092  -29.056 1.00 37.34 ? 133 ASP B CB  1 
ATOM   2259 C CG  . ASP B 1 133 ? 23.791 13.549  -29.834 1.00 38.42 ? 133 ASP B CG  1 
ATOM   2260 O OD1 . ASP B 1 133 ? 22.890 12.718  -30.122 1.00 39.06 ? 133 ASP B OD1 1 
ATOM   2261 O OD2 . ASP B 1 133 ? 23.711 14.755  -30.171 1.00 39.19 ? 133 ASP B OD2 1 
ATOM   2262 N N   . MET B 1 134 ? 26.656 11.527  -26.644 1.00 37.92 ? 134 MET B N   1 
ATOM   2263 C CA  . MET B 1 134 ? 27.817 10.847  -26.060 1.00 39.13 ? 134 MET B CA  1 
ATOM   2264 C C   . MET B 1 134 ? 27.552 9.377   -25.740 1.00 38.87 ? 134 MET B C   1 
ATOM   2265 O O   . MET B 1 134 ? 28.417 8.531   -25.968 1.00 38.94 ? 134 MET B O   1 
ATOM   2266 C CB  . MET B 1 134 ? 28.271 11.556  -24.791 1.00 39.02 ? 134 MET B CB  1 
ATOM   2267 C CG  . MET B 1 134 ? 29.186 12.730  -25.011 1.00 39.98 ? 134 MET B CG  1 
ATOM   2268 S SD  . MET B 1 134 ? 29.314 13.785  -23.553 1.00 42.72 ? 134 MET B SD  1 
ATOM   2269 C CE  . MET B 1 134 ? 29.846 12.608  -22.307 1.00 42.16 ? 134 MET B CE  1 
ATOM   2270 N N   . ALA B 1 135 ? 26.357 9.083   -25.216 1.00 39.28 ? 135 ALA B N   1 
ATOM   2271 C CA  . ALA B 1 135 ? 25.943 7.721   -24.863 1.00 39.59 ? 135 ALA B CA  1 
ATOM   2272 C C   . ALA B 1 135 ? 25.911 6.810   -26.086 1.00 40.17 ? 135 ALA B C   1 
ATOM   2273 O O   . ALA B 1 135 ? 26.472 5.717   -26.064 1.00 40.02 ? 135 ALA B O   1 
ATOM   2274 C CB  . ALA B 1 135 ? 24.562 7.735   -24.189 1.00 39.50 ? 135 ALA B CB  1 
ATOM   2275 N N   . ALA B 1 136 ? 25.234 7.275   -27.138 1.00 40.85 ? 136 ALA B N   1 
ATOM   2276 C CA  . ALA B 1 136 ? 25.091 6.548   -28.398 1.00 41.44 ? 136 ALA B CA  1 
ATOM   2277 C C   . ALA B 1 136 ? 26.423 6.303   -29.069 1.00 42.18 ? 136 ALA B C   1 
ATOM   2278 O O   . ALA B 1 136 ? 26.659 5.216   -29.591 1.00 42.42 ? 136 ALA B O   1 
ATOM   2279 C CB  . ALA B 1 136 ? 24.184 7.304   -29.338 1.00 40.99 ? 136 ALA B CB  1 
ATOM   2280 N N   . ALA B 1 137 ? 27.293 7.316   -29.066 1.00 43.12 ? 137 ALA B N   1 
ATOM   2281 C CA  . ALA B 1 137 ? 28.584 7.200   -29.749 1.00 43.69 ? 137 ALA B CA  1 
ATOM   2282 C C   . ALA B 1 137 ? 29.516 6.217   -29.038 1.00 44.46 ? 137 ALA B C   1 
ATOM   2283 O O   . ALA B 1 137 ? 30.483 5.737   -29.633 1.00 44.80 ? 137 ALA B O   1 
ATOM   2284 C CB  . ALA B 1 137 ? 29.241 8.560   -29.923 1.00 43.35 ? 137 ALA B CB  1 
ATOM   2285 N N   . LEU B 1 138 ? 29.216 5.906   -27.778 1.00 45.21 ? 138 LEU B N   1 
ATOM   2286 C CA  . LEU B 1 138 ? 29.903 4.820   -27.075 1.00 46.33 ? 138 LEU B CA  1 
ATOM   2287 C C   . LEU B 1 138 ? 29.533 3.431   -27.633 1.00 47.16 ? 138 LEU B C   1 
ATOM   2288 O O   . LEU B 1 138 ? 30.361 2.511   -27.603 1.00 47.56 ? 138 LEU B O   1 
ATOM   2289 C CB  . LEU B 1 138 ? 29.636 4.882   -25.565 1.00 46.53 ? 138 LEU B CB  1 
ATOM   2290 C CG  . LEU B 1 138 ? 30.357 5.975   -24.764 1.00 46.74 ? 138 LEU B CG  1 
ATOM   2291 C CD1 . LEU B 1 138 ? 29.757 6.097   -23.384 1.00 47.16 ? 138 LEU B CD1 1 
ATOM   2292 C CD2 . LEU B 1 138 ? 31.858 5.708   -24.689 1.00 48.17 ? 138 LEU B CD2 1 
ATOM   2293 N N   . GLU B 1 139 ? 28.308 3.285   -28.149 1.00 47.49 ? 139 GLU B N   1 
ATOM   2294 C CA  . GLU B 1 139 ? 27.870 2.020   -28.767 1.00 47.85 ? 139 GLU B CA  1 
ATOM   2295 C C   . GLU B 1 139 ? 28.773 1.597   -29.934 1.00 47.96 ? 139 GLU B C   1 
ATOM   2296 O O   . GLU B 1 139 ? 28.954 2.339   -30.905 1.00 48.23 ? 139 GLU B O   1 
ATOM   2297 C CB  . GLU B 1 139 ? 26.399 2.075   -29.228 1.00 47.46 ? 139 GLU B CB  1 
ATOM   2298 C CG  . GLU B 1 139 ? 25.358 2.402   -28.146 1.00 48.63 ? 139 GLU B CG  1 
ATOM   2299 C CD  . GLU B 1 139 ? 25.282 1.391   -26.990 1.00 49.35 ? 139 GLU B CD  1 
ATOM   2300 O OE1 . GLU B 1 139 ? 25.777 0.246   -27.101 1.00 50.06 ? 139 GLU B OE1 1 
ATOM   2301 O OE2 . GLU B 1 139 ? 24.705 1.754   -25.952 1.00 49.99 ? 139 GLU B OE2 1 
HETATM 2302 C C11 . BTN C 2 1   ? 30.012 4.355   11.453  1.00 39.17 ? 0   BTN Y C11 1 
HETATM 2303 O O12 . BTN C 2 1   ? 29.403 3.352   11.909  1.00 39.81 ? 0   BTN Y O12 1 
HETATM 2304 C C10 . BTN C 2 1   ? 29.246 5.461   10.785  1.00 39.36 ? 0   BTN Y C10 1 
HETATM 2305 C C9  . BTN C 2 1   ? 27.982 5.795   11.559  1.00 40.94 ? 0   BTN Y C9  1 
HETATM 2306 C C8  . BTN C 2 1   ? 27.000 6.474   10.609  1.00 42.49 ? 0   BTN Y C8  1 
HETATM 2307 C C7  . BTN C 2 1   ? 27.689 7.616   9.863   1.00 43.17 ? 0   BTN Y C7  1 
HETATM 2308 C C2  . BTN C 2 1   ? 26.965 8.020   8.582   1.00 44.45 ? 0   BTN Y C2  1 
HETATM 2309 S S1  . BTN C 2 1   ? 27.897 9.139   7.753   1.00 45.33 ? 0   BTN Y S1  1 
HETATM 2310 C C6  . BTN C 2 1   ? 26.423 9.744   6.861   1.00 43.91 ? 0   BTN Y C6  1 
HETATM 2311 C C5  . BTN C 2 1   ? 25.171 9.522   7.743   1.00 44.26 ? 0   BTN Y C5  1 
HETATM 2312 N N1  . BTN C 2 1   ? 24.837 10.798  8.452   1.00 44.46 ? 0   BTN Y N1  1 
HETATM 2313 C C3  . BTN C 2 1   ? 24.923 10.626  9.809   1.00 44.54 ? 0   BTN Y C3  1 
HETATM 2314 O O3  . BTN C 2 1   ? 24.430 11.583  10.849  1.00 44.91 ? 0   BTN Y O3  1 
HETATM 2315 N N2  . BTN C 2 1   ? 25.566 9.460   10.064  1.00 43.87 ? 0   BTN Y N2  1 
HETATM 2316 C C4  . BTN C 2 1   ? 25.571 8.596   8.870   1.00 44.34 ? 0   BTN Y C4  1 
ATOM   2317 N N   . TYR C 2 2   ? 31.267 4.464   11.534  1.00 38.31 ? 1   TYR Y N   1 
ATOM   2318 C CA  . TYR C 2 2   ? 32.152 3.451   12.159  1.00 37.82 ? 1   TYR Y CA  1 
ATOM   2319 C C   . TYR C 2 2   ? 31.677 3.075   13.549  1.00 37.98 ? 1   TYR Y C   1 
ATOM   2320 O O   . TYR C 2 2   ? 31.212 3.922   14.328  1.00 38.28 ? 1   TYR Y O   1 
ATOM   2321 C CB  . TYR C 2 2   ? 33.605 3.914   12.216  1.00 37.33 ? 1   TYR Y CB  1 
ATOM   2322 C CG  . TYR C 2 2   ? 34.557 2.840   12.724  1.00 36.97 ? 1   TYR Y CG  1 
ATOM   2323 C CD1 . TYR C 2 2   ? 35.076 1.858   11.863  1.00 37.60 ? 1   TYR Y CD1 1 
ATOM   2324 C CD2 . TYR C 2 2   ? 34.934 2.803   14.060  1.00 36.71 ? 1   TYR Y CD2 1 
ATOM   2325 C CE1 . TYR C 2 2   ? 35.949 0.867   12.345  1.00 35.71 ? 1   TYR Y CE1 1 
ATOM   2326 C CE2 . TYR C 2 2   ? 35.796 1.844   14.540  1.00 35.59 ? 1   TYR Y CE2 1 
ATOM   2327 C CZ  . TYR C 2 2   ? 36.298 0.883   13.688  1.00 35.76 ? 1   TYR Y CZ  1 
ATOM   2328 O OH  . TYR C 2 2   ? 37.151 -0.046  14.199  1.00 33.93 ? 1   TYR Y OH  1 
HETATM 2329 N N   . SEP C 2 3   ? 31.774 1.781   13.819  1.00 37.70 ? 2   SEP Y N   1 
HETATM 2330 C CA  . SEP C 2 3   ? 31.498 1.210   15.108  1.00 37.55 ? 2   SEP Y CA  1 
HETATM 2331 C CB  . SEP C 2 3   ? 30.253 0.344   15.057  1.00 37.64 ? 2   SEP Y CB  1 
HETATM 2332 O OG  . SEP C 2 3   ? 30.201 -0.473  16.205  1.00 38.87 ? 2   SEP Y OG  1 
HETATM 2333 C C   . SEP C 2 3   ? 32.692 0.355   15.496  1.00 37.49 ? 2   SEP Y C   1 
HETATM 2334 O O   . SEP C 2 3   ? 33.202 -0.413  14.667  1.00 36.88 ? 2   SEP Y O   1 
HETATM 2335 P P   . SEP C 2 3   ? 28.877 -0.199  17.106  1.00 39.38 ? 2   SEP Y P   1 
HETATM 2336 O O1P . SEP C 2 3   ? 28.929 -1.284  18.296  1.00 40.30 ? 2   SEP Y O1P 1 
HETATM 2337 O O2P . SEP C 2 3   ? 28.882 1.278   17.713  1.00 38.34 ? 2   SEP Y O2P 1 
HETATM 2338 O O3P . SEP C 2 3   ? 27.547 -0.427  16.221  1.00 40.77 ? 2   SEP Y O3P 1 
ATOM   2339 N N   . PRO C 2 4   ? 33.143 0.486   16.759  1.00 37.09 ? 3   PRO Y N   1 
ATOM   2340 C CA  . PRO C 2 4   ? 34.266 -0.293  17.278  1.00 37.22 ? 3   PRO Y CA  1 
ATOM   2341 C C   . PRO C 2 4   ? 33.966 -1.790  17.476  1.00 37.17 ? 3   PRO Y C   1 
ATOM   2342 O O   . PRO C 2 4   ? 34.846 -2.547  17.895  1.00 36.35 ? 3   PRO Y O   1 
ATOM   2343 C CB  . PRO C 2 4   ? 34.586 0.409   18.602  1.00 37.38 ? 3   PRO Y CB  1 
ATOM   2344 C CG  . PRO C 2 4   ? 33.260 0.985   19.039  1.00 36.84 ? 3   PRO Y CG  1 
ATOM   2345 C CD  . PRO C 2 4   ? 32.609 1.426   17.763  1.00 37.11 ? 3   PRO Y CD  1 
ATOM   2346 N N   . THR C 2 5   ? 32.742 -2.212  17.165  1.00 38.06 ? 4   THR Y N   1 
ATOM   2347 C CA  . THR C 2 5   ? 32.406 -3.635  17.159  1.00 38.96 ? 4   THR Y CA  1 
ATOM   2348 C C   . THR C 2 5   ? 32.214 -4.185  15.750  1.00 39.66 ? 4   THR Y C   1 
ATOM   2349 O O   . THR C 2 5   ? 31.905 -5.360  15.594  1.00 40.34 ? 4   THR Y O   1 
ATOM   2350 C CB  . THR C 2 5   ? 31.136 -3.963  17.968  1.00 39.17 ? 4   THR Y CB  1 
ATOM   2351 O OG1 . THR C 2 5   ? 30.012 -3.262  17.418  1.00 38.91 ? 4   THR Y OG1 1 
ATOM   2352 C CG2 . THR C 2 5   ? 31.316 -3.624  19.445  1.00 39.15 ? 4   THR Y CG2 1 
ATOM   2353 N N   . SER C 2 6   ? 32.394 -3.349  14.729  1.00 40.15 ? 5   SER Y N   1 
ATOM   2354 C CA  . SER C 2 6   ? 32.126 -3.774  13.357  1.00 40.45 ? 5   SER Y CA  1 
ATOM   2355 C C   . SER C 2 6   ? 33.093 -4.880  12.946  1.00 40.78 ? 5   SER Y C   1 
ATOM   2356 O O   . SER C 2 6   ? 34.262 -4.849  13.337  1.00 40.62 ? 5   SER Y O   1 
ATOM   2357 C CB  . SER C 2 6   ? 32.239 -2.600  12.399  1.00 40.35 ? 5   SER Y CB  1 
ATOM   2358 O OG  . SER C 2 6   ? 33.565 -2.134  12.372  1.00 41.03 ? 5   SER Y OG  1 
ATOM   2359 N N   . PRO C 2 7   ? 32.608 -5.873  12.170  1.00 40.93 ? 6   PRO Y N   1 
ATOM   2360 C CA  . PRO C 2 7   ? 33.502 -6.959  11.752  1.00 41.05 ? 6   PRO Y CA  1 
ATOM   2361 C C   . PRO C 2 7   ? 34.705 -6.475  10.932  1.00 41.07 ? 6   PRO Y C   1 
ATOM   2362 O O   . PRO C 2 7   ? 34.588 -5.526  10.137  1.00 41.34 ? 6   PRO Y O   1 
ATOM   2363 C CB  . PRO C 2 7   ? 32.598 -7.865  10.914  1.00 41.21 ? 6   PRO Y CB  1 
ATOM   2364 C CG  . PRO C 2 7   ? 31.402 -7.032  10.564  1.00 41.72 ? 6   PRO Y CG  1 
ATOM   2365 C CD  . PRO C 2 7   ? 31.231 -6.066  11.682  1.00 41.08 ? 6   PRO Y CD  1 
ATOM   2366 N N   . SER C 2 8   ? 35.857 -7.105  11.157  1.00 40.80 ? 7   SER Y N   1 
ATOM   2367 C CA  . SER C 2 8   ? 37.049 -6.853  10.342  1.00 41.00 ? 7   SER Y CA  1 
ATOM   2368 C C   . SER C 2 8   ? 36.892 -7.473  8.945   1.00 40.38 ? 7   SER Y C   1 
ATOM   2369 O O   . SER C 2 8   ? 36.142 -8.451  8.787   1.00 40.50 ? 7   SER Y O   1 
ATOM   2370 C CB  . SER C 2 8   ? 38.291 -7.400  11.043  1.00 41.40 ? 7   SER Y CB  1 
ATOM   2371 O OG  . SER C 2 8   ? 38.712 -6.512  12.064  1.00 42.60 ? 7   SER Y OG  1 
ATOM   2372 N N   . TYR C 2 9   ? 37.560 -6.904  7.936   1.00 39.21 ? 8   TYR Y N   1 
ATOM   2373 C CA  . TYR C 2 9   ? 37.452 -7.451  6.571   1.00 38.66 ? 8   TYR Y CA  1 
ATOM   2374 C C   . TYR C 2 9   ? 38.354 -8.677  6.361   1.00 38.02 ? 8   TYR Y C   1 
ATOM   2375 O O   . TYR C 2 9   ? 39.422 -8.776  6.949   1.00 37.46 ? 8   TYR Y O   1 
ATOM   2376 C CB  . TYR C 2 9   ? 37.623 -6.378  5.463   1.00 38.73 ? 8   TYR Y CB  1 
ATOM   2377 C CG  . TYR C 2 9   ? 38.989 -5.705  5.386   1.00 39.21 ? 8   TYR Y CG  1 
ATOM   2378 C CD1 . TYR C 2 9   ? 40.066 -6.342  4.762   1.00 39.62 ? 8   TYR Y CD1 1 
ATOM   2379 C CD2 . TYR C 2 9   ? 39.194 -4.418  5.908   1.00 38.51 ? 8   TYR Y CD2 1 
ATOM   2380 C CE1 . TYR C 2 9   ? 41.318 -5.734  4.680   1.00 38.90 ? 8   TYR Y CE1 1 
ATOM   2381 C CE2 . TYR C 2 9   ? 40.455 -3.799  5.839   1.00 37.96 ? 8   TYR Y CE2 1 
ATOM   2382 C CZ  . TYR C 2 9   ? 41.513 -4.477  5.225   1.00 38.93 ? 8   TYR Y CZ  1 
ATOM   2383 O OH  . TYR C 2 9   ? 42.770 -3.916  5.132   1.00 38.61 ? 8   TYR Y OH  1 
HETATM 2384 N N   . SEP C 2 10  ? 37.887 -9.625  5.552   1.00 37.93 ? 9   SEP Y N   1 
HETATM 2385 C CA  . SEP C 2 10  ? 38.648 -10.844 5.242   1.00 37.85 ? 9   SEP Y CA  1 
HETATM 2386 C CB  . SEP C 2 10  ? 38.511 -11.898 6.360   1.00 37.28 ? 9   SEP Y CB  1 
HETATM 2387 O OG  . SEP C 2 10  ? 37.336 -12.676 6.223   1.00 38.68 ? 9   SEP Y OG  1 
HETATM 2388 C C   . SEP C 2 10  ? 38.193 -11.385 3.889   1.00 37.33 ? 9   SEP Y C   1 
HETATM 2389 O O   . SEP C 2 10  ? 37.184 -10.916 3.362   1.00 36.97 ? 9   SEP Y O   1 
HETATM 2390 P P   . SEP C 2 10  ? 37.359 -13.964 7.205   1.00 39.36 ? 9   SEP Y P   1 
HETATM 2391 O O1P . SEP C 2 10  ? 36.844 -13.483 8.647   1.00 40.04 ? 9   SEP Y O1P 1 
HETATM 2392 O O2P . SEP C 2 10  ? 36.406 -15.130 6.625   1.00 40.65 ? 9   SEP Y O2P 1 
HETATM 2393 O O3P . SEP C 2 10  ? 38.860 -14.560 7.324   1.00 40.36 ? 9   SEP Y O3P 1 
ATOM   2394 N N   . PRO C 2 11  ? 38.942 -12.355 3.312   1.00 37.23 ? 10  PRO Y N   1 
ATOM   2395 C CA  . PRO C 2 11  ? 38.573 -12.938 2.025   1.00 37.15 ? 10  PRO Y CA  1 
ATOM   2396 C C   . PRO C 2 11  ? 37.378 -13.875 2.148   1.00 37.31 ? 10  PRO Y C   1 
ATOM   2397 O O   . PRO C 2 11  ? 36.290 -13.549 1.681   1.00 37.37 ? 10  PRO Y O   1 
ATOM   2398 C CB  . PRO C 2 11  ? 39.818 -13.745 1.634   1.00 37.15 ? 10  PRO Y CB  1 
ATOM   2399 C CG  . PRO C 2 11  ? 40.898 -13.293 2.548   1.00 36.87 ? 10  PRO Y CG  1 
ATOM   2400 C CD  . PRO C 2 11  ? 40.193 -12.944 3.812   1.00 37.26 ? 10  PRO Y CD  1 
ATOM   2401 N N   . PRO D 2 7   ? 11.836 1.617   -0.258  1.00 38.56 ? -1  PRO Z N   1 
ATOM   2402 C CA  . PRO D 2 7   ? 11.929 1.820   -1.692  1.00 38.44 ? -1  PRO Z CA  1 
ATOM   2403 C C   . PRO D 2 7   ? 13.283 2.379   -2.141  1.00 38.46 ? -1  PRO Z C   1 
ATOM   2404 O O   . PRO D 2 7   ? 13.841 3.261   -1.488  1.00 38.29 ? -1  PRO Z O   1 
ATOM   2405 C CB  . PRO D 2 7   ? 10.810 2.828   -1.957  1.00 38.39 ? -1  PRO Z CB  1 
ATOM   2406 C CG  . PRO D 2 7   ? 9.757  2.470   -0.948  1.00 38.62 ? -1  PRO Z CG  1 
ATOM   2407 C CD  . PRO D 2 7   ? 10.452 1.788   0.221   1.00 38.57 ? -1  PRO Z CD  1 
ATOM   2408 N N   . SER D 2 8   ? 13.797 1.843   -3.248  1.00 38.37 ? 0   SER Z N   1 
ATOM   2409 C CA  . SER D 2 8   ? 14.991 2.357   -3.908  1.00 38.14 ? 0   SER Z CA  1 
ATOM   2410 C C   . SER D 2 8   ? 14.647 3.684   -4.562  1.00 38.09 ? 0   SER Z C   1 
ATOM   2411 O O   . SER D 2 8   ? 13.505 3.881   -4.998  1.00 38.27 ? 0   SER Z O   1 
ATOM   2412 C CB  . SER D 2 8   ? 15.459 1.381   -4.991  1.00 38.16 ? 0   SER Z CB  1 
ATOM   2413 O OG  . SER D 2 8   ? 15.586 0.066   -4.490  1.00 38.04 ? 0   SER Z OG  1 
ATOM   2414 N N   . TYR D 2 9   ? 15.621 4.592   -4.636  1.00 37.86 ? 1   TYR Z N   1 
ATOM   2415 C CA  . TYR D 2 9   ? 15.414 5.868   -5.319  1.00 37.70 ? 1   TYR Z CA  1 
ATOM   2416 C C   . TYR D 2 9   ? 15.059 5.682   -6.800  1.00 38.02 ? 1   TYR Z C   1 
ATOM   2417 O O   . TYR D 2 9   ? 15.657 4.863   -7.512  1.00 37.62 ? 1   TYR Z O   1 
ATOM   2418 C CB  . TYR D 2 9   ? 16.614 6.817   -5.183  1.00 37.29 ? 1   TYR Z CB  1 
ATOM   2419 C CG  . TYR D 2 9   ? 16.373 8.179   -5.833  1.00 36.48 ? 1   TYR Z CG  1 
ATOM   2420 C CD1 . TYR D 2 9   ? 15.708 9.202   -5.148  1.00 35.92 ? 1   TYR Z CD1 1 
ATOM   2421 C CD2 . TYR D 2 9   ? 16.795 8.433   -7.137  1.00 37.44 ? 1   TYR Z CD2 1 
ATOM   2422 C CE1 . TYR D 2 9   ? 15.484 10.448  -5.739  1.00 35.43 ? 1   TYR Z CE1 1 
ATOM   2423 C CE2 . TYR D 2 9   ? 16.575 9.676   -7.751  1.00 36.65 ? 1   TYR Z CE2 1 
ATOM   2424 C CZ  . TYR D 2 9   ? 15.915 10.677  -7.047  1.00 37.41 ? 1   TYR Z CZ  1 
ATOM   2425 O OH  . TYR D 2 9   ? 15.699 11.903  -7.653  1.00 35.72 ? 1   TYR Z OH  1 
HETATM 2426 N N   . SEP D 2 10  ? 14.074 6.469   -7.225  1.00 38.43 ? 2   SEP Z N   1 
HETATM 2427 C CA  . SEP D 2 10  ? 13.603 6.538   -8.594  1.00 38.69 ? 2   SEP Z CA  1 
HETATM 2428 C CB  . SEP D 2 10  ? 12.194 5.957   -8.671  1.00 38.80 ? 2   SEP Z CB  1 
HETATM 2429 O OG  . SEP D 2 10  ? 11.600 6.284   -9.908  1.00 39.67 ? 2   SEP Z OG  1 
HETATM 2430 C C   . SEP D 2 10  ? 13.588 7.989   -9.091  1.00 38.79 ? 2   SEP Z C   1 
HETATM 2431 O O   . SEP D 2 10  ? 13.152 8.891   -8.364  1.00 39.13 ? 2   SEP Z O   1 
HETATM 2432 P P   . SEP D 2 10  ? 11.371 4.962   -10.797 1.00 40.50 ? 2   SEP Z P   1 
HETATM 2433 O O1P . SEP D 2 10  ? 10.555 5.388   -12.112 1.00 38.58 ? 2   SEP Z O1P 1 
HETATM 2434 O O2P . SEP D 2 10  ? 10.531 3.869   -9.964  1.00 41.44 ? 2   SEP Z O2P 1 
HETATM 2435 O O3P . SEP D 2 10  ? 12.816 4.361   -11.190 1.00 40.79 ? 2   SEP Z O3P 1 
ATOM   2436 N N   . PRO D 2 11  ? 14.053 8.224   -10.335 1.00 38.98 ? 3   PRO Z N   1 
ATOM   2437 C CA  . PRO D 2 11  ? 14.062 9.573   -10.920 1.00 39.02 ? 3   PRO Z CA  1 
ATOM   2438 C C   . PRO D 2 11  ? 12.665 10.139  -11.191 1.00 39.10 ? 3   PRO Z C   1 
ATOM   2439 O O   . PRO D 2 11  ? 12.551 11.303  -11.567 1.00 38.42 ? 3   PRO Z O   1 
ATOM   2440 C CB  . PRO D 2 11  ? 14.814 9.401   -12.242 1.00 39.06 ? 3   PRO Z CB  1 
ATOM   2441 C CG  . PRO D 2 11  ? 15.288 7.994   -12.284 1.00 39.69 ? 3   PRO Z CG  1 
ATOM   2442 C CD  . PRO D 2 11  ? 14.580 7.202   -11.256 1.00 39.26 ? 3   PRO Z CD  1 
ATOM   2443 N N   . THR D 2 12  ? 11.626 9.314   -11.030 1.00 39.78 ? 4   THR Z N   1 
ATOM   2444 C CA  . THR D 2 12  ? 10.234 9.767   -11.133 1.00 40.41 ? 4   THR Z CA  1 
ATOM   2445 C C   . THR D 2 12  ? 9.570  9.930   -9.750  1.00 40.94 ? 4   THR Z C   1 
ATOM   2446 O O   . THR D 2 12  ? 8.358  10.160  -9.664  1.00 41.26 ? 4   THR Z O   1 
ATOM   2447 C CB  . THR D 2 12  ? 9.353  8.833   -12.046 1.00 40.77 ? 4   THR Z CB  1 
ATOM   2448 O OG1 . THR D 2 12  ? 9.220  7.529   -11.459 1.00 39.62 ? 4   THR Z OG1 1 
ATOM   2449 C CG2 . THR D 2 12  ? 9.932  8.705   -13.459 1.00 41.06 ? 4   THR Z CG2 1 
ATOM   2450 N N   . SER D 2 13  ? 10.352 9.816   -8.673  1.00 41.38 ? 5   SER Z N   1 
ATOM   2451 C CA  . SER D 2 13  ? 9.775  9.819   -7.321  1.00 41.82 ? 5   SER Z CA  1 
ATOM   2452 C C   . SER D 2 13  ? 9.430  11.218  -6.807  1.00 42.01 ? 5   SER Z C   1 
ATOM   2453 O O   . SER D 2 13  ? 10.274 12.109  -6.838  1.00 42.22 ? 5   SER Z O   1 
ATOM   2454 C CB  . SER D 2 13  ? 10.639 9.031   -6.313  1.00 41.96 ? 5   SER Z CB  1 
ATOM   2455 O OG  . SER D 2 13  ? 11.946 9.558   -6.154  1.00 41.96 ? 5   SER Z OG  1 
ATOM   2456 N N   . PRO D 2 14  ? 8.177  11.422  -6.348  1.00 42.02 ? 6   PRO Z N   1 
ATOM   2457 C CA  . PRO D 2 14  ? 7.785  12.729  -5.818  1.00 42.06 ? 6   PRO Z CA  1 
ATOM   2458 C C   . PRO D 2 14  ? 8.314  12.962  -4.403  1.00 42.13 ? 6   PRO Z C   1 
ATOM   2459 O O   . PRO D 2 14  ? 9.495  12.719  -4.139  1.00 42.10 ? 6   PRO Z O   1 
ATOM   2460 C CB  . PRO D 2 14  ? 6.257  12.661  -5.817  1.00 42.04 ? 6   PRO Z CB  1 
ATOM   2461 C CG  . PRO D 2 14  ? 5.944  11.217  -5.660  1.00 41.96 ? 6   PRO Z CG  1 
ATOM   2462 C CD  . PRO D 2 14  ? 7.063  10.455  -6.318  1.00 42.15 ? 6   PRO Z CD  1 
HETATM 2463 C C   . ACT E 3 .   ? 32.902 8.409   13.994  1.00 42.05 ? 501 ACT A C   1 
HETATM 2464 O O   . ACT E 3 .   ? 32.632 8.970   15.070  1.00 42.94 ? 501 ACT A O   1 
HETATM 2465 O OXT . ACT E 3 .   ? 33.779 8.970   13.350  1.00 41.52 ? 501 ACT A OXT 1 
HETATM 2466 C CH3 . ACT E 3 .   ? 32.208 7.162   13.519  1.00 43.02 ? 501 ACT A CH3 1 
HETATM 2467 C C1  . GOL F 4 .   ? 27.121 29.991  -11.075 1.00 62.04 ? 503 GOL B C1  1 
HETATM 2468 O O1  . GOL F 4 .   ? 28.145 29.577  -11.963 1.00 61.87 ? 503 GOL B O1  1 
HETATM 2469 C C2  . GOL F 4 .   ? 25.739 29.618  -11.620 1.00 61.57 ? 503 GOL B C2  1 
HETATM 2470 O O2  . GOL F 4 .   ? 25.865 29.057  -12.908 1.00 62.04 ? 503 GOL B O2  1 
HETATM 2471 C C3  . GOL F 4 .   ? 25.054 28.619  -10.690 1.00 60.83 ? 503 GOL B C3  1 
HETATM 2472 O O3  . GOL F 4 .   ? 23.703 28.940  -10.425 1.00 58.21 ? 503 GOL B O3  1 
HETATM 2473 O O   . HOH G 5 .   ? 32.338 10.726  16.228  1.00 44.28 ? 502 HOH A O   1 
HETATM 2474 O O   . HOH G 5 .   ? 52.668 5.622   26.764  1.00 28.51 ? 503 HOH A O   1 
HETATM 2475 O O   . HOH G 5 .   ? 35.738 13.845  19.234  1.00 30.73 ? 504 HOH A O   1 
HETATM 2476 O O   . HOH G 5 .   ? 49.802 5.847   20.456  1.00 28.44 ? 505 HOH A O   1 
HETATM 2477 O O   . HOH G 5 .   ? 56.132 5.259   15.609  1.00 32.95 ? 506 HOH A O   1 
HETATM 2478 O O   . HOH G 5 .   ? 42.269 -7.069  31.701  1.00 41.59 ? 507 HOH A O   1 
HETATM 2479 O O   . HOH G 5 .   ? 53.346 5.016   19.876  1.00 29.52 ? 508 HOH A O   1 
HETATM 2480 O O   . HOH G 5 .   ? 32.867 4.253   21.025  1.00 29.05 ? 509 HOH A O   1 
HETATM 2481 O O   . HOH G 5 .   ? 49.259 3.497   1.810   1.00 32.23 ? 510 HOH A O   1 
HETATM 2482 O O   . HOH G 5 .   ? 41.310 19.049  12.550  1.00 45.90 ? 511 HOH A O   1 
HETATM 2483 O O   . HOH G 5 .   ? 48.716 12.143  20.165  1.00 26.84 ? 512 HOH A O   1 
HETATM 2484 O O   . HOH G 5 .   ? 51.027 10.430  21.236  1.00 36.56 ? 513 HOH A O   1 
HETATM 2485 O O   . HOH G 5 .   ? 48.258 -6.850  18.933  1.00 41.16 ? 514 HOH A O   1 
HETATM 2486 O O   . HOH G 5 .   ? 43.033 2.755   0.555   1.00 45.30 ? 515 HOH A O   1 
HETATM 2487 O O   . HOH G 5 .   ? 53.686 -2.737  2.958   1.00 37.90 ? 516 HOH A O   1 
HETATM 2488 O O   . HOH G 5 .   ? 37.102 -2.277  19.687  1.00 35.79 ? 517 HOH A O   1 
HETATM 2489 O O   . HOH G 5 .   ? 37.856 -4.485  20.609  1.00 44.92 ? 518 HOH A O   1 
HETATM 2490 O O   . HOH G 5 .   ? 39.200 -6.879  18.802  1.00 43.84 ? 519 HOH A O   1 
HETATM 2491 O O   . HOH G 5 .   ? 41.572 -7.610  18.123  1.00 41.28 ? 520 HOH A O   1 
HETATM 2492 O O   . HOH G 5 .   ? 56.094 5.042   18.826  1.00 39.24 ? 521 HOH A O   1 
HETATM 2493 O O   . HOH G 5 .   ? 55.200 7.170   17.243  1.00 36.52 ? 522 HOH A O   1 
HETATM 2494 O O   . HOH G 5 .   ? 28.189 12.357  9.542   1.00 48.12 ? 523 HOH A O   1 
HETATM 2495 O O   . HOH G 5 .   ? 58.826 -1.030  17.403  1.00 50.06 ? 524 HOH A O   1 
HETATM 2496 O O   . HOH G 5 .   ? 48.430 -6.435  21.572  1.00 42.54 ? 525 HOH A O   1 
HETATM 2497 O O   . HOH G 5 .   ? 37.906 -2.569  9.947   1.00 53.16 ? 526 HOH A O   1 
HETATM 2498 O O   . HOH H 5 .   ? 20.775 3.744   -6.912  1.00 25.12 ? 504 HOH B O   1 
HETATM 2499 O O   . HOH H 5 .   ? 26.618 2.658   -11.965 1.00 35.89 ? 505 HOH B O   1 
HETATM 2500 O O   . HOH H 5 .   ? 18.446 26.542  -5.277  1.00 34.73 ? 506 HOH B O   1 
HETATM 2501 O O   . HOH H 5 .   ? 32.643 14.530  -12.517 1.00 28.01 ? 507 HOH B O   1 
HETATM 2502 O O   . HOH H 5 .   ? 20.895 25.471  6.902   1.00 33.77 ? 508 HOH B O   1 
HETATM 2503 O O   . HOH H 5 .   ? 28.196 18.819  -13.371 1.00 29.06 ? 509 HOH B O   1 
HETATM 2504 O O   . HOH H 5 .   ? 17.239 5.844   -14.209 1.00 37.44 ? 510 HOH B O   1 
HETATM 2505 O O   . HOH H 5 .   ? 24.441 20.079  5.188   1.00 31.82 ? 511 HOH B O   1 
HETATM 2506 O O   . HOH H 5 .   ? 33.118 4.395   -4.643  1.00 35.36 ? 512 HOH B O   1 
HETATM 2507 O O   . HOH H 5 .   ? 27.265 23.766  -20.137 1.00 39.49 ? 513 HOH B O   1 
HETATM 2508 O O   . HOH H 5 .   ? 11.078 19.329  -9.051  1.00 40.57 ? 514 HOH B O   1 
HETATM 2509 O O   . HOH H 5 .   ? 32.424 30.740  -9.170  1.00 44.23 ? 515 HOH B O   1 
HETATM 2510 O O   . HOH H 5 .   ? 22.917 4.568   -26.235 1.00 37.69 ? 516 HOH B O   1 
HETATM 2511 O O   . HOH H 5 .   ? 28.345 28.769  -3.035  1.00 37.93 ? 517 HOH B O   1 
HETATM 2512 O O   . HOH H 5 .   ? 29.575 22.120  -12.835 1.00 32.87 ? 518 HOH B O   1 
HETATM 2513 O O   . HOH H 5 .   ? 31.081 24.004  -8.261  1.00 28.51 ? 519 HOH B O   1 
HETATM 2514 O O   . HOH H 5 .   ? 17.534 24.144  -15.261 1.00 41.58 ? 520 HOH B O   1 
HETATM 2515 O O   . HOH H 5 .   ? 32.510 16.874  -13.466 1.00 30.01 ? 521 HOH B O   1 
HETATM 2516 O O   . HOH H 5 .   ? 34.707 20.123  0.517   1.00 39.04 ? 522 HOH B O   1 
HETATM 2517 O O   . HOH H 5 .   ? 23.221 27.352  4.026   1.00 40.51 ? 523 HOH B O   1 
HETATM 2518 O O   . HOH H 5 .   ? 32.478 22.222  -9.608  1.00 38.03 ? 524 HOH B O   1 
HETATM 2519 O O   . HOH H 5 .   ? 17.932 2.288   -10.656 1.00 38.71 ? 525 HOH B O   1 
HETATM 2520 O O   . HOH H 5 .   ? 12.533 14.863  -14.176 1.00 49.45 ? 526 HOH B O   1 
HETATM 2521 O O   . HOH H 5 .   ? 14.146 13.068  -13.106 1.00 44.93 ? 527 HOH B O   1 
HETATM 2522 O O   . HOH H 5 .   ? 11.264 10.165  -20.450 1.00 43.12 ? 528 HOH B O   1 
HETATM 2523 O O   . HOH H 5 .   ? 25.231 -3.142  -7.004  1.00 50.08 ? 529 HOH B O   1 
HETATM 2524 O O   . HOH H 5 .   ? 12.940 8.565   -19.659 1.00 42.10 ? 530 HOH B O   1 
HETATM 2525 O O   . HOH H 5 .   ? 16.641 24.747  -12.355 1.00 46.21 ? 531 HOH B O   1 
HETATM 2526 O O   . HOH H 5 .   ? 15.104 19.302  1.929   1.00 40.22 ? 532 HOH B O   1 
HETATM 2527 O O   . HOH H 5 .   ? 17.661 29.199  -4.049  1.00 51.14 ? 533 HOH B O   1 
HETATM 2528 O O   . HOH I 5 .   ? 44.757 -4.819  2.985   1.00 33.12 ? 65  HOH Y O   1 
HETATM 2529 O O   . HOH I 5 .   ? 38.380 -3.975  11.993  1.00 48.37 ? 109 HOH Y O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   GLU 2   2   2   GLU GLU A . n 
A 1 3   ALA 3   3   3   ALA ALA A . n 
A 1 4   VAL 4   4   4   VAL VAL A . n 
A 1 5   LYS 5   5   5   LYS LYS A . n 
A 1 6   THR 6   6   6   THR THR A . n 
A 1 7   PHE 7   7   7   PHE PHE A . n 
A 1 8   ASN 8   8   8   ASN ASN A . n 
A 1 9   SER 9   9   9   SER SER A . n 
A 1 10  GLU 10  10  10  GLU GLU A . n 
A 1 11  LEU 11  11  11  LEU LEU A . n 
A 1 12  TYR 12  12  12  TYR TYR A . n 
A 1 13  SER 13  13  13  SER SER A . n 
A 1 14  LEU 14  14  14  LEU LEU A . n 
A 1 15  ASN 15  15  15  ASN ASN A . n 
A 1 16  ASP 16  16  16  ASP ASP A . n 
A 1 17  TYR 17  17  17  TYR TYR A . n 
A 1 18  LYS 18  18  18  LYS LYS A . n 
A 1 19  PRO 19  19  19  PRO PRO A . n 
A 1 20  PRO 20  20  20  PRO PRO A . n 
A 1 21  ILE 21  21  21  ILE ILE A . n 
A 1 22  SER 22  22  22  SER SER A . n 
A 1 23  LYS 23  23  23  LYS LYS A . n 
A 1 24  ALA 24  24  24  ALA ALA A . n 
A 1 25  LYS 25  25  25  LYS LYS A . n 
A 1 26  MET 26  26  26  MET MET A . n 
A 1 27  THR 27  27  27  THR THR A . n 
A 1 28  GLN 28  28  28  GLN GLN A . n 
A 1 29  ILE 29  29  29  ILE ILE A . n 
A 1 30  THR 30  30  30  THR THR A . n 
A 1 31  LYS 31  31  31  LYS LYS A . n 
A 1 32  ALA 32  32  32  ALA ALA A . n 
A 1 33  ALA 33  33  33  ALA ALA A . n 
A 1 34  ILE 34  34  34  ILE ILE A . n 
A 1 35  LYS 35  35  35  LYS LYS A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  ILE 37  37  37  ILE ILE A . n 
A 1 38  LYS 38  38  38  LYS LYS A . n 
A 1 39  PHE 39  39  39  PHE PHE A . n 
A 1 40  TYR 40  40  40  TYR TYR A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  HIS 42  42  42  HIS HIS A . n 
A 1 43  VAL 43  43  43  VAL VAL A . n 
A 1 44  VAL 44  44  44  VAL VAL A . n 
A 1 45  GLN 45  45  45  GLN GLN A . n 
A 1 46  SER 46  46  46  SER SER A . n 
A 1 47  VAL 47  47  47  VAL VAL A . n 
A 1 48  GLU 48  48  48  GLU GLU A . n 
A 1 49  LYS 49  49  49  LYS LYS A . n 
A 1 50  PHE 50  50  50  PHE PHE A . n 
A 1 51  ILE 51  51  51  ILE ILE A . n 
A 1 52  GLN 52  52  52  GLN GLN A . n 
A 1 53  LYS 53  53  53  LYS LYS A . n 
A 1 54  CYS 54  54  54  CYS CYS A . n 
A 1 55  LYS 55  55  55  LYS LYS A . n 
A 1 56  PRO 56  56  56  PRO PRO A . n 
A 1 57  GLU 57  57  57  GLU GLU A . n 
A 1 58  TYR 58  58  58  TYR TYR A . n 
A 1 59  LYS 59  59  59  LYS LYS A . n 
A 1 60  VAL 60  60  60  VAL VAL A . n 
A 1 61  PRO 61  61  61  PRO PRO A . n 
A 1 62  GLY 62  62  62  GLY GLY A . n 
A 1 63  LEU 63  63  63  LEU LEU A . n 
A 1 64  TYR 64  64  64  TYR TYR A . n 
A 1 65  VAL 65  65  65  VAL VAL A . n 
A 1 66  ILE 66  66  66  ILE ILE A . n 
A 1 67  ASP 67  67  67  ASP ASP A . n 
A 1 68  SER 68  68  68  SER SER A . n 
A 1 69  ILE 69  69  69  ILE ILE A . n 
A 1 70  VAL 70  70  70  VAL VAL A . n 
A 1 71  ARG 71  71  71  ARG ARG A . n 
A 1 72  GLN 72  72  72  GLN GLN A . n 
A 1 73  SER 73  73  73  SER SER A . n 
A 1 74  ARG 74  74  74  ARG ARG A . n 
A 1 75  HIS 75  75  75  HIS HIS A . n 
A 1 76  GLN 76  76  76  GLN GLN A . n 
A 1 77  PHE 77  77  77  PHE PHE A . n 
A 1 78  GLY 78  78  78  GLY GLY A . n 
A 1 79  GLN 79  79  79  GLN GLN A . n 
A 1 80  GLU 80  80  80  GLU GLU A . n 
A 1 81  LYS 81  81  81  LYS LYS A . n 
A 1 82  ASP 82  82  82  ASP ASP A . n 
A 1 83  VAL 83  83  83  VAL VAL A . n 
A 1 84  PHE 84  84  84  PHE PHE A . n 
A 1 85  ALA 85  85  85  ALA ALA A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  ARG 87  87  87  ARG ARG A . n 
A 1 88  PHE 88  88  88  PHE PHE A . n 
A 1 89  SER 89  89  89  SER SER A . n 
A 1 90  ASN 90  90  90  ASN ASN A . n 
A 1 91  ASN 91  91  91  ASN ASN A . n 
A 1 92  ILE 92  92  92  ILE ILE A . n 
A 1 93  ILE 93  93  93  ILE ILE A . n 
A 1 94  SER 94  94  94  SER SER A . n 
A 1 95  THR 95  95  95  THR THR A . n 
A 1 96  PHE 96  96  96  PHE PHE A . n 
A 1 97  GLN 97  97  97  GLN GLN A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 TYR 100 100 100 TYR TYR A . n 
A 1 101 ARG 101 101 101 ARG ARG A . n 
A 1 102 CYS 102 102 102 CYS CYS A . n 
A 1 103 PRO 103 103 103 PRO PRO A . n 
A 1 104 GLY 104 104 104 GLY GLY A . n 
A 1 105 ASP 105 105 105 ASP ASP A . n 
A 1 106 ASP 106 106 106 ASP ASP A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 LYS 109 109 109 LYS LYS A . n 
A 1 110 ILE 110 110 110 ILE ILE A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 ARG 112 112 112 ARG ARG A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 LEU 114 114 114 LEU LEU A . n 
A 1 115 ASN 115 115 115 ASN ASN A . n 
A 1 116 LEU 116 116 116 LEU LEU A . n 
A 1 117 TRP 117 117 117 TRP TRP A . n 
A 1 118 GLN 118 118 118 GLN GLN A . n 
A 1 119 LYS 119 119 119 LYS LYS A . n 
A 1 120 ASN 120 120 120 ASN ASN A . n 
A 1 121 ASN 121 121 121 ASN ASN A . n 
A 1 122 VAL 122 122 122 VAL VAL A . n 
A 1 123 PHE 123 123 123 PHE PHE A . n 
A 1 124 LYS 124 124 124 LYS LYS A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 GLU 126 126 126 GLU GLU A . n 
A 1 127 ILE 127 127 127 ILE ILE A . n 
A 1 128 ILE 128 128 128 ILE ILE A . n 
A 1 129 GLN 129 129 129 GLN GLN A . n 
A 1 130 PRO 130 130 130 PRO PRO A . n 
A 1 131 LEU 131 131 131 LEU LEU A . n 
A 1 132 LEU 132 132 132 LEU LEU A . n 
A 1 133 ASP 133 133 133 ASP ASP A . n 
A 1 134 MET 134 134 134 MET MET A . n 
A 1 135 ALA 135 135 135 ALA ALA A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 ALA 137 137 137 ALA ALA A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 HIS 140 140 140 HIS HIS A . n 
A 1 141 HIS 141 141 141 HIS HIS A . n 
A 1 142 HIS 142 142 ?   ?   ?   A . n 
A 1 143 HIS 143 143 ?   ?   ?   A . n 
A 1 144 HIS 144 144 ?   ?   ?   A . n 
A 1 145 HIS 145 145 ?   ?   ?   A . n 
B 1 1   MET 1   1   1   MET MET B . n 
B 1 2   GLU 2   2   2   GLU GLU B . n 
B 1 3   ALA 3   3   3   ALA ALA B . n 
B 1 4   VAL 4   4   4   VAL VAL B . n 
B 1 5   LYS 5   5   5   LYS LYS B . n 
B 1 6   THR 6   6   6   THR THR B . n 
B 1 7   PHE 7   7   7   PHE PHE B . n 
B 1 8   ASN 8   8   8   ASN ASN B . n 
B 1 9   SER 9   9   9   SER SER B . n 
B 1 10  GLU 10  10  10  GLU GLU B . n 
B 1 11  LEU 11  11  11  LEU LEU B . n 
B 1 12  TYR 12  12  12  TYR TYR B . n 
B 1 13  SER 13  13  13  SER SER B . n 
B 1 14  LEU 14  14  14  LEU LEU B . n 
B 1 15  ASN 15  15  15  ASN ASN B . n 
B 1 16  ASP 16  16  16  ASP ASP B . n 
B 1 17  TYR 17  17  17  TYR TYR B . n 
B 1 18  LYS 18  18  18  LYS LYS B . n 
B 1 19  PRO 19  19  19  PRO PRO B . n 
B 1 20  PRO 20  20  20  PRO PRO B . n 
B 1 21  ILE 21  21  21  ILE ILE B . n 
B 1 22  SER 22  22  22  SER SER B . n 
B 1 23  LYS 23  23  23  LYS LYS B . n 
B 1 24  ALA 24  24  24  ALA ALA B . n 
B 1 25  LYS 25  25  25  LYS LYS B . n 
B 1 26  MET 26  26  26  MET MET B . n 
B 1 27  THR 27  27  27  THR THR B . n 
B 1 28  GLN 28  28  28  GLN GLN B . n 
B 1 29  ILE 29  29  29  ILE ILE B . n 
B 1 30  THR 30  30  30  THR THR B . n 
B 1 31  LYS 31  31  31  LYS LYS B . n 
B 1 32  ALA 32  32  32  ALA ALA B . n 
B 1 33  ALA 33  33  33  ALA ALA B . n 
B 1 34  ILE 34  34  34  ILE ILE B . n 
B 1 35  LYS 35  35  35  LYS LYS B . n 
B 1 36  ALA 36  36  36  ALA ALA B . n 
B 1 37  ILE 37  37  37  ILE ILE B . n 
B 1 38  LYS 38  38  38  LYS LYS B . n 
B 1 39  PHE 39  39  39  PHE PHE B . n 
B 1 40  TYR 40  40  40  TYR TYR B . n 
B 1 41  LYS 41  41  41  LYS LYS B . n 
B 1 42  HIS 42  42  42  HIS HIS B . n 
B 1 43  VAL 43  43  43  VAL VAL B . n 
B 1 44  VAL 44  44  44  VAL VAL B . n 
B 1 45  GLN 45  45  45  GLN GLN B . n 
B 1 46  SER 46  46  46  SER SER B . n 
B 1 47  VAL 47  47  47  VAL VAL B . n 
B 1 48  GLU 48  48  48  GLU GLU B . n 
B 1 49  LYS 49  49  49  LYS LYS B . n 
B 1 50  PHE 50  50  50  PHE PHE B . n 
B 1 51  ILE 51  51  51  ILE ILE B . n 
B 1 52  GLN 52  52  52  GLN GLN B . n 
B 1 53  LYS 53  53  53  LYS LYS B . n 
B 1 54  CYS 54  54  54  CYS CYS B . n 
B 1 55  LYS 55  55  55  LYS LYS B . n 
B 1 56  PRO 56  56  56  PRO PRO B . n 
B 1 57  GLU 57  57  57  GLU GLU B . n 
B 1 58  TYR 58  58  58  TYR TYR B . n 
B 1 59  LYS 59  59  59  LYS LYS B . n 
B 1 60  VAL 60  60  60  VAL VAL B . n 
B 1 61  PRO 61  61  61  PRO PRO B . n 
B 1 62  GLY 62  62  62  GLY GLY B . n 
B 1 63  LEU 63  63  63  LEU LEU B . n 
B 1 64  TYR 64  64  64  TYR TYR B . n 
B 1 65  VAL 65  65  65  VAL VAL B . n 
B 1 66  ILE 66  66  66  ILE ILE B . n 
B 1 67  ASP 67  67  67  ASP ASP B . n 
B 1 68  SER 68  68  68  SER SER B . n 
B 1 69  ILE 69  69  69  ILE ILE B . n 
B 1 70  VAL 70  70  70  VAL VAL B . n 
B 1 71  ARG 71  71  71  ARG ARG B . n 
B 1 72  GLN 72  72  72  GLN GLN B . n 
B 1 73  SER 73  73  73  SER SER B . n 
B 1 74  ARG 74  74  74  ARG ARG B . n 
B 1 75  HIS 75  75  75  HIS HIS B . n 
B 1 76  GLN 76  76  76  GLN GLN B . n 
B 1 77  PHE 77  77  77  PHE PHE B . n 
B 1 78  GLY 78  78  78  GLY GLY B . n 
B 1 79  GLN 79  79  79  GLN GLN B . n 
B 1 80  GLU 80  80  80  GLU GLU B . n 
B 1 81  LYS 81  81  81  LYS LYS B . n 
B 1 82  ASP 82  82  82  ASP ASP B . n 
B 1 83  VAL 83  83  83  VAL VAL B . n 
B 1 84  PHE 84  84  84  PHE PHE B . n 
B 1 85  ALA 85  85  85  ALA ALA B . n 
B 1 86  PRO 86  86  86  PRO PRO B . n 
B 1 87  ARG 87  87  87  ARG ARG B . n 
B 1 88  PHE 88  88  88  PHE PHE B . n 
B 1 89  SER 89  89  89  SER SER B . n 
B 1 90  ASN 90  90  90  ASN ASN B . n 
B 1 91  ASN 91  91  91  ASN ASN B . n 
B 1 92  ILE 92  92  92  ILE ILE B . n 
B 1 93  ILE 93  93  93  ILE ILE B . n 
B 1 94  SER 94  94  94  SER SER B . n 
B 1 95  THR 95  95  95  THR THR B . n 
B 1 96  PHE 96  96  96  PHE PHE B . n 
B 1 97  GLN 97  97  97  GLN GLN B . n 
B 1 98  ASN 98  98  98  ASN ASN B . n 
B 1 99  LEU 99  99  99  LEU LEU B . n 
B 1 100 TYR 100 100 100 TYR TYR B . n 
B 1 101 ARG 101 101 101 ARG ARG B . n 
B 1 102 CYS 102 102 102 CYS CYS B . n 
B 1 103 PRO 103 103 103 PRO PRO B . n 
B 1 104 GLY 104 104 104 GLY GLY B . n 
B 1 105 ASP 105 105 105 ASP ASP B . n 
B 1 106 ASP 106 106 106 ASP ASP B . n 
B 1 107 LYS 107 107 107 LYS LYS B . n 
B 1 108 SER 108 108 108 SER SER B . n 
B 1 109 LYS 109 109 109 LYS LYS B . n 
B 1 110 ILE 110 110 110 ILE ILE B . n 
B 1 111 VAL 111 111 111 VAL VAL B . n 
B 1 112 ARG 112 112 112 ARG ARG B . n 
B 1 113 VAL 113 113 113 VAL VAL B . n 
B 1 114 LEU 114 114 114 LEU LEU B . n 
B 1 115 ASN 115 115 115 ASN ASN B . n 
B 1 116 LEU 116 116 116 LEU LEU B . n 
B 1 117 TRP 117 117 117 TRP TRP B . n 
B 1 118 GLN 118 118 118 GLN GLN B . n 
B 1 119 LYS 119 119 119 LYS LYS B . n 
B 1 120 ASN 120 120 120 ASN ASN B . n 
B 1 121 ASN 121 121 121 ASN ASN B . n 
B 1 122 VAL 122 122 122 VAL VAL B . n 
B 1 123 PHE 123 123 123 PHE PHE B . n 
B 1 124 LYS 124 124 124 LYS LYS B . n 
B 1 125 SER 125 125 125 SER SER B . n 
B 1 126 GLU 126 126 126 GLU GLU B . n 
B 1 127 ILE 127 127 127 ILE ILE B . n 
B 1 128 ILE 128 128 128 ILE ILE B . n 
B 1 129 GLN 129 129 129 GLN GLN B . n 
B 1 130 PRO 130 130 130 PRO PRO B . n 
B 1 131 LEU 131 131 131 LEU LEU B . n 
B 1 132 LEU 132 132 132 LEU LEU B . n 
B 1 133 ASP 133 133 133 ASP ASP B . n 
B 1 134 MET 134 134 134 MET MET B . n 
B 1 135 ALA 135 135 135 ALA ALA B . n 
B 1 136 ALA 136 136 136 ALA ALA B . n 
B 1 137 ALA 137 137 137 ALA ALA B . n 
B 1 138 LEU 138 138 138 LEU LEU B . n 
B 1 139 GLU 139 139 139 GLU GLU B . n 
B 1 140 HIS 140 140 ?   ?   ?   B . n 
B 1 141 HIS 141 141 ?   ?   ?   B . n 
B 1 142 HIS 142 142 ?   ?   ?   B . n 
B 1 143 HIS 143 143 ?   ?   ?   B . n 
B 1 144 HIS 144 144 ?   ?   ?   B . n 
B 1 145 HIS 145 145 ?   ?   ?   B . n 
C 2 1   BTN 1   0   0   BTN BTN Y . n 
C 2 2   TYR 2   1   1   TYR TYR Y . n 
C 2 3   SEP 3   2   2   SEP SEP Y . n 
C 2 4   PRO 4   3   3   PRO PRO Y . n 
C 2 5   THR 5   4   4   THR THR Y . n 
C 2 6   SER 6   5   5   SER SER Y . n 
C 2 7   PRO 7   6   6   PRO PRO Y . n 
C 2 8   SER 8   7   7   SER SER Y . n 
C 2 9   TYR 9   8   8   TYR TYR Y . n 
C 2 10  SEP 10  9   9   SEP SEP Y . n 
C 2 11  PRO 11  10  10  PRO PRO Y . n 
C 2 12  THR 12  11  ?   ?   ?   Y . n 
C 2 13  SER 13  12  ?   ?   ?   Y . n 
C 2 14  PRO 14  13  ?   ?   ?   Y . n 
C 2 15  SER 15  14  ?   ?   ?   Y . n 
D 2 1   BTN 1   -7  ?   ?   ?   Z . n 
D 2 2   TYR 2   -6  ?   ?   ?   Z . n 
D 2 3   SEP 3   -5  ?   ?   ?   Z . n 
D 2 4   PRO 4   -4  ?   ?   ?   Z . n 
D 2 5   THR 5   -3  ?   ?   ?   Z . n 
D 2 6   SER 6   -2  ?   ?   ?   Z . n 
D 2 7   PRO 7   -1  -1  PRO PRO Z . n 
D 2 8   SER 8   0   0   SER SER Z . n 
D 2 9   TYR 9   1   1   TYR TYR Z . n 
D 2 10  SEP 10  2   2   SEP SEP Z . n 
D 2 11  PRO 11  3   3   PRO PRO Z . n 
D 2 12  THR 12  4   4   THR THR Z . n 
D 2 13  SER 13  5   5   SER SER Z . n 
D 2 14  PRO 14  6   6   PRO PRO Z . n 
D 2 15  SER 15  7   ?   ?   ?   Z . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 ACT 1  501 501 ACT ACT A . 
F 4 GOL 1  503 503 GOL GOL B . 
G 5 HOH 1  502 502 HOH HOH A . 
G 5 HOH 2  503 503 HOH HOH A . 
G 5 HOH 3  504 504 HOH HOH A . 
G 5 HOH 4  505 505 HOH HOH A . 
G 5 HOH 5  506 506 HOH HOH A . 
G 5 HOH 6  507 507 HOH HOH A . 
G 5 HOH 7  508 508 HOH HOH A . 
G 5 HOH 8  509 509 HOH HOH A . 
G 5 HOH 9  510 510 HOH HOH A . 
G 5 HOH 10 511 511 HOH HOH A . 
G 5 HOH 11 512 512 HOH HOH A . 
G 5 HOH 12 513 513 HOH HOH A . 
G 5 HOH 13 514 514 HOH HOH A . 
G 5 HOH 14 515 515 HOH HOH A . 
G 5 HOH 15 516 516 HOH HOH A . 
G 5 HOH 16 517 517 HOH HOH A . 
G 5 HOH 17 518 518 HOH HOH A . 
G 5 HOH 18 519 519 HOH HOH A . 
G 5 HOH 19 520 520 HOH HOH A . 
G 5 HOH 20 521 521 HOH HOH A . 
G 5 HOH 21 522 522 HOH HOH A . 
G 5 HOH 22 523 523 HOH HOH A . 
G 5 HOH 23 524 524 HOH HOH A . 
G 5 HOH 24 525 525 HOH HOH A . 
G 5 HOH 25 526 526 HOH HOH A . 
H 5 HOH 1  504 504 HOH HOH B . 
H 5 HOH 2  505 505 HOH HOH B . 
H 5 HOH 3  506 506 HOH HOH B . 
H 5 HOH 4  507 507 HOH HOH B . 
H 5 HOH 5  508 508 HOH HOH B . 
H 5 HOH 6  509 509 HOH HOH B . 
H 5 HOH 7  510 510 HOH HOH B . 
H 5 HOH 8  511 511 HOH HOH B . 
H 5 HOH 9  512 512 HOH HOH B . 
H 5 HOH 10 513 513 HOH HOH B . 
H 5 HOH 11 514 514 HOH HOH B . 
H 5 HOH 12 515 515 HOH HOH B . 
H 5 HOH 13 516 516 HOH HOH B . 
H 5 HOH 14 517 517 HOH HOH B . 
H 5 HOH 15 518 518 HOH HOH B . 
H 5 HOH 16 519 519 HOH HOH B . 
H 5 HOH 17 520 520 HOH HOH B . 
H 5 HOH 18 521 521 HOH HOH B . 
H 5 HOH 19 522 522 HOH HOH B . 
H 5 HOH 20 523 523 HOH HOH B . 
H 5 HOH 21 524 524 HOH HOH B . 
H 5 HOH 22 525 525 HOH HOH B . 
H 5 HOH 23 526 526 HOH HOH B . 
H 5 HOH 24 527 527 HOH HOH B . 
H 5 HOH 25 528 528 HOH HOH B . 
H 5 HOH 26 529 529 HOH HOH B . 
H 5 HOH 27 530 530 HOH HOH B . 
H 5 HOH 28 531 531 HOH HOH B . 
H 5 HOH 29 532 532 HOH HOH B . 
H 5 HOH 30 533 533 HOH HOH B . 
I 5 HOH 1  65  65  HOH HOH Y . 
I 5 HOH 2  109 109 HOH HOH Y . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 C SEP 3  Y SEP 2 ? SER PHOSPHOSERINE 
2 C SEP 10 Y SEP 9 ? SER PHOSPHOSERINE 
3 D SEP 10 Z SEP 2 ? SER PHOSPHOSERINE 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E,G,I 
2 1 B,D,F,H   
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1890 ? 
1 MORE         -8   ? 
1 'SSA (A^2)'  8220 ? 
2 'ABSA (A^2)' 1150 ? 
2 MORE         -3   ? 
2 'SSA (A^2)'  8130 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-06-10 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-10-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Atomic model'              
3 2 'Structure model' 'Database references'       
4 2 'Structure model' 'Derived calculations'      
5 2 'Structure model' 'Non-polymer description'   
6 2 'Structure model' 'Refinement description'    
7 2 'Structure model' 'Structure summary'         
8 2 'Structure model' 'Version format compliance' 
9 3 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    3 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_software.name' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1 ? refined 43.5600 4.9389  17.1121 -0.2058 -0.1532 -0.1879 -0.0012 -0.0133 -0.0023 3.2418  4.0239  7.1599  
0.4574  1.6621  0.5197   0.0383  -0.2662 0.2280  -0.1631 0.2266  0.0847  -0.0964 0.1418  0.1626  
'X-RAY DIFFRACTION' 2 ? refined 23.7039 14.4660 -9.6025 -0.2044 -0.1641 -0.0891 -0.0409 -0.0357 -0.0188 2.6096  3.3246  6.8626  
0.0157  1.1572  0.8321   -0.1947 0.1945  0.0002  0.1156  -0.0542 -0.1415 0.0393  -0.0556 -0.2679 
'X-RAY DIFFRACTION' 3 ? refined 33.8437 -2.7897 10.8555 0.0030  0.1849  0.0165  -0.1132 -0.0599 -0.0859 7.7876  6.7047  7.5120  
-0.6087 -7.1513 1.8848   -0.3186 -0.5025 0.8211  0.7486  -0.6433 1.1584  -0.6377 0.2274  -0.8430 
'X-RAY DIFFRACTION' 4 ? refined 12.3539 7.4261  -7.1808 0.0402  0.2509  0.1190  -0.1997 0.0023  -0.1472 11.7597 55.3562 32.6383 
0.8673  8.3324  -37.0145 0.3206  0.2002  -0.5208 -0.8524 -0.2452 1.4476  1.7433  0.5511  -2.0353 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A 2  A 141 ? . . . . ? 
'X-RAY DIFFRACTION' 2 2 B 1  B 139 ? . . . . ? 
'X-RAY DIFFRACTION' 3 3 Y 1  Y 10  ? . . . . ? 
'X-RAY DIFFRACTION' 4 4 Z -1 Z 6   ? . . . . ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement        5.2.0019 ? 1 
MAR345 'data collection' SOFTWARE ? 2 
XDS    'data reduction'  .        ? 3 
XSCALE 'data scaling'    .        ? 4 
REFMAC phasing           5.2.0019 ? 5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   ACT 
_pdbx_validate_close_contact.auth_seq_id_1    501 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    502 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.12 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A HIS 142 ? A HIS 142 
3  1 Y 1 A HIS 143 ? A HIS 143 
4  1 Y 1 A HIS 144 ? A HIS 144 
5  1 Y 1 A HIS 145 ? A HIS 145 
6  1 Y 1 B HIS 140 ? B HIS 140 
7  1 Y 1 B HIS 141 ? B HIS 141 
8  1 Y 1 B HIS 142 ? B HIS 142 
9  1 Y 1 B HIS 143 ? B HIS 143 
10 1 Y 1 B HIS 144 ? B HIS 144 
11 1 Y 1 B HIS 145 ? B HIS 145 
12 1 Y 1 Y THR 11  ? C THR 12  
13 1 Y 1 Y SER 12  ? C SER 13  
14 1 Y 1 Y PRO 13  ? C PRO 14  
15 1 Y 1 Y SER 14  ? C SER 15  
16 1 Y 1 Z BTN -7  ? D BTN 1   
17 1 Y 1 Z TYR -6  ? D TYR 2   
18 1 Y 1 Z SEP -5  ? D SEP 3   
19 1 Y 1 Z PRO -4  ? D PRO 4   
20 1 Y 1 Z THR -3  ? D THR 5   
21 1 Y 1 Z SER -2  ? D SER 6   
22 1 Y 1 Z SER 7   ? D SER 15  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'ACETATE ION' ACT 
4 GLYCEROL      GOL 
5 water         HOH 
#