data_3D9M
# 
_entry.id   3D9M 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3D9M         
RCSB  RCSB047765   
WWPDB D_1000047765 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB  1sz9 'The RNA polymerase II CTD in mRNA processing: beta-turn recognition and beta-spiral model' unspecified 
PDB  1sza 'The RNA polymerase II CTD in mRNA processing: beta-turn recognition and beta-spiral model' unspecified 
PDB  2bf0 'CRYSTAL STRUCTURE OF THE RPR OF PCF11' unspecified 
PDB  3clj 'Structure of the RNA polymerase II CTD-interacting domain of Nrd1' unspecified 
BMRB 6404 'Backbone assignment of PCF11 CTD binding domain' unspecified 
PDB  3D9I 
;Snapshots of the RNA processing factor SCAF8 bound to
different phosphorylated forms of the carboxy-terminal
domain of RNA-POLYMERASE II
;
unspecified 
PDB  3D9J 
;Snapshots of the RNA processing factor SCAF8 bound to different 
phosphorylated forms of the carboxy-terminal domain of RNA-POLYMERASE II
;
unspecified 
PDB  3D9K 
;Snapshots of the RNA processing factor SCAF8 bound to different phosphorylated 
forms of the carboxy-terminal domain of RNA-POLYMERASE II (CTD phosphorylated at 
SER2 AND SER5)
;
unspecified 
PDB  3D9L 
;Snapshots of the RNA processing factor SCAF8 bound to different phosphorylated 
forms of the carboxy-terminal domain of RNA-POLYMERASE II (CTD phosphorylated at 
SER2)
;
unspecified 
PDB  3D9N 
;Snapshots of the RNA processing factor SCAF8 bound to different phosphorylated 
forms of the carboxy-terminal domain of RNA-POLYMERASE II (CTD phosphorylated at
SER2 and SER7)
;
unspecified 
PDB  3D9O 
;Snapshots of the RNA processing factor SCAF8 bound to different phosphorylated 
forms of the carboxy-terminal domain of RNA-POLYMERASE II (CTD unphosphorylated)
;
unspecified 
PDB  3D9P 
;Snapshots of the RNA processing factor SCAF8 bound to
different phosphorylated forms of the carboxy-terminal
domain of RNA-POLYMERASE II (CTD PHOSPHORYLATED AT 
SER2 AND SER5)
;
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3D9M 
_pdbx_database_status.recvd_initial_deposition_date   2008-05-27 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Becker, R.'   1 
'Loll, B.'     2 
'Meinhart, A.' 3 
# 
_citation.id                        primary 
_citation.title                     
;Snapshots of the RNA Processing Factor SCAF8 Bound to Different Phosphorylated Forms of the Carboxyl-terminal Domain of RNA Polymerase II.
;
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            283 
_citation.page_first                22659 
_citation.page_last                 22669 
_citation.year                      2008 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18550522 
_citation.pdbx_database_id_DOI      10.1074/jbc.M803540200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Becker, R.'   1 
primary 'Loll, B.'     2 
primary 'Meinhart, A.' 3 
# 
_cell.entry_id           3D9M 
_cell.length_a           57.610 
_cell.length_b           57.610 
_cell.length_c           106.580 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3D9M 
_symmetry.space_group_name_H-M             'P 43' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                78 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'RNA-binding protein 16' 16940.648 2   ? ? 'CTD INTERACTING DOMAIN OF SCAF8, UNP residues 1-136' ? 
2 polymer     syn CTD-PEPTIDE              1617.454  2   ? ? ?                                                     ? 
3 non-polymer syn 'AMMONIUM ION'           18.038    2   ? ? ?                                                     ? 
4 non-polymer syn 'SULFATE ION'            96.063    7   ? ? ?                                                     ? 
5 water       nat water                    18.015    161 ? ? ?                                                     ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RNA-binding motif protein 16' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;MEAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKVPGLYVIDSIVRQSRHQFGQE
KDVFAPRFSNNIISTFQNLYRCPGDDKSKIVRVLNLWQKNNVFKSEIIQPLLDMAAALEHHHHHH
;
;MEAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKVPGLYVIDSIVRQSRHQFGQE
KDVFAPRFSNNIISTFQNLYRCPGDDKSKIVRVLNLWQKNNVFKSEIIQPLLDMAAALEHHHHHH
;
A,B ? 
2 'polypeptide(L)' no yes 'YSPT(SEP)PSYSPT(SEP)PS' YSPTSPSYSPTSPS Y,Z ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLU n 
1 3   ALA n 
1 4   VAL n 
1 5   LYS n 
1 6   THR n 
1 7   PHE n 
1 8   ASN n 
1 9   SER n 
1 10  GLU n 
1 11  LEU n 
1 12  TYR n 
1 13  SER n 
1 14  LEU n 
1 15  ASN n 
1 16  ASP n 
1 17  TYR n 
1 18  LYS n 
1 19  PRO n 
1 20  PRO n 
1 21  ILE n 
1 22  SER n 
1 23  LYS n 
1 24  ALA n 
1 25  LYS n 
1 26  MET n 
1 27  THR n 
1 28  GLN n 
1 29  ILE n 
1 30  THR n 
1 31  LYS n 
1 32  ALA n 
1 33  ALA n 
1 34  ILE n 
1 35  LYS n 
1 36  ALA n 
1 37  ILE n 
1 38  LYS n 
1 39  PHE n 
1 40  TYR n 
1 41  LYS n 
1 42  HIS n 
1 43  VAL n 
1 44  VAL n 
1 45  GLN n 
1 46  SER n 
1 47  VAL n 
1 48  GLU n 
1 49  LYS n 
1 50  PHE n 
1 51  ILE n 
1 52  GLN n 
1 53  LYS n 
1 54  CYS n 
1 55  LYS n 
1 56  PRO n 
1 57  GLU n 
1 58  TYR n 
1 59  LYS n 
1 60  VAL n 
1 61  PRO n 
1 62  GLY n 
1 63  LEU n 
1 64  TYR n 
1 65  VAL n 
1 66  ILE n 
1 67  ASP n 
1 68  SER n 
1 69  ILE n 
1 70  VAL n 
1 71  ARG n 
1 72  GLN n 
1 73  SER n 
1 74  ARG n 
1 75  HIS n 
1 76  GLN n 
1 77  PHE n 
1 78  GLY n 
1 79  GLN n 
1 80  GLU n 
1 81  LYS n 
1 82  ASP n 
1 83  VAL n 
1 84  PHE n 
1 85  ALA n 
1 86  PRO n 
1 87  ARG n 
1 88  PHE n 
1 89  SER n 
1 90  ASN n 
1 91  ASN n 
1 92  ILE n 
1 93  ILE n 
1 94  SER n 
1 95  THR n 
1 96  PHE n 
1 97  GLN n 
1 98  ASN n 
1 99  LEU n 
1 100 TYR n 
1 101 ARG n 
1 102 CYS n 
1 103 PRO n 
1 104 GLY n 
1 105 ASP n 
1 106 ASP n 
1 107 LYS n 
1 108 SER n 
1 109 LYS n 
1 110 ILE n 
1 111 VAL n 
1 112 ARG n 
1 113 VAL n 
1 114 LEU n 
1 115 ASN n 
1 116 LEU n 
1 117 TRP n 
1 118 GLN n 
1 119 LYS n 
1 120 ASN n 
1 121 ASN n 
1 122 VAL n 
1 123 PHE n 
1 124 LYS n 
1 125 SER n 
1 126 GLU n 
1 127 ILE n 
1 128 ILE n 
1 129 GLN n 
1 130 PRO n 
1 131 LEU n 
1 132 LEU n 
1 133 ASP n 
1 134 MET n 
1 135 ALA n 
1 136 ALA n 
1 137 ALA n 
1 138 LEU n 
1 139 GLU n 
1 140 HIS n 
1 141 HIS n 
1 142 HIS n 
1 143 HIS n 
1 144 HIS n 
1 145 HIS n 
2 1   TYR n 
2 2   SER n 
2 3   PRO n 
2 4   THR n 
2 5   SEP n 
2 6   PRO n 
2 7   SER n 
2 8   TYR n 
2 9   SER n 
2 10  PRO n 
2 11  THR n 
2 12  SEP n 
2 13  PRO n 
2 14  SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               man 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'RBM16, KIAA1116' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)-RIL' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'PEPTIDE DERIVED FROM THE CONSERVED REPEAT SEQUENCE IN RNA POLYMERASE II CTD' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP RBM16_HUMAN Q9UPN6 1 
;MEAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKVPGLYVIDSIVRQSRHQFGQE
KDVFAPRFSNNIISTFQNLYRCPGDDKSKIVRVLNLWQKNNVFKSEIIQPLLDMAA
;
1 ? 
2 PDB 3D9M        3D9M   2 YSPTSPSYSPTSPS ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3D9M A 1 ? 136 ? Q9UPN6 1  ? 136 ? 1  136 
2 1 3D9M B 1 ? 136 ? Q9UPN6 1  ? 136 ? 1  136 
3 2 3D9M Y 1 ? 14  ? 3D9M   -6 ? 7   ? -6 7   
4 2 3D9M Z 1 ? 14  ? 3D9M   -6 ? 7   ? -6 7   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3D9M ALA A 137 ? UNP Q9UPN6 ? ? 'EXPRESSION TAG' 137 1  
1 3D9M LEU A 138 ? UNP Q9UPN6 ? ? 'EXPRESSION TAG' 138 2  
1 3D9M GLU A 139 ? UNP Q9UPN6 ? ? 'EXPRESSION TAG' 139 3  
1 3D9M HIS A 140 ? UNP Q9UPN6 ? ? 'EXPRESSION TAG' 140 4  
1 3D9M HIS A 141 ? UNP Q9UPN6 ? ? 'EXPRESSION TAG' 141 5  
1 3D9M HIS A 142 ? UNP Q9UPN6 ? ? 'EXPRESSION TAG' 142 6  
1 3D9M HIS A 143 ? UNP Q9UPN6 ? ? 'EXPRESSION TAG' 143 7  
1 3D9M HIS A 144 ? UNP Q9UPN6 ? ? 'EXPRESSION TAG' 144 8  
1 3D9M HIS A 145 ? UNP Q9UPN6 ? ? 'EXPRESSION TAG' 145 9  
2 3D9M ALA B 137 ? UNP Q9UPN6 ? ? 'EXPRESSION TAG' 137 10 
2 3D9M LEU B 138 ? UNP Q9UPN6 ? ? 'EXPRESSION TAG' 138 11 
2 3D9M GLU B 139 ? UNP Q9UPN6 ? ? 'EXPRESSION TAG' 139 12 
2 3D9M HIS B 140 ? UNP Q9UPN6 ? ? 'EXPRESSION TAG' 140 13 
2 3D9M HIS B 141 ? UNP Q9UPN6 ? ? 'EXPRESSION TAG' 141 14 
2 3D9M HIS B 142 ? UNP Q9UPN6 ? ? 'EXPRESSION TAG' 142 15 
2 3D9M HIS B 143 ? UNP Q9UPN6 ? ? 'EXPRESSION TAG' 143 16 
2 3D9M HIS B 144 ? UNP Q9UPN6 ? ? 'EXPRESSION TAG' 144 17 
2 3D9M HIS B 145 ? UNP Q9UPN6 ? ? 'EXPRESSION TAG' 145 18 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?               'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ?               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?               'C5 H11 N O2 S'  149.211 
NH4 non-polymer         . 'AMMONIUM ION'  ?               'H4 N 1'         18.038  
PHE 'L-peptide linking' y PHENYLALANINE   ?               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?               'C5 H9 N O2'     115.130 
SEP 'L-peptide linking' n PHOSPHOSERINE   PHOSPHONOSERINE 'C3 H8 N O6 P'   185.072 
SER 'L-peptide linking' y SERINE          ?               'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ?               'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ?               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3D9M 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.39 
_exptl_crystal.density_percent_sol   48.60 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_details    '1.2M Li2SO4, 1.6M (NH4)2SO4, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2007-12-17 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9538 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9538 
# 
_reflns.entry_id                     3D9M 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            1.75 
_reflns.d_resolution_low             100 
_reflns.number_all                   ? 
_reflns.number_obs                   33333 
_reflns.percent_possible_obs         95.3 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.04 
_reflns.pdbx_netI_over_sigmaI        27.7 
_reflns.B_iso_Wilson_estimate        31.2 
_reflns.pdbx_redundancy              4.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.75 
_reflns_shell.d_res_low              1.8 
_reflns_shell.percent_possible_all   91.4 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.35 
_reflns_shell.meanI_over_sigI_obs    5.1 
_reflns_shell.pdbx_redundancy        4.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2588 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3D9M 
_refine.ls_number_reflns_obs                     32269 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.20 
_refine.ls_d_res_high                            1.75 
_refine.ls_percent_reflns_obs                    97.23 
_refine.ls_R_factor_obs                          0.18315 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.18183 
_refine.ls_R_factor_R_free                       0.20723 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1721 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.959 
_refine.correlation_coeff_Fo_to_Fc_free          0.945 
_refine.B_iso_mean                               30.311 
_refine.aniso_B[1][1]                            0.61 
_refine.aniso_B[2][2]                            0.61 
_refine.aniso_B[3][3]                            -1.21 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'Pdb entry 3D9J' 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.113 
_refine.pdbx_overall_ESU_R_Free                  0.106 
_refine.overall_SU_ML                            0.069 
_refine.overall_SU_B                             4.257 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2357 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         37 
_refine_hist.number_atoms_solvent             161 
_refine_hist.number_atoms_total               2555 
_refine_hist.d_res_high                       1.75 
_refine_hist.d_res_low                        19.20 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.011  0.022  ? 2512 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.129  1.978  ? 3410 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   4.310  5.000  ? 312  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   35.498 24.685 ? 111  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   11.943 15.031 ? 478  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   17.520 15.000 ? 11   'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.080  0.200  ? 371  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.005  0.020  ? 1841 'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.201  0.200  ? 1219 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.308  0.200  ? 1759 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.123  0.200  ? 124  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.200  0.200  ? 56   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.070  0.200  ? 11   'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.716  1.500  ? 1541 'X-RAY DIFFRACTION' ? 
r_mcangle_it             1.133  2.000  ? 2458 'X-RAY DIFFRACTION' ? 
r_scbond_it              2.044  3.000  ? 1091 'X-RAY DIFFRACTION' ? 
r_scangle_it             3.266  4.500  ? 939  'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.750 
_refine_ls_shell.d_res_low                        1.795 
_refine_ls_shell.number_reflns_R_work             2404 
_refine_ls_shell.R_factor_R_work                  0.246 
_refine_ls_shell.percent_reflns_obs               98.90 
_refine_ls_shell.R_factor_R_free                  0.334 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             122 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                2404 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3D9M 
_struct.title                     
;Snapshots of the RNA processing factor SCAF8 bound to different phosphorylated forms of the Carboxy-Terminal Domain of RNA-Polymerase II
;
_struct.pdbx_descriptor           'RNA-binding protein 16, CTD-PEPTIDE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3D9M 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            
'SCAF8, RNA POLYMERASE II CTD INTERACTING DOMAIN, ARM REPEATS, PHOSPHO-CTD, Phosphoprotein, RNA-binding, Transcription' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 3 ? 
K N N 4 ? 
L N N 4 ? 
M N N 4 ? 
N N N 5 ? 
O N N 5 ? 
P N N 5 ? 
Q N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU A 2   ? SER A 13  ? GLU A 2   SER A 13  1 ? 12 
HELX_P HELX_P2  2  LEU A 14  ? TYR A 17  ? LEU A 14  TYR A 17  5 ? 4  
HELX_P HELX_P3  3  SER A 22  ? ALA A 36  ? SER A 22  ALA A 36  1 ? 15 
HELX_P HELX_P4  4  PHE A 39  ? CYS A 54  ? PHE A 39  CYS A 54  1 ? 16 
HELX_P HELX_P5  5  LYS A 55  ? GLU A 57  ? LYS A 55  GLU A 57  5 ? 3  
HELX_P HELX_P6  6  TYR A 58  ? GLY A 78  ? TYR A 58  GLY A 78  1 ? 21 
HELX_P HELX_P7  7  VAL A 83  ? ASN A 90  ? VAL A 83  ASN A 90  1 ? 8  
HELX_P HELX_P8  8  ASN A 91  ? TYR A 100 ? ASN A 91  TYR A 100 1 ? 10 
HELX_P HELX_P9  9  ARG A 101 ? CYS A 102 ? ARG A 101 CYS A 102 5 ? 2  
HELX_P HELX_P10 10 PRO A 103 ? ASP A 105 ? PRO A 103 ASP A 105 5 ? 3  
HELX_P HELX_P11 11 ASP A 106 ? ASN A 120 ? ASP A 106 ASN A 120 1 ? 15 
HELX_P HELX_P12 12 LYS A 124 ? GLU A 139 ? LYS A 124 GLU A 139 1 ? 16 
HELX_P HELX_P13 13 MET B 1   ? SER B 13  ? MET B 1   SER B 13  1 ? 13 
HELX_P HELX_P14 14 LEU B 14  ? TYR B 17  ? LEU B 14  TYR B 17  5 ? 4  
HELX_P HELX_P15 15 SER B 22  ? ALA B 36  ? SER B 22  ALA B 36  1 ? 15 
HELX_P HELX_P16 16 PHE B 39  ? CYS B 54  ? PHE B 39  CYS B 54  1 ? 16 
HELX_P HELX_P17 17 LYS B 55  ? GLU B 57  ? LYS B 55  GLU B 57  5 ? 3  
HELX_P HELX_P18 18 TYR B 58  ? GLY B 78  ? TYR B 58  GLY B 78  1 ? 21 
HELX_P HELX_P19 19 VAL B 83  ? ASN B 90  ? VAL B 83  ASN B 90  1 ? 8  
HELX_P HELX_P20 20 ASN B 91  ? TYR B 100 ? ASN B 91  TYR B 100 1 ? 10 
HELX_P HELX_P21 21 ARG B 101 ? CYS B 102 ? ARG B 101 CYS B 102 5 ? 2  
HELX_P HELX_P22 22 PRO B 103 ? ASP B 105 ? PRO B 103 ASP B 105 5 ? 3  
HELX_P HELX_P23 23 ASP B 106 ? ASN B 120 ? ASP B 106 ASN B 120 1 ? 15 
HELX_P HELX_P24 24 LYS B 124 ? GLU B 139 ? LYS B 124 GLU B 139 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? D THR 11 C ? ? ? 1_555 D SEP 12 N ? ? Z THR 4 Z SEP 5 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale2 covale ? ? D SEP 12 C ? ? ? 1_555 D PRO 13 N ? ? Z SEP 5 Z PRO 6 1_555 ? ? ? ? ? ? ? 1.353 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 19 A . ? PRO 19 A PRO 20 A ? PRO 20 A 1 4.98 
2 PRO 19 B . ? PRO 19 B PRO 20 B ? PRO 20 B 1 3.70 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NH4 A 400' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NH4 B 401' 
AC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SO4 A 501' 
AC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SO4 A 503' 
AC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SO4 B 504' 
AC6 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 B 506' 
AC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 A 507' 
AC8 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 A 508' 
AC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 B 509' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 ILE A 37  ? ILE A 37  . ? 1_555 ? 
2  AC1 4 SER A 73  ? SER A 73  . ? 1_555 ? 
3  AC1 4 PHE A 77  ? PHE A 77  . ? 1_555 ? 
4  AC1 4 ASP A 82  ? ASP A 82  . ? 1_555 ? 
5  AC2 4 ILE B 37  ? ILE B 37  . ? 1_555 ? 
6  AC2 4 SER B 73  ? SER B 73  . ? 1_555 ? 
7  AC2 4 PHE B 77  ? PHE B 77  . ? 1_555 ? 
8  AC2 4 ASP B 82  ? ASP B 82  . ? 1_555 ? 
9  AC3 2 LYS A 41  ? LYS A 41  . ? 1_555 ? 
10 AC3 2 ARG A 87  ? ARG A 87  . ? 1_555 ? 
11 AC4 2 GLY A 78  ? GLY A 78  . ? 1_555 ? 
12 AC4 2 GLN A 79  ? GLN A 79  . ? 1_555 ? 
13 AC5 2 LYS B 41  ? LYS B 41  . ? 1_555 ? 
14 AC5 2 ARG B 87  ? ARG B 87  . ? 1_555 ? 
15 AC6 3 ARG B 71  ? ARG B 71  . ? 1_555 ? 
16 AC6 3 PRO D 13  ? PRO Z 6   . ? 1_555 ? 
17 AC6 3 SER D 14  ? SER Z 7   . ? 1_555 ? 
18 AC7 4 ARG A 71  ? ARG A 71  . ? 1_555 ? 
19 AC7 4 LEU A 116 ? LEU A 116 . ? 1_555 ? 
20 AC7 4 ASN A 120 ? ASN A 120 . ? 1_555 ? 
21 AC7 4 HIS B 140 ? HIS B 140 . ? 2_655 ? 
22 AC8 3 TYR A 40  ? TYR A 40  . ? 1_555 ? 
23 AC8 3 ARG A 87  ? ARG A 87  . ? 1_555 ? 
24 AC8 3 ASN A 90  ? ASN A 90  . ? 1_555 ? 
25 AC9 4 TYR B 40  ? TYR B 40  . ? 1_555 ? 
26 AC9 4 LYS B 41  ? LYS B 41  . ? 1_555 ? 
27 AC9 4 ARG B 87  ? ARG B 87  . ? 1_555 ? 
28 AC9 4 ASN B 90  ? ASN B 90  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3D9M 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3D9M 
_atom_sites.fract_transf_matrix[1][1]   0.017358 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017358 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009383 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 2   ? 56.875 6.514   -0.174  1.00 45.31 ? 2   GLU A N   1 
ATOM   2    C CA  . GLU A 1 2   ? 55.795 6.522   -1.211  1.00 44.80 ? 2   GLU A CA  1 
ATOM   3    C C   . GLU A 1 2   ? 54.488 5.902   -0.690  1.00 44.01 ? 2   GLU A C   1 
ATOM   4    O O   . GLU A 1 2   ? 53.417 6.500   -0.821  1.00 43.95 ? 2   GLU A O   1 
ATOM   5    C CB  . GLU A 1 2   ? 56.283 5.844   -2.505  1.00 45.27 ? 2   GLU A CB  1 
ATOM   6    C CG  . GLU A 1 2   ? 55.226 5.653   -3.607  1.00 46.23 ? 2   GLU A CG  1 
ATOM   7    C CD  . GLU A 1 2   ? 54.470 6.925   -3.966  1.00 48.55 ? 2   GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 2   ? 55.080 7.849   -4.550  1.00 49.61 ? 2   GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 2   ? 53.254 6.988   -3.676  1.00 49.87 ? 2   GLU A OE2 1 
ATOM   10   N N   . ALA A 1 3   ? 54.580 4.705   -0.107  1.00 43.11 ? 3   ALA A N   1 
ATOM   11   C CA  . ALA A 1 3   ? 53.435 4.077   0.561   1.00 41.98 ? 3   ALA A CA  1 
ATOM   12   C C   . ALA A 1 3   ? 53.004 4.889   1.777   1.00 41.14 ? 3   ALA A C   1 
ATOM   13   O O   . ALA A 1 3   ? 51.820 4.907   2.136   1.00 40.82 ? 3   ALA A O   1 
ATOM   14   C CB  . ALA A 1 3   ? 53.765 2.643   0.965   1.00 42.10 ? 3   ALA A CB  1 
ATOM   15   N N   . VAL A 1 4   ? 53.973 5.564   2.396   1.00 40.00 ? 4   VAL A N   1 
ATOM   16   C CA  . VAL A 1 4   ? 53.718 6.398   3.573   1.00 39.04 ? 4   VAL A CA  1 
ATOM   17   C C   . VAL A 1 4   ? 53.002 7.685   3.169   1.00 37.63 ? 4   VAL A C   1 
ATOM   18   O O   . VAL A 1 4   ? 52.077 8.124   3.846   1.00 37.18 ? 4   VAL A O   1 
ATOM   19   C CB  . VAL A 1 4   ? 55.013 6.674   4.369   1.00 39.22 ? 4   VAL A CB  1 
ATOM   20   C CG1 . VAL A 1 4   ? 54.741 7.563   5.586   1.00 39.83 ? 4   VAL A CG1 1 
ATOM   21   C CG2 . VAL A 1 4   ? 55.615 5.350   4.828   1.00 39.73 ? 4   VAL A CG2 1 
ATOM   22   N N   . LYS A 1 5   ? 53.408 8.264   2.042   1.00 36.39 ? 5   LYS A N   1 
ATOM   23   C CA  . LYS A 1 5   ? 52.696 9.403   1.465   1.00 34.97 ? 5   LYS A CA  1 
ATOM   24   C C   . LYS A 1 5   ? 51.215 9.084   1.223   1.00 33.97 ? 5   LYS A C   1 
ATOM   25   O O   . LYS A 1 5   ? 50.346 9.896   1.547   1.00 33.87 ? 5   LYS A O   1 
ATOM   26   C CB  . LYS A 1 5   ? 53.383 9.862   0.176   1.00 35.27 ? 5   LYS A CB  1 
ATOM   27   C CG  . LYS A 1 5   ? 54.766 10.450  0.424   1.00 36.56 ? 5   LYS A CG  1 
ATOM   28   C CD  . LYS A 1 5   ? 55.568 10.584  -0.862  1.00 38.78 ? 5   LYS A CD  1 
ATOM   29   C CE  . LYS A 1 5   ? 56.995 11.004  -0.556  1.00 39.94 ? 5   LYS A CE  1 
ATOM   30   N NZ  . LYS A 1 5   ? 57.773 11.239  -1.799  1.00 40.43 ? 5   LYS A NZ  1 
ATOM   31   N N   . THR A 1 6   ? 50.933 7.898   0.688   1.00 32.38 ? 6   THR A N   1 
ATOM   32   C CA  . THR A 1 6   ? 49.562 7.484   0.389   1.00 31.64 ? 6   THR A CA  1 
ATOM   33   C C   . THR A 1 6   ? 48.763 7.280   1.669   1.00 31.02 ? 6   THR A C   1 
ATOM   34   O O   . THR A 1 6   ? 47.602 7.683   1.757   1.00 31.06 ? 6   THR A O   1 
ATOM   35   C CB  . THR A 1 6   ? 49.542 6.196   -0.446  1.00 32.06 ? 6   THR A CB  1 
ATOM   36   O OG1 . THR A 1 6   ? 50.238 6.438   -1.667  1.00 33.01 ? 6   THR A OG1 1 
ATOM   37   C CG2 . THR A 1 6   ? 48.108 5.761   -0.781  1.00 32.54 ? 6   THR A CG2 1 
ATOM   38   N N   . PHE A 1 7   ? 49.398 6.654   2.653   1.00 29.76 ? 7   PHE A N   1 
ATOM   39   C CA  . PHE A 1 7   ? 48.752 6.455   3.938   1.00 28.35 ? 7   PHE A CA  1 
ATOM   40   C C   . PHE A 1 7   ? 48.469 7.808   4.622   1.00 28.29 ? 7   PHE A C   1 
ATOM   41   O O   . PHE A 1 7   ? 47.362 8.041   5.115   1.00 26.81 ? 7   PHE A O   1 
ATOM   42   C CB  . PHE A 1 7   ? 49.576 5.569   4.866   1.00 29.01 ? 7   PHE A CB  1 
ATOM   43   C CG  . PHE A 1 7   ? 49.037 5.554   6.255   1.00 27.47 ? 7   PHE A CG  1 
ATOM   44   C CD1 . PHE A 1 7   ? 47.915 4.779   6.572   1.00 24.44 ? 7   PHE A CD1 1 
ATOM   45   C CD2 . PHE A 1 7   ? 49.592 6.382   7.231   1.00 27.94 ? 7   PHE A CD2 1 
ATOM   46   C CE1 . PHE A 1 7   ? 47.365 4.814   7.880   1.00 24.31 ? 7   PHE A CE1 1 
ATOM   47   C CE2 . PHE A 1 7   ? 49.068 6.401   8.519   1.00 27.18 ? 7   PHE A CE2 1 
ATOM   48   C CZ  . PHE A 1 7   ? 47.949 5.621   8.836   1.00 25.81 ? 7   PHE A CZ  1 
ATOM   49   N N   . ASN A 1 8   ? 49.467 8.692   4.642   1.00 28.27 ? 8   ASN A N   1 
ATOM   50   C CA  . ASN A 1 8   ? 49.300 10.014  5.241   1.00 28.88 ? 8   ASN A CA  1 
ATOM   51   C C   . ASN A 1 8   ? 48.155 10.770  4.589   1.00 28.97 ? 8   ASN A C   1 
ATOM   52   O O   . ASN A 1 8   ? 47.383 11.429  5.287   1.00 28.86 ? 8   ASN A O   1 
ATOM   53   C CB  . ASN A 1 8   ? 50.573 10.853  5.123   1.00 29.57 ? 8   ASN A CB  1 
ATOM   54   C CG  . ASN A 1 8   ? 51.684 10.353  6.012   1.00 31.01 ? 8   ASN A CG  1 
ATOM   55   O OD1 . ASN A 1 8   ? 51.449 9.615   6.967   1.00 33.31 ? 8   ASN A OD1 1 
ATOM   56   N ND2 . ASN A 1 8   ? 52.913 10.739  5.691   1.00 34.03 ? 8   ASN A ND2 1 
ATOM   57   N N   . SER A 1 9   ? 48.049 10.653  3.265   1.00 28.78 ? 9   SER A N   1 
ATOM   58   C CA  A SER A 1 9   ? 47.000 11.359  2.529   0.50 29.23 ? 9   SER A CA  1 
ATOM   59   C CA  B SER A 1 9   ? 46.998 11.337  2.505   0.50 28.93 ? 9   SER A CA  1 
ATOM   60   C C   . SER A 1 9   ? 45.614 10.840  2.916   1.00 29.03 ? 9   SER A C   1 
ATOM   61   O O   . SER A 1 9   ? 44.691 11.650  3.124   1.00 28.65 ? 9   SER A O   1 
ATOM   62   C CB  A SER A 1 9   ? 47.224 11.298  1.013   0.50 29.29 ? 9   SER A CB  1 
ATOM   63   C CB  B SER A 1 9   ? 47.206 11.166  0.995   0.50 28.88 ? 9   SER A CB  1 
ATOM   64   O OG  A SER A 1 9   ? 47.139 9.976   0.524   0.50 31.10 ? 9   SER A OG  1 
ATOM   65   O OG  B SER A 1 9   ? 48.186 12.068  0.506   0.50 28.97 ? 9   SER A OG  1 
ATOM   66   N N   . GLU A 1 10  ? 45.482 9.511   3.036   1.00 28.61 ? 10  GLU A N   1 
ATOM   67   C CA  . GLU A 1 10  ? 44.232 8.877   3.491   1.00 29.15 ? 10  GLU A CA  1 
ATOM   68   C C   . GLU A 1 10  ? 43.894 9.292   4.913   1.00 28.13 ? 10  GLU A C   1 
ATOM   69   O O   . GLU A 1 10  ? 42.744 9.634   5.222   1.00 27.24 ? 10  GLU A O   1 
ATOM   70   C CB  . GLU A 1 10  ? 44.292 7.342   3.431   1.00 29.69 ? 10  GLU A CB  1 
ATOM   71   C CG  . GLU A 1 10  ? 43.974 6.739   2.075   1.00 34.93 ? 10  GLU A CG  1 
ATOM   72   C CD  . GLU A 1 10  ? 42.715 7.330   1.448   1.00 39.43 ? 10  GLU A CD  1 
ATOM   73   O OE1 . GLU A 1 10  ? 41.589 7.087   1.955   1.00 41.27 ? 10  GLU A OE1 1 
ATOM   74   O OE2 . GLU A 1 10  ? 42.858 8.056   0.445   1.00 43.19 ? 10  GLU A OE2 1 
ATOM   75   N N   . LEU A 1 11  ? 44.903 9.270   5.778   1.00 26.82 ? 11  LEU A N   1 
ATOM   76   C CA  . LEU A 1 11  ? 44.681 9.568   7.179   1.00 27.03 ? 11  LEU A CA  1 
ATOM   77   C C   . LEU A 1 11  ? 44.212 11.010  7.367   1.00 27.18 ? 11  LEU A C   1 
ATOM   78   O O   . LEU A 1 11  ? 43.242 11.275  8.079   1.00 27.40 ? 11  LEU A O   1 
ATOM   79   C CB  . LEU A 1 11  ? 45.967 9.329   7.982   1.00 26.49 ? 11  LEU A CB  1 
ATOM   80   C CG  . LEU A 1 11  ? 45.899 9.720   9.452   1.00 27.66 ? 11  LEU A CG  1 
ATOM   81   C CD1 . LEU A 1 11  ? 44.869 8.861   10.200  1.00 28.42 ? 11  LEU A CD1 1 
ATOM   82   C CD2 . LEU A 1 11  ? 47.273 9.611   10.098  1.00 27.05 ? 11  LEU A CD2 1 
ATOM   83   N N   . TYR A 1 12  ? 44.926 11.949  6.752   1.00 27.30 ? 12  TYR A N   1 
ATOM   84   C CA  . TYR A 1 12  ? 44.600 13.348  6.909   1.00 27.70 ? 12  TYR A CA  1 
ATOM   85   C C   . TYR A 1 12  ? 43.316 13.738  6.171   1.00 26.78 ? 12  TYR A C   1 
ATOM   86   O O   . TYR A 1 12  ? 42.729 14.776  6.480   1.00 27.77 ? 12  TYR A O   1 
ATOM   87   C CB  . TYR A 1 12  ? 45.793 14.226  6.538   1.00 29.12 ? 12  TYR A CB  1 
ATOM   88   C CG  . TYR A 1 12  ? 46.768 14.295  7.693   1.00 30.31 ? 12  TYR A CG  1 
ATOM   89   C CD1 . TYR A 1 12  ? 46.685 15.334  8.617   1.00 32.35 ? 12  TYR A CD1 1 
ATOM   90   C CD2 . TYR A 1 12  ? 47.734 13.297  7.898   1.00 32.13 ? 12  TYR A CD2 1 
ATOM   91   C CE1 . TYR A 1 12  ? 47.546 15.411  9.692   1.00 32.70 ? 12  TYR A CE1 1 
ATOM   92   C CE2 . TYR A 1 12  ? 48.613 13.365  8.992   1.00 32.30 ? 12  TYR A CE2 1 
ATOM   93   C CZ  . TYR A 1 12  ? 48.503 14.438  9.879   1.00 32.63 ? 12  TYR A CZ  1 
ATOM   94   O OH  . TYR A 1 12  ? 49.331 14.575  10.970  1.00 33.03 ? 12  TYR A OH  1 
ATOM   95   N N   . SER A 1 13  ? 42.870 12.889  5.239   1.00 25.85 ? 13  SER A N   1 
ATOM   96   C CA  A SER A 1 13  ? 41.601 13.136  4.546   0.50 26.14 ? 13  SER A CA  1 
ATOM   97   C CA  B SER A 1 13  ? 41.594 13.107  4.536   0.50 25.42 ? 13  SER A CA  1 
ATOM   98   C C   . SER A 1 13  ? 40.412 13.096  5.513   1.00 25.53 ? 13  SER A C   1 
ATOM   99   O O   . SER A 1 13  ? 39.313 13.570  5.184   1.00 25.36 ? 13  SER A O   1 
ATOM   100  C CB  A SER A 1 13  ? 41.393 12.146  3.401   0.50 25.84 ? 13  SER A CB  1 
ATOM   101  C CB  B SER A 1 13  ? 41.384 12.075  3.411   0.50 24.94 ? 13  SER A CB  1 
ATOM   102  O OG  A SER A 1 13  ? 40.435 12.657  2.496   0.50 27.21 ? 13  SER A OG  1 
ATOM   103  O OG  B SER A 1 13  ? 40.895 10.832  3.895   0.50 21.97 ? 13  SER A OG  1 
ATOM   104  N N   . LEU A 1 14  ? 40.639 12.536  6.700   1.00 26.03 ? 14  LEU A N   1 
ATOM   105  C CA  . LEU A 1 14  ? 39.632 12.517  7.762   1.00 25.91 ? 14  LEU A CA  1 
ATOM   106  C C   . LEU A 1 14  ? 39.065 13.911  8.019   1.00 26.28 ? 14  LEU A C   1 
ATOM   107  O O   . LEU A 1 14  ? 37.897 14.053  8.376   1.00 25.54 ? 14  LEU A O   1 
ATOM   108  C CB  . LEU A 1 14  ? 40.187 11.925  9.049   1.00 25.95 ? 14  LEU A CB  1 
ATOM   109  C CG  . LEU A 1 14  ? 40.411 10.402  9.071   1.00 25.36 ? 14  LEU A CG  1 
ATOM   110  C CD1 . LEU A 1 14  ? 41.045 9.989   10.392  1.00 28.76 ? 14  LEU A CD1 1 
ATOM   111  C CD2 . LEU A 1 14  ? 39.085 9.696   8.847   1.00 28.82 ? 14  LEU A CD2 1 
ATOM   112  N N   . ASN A 1 15  ? 39.896 14.931  7.798   1.00 26.88 ? 15  ASN A N   1 
ATOM   113  C CA  . ASN A 1 15  ? 39.533 16.325  8.059   1.00 27.50 ? 15  ASN A CA  1 
ATOM   114  C C   . ASN A 1 15  ? 38.479 16.899  7.106   1.00 26.94 ? 15  ASN A C   1 
ATOM   115  O O   . ASN A 1 15  ? 37.972 17.999  7.333   1.00 26.39 ? 15  ASN A O   1 
ATOM   116  C CB  . ASN A 1 15  ? 40.791 17.205  8.076   1.00 28.42 ? 15  ASN A CB  1 
ATOM   117  C CG  . ASN A 1 15  ? 41.655 16.950  9.297   1.00 31.69 ? 15  ASN A CG  1 
ATOM   118  O OD1 . ASN A 1 15  ? 41.225 17.190  10.424  1.00 38.47 ? 15  ASN A OD1 1 
ATOM   119  N ND2 . ASN A 1 15  ? 42.871 16.452  9.085   1.00 34.83 ? 15  ASN A ND2 1 
ATOM   120  N N   . ASP A 1 16  ? 38.157 16.150  6.051   1.00 26.65 ? 16  ASP A N   1 
ATOM   121  C CA  . ASP A 1 16  ? 37.131 16.558  5.087   1.00 26.68 ? 16  ASP A CA  1 
ATOM   122  C C   . ASP A 1 16  ? 35.716 16.143  5.511   1.00 25.68 ? 16  ASP A C   1 
ATOM   123  O O   . ASP A 1 16  ? 34.722 16.520  4.869   1.00 24.93 ? 16  ASP A O   1 
ATOM   124  C CB  . ASP A 1 16  ? 37.437 15.954  3.713   1.00 27.66 ? 16  ASP A CB  1 
ATOM   125  C CG  . ASP A 1 16  ? 38.625 16.609  3.024   1.00 30.58 ? 16  ASP A CG  1 
ATOM   126  O OD1 . ASP A 1 16  ? 38.805 17.841  3.133   1.00 34.05 ? 16  ASP A OD1 1 
ATOM   127  O OD2 . ASP A 1 16  ? 39.374 15.879  2.345   1.00 35.49 ? 16  ASP A OD2 1 
ATOM   128  N N   . TYR A 1 17  ? 35.633 15.385  6.600   1.00 25.22 ? 17  TYR A N   1 
ATOM   129  C CA  . TYR A 1 17  ? 34.412 14.685  6.998   1.00 25.48 ? 17  TYR A CA  1 
ATOM   130  C C   . TYR A 1 17  ? 33.981 15.010  8.408   1.00 25.33 ? 17  TYR A C   1 
ATOM   131  O O   . TYR A 1 17  ? 34.825 15.193  9.283   1.00 25.79 ? 17  TYR A O   1 
ATOM   132  C CB  . TYR A 1 17  ? 34.615 13.158  6.873   1.00 25.44 ? 17  TYR A CB  1 
ATOM   133  C CG  . TYR A 1 17  ? 34.986 12.776  5.469   1.00 26.06 ? 17  TYR A CG  1 
ATOM   134  C CD1 . TYR A 1 17  ? 34.025 12.763  4.472   1.00 24.98 ? 17  TYR A CD1 1 
ATOM   135  C CD2 . TYR A 1 17  ? 36.306 12.453  5.131   1.00 27.06 ? 17  TYR A CD2 1 
ATOM   136  C CE1 . TYR A 1 17  ? 34.344 12.464  3.163   1.00 26.68 ? 17  TYR A CE1 1 
ATOM   137  C CE2 . TYR A 1 17  ? 36.641 12.141  3.811   1.00 26.65 ? 17  TYR A CE2 1 
ATOM   138  C CZ  . TYR A 1 17  ? 35.646 12.139  2.845   1.00 27.56 ? 17  TYR A CZ  1 
ATOM   139  O OH  . TYR A 1 17  ? 35.914 11.848  1.531   1.00 29.60 ? 17  TYR A OH  1 
ATOM   140  N N   . LYS A 1 18  ? 32.668 15.088  8.618   1.00 25.54 ? 18  LYS A N   1 
ATOM   141  C CA  . LYS A 1 18  ? 32.106 15.115  9.966   1.00 26.40 ? 18  LYS A CA  1 
ATOM   142  C C   . LYS A 1 18  ? 31.950 13.681  10.506  1.00 26.33 ? 18  LYS A C   1 
ATOM   143  O O   . LYS A 1 18  ? 31.244 12.863  9.910   1.00 26.07 ? 18  LYS A O   1 
ATOM   144  C CB  . LYS A 1 18  ? 30.757 15.856  9.986   1.00 27.19 ? 18  LYS A CB  1 
ATOM   145  C CG  . LYS A 1 18  ? 29.997 15.668  11.288  1.00 29.68 ? 18  LYS A CG  1 
ATOM   146  C CD  . LYS A 1 18  ? 29.181 16.869  11.660  1.00 31.95 ? 18  LYS A CD  1 
ATOM   147  C CE  . LYS A 1 18  ? 28.862 16.840  13.144  1.00 33.33 ? 18  LYS A CE  1 
ATOM   148  N NZ  . LYS A 1 18  ? 27.815 17.851  13.459  1.00 35.10 ? 18  LYS A NZ  1 
ATOM   149  N N   . PRO A 1 19  ? 32.596 13.371  11.649  1.00 26.38 ? 19  PRO A N   1 
ATOM   150  C CA  . PRO A 1 19  ? 32.427 12.048  12.259  1.00 26.85 ? 19  PRO A CA  1 
ATOM   151  C C   . PRO A 1 19  ? 30.972 11.786  12.670  1.00 27.65 ? 19  PRO A C   1 
ATOM   152  O O   . PRO A 1 19  ? 30.233 12.739  12.914  1.00 27.62 ? 19  PRO A O   1 
ATOM   153  C CB  . PRO A 1 19  ? 33.301 12.131  13.517  1.00 26.40 ? 19  PRO A CB  1 
ATOM   154  C CG  . PRO A 1 19  ? 34.261 13.230  13.249  1.00 27.12 ? 19  PRO A CG  1 
ATOM   155  C CD  . PRO A 1 19  ? 33.519 14.221  12.426  1.00 26.13 ? 19  PRO A CD  1 
ATOM   156  N N   . PRO A 1 20  ? 30.565 10.507  12.779  1.00 28.50 ? 20  PRO A N   1 
ATOM   157  C CA  . PRO A 1 20  ? 31.375 9.288   12.648  1.00 29.34 ? 20  PRO A CA  1 
ATOM   158  C C   . PRO A 1 20  ? 31.884 9.056   11.227  1.00 28.95 ? 20  PRO A C   1 
ATOM   159  O O   . PRO A 1 20  ? 31.184 9.380   10.253  1.00 29.59 ? 20  PRO A O   1 
ATOM   160  C CB  . PRO A 1 20  ? 30.401 8.174   13.049  1.00 29.81 ? 20  PRO A CB  1 
ATOM   161  C CG  . PRO A 1 20  ? 29.084 8.706   12.800  1.00 30.84 ? 20  PRO A CG  1 
ATOM   162  C CD  . PRO A 1 20  ? 29.157 10.191  13.074  1.00 29.55 ? 20  PRO A CD  1 
ATOM   163  N N   . ILE A 1 21  ? 33.097 8.513   11.139  1.00 29.07 ? 21  ILE A N   1 
ATOM   164  C CA  . ILE A 1 21  ? 33.744 8.199   9.868   1.00 28.76 ? 21  ILE A CA  1 
ATOM   165  C C   . ILE A 1 21  ? 33.135 6.931   9.251   1.00 28.57 ? 21  ILE A C   1 
ATOM   166  O O   . ILE A 1 21  ? 32.855 5.972   9.962   1.00 28.76 ? 21  ILE A O   1 
ATOM   167  C CB  . ILE A 1 21  ? 35.271 8.077   10.046  1.00 29.23 ? 21  ILE A CB  1 
ATOM   168  C CG1 . ILE A 1 21  ? 35.863 9.375   10.653  1.00 29.45 ? 21  ILE A CG1 1 
ATOM   169  C CG2 . ILE A 1 21  ? 35.976 7.670   8.737   1.00 29.71 ? 21  ILE A CG2 1 
ATOM   170  C CD1 . ILE A 1 21  ? 35.611 10.630  9.828   1.00 28.94 ? 21  ILE A CD1 1 
ATOM   171  N N   . SER A 1 22  ? 32.931 6.955   7.934   1.00 27.39 ? 22  SER A N   1 
ATOM   172  C CA  . SER A 1 22  ? 32.394 5.804   7.190   1.00 26.87 ? 22  SER A CA  1 
ATOM   173  C C   . SER A 1 22  ? 33.294 4.570   7.306   1.00 26.67 ? 22  SER A C   1 
ATOM   174  O O   . SER A 1 22  ? 34.511 4.677   7.486   1.00 25.97 ? 22  SER A O   1 
ATOM   175  C CB  . SER A 1 22  ? 32.181 6.145   5.716   1.00 27.47 ? 22  SER A CB  1 
ATOM   176  O OG  . SER A 1 22  ? 33.398 6.192   4.997   1.00 27.23 ? 22  SER A OG  1 
ATOM   177  N N   . LYS A 1 23  ? 32.672 3.400   7.198   1.00 27.37 ? 23  LYS A N   1 
ATOM   178  C CA  . LYS A 1 23  ? 33.404 2.129   7.212   1.00 28.30 ? 23  LYS A CA  1 
ATOM   179  C C   . LYS A 1 23  ? 34.396 2.098   6.055   1.00 27.24 ? 23  LYS A C   1 
ATOM   180  O O   . LYS A 1 23  ? 35.550 1.711   6.228   1.00 27.14 ? 23  LYS A O   1 
ATOM   181  C CB  . LYS A 1 23  ? 32.420 0.957   7.107   1.00 29.19 ? 23  LYS A CB  1 
ATOM   182  C CG  . LYS A 1 23  ? 31.547 0.757   8.359   1.00 30.74 ? 23  LYS A CG  1 
ATOM   183  C CD  . LYS A 1 23  ? 30.413 -0.237  8.119   1.00 32.37 ? 23  LYS A CD  1 
ATOM   184  C CE  . LYS A 1 23  ? 29.614 -0.472  9.406   1.00 36.05 ? 23  LYS A CE  1 
ATOM   185  N NZ  . LYS A 1 23  ? 28.714 -1.659  9.283   1.00 38.65 ? 23  LYS A NZ  1 
ATOM   186  N N   . ALA A 1 24  ? 33.945 2.560   4.891   1.00 27.05 ? 24  ALA A N   1 
ATOM   187  C CA  . ALA A 1 24  ? 34.759 2.542   3.682   1.00 26.55 ? 24  ALA A CA  1 
ATOM   188  C C   . ALA A 1 24  ? 36.019 3.373   3.842   1.00 26.18 ? 24  ALA A C   1 
ATOM   189  O O   . ALA A 1 24  ? 37.091 2.951   3.412   1.00 25.93 ? 24  ALA A O   1 
ATOM   190  C CB  . ALA A 1 24  ? 33.950 3.003   2.473   1.00 26.86 ? 24  ALA A CB  1 
ATOM   191  N N   . LYS A 1 25  ? 35.897 4.550   4.457   1.00 25.74 ? 25  LYS A N   1 
ATOM   192  C CA  . LYS A 1 25  ? 37.064 5.408   4.649   1.00 26.22 ? 25  LYS A CA  1 
ATOM   193  C C   . LYS A 1 25  ? 38.028 4.754   5.649   1.00 25.78 ? 25  LYS A C   1 
ATOM   194  O O   . LYS A 1 25  ? 39.248 4.761   5.454   1.00 24.81 ? 25  LYS A O   1 
ATOM   195  C CB  . LYS A 1 25  ? 36.664 6.839   5.062   1.00 26.53 ? 25  LYS A CB  1 
ATOM   196  C CG  . LYS A 1 25  ? 37.859 7.732   5.507   1.00 28.20 ? 25  LYS A CG  1 
ATOM   197  C CD  . LYS A 1 25  ? 38.883 7.952   4.384   1.00 30.45 ? 25  LYS A CD  1 
ATOM   198  C CE  . LYS A 1 25  ? 38.323 8.805   3.255   1.00 31.30 ? 25  LYS A CE  1 
ATOM   199  N NZ  . LYS A 1 25  ? 39.349 9.128   2.213   1.00 29.79 ? 25  LYS A NZ  1 
ATOM   200  N N   . MET A 1 26  ? 37.485 4.176   6.718   1.00 25.86 ? 26  MET A N   1 
ATOM   201  C CA  A MET A 1 26  ? 38.320 3.484   7.701   0.50 26.65 ? 26  MET A CA  1 
ATOM   202  C CA  B MET A 1 26  ? 38.318 3.486   7.694   0.50 26.52 ? 26  MET A CA  1 
ATOM   203  C C   . MET A 1 26  ? 39.038 2.300   7.057   1.00 26.64 ? 26  MET A C   1 
ATOM   204  O O   . MET A 1 26  ? 40.219 2.082   7.319   1.00 26.50 ? 26  MET A O   1 
ATOM   205  C CB  A MET A 1 26  ? 37.500 3.031   8.913   0.50 26.92 ? 26  MET A CB  1 
ATOM   206  C CB  B MET A 1 26  ? 37.481 3.070   8.900   0.50 26.80 ? 26  MET A CB  1 
ATOM   207  C CG  A MET A 1 26  ? 38.346 2.702   10.141  0.50 28.99 ? 26  MET A CG  1 
ATOM   208  C CG  B MET A 1 26  ? 37.009 4.273   9.715   0.50 27.96 ? 26  MET A CG  1 
ATOM   209  S SD  A MET A 1 26  ? 39.395 4.060   10.740  0.50 32.00 ? 26  MET A SD  1 
ATOM   210  S SD  B MET A 1 26  ? 38.369 5.190   10.481  0.50 32.62 ? 26  MET A SD  1 
ATOM   211  C CE  A MET A 1 26  ? 38.193 5.138   11.502  0.50 32.40 ? 26  MET A CE  1 
ATOM   212  C CE  B MET A 1 26  ? 39.072 3.912   11.492  0.50 32.52 ? 26  MET A CE  1 
ATOM   213  N N   . THR A 1 27  ? 38.325 1.570   6.206   1.00 26.86 ? 27  THR A N   1 
ATOM   214  C CA  . THR A 1 27  ? 38.901 0.442   5.463   1.00 27.73 ? 27  THR A CA  1 
ATOM   215  C C   . THR A 1 27  ? 40.044 0.913   4.562   1.00 27.71 ? 27  THR A C   1 
ATOM   216  O O   . THR A 1 27  ? 41.097 0.287   4.541   1.00 28.23 ? 27  THR A O   1 
ATOM   217  C CB  . THR A 1 27  ? 37.832 -0.321  4.672   1.00 28.35 ? 27  THR A CB  1 
ATOM   218  O OG1 . THR A 1 27  ? 36.892 -0.891  5.588   1.00 30.22 ? 27  THR A OG1 1 
ATOM   219  C CG2 . THR A 1 27  ? 38.451 -1.432  3.799   1.00 27.99 ? 27  THR A CG2 1 
ATOM   220  N N   . GLN A 1 28  ? 39.853 2.022   3.842   1.00 27.55 ? 28  GLN A N   1 
ATOM   221  C CA  . GLN A 1 28  ? 40.923 2.552   2.971   1.00 27.59 ? 28  GLN A CA  1 
ATOM   222  C C   . GLN A 1 28  ? 42.185 2.946   3.765   1.00 26.48 ? 28  GLN A C   1 
ATOM   223  O O   . GLN A 1 28  ? 43.318 2.663   3.344   1.00 26.03 ? 28  GLN A O   1 
ATOM   224  C CB  . GLN A 1 28  ? 40.422 3.727   2.116   1.00 28.29 ? 28  GLN A CB  1 
ATOM   225  C CG  . GLN A 1 28  ? 39.522 3.293   0.962   1.00 33.67 ? 28  GLN A CG  1 
ATOM   226  C CD  . GLN A 1 28  ? 40.085 2.101   0.175   1.00 39.64 ? 28  GLN A CD  1 
ATOM   227  O OE1 . GLN A 1 28  ? 41.131 2.207   -0.470  1.00 44.02 ? 28  GLN A OE1 1 
ATOM   228  N NE2 . GLN A 1 28  ? 39.393 0.957   0.238   1.00 41.76 ? 28  GLN A NE2 1 
ATOM   229  N N   . ILE A 1 29  ? 41.981 3.606   4.906   1.00 25.67 ? 29  ILE A N   1 
ATOM   230  C CA  . ILE A 1 29  ? 43.087 3.977   5.769   1.00 25.93 ? 29  ILE A CA  1 
ATOM   231  C C   . ILE A 1 29  ? 43.832 2.724   6.265   1.00 25.28 ? 29  ILE A C   1 
ATOM   232  O O   . ILE A 1 29  ? 45.062 2.680   6.258   1.00 26.31 ? 29  ILE A O   1 
ATOM   233  C CB  . ILE A 1 29  ? 42.600 4.832   6.961   1.00 25.02 ? 29  ILE A CB  1 
ATOM   234  C CG1 . ILE A 1 29  ? 42.115 6.217   6.454   1.00 25.74 ? 29  ILE A CG1 1 
ATOM   235  C CG2 . ILE A 1 29  ? 43.698 4.969   8.019   1.00 26.47 ? 29  ILE A CG2 1 
ATOM   236  C CD1 . ILE A 1 29  ? 41.277 7.013   7.492   1.00 27.66 ? 29  ILE A CD1 1 
ATOM   237  N N   . THR A 1 30  ? 43.073 1.720   6.685   1.00 25.88 ? 30  THR A N   1 
ATOM   238  C CA  . THR A 1 30  ? 43.646 0.498   7.258   1.00 26.45 ? 30  THR A CA  1 
ATOM   239  C C   . THR A 1 30  ? 44.424 -0.257  6.186   1.00 26.57 ? 30  THR A C   1 
ATOM   240  O O   . THR A 1 30  ? 45.549 -0.682  6.428   1.00 26.25 ? 30  THR A O   1 
ATOM   241  C CB  . THR A 1 30  ? 42.553 -0.391  7.851   1.00 27.19 ? 30  THR A CB  1 
ATOM   242  O OG1 . THR A 1 30  ? 41.879 0.342   8.869   1.00 28.48 ? 30  THR A OG1 1 
ATOM   243  C CG2 . THR A 1 30  ? 43.134 -1.666  8.480   1.00 27.85 ? 30  THR A CG2 1 
ATOM   244  N N   . LYS A 1 31  ? 43.819 -0.404  5.012   1.00 27.45 ? 31  LYS A N   1 
ATOM   245  C CA  . LYS A 1 31  ? 44.494 -1.091  3.900   1.00 27.95 ? 31  LYS A CA  1 
ATOM   246  C C   . LYS A 1 31  ? 45.812 -0.408  3.533   1.00 27.50 ? 31  LYS A C   1 
ATOM   247  O O   . LYS A 1 31  ? 46.801 -1.093  3.259   1.00 27.53 ? 31  LYS A O   1 
ATOM   248  C CB  . LYS A 1 31  ? 43.564 -1.195  2.691   1.00 28.63 ? 31  LYS A CB  1 
ATOM   249  C CG  . LYS A 1 31  ? 42.438 -2.198  2.929   1.00 31.08 ? 31  LYS A CG  1 
ATOM   250  C CD  . LYS A 1 31  ? 41.658 -2.494  1.641   1.00 35.91 ? 31  LYS A CD  1 
ATOM   251  C CE  . LYS A 1 31  ? 40.770 -3.721  1.814   1.00 39.04 ? 31  LYS A CE  1 
ATOM   252  N NZ  . LYS A 1 31  ? 41.520 -4.993  1.591   1.00 42.82 ? 31  LYS A NZ  1 
ATOM   253  N N   . ALA A 1 32  ? 45.828 0.931   3.539   1.00 27.04 ? 32  ALA A N   1 
ATOM   254  C CA  . ALA A 1 32  ? 47.037 1.717   3.232   1.00 26.59 ? 32  ALA A CA  1 
ATOM   255  C C   . ALA A 1 32  ? 48.123 1.512   4.297   1.00 26.52 ? 32  ALA A C   1 
ATOM   256  O O   . ALA A 1 32  ? 49.303 1.453   3.959   1.00 25.81 ? 32  ALA A O   1 
ATOM   257  C CB  . ALA A 1 32  ? 46.720 3.189   3.065   1.00 26.48 ? 32  ALA A CB  1 
ATOM   258  N N   . ALA A 1 33  ? 47.708 1.425   5.560   1.00 25.90 ? 33  ALA A N   1 
ATOM   259  C CA  . ALA A 1 33  ? 48.625 1.123   6.667   1.00 25.87 ? 33  ALA A CA  1 
ATOM   260  C C   . ALA A 1 33  ? 49.274 -0.268  6.487   1.00 26.04 ? 33  ALA A C   1 
ATOM   261  O O   . ALA A 1 33  ? 50.494 -0.408  6.569   1.00 26.22 ? 33  ALA A O   1 
ATOM   262  C CB  . ALA A 1 33  ? 47.884 1.196   7.986   1.00 26.46 ? 33  ALA A CB  1 
ATOM   263  N N   . ILE A 1 34  ? 48.428 -1.271  6.251   1.00 26.47 ? 34  ILE A N   1 
ATOM   264  C CA  . ILE A 1 34  ? 48.850 -2.670  6.097   1.00 26.79 ? 34  ILE A CA  1 
ATOM   265  C C   . ILE A 1 34  ? 49.760 -2.843  4.882   1.00 26.94 ? 34  ILE A C   1 
ATOM   266  O O   . ILE A 1 34  ? 50.791 -3.529  4.969   1.00 27.25 ? 34  ILE A O   1 
ATOM   267  C CB  . ILE A 1 34  ? 47.610 -3.645  6.034   1.00 26.82 ? 34  ILE A CB  1 
ATOM   268  C CG1 . ILE A 1 34  ? 46.730 -3.549  7.298   1.00 29.78 ? 34  ILE A CG1 1 
ATOM   269  C CG2 . ILE A 1 34  ? 48.055 -5.092  5.753   1.00 26.93 ? 34  ILE A CG2 1 
ATOM   270  C CD1 . ILE A 1 34  ? 47.402 -3.855  8.565   1.00 32.16 ? 34  ILE A CD1 1 
ATOM   271  N N   . LYS A 1 35  ? 49.397 -2.224  3.753   1.00 27.20 ? 35  LYS A N   1 
ATOM   272  C CA  . LYS A 1 35  ? 50.227 -2.273  2.544   1.00 28.56 ? 35  LYS A CA  1 
ATOM   273  C C   . LYS A 1 35  ? 51.646 -1.769  2.848   1.00 27.73 ? 35  LYS A C   1 
ATOM   274  O O   . LYS A 1 35  ? 52.632 -2.323  2.346   1.00 28.07 ? 35  LYS A O   1 
ATOM   275  C CB  . LYS A 1 35  ? 49.591 -1.459  1.399   1.00 28.46 ? 35  LYS A CB  1 
ATOM   276  C CG  . LYS A 1 35  ? 50.490 -1.284  0.173   1.00 31.37 ? 35  LYS A CG  1 
ATOM   277  C CD  . LYS A 1 35  ? 49.816 -0.451  -0.926  1.00 31.35 ? 35  LYS A CD  1 
ATOM   278  C CE  . LYS A 1 35  ? 48.680 -1.231  -1.557  1.00 35.33 ? 35  LYS A CE  1 
ATOM   279  N NZ  . LYS A 1 35  ? 48.119 -0.489  -2.720  1.00 37.41 ? 35  LYS A NZ  1 
ATOM   280  N N   . ALA A 1 36  ? 51.715 -0.744  3.694   1.00 28.01 ? 36  ALA A N   1 
ATOM   281  C CA  . ALA A 1 36  ? 52.955 -0.082  4.106   1.00 28.39 ? 36  ALA A CA  1 
ATOM   282  C C   . ALA A 1 36  ? 53.643 -0.706  5.335   1.00 28.69 ? 36  ALA A C   1 
ATOM   283  O O   . ALA A 1 36  ? 54.379 -0.019  6.052   1.00 28.01 ? 36  ALA A O   1 
ATOM   284  C CB  . ALA A 1 36  ? 52.678 1.396   4.375   1.00 28.28 ? 36  ALA A CB  1 
ATOM   285  N N   . ILE A 1 37  ? 53.447 -2.004  5.554   1.00 28.99 ? 37  ILE A N   1 
ATOM   286  C CA  . ILE A 1 37  ? 53.996 -2.671  6.754   1.00 29.88 ? 37  ILE A CA  1 
ATOM   287  C C   . ILE A 1 37  ? 55.539 -2.593  6.865   1.00 29.36 ? 37  ILE A C   1 
ATOM   288  O O   . ILE A 1 37  ? 56.091 -2.626  7.976   1.00 29.29 ? 37  ILE A O   1 
ATOM   289  C CB  . ILE A 1 37  ? 53.499 -4.145  6.865   1.00 30.64 ? 37  ILE A CB  1 
ATOM   290  C CG1 . ILE A 1 37  ? 53.683 -4.680  8.294   1.00 33.07 ? 37  ILE A CG1 1 
ATOM   291  C CG2 . ILE A 1 37  ? 54.145 -5.041  5.806   1.00 30.42 ? 37  ILE A CG2 1 
ATOM   292  C CD1 . ILE A 1 37  ? 53.493 -6.161  8.408   1.00 34.49 ? 37  ILE A CD1 1 
ATOM   293  N N   . LYS A 1 38  ? 56.225 -2.479  5.730   1.00 28.79 ? 38  LYS A N   1 
ATOM   294  C CA  . LYS A 1 38  ? 57.684 -2.268  5.712   1.00 29.24 ? 38  LYS A CA  1 
ATOM   295  C C   . LYS A 1 38  ? 58.046 -0.973  6.455   1.00 28.55 ? 38  LYS A C   1 
ATOM   296  O O   . LYS A 1 38  ? 59.105 -0.865  7.082   1.00 28.70 ? 38  LYS A O   1 
ATOM   297  C CB  . LYS A 1 38  ? 58.178 -2.216  4.265   1.00 29.07 ? 38  LYS A CB  1 
ATOM   298  C CG  . LYS A 1 38  ? 59.678 -2.143  4.064   1.00 31.17 ? 38  LYS A CG  1 
ATOM   299  C CD  . LYS A 1 38  ? 60.004 -1.920  2.589   1.00 30.89 ? 38  LYS A CD  1 
ATOM   300  C CE  . LYS A 1 38  ? 61.468 -1.549  2.363   1.00 35.84 ? 38  LYS A CE  1 
ATOM   301  N NZ  . LYS A 1 38  ? 61.935 -0.464  3.284   1.00 37.53 ? 38  LYS A NZ  1 
ATOM   302  N N   . PHE A 1 39  ? 57.149 0.003   6.375   1.00 27.81 ? 39  PHE A N   1 
ATOM   303  C CA  . PHE A 1 39  ? 57.342 1.309   6.997   1.00 27.70 ? 39  PHE A CA  1 
ATOM   304  C C   . PHE A 1 39  ? 56.455 1.480   8.237   1.00 27.46 ? 39  PHE A C   1 
ATOM   305  O O   . PHE A 1 39  ? 55.985 2.582   8.528   1.00 26.92 ? 39  PHE A O   1 
ATOM   306  C CB  . PHE A 1 39  ? 57.052 2.403   5.957   1.00 27.85 ? 39  PHE A CB  1 
ATOM   307  C CG  . PHE A 1 39  ? 57.792 2.207   4.651   1.00 28.78 ? 39  PHE A CG  1 
ATOM   308  C CD1 . PHE A 1 39  ? 59.131 2.559   4.539   1.00 29.02 ? 39  PHE A CD1 1 
ATOM   309  C CD2 . PHE A 1 39  ? 57.144 1.663   3.540   1.00 30.37 ? 39  PHE A CD2 1 
ATOM   310  C CE1 . PHE A 1 39  ? 59.823 2.373   3.341   1.00 30.21 ? 39  PHE A CE1 1 
ATOM   311  C CE2 . PHE A 1 39  ? 57.827 1.473   2.329   1.00 29.54 ? 39  PHE A CE2 1 
ATOM   312  C CZ  . PHE A 1 39  ? 59.167 1.831   2.234   1.00 29.86 ? 39  PHE A CZ  1 
ATOM   313  N N   . TYR A 1 40  ? 56.216 0.393   8.969   1.00 26.64 ? 40  TYR A N   1 
ATOM   314  C CA  . TYR A 1 40  ? 55.255 0.444   10.083  1.00 26.83 ? 40  TYR A CA  1 
ATOM   315  C C   . TYR A 1 40  ? 55.604 1.519   11.127  1.00 26.79 ? 40  TYR A C   1 
ATOM   316  O O   . TYR A 1 40  ? 54.720 2.128   11.721  1.00 26.88 ? 40  TYR A O   1 
ATOM   317  C CB  . TYR A 1 40  ? 55.101 -0.934  10.743  1.00 26.87 ? 40  TYR A CB  1 
ATOM   318  C CG  . TYR A 1 40  ? 56.273 -1.373  11.588  1.00 26.72 ? 40  TYR A CG  1 
ATOM   319  C CD1 . TYR A 1 40  ? 57.396 -1.980  11.018  1.00 25.14 ? 40  TYR A CD1 1 
ATOM   320  C CD2 . TYR A 1 40  ? 56.251 -1.198  12.976  1.00 26.36 ? 40  TYR A CD2 1 
ATOM   321  C CE1 . TYR A 1 40  ? 58.476 -2.382  11.822  1.00 28.14 ? 40  TYR A CE1 1 
ATOM   322  C CE2 . TYR A 1 40  ? 57.317 -1.584  13.774  1.00 28.76 ? 40  TYR A CE2 1 
ATOM   323  C CZ  . TYR A 1 40  ? 58.412 -2.183  13.204  1.00 27.22 ? 40  TYR A CZ  1 
ATOM   324  O OH  . TYR A 1 40  ? 59.470 -2.566  14.007  1.00 29.66 ? 40  TYR A OH  1 
ATOM   325  N N   . LYS A 1 41  ? 56.891 1.753   11.358  1.00 27.32 ? 41  LYS A N   1 
ATOM   326  C CA  . LYS A 1 41  ? 57.274 2.787   12.328  1.00 28.13 ? 41  LYS A CA  1 
ATOM   327  C C   . LYS A 1 41  ? 56.784 4.163   11.874  1.00 28.64 ? 41  LYS A C   1 
ATOM   328  O O   . LYS A 1 41  ? 56.312 4.970   12.687  1.00 28.36 ? 41  LYS A O   1 
ATOM   329  C CB  . LYS A 1 41  ? 58.782 2.785   12.568  1.00 28.16 ? 41  LYS A CB  1 
ATOM   330  C CG  . LYS A 1 41  ? 59.328 1.461   13.090  1.00 27.89 ? 41  LYS A CG  1 
ATOM   331  C CD  . LYS A 1 41  ? 60.839 1.548   13.323  1.00 28.58 ? 41  LYS A CD  1 
ATOM   332  C CE  . LYS A 1 41  ? 61.383 0.238   13.862  1.00 27.98 ? 41  LYS A CE  1 
ATOM   333  N NZ  . LYS A 1 41  ? 62.861 0.303   14.028  1.00 31.01 ? 41  LYS A NZ  1 
ATOM   334  N N   . HIS A 1 42  ? 56.893 4.419   10.569  1.00 28.48 ? 42  HIS A N   1 
ATOM   335  C CA  . HIS A 1 42  ? 56.403 5.677   9.989   1.00 28.84 ? 42  HIS A CA  1 
ATOM   336  C C   . HIS A 1 42  ? 54.882 5.779   10.088  1.00 28.21 ? 42  HIS A C   1 
ATOM   337  O O   . HIS A 1 42  ? 54.346 6.852   10.383  1.00 27.60 ? 42  HIS A O   1 
ATOM   338  C CB  . HIS A 1 42  ? 56.865 5.808   8.540   1.00 29.31 ? 42  HIS A CB  1 
ATOM   339  C CG  . HIS A 1 42  ? 58.346 5.962   8.400   1.00 32.77 ? 42  HIS A CG  1 
ATOM   340  N ND1 . HIS A 1 42  ? 59.205 4.884   8.392   1.00 35.82 ? 42  HIS A ND1 1 
ATOM   341  C CD2 . HIS A 1 42  ? 59.125 7.066   8.294   1.00 35.34 ? 42  HIS A CD2 1 
ATOM   342  C CE1 . HIS A 1 42  ? 60.450 5.317   8.281   1.00 37.26 ? 42  HIS A CE1 1 
ATOM   343  N NE2 . HIS A 1 42  ? 60.428 6.637   8.218   1.00 37.88 ? 42  HIS A NE2 1 
ATOM   344  N N   . VAL A 1 43  ? 54.194 4.661   9.834   1.00 27.49 ? 43  VAL A N   1 
ATOM   345  C CA  . VAL A 1 43  ? 52.731 4.612   9.933   1.00 27.38 ? 43  VAL A CA  1 
ATOM   346  C C   . VAL A 1 43  ? 52.295 4.966   11.368  1.00 26.92 ? 43  VAL A C   1 
ATOM   347  O O   . VAL A 1 43  ? 51.440 5.817   11.576  1.00 26.45 ? 43  VAL A O   1 
ATOM   348  C CB  . VAL A 1 43  ? 52.176 3.229   9.509   1.00 27.92 ? 43  VAL A CB  1 
ATOM   349  C CG1 . VAL A 1 43  ? 50.707 3.086   9.898   1.00 28.16 ? 43  VAL A CG1 1 
ATOM   350  C CG2 . VAL A 1 43  ? 52.367 3.024   7.979   1.00 27.13 ? 43  VAL A CG2 1 
ATOM   351  N N   . VAL A 1 44  ? 52.926 4.330   12.352  1.00 26.53 ? 44  VAL A N   1 
ATOM   352  C CA  . VAL A 1 44  ? 52.607 4.593   13.749  1.00 26.53 ? 44  VAL A CA  1 
ATOM   353  C C   . VAL A 1 44  ? 52.867 6.068   14.073  1.00 26.94 ? 44  VAL A C   1 
ATOM   354  O O   . VAL A 1 44  ? 52.018 6.735   14.681  1.00 26.51 ? 44  VAL A O   1 
ATOM   355  C CB  . VAL A 1 44  ? 53.369 3.650   14.691  1.00 26.27 ? 44  VAL A CB  1 
ATOM   356  C CG1 . VAL A 1 44  ? 53.245 4.116   16.144  1.00 26.93 ? 44  VAL A CG1 1 
ATOM   357  C CG2 . VAL A 1 44  ? 52.811 2.218   14.533  1.00 26.60 ? 44  VAL A CG2 1 
ATOM   358  N N   . GLN A 1 45  ? 54.012 6.574   13.647  1.00 27.56 ? 45  GLN A N   1 
ATOM   359  C CA  . GLN A 1 45  ? 54.373 7.968   13.937  1.00 28.48 ? 45  GLN A CA  1 
ATOM   360  C C   . GLN A 1 45  ? 53.338 8.949   13.363  1.00 28.13 ? 45  GLN A C   1 
ATOM   361  O O   . GLN A 1 45  ? 52.968 9.948   14.016  1.00 27.74 ? 45  GLN A O   1 
ATOM   362  C CB  . GLN A 1 45  ? 55.780 8.275   13.415  1.00 28.39 ? 45  GLN A CB  1 
ATOM   363  C CG  . GLN A 1 45  ? 56.260 9.690   13.766  1.00 31.19 ? 45  GLN A CG  1 
ATOM   364  C CD  . GLN A 1 45  ? 57.601 10.035  13.156  1.00 32.19 ? 45  GLN A CD  1 
ATOM   365  O OE1 . GLN A 1 45  ? 57.800 9.928   11.936  1.00 38.53 ? 45  GLN A OE1 1 
ATOM   366  N NE2 . GLN A 1 45  ? 58.532 10.472  13.999  1.00 36.49 ? 45  GLN A NE2 1 
ATOM   367  N N   . SER A 1 46  ? 52.857 8.649   12.155  1.00 27.24 ? 46  SER A N   1 
ATOM   368  C CA  . SER A 1 46  ? 51.862 9.478   11.487  1.00 27.93 ? 46  SER A CA  1 
ATOM   369  C C   . SER A 1 46  ? 50.527 9.491   12.224  1.00 27.39 ? 46  SER A C   1 
ATOM   370  O O   . SER A 1 46  ? 49.911 10.555  12.379  1.00 27.70 ? 46  SER A O   1 
ATOM   371  C CB  . SER A 1 46  ? 51.647 9.009   10.040  1.00 27.91 ? 46  SER A CB  1 
ATOM   372  O OG  . SER A 1 46  ? 52.703 9.432   9.207   1.00 31.96 ? 46  SER A OG  1 
ATOM   373  N N   . VAL A 1 47  ? 50.086 8.318   12.674  1.00 26.88 ? 47  VAL A N   1 
ATOM   374  C CA  . VAL A 1 47  ? 48.827 8.219   13.423  1.00 27.00 ? 47  VAL A CA  1 
ATOM   375  C C   . VAL A 1 47  ? 48.957 9.018   14.723  1.00 26.69 ? 47  VAL A C   1 
ATOM   376  O O   . VAL A 1 47  ? 48.034 9.770   15.119  1.00 26.84 ? 47  VAL A O   1 
ATOM   377  C CB  . VAL A 1 47  ? 48.475 6.765   13.719  1.00 26.35 ? 47  VAL A CB  1 
ATOM   378  C CG1 . VAL A 1 47  ? 47.297 6.688   14.656  1.00 27.74 ? 47  VAL A CG1 1 
ATOM   379  C CG2 . VAL A 1 47  ? 48.151 6.035   12.393  1.00 26.51 ? 47  VAL A CG2 1 
ATOM   380  N N   . GLU A 1 48  ? 50.094 8.831   15.395  1.00 27.08 ? 48  GLU A N   1 
ATOM   381  C CA  . GLU A 1 48  ? 50.322 9.507   16.673  1.00 26.41 ? 48  GLU A CA  1 
ATOM   382  C C   . GLU A 1 48  ? 50.327 11.017  16.511  1.00 27.19 ? 48  GLU A C   1 
ATOM   383  O O   . GLU A 1 48  ? 49.726 11.740  17.316  1.00 26.71 ? 48  GLU A O   1 
ATOM   384  C CB  . GLU A 1 48  ? 51.614 9.025   17.328  1.00 27.04 ? 48  GLU A CB  1 
ATOM   385  C CG  . GLU A 1 48  ? 51.473 7.619   17.894  1.00 25.90 ? 48  GLU A CG  1 
ATOM   386  C CD  . GLU A 1 48  ? 52.798 7.041   18.387  1.00 27.09 ? 48  GLU A CD  1 
ATOM   387  O OE1 . GLU A 1 48  ? 53.858 7.682   18.239  1.00 29.80 ? 48  GLU A OE1 1 
ATOM   388  O OE2 . GLU A 1 48  ? 52.742 5.920   18.905  1.00 31.43 ? 48  GLU A OE2 1 
ATOM   389  N N   . LYS A 1 49  ? 50.968 11.479  15.440  1.00 26.93 ? 49  LYS A N   1 
ATOM   390  C CA  . LYS A 1 49  ? 51.036 12.909  15.149  1.00 28.78 ? 49  LYS A CA  1 
ATOM   391  C C   . LYS A 1 49  ? 49.652 13.468  14.814  1.00 27.94 ? 49  LYS A C   1 
ATOM   392  O O   . LYS A 1 49  ? 49.305 14.574  15.243  1.00 28.41 ? 49  LYS A O   1 
ATOM   393  C CB  . LYS A 1 49  ? 52.075 13.184  14.063  1.00 28.66 ? 49  LYS A CB  1 
ATOM   394  C CG  . LYS A 1 49  ? 53.494 13.130  14.645  1.00 31.03 ? 49  LYS A CG  1 
ATOM   395  C CD  . LYS A 1 49  ? 54.621 13.559  13.704  1.00 31.67 ? 49  LYS A CD  1 
ATOM   396  C CE  . LYS A 1 49  ? 55.964 13.375  14.415  1.00 32.54 ? 49  LYS A CE  1 
ATOM   397  N NZ  . LYS A 1 49  ? 57.146 13.647  13.545  1.00 37.54 ? 49  LYS A NZ  1 
ATOM   398  N N   . PHE A 1 50  ? 48.851 12.680  14.097  1.00 27.13 ? 50  PHE A N   1 
ATOM   399  C CA  . PHE A 1 50  ? 47.489 13.076  13.775  1.00 27.14 ? 50  PHE A CA  1 
ATOM   400  C C   . PHE A 1 50  ? 46.702 13.313  15.052  1.00 27.07 ? 50  PHE A C   1 
ATOM   401  O O   . PHE A 1 50  ? 46.094 14.373  15.234  1.00 27.29 ? 50  PHE A O   1 
ATOM   402  C CB  . PHE A 1 50  ? 46.790 12.020  12.899  1.00 27.17 ? 50  PHE A CB  1 
ATOM   403  C CG  . PHE A 1 50  ? 45.363 12.349  12.589  1.00 27.88 ? 50  PHE A CG  1 
ATOM   404  C CD1 . PHE A 1 50  ? 45.046 13.152  11.496  1.00 29.16 ? 50  PHE A CD1 1 
ATOM   405  C CD2 . PHE A 1 50  ? 44.331 11.872  13.396  1.00 29.41 ? 50  PHE A CD2 1 
ATOM   406  C CE1 . PHE A 1 50  ? 43.711 13.468  11.204  1.00 29.93 ? 50  PHE A CE1 1 
ATOM   407  C CE2 . PHE A 1 50  ? 43.000 12.187  13.123  1.00 30.33 ? 50  PHE A CE2 1 
ATOM   408  C CZ  . PHE A 1 50  ? 42.690 12.986  12.015  1.00 29.41 ? 50  PHE A CZ  1 
ATOM   409  N N   . ILE A 1 51  ? 46.762 12.339  15.953  1.00 26.88 ? 51  ILE A N   1 
ATOM   410  C CA  . ILE A 1 51  ? 46.037 12.397  17.225  1.00 27.36 ? 51  ILE A CA  1 
ATOM   411  C C   . ILE A 1 51  ? 46.509 13.557  18.117  1.00 27.42 ? 51  ILE A C   1 
ATOM   412  O O   . ILE A 1 51  ? 45.700 14.182  18.806  1.00 26.92 ? 51  ILE A O   1 
ATOM   413  C CB  . ILE A 1 51  ? 46.147 11.037  17.972  1.00 27.18 ? 51  ILE A CB  1 
ATOM   414  C CG1 . ILE A 1 51  ? 45.298 9.977   17.243  1.00 26.15 ? 51  ILE A CG1 1 
ATOM   415  C CG2 . ILE A 1 51  ? 45.675 11.183  19.422  1.00 27.99 ? 51  ILE A CG2 1 
ATOM   416  C CD1 . ILE A 1 51  ? 45.546 8.552   17.722  1.00 27.51 ? 51  ILE A CD1 1 
ATOM   417  N N   . GLN A 1 52  ? 47.803 13.853  18.080  1.00 27.61 ? 52  GLN A N   1 
ATOM   418  C CA  . GLN A 1 52  ? 48.364 14.965  18.847  1.00 29.10 ? 52  GLN A CA  1 
ATOM   419  C C   . GLN A 1 52  ? 47.788 16.316  18.407  1.00 28.96 ? 52  GLN A C   1 
ATOM   420  O O   . GLN A 1 52  ? 47.479 17.175  19.243  1.00 29.10 ? 52  GLN A O   1 
ATOM   421  C CB  . GLN A 1 52  ? 49.892 14.983  18.717  1.00 28.58 ? 52  GLN A CB  1 
ATOM   422  C CG  . GLN A 1 52  ? 50.608 16.003  19.625  1.00 30.97 ? 52  GLN A CG  1 
ATOM   423  C CD  . GLN A 1 52  ? 52.019 16.358  19.150  1.00 32.54 ? 52  GLN A CD  1 
ATOM   424  O OE1 . GLN A 1 52  ? 52.444 15.968  18.058  1.00 39.80 ? 52  GLN A OE1 1 
ATOM   425  N NE2 . GLN A 1 52  ? 52.742 17.121  19.965  1.00 37.29 ? 52  GLN A NE2 1 
ATOM   426  N N   . LYS A 1 53  ? 47.644 16.482  17.096  1.00 28.53 ? 53  LYS A N   1 
ATOM   427  C CA  . LYS A 1 53  ? 47.410 17.797  16.498  1.00 29.34 ? 53  LYS A CA  1 
ATOM   428  C C   . LYS A 1 53  ? 45.977 18.039  16.008  1.00 29.17 ? 53  LYS A C   1 
ATOM   429  O O   . LYS A 1 53  ? 45.589 19.196  15.760  1.00 28.64 ? 53  LYS A O   1 
ATOM   430  C CB  . LYS A 1 53  ? 48.417 18.021  15.362  1.00 29.42 ? 53  LYS A CB  1 
ATOM   431  C CG  . LYS A 1 53  ? 49.878 18.112  15.829  1.00 31.31 ? 53  LYS A CG  1 
ATOM   432  C CD  . LYS A 1 53  ? 50.248 19.520  16.266  1.00 35.73 ? 53  LYS A CD  1 
ATOM   433  C CE  . LYS A 1 53  ? 51.722 19.638  16.643  1.00 36.43 ? 53  LYS A CE  1 
ATOM   434  N NZ  . LYS A 1 53  ? 52.133 21.069  16.745  1.00 39.38 ? 53  LYS A NZ  1 
ATOM   435  N N   . CYS A 1 54  ? 45.189 16.972  15.880  1.00 29.26 ? 54  CYS A N   1 
ATOM   436  C CA  . CYS A 1 54  ? 43.839 17.087  15.304  1.00 29.32 ? 54  CYS A CA  1 
ATOM   437  C C   . CYS A 1 54  ? 42.870 17.821  16.225  1.00 29.41 ? 54  CYS A C   1 
ATOM   438  O O   . CYS A 1 54  ? 43.111 17.946  17.424  1.00 29.28 ? 54  CYS A O   1 
ATOM   439  C CB  . CYS A 1 54  ? 43.268 15.714  14.931  1.00 29.71 ? 54  CYS A CB  1 
ATOM   440  S SG  . CYS A 1 54  ? 42.907 14.645  16.348  1.00 30.17 ? 54  CYS A SG  1 
ATOM   441  N N   . LYS A 1 55  ? 41.782 18.321  15.643  1.00 29.64 ? 55  LYS A N   1 
ATOM   442  C CA  . LYS A 1 55  ? 40.696 18.935  16.405  1.00 29.94 ? 55  LYS A CA  1 
ATOM   443  C C   . LYS A 1 55  ? 40.049 17.903  17.330  1.00 29.40 ? 55  LYS A C   1 
ATOM   444  O O   . LYS A 1 55  ? 40.126 16.702  17.066  1.00 29.12 ? 55  LYS A O   1 
ATOM   445  C CB  . LYS A 1 55  ? 39.668 19.561  15.452  1.00 30.01 ? 55  LYS A CB  1 
ATOM   446  C CG  . LYS A 1 55  ? 40.204 20.782  14.718  1.00 30.47 ? 55  LYS A CG  1 
ATOM   447  C CD  . LYS A 1 55  ? 39.289 21.228  13.573  1.00 31.95 ? 55  LYS A CD  1 
ATOM   448  C CE  . LYS A 1 55  ? 39.966 22.329  12.766  1.00 34.71 ? 55  LYS A CE  1 
ATOM   449  N NZ  . LYS A 1 55  ? 39.002 23.238  12.096  1.00 36.03 ? 55  LYS A NZ  1 
ATOM   450  N N   . PRO A 1 56  ? 39.444 18.354  18.445  1.00 29.42 ? 56  PRO A N   1 
ATOM   451  C CA  . PRO A 1 56  ? 38.855 17.405  19.405  1.00 29.07 ? 56  PRO A CA  1 
ATOM   452  C C   . PRO A 1 56  ? 37.870 16.389  18.802  1.00 29.07 ? 56  PRO A C   1 
ATOM   453  O O   . PRO A 1 56  ? 37.865 15.234  19.223  1.00 28.34 ? 56  PRO A O   1 
ATOM   454  C CB  . PRO A 1 56  ? 38.143 18.324  20.405  1.00 29.06 ? 56  PRO A CB  1 
ATOM   455  C CG  . PRO A 1 56  ? 38.912 19.588  20.341  1.00 29.61 ? 56  PRO A CG  1 
ATOM   456  C CD  . PRO A 1 56  ? 39.311 19.750  18.912  1.00 29.40 ? 56  PRO A CD  1 
ATOM   457  N N   . GLU A 1 57  ? 37.067 16.796  17.817  1.00 28.62 ? 57  GLU A N   1 
ATOM   458  C CA  . GLU A 1 57  ? 36.137 15.851  17.175  1.00 29.19 ? 57  GLU A CA  1 
ATOM   459  C C   . GLU A 1 57  ? 36.811 14.644  16.490  1.00 28.29 ? 57  GLU A C   1 
ATOM   460  O O   . GLU A 1 57  ? 36.147 13.643  16.232  1.00 27.83 ? 57  GLU A O   1 
ATOM   461  C CB  . GLU A 1 57  ? 35.159 16.568  16.211  1.00 29.10 ? 57  GLU A CB  1 
ATOM   462  C CG  . GLU A 1 57  ? 35.781 17.108  14.913  1.00 31.85 ? 57  GLU A CG  1 
ATOM   463  C CD  . GLU A 1 57  ? 34.954 18.216  14.229  1.00 32.26 ? 57  GLU A CD  1 
ATOM   464  O OE1 . GLU A 1 57  ? 34.193 18.955  14.905  1.00 37.18 ? 57  GLU A OE1 1 
ATOM   465  O OE2 . GLU A 1 57  ? 35.070 18.368  12.991  1.00 38.56 ? 57  GLU A OE2 1 
ATOM   466  N N   . TYR A 1 58  ? 38.110 14.735  16.205  1.00 27.53 ? 58  TYR A N   1 
ATOM   467  C CA  . TYR A 1 58  ? 38.812 13.677  15.472  1.00 27.11 ? 58  TYR A CA  1 
ATOM   468  C C   . TYR A 1 58  ? 39.616 12.719  16.353  1.00 27.10 ? 58  TYR A C   1 
ATOM   469  O O   . TYR A 1 58  ? 40.252 11.801  15.832  1.00 27.13 ? 58  TYR A O   1 
ATOM   470  C CB  . TYR A 1 58  ? 39.725 14.260  14.390  1.00 27.03 ? 58  TYR A CB  1 
ATOM   471  C CG  . TYR A 1 58  ? 38.938 14.928  13.291  1.00 26.03 ? 58  TYR A CG  1 
ATOM   472  C CD1 . TYR A 1 58  ? 38.194 14.169  12.390  1.00 26.72 ? 58  TYR A CD1 1 
ATOM   473  C CD2 . TYR A 1 58  ? 38.914 16.302  13.172  1.00 26.14 ? 58  TYR A CD2 1 
ATOM   474  C CE1 . TYR A 1 58  ? 37.455 14.771  11.393  1.00 25.08 ? 58  TYR A CE1 1 
ATOM   475  C CE2 . TYR A 1 58  ? 38.175 16.923  12.178  1.00 26.60 ? 58  TYR A CE2 1 
ATOM   476  C CZ  . TYR A 1 58  ? 37.451 16.148  11.286  1.00 26.84 ? 58  TYR A CZ  1 
ATOM   477  O OH  . TYR A 1 58  ? 36.718 16.782  10.302  1.00 27.30 ? 58  TYR A OH  1 
ATOM   478  N N   . LYS A 1 59  ? 39.591 12.946  17.668  1.00 26.80 ? 59  LYS A N   1 
ATOM   479  C CA  . LYS A 1 59  ? 40.325 12.075  18.602  1.00 27.54 ? 59  LYS A CA  1 
ATOM   480  C C   . LYS A 1 59  ? 39.817 10.638  18.535  1.00 27.64 ? 59  LYS A C   1 
ATOM   481  O O   . LYS A 1 59  ? 40.610 9.712   18.310  1.00 27.76 ? 59  LYS A O   1 
ATOM   482  C CB  . LYS A 1 59  ? 40.262 12.600  20.051  1.00 27.31 ? 59  LYS A CB  1 
ATOM   483  C CG  . LYS A 1 59  ? 40.746 14.031  20.257  1.00 29.75 ? 59  LYS A CG  1 
ATOM   484  C CD  . LYS A 1 59  ? 42.215 14.232  19.890  1.00 30.42 ? 59  LYS A CD  1 
ATOM   485  C CE  . LYS A 1 59  ? 42.652 15.653  20.227  1.00 31.83 ? 59  LYS A CE  1 
ATOM   486  N NZ  . LYS A 1 59  ? 44.008 15.980  19.703  1.00 32.98 ? 59  LYS A NZ  1 
ATOM   487  N N   . VAL A 1 60  ? 38.508 10.450  18.741  1.00 27.93 ? 60  VAL A N   1 
ATOM   488  C CA  . VAL A 1 60  ? 37.910 9.103   18.619  1.00 28.70 ? 60  VAL A CA  1 
ATOM   489  C C   . VAL A 1 60  ? 38.150 8.490   17.221  1.00 28.38 ? 60  VAL A C   1 
ATOM   490  O O   . VAL A 1 60  ? 38.620 7.343   17.134  1.00 28.02 ? 60  VAL A O   1 
ATOM   491  C CB  . VAL A 1 60  ? 36.427 9.053   19.102  1.00 29.25 ? 60  VAL A CB  1 
ATOM   492  C CG1 . VAL A 1 60  ? 35.725 7.760   18.662  1.00 30.88 ? 60  VAL A CG1 1 
ATOM   493  C CG2 . VAL A 1 60  ? 36.346 9.216   20.622  1.00 30.21 ? 60  VAL A CG2 1 
ATOM   494  N N   . PRO A 1 61  ? 37.837 9.227   16.122  1.00 27.98 ? 61  PRO A N   1 
ATOM   495  C CA  . PRO A 1 61  ? 38.321 8.756   14.804  1.00 28.00 ? 61  PRO A CA  1 
ATOM   496  C C   . PRO A 1 61  ? 39.793 8.261   14.770  1.00 27.52 ? 61  PRO A C   1 
ATOM   497  O O   . PRO A 1 61  ? 40.074 7.176   14.244  1.00 27.09 ? 61  PRO A O   1 
ATOM   498  C CB  . PRO A 1 61  ? 38.120 9.995   13.922  1.00 27.56 ? 61  PRO A CB  1 
ATOM   499  C CG  . PRO A 1 61  ? 36.831 10.557  14.430  1.00 27.95 ? 61  PRO A CG  1 
ATOM   500  C CD  . PRO A 1 61  ? 37.012 10.446  15.962  1.00 27.87 ? 61  PRO A CD  1 
ATOM   501  N N   . GLY A 1 62  ? 40.721 9.029   15.347  1.00 27.12 ? 62  GLY A N   1 
ATOM   502  C CA  . GLY A 1 62  ? 42.122 8.615   15.415  1.00 27.73 ? 62  GLY A CA  1 
ATOM   503  C C   . GLY A 1 62  ? 42.301 7.304   16.178  1.00 27.32 ? 62  GLY A C   1 
ATOM   504  O O   . GLY A 1 62  ? 43.041 6.412   15.752  1.00 27.95 ? 62  GLY A O   1 
ATOM   505  N N   . LEU A 1 63  ? 41.597 7.175   17.305  1.00 27.77 ? 63  LEU A N   1 
ATOM   506  C CA  . LEU A 1 63  ? 41.619 5.919   18.056  1.00 27.79 ? 63  LEU A CA  1 
ATOM   507  C C   . LEU A 1 63  ? 41.083 4.753   17.227  1.00 27.75 ? 63  LEU A C   1 
ATOM   508  O O   . LEU A 1 63  ? 41.637 3.655   17.250  1.00 27.92 ? 63  LEU A O   1 
ATOM   509  C CB  . LEU A 1 63  ? 40.830 6.033   19.371  1.00 28.09 ? 63  LEU A CB  1 
ATOM   510  C CG  . LEU A 1 63  ? 40.718 4.717   20.163  1.00 28.08 ? 63  LEU A CG  1 
ATOM   511  C CD1 . LEU A 1 63  ? 42.133 4.086   20.493  1.00 27.67 ? 63  LEU A CD1 1 
ATOM   512  C CD2 . LEU A 1 63  ? 39.837 4.934   21.427  1.00 28.73 ? 63  LEU A CD2 1 
ATOM   513  N N   . TYR A 1 64  ? 40.004 4.984   16.489  1.00 26.66 ? 64  TYR A N   1 
ATOM   514  C CA  . TYR A 1 64  ? 39.454 3.941   15.627  1.00 26.50 ? 64  TYR A CA  1 
ATOM   515  C C   . TYR A 1 64  ? 40.448 3.518   14.542  1.00 26.97 ? 64  TYR A C   1 
ATOM   516  O O   . TYR A 1 64  ? 40.431 2.373   14.099  1.00 26.37 ? 64  TYR A O   1 
ATOM   517  C CB  . TYR A 1 64  ? 38.141 4.393   14.999  1.00 27.42 ? 64  TYR A CB  1 
ATOM   518  C CG  . TYR A 1 64  ? 36.983 4.485   15.959  1.00 28.05 ? 64  TYR A CG  1 
ATOM   519  C CD1 . TYR A 1 64  ? 37.028 3.904   17.236  1.00 27.30 ? 64  TYR A CD1 1 
ATOM   520  C CD2 . TYR A 1 64  ? 35.809 5.115   15.575  1.00 28.92 ? 64  TYR A CD2 1 
ATOM   521  C CE1 . TYR A 1 64  ? 35.937 3.997   18.106  1.00 30.29 ? 64  TYR A CE1 1 
ATOM   522  C CE2 . TYR A 1 64  ? 34.725 5.191   16.416  1.00 29.38 ? 64  TYR A CE2 1 
ATOM   523  C CZ  . TYR A 1 64  ? 34.781 4.636   17.674  1.00 29.64 ? 64  TYR A CZ  1 
ATOM   524  O OH  . TYR A 1 64  ? 33.680 4.745   18.487  1.00 29.25 ? 64  TYR A OH  1 
ATOM   525  N N   . VAL A 1 65  ? 41.268 4.459   14.089  1.00 26.72 ? 65  VAL A N   1 
ATOM   526  C CA  . VAL A 1 65  ? 42.358 4.120   13.159  1.00 26.94 ? 65  VAL A CA  1 
ATOM   527  C C   . VAL A 1 65  ? 43.323 3.151   13.822  1.00 27.16 ? 65  VAL A C   1 
ATOM   528  O O   . VAL A 1 65  ? 43.693 2.135   13.234  1.00 26.45 ? 65  VAL A O   1 
ATOM   529  C CB  . VAL A 1 65  ? 43.070 5.384   12.624  1.00 27.21 ? 65  VAL A CB  1 
ATOM   530  C CG1 . VAL A 1 65  ? 44.299 5.016   11.818  1.00 28.60 ? 65  VAL A CG1 1 
ATOM   531  C CG2 . VAL A 1 65  ? 42.093 6.197   11.766  1.00 26.19 ? 65  VAL A CG2 1 
ATOM   532  N N   . ILE A 1 66  ? 43.733 3.454   15.047  1.00 25.83 ? 66  ILE A N   1 
ATOM   533  C CA  . ILE A 1 66  ? 44.672 2.540   15.748  1.00 26.05 ? 66  ILE A CA  1 
ATOM   534  C C   . ILE A 1 66  ? 43.987 1.183   15.869  1.00 26.50 ? 66  ILE A C   1 
ATOM   535  O O   . ILE A 1 66  ? 44.558 0.151   15.535  1.00 25.67 ? 66  ILE A O   1 
ATOM   536  C CB  . ILE A 1 66  ? 44.984 3.051   17.140  1.00 26.07 ? 66  ILE A CB  1 
ATOM   537  C CG1 . ILE A 1 66  ? 45.721 4.396   17.020  1.00 25.54 ? 66  ILE A CG1 1 
ATOM   538  C CG2 . ILE A 1 66  ? 45.891 2.017   17.888  1.00 26.01 ? 66  ILE A CG2 1 
ATOM   539  C CD1 . ILE A 1 66  ? 46.096 4.995   18.359  1.00 27.81 ? 66  ILE A CD1 1 
ATOM   540  N N   . ASP A 1 67  ? 42.754 1.208   16.358  1.00 25.77 ? 67  ASP A N   1 
ATOM   541  C CA  . ASP A 1 67  ? 41.999 -0.021  16.578  1.00 26.61 ? 67  ASP A CA  1 
ATOM   542  C C   . ASP A 1 67  ? 41.879 -0.843  15.294  1.00 26.89 ? 67  ASP A C   1 
ATOM   543  O O   . ASP A 1 67  ? 42.116 -2.058  15.298  1.00 26.61 ? 67  ASP A O   1 
ATOM   544  C CB  . ASP A 1 67  ? 40.590 0.319   17.117  1.00 27.53 ? 67  ASP A CB  1 
ATOM   545  C CG  . ASP A 1 67  ? 39.750 -0.920  17.356  1.00 29.52 ? 67  ASP A CG  1 
ATOM   546  O OD1 . ASP A 1 67  ? 40.164 -1.751  18.199  1.00 30.90 ? 67  ASP A OD1 1 
ATOM   547  O OD2 . ASP A 1 67  ? 38.687 -1.061  16.706  1.00 31.90 ? 67  ASP A OD2 1 
ATOM   548  N N   . SER A 1 68  ? 41.504 -0.185  14.191  1.00 26.88 ? 68  SER A N   1 
ATOM   549  C CA  . SER A 1 68  ? 41.311 -0.905  12.929  1.00 27.40 ? 68  SER A CA  1 
ATOM   550  C C   . SER A 1 68  ? 42.625 -1.529  12.438  1.00 27.56 ? 68  SER A C   1 
ATOM   551  O O   . SER A 1 68  ? 42.635 -2.677  11.979  1.00 27.22 ? 68  SER A O   1 
ATOM   552  C CB  . SER A 1 68  ? 40.697 0.017   11.877  1.00 28.09 ? 68  SER A CB  1 
ATOM   553  O OG  . SER A 1 68  ? 40.406 -0.667  10.662  1.00 28.97 ? 68  SER A OG  1 
ATOM   554  N N   . ILE A 1 69  ? 43.709 -0.761  12.517  1.00 27.16 ? 69  ILE A N   1 
ATOM   555  C CA  . ILE A 1 69  ? 45.013 -1.211  12.036  1.00 27.12 ? 69  ILE A CA  1 
ATOM   556  C C   . ILE A 1 69  ? 45.476 -2.396  12.874  1.00 27.17 ? 69  ILE A C   1 
ATOM   557  O O   . ILE A 1 69  ? 45.870 -3.426  12.344  1.00 25.41 ? 69  ILE A O   1 
ATOM   558  C CB  . ILE A 1 69  ? 46.069 -0.087  12.101  1.00 26.88 ? 69  ILE A CB  1 
ATOM   559  C CG1 . ILE A 1 69  ? 45.766 0.972   11.037  1.00 27.04 ? 69  ILE A CG1 1 
ATOM   560  C CG2 . ILE A 1 69  ? 47.510 -0.653  11.880  1.00 28.46 ? 69  ILE A CG2 1 
ATOM   561  C CD1 . ILE A 1 69  ? 46.603 2.250   11.142  1.00 27.99 ? 69  ILE A CD1 1 
ATOM   562  N N   . VAL A 1 70  ? 45.423 -2.251  14.193  1.00 27.87 ? 70  VAL A N   1 
ATOM   563  C CA  A VAL A 1 70  ? 45.913 -3.313  15.074  0.50 28.11 ? 70  VAL A CA  1 
ATOM   564  C CA  B VAL A 1 70  ? 45.923 -3.320  15.067  0.50 28.37 ? 70  VAL A CA  1 
ATOM   565  C C   . VAL A 1 70  ? 45.101 -4.592  14.933  1.00 28.71 ? 70  VAL A C   1 
ATOM   566  O O   . VAL A 1 70  ? 45.662 -5.687  14.836  1.00 28.52 ? 70  VAL A O   1 
ATOM   567  C CB  A VAL A 1 70  ? 45.969 -2.857  16.534  0.50 28.31 ? 70  VAL A CB  1 
ATOM   568  C CB  B VAL A 1 70  ? 46.092 -2.884  16.550  0.50 28.66 ? 70  VAL A CB  1 
ATOM   569  C CG1 A VAL A 1 70  ? 46.209 -4.048  17.442  0.50 28.10 ? 70  VAL A CG1 1 
ATOM   570  C CG1 B VAL A 1 70  ? 47.088 -1.743  16.657  0.50 28.20 ? 70  VAL A CG1 1 
ATOM   571  C CG2 A VAL A 1 70  ? 47.068 -1.830  16.712  0.50 27.70 ? 70  VAL A CG2 1 
ATOM   572  C CG2 B VAL A 1 70  ? 44.755 -2.527  17.202  0.50 29.72 ? 70  VAL A CG2 1 
ATOM   573  N N   . ARG A 1 71  ? 43.778 -4.462  14.897  1.00 28.15 ? 71  ARG A N   1 
ATOM   574  C CA  . ARG A 1 71  ? 42.933 -5.630  14.687  1.00 28.88 ? 71  ARG A CA  1 
ATOM   575  C C   . ARG A 1 71  ? 43.118 -6.301  13.325  1.00 27.48 ? 71  ARG A C   1 
ATOM   576  O O   . ARG A 1 71  ? 43.233 -7.522  13.263  1.00 26.96 ? 71  ARG A O   1 
ATOM   577  C CB  . ARG A 1 71  ? 41.468 -5.309  14.993  1.00 31.04 ? 71  ARG A CB  1 
ATOM   578  C CG  . ARG A 1 71  ? 41.286 -4.741  16.402  1.00 33.75 ? 71  ARG A CG  1 
ATOM   579  C CD  . ARG A 1 71  ? 41.371 -5.780  17.522  1.00 43.09 ? 71  ARG A CD  1 
ATOM   580  N NE  . ARG A 1 71  ? 40.134 -6.551  17.614  1.00 48.41 ? 71  ARG A NE  1 
ATOM   581  C CZ  . ARG A 1 71  ? 40.017 -7.742  18.188  1.00 50.09 ? 71  ARG A CZ  1 
ATOM   582  N NH1 . ARG A 1 71  ? 41.074 -8.338  18.724  1.00 52.72 ? 71  ARG A NH1 1 
ATOM   583  N NH2 . ARG A 1 71  ? 38.839 -8.347  18.206  1.00 51.92 ? 71  ARG A NH2 1 
ATOM   584  N N   . GLN A 1 72  ? 43.192 -5.512  12.246  1.00 26.52 ? 72  GLN A N   1 
ATOM   585  C CA  . GLN A 1 72  ? 43.404 -6.093  10.930  1.00 26.30 ? 72  GLN A CA  1 
ATOM   586  C C   . GLN A 1 72  ? 44.767 -6.777  10.881  1.00 25.80 ? 72  GLN A C   1 
ATOM   587  O O   . GLN A 1 72  ? 44.883 -7.850  10.331  1.00 24.63 ? 72  GLN A O   1 
ATOM   588  C CB  . GLN A 1 72  ? 43.293 -5.056  9.815   1.00 27.18 ? 72  GLN A CB  1 
ATOM   589  C CG  . GLN A 1 72  ? 43.553 -5.629  8.426   1.00 28.24 ? 72  GLN A CG  1 
ATOM   590  C CD  . GLN A 1 72  ? 42.509 -6.654  7.991   1.00 32.37 ? 72  GLN A CD  1 
ATOM   591  O OE1 . GLN A 1 72  ? 41.330 -6.596  8.397   1.00 32.79 ? 72  GLN A OE1 1 
ATOM   592  N NE2 . GLN A 1 72  ? 42.935 -7.600  7.164   1.00 30.04 ? 72  GLN A NE2 1 
ATOM   593  N N   . SER A 1 73  ? 45.783 -6.143  11.465  1.00 25.45 ? 73  SER A N   1 
ATOM   594  C CA  . SER A 1 73  ? 47.134 -6.714  11.415  1.00 24.93 ? 73  SER A CA  1 
ATOM   595  C C   . SER A 1 73  ? 47.212 -8.036  12.195  1.00 24.63 ? 73  SER A C   1 
ATOM   596  O O   . SER A 1 73  ? 47.786 -9.027  11.748  1.00 23.73 ? 73  SER A O   1 
ATOM   597  C CB  . SER A 1 73  ? 48.155 -5.701  11.921  1.00 25.24 ? 73  SER A CB  1 
ATOM   598  O OG  . SER A 1 73  ? 49.423 -6.325  12.024  1.00 25.76 ? 73  SER A OG  1 
ATOM   599  N N   . ARG A 1 74  ? 46.598 -8.058  13.373  1.00 24.73 ? 74  ARG A N   1 
ATOM   600  C CA  . ARG A 1 74  ? 46.563 -9.284  14.168  1.00 24.95 ? 74  ARG A CA  1 
ATOM   601  C C   . ARG A 1 74  ? 45.852 -10.421 13.426  1.00 24.74 ? 74  ARG A C   1 
ATOM   602  O O   . ARG A 1 74  ? 46.285 -11.576 13.454  1.00 24.88 ? 74  ARG A O   1 
ATOM   603  C CB  . ARG A 1 74  ? 45.921 -8.983  15.546  1.00 24.28 ? 74  ARG A CB  1 
ATOM   604  C CG  . ARG A 1 74  ? 46.875 -8.247  16.498  1.00 23.80 ? 74  ARG A CG  1 
ATOM   605  C CD  . ARG A 1 74  ? 46.152 -7.685  17.745  1.00 26.11 ? 74  ARG A CD  1 
ATOM   606  N NE  . ARG A 1 74  ? 45.489 -8.752  18.511  1.00 29.82 ? 74  ARG A NE  1 
ATOM   607  C CZ  . ARG A 1 74  ? 46.054 -9.451  19.493  1.00 29.89 ? 74  ARG A CZ  1 
ATOM   608  N NH1 . ARG A 1 74  ? 47.318 -9.235  19.843  1.00 29.97 ? 74  ARG A NH1 1 
ATOM   609  N NH2 . ARG A 1 74  ? 45.350 -10.384 20.124  1.00 30.63 ? 74  ARG A NH2 1 
ATOM   610  N N   . HIS A 1 75  ? 44.763 -10.089 12.749  1.00 25.03 ? 75  HIS A N   1 
ATOM   611  C CA  . HIS A 1 75  ? 44.014 -11.065 11.982  1.00 25.50 ? 75  HIS A CA  1 
ATOM   612  C C   . HIS A 1 75  ? 44.803 -11.581 10.760  1.00 24.41 ? 75  HIS A C   1 
ATOM   613  O O   . HIS A 1 75  ? 44.821 -12.764 10.480  1.00 24.55 ? 75  HIS A O   1 
ATOM   614  C CB  . HIS A 1 75  ? 42.692 -10.441 11.530  1.00 26.03 ? 75  HIS A CB  1 
ATOM   615  C CG  . HIS A 1 75  ? 41.950 -11.260 10.521  1.00 28.65 ? 75  HIS A CG  1 
ATOM   616  N ND1 . HIS A 1 75  ? 41.173 -12.344 10.869  1.00 33.18 ? 75  HIS A ND1 1 
ATOM   617  C CD2 . HIS A 1 75  ? 41.866 -11.154 9.173   1.00 31.51 ? 75  HIS A CD2 1 
ATOM   618  C CE1 . HIS A 1 75  ? 40.644 -12.871 9.780   1.00 32.94 ? 75  HIS A CE1 1 
ATOM   619  N NE2 . HIS A 1 75  ? 41.049 -12.167 8.737   1.00 33.54 ? 75  HIS A NE2 1 
ATOM   620  N N   . GLN A 1 76  ? 45.440 -10.653 10.053  1.00 24.16 ? 76  GLN A N   1 
ATOM   621  C CA  . GLN A 1 76  ? 46.100 -10.925 8.792   1.00 23.38 ? 76  GLN A CA  1 
ATOM   622  C C   . GLN A 1 76  ? 47.478 -11.581 8.961   1.00 22.64 ? 76  GLN A C   1 
ATOM   623  O O   . GLN A 1 76  ? 47.862 -12.435 8.153   1.00 22.43 ? 76  GLN A O   1 
ATOM   624  C CB  . GLN A 1 76  ? 46.206 -9.611  8.001   1.00 24.18 ? 76  GLN A CB  1 
ATOM   625  C CG  . GLN A 1 76  ? 46.831 -9.728  6.617   1.00 24.66 ? 76  GLN A CG  1 
ATOM   626  C CD  . GLN A 1 76  ? 46.542 -8.499  5.772   1.00 25.94 ? 76  GLN A CD  1 
ATOM   627  O OE1 . GLN A 1 76  ? 45.652 -7.710  6.096   1.00 27.95 ? 76  GLN A OE1 1 
ATOM   628  N NE2 . GLN A 1 76  ? 47.289 -8.339  4.676   1.00 26.71 ? 76  GLN A NE2 1 
ATOM   629  N N   . PHE A 1 77  ? 48.222 -11.158 9.986   1.00 21.94 ? 77  PHE A N   1 
ATOM   630  C CA  . PHE A 1 77  ? 49.591 -11.648 10.199  1.00 21.70 ? 77  PHE A CA  1 
ATOM   631  C C   . PHE A 1 77  ? 49.733 -12.595 11.384  1.00 22.20 ? 77  PHE A C   1 
ATOM   632  O O   . PHE A 1 77  ? 50.728 -13.311 11.501  1.00 21.39 ? 77  PHE A O   1 
ATOM   633  C CB  . PHE A 1 77  ? 50.569 -10.479 10.331  1.00 21.65 ? 77  PHE A CB  1 
ATOM   634  C CG  . PHE A 1 77  ? 50.557 -9.570  9.131   1.00 20.78 ? 77  PHE A CG  1 
ATOM   635  C CD1 . PHE A 1 77  ? 49.815 -8.408  9.160   1.00 22.97 ? 77  PHE A CD1 1 
ATOM   636  C CD2 . PHE A 1 77  ? 51.258 -9.907  7.966   1.00 21.78 ? 77  PHE A CD2 1 
ATOM   637  C CE1 . PHE A 1 77  ? 49.756 -7.557  8.053   1.00 23.93 ? 77  PHE A CE1 1 
ATOM   638  C CE2 . PHE A 1 77  ? 51.212 -9.067  6.842   1.00 21.62 ? 77  PHE A CE2 1 
ATOM   639  C CZ  . PHE A 1 77  ? 50.456 -7.877  6.894   1.00 22.97 ? 77  PHE A CZ  1 
ATOM   640  N N   . GLY A 1 78  ? 48.726 -12.612 12.247  1.00 22.94 ? 78  GLY A N   1 
ATOM   641  C CA  . GLY A 1 78  ? 48.774 -13.459 13.434  1.00 24.37 ? 78  GLY A CA  1 
ATOM   642  C C   . GLY A 1 78  ? 48.973 -12.590 14.663  1.00 25.49 ? 78  GLY A C   1 
ATOM   643  O O   . GLY A 1 78  ? 49.642 -11.563 14.609  1.00 25.10 ? 78  GLY A O   1 
ATOM   644  N N   . GLN A 1 79  ? 48.366 -12.990 15.778  1.00 27.16 ? 79  GLN A N   1 
ATOM   645  C CA  . GLN A 1 79  ? 48.392 -12.163 16.983  1.00 29.60 ? 79  GLN A CA  1 
ATOM   646  C C   . GLN A 1 79  ? 49.818 -11.925 17.448  1.00 29.50 ? 79  GLN A C   1 
ATOM   647  O O   . GLN A 1 79  ? 50.159 -10.816 17.857  1.00 30.56 ? 79  GLN A O   1 
ATOM   648  C CB  . GLN A 1 79  ? 47.603 -12.812 18.120  1.00 29.68 ? 79  GLN A CB  1 
ATOM   649  C CG  . GLN A 1 79  ? 46.117 -12.910 17.884  1.00 32.24 ? 79  GLN A CG  1 
ATOM   650  C CD  . GLN A 1 79  ? 45.399 -13.633 19.025  1.00 33.47 ? 79  GLN A CD  1 
ATOM   651  O OE1 . GLN A 1 79  ? 45.969 -13.869 20.100  1.00 37.38 ? 79  GLN A OE1 1 
ATOM   652  N NE2 . GLN A 1 79  ? 44.143 -13.994 18.787  1.00 38.52 ? 79  GLN A NE2 1 
ATOM   653  N N   . GLU A 1 80  ? 50.644 -12.967 17.362  1.00 29.62 ? 80  GLU A N   1 
ATOM   654  C CA  . GLU A 1 80  ? 52.007 -12.892 17.879  1.00 30.14 ? 80  GLU A CA  1 
ATOM   655  C C   . GLU A 1 80  ? 53.009 -12.308 16.881  1.00 29.49 ? 80  GLU A C   1 
ATOM   656  O O   . GLU A 1 80  ? 54.104 -11.916 17.266  1.00 29.59 ? 80  GLU A O   1 
ATOM   657  C CB  . GLU A 1 80  ? 52.457 -14.248 18.432  1.00 31.07 ? 80  GLU A CB  1 
ATOM   658  C CG  . GLU A 1 80  ? 51.641 -14.719 19.645  1.00 34.96 ? 80  GLU A CG  1 
ATOM   659  C CD  . GLU A 1 80  ? 51.506 -13.643 20.723  1.00 40.65 ? 80  GLU A CD  1 
ATOM   660  O OE1 . GLU A 1 80  ? 52.532 -13.258 21.328  1.00 44.28 ? 80  GLU A OE1 1 
ATOM   661  O OE2 . GLU A 1 80  ? 50.372 -13.175 20.966  1.00 44.11 ? 80  GLU A OE2 1 
ATOM   662  N N   . LYS A 1 81  ? 52.611 -12.191 15.616  1.00 28.33 ? 81  LYS A N   1 
ATOM   663  C CA  . LYS A 1 81  ? 53.496 -11.606 14.599  1.00 27.30 ? 81  LYS A CA  1 
ATOM   664  C C   . LYS A 1 81  ? 53.198 -10.147 14.262  1.00 27.03 ? 81  LYS A C   1 
ATOM   665  O O   . LYS A 1 81  ? 54.030 -9.478  13.638  1.00 27.16 ? 81  LYS A O   1 
ATOM   666  C CB  . LYS A 1 81  ? 53.521 -12.469 13.326  1.00 27.42 ? 81  LYS A CB  1 
ATOM   667  C CG  . LYS A 1 81  ? 54.137 -13.834 13.563  1.00 27.98 ? 81  LYS A CG  1 
ATOM   668  C CD  . LYS A 1 81  ? 55.650 -13.742 13.796  1.00 30.37 ? 81  LYS A CD  1 
ATOM   669  C CE  . LYS A 1 81  ? 56.267 -15.112 13.857  1.00 31.98 ? 81  LYS A CE  1 
ATOM   670  N NZ  . LYS A 1 81  ? 57.762 -15.089 13.794  1.00 33.89 ? 81  LYS A NZ  1 
ATOM   671  N N   . ASP A 1 82  ? 52.027 -9.663  14.682  1.00 26.31 ? 82  ASP A N   1 
ATOM   672  C CA  . ASP A 1 82  ? 51.612 -8.272  14.474  1.00 26.30 ? 82  ASP A CA  1 
ATOM   673  C C   . ASP A 1 82  ? 52.708 -7.308  14.946  1.00 26.13 ? 82  ASP A C   1 
ATOM   674  O O   . ASP A 1 82  ? 53.195 -7.426  16.067  1.00 27.39 ? 82  ASP A O   1 
ATOM   675  C CB  . ASP A 1 82  ? 50.301 -7.991  15.227  1.00 26.46 ? 82  ASP A CB  1 
ATOM   676  C CG  . ASP A 1 82  ? 50.060 -6.523  15.443  1.00 27.78 ? 82  ASP A CG  1 
ATOM   677  O OD1 . ASP A 1 82  ? 50.098 -5.760  14.447  1.00 28.37 ? 82  ASP A OD1 1 
ATOM   678  O OD2 . ASP A 1 82  ? 49.866 -6.131  16.621  1.00 27.91 ? 82  ASP A OD2 1 
ATOM   679  N N   . VAL A 1 83  ? 53.130 -6.401  14.069  1.00 25.38 ? 83  VAL A N   1 
ATOM   680  C CA  . VAL A 1 83  ? 54.151 -5.419  14.437  1.00 25.56 ? 83  VAL A CA  1 
ATOM   681  C C   . VAL A 1 83  ? 53.538 -4.109  14.980  1.00 25.96 ? 83  VAL A C   1 
ATOM   682  O O   . VAL A 1 83  ? 54.233 -3.303  15.621  1.00 26.29 ? 83  VAL A O   1 
ATOM   683  C CB  . VAL A 1 83  ? 55.070 -5.080  13.237  1.00 26.11 ? 83  VAL A CB  1 
ATOM   684  C CG1 . VAL A 1 83  ? 55.801 -6.328  12.754  1.00 24.24 ? 83  VAL A CG1 1 
ATOM   685  C CG2 . VAL A 1 83  ? 54.274 -4.419  12.115  1.00 25.65 ? 83  VAL A CG2 1 
ATOM   686  N N   . PHE A 1 84  ? 52.249 -3.897  14.708  1.00 25.79 ? 84  PHE A N   1 
ATOM   687  C CA  . PHE A 1 84  ? 51.620 -2.612  15.011  1.00 26.69 ? 84  PHE A CA  1 
ATOM   688  C C   . PHE A 1 84  ? 51.299 -2.385  16.498  1.00 27.30 ? 84  PHE A C   1 
ATOM   689  O O   . PHE A 1 84  ? 51.632 -1.329  17.056  1.00 27.98 ? 84  PHE A O   1 
ATOM   690  C CB  . PHE A 1 84  ? 50.384 -2.396  14.138  1.00 27.03 ? 84  PHE A CB  1 
ATOM   691  C CG  . PHE A 1 84  ? 50.715 -1.994  12.734  1.00 26.69 ? 84  PHE A CG  1 
ATOM   692  C CD1 . PHE A 1 84  ? 51.144 -0.698  12.448  1.00 27.66 ? 84  PHE A CD1 1 
ATOM   693  C CD2 . PHE A 1 84  ? 50.618 -2.913  11.697  1.00 29.92 ? 84  PHE A CD2 1 
ATOM   694  C CE1 . PHE A 1 84  ? 51.451 -0.314  11.135  1.00 29.87 ? 84  PHE A CE1 1 
ATOM   695  C CE2 . PHE A 1 84  ? 50.924 -2.543  10.377  1.00 30.17 ? 84  PHE A CE2 1 
ATOM   696  C CZ  . PHE A 1 84  ? 51.335 -1.251  10.102  1.00 29.35 ? 84  PHE A CZ  1 
ATOM   697  N N   . ALA A 1 85  ? 50.620 -3.332  17.133  1.00 27.69 ? 85  ALA A N   1 
ATOM   698  C CA  . ALA A 1 85  ? 50.309 -3.145  18.562  1.00 28.33 ? 85  ALA A CA  1 
ATOM   699  C C   . ALA A 1 85  ? 51.586 -2.948  19.403  1.00 28.04 ? 85  ALA A C   1 
ATOM   700  O O   . ALA A 1 85  ? 51.658 -1.967  20.188  1.00 27.84 ? 85  ALA A O   1 
ATOM   701  C CB  . ALA A 1 85  ? 49.459 -4.295  19.115  1.00 29.24 ? 85  ALA A CB  1 
ATOM   702  N N   . PRO A 1 86  ? 52.612 -3.822  19.221  1.00 27.80 ? 86  PRO A N   1 
ATOM   703  C CA  . PRO A 1 86  ? 53.836 -3.550  19.979  1.00 27.50 ? 86  PRO A CA  1 
ATOM   704  C C   . PRO A 1 86  ? 54.422 -2.159  19.699  1.00 27.63 ? 86  PRO A C   1 
ATOM   705  O O   . PRO A 1 86  ? 54.902 -1.512  20.636  1.00 27.64 ? 86  PRO A O   1 
ATOM   706  C CB  . PRO A 1 86  ? 54.797 -4.657  19.518  1.00 27.15 ? 86  PRO A CB  1 
ATOM   707  C CG  . PRO A 1 86  ? 53.904 -5.763  19.101  1.00 27.79 ? 86  PRO A CG  1 
ATOM   708  C CD  . PRO A 1 86  ? 52.744 -5.077  18.438  1.00 27.06 ? 86  PRO A CD  1 
ATOM   709  N N   . ARG A 1 87  ? 54.382 -1.697  18.444  1.00 26.94 ? 87  ARG A N   1 
ATOM   710  C CA  . ARG A 1 87  ? 54.938 -0.386  18.142  1.00 26.61 ? 87  ARG A CA  1 
ATOM   711  C C   . ARG A 1 87  ? 54.083 0.746   18.737  1.00 27.10 ? 87  ARG A C   1 
ATOM   712  O O   . ARG A 1 87  ? 54.631 1.660   19.346  1.00 27.62 ? 87  ARG A O   1 
ATOM   713  C CB  . ARG A 1 87  ? 55.129 -0.185  16.637  1.00 26.74 ? 87  ARG A CB  1 
ATOM   714  C CG  . ARG A 1 87  ? 55.849 1.127   16.267  1.00 26.14 ? 87  ARG A CG  1 
ATOM   715  C CD  . ARG A 1 87  ? 57.287 1.157   16.800  1.00 27.47 ? 87  ARG A CD  1 
ATOM   716  N NE  . ARG A 1 87  ? 57.955 2.396   16.404  1.00 29.80 ? 87  ARG A NE  1 
ATOM   717  C CZ  . ARG A 1 87  ? 59.259 2.625   16.528  1.00 28.75 ? 87  ARG A CZ  1 
ATOM   718  N NH1 . ARG A 1 87  ? 60.061 1.697   17.036  1.00 30.14 ? 87  ARG A NH1 1 
ATOM   719  N NH2 . ARG A 1 87  ? 59.762 3.792   16.139  1.00 32.02 ? 87  ARG A NH2 1 
ATOM   720  N N   . PHE A 1 88  ? 52.766 0.672   18.574  1.00 26.74 ? 88  PHE A N   1 
ATOM   721  C CA  . PHE A 1 88  ? 51.863 1.653   19.211  1.00 26.97 ? 88  PHE A CA  1 
ATOM   722  C C   . PHE A 1 88  ? 52.027 1.701   20.735  1.00 27.67 ? 88  PHE A C   1 
ATOM   723  O O   . PHE A 1 88  ? 51.806 2.749   21.350  1.00 27.53 ? 88  PHE A O   1 
ATOM   724  C CB  . PHE A 1 88  ? 50.402 1.350   18.891  1.00 27.31 ? 88  PHE A CB  1 
ATOM   725  C CG  . PHE A 1 88  ? 49.925 1.900   17.550  1.00 26.60 ? 88  PHE A CG  1 
ATOM   726  C CD1 . PHE A 1 88  ? 49.842 3.283   17.332  1.00 28.56 ? 88  PHE A CD1 1 
ATOM   727  C CD2 . PHE A 1 88  ? 49.491 1.029   16.539  1.00 27.58 ? 88  PHE A CD2 1 
ATOM   728  C CE1 . PHE A 1 88  ? 49.375 3.806   16.109  1.00 28.37 ? 88  PHE A CE1 1 
ATOM   729  C CE2 . PHE A 1 88  ? 49.014 1.541   15.318  1.00 28.11 ? 88  PHE A CE2 1 
ATOM   730  C CZ  . PHE A 1 88  ? 48.946 2.921   15.103  1.00 26.99 ? 88  PHE A CZ  1 
ATOM   731  N N   . SER A 1 89  ? 52.390 0.570   21.341  1.00 27.00 ? 89  SER A N   1 
ATOM   732  C CA  A SER A 1 89  ? 52.519 0.503   22.804  0.50 27.05 ? 89  SER A CA  1 
ATOM   733  C CA  B SER A 1 89  ? 52.562 0.460   22.801  0.50 27.34 ? 89  SER A CA  1 
ATOM   734  C C   . SER A 1 89  ? 53.601 1.429   23.364  1.00 27.54 ? 89  SER A C   1 
ATOM   735  O O   . SER A 1 89  ? 53.484 1.889   24.507  1.00 27.68 ? 89  SER A O   1 
ATOM   736  C CB  A SER A 1 89  ? 52.781 -0.931  23.269  0.50 27.36 ? 89  SER A CB  1 
ATOM   737  C CB  B SER A 1 89  ? 52.959 -0.974  23.183  0.50 27.42 ? 89  SER A CB  1 
ATOM   738  O OG  A SER A 1 89  ? 54.113 -1.302  23.023  0.50 26.66 ? 89  SER A OG  1 
ATOM   739  O OG  B SER A 1 89  ? 51.899 -1.882  22.915  0.50 28.98 ? 89  SER A OG  1 
ATOM   740  N N   . ASN A 1 90  ? 54.647 1.711   22.571  1.00 27.56 ? 90  ASN A N   1 
ATOM   741  C CA  . ASN A 1 90  ? 55.777 2.527   23.045  1.00 27.16 ? 90  ASN A CA  1 
ATOM   742  C C   . ASN A 1 90  ? 55.290 3.874   23.607  1.00 27.10 ? 90  ASN A C   1 
ATOM   743  O O   . ASN A 1 90  ? 55.642 4.256   24.737  1.00 26.54 ? 90  ASN A O   1 
ATOM   744  C CB  . ASN A 1 90  ? 56.808 2.759   21.929  1.00 27.60 ? 90  ASN A CB  1 
ATOM   745  C CG  . ASN A 1 90  ? 57.482 1.458   21.448  1.00 30.08 ? 90  ASN A CG  1 
ATOM   746  O OD1 . ASN A 1 90  ? 57.233 0.371   21.976  1.00 32.69 ? 90  ASN A OD1 1 
ATOM   747  N ND2 . ASN A 1 90  ? 58.347 1.581   20.437  1.00 29.91 ? 90  ASN A ND2 1 
ATOM   748  N N   . ASN A 1 91  ? 54.478 4.572   22.818  1.00 26.07 ? 91  ASN A N   1 
ATOM   749  C CA  . ASN A 1 91  ? 54.009 5.919   23.194  1.00 26.95 ? 91  ASN A CA  1 
ATOM   750  C C   . ASN A 1 91  ? 52.561 5.983   23.635  1.00 27.08 ? 91  ASN A C   1 
ATOM   751  O O   . ASN A 1 91  ? 51.971 7.070   23.711  1.00 26.87 ? 91  ASN A O   1 
ATOM   752  C CB  . ASN A 1 91  ? 54.211 6.895   22.038  1.00 27.62 ? 91  ASN A CB  1 
ATOM   753  C CG  . ASN A 1 91  ? 55.656 7.095   21.698  1.00 29.18 ? 91  ASN A CG  1 
ATOM   754  O OD1 . ASN A 1 91  ? 56.520 7.101   22.577  1.00 30.94 ? 91  ASN A OD1 1 
ATOM   755  N ND2 . ASN A 1 91  ? 55.938 7.269   20.413  1.00 29.95 ? 91  ASN A ND2 1 
ATOM   756  N N   . ILE A 1 92  ? 51.984 4.826   23.934  1.00 26.40 ? 92  ILE A N   1 
ATOM   757  C CA  . ILE A 1 92  ? 50.525 4.719   24.080  1.00 26.95 ? 92  ILE A CA  1 
ATOM   758  C C   . ILE A 1 92  ? 49.962 5.588   25.216  1.00 25.24 ? 92  ILE A C   1 
ATOM   759  O O   . ILE A 1 92  ? 48.858 6.102   25.107  1.00 24.96 ? 92  ILE A O   1 
ATOM   760  C CB  . ILE A 1 92  ? 50.067 3.233   24.218  1.00 26.51 ? 92  ILE A CB  1 
ATOM   761  C CG1 . ILE A 1 92  ? 48.608 3.093   23.765  1.00 28.75 ? 92  ILE A CG1 1 
ATOM   762  C CG2 . ILE A 1 92  ? 50.385 2.658   25.615  1.00 28.24 ? 92  ILE A CG2 1 
ATOM   763  C CD1 . ILE A 1 92  ? 48.123 1.657   23.578  1.00 31.22 ? 92  ILE A CD1 1 
ATOM   764  N N   . ILE A 1 93  ? 50.733 5.762   26.292  1.00 24.85 ? 93  ILE A N   1 
ATOM   765  C CA  . ILE A 1 93  ? 50.259 6.599   27.414  1.00 24.91 ? 93  ILE A CA  1 
ATOM   766  C C   . ILE A 1 93  ? 50.055 8.047   26.927  1.00 25.51 ? 93  ILE A C   1 
ATOM   767  O O   . ILE A 1 93  ? 49.015 8.662   27.199  1.00 26.35 ? 93  ILE A O   1 
ATOM   768  C CB  . ILE A 1 93  ? 51.230 6.560   28.623  1.00 25.13 ? 93  ILE A CB  1 
ATOM   769  C CG1 . ILE A 1 93  ? 51.403 5.117   29.135  1.00 26.94 ? 93  ILE A CG1 1 
ATOM   770  C CG2 . ILE A 1 93  ? 50.768 7.501   29.758  1.00 25.09 ? 93  ILE A CG2 1 
ATOM   771  C CD1 . ILE A 1 93  ? 50.139 4.500   29.753  1.00 28.23 ? 93  ILE A CD1 1 
ATOM   772  N N   . SER A 1 94  ? 51.043 8.550   26.188  1.00 25.34 ? 94  SER A N   1 
ATOM   773  C CA  . SER A 1 94  ? 51.020 9.901   25.602  1.00 26.88 ? 94  SER A CA  1 
ATOM   774  C C   . SER A 1 94  ? 49.872 10.021  24.588  1.00 26.15 ? 94  SER A C   1 
ATOM   775  O O   . SER A 1 94  ? 49.134 11.018  24.555  1.00 26.23 ? 94  SER A O   1 
ATOM   776  C CB  . SER A 1 94  ? 52.349 10.173  24.884  1.00 26.66 ? 94  SER A CB  1 
ATOM   777  O OG  . SER A 1 94  ? 53.421 10.341  25.804  1.00 33.85 ? 94  SER A OG  1 
ATOM   778  N N   . THR A 1 95  ? 49.731 8.999   23.754  1.00 25.98 ? 95  THR A N   1 
ATOM   779  C CA  . THR A 1 95  ? 48.651 8.962   22.764  1.00 25.61 ? 95  THR A CA  1 
ATOM   780  C C   . THR A 1 95  ? 47.277 9.123   23.438  1.00 25.73 ? 95  THR A C   1 
ATOM   781  O O   . THR A 1 95  ? 46.438 9.954   23.025  1.00 25.17 ? 95  THR A O   1 
ATOM   782  C CB  . THR A 1 95  ? 48.724 7.674   21.949  1.00 26.33 ? 95  THR A CB  1 
ATOM   783  O OG1 . THR A 1 95  ? 50.026 7.566   21.374  1.00 26.95 ? 95  THR A OG1 1 
ATOM   784  C CG2 . THR A 1 95  ? 47.677 7.698   20.823  1.00 26.70 ? 95  THR A CG2 1 
ATOM   785  N N   . PHE A 1 96  ? 47.073 8.383   24.526  1.00 24.83 ? 96  PHE A N   1 
ATOM   786  C CA  . PHE A 1 96  ? 45.832 8.469   25.256  1.00 25.37 ? 96  PHE A CA  1 
ATOM   787  C C   . PHE A 1 96  ? 45.612 9.751   26.034  1.00 25.76 ? 96  PHE A C   1 
ATOM   788  O O   . PHE A 1 96  ? 44.460 10.205  26.150  1.00 26.01 ? 96  PHE A O   1 
ATOM   789  C CB  . PHE A 1 96  ? 45.622 7.228   26.099  1.00 25.50 ? 96  PHE A CB  1 
ATOM   790  C CG  . PHE A 1 96  ? 44.962 6.134   25.340  1.00 26.28 ? 96  PHE A CG  1 
ATOM   791  C CD1 . PHE A 1 96  ? 45.675 5.408   24.369  1.00 26.05 ? 96  PHE A CD1 1 
ATOM   792  C CD2 . PHE A 1 96  ? 43.624 5.835   25.569  1.00 27.17 ? 96  PHE A CD2 1 
ATOM   793  C CE1 . PHE A 1 96  ? 45.058 4.382   23.619  1.00 25.60 ? 96  PHE A CE1 1 
ATOM   794  C CE2 . PHE A 1 96  ? 42.984 4.807   24.823  1.00 27.93 ? 96  PHE A CE2 1 
ATOM   795  C CZ  . PHE A 1 96  ? 43.714 4.086   23.846  1.00 27.39 ? 96  PHE A CZ  1 
ATOM   796  N N   . GLN A 1 97  ? 46.691 10.341  26.552  1.00 25.91 ? 97  GLN A N   1 
ATOM   797  C CA  . GLN A 1 97  ? 46.599 11.681  27.115  1.00 26.78 ? 97  GLN A CA  1 
ATOM   798  C C   . GLN A 1 97  ? 46.013 12.653  26.083  1.00 27.08 ? 97  GLN A C   1 
ATOM   799  O O   . GLN A 1 97  ? 45.113 13.432  26.409  1.00 27.21 ? 97  GLN A O   1 
ATOM   800  C CB  . GLN A 1 97  ? 47.956 12.154  27.590  1.00 26.78 ? 97  GLN A CB  1 
ATOM   801  C CG  . GLN A 1 97  ? 47.876 13.304  28.550  1.00 29.18 ? 97  GLN A CG  1 
ATOM   802  C CD  . GLN A 1 97  ? 49.238 13.661  29.050  1.00 31.05 ? 97  GLN A CD  1 
ATOM   803  O OE1 . GLN A 1 97  ? 50.238 13.425  28.364  1.00 31.90 ? 97  GLN A OE1 1 
ATOM   804  N NE2 . GLN A 1 97  ? 49.303 14.203  30.254  1.00 32.08 ? 97  GLN A NE2 1 
ATOM   805  N N   . ASN A 1 98  ? 46.490 12.550  24.839  1.00 26.79 ? 98  ASN A N   1 
ATOM   806  C CA  . ASN A 1 98  ? 45.969 13.355  23.734  1.00 27.68 ? 98  ASN A CA  1 
ATOM   807  C C   . ASN A 1 98  ? 44.522 12.991  23.395  1.00 27.59 ? 98  ASN A C   1 
ATOM   808  O O   . ASN A 1 98  ? 43.692 13.887  23.168  1.00 27.53 ? 98  ASN A O   1 
ATOM   809  C CB  . ASN A 1 98  ? 46.853 13.212  22.490  1.00 28.28 ? 98  ASN A CB  1 
ATOM   810  C CG  . ASN A 1 98  ? 48.240 13.788  22.682  1.00 29.46 ? 98  ASN A CG  1 
ATOM   811  O OD1 . ASN A 1 98  ? 48.457 14.676  23.519  1.00 32.59 ? 98  ASN A OD1 1 
ATOM   812  N ND2 . ASN A 1 98  ? 49.194 13.295  21.897  1.00 29.80 ? 98  ASN A ND2 1 
ATOM   813  N N   . LEU A 1 99  ? 44.224 11.691  23.360  1.00 26.81 ? 99  LEU A N   1 
ATOM   814  C CA  . LEU A 1 99  ? 42.858 11.207  23.054  1.00 27.41 ? 99  LEU A CA  1 
ATOM   815  C C   . LEU A 1 99  ? 41.798 11.682  24.055  1.00 28.38 ? 99  LEU A C   1 
ATOM   816  O O   . LEU A 1 99  ? 40.683 12.043  23.659  1.00 29.02 ? 99  LEU A O   1 
ATOM   817  C CB  . LEU A 1 99  ? 42.831 9.681   22.969  1.00 27.52 ? 99  LEU A CB  1 
ATOM   818  C CG  . LEU A 1 99  ? 43.527 9.038   21.777  1.00 25.27 ? 99  LEU A CG  1 
ATOM   819  C CD1 . LEU A 1 99  ? 43.552 7.542   22.014  1.00 28.94 ? 99  LEU A CD1 1 
ATOM   820  C CD2 . LEU A 1 99  ? 42.752 9.358   20.484  1.00 27.01 ? 99  LEU A CD2 1 
ATOM   821  N N   . TYR A 1 100 ? 42.147 11.710  25.342  1.00 29.10 ? 100 TYR A N   1 
ATOM   822  C CA  . TYR A 1 100 ? 41.172 12.077  26.370  1.00 30.13 ? 100 TYR A CA  1 
ATOM   823  C C   . TYR A 1 100 ? 40.820 13.576  26.368  1.00 31.07 ? 100 TYR A C   1 
ATOM   824  O O   . TYR A 1 100 ? 39.989 14.024  27.171  1.00 31.50 ? 100 TYR A O   1 
ATOM   825  C CB  . TYR A 1 100 ? 41.615 11.608  27.758  1.00 29.71 ? 100 TYR A CB  1 
ATOM   826  C CG  . TYR A 1 100 ? 41.459 10.113  27.995  1.00 29.75 ? 100 TYR A CG  1 
ATOM   827  C CD1 . TYR A 1 100 ? 40.205 9.488   27.883  1.00 29.47 ? 100 TYR A CD1 1 
ATOM   828  C CD2 . TYR A 1 100 ? 42.550 9.336   28.377  1.00 29.01 ? 100 TYR A CD2 1 
ATOM   829  C CE1 . TYR A 1 100 ? 40.057 8.121   28.119  1.00 29.05 ? 100 TYR A CE1 1 
ATOM   830  C CE2 . TYR A 1 100 ? 42.414 7.961   28.610  1.00 29.35 ? 100 TYR A CE2 1 
ATOM   831  C CZ  . TYR A 1 100 ? 41.168 7.367   28.483  1.00 29.57 ? 100 TYR A CZ  1 
ATOM   832  O OH  . TYR A 1 100 ? 41.028 6.010   28.717  1.00 30.02 ? 100 TYR A OH  1 
ATOM   833  N N   . ARG A 1 101 ? 41.446 14.333  25.465  1.00 32.07 ? 101 ARG A N   1 
ATOM   834  C CA  . ARG A 1 101 ? 41.092 15.744  25.233  1.00 34.22 ? 101 ARG A CA  1 
ATOM   835  C C   . ARG A 1 101 ? 39.966 15.882  24.186  1.00 34.35 ? 101 ARG A C   1 
ATOM   836  O O   . ARG A 1 101 ? 39.759 16.938  23.573  1.00 35.40 ? 101 ARG A O   1 
ATOM   837  C CB  . ARG A 1 101 ? 42.339 16.559  24.867  1.00 34.23 ? 101 ARG A CB  1 
ATOM   838  C CG  . ARG A 1 101 ? 43.416 16.517  25.969  1.00 35.98 ? 101 ARG A CG  1 
ATOM   839  C CD  . ARG A 1 101 ? 44.510 17.547  25.764  1.00 36.92 ? 101 ARG A CD  1 
ATOM   840  N NE  . ARG A 1 101 ? 45.481 17.542  26.864  1.00 42.96 ? 101 ARG A NE  1 
ATOM   841  C CZ  . ARG A 1 101 ? 46.654 16.907  26.836  1.00 44.44 ? 101 ARG A CZ  1 
ATOM   842  N NH1 . ARG A 1 101 ? 47.023 16.220  25.760  1.00 46.01 ? 101 ARG A NH1 1 
ATOM   843  N NH2 . ARG A 1 101 ? 47.464 16.962  27.884  1.00 45.74 ? 101 ARG A NH2 1 
ATOM   844  N N   . CYS A 1 102 ? 39.229 14.793  24.016  1.00 34.67 ? 102 CYS A N   1 
ATOM   845  C CA  . CYS A 1 102 ? 38.057 14.737  23.157  1.00 34.56 ? 102 CYS A CA  1 
ATOM   846  C C   . CYS A 1 102 ? 36.866 15.409  23.854  1.00 34.35 ? 102 CYS A C   1 
ATOM   847  O O   . CYS A 1 102 ? 36.913 15.652  25.065  1.00 34.02 ? 102 CYS A O   1 
ATOM   848  C CB  . CYS A 1 102 ? 37.718 13.278  22.890  1.00 34.84 ? 102 CYS A CB  1 
ATOM   849  S SG  . CYS A 1 102 ? 37.377 12.336  24.396  1.00 36.05 ? 102 CYS A SG  1 
ATOM   850  N N   . PRO A 1 103 ? 35.779 15.681  23.102  1.00 34.24 ? 103 PRO A N   1 
ATOM   851  C CA  . PRO A 1 103 ? 34.574 16.189  23.754  1.00 34.43 ? 103 PRO A CA  1 
ATOM   852  C C   . PRO A 1 103 ? 34.089 15.197  24.809  1.00 34.74 ? 103 PRO A C   1 
ATOM   853  O O   . PRO A 1 103 ? 34.265 13.995  24.646  1.00 34.13 ? 103 PRO A O   1 
ATOM   854  C CB  . PRO A 1 103 ? 33.561 16.295  22.607  1.00 34.49 ? 103 PRO A CB  1 
ATOM   855  C CG  . PRO A 1 103 ? 34.388 16.367  21.365  1.00 34.55 ? 103 PRO A CG  1 
ATOM   856  C CD  . PRO A 1 103 ? 35.600 15.525  21.647  1.00 34.09 ? 103 PRO A CD  1 
ATOM   857  N N   . GLY A 1 104 ? 33.497 15.705  25.888  1.00 35.24 ? 104 GLY A N   1 
ATOM   858  C CA  . GLY A 1 104 ? 33.056 14.866  27.008  1.00 36.24 ? 104 GLY A CA  1 
ATOM   859  C C   . GLY A 1 104 ? 32.174 13.690  26.617  1.00 36.93 ? 104 GLY A C   1 
ATOM   860  O O   . GLY A 1 104 ? 32.253 12.619  27.224  1.00 37.36 ? 104 GLY A O   1 
ATOM   861  N N   . ASP A 1 105 ? 31.357 13.881  25.583  1.00 37.47 ? 105 ASP A N   1 
ATOM   862  C CA  . ASP A 1 105 ? 30.442 12.841  25.109  1.00 38.16 ? 105 ASP A CA  1 
ATOM   863  C C   . ASP A 1 105 ? 31.174 11.721  24.360  1.00 37.81 ? 105 ASP A C   1 
ATOM   864  O O   . ASP A 1 105 ? 30.603 10.654  24.116  1.00 38.48 ? 105 ASP A O   1 
ATOM   865  C CB  . ASP A 1 105 ? 29.325 13.448  24.242  1.00 38.81 ? 105 ASP A CB  1 
ATOM   866  C CG  . ASP A 1 105 ? 29.660 13.443  22.756  1.00 41.18 ? 105 ASP A CG  1 
ATOM   867  O OD1 . ASP A 1 105 ? 30.619 14.139  22.344  1.00 43.92 ? 105 ASP A OD1 1 
ATOM   868  O OD2 . ASP A 1 105 ? 28.959 12.734  21.998  1.00 43.75 ? 105 ASP A OD2 1 
ATOM   869  N N   . ASP A 1 106 ? 32.430 11.980  23.997  1.00 37.05 ? 106 ASP A N   1 
ATOM   870  C CA  . ASP A 1 106 ? 33.256 11.025  23.262  1.00 36.35 ? 106 ASP A CA  1 
ATOM   871  C C   . ASP A 1 106 ? 34.092 10.115  24.175  1.00 35.60 ? 106 ASP A C   1 
ATOM   872  O O   . ASP A 1 106 ? 34.652 9.122   23.718  1.00 35.02 ? 106 ASP A O   1 
ATOM   873  C CB  . ASP A 1 106 ? 34.165 11.763  22.271  1.00 36.62 ? 106 ASP A CB  1 
ATOM   874  C CG  . ASP A 1 106 ? 33.487 12.051  20.938  1.00 37.47 ? 106 ASP A CG  1 
ATOM   875  O OD1 . ASP A 1 106 ? 32.257 11.823  20.794  1.00 39.72 ? 106 ASP A OD1 1 
ATOM   876  O OD2 . ASP A 1 106 ? 34.190 12.515  20.016  1.00 38.24 ? 106 ASP A OD2 1 
ATOM   877  N N   . LYS A 1 107 ? 34.162 10.446  25.466  1.00 35.16 ? 107 LYS A N   1 
ATOM   878  C CA  . LYS A 1 107 ? 34.942 9.671   26.435  1.00 34.32 ? 107 LYS A CA  1 
ATOM   879  C C   . LYS A 1 107 ? 34.498 8.205   26.598  1.00 33.71 ? 107 LYS A C   1 
ATOM   880  O O   . LYS A 1 107 ? 35.343 7.302   26.726  1.00 32.87 ? 107 LYS A O   1 
ATOM   881  C CB  . LYS A 1 107 ? 34.968 10.389  27.791  1.00 35.29 ? 107 LYS A CB  1 
ATOM   882  C CG  . LYS A 1 107 ? 35.819 9.711   28.851  1.00 36.79 ? 107 LYS A CG  1 
ATOM   883  C CD  . LYS A 1 107 ? 35.258 10.030  30.230  1.00 40.61 ? 107 LYS A CD  1 
ATOM   884  C CE  . LYS A 1 107 ? 36.060 9.367   31.331  1.00 40.89 ? 107 LYS A CE  1 
ATOM   885  N NZ  . LYS A 1 107 ? 35.465 9.653   32.670  1.00 42.09 ? 107 LYS A NZ  1 
ATOM   886  N N   . SER A 1 108 ? 33.183 7.966   26.585  1.00 32.95 ? 108 SER A N   1 
ATOM   887  C CA  . SER A 1 108 ? 32.653 6.608   26.715  1.00 32.36 ? 108 SER A CA  1 
ATOM   888  C C   . SER A 1 108 ? 33.061 5.733   25.540  1.00 31.49 ? 108 SER A C   1 
ATOM   889  O O   . SER A 1 108 ? 33.179 4.522   25.679  1.00 31.74 ? 108 SER A O   1 
ATOM   890  C CB  . SER A 1 108 ? 31.121 6.624   26.832  1.00 32.44 ? 108 SER A CB  1 
ATOM   891  O OG  . SER A 1 108 ? 30.548 7.276   25.714  1.00 33.92 ? 108 SER A OG  1 
ATOM   892  N N   . LYS A 1 109 ? 33.260 6.360   24.384  1.00 30.79 ? 109 LYS A N   1 
ATOM   893  C CA  . LYS A 1 109 ? 33.643 5.651   23.168  1.00 30.81 ? 109 LYS A CA  1 
ATOM   894  C C   . LYS A 1 109 ? 35.071 5.110   23.313  1.00 29.91 ? 109 LYS A C   1 
ATOM   895  O O   . LYS A 1 109 ? 35.376 4.022   22.830  1.00 29.69 ? 109 LYS A O   1 
ATOM   896  C CB  . LYS A 1 109 ? 33.530 6.566   21.946  1.00 31.25 ? 109 LYS A CB  1 
ATOM   897  C CG  . LYS A 1 109 ? 32.129 7.186   21.731  1.00 32.43 ? 109 LYS A CG  1 
ATOM   898  C CD  . LYS A 1 109 ? 32.088 7.964   20.417  1.00 32.76 ? 109 LYS A CD  1 
ATOM   899  C CE  . LYS A 1 109 ? 30.706 8.588   20.159  1.00 34.48 ? 109 LYS A CE  1 
ATOM   900  N NZ  . LYS A 1 109 ? 30.343 9.664   21.131  1.00 38.66 ? 109 LYS A NZ  1 
ATOM   901  N N   . ILE A 1 110 ? 35.920 5.861   24.018  1.00 29.28 ? 110 ILE A N   1 
ATOM   902  C CA  . ILE A 1 110 ? 37.305 5.426   24.286  1.00 28.83 ? 110 ILE A CA  1 
ATOM   903  C C   . ILE A 1 110 ? 37.363 4.200   25.198  1.00 27.78 ? 110 ILE A C   1 
ATOM   904  O O   . ILE A 1 110 ? 38.046 3.220   24.886  1.00 27.69 ? 110 ILE A O   1 
ATOM   905  C CB  . ILE A 1 110 ? 38.184 6.569   24.840  1.00 28.92 ? 110 ILE A CB  1 
ATOM   906  C CG1 . ILE A 1 110 ? 38.321 7.696   23.811  1.00 29.49 ? 110 ILE A CG1 1 
ATOM   907  C CG2 . ILE A 1 110 ? 39.578 6.039   25.244  1.00 28.76 ? 110 ILE A CG2 1 
ATOM   908  C CD1 . ILE A 1 110 ? 38.957 8.944   24.362  1.00 30.59 ? 110 ILE A CD1 1 
ATOM   909  N N   . VAL A 1 111 ? 36.647 4.261   26.316  1.00 27.34 ? 111 VAL A N   1 
ATOM   910  C CA  . VAL A 1 111 ? 36.578 3.158   27.273  1.00 27.24 ? 111 VAL A CA  1 
ATOM   911  C C   . VAL A 1 111 ? 36.062 1.868   26.610  1.00 27.07 ? 111 VAL A C   1 
ATOM   912  O O   . VAL A 1 111 ? 36.556 0.777   26.894  1.00 26.36 ? 111 VAL A O   1 
ATOM   913  C CB  . VAL A 1 111 ? 35.760 3.569   28.517  1.00 27.89 ? 111 VAL A CB  1 
ATOM   914  C CG1 . VAL A 1 111 ? 35.391 2.358   29.385  1.00 29.37 ? 111 VAL A CG1 1 
ATOM   915  C CG2 . VAL A 1 111 ? 36.569 4.569   29.315  1.00 27.15 ? 111 VAL A CG2 1 
ATOM   916  N N   . ARG A 1 112 ? 35.077 2.019   25.726  1.00 26.93 ? 112 ARG A N   1 
ATOM   917  C CA  A ARG A 1 112 ? 34.555 0.908   24.954  0.50 27.47 ? 112 ARG A CA  1 
ATOM   918  C CA  B ARG A 1 112 ? 34.563 0.907   24.942  0.50 27.08 ? 112 ARG A CA  1 
ATOM   919  C C   . ARG A 1 112 ? 35.697 0.192   24.216  1.00 26.64 ? 112 ARG A C   1 
ATOM   920  O O   . ARG A 1 112 ? 35.823 -1.042  24.286  1.00 26.91 ? 112 ARG A O   1 
ATOM   921  C CB  A ARG A 1 112 ? 33.496 1.423   23.969  0.50 27.65 ? 112 ARG A CB  1 
ATOM   922  C CB  B ARG A 1 112 ? 33.544 1.419   23.923  0.50 27.59 ? 112 ARG A CB  1 
ATOM   923  C CG  A ARG A 1 112 ? 32.465 0.392   23.555  0.50 28.76 ? 112 ARG A CG  1 
ATOM   924  C CG  B ARG A 1 112 ? 33.020 0.362   22.956  0.50 28.44 ? 112 ARG A CG  1 
ATOM   925  C CD  A ARG A 1 112 ? 31.297 1.005   22.762  0.50 29.25 ? 112 ARG A CD  1 
ATOM   926  C CD  B ARG A 1 112 ? 31.736 0.843   22.272  0.50 32.24 ? 112 ARG A CD  1 
ATOM   927  N NE  A ARG A 1 112 ? 30.557 2.027   23.508  0.50 33.11 ? 112 ARG A NE  1 
ATOM   928  N NE  B ARG A 1 112 ? 30.961 1.726   23.149  0.50 34.94 ? 112 ARG A NE  1 
ATOM   929  C CZ  A ARG A 1 112 ? 30.450 3.303   23.138  0.50 34.11 ? 112 ARG A CZ  1 
ATOM   930  C CZ  B ARG A 1 112 ? 30.135 1.323   24.114  0.50 36.13 ? 112 ARG A CZ  1 
ATOM   931  N NH1 A ARG A 1 112 ? 31.030 3.732   22.020  0.50 33.57 ? 112 ARG A NH1 1 
ATOM   932  N NH1 B ARG A 1 112 ? 29.945 0.031   24.351  0.50 37.20 ? 112 ARG A NH1 1 
ATOM   933  N NH2 A ARG A 1 112 ? 29.756 4.154   23.884  0.50 33.97 ? 112 ARG A NH2 1 
ATOM   934  N NH2 B ARG A 1 112 ? 29.496 2.220   24.851  0.50 36.59 ? 112 ARG A NH2 1 
ATOM   935  N N   . VAL A 1 113 ? 36.508 0.961   23.501  1.00 26.34 ? 113 VAL A N   1 
ATOM   936  C CA  . VAL A 1 113 ? 37.650 0.401   22.780  1.00 26.23 ? 113 VAL A CA  1 
ATOM   937  C C   . VAL A 1 113 ? 38.594 -0.300  23.759  1.00 26.14 ? 113 VAL A C   1 
ATOM   938  O O   . VAL A 1 113 ? 39.034 -1.420  23.492  1.00 25.84 ? 113 VAL A O   1 
ATOM   939  C CB  . VAL A 1 113 ? 38.400 1.472   21.940  1.00 27.27 ? 113 VAL A CB  1 
ATOM   940  C CG1 . VAL A 1 113 ? 39.713 0.927   21.384  1.00 27.82 ? 113 VAL A CG1 1 
ATOM   941  C CG2 . VAL A 1 113 ? 37.513 1.958   20.764  1.00 27.41 ? 113 VAL A CG2 1 
ATOM   942  N N   . LEU A 1 114 ? 38.906 0.350   24.885  1.00 25.23 ? 114 LEU A N   1 
ATOM   943  C CA  . LEU A 1 114 ? 39.820 -0.239  25.871  1.00 25.44 ? 114 LEU A CA  1 
ATOM   944  C C   . LEU A 1 114 ? 39.287 -1.547  26.423  1.00 25.64 ? 114 LEU A C   1 
ATOM   945  O O   . LEU A 1 114 ? 40.032 -2.507  26.580  1.00 25.74 ? 114 LEU A O   1 
ATOM   946  C CB  . LEU A 1 114 ? 40.112 0.733   27.031  1.00 25.17 ? 114 LEU A CB  1 
ATOM   947  C CG  . LEU A 1 114 ? 40.996 1.938   26.734  1.00 25.39 ? 114 LEU A CG  1 
ATOM   948  C CD1 . LEU A 1 114 ? 41.072 2.820   27.990  1.00 25.75 ? 114 LEU A CD1 1 
ATOM   949  C CD2 . LEU A 1 114 ? 42.402 1.489   26.274  1.00 27.72 ? 114 LEU A CD2 1 
ATOM   950  N N   . ASN A 1 115 ? 37.989 -1.588  26.704  1.00 25.86 ? 115 ASN A N   1 
ATOM   951  C CA  . ASN A 1 115 ? 37.370 -2.812  27.183  1.00 26.62 ? 115 ASN A CA  1 
ATOM   952  C C   . ASN A 1 115 ? 37.508 -3.947  26.178  1.00 26.17 ? 115 ASN A C   1 
ATOM   953  O O   . ASN A 1 115 ? 37.752 -5.103  26.544  1.00 25.98 ? 115 ASN A O   1 
ATOM   954  C CB  . ASN A 1 115 ? 35.888 -2.573  27.529  1.00 27.12 ? 115 ASN A CB  1 
ATOM   955  C CG  . ASN A 1 115 ? 35.687 -2.098  28.961  1.00 31.08 ? 115 ASN A CG  1 
ATOM   956  O OD1 . ASN A 1 115 ? 36.528 -2.339  29.832  1.00 37.08 ? 115 ASN A OD1 1 
ATOM   957  N ND2 . ASN A 1 115 ? 34.565 -1.427  29.216  1.00 34.14 ? 115 ASN A ND2 1 
ATOM   958  N N   . LEU A 1 116 ? 37.333 -3.618  24.901  1.00 25.16 ? 116 LEU A N   1 
ATOM   959  C CA  . LEU A 1 116 ? 37.436 -4.629  23.858  1.00 25.64 ? 116 LEU A CA  1 
ATOM   960  C C   . LEU A 1 116 ? 38.878 -5.090  23.692  1.00 25.47 ? 116 LEU A C   1 
ATOM   961  O O   . LEU A 1 116 ? 39.136 -6.278  23.479  1.00 26.08 ? 116 LEU A O   1 
ATOM   962  C CB  . LEU A 1 116 ? 36.863 -4.110  22.543  1.00 25.90 ? 116 LEU A CB  1 
ATOM   963  C CG  . LEU A 1 116 ? 35.324 -4.013  22.579  1.00 25.93 ? 116 LEU A CG  1 
ATOM   964  C CD1 . LEU A 1 116 ? 34.801 -3.262  21.365  1.00 27.65 ? 116 LEU A CD1 1 
ATOM   965  C CD2 . LEU A 1 116 ? 34.642 -5.384  22.703  1.00 29.66 ? 116 LEU A CD2 1 
ATOM   966  N N   . TRP A 1 117 ? 39.814 -4.147  23.791  1.00 24.83 ? 117 TRP A N   1 
ATOM   967  C CA  . TRP A 1 117 ? 41.237 -4.492  23.781  1.00 25.21 ? 117 TRP A CA  1 
ATOM   968  C C   . TRP A 1 117 ? 41.568 -5.438  24.932  1.00 25.40 ? 117 TRP A C   1 
ATOM   969  O O   . TRP A 1 117 ? 42.272 -6.432  24.753  1.00 25.66 ? 117 TRP A O   1 
ATOM   970  C CB  . TRP A 1 117 ? 42.103 -3.237  23.849  1.00 26.44 ? 117 TRP A CB  1 
ATOM   971  C CG  . TRP A 1 117 ? 42.165 -2.450  22.552  1.00 25.39 ? 117 TRP A CG  1 
ATOM   972  C CD1 . TRP A 1 117 ? 41.605 -2.763  21.338  1.00 28.11 ? 117 TRP A CD1 1 
ATOM   973  C CD2 . TRP A 1 117 ? 42.862 -1.226  22.372  1.00 25.48 ? 117 TRP A CD2 1 
ATOM   974  N NE1 . TRP A 1 117 ? 41.933 -1.784  20.398  1.00 26.84 ? 117 TRP A NE1 1 
ATOM   975  C CE2 . TRP A 1 117 ? 42.701 -0.836  21.015  1.00 27.13 ? 117 TRP A CE2 1 
ATOM   976  C CE3 . TRP A 1 117 ? 43.621 -0.419  23.230  1.00 26.30 ? 117 TRP A CE3 1 
ATOM   977  C CZ2 . TRP A 1 117 ? 43.261 0.330   20.501  1.00 29.07 ? 117 TRP A CZ2 1 
ATOM   978  C CZ3 . TRP A 1 117 ? 44.183 0.742   22.723  1.00 27.76 ? 117 TRP A CZ3 1 
ATOM   979  C CH2 . TRP A 1 117 ? 43.996 1.105   21.362  1.00 28.86 ? 117 TRP A CH2 1 
ATOM   980  N N   . GLN A 1 118 ? 41.017 -5.159  26.109  1.00 24.93 ? 118 GLN A N   1 
ATOM   981  C CA  . GLN A 1 118 ? 41.307 -6.003  27.260  1.00 25.02 ? 118 GLN A CA  1 
ATOM   982  C C   . GLN A 1 118 ? 40.753 -7.414  27.053  1.00 25.74 ? 118 GLN A C   1 
ATOM   983  O O   . GLN A 1 118 ? 41.441 -8.415  27.285  1.00 25.91 ? 118 GLN A O   1 
ATOM   984  C CB  . GLN A 1 118 ? 40.763 -5.374  28.542  1.00 25.12 ? 118 GLN A CB  1 
ATOM   985  C CG  . GLN A 1 118 ? 41.369 -6.046  29.742  1.00 24.10 ? 118 GLN A CG  1 
ATOM   986  C CD  . GLN A 1 118 ? 40.812 -5.613  31.076  1.00 23.90 ? 118 GLN A CD  1 
ATOM   987  O OE1 . GLN A 1 118 ? 41.470 -5.824  32.088  1.00 24.36 ? 118 GLN A OE1 1 
ATOM   988  N NE2 . GLN A 1 118 ? 39.576 -5.078  31.105  1.00 21.95 ? 118 GLN A NE2 1 
ATOM   989  N N   . LYS A 1 119 ? 39.507 -7.493  26.592  1.00 25.78 ? 119 LYS A N   1 
ATOM   990  C CA  . LYS A 1 119 ? 38.863 -8.781  26.333  1.00 26.75 ? 119 LYS A CA  1 
ATOM   991  C C   . LYS A 1 119 ? 39.641 -9.639  25.329  1.00 27.72 ? 119 LYS A C   1 
ATOM   992  O O   . LYS A 1 119 ? 39.786 -10.845 25.518  1.00 27.93 ? 119 LYS A O   1 
ATOM   993  C CB  . LYS A 1 119 ? 37.421 -8.559  25.859  1.00 26.85 ? 119 LYS A CB  1 
ATOM   994  C CG  . LYS A 1 119 ? 36.619 -9.833  25.668  1.00 26.16 ? 119 LYS A CG  1 
ATOM   995  C CD  . LYS A 1 119 ? 36.762 -10.394 24.255  1.00 27.19 ? 119 LYS A CD  1 
ATOM   996  C CE  . LYS A 1 119 ? 35.910 -11.628 24.060  1.00 28.73 ? 119 LYS A CE  1 
ATOM   997  N NZ  . LYS A 1 119 ? 36.170 -12.191 22.691  1.00 30.25 ? 119 LYS A NZ  1 
ATOM   998  N N   . ASN A 1 120 ? 40.131 -9.002  24.265  1.00 28.53 ? 120 ASN A N   1 
ATOM   999  C CA  . ASN A 1 120 ? 40.806 -9.688  23.166  1.00 30.16 ? 120 ASN A CA  1 
ATOM   1000 C C   . ASN A 1 120 ? 42.332 -9.729  23.293  1.00 31.32 ? 120 ASN A C   1 
ATOM   1001 O O   . ASN A 1 120 ? 43.025 -10.164 22.360  1.00 32.38 ? 120 ASN A O   1 
ATOM   1002 C CB  . ASN A 1 120 ? 40.420 -9.033  21.840  1.00 30.33 ? 120 ASN A CB  1 
ATOM   1003 C CG  . ASN A 1 120 ? 38.990 -9.293  21.463  1.00 30.35 ? 120 ASN A CG  1 
ATOM   1004 O OD1 . ASN A 1 120 ? 38.605 -10.426 21.173  1.00 30.94 ? 120 ASN A OD1 1 
ATOM   1005 N ND2 . ASN A 1 120 ? 38.188 -8.245  21.458  1.00 32.30 ? 120 ASN A ND2 1 
ATOM   1006 N N   . ASN A 1 121 ? 42.836 -9.272  24.440  1.00 32.50 ? 121 ASN A N   1 
ATOM   1007 C CA  . ASN A 1 121 ? 44.271 -9.225  24.750  1.00 33.96 ? 121 ASN A CA  1 
ATOM   1008 C C   . ASN A 1 121 ? 45.087 -8.535  23.661  1.00 34.81 ? 121 ASN A C   1 
ATOM   1009 O O   . ASN A 1 121 ? 46.167 -9.002  23.292  1.00 35.11 ? 121 ASN A O   1 
ATOM   1010 C CB  . ASN A 1 121 ? 44.819 -10.629 25.029  1.00 34.60 ? 121 ASN A CB  1 
ATOM   1011 C CG  . ASN A 1 121 ? 44.167 -11.277 26.223  1.00 35.65 ? 121 ASN A CG  1 
ATOM   1012 O OD1 . ASN A 1 121 ? 44.246 -10.775 27.348  1.00 37.43 ? 121 ASN A OD1 1 
ATOM   1013 N ND2 . ASN A 1 121 ? 43.521 -12.407 25.992  1.00 37.79 ? 121 ASN A ND2 1 
ATOM   1014 N N   . VAL A 1 122 ? 44.561 -7.420  23.166  1.00 34.98 ? 122 VAL A N   1 
ATOM   1015 C CA  . VAL A 1 122 ? 45.185 -6.679  22.066  1.00 36.22 ? 122 VAL A CA  1 
ATOM   1016 C C   . VAL A 1 122 ? 46.476 -6.008  22.551  1.00 37.32 ? 122 VAL A C   1 
ATOM   1017 O O   . VAL A 1 122 ? 47.461 -5.919  21.801  1.00 38.04 ? 122 VAL A O   1 
ATOM   1018 C CB  . VAL A 1 122 ? 44.195 -5.669  21.446  1.00 35.48 ? 122 VAL A CB  1 
ATOM   1019 C CG1 . VAL A 1 122 ? 44.859 -4.818  20.353  1.00 37.17 ? 122 VAL A CG1 1 
ATOM   1020 C CG2 . VAL A 1 122 ? 42.983 -6.376  20.891  1.00 35.65 ? 122 VAL A CG2 1 
ATOM   1021 N N   . PHE A 1 123 ? 46.458 -5.534  23.797  1.00 37.96 ? 123 PHE A N   1 
ATOM   1022 C CA  . PHE A 1 123 ? 47.658 -5.075  24.508  1.00 38.81 ? 123 PHE A CA  1 
ATOM   1023 C C   . PHE A 1 123 ? 47.706 -5.819  25.843  1.00 39.33 ? 123 PHE A C   1 
ATOM   1024 O O   . PHE A 1 123 ? 46.665 -6.293  26.334  1.00 39.48 ? 123 PHE A O   1 
ATOM   1025 C CB  . PHE A 1 123 ? 47.638 -3.543  24.731  1.00 38.38 ? 123 PHE A CB  1 
ATOM   1026 C CG  . PHE A 1 123 ? 47.671 -2.728  23.465  1.00 38.23 ? 123 PHE A CG  1 
ATOM   1027 C CD1 . PHE A 1 123 ? 48.886 -2.318  22.913  1.00 36.45 ? 123 PHE A CD1 1 
ATOM   1028 C CD2 . PHE A 1 123 ? 46.494 -2.354  22.819  1.00 36.85 ? 123 PHE A CD2 1 
ATOM   1029 C CE1 . PHE A 1 123 ? 48.920 -1.549  21.756  1.00 36.29 ? 123 PHE A CE1 1 
ATOM   1030 C CE2 . PHE A 1 123 ? 46.517 -1.593  21.648  1.00 37.72 ? 123 PHE A CE2 1 
ATOM   1031 C CZ  . PHE A 1 123 ? 47.751 -1.184  21.111  1.00 36.58 ? 123 PHE A CZ  1 
ATOM   1032 N N   . LYS A 1 124 ? 48.894 -5.940  26.442  1.00 39.86 ? 124 LYS A N   1 
ATOM   1033 C CA  A LYS A 1 124 ? 48.978 -6.639  27.721  0.50 39.97 ? 124 LYS A CA  1 
ATOM   1034 C CA  B LYS A 1 124 ? 49.064 -6.600  27.737  0.50 39.99 ? 124 LYS A CA  1 
ATOM   1035 C C   . LYS A 1 124 ? 48.400 -5.785  28.845  1.00 39.96 ? 124 LYS A C   1 
ATOM   1036 O O   . LYS A 1 124 ? 48.299 -4.562  28.728  1.00 39.52 ? 124 LYS A O   1 
ATOM   1037 C CB  A LYS A 1 124 ? 50.402 -7.131  28.038  0.50 40.35 ? 124 LYS A CB  1 
ATOM   1038 C CB  B LYS A 1 124 ? 50.555 -6.787  28.051  0.50 40.33 ? 124 LYS A CB  1 
ATOM   1039 C CG  A LYS A 1 124 ? 50.474 -8.270  29.088  0.50 40.62 ? 124 LYS A CG  1 
ATOM   1040 C CG  B LYS A 1 124 ? 51.285 -7.756  27.124  0.50 40.79 ? 124 LYS A CG  1 
ATOM   1041 C CD  A LYS A 1 124 ? 49.529 -9.447  28.772  0.50 40.44 ? 124 LYS A CD  1 
ATOM   1042 C CD  B LYS A 1 124 ? 52.601 -8.213  27.739  0.50 41.89 ? 124 LYS A CD  1 
ATOM   1043 C CE  A LYS A 1 124 ? 49.632 -10.573 29.794  0.50 40.60 ? 124 LYS A CE  1 
ATOM   1044 C CE  B LYS A 1 124 ? 53.205 -9.379  26.972  0.50 42.40 ? 124 LYS A CE  1 
ATOM   1045 N NZ  A LYS A 1 124 ? 49.067 -10.230 31.138  0.50 39.98 ? 124 LYS A NZ  1 
ATOM   1046 N NZ  B LYS A 1 124 ? 52.404 -10.630 27.116  0.50 42.79 ? 124 LYS A NZ  1 
ATOM   1047 N N   . SER A 1 125 ? 47.978 -6.452  29.918  1.00 39.81 ? 125 SER A N   1 
ATOM   1048 C CA  . SER A 1 125 ? 47.314 -5.806  31.065  1.00 39.51 ? 125 SER A CA  1 
ATOM   1049 C C   . SER A 1 125 ? 48.073 -4.627  31.679  1.00 38.97 ? 125 SER A C   1 
ATOM   1050 O O   . SER A 1 125 ? 47.461 -3.669  32.146  1.00 38.67 ? 125 SER A O   1 
ATOM   1051 C CB  . SER A 1 125 ? 46.984 -6.838  32.151  1.00 39.91 ? 125 SER A CB  1 
ATOM   1052 O OG  . SER A 1 125 ? 46.486 -6.215  33.332  1.00 41.29 ? 125 SER A OG  1 
ATOM   1053 N N   . GLU A 1 126 ? 49.401 -4.699  31.688  1.00 38.10 ? 126 GLU A N   1 
ATOM   1054 C CA  . GLU A 1 126 ? 50.201 -3.620  32.256  1.00 37.35 ? 126 GLU A CA  1 
ATOM   1055 C C   . GLU A 1 126 ? 50.188 -2.371  31.368  1.00 36.18 ? 126 GLU A C   1 
ATOM   1056 O O   . GLU A 1 126 ? 50.614 -1.292  31.801  1.00 35.45 ? 126 GLU A O   1 
ATOM   1057 C CB  . GLU A 1 126 ? 51.631 -4.086  32.524  1.00 38.27 ? 126 GLU A CB  1 
ATOM   1058 C CG  . GLU A 1 126 ? 52.471 -4.323  31.282  1.00 39.59 ? 126 GLU A CG  1 
ATOM   1059 C CD  . GLU A 1 126 ? 53.745 -5.096  31.588  1.00 42.92 ? 126 GLU A CD  1 
ATOM   1060 O OE1 . GLU A 1 126 ? 54.202 -5.087  32.759  1.00 45.41 ? 126 GLU A OE1 1 
ATOM   1061 O OE2 . GLU A 1 126 ? 54.289 -5.719  30.653  1.00 44.91 ? 126 GLU A OE2 1 
ATOM   1062 N N   . ILE A 1 127 ? 49.715 -2.538  30.135  1.00 34.66 ? 127 ILE A N   1 
ATOM   1063 C CA  . ILE A 1 127 ? 49.469 -1.416  29.231  1.00 34.16 ? 127 ILE A CA  1 
ATOM   1064 C C   . ILE A 1 127 ? 48.022 -0.938  29.402  1.00 32.37 ? 127 ILE A C   1 
ATOM   1065 O O   . ILE A 1 127 ? 47.778 0.252   29.609  1.00 31.80 ? 127 ILE A O   1 
ATOM   1066 C CB  . ILE A 1 127 ? 49.764 -1.772  27.733  1.00 34.88 ? 127 ILE A CB  1 
ATOM   1067 C CG1 . ILE A 1 127 ? 51.263 -2.018  27.487  1.00 36.83 ? 127 ILE A CG1 1 
ATOM   1068 C CG2 . ILE A 1 127 ? 49.201 -0.700  26.778  1.00 35.65 ? 127 ILE A CG2 1 
ATOM   1069 C CD1 . ILE A 1 127 ? 52.194 -0.800  27.687  1.00 39.70 ? 127 ILE A CD1 1 
ATOM   1070 N N   . ILE A 1 128 ? 47.062 -1.863  29.340  1.00 30.43 ? 128 ILE A N   1 
ATOM   1071 C CA  . ILE A 1 128 ? 45.639 -1.477  29.392  1.00 29.00 ? 128 ILE A CA  1 
ATOM   1072 C C   . ILE A 1 128 ? 45.213 -0.868  30.733  1.00 27.59 ? 128 ILE A C   1 
ATOM   1073 O O   . ILE A 1 128 ? 44.407 0.066   30.762  1.00 26.39 ? 128 ILE A O   1 
ATOM   1074 C CB  . ILE A 1 128 ? 44.688 -2.652  28.998  1.00 29.93 ? 128 ILE A CB  1 
ATOM   1075 C CG1 . ILE A 1 128 ? 44.905 -3.072  27.535  1.00 31.49 ? 128 ILE A CG1 1 
ATOM   1076 C CG2 . ILE A 1 128 ? 43.215 -2.291  29.276  1.00 30.50 ? 128 ILE A CG2 1 
ATOM   1077 C CD1 . ILE A 1 128 ? 44.609 -2.012  26.474  1.00 37.03 ? 128 ILE A CD1 1 
ATOM   1078 N N   . GLN A 1 129 ? 45.722 -1.391  31.849  1.00 26.97 ? 129 GLN A N   1 
ATOM   1079 C CA  . GLN A 1 129 ? 45.252 -0.891  33.140  1.00 26.59 ? 129 GLN A CA  1 
ATOM   1080 C C   . GLN A 1 129 ? 45.496 0.615   33.360  1.00 26.29 ? 129 GLN A C   1 
ATOM   1081 O O   . GLN A 1 129 ? 44.567 1.307   33.776  1.00 24.48 ? 129 GLN A O   1 
ATOM   1082 C CB  . GLN A 1 129 ? 45.746 -1.731  34.336  1.00 27.15 ? 129 GLN A CB  1 
ATOM   1083 C CG  . GLN A 1 129 ? 45.346 -3.223  34.268  1.00 30.08 ? 129 GLN A CG  1 
ATOM   1084 C CD  . GLN A 1 129 ? 43.845 -3.470  34.071  1.00 31.47 ? 129 GLN A CD  1 
ATOM   1085 O OE1 . GLN A 1 129 ? 43.005 -2.799  34.670  1.00 30.17 ? 129 GLN A OE1 1 
ATOM   1086 N NE2 . GLN A 1 129 ? 43.515 -4.450  33.231  1.00 32.69 ? 129 GLN A NE2 1 
ATOM   1087 N N   . PRO A 1 130 ? 46.733 1.123   33.080  1.00 25.81 ? 130 PRO A N   1 
ATOM   1088 C CA  . PRO A 1 130 ? 46.952 2.578   33.205  1.00 25.33 ? 130 PRO A CA  1 
ATOM   1089 C C   . PRO A 1 130 ? 46.026 3.397   32.305  1.00 23.72 ? 130 PRO A C   1 
ATOM   1090 O O   . PRO A 1 130 ? 45.611 4.475   32.699  1.00 22.63 ? 130 PRO A O   1 
ATOM   1091 C CB  . PRO A 1 130 ? 48.404 2.776   32.728  1.00 25.95 ? 130 PRO A CB  1 
ATOM   1092 C CG  . PRO A 1 130 ? 49.054 1.474   32.898  1.00 27.97 ? 130 PRO A CG  1 
ATOM   1093 C CD  . PRO A 1 130 ? 47.974 0.421   32.704  1.00 26.53 ? 130 PRO A CD  1 
ATOM   1094 N N   . LEU A 1 131 ? 45.721 2.878   31.122  1.00 23.25 ? 131 LEU A N   1 
ATOM   1095 C CA  . LEU A 1 131 ? 44.823 3.554   30.175  1.00 22.73 ? 131 LEU A CA  1 
ATOM   1096 C C   . LEU A 1 131 ? 43.403 3.640   30.765  1.00 23.34 ? 131 LEU A C   1 
ATOM   1097 O O   . LEU A 1 131 ? 42.735 4.680   30.677  1.00 22.73 ? 131 LEU A O   1 
ATOM   1098 C CB  . LEU A 1 131 ? 44.826 2.836   28.822  1.00 23.10 ? 131 LEU A CB  1 
ATOM   1099 C CG  . LEU A 1 131 ? 46.166 2.801   28.069  1.00 23.67 ? 131 LEU A CG  1 
ATOM   1100 C CD1 . LEU A 1 131 ? 46.031 2.062   26.724  1.00 25.14 ? 131 LEU A CD1 1 
ATOM   1101 C CD2 . LEU A 1 131 ? 46.744 4.232   27.896  1.00 25.02 ? 131 LEU A CD2 1 
ATOM   1102 N N   . LEU A 1 132 ? 42.949 2.539   31.365  1.00 23.65 ? 132 LEU A N   1 
ATOM   1103 C CA  . LEU A 1 132 ? 41.662 2.522   32.068  1.00 24.22 ? 132 LEU A CA  1 
ATOM   1104 C C   . LEU A 1 132 ? 41.659 3.470   33.278  1.00 24.07 ? 132 LEU A C   1 
ATOM   1105 O O   . LEU A 1 132 ? 40.671 4.175   33.562  1.00 24.03 ? 132 LEU A O   1 
ATOM   1106 C CB  . LEU A 1 132 ? 41.343 1.091   32.518  1.00 24.32 ? 132 LEU A CB  1 
ATOM   1107 C CG  . LEU A 1 132 ? 40.996 0.120   31.385  1.00 25.59 ? 132 LEU A CG  1 
ATOM   1108 C CD1 . LEU A 1 132 ? 40.987 -1.302  31.964  1.00 25.01 ? 132 LEU A CD1 1 
ATOM   1109 C CD2 . LEU A 1 132 ? 39.633 0.461   30.768  1.00 25.88 ? 132 LEU A CD2 1 
ATOM   1110 N N   . ASP A 1 133 ? 42.769 3.467   34.014  1.00 23.94 ? 133 ASP A N   1 
ATOM   1111 C CA  . ASP A 1 133 ? 42.945 4.382   35.130  1.00 24.19 ? 133 ASP A CA  1 
ATOM   1112 C C   . ASP A 1 133 ? 42.819 5.839   34.680  1.00 24.06 ? 133 ASP A C   1 
ATOM   1113 O O   . ASP A 1 133 ? 42.212 6.652   35.364  1.00 24.11 ? 133 ASP A O   1 
ATOM   1114 C CB  . ASP A 1 133 ? 44.311 4.159   35.798  1.00 24.30 ? 133 ASP A CB  1 
ATOM   1115 C CG  . ASP A 1 133 ? 44.406 2.822   36.524  1.00 27.03 ? 133 ASP A CG  1 
ATOM   1116 O OD1 . ASP A 1 133 ? 43.352 2.195   36.784  1.00 27.03 ? 133 ASP A OD1 1 
ATOM   1117 O OD2 . ASP A 1 133 ? 45.544 2.404   36.839  1.00 28.69 ? 133 ASP A OD2 1 
ATOM   1118 N N   . MET A 1 134 ? 43.426 6.171   33.539  1.00 24.62 ? 134 MET A N   1 
ATOM   1119 C CA  . MET A 1 134 ? 43.333 7.532   33.010  1.00 26.43 ? 134 MET A CA  1 
ATOM   1120 C C   . MET A 1 134 ? 41.886 7.964   32.715  1.00 26.86 ? 134 MET A C   1 
ATOM   1121 O O   . MET A 1 134 ? 41.501 9.086   33.018  1.00 27.14 ? 134 MET A O   1 
ATOM   1122 C CB  . MET A 1 134 ? 44.210 7.660   31.761  1.00 26.52 ? 134 MET A CB  1 
ATOM   1123 C CG  . MET A 1 134 ? 45.692 7.634   32.097  1.00 27.14 ? 134 MET A CG  1 
ATOM   1124 S SD  . MET A 1 134 ? 46.734 7.663   30.618  1.00 31.09 ? 134 MET A SD  1 
ATOM   1125 C CE  . MET A 1 134 ? 46.232 9.228   29.954  1.00 26.62 ? 134 MET A CE  1 
ATOM   1126 N N   . ALA A 1 135 ? 41.097 7.064   32.127  1.00 27.54 ? 135 ALA A N   1 
ATOM   1127 C CA  . ALA A 1 135 ? 39.671 7.327   31.904  1.00 28.37 ? 135 ALA A CA  1 
ATOM   1128 C C   . ALA A 1 135 ? 38.956 7.595   33.218  1.00 28.05 ? 135 ALA A C   1 
ATOM   1129 O O   . ALA A 1 135 ? 38.265 8.609   33.371  1.00 28.27 ? 135 ALA A O   1 
ATOM   1130 C CB  . ALA A 1 135 ? 39.035 6.157   31.178  1.00 28.08 ? 135 ALA A CB  1 
ATOM   1131 N N   . ALA A 1 136 ? 39.162 6.710   34.193  1.00 28.80 ? 136 ALA A N   1 
ATOM   1132 C CA  . ALA A 1 136 ? 38.580 6.863   35.536  1.00 29.43 ? 136 ALA A CA  1 
ATOM   1133 C C   . ALA A 1 136 ? 38.942 8.188   36.229  1.00 30.18 ? 136 ALA A C   1 
ATOM   1134 O O   . ALA A 1 136 ? 38.086 8.835   36.852  1.00 30.09 ? 136 ALA A O   1 
ATOM   1135 C CB  . ALA A 1 136 ? 38.979 5.675   36.415  1.00 29.40 ? 136 ALA A CB  1 
ATOM   1136 N N   . ALA A 1 137 ? 40.215 8.583   36.119  1.00 30.58 ? 137 ALA A N   1 
ATOM   1137 C CA  . ALA A 1 137 ? 40.713 9.805   36.755  1.00 31.66 ? 137 ALA A CA  1 
ATOM   1138 C C   . ALA A 1 137 ? 40.072 11.081  36.211  1.00 32.44 ? 137 ALA A C   1 
ATOM   1139 O O   . ALA A 1 137 ? 40.045 12.102  36.896  1.00 33.03 ? 137 ALA A O   1 
ATOM   1140 C CB  . ALA A 1 137 ? 42.234 9.886   36.661  1.00 31.22 ? 137 ALA A CB  1 
ATOM   1141 N N   . LEU A 1 138 ? 39.549 11.015  34.990  1.00 33.90 ? 138 LEU A N   1 
ATOM   1142 C CA  . LEU A 1 138 ? 38.861 12.158  34.393  1.00 35.32 ? 138 LEU A CA  1 
ATOM   1143 C C   . LEU A 1 138 ? 37.538 12.492  35.085  1.00 36.11 ? 138 LEU A C   1 
ATOM   1144 O O   . LEU A 1 138 ? 37.323 13.641  35.456  1.00 36.47 ? 138 LEU A O   1 
ATOM   1145 C CB  . LEU A 1 138 ? 38.656 11.957  32.888  1.00 35.45 ? 138 LEU A CB  1 
ATOM   1146 C CG  . LEU A 1 138 ? 39.874 12.237  32.004  1.00 36.58 ? 138 LEU A CG  1 
ATOM   1147 C CD1 . LEU A 1 138 ? 39.471 12.128  30.550  1.00 38.88 ? 138 LEU A CD1 1 
ATOM   1148 C CD2 . LEU A 1 138 ? 40.483 13.614  32.296  1.00 38.07 ? 138 LEU A CD2 1 
ATOM   1149 N N   . GLU A 1 139 ? 36.661 11.496  35.235  1.00 37.03 ? 139 GLU A N   1 
ATOM   1150 C CA  . GLU A 1 139 ? 35.381 11.673  35.941  1.00 37.55 ? 139 GLU A CA  1 
ATOM   1151 C C   . GLU A 1 139 ? 35.586 11.800  37.441  1.00 37.63 ? 139 GLU A C   1 
ATOM   1152 O O   . GLU A 1 139 ? 35.888 12.883  37.950  1.00 38.17 ? 139 GLU A O   1 
ATOM   1153 C CB  . GLU A 1 139 ? 34.431 10.516  35.632  1.00 37.66 ? 139 GLU A CB  1 
ATOM   1154 N N   . MET B 1 1   ? 34.389 24.214  7.361   1.00 43.27 ? 1   MET B N   1 
ATOM   1155 C CA  . MET B 1 1   ? 32.943 24.428  7.068   1.00 43.21 ? 1   MET B CA  1 
ATOM   1156 C C   . MET B 1 1   ? 32.164 23.203  7.531   1.00 41.47 ? 1   MET B C   1 
ATOM   1157 O O   . MET B 1 1   ? 32.156 22.184  6.852   1.00 40.84 ? 1   MET B O   1 
ATOM   1158 C CB  . MET B 1 1   ? 32.730 24.686  5.567   1.00 43.53 ? 1   MET B CB  1 
ATOM   1159 C CG  . MET B 1 1   ? 33.507 25.891  5.038   1.00 44.85 ? 1   MET B CG  1 
ATOM   1160 S SD  . MET B 1 1   ? 33.833 25.829  3.266   1.00 46.63 ? 1   MET B SD  1 
ATOM   1161 C CE  . MET B 1 1   ? 34.971 27.214  3.130   1.00 44.84 ? 1   MET B CE  1 
ATOM   1162 N N   . GLU B 1 2   ? 31.555 23.311  8.714   1.00 39.91 ? 2   GLU B N   1 
ATOM   1163 C CA  . GLU B 1 2   ? 30.738 22.250  9.317   1.00 38.32 ? 2   GLU B CA  1 
ATOM   1164 C C   . GLU B 1 2   ? 29.741 21.646  8.325   1.00 36.44 ? 2   GLU B C   1 
ATOM   1165 O O   . GLU B 1 2   ? 29.675 20.425  8.155   1.00 35.29 ? 2   GLU B O   1 
ATOM   1166 C CB  . GLU B 1 2   ? 29.964 22.812  10.510  1.00 38.96 ? 2   GLU B CB  1 
ATOM   1167 C CG  . GLU B 1 2   ? 29.051 21.818  11.223  1.00 41.84 ? 2   GLU B CG  1 
ATOM   1168 C CD  . GLU B 1 2   ? 29.693 21.177  12.442  1.00 46.13 ? 2   GLU B CD  1 
ATOM   1169 O OE1 . GLU B 1 2   ? 30.899 20.827  12.391  1.00 47.11 ? 2   GLU B OE1 1 
ATOM   1170 O OE2 . GLU B 1 2   ? 28.977 21.023  13.462  1.00 48.68 ? 2   GLU B OE2 1 
ATOM   1171 N N   . ALA B 1 3   ? 28.949 22.511  7.694   1.00 34.44 ? 3   ALA B N   1 
ATOM   1172 C CA  . ALA B 1 3   ? 27.911 22.047  6.785   1.00 32.96 ? 3   ALA B CA  1 
ATOM   1173 C C   . ALA B 1 3   ? 28.497 21.273  5.611   1.00 31.80 ? 3   ALA B C   1 
ATOM   1174 O O   . ALA B 1 3   ? 27.899 20.303  5.141   1.00 32.06 ? 3   ALA B O   1 
ATOM   1175 C CB  . ALA B 1 3   ? 27.063 23.220  6.290   1.00 33.13 ? 3   ALA B CB  1 
ATOM   1176 N N   . VAL B 1 4   ? 29.667 21.702  5.141   1.00 30.98 ? 4   VAL B N   1 
ATOM   1177 C CA  . VAL B 1 4   ? 30.303 21.054  3.991   1.00 29.84 ? 4   VAL B CA  1 
ATOM   1178 C C   . VAL B 1 4   ? 30.835 19.686  4.428   1.00 28.91 ? 4   VAL B C   1 
ATOM   1179 O O   . VAL B 1 4   ? 30.623 18.704  3.731   1.00 27.61 ? 4   VAL B O   1 
ATOM   1180 C CB  . VAL B 1 4   ? 31.401 21.940  3.363   1.00 30.60 ? 4   VAL B CB  1 
ATOM   1181 C CG1 . VAL B 1 4   ? 32.200 21.186  2.305   1.00 32.09 ? 4   VAL B CG1 1 
ATOM   1182 C CG2 . VAL B 1 4   ? 30.735 23.157  2.708   1.00 30.62 ? 4   VAL B CG2 1 
ATOM   1183 N N   . LYS B 1 5   ? 31.465 19.633  5.598   1.00 28.05 ? 5   LYS B N   1 
ATOM   1184 C CA  . LYS B 1 5   ? 31.944 18.341  6.152   1.00 27.01 ? 5   LYS B CA  1 
ATOM   1185 C C   . LYS B 1 5   ? 30.809 17.338  6.347   1.00 26.97 ? 5   LYS B C   1 
ATOM   1186 O O   . LYS B 1 5   ? 30.986 16.147  6.060   1.00 26.94 ? 5   LYS B O   1 
ATOM   1187 C CB  . LYS B 1 5   ? 32.693 18.532  7.467   1.00 27.43 ? 5   LYS B CB  1 
ATOM   1188 C CG  . LYS B 1 5   ? 33.966 19.310  7.314   1.00 26.83 ? 5   LYS B CG  1 
ATOM   1189 C CD  . LYS B 1 5   ? 34.769 19.263  8.583   1.00 27.87 ? 5   LYS B CD  1 
ATOM   1190 C CE  . LYS B 1 5   ? 36.029 20.042  8.410   1.00 30.56 ? 5   LYS B CE  1 
ATOM   1191 N NZ  . LYS B 1 5   ? 36.939 19.760  9.548   1.00 31.81 ? 5   LYS B NZ  1 
ATOM   1192 N N   . THR B 1 6   ? 29.661 17.811  6.845   1.00 26.34 ? 6   THR B N   1 
ATOM   1193 C CA  . THR B 1 6   ? 28.464 16.982  7.012   1.00 27.23 ? 6   THR B CA  1 
ATOM   1194 C C   . THR B 1 6   ? 27.972 16.445  5.665   1.00 27.03 ? 6   THR B C   1 
ATOM   1195 O O   . THR B 1 6   ? 27.657 15.251  5.523   1.00 27.42 ? 6   THR B O   1 
ATOM   1196 C CB  . THR B 1 6   ? 27.342 17.775  7.682   1.00 27.75 ? 6   THR B CB  1 
ATOM   1197 O OG1 . THR B 1 6   ? 27.796 18.206  8.972   1.00 28.89 ? 6   THR B OG1 1 
ATOM   1198 C CG2 . THR B 1 6   ? 26.065 16.943  7.831   1.00 29.15 ? 6   THR B CG2 1 
ATOM   1199 N N   . PHE B 1 7   ? 27.898 17.331  4.677   1.00 26.71 ? 7   PHE B N   1 
ATOM   1200 C CA  . PHE B 1 7   ? 27.561 16.888  3.330   1.00 26.18 ? 7   PHE B CA  1 
ATOM   1201 C C   . PHE B 1 7   ? 28.575 15.830  2.802   1.00 26.56 ? 7   PHE B C   1 
ATOM   1202 O O   . PHE B 1 7   ? 28.167 14.782  2.261   1.00 26.32 ? 7   PHE B O   1 
ATOM   1203 C CB  . PHE B 1 7   ? 27.458 18.048  2.335   1.00 26.95 ? 7   PHE B CB  1 
ATOM   1204 C CG  . PHE B 1 7   ? 27.213 17.559  0.953   1.00 26.33 ? 7   PHE B CG  1 
ATOM   1205 C CD1 . PHE B 1 7   ? 25.946 17.054  0.597   1.00 27.33 ? 7   PHE B CD1 1 
ATOM   1206 C CD2 . PHE B 1 7   ? 28.257 17.507  0.024   1.00 27.19 ? 7   PHE B CD2 1 
ATOM   1207 C CE1 . PHE B 1 7   ? 25.725 16.507  -0.675  1.00 25.55 ? 7   PHE B CE1 1 
ATOM   1208 C CE2 . PHE B 1 7   ? 28.030 16.975  -1.263  1.00 26.12 ? 7   PHE B CE2 1 
ATOM   1209 C CZ  . PHE B 1 7   ? 26.767 16.483  -1.602  1.00 26.72 ? 7   PHE B CZ  1 
ATOM   1210 N N   . ASN B 1 8   ? 29.869 16.135  2.931   1.00 26.25 ? 8   ASN B N   1 
ATOM   1211 C CA  . ASN B 1 8   ? 30.933 15.199  2.494   1.00 26.21 ? 8   ASN B CA  1 
ATOM   1212 C C   . ASN B 1 8   ? 30.738 13.808  3.116   1.00 26.43 ? 8   ASN B C   1 
ATOM   1213 O O   . ASN B 1 8   ? 30.841 12.784  2.416   1.00 26.44 ? 8   ASN B O   1 
ATOM   1214 C CB  . ASN B 1 8   ? 32.321 15.745  2.834   1.00 26.49 ? 8   ASN B CB  1 
ATOM   1215 C CG  . ASN B 1 8   ? 32.715 16.931  1.958   1.00 28.06 ? 8   ASN B CG  1 
ATOM   1216 O OD1 . ASN B 1 8   ? 32.103 17.160  0.911   1.00 28.58 ? 8   ASN B OD1 1 
ATOM   1217 N ND2 . ASN B 1 8   ? 33.761 17.650  2.358   1.00 27.95 ? 8   ASN B ND2 1 
ATOM   1218 N N   . SER B 1 9   ? 30.432 13.787  4.416   1.00 25.37 ? 9   SER B N   1 
ATOM   1219 C CA  . SER B 1 9   ? 30.143 12.525  5.108   1.00 25.92 ? 9   SER B CA  1 
ATOM   1220 C C   . SER B 1 9   ? 28.969 11.762  4.493   1.00 26.40 ? 9   SER B C   1 
ATOM   1221 O O   . SER B 1 9   ? 29.082 10.555  4.251   1.00 25.41 ? 9   SER B O   1 
ATOM   1222 C CB  . SER B 1 9   ? 29.943 12.742  6.612   1.00 25.50 ? 9   SER B CB  1 
ATOM   1223 O OG  . SER B 1 9   ? 31.191 12.849  7.285   1.00 25.20 ? 9   SER B OG  1 
ATOM   1224 N N   . GLU B 1 10  ? 27.862 12.454  4.210   1.00 26.33 ? 10  GLU B N   1 
ATOM   1225 C CA  . GLU B 1 10  ? 26.687 11.795  3.617   1.00 27.22 ? 10  GLU B CA  1 
ATOM   1226 C C   . GLU B 1 10  ? 27.011 11.254  2.230   1.00 26.95 ? 10  GLU B C   1 
ATOM   1227 O O   . GLU B 1 10  ? 26.691 10.107  1.894   1.00 27.35 ? 10  GLU B O   1 
ATOM   1228 C CB  . GLU B 1 10  ? 25.505 12.771  3.534   1.00 27.57 ? 10  GLU B CB  1 
ATOM   1229 C CG  . GLU B 1 10  ? 24.803 13.045  4.888   1.00 30.77 ? 10  GLU B CG  1 
ATOM   1230 C CD  . GLU B 1 10  ? 24.184 11.787  5.521   1.00 35.82 ? 10  GLU B CD  1 
ATOM   1231 O OE1 . GLU B 1 10  ? 23.919 10.793  4.805   1.00 36.45 ? 10  GLU B OE1 1 
ATOM   1232 O OE2 . GLU B 1 10  ? 23.976 11.794  6.748   1.00 39.14 ? 10  GLU B OE2 1 
ATOM   1233 N N   . LEU B 1 11  ? 27.696 12.071  1.442   1.00 26.81 ? 11  LEU B N   1 
ATOM   1234 C CA  . LEU B 1 11  ? 28.049 11.703  0.078   1.00 27.67 ? 11  LEU B CA  1 
ATOM   1235 C C   . LEU B 1 11  ? 28.997 10.506  0.049   1.00 27.92 ? 11  LEU B C   1 
ATOM   1236 O O   . LEU B 1 11  ? 28.763 9.511   -0.668  1.00 26.92 ? 11  LEU B O   1 
ATOM   1237 C CB  . LEU B 1 11  ? 28.668 12.910  -0.651  1.00 27.56 ? 11  LEU B CB  1 
ATOM   1238 C CG  . LEU B 1 11  ? 29.129 12.650  -2.091  1.00 28.05 ? 11  LEU B CG  1 
ATOM   1239 C CD1 . LEU B 1 11  ? 27.982 12.161  -2.968  1.00 29.54 ? 11  LEU B CD1 1 
ATOM   1240 C CD2 . LEU B 1 11  ? 29.784 13.920  -2.647  1.00 28.58 ? 11  LEU B CD2 1 
ATOM   1241 N N   . TYR B 1 12  ? 30.073 10.574  0.822   1.00 27.29 ? 12  TYR B N   1 
ATOM   1242 C CA  . TYR B 1 12  ? 31.052 9.498   0.793   1.00 27.57 ? 12  TYR B CA  1 
ATOM   1243 C C   . TYR B 1 12  ? 30.456 8.199   1.348   1.00 27.01 ? 12  TYR B C   1 
ATOM   1244 O O   . TYR B 1 12  ? 30.881 7.114   0.967   1.00 27.34 ? 12  TYR B O   1 
ATOM   1245 C CB  . TYR B 1 12  ? 32.326 9.889   1.544   1.00 28.89 ? 12  TYR B CB  1 
ATOM   1246 C CG  . TYR B 1 12  ? 33.466 8.924   1.323   1.00 30.18 ? 12  TYR B CG  1 
ATOM   1247 C CD1 . TYR B 1 12  ? 33.632 7.804   2.136   1.00 32.21 ? 12  TYR B CD1 1 
ATOM   1248 C CD2 . TYR B 1 12  ? 34.357 9.110   0.267   1.00 32.69 ? 12  TYR B CD2 1 
ATOM   1249 C CE1 . TYR B 1 12  ? 34.665 6.905   1.907   1.00 32.24 ? 12  TYR B CE1 1 
ATOM   1250 C CE2 . TYR B 1 12  ? 35.404 8.229   0.047   1.00 33.69 ? 12  TYR B CE2 1 
ATOM   1251 C CZ  . TYR B 1 12  ? 35.548 7.129   0.862   1.00 31.23 ? 12  TYR B CZ  1 
ATOM   1252 O OH  . TYR B 1 12  ? 36.581 6.256   0.637   1.00 33.12 ? 12  TYR B OH  1 
ATOM   1253 N N   . SER B 1 13  ? 29.457 8.323   2.221   1.00 26.66 ? 13  SER B N   1 
ATOM   1254 C CA  . SER B 1 13  ? 28.794 7.161   2.833   1.00 26.90 ? 13  SER B CA  1 
ATOM   1255 C C   . SER B 1 13  ? 28.132 6.245   1.784   1.00 26.19 ? 13  SER B C   1 
ATOM   1256 O O   . SER B 1 13  ? 27.820 5.092   2.081   1.00 25.40 ? 13  SER B O   1 
ATOM   1257 C CB  . SER B 1 13  ? 27.775 7.608   3.889   1.00 27.45 ? 13  SER B CB  1 
ATOM   1258 O OG  . SER B 1 13  ? 26.548 8.029   3.313   1.00 29.82 ? 13  SER B OG  1 
ATOM   1259 N N   . LEU B 1 14  ? 27.923 6.761   0.571   1.00 26.29 ? 14  LEU B N   1 
ATOM   1260 C CA  . LEU B 1 14  ? 27.504 5.893   -0.563  1.00 26.42 ? 14  LEU B CA  1 
ATOM   1261 C C   . LEU B 1 14  ? 28.369 4.660   -0.697  1.00 25.90 ? 14  LEU B C   1 
ATOM   1262 O O   . LEU B 1 14  ? 27.888 3.590   -1.084  1.00 25.52 ? 14  LEU B O   1 
ATOM   1263 C CB  . LEU B 1 14  ? 27.529 6.657   -1.894  1.00 26.62 ? 14  LEU B CB  1 
ATOM   1264 C CG  . LEU B 1 14  ? 26.435 7.708   -2.122  1.00 26.66 ? 14  LEU B CG  1 
ATOM   1265 C CD1 . LEU B 1 14  ? 26.643 8.360   -3.469  1.00 28.31 ? 14  LEU B CD1 1 
ATOM   1266 C CD2 . LEU B 1 14  ? 25.031 7.077   -2.028  1.00 28.45 ? 14  LEU B CD2 1 
ATOM   1267 N N   . ASN B 1 15  ? 29.655 4.797   -0.366  1.00 25.36 ? 15  ASN B N   1 
ATOM   1268 C CA  . ASN B 1 15  ? 30.593 3.691   -0.463  1.00 25.16 ? 15  ASN B CA  1 
ATOM   1269 C C   . ASN B 1 15  ? 30.302 2.544   0.495   1.00 24.65 ? 15  ASN B C   1 
ATOM   1270 O O   . ASN B 1 15  ? 30.832 1.439   0.336   1.00 25.07 ? 15  ASN B O   1 
ATOM   1271 C CB  . ASN B 1 15  ? 32.014 4.186   -0.241  1.00 25.41 ? 15  ASN B CB  1 
ATOM   1272 C CG  . ASN B 1 15  ? 32.573 4.862   -1.460  1.00 28.33 ? 15  ASN B CG  1 
ATOM   1273 O OD1 . ASN B 1 15  ? 32.743 4.226   -2.505  1.00 33.13 ? 15  ASN B OD1 1 
ATOM   1274 N ND2 . ASN B 1 15  ? 32.860 6.144   -1.349  1.00 24.68 ? 15  ASN B ND2 1 
ATOM   1275 N N   . ASP B 1 16  ? 29.458 2.811   1.485   1.00 25.17 ? 16  ASP B N   1 
ATOM   1276 C CA  . ASP B 1 16  ? 29.084 1.800   2.475   1.00 26.22 ? 16  ASP B CA  1 
ATOM   1277 C C   . ASP B 1 16  ? 27.827 1.021   2.048   1.00 26.72 ? 16  ASP B C   1 
ATOM   1278 O O   . ASP B 1 16  ? 27.338 0.172   2.794   1.00 26.90 ? 16  ASP B O   1 
ATOM   1279 C CB  . ASP B 1 16  ? 28.841 2.457   3.836   1.00 26.27 ? 16  ASP B CB  1 
ATOM   1280 C CG  . ASP B 1 16  ? 30.129 2.914   4.530   1.00 29.32 ? 16  ASP B CG  1 
ATOM   1281 O OD1 . ASP B 1 16  ? 31.236 2.451   4.182   1.00 28.43 ? 16  ASP B OD1 1 
ATOM   1282 O OD2 . ASP B 1 16  ? 30.014 3.727   5.471   1.00 34.04 ? 16  ASP B OD2 1 
ATOM   1283 N N   . TYR B 1 17  ? 27.295 1.326   0.862   1.00 27.44 ? 17  TYR B N   1 
ATOM   1284 C CA  . TYR B 1 17  ? 26.090 0.648   0.374   1.00 28.87 ? 17  TYR B CA  1 
ATOM   1285 C C   . TYR B 1 17  ? 26.275 0.047   -1.002  1.00 28.78 ? 17  TYR B C   1 
ATOM   1286 O O   . TYR B 1 17  ? 27.003 0.581   -1.825  1.00 29.31 ? 17  TYR B O   1 
ATOM   1287 C CB  . TYR B 1 17  ? 24.911 1.622   0.343   1.00 30.03 ? 17  TYR B CB  1 
ATOM   1288 C CG  . TYR B 1 17  ? 24.611 2.225   1.688   1.00 31.74 ? 17  TYR B CG  1 
ATOM   1289 C CD1 . TYR B 1 17  ? 23.773 1.572   2.595   1.00 34.70 ? 17  TYR B CD1 1 
ATOM   1290 C CD2 . TYR B 1 17  ? 25.188 3.437   2.071   1.00 32.44 ? 17  TYR B CD2 1 
ATOM   1291 C CE1 . TYR B 1 17  ? 23.509 2.115   3.839   1.00 35.64 ? 17  TYR B CE1 1 
ATOM   1292 C CE2 . TYR B 1 17  ? 24.927 3.990   3.306   1.00 34.13 ? 17  TYR B CE2 1 
ATOM   1293 C CZ  . TYR B 1 17  ? 24.086 3.331   4.182   1.00 35.44 ? 17  TYR B CZ  1 
ATOM   1294 O OH  . TYR B 1 17  ? 23.828 3.883   5.415   1.00 36.84 ? 17  TYR B OH  1 
ATOM   1295 N N   . LYS B 1 18  ? 25.582 -1.054  -1.263  1.00 28.77 ? 18  LYS B N   1 
ATOM   1296 C CA  . LYS B 1 18  ? 25.567 -1.637  -2.583  1.00 29.37 ? 18  LYS B CA  1 
ATOM   1297 C C   . LYS B 1 18  ? 24.439 -0.974  -3.381  1.00 29.41 ? 18  LYS B C   1 
ATOM   1298 O O   . LYS B 1 18  ? 23.293 -0.961  -2.926  1.00 30.00 ? 18  LYS B O   1 
ATOM   1299 C CB  . LYS B 1 18  ? 25.358 -3.157  -2.479  1.00 29.98 ? 18  LYS B CB  1 
ATOM   1300 C CG  . LYS B 1 18  ? 25.545 -3.912  -3.774  1.00 32.34 ? 18  LYS B CG  1 
ATOM   1301 C CD  . LYS B 1 18  ? 25.273 -5.389  -3.548  1.00 34.61 ? 18  LYS B CD  1 
ATOM   1302 C CE  . LYS B 1 18  ? 25.070 -6.148  -4.844  1.00 35.38 ? 18  LYS B CE  1 
ATOM   1303 N NZ  . LYS B 1 18  ? 24.699 -7.563  -4.535  1.00 37.14 ? 18  LYS B NZ  1 
ATOM   1304 N N   . PRO B 1 19  ? 24.763 -0.394  -4.549  1.00 29.29 ? 19  PRO B N   1 
ATOM   1305 C CA  . PRO B 1 19  ? 23.731 0.157   -5.440  1.00 29.57 ? 19  PRO B CA  1 
ATOM   1306 C C   . PRO B 1 19  ? 22.747 -0.943  -5.863  1.00 29.77 ? 19  PRO B C   1 
ATOM   1307 O O   . PRO B 1 19  ? 23.152 -2.091  -5.977  1.00 29.23 ? 19  PRO B O   1 
ATOM   1308 C CB  . PRO B 1 19  ? 24.535 0.622   -6.650  1.00 29.79 ? 19  PRO B CB  1 
ATOM   1309 C CG  . PRO B 1 19  ? 25.886 0.935   -6.089  1.00 29.90 ? 19  PRO B CG  1 
ATOM   1310 C CD  . PRO B 1 19  ? 26.112 -0.183  -5.106  1.00 29.47 ? 19  PRO B CD  1 
ATOM   1311 N N   . PRO B 1 20  ? 21.475 -0.590  -6.131  1.00 30.08 ? 20  PRO B N   1 
ATOM   1312 C CA  . PRO B 1 20  ? 20.858 0.741   -6.155  1.00 30.03 ? 20  PRO B CA  1 
ATOM   1313 C C   . PRO B 1 20  ? 20.719 1.375   -4.776  1.00 29.50 ? 20  PRO B C   1 
ATOM   1314 O O   . PRO B 1 20  ? 20.310 0.718   -3.813  1.00 29.83 ? 20  PRO B O   1 
ATOM   1315 C CB  . PRO B 1 20  ? 19.460 0.473   -6.747  1.00 30.15 ? 20  PRO B CB  1 
ATOM   1316 C CG  . PRO B 1 20  ? 19.192 -0.928  -6.473  1.00 31.26 ? 20  PRO B CG  1 
ATOM   1317 C CD  . PRO B 1 20  ? 20.512 -1.644  -6.508  1.00 30.54 ? 20  PRO B CD  1 
ATOM   1318 N N   . ILE B 1 21  ? 21.042 2.658   -4.714  1.00 29.29 ? 21  ILE B N   1 
ATOM   1319 C CA  . ILE B 1 21  ? 20.947 3.418   -3.482  1.00 28.71 ? 21  ILE B CA  1 
ATOM   1320 C C   . ILE B 1 21  ? 19.482 3.655   -3.090  1.00 28.84 ? 21  ILE B C   1 
ATOM   1321 O O   . ILE B 1 21  ? 18.655 4.010   -3.940  1.00 28.78 ? 21  ILE B O   1 
ATOM   1322 C CB  . ILE B 1 21  ? 21.742 4.740   -3.614  1.00 28.56 ? 21  ILE B CB  1 
ATOM   1323 C CG1 . ILE B 1 21  ? 23.208 4.439   -4.020  1.00 28.03 ? 21  ILE B CG1 1 
ATOM   1324 C CG2 . ILE B 1 21  ? 21.649 5.564   -2.336  1.00 27.68 ? 21  ILE B CG2 1 
ATOM   1325 C CD1 . ILE B 1 21  ? 24.001 3.568   -2.999  1.00 25.65 ? 21  ILE B CD1 1 
ATOM   1326 N N   . SER B 1 22  ? 19.184 3.482   -1.805  1.00 28.44 ? 22  SER B N   1 
ATOM   1327 C CA  . SER B 1 22  ? 17.832 3.672   -1.276  1.00 29.10 ? 22  SER B CA  1 
ATOM   1328 C C   . SER B 1 22  ? 17.355 5.135   -1.376  1.00 29.80 ? 22  SER B C   1 
ATOM   1329 O O   . SER B 1 22  ? 18.157 6.067   -1.462  1.00 29.60 ? 22  SER B O   1 
ATOM   1330 C CB  . SER B 1 22  ? 17.746 3.196   0.171   1.00 29.10 ? 22  SER B CB  1 
ATOM   1331 O OG  . SER B 1 22  ? 18.397 4.105   1.040   1.00 27.63 ? 22  SER B OG  1 
ATOM   1332 N N   . LYS B 1 23  ? 16.033 5.317   -1.367  1.00 30.84 ? 23  LYS B N   1 
ATOM   1333 C CA  . LYS B 1 23  ? 15.429 6.654   -1.330  1.00 31.09 ? 23  LYS B CA  1 
ATOM   1334 C C   . LYS B 1 23  ? 15.817 7.388   -0.046  1.00 30.78 ? 23  LYS B C   1 
ATOM   1335 O O   . LYS B 1 23  ? 16.108 8.592   -0.073  1.00 30.82 ? 23  LYS B O   1 
ATOM   1336 C CB  . LYS B 1 23  ? 13.898 6.534   -1.390  1.00 31.81 ? 23  LYS B CB  1 
ATOM   1337 C CG  . LYS B 1 23  ? 13.354 6.126   -2.748  1.00 33.64 ? 23  LYS B CG  1 
ATOM   1338 C CD  . LYS B 1 23  ? 11.847 5.924   -2.667  1.00 35.97 ? 23  LYS B CD  1 
ATOM   1339 C CE  . LYS B 1 23  ? 11.361 4.905   -3.682  1.00 38.06 ? 23  LYS B CE  1 
ATOM   1340 N NZ  . LYS B 1 23  ? 9.903  4.657   -3.534  1.00 39.73 ? 23  LYS B NZ  1 
ATOM   1341 N N   . ALA B 1 24  ? 15.823 6.651   1.066   1.00 30.22 ? 24  ALA B N   1 
ATOM   1342 C CA  . ALA B 1 24  ? 16.187 7.194   2.382   1.00 29.54 ? 24  ALA B CA  1 
ATOM   1343 C C   . ALA B 1 24  ? 17.600 7.798   2.347   1.00 29.12 ? 24  ALA B C   1 
ATOM   1344 O O   . ALA B 1 24  ? 17.808 8.915   2.817   1.00 28.62 ? 24  ALA B O   1 
ATOM   1345 C CB  . ALA B 1 24  ? 16.081 6.123   3.456   1.00 29.64 ? 24  ALA B CB  1 
ATOM   1346 N N   . LYS B 1 25  ? 18.556 7.071   1.765   1.00 28.39 ? 25  LYS B N   1 
ATOM   1347 C CA  . LYS B 1 25  ? 19.942 7.555   1.704   1.00 27.98 ? 25  LYS B CA  1 
ATOM   1348 C C   . LYS B 1 25  ? 20.045 8.760   0.793   1.00 27.72 ? 25  LYS B C   1 
ATOM   1349 O O   . LYS B 1 25  ? 20.712 9.746   1.116   1.00 26.66 ? 25  LYS B O   1 
ATOM   1350 C CB  . LYS B 1 25  ? 20.919 6.444   1.278   1.00 28.05 ? 25  LYS B CB  1 
ATOM   1351 C CG  . LYS B 1 25  ? 22.394 6.903   1.069   1.00 28.84 ? 25  LYS B CG  1 
ATOM   1352 C CD  . LYS B 1 25  ? 22.988 7.653   2.277   1.00 33.44 ? 25  LYS B CD  1 
ATOM   1353 C CE  . LYS B 1 25  ? 23.162 6.776   3.481   1.00 36.56 ? 25  LYS B CE  1 
ATOM   1354 N NZ  . LYS B 1 25  ? 23.780 7.531   4.622   1.00 40.18 ? 25  LYS B NZ  1 
ATOM   1355 N N   . MET B 1 26  ? 19.370 8.698   -0.348  1.00 27.48 ? 26  MET B N   1 
ATOM   1356 C CA  . MET B 1 26  ? 19.419 9.824   -1.262  1.00 28.39 ? 26  MET B CA  1 
ATOM   1357 C C   . MET B 1 26  ? 18.830 11.082  -0.619  1.00 28.20 ? 26  MET B C   1 
ATOM   1358 O O   . MET B 1 26  ? 19.361 12.184  -0.800  1.00 27.72 ? 26  MET B O   1 
ATOM   1359 C CB  . MET B 1 26  ? 18.709 9.484   -2.560  1.00 29.05 ? 26  MET B CB  1 
ATOM   1360 C CG  . MET B 1 26  ? 19.131 10.377  -3.698  1.00 32.09 ? 26  MET B CG  1 
ATOM   1361 S SD  . MET B 1 26  ? 20.913 10.362  -4.070  1.00 38.36 ? 26  MET B SD  1 
ATOM   1362 C CE  . MET B 1 26  ? 21.226 8.733   -4.667  1.00 35.72 ? 26  MET B CE  1 
ATOM   1363 N N   . THR B 1 27  ? 17.762 10.902  0.152   1.00 28.67 ? 27  THR B N   1 
ATOM   1364 C CA  . THR B 1 27  ? 17.112 12.009  0.876   1.00 28.55 ? 27  THR B CA  1 
ATOM   1365 C C   . THR B 1 27  ? 18.082 12.646  1.886   1.00 28.53 ? 27  THR B C   1 
ATOM   1366 O O   . THR B 1 27  ? 18.154 13.877  1.991   1.00 27.36 ? 27  THR B O   1 
ATOM   1367 C CB  . THR B 1 27  ? 15.825 11.515  1.556   1.00 29.19 ? 27  THR B CB  1 
ATOM   1368 O OG1 . THR B 1 27  ? 14.866 11.208  0.537   1.00 29.75 ? 27  THR B OG1 1 
ATOM   1369 C CG2 . THR B 1 27  ? 15.240 12.564  2.503   1.00 29.25 ? 27  THR B CG2 1 
ATOM   1370 N N   . GLN B 1 28  ? 18.842 11.807  2.591   1.00 27.90 ? 28  GLN B N   1 
ATOM   1371 C CA  A GLN B 1 28  ? 19.832 12.243  3.587   0.50 28.08 ? 28  GLN B CA  1 
ATOM   1372 C CA  B GLN B 1 28  ? 19.756 12.342  3.590   0.50 28.03 ? 28  GLN B CA  1 
ATOM   1373 C C   . GLN B 1 28  ? 20.905 13.113  2.950   1.00 27.82 ? 28  GLN B C   1 
ATOM   1374 O O   . GLN B 1 28  ? 21.287 14.161  3.471   1.00 27.28 ? 28  GLN B O   1 
ATOM   1375 C CB  A GLN B 1 28  ? 20.528 11.035  4.216   0.50 28.23 ? 28  GLN B CB  1 
ATOM   1376 C CB  B GLN B 1 28  ? 20.243 11.268  4.566   0.50 28.46 ? 28  GLN B CB  1 
ATOM   1377 C CG  A GLN B 1 28  ? 19.709 10.218  5.202   0.50 28.81 ? 28  GLN B CG  1 
ATOM   1378 C CG  B GLN B 1 28  ? 19.170 10.785  5.563   0.50 29.97 ? 28  GLN B CG  1 
ATOM   1379 C CD  A GLN B 1 28  ? 20.580 9.305   6.059   0.50 29.36 ? 28  GLN B CD  1 
ATOM   1380 C CD  B GLN B 1 28  ? 18.387 11.917  6.236   0.50 32.11 ? 28  GLN B CD  1 
ATOM   1381 O OE1 A GLN B 1 28  ? 21.709 8.961   5.686   0.50 32.16 ? 28  GLN B OE1 1 
ATOM   1382 O OE1 B GLN B 1 28  ? 18.962 12.798  6.882   0.50 34.45 ? 28  GLN B OE1 1 
ATOM   1383 N NE2 A GLN B 1 28  ? 20.061 8.910   7.216   0.50 31.58 ? 28  GLN B NE2 1 
ATOM   1384 N NE2 B GLN B 1 28  ? 17.063 11.888  6.093   0.50 31.87 ? 28  GLN B NE2 1 
ATOM   1385 N N   . ILE B 1 29  ? 21.421 12.628  1.818   1.00 26.88 ? 29  ILE B N   1 
ATOM   1386 C CA  . ILE B 1 29  ? 22.455 13.350  1.086   1.00 26.29 ? 29  ILE B CA  1 
ATOM   1387 C C   . ILE B 1 29  ? 21.894 14.694  0.610   1.00 26.47 ? 29  ILE B C   1 
ATOM   1388 O O   . ILE B 1 29  ? 22.540 15.745  0.759   1.00 26.40 ? 29  ILE B O   1 
ATOM   1389 C CB  . ILE B 1 29  ? 22.955 12.522  -0.102  1.00 26.30 ? 29  ILE B CB  1 
ATOM   1390 C CG1 . ILE B 1 29  ? 23.751 11.317  0.410   1.00 26.01 ? 29  ILE B CG1 1 
ATOM   1391 C CG2 . ILE B 1 29  ? 23.809 13.377  -1.070  1.00 27.75 ? 29  ILE B CG2 1 
ATOM   1392 C CD1 . ILE B 1 29  ? 23.947 10.212  -0.649  1.00 26.43 ? 29  ILE B CD1 1 
ATOM   1393 N N   . THR B 1 30  ? 20.696 14.645  0.033   1.00 26.65 ? 30  THR B N   1 
ATOM   1394 C CA  . THR B 1 30  ? 20.032 15.860  -0.450  1.00 26.69 ? 30  THR B CA  1 
ATOM   1395 C C   . THR B 1 30  ? 19.778 16.895  0.647   1.00 27.19 ? 30  THR B C   1 
ATOM   1396 O O   . THR B 1 30  ? 20.075 18.081  0.465   1.00 26.63 ? 30  THR B O   1 
ATOM   1397 C CB  . THR B 1 30  ? 18.739 15.524  -1.183  1.00 27.81 ? 30  THR B CB  1 
ATOM   1398 O OG1 . THR B 1 30  ? 19.073 14.585  -2.200  1.00 28.89 ? 30  THR B OG1 1 
ATOM   1399 C CG2 . THR B 1 30  ? 18.173 16.766  -1.857  1.00 28.29 ? 30  THR B CG2 1 
ATOM   1400 N N   . LYS B 1 31  ? 19.244 16.447  1.773   1.00 26.35 ? 31  LYS B N   1 
ATOM   1401 C CA  . LYS B 1 31  ? 18.994 17.353  2.902   1.00 26.83 ? 31  LYS B CA  1 
ATOM   1402 C C   . LYS B 1 31  ? 20.284 18.035  3.350   1.00 26.24 ? 31  LYS B C   1 
ATOM   1403 O O   . LYS B 1 31  ? 20.276 19.247  3.604   1.00 25.87 ? 31  LYS B O   1 
ATOM   1404 C CB  . LYS B 1 31  ? 18.338 16.610  4.060   1.00 26.74 ? 31  LYS B CB  1 
ATOM   1405 C CG  . LYS B 1 31  ? 16.875 16.268  3.787   1.00 29.06 ? 31  LYS B CG  1 
ATOM   1406 C CD  . LYS B 1 31  ? 16.305 15.444  4.923   1.00 31.57 ? 31  LYS B CD  1 
ATOM   1407 C CE  . LYS B 1 31  ? 14.804 15.253  4.739   1.00 32.67 ? 31  LYS B CE  1 
ATOM   1408 N NZ  . LYS B 1 31  ? 14.265 14.286  5.739   1.00 35.71 ? 31  LYS B NZ  1 
ATOM   1409 N N   . ALA B 1 32  ? 21.386 17.275  3.390   1.00 25.65 ? 32  ALA B N   1 
ATOM   1410 C CA  . ALA B 1 32  ? 22.700 17.834  3.773   1.00 26.05 ? 32  ALA B CA  1 
ATOM   1411 C C   . ALA B 1 32  ? 23.186 18.884  2.774   1.00 25.84 ? 32  ALA B C   1 
ATOM   1412 O O   . ALA B 1 32  ? 23.751 19.897  3.180   1.00 26.01 ? 32  ALA B O   1 
ATOM   1413 C CB  . ALA B 1 32  ? 23.768 16.730  3.963   1.00 25.88 ? 32  ALA B CB  1 
ATOM   1414 N N   . ALA B 1 33  ? 22.947 18.638  1.485   1.00 25.89 ? 33  ALA B N   1 
ATOM   1415 C CA  . ALA B 1 33  ? 23.321 19.585  0.425   1.00 25.34 ? 33  ALA B CA  1 
ATOM   1416 C C   . ALA B 1 33  ? 22.578 20.898  0.609   1.00 26.00 ? 33  ALA B C   1 
ATOM   1417 O O   . ALA B 1 33  ? 23.167 21.986  0.529   1.00 26.02 ? 33  ALA B O   1 
ATOM   1418 C CB  . ALA B 1 33  ? 23.025 18.978  -0.946  1.00 25.93 ? 33  ALA B CB  1 
ATOM   1419 N N   . ILE B 1 34  ? 21.275 20.786  0.863   1.00 25.08 ? 34  ILE B N   1 
ATOM   1420 C CA  . ILE B 1 34  ? 20.390 21.960  0.981   1.00 24.95 ? 34  ILE B CA  1 
ATOM   1421 C C   . ILE B 1 34  ? 20.752 22.760  2.231   1.00 25.09 ? 34  ILE B C   1 
ATOM   1422 O O   . ILE B 1 34  ? 20.795 23.982  2.196   1.00 25.12 ? 34  ILE B O   1 
ATOM   1423 C CB  . ILE B 1 34  ? 18.916 21.531  1.011   1.00 25.14 ? 34  ILE B CB  1 
ATOM   1424 C CG1 . ILE B 1 34  ? 18.507 20.888  -0.324  1.00 28.05 ? 34  ILE B CG1 1 
ATOM   1425 C CG2 . ILE B 1 34  ? 17.953 22.740  1.334   1.00 23.41 ? 34  ILE B CG2 1 
ATOM   1426 C CD1 . ILE B 1 34  ? 18.592 21.771  -1.563  1.00 30.04 ? 34  ILE B CD1 1 
ATOM   1427 N N   . LYS B 1 35  ? 21.029 22.060  3.328   1.00 25.49 ? 35  LYS B N   1 
ATOM   1428 C CA  . LYS B 1 35  ? 21.465 22.736  4.555   1.00 26.46 ? 35  LYS B CA  1 
ATOM   1429 C C   . LYS B 1 35  ? 22.775 23.495  4.342   1.00 26.51 ? 35  LYS B C   1 
ATOM   1430 O O   . LYS B 1 35  ? 23.017 24.505  5.012   1.00 27.27 ? 35  LYS B O   1 
ATOM   1431 C CB  . LYS B 1 35  ? 21.606 21.741  5.704   1.00 26.60 ? 35  LYS B CB  1 
ATOM   1432 C CG  . LYS B 1 35  ? 20.268 21.366  6.279   1.00 30.41 ? 35  LYS B CG  1 
ATOM   1433 C CD  . LYS B 1 35  ? 20.349 20.203  7.257   1.00 36.03 ? 35  LYS B CD  1 
ATOM   1434 C CE  . LYS B 1 35  ? 18.950 19.616  7.443   1.00 39.18 ? 35  LYS B CE  1 
ATOM   1435 N NZ  . LYS B 1 35  ? 18.921 18.565  8.502   1.00 41.71 ? 35  LYS B NZ  1 
ATOM   1436 N N   . ALA B 1 36  ? 23.578 23.025  3.386   1.00 26.41 ? 36  ALA B N   1 
ATOM   1437 C CA  . ALA B 1 36  ? 24.880 23.616  3.067   1.00 27.32 ? 36  ALA B CA  1 
ATOM   1438 C C   . ALA B 1 36  ? 24.805 24.610  1.901   1.00 27.85 ? 36  ALA B C   1 
ATOM   1439 O O   . ALA B 1 36  ? 25.815 24.911  1.273   1.00 27.90 ? 36  ALA B O   1 
ATOM   1440 C CB  . ALA B 1 36  ? 25.897 22.517  2.767   1.00 26.86 ? 36  ALA B CB  1 
ATOM   1441 N N   . ILE B 1 37  ? 23.615 25.144  1.641   1.00 27.96 ? 37  ILE B N   1 
ATOM   1442 C CA  . ILE B 1 37  ? 23.404 26.012  0.470   1.00 28.99 ? 37  ILE B CA  1 
ATOM   1443 C C   . ILE B 1 37  ? 24.311 27.265  0.415   1.00 28.94 ? 37  ILE B C   1 
ATOM   1444 O O   . ILE B 1 37  ? 24.683 27.697  -0.685  1.00 28.85 ? 37  ILE B O   1 
ATOM   1445 C CB  . ILE B 1 37  ? 21.903 26.330  0.248   1.00 29.56 ? 37  ILE B CB  1 
ATOM   1446 C CG1 . ILE B 1 37  ? 21.669 26.971  -1.127  1.00 31.90 ? 37  ILE B CG1 1 
ATOM   1447 C CG2 . ILE B 1 37  ? 21.340 27.191  1.371   1.00 30.14 ? 37  ILE B CG2 1 
ATOM   1448 C CD1 . ILE B 1 37  ? 20.608 26.277  -1.920  1.00 35.89 ? 37  ILE B CD1 1 
ATOM   1449 N N   . LYS B 1 38  ? 24.690 27.816  1.569   1.00 29.17 ? 38  LYS B N   1 
ATOM   1450 C CA  . LYS B 1 38  ? 25.638 28.950  1.616   1.00 29.51 ? 38  LYS B CA  1 
ATOM   1451 C C   . LYS B 1 38  ? 26.958 28.585  0.911   1.00 29.42 ? 38  LYS B C   1 
ATOM   1452 O O   . LYS B 1 38  ? 27.639 29.445  0.329   1.00 29.47 ? 38  LYS B O   1 
ATOM   1453 C CB  . LYS B 1 38  ? 25.906 29.365  3.072   1.00 29.36 ? 38  LYS B CB  1 
ATOM   1454 C CG  . LYS B 1 38  ? 26.951 30.485  3.276   1.00 31.21 ? 38  LYS B CG  1 
ATOM   1455 C CD  . LYS B 1 38  ? 27.312 30.625  4.749   1.00 31.06 ? 38  LYS B CD  1 
ATOM   1456 C CE  . LYS B 1 38  ? 28.455 31.611  4.975   1.00 34.23 ? 38  LYS B CE  1 
ATOM   1457 N NZ  . LYS B 1 38  ? 28.907 31.614  6.392   1.00 35.48 ? 38  LYS B NZ  1 
ATOM   1458 N N   . PHE B 1 39  ? 27.289 27.302  0.971   1.00 27.80 ? 39  PHE B N   1 
ATOM   1459 C CA  . PHE B 1 39  ? 28.520 26.761  0.420   1.00 28.16 ? 39  PHE B CA  1 
ATOM   1460 C C   . PHE B 1 39  ? 28.232 25.888  -0.805  1.00 27.31 ? 39  PHE B C   1 
ATOM   1461 O O   . PHE B 1 39  ? 28.901 24.859  -1.031  1.00 26.56 ? 39  PHE B O   1 
ATOM   1462 C CB  . PHE B 1 39  ? 29.221 25.934  1.499   1.00 28.34 ? 39  PHE B CB  1 
ATOM   1463 C CG  . PHE B 1 39  ? 29.470 26.693  2.778   1.00 29.78 ? 39  PHE B CG  1 
ATOM   1464 C CD1 . PHE B 1 39  ? 30.509 27.618  2.860   1.00 29.72 ? 39  PHE B CD1 1 
ATOM   1465 C CD2 . PHE B 1 39  ? 28.658 26.489  3.893   1.00 31.12 ? 39  PHE B CD2 1 
ATOM   1466 C CE1 . PHE B 1 39  ? 30.749 28.340  4.047   1.00 31.96 ? 39  PHE B CE1 1 
ATOM   1467 C CE2 . PHE B 1 39  ? 28.892 27.204  5.085   1.00 31.92 ? 39  PHE B CE2 1 
ATOM   1468 C CZ  . PHE B 1 39  ? 29.935 28.127  5.153   1.00 31.22 ? 39  PHE B CZ  1 
ATOM   1469 N N   . TYR B 1 40  ? 27.260 26.309  -1.615  1.00 26.61 ? 40  TYR B N   1 
ATOM   1470 C CA  . TYR B 1 40  ? 26.809 25.474  -2.738  1.00 26.16 ? 40  TYR B CA  1 
ATOM   1471 C C   . TYR B 1 40  ? 27.946 25.157  -3.710  1.00 25.13 ? 40  TYR B C   1 
ATOM   1472 O O   . TYR B 1 40  ? 27.940 24.114  -4.357  1.00 25.19 ? 40  TYR B O   1 
ATOM   1473 C CB  . TYR B 1 40  ? 25.618 26.100  -3.479  1.00 26.32 ? 40  TYR B CB  1 
ATOM   1474 C CG  . TYR B 1 40  ? 25.965 27.331  -4.279  1.00 27.31 ? 40  TYR B CG  1 
ATOM   1475 C CD1 . TYR B 1 40  ? 26.233 27.241  -5.647  1.00 27.36 ? 40  TYR B CD1 1 
ATOM   1476 C CD2 . TYR B 1 40  ? 26.019 28.589  -3.669  1.00 26.35 ? 40  TYR B CD2 1 
ATOM   1477 C CE1 . TYR B 1 40  ? 26.555 28.378  -6.380  1.00 26.80 ? 40  TYR B CE1 1 
ATOM   1478 C CE2 . TYR B 1 40  ? 26.340 29.725  -4.394  1.00 27.34 ? 40  TYR B CE2 1 
ATOM   1479 C CZ  . TYR B 1 40  ? 26.600 29.605  -5.756  1.00 27.05 ? 40  TYR B CZ  1 
ATOM   1480 O OH  . TYR B 1 40  ? 26.912 30.741  -6.471  1.00 29.69 ? 40  TYR B OH  1 
ATOM   1481 N N   . LYS B 1 41  ? 28.919 26.057  -3.808  1.00 26.46 ? 41  LYS B N   1 
ATOM   1482 C CA  . LYS B 1 41  ? 30.052 25.812  -4.705  1.00 26.04 ? 41  LYS B CA  1 
ATOM   1483 C C   . LYS B 1 41  ? 30.879 24.635  -4.180  1.00 26.52 ? 41  LYS B C   1 
ATOM   1484 O O   . LYS B 1 41  ? 31.343 23.803  -4.954  1.00 26.35 ? 41  LYS B O   1 
ATOM   1485 C CB  . LYS B 1 41  ? 30.907 27.061  -4.862  1.00 26.05 ? 41  LYS B CB  1 
ATOM   1486 C CG  . LYS B 1 41  ? 30.178 28.230  -5.482  1.00 26.40 ? 41  LYS B CG  1 
ATOM   1487 C CD  . LYS B 1 41  ? 31.104 29.440  -5.524  1.00 26.86 ? 41  LYS B CD  1 
ATOM   1488 C CE  . LYS B 1 41  ? 30.423 30.644  -6.156  1.00 28.60 ? 41  LYS B CE  1 
ATOM   1489 N NZ  . LYS B 1 41  ? 31.399 31.756  -6.300  1.00 28.70 ? 41  LYS B NZ  1 
ATOM   1490 N N   . HIS B 1 42  ? 31.058 24.562  -2.863  1.00 26.75 ? 42  HIS B N   1 
ATOM   1491 C CA  . HIS B 1 42  ? 31.779 23.425  -2.280  1.00 27.31 ? 42  HIS B CA  1 
ATOM   1492 C C   . HIS B 1 42  ? 31.015 22.117  -2.432  1.00 26.77 ? 42  HIS B C   1 
ATOM   1493 O O   . HIS B 1 42  ? 31.622 21.073  -2.679  1.00 26.75 ? 42  HIS B O   1 
ATOM   1494 C CB  . HIS B 1 42  ? 32.077 23.678  -0.808  1.00 27.83 ? 42  HIS B CB  1 
ATOM   1495 C CG  . HIS B 1 42  ? 33.064 24.773  -0.577  1.00 31.09 ? 42  HIS B CG  1 
ATOM   1496 N ND1 . HIS B 1 42  ? 34.371 24.533  -0.207  1.00 35.02 ? 42  HIS B ND1 1 
ATOM   1497 C CD2 . HIS B 1 42  ? 32.935 26.117  -0.656  1.00 33.72 ? 42  HIS B CD2 1 
ATOM   1498 C CE1 . HIS B 1 42  ? 35.006 25.683  -0.072  1.00 34.83 ? 42  HIS B CE1 1 
ATOM   1499 N NE2 . HIS B 1 42  ? 34.157 26.661  -0.336  1.00 36.08 ? 42  HIS B NE2 1 
ATOM   1500 N N   . VAL B 1 43  ? 29.690 22.169  -2.263  1.00 26.47 ? 43  VAL B N   1 
ATOM   1501 C CA  . VAL B 1 43  ? 28.837 21.013  -2.490  1.00 26.55 ? 43  VAL B CA  1 
ATOM   1502 C C   . VAL B 1 43  ? 28.989 20.478  -3.928  1.00 26.43 ? 43  VAL B C   1 
ATOM   1503 O O   . VAL B 1 43  ? 29.203 19.289  -4.134  1.00 26.01 ? 43  VAL B O   1 
ATOM   1504 C CB  . VAL B 1 43  ? 27.338 21.311  -2.181  1.00 27.61 ? 43  VAL B CB  1 
ATOM   1505 C CG1 . VAL B 1 43  ? 26.459 20.126  -2.618  1.00 27.73 ? 43  VAL B CG1 1 
ATOM   1506 C CG2 . VAL B 1 43  ? 27.150 21.634  -0.688  1.00 26.72 ? 43  VAL B CG2 1 
ATOM   1507 N N   . VAL B 1 44  ? 28.924 21.367  -4.915  1.00 26.51 ? 44  VAL B N   1 
ATOM   1508 C CA  . VAL B 1 44  ? 29.094 20.949  -6.311  1.00 27.18 ? 44  VAL B CA  1 
ATOM   1509 C C   . VAL B 1 44  ? 30.481 20.323  -6.535  1.00 27.24 ? 44  VAL B C   1 
ATOM   1510 O O   . VAL B 1 44  ? 30.587 19.224  -7.120  1.00 28.13 ? 44  VAL B O   1 
ATOM   1511 C CB  . VAL B 1 44  ? 28.828 22.130  -7.276  1.00 26.80 ? 44  VAL B CB  1 
ATOM   1512 C CG1 . VAL B 1 44  ? 29.266 21.790  -8.688  1.00 28.09 ? 44  VAL B CG1 1 
ATOM   1513 C CG2 . VAL B 1 44  ? 27.337 22.472  -7.247  1.00 26.42 ? 44  VAL B CG2 1 
ATOM   1514 N N   . GLN B 1 45  ? 31.510 20.990  -6.013  1.00 27.36 ? 45  GLN B N   1 
ATOM   1515 C CA  . GLN B 1 45  ? 32.883 20.510  -6.130  1.00 27.88 ? 45  GLN B CA  1 
ATOM   1516 C C   . GLN B 1 45  ? 33.018 19.092  -5.555  1.00 27.86 ? 45  GLN B C   1 
ATOM   1517 O O   . GLN B 1 45  ? 33.627 18.217  -6.204  1.00 26.97 ? 45  GLN B O   1 
ATOM   1518 C CB  . GLN B 1 45  ? 33.852 21.465  -5.438  1.00 28.29 ? 45  GLN B CB  1 
ATOM   1519 C CG  . GLN B 1 45  ? 35.280 21.000  -5.510  1.00 31.57 ? 45  GLN B CG  1 
ATOM   1520 C CD  . GLN B 1 45  ? 36.197 21.863  -4.691  1.00 36.70 ? 45  GLN B CD  1 
ATOM   1521 O OE1 . GLN B 1 45  ? 35.862 22.274  -3.570  1.00 39.08 ? 45  GLN B OE1 1 
ATOM   1522 N NE2 . GLN B 1 45  ? 37.375 22.137  -5.230  1.00 39.05 ? 45  GLN B NE2 1 
ATOM   1523 N N   . SER B 1 46  ? 32.419 18.861  -4.372  1.00 27.16 ? 46  SER B N   1 
ATOM   1524 C CA  . SER B 1 46  ? 32.481 17.532  -3.728  1.00 27.06 ? 46  SER B CA  1 
ATOM   1525 C C   . SER B 1 46  ? 31.788 16.464  -4.550  1.00 26.42 ? 46  SER B C   1 
ATOM   1526 O O   . SER B 1 46  ? 32.301 15.352  -4.666  1.00 26.81 ? 46  SER B O   1 
ATOM   1527 C CB  . SER B 1 46  ? 31.909 17.549  -2.310  1.00 27.01 ? 46  SER B CB  1 
ATOM   1528 O OG  . SER B 1 46  ? 32.795 18.260  -1.455  1.00 27.50 ? 46  SER B OG  1 
ATOM   1529 N N   . VAL B 1 47  ? 30.643 16.812  -5.143  1.00 26.57 ? 47  VAL B N   1 
ATOM   1530 C CA  . VAL B 1 47  ? 29.904 15.860  -5.968  1.00 26.78 ? 47  VAL B CA  1 
ATOM   1531 C C   . VAL B 1 47  ? 30.727 15.527  -7.223  1.00 27.14 ? 47  VAL B C   1 
ATOM   1532 O O   . VAL B 1 47  ? 30.851 14.356  -7.608  1.00 26.96 ? 47  VAL B O   1 
ATOM   1533 C CB  . VAL B 1 47  ? 28.490 16.371  -6.325  1.00 27.31 ? 47  VAL B CB  1 
ATOM   1534 C CG1 . VAL B 1 47  ? 27.845 15.470  -7.383  1.00 27.49 ? 47  VAL B CG1 1 
ATOM   1535 C CG2 . VAL B 1 47  ? 27.594 16.413  -5.046  1.00 26.40 ? 47  VAL B CG2 1 
ATOM   1536 N N   . GLU B 1 48  ? 31.288 16.560  -7.846  1.00 27.47 ? 48  GLU B N   1 
ATOM   1537 C CA  . GLU B 1 48  ? 32.088 16.348  -9.050  1.00 27.40 ? 48  GLU B CA  1 
ATOM   1538 C C   . GLU B 1 48  ? 33.316 15.488  -8.726  1.00 27.14 ? 48  GLU B C   1 
ATOM   1539 O O   . GLU B 1 48  ? 33.682 14.611  -9.497  1.00 27.75 ? 48  GLU B O   1 
ATOM   1540 C CB  . GLU B 1 48  ? 32.475 17.687  -9.688  1.00 27.95 ? 48  GLU B CB  1 
ATOM   1541 C CG  . GLU B 1 48  ? 31.260 18.402  -10.274 1.00 27.68 ? 48  GLU B CG  1 
ATOM   1542 C CD  . GLU B 1 48  ? 31.556 19.802  -10.818 1.00 28.88 ? 48  GLU B CD  1 
ATOM   1543 O OE1 . GLU B 1 48  ? 32.654 20.354  -10.578 1.00 29.96 ? 48  GLU B OE1 1 
ATOM   1544 O OE2 . GLU B 1 48  ? 30.638 20.360  -11.452 1.00 30.86 ? 48  GLU B OE2 1 
ATOM   1545 N N   . LYS B 1 49  ? 33.939 15.735  -7.575  1.00 27.32 ? 49  LYS B N   1 
ATOM   1546 C CA  . LYS B 1 49  ? 35.109 14.961  -7.151  1.00 27.75 ? 49  LYS B CA  1 
ATOM   1547 C C   . LYS B 1 49  ? 34.747 13.500  -6.900  1.00 27.01 ? 49  LYS B C   1 
ATOM   1548 O O   . LYS B 1 49  ? 35.507 12.589  -7.264  1.00 27.30 ? 49  LYS B O   1 
ATOM   1549 C CB  . LYS B 1 49  ? 35.728 15.587  -5.904  1.00 28.38 ? 49  LYS B CB  1 
ATOM   1550 C CG  . LYS B 1 49  ? 37.118 15.092  -5.567  1.00 31.49 ? 49  LYS B CG  1 
ATOM   1551 C CD  . LYS B 1 49  ? 38.049 15.064  -6.777  1.00 35.65 ? 49  LYS B CD  1 
ATOM   1552 C CE  . LYS B 1 49  ? 38.672 16.414  -7.095  1.00 38.01 ? 49  LYS B CE  1 
ATOM   1553 N NZ  . LYS B 1 49  ? 39.954 16.200  -7.866  1.00 39.34 ? 49  LYS B NZ  1 
ATOM   1554 N N   . PHE B 1 50  ? 33.589 13.284  -6.288  1.00 27.47 ? 50  PHE B N   1 
ATOM   1555 C CA  . PHE B 1 50  ? 33.099 11.927  -6.062  1.00 27.08 ? 50  PHE B CA  1 
ATOM   1556 C C   . PHE B 1 50  ? 32.920 11.196  -7.395  1.00 27.67 ? 50  PHE B C   1 
ATOM   1557 O O   . PHE B 1 50  ? 33.350 10.053  -7.554  1.00 28.14 ? 50  PHE B O   1 
ATOM   1558 C CB  . PHE B 1 50  ? 31.799 11.948  -5.256  1.00 27.50 ? 50  PHE B CB  1 
ATOM   1559 C CG  . PHE B 1 50  ? 31.211 10.579  -5.026  1.00 26.64 ? 50  PHE B CG  1 
ATOM   1560 C CD1 . PHE B 1 50  ? 31.554 9.840   -3.899  1.00 29.52 ? 50  PHE B CD1 1 
ATOM   1561 C CD2 . PHE B 1 50  ? 30.300 10.039  -5.935  1.00 27.88 ? 50  PHE B CD2 1 
ATOM   1562 C CE1 . PHE B 1 50  ? 31.017 8.565   -3.688  1.00 27.94 ? 50  PHE B CE1 1 
ATOM   1563 C CE2 . PHE B 1 50  ? 29.750 8.749   -5.742  1.00 29.40 ? 50  PHE B CE2 1 
ATOM   1564 C CZ  . PHE B 1 50  ? 30.114 8.017   -4.609  1.00 29.26 ? 50  PHE B CZ  1 
ATOM   1565 N N   . ILE B 1 51  ? 32.258 11.854  -8.339  1.00 27.42 ? 51  ILE B N   1 
ATOM   1566 C CA  . ILE B 1 51  ? 32.028 11.275  -9.660  1.00 27.47 ? 51  ILE B CA  1 
ATOM   1567 C C   . ILE B 1 51  ? 33.351 10.982  -10.403 1.00 28.29 ? 51  ILE B C   1 
ATOM   1568 O O   . ILE B 1 51  ? 33.469 9.961   -11.115 1.00 28.80 ? 51  ILE B O   1 
ATOM   1569 C CB  . ILE B 1 51  ? 31.060 12.172  -10.470 1.00 27.15 ? 51  ILE B CB  1 
ATOM   1570 C CG1 . ILE B 1 51  ? 29.635 12.009  -9.910  1.00 27.32 ? 51  ILE B CG1 1 
ATOM   1571 C CG2 . ILE B 1 51  ? 31.053 11.782  -11.972 1.00 26.94 ? 51  ILE B CG2 1 
ATOM   1572 C CD1 . ILE B 1 51  ? 28.679 13.087  -10.377 1.00 27.38 ? 51  ILE B CD1 1 
ATOM   1573 N N   . GLN B 1 52  ? 34.336 11.861  -10.241 1.00 28.53 ? 52  GLN B N   1 
ATOM   1574 C CA  . GLN B 1 52  ? 35.628 11.682  -10.893 1.00 29.87 ? 52  GLN B CA  1 
ATOM   1575 C C   . GLN B 1 52  ? 36.330 10.433  -10.355 1.00 29.51 ? 52  GLN B C   1 
ATOM   1576 O O   . GLN B 1 52  ? 36.893 9.645   -11.118 1.00 29.96 ? 52  GLN B O   1 
ATOM   1577 C CB  . GLN B 1 52  ? 36.510 12.916  -10.692 1.00 29.55 ? 52  GLN B CB  1 
ATOM   1578 C CG  . GLN B 1 52  ? 37.891 12.821  -11.354 1.00 31.35 ? 52  GLN B CG  1 
ATOM   1579 C CD  . GLN B 1 52  ? 38.865 13.891  -10.862 1.00 32.26 ? 52  GLN B CD  1 
ATOM   1580 O OE1 . GLN B 1 52  ? 38.555 14.659  -9.954  1.00 39.34 ? 52  GLN B OE1 1 
ATOM   1581 N NE2 . GLN B 1 52  ? 40.056 13.934  -11.457 1.00 36.04 ? 52  GLN B NE2 1 
ATOM   1582 N N   . LYS B 1 53  ? 36.266 10.253  -9.038  1.00 29.80 ? 53  LYS B N   1 
ATOM   1583 C CA  . LYS B 1 53  ? 37.125 9.289   -8.349  1.00 30.25 ? 53  LYS B CA  1 
ATOM   1584 C C   . LYS B 1 53  ? 36.460 7.967   -7.941  1.00 29.52 ? 53  LYS B C   1 
ATOM   1585 O O   . LYS B 1 53  ? 37.147 7.011   -7.576  1.00 29.35 ? 53  LYS B O   1 
ATOM   1586 C CB  . LYS B 1 53  ? 37.786 9.964   -7.138  1.00 30.78 ? 53  LYS B CB  1 
ATOM   1587 C CG  . LYS B 1 53  ? 38.853 10.972  -7.534  1.00 33.84 ? 53  LYS B CG  1 
ATOM   1588 C CD  . LYS B 1 53  ? 39.505 11.609  -6.318  1.00 39.09 ? 53  LYS B CD  1 
ATOM   1589 C CE  . LYS B 1 53  ? 40.599 12.585  -6.725  1.00 40.86 ? 53  LYS B CE  1 
ATOM   1590 N NZ  . LYS B 1 53  ? 41.900 11.921  -7.026  1.00 42.37 ? 53  LYS B NZ  1 
ATOM   1591 N N   . CYS B 1 54  ? 35.141 7.889   -8.019  1.00 29.12 ? 54  CYS B N   1 
ATOM   1592 C CA  . CYS B 1 54  ? 34.445 6.741   -7.441  1.00 28.46 ? 54  CYS B CA  1 
ATOM   1593 C C   . CYS B 1 54  ? 34.552 5.501   -8.322  1.00 28.51 ? 54  CYS B C   1 
ATOM   1594 O O   . CYS B 1 54  ? 34.888 5.586   -9.513  1.00 28.76 ? 54  CYS B O   1 
ATOM   1595 C CB  . CYS B 1 54  ? 32.978 7.070   -7.166  1.00 27.74 ? 54  CYS B CB  1 
ATOM   1596 S SG  . CYS B 1 54  ? 32.022 7.323   -8.680  1.00 29.51 ? 54  CYS B SG  1 
ATOM   1597 N N   . LYS B 1 55  ? 34.271 4.344   -7.730  1.00 28.47 ? 55  LYS B N   1 
ATOM   1598 C CA  . LYS B 1 55  ? 34.222 3.078   -8.483  1.00 28.49 ? 55  LYS B CA  1 
ATOM   1599 C C   . LYS B 1 55  ? 33.120 3.147   -9.553  1.00 28.44 ? 55  LYS B C   1 
ATOM   1600 O O   . LYS B 1 55  ? 32.153 3.900   -9.385  1.00 27.76 ? 55  LYS B O   1 
ATOM   1601 C CB  . LYS B 1 55  ? 33.937 1.923   -7.532  1.00 28.81 ? 55  LYS B CB  1 
ATOM   1602 C CG  . LYS B 1 55  ? 35.098 1.542   -6.615  1.00 33.08 ? 55  LYS B CG  1 
ATOM   1603 C CD  . LYS B 1 55  ? 34.581 0.796   -5.396  1.00 37.20 ? 55  LYS B CD  1 
ATOM   1604 C CE  . LYS B 1 55  ? 35.693 0.096   -4.660  1.00 40.50 ? 55  LYS B CE  1 
ATOM   1605 N NZ  . LYS B 1 55  ? 35.228 -0.292  -3.297  1.00 42.80 ? 55  LYS B NZ  1 
ATOM   1606 N N   . PRO B 1 56  ? 33.262 2.379   -10.659 1.00 27.88 ? 56  PRO B N   1 
ATOM   1607 C CA  . PRO B 1 56  ? 32.256 2.445   -11.745 1.00 28.40 ? 56  PRO B CA  1 
ATOM   1608 C C   . PRO B 1 56  ? 30.789 2.271   -11.296 1.00 28.15 ? 56  PRO B C   1 
ATOM   1609 O O   . PRO B 1 56  ? 29.915 2.979   -11.799 1.00 28.07 ? 56  PRO B O   1 
ATOM   1610 C CB  . PRO B 1 56  ? 32.689 1.323   -12.690 1.00 28.39 ? 56  PRO B CB  1 
ATOM   1611 C CG  . PRO B 1 56  ? 34.168 1.211   -12.460 1.00 28.66 ? 56  PRO B CG  1 
ATOM   1612 C CD  . PRO B 1 56  ? 34.356 1.435   -10.988 1.00 28.45 ? 56  PRO B CD  1 
ATOM   1613 N N   . GLU B 1 57  ? 30.531 1.380   -10.338 1.00 28.26 ? 57  GLU B N   1 
ATOM   1614 C CA  A GLU B 1 57  ? 29.151 1.138   -9.881  0.80 28.25 ? 57  GLU B CA  1 
ATOM   1615 C CA  B GLU B 1 57  ? 29.165 1.127   -9.861  0.20 27.86 ? 57  GLU B CA  1 
ATOM   1616 C C   . GLU B 1 57  ? 28.520 2.332   -9.161  1.00 27.83 ? 57  GLU B C   1 
ATOM   1617 O O   . GLU B 1 57  ? 27.302 2.344   -8.939  1.00 27.35 ? 57  GLU B O   1 
ATOM   1618 C CB  A GLU B 1 57  ? 29.065 -0.121  -9.004  0.80 28.72 ? 57  GLU B CB  1 
ATOM   1619 C CB  B GLU B 1 57  ? 29.125 -0.108  -8.949  0.20 28.01 ? 57  GLU B CB  1 
ATOM   1620 C CG  A GLU B 1 57  ? 29.864 -0.053  -7.700  0.80 30.70 ? 57  GLU B CG  1 
ATOM   1621 C CG  B GLU B 1 57  ? 29.755 0.092   -7.569  0.20 28.04 ? 57  GLU B CG  1 
ATOM   1622 C CD  A GLU B 1 57  ? 31.274 -0.625  -7.822  0.80 32.27 ? 57  GLU B CD  1 
ATOM   1623 C CD  B GLU B 1 57  ? 29.734 -1.163  -6.708  0.20 27.97 ? 57  GLU B CD  1 
ATOM   1624 O OE1 A GLU B 1 57  ? 31.808 -0.733  -8.956  0.80 32.40 ? 57  GLU B OE1 1 
ATOM   1625 O OE1 B GLU B 1 57  ? 29.016 -2.131  -7.048  0.20 27.85 ? 57  GLU B OE1 1 
ATOM   1626 O OE2 A GLU B 1 57  ? 31.846 -0.983  -6.766  0.80 34.05 ? 57  GLU B OE2 1 
ATOM   1627 O OE2 B GLU B 1 57  ? 30.444 -1.180  -5.681  0.20 27.89 ? 57  GLU B OE2 1 
ATOM   1628 N N   . TYR B 1 58  ? 29.338 3.332   -8.802  1.00 26.79 ? 58  TYR B N   1 
ATOM   1629 C CA  . TYR B 1 58  ? 28.837 4.542   -8.134  1.00 26.58 ? 58  TYR B CA  1 
ATOM   1630 C C   . TYR B 1 58  ? 28.653 5.753   -9.055  1.00 26.63 ? 58  TYR B C   1 
ATOM   1631 O O   . TYR B 1 58  ? 28.187 6.802   -8.607  1.00 27.01 ? 58  TYR B O   1 
ATOM   1632 C CB  . TYR B 1 58  ? 29.708 4.907   -6.934  1.00 26.53 ? 58  TYR B CB  1 
ATOM   1633 C CG  . TYR B 1 58  ? 29.597 3.898   -5.826  1.00 26.58 ? 58  TYR B CG  1 
ATOM   1634 C CD1 . TYR B 1 58  ? 28.433 3.803   -5.064  1.00 26.44 ? 58  TYR B CD1 1 
ATOM   1635 C CD2 . TYR B 1 58  ? 30.652 3.032   -5.540  1.00 27.20 ? 58  TYR B CD2 1 
ATOM   1636 C CE1 . TYR B 1 58  ? 28.316 2.843   -4.055  1.00 27.03 ? 58  TYR B CE1 1 
ATOM   1637 C CE2 . TYR B 1 58  ? 30.551 2.086   -4.525  1.00 28.46 ? 58  TYR B CE2 1 
ATOM   1638 C CZ  . TYR B 1 58  ? 29.387 2.014   -3.773  1.00 26.66 ? 58  TYR B CZ  1 
ATOM   1639 O OH  . TYR B 1 58  ? 29.309 1.053   -2.781  1.00 26.59 ? 58  TYR B OH  1 
ATOM   1640 N N   . LYS B 1 59  ? 28.959 5.588   -10.346 1.00 27.15 ? 59  LYS B N   1 
ATOM   1641 C CA  . LYS B 1 59  ? 28.753 6.685   -11.306 1.00 27.54 ? 59  LYS B CA  1 
ATOM   1642 C C   . LYS B 1 59  ? 27.277 7.073   -11.349 1.00 27.62 ? 59  LYS B C   1 
ATOM   1643 O O   . LYS B 1 59  ? 26.940 8.242   -11.158 1.00 28.22 ? 59  LYS B O   1 
ATOM   1644 C CB  . LYS B 1 59  ? 29.261 6.325   -12.721 1.00 27.78 ? 59  LYS B CB  1 
ATOM   1645 C CG  . LYS B 1 59  ? 30.752 5.968   -12.831 1.00 27.78 ? 59  LYS B CG  1 
ATOM   1646 C CD  . LYS B 1 59  ? 31.671 7.082   -12.346 1.00 27.11 ? 59  LYS B CD  1 
ATOM   1647 C CE  . LYS B 1 59  ? 33.113 6.630   -12.486 1.00 30.33 ? 59  LYS B CE  1 
ATOM   1648 N NZ  . LYS B 1 59  ? 34.095 7.533   -11.819 1.00 30.51 ? 59  LYS B NZ  1 
ATOM   1649 N N   . VAL B 1 60  ? 26.401 6.099   -11.592 1.00 27.86 ? 60  VAL B N   1 
ATOM   1650 C CA  . VAL B 1 60  ? 24.952 6.400   -11.651 1.00 28.52 ? 60  VAL B CA  1 
ATOM   1651 C C   . VAL B 1 60  ? 24.411 6.948   -10.308 1.00 27.86 ? 60  VAL B C   1 
ATOM   1652 O O   . VAL B 1 60  ? 23.702 7.961   -10.298 1.00 26.95 ? 60  VAL B O   1 
ATOM   1653 C CB  . VAL B 1 60  ? 24.130 5.230   -12.229 1.00 28.92 ? 60  VAL B CB  1 
ATOM   1654 C CG1 . VAL B 1 60  ? 22.637 5.437   -11.999 1.00 29.99 ? 60  VAL B CG1 1 
ATOM   1655 C CG2 . VAL B 1 60  ? 24.437 5.079   -13.724 1.00 30.79 ? 60  VAL B CG2 1 
ATOM   1656 N N   . PRO B 1 61  ? 24.751 6.306   -9.174  1.00 27.20 ? 61  PRO B N   1 
ATOM   1657 C CA  . PRO B 1 61  ? 24.426 6.985   -7.899  1.00 26.78 ? 61  PRO B CA  1 
ATOM   1658 C C   . PRO B 1 61  ? 24.902 8.446   -7.795  1.00 26.74 ? 61  PRO B C   1 
ATOM   1659 O O   . PRO B 1 61  ? 24.164 9.292   -7.281  1.00 25.73 ? 61  PRO B O   1 
ATOM   1660 C CB  . PRO B 1 61  ? 25.108 6.088   -6.855  1.00 26.27 ? 61  PRO B CB  1 
ATOM   1661 C CG  . PRO B 1 61  ? 25.001 4.701   -7.478  1.00 27.02 ? 61  PRO B CG  1 
ATOM   1662 C CD  . PRO B 1 61  ? 25.287 4.953   -8.944  1.00 27.17 ? 61  PRO B CD  1 
ATOM   1663 N N   . GLY B 1 62  ? 26.104 8.746   -8.286  1.00 26.35 ? 62  GLY B N   1 
ATOM   1664 C CA  . GLY B 1 62  ? 26.606 10.117  -8.304  1.00 26.91 ? 62  GLY B CA  1 
ATOM   1665 C C   . GLY B 1 62  ? 25.711 11.029  -9.143  1.00 26.60 ? 62  GLY B C   1 
ATOM   1666 O O   . GLY B 1 62  ? 25.396 12.146  -8.745  1.00 26.67 ? 62  GLY B O   1 
ATOM   1667 N N   . LEU B 1 63  ? 25.301 10.548  -10.306 1.00 26.96 ? 63  LEU B N   1 
ATOM   1668 C CA  . LEU B 1 63  ? 24.355 11.299  -11.139 1.00 26.80 ? 63  LEU B CA  1 
ATOM   1669 C C   . LEU B 1 63  ? 23.017 11.502  -10.433 1.00 26.93 ? 63  LEU B C   1 
ATOM   1670 O O   . LEU B 1 63  ? 22.415 12.569  -10.509 1.00 27.59 ? 63  LEU B O   1 
ATOM   1671 C CB  . LEU B 1 63  ? 24.158 10.579  -12.479 1.00 26.78 ? 63  LEU B CB  1 
ATOM   1672 C CG  . LEU B 1 63  ? 23.096 11.207  -13.400 1.00 28.44 ? 63  LEU B CG  1 
ATOM   1673 C CD1 . LEU B 1 63  ? 23.436 12.652  -13.781 1.00 27.47 ? 63  LEU B CD1 1 
ATOM   1674 C CD2 . LEU B 1 63  ? 22.983 10.362  -14.646 1.00 29.24 ? 63  LEU B CD2 1 
ATOM   1675 N N   . TYR B 1 64  ? 22.543 10.465  -9.751  1.00 26.23 ? 64  TYR B N   1 
ATOM   1676 C CA  . TYR B 1 64  ? 21.306 10.579  -8.989  1.00 25.90 ? 64  TYR B CA  1 
ATOM   1677 C C   . TYR B 1 64  ? 21.417 11.648  -7.894  1.00 26.50 ? 64  TYR B C   1 
ATOM   1678 O O   . TYR B 1 64  ? 20.435 12.317  -7.590  1.00 26.21 ? 64  TYR B O   1 
ATOM   1679 C CB  . TYR B 1 64  ? 20.911 9.222   -8.406  1.00 26.24 ? 64  TYR B CB  1 
ATOM   1680 C CG  . TYR B 1 64  ? 20.376 8.234   -9.422  1.00 26.15 ? 64  TYR B CG  1 
ATOM   1681 C CD1 . TYR B 1 64  ? 20.087 8.627   -10.730 1.00 27.13 ? 64  TYR B CD1 1 
ATOM   1682 C CD2 . TYR B 1 64  ? 20.146 6.897   -9.068  1.00 26.97 ? 64  TYR B CD2 1 
ATOM   1683 C CE1 . TYR B 1 64  ? 19.584 7.706   -11.668 1.00 27.74 ? 64  TYR B CE1 1 
ATOM   1684 C CE2 . TYR B 1 64  ? 19.628 5.987   -9.989  1.00 28.33 ? 64  TYR B CE2 1 
ATOM   1685 C CZ  . TYR B 1 64  ? 19.367 6.392   -11.283 1.00 27.33 ? 64  TYR B CZ  1 
ATOM   1686 O OH  . TYR B 1 64  ? 18.867 5.486   -12.199 1.00 27.89 ? 64  TYR B OH  1 
ATOM   1687 N N   . VAL B 1 65  ? 22.597 11.763  -7.289  1.00 27.27 ? 65  VAL B N   1 
ATOM   1688 C CA  . VAL B 1 65  ? 22.872 12.847  -6.330  1.00 27.08 ? 65  VAL B CA  1 
ATOM   1689 C C   . VAL B 1 65  ? 22.647 14.208  -6.980  1.00 27.45 ? 65  VAL B C   1 
ATOM   1690 O O   . VAL B 1 65  ? 21.977 15.055  -6.404  1.00 27.37 ? 65  VAL B O   1 
ATOM   1691 C CB  . VAL B 1 65  ? 24.278 12.719  -5.682  1.00 27.01 ? 65  VAL B CB  1 
ATOM   1692 C CG1 . VAL B 1 65  ? 24.600 13.967  -4.889  1.00 28.04 ? 65  VAL B CG1 1 
ATOM   1693 C CG2 . VAL B 1 65  ? 24.339 11.465  -4.759  1.00 28.18 ? 65  VAL B CG2 1 
ATOM   1694 N N   . ILE B 1 66  ? 23.212 14.421  -8.169  1.00 26.91 ? 66  ILE B N   1 
ATOM   1695 C CA  . ILE B 1 66  ? 23.018 15.699  -8.881  1.00 26.66 ? 66  ILE B CA  1 
ATOM   1696 C C   . ILE B 1 66  ? 21.522 15.912  -9.107  1.00 26.88 ? 66  ILE B C   1 
ATOM   1697 O O   . ILE B 1 66  ? 20.980 16.969  -8.803  1.00 25.86 ? 66  ILE B O   1 
ATOM   1698 C CB  . ILE B 1 66  ? 23.765 15.738  -10.234 1.00 26.74 ? 66  ILE B CB  1 
ATOM   1699 C CG1 . ILE B 1 66  ? 25.297 15.666  -10.024 1.00 26.31 ? 66  ILE B CG1 1 
ATOM   1700 C CG2 . ILE B 1 66  ? 23.335 16.994  -11.047 1.00 26.50 ? 66  ILE B CG2 1 
ATOM   1701 C CD1 . ILE B 1 66  ? 26.102 15.653  -11.347 1.00 27.24 ? 66  ILE B CD1 1 
ATOM   1702 N N   . ASP B 1 67  ? 20.869 14.901  -9.675  1.00 26.16 ? 67  ASP B N   1 
ATOM   1703 C CA  . ASP B 1 67  ? 19.436 14.950  -9.947  1.00 26.77 ? 67  ASP B CA  1 
ATOM   1704 C C   . ASP B 1 67  ? 18.624 15.329  -8.716  1.00 26.59 ? 67  ASP B C   1 
ATOM   1705 O O   . ASP B 1 67  ? 17.775 16.250  -8.759  1.00 26.49 ? 67  ASP B O   1 
ATOM   1706 C CB  . ASP B 1 67  ? 18.953 13.595  -10.502 1.00 26.79 ? 67  ASP B CB  1 
ATOM   1707 C CG  . ASP B 1 67  ? 17.473 13.618  -10.859 1.00 28.48 ? 67  ASP B CG  1 
ATOM   1708 O OD1 . ASP B 1 67  ? 17.128 14.335  -11.829 1.00 30.43 ? 67  ASP B OD1 1 
ATOM   1709 O OD2 . ASP B 1 67  ? 16.656 12.979  -10.155 1.00 28.58 ? 67  ASP B OD2 1 
ATOM   1710 N N   . SER B 1 68  ? 18.875 14.630  -7.611  1.00 25.74 ? 68  SER B N   1 
ATOM   1711 C CA  . SER B 1 68  ? 18.087 14.832  -6.393  1.00 27.12 ? 68  SER B CA  1 
ATOM   1712 C C   . SER B 1 68  ? 18.311 16.238  -5.808  1.00 26.84 ? 68  SER B C   1 
ATOM   1713 O O   . SER B 1 68  ? 17.341 16.897  -5.415  1.00 26.36 ? 68  SER B O   1 
ATOM   1714 C CB  . SER B 1 68  ? 18.428 13.764  -5.355  1.00 27.77 ? 68  SER B CB  1 
ATOM   1715 O OG  . SER B 1 68  ? 17.574 13.848  -4.220  1.00 29.88 ? 68  SER B OG  1 
ATOM   1716 N N   . ILE B 1 69  ? 19.575 16.672  -5.748  1.00 26.68 ? 69  ILE B N   1 
ATOM   1717 C CA  . ILE B 1 69  ? 19.909 18.018  -5.236  1.00 26.58 ? 69  ILE B CA  1 
ATOM   1718 C C   . ILE B 1 69  ? 19.244 19.099  -6.097  1.00 26.70 ? 69  ILE B C   1 
ATOM   1719 O O   . ILE B 1 69  ? 18.566 19.981  -5.581  1.00 25.35 ? 69  ILE B O   1 
ATOM   1720 C CB  . ILE B 1 69  ? 21.433 18.262  -5.195  1.00 27.48 ? 69  ILE B CB  1 
ATOM   1721 C CG1 . ILE B 1 69  ? 22.067 17.355  -4.141  1.00 27.10 ? 69  ILE B CG1 1 
ATOM   1722 C CG2 . ILE B 1 69  ? 21.738 19.759  -4.864  1.00 27.58 ? 69  ILE B CG2 1 
ATOM   1723 C CD1 . ILE B 1 69  ? 23.623 17.296  -4.220  1.00 27.53 ? 69  ILE B CD1 1 
ATOM   1724 N N   . VAL B 1 70  ? 19.418 18.997  -7.409  1.00 26.80 ? 70  VAL B N   1 
ATOM   1725 C CA  . VAL B 1 70  ? 18.884 20.026  -8.311  1.00 27.28 ? 70  VAL B CA  1 
ATOM   1726 C C   . VAL B 1 70  ? 17.361 20.071  -8.247  1.00 27.72 ? 70  VAL B C   1 
ATOM   1727 O O   . VAL B 1 70  ? 16.767 21.142  -8.149  1.00 26.31 ? 70  VAL B O   1 
ATOM   1728 C CB  . VAL B 1 70  ? 19.374 19.800  -9.743  1.00 27.86 ? 70  VAL B CB  1 
ATOM   1729 C CG1 . VAL B 1 70  ? 18.575 20.677  -10.723 1.00 28.87 ? 70  VAL B CG1 1 
ATOM   1730 C CG2 . VAL B 1 70  ? 20.886 20.068  -9.821  1.00 28.00 ? 70  VAL B CG2 1 
ATOM   1731 N N   . ARG B 1 71  ? 16.716 18.904  -8.240  1.00 27.36 ? 71  ARG B N   1 
ATOM   1732 C CA  . ARG B 1 71  ? 15.255 18.896  -8.222  1.00 27.61 ? 71  ARG B CA  1 
ATOM   1733 C C   . ARG B 1 71  ? 14.724 19.371  -6.870  1.00 26.42 ? 71  ARG B C   1 
ATOM   1734 O O   . ARG B 1 71  ? 13.733 20.114  -6.815  1.00 26.25 ? 71  ARG B O   1 
ATOM   1735 C CB  . ARG B 1 71  ? 14.714 17.518  -8.630  1.00 27.93 ? 71  ARG B CB  1 
ATOM   1736 C CG  . ARG B 1 71  ? 15.000 17.209  -10.108 1.00 28.92 ? 71  ARG B CG  1 
ATOM   1737 C CD  . ARG B 1 71  ? 14.208 16.013  -10.654 1.00 30.92 ? 71  ARG B CD  1 
ATOM   1738 N NE  . ARG B 1 71  ? 14.389 14.793  -9.865  1.00 36.82 ? 71  ARG B NE  1 
ATOM   1739 C CZ  . ARG B 1 71  ? 13.408 14.137  -9.254  1.00 38.10 ? 71  ARG B CZ  1 
ATOM   1740 N NH1 . ARG B 1 71  ? 12.155 14.576  -9.313  1.00 41.32 ? 71  ARG B NH1 1 
ATOM   1741 N NH2 . ARG B 1 71  ? 13.679 13.040  -8.567  1.00 41.51 ? 71  ARG B NH2 1 
ATOM   1742 N N   . GLN B 1 72  ? 15.406 19.003  -5.785  1.00 25.76 ? 72  GLN B N   1 
ATOM   1743 C CA  . GLN B 1 72  ? 14.958 19.456  -4.463  1.00 25.87 ? 72  GLN B CA  1 
ATOM   1744 C C   . GLN B 1 72  ? 15.147 20.956  -4.316  1.00 24.89 ? 72  GLN B C   1 
ATOM   1745 O O   . GLN B 1 72  ? 14.283 21.631  -3.757  1.00 25.03 ? 72  GLN B O   1 
ATOM   1746 C CB  . GLN B 1 72  ? 15.670 18.702  -3.332  1.00 25.78 ? 72  GLN B CB  1 
ATOM   1747 C CG  . GLN B 1 72  ? 15.286 19.164  -1.914  1.00 29.43 ? 72  GLN B CG  1 
ATOM   1748 C CD  . GLN B 1 72  ? 13.813 18.974  -1.627  1.00 32.19 ? 72  GLN B CD  1 
ATOM   1749 O OE1 . GLN B 1 72  ? 13.196 18.018  -2.101  1.00 34.84 ? 72  GLN B OE1 1 
ATOM   1750 N NE2 . GLN B 1 72  ? 13.233 19.888  -0.851  1.00 33.46 ? 72  GLN B NE2 1 
ATOM   1751 N N   . SER B 1 73  ? 16.274 21.464  -4.804  1.00 24.33 ? 73  SER B N   1 
ATOM   1752 C CA  . SER B 1 73  ? 16.545 22.914  -4.739  1.00 24.73 ? 73  SER B CA  1 
ATOM   1753 C C   . SER B 1 73  ? 15.518 23.713  -5.549  1.00 24.85 ? 73  SER B C   1 
ATOM   1754 O O   . SER B 1 73  ? 14.996 24.730  -5.083  1.00 24.72 ? 73  SER B O   1 
ATOM   1755 C CB  . SER B 1 73  ? 17.979 23.227  -5.195  1.00 24.49 ? 73  SER B CB  1 
ATOM   1756 O OG  . SER B 1 73  ? 18.216 24.629  -5.188  1.00 26.05 ? 73  SER B OG  1 
ATOM   1757 N N   . ARG B 1 74  ? 15.211 23.251  -6.761  1.00 24.89 ? 74  ARG B N   1 
ATOM   1758 C CA  . ARG B 1 74  ? 14.209 23.919  -7.591  1.00 24.43 ? 74  ARG B CA  1 
ATOM   1759 C C   . ARG B 1 74  ? 12.849 23.959  -6.888  1.00 24.45 ? 74  ARG B C   1 
ATOM   1760 O O   . ARG B 1 74  ? 12.162 24.966  -6.910  1.00 24.15 ? 74  ARG B O   1 
ATOM   1761 C CB  . ARG B 1 74  ? 14.120 23.253  -8.970  1.00 24.65 ? 74  ARG B CB  1 
ATOM   1762 C CG  . ARG B 1 74  ? 15.340 23.553  -9.837  1.00 25.28 ? 74  ARG B CG  1 
ATOM   1763 C CD  . ARG B 1 74  ? 15.484 22.582  -11.032 1.00 25.22 ? 74  ARG B CD  1 
ATOM   1764 N NE  . ARG B 1 74  ? 14.280 22.549  -11.851 1.00 27.18 ? 74  ARG B NE  1 
ATOM   1765 C CZ  . ARG B 1 74  ? 13.981 23.419  -12.820 1.00 28.56 ? 74  ARG B CZ  1 
ATOM   1766 N NH1 . ARG B 1 74  ? 14.792 24.431  -13.117 1.00 29.32 ? 74  ARG B NH1 1 
ATOM   1767 N NH2 . ARG B 1 74  ? 12.852 23.282  -13.494 1.00 30.15 ? 74  ARG B NH2 1 
ATOM   1768 N N   . HIS B 1 75  ? 12.514 22.875  -6.194  1.00 24.61 ? 75  HIS B N   1 
ATOM   1769 C CA  . HIS B 1 75  ? 11.262 22.788  -5.447  1.00 25.16 ? 75  HIS B CA  1 
ATOM   1770 C C   . HIS B 1 75  ? 11.230 23.725  -4.244  1.00 24.47 ? 75  HIS B C   1 
ATOM   1771 O O   . HIS B 1 75  ? 10.241 24.439  -4.029  1.00 24.67 ? 75  HIS B O   1 
ATOM   1772 C CB  . HIS B 1 75  ? 11.057 21.350  -4.967  1.00 26.23 ? 75  HIS B CB  1 
ATOM   1773 C CG  . HIS B 1 75  ? 9.770  21.132  -4.244  1.00 28.84 ? 75  HIS B CG  1 
ATOM   1774 N ND1 . HIS B 1 75  ? 8.549  21.100  -4.884  1.00 33.45 ? 75  HIS B ND1 1 
ATOM   1775 C CD2 . HIS B 1 75  ? 9.512  20.949  -2.928  1.00 31.94 ? 75  HIS B CD2 1 
ATOM   1776 C CE1 . HIS B 1 75  ? 7.594  20.904  -3.993  1.00 33.85 ? 75  HIS B CE1 1 
ATOM   1777 N NE2 . HIS B 1 75  ? 8.152  20.808  -2.800  1.00 33.49 ? 75  HIS B NE2 1 
ATOM   1778 N N   . GLN B 1 76  ? 12.314 23.685  -3.471  1.00 24.06 ? 76  GLN B N   1 
ATOM   1779 C CA  . GLN B 1 76  ? 12.408 24.368  -2.183  1.00 23.45 ? 76  GLN B CA  1 
ATOM   1780 C C   . GLN B 1 76  ? 12.655 25.880  -2.306  1.00 23.08 ? 76  GLN B C   1 
ATOM   1781 O O   . GLN B 1 76  ? 12.140 26.656  -1.491  1.00 22.01 ? 76  GLN B O   1 
ATOM   1782 C CB  . GLN B 1 76  ? 13.493 23.715  -1.339  1.00 23.72 ? 76  GLN B CB  1 
ATOM   1783 C CG  . GLN B 1 76  ? 13.594 24.254  0.041   1.00 24.38 ? 76  GLN B CG  1 
ATOM   1784 C CD  . GLN B 1 76  ? 14.307 23.314  0.980   1.00 26.57 ? 76  GLN B CD  1 
ATOM   1785 O OE1 . GLN B 1 76  ? 14.541 22.139  0.672   1.00 27.39 ? 76  GLN B OE1 1 
ATOM   1786 N NE2 . GLN B 1 76  ? 14.673 23.831  2.133   1.00 29.30 ? 76  GLN B NE2 1 
ATOM   1787 N N   . PHE B 1 77  ? 13.422 26.283  -3.320  1.00 22.79 ? 77  PHE B N   1 
ATOM   1788 C CA  . PHE B 1 77  ? 13.780 27.701  -3.528  1.00 23.32 ? 77  PHE B CA  1 
ATOM   1789 C C   . PHE B 1 77  ? 13.160 28.365  -4.749  1.00 23.76 ? 77  PHE B C   1 
ATOM   1790 O O   . PHE B 1 77  ? 13.141 29.600  -4.863  1.00 23.17 ? 77  PHE B O   1 
ATOM   1791 C CB  . PHE B 1 77  ? 15.312 27.835  -3.569  1.00 22.81 ? 77  PHE B CB  1 
ATOM   1792 C CG  . PHE B 1 77  ? 15.976 27.311  -2.333  1.00 23.37 ? 77  PHE B CG  1 
ATOM   1793 C CD1 . PHE B 1 77  ? 16.010 28.080  -1.152  1.00 23.35 ? 77  PHE B CD1 1 
ATOM   1794 C CD2 . PHE B 1 77  ? 16.538 26.047  -2.337  1.00 24.30 ? 77  PHE B CD2 1 
ATOM   1795 C CE1 . PHE B 1 77  ? 16.613 27.580  0.004   1.00 23.05 ? 77  PHE B CE1 1 
ATOM   1796 C CE2 . PHE B 1 77  ? 17.154 25.519  -1.182  1.00 24.39 ? 77  PHE B CE2 1 
ATOM   1797 C CZ  . PHE B 1 77  ? 17.183 26.297  -0.003  1.00 24.18 ? 77  PHE B CZ  1 
ATOM   1798 N N   . GLY B 1 78  ? 12.629 27.551  -5.655  1.00 24.13 ? 78  GLY B N   1 
ATOM   1799 C CA  . GLY B 1 78  ? 12.026 28.089  -6.876  1.00 25.84 ? 78  GLY B CA  1 
ATOM   1800 C C   . GLY B 1 78  ? 12.893 27.730  -8.057  1.00 26.39 ? 78  GLY B C   1 
ATOM   1801 O O   . GLY B 1 78  ? 14.118 27.691  -7.959  1.00 26.17 ? 78  GLY B O   1 
ATOM   1802 N N   . GLN B 1 79  ? 12.262 27.459  -9.194  1.00 28.21 ? 79  GLN B N   1 
ATOM   1803 C CA  . GLN B 1 79  ? 13.023 27.027  -10.356 1.00 29.70 ? 79  GLN B CA  1 
ATOM   1804 C C   . GLN B 1 79  ? 14.046 28.064  -10.811 1.00 29.30 ? 79  GLN B C   1 
ATOM   1805 O O   . GLN B 1 79  ? 15.163 27.694  -11.191 1.00 30.59 ? 79  GLN B O   1 
ATOM   1806 C CB  . GLN B 1 79  ? 12.085 26.654  -11.499 1.00 29.96 ? 79  GLN B CB  1 
ATOM   1807 C CG  . GLN B 1 79  ? 11.191 25.465  -11.182 1.00 32.55 ? 79  GLN B CG  1 
ATOM   1808 C CD  . GLN B 1 79  ? 10.284 25.089  -12.344 1.00 32.59 ? 79  GLN B CD  1 
ATOM   1809 O OE1 . GLN B 1 79  ? 9.994  25.903  -13.219 1.00 35.24 ? 79  GLN B OE1 1 
ATOM   1810 N NE2 . GLN B 1 79  ? 9.833  23.840  -12.352 1.00 37.71 ? 79  GLN B NE2 1 
ATOM   1811 N N   . GLU B 1 80  ? 13.664 29.342  -10.735 1.00 29.51 ? 80  GLU B N   1 
ATOM   1812 C CA  A GLU B 1 80  ? 14.529 30.417  -11.203 0.50 29.95 ? 80  GLU B CA  1 
ATOM   1813 C CA  B GLU B 1 80  ? 14.470 30.484  -11.176 0.50 30.02 ? 80  GLU B CA  1 
ATOM   1814 C C   . GLU B 1 80  ? 15.543 30.874  -10.158 1.00 29.96 ? 80  GLU B C   1 
ATOM   1815 O O   . GLU B 1 80  ? 16.503 31.573  -10.492 1.00 30.78 ? 80  GLU B O   1 
ATOM   1816 C CB  A GLU B 1 80  ? 13.705 31.600  -11.743 0.50 30.20 ? 80  GLU B CB  1 
ATOM   1817 C CB  B GLU B 1 80  ? 13.551 31.698  -11.463 0.50 29.96 ? 80  GLU B CB  1 
ATOM   1818 C CG  A GLU B 1 80  ? 12.870 31.265  -12.984 0.50 31.79 ? 80  GLU B CG  1 
ATOM   1819 C CG  B GLU B 1 80  ? 14.257 32.950  -12.010 0.50 30.87 ? 80  GLU B CG  1 
ATOM   1820 C CD  A GLU B 1 80  ? 13.694 30.670  -14.125 0.50 34.21 ? 80  GLU B CD  1 
ATOM   1821 C CD  B GLU B 1 80  ? 13.368 34.197  -12.048 0.50 31.08 ? 80  GLU B CD  1 
ATOM   1822 O OE1 A GLU B 1 80  ? 14.730 31.265  -14.494 0.50 35.84 ? 80  GLU B OE1 1 
ATOM   1823 O OE1 B GLU B 1 80  ? 12.649 34.472  -11.062 0.50 33.49 ? 80  GLU B OE1 1 
ATOM   1824 O OE2 A GLU B 1 80  ? 13.301 29.607  -14.657 0.50 34.68 ? 80  GLU B OE2 1 
ATOM   1825 O OE2 B GLU B 1 80  ? 13.399 34.926  -13.064 0.50 32.85 ? 80  GLU B OE2 1 
ATOM   1826 N N   . LYS B 1 81  ? 15.363 30.451  -8.907  1.00 29.06 ? 81  LYS B N   1 
ATOM   1827 C CA  . LYS B 1 81  ? 16.261 30.870  -7.836  1.00 28.77 ? 81  LYS B CA  1 
ATOM   1828 C C   . LYS B 1 81  ? 17.307 29.815  -7.492  1.00 28.51 ? 81  LYS B C   1 
ATOM   1829 O O   . LYS B 1 81  ? 18.311 30.117  -6.840  1.00 28.70 ? 81  LYS B O   1 
ATOM   1830 C CB  . LYS B 1 81  ? 15.463 31.298  -6.598  1.00 29.03 ? 81  LYS B CB  1 
ATOM   1831 C CG  . LYS B 1 81  ? 14.539 32.507  -6.846  1.00 29.79 ? 81  LYS B CG  1 
ATOM   1832 C CD  . LYS B 1 81  ? 15.325 33.768  -7.225  1.00 31.38 ? 81  LYS B CD  1 
ATOM   1833 C CE  . LYS B 1 81  ? 14.473 35.029  -7.135  1.00 35.10 ? 81  LYS B CE  1 
ATOM   1834 N NZ  . LYS B 1 81  ? 13.389 35.086  -8.160  1.00 35.73 ? 81  LYS B NZ  1 
ATOM   1835 N N   . ASP B 1 82  ? 17.070 28.587  -7.949  1.00 27.72 ? 82  ASP B N   1 
ATOM   1836 C CA  . ASP B 1 82  ? 17.988 27.465  -7.713  1.00 28.25 ? 82  ASP B CA  1 
ATOM   1837 C C   . ASP B 1 82  ? 19.422 27.820  -8.140  1.00 28.36 ? 82  ASP B C   1 
ATOM   1838 O O   . ASP B 1 82  ? 19.660 28.253  -9.284  1.00 29.02 ? 82  ASP B O   1 
ATOM   1839 C CB  . ASP B 1 82  ? 17.495 26.218  -8.467  1.00 27.97 ? 82  ASP B CB  1 
ATOM   1840 C CG  . ASP B 1 82  ? 18.583 25.179  -8.664  1.00 28.06 ? 82  ASP B CG  1 
ATOM   1841 O OD1 . ASP B 1 82  ? 19.205 24.762  -7.667  1.00 28.51 ? 82  ASP B OD1 1 
ATOM   1842 O OD2 . ASP B 1 82  ? 18.824 24.788  -9.835  1.00 28.72 ? 82  ASP B OD2 1 
ATOM   1843 N N   . VAL B 1 83  ? 20.363 27.647  -7.219  1.00 27.92 ? 83  VAL B N   1 
ATOM   1844 C CA  . VAL B 1 83  ? 21.775 27.913  -7.497  1.00 27.34 ? 83  VAL B CA  1 
ATOM   1845 C C   . VAL B 1 83  ? 22.528 26.672  -7.995  1.00 27.50 ? 83  VAL B C   1 
ATOM   1846 O O   . VAL B 1 83  ? 23.626 26.790  -8.549  1.00 26.76 ? 83  VAL B O   1 
ATOM   1847 C CB  . VAL B 1 83  ? 22.499 28.499  -6.246  1.00 27.26 ? 83  VAL B CB  1 
ATOM   1848 C CG1 . VAL B 1 83  ? 21.864 29.818  -5.839  1.00 28.39 ? 83  VAL B CG1 1 
ATOM   1849 C CG2 . VAL B 1 83  ? 22.467 27.505  -5.080  1.00 27.68 ? 83  VAL B CG2 1 
ATOM   1850 N N   . PHE B 1 84  ? 21.942 25.489  -7.796  1.00 26.95 ? 84  PHE B N   1 
ATOM   1851 C CA  . PHE B 1 84  ? 22.662 24.237  -8.071  1.00 27.02 ? 84  PHE B CA  1 
ATOM   1852 C C   . PHE B 1 84  ? 22.753 23.889  -9.551  1.00 26.78 ? 84  PHE B C   1 
ATOM   1853 O O   . PHE B 1 84  ? 23.846 23.553  -10.027 1.00 27.36 ? 84  PHE B O   1 
ATOM   1854 C CB  . PHE B 1 84  ? 22.101 23.060  -7.264  1.00 27.27 ? 84  PHE B CB  1 
ATOM   1855 C CG  . PHE B 1 84  ? 22.518 23.067  -5.813  1.00 26.74 ? 84  PHE B CG  1 
ATOM   1856 C CD1 . PHE B 1 84  ? 23.815 22.673  -5.437  1.00 28.31 ? 84  PHE B CD1 1 
ATOM   1857 C CD2 . PHE B 1 84  ? 21.619 23.449  -4.819  1.00 29.43 ? 84  PHE B CD2 1 
ATOM   1858 C CE1 . PHE B 1 84  ? 24.214 22.658  -4.077  1.00 27.87 ? 84  PHE B CE1 1 
ATOM   1859 C CE2 . PHE B 1 84  ? 22.004 23.449  -3.457  1.00 29.32 ? 84  PHE B CE2 1 
ATOM   1860 C CZ  . PHE B 1 84  ? 23.308 23.031  -3.085  1.00 28.88 ? 84  PHE B CZ  1 
ATOM   1861 N N   . ALA B 1 85  ? 21.638 23.942  -10.285 1.00 27.14 ? 85  ALA B N   1 
ATOM   1862 C CA  . ALA B 1 85  ? 21.704 23.549  -11.709 1.00 27.44 ? 85  ALA B CA  1 
ATOM   1863 C C   . ALA B 1 85  ? 22.688 24.461  -12.456 1.00 28.09 ? 85  ALA B C   1 
ATOM   1864 O O   . ALA B 1 85  ? 23.573 23.962  -13.185 1.00 27.89 ? 85  ALA B O   1 
ATOM   1865 C CB  . ALA B 1 85  ? 20.314 23.561  -12.381 1.00 28.11 ? 85  ALA B CB  1 
ATOM   1866 N N   . PRO B 1 86  ? 22.567 25.796  -12.264 1.00 28.00 ? 86  PRO B N   1 
ATOM   1867 C CA  . PRO B 1 86  ? 23.536 26.655  -12.924 1.00 28.04 ? 86  PRO B CA  1 
ATOM   1868 C C   . PRO B 1 86  ? 24.972 26.311  -12.563 1.00 28.24 ? 86  PRO B C   1 
ATOM   1869 O O   . PRO B 1 86  ? 25.828 26.314  -13.449 1.00 29.29 ? 86  PRO B O   1 
ATOM   1870 C CB  . PRO B 1 86  ? 23.179 28.054  -12.409 1.00 27.86 ? 86  PRO B CB  1 
ATOM   1871 C CG  . PRO B 1 86  ? 21.749 27.968  -12.089 1.00 28.95 ? 86  PRO B CG  1 
ATOM   1872 C CD  . PRO B 1 86  ? 21.567 26.593  -11.519 1.00 28.29 ? 86  PRO B CD  1 
ATOM   1873 N N   . ARG B 1 87  ? 25.243 26.038  -11.281 1.00 28.22 ? 87  ARG B N   1 
ATOM   1874 C CA  . ARG B 1 87  ? 26.604 25.704  -10.862 1.00 27.44 ? 87  ARG B CA  1 
ATOM   1875 C C   . ARG B 1 87  ? 27.093 24.351  -11.416 1.00 27.35 ? 87  ARG B C   1 
ATOM   1876 O O   . ARG B 1 87  ? 28.231 24.257  -11.897 1.00 27.53 ? 87  ARG B O   1 
ATOM   1877 C CB  . ARG B 1 87  ? 26.750 25.753  -9.332  1.00 27.72 ? 87  ARG B CB  1 
ATOM   1878 C CG  . ARG B 1 87  ? 28.182 25.577  -8.852  1.00 26.96 ? 87  ARG B CG  1 
ATOM   1879 C CD  . ARG B 1 87  ? 29.096 26.694  -9.340  1.00 27.86 ? 87  ARG B CD  1 
ATOM   1880 N NE  . ARG B 1 87  ? 30.437 26.535  -8.791  1.00 28.82 ? 87  ARG B NE  1 
ATOM   1881 C CZ  . ARG B 1 87  ? 31.379 27.469  -8.813  1.00 28.76 ? 87  ARG B CZ  1 
ATOM   1882 N NH1 . ARG B 1 87  ? 31.134 28.670  -9.339  1.00 30.97 ? 87  ARG B NH1 1 
ATOM   1883 N NH2 . ARG B 1 87  ? 32.570 27.211  -8.289  1.00 31.52 ? 87  ARG B NH2 1 
ATOM   1884 N N   . PHE B 1 88  ? 26.237 23.325  -11.369 1.00 27.26 ? 88  PHE B N   1 
ATOM   1885 C CA  . PHE B 1 88  ? 26.585 22.028  -11.953 1.00 27.19 ? 88  PHE B CA  1 
ATOM   1886 C C   . PHE B 1 88  ? 26.830 22.126  -13.461 1.00 27.83 ? 88  PHE B C   1 
ATOM   1887 O O   . PHE B 1 88  ? 27.599 21.332  -14.024 1.00 28.50 ? 88  PHE B O   1 
ATOM   1888 C CB  . PHE B 1 88  ? 25.477 20.986  -11.695 1.00 27.37 ? 88  PHE B CB  1 
ATOM   1889 C CG  . PHE B 1 88  ? 25.580 20.312  -10.343 1.00 26.53 ? 88  PHE B CG  1 
ATOM   1890 C CD1 . PHE B 1 88  ? 26.679 19.501  -10.031 1.00 29.12 ? 88  PHE B CD1 1 
ATOM   1891 C CD2 . PHE B 1 88  ? 24.556 20.442  -9.416  1.00 27.15 ? 88  PHE B CD2 1 
ATOM   1892 C CE1 . PHE B 1 88  ? 26.782 18.874  -8.779  1.00 28.67 ? 88  PHE B CE1 1 
ATOM   1893 C CE2 . PHE B 1 88  ? 24.651 19.812  -8.152  1.00 25.90 ? 88  PHE B CE2 1 
ATOM   1894 C CZ  . PHE B 1 88  ? 25.739 19.024  -7.849  1.00 27.59 ? 88  PHE B CZ  1 
ATOM   1895 N N   . SER B 1 89  ? 26.160 23.081  -14.105 1.00 27.72 ? 89  SER B N   1 
ATOM   1896 C CA  A SER B 1 89  ? 26.275 23.268  -15.552 0.50 28.09 ? 89  SER B CA  1 
ATOM   1897 C CA  B SER B 1 89  ? 26.273 23.265  -15.552 0.50 27.66 ? 89  SER B CA  1 
ATOM   1898 C C   . SER B 1 89  ? 27.695 23.609  -15.989 1.00 27.83 ? 89  SER B C   1 
ATOM   1899 O O   . SER B 1 89  ? 28.105 23.247  -17.089 1.00 27.99 ? 89  SER B O   1 
ATOM   1900 C CB  A SER B 1 89  ? 25.310 24.356  -16.040 0.50 27.96 ? 89  SER B CB  1 
ATOM   1901 C CB  B SER B 1 89  ? 25.286 24.336  -16.046 0.50 27.45 ? 89  SER B CB  1 
ATOM   1902 O OG  A SER B 1 89  ? 25.787 25.649  -15.708 0.50 29.15 ? 89  SER B OG  1 
ATOM   1903 O OG  B SER B 1 89  ? 23.940 23.882  -15.969 0.50 26.00 ? 89  SER B OG  1 
ATOM   1904 N N   . ASN B 1 90  ? 28.438 24.309  -15.121 1.00 27.75 ? 90  ASN B N   1 
ATOM   1905 C CA  . ASN B 1 90  ? 29.780 24.823  -15.458 1.00 28.57 ? 90  ASN B CA  1 
ATOM   1906 C C   . ASN B 1 90  ? 30.742 23.743  -15.987 1.00 28.56 ? 90  ASN B C   1 
ATOM   1907 O O   . ASN B 1 90  ? 31.304 23.873  -17.091 1.00 27.65 ? 90  ASN B O   1 
ATOM   1908 C CB  . ASN B 1 90  ? 30.398 25.557  -14.257 1.00 28.56 ? 90  ASN B CB  1 
ATOM   1909 C CG  . ASN B 1 90  ? 29.645 26.841  -13.887 1.00 30.75 ? 90  ASN B CG  1 
ATOM   1910 O OD1 . ASN B 1 90  ? 28.692 27.245  -14.562 1.00 30.50 ? 90  ASN B OD1 1 
ATOM   1911 N ND2 . ASN B 1 90  ? 30.100 27.503  -12.819 1.00 30.65 ? 90  ASN B ND2 1 
ATOM   1912 N N   . ASN B 1 91  ? 30.910 22.679  -15.201 1.00 28.17 ? 91  ASN B N   1 
ATOM   1913 C CA  . ASN B 1 91  ? 31.805 21.576  -15.566 1.00 28.50 ? 91  ASN B CA  1 
ATOM   1914 C C   . ASN B 1 91  ? 31.070 20.347  -16.067 1.00 28.44 ? 91  ASN B C   1 
ATOM   1915 O O   . ASN B 1 91  ? 31.590 19.242  -15.974 1.00 27.80 ? 91  ASN B O   1 
ATOM   1916 C CB  . ASN B 1 91  ? 32.652 21.156  -14.360 1.00 29.64 ? 91  ASN B CB  1 
ATOM   1917 C CG  . ASN B 1 91  ? 33.558 22.267  -13.866 1.00 30.05 ? 91  ASN B CG  1 
ATOM   1918 O OD1 . ASN B 1 91  ? 34.079 23.072  -14.648 1.00 29.55 ? 91  ASN B OD1 1 
ATOM   1919 N ND2 . ASN B 1 91  ? 33.776 22.300  -12.554 1.00 33.37 ? 91  ASN B ND2 1 
ATOM   1920 N N   . ILE B 1 92  ? 29.854 20.522  -16.583 1.00 27.32 ? 92  ILE B N   1 
ATOM   1921 C CA  . ILE B 1 92  ? 29.016 19.360  -16.855 1.00 27.56 ? 92  ILE B CA  1 
ATOM   1922 C C   . ILE B 1 92  ? 29.586 18.413  -17.936 1.00 26.25 ? 92  ILE B C   1 
ATOM   1923 O O   . ILE B 1 92  ? 29.371 17.200  -17.869 1.00 26.00 ? 92  ILE B O   1 
ATOM   1924 C CB  . ILE B 1 92  ? 27.552 19.783  -17.162 1.00 27.71 ? 92  ILE B CB  1 
ATOM   1925 C CG1 . ILE B 1 92  ? 26.563 18.637  -16.850 1.00 29.15 ? 92  ILE B CG1 1 
ATOM   1926 C CG2 . ILE B 1 92  ? 27.444 20.377  -18.582 1.00 28.55 ? 92  ILE B CG2 1 
ATOM   1927 C CD1 . ILE B 1 92  ? 25.122 19.101  -16.783 1.00 30.07 ? 92  ILE B CD1 1 
ATOM   1928 N N   . ILE B 1 93  ? 30.300 18.958  -18.920 1.00 26.83 ? 93  ILE B N   1 
ATOM   1929 C CA  . ILE B 1 93  ? 30.934 18.093  -19.938 1.00 25.95 ? 93  ILE B CA  1 
ATOM   1930 C C   . ILE B 1 93  ? 31.945 17.145  -19.260 1.00 26.29 ? 93  ILE B C   1 
ATOM   1931 O O   . ILE B 1 93  ? 31.940 15.932  -19.515 1.00 26.92 ? 93  ILE B O   1 
ATOM   1932 C CB  . ILE B 1 93  ? 31.594 18.926  -21.043 1.00 26.86 ? 93  ILE B CB  1 
ATOM   1933 C CG1 . ILE B 1 93  ? 30.533 19.729  -21.815 1.00 26.95 ? 93  ILE B CG1 1 
ATOM   1934 C CG2 . ILE B 1 93  ? 32.401 18.034  -21.995 1.00 25.81 ? 93  ILE B CG2 1 
ATOM   1935 C CD1 . ILE B 1 93  ? 29.654 18.899  -22.760 1.00 27.56 ? 93  ILE B CD1 1 
ATOM   1936 N N   . SER B 1 94  ? 32.798 17.715  -18.400 1.00 25.78 ? 94  SER B N   1 
ATOM   1937 C CA  A SER B 1 94  ? 33.752 16.963  -17.584 0.50 26.08 ? 94  SER B CA  1 
ATOM   1938 C CA  B SER B 1 94  ? 33.748 16.928  -17.612 0.50 26.08 ? 94  SER B CA  1 
ATOM   1939 C C   . SER B 1 94  ? 33.032 15.878  -16.772 1.00 26.23 ? 94  SER B C   1 
ATOM   1940 O O   . SER B 1 94  ? 33.459 14.700  -16.711 1.00 26.12 ? 94  SER B O   1 
ATOM   1941 C CB  A SER B 1 94  ? 34.448 17.942  -16.626 0.50 25.96 ? 94  SER B CB  1 
ATOM   1942 C CB  B SER B 1 94  ? 34.549 17.838  -16.683 0.50 26.10 ? 94  SER B CB  1 
ATOM   1943 O OG  A SER B 1 94  ? 35.389 17.302  -15.790 0.50 27.14 ? 94  SER B OG  1 
ATOM   1944 O OG  B SER B 1 94  ? 35.607 18.447  -17.391 0.50 27.00 ? 94  SER B OG  1 
ATOM   1945 N N   . THR B 1 95  ? 31.955 16.299  -16.123 1.00 26.42 ? 95  THR B N   1 
ATOM   1946 C CA  . THR B 1 95  ? 31.204 15.414  -15.241 1.00 27.13 ? 95  THR B CA  1 
ATOM   1947 C C   . THR B 1 95  ? 30.706 14.215  -16.029 1.00 26.99 ? 95  THR B C   1 
ATOM   1948 O O   . THR B 1 95  ? 30.835 13.083  -15.581 1.00 26.78 ? 95  THR B O   1 
ATOM   1949 C CB  . THR B 1 95  ? 30.037 16.164  -14.588 1.00 27.92 ? 95  THR B CB  1 
ATOM   1950 O OG1 . THR B 1 95  ? 30.556 17.281  -13.875 1.00 27.61 ? 95  THR B OG1 1 
ATOM   1951 C CG2 . THR B 1 95  ? 29.290 15.258  -13.622 1.00 28.82 ? 95  THR B CG2 1 
ATOM   1952 N N   . PHE B 1 96  ? 30.152 14.467  -17.215 1.00 26.15 ? 96  PHE B N   1 
ATOM   1953 C CA  . PHE B 1 96  ? 29.598 13.381  -18.003 1.00 26.74 ? 96  PHE B CA  1 
ATOM   1954 C C   . PHE B 1 96  ? 30.641 12.476  -18.667 1.00 26.73 ? 96  PHE B C   1 
ATOM   1955 O O   . PHE B 1 96  ? 30.436 11.267  -18.779 1.00 27.47 ? 96  PHE B O   1 
ATOM   1956 C CB  . PHE B 1 96  ? 28.521 13.881  -18.958 1.00 27.24 ? 96  PHE B CB  1 
ATOM   1957 C CG  . PHE B 1 96  ? 27.184 13.994  -18.300 1.00 26.58 ? 96  PHE B CG  1 
ATOM   1958 C CD1 . PHE B 1 96  ? 26.925 15.041  -17.405 1.00 26.13 ? 96  PHE B CD1 1 
ATOM   1959 C CD2 . PHE B 1 96  ? 26.191 13.028  -18.511 1.00 28.57 ? 96  PHE B CD2 1 
ATOM   1960 C CE1 . PHE B 1 96  ? 25.667 15.130  -16.758 1.00 26.83 ? 96  PHE B CE1 1 
ATOM   1961 C CE2 . PHE B 1 96  ? 24.944 13.115  -17.876 1.00 28.47 ? 96  PHE B CE2 1 
ATOM   1962 C CZ  . PHE B 1 96  ? 24.689 14.174  -16.991 1.00 28.54 ? 96  PHE B CZ  1 
ATOM   1963 N N   . GLN B 1 97  ? 31.754 13.062  -19.074 1.00 27.53 ? 97  GLN B N   1 
ATOM   1964 C CA  . GLN B 1 97  ? 32.918 12.269  -19.469 1.00 28.11 ? 97  GLN B CA  1 
ATOM   1965 C C   . GLN B 1 97  ? 33.234 11.235  -18.381 1.00 28.09 ? 97  GLN B C   1 
ATOM   1966 O O   . GLN B 1 97  ? 33.451 10.066  -18.702 1.00 29.24 ? 97  GLN B O   1 
ATOM   1967 C CB  . GLN B 1 97  ? 34.127 13.161  -19.712 1.00 28.59 ? 97  GLN B CB  1 
ATOM   1968 C CG  . GLN B 1 97  ? 34.044 13.971  -21.002 1.00 29.27 ? 97  GLN B CG  1 
ATOM   1969 C CD  . GLN B 1 97  ? 35.213 14.934  -21.156 1.00 28.74 ? 97  GLN B CD  1 
ATOM   1970 O OE1 . GLN B 1 97  ? 36.110 14.991  -20.299 1.00 31.78 ? 97  GLN B OE1 1 
ATOM   1971 N NE2 . GLN B 1 97  ? 35.218 15.691  -22.250 1.00 27.08 ? 97  GLN B NE2 1 
ATOM   1972 N N   . ASN B 1 98  ? 33.240 11.663  -17.112 1.00 27.54 ? 98  ASN B N   1 
ATOM   1973 C CA  . ASN B 1 98  ? 33.483 10.751  -15.972 1.00 27.44 ? 98  ASN B CA  1 
ATOM   1974 C C   . ASN B 1 98  ? 32.337 9.770   -15.737 1.00 27.69 ? 98  ASN B C   1 
ATOM   1975 O O   . ASN B 1 98  ? 32.565 8.579   -15.471 1.00 27.67 ? 98  ASN B O   1 
ATOM   1976 C CB  . ASN B 1 98  ? 33.799 11.530  -14.678 1.00 27.82 ? 98  ASN B CB  1 
ATOM   1977 C CG  . ASN B 1 98  ? 35.096 12.339  -14.781 1.00 28.93 ? 98  ASN B CG  1 
ATOM   1978 O OD1 . ASN B 1 98  ? 35.996 12.004  -15.557 1.00 32.54 ? 98  ASN B OD1 1 
ATOM   1979 N ND2 . ASN B 1 98  ? 35.204 13.390  -13.975 1.00 30.48 ? 98  ASN B ND2 1 
ATOM   1980 N N   . LEU B 1 99  ? 31.108 10.263  -15.859 1.00 27.11 ? 99  LEU B N   1 
ATOM   1981 C CA  . LEU B 1 99  ? 29.921 9.414   -15.690 1.00 27.57 ? 99  LEU B CA  1 
ATOM   1982 C C   . LEU B 1 99  ? 29.885 8.247   -16.667 1.00 28.21 ? 99  LEU B C   1 
ATOM   1983 O O   . LEU B 1 99  ? 29.482 7.143   -16.289 1.00 27.78 ? 99  LEU B O   1 
ATOM   1984 C CB  . LEU B 1 99  ? 28.637 10.222  -15.832 1.00 27.94 ? 99  LEU B CB  1 
ATOM   1985 C CG  . LEU B 1 99  ? 28.317 11.081  -14.618 1.00 26.31 ? 99  LEU B CG  1 
ATOM   1986 C CD1 . LEU B 1 99  ? 27.102 11.949  -14.953 1.00 30.48 ? 99  LEU B CD1 1 
ATOM   1987 C CD2 . LEU B 1 99  ? 28.055 10.193  -13.378 1.00 27.36 ? 99  LEU B CD2 1 
ATOM   1988 N N   . TYR B 1 100 ? 30.325 8.492   -17.902 1.00 28.68 ? 100 TYR B N   1 
ATOM   1989 C CA  . TYR B 1 100 ? 30.239 7.484   -18.964 1.00 29.77 ? 100 TYR B CA  1 
ATOM   1990 C C   . TYR B 1 100 ? 31.328 6.413   -18.835 1.00 30.25 ? 100 TYR B C   1 
ATOM   1991 O O   . TYR B 1 100 ? 31.428 5.517   -19.680 1.00 30.32 ? 100 TYR B O   1 
ATOM   1992 C CB  . TYR B 1 100 ? 30.264 8.137   -20.355 1.00 29.71 ? 100 TYR B CB  1 
ATOM   1993 C CG  . TYR B 1 100 ? 28.945 8.800   -20.742 1.00 30.18 ? 100 TYR B CG  1 
ATOM   1994 C CD1 . TYR B 1 100 ? 27.725 8.097   -20.668 1.00 30.04 ? 100 TYR B CD1 1 
ATOM   1995 C CD2 . TYR B 1 100 ? 28.917 10.106  -21.198 1.00 29.72 ? 100 TYR B CD2 1 
ATOM   1996 C CE1 . TYR B 1 100 ? 26.523 8.705   -21.028 1.00 30.30 ? 100 TYR B CE1 1 
ATOM   1997 C CE2 . TYR B 1 100 ? 27.717 10.726  -21.552 1.00 30.06 ? 100 TYR B CE2 1 
ATOM   1998 C CZ  . TYR B 1 100 ? 26.529 10.026  -21.465 1.00 30.41 ? 100 TYR B CZ  1 
ATOM   1999 O OH  . TYR B 1 100 ? 25.347 10.649  -21.811 1.00 30.43 ? 100 TYR B OH  1 
ATOM   2000 N N   . ARG B 1 101 ? 32.119 6.504   -17.765 1.00 30.78 ? 101 ARG B N   1 
ATOM   2001 C CA  . ARG B 1 101 ? 33.045 5.440   -17.379 1.00 32.44 ? 101 ARG B CA  1 
ATOM   2002 C C   . ARG B 1 101 ? 32.349 4.403   -16.479 1.00 32.58 ? 101 ARG B C   1 
ATOM   2003 O O   . ARG B 1 101 ? 32.995 3.629   -15.768 1.00 34.19 ? 101 ARG B O   1 
ATOM   2004 C CB  . ARG B 1 101 ? 34.284 6.024   -16.704 1.00 32.65 ? 101 ARG B CB  1 
ATOM   2005 C CG  . ARG B 1 101 ? 35.108 6.912   -17.622 1.00 35.99 ? 101 ARG B CG  1 
ATOM   2006 C CD  . ARG B 1 101 ? 36.539 7.042   -17.138 1.00 42.14 ? 101 ARG B CD  1 
ATOM   2007 N NE  . ARG B 1 101 ? 37.446 7.380   -18.236 1.00 45.37 ? 101 ARG B NE  1 
ATOM   2008 C CZ  . ARG B 1 101 ? 37.980 6.500   -19.083 1.00 47.92 ? 101 ARG B CZ  1 
ATOM   2009 N NH1 . ARG B 1 101 ? 37.701 5.202   -18.983 1.00 49.47 ? 101 ARG B NH1 1 
ATOM   2010 N NH2 . ARG B 1 101 ? 38.795 6.918   -20.045 1.00 48.72 ? 101 ARG B NH2 1 
ATOM   2011 N N   . CYS B 1 102 ? 31.022 4.391   -16.538 1.00 32.48 ? 102 CYS B N   1 
ATOM   2012 C CA  . CYS B 1 102 ? 30.194 3.431   -15.823 1.00 31.77 ? 102 CYS B CA  1 
ATOM   2013 C C   . CYS B 1 102 ? 30.181 2.088   -16.547 1.00 31.66 ? 102 CYS B C   1 
ATOM   2014 O O   . CYS B 1 102 ? 30.595 2.011   -17.709 1.00 31.07 ? 102 CYS B O   1 
ATOM   2015 C CB  . CYS B 1 102 ? 28.775 3.970   -15.742 1.00 31.20 ? 102 CYS B CB  1 
ATOM   2016 S SG  . CYS B 1 102 ? 28.057 4.203   -17.397 1.00 31.74 ? 102 CYS B SG  1 
ATOM   2017 N N   . PRO B 1 103 ? 29.691 1.021   -15.873 1.00 31.59 ? 103 PRO B N   1 
ATOM   2018 C CA  . PRO B 1 103 ? 29.524 -0.257  -16.568 1.00 31.95 ? 103 PRO B CA  1 
ATOM   2019 C C   . PRO B 1 103 ? 28.574 -0.094  -17.751 1.00 32.12 ? 103 PRO B C   1 
ATOM   2020 O O   . PRO B 1 103 ? 27.682 0.771   -17.725 1.00 31.37 ? 103 PRO B O   1 
ATOM   2021 C CB  . PRO B 1 103 ? 28.906 -1.171  -15.499 1.00 32.01 ? 103 PRO B CB  1 
ATOM   2022 C CG  . PRO B 1 103 ? 29.289 -0.543  -14.187 1.00 31.95 ? 103 PRO B CG  1 
ATOM   2023 C CD  . PRO B 1 103 ? 29.276 0.937   -14.459 1.00 31.09 ? 103 PRO B CD  1 
ATOM   2024 N N   . GLY B 1 104 ? 28.774 -0.913  -18.779 1.00 32.50 ? 104 GLY B N   1 
ATOM   2025 C CA  . GLY B 1 104 ? 27.993 -0.813  -20.010 1.00 33.11 ? 104 GLY B CA  1 
ATOM   2026 C C   . GLY B 1 104 ? 26.487 -0.712  -19.822 1.00 33.74 ? 104 GLY B C   1 
ATOM   2027 O O   . GLY B 1 104 ? 25.833 0.093   -20.499 1.00 33.74 ? 104 GLY B O   1 
ATOM   2028 N N   . ASP B 1 105 ? 25.936 -1.527  -18.917 1.00 33.79 ? 105 ASP B N   1 
ATOM   2029 C CA  . ASP B 1 105 ? 24.478 -1.578  -18.699 1.00 34.40 ? 105 ASP B CA  1 
ATOM   2030 C C   . ASP B 1 105 ? 23.925 -0.369  -17.938 1.00 33.98 ? 105 ASP B C   1 
ATOM   2031 O O   . ASP B 1 105 ? 22.700 -0.191  -17.848 1.00 34.24 ? 105 ASP B O   1 
ATOM   2032 C CB  . ASP B 1 105 ? 24.035 -2.891  -18.032 1.00 35.20 ? 105 ASP B CB  1 
ATOM   2033 C CG  . ASP B 1 105 ? 24.922 -3.308  -16.860 1.00 37.31 ? 105 ASP B CG  1 
ATOM   2034 O OD1 . ASP B 1 105 ? 25.408 -2.437  -16.111 1.00 40.46 ? 105 ASP B OD1 1 
ATOM   2035 O OD2 . ASP B 1 105 ? 25.113 -4.535  -16.678 1.00 40.54 ? 105 ASP B OD2 1 
ATOM   2036 N N   . ASP B 1 106 ? 24.823 0.455   -17.398 1.00 32.38 ? 106 ASP B N   1 
ATOM   2037 C CA  . ASP B 1 106 ? 24.426 1.675   -16.716 1.00 31.47 ? 106 ASP B CA  1 
ATOM   2038 C C   . ASP B 1 106 ? 24.299 2.875   -17.662 1.00 29.84 ? 106 ASP B C   1 
ATOM   2039 O O   . ASP B 1 106 ? 23.725 3.881   -17.285 1.00 29.82 ? 106 ASP B O   1 
ATOM   2040 C CB  . ASP B 1 106 ? 25.386 2.004   -15.564 1.00 31.93 ? 106 ASP B CB  1 
ATOM   2041 C CG  . ASP B 1 106 ? 25.099 1.203   -14.297 1.00 33.42 ? 106 ASP B CG  1 
ATOM   2042 O OD1 . ASP B 1 106 ? 24.240 0.294   -14.316 1.00 34.86 ? 106 ASP B OD1 1 
ATOM   2043 O OD2 . ASP B 1 106 ? 25.751 1.475   -13.263 1.00 35.54 ? 106 ASP B OD2 1 
ATOM   2044 N N   . LYS B 1 107 ? 24.828 2.779   -18.879 1.00 29.18 ? 107 LYS B N   1 
ATOM   2045 C CA  . LYS B 1 107 ? 24.709 3.884   -19.854 1.00 28.98 ? 107 LYS B CA  1 
ATOM   2046 C C   . LYS B 1 107 ? 23.248 4.311   -20.084 1.00 27.33 ? 107 LYS B C   1 
ATOM   2047 O O   . LYS B 1 107 ? 22.950 5.500   -20.155 1.00 26.84 ? 107 LYS B O   1 
ATOM   2048 C CB  . LYS B 1 107 ? 25.346 3.525   -21.189 1.00 28.95 ? 107 LYS B CB  1 
ATOM   2049 C CG  . LYS B 1 107 ? 26.879 3.542   -21.210 1.00 31.88 ? 107 LYS B CG  1 
ATOM   2050 C CD  . LYS B 1 107 ? 27.397 3.207   -22.612 1.00 31.51 ? 107 LYS B CD  1 
ATOM   2051 C CE  . LYS B 1 107 ? 27.221 1.718   -22.948 1.00 35.99 ? 107 LYS B CE  1 
ATOM   2052 N NZ  . LYS B 1 107 ? 27.792 1.308   -24.260 1.00 39.55 ? 107 LYS B NZ  1 
ATOM   2053 N N   . SER B 1 108 ? 22.339 3.345   -20.191 1.00 26.27 ? 108 SER B N   1 
ATOM   2054 C CA  . SER B 1 108 ? 20.930 3.672   -20.417 1.00 26.07 ? 108 SER B CA  1 
ATOM   2055 C C   . SER B 1 108 ? 20.339 4.480   -19.251 1.00 26.52 ? 108 SER B C   1 
ATOM   2056 O O   . SER B 1 108 ? 19.395 5.260   -19.433 1.00 26.25 ? 108 SER B O   1 
ATOM   2057 C CB  . SER B 1 108 ? 20.112 2.403   -20.639 1.00 26.83 ? 108 SER B CB  1 
ATOM   2058 O OG  . SER B 1 108 ? 20.113 1.611   -19.470 1.00 28.28 ? 108 SER B OG  1 
ATOM   2059 N N   . LYS B 1 109 ? 20.876 4.276   -18.050 1.00 25.87 ? 109 LYS B N   1 
ATOM   2060 C CA  . LYS B 1 109 ? 20.357 4.981   -16.873 1.00 26.62 ? 109 LYS B CA  1 
ATOM   2061 C C   . LYS B 1 109 ? 20.725 6.466   -16.911 1.00 26.60 ? 109 LYS B C   1 
ATOM   2062 O O   . LYS B 1 109 ? 19.944 7.319   -16.469 1.00 27.14 ? 109 LYS B O   1 
ATOM   2063 C CB  . LYS B 1 109 ? 20.868 4.325   -15.592 1.00 26.80 ? 109 LYS B CB  1 
ATOM   2064 C CG  . LYS B 1 109 ? 20.501 2.856   -15.487 1.00 29.41 ? 109 LYS B CG  1 
ATOM   2065 C CD  . LYS B 1 109 ? 21.143 2.231   -14.261 1.00 32.08 ? 109 LYS B CD  1 
ATOM   2066 C CE  . LYS B 1 109 ? 20.872 0.724   -14.251 1.00 34.88 ? 109 LYS B CE  1 
ATOM   2067 N NZ  . LYS B 1 109 ? 21.480 0.095   -13.052 1.00 38.31 ? 109 LYS B NZ  1 
ATOM   2068 N N   . ILE B 1 110 ? 21.903 6.755   -17.461 1.00 26.22 ? 110 ILE B N   1 
ATOM   2069 C CA  . ILE B 1 110 ? 22.379 8.128   -17.648 1.00 26.74 ? 110 ILE B CA  1 
ATOM   2070 C C   . ILE B 1 110 ? 21.490 8.842   -18.667 1.00 26.44 ? 110 ILE B C   1 
ATOM   2071 O O   . ILE B 1 110 ? 21.045 9.981   -18.432 1.00 27.12 ? 110 ILE B O   1 
ATOM   2072 C CB  . ILE B 1 110 ? 23.855 8.154   -18.098 1.00 26.47 ? 110 ILE B CB  1 
ATOM   2073 C CG1 . ILE B 1 110 ? 24.749 7.488   -17.027 1.00 27.28 ? 110 ILE B CG1 1 
ATOM   2074 C CG2 . ILE B 1 110 ? 24.334 9.609   -18.391 1.00 26.37 ? 110 ILE B CG2 1 
ATOM   2075 C CD1 . ILE B 1 110 ? 26.208 7.414   -17.412 1.00 28.29 ? 110 ILE B CD1 1 
ATOM   2076 N N   . VAL B 1 111 ? 21.213 8.168   -19.784 1.00 25.27 ? 111 VAL B N   1 
ATOM   2077 C CA  . VAL B 1 111 ? 20.398 8.784   -20.828 1.00 25.15 ? 111 VAL B CA  1 
ATOM   2078 C C   . VAL B 1 111 ? 18.973 9.028   -20.308 1.00 25.46 ? 111 VAL B C   1 
ATOM   2079 O O   . VAL B 1 111 ? 18.361 10.059  -20.605 1.00 25.11 ? 111 VAL B O   1 
ATOM   2080 C CB  . VAL B 1 111 ? 20.416 7.954   -22.119 1.00 25.67 ? 111 VAL B CB  1 
ATOM   2081 C CG1 . VAL B 1 111 ? 19.417 8.492   -23.139 1.00 26.10 ? 111 VAL B CG1 1 
ATOM   2082 C CG2 . VAL B 1 111 ? 21.828 7.938   -22.703 1.00 26.29 ? 111 VAL B CG2 1 
ATOM   2083 N N   . ARG B 1 112 ? 18.455 8.081   -19.528 1.00 25.03 ? 112 ARG B N   1 
ATOM   2084 C CA  . ARG B 1 112 ? 17.133 8.249   -18.917 1.00 26.55 ? 112 ARG B CA  1 
ATOM   2085 C C   . ARG B 1 112 ? 17.056 9.564   -18.133 1.00 25.86 ? 112 ARG B C   1 
ATOM   2086 O O   . ARG B 1 112 ? 16.078 10.324  -18.292 1.00 25.94 ? 112 ARG B O   1 
ATOM   2087 C CB  . ARG B 1 112 ? 16.793 7.072   -18.007 1.00 25.87 ? 112 ARG B CB  1 
ATOM   2088 C CG  . ARG B 1 112 ? 15.349 7.127   -17.541 1.00 29.60 ? 112 ARG B CG  1 
ATOM   2089 C CD  . ARG B 1 112 ? 15.039 5.996   -16.611 1.00 36.12 ? 112 ARG B CD  1 
ATOM   2090 N NE  . ARG B 1 112 ? 13.595 5.798   -16.468 1.00 40.71 ? 112 ARG B NE  1 
ATOM   2091 C CZ  . ARG B 1 112 ? 13.015 5.267   -15.393 1.00 44.50 ? 112 ARG B CZ  1 
ATOM   2092 N NH1 . ARG B 1 112 ? 13.749 4.906   -14.342 1.00 46.57 ? 112 ARG B NH1 1 
ATOM   2093 N NH2 . ARG B 1 112 ? 11.695 5.118   -15.358 1.00 46.17 ? 112 ARG B NH2 1 
ATOM   2094 N N   . VAL B 1 113 ? 18.055 9.817   -17.283 1.00 25.46 ? 113 VAL B N   1 
ATOM   2095 C CA  . VAL B 1 113 ? 18.130 11.073  -16.513 1.00 25.83 ? 113 VAL B CA  1 
ATOM   2096 C C   . VAL B 1 113 ? 18.209 12.289  -17.448 1.00 25.73 ? 113 VAL B C   1 
ATOM   2097 O O   . VAL B 1 113 ? 17.476 13.266  -17.270 1.00 25.87 ? 113 VAL B O   1 
ATOM   2098 C CB  . VAL B 1 113 ? 19.308 11.060  -15.519 1.00 26.40 ? 113 VAL B CB  1 
ATOM   2099 C CG1 . VAL B 1 113 ? 19.483 12.425  -14.853 1.00 27.76 ? 113 VAL B CG1 1 
ATOM   2100 C CG2 . VAL B 1 113 ? 19.083 9.972   -14.455 1.00 27.50 ? 113 VAL B CG2 1 
ATOM   2101 N N   . LEU B 1 114 ? 19.071 12.223  -18.457 1.00 25.53 ? 114 LEU B N   1 
ATOM   2102 C CA  . LEU B 1 114 ? 19.171 13.335  -19.433 1.00 25.33 ? 114 LEU B CA  1 
ATOM   2103 C C   . LEU B 1 114 ? 17.838 13.649  -20.108 1.00 25.90 ? 114 LEU B C   1 
ATOM   2104 O O   . LEU B 1 114 ? 17.454 14.822  -20.278 1.00 25.09 ? 114 LEU B O   1 
ATOM   2105 C CB  . LEU B 1 114 ? 20.231 13.029  -20.493 1.00 25.80 ? 114 LEU B CB  1 
ATOM   2106 C CG  . LEU B 1 114 ? 21.689 13.126  -20.000 1.00 25.35 ? 114 LEU B CG  1 
ATOM   2107 C CD1 . LEU B 1 114 ? 22.658 12.618  -21.081 1.00 26.23 ? 114 LEU B CD1 1 
ATOM   2108 C CD2 . LEU B 1 114 ? 22.054 14.568  -19.578 1.00 27.41 ? 114 LEU B CD2 1 
ATOM   2109 N N   . ASN B 1 115 ? 17.134 12.598  -20.534 1.00 25.38 ? 115 ASN B N   1 
ATOM   2110 C CA  . ASN B 1 115 ? 15.844 12.784  -21.181 1.00 25.98 ? 115 ASN B CA  1 
ATOM   2111 C C   . ASN B 1 115 ? 14.820 13.447  -20.254 1.00 26.35 ? 115 ASN B C   1 
ATOM   2112 O O   . ASN B 1 115 ? 14.010 14.266  -20.702 1.00 26.20 ? 115 ASN B O   1 
ATOM   2113 C CB  . ASN B 1 115 ? 15.312 11.463  -21.715 1.00 25.75 ? 115 ASN B CB  1 
ATOM   2114 C CG  . ASN B 1 115 ? 15.896 11.108  -23.073 1.00 28.56 ? 115 ASN B CG  1 
ATOM   2115 O OD1 . ASN B 1 115 ? 16.486 11.958  -23.762 1.00 31.08 ? 115 ASN B OD1 1 
ATOM   2116 N ND2 . ASN B 1 115 ? 15.715 9.867   -23.474 1.00 28.17 ? 115 ASN B ND2 1 
ATOM   2117 N N   . LEU B 1 116 ? 14.851 13.064  -18.975 1.00 26.31 ? 116 LEU B N   1 
ATOM   2118 C CA  . LEU B 1 116 ? 13.972 13.673  -17.970 1.00 27.28 ? 116 LEU B CA  1 
ATOM   2119 C C   . LEU B 1 116 ? 14.353 15.140  -17.727 1.00 27.07 ? 116 LEU B C   1 
ATOM   2120 O O   . LEU B 1 116 ? 13.474 16.006  -17.626 1.00 27.90 ? 116 LEU B O   1 
ATOM   2121 C CB  . LEU B 1 116 ? 14.027 12.879  -16.655 1.00 27.84 ? 116 LEU B CB  1 
ATOM   2122 C CG  . LEU B 1 116 ? 13.183 11.583  -16.677 1.00 28.31 ? 116 LEU B CG  1 
ATOM   2123 C CD1 . LEU B 1 116 ? 13.592 10.710  -15.496 1.00 31.66 ? 116 LEU B CD1 1 
ATOM   2124 C CD2 . LEU B 1 116 ? 11.694 11.848  -16.645 1.00 30.88 ? 116 LEU B CD2 1 
ATOM   2125 N N   . TRP B 1 117 ? 15.656 15.426  -17.658 1.00 27.31 ? 117 TRP B N   1 
ATOM   2126 C CA  . TRP B 1 117 ? 16.088 16.813  -17.503 1.00 27.20 ? 117 TRP B CA  1 
ATOM   2127 C C   . TRP B 1 117 ? 15.599 17.688  -18.655 1.00 27.89 ? 117 TRP B C   1 
ATOM   2128 O O   . TRP B 1 117 ? 15.159 18.822  -18.435 1.00 28.24 ? 117 TRP B O   1 
ATOM   2129 C CB  . TRP B 1 117 ? 17.603 16.912  -17.396 1.00 28.15 ? 117 TRP B CB  1 
ATOM   2130 C CG  . TRP B 1 117 ? 18.147 16.437  -16.107 1.00 27.43 ? 117 TRP B CG  1 
ATOM   2131 C CD1 . TRP B 1 117 ? 17.446 16.058  -14.989 1.00 29.03 ? 117 TRP B CD1 1 
ATOM   2132 C CD2 . TRP B 1 117 ? 19.529 16.347  -15.770 1.00 29.68 ? 117 TRP B CD2 1 
ATOM   2133 N NE1 . TRP B 1 117 ? 18.327 15.712  -13.974 1.00 30.14 ? 117 TRP B NE1 1 
ATOM   2134 C CE2 . TRP B 1 117 ? 19.609 15.893  -14.426 1.00 29.88 ? 117 TRP B CE2 1 
ATOM   2135 C CE3 . TRP B 1 117 ? 20.711 16.599  -16.477 1.00 29.47 ? 117 TRP B CE3 1 
ATOM   2136 C CZ2 . TRP B 1 117 ? 20.835 15.673  -13.779 1.00 30.74 ? 117 TRP B CZ2 1 
ATOM   2137 C CZ3 . TRP B 1 117 ? 21.936 16.396  -15.835 1.00 28.81 ? 117 TRP B CZ3 1 
ATOM   2138 C CH2 . TRP B 1 117 ? 21.983 15.928  -14.494 1.00 29.36 ? 117 TRP B CH2 1 
ATOM   2139 N N   . GLN B 1 118 ? 15.687 17.156  -19.877 1.00 27.29 ? 118 GLN B N   1 
ATOM   2140 C CA  . GLN B 1 118 ? 15.190 17.866  -21.062 1.00 28.99 ? 118 GLN B CA  1 
ATOM   2141 C C   . GLN B 1 118 ? 13.676 18.063  -21.006 1.00 29.13 ? 118 GLN B C   1 
ATOM   2142 O O   . GLN B 1 118 ? 13.186 19.184  -21.186 1.00 29.74 ? 118 GLN B O   1 
ATOM   2143 C CB  . GLN B 1 118 ? 15.569 17.111  -22.340 1.00 29.17 ? 118 GLN B CB  1 
ATOM   2144 C CG  . GLN B 1 118 ? 15.270 17.898  -23.636 1.00 32.95 ? 118 GLN B CG  1 
ATOM   2145 C CD  . GLN B 1 118 ? 16.338 17.682  -24.692 1.00 37.63 ? 118 GLN B CD  1 
ATOM   2146 O OE1 . GLN B 1 118 ? 17.260 18.498  -24.848 1.00 40.77 ? 118 GLN B OE1 1 
ATOM   2147 N NE2 . GLN B 1 118 ? 16.240 16.572  -25.402 1.00 38.70 ? 118 GLN B NE2 1 
ATOM   2148 N N   . LYS B 1 119 ? 12.947 16.981  -20.746 1.00 28.93 ? 119 LYS B N   1 
ATOM   2149 C CA  . LYS B 1 119 ? 11.477 16.992  -20.766 1.00 30.09 ? 119 LYS B CA  1 
ATOM   2150 C C   . LYS B 1 119 ? 10.944 17.965  -19.714 1.00 30.36 ? 119 LYS B C   1 
ATOM   2151 O O   . LYS B 1 119 ? 9.960  18.677  -19.946 1.00 29.74 ? 119 LYS B O   1 
ATOM   2152 C CB  . LYS B 1 119 ? 10.946 15.574  -20.515 1.00 30.23 ? 119 LYS B CB  1 
ATOM   2153 C CG  . LYS B 1 119 ? 9.423  15.415  -20.475 1.00 33.06 ? 119 LYS B CG  1 
ATOM   2154 C CD  . LYS B 1 119 ? 9.079  14.362  -19.423 1.00 36.77 ? 119 LYS B CD  1 
ATOM   2155 C CE  . LYS B 1 119 ? 7.637  13.903  -19.514 1.00 40.81 ? 119 LYS B CE  1 
ATOM   2156 N NZ  . LYS B 1 119 ? 7.385  12.809  -18.524 1.00 43.75 ? 119 LYS B NZ  1 
ATOM   2157 N N   . ASN B 1 120 ? 11.634 18.017  -18.579 1.00 30.71 ? 120 ASN B N   1 
ATOM   2158 C CA  . ASN B 1 120 ? 11.194 18.802  -17.433 1.00 31.93 ? 120 ASN B CA  1 
ATOM   2159 C C   . ASN B 1 120 ? 11.919 20.139  -17.276 1.00 32.44 ? 120 ASN B C   1 
ATOM   2160 O O   . ASN B 1 120 ? 11.716 20.854  -16.288 1.00 32.85 ? 120 ASN B O   1 
ATOM   2161 C CB  . ASN B 1 120 ? 11.280 17.953  -16.159 1.00 32.17 ? 120 ASN B CB  1 
ATOM   2162 C CG  . ASN B 1 120 ? 10.321 16.756  -16.189 1.00 33.37 ? 120 ASN B CG  1 
ATOM   2163 O OD1 . ASN B 1 120 ? 10.699 15.626  -15.855 1.00 36.31 ? 120 ASN B OD1 1 
ATOM   2164 N ND2 . ASN B 1 120 ? 9.086  16.999  -16.591 1.00 34.01 ? 120 ASN B ND2 1 
ATOM   2165 N N   . ASN B 1 121 ? 12.747 20.471  -18.265 1.00 32.78 ? 121 ASN B N   1 
ATOM   2166 C CA  . ASN B 1 121 ? 13.488 21.738  -18.308 1.00 33.71 ? 121 ASN B CA  1 
ATOM   2167 C C   . ASN B 1 121 ? 14.354 21.979  -17.067 1.00 34.14 ? 121 ASN B C   1 
ATOM   2168 O O   . ASN B 1 121 ? 14.505 23.125  -16.624 1.00 34.11 ? 121 ASN B O   1 
ATOM   2169 C CB  . ASN B 1 121 ? 12.542 22.938  -18.569 1.00 33.97 ? 121 ASN B CB  1 
ATOM   2170 C CG  . ASN B 1 121 ? 11.825 22.858  -19.915 1.00 36.13 ? 121 ASN B CG  1 
ATOM   2171 O OD1 . ASN B 1 121 ? 12.439 22.632  -20.964 1.00 38.65 ? 121 ASN B OD1 1 
ATOM   2172 N ND2 . ASN B 1 121 ? 10.512 23.065  -19.890 1.00 37.83 ? 121 ASN B ND2 1 
ATOM   2173 N N   . VAL B 1 122 ? 14.918 20.893  -16.524 1.00 33.36 ? 122 VAL B N   1 
ATOM   2174 C CA  . VAL B 1 122 ? 15.779 20.933  -15.331 1.00 33.89 ? 122 VAL B CA  1 
ATOM   2175 C C   . VAL B 1 122 ? 17.089 21.657  -15.662 1.00 34.64 ? 122 VAL B C   1 
ATOM   2176 O O   . VAL B 1 122 ? 17.580 22.461  -14.861 1.00 35.23 ? 122 VAL B O   1 
ATOM   2177 C CB  . VAL B 1 122 ? 16.037 19.508  -14.749 1.00 33.03 ? 122 VAL B CB  1 
ATOM   2178 C CG1 . VAL B 1 122 ? 16.951 19.559  -13.512 1.00 33.06 ? 122 VAL B CG1 1 
ATOM   2179 C CG2 . VAL B 1 122 ? 14.720 18.815  -14.403 1.00 33.73 ? 122 VAL B CG2 1 
ATOM   2180 N N   . PHE B 1 123 ? 17.639 21.363  -16.838 1.00 35.42 ? 123 PHE B N   1 
ATOM   2181 C CA  . PHE B 1 123 ? 18.783 22.077  -17.403 1.00 36.32 ? 123 PHE B CA  1 
ATOM   2182 C C   . PHE B 1 123 ? 18.382 22.603  -18.768 1.00 36.97 ? 123 PHE B C   1 
ATOM   2183 O O   . PHE B 1 123 ? 17.447 22.098  -19.414 1.00 36.90 ? 123 PHE B O   1 
ATOM   2184 C CB  . PHE B 1 123 ? 20.042 21.181  -17.535 1.00 36.50 ? 123 PHE B CB  1 
ATOM   2185 C CG  . PHE B 1 123 ? 20.675 20.782  -16.223 1.00 36.23 ? 123 PHE B CG  1 
ATOM   2186 C CD1 . PHE B 1 123 ? 20.141 19.754  -15.456 1.00 35.12 ? 123 PHE B CD1 1 
ATOM   2187 C CD2 . PHE B 1 123 ? 21.815 21.435  -15.747 1.00 36.57 ? 123 PHE B CD2 1 
ATOM   2188 C CE1 . PHE B 1 123 ? 20.715 19.379  -14.253 1.00 36.46 ? 123 PHE B CE1 1 
ATOM   2189 C CE2 . PHE B 1 123 ? 22.412 21.051  -14.553 1.00 35.86 ? 123 PHE B CE2 1 
ATOM   2190 C CZ  . PHE B 1 123 ? 21.863 20.037  -13.795 1.00 36.71 ? 123 PHE B CZ  1 
ATOM   2191 N N   . LYS B 1 124 ? 19.092 23.630  -19.219 1.00 37.72 ? 124 LYS B N   1 
ATOM   2192 C CA  . LYS B 1 124 ? 18.816 24.217  -20.514 1.00 38.42 ? 124 LYS B CA  1 
ATOM   2193 C C   . LYS B 1 124 ? 19.110 23.201  -21.623 1.00 38.34 ? 124 LYS B C   1 
ATOM   2194 O O   . LYS B 1 124 ? 20.077 22.434  -21.542 1.00 38.31 ? 124 LYS B O   1 
ATOM   2195 C CB  . LYS B 1 124 ? 19.604 25.519  -20.696 1.00 38.64 ? 124 LYS B CB  1 
ATOM   2196 C CG  . LYS B 1 124 ? 19.375 26.531  -19.572 1.00 39.78 ? 124 LYS B CG  1 
ATOM   2197 C CD  . LYS B 1 124 ? 20.173 27.805  -19.801 1.00 40.32 ? 124 LYS B CD  1 
ATOM   2198 C CE  . LYS B 1 124 ? 19.755 28.891  -18.820 1.00 43.23 ? 124 LYS B CE  1 
ATOM   2199 N NZ  . LYS B 1 124 ? 20.365 30.201  -19.182 1.00 45.19 ? 124 LYS B NZ  1 
ATOM   2200 N N   . SER B 1 125 ? 18.252 23.177  -22.633 1.00 37.92 ? 125 SER B N   1 
ATOM   2201 C CA  . SER B 1 125 ? 18.350 22.195  -23.717 1.00 38.10 ? 125 SER B CA  1 
ATOM   2202 C C   . SER B 1 125 ? 19.709 22.241  -24.429 1.00 37.63 ? 125 SER B C   1 
ATOM   2203 O O   . SER B 1 125 ? 20.256 21.201  -24.794 1.00 37.27 ? 125 SER B O   1 
ATOM   2204 C CB  . SER B 1 125 ? 17.209 22.383  -24.712 1.00 38.70 ? 125 SER B CB  1 
ATOM   2205 O OG  . SER B 1 125 ? 16.802 21.136  -25.243 1.00 39.54 ? 125 SER B OG  1 
ATOM   2206 N N   . GLU B 1 126 ? 20.241 23.456  -24.599 1.00 37.24 ? 126 GLU B N   1 
ATOM   2207 C CA  . GLU B 1 126 ? 21.583 23.704  -25.148 1.00 36.95 ? 126 GLU B CA  1 
ATOM   2208 C C   . GLU B 1 126 ? 22.705 22.970  -24.386 1.00 36.03 ? 126 GLU B C   1 
ATOM   2209 O O   . GLU B 1 126 ? 23.739 22.617  -24.961 1.00 35.45 ? 126 GLU B O   1 
ATOM   2210 C CB  . GLU B 1 126 ? 21.857 25.216  -25.146 1.00 37.32 ? 126 GLU B CB  1 
ATOM   2211 C CG  . GLU B 1 126 ? 23.046 25.662  -25.993 1.00 39.11 ? 126 GLU B CG  1 
ATOM   2212 C CD  . GLU B 1 126 ? 23.183 27.187  -26.094 1.00 38.82 ? 126 GLU B CD  1 
ATOM   2213 O OE1 . GLU B 1 126 ? 23.486 27.834  -25.068 1.00 42.70 ? 126 GLU B OE1 1 
ATOM   2214 O OE2 . GLU B 1 126 ? 23.010 27.737  -27.208 1.00 42.61 ? 126 GLU B OE2 1 
ATOM   2215 N N   . ILE B 1 127 ? 22.493 22.771  -23.088 1.00 34.41 ? 127 ILE B N   1 
ATOM   2216 C CA  . ILE B 1 127 ? 23.461 22.123  -22.215 1.00 33.86 ? 127 ILE B CA  1 
ATOM   2217 C C   . ILE B 1 127 ? 23.339 20.601  -22.359 1.00 32.69 ? 127 ILE B C   1 
ATOM   2218 O O   . ILE B 1 127 ? 24.340 19.867  -22.378 1.00 32.27 ? 127 ILE B O   1 
ATOM   2219 C CB  . ILE B 1 127 ? 23.212 22.528  -20.728 1.00 34.57 ? 127 ILE B CB  1 
ATOM   2220 C CG1 . ILE B 1 127 ? 23.347 24.048  -20.509 1.00 36.02 ? 127 ILE B CG1 1 
ATOM   2221 C CG2 . ILE B 1 127 ? 24.084 21.720  -19.755 1.00 34.63 ? 127 ILE B CG2 1 
ATOM   2222 C CD1 . ILE B 1 127 ? 24.683 24.660  -20.921 1.00 38.16 ? 127 ILE B CD1 1 
ATOM   2223 N N   . ILE B 1 128 ? 22.101 20.136  -22.471 1.00 30.70 ? 128 ILE B N   1 
ATOM   2224 C CA  . ILE B 1 128 ? 21.809 18.702  -22.464 1.00 29.90 ? 128 ILE B CA  1 
ATOM   2225 C C   . ILE B 1 128 ? 22.190 18.002  -23.760 1.00 28.56 ? 128 ILE B C   1 
ATOM   2226 O O   . ILE B 1 128 ? 22.657 16.863  -23.731 1.00 28.15 ? 128 ILE B O   1 
ATOM   2227 C CB  . ILE B 1 128 ? 20.320 18.446  -22.151 1.00 29.47 ? 128 ILE B CB  1 
ATOM   2228 C CG1 . ILE B 1 128 ? 20.032 18.808  -20.692 1.00 30.91 ? 128 ILE B CG1 1 
ATOM   2229 C CG2 . ILE B 1 128 ? 19.922 16.980  -22.436 1.00 30.27 ? 128 ILE B CG2 1 
ATOM   2230 C CD1 . ILE B 1 128 ? 18.544 18.944  -20.380 1.00 32.62 ? 128 ILE B CD1 1 
ATOM   2231 N N   . GLN B 1 129 ? 21.979 18.672  -24.889 1.00 27.84 ? 129 GLN B N   1 
ATOM   2232 C CA  . GLN B 1 129 ? 22.137 18.006  -26.178 1.00 27.70 ? 129 GLN B CA  1 
ATOM   2233 C C   . GLN B 1 129 ? 23.528 17.394  -26.389 1.00 26.77 ? 129 GLN B C   1 
ATOM   2234 O O   . GLN B 1 129 ? 23.628 16.254  -26.846 1.00 26.10 ? 129 GLN B O   1 
ATOM   2235 C CB  . GLN B 1 129 ? 21.719 18.895  -27.365 1.00 28.23 ? 129 GLN B CB  1 
ATOM   2236 C CG  . GLN B 1 129 ? 21.494 18.103  -28.668 1.00 31.12 ? 129 GLN B CG  1 
ATOM   2237 C CD  . GLN B 1 129 ? 20.524 16.917  -28.492 1.00 34.40 ? 129 GLN B CD  1 
ATOM   2238 O OE1 . GLN B 1 129 ? 19.399 17.081  -28.016 1.00 36.15 ? 129 GLN B OE1 1 
ATOM   2239 N NE2 . GLN B 1 129 ? 20.973 15.721  -28.869 1.00 33.59 ? 129 GLN B NE2 1 
ATOM   2240 N N   . PRO B 1 130 ? 24.603 18.153  -26.100 1.00 26.49 ? 130 PRO B N   1 
ATOM   2241 C CA  . PRO B 1 130 ? 25.918 17.517  -26.256 1.00 25.78 ? 130 PRO B CA  1 
ATOM   2242 C C   . PRO B 1 130 ? 26.124 16.288  -25.368 1.00 25.08 ? 130 PRO B C   1 
ATOM   2243 O O   . PRO B 1 130 ? 26.856 15.385  -25.766 1.00 24.22 ? 130 PRO B O   1 
ATOM   2244 C CB  . PRO B 1 130 ? 26.907 18.632  -25.868 1.00 26.34 ? 130 PRO B CB  1 
ATOM   2245 C CG  . PRO B 1 130 ? 26.166 19.895  -26.080 1.00 28.00 ? 130 PRO B CG  1 
ATOM   2246 C CD  . PRO B 1 130 ? 24.728 19.580  -25.746 1.00 27.06 ? 130 PRO B CD  1 
ATOM   2247 N N   . LEU B 1 131 ? 25.494 16.263  -24.191 1.00 23.65 ? 131 LEU B N   1 
ATOM   2248 C CA  . LEU B 1 131 ? 25.599 15.122  -23.266 1.00 23.65 ? 131 LEU B CA  1 
ATOM   2249 C C   . LEU B 1 131 ? 24.904 13.871  -23.856 1.00 24.10 ? 131 LEU B C   1 
ATOM   2250 O O   . LEU B 1 131 ? 25.421 12.764  -23.770 1.00 23.83 ? 131 LEU B O   1 
ATOM   2251 C CB  . LEU B 1 131 ? 25.027 15.462  -21.880 1.00 24.10 ? 131 LEU B CB  1 
ATOM   2252 C CG  . LEU B 1 131 ? 25.533 16.772  -21.251 1.00 24.80 ? 131 LEU B CG  1 
ATOM   2253 C CD1 . LEU B 1 131 ? 24.814 17.021  -19.919 1.00 25.94 ? 131 LEU B CD1 1 
ATOM   2254 C CD2 . LEU B 1 131 ? 27.052 16.713  -21.055 1.00 27.19 ? 131 LEU B CD2 1 
ATOM   2255 N N   . LEU B 1 132 ? 23.746 14.068  -24.472 1.00 24.11 ? 132 LEU B N   1 
ATOM   2256 C CA  . LEU B 1 132 ? 23.093 12.972  -25.185 1.00 24.91 ? 132 LEU B CA  1 
ATOM   2257 C C   . LEU B 1 132 ? 23.925 12.518  -26.379 1.00 25.23 ? 132 LEU B C   1 
ATOM   2258 O O   . LEU B 1 132 ? 24.028 11.312  -26.644 1.00 25.22 ? 132 LEU B O   1 
ATOM   2259 C CB  . LEU B 1 132 ? 21.710 13.391  -25.665 1.00 25.39 ? 132 LEU B CB  1 
ATOM   2260 C CG  . LEU B 1 132 ? 20.669 13.545  -24.558 1.00 26.33 ? 132 LEU B CG  1 
ATOM   2261 C CD1 . LEU B 1 132 ? 19.507 14.360  -25.115 1.00 28.83 ? 132 LEU B CD1 1 
ATOM   2262 C CD2 . LEU B 1 132 ? 20.201 12.166  -24.064 1.00 28.25 ? 132 LEU B CD2 1 
ATOM   2263 N N   . ASP B 1 133 ? 24.499 13.479  -27.108 1.00 24.50 ? 133 ASP B N   1 
ATOM   2264 C CA  . ASP B 1 133 ? 25.302 13.139  -28.292 1.00 25.47 ? 133 ASP B CA  1 
ATOM   2265 C C   . ASP B 1 133 ? 26.487 12.264  -27.870 1.00 24.73 ? 133 ASP B C   1 
ATOM   2266 O O   . ASP B 1 133 ? 26.807 11.291  -28.554 1.00 23.28 ? 133 ASP B O   1 
ATOM   2267 C CB  . ASP B 1 133 ? 25.765 14.398  -29.030 1.00 25.70 ? 133 ASP B CB  1 
ATOM   2268 C CG  . ASP B 1 133 ? 24.621 15.145  -29.711 1.00 28.71 ? 133 ASP B CG  1 
ATOM   2269 O OD1 . ASP B 1 133 ? 23.508 14.581  -29.850 1.00 29.56 ? 133 ASP B OD1 1 
ATOM   2270 O OD2 . ASP B 1 133 ? 24.844 16.296  -30.143 1.00 31.35 ? 133 ASP B OD2 1 
ATOM   2271 N N   . MET B 1 134 ? 27.107 12.617  -26.737 1.00 25.17 ? 134 MET B N   1 
ATOM   2272 C CA  A MET B 1 134 ? 28.170 11.803  -26.165 0.50 25.22 ? 134 MET B CA  1 
ATOM   2273 C CA  B MET B 1 134 ? 28.166 11.830  -26.099 0.50 26.10 ? 134 MET B CA  1 
ATOM   2274 C C   . MET B 1 134 ? 27.727 10.371  -25.888 1.00 25.72 ? 134 MET B C   1 
ATOM   2275 O O   . MET B 1 134 ? 28.465 9.432   -26.187 1.00 25.51 ? 134 MET B O   1 
ATOM   2276 C CB  A MET B 1 134 ? 28.694 12.434  -24.888 0.50 25.81 ? 134 MET B CB  1 
ATOM   2277 C CB  B MET B 1 134 ? 28.539 12.476  -24.749 0.50 26.58 ? 134 MET B CB  1 
ATOM   2278 C CG  A MET B 1 134 ? 29.263 13.795  -25.118 0.50 24.19 ? 134 MET B CG  1 
ATOM   2279 C CG  B MET B 1 134 ? 29.912 12.113  -24.181 0.50 27.74 ? 134 MET B CG  1 
ATOM   2280 S SD  A MET B 1 134 ? 29.924 14.474  -23.606 0.50 26.12 ? 134 MET B SD  1 
ATOM   2281 S SD  B MET B 1 134 ? 30.365 13.136  -22.740 0.50 28.72 ? 134 MET B SD  1 
ATOM   2282 C CE  A MET B 1 134 ? 31.208 13.237  -23.386 0.50 21.00 ? 134 MET B CE  1 
ATOM   2283 C CE  B MET B 1 134 ? 30.803 14.670  -23.562 0.50 30.68 ? 134 MET B CE  1 
ATOM   2284 N N   . ALA B 1 135 ? 26.520 10.193  -25.353 1.00 25.42 ? 135 ALA B N   1 
ATOM   2285 C CA  . ALA B 1 135 ? 25.992 8.835   -25.128 1.00 25.96 ? 135 ALA B CA  1 
ATOM   2286 C C   . ALA B 1 135 ? 25.902 8.048   -26.435 1.00 25.15 ? 135 ALA B C   1 
ATOM   2287 O O   . ALA B 1 135 ? 26.355 6.889   -26.516 1.00 25.90 ? 135 ALA B O   1 
ATOM   2288 C CB  . ALA B 1 135 ? 24.614 8.885   -24.427 1.00 25.34 ? 135 ALA B CB  1 
ATOM   2289 N N   . ALA B 1 136 ? 25.346 8.679   -27.472 1.00 25.24 ? 136 ALA B N   1 
ATOM   2290 C CA  . ALA B 1 136 ? 25.139 8.007   -28.747 1.00 25.20 ? 136 ALA B CA  1 
ATOM   2291 C C   . ALA B 1 136 ? 26.464 7.665   -29.418 1.00 25.42 ? 136 ALA B C   1 
ATOM   2292 O O   . ALA B 1 136 ? 26.625 6.579   -29.957 1.00 24.42 ? 136 ALA B O   1 
ATOM   2293 C CB  . ALA B 1 136 ? 24.263 8.844   -29.680 1.00 25.03 ? 136 ALA B CB  1 
ATOM   2294 N N   . ALA B 1 137 ? 27.424 8.595   -29.362 1.00 25.67 ? 137 ALA B N   1 
ATOM   2295 C CA  . ALA B 1 137 ? 28.719 8.385   -30.001 1.00 26.82 ? 137 ALA B CA  1 
ATOM   2296 C C   . ALA B 1 137 ? 29.432 7.173   -29.405 1.00 27.72 ? 137 ALA B C   1 
ATOM   2297 O O   . ALA B 1 137 ? 30.142 6.461   -30.116 1.00 27.82 ? 137 ALA B O   1 
ATOM   2298 C CB  . ALA B 1 137 ? 29.594 9.636   -29.893 1.00 26.92 ? 137 ALA B CB  1 
ATOM   2299 N N   . LEU B 1 138 ? 29.216 6.936   -28.110 1.00 29.27 ? 138 LEU B N   1 
ATOM   2300 C CA  . LEU B 1 138 ? 29.783 5.776   -27.423 1.00 31.29 ? 138 LEU B CA  1 
ATOM   2301 C C   . LEU B 1 138 ? 29.238 4.456   -27.978 1.00 32.24 ? 138 LEU B C   1 
ATOM   2302 O O   . LEU B 1 138 ? 29.934 3.442   -27.941 1.00 32.75 ? 138 LEU B O   1 
ATOM   2303 C CB  . LEU B 1 138 ? 29.552 5.857   -25.906 1.00 31.30 ? 138 LEU B CB  1 
ATOM   2304 C CG  . LEU B 1 138 ? 30.439 6.808   -25.088 1.00 33.29 ? 138 LEU B CG  1 
ATOM   2305 C CD1 . LEU B 1 138 ? 29.930 6.872   -23.672 1.00 35.69 ? 138 LEU B CD1 1 
ATOM   2306 C CD2 . LEU B 1 138 ? 31.919 6.396   -25.101 1.00 34.99 ? 138 LEU B CD2 1 
ATOM   2307 N N   . GLU B 1 139 ? 28.015 4.483   -28.512 1.00 33.64 ? 139 GLU B N   1 
ATOM   2308 C CA  . GLU B 1 139 ? 27.369 3.289   -29.093 1.00 35.07 ? 139 GLU B CA  1 
ATOM   2309 C C   . GLU B 1 139 ? 27.796 3.018   -30.534 1.00 36.05 ? 139 GLU B C   1 
ATOM   2310 O O   . GLU B 1 139 ? 27.417 1.998   -31.132 1.00 36.38 ? 139 GLU B O   1 
ATOM   2311 C CB  . GLU B 1 139 ? 25.837 3.399   -29.033 1.00 34.88 ? 139 GLU B CB  1 
ATOM   2312 C CG  . GLU B 1 139 ? 25.249 3.647   -27.654 1.00 36.01 ? 139 GLU B CG  1 
ATOM   2313 C CD  . GLU B 1 139 ? 25.405 2.470   -26.690 1.00 36.38 ? 139 GLU B CD  1 
ATOM   2314 O OE1 . GLU B 1 139 ? 25.775 1.351   -27.118 1.00 39.41 ? 139 GLU B OE1 1 
ATOM   2315 O OE2 . GLU B 1 139 ? 25.125 2.676   -25.496 1.00 38.34 ? 139 GLU B OE2 1 
ATOM   2316 N N   . HIS B 1 140 ? 28.575 3.937   -31.096 1.00 37.04 ? 140 HIS B N   1 
ATOM   2317 C CA  . HIS B 1 140 ? 29.046 3.820   -32.467 1.00 37.89 ? 140 HIS B CA  1 
ATOM   2318 C C   . HIS B 1 140 ? 30.557 3.598   -32.518 1.00 38.32 ? 140 HIS B C   1 
ATOM   2319 O O   . HIS B 1 140 ? 31.241 3.681   -31.492 1.00 38.77 ? 140 HIS B O   1 
ATOM   2320 C CB  . HIS B 1 140 ? 28.653 5.068   -33.265 1.00 38.29 ? 140 HIS B CB  1 
ATOM   2321 C CG  . HIS B 1 140 ? 27.184 5.166   -33.559 1.00 38.26 ? 140 HIS B CG  1 
ATOM   2322 N ND1 . HIS B 1 140 ? 26.548 4.332   -34.455 1.00 37.61 ? 140 HIS B ND1 1 
ATOM   2323 C CD2 . HIS B 1 140 ? 26.232 6.010   -33.093 1.00 37.13 ? 140 HIS B CD2 1 
ATOM   2324 C CE1 . HIS B 1 140 ? 25.267 4.651   -34.520 1.00 37.16 ? 140 HIS B CE1 1 
ATOM   2325 N NE2 . HIS B 1 140 ? 25.050 5.668   -33.706 1.00 37.01 ? 140 HIS B NE2 1 
ATOM   2326 N N   . TYR C 2 8   ? 32.104 3.389   10.966  1.00 29.24 ? 1   TYR Y N   1 
ATOM   2327 C CA  . TYR C 2 8   ? 32.953 2.346   11.608  1.00 29.24 ? 1   TYR Y CA  1 
ATOM   2328 C C   . TYR C 2 8   ? 32.625 2.202   13.090  1.00 29.30 ? 1   TYR Y C   1 
ATOM   2329 O O   . TYR C 2 8   ? 32.344 3.186   13.786  1.00 29.33 ? 1   TYR Y O   1 
ATOM   2330 C CB  . TYR C 2 8   ? 34.447 2.659   11.416  1.00 29.13 ? 1   TYR Y CB  1 
ATOM   2331 C CG  . TYR C 2 8   ? 35.399 1.688   12.099  1.00 29.19 ? 1   TYR Y CG  1 
ATOM   2332 C CD1 . TYR C 2 8   ? 35.776 0.490   11.482  1.00 29.78 ? 1   TYR Y CD1 1 
ATOM   2333 C CD2 . TYR C 2 8   ? 35.928 1.973   13.364  1.00 28.96 ? 1   TYR Y CD2 1 
ATOM   2334 C CE1 . TYR C 2 8   ? 36.653 -0.405  12.117  1.00 28.66 ? 1   TYR Y CE1 1 
ATOM   2335 C CE2 . TYR C 2 8   ? 36.802 1.092   14.002  1.00 28.47 ? 1   TYR Y CE2 1 
ATOM   2336 C CZ  . TYR C 2 8   ? 37.154 -0.097  13.372  1.00 29.02 ? 1   TYR Y CZ  1 
ATOM   2337 O OH  . TYR C 2 8   ? 38.012 -0.960  13.997  1.00 28.37 ? 1   TYR Y OH  1 
ATOM   2338 N N   . SER C 2 9   ? 32.653 0.957   13.551  1.00 29.47 ? 2   SER Y N   1 
ATOM   2339 C CA  . SER C 2 9   ? 32.558 0.646   14.966  1.00 29.55 ? 2   SER Y CA  1 
ATOM   2340 C C   . SER C 2 9   ? 33.668 -0.342  15.313  1.00 29.77 ? 2   SER Y C   1 
ATOM   2341 O O   . SER C 2 9   ? 34.026 -1.190  14.473  1.00 30.11 ? 2   SER Y O   1 
ATOM   2342 C CB  . SER C 2 9   ? 31.189 0.048   15.303  1.00 29.62 ? 2   SER Y CB  1 
ATOM   2343 O OG  . SER C 2 9   ? 31.068 -0.208  16.695  1.00 29.46 ? 2   SER Y OG  1 
ATOM   2344 N N   . PRO C 2 10  ? 34.234 -0.222  16.533  1.00 29.47 ? 3   PRO Y N   1 
ATOM   2345 C CA  . PRO C 2 10  ? 35.171 -1.215  17.057  1.00 29.57 ? 3   PRO Y CA  1 
ATOM   2346 C C   . PRO C 2 10  ? 34.509 -2.589  17.189  1.00 29.78 ? 3   PRO Y C   1 
ATOM   2347 O O   . PRO C 2 10  ? 35.134 -3.536  17.665  1.00 30.08 ? 3   PRO Y O   1 
ATOM   2348 C CB  . PRO C 2 10  ? 35.531 -0.664  18.443  1.00 29.56 ? 3   PRO Y CB  1 
ATOM   2349 C CG  . PRO C 2 10  ? 34.422 0.268   18.794  1.00 29.44 ? 3   PRO Y CG  1 
ATOM   2350 C CD  . PRO C 2 10  ? 34.026 0.883   17.490  1.00 29.41 ? 3   PRO Y CD  1 
ATOM   2351 N N   . PRO D 2 6   ? 12.897 0.528   -0.721  1.00 30.68 ? -1  PRO Z N   1 
ATOM   2352 C CA  . PRO D 2 6   ? 12.643 1.465   -1.811  1.00 30.38 ? -1  PRO Z CA  1 
ATOM   2353 C C   . PRO D 2 6   ? 13.919 2.192   -2.220  1.00 30.43 ? -1  PRO Z C   1 
ATOM   2354 O O   . PRO D 2 6   ? 14.617 2.739   -1.359  1.00 30.25 ? -1  PRO Z O   1 
ATOM   2355 C CB  . PRO D 2 6   ? 11.643 2.444   -1.195  1.00 30.42 ? -1  PRO Z CB  1 
ATOM   2356 C CG  . PRO D 2 6   ? 10.914 1.643   -0.181  1.00 30.67 ? -1  PRO Z CG  1 
ATOM   2357 C CD  . PRO D 2 6   ? 11.903 0.645   0.361   1.00 30.66 ? -1  PRO Z CD  1 
ATOM   2358 N N   . SER D 2 7   ? 14.214 2.184   -3.521  1.00 29.98 ? 0   SER Z N   1 
ATOM   2359 C CA  . SER D 2 7   ? 15.415 2.813   -4.060  1.00 29.28 ? 0   SER Z CA  1 
ATOM   2360 C C   . SER D 2 7   ? 15.101 4.040   -4.904  1.00 28.75 ? 0   SER Z C   1 
ATOM   2361 O O   . SER D 2 7   ? 14.031 4.148   -5.515  1.00 27.85 ? 0   SER Z O   1 
ATOM   2362 C CB  . SER D 2 7   ? 16.239 1.814   -4.872  1.00 29.89 ? 0   SER Z CB  1 
ATOM   2363 O OG  . SER D 2 7   ? 15.524 1.349   -5.998  1.00 29.90 ? 0   SER Z OG  1 
ATOM   2364 N N   . TYR D 2 8   ? 16.058 4.955   -4.935  1.00 27.67 ? 1   TYR Z N   1 
ATOM   2365 C CA  . TYR D 2 8   ? 15.874 6.239   -5.582  1.00 27.49 ? 1   TYR Z CA  1 
ATOM   2366 C C   . TYR D 2 8   ? 15.587 6.072   -7.062  1.00 27.72 ? 1   TYR Z C   1 
ATOM   2367 O O   . TYR D 2 8   ? 16.238 5.282   -7.745  1.00 27.34 ? 1   TYR Z O   1 
ATOM   2368 C CB  . TYR D 2 8   ? 17.103 7.126   -5.393  1.00 27.31 ? 1   TYR Z CB  1 
ATOM   2369 C CG  . TYR D 2 8   ? 16.917 8.501   -6.004  1.00 26.64 ? 1   TYR Z CG  1 
ATOM   2370 C CD1 . TYR D 2 8   ? 16.284 9.518   -5.294  1.00 26.23 ? 1   TYR Z CD1 1 
ATOM   2371 C CD2 . TYR D 2 8   ? 17.342 8.769   -7.305  1.00 27.02 ? 1   TYR Z CD2 1 
ATOM   2372 C CE1 . TYR D 2 8   ? 16.105 10.780  -5.851  1.00 26.14 ? 1   TYR Z CE1 1 
ATOM   2373 C CE2 . TYR D 2 8   ? 17.161 10.036  -7.879  1.00 28.85 ? 1   TYR Z CE2 1 
ATOM   2374 C CZ  . TYR D 2 8   ? 16.544 11.032  -7.143  1.00 27.31 ? 1   TYR Z CZ  1 
ATOM   2375 O OH  . TYR D 2 8   ? 16.361 12.278  -7.702  1.00 26.48 ? 1   TYR Z OH  1 
ATOM   2376 N N   . SER D 2 9   ? 14.598 6.824   -7.534  1.00 27.82 ? 2   SER Z N   1 
ATOM   2377 C CA  . SER D 2 9   ? 14.303 6.943   -8.952  1.00 28.73 ? 2   SER Z CA  1 
ATOM   2378 C C   . SER D 2 9   ? 14.254 8.419   -9.365  1.00 28.42 ? 2   SER Z C   1 
ATOM   2379 O O   . SER D 2 9   ? 13.661 9.238   -8.657  1.00 28.83 ? 2   SER Z O   1 
ATOM   2380 C CB  . SER D 2 9   ? 12.967 6.282   -9.274  1.00 28.55 ? 2   SER Z CB  1 
ATOM   2381 O OG  . SER D 2 9   ? 12.490 6.691   -10.545 1.00 30.07 ? 2   SER Z OG  1 
ATOM   2382 N N   . PRO D 2 10  ? 14.830 8.754   -10.537 1.00 28.32 ? 3   PRO Z N   1 
ATOM   2383 C CA  . PRO D 2 10  ? 14.747 10.146  -11.004 1.00 28.42 ? 3   PRO Z CA  1 
ATOM   2384 C C   . PRO D 2 10  ? 13.336 10.560  -11.469 1.00 29.06 ? 3   PRO Z C   1 
ATOM   2385 O O   . PRO D 2 10  ? 13.124 11.722  -11.815 1.00 28.89 ? 3   PRO Z O   1 
ATOM   2386 C CB  . PRO D 2 10  ? 15.708 10.172  -12.203 1.00 28.38 ? 3   PRO Z CB  1 
ATOM   2387 C CG  . PRO D 2 10  ? 15.666 8.764   -12.732 1.00 28.38 ? 3   PRO Z CG  1 
ATOM   2388 C CD  . PRO D 2 10  ? 15.542 7.887   -11.502 1.00 28.28 ? 3   PRO Z CD  1 
ATOM   2389 N N   . THR D 2 11  ? 12.390 9.617   -11.491 1.00 29.75 ? 4   THR Z N   1 
ATOM   2390 C CA  . THR D 2 11  ? 11.000 9.920   -11.850 1.00 31.02 ? 4   THR Z CA  1 
ATOM   2391 C C   . THR D 2 11  ? 10.139 10.250  -10.623 1.00 31.85 ? 4   THR Z C   1 
ATOM   2392 O O   . THR D 2 11  ? 8.967  10.625  -10.755 1.00 31.76 ? 4   THR Z O   1 
ATOM   2393 C CB  . THR D 2 11  ? 10.343 8.748   -12.607 1.00 31.12 ? 4   THR Z CB  1 
ATOM   2394 O OG1 . THR D 2 11  ? 10.227 7.616   -11.736 1.00 31.18 ? 4   THR Z OG1 1 
ATOM   2395 C CG2 . THR D 2 11  ? 11.163 8.366   -13.833 1.00 31.78 ? 4   THR Z CG2 1 
HETATM 2396 N N   . SEP D 2 12  ? 10.721 10.098  -9.435  1.00 32.86 ? 5   SEP Z N   1 
HETATM 2397 C CA  . SEP D 2 12  ? 9.999  10.323  -8.180  1.00 34.17 ? 5   SEP Z CA  1 
HETATM 2398 C CB  . SEP D 2 12  ? 10.627 9.488   -7.064  1.00 34.38 ? 5   SEP Z CB  1 
HETATM 2399 O OG  . SEP D 2 12  ? 9.749  9.347   -5.961  1.00 36.87 ? 5   SEP Z OG  1 
HETATM 2400 C C   . SEP D 2 12  ? 9.995  11.804  -7.783  1.00 34.15 ? 5   SEP Z C   1 
HETATM 2401 O O   . SEP D 2 12  ? 11.020 12.477  -7.927  1.00 34.32 ? 5   SEP Z O   1 
HETATM 2402 P P   . SEP D 2 12  ? 9.669  7.789   -5.549  1.00 39.57 ? 5   SEP Z P   1 
HETATM 2403 O O1P . SEP D 2 12  ? 8.449  7.089   -6.335  1.00 39.51 ? 5   SEP Z O1P 1 
HETATM 2404 O O2P . SEP D 2 12  ? 11.057 7.061   -5.952  1.00 40.17 ? 5   SEP Z O2P 1 
HETATM 2405 O O3P . SEP D 2 12  ? 9.414  7.677   -3.963  1.00 39.64 ? 5   SEP Z O3P 1 
ATOM   2406 N N   . PRO D 2 13  ? 8.845  12.314  -7.284  1.00 34.23 ? 6   PRO Z N   1 
ATOM   2407 C CA  . PRO D 2 13  ? 8.727  13.702  -6.813  1.00 34.29 ? 6   PRO Z CA  1 
ATOM   2408 C C   . PRO D 2 13  ? 9.692  14.076  -5.679  1.00 34.38 ? 6   PRO Z C   1 
ATOM   2409 O O   . PRO D 2 13  ? 10.211 13.198  -4.987  1.00 34.53 ? 6   PRO Z O   1 
ATOM   2410 C CB  . PRO D 2 13  ? 7.278  13.779  -6.306  1.00 34.29 ? 6   PRO Z CB  1 
ATOM   2411 C CG  . PRO D 2 13  ? 6.564  12.699  -7.025  1.00 34.27 ? 6   PRO Z CG  1 
ATOM   2412 C CD  . PRO D 2 13  ? 7.561  11.594  -7.165  1.00 34.17 ? 6   PRO Z CD  1 
ATOM   2413 N N   . SER D 2 14  ? 9.917  15.377  -5.503  1.00 34.55 ? 7   SER Z N   1 
ATOM   2414 C CA  . SER D 2 14  ? 10.773 15.898  -4.433  1.00 34.53 ? 7   SER Z CA  1 
ATOM   2415 C C   . SER D 2 14  ? 10.044 15.933  -3.090  1.00 34.50 ? 7   SER Z C   1 
ATOM   2416 O O   . SER D 2 14  ? 9.296  16.866  -2.794  1.00 34.66 ? 7   SER Z O   1 
ATOM   2417 C CB  . SER D 2 14  ? 11.303 17.291  -4.796  1.00 34.47 ? 7   SER Z CB  1 
ATOM   2418 O OG  . SER D 2 14  ? 12.191 17.223  -5.901  1.00 34.42 ? 7   SER Z OG  1 
HETATM 2419 N N   . NH4 E 3 .   ? 52.106 -7.100  11.374  1.00 19.57 ? 400 NH4 A N   1 
HETATM 2420 S S   . SO4 F 4 .   ? 63.368 3.571   16.497  1.00 55.00 ? 501 SO4 A S   1 
HETATM 2421 O O1  . SO4 F 4 .   ? 64.743 3.797   16.939  1.00 54.36 ? 501 SO4 A O1  1 
HETATM 2422 O O2  . SO4 F 4 .   ? 63.262 3.802   15.058  1.00 54.26 ? 501 SO4 A O2  1 
HETATM 2423 O O3  . SO4 F 4 .   ? 63.005 2.188   16.792  1.00 53.74 ? 501 SO4 A O3  1 
HETATM 2424 O O4  . SO4 F 4 .   ? 62.485 4.504   17.199  1.00 53.82 ? 501 SO4 A O4  1 
HETATM 2425 S S   . SO4 G 4 .   ? 47.213 -16.322 15.566  1.00 62.07 ? 503 SO4 A S   1 
HETATM 2426 O O1  . SO4 G 4 .   ? 48.443 -16.136 16.340  1.00 61.82 ? 503 SO4 A O1  1 
HETATM 2427 O O2  . SO4 G 4 .   ? 47.551 -16.968 14.298  1.00 61.43 ? 503 SO4 A O2  1 
HETATM 2428 O O3  . SO4 G 4 .   ? 46.284 -17.166 16.318  1.00 62.38 ? 503 SO4 A O3  1 
HETATM 2429 O O4  . SO4 G 4 .   ? 46.553 -15.043 15.303  1.00 61.62 ? 503 SO4 A O4  1 
HETATM 2430 S S   . SO4 H 4 .   ? 35.282 -8.446  19.470  1.00 46.81 ? 507 SO4 A S   1 
HETATM 2431 O O1  . SO4 H 4 .   ? 36.076 -9.031  18.383  1.00 45.61 ? 507 SO4 A O1  1 
HETATM 2432 O O2  . SO4 H 4 .   ? 33.863 -8.720  19.237  1.00 46.49 ? 507 SO4 A O2  1 
HETATM 2433 O O3  . SO4 H 4 .   ? 35.699 -9.074  20.726  1.00 45.59 ? 507 SO4 A O3  1 
HETATM 2434 O O4  . SO4 H 4 .   ? 35.491 -6.999  19.547  1.00 45.55 ? 507 SO4 A O4  1 
HETATM 2435 S S   . SO4 I 4 .   ? 59.312 -1.864  17.920  1.00 44.59 ? 508 SO4 A S   1 
HETATM 2436 O O1  . SO4 I 4 .   ? 59.511 -1.599  16.496  1.00 44.84 ? 508 SO4 A O1  1 
HETATM 2437 O O2  . SO4 I 4 .   ? 57.929 -2.271  18.176  1.00 43.18 ? 508 SO4 A O2  1 
HETATM 2438 O O3  . SO4 I 4 .   ? 60.226 -2.944  18.295  1.00 44.82 ? 508 SO4 A O3  1 
HETATM 2439 O O4  . SO4 I 4 .   ? 59.599 -0.638  18.659  1.00 42.41 ? 508 SO4 A O4  1 
HETATM 2440 N N   . NH4 J 3 .   ? 19.043 27.129  -4.623  1.00 20.94 ? 401 NH4 B N   1 
HETATM 2441 S S   . SO4 K 4 .   ? 34.368 30.499  -8.360  1.00 47.12 ? 504 SO4 B S   1 
HETATM 2442 O O1  . SO4 K 4 .   ? 35.447 31.346  -8.868  1.00 46.91 ? 504 SO4 B O1  1 
HETATM 2443 O O2  . SO4 K 4 .   ? 33.077 31.135  -8.618  1.00 44.83 ? 504 SO4 B O2  1 
HETATM 2444 O O3  . SO4 K 4 .   ? 34.459 29.207  -9.042  1.00 46.73 ? 504 SO4 B O3  1 
HETATM 2445 O O4  . SO4 K 4 .   ? 34.545 30.282  -6.926  1.00 47.86 ? 504 SO4 B O4  1 
HETATM 2446 S S   . SO4 L 4 .   ? 10.014 17.394  -9.238  1.00 62.43 ? 506 SO4 B S   1 
HETATM 2447 O O1  . SO4 L 4 .   ? 10.030 17.008  -10.649 1.00 61.94 ? 506 SO4 B O1  1 
HETATM 2448 O O2  . SO4 L 4 .   ? 9.126  16.509  -8.490  1.00 61.88 ? 506 SO4 B O2  1 
HETATM 2449 O O3  . SO4 L 4 .   ? 11.373 17.289  -8.716  1.00 62.46 ? 506 SO4 B O3  1 
HETATM 2450 O O4  . SO4 L 4 .   ? 9.548  18.774  -9.099  1.00 61.96 ? 506 SO4 B O4  1 
HETATM 2451 S S   . SO4 M 4 .   ? 27.900 30.204  -10.366 1.00 43.43 ? 509 SO4 B S   1 
HETATM 2452 O O1  . SO4 M 4 .   ? 29.111 29.716  -11.028 1.00 41.13 ? 509 SO4 B O1  1 
HETATM 2453 O O2  . SO4 M 4 .   ? 26.746 29.421  -10.831 1.00 42.48 ? 509 SO4 B O2  1 
HETATM 2454 O O3  . SO4 M 4 .   ? 28.045 30.103  -8.910  1.00 43.48 ? 509 SO4 B O3  1 
HETATM 2455 O O4  . SO4 M 4 .   ? 27.688 31.616  -10.684 1.00 44.82 ? 509 SO4 B O4  1 
HETATM 2456 O O   . HOH N 5 .   ? 56.759 -3.934  16.369  1.00 22.79 ? 509 HOH A O   1 
HETATM 2457 O O   . HOH N 5 .   ? 50.685 5.120   20.430  1.00 20.43 ? 510 HOH A O   1 
HETATM 2458 O O   . HOH N 5 .   ? 54.491 4.345   19.902  1.00 19.06 ? 511 HOH A O   1 
HETATM 2459 O O   . HOH N 5 .   ? 56.193 6.954   16.927  1.00 27.25 ? 512 HOH A O   1 
HETATM 2460 O O   . HOH N 5 .   ? 51.674 9.691   21.038  1.00 22.36 ? 513 HOH A O   1 
HETATM 2461 O O   . HOH N 5 .   ? 49.469 11.224  20.056  1.00 23.95 ? 514 HOH A O   1 
HETATM 2462 O O   . HOH N 5 .   ? 34.073 12.677  17.283  1.00 43.30 ? 515 HOH A O   1 
HETATM 2463 O O   . HOH N 5 .   ? 36.762 12.649  19.519  1.00 25.10 ? 516 HOH A O   1 
HETATM 2464 O O   . HOH N 5 .   ? 33.753 3.148   20.798  1.00 26.52 ? 517 HOH A O   1 
HETATM 2465 O O   . HOH N 5 .   ? 49.550 -7.846  18.679  1.00 23.00 ? 518 HOH A O   1 
HETATM 2466 O O   . HOH N 5 .   ? 51.422 -15.789 11.668  1.00 25.42 ? 519 HOH A O   1 
HETATM 2467 O O   . HOH N 5 .   ? 59.204 4.272   19.716  1.00 36.08 ? 520 HOH A O   1 
HETATM 2468 O O   . HOH N 5 .   ? 53.663 4.937   26.692  1.00 19.59 ? 521 HOH A O   1 
HETATM 2469 O O   . HOH N 5 .   ? 43.422 -7.910  31.572  1.00 30.31 ? 522 HOH A O   1 
HETATM 2470 O O   . HOH N 5 .   ? 42.112 -9.148  14.997  1.00 26.36 ? 523 HOH A O   1 
HETATM 2471 O O   . HOH N 5 .   ? 37.223 -5.096  29.372  1.00 22.78 ? 524 HOH A O   1 
HETATM 2472 O O   . HOH N 5 .   ? 50.832 -15.201 15.429  1.00 39.34 ? 525 HOH A O   1 
HETATM 2473 O O   . HOH N 5 .   ? 59.400 0.840   9.767   1.00 28.31 ? 526 HOH A O   1 
HETATM 2474 O O   . HOH N 5 .   ? 31.292 6.541   17.109  1.00 37.95 ? 527 HOH A O   1 
HETATM 2475 O O   . HOH N 5 .   ? 55.279 -2.597  2.956   1.00 25.31 ? 528 HOH A O   1 
HETATM 2476 O O   . HOH N 5 .   ? 45.529 -8.041  35.570  1.00 32.54 ? 529 HOH A O   1 
HETATM 2477 O O   . HOH N 5 .   ? 56.845 4.801   15.339  1.00 24.93 ? 530 HOH A O   1 
HETATM 2478 O O   . HOH N 5 .   ? 48.189 3.539   37.344  1.00 24.85 ? 531 HOH A O   1 
HETATM 2479 O O   . HOH N 5 .   ? 43.405 11.049  33.238  1.00 23.93 ? 532 HOH A O   1 
HETATM 2480 O O   . HOH N 5 .   ? 44.128 -14.340 8.225   1.00 33.33 ? 533 HOH A O   1 
HETATM 2481 O O   . HOH N 5 .   ? 44.068 14.106  28.844  1.00 28.94 ? 534 HOH A O   1 
HETATM 2482 O O   . HOH N 5 .   ? 46.547 -6.471  2.574   1.00 32.50 ? 535 HOH A O   1 
HETATM 2483 O O   . HOH N 5 .   ? 43.779 2.019   0.733   1.00 28.39 ? 536 HOH A O   1 
HETATM 2484 O O   . HOH N 5 .   ? 49.741 -6.835  21.258  1.00 25.36 ? 537 HOH A O   1 
HETATM 2485 O O   . HOH N 5 .   ? 34.372 7.888   13.675  1.00 28.41 ? 538 HOH A O   1 
HETATM 2486 O O   . HOH N 5 .   ? 50.052 2.581   1.551   1.00 30.21 ? 539 HOH A O   1 
HETATM 2487 O O   . HOH N 5 .   ? 52.500 -8.907  18.236  1.00 26.11 ? 540 HOH A O   1 
HETATM 2488 O O   . HOH N 5 .   ? 34.627 -0.607  32.091  1.00 26.19 ? 541 HOH A O   1 
HETATM 2489 O O   . HOH N 5 .   ? 44.643 -5.203  4.991   1.00 21.18 ? 542 HOH A O   1 
HETATM 2490 O O   . HOH N 5 .   ? 33.950 9.085   5.913   1.00 40.94 ? 543 HOH A O   1 
HETATM 2491 O O   . HOH N 5 .   ? 56.997 4.609   18.685  1.00 28.22 ? 544 HOH A O   1 
HETATM 2492 O O   . HOH N 5 .   ? 45.963 -3.889  2.813   1.00 29.06 ? 545 HOH A O   1 
HETATM 2493 O O   . HOH N 5 .   ? 33.606 5.506   12.597  1.00 40.95 ? 546 HOH A O   1 
HETATM 2494 O O   . HOH N 5 .   ? 36.963 1.272   1.307   1.00 37.30 ? 547 HOH A O   1 
HETATM 2495 O O   . HOH N 5 .   ? 38.100 3.121   33.529  1.00 28.16 ? 548 HOH A O   1 
HETATM 2496 O O   . HOH N 5 .   ? 33.220 8.937   15.867  1.00 37.75 ? 549 HOH A O   1 
HETATM 2497 O O   . HOH N 5 .   ? 41.997 -5.844  4.333   1.00 40.23 ? 550 HOH A O   1 
HETATM 2498 O O   . HOH N 5 .   ? 55.151 -1.360  25.827  1.00 37.79 ? 551 HOH A O   1 
HETATM 2499 O O   . HOH N 5 .   ? 39.987 -3.869  11.202  1.00 34.57 ? 552 HOH A O   1 
HETATM 2500 O O   . HOH N 5 .   ? 52.774 12.693  18.567  1.00 38.45 ? 553 HOH A O   1 
HETATM 2501 O O   . HOH N 5 .   ? 50.635 -10.236 20.690  1.00 38.11 ? 554 HOH A O   1 
HETATM 2502 O O   . HOH N 5 .   ? 54.843 10.203  18.529  1.00 34.62 ? 555 HOH A O   1 
HETATM 2503 O O   . HOH N 5 .   ? 54.903 1.282   26.949  1.00 32.53 ? 556 HOH A O   1 
HETATM 2504 O O   . HOH N 5 .   ? 58.691 -5.500  14.677  1.00 36.49 ? 557 HOH A O   1 
HETATM 2505 O O   . HOH N 5 .   ? 59.225 -5.618  11.681  1.00 43.62 ? 558 HOH A O   1 
HETATM 2506 O O   . HOH N 5 .   ? 36.073 5.135   33.266  1.00 37.93 ? 559 HOH A O   1 
HETATM 2507 O O   . HOH N 5 .   ? 57.455 -6.427  17.291  1.00 40.59 ? 560 HOH A O   1 
HETATM 2508 O O   . HOH N 5 .   ? 62.188 -3.169  13.041  1.00 41.31 ? 561 HOH A O   1 
HETATM 2509 O O   . HOH N 5 .   ? 57.604 -4.753  9.106   1.00 45.95 ? 562 HOH A O   1 
HETATM 2510 O O   . HOH N 5 .   ? 56.846 -9.798  13.639  1.00 33.60 ? 563 HOH A O   1 
HETATM 2511 O O   . HOH N 5 .   ? 54.363 10.689  22.017  1.00 37.75 ? 564 HOH A O   1 
HETATM 2512 O O   . HOH N 5 .   ? 41.580 18.228  12.876  1.00 37.51 ? 565 HOH A O   1 
HETATM 2513 O O   . HOH N 5 .   ? 58.753 8.090   19.639  1.00 44.68 ? 566 HOH A O   1 
HETATM 2514 O O   . HOH N 5 .   ? 58.920 1.405   24.924  1.00 49.81 ? 567 HOH A O   1 
HETATM 2515 O O   . HOH N 5 .   ? 60.303 3.113   23.369  1.00 46.12 ? 568 HOH A O   1 
HETATM 2516 O O   . HOH N 5 .   ? 40.853 -9.684  5.819   1.00 51.09 ? 569 HOH A O   1 
HETATM 2517 O O   . HOH N 5 .   ? 28.796 7.463   22.772  1.00 47.93 ? 570 HOH A O   1 
HETATM 2518 O O   . HOH N 5 .   ? 48.336 -10.559 33.883  1.00 47.17 ? 571 HOH A O   1 
HETATM 2519 O O   . HOH N 5 .   ? 49.687 1.437   36.178  1.00 39.35 ? 572 HOH A O   1 
HETATM 2520 O O   . HOH N 5 .   ? 61.436 2.849   9.989   1.00 47.93 ? 573 HOH A O   1 
HETATM 2521 O O   . HOH N 5 .   ? 59.024 5.542   21.827  1.00 38.54 ? 574 HOH A O   1 
HETATM 2522 O O   . HOH N 5 .   ? 55.707 9.227   9.598   1.00 38.01 ? 575 HOH A O   1 
HETATM 2523 O O   . HOH N 5 .   ? 36.423 19.403  17.216  1.00 48.07 ? 576 HOH A O   1 
HETATM 2524 O O   . HOH N 5 .   ? 35.241 5.515   36.011  1.00 44.78 ? 577 HOH A O   1 
HETATM 2525 O O   . HOH N 5 .   ? 57.734 -2.406  21.237  1.00 39.56 ? 578 HOH A O   1 
HETATM 2526 O O   . HOH N 5 .   ? 60.713 -0.911  22.136  1.00 51.67 ? 579 HOH A O   1 
HETATM 2527 O O   . HOH N 5 .   ? 42.269 -10.841 18.936  1.00 39.62 ? 580 HOH A O   1 
HETATM 2528 O O   . HOH N 5 .   ? 49.644 -17.577 12.847  1.00 38.34 ? 581 HOH A O   1 
HETATM 2529 O O   . HOH O 5 .   ? 21.373 3.980   -7.188  1.00 24.18 ? 510 HOH B O   1 
HETATM 2530 O O   . HOH O 5 .   ? 25.065 19.959  5.600   1.00 23.00 ? 511 HOH B O   1 
HETATM 2531 O O   . HOH O 5 .   ? 32.080 10.264  7.413   1.00 34.48 ? 512 HOH B O   1 
HETATM 2532 O O   . HOH O 5 .   ? 18.468 2.791   -11.166 1.00 33.28 ? 513 HOH B O   1 
HETATM 2533 O O   . HOH O 5 .   ? 17.995 6.379   -14.561 1.00 24.77 ? 514 HOH B O   1 
HETATM 2534 O O   . HOH O 5 .   ? 15.681 20.017  2.157   1.00 30.80 ? 515 HOH B O   1 
HETATM 2535 O O   . HOH O 5 .   ? 17.715 20.218  4.156   1.00 26.87 ? 516 HOH B O   1 
HETATM 2536 O O   . HOH O 5 .   ? 24.040 26.922  4.441   1.00 23.13 ? 517 HOH B O   1 
HETATM 2537 O O   . HOH O 5 .   ? 24.522 29.254  -9.198  1.00 23.50 ? 518 HOH B O   1 
HETATM 2538 O O   . HOH O 5 .   ? 17.348 25.515  -11.948 1.00 22.38 ? 519 HOH B O   1 
HETATM 2539 O O   . HOH O 5 .   ? 30.395 22.722  -12.362 1.00 21.44 ? 520 HOH B O   1 
HETATM 2540 O O   . HOH O 5 .   ? 31.914 24.507  -10.731 1.00 33.64 ? 521 HOH B O   1 
HETATM 2541 O O   . HOH O 5 .   ? 31.868 24.337  -7.596  1.00 25.75 ? 522 HOH B O   1 
HETATM 2542 O O   . HOH O 5 .   ? 33.167 22.537  -9.023  1.00 27.46 ? 523 HOH B O   1 
HETATM 2543 O O   . HOH O 5 .   ? 33.298 14.679  -12.183 1.00 24.28 ? 524 HOH B O   1 
HETATM 2544 O O   . HOH O 5 .   ? 28.851 19.178  -13.011 1.00 23.26 ? 525 HOH B O   1 
HETATM 2545 O O   . HOH O 5 .   ? 27.208 3.471   -12.323 1.00 20.81 ? 526 HOH B O   1 
HETATM 2546 O O   . HOH O 5 .   ? 11.827 20.240  -8.789  1.00 25.98 ? 527 HOH B O   1 
HETATM 2547 O O   . HOH O 5 .   ? 30.985 21.903  -19.221 1.00 31.35 ? 528 HOH B O   1 
HETATM 2548 O O   . HOH O 5 .   ? 12.924 15.466  -13.868 1.00 34.47 ? 529 HOH B O   1 
HETATM 2549 O O   . HOH O 5 .   ? 11.947 17.831  -12.597 1.00 39.48 ? 530 HOH B O   1 
HETATM 2550 O O   . HOH O 5 .   ? 17.909 28.566  -11.363 1.00 28.79 ? 531 HOH B O   1 
HETATM 2551 O O   . HOH O 5 .   ? 33.819 4.581   -4.805  1.00 30.92 ? 532 HOH B O   1 
HETATM 2552 O O   . HOH O 5 .   ? 10.065 26.363  0.101   1.00 26.82 ? 533 HOH B O   1 
HETATM 2553 O O   . HOH O 5 .   ? 33.403 17.418  -13.226 1.00 22.94 ? 534 HOH B O   1 
HETATM 2554 O O   . HOH O 5 .   ? 13.679 9.435   -19.436 1.00 24.84 ? 535 HOH B O   1 
HETATM 2555 O O   . HOH O 5 .   ? 29.098 28.784  -2.210  1.00 26.87 ? 536 HOH B O   1 
HETATM 2556 O O   . HOH O 5 .   ? 16.088 9.736   4.844   1.00 31.26 ? 537 HOH B O   1 
HETATM 2557 O O   . HOH O 5 .   ? 17.321 3.066   -18.026 1.00 29.46 ? 538 HOH B O   1 
HETATM 2558 O O   . HOH O 5 .   ? 21.101 14.607  6.086   1.00 26.69 ? 539 HOH B O   1 
HETATM 2559 O O   . HOH O 5 .   ? 16.021 27.787  -14.121 1.00 39.61 ? 540 HOH B O   1 
HETATM 2560 O O   . HOH O 5 .   ? 12.819 20.262  -11.250 1.00 33.11 ? 541 HOH B O   1 
HETATM 2561 O O   . HOH O 5 .   ? 21.368 2.689   -0.065  1.00 28.97 ? 542 HOH B O   1 
HETATM 2562 O O   . HOH O 5 .   ? 21.503 24.718  -17.445 1.00 34.61 ? 543 HOH B O   1 
HETATM 2563 O O   . HOH O 5 .   ? 14.762 13.741  -13.145 1.00 26.59 ? 544 HOH B O   1 
HETATM 2564 O O   . HOH O 5 .   ? 30.809 9.104   5.491   1.00 35.89 ? 545 HOH B O   1 
HETATM 2565 O O   . HOH O 5 .   ? 39.624 19.810  10.157  1.00 47.19 ? 546 HOH B O   1 
HETATM 2566 O O   . HOH O 5 .   ? 27.007 13.745  7.826   1.00 38.60 ? 547 HOH B O   1 
HETATM 2567 O O   . HOH O 5 .   ? 8.503  13.213  -16.013 1.00 42.62 ? 548 HOH B O   1 
HETATM 2568 O O   . HOH O 5 .   ? 13.201 14.422  -23.360 1.00 33.50 ? 549 HOH B O   1 
HETATM 2569 O O   . HOH O 5 .   ? 18.154 24.948  -14.561 1.00 28.75 ? 550 HOH B O   1 
HETATM 2570 O O   . HOH O 5 .   ? 25.269 1.354   -10.415 1.00 31.23 ? 551 HOH B O   1 
HETATM 2571 O O   . HOH O 5 .   ? 19.294 32.590  -6.890  1.00 33.90 ? 552 HOH B O   1 
HETATM 2572 O O   . HOH O 5 .   ? 23.439 22.576  -27.892 1.00 33.31 ? 553 HOH B O   1 
HETATM 2573 O O   . HOH O 5 .   ? 34.184 20.928  -1.321  1.00 36.65 ? 554 HOH B O   1 
HETATM 2574 O O   . HOH O 5 .   ? 27.368 18.002  -30.398 1.00 39.77 ? 555 HOH B O   1 
HETATM 2575 O O   . HOH O 5 .   ? 25.847 26.519  -27.600 1.00 38.80 ? 556 HOH B O   1 
HETATM 2576 O O   . HOH O 5 .   ? 11.214 21.033  -13.682 1.00 38.23 ? 557 HOH B O   1 
HETATM 2577 O O   . HOH O 5 .   ? 16.842 3.889   -15.280 1.00 30.04 ? 558 HOH B O   1 
HETATM 2578 O O   . HOH O 5 .   ? 35.102 22.284  -17.120 1.00 36.04 ? 559 HOH B O   1 
HETATM 2579 O O   . HOH O 5 .   ? 9.598  28.898  -9.891  1.00 47.50 ? 560 HOH B O   1 
HETATM 2580 O O   . HOH O 5 .   ? 23.605 30.702  -1.006  1.00 44.65 ? 561 HOH B O   1 
HETATM 2581 O O   . HOH O 5 .   ? 14.699 15.590  -5.197  1.00 30.30 ? 562 HOH B O   1 
HETATM 2582 O O   . HOH O 5 .   ? 15.740 12.513  -2.652  1.00 43.57 ? 563 HOH B O   1 
HETATM 2583 O O   . HOH O 5 .   ? 32.703 1.022   -1.839  1.00 37.85 ? 564 HOH B O   1 
HETATM 2584 O O   . HOH O 5 .   ? 26.287 9.120   -32.887 1.00 39.55 ? 565 HOH B O   1 
HETATM 2585 O O   . HOH O 5 .   ? 20.708 25.926  -15.265 1.00 37.07 ? 566 HOH B O   1 
HETATM 2586 O O   . HOH O 5 .   ? 26.871 21.452  -22.794 1.00 36.87 ? 567 HOH B O   1 
HETATM 2587 O O   . HOH O 5 .   ? 27.588 24.868  -19.222 1.00 35.70 ? 568 HOH B O   1 
HETATM 2588 O O   . HOH O 5 .   ? 35.186 19.754  -10.439 1.00 40.96 ? 569 HOH B O   1 
HETATM 2589 O O   . HOH O 5 .   ? 28.540 22.835  -21.201 1.00 31.74 ? 570 HOH B O   1 
HETATM 2590 O O   . HOH O 5 .   ? 23.286 31.361  1.650   1.00 35.74 ? 571 HOH B O   1 
HETATM 2591 O O   . HOH O 5 .   ? 29.469 25.510  7.845   1.00 48.37 ? 572 HOH B O   1 
HETATM 2592 O O   . HOH O 5 .   ? 34.550 7.384   -3.610  1.00 35.07 ? 573 HOH B O   1 
HETATM 2593 O O   . HOH O 5 .   ? 21.693 0.142   -0.936  1.00 35.92 ? 574 HOH B O   1 
HETATM 2594 O O   . HOH O 5 .   ? 24.175 -2.437  0.899   1.00 45.28 ? 575 HOH B O   1 
HETATM 2595 O O   . HOH O 5 .   ? 22.542 2.631   -9.513  1.00 34.95 ? 576 HOH B O   1 
HETATM 2596 O O   . HOH O 5 .   ? 12.891 25.182  -15.729 1.00 40.36 ? 577 HOH B O   1 
HETATM 2597 O O   . HOH O 5 .   ? 36.142 23.716  -10.936 1.00 46.02 ? 578 HOH B O   1 
HETATM 2598 O O   . HOH O 5 .   ? 15.500 21.751  -21.405 1.00 37.99 ? 579 HOH B O   1 
HETATM 2599 O O   . HOH O 5 .   ? 26.177 11.189  -31.316 1.00 29.10 ? 580 HOH B O   1 
HETATM 2600 O O   . HOH O 5 .   ? 18.806 33.991  -8.990  1.00 47.17 ? 581 HOH B O   1 
HETATM 2601 O O   . HOH O 5 .   ? 10.434 22.736  -9.367  1.00 38.98 ? 582 HOH B O   1 
HETATM 2602 O O   . HOH O 5 .   ? 23.489 18.778  -31.439 1.00 42.81 ? 583 HOH B O   1 
HETATM 2603 O O   . HOH O 5 .   ? 25.814 26.754  -18.575 1.00 37.52 ? 584 HOH B O   1 
HETATM 2604 O O   . HOH O 5 .   ? 7.292  22.034  -7.264  1.00 50.87 ? 585 HOH B O   1 
HETATM 2605 O O   . HOH O 5 .   ? 30.093 31.435  1.366   1.00 47.88 ? 586 HOH B O   1 
HETATM 2606 O O   . HOH O 5 .   ? 27.776 33.031  -5.151  1.00 42.71 ? 587 HOH B O   1 
HETATM 2607 O O   . HOH O 5 .   ? 31.306 28.279  -1.571  1.00 54.53 ? 588 HOH B O   1 
HETATM 2608 O O   . HOH O 5 .   ? 36.599 9.188   -13.814 1.00 42.58 ? 589 HOH B O   1 
HETATM 2609 O O   . HOH O 5 .   ? 11.751 11.424  -20.136 1.00 37.19 ? 590 HOH B O   1 
HETATM 2610 O O   . HOH P 5 .   ? 29.903 4.661   10.427  1.00 39.39 ? 144 HOH Y O   1 
HETATM 2611 O O   . HOH Q 5 .   ? 14.469 4.070   1.186   1.00 34.82 ? 26  HOH Z O   1 
HETATM 2612 O O   . HOH Q 5 .   ? 18.768 4.369   -6.869  1.00 30.84 ? 47  HOH Z O   1 
HETATM 2613 O O   . HOH Q 5 .   ? 13.016 8.105   -5.574  1.00 40.61 ? 212 HOH Z O   1 
HETATM 2614 O O   . HOH Q 5 .   ? 12.340 3.170   -7.424  1.00 43.66 ? 232 HOH Z O   1 
HETATM 2615 O O   . HOH Q 5 .   ? 10.002 5.069   -7.389  1.00 55.22 ? 233 HOH Z O   1 
HETATM 2616 O O   . HOH Q 5 .   ? 12.742 9.788   -3.500  1.00 39.87 ? 237 HOH Z O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   GLU 2   2   2   GLU GLU A . n 
A 1 3   ALA 3   3   3   ALA ALA A . n 
A 1 4   VAL 4   4   4   VAL VAL A . n 
A 1 5   LYS 5   5   5   LYS LYS A . n 
A 1 6   THR 6   6   6   THR THR A . n 
A 1 7   PHE 7   7   7   PHE PHE A . n 
A 1 8   ASN 8   8   8   ASN ASN A . n 
A 1 9   SER 9   9   9   SER SER A . n 
A 1 10  GLU 10  10  10  GLU GLU A . n 
A 1 11  LEU 11  11  11  LEU LEU A . n 
A 1 12  TYR 12  12  12  TYR TYR A . n 
A 1 13  SER 13  13  13  SER SER A . n 
A 1 14  LEU 14  14  14  LEU LEU A . n 
A 1 15  ASN 15  15  15  ASN ASN A . n 
A 1 16  ASP 16  16  16  ASP ASP A . n 
A 1 17  TYR 17  17  17  TYR TYR A . n 
A 1 18  LYS 18  18  18  LYS LYS A . n 
A 1 19  PRO 19  19  19  PRO PRO A . n 
A 1 20  PRO 20  20  20  PRO PRO A . n 
A 1 21  ILE 21  21  21  ILE ILE A . n 
A 1 22  SER 22  22  22  SER SER A . n 
A 1 23  LYS 23  23  23  LYS LYS A . n 
A 1 24  ALA 24  24  24  ALA ALA A . n 
A 1 25  LYS 25  25  25  LYS LYS A . n 
A 1 26  MET 26  26  26  MET MET A . n 
A 1 27  THR 27  27  27  THR THR A . n 
A 1 28  GLN 28  28  28  GLN GLN A . n 
A 1 29  ILE 29  29  29  ILE ILE A . n 
A 1 30  THR 30  30  30  THR THR A . n 
A 1 31  LYS 31  31  31  LYS LYS A . n 
A 1 32  ALA 32  32  32  ALA ALA A . n 
A 1 33  ALA 33  33  33  ALA ALA A . n 
A 1 34  ILE 34  34  34  ILE ILE A . n 
A 1 35  LYS 35  35  35  LYS LYS A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  ILE 37  37  37  ILE ILE A . n 
A 1 38  LYS 38  38  38  LYS LYS A . n 
A 1 39  PHE 39  39  39  PHE PHE A . n 
A 1 40  TYR 40  40  40  TYR TYR A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  HIS 42  42  42  HIS HIS A . n 
A 1 43  VAL 43  43  43  VAL VAL A . n 
A 1 44  VAL 44  44  44  VAL VAL A . n 
A 1 45  GLN 45  45  45  GLN GLN A . n 
A 1 46  SER 46  46  46  SER SER A . n 
A 1 47  VAL 47  47  47  VAL VAL A . n 
A 1 48  GLU 48  48  48  GLU GLU A . n 
A 1 49  LYS 49  49  49  LYS LYS A . n 
A 1 50  PHE 50  50  50  PHE PHE A . n 
A 1 51  ILE 51  51  51  ILE ILE A . n 
A 1 52  GLN 52  52  52  GLN GLN A . n 
A 1 53  LYS 53  53  53  LYS LYS A . n 
A 1 54  CYS 54  54  54  CYS CYS A . n 
A 1 55  LYS 55  55  55  LYS LYS A . n 
A 1 56  PRO 56  56  56  PRO PRO A . n 
A 1 57  GLU 57  57  57  GLU GLU A . n 
A 1 58  TYR 58  58  58  TYR TYR A . n 
A 1 59  LYS 59  59  59  LYS LYS A . n 
A 1 60  VAL 60  60  60  VAL VAL A . n 
A 1 61  PRO 61  61  61  PRO PRO A . n 
A 1 62  GLY 62  62  62  GLY GLY A . n 
A 1 63  LEU 63  63  63  LEU LEU A . n 
A 1 64  TYR 64  64  64  TYR TYR A . n 
A 1 65  VAL 65  65  65  VAL VAL A . n 
A 1 66  ILE 66  66  66  ILE ILE A . n 
A 1 67  ASP 67  67  67  ASP ASP A . n 
A 1 68  SER 68  68  68  SER SER A . n 
A 1 69  ILE 69  69  69  ILE ILE A . n 
A 1 70  VAL 70  70  70  VAL VAL A . n 
A 1 71  ARG 71  71  71  ARG ARG A . n 
A 1 72  GLN 72  72  72  GLN GLN A . n 
A 1 73  SER 73  73  73  SER SER A . n 
A 1 74  ARG 74  74  74  ARG ARG A . n 
A 1 75  HIS 75  75  75  HIS HIS A . n 
A 1 76  GLN 76  76  76  GLN GLN A . n 
A 1 77  PHE 77  77  77  PHE PHE A . n 
A 1 78  GLY 78  78  78  GLY GLY A . n 
A 1 79  GLN 79  79  79  GLN GLN A . n 
A 1 80  GLU 80  80  80  GLU GLU A . n 
A 1 81  LYS 81  81  81  LYS LYS A . n 
A 1 82  ASP 82  82  82  ASP ASP A . n 
A 1 83  VAL 83  83  83  VAL VAL A . n 
A 1 84  PHE 84  84  84  PHE PHE A . n 
A 1 85  ALA 85  85  85  ALA ALA A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  ARG 87  87  87  ARG ARG A . n 
A 1 88  PHE 88  88  88  PHE PHE A . n 
A 1 89  SER 89  89  89  SER SER A . n 
A 1 90  ASN 90  90  90  ASN ASN A . n 
A 1 91  ASN 91  91  91  ASN ASN A . n 
A 1 92  ILE 92  92  92  ILE ILE A . n 
A 1 93  ILE 93  93  93  ILE ILE A . n 
A 1 94  SER 94  94  94  SER SER A . n 
A 1 95  THR 95  95  95  THR THR A . n 
A 1 96  PHE 96  96  96  PHE PHE A . n 
A 1 97  GLN 97  97  97  GLN GLN A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 TYR 100 100 100 TYR TYR A . n 
A 1 101 ARG 101 101 101 ARG ARG A . n 
A 1 102 CYS 102 102 102 CYS CYS A . n 
A 1 103 PRO 103 103 103 PRO PRO A . n 
A 1 104 GLY 104 104 104 GLY GLY A . n 
A 1 105 ASP 105 105 105 ASP ASP A . n 
A 1 106 ASP 106 106 106 ASP ASP A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 LYS 109 109 109 LYS LYS A . n 
A 1 110 ILE 110 110 110 ILE ILE A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 ARG 112 112 112 ARG ARG A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 LEU 114 114 114 LEU LEU A . n 
A 1 115 ASN 115 115 115 ASN ASN A . n 
A 1 116 LEU 116 116 116 LEU LEU A . n 
A 1 117 TRP 117 117 117 TRP TRP A . n 
A 1 118 GLN 118 118 118 GLN GLN A . n 
A 1 119 LYS 119 119 119 LYS LYS A . n 
A 1 120 ASN 120 120 120 ASN ASN A . n 
A 1 121 ASN 121 121 121 ASN ASN A . n 
A 1 122 VAL 122 122 122 VAL VAL A . n 
A 1 123 PHE 123 123 123 PHE PHE A . n 
A 1 124 LYS 124 124 124 LYS LYS A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 GLU 126 126 126 GLU GLU A . n 
A 1 127 ILE 127 127 127 ILE ILE A . n 
A 1 128 ILE 128 128 128 ILE ILE A . n 
A 1 129 GLN 129 129 129 GLN GLN A . n 
A 1 130 PRO 130 130 130 PRO PRO A . n 
A 1 131 LEU 131 131 131 LEU LEU A . n 
A 1 132 LEU 132 132 132 LEU LEU A . n 
A 1 133 ASP 133 133 133 ASP ASP A . n 
A 1 134 MET 134 134 134 MET MET A . n 
A 1 135 ALA 135 135 135 ALA ALA A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 ALA 137 137 137 ALA ALA A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 GLU 139 139 139 GLU ALA A . n 
A 1 140 HIS 140 140 ?   ?   ?   A . n 
A 1 141 HIS 141 141 ?   ?   ?   A . n 
A 1 142 HIS 142 142 ?   ?   ?   A . n 
A 1 143 HIS 143 143 ?   ?   ?   A . n 
A 1 144 HIS 144 144 ?   ?   ?   A . n 
A 1 145 HIS 145 145 ?   ?   ?   A . n 
B 1 1   MET 1   1   1   MET MET B . n 
B 1 2   GLU 2   2   2   GLU GLU B . n 
B 1 3   ALA 3   3   3   ALA ALA B . n 
B 1 4   VAL 4   4   4   VAL VAL B . n 
B 1 5   LYS 5   5   5   LYS LYS B . n 
B 1 6   THR 6   6   6   THR THR B . n 
B 1 7   PHE 7   7   7   PHE PHE B . n 
B 1 8   ASN 8   8   8   ASN ASN B . n 
B 1 9   SER 9   9   9   SER SER B . n 
B 1 10  GLU 10  10  10  GLU GLU B . n 
B 1 11  LEU 11  11  11  LEU LEU B . n 
B 1 12  TYR 12  12  12  TYR TYR B . n 
B 1 13  SER 13  13  13  SER SER B . n 
B 1 14  LEU 14  14  14  LEU LEU B . n 
B 1 15  ASN 15  15  15  ASN ASN B . n 
B 1 16  ASP 16  16  16  ASP ASP B . n 
B 1 17  TYR 17  17  17  TYR TYR B . n 
B 1 18  LYS 18  18  18  LYS LYS B . n 
B 1 19  PRO 19  19  19  PRO PRO B . n 
B 1 20  PRO 20  20  20  PRO PRO B . n 
B 1 21  ILE 21  21  21  ILE ILE B . n 
B 1 22  SER 22  22  22  SER SER B . n 
B 1 23  LYS 23  23  23  LYS LYS B . n 
B 1 24  ALA 24  24  24  ALA ALA B . n 
B 1 25  LYS 25  25  25  LYS LYS B . n 
B 1 26  MET 26  26  26  MET MET B . n 
B 1 27  THR 27  27  27  THR THR B . n 
B 1 28  GLN 28  28  28  GLN GLN B . n 
B 1 29  ILE 29  29  29  ILE ILE B . n 
B 1 30  THR 30  30  30  THR THR B . n 
B 1 31  LYS 31  31  31  LYS LYS B . n 
B 1 32  ALA 32  32  32  ALA ALA B . n 
B 1 33  ALA 33  33  33  ALA ALA B . n 
B 1 34  ILE 34  34  34  ILE ILE B . n 
B 1 35  LYS 35  35  35  LYS LYS B . n 
B 1 36  ALA 36  36  36  ALA ALA B . n 
B 1 37  ILE 37  37  37  ILE ILE B . n 
B 1 38  LYS 38  38  38  LYS LYS B . n 
B 1 39  PHE 39  39  39  PHE PHE B . n 
B 1 40  TYR 40  40  40  TYR TYR B . n 
B 1 41  LYS 41  41  41  LYS LYS B . n 
B 1 42  HIS 42  42  42  HIS HIS B . n 
B 1 43  VAL 43  43  43  VAL VAL B . n 
B 1 44  VAL 44  44  44  VAL VAL B . n 
B 1 45  GLN 45  45  45  GLN GLN B . n 
B 1 46  SER 46  46  46  SER SER B . n 
B 1 47  VAL 47  47  47  VAL VAL B . n 
B 1 48  GLU 48  48  48  GLU GLU B . n 
B 1 49  LYS 49  49  49  LYS LYS B . n 
B 1 50  PHE 50  50  50  PHE PHE B . n 
B 1 51  ILE 51  51  51  ILE ILE B . n 
B 1 52  GLN 52  52  52  GLN GLN B . n 
B 1 53  LYS 53  53  53  LYS LYS B . n 
B 1 54  CYS 54  54  54  CYS CYS B . n 
B 1 55  LYS 55  55  55  LYS LYS B . n 
B 1 56  PRO 56  56  56  PRO PRO B . n 
B 1 57  GLU 57  57  57  GLU GLU B . n 
B 1 58  TYR 58  58  58  TYR TYR B . n 
B 1 59  LYS 59  59  59  LYS LYS B . n 
B 1 60  VAL 60  60  60  VAL VAL B . n 
B 1 61  PRO 61  61  61  PRO PRO B . n 
B 1 62  GLY 62  62  62  GLY GLY B . n 
B 1 63  LEU 63  63  63  LEU LEU B . n 
B 1 64  TYR 64  64  64  TYR TYR B . n 
B 1 65  VAL 65  65  65  VAL VAL B . n 
B 1 66  ILE 66  66  66  ILE ILE B . n 
B 1 67  ASP 67  67  67  ASP ASP B . n 
B 1 68  SER 68  68  68  SER SER B . n 
B 1 69  ILE 69  69  69  ILE ILE B . n 
B 1 70  VAL 70  70  70  VAL VAL B . n 
B 1 71  ARG 71  71  71  ARG ARG B . n 
B 1 72  GLN 72  72  72  GLN GLN B . n 
B 1 73  SER 73  73  73  SER SER B . n 
B 1 74  ARG 74  74  74  ARG ARG B . n 
B 1 75  HIS 75  75  75  HIS HIS B . n 
B 1 76  GLN 76  76  76  GLN GLN B . n 
B 1 77  PHE 77  77  77  PHE PHE B . n 
B 1 78  GLY 78  78  78  GLY GLY B . n 
B 1 79  GLN 79  79  79  GLN GLN B . n 
B 1 80  GLU 80  80  80  GLU GLU B . n 
B 1 81  LYS 81  81  81  LYS LYS B . n 
B 1 82  ASP 82  82  82  ASP ASP B . n 
B 1 83  VAL 83  83  83  VAL VAL B . n 
B 1 84  PHE 84  84  84  PHE PHE B . n 
B 1 85  ALA 85  85  85  ALA ALA B . n 
B 1 86  PRO 86  86  86  PRO PRO B . n 
B 1 87  ARG 87  87  87  ARG ARG B . n 
B 1 88  PHE 88  88  88  PHE PHE B . n 
B 1 89  SER 89  89  89  SER SER B . n 
B 1 90  ASN 90  90  90  ASN ASN B . n 
B 1 91  ASN 91  91  91  ASN ASN B . n 
B 1 92  ILE 92  92  92  ILE ILE B . n 
B 1 93  ILE 93  93  93  ILE ILE B . n 
B 1 94  SER 94  94  94  SER SER B . n 
B 1 95  THR 95  95  95  THR THR B . n 
B 1 96  PHE 96  96  96  PHE PHE B . n 
B 1 97  GLN 97  97  97  GLN GLN B . n 
B 1 98  ASN 98  98  98  ASN ASN B . n 
B 1 99  LEU 99  99  99  LEU LEU B . n 
B 1 100 TYR 100 100 100 TYR TYR B . n 
B 1 101 ARG 101 101 101 ARG ARG B . n 
B 1 102 CYS 102 102 102 CYS CYS B . n 
B 1 103 PRO 103 103 103 PRO PRO B . n 
B 1 104 GLY 104 104 104 GLY GLY B . n 
B 1 105 ASP 105 105 105 ASP ASP B . n 
B 1 106 ASP 106 106 106 ASP ASP B . n 
B 1 107 LYS 107 107 107 LYS LYS B . n 
B 1 108 SER 108 108 108 SER SER B . n 
B 1 109 LYS 109 109 109 LYS LYS B . n 
B 1 110 ILE 110 110 110 ILE ILE B . n 
B 1 111 VAL 111 111 111 VAL VAL B . n 
B 1 112 ARG 112 112 112 ARG ARG B . n 
B 1 113 VAL 113 113 113 VAL VAL B . n 
B 1 114 LEU 114 114 114 LEU LEU B . n 
B 1 115 ASN 115 115 115 ASN ASN B . n 
B 1 116 LEU 116 116 116 LEU LEU B . n 
B 1 117 TRP 117 117 117 TRP TRP B . n 
B 1 118 GLN 118 118 118 GLN GLN B . n 
B 1 119 LYS 119 119 119 LYS LYS B . n 
B 1 120 ASN 120 120 120 ASN ASN B . n 
B 1 121 ASN 121 121 121 ASN ASN B . n 
B 1 122 VAL 122 122 122 VAL VAL B . n 
B 1 123 PHE 123 123 123 PHE PHE B . n 
B 1 124 LYS 124 124 124 LYS LYS B . n 
B 1 125 SER 125 125 125 SER SER B . n 
B 1 126 GLU 126 126 126 GLU GLU B . n 
B 1 127 ILE 127 127 127 ILE ILE B . n 
B 1 128 ILE 128 128 128 ILE ILE B . n 
B 1 129 GLN 129 129 129 GLN GLN B . n 
B 1 130 PRO 130 130 130 PRO PRO B . n 
B 1 131 LEU 131 131 131 LEU LEU B . n 
B 1 132 LEU 132 132 132 LEU LEU B . n 
B 1 133 ASP 133 133 133 ASP ASP B . n 
B 1 134 MET 134 134 134 MET MET B . n 
B 1 135 ALA 135 135 135 ALA ALA B . n 
B 1 136 ALA 136 136 136 ALA ALA B . n 
B 1 137 ALA 137 137 137 ALA ALA B . n 
B 1 138 LEU 138 138 138 LEU LEU B . n 
B 1 139 GLU 139 139 139 GLU GLU B . n 
B 1 140 HIS 140 140 140 HIS HIS B . n 
B 1 141 HIS 141 141 ?   ?   ?   B . n 
B 1 142 HIS 142 142 ?   ?   ?   B . n 
B 1 143 HIS 143 143 ?   ?   ?   B . n 
B 1 144 HIS 144 144 ?   ?   ?   B . n 
B 1 145 HIS 145 145 ?   ?   ?   B . n 
C 2 1   TYR 1   -6  ?   ?   ?   Y . n 
C 2 2   SER 2   -5  ?   ?   ?   Y . n 
C 2 3   PRO 3   -4  ?   ?   ?   Y . n 
C 2 4   THR 4   -3  ?   ?   ?   Y . n 
C 2 5   SEP 5   -2  ?   ?   ?   Y . n 
C 2 6   PRO 6   -1  ?   ?   ?   Y . n 
C 2 7   SER 7   0   ?   ?   ?   Y . n 
C 2 8   TYR 8   1   1   TYR TYR Y . n 
C 2 9   SER 9   2   2   SER SER Y . n 
C 2 10  PRO 10  3   3   PRO PRO Y . n 
C 2 11  THR 11  4   ?   ?   ?   Y . n 
C 2 12  SEP 12  5   ?   ?   ?   Y . n 
C 2 13  PRO 13  6   ?   ?   ?   Y . n 
C 2 14  SER 14  7   ?   ?   ?   Y . n 
D 2 1   TYR 1   -6  ?   ?   ?   Z . n 
D 2 2   SER 2   -5  ?   ?   ?   Z . n 
D 2 3   PRO 3   -4  ?   ?   ?   Z . n 
D 2 4   THR 4   -3  ?   ?   ?   Z . n 
D 2 5   SEP 5   -2  ?   ?   ?   Z . n 
D 2 6   PRO 6   -1  -1  PRO PRO Z . n 
D 2 7   SER 7   0   0   SER SER Z . n 
D 2 8   TYR 8   1   1   TYR TYR Z . n 
D 2 9   SER 9   2   2   SER SER Z . n 
D 2 10  PRO 10  3   3   PRO PRO Z . n 
D 2 11  THR 11  4   4   THR THR Z . n 
D 2 12  SEP 12  5   5   SEP SEP Z . n 
D 2 13  PRO 13  6   6   PRO PRO Z . n 
D 2 14  SER 14  7   7   SER SER Z . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 NH4 1  400 400 NH4 NH4 A . 
F 4 SO4 1  501 501 SO4 SO4 A . 
G 4 SO4 1  503 503 SO4 SO4 A . 
H 4 SO4 1  507 507 SO4 SO4 A . 
I 4 SO4 1  508 508 SO4 SO4 A . 
J 3 NH4 1  401 401 NH4 NH4 B . 
K 4 SO4 1  504 504 SO4 SO4 B . 
L 4 SO4 1  506 506 SO4 SO4 B . 
M 4 SO4 1  509 509 SO4 SO4 B . 
N 5 HOH 1  509 7   HOH HOH A . 
N 5 HOH 2  510 8   HOH HOH A . 
N 5 HOH 3  511 9   HOH HOH A . 
N 5 HOH 4  512 10  HOH HOH A . 
N 5 HOH 5  513 11  HOH HOH A . 
N 5 HOH 6  514 12  HOH HOH A . 
N 5 HOH 7  515 13  HOH HOH A . 
N 5 HOH 8  516 14  HOH HOH A . 
N 5 HOH 9  517 15  HOH HOH A . 
N 5 HOH 10 518 16  HOH HOH A . 
N 5 HOH 11 519 17  HOH HOH A . 
N 5 HOH 12 520 18  HOH HOH A . 
N 5 HOH 13 521 19  HOH HOH A . 
N 5 HOH 14 522 20  HOH HOH A . 
N 5 HOH 15 523 22  HOH HOH A . 
N 5 HOH 16 524 48  HOH HOH A . 
N 5 HOH 17 525 49  HOH HOH A . 
N 5 HOH 18 526 50  HOH HOH A . 
N 5 HOH 19 527 51  HOH HOH A . 
N 5 HOH 20 528 55  HOH HOH A . 
N 5 HOH 21 529 56  HOH HOH A . 
N 5 HOH 22 530 59  HOH HOH A . 
N 5 HOH 23 531 63  HOH HOH A . 
N 5 HOH 24 532 64  HOH HOH A . 
N 5 HOH 25 533 67  HOH HOH A . 
N 5 HOH 26 534 69  HOH HOH A . 
N 5 HOH 27 535 73  HOH HOH A . 
N 5 HOH 28 536 74  HOH HOH A . 
N 5 HOH 29 537 75  HOH HOH A . 
N 5 HOH 30 538 79  HOH HOH A . 
N 5 HOH 31 539 81  HOH HOH A . 
N 5 HOH 32 540 82  HOH HOH A . 
N 5 HOH 33 541 85  HOH HOH A . 
N 5 HOH 34 542 86  HOH HOH A . 
N 5 HOH 35 543 87  HOH HOH A . 
N 5 HOH 36 544 89  HOH HOH A . 
N 5 HOH 37 545 97  HOH HOH A . 
N 5 HOH 38 546 101 HOH HOH A . 
N 5 HOH 39 547 104 HOH HOH A . 
N 5 HOH 40 548 111 HOH HOH A . 
N 5 HOH 41 549 112 HOH HOH A . 
N 5 HOH 42 550 114 HOH HOH A . 
N 5 HOH 43 551 123 HOH HOH A . 
N 5 HOH 44 552 126 HOH HOH A . 
N 5 HOH 45 553 133 HOH HOH A . 
N 5 HOH 46 554 136 HOH HOH A . 
N 5 HOH 47 555 138 HOH HOH A . 
N 5 HOH 48 556 140 HOH HOH A . 
N 5 HOH 49 557 146 HOH HOH A . 
N 5 HOH 50 558 151 HOH HOH A . 
N 5 HOH 51 559 159 HOH HOH A . 
N 5 HOH 52 560 160 HOH HOH A . 
N 5 HOH 53 561 162 HOH HOH A . 
N 5 HOH 54 562 169 HOH HOH A . 
N 5 HOH 55 563 175 HOH HOH A . 
N 5 HOH 56 564 188 HOH HOH A . 
N 5 HOH 57 565 192 HOH HOH A . 
N 5 HOH 58 566 193 HOH HOH A . 
N 5 HOH 59 567 194 HOH HOH A . 
N 5 HOH 60 568 195 HOH HOH A . 
N 5 HOH 61 569 197 HOH HOH A . 
N 5 HOH 62 570 198 HOH HOH A . 
N 5 HOH 63 571 199 HOH HOH A . 
N 5 HOH 64 572 200 HOH HOH A . 
N 5 HOH 65 573 213 HOH HOH A . 
N 5 HOH 66 574 221 HOH HOH A . 
N 5 HOH 67 575 218 HOH HOH A . 
N 5 HOH 68 576 222 HOH HOH A . 
N 5 HOH 69 577 223 HOH HOH A . 
N 5 HOH 70 578 226 HOH HOH A . 
N 5 HOH 71 579 227 HOH HOH A . 
N 5 HOH 72 580 231 HOH HOH A . 
N 5 HOH 73 581 243 HOH HOH A . 
O 5 HOH 1  510 1   HOH HOH B . 
O 5 HOH 2  511 2   HOH HOH B . 
O 5 HOH 3  512 23  HOH HOH B . 
O 5 HOH 4  513 24  HOH HOH B . 
O 5 HOH 5  514 25  HOH HOH B . 
O 5 HOH 6  515 27  HOH HOH B . 
O 5 HOH 7  516 29  HOH HOH B . 
O 5 HOH 8  517 30  HOH HOH B . 
O 5 HOH 9  518 32  HOH HOH B . 
O 5 HOH 10 519 33  HOH HOH B . 
O 5 HOH 11 520 34  HOH HOH B . 
O 5 HOH 12 521 35  HOH HOH B . 
O 5 HOH 13 522 36  HOH HOH B . 
O 5 HOH 14 523 37  HOH HOH B . 
O 5 HOH 15 524 38  HOH HOH B . 
O 5 HOH 16 525 39  HOH HOH B . 
O 5 HOH 17 526 40  HOH HOH B . 
O 5 HOH 18 527 41  HOH HOH B . 
O 5 HOH 19 528 43  HOH HOH B . 
O 5 HOH 20 529 45  HOH HOH B . 
O 5 HOH 21 530 46  HOH HOH B . 
O 5 HOH 22 531 53  HOH HOH B . 
O 5 HOH 23 532 54  HOH HOH B . 
O 5 HOH 24 533 57  HOH HOH B . 
O 5 HOH 25 534 60  HOH HOH B . 
O 5 HOH 26 535 62  HOH HOH B . 
O 5 HOH 27 536 65  HOH HOH B . 
O 5 HOH 28 537 66  HOH HOH B . 
O 5 HOH 29 538 70  HOH HOH B . 
O 5 HOH 30 539 71  HOH HOH B . 
O 5 HOH 31 540 76  HOH HOH B . 
O 5 HOH 32 541 78  HOH HOH B . 
O 5 HOH 33 542 80  HOH HOH B . 
O 5 HOH 34 543 83  HOH HOH B . 
O 5 HOH 35 544 88  HOH HOH B . 
O 5 HOH 36 545 90  HOH HOH B . 
O 5 HOH 37 546 91  HOH HOH B . 
O 5 HOH 38 547 94  HOH HOH B . 
O 5 HOH 39 548 95  HOH HOH B . 
O 5 HOH 40 549 96  HOH HOH B . 
O 5 HOH 41 550 99  HOH HOH B . 
O 5 HOH 42 551 102 HOH HOH B . 
O 5 HOH 43 552 103 HOH HOH B . 
O 5 HOH 44 553 105 HOH HOH B . 
O 5 HOH 45 554 106 HOH HOH B . 
O 5 HOH 46 555 110 HOH HOH B . 
O 5 HOH 47 556 115 HOH HOH B . 
O 5 HOH 48 557 116 HOH HOH B . 
O 5 HOH 49 558 120 HOH HOH B . 
O 5 HOH 50 559 121 HOH HOH B . 
O 5 HOH 51 560 127 HOH HOH B . 
O 5 HOH 52 561 129 HOH HOH B . 
O 5 HOH 53 562 130 HOH HOH B . 
O 5 HOH 54 563 134 HOH HOH B . 
O 5 HOH 55 564 135 HOH HOH B . 
O 5 HOH 56 565 139 HOH HOH B . 
O 5 HOH 57 566 141 HOH HOH B . 
O 5 HOH 58 567 163 HOH HOH B . 
O 5 HOH 59 568 172 HOH HOH B . 
O 5 HOH 60 569 173 HOH HOH B . 
O 5 HOH 61 570 190 HOH HOH B . 
O 5 HOH 62 571 191 HOH HOH B . 
O 5 HOH 63 572 201 HOH HOH B . 
O 5 HOH 64 573 202 HOH HOH B . 
O 5 HOH 65 574 203 HOH HOH B . 
O 5 HOH 66 575 204 HOH HOH B . 
O 5 HOH 67 576 205 HOH HOH B . 
O 5 HOH 68 577 206 HOH HOH B . 
O 5 HOH 69 578 208 HOH HOH B . 
O 5 HOH 70 579 209 HOH HOH B . 
O 5 HOH 71 580 210 HOH HOH B . 
O 5 HOH 72 581 211 HOH HOH B . 
O 5 HOH 73 582 216 HOH HOH B . 
O 5 HOH 74 583 219 HOH HOH B . 
O 5 HOH 75 584 225 HOH HOH B . 
O 5 HOH 76 585 230 HOH HOH B . 
O 5 HOH 77 586 235 HOH HOH B . 
O 5 HOH 78 587 236 HOH HOH B . 
O 5 HOH 79 588 240 HOH HOH B . 
O 5 HOH 80 589 241 HOH HOH B . 
O 5 HOH 81 590 242 HOH HOH B . 
P 5 HOH 1  144 144 HOH HOH Y . 
Q 5 HOH 1  26  26  HOH HOH Z . 
Q 5 HOH 2  47  47  HOH HOH Z . 
Q 5 HOH 3  212 212 HOH HOH Z . 
Q 5 HOH 4  232 232 HOH HOH Z . 
Q 5 HOH 5  233 233 HOH HOH Z . 
Q 5 HOH 6  237 237 HOH HOH Z . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    D 
_pdbx_struct_mod_residue.label_comp_id    SEP 
_pdbx_struct_mod_residue.label_seq_id     12 
_pdbx_struct_mod_residue.auth_asym_id     Z 
_pdbx_struct_mod_residue.auth_comp_id     SEP 
_pdbx_struct_mod_residue.auth_seq_id      5 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   SER 
_pdbx_struct_mod_residue.details          PHOSPHOSERINE 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 B,D,J,K,L,M,O,Q   
2 1 A,C,E,F,G,H,I,N,P 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1800 ? 
1 MORE         -42  ? 
1 'SSA (A^2)'  8290 ? 
2 'ABSA (A^2)' 1290 ? 
2 MORE         -46  ? 
2 'SSA (A^2)'  7870 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-06-10 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-10-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
3 3 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    3 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_software.name' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 44.7150 3.9467  16.6273 -0.1902 -0.1587 -0.1562 0.0128  -0.0228 -0.0183 2.2659  2.6929  5.1185   0.3107   0.8107   
0.8962   -0.0430 -0.0889 0.1523  -0.1270 -0.2060 0.0639  -0.1584 -0.1123 0.2490  'X-RAY DIFFRACTION' 
2 ? refined 24.4361 14.7468 -9.7175 -0.2143 -0.1764 -0.1380 -0.0140 -0.0221 -0.0084 1.7714  2.4206  5.2605   -0.1741  0.3804   
0.9414   -0.1255 0.0385  -0.0470 -0.0137 0.1486  -0.0770 -0.0673 0.0198  -0.0232 'X-RAY DIFFRACTION' 
3 ? refined 12.6338 8.6619  -6.9540 -0.0296 0.2255  0.0670  -0.0812 0.0636  0.0024  15.0671 47.6720 38.6848  1.3820   12.9695  
-24.6178 0.4163  -1.1942 -0.4028 1.8060  0.3672  2.5465  -0.2150 -2.9809 -0.7836 'X-RAY DIFFRACTION' 
4 ? refined 34.3323 0.4154  14.5864 0.1742  0.0763  0.1512  0.0962  -0.0269 -0.0065 37.4000 23.6257 128.1427 -20.4843 -31.5929 
7.1074   0.9592  0.2329  2.0616  1.2960  0.1499  0.9862  -1.9155 -3.0024 -1.1091 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 2  A 2 A 139 A 139 ? 'X-RAY DIFFRACTION' ? 
2 2 B 1  B 1 B 140 B 140 ? 'X-RAY DIFFRACTION' ? 
3 3 Z -1 D 6 Z 7   D 14  ? 'X-RAY DIFFRACTION' ? 
4 4 Y 1  C 8 Y 3   C 10  ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement        5.2.0019 ? 1 
MAR345 'data collection' SOFTWARE ? 2 
XDS    'data reduction'  .        ? 3 
XSCALE 'data scaling'    .        ? 4 
REFMAC phasing           5.2.0019 ? 5 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A GLU 139 ? CG  ? A GLU 139 CG  
2 1 Y 1 A GLU 139 ? CD  ? A GLU 139 CD  
3 1 Y 1 A GLU 139 ? OE1 ? A GLU 139 OE1 
4 1 Y 1 A GLU 139 ? OE2 ? A GLU 139 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A HIS 140 ? A HIS 140 
3  1 Y 1 A HIS 141 ? A HIS 141 
4  1 Y 1 A HIS 142 ? A HIS 142 
5  1 Y 1 A HIS 143 ? A HIS 143 
6  1 Y 1 A HIS 144 ? A HIS 144 
7  1 Y 1 A HIS 145 ? A HIS 145 
8  1 Y 1 B HIS 141 ? B HIS 141 
9  1 Y 1 B HIS 142 ? B HIS 142 
10 1 Y 1 B HIS 143 ? B HIS 143 
11 1 Y 1 B HIS 144 ? B HIS 144 
12 1 Y 1 B HIS 145 ? B HIS 145 
13 1 Y 1 Y TYR -6  ? C TYR 1   
14 1 Y 1 Y SER -5  ? C SER 2   
15 1 Y 1 Y PRO -4  ? C PRO 3   
16 1 Y 1 Y THR -3  ? C THR 4   
17 1 Y 1 Y SEP -2  ? C SEP 5   
18 1 Y 1 Y PRO -1  ? C PRO 6   
19 1 Y 1 Y SER 0   ? C SER 7   
20 1 Y 1 Y THR 4   ? C THR 11  
21 1 Y 1 Y SEP 5   ? C SEP 12  
22 1 Y 1 Y PRO 6   ? C PRO 13  
23 1 Y 1 Y SER 7   ? C SER 14  
24 1 Y 1 Z TYR -6  ? D TYR 1   
25 1 Y 1 Z SER -5  ? D SER 2   
26 1 Y 1 Z PRO -4  ? D PRO 3   
27 1 Y 1 Z THR -3  ? D THR 4   
28 1 Y 1 Z SEP -2  ? D SEP 5   
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'AMMONIUM ION' NH4 
4 'SULFATE ION'  SO4 
5 water          HOH 
#