data_3DC1
# 
_entry.id   3DC1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3DC1         
RCSB  RCSB047849   
WWPDB D_1000047849 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3DC1 
_pdbx_database_status.recvd_initial_deposition_date   2008-06-03 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Han, Q.'      1 
'Cai, T.'      2 
'Tagle, D.A.'  3 
'Robinson, H.' 4 
'Li, J.'       5 
# 
_citation.id                        primary 
_citation.title                     
'Substrate specificity and structure of human aminoadipate aminotransferase/kynurenine aminotransferase II' 
_citation.journal_abbrev            Biosci.Rep. 
_citation.journal_volume            28 
_citation.page_first                205 
_citation.page_last                 215 
_citation.year                      2008 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           0144-8463 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18620547 
_citation.pdbx_database_id_DOI      10.1042/BSR20080085 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Han, Q.'      1 
primary 'Cai, T.'      2 
primary 'Tagle, D.A.'  3 
primary 'Robinson, H.' 4 
primary 'Li, J.'       5 
# 
_cell.entry_id           3DC1 
_cell.length_a           60.930 
_cell.length_b           72.090 
_cell.length_c           109.079 
_cell.angle_alpha        89.97 
_cell.angle_beta         100.65 
_cell.angle_gamma        93.88 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3DC1 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Kynurenine/alpha-aminoadipate aminotransferase mitochondrial' 47628.551 4   '2.6.1.7, 2.6.1.39' ? ? ? 
2 non-polymer syn '2-OXOGLUTARIC ACID'                                           146.098   1   ?                   ? ? ? 
3 non-polymer syn GLYCEROL                                                       92.094    6   ?                   ? ? ? 
4 water       nat water                                                          18.015    828 ?                   ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;KAT/AadAT, Kynurenine--oxoglutarate transaminase II, Kynurenine aminotransferase II, Kynurenine--oxoglutarate aminotransferase II, 2-aminoadipate transaminase, 2-aminoadipate aminotransferase, Alpha-aminoadipate aminotransferase, AadAT
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGI
PELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVA
SDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNK
FRVPTFLSMDVDGRVIRADSFS(LLP)IISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFM
AHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSP
YLRASFSSASPEQMDVAFQVLAQLIKESL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGI
PELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVA
SDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNK
FRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVD
RVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRA
SFSSASPEQMDVAFQVLAQLIKESL
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASN n 
1 3   TYR n 
1 4   ALA n 
1 5   ARG n 
1 6   PHE n 
1 7   ILE n 
1 8   THR n 
1 9   ALA n 
1 10  ALA n 
1 11  SER n 
1 12  ALA n 
1 13  ALA n 
1 14  ARG n 
1 15  ASN n 
1 16  PRO n 
1 17  SER n 
1 18  PRO n 
1 19  ILE n 
1 20  ARG n 
1 21  THR n 
1 22  MET n 
1 23  THR n 
1 24  ASP n 
1 25  ILE n 
1 26  LEU n 
1 27  SER n 
1 28  ARG n 
1 29  GLY n 
1 30  PRO n 
1 31  LYS n 
1 32  SER n 
1 33  MET n 
1 34  ILE n 
1 35  SER n 
1 36  LEU n 
1 37  ALA n 
1 38  GLY n 
1 39  GLY n 
1 40  LEU n 
1 41  PRO n 
1 42  ASN n 
1 43  PRO n 
1 44  ASN n 
1 45  MET n 
1 46  PHE n 
1 47  PRO n 
1 48  PHE n 
1 49  LYS n 
1 50  THR n 
1 51  ALA n 
1 52  VAL n 
1 53  ILE n 
1 54  THR n 
1 55  VAL n 
1 56  GLU n 
1 57  ASN n 
1 58  GLY n 
1 59  LYS n 
1 60  THR n 
1 61  ILE n 
1 62  GLN n 
1 63  PHE n 
1 64  GLY n 
1 65  GLU n 
1 66  GLU n 
1 67  MET n 
1 68  MET n 
1 69  LYS n 
1 70  ARG n 
1 71  ALA n 
1 72  LEU n 
1 73  GLN n 
1 74  TYR n 
1 75  SER n 
1 76  PRO n 
1 77  SER n 
1 78  ALA n 
1 79  GLY n 
1 80  ILE n 
1 81  PRO n 
1 82  GLU n 
1 83  LEU n 
1 84  LEU n 
1 85  SER n 
1 86  TRP n 
1 87  LEU n 
1 88  LYS n 
1 89  GLN n 
1 90  LEU n 
1 91  GLN n 
1 92  ILE n 
1 93  LYS n 
1 94  LEU n 
1 95  HIS n 
1 96  ASN n 
1 97  PRO n 
1 98  PRO n 
1 99  THR n 
1 100 ILE n 
1 101 HIS n 
1 102 TYR n 
1 103 PRO n 
1 104 PRO n 
1 105 SER n 
1 106 GLN n 
1 107 GLY n 
1 108 GLN n 
1 109 MET n 
1 110 ASP n 
1 111 LEU n 
1 112 CYS n 
1 113 VAL n 
1 114 THR n 
1 115 SER n 
1 116 GLY n 
1 117 SER n 
1 118 GLN n 
1 119 GLN n 
1 120 GLY n 
1 121 LEU n 
1 122 CYS n 
1 123 LYS n 
1 124 VAL n 
1 125 PHE n 
1 126 GLU n 
1 127 MET n 
1 128 ILE n 
1 129 ILE n 
1 130 ASN n 
1 131 PRO n 
1 132 GLY n 
1 133 ASP n 
1 134 ASN n 
1 135 VAL n 
1 136 LEU n 
1 137 LEU n 
1 138 ASP n 
1 139 GLU n 
1 140 PRO n 
1 141 ALA n 
1 142 TYR n 
1 143 SER n 
1 144 GLY n 
1 145 THR n 
1 146 LEU n 
1 147 GLN n 
1 148 SER n 
1 149 LEU n 
1 150 HIS n 
1 151 PRO n 
1 152 LEU n 
1 153 GLY n 
1 154 CYS n 
1 155 ASN n 
1 156 ILE n 
1 157 ILE n 
1 158 ASN n 
1 159 VAL n 
1 160 ALA n 
1 161 SER n 
1 162 ASP n 
1 163 GLU n 
1 164 SER n 
1 165 GLY n 
1 166 ILE n 
1 167 VAL n 
1 168 PRO n 
1 169 ASP n 
1 170 SER n 
1 171 LEU n 
1 172 ARG n 
1 173 ASP n 
1 174 ILE n 
1 175 LEU n 
1 176 SER n 
1 177 ARG n 
1 178 TRP n 
1 179 LYS n 
1 180 PRO n 
1 181 GLU n 
1 182 ASP n 
1 183 ALA n 
1 184 LYS n 
1 185 ASN n 
1 186 PRO n 
1 187 GLN n 
1 188 LYS n 
1 189 ASN n 
1 190 THR n 
1 191 PRO n 
1 192 LYS n 
1 193 PHE n 
1 194 LEU n 
1 195 TYR n 
1 196 THR n 
1 197 VAL n 
1 198 PRO n 
1 199 ASN n 
1 200 GLY n 
1 201 ASN n 
1 202 ASN n 
1 203 PRO n 
1 204 THR n 
1 205 GLY n 
1 206 ASN n 
1 207 SER n 
1 208 LEU n 
1 209 THR n 
1 210 SER n 
1 211 GLU n 
1 212 ARG n 
1 213 LYS n 
1 214 LYS n 
1 215 GLU n 
1 216 ILE n 
1 217 TYR n 
1 218 GLU n 
1 219 LEU n 
1 220 ALA n 
1 221 ARG n 
1 222 LYS n 
1 223 TYR n 
1 224 ASP n 
1 225 PHE n 
1 226 LEU n 
1 227 ILE n 
1 228 ILE n 
1 229 GLU n 
1 230 ASP n 
1 231 ASP n 
1 232 PRO n 
1 233 TYR n 
1 234 TYR n 
1 235 PHE n 
1 236 LEU n 
1 237 GLN n 
1 238 PHE n 
1 239 ASN n 
1 240 LYS n 
1 241 PHE n 
1 242 ARG n 
1 243 VAL n 
1 244 PRO n 
1 245 THR n 
1 246 PHE n 
1 247 LEU n 
1 248 SER n 
1 249 MET n 
1 250 ASP n 
1 251 VAL n 
1 252 ASP n 
1 253 GLY n 
1 254 ARG n 
1 255 VAL n 
1 256 ILE n 
1 257 ARG n 
1 258 ALA n 
1 259 ASP n 
1 260 SER n 
1 261 PHE n 
1 262 SER n 
1 263 LLP n 
1 264 ILE n 
1 265 ILE n 
1 266 SER n 
1 267 SER n 
1 268 GLY n 
1 269 LEU n 
1 270 ARG n 
1 271 ILE n 
1 272 GLY n 
1 273 PHE n 
1 274 LEU n 
1 275 THR n 
1 276 GLY n 
1 277 PRO n 
1 278 LYS n 
1 279 PRO n 
1 280 LEU n 
1 281 ILE n 
1 282 GLU n 
1 283 ARG n 
1 284 VAL n 
1 285 ILE n 
1 286 LEU n 
1 287 HIS n 
1 288 ILE n 
1 289 GLN n 
1 290 VAL n 
1 291 SER n 
1 292 THR n 
1 293 LEU n 
1 294 HIS n 
1 295 PRO n 
1 296 SER n 
1 297 THR n 
1 298 PHE n 
1 299 ASN n 
1 300 GLN n 
1 301 LEU n 
1 302 MET n 
1 303 ILE n 
1 304 SER n 
1 305 GLN n 
1 306 LEU n 
1 307 LEU n 
1 308 HIS n 
1 309 GLU n 
1 310 TRP n 
1 311 GLY n 
1 312 GLU n 
1 313 GLU n 
1 314 GLY n 
1 315 PHE n 
1 316 MET n 
1 317 ALA n 
1 318 HIS n 
1 319 VAL n 
1 320 ASP n 
1 321 ARG n 
1 322 VAL n 
1 323 ILE n 
1 324 ASP n 
1 325 PHE n 
1 326 TYR n 
1 327 SER n 
1 328 ASN n 
1 329 GLN n 
1 330 LYS n 
1 331 ASP n 
1 332 ALA n 
1 333 ILE n 
1 334 LEU n 
1 335 ALA n 
1 336 ALA n 
1 337 ALA n 
1 338 ASP n 
1 339 LYS n 
1 340 TRP n 
1 341 LEU n 
1 342 THR n 
1 343 GLY n 
1 344 LEU n 
1 345 ALA n 
1 346 GLU n 
1 347 TRP n 
1 348 HIS n 
1 349 VAL n 
1 350 PRO n 
1 351 ALA n 
1 352 ALA n 
1 353 GLY n 
1 354 MET n 
1 355 PHE n 
1 356 LEU n 
1 357 TRP n 
1 358 ILE n 
1 359 LYS n 
1 360 VAL n 
1 361 LYS n 
1 362 GLY n 
1 363 ILE n 
1 364 ASN n 
1 365 ASP n 
1 366 VAL n 
1 367 LYS n 
1 368 GLU n 
1 369 LEU n 
1 370 ILE n 
1 371 GLU n 
1 372 GLU n 
1 373 LYS n 
1 374 ALA n 
1 375 VAL n 
1 376 LYS n 
1 377 MET n 
1 378 GLY n 
1 379 VAL n 
1 380 LEU n 
1 381 MET n 
1 382 LEU n 
1 383 PRO n 
1 384 GLY n 
1 385 ASN n 
1 386 ALA n 
1 387 PHE n 
1 388 TYR n 
1 389 VAL n 
1 390 ASP n 
1 391 SER n 
1 392 SER n 
1 393 ALA n 
1 394 PRO n 
1 395 SER n 
1 396 PRO n 
1 397 TYR n 
1 398 LEU n 
1 399 ARG n 
1 400 ALA n 
1 401 SER n 
1 402 PHE n 
1 403 SER n 
1 404 SER n 
1 405 ALA n 
1 406 SER n 
1 407 PRO n 
1 408 GLU n 
1 409 GLN n 
1 410 MET n 
1 411 ASP n 
1 412 VAL n 
1 413 ALA n 
1 414 PHE n 
1 415 GLN n 
1 416 VAL n 
1 417 LEU n 
1 418 ALA n 
1 419 GLN n 
1 420 LEU n 
1 421 ILE n 
1 422 LYS n 
1 423 GLU n 
1 424 SER n 
1 425 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'AADAT, KAT2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PTYB 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    AADAT_HUMAN 
_struct_ref.pdbx_db_accession          Q8N5Z0 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGI
PELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVA
SDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNK
FRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVD
RVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRA
SFSSASPEQMDVAFQVLAQLIKESL
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3DC1 A 1 ? 425 ? Q8N5Z0 1 ? 425 ? 1 425 
2 1 3DC1 B 1 ? 425 ? Q8N5Z0 1 ? 425 ? 1 425 
3 1 3DC1 C 1 ? 425 ? Q8N5Z0 1 ? 425 ? 1 425 
4 1 3DC1 D 1 ? 425 ? Q8N5Z0 1 ? 425 ? 1 425 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
AKG non-polymer         . '2-OXOGLUTARIC ACID'                                                                                    
?                                      'C5 H6 O5'        146.098 
ALA 'L-peptide linking' y ALANINE                                                                                                 
?                                      'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                                                                                
?                                      'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                              
?                                      'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                                         
?                                      'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                                                
?                                      'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                                               
?                                      'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                                         
?                                      'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                                                                                 
?                                      'C2 H5 N O2'      75.067  
GOL non-polymer         . GLYCEROL                                                                                                
'GLYCERIN; PROPANE-1,2,3-TRIOL'        'C3 H8 O3'        92.094  
HIS 'L-peptide linking' y HISTIDINE                                                                                               
?                                      'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                                                                                   
?                                      'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                                              
?                                      'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                                 
?                                      'C6 H13 N O2'     131.173 
LLP 'L-peptide linking' n '(2S)-2-amino-6-[[3-hydroxy-2-methyl-5-(phosphonooxymethyl)pyridin-4-yl]methylideneamino]hexanoic acid' 
"N'-PYRIDOXYL-LYSINE-5'-MONOPHOSPHATE" 'C14 H22 N3 O7 P' 375.314 
LYS 'L-peptide linking' y LYSINE                                                                                                  
?                                      'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                                                                              
?                                      'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                                           
?                                      'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                                                                                 
?                                      'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                                                                                  
?                                      'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                                                                               
?                                      'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                              
?                                      'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                                
?                                      'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                                                                                  
?                                      'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          3DC1 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.47 
_exptl_crystal.density_percent_sol   50.11 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    '100mM HEPES, 15% PEG 10000, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           200 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2007-07-02 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.08090 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X29A' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X29A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.08090 
# 
_reflns.entry_id                     3DC1 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.50 
_reflns.d_resolution_low             29.69 
_reflns.number_all                   ? 
_reflns.number_obs                   63835 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            0.106 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        89.6 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.50 
_reflns_shell.d_res_low              2.59 
_reflns_shell.percent_possible_all   59.7 
_reflns_shell.Rmerge_I_obs           0.295 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    15.7 
_reflns_shell.pdbx_redundancy        2.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3DC1 
_refine.ls_number_reflns_obs                     54268 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.69 
_refine.ls_d_res_high                            2.50 
_refine.ls_percent_reflns_obs                    88.72 
_refine.ls_R_factor_obs                          0.21681 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.21537 
_refine.ls_R_factor_R_free                       0.24412 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  2890 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.925 
_refine.correlation_coeff_Fo_to_Fc_free          0.901 
_refine.B_iso_mean                               33.861 
_refine.aniso_B[1][1]                            0.00 
_refine.aniso_B[2][2]                            0.00 
_refine.aniso_B[3][3]                            0.00 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 2R2N' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.327 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        13193 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         46 
_refine_hist.number_atoms_solvent             828 
_refine_hist.number_atoms_total               14067 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        29.69 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.020  0.022  ? 13561 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.857  1.980  ? 18402 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   9.279  5.000  ? 1668  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   40.794 24.632 ? 570   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   20.368 15.000 ? 2320  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   18.221 15.000 ? 61    'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.130  0.200  ? 2022  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.010  0.020  ? 10209 'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.261  0.200  ? 7421  'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.325  0.200  ? 9169  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.213  0.200  ? 940   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.259  0.200  ? 66    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.317  0.200  ? 15    'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.983  1.500  ? 8390  'X-RAY DIFFRACTION' ? 
r_mcangle_it             1.730  2.000  ? 13609 'X-RAY DIFFRACTION' ? 
r_scbond_it              2.757  3.000  ? 5171  'X-RAY DIFFRACTION' ? 
r_scangle_it             3.965  4.500  ? 4793  'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.50 
_refine_ls_shell.d_res_low                        2.59 
_refine_ls_shell.number_reflns_R_work             2281 
_refine_ls_shell.R_factor_R_work                  0.185 
_refine_ls_shell.percent_reflns_obs               49.97 
_refine_ls_shell.R_factor_R_free                  0.206 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             123 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3DC1 
_struct.title                     'Crystal structure of kynurenine aminotransferase II complex with alpha-ketoglutarate' 
_struct.pdbx_descriptor           'Kynurenine/alpha-aminoadipate aminotransferase mitochondrial (E.C.2.6.1.7, 2.6.1.39)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3DC1 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;ALPHA & BETA PROTEIN, PLP-DEPENDENT TRANSFERASE, AMINOTRANSFERASE, MULTIFUNCTIONAL ENZYME, PYRIDOXAL PHOSPHATE, Mitochondrion, Transferase, Transit peptide
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 4 ? 
M N N 4 ? 
N N N 4 ? 
O N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TYR A 3   ? ILE A 7   ? TYR A 3   ILE A 7   5 ? 5  
HELX_P HELX_P2  2  THR A 8   ? ARG A 14  ? THR A 8   ARG A 14  1 ? 7  
HELX_P HELX_P3  3  ASN A 42  ? PHE A 46  ? ASN A 42  PHE A 46  5 ? 5  
HELX_P HELX_P4  4  GLY A 64  ? LEU A 72  ? GLY A 64  LEU A 72  1 ? 9  
HELX_P HELX_P5  5  ILE A 80  ? HIS A 95  ? ILE A 80  HIS A 95  1 ? 16 
HELX_P HELX_P6  6  PRO A 103 ? GLY A 107 ? PRO A 103 GLY A 107 5 ? 5  
HELX_P HELX_P7  7  GLY A 116 ? ILE A 129 ? GLY A 116 ILE A 129 1 ? 14 
HELX_P HELX_P8  8  TYR A 142 ? HIS A 150 ? TYR A 142 HIS A 150 1 ? 9  
HELX_P HELX_P9  9  PRO A 151 ? GLY A 153 ? PRO A 151 GLY A 153 5 ? 3  
HELX_P HELX_P10 10 VAL A 167 ? SER A 176 ? VAL A 167 SER A 176 1 ? 10 
HELX_P HELX_P11 11 ARG A 177 ? TRP A 178 ? ARG A 177 TRP A 178 5 ? 2  
HELX_P HELX_P12 12 LYS A 179 ? LYS A 184 ? LYS A 179 LYS A 184 5 ? 6  
HELX_P HELX_P13 13 ASN A 185 ? ASN A 189 ? ASN A 185 ASN A 189 5 ? 5  
HELX_P HELX_P14 14 THR A 209 ? ASP A 224 ? THR A 209 ASP A 224 1 ? 16 
HELX_P HELX_P15 15 PHE A 246 ? ASP A 250 ? PHE A 246 ASP A 250 5 ? 5  
HELX_P HELX_P16 16 LYS A 278 ? GLN A 289 ? LYS A 278 GLN A 289 1 ? 12 
HELX_P HELX_P17 17 SER A 296 ? GLY A 311 ? SER A 296 GLY A 311 1 ? 16 
HELX_P HELX_P18 18 GLY A 311 ? THR A 342 ? GLY A 311 THR A 342 1 ? 32 
HELX_P HELX_P19 19 VAL A 366 ? GLU A 372 ? VAL A 366 GLU A 372 1 ? 7  
HELX_P HELX_P20 20 GLU A 372 ? MET A 377 ? GLU A 372 MET A 377 1 ? 6  
HELX_P HELX_P21 21 ASN A 385 ? TYR A 388 ? ASN A 385 TYR A 388 5 ? 4  
HELX_P HELX_P22 22 SER A 406 ? LEU A 425 ? SER A 406 LEU A 425 1 ? 20 
HELX_P HELX_P23 23 TYR B 3   ? ILE B 7   ? TYR B 3   ILE B 7   5 ? 5  
HELX_P HELX_P24 24 THR B 8   ? ALA B 13  ? THR B 8   ALA B 13  1 ? 6  
HELX_P HELX_P25 25 ASN B 42  ? PHE B 46  ? ASN B 42  PHE B 46  5 ? 5  
HELX_P HELX_P26 26 GLY B 64  ? LEU B 72  ? GLY B 64  LEU B 72  1 ? 9  
HELX_P HELX_P27 27 ILE B 80  ? ASN B 96  ? ILE B 80  ASN B 96  1 ? 17 
HELX_P HELX_P28 28 GLY B 116 ? ILE B 129 ? GLY B 116 ILE B 129 1 ? 14 
HELX_P HELX_P29 29 TYR B 142 ? HIS B 150 ? TYR B 142 HIS B 150 1 ? 9  
HELX_P HELX_P30 30 PRO B 151 ? GLY B 153 ? PRO B 151 GLY B 153 5 ? 3  
HELX_P HELX_P31 31 VAL B 167 ? SER B 176 ? VAL B 167 SER B 176 1 ? 10 
HELX_P HELX_P32 32 ARG B 177 ? TRP B 178 ? ARG B 177 TRP B 178 5 ? 2  
HELX_P HELX_P33 33 LYS B 179 ? ASN B 189 ? LYS B 179 ASN B 189 5 ? 11 
HELX_P HELX_P34 34 THR B 209 ? TYR B 223 ? THR B 209 TYR B 223 1 ? 15 
HELX_P HELX_P35 35 TYR B 233 ? GLN B 237 ? TYR B 233 GLN B 237 5 ? 5  
HELX_P HELX_P36 36 PHE B 246 ? ASP B 250 ? PHE B 246 ASP B 250 5 ? 5  
HELX_P HELX_P37 37 LYS B 278 ? GLN B 289 ? LYS B 278 GLN B 289 1 ? 12 
HELX_P HELX_P38 38 SER B 296 ? LEU B 341 ? SER B 296 LEU B 341 1 ? 46 
HELX_P HELX_P39 39 ASP B 365 ? GLU B 372 ? ASP B 365 GLU B 372 1 ? 8  
HELX_P HELX_P40 40 GLU B 372 ? MET B 377 ? GLU B 372 MET B 377 1 ? 6  
HELX_P HELX_P41 41 ASN B 385 ? TYR B 388 ? ASN B 385 TYR B 388 5 ? 4  
HELX_P HELX_P42 42 SER B 406 ? GLU B 423 ? SER B 406 GLU B 423 1 ? 18 
HELX_P HELX_P43 43 THR C 8   ? ALA C 13  ? THR C 8   ALA C 13  1 ? 6  
HELX_P HELX_P44 44 ASN C 42  ? PHE C 46  ? ASN C 42  PHE C 46  5 ? 5  
HELX_P HELX_P45 45 GLY C 64  ? LEU C 72  ? GLY C 64  LEU C 72  1 ? 9  
HELX_P HELX_P46 46 ILE C 80  ? ASN C 96  ? ILE C 80  ASN C 96  1 ? 17 
HELX_P HELX_P47 47 PRO C 103 ? GLY C 107 ? PRO C 103 GLY C 107 5 ? 5  
HELX_P HELX_P48 48 GLY C 116 ? ILE C 129 ? GLY C 116 ILE C 129 1 ? 14 
HELX_P HELX_P49 49 TYR C 142 ? HIS C 150 ? TYR C 142 HIS C 150 1 ? 9  
HELX_P HELX_P50 50 PRO C 151 ? GLY C 153 ? PRO C 151 GLY C 153 5 ? 3  
HELX_P HELX_P51 51 VAL C 167 ? SER C 176 ? VAL C 167 SER C 176 1 ? 10 
HELX_P HELX_P52 52 ARG C 177 ? TRP C 178 ? ARG C 177 TRP C 178 5 ? 2  
HELX_P HELX_P53 53 LYS C 179 ? ASN C 189 ? LYS C 179 ASN C 189 5 ? 11 
HELX_P HELX_P54 54 THR C 209 ? TYR C 223 ? THR C 209 TYR C 223 1 ? 15 
HELX_P HELX_P55 55 PHE C 246 ? ASP C 250 ? PHE C 246 ASP C 250 5 ? 5  
HELX_P HELX_P56 56 LYS C 278 ? GLN C 289 ? LYS C 278 GLN C 289 1 ? 12 
HELX_P HELX_P57 57 SER C 296 ? LEU C 341 ? SER C 296 LEU C 341 1 ? 46 
HELX_P HELX_P58 58 VAL C 366 ? GLU C 372 ? VAL C 366 GLU C 372 1 ? 7  
HELX_P HELX_P59 59 LYS C 373 ? GLY C 378 ? LYS C 373 GLY C 378 1 ? 6  
HELX_P HELX_P60 60 ASN C 385 ? TYR C 388 ? ASN C 385 TYR C 388 5 ? 4  
HELX_P HELX_P61 61 SER C 406 ? SER C 424 ? SER C 406 SER C 424 1 ? 19 
HELX_P HELX_P62 62 ASN D 2   ? ILE D 7   ? ASN D 2   ILE D 7   5 ? 6  
HELX_P HELX_P63 63 THR D 8   ? ALA D 13  ? THR D 8   ALA D 13  1 ? 6  
HELX_P HELX_P64 64 ASN D 42  ? PHE D 46  ? ASN D 42  PHE D 46  5 ? 5  
HELX_P HELX_P65 65 GLY D 64  ? LEU D 72  ? GLY D 64  LEU D 72  1 ? 9  
HELX_P HELX_P66 66 ILE D 80  ? HIS D 95  ? ILE D 80  HIS D 95  1 ? 16 
HELX_P HELX_P67 67 GLY D 116 ? ILE D 129 ? GLY D 116 ILE D 129 1 ? 14 
HELX_P HELX_P68 68 TYR D 142 ? HIS D 150 ? TYR D 142 HIS D 150 1 ? 9  
HELX_P HELX_P69 69 PRO D 151 ? GLY D 153 ? PRO D 151 GLY D 153 5 ? 3  
HELX_P HELX_P70 70 VAL D 167 ? SER D 176 ? VAL D 167 SER D 176 1 ? 10 
HELX_P HELX_P71 71 GLU D 181 ? ASN D 189 ? GLU D 181 ASN D 189 5 ? 9  
HELX_P HELX_P72 72 THR D 209 ? TYR D 223 ? THR D 209 TYR D 223 1 ? 15 
HELX_P HELX_P73 73 TYR D 233 ? GLN D 237 ? TYR D 233 GLN D 237 5 ? 5  
HELX_P HELX_P74 74 PHE D 246 ? ASP D 250 ? PHE D 246 ASP D 250 5 ? 5  
HELX_P HELX_P75 75 LYS D 278 ? GLN D 289 ? LYS D 278 GLN D 289 1 ? 12 
HELX_P HELX_P76 76 SER D 296 ? LEU D 341 ? SER D 296 LEU D 341 1 ? 46 
HELX_P HELX_P77 77 VAL D 366 ? LYS D 373 ? VAL D 366 LYS D 373 1 ? 8  
HELX_P HELX_P78 78 ASN D 385 ? TYR D 388 ? ASN D 385 TYR D 388 5 ? 4  
HELX_P HELX_P79 79 SER D 406 ? LEU D 425 ? SER D 406 LEU D 425 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A SER 262 C ? ? ? 1_555 A LLP 263 N ? ? A SER 262 A LLP 263 1_555 ? ? ? ? ? ? ? 1.320 ? 
covale2 covale ? ? A LLP 263 C ? ? ? 1_555 A ILE 264 N ? ? A LLP 263 A ILE 264 1_555 ? ? ? ? ? ? ? 1.318 ? 
covale3 covale ? ? B SER 262 C ? ? ? 1_555 B LLP 263 N ? ? B SER 262 B LLP 263 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale4 covale ? ? B LLP 263 C ? ? ? 1_555 B ILE 264 N ? ? B LLP 263 B ILE 264 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale5 covale ? ? C SER 262 C ? ? ? 1_555 C LLP 263 N ? ? C SER 262 C LLP 263 1_555 ? ? ? ? ? ? ? 1.318 ? 
covale6 covale ? ? C LLP 263 C ? ? ? 1_555 C ILE 264 N ? ? C LLP 263 C ILE 264 1_555 ? ? ? ? ? ? ? 1.323 ? 
covale7 covale ? ? D SER 262 C ? ? ? 1_555 D LLP 263 N ? ? D SER 262 D LLP 263 1_555 ? ? ? ? ? ? ? 1.317 ? 
covale8 covale ? ? D LLP 263 C ? ? ? 1_555 D ILE 264 N ? ? D LLP 263 D ILE 264 1_555 ? ? ? ? ? ? ? 1.330 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 139 A . ? GLU 139 A PRO 140 A ? PRO 140 A 1 5.44  
2 ASN 202 A . ? ASN 202 A PRO 203 A ? PRO 203 A 1 15.45 
3 GLU 139 B . ? GLU 139 B PRO 140 B ? PRO 140 B 1 13.60 
4 GLU 139 C . ? GLU 139 C PRO 140 C ? PRO 140 C 1 -4.72 
5 ASN 202 C . ? ASN 202 C PRO 203 C ? PRO 203 C 1 11.78 
6 GLU 139 D . ? GLU 139 D PRO 140 D ? PRO 140 D 1 4.86  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 4 ? 
C ? 7 ? 
D ? 2 ? 
E ? 4 ? 
F ? 2 ? 
G ? 7 ? 
H ? 2 ? 
I ? 4 ? 
J ? 2 ? 
K ? 4 ? 
L ? 7 ? 
M ? 2 ? 
N ? 4 ? 
O ? 2 ? 
P ? 7 ? 
Q ? 2 ? 
R ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? parallel      
C 6 7 ? parallel      
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? parallel      
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? parallel      
G 4 5 ? parallel      
G 5 6 ? parallel      
G 6 7 ? parallel      
H 1 2 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
J 1 2 ? parallel      
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
K 3 4 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
L 3 4 ? parallel      
L 4 5 ? parallel      
L 5 6 ? parallel      
L 6 7 ? parallel      
M 1 2 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
N 3 4 ? anti-parallel 
O 1 2 ? parallel      
P 1 2 ? anti-parallel 
P 2 3 ? anti-parallel 
P 3 4 ? parallel      
P 4 5 ? parallel      
P 5 6 ? parallel      
P 6 7 ? parallel      
Q 1 2 ? anti-parallel 
R 1 2 ? anti-parallel 
R 2 3 ? anti-parallel 
R 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 34  ? SER A 35  ? ILE A 34  SER A 35  
A 2 VAL B 379 ? LEU B 380 ? VAL B 379 LEU B 380 
B 1 ILE A 61  ? PHE A 63  ? ILE A 61  PHE A 63  
B 2 PHE A 48  ? VAL A 55  ? PHE A 48  VAL A 55  
B 3 PHE B 48  ? VAL B 55  ? PHE B 48  VAL B 55  
B 4 ILE B 61  ? PHE B 63  ? ILE B 61  PHE B 63  
C 1 MET A 109 ? THR A 114 ? MET A 109 THR A 114 
C 2 GLY A 272 ? PRO A 277 ? GLY A 272 PRO A 277 
C 3 VAL A 255 ? SER A 260 ? VAL A 255 SER A 260 
C 4 LEU A 226 ? ASP A 230 ? LEU A 226 ASP A 230 
C 5 PHE A 193 ? THR A 196 ? PHE A 193 THR A 196 
C 6 ASN A 134 ? ASP A 138 ? ASN A 134 ASP A 138 
C 7 ASN A 155 ? VAL A 159 ? ASN A 155 VAL A 159 
D 1 SER A 161 ? ASP A 162 ? SER A 161 ASP A 162 
D 2 GLY A 165 ? ILE A 166 ? GLY A 165 ILE A 166 
E 1 ALA A 345 ? TRP A 347 ? ALA A 345 TRP A 347 
E 2 PHE A 355 ? VAL A 360 ? PHE A 355 VAL A 360 
E 3 TYR A 397 ? SER A 401 ? TYR A 397 SER A 401 
E 4 LEU A 382 ? PRO A 383 ? LEU A 382 PRO A 383 
F 1 VAL A 379 ? LEU A 380 ? VAL A 379 LEU A 380 
F 2 ILE B 34  ? SER B 35  ? ILE B 34  SER B 35  
G 1 MET B 109 ? THR B 114 ? MET B 109 THR B 114 
G 2 GLY B 272 ? PRO B 277 ? GLY B 272 PRO B 277 
G 3 VAL B 255 ? SER B 260 ? VAL B 255 SER B 260 
G 4 LEU B 226 ? ASP B 230 ? LEU B 226 ASP B 230 
G 5 PHE B 193 ? THR B 196 ? PHE B 193 THR B 196 
G 6 ASN B 134 ? ASP B 138 ? ASN B 134 ASP B 138 
G 7 ASN B 155 ? VAL B 159 ? ASN B 155 VAL B 159 
H 1 SER B 161 ? ASP B 162 ? SER B 161 ASP B 162 
H 2 GLY B 165 ? ILE B 166 ? GLY B 165 ILE B 166 
I 1 ALA B 345 ? TRP B 347 ? ALA B 345 TRP B 347 
I 2 PHE B 355 ? VAL B 360 ? PHE B 355 VAL B 360 
I 3 TYR B 397 ? SER B 401 ? TYR B 397 SER B 401 
I 4 LEU B 382 ? PRO B 383 ? LEU B 382 PRO B 383 
J 1 ILE C 34  ? SER C 35  ? ILE C 34  SER C 35  
J 2 VAL D 379 ? LEU D 380 ? VAL D 379 LEU D 380 
K 1 ILE C 61  ? PHE C 63  ? ILE C 61  PHE C 63  
K 2 PHE C 48  ? VAL C 55  ? PHE C 48  VAL C 55  
K 3 PHE D 48  ? VAL D 55  ? PHE D 48  VAL D 55  
K 4 ILE D 61  ? PHE D 63  ? ILE D 61  PHE D 63  
L 1 MET C 109 ? THR C 114 ? MET C 109 THR C 114 
L 2 GLY C 272 ? PRO C 277 ? GLY C 272 PRO C 277 
L 3 VAL C 255 ? ASP C 259 ? VAL C 255 ASP C 259 
L 4 LEU C 226 ? ASP C 231 ? LEU C 226 ASP C 231 
L 5 PHE C 193 ? THR C 196 ? PHE C 193 THR C 196 
L 6 ASN C 134 ? LEU C 137 ? ASN C 134 LEU C 137 
L 7 ASN C 155 ? ASN C 158 ? ASN C 155 ASN C 158 
M 1 SER C 161 ? ASP C 162 ? SER C 161 ASP C 162 
M 2 GLY C 165 ? ILE C 166 ? GLY C 165 ILE C 166 
N 1 ALA C 345 ? TRP C 347 ? ALA C 345 TRP C 347 
N 2 PHE C 355 ? VAL C 360 ? PHE C 355 VAL C 360 
N 3 TYR C 397 ? SER C 401 ? TYR C 397 SER C 401 
N 4 LEU C 382 ? PRO C 383 ? LEU C 382 PRO C 383 
O 1 VAL C 379 ? LEU C 380 ? VAL C 379 LEU C 380 
O 2 ILE D 34  ? SER D 35  ? ILE D 34  SER D 35  
P 1 MET D 109 ? THR D 114 ? MET D 109 THR D 114 
P 2 GLY D 272 ? PRO D 277 ? GLY D 272 PRO D 277 
P 3 VAL D 255 ? ASP D 259 ? VAL D 255 ASP D 259 
P 4 LEU D 226 ? ASP D 231 ? LEU D 226 ASP D 231 
P 5 PHE D 193 ? THR D 196 ? PHE D 193 THR D 196 
P 6 ASN D 134 ? ASP D 138 ? ASN D 134 ASP D 138 
P 7 ASN D 155 ? VAL D 159 ? ASN D 155 VAL D 159 
Q 1 SER D 161 ? ASP D 162 ? SER D 161 ASP D 162 
Q 2 GLY D 165 ? ILE D 166 ? GLY D 165 ILE D 166 
R 1 ALA D 345 ? GLU D 346 ? ALA D 345 GLU D 346 
R 2 PHE D 355 ? VAL D 360 ? PHE D 355 VAL D 360 
R 3 TYR D 397 ? SER D 401 ? TYR D 397 SER D 401 
R 4 LEU D 382 ? PRO D 383 ? LEU D 382 PRO D 383 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 34  ? N ILE A 34  O LEU B 380 ? O LEU B 380 
B 1 2 O PHE A 63  ? O PHE A 63  N ALA A 51  ? N ALA A 51  
B 2 3 N THR A 54  ? N THR A 54  O LYS B 49  ? O LYS B 49  
B 3 4 N ILE B 53  ? N ILE B 53  O ILE B 61  ? O ILE B 61  
C 1 2 N THR A 114 ? N THR A 114 O GLY A 272 ? O GLY A 272 
C 2 3 O THR A 275 ? O THR A 275 N ARG A 257 ? N ARG A 257 
C 3 4 O ILE A 256 ? O ILE A 256 N ILE A 227 ? N ILE A 227 
C 4 5 O LEU A 226 ? O LEU A 226 N LEU A 194 ? N LEU A 194 
C 5 6 O TYR A 195 ? O TYR A 195 N LEU A 136 ? N LEU A 136 
C 6 7 N VAL A 135 ? N VAL A 135 O ILE A 157 ? O ILE A 157 
D 1 2 N ASP A 162 ? N ASP A 162 O GLY A 165 ? O GLY A 165 
E 1 2 N GLU A 346 ? N GLU A 346 O LYS A 359 ? O LYS A 359 
E 2 3 N LEU A 356 ? N LEU A 356 O ALA A 400 ? O ALA A 400 
E 3 4 O ARG A 399 ? O ARG A 399 N LEU A 382 ? N LEU A 382 
F 1 2 N LEU A 380 ? N LEU A 380 O ILE B 34  ? O ILE B 34  
G 1 2 N THR B 114 ? N THR B 114 O GLY B 272 ? O GLY B 272 
G 2 3 O PHE B 273 ? O PHE B 273 N ASP B 259 ? N ASP B 259 
G 3 4 O ALA B 258 ? O ALA B 258 N GLU B 229 ? N GLU B 229 
G 4 5 O ILE B 228 ? O ILE B 228 N LEU B 194 ? N LEU B 194 
G 5 6 O TYR B 195 ? O TYR B 195 N LEU B 136 ? N LEU B 136 
G 6 7 N VAL B 135 ? N VAL B 135 O ILE B 157 ? O ILE B 157 
H 1 2 N ASP B 162 ? N ASP B 162 O GLY B 165 ? O GLY B 165 
I 1 2 N GLU B 346 ? N GLU B 346 O LYS B 359 ? O LYS B 359 
I 2 3 N ILE B 358 ? N ILE B 358 O LEU B 398 ? O LEU B 398 
I 3 4 O ARG B 399 ? O ARG B 399 N LEU B 382 ? N LEU B 382 
J 1 2 N ILE C 34  ? N ILE C 34  O LEU D 380 ? O LEU D 380 
K 1 2 O PHE C 63  ? O PHE C 63  N ALA C 51  ? N ALA C 51  
K 2 3 N THR C 54  ? N THR C 54  O LYS D 49  ? O LYS D 49  
K 3 4 N ILE D 53  ? N ILE D 53  O ILE D 61  ? O ILE D 61  
L 1 2 N THR C 114 ? N THR C 114 O GLY C 272 ? O GLY C 272 
L 2 3 O THR C 275 ? O THR C 275 N ARG C 257 ? N ARG C 257 
L 3 4 O ILE C 256 ? O ILE C 256 N ILE C 227 ? N ILE C 227 
L 4 5 O ASP C 230 ? O ASP C 230 N THR C 196 ? N THR C 196 
L 5 6 O TYR C 195 ? O TYR C 195 N LEU C 136 ? N LEU C 136 
L 6 7 N VAL C 135 ? N VAL C 135 O ILE C 157 ? O ILE C 157 
M 1 2 N ASP C 162 ? N ASP C 162 O GLY C 165 ? O GLY C 165 
N 1 2 N GLU C 346 ? N GLU C 346 O LYS C 359 ? O LYS C 359 
N 2 3 N LEU C 356 ? N LEU C 356 O ALA C 400 ? O ALA C 400 
N 3 4 O ARG C 399 ? O ARG C 399 N LEU C 382 ? N LEU C 382 
O 1 2 N LEU C 380 ? N LEU C 380 O ILE D 34  ? O ILE D 34  
P 1 2 N THR D 114 ? N THR D 114 O GLY D 272 ? O GLY D 272 
P 2 3 O THR D 275 ? O THR D 275 N ARG D 257 ? N ARG D 257 
P 3 4 O ILE D 256 ? O ILE D 256 N ILE D 227 ? N ILE D 227 
P 4 5 O ASP D 230 ? O ASP D 230 N THR D 196 ? N THR D 196 
P 5 6 O TYR D 195 ? O TYR D 195 N LEU D 136 ? N LEU D 136 
P 6 7 N VAL D 135 ? N VAL D 135 O ILE D 157 ? O ILE D 157 
Q 1 2 N ASP D 162 ? N ASP D 162 O GLY D 165 ? O GLY D 165 
R 1 2 N GLU D 346 ? N GLU D 346 O LYS D 359 ? O LYS D 359 
R 2 3 N LEU D 356 ? N LEU D 356 O ALA D 400 ? O ALA D 400 
R 3 4 O ARG D 399 ? O ARG D 399 N LEU D 382 ? N LEU D 382 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE AKG A 426' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE GOL A 427' 
AC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE GOL A 428' 
AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE GOL C 426' 
AC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE GOL C 427' 
AC6 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE GOL D 426' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 PRO A 18  ? PRO A 18  . ? 1_555 ? 
2  AC1 5 GLY A 39  ? GLY A 39  . ? 1_555 ? 
3  AC1 5 LEU A 293 ? LEU A 293 . ? 1_555 ? 
4  AC1 5 TYR B 142 ? TYR B 142 . ? 1_555 ? 
5  AC1 5 LLP B 263 ? LLP B 263 . ? 1_555 ? 
6  AC2 6 GLN A 118 ? GLN A 118 . ? 1_555 ? 
7  AC2 6 TYR A 142 ? TYR A 142 . ? 1_555 ? 
8  AC2 6 LLP A 263 ? LLP A 263 . ? 1_555 ? 
9  AC2 6 ILE B 19  ? ILE B 19  . ? 1_555 ? 
10 AC2 6 TYR B 74  ? TYR B 74  . ? 1_555 ? 
11 AC2 6 LEU B 293 ? LEU B 293 . ? 1_555 ? 
12 AC3 3 PRO A 16  ? PRO A 16  . ? 1_555 ? 
13 AC3 3 PRO A 18  ? PRO A 18  . ? 1_555 ? 
14 AC3 3 HOH L .   ? HOH A 653 . ? 1_555 ? 
15 AC4 5 ILE C 19  ? ILE C 19  . ? 1_555 ? 
16 AC4 5 GLY C 39  ? GLY C 39  . ? 1_555 ? 
17 AC4 5 TYR C 74  ? TYR C 74  . ? 1_555 ? 
18 AC4 5 GLN D 118 ? GLN D 118 . ? 1_555 ? 
19 AC4 5 LLP D 263 ? LLP D 263 . ? 1_555 ? 
20 AC5 3 GLY C 29  ? GLY C 29  . ? 1_555 ? 
21 AC5 3 PRO C 30  ? PRO C 30  . ? 1_555 ? 
22 AC5 3 VAL D 375 ? VAL D 375 . ? 1_555 ? 
23 AC6 7 TYR C 142 ? TYR C 142 . ? 1_555 ? 
24 AC6 7 TYR C 233 ? TYR C 233 . ? 1_555 ? 
25 AC6 7 LLP C 263 ? LLP C 263 . ? 1_555 ? 
26 AC6 7 MET C 354 ? MET C 354 . ? 1_555 ? 
27 AC6 7 ILE D 19  ? ILE D 19  . ? 1_555 ? 
28 AC6 7 GLY D 39  ? GLY D 39  . ? 1_555 ? 
29 AC6 7 TYR D 74  ? TYR D 74  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3DC1 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3DC1 
_atom_sites.fract_transf_matrix[1][1]   0.016412 
_atom_sites.fract_transf_matrix[1][2]   0.001114 
_atom_sites.fract_transf_matrix[1][3]   0.003099 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013903 
_atom_sites.fract_transf_matrix[2][3]   0.000169 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009329 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N     . MET A 1 1   ? 26.832  -37.410 0.511    1.00 53.03 ? 1   MET A N     1 
ATOM   2     C CA    . MET A 1 1   ? 27.164  -37.869 1.853    1.00 52.21 ? 1   MET A CA    1 
ATOM   3     C C     . MET A 1 1   ? 27.839  -36.777 2.651    1.00 50.43 ? 1   MET A C     1 
ATOM   4     O O     . MET A 1 1   ? 27.628  -36.659 3.840    1.00 50.01 ? 1   MET A O     1 
ATOM   5     C CB    . MET A 1 1   ? 28.061  -39.104 1.801    1.00 52.91 ? 1   MET A CB    1 
ATOM   6     C CG    . MET A 1 1   ? 28.383  -39.694 3.157    1.00 55.16 ? 1   MET A CG    1 
ATOM   7     S SD    . MET A 1 1   ? 27.895  -41.417 3.340    1.00 66.69 ? 1   MET A SD    1 
ATOM   8     C CE    . MET A 1 1   ? 29.074  -42.243 2.264    1.00 63.66 ? 1   MET A CE    1 
ATOM   9     N N     . ASN A 1 2   ? 28.663  -35.988 1.985    1.00 48.54 ? 2   ASN A N     1 
ATOM   10    C CA    . ASN A 1 2   ? 29.238  -34.781 2.573    1.00 46.43 ? 2   ASN A CA    1 
ATOM   11    C C     . ASN A 1 2   ? 28.909  -33.607 1.653    1.00 45.66 ? 2   ASN A C     1 
ATOM   12    O O     . ASN A 1 2   ? 29.590  -33.375 0.638    1.00 46.48 ? 2   ASN A O     1 
ATOM   13    C CB    . ASN A 1 2   ? 30.747  -34.910 2.723    1.00 46.07 ? 2   ASN A CB    1 
ATOM   14    C CG    . ASN A 1 2   ? 31.394  -33.612 3.123    1.00 44.88 ? 2   ASN A CG    1 
ATOM   15    O OD1   . ASN A 1 2   ? 30.739  -32.728 3.721    1.00 41.62 ? 2   ASN A OD1   1 
ATOM   16    N ND2   . ASN A 1 2   ? 32.694  -33.477 2.812    1.00 37.16 ? 2   ASN A ND2   1 
ATOM   17    N N     . TYR A 1 3   ? 27.853  -32.892 2.016    1.00 43.33 ? 3   TYR A N     1 
ATOM   18    C CA    . TYR A 1 3   ? 27.264  -31.891 1.154    1.00 40.93 ? 3   TYR A CA    1 
ATOM   19    C C     . TYR A 1 3   ? 27.950  -30.555 1.308    1.00 40.25 ? 3   TYR A C     1 
ATOM   20    O O     . TYR A 1 3   ? 27.776  -29.690 0.458    1.00 39.82 ? 3   TYR A O     1 
ATOM   21    C CB    . TYR A 1 3   ? 25.735  -31.754 1.386    1.00 39.82 ? 3   TYR A CB    1 
ATOM   22    C CG    . TYR A 1 3   ? 24.926  -33.025 1.101    1.00 37.11 ? 3   TYR A CG    1 
ATOM   23    C CD1   . TYR A 1 3   ? 24.465  -33.838 2.144    1.00 37.83 ? 3   TYR A CD1   1 
ATOM   24    C CD2   . TYR A 1 3   ? 24.632  -33.402 -0.183   1.00 34.58 ? 3   TYR A CD2   1 
ATOM   25    C CE1   . TYR A 1 3   ? 23.720  -34.985 1.893    1.00 37.06 ? 3   TYR A CE1   1 
ATOM   26    C CE2   . TYR A 1 3   ? 23.901  -34.559 -0.458   1.00 34.65 ? 3   TYR A CE2   1 
ATOM   27    C CZ    . TYR A 1 3   ? 23.437  -35.338 0.582    1.00 36.14 ? 3   TYR A CZ    1 
ATOM   28    O OH    . TYR A 1 3   ? 22.763  -36.496 0.312    1.00 35.28 ? 3   TYR A OH    1 
ATOM   29    N N     . ALA A 1 4   ? 28.726  -30.371 2.374    1.00 39.59 ? 4   ALA A N     1 
ATOM   30    C CA    . ALA A 1 4   ? 29.386  -29.075 2.584    1.00 38.74 ? 4   ALA A CA    1 
ATOM   31    C C     . ALA A 1 4   ? 30.392  -28.753 1.476    1.00 38.45 ? 4   ALA A C     1 
ATOM   32    O O     . ALA A 1 4   ? 30.572  -27.594 1.114    1.00 38.85 ? 4   ALA A O     1 
ATOM   33    C CB    . ALA A 1 4   ? 30.012  -28.993 3.934    1.00 38.32 ? 4   ALA A CB    1 
ATOM   34    N N     . ARG A 1 5   ? 31.002  -29.766 0.884    1.00 38.09 ? 5   ARG A N     1 
ATOM   35    C CA    . ARG A 1 5   ? 31.978  -29.476 -0.169   1.00 38.42 ? 5   ARG A CA    1 
ATOM   36    C C     . ARG A 1 5   ? 31.245  -29.063 -1.454   1.00 37.88 ? 5   ARG A C     1 
ATOM   37    O O     . ARG A 1 5   ? 31.839  -28.578 -2.404   1.00 38.29 ? 5   ARG A O     1 
ATOM   38    C CB    . ARG A 1 5   ? 32.972  -30.647 -0.389   1.00 38.84 ? 5   ARG A CB    1 
ATOM   39    C CG    . ARG A 1 5   ? 32.314  -31.976 -0.706   1.00 39.00 ? 5   ARG A CG    1 
ATOM   40    C CD    . ARG A 1 5   ? 33.314  -33.055 -1.000   1.00 36.88 ? 5   ARG A CD    1 
ATOM   41    N NE    . ARG A 1 5   ? 33.784  -32.991 -2.386   1.00 36.36 ? 5   ARG A NE    1 
ATOM   42    C CZ    . ARG A 1 5   ? 33.495  -33.898 -3.317   1.00 33.98 ? 5   ARG A CZ    1 
ATOM   43    N NH1   . ARG A 1 5   ? 33.975  -33.774 -4.554   1.00 26.10 ? 5   ARG A NH1   1 
ATOM   44    N NH2   . ARG A 1 5   ? 32.739  -34.950 -2.996   1.00 35.36 ? 5   ARG A NH2   1 
ATOM   45    N N     . PHE A 1 6   ? 29.931  -29.230 -1.421   1.00 37.26 ? 6   PHE A N     1 
ATOM   46    C CA    . PHE A 1 6   ? 29.051  -29.004 -2.543   1.00 36.34 ? 6   PHE A CA    1 
ATOM   47    C C     . PHE A 1 6   ? 28.301  -27.656 -2.461   1.00 36.54 ? 6   PHE A C     1 
ATOM   48    O O     . PHE A 1 6   ? 27.508  -27.312 -3.348   1.00 36.94 ? 6   PHE A O     1 
ATOM   49    C CB    . PHE A 1 6   ? 28.037  -30.156 -2.558   1.00 36.42 ? 6   PHE A CB    1 
ATOM   50    C CG    . PHE A 1 6   ? 28.599  -31.457 -3.066   1.00 34.50 ? 6   PHE A CG    1 
ATOM   51    C CD1   . PHE A 1 6   ? 28.633  -32.587 -2.245   1.00 33.70 ? 6   PHE A CD1   1 
ATOM   52    C CD2   . PHE A 1 6   ? 29.089  -31.550 -4.361   1.00 31.15 ? 6   PHE A CD2   1 
ATOM   53    C CE1   . PHE A 1 6   ? 29.148  -33.809 -2.722   1.00 33.53 ? 6   PHE A CE1   1 
ATOM   54    C CE2   . PHE A 1 6   ? 29.617  -32.753 -4.853   1.00 33.41 ? 6   PHE A CE2   1 
ATOM   55    C CZ    . PHE A 1 6   ? 29.643  -33.891 -4.023   1.00 33.80 ? 6   PHE A CZ    1 
ATOM   56    N N     . ILE A 1 7   ? 28.544  -26.908 -1.383   1.00 35.62 ? 7   ILE A N     1 
ATOM   57    C CA    . ILE A 1 7   ? 27.789  -25.730 -1.063   1.00 34.86 ? 7   ILE A CA    1 
ATOM   58    C C     . ILE A 1 7   ? 28.753  -24.588 -0.829   1.00 35.29 ? 7   ILE A C     1 
ATOM   59    O O     . ILE A 1 7   ? 29.581  -24.622 0.099    1.00 37.00 ? 7   ILE A O     1 
ATOM   60    C CB    . ILE A 1 7   ? 26.927  -25.954 0.228    1.00 35.16 ? 7   ILE A CB    1 
ATOM   61    C CG1   . ILE A 1 7   ? 25.983  -27.155 0.083    1.00 33.37 ? 7   ILE A CG1   1 
ATOM   62    C CG2   . ILE A 1 7   ? 26.167  -24.715 0.588    1.00 34.13 ? 7   ILE A CG2   1 
ATOM   63    C CD1   . ILE A 1 7   ? 25.387  -27.655 1.430    1.00 34.56 ? 7   ILE A CD1   1 
ATOM   64    N N     . THR A 1 8   ? 28.622  -23.560 -1.645   1.00 34.58 ? 8   THR A N     1 
ATOM   65    C CA    . THR A 1 8   ? 29.383  -22.305 -1.522   1.00 34.29 ? 8   THR A CA    1 
ATOM   66    C C     . THR A 1 8   ? 29.398  -21.595 -0.122   1.00 33.62 ? 8   THR A C     1 
ATOM   67    O O     . THR A 1 8   ? 28.434  -21.678 0.685    1.00 33.26 ? 8   THR A O     1 
ATOM   68    C CB    . THR A 1 8   ? 28.923  -21.363 -2.625   1.00 33.84 ? 8   THR A CB    1 
ATOM   69    O OG1   . THR A 1 8   ? 29.216  -21.981 -3.901   1.00 35.17 ? 8   THR A OG1   1 
ATOM   70    C CG2   . THR A 1 8   ? 29.658  -20.086 -2.564   1.00 36.73 ? 8   THR A CG2   1 
ATOM   71    N N     . ALA A 1 9   ? 30.483  -20.880 0.168    1.00 32.41 ? 9   ALA A N     1 
ATOM   72    C CA    . ALA A 1 9   ? 30.568  -20.164 1.459    1.00 31.54 ? 9   ALA A CA    1 
ATOM   73    C C     . ALA A 1 9   ? 29.287  -19.337 1.618    1.00 29.97 ? 9   ALA A C     1 
ATOM   74    O O     . ALA A 1 9   ? 28.672  -19.346 2.688    1.00 29.56 ? 9   ALA A O     1 
ATOM   75    C CB    . ALA A 1 9   ? 31.809  -19.258 1.534    1.00 30.48 ? 9   ALA A CB    1 
ATOM   76    N N     . ALA A 1 10  ? 28.933  -18.641 0.533    1.00 27.78 ? 10  ALA A N     1 
ATOM   77    C CA    . ALA A 1 10  ? 27.723  -17.787 0.412    1.00 26.67 ? 10  ALA A CA    1 
ATOM   78    C C     . ALA A 1 10  ? 26.415  -18.537 0.667    1.00 25.99 ? 10  ALA A C     1 
ATOM   79    O O     . ALA A 1 10  ? 25.607  -18.206 1.532    1.00 24.75 ? 10  ALA A O     1 
ATOM   80    C CB    . ALA A 1 10  ? 27.670  -17.137 -0.994   1.00 24.53 ? 10  ALA A CB    1 
ATOM   81    N N     . SER A 1 11  ? 26.213  -19.586 -0.123   1.00 26.02 ? 11  SER A N     1 
ATOM   82    C CA    . SER A 1 11  ? 25.060  -20.458 0.043    1.00 26.94 ? 11  SER A CA    1 
ATOM   83    C C     . SER A 1 11  ? 24.917  -20.916 1.491    1.00 27.77 ? 11  SER A C     1 
ATOM   84    O O     . SER A 1 11  ? 23.813  -21.192 1.960    1.00 27.41 ? 11  SER A O     1 
ATOM   85    C CB    . SER A 1 11  ? 25.167  -21.672 -0.882   1.00 26.22 ? 11  SER A CB    1 
ATOM   86    O OG    . SER A 1 11  ? 23.913  -22.313 -1.029   1.00 29.08 ? 11  SER A OG    1 
ATOM   87    N N     . ALA A 1 12  ? 26.042  -20.994 2.195    1.00 28.42 ? 12  ALA A N     1 
ATOM   88    C CA    . ALA A 1 12  ? 26.090  -21.664 3.490    1.00 27.81 ? 12  ALA A CA    1 
ATOM   89    C C     . ALA A 1 12  ? 25.812  -20.688 4.627    1.00 27.30 ? 12  ALA A C     1 
ATOM   90    O O     . ALA A 1 12  ? 25.285  -21.071 5.672    1.00 26.92 ? 12  ALA A O     1 
ATOM   91    C CB    . ALA A 1 12  ? 27.436  -22.340 3.686    1.00 28.38 ? 12  ALA A CB    1 
ATOM   92    N N     . ALA A 1 13  ? 26.168  -19.429 4.416    1.00 25.30 ? 13  ALA A N     1 
ATOM   93    C CA    . ALA A 1 13  ? 25.947  -18.393 5.418    1.00 25.38 ? 13  ALA A CA    1 
ATOM   94    C C     . ALA A 1 13  ? 24.500  -17.910 5.402    1.00 27.75 ? 13  ALA A C     1 
ATOM   95    O O     . ALA A 1 13  ? 24.116  -17.045 6.189    1.00 28.92 ? 13  ALA A O     1 
ATOM   96    C CB    . ALA A 1 13  ? 26.899  -17.228 5.195    1.00 22.97 ? 13  ALA A CB    1 
ATOM   97    N N     . ARG A 1 14  ? 23.703  -18.476 4.502    1.00 29.29 ? 14  ARG A N     1 
ATOM   98    C CA    . ARG A 1 14  ? 22.287  -18.118 4.395    1.00 31.28 ? 14  ARG A CA    1 
ATOM   99    C C     . ARG A 1 14  ? 21.470  -18.618 5.586    1.00 31.62 ? 14  ARG A C     1 
ATOM   100   O O     . ARG A 1 14  ? 21.542  -19.792 5.954    1.00 32.30 ? 14  ARG A O     1 
ATOM   101   C CB    . ARG A 1 14  ? 21.692  -18.639 3.084    1.00 30.35 ? 14  ARG A CB    1 
ATOM   102   C CG    . ARG A 1 14  ? 22.228  -17.952 1.837    1.00 32.03 ? 14  ARG A CG    1 
ATOM   103   C CD    . ARG A 1 14  ? 21.522  -18.437 0.580    1.00 31.93 ? 14  ARG A CD    1 
ATOM   104   N NE    . ARG A 1 14  ? 22.018  -17.757 -0.616   1.00 20.69 ? 14  ARG A NE    1 
ATOM   105   C CZ    . ARG A 1 14  ? 21.517  -16.626 -1.109   1.00 20.00 ? 14  ARG A CZ    1 
ATOM   106   N NH1   . ARG A 1 14  ? 20.490  -16.026 -0.518   1.00 10.16 ? 14  ARG A NH1   1 
ATOM   107   N NH2   . ARG A 1 14  ? 22.046  -16.091 -2.200   1.00 18.75 ? 14  ARG A NH2   1 
ATOM   108   N N     . ASN A 1 15  ? 20.703  -17.709 6.183    1.00 33.07 ? 15  ASN A N     1 
ATOM   109   C CA    . ASN A 1 15  ? 19.837  -18.033 7.314    1.00 34.47 ? 15  ASN A CA    1 
ATOM   110   C C     . ASN A 1 15  ? 18.358  -17.962 6.929    1.00 34.75 ? 15  ASN A C     1 
ATOM   111   O O     . ASN A 1 15  ? 17.974  -17.114 6.120    1.00 33.92 ? 15  ASN A O     1 
ATOM   112   C CB    . ASN A 1 15  ? 20.129  -17.103 8.497    1.00 33.78 ? 15  ASN A CB    1 
ATOM   113   C CG    . ASN A 1 15  ? 21.532  -17.283 9.057    1.00 36.36 ? 15  ASN A CG    1 
ATOM   114   O OD1   . ASN A 1 15  ? 22.012  -18.406 9.223    1.00 38.36 ? 15  ASN A OD1   1 
ATOM   115   N ND2   . ASN A 1 15  ? 22.191  -16.171 9.360    1.00 34.39 ? 15  ASN A ND2   1 
ATOM   116   N N     . PRO A 1 16  ? 17.546  -18.844 7.501    1.00 36.20 ? 16  PRO A N     1 
ATOM   117   C CA    . PRO A 1 16  ? 16.131  -18.944 7.126    1.00 36.93 ? 16  PRO A CA    1 
ATOM   118   C C     . PRO A 1 16  ? 15.375  -17.651 7.415    1.00 37.15 ? 16  PRO A C     1 
ATOM   119   O O     . PRO A 1 16  ? 15.514  -17.087 8.500    1.00 36.48 ? 16  PRO A O     1 
ATOM   120   C CB    . PRO A 1 16  ? 15.612  -20.069 8.024    1.00 36.70 ? 16  PRO A CB    1 
ATOM   121   C CG    . PRO A 1 16  ? 16.510  -20.042 9.209    1.00 34.90 ? 16  PRO A CG    1 
ATOM   122   C CD    . PRO A 1 16  ? 17.864  -19.666 8.682    1.00 36.49 ? 16  PRO A CD    1 
ATOM   123   N N     . SER A 1 17  ? 14.631  -17.192 6.411    1.00 39.79 ? 17  SER A N     1 
ATOM   124   C CA    . SER A 1 17  ? 14.115  -15.827 6.314    1.00 43.80 ? 17  SER A CA    1 
ATOM   125   C C     . SER A 1 17  ? 12.642  -15.784 5.906    1.00 43.28 ? 17  SER A C     1 
ATOM   126   O O     . SER A 1 17  ? 12.290  -15.184 4.905    1.00 41.09 ? 17  SER A O     1 
ATOM   127   C CB    . SER A 1 17  ? 14.927  -15.015 5.314    1.00 41.35 ? 17  SER A CB    1 
ATOM   128   O OG    . SER A 1 17  ? 14.419  -13.704 5.193    1.00 43.27 ? 17  SER A OG    1 
ATOM   129   N N     . PRO A 1 18  ? 11.785  -16.408 6.699    1.00 46.03 ? 18  PRO A N     1 
ATOM   130   C CA    . PRO A 1 18  ? 10.349  -16.425 6.401    1.00 49.35 ? 18  PRO A CA    1 
ATOM   131   C C     . PRO A 1 18  ? 9.679   -15.103 6.725    1.00 51.89 ? 18  PRO A C     1 
ATOM   132   O O     . PRO A 1 18  ? 8.721   -15.131 7.481    1.00 52.32 ? 18  PRO A O     1 
ATOM   133   C CB    . PRO A 1 18  ? 9.818   -17.516 7.330    1.00 48.88 ? 18  PRO A CB    1 
ATOM   134   C CG    . PRO A 1 18  ? 11.012  -18.322 7.668    1.00 47.23 ? 18  PRO A CG    1 
ATOM   135   C CD    . PRO A 1 18  ? 12.120  -17.337 7.787    1.00 45.15 ? 18  PRO A CD    1 
ATOM   136   N N     . GLY A 1 29  ? 0.332   -22.772 20.233   1.00 85.18 ? 29  GLY A N     1 
ATOM   137   C CA    . GLY A 1 29  ? -0.689  -21.741 20.270   1.00 83.85 ? 29  GLY A CA    1 
ATOM   138   C C     . GLY A 1 29  ? -2.042  -22.280 20.695   1.00 83.50 ? 29  GLY A C     1 
ATOM   139   O O     . GLY A 1 29  ? -2.815  -22.764 19.869   1.00 83.55 ? 29  GLY A O     1 
ATOM   140   N N     . PRO A 1 30  ? -2.327  -22.194 21.990   1.00 82.64 ? 30  PRO A N     1 
ATOM   141   C CA    . PRO A 1 30  ? -3.673  -22.467 22.502   1.00 81.33 ? 30  PRO A CA    1 
ATOM   142   C C     . PRO A 1 30  ? -4.754  -21.930 21.568   1.00 77.85 ? 30  PRO A C     1 
ATOM   143   O O     . PRO A 1 30  ? -5.655  -22.671 21.180   1.00 76.72 ? 30  PRO A O     1 
ATOM   144   C CB    . PRO A 1 30  ? -3.699  -21.704 23.827   1.00 81.86 ? 30  PRO A CB    1 
ATOM   145   C CG    . PRO A 1 30  ? -2.278  -21.673 24.264   1.00 82.33 ? 30  PRO A CG    1 
ATOM   146   C CD    . PRO A 1 30  ? -1.465  -21.566 23.006   1.00 82.97 ? 30  PRO A CD    1 
ATOM   147   N N     . LYS A 1 31  ? -4.658  -20.652 21.216   1.00 74.28 ? 31  LYS A N     1 
ATOM   148   C CA    . LYS A 1 31  ? -5.637  -20.023 20.339   1.00 70.89 ? 31  LYS A CA    1 
ATOM   149   C C     . LYS A 1 31  ? -7.033  -19.935 20.947   1.00 68.47 ? 31  LYS A C     1 
ATOM   150   O O     . LYS A 1 31  ? -7.225  -20.226 22.128   1.00 69.17 ? 31  LYS A O     1 
ATOM   151   C CB    . LYS A 1 31  ? -5.834  -20.856 19.070   1.00 71.23 ? 31  LYS A CB    1 
ATOM   152   C CG    . LYS A 1 31  ? -6.568  -22.167 19.296   1.00 70.49 ? 31  LYS A CG    1 
ATOM   153   C CD    . LYS A 1 31  ? -7.676  -22.009 20.325   1.00 70.51 ? 31  LYS A CD    1 
ATOM   154   C CE    . LYS A 1 31  ? -9.046  -22.196 19.695   1.00 67.30 ? 31  LYS A CE    1 
ATOM   155   N NZ    . LYS A 1 31  ? -8.967  -22.927 18.400   1.00 68.74 ? 31  LYS A NZ    1 
ATOM   156   N N     . SER A 1 32  ? -8.004  -19.533 20.133   1.00 64.17 ? 32  SER A N     1 
ATOM   157   C CA    . SER A 1 32  ? -8.447  -18.144 20.097   1.00 58.90 ? 32  SER A CA    1 
ATOM   158   C C     . SER A 1 32  ? -7.288  -17.188 20.357   1.00 58.25 ? 32  SER A C     1 
ATOM   159   O O     . SER A 1 32  ? -7.208  -16.568 21.418   1.00 57.95 ? 32  SER A O     1 
ATOM   160   C CB    . SER A 1 32  ? -9.562  -17.910 21.118   1.00 59.57 ? 32  SER A CB    1 
ATOM   161   O OG    . SER A 1 32  ? -9.028  -17.584 22.390   1.00 55.06 ? 32  SER A OG    1 
ATOM   162   N N     . MET A 1 33  ? -6.391  -17.073 19.383   1.00 54.11 ? 33  MET A N     1 
ATOM   163   C CA    . MET A 1 33  ? -5.241  -16.186 19.501   1.00 52.11 ? 33  MET A CA    1 
ATOM   164   C C     . MET A 1 33  ? -5.437  -14.916 18.679   1.00 48.58 ? 33  MET A C     1 
ATOM   165   O O     . MET A 1 33  ? -5.980  -14.957 17.576   1.00 49.11 ? 33  MET A O     1 
ATOM   166   C CB    . MET A 1 33  ? -3.963  -16.904 19.062   1.00 51.46 ? 33  MET A CB    1 
ATOM   167   C CG    . MET A 1 33  ? -2.800  -15.973 18.759   1.00 49.63 ? 33  MET A CG    1 
ATOM   168   S SD    . MET A 1 33  ? -1.467  -16.110 19.964   1.00 63.34 ? 33  MET A SD    1 
ATOM   169   C CE    . MET A 1 33  ? -1.920  -17.627 20.801   1.00 61.57 ? 33  MET A CE    1 
ATOM   170   N N     . ILE A 1 34  ? -4.990  -13.789 19.225   1.00 45.42 ? 34  ILE A N     1 
ATOM   171   C CA    . ILE A 1 34  ? -4.826  -12.571 18.441   1.00 40.30 ? 34  ILE A CA    1 
ATOM   172   C C     . ILE A 1 34  ? -3.365  -12.355 18.057   1.00 39.99 ? 34  ILE A C     1 
ATOM   173   O O     . ILE A 1 34  ? -2.484  -12.338 18.916   1.00 41.72 ? 34  ILE A O     1 
ATOM   174   C CB    . ILE A 1 34  ? -5.354  -11.353 19.220   1.00 39.04 ? 34  ILE A CB    1 
ATOM   175   C CG1   . ILE A 1 34  ? -6.842  -11.525 19.534   1.00 36.35 ? 34  ILE A CG1   1 
ATOM   176   C CG2   . ILE A 1 34  ? -5.116  -10.073 18.433   1.00 38.08 ? 34  ILE A CG2   1 
ATOM   177   C CD1   . ILE A 1 34  ? -7.330  -10.656 20.671   1.00 34.00 ? 34  ILE A CD1   1 
ATOM   178   N N     . SER A 1 35  ? -3.117  -12.191 16.762   1.00 38.46 ? 35  SER A N     1 
ATOM   179   C CA    . SER A 1 35  ? -1.754  -12.063 16.251   1.00 33.41 ? 35  SER A CA    1 
ATOM   180   C C     . SER A 1 35  ? -1.535  -10.741 15.518   1.00 30.81 ? 35  SER A C     1 
ATOM   181   O O     . SER A 1 35  ? -2.322  -10.359 14.650   1.00 27.71 ? 35  SER A O     1 
ATOM   182   C CB    . SER A 1 35  ? -1.412  -13.240 15.335   1.00 32.58 ? 35  SER A CB    1 
ATOM   183   O OG    . SER A 1 35  ? -0.054  -13.198 14.928   1.00 31.95 ? 35  SER A OG    1 
ATOM   184   N N     . LEU A 1 36  ? -0.459  -10.046 15.874   1.00 28.88 ? 36  LEU A N     1 
ATOM   185   C CA    . LEU A 1 36  ? -0.230  -8.689  15.394   1.00 28.64 ? 36  LEU A CA    1 
ATOM   186   C C     . LEU A 1 36  ? 1.135   -8.563  14.725   1.00 28.87 ? 36  LEU A C     1 
ATOM   187   O O     . LEU A 1 36  ? 1.418   -7.572  14.051   1.00 29.50 ? 36  LEU A O     1 
ATOM   188   C CB    . LEU A 1 36  ? -0.347  -7.688  16.544   1.00 27.63 ? 36  LEU A CB    1 
ATOM   189   C CG    . LEU A 1 36  ? -1.764  -7.368  17.022   1.00 29.41 ? 36  LEU A CG    1 
ATOM   190   C CD1   . LEU A 1 36  ? -1.729  -6.398  18.194   1.00 28.79 ? 36  LEU A CD1   1 
ATOM   191   C CD2   . LEU A 1 36  ? -2.602  -6.807  15.883   1.00 20.61 ? 36  LEU A CD2   1 
ATOM   192   N N     . ALA A 1 37  ? 1.884   -9.664  14.789   1.00 31.62 ? 37  ALA A N     1 
ATOM   193   C CA    . ALA A 1 37  ? 3.214   -9.777  14.210   1.00 31.30 ? 37  ALA A CA    1 
ATOM   194   C C     . ALA A 1 37  ? 3.283   -10.496 12.869   1.00 31.56 ? 37  ALA A C     1 
ATOM   195   O O     . ALA A 1 37  ? 4.358   -10.837 12.399   1.00 32.26 ? 37  ALA A O     1 
ATOM   196   C CB    . ALA A 1 37  ? 4.128   -10.448 15.178   1.00 31.45 ? 37  ALA A CB    1 
ATOM   197   N N     . GLY A 1 38  ? 2.140   -10.716 12.240   1.00 32.12 ? 38  GLY A N     1 
ATOM   198   C CA    . GLY A 1 38  ? 2.118   -11.147 10.858   1.00 30.79 ? 38  GLY A CA    1 
ATOM   199   C C     . GLY A 1 38  ? 2.619   -10.083 9.926    1.00 30.42 ? 38  GLY A C     1 
ATOM   200   O O     . GLY A 1 38  ? 2.596   -8.914  10.256   1.00 29.86 ? 38  GLY A O     1 
ATOM   201   N N     . GLY A 1 39  ? 3.065   -10.481 8.750    1.00 30.82 ? 39  GLY A N     1 
ATOM   202   C CA    . GLY A 1 39  ? 3.356   -9.511  7.716    1.00 32.11 ? 39  GLY A CA    1 
ATOM   203   C C     . GLY A 1 39  ? 2.448   -9.552  6.499    1.00 33.08 ? 39  GLY A C     1 
ATOM   204   O O     . GLY A 1 39  ? 2.540   -8.704  5.631    1.00 33.19 ? 39  GLY A O     1 
ATOM   205   N N     . LEU A 1 40  ? 1.571   -10.550 6.449    1.00 32.50 ? 40  LEU A N     1 
ATOM   206   C CA    . LEU A 1 40  ? 0.507   -10.585 5.454    1.00 31.15 ? 40  LEU A CA    1 
ATOM   207   C C     . LEU A 1 40  ? -0.191  -9.234  5.345    1.00 29.22 ? 40  LEU A C     1 
ATOM   208   O O     . LEU A 1 40  ? -0.616  -8.661  6.348    1.00 31.31 ? 40  LEU A O     1 
ATOM   209   C CB    . LEU A 1 40  ? -0.510  -11.676 5.795    1.00 31.52 ? 40  LEU A CB    1 
ATOM   210   C CG    . LEU A 1 40  ? 0.063   -13.009 6.280    1.00 32.66 ? 40  LEU A CG    1 
ATOM   211   C CD1   . LEU A 1 40  ? -0.954  -14.127 6.106    1.00 27.48 ? 40  LEU A CD1   1 
ATOM   212   C CD2   . LEU A 1 40  ? 1.356   -13.337 5.548    1.00 29.41 ? 40  LEU A CD2   1 
ATOM   213   N N     . PRO A 1 41  ? -0.305  -8.729  4.120    1.00 26.63 ? 41  PRO A N     1 
ATOM   214   C CA    . PRO A 1 41  ? -1.282  -7.682  3.806    1.00 25.45 ? 41  PRO A CA    1 
ATOM   215   C C     . PRO A 1 41  ? -2.715  -8.189  3.928    1.00 23.65 ? 41  PRO A C     1 
ATOM   216   O O     . PRO A 1 41  ? -2.960  -9.386  3.776    1.00 22.86 ? 41  PRO A O     1 
ATOM   217   C CB    . PRO A 1 41  ? -0.966  -7.342  2.349    1.00 25.74 ? 41  PRO A CB    1 
ATOM   218   C CG    . PRO A 1 41  ? -0.389  -8.594  1.793    1.00 25.53 ? 41  PRO A CG    1 
ATOM   219   C CD    . PRO A 1 41  ? 0.384   -9.224  2.916    1.00 26.25 ? 41  PRO A CD    1 
ATOM   220   N N     . ASN A 1 42  ? -3.647  -7.283  4.199    1.00 21.96 ? 42  ASN A N     1 
ATOM   221   C CA    . ASN A 1 42  ? -5.064  -7.623  4.215    1.00 21.15 ? 42  ASN A CA    1 
ATOM   222   C C     . ASN A 1 42  ? -5.589  -7.972  2.826    1.00 21.33 ? 42  ASN A C     1 
ATOM   223   O O     . ASN A 1 42  ? -5.796  -7.092  1.991    1.00 21.30 ? 42  ASN A O     1 
ATOM   224   C CB    . ASN A 1 42  ? -5.884  -6.478  4.814    1.00 20.69 ? 42  ASN A CB    1 
ATOM   225   C CG    . ASN A 1 42  ? -7.266  -6.918  5.255    1.00 23.54 ? 42  ASN A CG    1 
ATOM   226   O OD1   . ASN A 1 42  ? -7.906  -7.741  4.599    1.00 26.72 ? 42  ASN A OD1   1 
ATOM   227   N ND2   . ASN A 1 42  ? -7.734  -6.372  6.371    1.00 22.27 ? 42  ASN A ND2   1 
ATOM   228   N N     . PRO A 1 43  ? -5.803  -9.262  2.587    1.00 21.06 ? 43  PRO A N     1 
ATOM   229   C CA    . PRO A 1 43  ? -6.078  -9.751  1.258    1.00 22.14 ? 43  PRO A CA    1 
ATOM   230   C C     . PRO A 1 43  ? -7.473  -9.255  0.700    1.00 23.28 ? 43  PRO A C     1 
ATOM   231   O O     . PRO A 1 43  ? -7.716  -9.335  -0.510   1.00 23.80 ? 43  PRO A O     1 
ATOM   232   C CB    . PRO A 1 43  ? -6.047  -11.254 1.439    1.00 22.59 ? 43  PRO A CB    1 
ATOM   233   C CG    . PRO A 1 43  ? -6.611  -11.458 2.838    1.00 20.81 ? 43  PRO A CG    1 
ATOM   234   C CD    . PRO A 1 43  ? -6.119  -10.268 3.620    1.00 21.83 ? 43  PRO A CD    1 
ATOM   235   N N     . ASN A 1 44  ? -8.312  -8.703  1.572    1.00 22.65 ? 44  ASN A N     1 
ATOM   236   C CA    . ASN A 1 44  ? -9.616  -8.179  1.213    1.00 24.12 ? 44  ASN A CA    1 
ATOM   237   C C     . ASN A 1 44  ? -9.551  -6.951  0.343    1.00 23.65 ? 44  ASN A C     1 
ATOM   238   O O     . ASN A 1 44  ? -10.592 -6.519  -0.189   1.00 23.03 ? 44  ASN A O     1 
ATOM   239   C CB    . ASN A 1 44  ? -10.398 -7.745  2.476    1.00 24.80 ? 44  ASN A CB    1 
ATOM   240   C CG    . ASN A 1 44  ? -11.114 -8.873  3.100    1.00 28.47 ? 44  ASN A CG    1 
ATOM   241   O OD1   . ASN A 1 44  ? -11.820 -9.612  2.403    1.00 32.95 ? 44  ASN A OD1   1 
ATOM   242   N ND2   . ASN A 1 44  ? -10.920 -9.065  4.427    1.00 31.51 ? 44  ASN A ND2   1 
ATOM   243   N N     . MET A 1 45  ? -8.372  -6.353  0.271    1.00 23.12 ? 45  MET A N     1 
ATOM   244   C CA    . MET A 1 45  ? -8.187  -5.110  -0.480   1.00 24.80 ? 45  MET A CA    1 
ATOM   245   C C     . MET A 1 45  ? -7.954  -5.424  -1.953   1.00 25.01 ? 45  MET A C     1 
ATOM   246   O O     . MET A 1 45  ? -7.869  -4.524  -2.799   1.00 25.60 ? 45  MET A O     1 
ATOM   247   C CB    . MET A 1 45  ? -6.980  -4.338  0.055    1.00 25.84 ? 45  MET A CB    1 
ATOM   248   C CG    . MET A 1 45  ? -7.152  -3.808  1.453    1.00 29.23 ? 45  MET A CG    1 
ATOM   249   S SD    . MET A 1 45  ? -8.050  -2.306  1.363    1.00 38.70 ? 45  MET A SD    1 
ATOM   250   C CE    . MET A 1 45  ? -9.681  -2.884  1.853    1.00 36.22 ? 45  MET A CE    1 
ATOM   251   N N     . PHE A 1 46  ? -7.863  -6.703  -2.263   1.00 24.29 ? 46  PHE A N     1 
ATOM   252   C CA    . PHE A 1 46  ? -7.490  -7.079  -3.568   1.00 24.96 ? 46  PHE A CA    1 
ATOM   253   C C     . PHE A 1 46  ? -8.723  -7.138  -4.463   1.00 25.24 ? 46  PHE A C     1 
ATOM   254   O O     . PHE A 1 46  ? -9.809  -7.426  -3.996   1.00 26.75 ? 46  PHE A O     1 
ATOM   255   C CB    . PHE A 1 46  ? -6.735  -8.375  -3.527   1.00 23.88 ? 46  PHE A CB    1 
ATOM   256   C CG    . PHE A 1 46  ? -5.450  -8.287  -2.790   1.00 24.22 ? 46  PHE A CG    1 
ATOM   257   C CD1   . PHE A 1 46  ? -4.708  -7.075  -2.772   1.00 24.00 ? 46  PHE A CD1   1 
ATOM   258   C CD2   . PHE A 1 46  ? -4.923  -9.428  -2.163   1.00 20.74 ? 46  PHE A CD2   1 
ATOM   259   C CE1   . PHE A 1 46  ? -3.434  -7.004  -2.097   1.00 20.42 ? 46  PHE A CE1   1 
ATOM   260   C CE2   . PHE A 1 46  ? -3.691  -9.372  -1.519   1.00 19.92 ? 46  PHE A CE2   1 
ATOM   261   C CZ    . PHE A 1 46  ? -2.943  -8.138  -1.507   1.00 21.69 ? 46  PHE A CZ    1 
ATOM   262   N N     . PRO A 1 47  ? -8.553  -6.819  -5.756   1.00 24.70 ? 47  PRO A N     1 
ATOM   263   C CA    . PRO A 1 47  ? -9.747  -6.567  -6.595   1.00 24.62 ? 47  PRO A CA    1 
ATOM   264   C C     . PRO A 1 47  ? -10.387 -7.836  -7.092   1.00 24.86 ? 47  PRO A C     1 
ATOM   265   O O     . PRO A 1 47  ? -11.610 -7.877  -7.338   1.00 24.91 ? 47  PRO A O     1 
ATOM   266   C CB    . PRO A 1 47  ? -9.173  -5.769  -7.763   1.00 24.40 ? 47  PRO A CB    1 
ATOM   267   C CG    . PRO A 1 47  ? -7.686  -5.516  -7.378   1.00 21.57 ? 47  PRO A CG    1 
ATOM   268   C CD    . PRO A 1 47  ? -7.308  -6.596  -6.492   1.00 22.23 ? 47  PRO A CD    1 
ATOM   269   N N     . PHE A 1 48  ? -9.587  -8.894  -7.157   1.00 24.50 ? 48  PHE A N     1 
ATOM   270   C CA    . PHE A 1 48  ? -10.034 -10.112 -7.780   1.00 25.54 ? 48  PHE A CA    1 
ATOM   271   C C     . PHE A 1 48  ? -10.758 -10.912 -6.716   1.00 26.59 ? 48  PHE A C     1 
ATOM   272   O O     . PHE A 1 48  ? -10.234 -11.125 -5.609   1.00 29.27 ? 48  PHE A O     1 
ATOM   273   C CB    . PHE A 1 48  ? -8.853  -10.854 -8.384   1.00 25.36 ? 48  PHE A CB    1 
ATOM   274   C CG    . PHE A 1 48  ? -7.966  -10.002 -9.314   1.00 24.74 ? 48  PHE A CG    1 
ATOM   275   C CD1   . PHE A 1 48  ? -8.397  -9.614  -10.570  1.00 22.26 ? 48  PHE A CD1   1 
ATOM   276   C CD2   . PHE A 1 48  ? -6.661  -9.648  -8.926   1.00 28.21 ? 48  PHE A CD2   1 
ATOM   277   C CE1   . PHE A 1 48  ? -7.545  -8.904  -11.452  1.00 23.18 ? 48  PHE A CE1   1 
ATOM   278   C CE2   . PHE A 1 48  ? -5.808  -8.947  -9.792   1.00 24.54 ? 48  PHE A CE2   1 
ATOM   279   C CZ    . PHE A 1 48  ? -6.263  -8.567  -11.049  1.00 25.69 ? 48  PHE A CZ    1 
ATOM   280   N N     . LYS A 1 49  ? -11.975 -11.323 -7.034   1.00 26.17 ? 49  LYS A N     1 
ATOM   281   C CA    . LYS A 1 49  ? -12.904 -11.793 -6.053   1.00 25.70 ? 49  LYS A CA    1 
ATOM   282   C C     . LYS A 1 49  ? -13.225 -13.291 -6.245   1.00 25.88 ? 49  LYS A C     1 
ATOM   283   O O     . LYS A 1 49  ? -13.321 -14.033 -5.238   1.00 23.76 ? 49  LYS A O     1 
ATOM   284   C CB    . LYS A 1 49  ? -14.190 -10.929 -6.097   1.00 25.49 ? 49  LYS A CB    1 
ATOM   285   C CG    . LYS A 1 49  ? -14.039 -9.458  -5.636   1.00 24.72 ? 49  LYS A CG    1 
ATOM   286   C CD    . LYS A 1 49  ? -13.527 -9.315  -4.171   1.00 25.71 ? 49  LYS A CD    1 
ATOM   287   C CE    . LYS A 1 49  ? -12.467 -8.189  -4.039   1.00 21.26 ? 49  LYS A CE    1 
ATOM   288   N NZ    . LYS A 1 49  ? -12.137 -7.933  -2.561   1.00 23.91 ? 49  LYS A NZ    1 
ATOM   289   N N     . THR A 1 50  ? -13.431 -13.720 -7.514   1.00 25.37 ? 50  THR A N     1 
ATOM   290   C CA    . THR A 1 50  ? -13.788 -15.126 -7.809   1.00 24.80 ? 50  THR A CA    1 
ATOM   291   C C     . THR A 1 50  ? -13.238 -15.607 -9.093   1.00 24.93 ? 50  THR A C     1 
ATOM   292   O O     . THR A 1 50  ? -13.027 -14.837 -10.027  1.00 24.51 ? 50  THR A O     1 
ATOM   293   C CB    . THR A 1 50  ? -15.335 -15.418 -7.847   1.00 26.06 ? 50  THR A CB    1 
ATOM   294   O OG1   . THR A 1 50  ? -15.939 -14.915 -9.070   1.00 23.13 ? 50  THR A OG1   1 
ATOM   295   C CG2   . THR A 1 50  ? -16.039 -14.898 -6.586   1.00 25.57 ? 50  THR A CG2   1 
ATOM   296   N N     . ALA A 1 51  ? -12.983 -16.903 -9.166   1.00 25.28 ? 51  ALA A N     1 
ATOM   297   C CA    . ALA A 1 51  ? -12.457 -17.415 -10.411  1.00 26.62 ? 51  ALA A CA    1 
ATOM   298   C C     . ALA A 1 51  ? -13.141 -18.689 -10.800  1.00 27.19 ? 51  ALA A C     1 
ATOM   299   O O     . ALA A 1 51  ? -13.501 -19.505 -9.927   1.00 28.29 ? 51  ALA A O     1 
ATOM   300   C CB    . ALA A 1 51  ? -10.930 -17.631 -10.325  1.00 26.76 ? 51  ALA A CB    1 
ATOM   301   N N     . VAL A 1 52  ? -13.313 -18.835 -12.109  1.00 26.88 ? 52  VAL A N     1 
ATOM   302   C CA    . VAL A 1 52  ? -13.728 -20.067 -12.740  1.00 27.72 ? 52  VAL A CA    1 
ATOM   303   C C     . VAL A 1 52  ? -12.772 -20.300 -13.913  1.00 26.94 ? 52  VAL A C     1 
ATOM   304   O O     . VAL A 1 52  ? -12.476 -19.406 -14.677  1.00 28.25 ? 52  VAL A O     1 
ATOM   305   C CB    . VAL A 1 52  ? -15.236 -20.048 -13.263  1.00 29.13 ? 52  VAL A CB    1 
ATOM   306   C CG1   . VAL A 1 52  ? -16.219 -19.572 -12.202  1.00 27.39 ? 52  VAL A CG1   1 
ATOM   307   C CG2   . VAL A 1 52  ? -15.382 -19.174 -14.463  1.00 30.61 ? 52  VAL A CG2   1 
ATOM   308   N N     . ILE A 1 53  ? -12.277 -21.515 -14.037  1.00 26.38 ? 53  ILE A N     1 
ATOM   309   C CA    . ILE A 1 53  ? -11.407 -21.867 -15.106  1.00 25.59 ? 53  ILE A CA    1 
ATOM   310   C C     . ILE A 1 53  ? -11.929 -23.208 -15.627  1.00 26.12 ? 53  ILE A C     1 
ATOM   311   O O     . ILE A 1 53  ? -12.257 -24.088 -14.814  1.00 26.75 ? 53  ILE A O     1 
ATOM   312   C CB    . ILE A 1 53  ? -9.956  -21.928 -14.527  1.00 26.36 ? 53  ILE A CB    1 
ATOM   313   C CG1   . ILE A 1 53  ? -9.525  -20.513 -14.061  1.00 23.99 ? 53  ILE A CG1   1 
ATOM   314   C CG2   . ILE A 1 53  ? -8.946  -22.578 -15.499  1.00 20.91 ? 53  ILE A CG2   1 
ATOM   315   C CD1   . ILE A 1 53  ? -8.166  -20.503 -13.393  1.00 26.15 ? 53  ILE A CD1   1 
ATOM   316   N N     . THR A 1 54  ? -12.049 -23.355 -16.950  1.00 26.31 ? 54  THR A N     1 
ATOM   317   C CA    . THR A 1 54  ? -12.479 -24.615 -17.551  1.00 28.31 ? 54  THR A CA    1 
ATOM   318   C C     . THR A 1 54  ? -11.287 -25.437 -18.008  1.00 30.01 ? 54  THR A C     1 
ATOM   319   O O     . THR A 1 54  ? -10.246 -24.900 -18.403  1.00 29.85 ? 54  THR A O     1 
ATOM   320   C CB    . THR A 1 54  ? -13.419 -24.460 -18.765  1.00 27.61 ? 54  THR A CB    1 
ATOM   321   O OG1   . THR A 1 54  ? -12.725 -23.805 -19.805  1.00 32.76 ? 54  THR A OG1   1 
ATOM   322   C CG2   . THR A 1 54  ? -14.682 -23.660 -18.472  1.00 29.02 ? 54  THR A CG2   1 
ATOM   323   N N     . VAL A 1 55  ? -11.497 -26.741 -17.996  1.00 32.05 ? 55  VAL A N     1 
ATOM   324   C CA    . VAL A 1 55  ? -10.524 -27.768 -18.265  1.00 33.98 ? 55  VAL A CA    1 
ATOM   325   C C     . VAL A 1 55  ? -11.183 -28.649 -19.320  1.00 36.57 ? 55  VAL A C     1 
ATOM   326   O O     . VAL A 1 55  ? -12.374 -28.995 -19.184  1.00 35.27 ? 55  VAL A O     1 
ATOM   327   C CB    . VAL A 1 55  ? -10.261 -28.588 -16.949  1.00 34.52 ? 55  VAL A CB    1 
ATOM   328   C CG1   . VAL A 1 55  ? -9.358  -29.812 -17.202  1.00 34.42 ? 55  VAL A CG1   1 
ATOM   329   C CG2   . VAL A 1 55  ? -9.624  -27.703 -15.855  1.00 33.86 ? 55  VAL A CG2   1 
ATOM   330   N N     . GLU A 1 56  ? -10.445 -28.952 -20.402  1.00 39.50 ? 56  GLU A N     1 
ATOM   331   C CA    . GLU A 1 56  ? -10.850 -30.013 -21.337  1.00 42.10 ? 56  GLU A CA    1 
ATOM   332   C C     . GLU A 1 56  ? -10.799 -31.367 -20.596  1.00 42.97 ? 56  GLU A C     1 
ATOM   333   O O     . GLU A 1 56  ? -9.777  -31.701 -19.984  1.00 43.06 ? 56  GLU A O     1 
ATOM   334   C CB    . GLU A 1 56  ? -9.916  -30.044 -22.560  1.00 42.22 ? 56  GLU A CB    1 
ATOM   335   C CG    . GLU A 1 56  ? -10.587 -30.527 -23.875  1.00 43.81 ? 56  GLU A CG    1 
ATOM   336   C CD    . GLU A 1 56  ? -9.599  -30.637 -25.052  1.00 44.37 ? 56  GLU A CD    1 
ATOM   337   O OE1   . GLU A 1 56  ? -9.767  -29.893 -26.040  1.00 45.86 ? 56  GLU A OE1   1 
ATOM   338   O OE2   . GLU A 1 56  ? -8.633  -31.439 -24.978  1.00 48.62 ? 56  GLU A OE2   1 
ATOM   339   N N     . ASN A 1 57  ? -11.896 -32.125 -20.634  1.00 44.34 ? 57  ASN A N     1 
ATOM   340   C CA    . ASN A 1 57  ? -11.998 -33.442 -19.923  1.00 45.73 ? 57  ASN A CA    1 
ATOM   341   C C     . ASN A 1 57  ? -11.669 -33.386 -18.405  1.00 45.82 ? 57  ASN A C     1 
ATOM   342   O O     . ASN A 1 57  ? -10.809 -34.139 -17.872  1.00 46.36 ? 57  ASN A O     1 
ATOM   343   C CB    . ASN A 1 57  ? -11.228 -34.602 -20.627  1.00 45.77 ? 57  ASN A CB    1 
ATOM   344   C CG    . ASN A 1 57  ? -11.123 -34.451 -22.165  1.00 47.46 ? 57  ASN A CG    1 
ATOM   345   O OD1   . ASN A 1 57  ? -10.093 -34.843 -22.747  1.00 49.32 ? 57  ASN A OD1   1 
ATOM   346   N ND2   . ASN A 1 57  ? -12.187 -33.911 -22.829  1.00 46.87 ? 57  ASN A ND2   1 
ATOM   347   N N     . GLY A 1 58  ? -12.369 -32.483 -17.722  1.00 45.51 ? 58  GLY A N     1 
ATOM   348   C CA    . GLY A 1 58  ? -12.103 -32.198 -16.316  1.00 44.94 ? 58  GLY A CA    1 
ATOM   349   C C     . GLY A 1 58  ? -13.216 -31.334 -15.759  1.00 44.91 ? 58  GLY A C     1 
ATOM   350   O O     . GLY A 1 58  ? -13.842 -30.562 -16.501  1.00 45.19 ? 58  GLY A O     1 
ATOM   351   N N     . LYS A 1 59  ? -13.471 -31.473 -14.458  1.00 44.12 ? 59  LYS A N     1 
ATOM   352   C CA    . LYS A 1 59  ? -14.251 -30.503 -13.726  1.00 43.74 ? 59  LYS A CA    1 
ATOM   353   C C     . LYS A 1 59  ? -13.627 -29.106 -13.744  1.00 42.60 ? 59  LYS A C     1 
ATOM   354   O O     . LYS A 1 59  ? -12.409 -28.916 -13.521  1.00 42.65 ? 59  LYS A O     1 
ATOM   355   C CB    . LYS A 1 59  ? -14.475 -30.964 -12.284  1.00 44.25 ? 59  LYS A CB    1 
ATOM   356   C CG    . LYS A 1 59  ? -15.560 -32.037 -12.170  1.00 46.70 ? 59  LYS A CG    1 
ATOM   357   C CD    . LYS A 1 59  ? -15.848 -32.458 -10.715  1.00 45.47 ? 59  LYS A CD    1 
ATOM   358   C CE    . LYS A 1 59  ? -15.988 -33.971 -10.627  1.00 47.97 ? 59  LYS A CE    1 
ATOM   359   N NZ    . LYS A 1 59  ? -16.563 -34.511 -11.909  1.00 47.77 ? 59  LYS A NZ    1 
ATOM   360   N N     . THR A 1 60  ? -14.496 -28.144 -14.037  1.00 40.41 ? 60  THR A N     1 
ATOM   361   C CA    . THR A 1 60  ? -14.238 -26.738 -13.899  1.00 38.13 ? 60  THR A CA    1 
ATOM   362   C C     . THR A 1 60  ? -13.621 -26.360 -12.548  1.00 37.82 ? 60  THR A C     1 
ATOM   363   O O     . THR A 1 60  ? -14.205 -26.604 -11.495  1.00 36.59 ? 60  THR A O     1 
ATOM   364   C CB    . THR A 1 60  ? -15.550 -25.996 -14.056  1.00 37.89 ? 60  THR A CB    1 
ATOM   365   O OG1   . THR A 1 60  ? -16.031 -26.215 -15.393  1.00 36.70 ? 60  THR A OG1   1 
ATOM   366   C CG2   . THR A 1 60  ? -15.381 -24.499 -13.751  1.00 35.61 ? 60  THR A CG2   1 
ATOM   367   N N     . ILE A 1 61  ? -12.438 -25.743 -12.588  1.00 37.14 ? 61  ILE A N     1 
ATOM   368   C CA    . ILE A 1 61  ? -11.835 -25.242 -11.361  1.00 35.91 ? 61  ILE A CA    1 
ATOM   369   C C     . ILE A 1 61  ? -12.494 -23.925 -10.941  1.00 36.35 ? 61  ILE A C     1 
ATOM   370   O O     . ILE A 1 61  ? -12.622 -22.994 -11.755  1.00 35.70 ? 61  ILE A O     1 
ATOM   371   C CB    . ILE A 1 61  ? -10.364 -25.005 -11.532  1.00 35.37 ? 61  ILE A CB    1 
ATOM   372   C CG1   . ILE A 1 61  ? -9.625  -26.325 -11.716  1.00 33.44 ? 61  ILE A CG1   1 
ATOM   373   C CG2   . ILE A 1 61  ? -9.832  -24.180 -10.373  1.00 34.92 ? 61  ILE A CG2   1 
ATOM   374   C CD1   . ILE A 1 61  ? -8.255  -26.169 -12.368  1.00 24.59 ? 61  ILE A CD1   1 
ATOM   375   N N     . GLN A 1 62  ? -12.887 -23.849 -9.663   1.00 35.93 ? 62  GLN A N     1 
ATOM   376   C CA    . GLN A 1 62  ? -13.540 -22.661 -9.149   1.00 35.97 ? 62  GLN A CA    1 
ATOM   377   C C     . GLN A 1 62  ? -12.837 -22.146 -7.930   1.00 34.50 ? 62  GLN A C     1 
ATOM   378   O O     . GLN A 1 62  ? -12.548 -22.917 -7.044   1.00 34.81 ? 62  GLN A O     1 
ATOM   379   C CB    . GLN A 1 62  ? -14.973 -22.966 -8.749   1.00 35.35 ? 62  GLN A CB    1 
ATOM   380   C CG    . GLN A 1 62  ? -15.820 -23.386 -9.874   1.00 39.40 ? 62  GLN A CG    1 
ATOM   381   C CD    . GLN A 1 62  ? -17.274 -23.203 -9.528   1.00 44.35 ? 62  GLN A CD    1 
ATOM   382   O OE1   . GLN A 1 62  ? -17.781 -23.788 -8.564   1.00 48.14 ? 62  GLN A OE1   1 
ATOM   383   N NE2   . GLN A 1 62  ? -17.944 -22.356 -10.273  1.00 42.17 ? 62  GLN A NE2   1 
ATOM   384   N N     . PHE A 1 63  ? -12.614 -20.840 -7.869   1.00 33.72 ? 63  PHE A N     1 
ATOM   385   C CA    . PHE A 1 63  ? -12.210 -20.196 -6.632   1.00 33.47 ? 63  PHE A CA    1 
ATOM   386   C C     . PHE A 1 63  ? -13.346 -19.368 -6.116   1.00 33.59 ? 63  PHE A C     1 
ATOM   387   O O     . PHE A 1 63  ? -13.772 -18.424 -6.782   1.00 35.05 ? 63  PHE A O     1 
ATOM   388   C CB    . PHE A 1 63  ? -11.024 -19.276 -6.845   1.00 33.53 ? 63  PHE A CB    1 
ATOM   389   C CG    . PHE A 1 63  ? -9.756  -19.974 -7.243   1.00 33.02 ? 63  PHE A CG    1 
ATOM   390   C CD1   . PHE A 1 63  ? -9.737  -21.329 -7.542   1.00 31.38 ? 63  PHE A CD1   1 
ATOM   391   C CD2   . PHE A 1 63  ? -8.581  -19.244 -7.377   1.00 34.74 ? 63  PHE A CD2   1 
ATOM   392   C CE1   . PHE A 1 63  ? -8.576  -21.958 -7.944   1.00 32.72 ? 63  PHE A CE1   1 
ATOM   393   C CE2   . PHE A 1 63  ? -7.382  -19.879 -7.757   1.00 34.45 ? 63  PHE A CE2   1 
ATOM   394   C CZ    . PHE A 1 63  ? -7.387  -21.247 -8.017   1.00 34.06 ? 63  PHE A CZ    1 
ATOM   395   N N     . GLY A 1 64  ? -13.868 -19.739 -4.945   1.00 33.89 ? 64  GLY A N     1 
ATOM   396   C CA    . GLY A 1 64  ? -14.852 -18.933 -4.221   1.00 32.20 ? 64  GLY A CA    1 
ATOM   397   C C     . GLY A 1 64  ? -14.105 -17.813 -3.545   1.00 32.47 ? 64  GLY A C     1 
ATOM   398   O O     . GLY A 1 64  ? -12.859 -17.810 -3.534   1.00 32.07 ? 64  GLY A O     1 
ATOM   399   N N     . GLU A 1 65  ? -14.843 -16.897 -2.923   1.00 32.13 ? 65  GLU A N     1 
ATOM   400   C CA    . GLU A 1 65  ? -14.212 -15.772 -2.265   1.00 33.01 ? 65  GLU A CA    1 
ATOM   401   C C     . GLU A 1 65  ? -13.067 -16.129 -1.278   1.00 32.99 ? 65  GLU A C     1 
ATOM   402   O O     . GLU A 1 65  ? -12.066 -15.402 -1.219   1.00 31.50 ? 65  GLU A O     1 
ATOM   403   C CB    . GLU A 1 65  ? -15.220 -14.814 -1.642   1.00 33.65 ? 65  GLU A CB    1 
ATOM   404   C CG    . GLU A 1 65  ? -16.584 -15.405 -1.330   1.00 38.56 ? 65  GLU A CG    1 
ATOM   405   C CD    . GLU A 1 65  ? -17.539 -15.397 -2.538   1.00 43.51 ? 65  GLU A CD    1 
ATOM   406   O OE1   . GLU A 1 65  ? -17.923 -16.499 -3.034   1.00 44.95 ? 65  GLU A OE1   1 
ATOM   407   O OE2   . GLU A 1 65  ? -17.892 -14.281 -2.988   1.00 46.08 ? 65  GLU A OE2   1 
ATOM   408   N N     . GLU A 1 66  ? -13.185 -17.255 -0.572   1.00 32.87 ? 66  GLU A N     1 
ATOM   409   C CA    . GLU A 1 66  ? -12.145 -17.654 0.395    1.00 34.03 ? 66  GLU A CA    1 
ATOM   410   C C     . GLU A 1 66  ? -10.872 -18.202 -0.227   1.00 33.24 ? 66  GLU A C     1 
ATOM   411   O O     . GLU A 1 66  ? -9.830  -17.590 -0.069   1.00 33.36 ? 66  GLU A O     1 
ATOM   412   C CB    . GLU A 1 66  ? -12.652 -18.536 1.559    1.00 34.04 ? 66  GLU A CB    1 
ATOM   413   C CG    . GLU A 1 66  ? -13.436 -17.767 2.648    1.00 36.95 ? 66  GLU A CG    1 
ATOM   414   C CD    . GLU A 1 66  ? -12.648 -16.626 3.368    1.00 43.50 ? 66  GLU A CD    1 
ATOM   415   O OE1   . GLU A 1 66  ? -11.406 -16.737 3.632    1.00 45.13 ? 66  GLU A OE1   1 
ATOM   416   O OE2   . GLU A 1 66  ? -13.309 -15.606 3.696    1.00 44.28 ? 66  GLU A OE2   1 
ATOM   417   N N     . MET A 1 67  ? -10.959 -19.334 -0.911   1.00 33.05 ? 67  MET A N     1 
ATOM   418   C CA    . MET A 1 67  ? -9.926  -19.797 -1.821   1.00 32.79 ? 67  MET A CA    1 
ATOM   419   C C     . MET A 1 67  ? -9.184  -18.671 -2.591   1.00 32.71 ? 67  MET A C     1 
ATOM   420   O O     . MET A 1 67  ? -7.907  -18.598 -2.572   1.00 33.19 ? 67  MET A O     1 
ATOM   421   C CB    . MET A 1 67  ? -10.533 -20.776 -2.825   1.00 33.42 ? 67  MET A CB    1 
ATOM   422   C CG    . MET A 1 67  ? -9.511  -21.639 -3.569   1.00 36.36 ? 67  MET A CG    1 
ATOM   423   S SD    . MET A 1 67  ? -8.218  -22.280 -2.491   1.00 42.12 ? 67  MET A SD    1 
ATOM   424   C CE    . MET A 1 67  ? -9.115  -23.581 -1.621   1.00 43.41 ? 67  MET A CE    1 
ATOM   425   N N     . MET A 1 68  ? -9.969  -17.822 -3.267   1.00 30.84 ? 68  MET A N     1 
ATOM   426   C CA    . MET A 1 68  ? -9.436  -16.696 -4.040   1.00 30.44 ? 68  MET A CA    1 
ATOM   427   C C     . MET A 1 68  ? -8.522  -15.805 -3.228   1.00 29.32 ? 68  MET A C     1 
ATOM   428   O O     . MET A 1 68  ? -7.431  -15.438 -3.682   1.00 29.26 ? 68  MET A O     1 
ATOM   429   C CB    . MET A 1 68  ? -10.556 -15.826 -4.603   1.00 29.73 ? 68  MET A CB    1 
ATOM   430   C CG    . MET A 1 68  ? -10.060 -14.577 -5.293   1.00 31.38 ? 68  MET A CG    1 
ATOM   431   S SD    . MET A 1 68  ? -9.155  -14.783 -6.870   1.00 37.61 ? 68  MET A SD    1 
ATOM   432   C CE    . MET A 1 68  ? -10.113 -15.961 -7.727   1.00 36.59 ? 68  MET A CE    1 
ATOM   433   N N     . LYS A 1 69  ? -9.033  -15.399 -2.069   1.00 27.19 ? 69  LYS A N     1 
ATOM   434   C CA    . LYS A 1 69  ? -8.272  -14.673 -1.085   1.00 26.02 ? 69  LYS A CA    1 
ATOM   435   C C     . LYS A 1 69  ? -6.930  -15.357 -0.720   1.00 24.23 ? 69  LYS A C     1 
ATOM   436   O O     . LYS A 1 69  ? -5.903  -14.711 -0.661   1.00 23.55 ? 69  LYS A O     1 
ATOM   437   C CB    . LYS A 1 69  ? -9.135  -14.456 0.156    1.00 25.87 ? 69  LYS A CB    1 
ATOM   438   C CG    . LYS A 1 69  ? -10.157 -13.340 -0.076   1.00 25.39 ? 69  LYS A CG    1 
ATOM   439   C CD    . LYS A 1 69  ? -10.708 -12.782 1.221    1.00 29.70 ? 69  LYS A CD    1 
ATOM   440   C CE    . LYS A 1 69  ? -11.512 -13.814 1.972    1.00 32.88 ? 69  LYS A CE    1 
ATOM   441   N NZ    . LYS A 1 69  ? -11.746 -13.373 3.371    1.00 40.10 ? 69  LYS A NZ    1 
ATOM   442   N N     . ARG A 1 70  ? -6.966  -16.665 -0.522   1.00 22.68 ? 70  ARG A N     1 
ATOM   443   C CA    . ARG A 1 70  ? -5.792  -17.416 -0.218   1.00 22.43 ? 70  ARG A CA    1 
ATOM   444   C C     . ARG A 1 70  ? -4.878  -17.419 -1.429   1.00 23.51 ? 70  ARG A C     1 
ATOM   445   O O     . ARG A 1 70  ? -3.661  -17.502 -1.285   1.00 23.55 ? 70  ARG A O     1 
ATOM   446   C CB    . ARG A 1 70  ? -6.164  -18.852 0.127    1.00 21.88 ? 70  ARG A CB    1 
ATOM   447   C CG    . ARG A 1 70  ? -4.935  -19.672 0.472    1.00 15.36 ? 70  ARG A CG    1 
ATOM   448   C CD    . ARG A 1 70  ? -5.257  -21.097 0.542    1.00 12.60 ? 70  ARG A CD    1 
ATOM   449   N NE    . ARG A 1 70  ? -4.053  -21.891 0.613    1.00 13.57 ? 70  ARG A NE    1 
ATOM   450   C CZ    . ARG A 1 70  ? -3.975  -23.201 0.342    1.00 18.39 ? 70  ARG A CZ    1 
ATOM   451   N NH1   . ARG A 1 70  ? -5.074  -23.886 -0.083   1.00 11.77 ? 70  ARG A NH1   1 
ATOM   452   N NH2   . ARG A 1 70  ? -2.770  -23.826 0.494    1.00 14.94 ? 70  ARG A NH2   1 
ATOM   453   N N     . ALA A 1 71  ? -5.493  -17.294 -2.610   1.00 23.65 ? 71  ALA A N     1 
ATOM   454   C CA    . ALA A 1 71  ? -4.815  -17.408 -3.858   1.00 24.33 ? 71  ALA A CA    1 
ATOM   455   C C     . ALA A 1 71  ? -4.163  -16.116 -4.261   1.00 24.83 ? 71  ALA A C     1 
ATOM   456   O O     . ALA A 1 71  ? -3.304  -16.119 -5.143   1.00 26.76 ? 71  ALA A O     1 
ATOM   457   C CB    . ALA A 1 71  ? -5.767  -17.875 -4.952   1.00 25.26 ? 71  ALA A CB    1 
ATOM   458   N N     . LEU A 1 72  ? -4.527  -15.030 -3.601   1.00 25.05 ? 72  LEU A N     1 
ATOM   459   C CA    . LEU A 1 72  ? -3.999  -13.690 -3.931   1.00 25.05 ? 72  LEU A CA    1 
ATOM   460   C C     . LEU A 1 72  ? -2.978  -13.260 -2.875   1.00 24.03 ? 72  LEU A C     1 
ATOM   461   O O     . LEU A 1 72  ? -2.468  -12.098 -2.885   1.00 21.26 ? 72  LEU A O     1 
ATOM   462   C CB    . LEU A 1 72  ? -5.162  -12.667 -4.011   1.00 24.47 ? 72  LEU A CB    1 
ATOM   463   C CG    . LEU A 1 72  ? -6.148  -12.815 -5.197   1.00 27.47 ? 72  LEU A CG    1 
ATOM   464   C CD1   . LEU A 1 72  ? -7.321  -11.759 -5.148   1.00 23.86 ? 72  LEU A CD1   1 
ATOM   465   C CD2   . LEU A 1 72  ? -5.442  -12.755 -6.541   1.00 25.01 ? 72  LEU A CD2   1 
ATOM   466   N N     . GLN A 1 73  ? -2.721  -14.211 -1.958   1.00 24.03 ? 73  GLN A N     1 
ATOM   467   C CA    . GLN A 1 73  ? -2.010  -13.958 -0.685   1.00 24.55 ? 73  GLN A CA    1 
ATOM   468   C C     . GLN A 1 73  ? -0.597  -14.599 -0.668   1.00 23.91 ? 73  GLN A C     1 
ATOM   469   O O     . GLN A 1 73  ? -0.381  -15.594 -1.363   1.00 24.37 ? 73  GLN A O     1 
ATOM   470   C CB    . GLN A 1 73  ? -2.880  -14.488 0.492    1.00 25.03 ? 73  GLN A CB    1 
ATOM   471   C CG    . GLN A 1 73  ? -2.387  -14.275 1.936    1.00 23.08 ? 73  GLN A CG    1 
ATOM   472   C CD    . GLN A 1 73  ? -2.025  -12.829 2.235    1.00 26.59 ? 73  GLN A CD    1 
ATOM   473   O OE1   . GLN A 1 73  ? -1.130  -12.284 1.628    1.00 30.12 ? 73  GLN A OE1   1 
ATOM   474   N NE2   . GLN A 1 73  ? -2.730  -12.203 3.164    1.00 32.31 ? 73  GLN A NE2   1 
ATOM   475   N N     . TYR A 1 74  ? 0.336   -14.075 0.124    1.00 22.49 ? 74  TYR A N     1 
ATOM   476   C CA    . TYR A 1 74  ? 1.580   -14.749 0.342    1.00 21.94 ? 74  TYR A CA    1 
ATOM   477   C C     . TYR A 1 74  ? 1.281   -16.216 0.738    1.00 23.79 ? 74  TYR A C     1 
ATOM   478   O O     . TYR A 1 74  ? 0.302   -16.508 1.528    1.00 23.15 ? 74  TYR A O     1 
ATOM   479   C CB    . TYR A 1 74  ? 2.351   -14.054 1.473    1.00 21.89 ? 74  TYR A CB    1 
ATOM   480   C CG    . TYR A 1 74  ? 3.034   -12.796 1.039    1.00 21.17 ? 74  TYR A CG    1 
ATOM   481   C CD1   . TYR A 1 74  ? 3.983   -12.829 0.031    1.00 19.58 ? 74  TYR A CD1   1 
ATOM   482   C CD2   . TYR A 1 74  ? 2.744   -11.590 1.628    1.00 17.54 ? 74  TYR A CD2   1 
ATOM   483   C CE1   . TYR A 1 74  ? 4.591   -11.698 -0.389   1.00 18.19 ? 74  TYR A CE1   1 
ATOM   484   C CE2   . TYR A 1 74  ? 3.334   -10.427 1.191    1.00 14.82 ? 74  TYR A CE2   1 
ATOM   485   C CZ    . TYR A 1 74  ? 4.266   -10.493 0.172    1.00 19.40 ? 74  TYR A CZ    1 
ATOM   486   O OH    . TYR A 1 74  ? 4.940   -9.358  -0.286   1.00 21.54 ? 74  TYR A OH    1 
ATOM   487   N N     . SER A 1 75  ? 2.096   -17.145 0.233    1.00 23.39 ? 75  SER A N     1 
ATOM   488   C CA    . SER A 1 75  ? 2.036   -18.547 0.723    1.00 24.33 ? 75  SER A CA    1 
ATOM   489   C C     . SER A 1 75  ? 3.462   -19.152 1.018    1.00 25.38 ? 75  SER A C     1 
ATOM   490   O O     . SER A 1 75  ? 4.487   -18.446 0.866    1.00 24.76 ? 75  SER A O     1 
ATOM   491   C CB    . SER A 1 75  ? 1.247   -19.434 -0.261   1.00 23.39 ? 75  SER A CB    1 
ATOM   492   O OG    . SER A 1 75  ? 1.826   -19.338 -1.543   1.00 18.98 ? 75  SER A OG    1 
ATOM   493   N N     . PRO A 1 76  ? 3.536   -20.454 1.393    1.00 26.17 ? 76  PRO A N     1 
ATOM   494   C CA    . PRO A 1 76  ? 4.846   -20.982 1.777    1.00 27.78 ? 76  PRO A CA    1 
ATOM   495   C C     . PRO A 1 76  ? 5.814   -20.955 0.618    1.00 29.12 ? 76  PRO A C     1 
ATOM   496   O O     . PRO A 1 76  ? 5.402   -21.166 -0.555   1.00 30.82 ? 76  PRO A O     1 
ATOM   497   C CB    . PRO A 1 76  ? 4.535   -22.419 2.188    1.00 28.11 ? 76  PRO A CB    1 
ATOM   498   C CG    . PRO A 1 76  ? 3.043   -22.389 2.528    1.00 27.52 ? 76  PRO A CG    1 
ATOM   499   C CD    . PRO A 1 76  ? 2.495   -21.488 1.503    1.00 26.35 ? 76  PRO A CD    1 
ATOM   500   N N     . SER A 1 77  ? 7.076   -20.695 0.969    1.00 29.13 ? 77  SER A N     1 
ATOM   501   C CA    . SER A 1 77  ? 8.262   -20.620 0.065    1.00 29.26 ? 77  SER A CA    1 
ATOM   502   C C     . SER A 1 77  ? 8.494   -21.733 -0.921   1.00 28.19 ? 77  SER A C     1 
ATOM   503   O O     . SER A 1 77  ? 8.913   -21.525 -2.083   1.00 28.29 ? 77  SER A O     1 
ATOM   504   C CB    . SER A 1 77  ? 9.504   -20.540 0.943    1.00 29.59 ? 77  SER A CB    1 
ATOM   505   O OG    . SER A 1 77  ? 9.187   -19.703 2.050    1.00 34.08 ? 77  SER A OG    1 
ATOM   506   N N     . ALA A 1 78  ? 8.270   -22.931 -0.421   1.00 27.21 ? 78  ALA A N     1 
ATOM   507   C CA    . ALA A 1 78  ? 8.605   -24.138 -1.114   1.00 25.51 ? 78  ALA A CA    1 
ATOM   508   C C     . ALA A 1 78  ? 7.382   -24.742 -1.796   1.00 25.42 ? 78  ALA A C     1 
ATOM   509   O O     . ALA A 1 78  ? 7.519   -25.759 -2.479   1.00 26.97 ? 78  ALA A O     1 
ATOM   510   C CB    . ALA A 1 78  ? 9.178   -25.111 -0.090   1.00 26.48 ? 78  ALA A CB    1 
ATOM   511   N N     . GLY A 1 79  ? 6.190   -24.142 -1.612   1.00 24.47 ? 79  GLY A N     1 
ATOM   512   C CA    . GLY A 1 79  ? 4.968   -24.511 -2.358   1.00 22.58 ? 79  GLY A CA    1 
ATOM   513   C C     . GLY A 1 79  ? 3.786   -24.692 -1.419   1.00 22.48 ? 79  GLY A C     1 
ATOM   514   O O     . GLY A 1 79  ? 3.982   -25.019 -0.225   1.00 22.12 ? 79  GLY A O     1 
ATOM   515   N N     . ILE A 1 80  ? 2.565   -24.464 -1.902   1.00 21.34 ? 80  ILE A N     1 
ATOM   516   C CA    . ILE A 1 80  ? 1.407   -24.811 -1.069   1.00 22.80 ? 80  ILE A CA    1 
ATOM   517   C C     . ILE A 1 80  ? 1.515   -26.325 -0.733   1.00 23.66 ? 80  ILE A C     1 
ATOM   518   O O     . ILE A 1 80  ? 2.017   -27.109 -1.580   1.00 25.43 ? 80  ILE A O     1 
ATOM   519   C CB    . ILE A 1 80  ? 0.095   -24.479 -1.760   1.00 22.24 ? 80  ILE A CB    1 
ATOM   520   C CG1   . ILE A 1 80  ? -0.161  -25.420 -2.887   1.00 20.15 ? 80  ILE A CG1   1 
ATOM   521   C CG2   . ILE A 1 80  ? 0.098   -23.080 -2.275   1.00 22.02 ? 80  ILE A CG2   1 
ATOM   522   C CD1   . ILE A 1 80  ? -1.067  -24.829 -3.979   1.00 24.38 ? 80  ILE A CD1   1 
ATOM   523   N N     . PRO A 1 81  ? 1.163   -26.734 0.501    1.00 22.59 ? 81  PRO A N     1 
ATOM   524   C CA    . PRO A 1 81  ? 1.257   -28.141 0.957    1.00 23.67 ? 81  PRO A CA    1 
ATOM   525   C C     . PRO A 1 81  ? 0.369   -29.170 0.236    1.00 25.68 ? 81  PRO A C     1 
ATOM   526   O O     . PRO A 1 81  ? 0.617   -30.362 0.288    1.00 28.33 ? 81  PRO A O     1 
ATOM   527   C CB    . PRO A 1 81  ? 0.830   -28.064 2.472    1.00 24.45 ? 81  PRO A CB    1 
ATOM   528   C CG    . PRO A 1 81  ? -0.057  -26.795 2.603    1.00 21.25 ? 81  PRO A CG    1 
ATOM   529   C CD    . PRO A 1 81  ? 0.742   -25.844 1.602    1.00 23.96 ? 81  PRO A CD    1 
ATOM   530   N N     . GLU A 1 82  ? -0.664  -28.762 -0.463   1.00 26.69 ? 82  GLU A N     1 
ATOM   531   C CA    . GLU A 1 82  ? -1.461  -29.768 -1.106   1.00 27.46 ? 82  GLU A CA    1 
ATOM   532   C C     . GLU A 1 82  ? -0.790  -30.080 -2.461   1.00 27.36 ? 82  GLU A C     1 
ATOM   533   O O     . GLU A 1 82  ? -0.787  -31.253 -2.981   1.00 26.94 ? 82  GLU A O     1 
ATOM   534   C CB    . GLU A 1 82  ? -2.970  -29.373 -1.077   1.00 27.13 ? 82  GLU A CB    1 
ATOM   535   C CG    . GLU A 1 82  ? -3.295  -28.001 -1.616   1.00 31.55 ? 82  GLU A CG    1 
ATOM   536   C CD    . GLU A 1 82  ? -3.291  -26.853 -0.583   1.00 33.63 ? 82  GLU A CD    1 
ATOM   537   O OE1   . GLU A 1 82  ? -2.185  -26.487 -0.043   1.00 28.95 ? 82  GLU A OE1   1 
ATOM   538   O OE2   . GLU A 1 82  ? -4.419  -26.287 -0.373   1.00 30.37 ? 82  GLU A OE2   1 
ATOM   539   N N     . LEU A 1 83  ? -0.093  -29.065 -2.978   1.00 26.82 ? 83  LEU A N     1 
ATOM   540   C CA    . LEU A 1 83  ? 0.728   -29.299 -4.183   1.00 26.91 ? 83  LEU A CA    1 
ATOM   541   C C     . LEU A 1 83  ? 2.050   -30.025 -3.789   1.00 27.23 ? 83  LEU A C     1 
ATOM   542   O O     . LEU A 1 83  ? 2.421   -31.003 -4.431   1.00 28.48 ? 83  LEU A O     1 
ATOM   543   C CB    . LEU A 1 83  ? 0.947   -27.992 -4.992   1.00 26.15 ? 83  LEU A CB    1 
ATOM   544   C CG    . LEU A 1 83  ? 1.883   -28.027 -6.214   1.00 26.32 ? 83  LEU A CG    1 
ATOM   545   C CD1   . LEU A 1 83  ? 1.436   -29.028 -7.359   1.00 17.69 ? 83  LEU A CD1   1 
ATOM   546   C CD2   . LEU A 1 83  ? 2.232   -26.607 -6.755   1.00 25.78 ? 83  LEU A CD2   1 
ATOM   547   N N     . LEU A 1 84  ? 2.739   -29.603 -2.721   1.00 26.65 ? 84  LEU A N     1 
ATOM   548   C CA    . LEU A 1 84  ? 3.987   -30.325 -2.333   1.00 25.95 ? 84  LEU A CA    1 
ATOM   549   C C     . LEU A 1 84  ? 3.757   -31.775 -2.030   1.00 25.14 ? 84  LEU A C     1 
ATOM   550   O O     . LEU A 1 84  ? 4.557   -32.619 -2.432   1.00 26.40 ? 84  LEU A O     1 
ATOM   551   C CB    . LEU A 1 84  ? 4.647   -29.780 -1.090   1.00 25.33 ? 84  LEU A CB    1 
ATOM   552   C CG    . LEU A 1 84  ? 5.564   -28.613 -1.217   1.00 25.69 ? 84  LEU A CG    1 
ATOM   553   C CD1   . LEU A 1 84  ? 5.882   -28.163 0.231    1.00 22.74 ? 84  LEU A CD1   1 
ATOM   554   C CD2   . LEU A 1 84  ? 6.812   -28.944 -2.136   1.00 24.05 ? 84  LEU A CD2   1 
ATOM   555   N N     . SER A 1 85  ? 2.703   -32.101 -1.300   1.00 24.16 ? 85  SER A N     1 
ATOM   556   C CA    . SER A 1 85  ? 2.515   -33.528 -1.018   1.00 23.66 ? 85  SER A CA    1 
ATOM   557   C C     . SER A 1 85  ? 2.185   -34.339 -2.242   1.00 23.04 ? 85  SER A C     1 
ATOM   558   O O     . SER A 1 85  ? 2.528   -35.520 -2.302   1.00 25.03 ? 85  SER A O     1 
ATOM   559   C CB    . SER A 1 85  ? 1.523   -33.780 0.093    1.00 22.74 ? 85  SER A CB    1 
ATOM   560   O OG    . SER A 1 85  ? 0.242   -33.293 -0.220   1.00 27.10 ? 85  SER A OG    1 
ATOM   561   N N     . TRP A 1 86  ? 1.548   -33.713 -3.225   1.00 23.38 ? 86  TRP A N     1 
ATOM   562   C CA    . TRP A 1 86  ? 1.074   -34.435 -4.411   1.00 23.36 ? 86  TRP A CA    1 
ATOM   563   C C     . TRP A 1 86  ? 2.271   -34.615 -5.285   1.00 22.57 ? 86  TRP A C     1 
ATOM   564   O O     . TRP A 1 86  ? 2.472   -35.712 -5.826   1.00 23.17 ? 86  TRP A O     1 
ATOM   565   C CB    . TRP A 1 86  ? -0.062  -33.705 -5.147   1.00 22.54 ? 86  TRP A CB    1 
ATOM   566   C CG    . TRP A 1 86  ? -0.868  -34.484 -6.158   1.00 23.19 ? 86  TRP A CG    1 
ATOM   567   C CD1   . TRP A 1 86  ? -2.145  -34.899 -5.991   1.00 24.98 ? 86  TRP A CD1   1 
ATOM   568   C CD2   . TRP A 1 86  ? -0.498  -34.889 -7.522   1.00 19.97 ? 86  TRP A CD2   1 
ATOM   569   N NE1   . TRP A 1 86  ? -2.589  -35.545 -7.122   1.00 22.51 ? 86  TRP A NE1   1 
ATOM   570   C CE2   . TRP A 1 86  ? -1.625  -35.528 -8.078   1.00 14.33 ? 86  TRP A CE2   1 
ATOM   571   C CE3   . TRP A 1 86  ? 0.666   -34.753 -8.312   1.00 19.69 ? 86  TRP A CE3   1 
ATOM   572   C CZ2   . TRP A 1 86  ? -1.632  -36.076 -9.370   1.00 22.73 ? 86  TRP A CZ2   1 
ATOM   573   C CZ3   . TRP A 1 86  ? 0.691   -35.338 -9.621   1.00 21.59 ? 86  TRP A CZ3   1 
ATOM   574   C CH2   . TRP A 1 86  ? -0.455  -35.982 -10.134  1.00 24.00 ? 86  TRP A CH2   1 
ATOM   575   N N     . LEU A 1 87  ? 3.120   -33.602 -5.409   1.00 22.19 ? 87  LEU A N     1 
ATOM   576   C CA    . LEU A 1 87  ? 4.396   -33.896 -6.137   1.00 21.97 ? 87  LEU A CA    1 
ATOM   577   C C     . LEU A 1 87  ? 5.377   -34.866 -5.394   1.00 22.15 ? 87  LEU A C     1 
ATOM   578   O O     . LEU A 1 87  ? 5.980   -35.726 -5.986   1.00 21.57 ? 87  LEU A O     1 
ATOM   579   C CB    . LEU A 1 87  ? 5.089   -32.624 -6.575   1.00 21.86 ? 87  LEU A CB    1 
ATOM   580   C CG    . LEU A 1 87  ? 4.248   -31.688 -7.402   1.00 17.61 ? 87  LEU A CG    1 
ATOM   581   C CD1   . LEU A 1 87  ? 4.632   -30.246 -7.220   1.00 16.89 ? 87  LEU A CD1   1 
ATOM   582   C CD2   . LEU A 1 87  ? 4.505   -32.091 -8.756   1.00 15.78 ? 87  LEU A CD2   1 
ATOM   583   N N     . LYS A 1 88  ? 5.496   -34.677 -4.084   1.00 24.01 ? 88  LYS A N     1 
ATOM   584   C CA    . LYS A 1 88  ? 6.266   -35.588 -3.245   1.00 26.63 ? 88  LYS A CA    1 
ATOM   585   C C     . LYS A 1 88  ? 5.752   -37.018 -3.368   1.00 27.18 ? 88  LYS A C     1 
ATOM   586   O O     . LYS A 1 88  ? 6.535   -37.965 -3.445   1.00 28.99 ? 88  LYS A O     1 
ATOM   587   C CB    . LYS A 1 88  ? 6.223   -35.137 -1.784   1.00 26.60 ? 88  LYS A CB    1 
ATOM   588   C CG    . LYS A 1 88  ? 7.368   -34.221 -1.382   1.00 27.72 ? 88  LYS A CG    1 
ATOM   589   C CD    . LYS A 1 88  ? 7.299   -33.867 0.094    1.00 25.32 ? 88  LYS A CD    1 
ATOM   590   C CE    . LYS A 1 88  ? 8.415   -32.911 0.485    1.00 28.62 ? 88  LYS A CE    1 
ATOM   591   N NZ    . LYS A 1 88  ? 8.595   -32.841 1.961    1.00 30.21 ? 88  LYS A NZ    1 
ATOM   592   N N     . GLN A 1 89  ? 4.433   -37.169 -3.386   1.00 28.64 ? 89  GLN A N     1 
ATOM   593   C CA    . GLN A 1 89  ? 3.812   -38.462 -3.651   1.00 29.78 ? 89  GLN A CA    1 
ATOM   594   C C     . GLN A 1 89  ? 4.125   -38.945 -5.063   1.00 29.80 ? 89  GLN A C     1 
ATOM   595   O O     . GLN A 1 89  ? 4.760   -39.976 -5.247   1.00 31.13 ? 89  GLN A O     1 
ATOM   596   C CB    . GLN A 1 89  ? 2.298   -38.380 -3.447   1.00 30.91 ? 89  GLN A CB    1 
ATOM   597   C CG    . GLN A 1 89  ? 1.709   -39.562 -2.695   1.00 34.17 ? 89  GLN A CG    1 
ATOM   598   C CD    . GLN A 1 89  ? 0.489   -40.141 -3.382   1.00 35.26 ? 89  GLN A CD    1 
ATOM   599   O OE1   . GLN A 1 89  ? -0.580  -39.531 -3.378   1.00 27.71 ? 89  GLN A OE1   1 
ATOM   600   N NE2   . GLN A 1 89  ? 0.644   -41.312 -3.975   1.00 31.99 ? 89  GLN A NE2   1 
ATOM   601   N N     . LEU A 1 90  ? 3.699   -38.211 -6.078   1.00 29.47 ? 90  LEU A N     1 
ATOM   602   C CA    . LEU A 1 90  ? 4.027   -38.593 -7.435   1.00 30.25 ? 90  LEU A CA    1 
ATOM   603   C C     . LEU A 1 90  ? 5.460   -39.080 -7.522   1.00 30.13 ? 90  LEU A C     1 
ATOM   604   O O     . LEU A 1 90  ? 5.765   -40.024 -8.221   1.00 29.01 ? 90  LEU A O     1 
ATOM   605   C CB    . LEU A 1 90  ? 3.783   -37.452 -8.419   1.00 30.25 ? 90  LEU A CB    1 
ATOM   606   C CG    . LEU A 1 90  ? 4.440   -37.572 -9.798   1.00 30.36 ? 90  LEU A CG    1 
ATOM   607   C CD1   . LEU A 1 90  ? 3.465   -37.796 -10.893  1.00 31.14 ? 90  LEU A CD1   1 
ATOM   608   C CD2   . LEU A 1 90  ? 5.291   -36.387 -10.112  1.00 29.77 ? 90  LEU A CD2   1 
ATOM   609   N N     . GLN A 1 91  ? 6.341   -38.437 -6.784   1.00 31.07 ? 91  GLN A N     1 
ATOM   610   C CA    . GLN A 1 91  ? 7.762   -38.728 -6.927   1.00 31.19 ? 91  GLN A CA    1 
ATOM   611   C C     . GLN A 1 91  ? 8.110   -40.086 -6.326   1.00 32.34 ? 91  GLN A C     1 
ATOM   612   O O     . GLN A 1 91  ? 8.897   -40.844 -6.894   1.00 31.47 ? 91  GLN A O     1 
ATOM   613   C CB    . GLN A 1 91  ? 8.602   -37.638 -6.270   1.00 30.36 ? 91  GLN A CB    1 
ATOM   614   C CG    . GLN A 1 91  ? 8.555   -36.303 -6.994   1.00 27.46 ? 91  GLN A CG    1 
ATOM   615   C CD    . GLN A 1 91  ? 9.201   -36.353 -8.364   1.00 29.98 ? 91  GLN A CD    1 
ATOM   616   O OE1   . GLN A 1 91  ? 8.859   -37.206 -9.182   1.00 25.90 ? 91  GLN A OE1   1 
ATOM   617   N NE2   . GLN A 1 91  ? 10.137  -35.451 -8.618   1.00 30.28 ? 91  GLN A NE2   1 
ATOM   618   N N     . ILE A 1 92  ? 7.519   -40.386 -5.174   1.00 34.09 ? 92  ILE A N     1 
ATOM   619   C CA    . ILE A 1 92  ? 7.630   -41.713 -4.579   1.00 35.52 ? 92  ILE A CA    1 
ATOM   620   C C     . ILE A 1 92  ? 7.052   -42.781 -5.500   1.00 36.61 ? 92  ILE A C     1 
ATOM   621   O O     . ILE A 1 92  ? 7.452   -43.943 -5.447   1.00 37.51 ? 92  ILE A O     1 
ATOM   622   C CB    . ILE A 1 92  ? 6.923   -41.752 -3.212   1.00 35.93 ? 92  ILE A CB    1 
ATOM   623   C CG1   . ILE A 1 92  ? 7.681   -40.906 -2.193   1.00 34.98 ? 92  ILE A CG1   1 
ATOM   624   C CG2   . ILE A 1 92  ? 6.791   -43.186 -2.721   1.00 35.73 ? 92  ILE A CG2   1 
ATOM   625   C CD1   . ILE A 1 92  ? 7.075   -40.927 -0.807   1.00 39.55 ? 92  ILE A CD1   1 
ATOM   626   N N     . LYS A 1 93  ? 6.107   -42.378 -6.345   1.00 37.26 ? 93  LYS A N     1 
ATOM   627   C CA    . LYS A 1 93  ? 5.334   -43.324 -7.138   1.00 39.16 ? 93  LYS A CA    1 
ATOM   628   C C     . LYS A 1 93  ? 5.972   -43.552 -8.503   1.00 39.93 ? 93  LYS A C     1 
ATOM   629   O O     . LYS A 1 93  ? 5.963   -44.667 -9.025   1.00 41.60 ? 93  LYS A O     1 
ATOM   630   C CB    . LYS A 1 93  ? 3.894   -42.832 -7.306   1.00 39.58 ? 93  LYS A CB    1 
ATOM   631   C CG    . LYS A 1 93  ? 2.923   -43.395 -6.282   1.00 41.25 ? 93  LYS A CG    1 
ATOM   632   C CD    . LYS A 1 93  ? 2.648   -44.867 -6.533   1.00 44.16 ? 93  LYS A CD    1 
ATOM   633   C CE    . LYS A 1 93  ? 1.423   -45.339 -5.766   1.00 47.11 ? 93  LYS A CE    1 
ATOM   634   N NZ    . LYS A 1 93  ? 0.194   -44.610 -6.182   1.00 49.74 ? 93  LYS A NZ    1 
ATOM   635   N N     . LEU A 1 94  ? 6.526   -42.489 -9.077   1.00 39.91 ? 94  LEU A N     1 
ATOM   636   C CA    . LEU A 1 94  ? 7.199   -42.578 -10.375  1.00 39.70 ? 94  LEU A CA    1 
ATOM   637   C C     . LEU A 1 94  ? 8.624   -43.074 -10.284  1.00 39.30 ? 94  LEU A C     1 
ATOM   638   O O     . LEU A 1 94  ? 9.123   -43.625 -11.260  1.00 39.70 ? 94  LEU A O     1 
ATOM   639   C CB    . LEU A 1 94  ? 7.135   -41.270 -11.183  1.00 39.26 ? 94  LEU A CB    1 
ATOM   640   C CG    . LEU A 1 94  ? 5.673   -40.944 -11.491  1.00 40.18 ? 94  LEU A CG    1 
ATOM   641   C CD1   . LEU A 1 94  ? 5.542   -39.948 -12.568  1.00 39.84 ? 94  LEU A CD1   1 
ATOM   642   C CD2   . LEU A 1 94  ? 4.861   -42.221 -11.835  1.00 42.90 ? 94  LEU A CD2   1 
ATOM   643   N N     . HIS A 1 95  ? 9.265   -42.883 -9.136   1.00 38.90 ? 95  HIS A N     1 
ATOM   644   C CA    . HIS A 1 95  ? 10.699  -43.120 -9.010   1.00 39.37 ? 95  HIS A CA    1 
ATOM   645   C C     . HIS A 1 95  ? 11.022  -43.875 -7.726   1.00 39.91 ? 95  HIS A C     1 
ATOM   646   O O     . HIS A 1 95  ? 12.007  -44.609 -7.659   1.00 39.96 ? 95  HIS A O     1 
ATOM   647   C CB    . HIS A 1 95  ? 11.466  -41.797 -9.050   1.00 38.50 ? 95  HIS A CB    1 
ATOM   648   C CG    . HIS A 1 95  ? 11.226  -40.995 -10.292  1.00 36.82 ? 95  HIS A CG    1 
ATOM   649   N ND1   . HIS A 1 95  ? 10.737  -39.708 -10.263  1.00 34.19 ? 95  HIS A ND1   1 
ATOM   650   C CD2   . HIS A 1 95  ? 11.407  -41.300 -11.599  1.00 34.69 ? 95  HIS A CD2   1 
ATOM   651   C CE1   . HIS A 1 95  ? 10.628  -39.254 -11.499  1.00 34.66 ? 95  HIS A CE1   1 
ATOM   652   N NE2   . HIS A 1 95  ? 11.028  -40.200 -12.329  1.00 33.02 ? 95  HIS A NE2   1 
ATOM   653   N N     . ASN A 1 96  ? 10.187  -43.690 -6.709   1.00 40.79 ? 96  ASN A N     1 
ATOM   654   C CA    . ASN A 1 96  ? 10.352  -44.395 -5.443   1.00 40.87 ? 96  ASN A CA    1 
ATOM   655   C C     . ASN A 1 96  ? 11.794  -44.362 -4.948   1.00 40.81 ? 96  ASN A C     1 
ATOM   656   O O     . ASN A 1 96  ? 12.472  -45.389 -4.913   1.00 40.29 ? 96  ASN A O     1 
ATOM   657   C CB    . ASN A 1 96  ? 9.872   -45.841 -5.570   1.00 41.16 ? 96  ASN A CB    1 
ATOM   658   C CG    . ASN A 1 96  ? 10.194  -46.672 -4.343   1.00 42.68 ? 96  ASN A CG    1 
ATOM   659   O OD1   . ASN A 1 96  ? 10.003  -46.228 -3.211   1.00 46.40 ? 96  ASN A OD1   1 
ATOM   660   N ND2   . ASN A 1 96  ? 10.687  -47.885 -4.562   1.00 41.80 ? 96  ASN A ND2   1 
ATOM   661   N N     . PRO A 1 97  ? 12.256  -43.177 -4.568   1.00 40.74 ? 97  PRO A N     1 
ATOM   662   C CA    . PRO A 1 97  ? 13.679  -42.956 -4.294   1.00 41.05 ? 97  PRO A CA    1 
ATOM   663   C C     . PRO A 1 97  ? 14.135  -43.688 -3.036   1.00 41.03 ? 97  PRO A C     1 
ATOM   664   O O     . PRO A 1 97  ? 13.463  -43.622 -2.007   1.00 41.20 ? 97  PRO A O     1 
ATOM   665   C CB    . PRO A 1 97  ? 13.759  -41.444 -4.079   1.00 40.64 ? 97  PRO A CB    1 
ATOM   666   C CG    . PRO A 1 97  ? 12.635  -40.896 -4.884   1.00 40.06 ? 97  PRO A CG    1 
ATOM   667   C CD    . PRO A 1 97  ? 11.533  -41.913 -4.797   1.00 39.85 ? 97  PRO A CD    1 
ATOM   668   N N     . PRO A 1 98  ? 15.266  -44.380 -3.125   1.00 41.63 ? 98  PRO A N     1 
ATOM   669   C CA    . PRO A 1 98  ? 15.808  -45.121 -1.982   1.00 41.07 ? 98  PRO A CA    1 
ATOM   670   C C     . PRO A 1 98  ? 16.081  -44.207 -0.793   1.00 40.49 ? 98  PRO A C     1 
ATOM   671   O O     . PRO A 1 98  ? 16.486  -44.687 0.269    1.00 39.56 ? 98  PRO A O     1 
ATOM   672   C CB    . PRO A 1 98  ? 17.123  -45.682 -2.527   1.00 41.83 ? 98  PRO A CB    1 
ATOM   673   C CG    . PRO A 1 98  ? 16.893  -45.811 -3.990   1.00 41.84 ? 98  PRO A CG    1 
ATOM   674   C CD    . PRO A 1 98  ? 16.003  -44.663 -4.370   1.00 41.16 ? 98  PRO A CD    1 
ATOM   675   N N     . THR A 1 99  ? 15.860  -42.916 -0.976   1.00 39.21 ? 99  THR A N     1 
ATOM   676   C CA    . THR A 1 99  ? 16.379  -41.927 -0.074   1.00 38.23 ? 99  THR A CA    1 
ATOM   677   C C     . THR A 1 99  ? 15.233  -41.381 0.758    1.00 36.90 ? 99  THR A C     1 
ATOM   678   O O     . THR A 1 99  ? 15.444  -40.645 1.713    1.00 35.58 ? 99  THR A O     1 
ATOM   679   C CB    . THR A 1 99  ? 17.033  -40.831 -0.937   1.00 39.20 ? 99  THR A CB    1 
ATOM   680   O OG1   . THR A 1 99  ? 18.053  -40.122 -0.219   1.00 41.49 ? 99  THR A OG1   1 
ATOM   681   C CG2   . THR A 1 99  ? 16.007  -39.864 -1.472   1.00 38.08 ? 99  THR A CG2   1 
ATOM   682   N N     . ILE A 1 100 ? 14.010  -41.759 0.379    1.00 36.18 ? 100 ILE A N     1 
ATOM   683   C CA    . ILE A 1 100 ? 12.798  -41.224 0.970    1.00 35.41 ? 100 ILE A CA    1 
ATOM   684   C C     . ILE A 1 100 ? 12.867  -41.318 2.488    1.00 34.77 ? 100 ILE A C     1 
ATOM   685   O O     . ILE A 1 100 ? 12.648  -40.314 3.203    1.00 32.30 ? 100 ILE A O     1 
ATOM   686   C CB    . ILE A 1 100 ? 11.458  -41.900 0.418    1.00 36.40 ? 100 ILE A CB    1 
ATOM   687   C CG1   . ILE A 1 100 ? 11.574  -43.435 0.343    1.00 38.04 ? 100 ILE A CG1   1 
ATOM   688   C CG2   . ILE A 1 100 ? 11.048  -41.323 -0.966   1.00 35.18 ? 100 ILE A CG2   1 
ATOM   689   C CD1   . ILE A 1 100 ? 10.294  -44.194 0.002    1.00 37.46 ? 100 ILE A CD1   1 
ATOM   690   N N     . HIS A 1 101 ? 13.203  -42.512 2.993    1.00 34.91 ? 101 HIS A N     1 
ATOM   691   C CA    . HIS A 1 101 ? 13.180  -42.716 4.442    1.00 34.30 ? 101 HIS A CA    1 
ATOM   692   C C     . HIS A 1 101 ? 14.506  -42.545 5.139    1.00 35.08 ? 101 HIS A C     1 
ATOM   693   O O     . HIS A 1 101 ? 14.672  -43.028 6.262    1.00 35.84 ? 101 HIS A O     1 
ATOM   694   C CB    . HIS A 1 101 ? 12.478  -44.022 4.810    1.00 33.58 ? 101 HIS A CB    1 
ATOM   695   C CG    . HIS A 1 101 ? 11.041  -44.055 4.403    1.00 32.73 ? 101 HIS A CG    1 
ATOM   696   N ND1   . HIS A 1 101 ? 10.453  -45.160 3.828    1.00 32.21 ? 101 HIS A ND1   1 
ATOM   697   C CD2   . HIS A 1 101 ? 10.084  -43.092 4.432    1.00 34.93 ? 101 HIS A CD2   1 
ATOM   698   C CE1   . HIS A 1 101 ? 9.187   -44.891 3.552    1.00 32.29 ? 101 HIS A CE1   1 
ATOM   699   N NE2   . HIS A 1 101 ? 8.942   -43.638 3.890    1.00 32.84 ? 101 HIS A NE2   1 
ATOM   700   N N     . TYR A 1 102 ? 15.438  -41.833 4.497    1.00 35.75 ? 102 TYR A N     1 
ATOM   701   C CA    . TYR A 1 102 ? 16.730  -41.449 5.138    1.00 36.10 ? 102 TYR A CA    1 
ATOM   702   C C     . TYR A 1 102 ? 16.636  -40.388 6.216    1.00 37.40 ? 102 TYR A C     1 
ATOM   703   O O     . TYR A 1 102 ? 15.776  -39.501 6.141    1.00 38.44 ? 102 TYR A O     1 
ATOM   704   C CB    . TYR A 1 102 ? 17.744  -40.877 4.131    1.00 33.85 ? 102 TYR A CB    1 
ATOM   705   C CG    . TYR A 1 102 ? 18.352  -41.897 3.234    1.00 32.03 ? 102 TYR A CG    1 
ATOM   706   C CD1   . TYR A 1 102 ? 19.251  -41.516 2.249    1.00 29.33 ? 102 TYR A CD1   1 
ATOM   707   C CD2   . TYR A 1 102 ? 18.020  -43.264 3.364    1.00 29.09 ? 102 TYR A CD2   1 
ATOM   708   C CE1   . TYR A 1 102 ? 19.827  -42.465 1.417    1.00 32.54 ? 102 TYR A CE1   1 
ATOM   709   C CE2   . TYR A 1 102 ? 18.569  -44.215 2.536    1.00 28.07 ? 102 TYR A CE2   1 
ATOM   710   C CZ    . TYR A 1 102 ? 19.471  -43.813 1.555    1.00 30.84 ? 102 TYR A CZ    1 
ATOM   711   O OH    . TYR A 1 102 ? 20.018  -44.738 0.710    1.00 27.32 ? 102 TYR A OH    1 
ATOM   712   N N     . PRO A 1 103 ? 17.558  -40.438 7.200    1.00 38.07 ? 103 PRO A N     1 
ATOM   713   C CA    . PRO A 1 103 ? 17.776  -39.242 7.974    1.00 38.39 ? 103 PRO A CA    1 
ATOM   714   C C     . PRO A 1 103 ? 17.902  -37.951 7.133    1.00 38.81 ? 103 PRO A C     1 
ATOM   715   O O     . PRO A 1 103 ? 18.607  -37.937 6.120    1.00 37.88 ? 103 PRO A O     1 
ATOM   716   C CB    . PRO A 1 103 ? 19.045  -39.581 8.745    1.00 39.14 ? 103 PRO A CB    1 
ATOM   717   C CG    . PRO A 1 103 ? 18.881  -41.077 8.995    1.00 38.74 ? 103 PRO A CG    1 
ATOM   718   C CD    . PRO A 1 103 ? 18.353  -41.574 7.709    1.00 38.21 ? 103 PRO A CD    1 
ATOM   719   N N     . PRO A 1 104 ? 17.242  -36.849 7.584    1.00 39.25 ? 104 PRO A N     1 
ATOM   720   C CA    . PRO A 1 104 ? 17.341  -35.585 6.853    1.00 39.19 ? 104 PRO A CA    1 
ATOM   721   C C     . PRO A 1 104 ? 18.808  -35.173 6.520    1.00 39.31 ? 104 PRO A C     1 
ATOM   722   O O     . PRO A 1 104 ? 19.124  -34.795 5.371    1.00 39.43 ? 104 PRO A O     1 
ATOM   723   C CB    . PRO A 1 104 ? 16.715  -34.574 7.815    1.00 39.79 ? 104 PRO A CB    1 
ATOM   724   C CG    . PRO A 1 104 ? 15.852  -35.360 8.741    1.00 39.17 ? 104 PRO A CG    1 
ATOM   725   C CD    . PRO A 1 104 ? 16.444  -36.723 8.828    1.00 39.00 ? 104 PRO A CD    1 
ATOM   726   N N     . SER A 1 105 ? 19.692  -35.211 7.508    1.00 38.98 ? 105 SER A N     1 
ATOM   727   C CA    . SER A 1 105 ? 21.069  -34.694 7.308    1.00 38.53 ? 105 SER A CA    1 
ATOM   728   C C     . SER A 1 105 ? 21.872  -35.637 6.407    1.00 38.26 ? 105 SER A C     1 
ATOM   729   O O     . SER A 1 105 ? 22.870  -35.258 5.840    1.00 38.50 ? 105 SER A O     1 
ATOM   730   C CB    . SER A 1 105 ? 21.755  -34.566 8.641    1.00 38.20 ? 105 SER A CB    1 
ATOM   731   O OG    . SER A 1 105 ? 21.870  -35.859 9.174    1.00 37.73 ? 105 SER A OG    1 
ATOM   732   N N     . GLN A 1 106 ? 21.409  -36.876 6.281    1.00 38.32 ? 106 GLN A N     1 
ATOM   733   C CA    . GLN A 1 106 ? 21.933  -37.814 5.298    1.00 37.48 ? 106 GLN A CA    1 
ATOM   734   C C     . GLN A 1 106 ? 21.207  -37.822 3.938    1.00 37.95 ? 106 GLN A C     1 
ATOM   735   O O     . GLN A 1 106 ? 21.220  -38.832 3.232    1.00 39.28 ? 106 GLN A O     1 
ATOM   736   C CB    . GLN A 1 106 ? 21.902  -39.214 5.873    1.00 37.87 ? 106 GLN A CB    1 
ATOM   737   C CG    . GLN A 1 106 ? 22.887  -39.473 7.017    1.00 40.10 ? 106 GLN A CG    1 
ATOM   738   C CD    . GLN A 1 106 ? 23.171  -40.959 7.173    1.00 46.55 ? 106 GLN A CD    1 
ATOM   739   O OE1   . GLN A 1 106 ? 22.263  -41.809 7.045    1.00 46.90 ? 106 GLN A OE1   1 
ATOM   740   N NE2   . GLN A 1 106 ? 24.450  -41.296 7.425    1.00 51.64 ? 106 GLN A NE2   1 
ATOM   741   N N     . GLY A 1 107 ? 20.584  -36.716 3.539    1.00 36.89 ? 107 GLY A N     1 
ATOM   742   C CA    . GLY A 1 107 ? 20.022  -36.634 2.197    1.00 35.11 ? 107 GLY A CA    1 
ATOM   743   C C     . GLY A 1 107 ? 18.553  -36.995 1.964    1.00 33.76 ? 107 GLY A C     1 
ATOM   744   O O     . GLY A 1 107 ? 18.147  -37.091 0.836    1.00 34.59 ? 107 GLY A O     1 
ATOM   745   N N     . GLN A 1 108 ? 17.738  -37.150 2.994    1.00 31.85 ? 108 GLN A N     1 
ATOM   746   C CA    . GLN A 1 108 ? 16.318  -37.459 2.768    1.00 30.60 ? 108 GLN A CA    1 
ATOM   747   C C     . GLN A 1 108 ? 15.592  -36.718 1.594    1.00 30.91 ? 108 GLN A C     1 
ATOM   748   O O     . GLN A 1 108 ? 15.513  -35.479 1.537    1.00 30.23 ? 108 GLN A O     1 
ATOM   749   C CB    . GLN A 1 108 ? 15.569  -37.240 4.052    1.00 30.01 ? 108 GLN A CB    1 
ATOM   750   C CG    . GLN A 1 108 ? 14.141  -37.572 3.949    1.00 26.37 ? 108 GLN A CG    1 
ATOM   751   C CD    . GLN A 1 108 ? 13.458  -37.472 5.254    1.00 26.38 ? 108 GLN A CD    1 
ATOM   752   O OE1   . GLN A 1 108 ? 12.516  -38.212 5.515    1.00 30.37 ? 108 GLN A OE1   1 
ATOM   753   N NE2   . GLN A 1 108 ? 13.899  -36.541 6.103    1.00 27.63 ? 108 GLN A NE2   1 
ATOM   754   N N     . MET A 1 109 ? 15.076  -37.482 0.646    1.00 30.98 ? 109 MET A N     1 
ATOM   755   C CA    . MET A 1 109 ? 14.437  -36.886 -0.510   1.00 31.78 ? 109 MET A CA    1 
ATOM   756   C C     . MET A 1 109 ? 13.613  -35.685 -0.081   1.00 31.38 ? 109 MET A C     1 
ATOM   757   O O     . MET A 1 109 ? 12.663  -35.825 0.737    1.00 32.32 ? 109 MET A O     1 
ATOM   758   C CB    . MET A 1 109 ? 13.513  -37.892 -1.197   1.00 31.87 ? 109 MET A CB    1 
ATOM   759   C CG    . MET A 1 109 ? 13.087  -37.459 -2.605   1.00 32.77 ? 109 MET A CG    1 
ATOM   760   S SD    . MET A 1 109 ? 11.367  -37.896 -3.016   1.00 34.14 ? 109 MET A SD    1 
ATOM   761   C CE    . MET A 1 109 ? 10.586  -37.289 -1.529   1.00 27.53 ? 109 MET A CE    1 
ATOM   762   N N     . ASP A 1 110 ? 13.961  -34.520 -0.621   1.00 29.71 ? 110 ASP A N     1 
ATOM   763   C CA    . ASP A 1 110 ? 13.191  -33.299 -0.396   1.00 28.47 ? 110 ASP A CA    1 
ATOM   764   C C     . ASP A 1 110 ? 12.763  -32.733 -1.789   1.00 27.54 ? 110 ASP A C     1 
ATOM   765   O O     . ASP A 1 110 ? 13.247  -33.185 -2.841   1.00 26.97 ? 110 ASP A O     1 
ATOM   766   C CB    . ASP A 1 110 ? 14.052  -32.341 0.476    1.00 30.04 ? 110 ASP A CB    1 
ATOM   767   C CG    . ASP A 1 110 ? 13.237  -31.258 1.226    1.00 31.91 ? 110 ASP A CG    1 
ATOM   768   O OD1   . ASP A 1 110 ? 11.984  -31.330 1.373    1.00 33.40 ? 110 ASP A OD1   1 
ATOM   769   O OD2   . ASP A 1 110 ? 13.887  -30.280 1.649    1.00 34.83 ? 110 ASP A OD2   1 
ATOM   770   N N     . LEU A 1 111 ? 11.815  -31.805 -1.790   1.00 26.61 ? 111 LEU A N     1 
ATOM   771   C CA    . LEU A 1 111 ? 11.172  -31.248 -3.008   1.00 25.69 ? 111 LEU A CA    1 
ATOM   772   C C     . LEU A 1 111 ? 10.604  -29.871 -2.673   1.00 24.31 ? 111 LEU A C     1 
ATOM   773   O O     . LEU A 1 111 ? 9.849   -29.743 -1.725   1.00 21.23 ? 111 LEU A O     1 
ATOM   774   C CB    . LEU A 1 111 ? 10.041  -32.152 -3.544   1.00 25.30 ? 111 LEU A CB    1 
ATOM   775   C CG    . LEU A 1 111 ? 9.287   -31.851 -4.897   1.00 26.43 ? 111 LEU A CG    1 
ATOM   776   C CD1   . LEU A 1 111 ? 10.033  -32.177 -6.203   1.00 30.68 ? 111 LEU A CD1   1 
ATOM   777   C CD2   . LEU A 1 111 ? 7.960   -32.548 -5.051   1.00 25.74 ? 111 LEU A CD2   1 
ATOM   778   N N     . CYS A 1 112 ? 10.945  -28.848 -3.459   1.00 24.85 ? 112 CYS A N     1 
ATOM   779   C CA    . CYS A 1 112 ? 10.171  -27.613 -3.428   1.00 27.52 ? 112 CYS A CA    1 
ATOM   780   C C     . CYS A 1 112 ? 9.570   -27.274 -4.762   1.00 26.31 ? 112 CYS A C     1 
ATOM   781   O O     . CYS A 1 112 ? 10.214  -27.478 -5.792   1.00 28.36 ? 112 CYS A O     1 
ATOM   782   C CB    . CYS A 1 112 ? 10.961  -26.417 -2.920   1.00 27.99 ? 112 CYS A CB    1 
ATOM   783   S SG    . CYS A 1 112 ? 12.464  -26.115 -3.807   1.00 39.53 ? 112 CYS A SG    1 
ATOM   784   N N     . VAL A 1 113 ? 8.346   -26.719 -4.750   1.00 25.68 ? 113 VAL A N     1 
ATOM   785   C CA    . VAL A 1 113 ? 7.752   -26.161 -5.986   1.00 23.58 ? 113 VAL A CA    1 
ATOM   786   C C     . VAL A 1 113 ? 8.614   -24.936 -6.356   1.00 25.06 ? 113 VAL A C     1 
ATOM   787   O O     . VAL A 1 113 ? 9.003   -24.163 -5.461   1.00 25.58 ? 113 VAL A O     1 
ATOM   788   C CB    . VAL A 1 113 ? 6.289   -25.772 -5.770   1.00 23.28 ? 113 VAL A CB    1 
ATOM   789   C CG1   . VAL A 1 113 ? 5.727   -25.001 -6.930   1.00 18.90 ? 113 VAL A CG1   1 
ATOM   790   C CG2   . VAL A 1 113 ? 5.441   -27.039 -5.428   1.00 19.67 ? 113 VAL A CG2   1 
ATOM   791   N N     . THR A 1 114 ? 8.980   -24.794 -7.629   1.00 24.11 ? 114 THR A N     1 
ATOM   792   C CA    . THR A 1 114 ? 9.716   -23.624 -8.030   1.00 26.16 ? 114 THR A CA    1 
ATOM   793   C C     . THR A 1 114 ? 9.038   -22.874 -9.174   1.00 27.75 ? 114 THR A C     1 
ATOM   794   O O     . THR A 1 114 ? 8.099   -23.374 -9.812   1.00 27.84 ? 114 THR A O     1 
ATOM   795   C CB    . THR A 1 114 ? 11.225  -23.927 -8.427   1.00 26.84 ? 114 THR A CB    1 
ATOM   796   O OG1   . THR A 1 114 ? 11.234  -24.850 -9.514   1.00 26.16 ? 114 THR A OG1   1 
ATOM   797   C CG2   . THR A 1 114 ? 12.046  -24.481 -7.201   1.00 24.25 ? 114 THR A CG2   1 
ATOM   798   N N     . SER A 1 115 ? 9.519   -21.650 -9.401   1.00 28.43 ? 115 SER A N     1 
ATOM   799   C CA    . SER A 1 115 ? 8.922   -20.784 -10.385  1.00 29.06 ? 115 SER A CA    1 
ATOM   800   C C     . SER A 1 115 ? 9.293   -21.260 -11.784  1.00 29.70 ? 115 SER A C     1 
ATOM   801   O O     . SER A 1 115 ? 9.997   -20.589 -12.485  1.00 31.49 ? 115 SER A O     1 
ATOM   802   C CB    . SER A 1 115 ? 9.351   -19.339 -10.113  1.00 27.70 ? 115 SER A CB    1 
ATOM   803   O OG    . SER A 1 115 ? 8.505   -18.791 -9.125   1.00 26.17 ? 115 SER A OG    1 
ATOM   804   N N     . GLY A 1 116 ? 8.864   -22.448 -12.165  1.00 30.31 ? 116 GLY A N     1 
ATOM   805   C CA    . GLY A 1 116 ? 9.409   -23.078 -13.380  1.00 32.12 ? 116 GLY A CA    1 
ATOM   806   C C     . GLY A 1 116 ? 10.725  -23.803 -13.050  1.00 33.68 ? 116 GLY A C     1 
ATOM   807   O O     . GLY A 1 116 ? 11.450  -23.403 -12.138  1.00 33.26 ? 116 GLY A O     1 
ATOM   808   N N     . SER A 1 117 ? 11.055  -24.846 -13.812  1.00 34.56 ? 117 SER A N     1 
ATOM   809   C CA    . SER A 1 117 ? 12.098  -25.773 -13.411  1.00 35.09 ? 117 SER A CA    1 
ATOM   810   C C     . SER A 1 117 ? 13.464  -25.096 -13.470  1.00 34.80 ? 117 SER A C     1 
ATOM   811   O O     . SER A 1 117 ? 14.331  -25.359 -12.651  1.00 34.80 ? 117 SER A O     1 
ATOM   812   C CB    . SER A 1 117 ? 12.041  -27.059 -14.229  1.00 34.36 ? 117 SER A CB    1 
ATOM   813   O OG    . SER A 1 117 ? 12.715  -26.897 -15.473  1.00 39.33 ? 117 SER A OG    1 
ATOM   814   N N     . GLN A 1 118 ? 13.635  -24.167 -14.391  1.00 34.61 ? 118 GLN A N     1 
ATOM   815   C CA    . GLN A 1 118 ? 14.931  -23.469 -14.481  1.00 34.53 ? 118 GLN A CA    1 
ATOM   816   C C     . GLN A 1 118 ? 15.261  -22.514 -13.324  1.00 33.93 ? 118 GLN A C     1 
ATOM   817   O O     . GLN A 1 118 ? 16.417  -22.070 -13.192  1.00 33.65 ? 118 GLN A O     1 
ATOM   818   C CB    . GLN A 1 118 ? 15.085  -22.764 -15.826  1.00 34.68 ? 118 GLN A CB    1 
ATOM   819   C CG    . GLN A 1 118 ? 15.314  -23.718 -16.967  1.00 36.91 ? 118 GLN A CG    1 
ATOM   820   C CD    . GLN A 1 118 ? 15.537  -22.986 -18.279  1.00 42.89 ? 118 GLN A CD    1 
ATOM   821   O OE1   . GLN A 1 118 ? 16.459  -22.168 -18.397  1.00 44.49 ? 118 GLN A OE1   1 
ATOM   822   N NE2   . GLN A 1 118 ? 14.672  -23.256 -19.276  1.00 45.10 ? 118 GLN A NE2   1 
ATOM   823   N N     . GLN A 1 119 ? 14.268  -22.208 -12.483  1.00 33.01 ? 119 GLN A N     1 
ATOM   824   C CA    . GLN A 1 119 ? 14.537  -21.472 -11.265  1.00 32.34 ? 119 GLN A CA    1 
ATOM   825   C C     . GLN A 1 119 ? 15.345  -22.378 -10.375  1.00 33.30 ? 119 GLN A C     1 
ATOM   826   O O     . GLN A 1 119 ? 16.432  -21.997 -9.954   1.00 34.18 ? 119 GLN A O     1 
ATOM   827   C CB    . GLN A 1 119 ? 13.286  -21.001 -10.527  1.00 31.65 ? 119 GLN A CB    1 
ATOM   828   C CG    . GLN A 1 119 ? 13.540  -19.780 -9.622   1.00 29.15 ? 119 GLN A CG    1 
ATOM   829   C CD    . GLN A 1 119 ? 12.591  -19.709 -8.429   1.00 28.74 ? 119 GLN A CD    1 
ATOM   830   O OE1   . GLN A 1 119 ? 11.929  -20.703 -8.075   1.00 26.84 ? 119 GLN A OE1   1 
ATOM   831   N NE2   . GLN A 1 119 ? 12.502  -18.521 -7.814   1.00 23.96 ? 119 GLN A NE2   1 
ATOM   832   N N     . GLY A 1 120 ? 14.845  -23.589 -10.124  1.00 32.77 ? 120 GLY A N     1 
ATOM   833   C CA    . GLY A 1 120 ? 15.554  -24.509 -9.275   1.00 32.59 ? 120 GLY A CA    1 
ATOM   834   C C     . GLY A 1 120 ? 16.977  -24.762 -9.745   1.00 33.61 ? 120 GLY A C     1 
ATOM   835   O O     . GLY A 1 120 ? 17.924  -24.797 -8.920   1.00 33.40 ? 120 GLY A O     1 
ATOM   836   N N     . LEU A 1 121 ? 17.137  -24.912 -11.068  1.00 33.12 ? 121 LEU A N     1 
ATOM   837   C CA    . LEU A 1 121 ? 18.393  -25.377 -11.658  1.00 33.31 ? 121 LEU A CA    1 
ATOM   838   C C     . LEU A 1 121 ? 19.491  -24.299 -11.653  1.00 33.43 ? 121 LEU A C     1 
ATOM   839   O O     . LEU A 1 121 ? 20.693  -24.584 -11.469  1.00 32.93 ? 121 LEU A O     1 
ATOM   840   C CB    . LEU A 1 121 ? 18.120  -25.940 -13.070  1.00 34.07 ? 121 LEU A CB    1 
ATOM   841   C CG    . LEU A 1 121 ? 19.272  -26.498 -13.912  1.00 32.88 ? 121 LEU A CG    1 
ATOM   842   C CD1   . LEU A 1 121 ? 18.913  -27.781 -14.610  1.00 35.29 ? 121 LEU A CD1   1 
ATOM   843   C CD2   . LEU A 1 121 ? 19.679  -25.465 -14.911  1.00 36.26 ? 121 LEU A CD2   1 
ATOM   844   N N     . CYS A 1 122 ? 19.059  -23.053 -11.856  1.00 33.45 ? 122 CYS A N     1 
ATOM   845   C CA    . CYS A 1 122 ? 19.903  -21.886 -11.611  1.00 32.41 ? 122 CYS A CA    1 
ATOM   846   C C     . CYS A 1 122 ? 20.325  -21.815 -10.127  1.00 32.55 ? 122 CYS A C     1 
ATOM   847   O O     . CYS A 1 122 ? 21.533  -21.715 -9.830   1.00 32.41 ? 122 CYS A O     1 
ATOM   848   C CB    . CYS A 1 122 ? 19.150  -20.647 -12.008  1.00 31.91 ? 122 CYS A CB    1 
ATOM   849   S SG    . CYS A 1 122 ? 20.102  -19.138 -12.176  1.00 32.54 ? 122 CYS A SG    1 
ATOM   850   N N     . LYS A 1 123 ? 19.350  -21.894 -9.204   1.00 31.28 ? 123 LYS A N     1 
ATOM   851   C CA    . LYS A 1 123 ? 19.654  -21.711 -7.771   1.00 30.39 ? 123 LYS A CA    1 
ATOM   852   C C     . LYS A 1 123 ? 20.640  -22.799 -7.312   1.00 30.38 ? 123 LYS A C     1 
ATOM   853   O O     . LYS A 1 123 ? 21.423  -22.603 -6.387   1.00 29.25 ? 123 LYS A O     1 
ATOM   854   C CB    . LYS A 1 123 ? 18.393  -21.741 -6.919   1.00 29.51 ? 123 LYS A CB    1 
ATOM   855   C CG    . LYS A 1 123 ? 17.838  -20.363 -6.449   1.00 28.78 ? 123 LYS A CG    1 
ATOM   856   C CD    . LYS A 1 123 ? 16.706  -19.789 -7.355   1.00 31.14 ? 123 LYS A CD    1 
ATOM   857   C CE    . LYS A 1 123 ? 15.965  -18.595 -6.687   1.00 29.98 ? 123 LYS A CE    1 
ATOM   858   N NZ    . LYS A 1 123 ? 16.778  -17.325 -6.644   1.00 30.03 ? 123 LYS A NZ    1 
ATOM   859   N N     . VAL A 1 124 ? 20.587  -23.927 -8.023   1.00 29.96 ? 124 VAL A N     1 
ATOM   860   C CA    . VAL A 1 124 ? 21.462  -25.019 -7.830   1.00 30.24 ? 124 VAL A CA    1 
ATOM   861   C C     . VAL A 1 124 ? 22.909  -24.808 -8.369   1.00 30.97 ? 124 VAL A C     1 
ATOM   862   O O     . VAL A 1 124 ? 23.883  -25.314 -7.764   1.00 31.22 ? 124 VAL A O     1 
ATOM   863   C CB    . VAL A 1 124 ? 20.856  -26.263 -8.392   1.00 29.80 ? 124 VAL A CB    1 
ATOM   864   C CG1   . VAL A 1 124 ? 21.933  -27.295 -8.601   1.00 29.19 ? 124 VAL A CG1   1 
ATOM   865   C CG2   . VAL A 1 124 ? 19.801  -26.758 -7.429   1.00 30.65 ? 124 VAL A CG2   1 
ATOM   866   N N     . PHE A 1 125 ? 23.073  -24.077 -9.465   1.00 30.91 ? 125 PHE A N     1 
ATOM   867   C CA    . PHE A 1 125 ? 24.435  -23.801 -9.924   1.00 31.23 ? 125 PHE A CA    1 
ATOM   868   C C     . PHE A 1 125 ? 25.054  -22.767 -9.022   1.00 31.72 ? 125 PHE A C     1 
ATOM   869   O O     . PHE A 1 125 ? 26.280  -22.814 -8.764   1.00 32.99 ? 125 PHE A O     1 
ATOM   870   C CB    . PHE A 1 125 ? 24.537  -23.335 -11.403  1.00 30.65 ? 125 PHE A CB    1 
ATOM   871   C CG    . PHE A 1 125 ? 24.026  -24.340 -12.409  1.00 29.38 ? 125 PHE A CG    1 
ATOM   872   C CD1   . PHE A 1 125 ? 23.369  -23.918 -13.539  1.00 25.76 ? 125 PHE A CD1   1 
ATOM   873   C CD2   . PHE A 1 125 ? 24.213  -25.705 -12.219  1.00 30.44 ? 125 PHE A CD2   1 
ATOM   874   C CE1   . PHE A 1 125 ? 22.860  -24.833 -14.464  1.00 29.12 ? 125 PHE A CE1   1 
ATOM   875   C CE2   . PHE A 1 125 ? 23.727  -26.637 -13.163  1.00 32.57 ? 125 PHE A CE2   1 
ATOM   876   C CZ    . PHE A 1 125 ? 23.037  -26.181 -14.292  1.00 30.02 ? 125 PHE A CZ    1 
ATOM   877   N N     . GLU A 1 126 ? 24.226  -21.819 -8.565   1.00 30.99 ? 126 GLU A N     1 
ATOM   878   C CA    . GLU A 1 126 ? 24.735  -20.724 -7.746   1.00 30.13 ? 126 GLU A CA    1 
ATOM   879   C C     . GLU A 1 126 ? 25.175  -21.264 -6.415   1.00 29.72 ? 126 GLU A C     1 
ATOM   880   O O     . GLU A 1 126 ? 26.143  -20.772 -5.823   1.00 30.04 ? 126 GLU A O     1 
ATOM   881   C CB    . GLU A 1 126 ? 23.757  -19.562 -7.627   1.00 29.13 ? 126 GLU A CB    1 
ATOM   882   C CG    . GLU A 1 126 ? 23.502  -18.895 -9.006   1.00 29.32 ? 126 GLU A CG    1 
ATOM   883   C CD    . GLU A 1 126 ? 22.277  -17.978 -9.078   1.00 29.45 ? 126 GLU A CD    1 
ATOM   884   O OE1   . GLU A 1 126 ? 22.254  -17.056 -9.908   1.00 27.78 ? 126 GLU A OE1   1 
ATOM   885   O OE2   . GLU A 1 126 ? 21.332  -18.138 -8.295   1.00 30.61 ? 126 GLU A OE2   1 
ATOM   886   N N     . MET A 1 127 ? 24.498  -22.317 -5.979   1.00 29.51 ? 127 MET A N     1 
ATOM   887   C CA    . MET A 1 127 ? 24.780  -22.963 -4.708   1.00 29.07 ? 127 MET A CA    1 
ATOM   888   C C     . MET A 1 127 ? 26.129  -23.737 -4.762   1.00 29.99 ? 127 MET A C     1 
ATOM   889   O O     . MET A 1 127 ? 26.909  -23.747 -3.801   1.00 29.14 ? 127 MET A O     1 
ATOM   890   C CB    . MET A 1 127 ? 23.627  -23.899 -4.382   1.00 28.99 ? 127 MET A CB    1 
ATOM   891   C CG    . MET A 1 127 ? 23.795  -24.695 -3.126   1.00 27.84 ? 127 MET A CG    1 
ATOM   892   S SD    . MET A 1 127 ? 22.638  -26.056 -2.957   1.00 28.92 ? 127 MET A SD    1 
ATOM   893   C CE    . MET A 1 127 ? 22.938  -27.259 -4.249   1.00 24.79 ? 127 MET A CE    1 
ATOM   894   N N     . ILE A 1 128 ? 26.412  -24.341 -5.920   1.00 30.39 ? 128 ILE A N     1 
ATOM   895   C CA    . ILE A 1 128 ? 27.520  -25.290 -6.058   1.00 29.53 ? 128 ILE A CA    1 
ATOM   896   C C     . ILE A 1 128 ? 28.841  -24.663 -6.509   1.00 31.32 ? 128 ILE A C     1 
ATOM   897   O O     . ILE A 1 128 ? 29.899  -24.995 -5.960   1.00 31.94 ? 128 ILE A O     1 
ATOM   898   C CB    . ILE A 1 128 ? 27.140  -26.405 -7.019   1.00 28.44 ? 128 ILE A CB    1 
ATOM   899   C CG1   . ILE A 1 128 ? 25.968  -27.207 -6.464   1.00 22.13 ? 128 ILE A CG1   1 
ATOM   900   C CG2   . ILE A 1 128 ? 28.358  -27.274 -7.362   1.00 26.53 ? 128 ILE A CG2   1 
ATOM   901   C CD1   . ILE A 1 128 ? 25.343  -28.098 -7.482   1.00 16.01 ? 128 ILE A CD1   1 
ATOM   902   N N     . ILE A 1 129 ? 28.756  -23.735 -7.461   1.00 32.20 ? 129 ILE A N     1 
ATOM   903   C CA    . ILE A 1 129 ? 29.884  -23.356 -8.291   1.00 32.74 ? 129 ILE A CA    1 
ATOM   904   C C     . ILE A 1 129 ? 30.665  -22.159 -7.791   1.00 33.48 ? 129 ILE A C     1 
ATOM   905   O O     . ILE A 1 129 ? 30.171  -21.039 -7.791   1.00 31.25 ? 129 ILE A O     1 
ATOM   906   C CB    . ILE A 1 129 ? 29.470  -23.084 -9.793   1.00 32.68 ? 129 ILE A CB    1 
ATOM   907   C CG1   . ILE A 1 129 ? 28.885  -24.326 -10.462  1.00 32.33 ? 129 ILE A CG1   1 
ATOM   908   C CG2   . ILE A 1 129 ? 30.673  -22.572 -10.609  1.00 32.54 ? 129 ILE A CG2   1 
ATOM   909   C CD1   . ILE A 1 129 ? 28.099  -24.078 -11.806  1.00 33.09 ? 129 ILE A CD1   1 
ATOM   910   N N     . ASN A 1 130 ? 31.925  -22.432 -7.416   1.00 35.15 ? 130 ASN A N     1 
ATOM   911   C CA    . ASN A 1 130 ? 32.977  -21.417 -7.213   1.00 35.13 ? 130 ASN A CA    1 
ATOM   912   C C     . ASN A 1 130 ? 33.753  -21.182 -8.499   1.00 34.79 ? 130 ASN A C     1 
ATOM   913   O O     . ASN A 1 130 ? 33.905  -22.119 -9.292   1.00 34.85 ? 130 ASN A O     1 
ATOM   914   C CB    . ASN A 1 130 ? 33.929  -21.927 -6.146   1.00 35.62 ? 130 ASN A CB    1 
ATOM   915   C CG    . ASN A 1 130 ? 33.257  -22.071 -4.813   1.00 35.95 ? 130 ASN A CG    1 
ATOM   916   O OD1   . ASN A 1 130 ? 32.578  -21.145 -4.346   1.00 37.64 ? 130 ASN A OD1   1 
ATOM   917   N ND2   . ASN A 1 130 ? 33.383  -23.243 -4.215   1.00 36.05 ? 130 ASN A ND2   1 
ATOM   918   N N     . PRO A 1 131 ? 34.249  -19.946 -8.730   1.00 34.96 ? 131 PRO A N     1 
ATOM   919   C CA    . PRO A 1 131 ? 34.970  -19.786 -10.019  1.00 34.91 ? 131 PRO A CA    1 
ATOM   920   C C     . PRO A 1 131 ? 36.219  -20.655 -10.041  1.00 35.11 ? 131 PRO A C     1 
ATOM   921   O O     . PRO A 1 131 ? 36.938  -20.722 -9.051   1.00 34.24 ? 131 PRO A O     1 
ATOM   922   C CB    . PRO A 1 131 ? 35.322  -18.288 -10.066  1.00 35.08 ? 131 PRO A CB    1 
ATOM   923   C CG    . PRO A 1 131 ? 34.450  -17.642 -8.935   1.00 35.60 ? 131 PRO A CG    1 
ATOM   924   C CD    . PRO A 1 131 ? 34.257  -18.705 -7.923   1.00 34.31 ? 131 PRO A CD    1 
ATOM   925   N N     . GLY A 1 132 ? 36.434  -21.372 -11.141  1.00 36.04 ? 132 GLY A N     1 
ATOM   926   C CA    . GLY A 1 132 ? 37.536  -22.312 -11.210  1.00 36.67 ? 132 GLY A CA    1 
ATOM   927   C C     . GLY A 1 132 ? 37.105  -23.755 -11.136  1.00 37.08 ? 132 GLY A C     1 
ATOM   928   O O     . GLY A 1 132 ? 37.787  -24.643 -11.646  1.00 37.41 ? 132 GLY A O     1 
ATOM   929   N N     . ASP A 1 133 ? 35.955  -24.017 -10.533  1.00 37.70 ? 133 ASP A N     1 
ATOM   930   C CA    . ASP A 1 133 ? 35.501  -25.402 -10.434  1.00 37.57 ? 133 ASP A CA    1 
ATOM   931   C C     . ASP A 1 133 ? 35.324  -26.055 -11.796  1.00 37.70 ? 133 ASP A C     1 
ATOM   932   O O     . ASP A 1 133 ? 35.020  -25.398 -12.788  1.00 36.57 ? 133 ASP A O     1 
ATOM   933   C CB    . ASP A 1 133 ? 34.193  -25.492 -9.686   1.00 37.67 ? 133 ASP A CB    1 
ATOM   934   C CG    . ASP A 1 133 ? 34.328  -25.109 -8.271   1.00 38.31 ? 133 ASP A CG    1 
ATOM   935   O OD1   . ASP A 1 133 ? 35.479  -25.182 -7.769   1.00 36.18 ? 133 ASP A OD1   1 
ATOM   936   O OD2   . ASP A 1 133 ? 33.277  -24.748 -7.670   1.00 39.72 ? 133 ASP A OD2   1 
ATOM   937   N N     . ASN A 1 134 ? 35.480  -27.373 -11.792  1.00 38.09 ? 134 ASN A N     1 
ATOM   938   C CA    . ASN A 1 134 ? 35.365  -28.202 -12.964  1.00 38.52 ? 134 ASN A CA    1 
ATOM   939   C C     . ASN A 1 134 ? 34.013  -28.879 -13.012  1.00 38.69 ? 134 ASN A C     1 
ATOM   940   O O     . ASN A 1 134 ? 33.607  -29.466 -12.007  1.00 39.87 ? 134 ASN A O     1 
ATOM   941   C CB    . ASN A 1 134 ? 36.478  -29.262 -12.931  1.00 37.80 ? 134 ASN A CB    1 
ATOM   942   C CG    . ASN A 1 134 ? 37.828  -28.682 -13.287  1.00 39.17 ? 134 ASN A CG    1 
ATOM   943   O OD1   . ASN A 1 134 ? 37.941  -27.937 -14.272  1.00 35.44 ? 134 ASN A OD1   1 
ATOM   944   N ND2   . ASN A 1 134 ? 38.879  -29.015 -12.484  1.00 37.96 ? 134 ASN A ND2   1 
ATOM   945   N N     . VAL A 1 135 ? 33.325  -28.806 -14.159  1.00 37.90 ? 135 VAL A N     1 
ATOM   946   C CA    . VAL A 1 135 ? 31.983  -29.408 -14.301  1.00 37.68 ? 135 VAL A CA    1 
ATOM   947   C C     . VAL A 1 135 ? 31.771  -30.208 -15.602  1.00 36.93 ? 135 VAL A C     1 
ATOM   948   O O     . VAL A 1 135 ? 32.364  -29.935 -16.651  1.00 36.46 ? 135 VAL A O     1 
ATOM   949   C CB    . VAL A 1 135 ? 30.810  -28.360 -14.109  1.00 38.02 ? 135 VAL A CB    1 
ATOM   950   C CG1   . VAL A 1 135 ? 30.968  -27.585 -12.778  1.00 38.59 ? 135 VAL A CG1   1 
ATOM   951   C CG2   . VAL A 1 135 ? 30.694  -27.416 -15.313  1.00 39.01 ? 135 VAL A CG2   1 
ATOM   952   N N     . LEU A 1 136 ? 30.944  -31.226 -15.514  1.00 35.72 ? 136 LEU A N     1 
ATOM   953   C CA    . LEU A 1 136 ? 30.759  -32.091 -16.642  1.00 35.42 ? 136 LEU A CA    1 
ATOM   954   C C     . LEU A 1 136 ? 29.381  -31.876 -17.224  1.00 34.83 ? 136 LEU A C     1 
ATOM   955   O O     . LEU A 1 136 ? 28.404  -31.803 -16.504  1.00 34.62 ? 136 LEU A O     1 
ATOM   956   C CB    . LEU A 1 136 ? 30.998  -33.547 -16.252  1.00 34.58 ? 136 LEU A CB    1 
ATOM   957   C CG    . LEU A 1 136 ? 32.341  -33.859 -15.589  1.00 34.75 ? 136 LEU A CG    1 
ATOM   958   C CD1   . LEU A 1 136 ? 32.271  -35.082 -14.727  1.00 34.06 ? 136 LEU A CD1   1 
ATOM   959   C CD2   . LEU A 1 136 ? 33.461  -33.975 -16.583  1.00 30.22 ? 136 LEU A CD2   1 
ATOM   960   N N     . LEU A 1 137 ? 29.321  -31.745 -18.538  1.00 34.35 ? 137 LEU A N     1 
ATOM   961   C CA    . LEU A 1 137 ? 28.152  -32.146 -19.281  1.00 34.16 ? 137 LEU A CA    1 
ATOM   962   C C     . LEU A 1 137 ? 28.461  -32.556 -20.700  1.00 35.33 ? 137 LEU A C     1 
ATOM   963   O O     . LEU A 1 137 ? 29.613  -32.599 -21.097  1.00 35.51 ? 137 LEU A O     1 
ATOM   964   C CB    . LEU A 1 137 ? 27.073  -31.064 -19.236  1.00 33.84 ? 137 LEU A CB    1 
ATOM   965   C CG    . LEU A 1 137 ? 27.099  -29.745 -20.008  1.00 30.40 ? 137 LEU A CG    1 
ATOM   966   C CD1   . LEU A 1 137 ? 26.985  -28.549 -19.117  1.00 28.70 ? 137 LEU A CD1   1 
ATOM   967   C CD2   . LEU A 1 137 ? 28.232  -29.611 -20.964  1.00 25.52 ? 137 LEU A CD2   1 
ATOM   968   N N     . ASP A 1 138 ? 27.417  -32.863 -21.459  1.00 36.14 ? 138 ASP A N     1 
ATOM   969   C CA    . ASP A 1 138 ? 27.587  -33.409 -22.798  1.00 36.67 ? 138 ASP A CA    1 
ATOM   970   C C     . ASP A 1 138 ? 27.072  -32.444 -23.822  1.00 36.30 ? 138 ASP A C     1 
ATOM   971   O O     . ASP A 1 138 ? 25.935  -32.082 -23.788  1.00 37.66 ? 138 ASP A O     1 
ATOM   972   C CB    . ASP A 1 138 ? 26.901  -34.776 -22.930  1.00 36.95 ? 138 ASP A CB    1 
ATOM   973   C CG    . ASP A 1 138 ? 25.370  -34.720 -22.721  1.00 38.48 ? 138 ASP A CG    1 
ATOM   974   O OD1   . ASP A 1 138 ? 24.903  -34.226 -21.661  1.00 40.88 ? 138 ASP A OD1   1 
ATOM   975   O OD2   . ASP A 1 138 ? 24.633  -35.182 -23.627  1.00 39.30 ? 138 ASP A OD2   1 
ATOM   976   N N     . GLU A 1 139 ? 27.947  -32.019 -24.729  1.00 37.15 ? 139 GLU A N     1 
ATOM   977   C CA    . GLU A 1 139 ? 27.631  -31.113 -25.843  1.00 35.42 ? 139 GLU A CA    1 
ATOM   978   C C     . GLU A 1 139 ? 27.222  -31.930 -27.064  1.00 34.44 ? 139 GLU A C     1 
ATOM   979   O O     . GLU A 1 139 ? 27.856  -32.986 -27.303  1.00 33.89 ? 139 GLU A O     1 
ATOM   980   C CB    . GLU A 1 139 ? 28.853  -30.314 -26.209  1.00 35.73 ? 139 GLU A CB    1 
ATOM   981   C CG    . GLU A 1 139 ? 29.133  -29.170 -25.303  1.00 37.89 ? 139 GLU A CG    1 
ATOM   982   C CD    . GLU A 1 139 ? 30.377  -28.419 -25.758  1.00 41.62 ? 139 GLU A CD    1 
ATOM   983   O OE1   . GLU A 1 139 ? 30.462  -27.201 -25.530  1.00 41.35 ? 139 GLU A OE1   1 
ATOM   984   O OE2   . GLU A 1 139 ? 31.289  -29.065 -26.337  1.00 45.99 ? 139 GLU A OE2   1 
ATOM   985   N N     . PRO A 1 140 ? 26.173  -31.460 -27.832  1.00 32.73 ? 140 PRO A N     1 
ATOM   986   C CA    . PRO A 1 140 ? 25.509  -30.170 -27.609  1.00 32.09 ? 140 PRO A CA    1 
ATOM   987   C C     . PRO A 1 140 ? 24.661  -30.138 -26.330  1.00 32.77 ? 140 PRO A C     1 
ATOM   988   O O     . PRO A 1 140 ? 24.060  -31.162 -25.961  1.00 31.67 ? 140 PRO A O     1 
ATOM   989   C CB    . PRO A 1 140 ? 24.610  -30.016 -28.834  1.00 31.36 ? 140 PRO A CB    1 
ATOM   990   C CG    . PRO A 1 140 ? 24.992  -31.125 -29.755  1.00 30.86 ? 140 PRO A CG    1 
ATOM   991   C CD    . PRO A 1 140 ? 25.534  -32.194 -28.944  1.00 31.83 ? 140 PRO A CD    1 
ATOM   992   N N     . ALA A 1 141 ? 24.624  -28.967 -25.675  1.00 33.33 ? 141 ALA A N     1 
ATOM   993   C CA    . ALA A 1 141 ? 23.890  -28.770 -24.410  1.00 34.94 ? 141 ALA A CA    1 
ATOM   994   C C     . ALA A 1 141 ? 22.930  -27.597 -24.583  1.00 35.73 ? 141 ALA A C     1 
ATOM   995   O O     . ALA A 1 141 ? 23.162  -26.747 -25.474  1.00 36.09 ? 141 ALA A O     1 
ATOM   996   C CB    . ALA A 1 141 ? 24.865  -28.511 -23.241  1.00 34.32 ? 141 ALA A CB    1 
ATOM   997   N N     . TYR A 1 142 ? 21.850  -27.543 -23.798  1.00 35.83 ? 142 TYR A N     1 
ATOM   998   C CA    . TYR A 1 142 ? 20.862  -26.473 -24.010  1.00 36.17 ? 142 TYR A CA    1 
ATOM   999   C C     . TYR A 1 142 ? 21.500  -25.087 -23.802  1.00 36.89 ? 142 TYR A C     1 
ATOM   1000  O O     . TYR A 1 142 ? 22.105  -24.806 -22.748  1.00 37.20 ? 142 TYR A O     1 
ATOM   1001  C CB    . TYR A 1 142 ? 19.597  -26.676 -23.161  1.00 36.72 ? 142 TYR A CB    1 
ATOM   1002  C CG    . TYR A 1 142 ? 18.650  -25.459 -22.985  1.00 36.57 ? 142 TYR A CG    1 
ATOM   1003  C CD1   . TYR A 1 142 ? 18.417  -24.914 -21.694  1.00 38.12 ? 142 TYR A CD1   1 
ATOM   1004  C CD2   . TYR A 1 142 ? 17.968  -24.895 -24.057  1.00 36.67 ? 142 TYR A CD2   1 
ATOM   1005  C CE1   . TYR A 1 142 ? 17.624  -23.841 -21.491  1.00 34.62 ? 142 TYR A CE1   1 
ATOM   1006  C CE2   . TYR A 1 142 ? 17.126  -23.794 -23.862  1.00 37.89 ? 142 TYR A CE2   1 
ATOM   1007  C CZ    . TYR A 1 142 ? 16.970  -23.280 -22.552  1.00 37.77 ? 142 TYR A CZ    1 
ATOM   1008  O OH    . TYR A 1 142 ? 16.148  -22.204 -22.292  1.00 39.83 ? 142 TYR A OH    1 
ATOM   1009  N N     . SER A 1 143 ? 21.380  -24.234 -24.814  1.00 36.07 ? 143 SER A N     1 
ATOM   1010  C CA    . SER A 1 143 ? 21.980  -22.899 -24.754  1.00 35.84 ? 143 SER A CA    1 
ATOM   1011  C C     . SER A 1 143 ? 21.726  -22.147 -23.434  1.00 34.94 ? 143 SER A C     1 
ATOM   1012  O O     . SER A 1 143 ? 22.563  -21.350 -22.984  1.00 33.46 ? 143 SER A O     1 
ATOM   1013  C CB    . SER A 1 143 ? 21.485  -22.073 -25.932  1.00 36.40 ? 143 SER A CB    1 
ATOM   1014  O OG    . SER A 1 143 ? 20.078  -21.930 -25.880  1.00 36.40 ? 143 SER A OG    1 
ATOM   1015  N N     . GLY A 1 144 ? 20.575  -22.425 -22.805  1.00 34.61 ? 144 GLY A N     1 
ATOM   1016  C CA    . GLY A 1 144 ? 20.177  -21.719 -21.582  1.00 33.46 ? 144 GLY A CA    1 
ATOM   1017  C C     . GLY A 1 144 ? 21.109  -22.066 -20.432  1.00 32.92 ? 144 GLY A C     1 
ATOM   1018  O O     . GLY A 1 144 ? 21.435  -21.235 -19.589  1.00 32.54 ? 144 GLY A O     1 
ATOM   1019  N N     . THR A 1 145 ? 21.480  -23.328 -20.392  1.00 32.81 ? 145 THR A N     1 
ATOM   1020  C CA    . THR A 1 145 ? 22.293  -23.891 -19.357  1.00 33.88 ? 145 THR A CA    1 
ATOM   1021  C C     . THR A 1 145 ? 23.715  -23.463 -19.603  1.00 33.18 ? 145 THR A C     1 
ATOM   1022  O O     . THR A 1 145 ? 24.385  -23.036 -18.670  1.00 34.14 ? 145 THR A O     1 
ATOM   1023  C CB    . THR A 1 145 ? 22.151  -25.403 -19.328  1.00 34.78 ? 145 THR A CB    1 
ATOM   1024  O OG1   . THR A 1 145 ? 20.772  -25.715 -19.093  1.00 38.32 ? 145 THR A OG1   1 
ATOM   1025  C CG2   . THR A 1 145 ? 23.003  -26.032 -18.251  1.00 34.31 ? 145 THR A CG2   1 
ATOM   1026  N N     . LEU A 1 146 ? 24.134  -23.466 -20.859  1.00 33.14 ? 146 LEU A N     1 
ATOM   1027  C CA    . LEU A 1 146 ? 25.402  -22.849 -21.249  1.00 33.28 ? 146 LEU A CA    1 
ATOM   1028  C C     . LEU A 1 146 ? 25.547  -21.437 -20.714  1.00 33.88 ? 146 LEU A C     1 
ATOM   1029  O O     . LEU A 1 146 ? 26.553  -21.108 -20.010  1.00 34.79 ? 146 LEU A O     1 
ATOM   1030  C CB    . LEU A 1 146 ? 25.682  -22.966 -22.760  1.00 32.10 ? 146 LEU A CB    1 
ATOM   1031  C CG    . LEU A 1 146 ? 25.794  -24.450 -23.150  1.00 29.48 ? 146 LEU A CG    1 
ATOM   1032  C CD1   . LEU A 1 146 ? 26.238  -24.737 -24.556  1.00 24.05 ? 146 LEU A CD1   1 
ATOM   1033  C CD2   . LEU A 1 146 ? 26.734  -25.171 -22.160  1.00 30.03 ? 146 LEU A CD2   1 
ATOM   1034  N N     . GLN A 1 147 ? 24.527  -20.632 -20.965  1.00 33.93 ? 147 GLN A N     1 
ATOM   1035  C CA    . GLN A 1 147 ? 24.598  -19.192 -20.632  1.00 34.23 ? 147 GLN A CA    1 
ATOM   1036  C C     . GLN A 1 147 ? 24.431  -18.899 -19.141  1.00 33.73 ? 147 GLN A C     1 
ATOM   1037  O O     . GLN A 1 147 ? 24.840  -17.819 -18.676  1.00 33.74 ? 147 GLN A O     1 
ATOM   1038  C CB    . GLN A 1 147 ? 23.599  -18.383 -21.469  1.00 33.20 ? 147 GLN A CB    1 
ATOM   1039  C CG    . GLN A 1 147 ? 23.947  -18.390 -22.968  1.00 39.04 ? 147 GLN A CG    1 
ATOM   1040  C CD    . GLN A 1 147 ? 25.140  -17.438 -23.379  1.00 44.38 ? 147 GLN A CD    1 
ATOM   1041  O OE1   . GLN A 1 147 ? 25.616  -16.567 -22.615  1.00 44.39 ? 147 GLN A OE1   1 
ATOM   1042  N NE2   . GLN A 1 147 ? 25.583  -17.605 -24.612  1.00 46.83 ? 147 GLN A NE2   1 
ATOM   1043  N N     . SER A 1 148 ? 23.809  -19.843 -18.419  1.00 33.00 ? 148 SER A N     1 
ATOM   1044  C CA    . SER A 1 148 ? 23.698  -19.777 -16.985  1.00 33.18 ? 148 SER A CA    1 
ATOM   1045  C C     . SER A 1 148 ? 25.033  -20.066 -16.324  1.00 33.09 ? 148 SER A C     1 
ATOM   1046  O O     . SER A 1 148 ? 25.400  -19.433 -15.364  1.00 32.73 ? 148 SER A O     1 
ATOM   1047  C CB    . SER A 1 148 ? 22.709  -20.804 -16.492  1.00 33.98 ? 148 SER A CB    1 
ATOM   1048  O OG    . SER A 1 148 ? 22.187  -20.396 -15.227  1.00 36.61 ? 148 SER A OG    1 
ATOM   1049  N N     . LEU A 1 149 ? 25.750  -21.045 -16.859  1.00 33.67 ? 149 LEU A N     1 
ATOM   1050  C CA    . LEU A 1 149 ? 26.940  -21.577 -16.240  1.00 33.74 ? 149 LEU A CA    1 
ATOM   1051  C C     . LEU A 1 149 ? 28.096  -20.647 -16.559  1.00 33.74 ? 149 LEU A C     1 
ATOM   1052  O O     . LEU A 1 149 ? 29.075  -20.545 -15.810  1.00 32.53 ? 149 LEU A O     1 
ATOM   1053  C CB    . LEU A 1 149 ? 27.207  -22.976 -16.796  1.00 33.81 ? 149 LEU A CB    1 
ATOM   1054  C CG    . LEU A 1 149 ? 26.363  -24.087 -16.175  1.00 34.90 ? 149 LEU A CG    1 
ATOM   1055  C CD1   . LEU A 1 149 ? 26.724  -25.417 -16.746  1.00 35.88 ? 149 LEU A CD1   1 
ATOM   1056  C CD2   . LEU A 1 149 ? 26.614  -24.103 -14.709  1.00 37.05 ? 149 LEU A CD2   1 
ATOM   1057  N N     . HIS A 1 150 ? 27.942  -19.950 -17.676  1.00 33.90 ? 150 HIS A N     1 
ATOM   1058  C CA    . HIS A 1 150 ? 29.078  -19.280 -18.251  1.00 34.59 ? 150 HIS A CA    1 
ATOM   1059  C C     . HIS A 1 150 ? 29.612  -18.221 -17.310  1.00 33.66 ? 150 HIS A C     1 
ATOM   1060  O O     . HIS A 1 150 ? 30.788  -18.178 -17.098  1.00 33.52 ? 150 HIS A O     1 
ATOM   1061  C CB    . HIS A 1 150 ? 28.767  -18.687 -19.613  1.00 35.07 ? 150 HIS A CB    1 
ATOM   1062  C CG    . HIS A 1 150 ? 29.804  -17.712 -20.062  1.00 39.91 ? 150 HIS A CG    1 
ATOM   1063  N ND1   . HIS A 1 150 ? 29.544  -16.363 -20.218  1.00 42.64 ? 150 HIS A ND1   1 
ATOM   1064  C CD2   . HIS A 1 150 ? 31.120  -17.883 -20.342  1.00 38.70 ? 150 HIS A CD2   1 
ATOM   1065  C CE1   . HIS A 1 150 ? 30.653  -15.751 -20.599  1.00 41.28 ? 150 HIS A CE1   1 
ATOM   1066  N NE2   . HIS A 1 150 ? 31.624  -16.647 -20.662  1.00 40.23 ? 150 HIS A NE2   1 
ATOM   1067  N N     . PRO A 1 151 ? 28.728  -17.359 -16.744  1.00 33.51 ? 151 PRO A N     1 
ATOM   1068  C CA    . PRO A 1 151 ? 29.200  -16.345 -15.798  1.00 32.12 ? 151 PRO A CA    1 
ATOM   1069  C C     . PRO A 1 151 ? 29.592  -16.859 -14.440  1.00 31.22 ? 151 PRO A C     1 
ATOM   1070  O O     . PRO A 1 151 ? 30.143  -16.110 -13.660  1.00 30.95 ? 151 PRO A O     1 
ATOM   1071  C CB    . PRO A 1 151 ? 27.999  -15.403 -15.656  1.00 31.62 ? 151 PRO A CB    1 
ATOM   1072  C CG    . PRO A 1 151 ? 26.798  -16.266 -15.996  1.00 32.92 ? 151 PRO A CG    1 
ATOM   1073  C CD    . PRO A 1 151 ? 27.275  -17.216 -17.034  1.00 33.06 ? 151 PRO A CD    1 
ATOM   1074  N N     . LEU A 1 152 ? 29.290  -18.113 -14.141  1.00 31.21 ? 152 LEU A N     1 
ATOM   1075  C CA    . LEU A 1 152 ? 29.669  -18.674 -12.869  1.00 30.69 ? 152 LEU A CA    1 
ATOM   1076  C C     . LEU A 1 152 ? 31.170  -19.049 -12.816  1.00 32.08 ? 152 LEU A C     1 
ATOM   1077  O O     . LEU A 1 152 ? 31.699  -19.313 -11.734  1.00 31.83 ? 152 LEU A O     1 
ATOM   1078  C CB    . LEU A 1 152 ? 28.791  -19.872 -12.548  1.00 30.54 ? 152 LEU A CB    1 
ATOM   1079  C CG    . LEU A 1 152 ? 27.474  -19.682 -11.749  1.00 32.68 ? 152 LEU A CG    1 
ATOM   1080  C CD1   . LEU A 1 152 ? 27.685  -19.187 -10.290  1.00 34.07 ? 152 LEU A CD1   1 
ATOM   1081  C CD2   . LEU A 1 152 ? 26.479  -18.779 -12.430  1.00 30.23 ? 152 LEU A CD2   1 
ATOM   1082  N N     . GLY A 1 153 ? 31.824  -19.065 -13.974  1.00 32.09 ? 153 GLY A N     1 
ATOM   1083  C CA    . GLY A 1 153 ? 33.269  -19.184 -14.031  1.00 34.41 ? 153 GLY A CA    1 
ATOM   1084  C C     . GLY A 1 153 ? 33.750  -20.583 -13.700  1.00 35.26 ? 153 GLY A C     1 
ATOM   1085  O O     . GLY A 1 153 ? 34.800  -20.758 -13.082  1.00 36.12 ? 153 GLY A O     1 
ATOM   1086  N N     . CYS A 1 154 ? 32.977  -21.582 -14.112  1.00 36.15 ? 154 CYS A N     1 
ATOM   1087  C CA    . CYS A 1 154 ? 33.430  -22.967 -14.075  1.00 36.08 ? 154 CYS A CA    1 
ATOM   1088  C C     . CYS A 1 154 ? 34.207  -23.327 -15.337  1.00 36.62 ? 154 CYS A C     1 
ATOM   1089  O O     . CYS A 1 154 ? 33.967  -22.766 -16.407  1.00 37.09 ? 154 CYS A O     1 
ATOM   1090  C CB    . CYS A 1 154 ? 32.243  -23.915 -13.900  1.00 36.08 ? 154 CYS A CB    1 
ATOM   1091  S SG    . CYS A 1 154 ? 30.762  -23.436 -14.819  1.00 38.65 ? 154 CYS A SG    1 
ATOM   1092  N N     . ASN A 1 155 ? 35.138  -24.266 -15.206  1.00 36.55 ? 155 ASN A N     1 
ATOM   1093  C CA    . ASN A 1 155 ? 35.626  -25.027 -16.350  1.00 36.49 ? 155 ASN A CA    1 
ATOM   1094  C C     . ASN A 1 155 ? 34.635  -26.096 -16.797  1.00 34.97 ? 155 ASN A C     1 
ATOM   1095  O O     . ASN A 1 155 ? 34.452  -27.108 -16.121  1.00 35.68 ? 155 ASN A O     1 
ATOM   1096  C CB    . ASN A 1 155 ? 36.980  -25.665 -16.031  1.00 37.09 ? 155 ASN A CB    1 
ATOM   1097  C CG    . ASN A 1 155 ? 38.069  -24.636 -15.798  1.00 40.39 ? 155 ASN A CG    1 
ATOM   1098  O OD1   . ASN A 1 155 ? 38.324  -23.783 -16.648  1.00 39.89 ? 155 ASN A OD1   1 
ATOM   1099  N ND2   . ASN A 1 155 ? 38.718  -24.712 -14.642  1.00 45.71 ? 155 ASN A ND2   1 
ATOM   1100  N N     . ILE A 1 156 ? 33.998  -25.862 -17.940  1.00 34.13 ? 156 ILE A N     1 
ATOM   1101  C CA    . ILE A 1 156 ? 33.136  -26.876 -18.567  1.00 33.33 ? 156 ILE A CA    1 
ATOM   1102  C C     . ILE A 1 156 ? 33.952  -27.954 -19.269  1.00 31.96 ? 156 ILE A C     1 
ATOM   1103  O O     . ILE A 1 156 ? 34.766  -27.667 -20.104  1.00 32.07 ? 156 ILE A O     1 
ATOM   1104  C CB    . ILE A 1 156 ? 31.998  -26.269 -19.494  1.00 32.16 ? 156 ILE A CB    1 
ATOM   1105  C CG1   . ILE A 1 156 ? 31.123  -25.319 -18.669  1.00 33.62 ? 156 ILE A CG1   1 
ATOM   1106  C CG2   . ILE A 1 156 ? 31.115  -27.375 -19.974  1.00 32.98 ? 156 ILE A CG2   1 
ATOM   1107  C CD1   . ILE A 1 156 ? 30.302  -24.326 -19.406  1.00 29.07 ? 156 ILE A CD1   1 
ATOM   1108  N N     . ILE A 1 157 ? 33.743  -29.197 -18.896  1.00 32.43 ? 157 ILE A N     1 
ATOM   1109  C CA    . ILE A 1 157 ? 34.469  -30.292 -19.529  1.00 33.09 ? 157 ILE A CA    1 
ATOM   1110  C C     . ILE A 1 157 ? 33.480  -31.156 -20.239  1.00 33.46 ? 157 ILE A C     1 
ATOM   1111  O O     . ILE A 1 157 ? 32.595  -31.766 -19.618  1.00 34.06 ? 157 ILE A O     1 
ATOM   1112  C CB    . ILE A 1 157 ? 35.329  -31.151 -18.554  1.00 31.83 ? 157 ILE A CB    1 
ATOM   1113  C CG1   . ILE A 1 157 ? 36.405  -30.298 -17.886  1.00 31.65 ? 157 ILE A CG1   1 
ATOM   1114  C CG2   . ILE A 1 157 ? 35.992  -32.303 -19.321  1.00 31.52 ? 157 ILE A CG2   1 
ATOM   1115  C CD1   . ILE A 1 157 ? 36.975  -30.920 -16.582  1.00 32.79 ? 157 ILE A CD1   1 
ATOM   1116  N N     . ASN A 1 158 ? 33.688  -31.229 -21.546  1.00 34.01 ? 158 ASN A N     1 
ATOM   1117  C CA    . ASN A 1 158 ? 32.758  -31.839 -22.447  1.00 34.26 ? 158 ASN A CA    1 
ATOM   1118  C C     . ASN A 1 158 ? 32.922  -33.341 -22.438  1.00 34.19 ? 158 ASN A C     1 
ATOM   1119  O O     . ASN A 1 158 ? 34.035  -33.837 -22.487  1.00 35.63 ? 158 ASN A O     1 
ATOM   1120  C CB    . ASN A 1 158 ? 32.957  -31.256 -23.850  1.00 34.70 ? 158 ASN A CB    1 
ATOM   1121  C CG    . ASN A 1 158 ? 31.994  -31.842 -24.854  1.00 36.51 ? 158 ASN A CG    1 
ATOM   1122  O OD1   . ASN A 1 158 ? 30.792  -31.916 -24.606  1.00 40.28 ? 158 ASN A OD1   1 
ATOM   1123  N ND2   . ASN A 1 158 ? 32.509  -32.272 -25.983  1.00 39.00 ? 158 ASN A ND2   1 
ATOM   1124  N N     . VAL A 1 159 ? 31.817  -34.065 -22.317  1.00 33.73 ? 159 VAL A N     1 
ATOM   1125  C CA    . VAL A 1 159 ? 31.814  -35.523 -22.320  1.00 32.60 ? 159 VAL A CA    1 
ATOM   1126  C C     . VAL A 1 159 ? 31.238  -35.931 -23.665  1.00 33.36 ? 159 VAL A C     1 
ATOM   1127  O O     . VAL A 1 159 ? 30.395  -35.240 -24.169  1.00 34.50 ? 159 VAL A O     1 
ATOM   1128  C CB    . VAL A 1 159 ? 31.033  -36.069 -21.093  1.00 31.95 ? 159 VAL A CB    1 
ATOM   1129  C CG1   . VAL A 1 159 ? 30.766  -37.565 -21.197  1.00 30.53 ? 159 VAL A CG1   1 
ATOM   1130  C CG2   . VAL A 1 159 ? 31.808  -35.753 -19.767  1.00 30.33 ? 159 VAL A CG2   1 
ATOM   1131  N N     . ALA A 1 160 ? 31.713  -37.008 -24.281  1.00 33.91 ? 160 ALA A N     1 
ATOM   1132  C CA    . ALA A 1 160 ? 31.241  -37.336 -25.620  1.00 35.29 ? 160 ALA A CA    1 
ATOM   1133  C C     . ALA A 1 160 ? 29.813  -37.867 -25.486  1.00 36.01 ? 160 ALA A C     1 
ATOM   1134  O O     . ALA A 1 160 ? 29.470  -38.466 -24.464  1.00 36.50 ? 160 ALA A O     1 
ATOM   1135  C CB    . ALA A 1 160 ? 32.154  -38.378 -26.289  1.00 34.49 ? 160 ALA A CB    1 
ATOM   1136  N N     . SER A 1 161 ? 28.982  -37.634 -26.498  1.00 36.57 ? 161 SER A N     1 
ATOM   1137  C CA    . SER A 1 161 ? 27.592  -38.139 -26.507  1.00 36.62 ? 161 SER A CA    1 
ATOM   1138  C C     . SER A 1 161 ? 27.369  -38.816 -27.842  1.00 37.11 ? 161 SER A C     1 
ATOM   1139  O O     . SER A 1 161 ? 28.213  -38.685 -28.732  1.00 37.59 ? 161 SER A O     1 
ATOM   1140  C CB    . SER A 1 161 ? 26.590  -36.986 -26.337  1.00 36.55 ? 161 SER A CB    1 
ATOM   1141  O OG    . SER A 1 161 ? 26.993  -35.843 -27.091  1.00 35.06 ? 161 SER A OG    1 
ATOM   1142  N N     . ASP A 1 162 ? 26.240  -39.506 -27.999  1.00 37.34 ? 162 ASP A N     1 
ATOM   1143  C CA    . ASP A 1 162 ? 25.907  -40.148 -29.260  1.00 37.70 ? 162 ASP A CA    1 
ATOM   1144  C C     . ASP A 1 162 ? 24.392  -40.414 -29.296  1.00 37.52 ? 162 ASP A C     1 
ATOM   1145  O O     . ASP A 1 162 ? 23.670  -39.791 -28.549  1.00 37.37 ? 162 ASP A O     1 
ATOM   1146  C CB    . ASP A 1 162 ? 26.737  -41.436 -29.440  1.00 38.14 ? 162 ASP A CB    1 
ATOM   1147  C CG    . ASP A 1 162 ? 26.235  -42.604 -28.592  1.00 42.61 ? 162 ASP A CG    1 
ATOM   1148  O OD1   . ASP A 1 162 ? 25.356  -42.400 -27.695  1.00 45.12 ? 162 ASP A OD1   1 
ATOM   1149  O OD2   . ASP A 1 162 ? 26.730  -43.743 -28.828  1.00 46.46 ? 162 ASP A OD2   1 
ATOM   1150  N N     . GLU A 1 163 ? 23.914  -41.331 -30.144  1.00 38.29 ? 163 GLU A N     1 
ATOM   1151  C CA    . GLU A 1 163 ? 22.479  -41.667 -30.251  1.00 38.48 ? 163 GLU A CA    1 
ATOM   1152  C C     . GLU A 1 163 ? 21.752  -41.767 -28.920  1.00 37.68 ? 163 GLU A C     1 
ATOM   1153  O O     . GLU A 1 163 ? 20.538  -41.539 -28.847  1.00 36.34 ? 163 GLU A O     1 
ATOM   1154  C CB    . GLU A 1 163 ? 22.241  -42.969 -30.994  1.00 38.47 ? 163 GLU A CB    1 
ATOM   1155  C CG    . GLU A 1 163 ? 23.074  -43.155 -32.249  1.00 43.42 ? 163 GLU A CG    1 
ATOM   1156  C CD    . GLU A 1 163 ? 24.404  -43.862 -31.970  1.00 49.40 ? 163 GLU A CD    1 
ATOM   1157  O OE1   . GLU A 1 163 ? 25.264  -43.253 -31.266  1.00 48.24 ? 163 GLU A OE1   1 
ATOM   1158  O OE2   . GLU A 1 163 ? 24.570  -45.026 -32.456  1.00 48.97 ? 163 GLU A OE2   1 
ATOM   1159  N N     . SER A 1 164 ? 22.542  -42.085 -27.894  1.00 36.98 ? 164 SER A N     1 
ATOM   1160  C CA    . SER A 1 164 ? 22.083  -42.609 -26.614  1.00 36.92 ? 164 SER A CA    1 
ATOM   1161  C C     . SER A 1 164 ? 22.562  -41.714 -25.490  1.00 36.67 ? 164 SER A C     1 
ATOM   1162  O O     . SER A 1 164 ? 22.614  -42.147 -24.372  1.00 36.46 ? 164 SER A O     1 
ATOM   1163  C CB    . SER A 1 164 ? 22.684  -44.000 -26.372  1.00 36.84 ? 164 SER A CB    1 
ATOM   1164  O OG    . SER A 1 164 ? 22.435  -44.860 -27.476  1.00 37.38 ? 164 SER A OG    1 
ATOM   1165  N N     . GLY A 1 165 ? 22.926  -40.474 -25.785  1.00 36.78 ? 165 GLY A N     1 
ATOM   1166  C CA    . GLY A 1 165 ? 23.368  -39.568 -24.729  1.00 37.92 ? 165 GLY A CA    1 
ATOM   1167  C C     . GLY A 1 165 ? 24.838  -39.714 -24.370  1.00 38.50 ? 165 GLY A C     1 
ATOM   1168  O O     . GLY A 1 165 ? 25.680  -40.121 -25.195  1.00 38.98 ? 165 GLY A O     1 
ATOM   1169  N N     . ILE A 1 166 ? 25.131  -39.379 -23.124  1.00 38.97 ? 166 ILE A N     1 
ATOM   1170  C CA    . ILE A 1 166 ? 26.493  -39.385 -22.584  1.00 38.83 ? 166 ILE A CA    1 
ATOM   1171  C C     . ILE A 1 166 ? 27.126  -40.749 -22.794  1.00 38.89 ? 166 ILE A C     1 
ATOM   1172  O O     . ILE A 1 166 ? 26.620  -41.770 -22.295  1.00 39.20 ? 166 ILE A O     1 
ATOM   1173  C CB    . ILE A 1 166 ? 26.479  -38.976 -21.076  1.00 38.41 ? 166 ILE A CB    1 
ATOM   1174  C CG1   . ILE A 1 166 ? 26.111  -37.496 -20.950  1.00 38.34 ? 166 ILE A CG1   1 
ATOM   1175  C CG2   . ILE A 1 166 ? 27.791  -39.322 -20.364  1.00 38.63 ? 166 ILE A CG2   1 
ATOM   1176  C CD1   . ILE A 1 166 ? 26.156  -36.904 -19.523  1.00 37.23 ? 166 ILE A CD1   1 
ATOM   1177  N N     . VAL A 1 167 ? 28.202  -40.762 -23.571  1.00 38.76 ? 167 VAL A N     1 
ATOM   1178  C CA    . VAL A 1 167 ? 29.017  -41.967 -23.722  1.00 39.19 ? 167 VAL A CA    1 
ATOM   1179  C C     . VAL A 1 167 ? 29.809  -42.165 -22.390  1.00 39.24 ? 167 VAL A C     1 
ATOM   1180  O O     . VAL A 1 167 ? 30.685  -41.365 -22.059  1.00 39.41 ? 167 VAL A O     1 
ATOM   1181  C CB    . VAL A 1 167 ? 29.927  -41.907 -25.038  1.00 39.33 ? 167 VAL A CB    1 
ATOM   1182  C CG1   . VAL A 1 167 ? 30.856  -43.138 -25.156  1.00 38.25 ? 167 VAL A CG1   1 
ATOM   1183  C CG2   . VAL A 1 167 ? 29.071  -41.784 -26.321  1.00 37.42 ? 167 VAL A CG2   1 
ATOM   1184  N N     . PRO A 1 168 ? 29.476  -43.213 -21.600  1.00 39.58 ? 168 PRO A N     1 
ATOM   1185  C CA    . PRO A 1 168 ? 30.157  -43.357 -20.288  1.00 39.33 ? 168 PRO A CA    1 
ATOM   1186  C C     . PRO A 1 168 ? 31.678  -43.722 -20.347  1.00 39.64 ? 168 PRO A C     1 
ATOM   1187  O O     . PRO A 1 168 ? 32.459  -43.328 -19.442  1.00 39.43 ? 168 PRO A O     1 
ATOM   1188  C CB    . PRO A 1 168 ? 29.334  -44.417 -19.576  1.00 39.15 ? 168 PRO A CB    1 
ATOM   1189  C CG    . PRO A 1 168 ? 28.705  -45.214 -20.675  1.00 39.73 ? 168 PRO A CG    1 
ATOM   1190  C CD    . PRO A 1 168 ? 28.507  -44.301 -21.855  1.00 38.65 ? 168 PRO A CD    1 
ATOM   1191  N N     . ASP A 1 169 ? 32.111  -44.418 -21.391  1.00 39.42 ? 169 ASP A N     1 
ATOM   1192  C CA    . ASP A 1 169 ? 33.548  -44.669 -21.585  1.00 40.35 ? 169 ASP A CA    1 
ATOM   1193  C C     . ASP A 1 169 ? 34.296  -43.344 -21.596  1.00 40.91 ? 169 ASP A C     1 
ATOM   1194  O O     . ASP A 1 169 ? 35.458  -43.230 -21.137  1.00 40.93 ? 169 ASP A O     1 
ATOM   1195  C CB    . ASP A 1 169 ? 33.799  -45.343 -22.929  1.00 41.04 ? 169 ASP A CB    1 
ATOM   1196  C CG    . ASP A 1 169 ? 33.843  -46.862 -22.840  1.00 41.83 ? 169 ASP A CG    1 
ATOM   1197  O OD1   . ASP A 1 169 ? 33.835  -47.420 -21.719  1.00 42.72 ? 169 ASP A OD1   1 
ATOM   1198  O OD2   . ASP A 1 169 ? 33.885  -47.484 -23.917  1.00 41.19 ? 169 ASP A OD2   1 
ATOM   1199  N N     . SER A 1 170 ? 33.614  -42.338 -22.138  1.00 40.69 ? 170 SER A N     1 
ATOM   1200  C CA    . SER A 1 170 ? 34.188  -41.029 -22.298  1.00 40.37 ? 170 SER A CA    1 
ATOM   1201  C C     . SER A 1 170 ? 34.235  -40.405 -20.905  1.00 39.81 ? 170 SER A C     1 
ATOM   1202  O O     . SER A 1 170 ? 35.272  -39.886 -20.455  1.00 38.89 ? 170 SER A O     1 
ATOM   1203  C CB    . SER A 1 170 ? 33.362  -40.246 -23.331  1.00 40.18 ? 170 SER A CB    1 
ATOM   1204  O OG    . SER A 1 170 ? 33.722  -38.879 -23.344  1.00 43.17 ? 170 SER A OG    1 
ATOM   1205  N N     . LEU A 1 171 ? 33.120  -40.524 -20.187  1.00 39.42 ? 171 LEU A N     1 
ATOM   1206  C CA    . LEU A 1 171 ? 33.109  -40.154 -18.779  1.00 38.82 ? 171 LEU A CA    1 
ATOM   1207  C C     . LEU A 1 171 ? 34.238  -40.838 -17.956  1.00 39.86 ? 171 LEU A C     1 
ATOM   1208  O O     . LEU A 1 171 ? 34.863  -40.188 -17.106  1.00 40.24 ? 171 LEU A O     1 
ATOM   1209  C CB    . LEU A 1 171 ? 31.711  -40.374 -18.151  1.00 38.57 ? 171 LEU A CB    1 
ATOM   1210  C CG    . LEU A 1 171 ? 31.451  -39.802 -16.752  1.00 36.08 ? 171 LEU A CG    1 
ATOM   1211  C CD1   . LEU A 1 171 ? 31.803  -38.319 -16.661  1.00 31.93 ? 171 LEU A CD1   1 
ATOM   1212  C CD2   . LEU A 1 171 ? 30.018  -40.041 -16.313  1.00 37.42 ? 171 LEU A CD2   1 
ATOM   1213  N N     . ARG A 1 172 ? 34.505  -42.124 -18.195  1.00 40.13 ? 172 ARG A N     1 
ATOM   1214  C CA    . ARG A 1 172 ? 35.631  -42.827 -17.507  1.00 41.73 ? 172 ARG A CA    1 
ATOM   1215  C C     . ARG A 1 172 ? 37.034  -42.234 -17.845  1.00 41.13 ? 172 ARG A C     1 
ATOM   1216  O O     . ARG A 1 172 ? 37.871  -41.963 -16.965  1.00 41.33 ? 172 ARG A O     1 
ATOM   1217  C CB    . ARG A 1 172 ? 35.603  -44.335 -17.835  1.00 40.85 ? 172 ARG A CB    1 
ATOM   1218  C CG    . ARG A 1 172 ? 35.920  -45.230 -16.658  1.00 43.02 ? 172 ARG A CG    1 
ATOM   1219  C CD    . ARG A 1 172 ? 35.498  -46.705 -16.898  1.00 45.38 ? 172 ARG A CD    1 
ATOM   1220  N NE    . ARG A 1 172 ? 34.063  -46.984 -16.652  1.00 50.00 ? 172 ARG A NE    1 
ATOM   1221  C CZ    . ARG A 1 172 ? 33.178  -47.377 -17.578  1.00 52.24 ? 172 ARG A CZ    1 
ATOM   1222  N NH1   . ARG A 1 172 ? 33.541  -47.537 -18.866  1.00 48.16 ? 172 ARG A NH1   1 
ATOM   1223  N NH2   . ARG A 1 172 ? 31.910  -47.621 -17.209  1.00 52.73 ? 172 ARG A NH2   1 
ATOM   1224  N N     . ASP A 1 173 ? 37.285  -42.056 -19.127  1.00 41.34 ? 173 ASP A N     1 
ATOM   1225  C CA    . ASP A 1 173 ? 38.561  -41.515 -19.587  1.00 42.46 ? 173 ASP A CA    1 
ATOM   1226  C C     . ASP A 1 173 ? 38.816  -40.087 -19.085  1.00 42.73 ? 173 ASP A C     1 
ATOM   1227  O O     . ASP A 1 173 ? 39.969  -39.719 -18.810  1.00 41.77 ? 173 ASP A O     1 
ATOM   1228  C CB    . ASP A 1 173 ? 38.644  -41.610 -21.108  1.00 42.37 ? 173 ASP A CB    1 
ATOM   1229  C CG    . ASP A 1 173 ? 38.614  -43.068 -21.602  1.00 44.68 ? 173 ASP A CG    1 
ATOM   1230  O OD1   . ASP A 1 173 ? 38.839  -43.290 -22.815  1.00 46.32 ? 173 ASP A OD1   1 
ATOM   1231  O OD2   . ASP A 1 173 ? 38.367  -43.997 -20.779  1.00 46.03 ? 173 ASP A OD2   1 
ATOM   1232  N N     . ILE A 1 174 ? 37.740  -39.305 -18.928  1.00 42.86 ? 174 ILE A N     1 
ATOM   1233  C CA    . ILE A 1 174 ? 37.877  -37.934 -18.429  1.00 43.17 ? 174 ILE A CA    1 
ATOM   1234  C C     . ILE A 1 174 ? 38.283  -37.977 -16.960  1.00 43.32 ? 174 ILE A C     1 
ATOM   1235  O O     . ILE A 1 174 ? 39.187  -37.246 -16.507  1.00 43.93 ? 174 ILE A O     1 
ATOM   1236  C CB    . ILE A 1 174 ? 36.582  -37.082 -18.628  1.00 43.52 ? 174 ILE A CB    1 
ATOM   1237  C CG1   . ILE A 1 174 ? 36.257  -36.923 -20.120  1.00 42.02 ? 174 ILE A CG1   1 
ATOM   1238  C CG2   . ILE A 1 174 ? 36.738  -35.717 -17.965  1.00 44.04 ? 174 ILE A CG2   1 
ATOM   1239  C CD1   . ILE A 1 174 ? 35.358  -35.788 -20.405  1.00 42.64 ? 174 ILE A CD1   1 
ATOM   1240  N N     . LEU A 1 175 ? 37.640  -38.868 -16.219  1.00 42.74 ? 175 LEU A N     1 
ATOM   1241  C CA    . LEU A 1 175 ? 37.874  -38.903 -14.798  1.00 42.34 ? 175 LEU A CA    1 
ATOM   1242  C C     . LEU A 1 175 ? 39.258  -39.501 -14.501  1.00 42.80 ? 175 LEU A C     1 
ATOM   1243  O O     . LEU A 1 175 ? 39.900  -39.089 -13.550  1.00 43.39 ? 175 LEU A O     1 
ATOM   1244  C CB    . LEU A 1 175 ? 36.697  -39.587 -14.076  1.00 42.11 ? 175 LEU A CB    1 
ATOM   1245  C CG    . LEU A 1 175 ? 35.368  -38.804 -14.319  1.00 40.24 ? 175 LEU A CG    1 
ATOM   1246  C CD1   . LEU A 1 175 ? 34.055  -39.604 -14.147  1.00 34.75 ? 175 LEU A CD1   1 
ATOM   1247  C CD2   . LEU A 1 175 ? 35.337  -37.475 -13.560  1.00 34.49 ? 175 LEU A CD2   1 
ATOM   1248  N N     . SER A 1 176 ? 39.740  -40.418 -15.342  1.00 42.52 ? 176 SER A N     1 
ATOM   1249  C CA    . SER A 1 176 ? 41.046  -41.046 -15.115  1.00 42.43 ? 176 SER A CA    1 
ATOM   1250  C C     . SER A 1 176 ? 42.181  -40.043 -14.847  1.00 42.52 ? 176 SER A C     1 
ATOM   1251  O O     . SER A 1 176 ? 43.149  -40.390 -14.183  1.00 42.46 ? 176 SER A O     1 
ATOM   1252  C CB    . SER A 1 176 ? 41.416  -42.103 -16.182  1.00 42.05 ? 176 SER A CB    1 
ATOM   1253  O OG    . SER A 1 176 ? 41.111  -41.684 -17.504  1.00 42.70 ? 176 SER A OG    1 
ATOM   1254  N N     . ARG A 1 177 ? 42.038  -38.788 -15.267  1.00 41.95 ? 177 ARG A N     1 
ATOM   1255  C CA    . ARG A 1 177 ? 42.996  -37.774 -14.805  1.00 41.98 ? 177 ARG A CA    1 
ATOM   1256  C C     . ARG A 1 177 ? 43.050  -37.499 -13.273  1.00 41.54 ? 177 ARG A C     1 
ATOM   1257  O O     . ARG A 1 177 ? 43.931  -36.785 -12.806  1.00 42.39 ? 177 ARG A O     1 
ATOM   1258  C CB    . ARG A 1 177 ? 42.830  -36.480 -15.590  1.00 42.60 ? 177 ARG A CB    1 
ATOM   1259  C CG    . ARG A 1 177 ? 41.858  -35.487 -14.995  1.00 44.80 ? 177 ARG A CG    1 
ATOM   1260  C CD    . ARG A 1 177 ? 41.468  -34.415 -16.003  1.00 48.54 ? 177 ARG A CD    1 
ATOM   1261  N NE    . ARG A 1 177 ? 40.859  -34.959 -17.225  1.00 52.10 ? 177 ARG A NE    1 
ATOM   1262  C CZ    . ARG A 1 177 ? 40.288  -34.201 -18.170  1.00 54.74 ? 177 ARG A CZ    1 
ATOM   1263  N NH1   . ARG A 1 177 ? 39.776  -34.774 -19.263  1.00 54.91 ? 177 ARG A NH1   1 
ATOM   1264  N NH2   . ARG A 1 177 ? 40.242  -32.862 -18.033  1.00 53.25 ? 177 ARG A NH2   1 
ATOM   1265  N N     . TRP A 1 178 ? 42.104  -38.043 -12.499  1.00 40.51 ? 178 TRP A N     1 
ATOM   1266  C CA    . TRP A 1 178 ? 42.137  -37.985 -11.024  1.00 38.86 ? 178 TRP A CA    1 
ATOM   1267  C C     . TRP A 1 178 ? 42.080  -39.431 -10.483  1.00 38.98 ? 178 TRP A C     1 
ATOM   1268  O O     . TRP A 1 178 ? 41.902  -40.404 -11.250  1.00 38.99 ? 178 TRP A O     1 
ATOM   1269  C CB    . TRP A 1 178 ? 40.940  -37.197 -10.454  1.00 37.56 ? 178 TRP A CB    1 
ATOM   1270  C CG    . TRP A 1 178 ? 40.851  -35.755 -10.803  1.00 34.91 ? 178 TRP A CG    1 
ATOM   1271  C CD1   . TRP A 1 178 ? 41.537  -34.727 -10.222  1.00 34.69 ? 178 TRP A CD1   1 
ATOM   1272  C CD2   . TRP A 1 178 ? 40.026  -35.156 -11.825  1.00 33.27 ? 178 TRP A CD2   1 
ATOM   1273  N NE1   . TRP A 1 178 ? 41.208  -33.524 -10.822  1.00 33.59 ? 178 TRP A NE1   1 
ATOM   1274  C CE2   . TRP A 1 178 ? 40.277  -33.767 -11.806  1.00 32.62 ? 178 TRP A CE2   1 
ATOM   1275  C CE3   . TRP A 1 178 ? 39.107  -35.664 -12.754  1.00 32.11 ? 178 TRP A CE3   1 
ATOM   1276  C CZ2   . TRP A 1 178 ? 39.621  -32.881 -12.659  1.00 35.93 ? 178 TRP A CZ2   1 
ATOM   1277  C CZ3   . TRP A 1 178 ? 38.475  -34.788 -13.607  1.00 34.12 ? 178 TRP A CZ3   1 
ATOM   1278  C CH2   . TRP A 1 178 ? 38.730  -33.408 -13.554  1.00 35.82 ? 178 TRP A CH2   1 
ATOM   1279  N N     . LYS A 1 179 ? 42.224  -39.583 -9.174   1.00 38.80 ? 179 LYS A N     1 
ATOM   1280  C CA    . LYS A 1 179 ? 41.914  -40.878 -8.555   1.00 39.67 ? 179 LYS A CA    1 
ATOM   1281  C C     . LYS A 1 179 ? 40.771  -40.649 -7.623   1.00 39.04 ? 179 LYS A C     1 
ATOM   1282  O O     . LYS A 1 179 ? 40.640  -39.547 -7.079   1.00 39.38 ? 179 LYS A O     1 
ATOM   1283  C CB    . LYS A 1 179 ? 43.093  -41.542 -7.784   1.00 39.73 ? 179 LYS A CB    1 
ATOM   1284  C CG    . LYS A 1 179 ? 44.317  -40.705 -7.524   1.00 43.53 ? 179 LYS A CG    1 
ATOM   1285  C CD    . LYS A 1 179 ? 45.290  -40.893 -8.715   1.00 47.12 ? 179 LYS A CD    1 
ATOM   1286  C CE    . LYS A 1 179 ? 46.516  -39.972 -8.642   1.00 49.08 ? 179 LYS A CE    1 
ATOM   1287  N NZ    . LYS A 1 179 ? 47.303  -39.990 -9.940   1.00 47.44 ? 179 LYS A NZ    1 
ATOM   1288  N N     . PRO A 1 180 ? 39.955  -41.682 -7.396   1.00 39.44 ? 180 PRO A N     1 
ATOM   1289  C CA    . PRO A 1 180 ? 38.810  -41.475 -6.486   1.00 40.45 ? 180 PRO A CA    1 
ATOM   1290  C C     . PRO A 1 180 ? 39.173  -40.648 -5.249   1.00 41.96 ? 180 PRO A C     1 
ATOM   1291  O O     . PRO A 1 180 ? 38.398  -39.771 -4.850   1.00 42.52 ? 180 PRO A O     1 
ATOM   1292  C CB    . PRO A 1 180 ? 38.392  -42.896 -6.097   1.00 40.31 ? 180 PRO A CB    1 
ATOM   1293  C CG    . PRO A 1 180 ? 38.980  -43.813 -7.173   1.00 39.69 ? 180 PRO A CG    1 
ATOM   1294  C CD    . PRO A 1 180 ? 40.028  -43.056 -7.940   1.00 38.46 ? 180 PRO A CD    1 
ATOM   1295  N N     . GLU A 1 181 ? 40.367  -40.895 -4.695   1.00 43.59 ? 181 GLU A N     1 
ATOM   1296  C CA    . GLU A 1 181 ? 40.886  -40.278 -3.462   1.00 44.54 ? 181 GLU A CA    1 
ATOM   1297  C C     . GLU A 1 181 ? 40.966  -38.760 -3.481   1.00 44.52 ? 181 GLU A C     1 
ATOM   1298  O O     . GLU A 1 181 ? 41.022  -38.122 -2.412   1.00 44.30 ? 181 GLU A O     1 
ATOM   1299  C CB    . GLU A 1 181 ? 42.262  -40.857 -3.135   1.00 45.18 ? 181 GLU A CB    1 
ATOM   1300  C CG    . GLU A 1 181 ? 42.237  -42.357 -2.789   1.00 50.16 ? 181 GLU A CG    1 
ATOM   1301  C CD    . GLU A 1 181 ? 42.319  -43.255 -4.042   1.00 56.70 ? 181 GLU A CD    1 
ATOM   1302  O OE1   . GLU A 1 181 ? 41.369  -44.056 -4.310   1.00 58.59 ? 181 GLU A OE1   1 
ATOM   1303  O OE2   . GLU A 1 181 ? 43.338  -43.137 -4.761   1.00 57.43 ? 181 GLU A OE2   1 
ATOM   1304  N N     . ASP A 1 182 ? 40.962  -38.195 -4.688   1.00 44.58 ? 182 ASP A N     1 
ATOM   1305  C CA    . ASP A 1 182 ? 41.028  -36.746 -4.920   1.00 45.60 ? 182 ASP A CA    1 
ATOM   1306  C C     . ASP A 1 182 ? 39.688  -36.020 -4.640   1.00 45.39 ? 182 ASP A C     1 
ATOM   1307  O O     . ASP A 1 182 ? 39.634  -34.763 -4.606   1.00 44.34 ? 182 ASP A O     1 
ATOM   1308  C CB    . ASP A 1 182 ? 41.388  -36.478 -6.399   1.00 46.49 ? 182 ASP A CB    1 
ATOM   1309  C CG    . ASP A 1 182 ? 42.863  -36.698 -6.722   1.00 49.59 ? 182 ASP A CG    1 
ATOM   1310  O OD1   . ASP A 1 182 ? 43.281  -36.298 -7.860   1.00 49.84 ? 182 ASP A OD1   1 
ATOM   1311  O OD2   . ASP A 1 182 ? 43.596  -37.264 -5.863   1.00 51.34 ? 182 ASP A OD2   1 
ATOM   1312  N N     . ALA A 1 183 ? 38.602  -36.789 -4.520   1.00 44.97 ? 183 ALA A N     1 
ATOM   1313  C CA    . ALA A 1 183 ? 37.332  -36.236 -4.014   1.00 46.02 ? 183 ALA A CA    1 
ATOM   1314  C C     . ALA A 1 183 ? 37.463  -35.582 -2.601   1.00 46.51 ? 183 ALA A C     1 
ATOM   1315  O O     . ALA A 1 183 ? 36.846  -34.519 -2.302   1.00 46.83 ? 183 ALA A O     1 
ATOM   1316  C CB    . ALA A 1 183 ? 36.253  -37.317 -4.004   1.00 45.81 ? 183 ALA A CB    1 
ATOM   1317  N N     . LYS A 1 184 ? 38.248  -36.215 -1.728   1.00 46.31 ? 184 LYS A N     1 
ATOM   1318  C CA    . LYS A 1 184 ? 38.341  -35.730 -0.352   1.00 47.35 ? 184 LYS A CA    1 
ATOM   1319  C C     . LYS A 1 184 ? 39.328  -34.568 -0.240   1.00 47.75 ? 184 LYS A C     1 
ATOM   1320  O O     . LYS A 1 184 ? 39.414  -33.922 0.795    1.00 47.73 ? 184 LYS A O     1 
ATOM   1321  C CB    . LYS A 1 184 ? 38.621  -36.878 0.620    1.00 47.27 ? 184 LYS A CB    1 
ATOM   1322  C CG    . LYS A 1 184 ? 37.384  -37.756 0.873    1.00 48.20 ? 184 LYS A CG    1 
ATOM   1323  C CD    . LYS A 1 184 ? 37.739  -39.134 1.438    1.00 50.97 ? 184 LYS A CD    1 
ATOM   1324  C CE    . LYS A 1 184 ? 38.454  -40.043 0.420    1.00 51.65 ? 184 LYS A CE    1 
ATOM   1325  N NZ    . LYS A 1 184 ? 37.602  -41.097 -0.290   1.00 49.94 ? 184 LYS A NZ    1 
ATOM   1326  N N     . ASN A 1 185 ? 40.000  -34.264 -1.347   1.00 48.14 ? 185 ASN A N     1 
ATOM   1327  C CA    . ASN A 1 185 ? 41.006  -33.213 -1.408   1.00 48.91 ? 185 ASN A CA    1 
ATOM   1328  C C     . ASN A 1 185 ? 40.535  -32.104 -2.326   1.00 49.02 ? 185 ASN A C     1 
ATOM   1329  O O     . ASN A 1 185 ? 40.747  -32.176 -3.522   1.00 48.79 ? 185 ASN A O     1 
ATOM   1330  C CB    . ASN A 1 185 ? 42.348  -33.792 -1.917   1.00 48.87 ? 185 ASN A CB    1 
ATOM   1331  C CG    . ASN A 1 185 ? 43.561  -32.846 -1.699   1.00 49.13 ? 185 ASN A CG    1 
ATOM   1332  O OD1   . ASN A 1 185 ? 43.472  -31.605 -1.807   1.00 48.93 ? 185 ASN A OD1   1 
ATOM   1333  N ND2   . ASN A 1 185 ? 44.708  -33.455 -1.408   1.00 47.30 ? 185 ASN A ND2   1 
ATOM   1334  N N     . PRO A 1 186 ? 39.917  -31.056 -1.766   1.00 49.55 ? 186 PRO A N     1 
ATOM   1335  C CA    . PRO A 1 186 ? 39.325  -30.025 -2.628   1.00 49.72 ? 186 PRO A CA    1 
ATOM   1336  C C     . PRO A 1 186 ? 40.323  -29.395 -3.592   1.00 49.58 ? 186 PRO A C     1 
ATOM   1337  O O     . PRO A 1 186 ? 39.922  -28.918 -4.667   1.00 48.89 ? 186 PRO A O     1 
ATOM   1338  C CB    . PRO A 1 186 ? 38.827  -28.969 -1.637   1.00 49.61 ? 186 PRO A CB    1 
ATOM   1339  C CG    . PRO A 1 186 ? 38.682  -29.692 -0.350   1.00 49.95 ? 186 PRO A CG    1 
ATOM   1340  C CD    . PRO A 1 186 ? 39.731  -30.756 -0.338   1.00 49.69 ? 186 PRO A CD    1 
ATOM   1341  N N     . GLN A 1 187 ? 41.610  -29.405 -3.224   1.00 49.86 ? 187 GLN A N     1 
ATOM   1342  C CA    . GLN A 1 187 ? 42.624  -28.678 -4.020   1.00 50.17 ? 187 GLN A CA    1 
ATOM   1343  C C     . GLN A 1 187 ? 42.985  -29.406 -5.312   1.00 49.38 ? 187 GLN A C     1 
ATOM   1344  O O     . GLN A 1 187 ? 43.529  -28.811 -6.247   1.00 49.16 ? 187 GLN A O     1 
ATOM   1345  C CB    . GLN A 1 187 ? 43.812  -28.185 -3.166   1.00 49.77 ? 187 GLN A CB    1 
ATOM   1346  C CG    . GLN A 1 187 ? 43.358  -26.998 -2.244   1.00 51.48 ? 187 GLN A CG    1 
ATOM   1347  C CD    . GLN A 1 187 ? 44.479  -26.288 -1.439   1.00 53.15 ? 187 GLN A CD    1 
ATOM   1348  O OE1   . GLN A 1 187 ? 44.280  -25.164 -0.950   1.00 56.05 ? 187 GLN A OE1   1 
ATOM   1349  N NE2   . GLN A 1 187 ? 45.646  -26.942 -1.286   1.00 56.18 ? 187 GLN A NE2   1 
ATOM   1350  N N     . LYS A 1 188 ? 42.601  -30.681 -5.376   1.00 48.77 ? 188 LYS A N     1 
ATOM   1351  C CA    . LYS A 1 188 ? 42.625  -31.440 -6.620   1.00 48.26 ? 188 LYS A CA    1 
ATOM   1352  C C     . LYS A 1 188 ? 41.646  -30.945 -7.696   1.00 47.58 ? 188 LYS A C     1 
ATOM   1353  O O     . LYS A 1 188 ? 41.820  -31.255 -8.886   1.00 47.18 ? 188 LYS A O     1 
ATOM   1354  C CB    . LYS A 1 188 ? 42.399  -32.927 -6.340   1.00 48.85 ? 188 LYS A CB    1 
ATOM   1355  C CG    . LYS A 1 188 ? 43.579  -33.653 -5.643   1.00 50.50 ? 188 LYS A CG    1 
ATOM   1356  C CD    . LYS A 1 188 ? 44.969  -33.178 -6.132   1.00 50.89 ? 188 LYS A CD    1 
ATOM   1357  C CE    . LYS A 1 188 ? 46.068  -34.179 -5.808   1.00 49.84 ? 188 LYS A CE    1 
ATOM   1358  N NZ    . LYS A 1 188 ? 46.604  -34.888 -7.025   1.00 49.99 ? 188 LYS A NZ    1 
ATOM   1359  N N     . ASN A 1 189 ? 40.619  -30.195 -7.284   1.00 46.57 ? 189 ASN A N     1 
ATOM   1360  C CA    . ASN A 1 189 ? 39.574  -29.706 -8.195   1.00 45.22 ? 189 ASN A CA    1 
ATOM   1361  C C     . ASN A 1 189 ? 38.781  -30.771 -8.937   1.00 43.27 ? 189 ASN A C     1 
ATOM   1362  O O     . ASN A 1 189 ? 38.400  -30.590 -10.094  1.00 43.76 ? 189 ASN A O     1 
ATOM   1363  C CB    . ASN A 1 189 ? 40.153  -28.696 -9.175   1.00 46.13 ? 189 ASN A CB    1 
ATOM   1364  C CG    . ASN A 1 189 ? 40.718  -27.494 -8.469   1.00 49.53 ? 189 ASN A CG    1 
ATOM   1365  O OD1   . ASN A 1 189 ? 40.081  -26.946 -7.560   1.00 53.02 ? 189 ASN A OD1   1 
ATOM   1366  N ND2   . ASN A 1 189 ? 41.936  -27.081 -8.856   1.00 52.23 ? 189 ASN A ND2   1 
ATOM   1367  N N     . THR A 1 190 ? 38.501  -31.874 -8.265   1.00 40.71 ? 190 THR A N     1 
ATOM   1368  C CA    . THR A 1 190 ? 37.601  -32.866 -8.842   1.00 38.80 ? 190 THR A CA    1 
ATOM   1369  C C     . THR A 1 190 ? 36.236  -32.286 -9.279   1.00 37.22 ? 190 THR A C     1 
ATOM   1370  O O     . THR A 1 190 ? 35.728  -31.344 -8.694   1.00 36.40 ? 190 THR A O     1 
ATOM   1371  C CB    . THR A 1 190 ? 37.349  -34.073 -7.889   1.00 38.07 ? 190 THR A CB    1 
ATOM   1372  O OG1   . THR A 1 190 ? 37.332  -33.631 -6.537   1.00 35.12 ? 190 THR A OG1   1 
ATOM   1373  C CG2   . THR A 1 190 ? 38.404  -35.127 -8.088   1.00 38.25 ? 190 THR A CG2   1 
ATOM   1374  N N     . PRO A 1 191 ? 35.652  -32.851 -10.333  1.00 36.19 ? 191 PRO A N     1 
ATOM   1375  C CA    . PRO A 1 191 ? 34.328  -32.365 -10.764  1.00 35.18 ? 191 PRO A CA    1 
ATOM   1376  C C     . PRO A 1 191 ? 33.258  -32.207 -9.656   1.00 33.07 ? 191 PRO A C     1 
ATOM   1377  O O     . PRO A 1 191 ? 32.896  -33.155 -8.963   1.00 31.96 ? 191 PRO A O     1 
ATOM   1378  C CB    . PRO A 1 191 ? 33.911  -33.393 -11.812  1.00 34.72 ? 191 PRO A CB    1 
ATOM   1379  C CG    . PRO A 1 191 ? 35.205  -33.802 -12.402  1.00 36.17 ? 191 PRO A CG    1 
ATOM   1380  C CD    . PRO A 1 191 ? 36.144  -33.910 -11.221  1.00 36.35 ? 191 PRO A CD    1 
ATOM   1381  N N     . LYS A 1 192 ? 32.763  -30.995 -9.505   1.00 31.60 ? 192 LYS A N     1 
ATOM   1382  C CA    . LYS A 1 192 ? 31.654  -30.742 -8.565   1.00 30.56 ? 192 LYS A CA    1 
ATOM   1383  C C     . LYS A 1 192 ? 30.334  -31.529 -8.837   1.00 29.44 ? 192 LYS A C     1 
ATOM   1384  O O     . LYS A 1 192 ? 29.623  -31.906 -7.839   1.00 27.00 ? 192 LYS A O     1 
ATOM   1385  C CB    . LYS A 1 192 ? 31.378  -29.242 -8.525   1.00 30.80 ? 192 LYS A CB    1 
ATOM   1386  C CG    . LYS A 1 192 ? 31.702  -28.540 -7.214   1.00 31.97 ? 192 LYS A CG    1 
ATOM   1387  C CD    . LYS A 1 192 ? 33.127  -28.795 -6.689   1.00 33.80 ? 192 LYS A CD    1 
ATOM   1388  C CE    . LYS A 1 192 ? 33.284  -28.042 -5.312   1.00 32.63 ? 192 LYS A CE    1 
ATOM   1389  N NZ    . LYS A 1 192 ? 33.118  -26.550 -5.536   1.00 34.90 ? 192 LYS A NZ    1 
ATOM   1390  N N     . PHE A 1 193 ? 30.050  -31.755 -10.153  1.00 27.72 ? 193 PHE A N     1 
ATOM   1391  C CA    . PHE A 1 193 ? 28.824  -32.383 -10.686  1.00 28.60 ? 193 PHE A CA    1 
ATOM   1392  C C     . PHE A 1 193 ? 28.796  -32.719 -12.214  1.00 28.45 ? 193 PHE A C     1 
ATOM   1393  O O     . PHE A 1 193 ? 29.458  -32.074 -13.011  1.00 28.63 ? 193 PHE A O     1 
ATOM   1394  C CB    . PHE A 1 193 ? 27.549  -31.549 -10.333  1.00 29.22 ? 193 PHE A CB    1 
ATOM   1395  C CG    . PHE A 1 193 ? 27.457  -30.200 -11.041  1.00 28.72 ? 193 PHE A CG    1 
ATOM   1396  C CD1   . PHE A 1 193 ? 27.836  -29.036 -10.401  1.00 32.94 ? 193 PHE A CD1   1 
ATOM   1397  C CD2   . PHE A 1 193 ? 27.013  -30.104 -12.336  1.00 29.98 ? 193 PHE A CD2   1 
ATOM   1398  C CE1   . PHE A 1 193 ? 27.745  -27.775 -11.059  1.00 29.71 ? 193 PHE A CE1   1 
ATOM   1399  C CE2   . PHE A 1 193 ? 26.952  -28.880 -12.983  1.00 30.98 ? 193 PHE A CE2   1 
ATOM   1400  C CZ    . PHE A 1 193 ? 27.328  -27.721 -12.335  1.00 30.24 ? 193 PHE A CZ    1 
ATOM   1401  N N     . LEU A 1 194 ? 27.987  -33.716 -12.587  1.00 29.22 ? 194 LEU A N     1 
ATOM   1402  C CA    . LEU A 1 194 ? 27.566  -33.996 -13.973  1.00 30.48 ? 194 LEU A CA    1 
ATOM   1403  C C     . LEU A 1 194 ? 26.152  -33.505 -14.297  1.00 30.06 ? 194 LEU A C     1 
ATOM   1404  O O     . LEU A 1 194 ? 25.169  -34.004 -13.732  1.00 30.68 ? 194 LEU A O     1 
ATOM   1405  C CB    . LEU A 1 194 ? 27.588  -35.502 -14.278  1.00 31.52 ? 194 LEU A CB    1 
ATOM   1406  C CG    . LEU A 1 194 ? 26.894  -35.800 -15.625  1.00 32.89 ? 194 LEU A CG    1 
ATOM   1407  C CD1   . LEU A 1 194 ? 27.839  -35.420 -16.729  1.00 35.85 ? 194 LEU A CD1   1 
ATOM   1408  C CD2   . LEU A 1 194 ? 26.430  -37.220 -15.790  1.00 34.72 ? 194 LEU A CD2   1 
ATOM   1409  N N     . TYR A 1 195 ? 26.057  -32.561 -15.228  1.00 30.27 ? 195 TYR A N     1 
ATOM   1410  C CA    . TYR A 1 195 ? 24.759  -32.038 -15.682  1.00 30.20 ? 195 TYR A CA    1 
ATOM   1411  C C     . TYR A 1 195 ? 24.424  -32.731 -16.938  1.00 31.14 ? 195 TYR A C     1 
ATOM   1412  O O     . TYR A 1 195 ? 25.254  -32.763 -17.844  1.00 32.21 ? 195 TYR A O     1 
ATOM   1413  C CB    . TYR A 1 195 ? 24.783  -30.519 -15.943  1.00 28.78 ? 195 TYR A CB    1 
ATOM   1414  C CG    . TYR A 1 195 ? 23.583  -29.992 -16.722  1.00 28.61 ? 195 TYR A CG    1 
ATOM   1415  C CD1   . TYR A 1 195 ? 22.409  -29.589 -16.062  1.00 28.15 ? 195 TYR A CD1   1 
ATOM   1416  C CD2   . TYR A 1 195 ? 23.610  -29.893 -18.128  1.00 21.11 ? 195 TYR A CD2   1 
ATOM   1417  C CE1   . TYR A 1 195 ? 21.305  -29.093 -16.779  1.00 23.63 ? 195 TYR A CE1   1 
ATOM   1418  C CE2   . TYR A 1 195 ? 22.534  -29.428 -18.806  1.00 27.30 ? 195 TYR A CE2   1 
ATOM   1419  C CZ    . TYR A 1 195 ? 21.382  -29.015 -18.132  1.00 25.61 ? 195 TYR A CZ    1 
ATOM   1420  O OH    . TYR A 1 195 ? 20.313  -28.551 -18.865  1.00 28.56 ? 195 TYR A OH    1 
ATOM   1421  N N     . THR A 1 196 ? 23.185  -33.211 -17.016  1.00 31.98 ? 196 THR A N     1 
ATOM   1422  C CA    . THR A 1 196 ? 22.642  -33.937 -18.141  1.00 32.76 ? 196 THR A CA    1 
ATOM   1423  C C     . THR A 1 196 ? 21.140  -33.618 -18.383  1.00 33.17 ? 196 THR A C     1 
ATOM   1424  O O     . THR A 1 196 ? 20.411  -33.156 -17.459  1.00 33.65 ? 196 THR A O     1 
ATOM   1425  C CB    . THR A 1 196 ? 22.808  -35.446 -17.908  1.00 32.66 ? 196 THR A CB    1 
ATOM   1426  O OG1   . THR A 1 196 ? 22.275  -36.185 -19.022  1.00 35.15 ? 196 THR A OG1   1 
ATOM   1427  C CG2   . THR A 1 196 ? 22.109  -35.902 -16.588  1.00 34.73 ? 196 THR A CG2   1 
ATOM   1428  N N     . VAL A 1 197 ? 20.698  -33.850 -19.625  1.00 32.55 ? 197 VAL A N     1 
ATOM   1429  C CA    . VAL A 1 197 ? 19.284  -33.858 -19.995  1.00 31.32 ? 197 VAL A CA    1 
ATOM   1430  C C     . VAL A 1 197 ? 19.008  -35.285 -20.483  1.00 31.47 ? 197 VAL A C     1 
ATOM   1431  O O     . VAL A 1 197 ? 19.209  -35.620 -21.665  1.00 31.50 ? 197 VAL A O     1 
ATOM   1432  C CB    . VAL A 1 197 ? 18.912  -32.806 -21.100  1.00 30.87 ? 197 VAL A CB    1 
ATOM   1433  C CG1   . VAL A 1 197 ? 17.445  -32.854 -21.412  1.00 31.57 ? 197 VAL A CG1   1 
ATOM   1434  C CG2   . VAL A 1 197 ? 19.222  -31.399 -20.648  1.00 29.92 ? 197 VAL A CG2   1 
ATOM   1435  N N     . PRO A 1 198 ? 18.501  -36.129 -19.584  1.00 30.75 ? 198 PRO A N     1 
ATOM   1436  C CA    . PRO A 1 198 ? 18.437  -37.511 -19.949  1.00 30.75 ? 198 PRO A CA    1 
ATOM   1437  C C     . PRO A 1 198 ? 17.403  -37.896 -21.027  1.00 29.86 ? 198 PRO A C     1 
ATOM   1438  O O     . PRO A 1 198 ? 17.510  -38.976 -21.519  1.00 29.76 ? 198 PRO A O     1 
ATOM   1439  C CB    . PRO A 1 198 ? 18.148  -38.250 -18.594  1.00 29.95 ? 198 PRO A CB    1 
ATOM   1440  C CG    . PRO A 1 198 ? 18.191  -37.232 -17.546  1.00 30.95 ? 198 PRO A CG    1 
ATOM   1441  C CD    . PRO A 1 198 ? 17.952  -35.896 -18.245  1.00 31.44 ? 198 PRO A CD    1 
ATOM   1442  N N     . ASN A 1 199 ? 16.461  -37.015 -21.345  1.00 30.02 ? 199 ASN A N     1 
ATOM   1443  C CA    . ASN A 1 199 ? 15.362  -37.357 -22.240  1.00 30.02 ? 199 ASN A CA    1 
ATOM   1444  C C     . ASN A 1 199 ? 15.192  -36.338 -23.361  1.00 30.52 ? 199 ASN A C     1 
ATOM   1445  O O     . ASN A 1 199 ? 15.168  -35.131 -23.118  1.00 32.39 ? 199 ASN A O     1 
ATOM   1446  C CB    . ASN A 1 199 ? 14.058  -37.499 -21.455  1.00 29.16 ? 199 ASN A CB    1 
ATOM   1447  C CG    . ASN A 1 199 ? 14.073  -38.681 -20.506  1.00 30.67 ? 199 ASN A CG    1 
ATOM   1448  O OD1   . ASN A 1 199 ? 14.331  -39.814 -20.912  1.00 30.32 ? 199 ASN A OD1   1 
ATOM   1449  N ND2   . ASN A 1 199 ? 13.796  -38.422 -19.234  1.00 28.36 ? 199 ASN A ND2   1 
ATOM   1450  N N     . GLY A 1 200 ? 15.076  -36.830 -24.590  1.00 30.07 ? 200 GLY A N     1 
ATOM   1451  C CA    . GLY A 1 200 ? 15.464  -36.063 -25.759  1.00 30.34 ? 200 GLY A CA    1 
ATOM   1452  C C     . GLY A 1 200 ? 16.077  -34.725 -25.397  1.00 30.10 ? 200 GLY A C     1 
ATOM   1453  O O     . GLY A 1 200 ? 15.418  -33.688 -25.473  1.00 30.58 ? 200 GLY A O     1 
ATOM   1454  N N     . ASN A 1 201 ? 17.346  -34.748 -25.002  1.00 29.63 ? 201 ASN A N     1 
ATOM   1455  C CA    . ASN A 1 201 ? 18.156  -33.537 -24.956  1.00 29.13 ? 201 ASN A CA    1 
ATOM   1456  C C     . ASN A 1 201 ? 17.651  -32.469 -25.920  1.00 29.26 ? 201 ASN A C     1 
ATOM   1457  O O     . ASN A 1 201 ? 17.399  -32.746 -27.092  1.00 28.17 ? 201 ASN A O     1 
ATOM   1458  C CB    . ASN A 1 201 ? 19.622  -33.862 -25.252  1.00 29.57 ? 201 ASN A CB    1 
ATOM   1459  C CG    . ASN A 1 201 ? 20.554  -32.718 -24.904  1.00 30.17 ? 201 ASN A CG    1 
ATOM   1460  O OD1   . ASN A 1 201 ? 21.492  -32.419 -25.643  1.00 29.66 ? 201 ASN A OD1   1 
ATOM   1461  N ND2   . ASN A 1 201 ? 20.299  -32.070 -23.773  1.00 32.70 ? 201 ASN A ND2   1 
ATOM   1462  N N     . ASN A 1 202 ? 17.506  -31.247 -25.417  1.00 28.22 ? 202 ASN A N     1 
ATOM   1463  C CA    . ASN A 1 202 ? 17.446  -30.081 -26.264  1.00 27.73 ? 202 ASN A CA    1 
ATOM   1464  C C     . ASN A 1 202 ? 18.891  -29.602 -26.538  1.00 28.97 ? 202 ASN A C     1 
ATOM   1465  O O     . ASN A 1 202 ? 19.582  -29.158 -25.605  1.00 27.51 ? 202 ASN A O     1 
ATOM   1466  C CB    . ASN A 1 202 ? 16.586  -29.019 -25.607  1.00 27.17 ? 202 ASN A CB    1 
ATOM   1467  C CG    . ASN A 1 202 ? 16.534  -27.777 -26.364  1.00 24.54 ? 202 ASN A CG    1 
ATOM   1468  O OD1   . ASN A 1 202 ? 17.160  -27.650 -27.431  1.00 22.26 ? 202 ASN A OD1   1 
ATOM   1469  N ND2   . ASN A 1 202 ? 15.800  -26.796 -25.825  1.00 24.08 ? 202 ASN A ND2   1 
ATOM   1470  N N     . PRO A 1 203 ? 19.340  -29.637 -27.831  1.00 29.68 ? 203 PRO A N     1 
ATOM   1471  C CA    . PRO A 1 203 ? 18.668  -29.772 -29.134  1.00 30.14 ? 203 PRO A CA    1 
ATOM   1472  C C     . PRO A 1 203 ? 18.702  -31.162 -29.834  1.00 30.44 ? 203 PRO A C     1 
ATOM   1473  O O     . PRO A 1 203 ? 18.120  -31.295 -30.919  1.00 30.12 ? 203 PRO A O     1 
ATOM   1474  C CB    . PRO A 1 203 ? 19.522  -28.846 -30.010  1.00 30.85 ? 203 PRO A CB    1 
ATOM   1475  C CG    . PRO A 1 203 ? 20.956  -29.109 -29.479  1.00 30.93 ? 203 PRO A CG    1 
ATOM   1476  C CD    . PRO A 1 203 ? 20.805  -29.540 -28.022  1.00 30.22 ? 203 PRO A CD    1 
ATOM   1477  N N     . THR A 1 204 ? 19.391  -32.174 -29.279  1.00 29.77 ? 204 THR A N     1 
ATOM   1478  C CA    . THR A 1 204 ? 19.542  -33.411 -30.043  1.00 28.66 ? 204 THR A CA    1 
ATOM   1479  C C     . THR A 1 204 ? 18.296  -34.294 -30.094  1.00 29.14 ? 204 THR A C     1 
ATOM   1480  O O     . THR A 1 204 ? 18.144  -35.062 -31.032  1.00 29.72 ? 204 THR A O     1 
ATOM   1481  C CB    . THR A 1 204 ? 20.680  -34.293 -29.552  1.00 28.15 ? 204 THR A CB    1 
ATOM   1482  O OG1   . THR A 1 204 ? 20.327  -34.819 -28.281  1.00 28.34 ? 204 THR A OG1   1 
ATOM   1483  C CG2   . THR A 1 204 ? 22.091  -33.564 -29.555  1.00 28.35 ? 204 THR A CG2   1 
ATOM   1484  N N     . GLY A 1 205 ? 17.459  -34.256 -29.063  1.00 28.62 ? 205 GLY A N     1 
ATOM   1485  C CA    . GLY A 1 205 ? 16.361  -35.180 -28.978  1.00 29.18 ? 205 GLY A CA    1 
ATOM   1486  C C     . GLY A 1 205 ? 16.730  -36.620 -28.649  1.00 30.25 ? 205 GLY A C     1 
ATOM   1487  O O     . GLY A 1 205 ? 15.841  -37.529 -28.691  1.00 29.75 ? 205 GLY A O     1 
ATOM   1488  N N     . ASN A 1 206 ? 18.015  -36.823 -28.310  1.00 29.43 ? 206 ASN A N     1 
ATOM   1489  C CA    . ASN A 1 206 ? 18.531  -38.097 -27.810  1.00 29.80 ? 206 ASN A CA    1 
ATOM   1490  C C     . ASN A 1 206 ? 18.234  -38.357 -26.306  1.00 29.51 ? 206 ASN A C     1 
ATOM   1491  O O     . ASN A 1 206 ? 18.192  -37.427 -25.496  1.00 28.19 ? 206 ASN A O     1 
ATOM   1492  C CB    . ASN A 1 206 ? 20.073  -38.186 -28.090  1.00 29.53 ? 206 ASN A CB    1 
ATOM   1493  C CG    . ASN A 1 206 ? 20.389  -38.304 -29.603  1.00 31.78 ? 206 ASN A CG    1 
ATOM   1494  O OD1   . ASN A 1 206 ? 21.198  -37.549 -30.174  1.00 30.68 ? 206 ASN A OD1   1 
ATOM   1495  N ND2   . ASN A 1 206 ? 19.698  -39.218 -30.260  1.00 33.42 ? 206 ASN A ND2   1 
ATOM   1496  N N     . SER A 1 207 ? 18.081  -39.636 -25.935  1.00 29.92 ? 207 SER A N     1 
ATOM   1497  C CA    . SER A 1 207 ? 17.970  -40.012 -24.517  1.00 29.92 ? 207 SER A CA    1 
ATOM   1498  C C     . SER A 1 207 ? 18.949  -41.134 -24.110  1.00 30.42 ? 207 SER A C     1 
ATOM   1499  O O     . SER A 1 207 ? 19.193  -42.081 -24.868  1.00 29.85 ? 207 SER A O     1 
ATOM   1500  C CB    . SER A 1 207 ? 16.546  -40.441 -24.156  1.00 28.53 ? 207 SER A CB    1 
ATOM   1501  O OG    . SER A 1 207 ? 15.582  -39.565 -24.702  1.00 29.86 ? 207 SER A OG    1 
ATOM   1502  N N     . LEU A 1 208 ? 19.434  -41.028 -22.877  1.00 31.92 ? 208 LEU A N     1 
ATOM   1503  C CA    . LEU A 1 208 ? 20.250  -42.056 -22.200  1.00 33.62 ? 208 LEU A CA    1 
ATOM   1504  C C     . LEU A 1 208 ? 19.557  -43.394 -22.155  1.00 34.76 ? 208 LEU A C     1 
ATOM   1505  O O     . LEU A 1 208 ? 18.345  -43.484 -22.235  1.00 34.83 ? 208 LEU A O     1 
ATOM   1506  C CB    . LEU A 1 208 ? 20.607  -41.612 -20.779  1.00 32.94 ? 208 LEU A CB    1 
ATOM   1507  C CG    . LEU A 1 208 ? 21.871  -40.730 -20.670  1.00 34.31 ? 208 LEU A CG    1 
ATOM   1508  C CD1   . LEU A 1 208 ? 21.852  -40.234 -19.286  1.00 35.40 ? 208 LEU A CD1   1 
ATOM   1509  C CD2   . LEU A 1 208 ? 23.262  -41.477 -20.963  1.00 29.16 ? 208 LEU A CD2   1 
ATOM   1510  N N     . THR A 1 209 ? 20.323  -44.461 -22.046  1.00 36.41 ? 209 THR A N     1 
ATOM   1511  C CA    . THR A 1 209 ? 19.686  -45.748 -21.837  1.00 37.46 ? 209 THR A CA    1 
ATOM   1512  C C     . THR A 1 209 ? 19.831  -46.041 -20.375  1.00 38.66 ? 209 THR A C     1 
ATOM   1513  O O     . THR A 1 209 ? 20.652  -45.420 -19.721  1.00 38.16 ? 209 THR A O     1 
ATOM   1514  C CB    . THR A 1 209 ? 20.381  -46.818 -22.606  1.00 38.18 ? 209 THR A CB    1 
ATOM   1515  O OG1   . THR A 1 209 ? 21.808  -46.714 -22.356  1.00 36.03 ? 209 THR A OG1   1 
ATOM   1516  C CG2   . THR A 1 209 ? 19.995  -46.676 -24.126  1.00 36.18 ? 209 THR A CG2   1 
ATOM   1517  N N     . SER A 1 210 ? 19.002  -46.960 -19.884  1.00 39.00 ? 210 SER A N     1 
ATOM   1518  C CA    . SER A 1 210 ? 19.091  -47.486 -18.549  1.00 39.84 ? 210 SER A CA    1 
ATOM   1519  C C     . SER A 1 210 ? 20.483  -48.134 -18.193  1.00 40.39 ? 210 SER A C     1 
ATOM   1520  O O     . SER A 1 210 ? 20.960  -48.001 -17.050  1.00 41.20 ? 210 SER A O     1 
ATOM   1521  C CB    . SER A 1 210 ? 17.921  -48.465 -18.331  1.00 39.06 ? 210 SER A CB    1 
ATOM   1522  O OG    . SER A 1 210 ? 17.944  -48.954 -17.010  1.00 41.20 ? 210 SER A OG    1 
ATOM   1523  N N     . GLU A 1 211 ? 21.141  -48.812 -19.144  1.00 40.31 ? 211 GLU A N     1 
ATOM   1524  C CA    . GLU A 1 211 ? 22.483  -49.384 -18.863  1.00 40.31 ? 211 GLU A CA    1 
ATOM   1525  C C     . GLU A 1 211 ? 23.464  -48.230 -18.605  1.00 39.99 ? 211 GLU A C     1 
ATOM   1526  O O     . GLU A 1 211 ? 24.241  -48.261 -17.651  1.00 40.31 ? 211 GLU A O     1 
ATOM   1527  C CB    . GLU A 1 211 ? 22.993  -50.286 -19.998  1.00 40.24 ? 211 GLU A CB    1 
ATOM   1528  C CG    . GLU A 1 211 ? 22.275  -51.635 -20.192  1.00 43.24 ? 211 GLU A CG    1 
ATOM   1529  C CD    . GLU A 1 211 ? 21.057  -51.604 -21.191  1.00 49.73 ? 211 GLU A CD    1 
ATOM   1530  O OE1   . GLU A 1 211 ? 20.311  -50.569 -21.283  1.00 45.98 ? 211 GLU A OE1   1 
ATOM   1531  O OE2   . GLU A 1 211 ? 20.853  -52.647 -21.882  1.00 52.56 ? 211 GLU A OE2   1 
ATOM   1532  N N     . ARG A 1 212 ? 23.403  -47.202 -19.450  1.00 39.36 ? 212 ARG A N     1 
ATOM   1533  C CA    . ARG A 1 212 ? 24.291  -46.046 -19.344  1.00 38.35 ? 212 ARG A CA    1 
ATOM   1534  C C     . ARG A 1 212 ? 24.081  -45.271 -18.058  1.00 38.86 ? 212 ARG A C     1 
ATOM   1535  O O     . ARG A 1 212 ? 25.039  -44.862 -17.397  1.00 38.86 ? 212 ARG A O     1 
ATOM   1536  C CB    . ARG A 1 212 ? 24.125  -45.117 -20.536  1.00 37.71 ? 212 ARG A CB    1 
ATOM   1537  C CG    . ARG A 1 212 ? 24.617  -45.705 -21.858  1.00 36.89 ? 212 ARG A CG    1 
ATOM   1538  C CD    . ARG A 1 212 ? 24.978  -44.631 -22.874  1.00 36.03 ? 212 ARG A CD    1 
ATOM   1539  N NE    . ARG A 1 212 ? 25.446  -45.231 -24.124  1.00 38.90 ? 212 ARG A NE    1 
ATOM   1540  C CZ    . ARG A 1 212 ? 25.841  -44.541 -25.187  1.00 40.64 ? 212 ARG A CZ    1 
ATOM   1541  N NH1   . ARG A 1 212 ? 25.831  -43.194 -25.173  1.00 41.97 ? 212 ARG A NH1   1 
ATOM   1542  N NH2   . ARG A 1 212 ? 26.221  -45.195 -26.279  1.00 40.93 ? 212 ARG A NH2   1 
ATOM   1543  N N     . LYS A 1 213 ? 22.824  -45.079 -17.693  1.00 38.58 ? 213 LYS A N     1 
ATOM   1544  C CA    . LYS A 1 213 ? 22.524  -44.377 -16.478  1.00 38.11 ? 213 LYS A CA    1 
ATOM   1545  C C     . LYS A 1 213 ? 23.129  -45.129 -15.266  1.00 38.61 ? 213 LYS A C     1 
ATOM   1546  O O     . LYS A 1 213 ? 23.816  -44.499 -14.457  1.00 37.94 ? 213 LYS A O     1 
ATOM   1547  C CB    . LYS A 1 213 ? 21.018  -44.125 -16.357  1.00 38.11 ? 213 LYS A CB    1 
ATOM   1548  C CG    . LYS A 1 213 ? 20.446  -42.995 -17.259  1.00 35.94 ? 213 LYS A CG    1 
ATOM   1549  C CD    . LYS A 1 213 ? 18.956  -42.963 -17.072  1.00 31.78 ? 213 LYS A CD    1 
ATOM   1550  C CE    . LYS A 1 213 ? 18.290  -41.768 -17.674  1.00 36.06 ? 213 LYS A CE    1 
ATOM   1551  N NZ    . LYS A 1 213 ? 16.792  -41.855 -17.609  1.00 36.82 ? 213 LYS A NZ    1 
ATOM   1552  N N     . LYS A 1 214 ? 22.910  -46.447 -15.151  1.00 38.90 ? 214 LYS A N     1 
ATOM   1553  C CA    . LYS A 1 214 ? 23.689  -47.255 -14.175  1.00 39.99 ? 214 LYS A CA    1 
ATOM   1554  C C     . LYS A 1 214 ? 25.208  -46.926 -14.132  1.00 39.66 ? 214 LYS A C     1 
ATOM   1555  O O     . LYS A 1 214 ? 25.724  -46.486 -13.080  1.00 39.75 ? 214 LYS A O     1 
ATOM   1556  C CB    . LYS A 1 214 ? 23.501  -48.756 -14.393  1.00 40.48 ? 214 LYS A CB    1 
ATOM   1557  C CG    . LYS A 1 214 ? 22.162  -49.322 -13.922  1.00 42.72 ? 214 LYS A CG    1 
ATOM   1558  C CD    . LYS A 1 214 ? 22.099  -50.817 -14.294  1.00 44.86 ? 214 LYS A CD    1 
ATOM   1559  C CE    . LYS A 1 214 ? 20.844  -51.537 -13.801  1.00 46.48 ? 214 LYS A CE    1 
ATOM   1560  N NZ    . LYS A 1 214 ? 19.603  -51.227 -14.614  1.00 41.25 ? 214 LYS A NZ    1 
ATOM   1561  N N     . GLU A 1 215 ? 25.906  -47.126 -15.262  1.00 39.09 ? 215 GLU A N     1 
ATOM   1562  C CA    . GLU A 1 215 ? 27.345  -46.834 -15.386  1.00 38.41 ? 215 GLU A CA    1 
ATOM   1563  C C     . GLU A 1 215 ? 27.665  -45.423 -14.920  1.00 37.54 ? 215 GLU A C     1 
ATOM   1564  O O     . GLU A 1 215 ? 28.598  -45.245 -14.118  1.00 38.50 ? 215 GLU A O     1 
ATOM   1565  C CB    . GLU A 1 215 ? 27.863  -47.025 -16.829  1.00 38.30 ? 215 GLU A CB    1 
ATOM   1566  C CG    . GLU A 1 215 ? 28.189  -48.449 -17.259  1.00 37.82 ? 215 GLU A CG    1 
ATOM   1567  C CD    . GLU A 1 215 ? 28.129  -48.664 -18.787  1.00 41.00 ? 215 GLU A CD    1 
ATOM   1568  O OE1   . GLU A 1 215 ? 27.082  -48.369 -19.438  1.00 44.93 ? 215 GLU A OE1   1 
ATOM   1569  O OE2   . GLU A 1 215 ? 29.127  -49.148 -19.354  1.00 43.98 ? 215 GLU A OE2   1 
ATOM   1570  N N     . ILE A 1 216 ? 26.887  -44.432 -15.377  1.00 35.99 ? 216 ILE A N     1 
ATOM   1571  C CA    . ILE A 1 216 ? 27.115  -43.038 -14.992  1.00 35.07 ? 216 ILE A CA    1 
ATOM   1572  C C     . ILE A 1 216 ? 27.055  -42.850 -13.483  1.00 35.75 ? 216 ILE A C     1 
ATOM   1573  O O     . ILE A 1 216 ? 27.936  -42.230 -12.917  1.00 36.09 ? 216 ILE A O     1 
ATOM   1574  C CB    . ILE A 1 216 ? 26.220  -42.039 -15.720  1.00 35.36 ? 216 ILE A CB    1 
ATOM   1575  C CG1   . ILE A 1 216 ? 26.512  -42.096 -17.231  1.00 35.78 ? 216 ILE A CG1   1 
ATOM   1576  C CG2   . ILE A 1 216 ? 26.434  -40.601 -15.172  1.00 32.45 ? 216 ILE A CG2   1 
ATOM   1577  C CD1   . ILE A 1 216 ? 25.797  -41.061 -18.060  1.00 34.57 ? 216 ILE A CD1   1 
ATOM   1578  N N     . TYR A 1 217 ? 26.043  -43.444 -12.848  1.00 35.27 ? 217 TYR A N     1 
ATOM   1579  C CA    . TYR A 1 217 ? 25.953  -43.541 -11.431  1.00 34.85 ? 217 TYR A CA    1 
ATOM   1580  C C     . TYR A 1 217 ? 27.208  -44.137 -10.707  1.00 35.33 ? 217 TYR A C     1 
ATOM   1581  O O     . TYR A 1 217 ? 27.718  -43.507 -9.795   1.00 34.29 ? 217 TYR A O     1 
ATOM   1582  C CB    . TYR A 1 217 ? 24.641  -44.245 -11.039  1.00 33.75 ? 217 TYR A CB    1 
ATOM   1583  C CG    . TYR A 1 217 ? 24.219  -43.776 -9.688   1.00 33.51 ? 217 TYR A CG    1 
ATOM   1584  C CD1   . TYR A 1 217 ? 23.550  -42.558 -9.535   1.00 29.60 ? 217 TYR A CD1   1 
ATOM   1585  C CD2   . TYR A 1 217 ? 24.594  -44.491 -8.533   1.00 31.03 ? 217 TYR A CD2   1 
ATOM   1586  C CE1   . TYR A 1 217 ? 23.208  -42.067 -8.246   1.00 31.90 ? 217 TYR A CE1   1 
ATOM   1587  C CE2   . TYR A 1 217 ? 24.238  -44.048 -7.248   1.00 27.90 ? 217 TYR A CE2   1 
ATOM   1588  C CZ    . TYR A 1 217 ? 23.560  -42.822 -7.104   1.00 34.14 ? 217 TYR A CZ    1 
ATOM   1589  O OH    . TYR A 1 217 ? 23.216  -42.355 -5.831   1.00 35.82 ? 217 TYR A OH    1 
ATOM   1590  N N     . GLU A 1 218 ? 27.690  -45.326 -11.108  1.00 36.76 ? 218 GLU A N     1 
ATOM   1591  C CA    . GLU A 1 218 ? 28.961  -45.913 -10.568  1.00 37.91 ? 218 GLU A CA    1 
ATOM   1592  C C     . GLU A 1 218 ? 30.126  -44.917 -10.534  1.00 37.84 ? 218 GLU A C     1 
ATOM   1593  O O     . GLU A 1 218 ? 30.755  -44.740 -9.486   1.00 36.61 ? 218 GLU A O     1 
ATOM   1594  C CB    . GLU A 1 218 ? 29.404  -47.217 -11.313  1.00 38.16 ? 218 GLU A CB    1 
ATOM   1595  C CG    . GLU A 1 218 ? 30.126  -48.321 -10.419  1.00 38.09 ? 218 GLU A CG    1 
ATOM   1596  C CD    . GLU A 1 218 ? 30.163  -49.760 -11.072  1.00 41.24 ? 218 GLU A CD    1 
ATOM   1597  O OE1   . GLU A 1 218 ? 30.464  -49.835 -12.294  1.00 45.13 ? 218 GLU A OE1   1 
ATOM   1598  O OE2   . GLU A 1 218 ? 29.903  -50.812 -10.383  1.00 44.51 ? 218 GLU A OE2   1 
ATOM   1599  N N     . LEU A 1 219 ? 30.396  -44.281 -11.680  1.00 39.68 ? 219 LEU A N     1 
ATOM   1600  C CA    . LEU A 1 219 ? 31.460  -43.235 -11.813  1.00 40.41 ? 219 LEU A CA    1 
ATOM   1601  C C     . LEU A 1 219 ? 31.240  -42.081 -10.846  1.00 41.21 ? 219 LEU A C     1 
ATOM   1602  O O     . LEU A 1 219 ? 32.200  -41.624 -10.169  1.00 42.06 ? 219 LEU A O     1 
ATOM   1603  C CB    . LEU A 1 219 ? 31.518  -42.638 -13.229  1.00 40.17 ? 219 LEU A CB    1 
ATOM   1604  C CG    . LEU A 1 219 ? 32.265  -43.186 -14.464  1.00 41.32 ? 219 LEU A CG    1 
ATOM   1605  C CD1   . LEU A 1 219 ? 33.817  -43.297 -14.269  1.00 38.70 ? 219 LEU A CD1   1 
ATOM   1606  C CD2   . LEU A 1 219 ? 31.649  -44.497 -14.890  1.00 42.03 ? 219 LEU A CD2   1 
ATOM   1607  N N     . ALA A 1 220 ? 30.003  -41.575 -10.805  1.00 40.77 ? 220 ALA A N     1 
ATOM   1608  C CA    . ALA A 1 220 ? 29.651  -40.481 -9.860   1.00 41.63 ? 220 ALA A CA    1 
ATOM   1609  C C     . ALA A 1 220 ? 29.862  -40.871 -8.378   1.00 41.85 ? 220 ALA A C     1 
ATOM   1610  O O     . ALA A 1 220 ? 30.346  -40.061 -7.558   1.00 40.63 ? 220 ALA A O     1 
ATOM   1611  C CB    . ALA A 1 220 ? 28.217  -39.995 -10.101  1.00 41.12 ? 220 ALA A CB    1 
ATOM   1612  N N     . ARG A 1 221 ? 29.491  -42.111 -8.049   1.00 42.75 ? 221 ARG A N     1 
ATOM   1613  C CA    . ARG A 1 221 ? 29.845  -42.707 -6.767   1.00 45.06 ? 221 ARG A CA    1 
ATOM   1614  C C     . ARG A 1 221 ? 31.387  -42.693 -6.541   1.00 44.58 ? 221 ARG A C     1 
ATOM   1615  O O     . ARG A 1 221 ? 31.877  -42.056 -5.621   1.00 43.84 ? 221 ARG A O     1 
ATOM   1616  C CB    . ARG A 1 221 ? 29.237  -44.124 -6.644   1.00 44.68 ? 221 ARG A CB    1 
ATOM   1617  C CG    . ARG A 1 221 ? 29.578  -44.852 -5.317   1.00 46.96 ? 221 ARG A CG    1 
ATOM   1618  C CD    . ARG A 1 221 ? 28.998  -46.294 -5.242   1.00 48.79 ? 221 ARG A CD    1 
ATOM   1619  N NE    . ARG A 1 221 ? 29.842  -47.383 -5.785   1.00 55.84 ? 221 ARG A NE    1 
ATOM   1620  C CZ    . ARG A 1 221 ? 29.663  -48.008 -6.956   1.00 58.76 ? 221 ARG A CZ    1 
ATOM   1621  N NH1   . ARG A 1 221 ? 28.665  -47.663 -7.774   1.00 61.55 ? 221 ARG A NH1   1 
ATOM   1622  N NH2   . ARG A 1 221 ? 30.486  -48.995 -7.317   1.00 58.42 ? 221 ARG A NH2   1 
ATOM   1623  N N     . LYS A 1 222 ? 32.127  -43.355 -7.430   1.00 45.46 ? 222 LYS A N     1 
ATOM   1624  C CA    . LYS A 1 222 ? 33.598  -43.506 -7.368   1.00 45.92 ? 222 LYS A CA    1 
ATOM   1625  C C     . LYS A 1 222 ? 34.280  -42.173 -7.060   1.00 45.61 ? 222 LYS A C     1 
ATOM   1626  O O     . LYS A 1 222 ? 35.197  -42.096 -6.211   1.00 45.49 ? 222 LYS A O     1 
ATOM   1627  C CB    . LYS A 1 222 ? 34.086  -44.070 -8.702   1.00 45.30 ? 222 LYS A CB    1 
ATOM   1628  C CG    . LYS A 1 222 ? 35.427  -44.810 -8.746   1.00 47.90 ? 222 LYS A CG    1 
ATOM   1629  C CD    . LYS A 1 222 ? 35.373  -45.915 -9.895   1.00 47.95 ? 222 LYS A CD    1 
ATOM   1630  C CE    . LYS A 1 222 ? 36.700  -46.635 -10.209  1.00 49.12 ? 222 LYS A CE    1 
ATOM   1631  N NZ    . LYS A 1 222 ? 36.509  -48.096 -10.617  1.00 50.00 ? 222 LYS A NZ    1 
ATOM   1632  N N     . TYR A 1 223 ? 33.782  -41.133 -7.727   1.00 45.31 ? 223 TYR A N     1 
ATOM   1633  C CA    . TYR A 1 223 ? 34.399  -39.814 -7.782   1.00 44.84 ? 223 TYR A CA    1 
ATOM   1634  C C     . TYR A 1 223 ? 33.649  -38.709 -7.026   1.00 44.87 ? 223 TYR A C     1 
ATOM   1635  O O     . TYR A 1 223 ? 34.042  -37.534 -7.028   1.00 45.14 ? 223 TYR A O     1 
ATOM   1636  C CB    . TYR A 1 223 ? 34.582  -39.432 -9.235   1.00 45.16 ? 223 TYR A CB    1 
ATOM   1637  C CG    . TYR A 1 223 ? 35.652  -40.248 -9.919   1.00 45.43 ? 223 TYR A CG    1 
ATOM   1638  C CD1   . TYR A 1 223 ? 37.005  -39.968 -9.701   1.00 45.00 ? 223 TYR A CD1   1 
ATOM   1639  C CD2   . TYR A 1 223 ? 35.315  -41.310 -10.757  1.00 44.29 ? 223 TYR A CD2   1 
ATOM   1640  C CE1   . TYR A 1 223 ? 37.987  -40.695 -10.301  1.00 45.15 ? 223 TYR A CE1   1 
ATOM   1641  C CE2   . TYR A 1 223 ? 36.295  -42.058 -11.375  1.00 42.66 ? 223 TYR A CE2   1 
ATOM   1642  C CZ    . TYR A 1 223 ? 37.635  -41.740 -11.138  1.00 45.74 ? 223 TYR A CZ    1 
ATOM   1643  O OH    . TYR A 1 223 ? 38.643  -42.464 -11.730  1.00 46.34 ? 223 TYR A OH    1 
ATOM   1644  N N     . ASP A 1 224 ? 32.574  -39.098 -6.359   1.00 44.68 ? 224 ASP A N     1 
ATOM   1645  C CA    . ASP A 1 224 ? 31.842  -38.212 -5.471   1.00 44.55 ? 224 ASP A CA    1 
ATOM   1646  C C     . ASP A 1 224 ? 31.480  -36.894 -6.152   1.00 42.89 ? 224 ASP A C     1 
ATOM   1647  O O     . ASP A 1 224 ? 31.844  -35.806 -5.710   1.00 42.81 ? 224 ASP A O     1 
ATOM   1648  C CB    . ASP A 1 224 ? 32.594  -37.985 -4.149   1.00 45.12 ? 224 ASP A CB    1 
ATOM   1649  C CG    . ASP A 1 224 ? 31.647  -37.745 -2.985   1.00 48.06 ? 224 ASP A CG    1 
ATOM   1650  O OD1   . ASP A 1 224 ? 30.476  -38.187 -3.112   1.00 50.48 ? 224 ASP A OD1   1 
ATOM   1651  O OD2   . ASP A 1 224 ? 32.065  -37.132 -1.955   1.00 47.06 ? 224 ASP A OD2   1 
ATOM   1652  N N     . PHE A 1 225 ? 30.763  -36.999 -7.248   1.00 40.64 ? 225 PHE A N     1 
ATOM   1653  C CA    . PHE A 1 225 ? 30.202  -35.821 -7.789   1.00 39.77 ? 225 PHE A CA    1 
ATOM   1654  C C     . PHE A 1 225 ? 28.657  -35.899 -7.857   1.00 38.80 ? 225 PHE A C     1 
ATOM   1655  O O     . PHE A 1 225 ? 28.049  -36.960 -7.934   1.00 37.96 ? 225 PHE A O     1 
ATOM   1656  C CB    . PHE A 1 225 ? 30.913  -35.393 -9.106   1.00 39.84 ? 225 PHE A CB    1 
ATOM   1657  C CG    . PHE A 1 225 ? 30.754  -36.355 -10.234  1.00 38.86 ? 225 PHE A CG    1 
ATOM   1658  C CD1   . PHE A 1 225 ? 29.547  -36.431 -10.944  1.00 35.15 ? 225 PHE A CD1   1 
ATOM   1659  C CD2   . PHE A 1 225 ? 31.827  -37.199 -10.603  1.00 39.37 ? 225 PHE A CD2   1 
ATOM   1660  C CE1   . PHE A 1 225 ? 29.404  -37.337 -11.987  1.00 35.11 ? 225 PHE A CE1   1 
ATOM   1661  C CE2   . PHE A 1 225 ? 31.695  -38.121 -11.655  1.00 34.75 ? 225 PHE A CE2   1 
ATOM   1662  C CZ    . PHE A 1 225 ? 30.483  -38.174 -12.353  1.00 37.56 ? 225 PHE A CZ    1 
ATOM   1663  N N     . LEU A 1 226 ? 28.036  -34.743 -7.794   1.00 38.01 ? 226 LEU A N     1 
ATOM   1664  C CA    . LEU A 1 226 ? 26.581  -34.661 -7.921   1.00 37.59 ? 226 LEU A CA    1 
ATOM   1665  C C     . LEU A 1 226 ? 26.135  -34.962 -9.341   1.00 37.30 ? 226 LEU A C     1 
ATOM   1666  O O     . LEU A 1 226 ? 26.869  -34.692 -10.310  1.00 36.97 ? 226 LEU A O     1 
ATOM   1667  C CB    . LEU A 1 226 ? 26.073  -33.262 -7.505   1.00 36.51 ? 226 LEU A CB    1 
ATOM   1668  C CG    . LEU A 1 226 ? 26.236  -33.014 -6.014   1.00 35.82 ? 226 LEU A CG    1 
ATOM   1669  C CD1   . LEU A 1 226 ? 25.829  -31.599 -5.642   1.00 36.02 ? 226 LEU A CD1   1 
ATOM   1670  C CD2   . LEU A 1 226 ? 25.491  -34.051 -5.184   1.00 33.98 ? 226 LEU A CD2   1 
ATOM   1671  N N     . ILE A 1 227 ? 24.939  -35.529 -9.456   1.00 36.54 ? 227 ILE A N     1 
ATOM   1672  C CA    . ILE A 1 227 ? 24.293  -35.592 -10.747  1.00 36.91 ? 227 ILE A CA    1 
ATOM   1673  C C     . ILE A 1 227 ? 23.070  -34.678 -10.737  1.00 37.39 ? 227 ILE A C     1 
ATOM   1674  O O     . ILE A 1 227 ? 22.167  -34.823 -9.902   1.00 38.05 ? 227 ILE A O     1 
ATOM   1675  C CB    . ILE A 1 227 ? 23.916  -37.041 -11.173  1.00 36.91 ? 227 ILE A CB    1 
ATOM   1676  C CG1   . ILE A 1 227 ? 25.085  -38.005 -10.953  1.00 35.36 ? 227 ILE A CG1   1 
ATOM   1677  C CG2   . ILE A 1 227 ? 23.516  -37.057 -12.636  1.00 35.59 ? 227 ILE A CG2   1 
ATOM   1678  C CD1   . ILE A 1 227 ? 24.728  -39.434 -11.304  1.00 37.08 ? 227 ILE A CD1   1 
ATOM   1679  N N     . ILE A 1 228 ? 23.083  -33.692 -11.626  1.00 37.40 ? 228 ILE A N     1 
ATOM   1680  C CA    . ILE A 1 228 ? 21.890  -32.908 -11.898  1.00 36.28 ? 228 ILE A CA    1 
ATOM   1681  C C     . ILE A 1 228 ? 21.287  -33.465 -13.167  1.00 36.06 ? 228 ILE A C     1 
ATOM   1682  O O     . ILE A 1 228 ? 21.839  -33.347 -14.269  1.00 36.14 ? 228 ILE A O     1 
ATOM   1683  C CB    . ILE A 1 228 ? 22.172  -31.435 -12.118  1.00 36.24 ? 228 ILE A CB    1 
ATOM   1684  C CG1   . ILE A 1 228 ? 23.185  -30.913 -11.096  1.00 35.41 ? 228 ILE A CG1   1 
ATOM   1685  C CG2   . ILE A 1 228 ? 20.843  -30.650 -12.101  1.00 35.80 ? 228 ILE A CG2   1 
ATOM   1686  C CD1   . ILE A 1 228 ? 23.659  -29.499 -11.391  1.00 33.29 ? 228 ILE A CD1   1 
ATOM   1687  N N     . GLU A 1 229 ? 20.172  -34.129 -12.957  1.00 35.20 ? 229 GLU A N     1 
ATOM   1688  C CA    . GLU A 1 229 ? 19.309  -34.632 -13.973  1.00 34.29 ? 229 GLU A CA    1 
ATOM   1689  C C     . GLU A 1 229 ? 18.293  -33.557 -14.312  1.00 33.76 ? 229 GLU A C     1 
ATOM   1690  O O     . GLU A 1 229 ? 17.346  -33.316 -13.537  1.00 33.71 ? 229 GLU A O     1 
ATOM   1691  C CB    . GLU A 1 229 ? 18.596  -35.795 -13.329  1.00 35.34 ? 229 GLU A CB    1 
ATOM   1692  C CG    . GLU A 1 229 ? 17.391  -36.317 -14.009  1.00 35.18 ? 229 GLU A CG    1 
ATOM   1693  C CD    . GLU A 1 229 ? 17.082  -37.713 -13.515  1.00 36.08 ? 229 GLU A CD    1 
ATOM   1694  O OE1   . GLU A 1 229 ? 17.200  -38.658 -14.323  1.00 37.83 ? 229 GLU A OE1   1 
ATOM   1695  O OE2   . GLU A 1 229 ? 16.739  -37.859 -12.319  1.00 33.60 ? 229 GLU A OE2   1 
ATOM   1696  N N     . ASP A 1 230 ? 18.477  -32.905 -15.463  1.00 32.54 ? 230 ASP A N     1 
ATOM   1697  C CA    . ASP A 1 230 ? 17.549  -31.909 -15.975  1.00 30.61 ? 230 ASP A CA    1 
ATOM   1698  C C     . ASP A 1 230 ? 16.535  -32.605 -16.807  1.00 28.20 ? 230 ASP A C     1 
ATOM   1699  O O     . ASP A 1 230 ? 16.812  -32.929 -17.945  1.00 28.49 ? 230 ASP A O     1 
ATOM   1700  C CB    . ASP A 1 230 ? 18.280  -30.843 -16.817  1.00 32.42 ? 230 ASP A CB    1 
ATOM   1701  C CG    . ASP A 1 230 ? 17.373  -29.655 -17.213  1.00 34.17 ? 230 ASP A CG    1 
ATOM   1702  O OD1   . ASP A 1 230 ? 16.227  -29.560 -16.682  1.00 36.28 ? 230 ASP A OD1   1 
ATOM   1703  O OD2   . ASP A 1 230 ? 17.824  -28.810 -18.031  1.00 35.09 ? 230 ASP A OD2   1 
ATOM   1704  N N     . ASP A 1 231 ? 15.332  -32.833 -16.302  1.00 26.78 ? 231 ASP A N     1 
ATOM   1705  C CA    . ASP A 1 231 ? 14.411  -33.762 -16.960  1.00 25.44 ? 231 ASP A CA    1 
ATOM   1706  C C     . ASP A 1 231 ? 13.041  -33.162 -17.367  1.00 25.39 ? 231 ASP A C     1 
ATOM   1707  O O     . ASP A 1 231 ? 11.992  -33.653 -16.994  1.00 22.41 ? 231 ASP A O     1 
ATOM   1708  C CB    . ASP A 1 231 ? 14.261  -35.031 -16.117  1.00 24.68 ? 231 ASP A CB    1 
ATOM   1709  C CG    . ASP A 1 231 ? 14.168  -36.306 -16.943  1.00 26.88 ? 231 ASP A CG    1 
ATOM   1710  O OD1   . ASP A 1 231 ? 13.855  -36.262 -18.138  1.00 30.32 ? 231 ASP A OD1   1 
ATOM   1711  O OD2   . ASP A 1 231 ? 14.403  -37.417 -16.456  1.00 22.86 ? 231 ASP A OD2   1 
ATOM   1712  N N     . PRO A 1 232 ? 13.080  -32.101 -18.157  1.00 26.21 ? 232 PRO A N     1 
ATOM   1713  C CA    . PRO A 1 232 ? 11.878  -31.381 -18.557  1.00 26.62 ? 232 PRO A CA    1 
ATOM   1714  C C     . PRO A 1 232 ? 11.054  -32.140 -19.557  1.00 26.65 ? 232 PRO A C     1 
ATOM   1715  O O     . PRO A 1 232 ? 9.904   -31.812 -19.763  1.00 27.08 ? 232 PRO A O     1 
ATOM   1716  C CB    . PRO A 1 232 ? 12.454  -30.122 -19.239  1.00 25.97 ? 232 PRO A CB    1 
ATOM   1717  C CG    . PRO A 1 232 ? 13.701  -30.663 -19.909  1.00 25.82 ? 232 PRO A CG    1 
ATOM   1718  C CD    . PRO A 1 232 ? 14.269  -31.561 -18.841  1.00 26.36 ? 232 PRO A CD    1 
ATOM   1719  N N     . TYR A 1 233 ? 11.664  -33.117 -20.215  1.00 27.95 ? 233 TYR A N     1 
ATOM   1720  C CA    . TYR A 1 233 ? 11.003  -33.926 -21.258  1.00 27.23 ? 233 TYR A CA    1 
ATOM   1721  C C     . TYR A 1 233 ? 10.707  -35.333 -20.673  1.00 26.64 ? 233 TYR A C     1 
ATOM   1722  O O     . TYR A 1 233 ? 10.524  -36.279 -21.376  1.00 27.90 ? 233 TYR A O     1 
ATOM   1723  C CB    . TYR A 1 233 ? 11.887  -34.014 -22.534  1.00 27.34 ? 233 TYR A CB    1 
ATOM   1724  C CG    . TYR A 1 233 ? 12.184  -32.652 -23.203  1.00 28.38 ? 233 TYR A CG    1 
ATOM   1725  C CD1   . TYR A 1 233 ? 13.437  -32.048 -23.119  1.00 28.72 ? 233 TYR A CD1   1 
ATOM   1726  C CD2   . TYR A 1 233 ? 11.187  -31.959 -23.918  1.00 28.63 ? 233 TYR A CD2   1 
ATOM   1727  C CE1   . TYR A 1 233 ? 13.696  -30.745 -23.761  1.00 29.31 ? 233 TYR A CE1   1 
ATOM   1728  C CE2   . TYR A 1 233 ? 11.413  -30.686 -24.517  1.00 28.85 ? 233 TYR A CE2   1 
ATOM   1729  C CZ    . TYR A 1 233 ? 12.664  -30.077 -24.448  1.00 30.91 ? 233 TYR A CZ    1 
ATOM   1730  O OH    . TYR A 1 233 ? 12.856  -28.818 -25.084  1.00 31.00 ? 233 TYR A OH    1 
ATOM   1731  N N     . TYR A 1 234 ? 10.690  -35.487 -19.370  1.00 26.41 ? 234 TYR A N     1 
ATOM   1732  C CA    . TYR A 1 234 ? 10.383  -36.800 -18.788  1.00 26.37 ? 234 TYR A CA    1 
ATOM   1733  C C     . TYR A 1 234 ? 8.998   -37.318 -19.145  1.00 25.32 ? 234 TYR A C     1 
ATOM   1734  O O     . TYR A 1 234 ? 8.802   -38.520 -19.307  1.00 25.83 ? 234 TYR A O     1 
ATOM   1735  C CB    . TYR A 1 234 ? 10.581  -36.805 -17.270  1.00 26.42 ? 234 TYR A CB    1 
ATOM   1736  C CG    . TYR A 1 234 ? 10.252  -38.128 -16.673  1.00 29.41 ? 234 TYR A CG    1 
ATOM   1737  C CD1   . TYR A 1 234 ? 11.167  -39.204 -16.732  1.00 31.59 ? 234 TYR A CD1   1 
ATOM   1738  C CD2   . TYR A 1 234 ? 9.006   -38.331 -16.047  1.00 28.07 ? 234 TYR A CD2   1 
ATOM   1739  C CE1   . TYR A 1 234 ? 10.812  -40.464 -16.163  1.00 30.34 ? 234 TYR A CE1   1 
ATOM   1740  C CE2   . TYR A 1 234 ? 8.649   -39.536 -15.533  1.00 26.52 ? 234 TYR A CE2   1 
ATOM   1741  C CZ    . TYR A 1 234 ? 9.538   -40.601 -15.570  1.00 29.74 ? 234 TYR A CZ    1 
ATOM   1742  O OH    . TYR A 1 234 ? 9.106   -41.801 -15.035  1.00 28.20 ? 234 TYR A OH    1 
ATOM   1743  N N     . PHE A 1 235 ? 8.018   -36.437 -19.242  1.00 24.52 ? 235 PHE A N     1 
ATOM   1744  C CA    . PHE A 1 235 ? 6.717   -36.901 -19.577  1.00 24.36 ? 235 PHE A CA    1 
ATOM   1745  C C     . PHE A 1 235 ? 6.421   -36.813 -21.078  1.00 25.72 ? 235 PHE A C     1 
ATOM   1746  O O     . PHE A 1 235 ? 5.237   -36.969 -21.501  1.00 26.17 ? 235 PHE A O     1 
ATOM   1747  C CB    . PHE A 1 235 ? 5.686   -36.147 -18.790  1.00 23.62 ? 235 PHE A CB    1 
ATOM   1748  C CG    . PHE A 1 235 ? 5.850   -36.246 -17.320  1.00 22.72 ? 235 PHE A CG    1 
ATOM   1749  C CD1   . PHE A 1 235 ? 5.517   -37.418 -16.646  1.00 20.57 ? 235 PHE A CD1   1 
ATOM   1750  C CD2   . PHE A 1 235 ? 6.279   -35.121 -16.578  1.00 21.82 ? 235 PHE A CD2   1 
ATOM   1751  C CE1   . PHE A 1 235 ? 5.679   -37.494 -15.221  1.00 14.97 ? 235 PHE A CE1   1 
ATOM   1752  C CE2   . PHE A 1 235 ? 6.439   -35.177 -15.154  1.00 14.39 ? 235 PHE A CE2   1 
ATOM   1753  C CZ    . PHE A 1 235 ? 6.103   -36.341 -14.493  1.00 16.80 ? 235 PHE A CZ    1 
ATOM   1754  N N     . LEU A 1 236 ? 7.471   -36.559 -21.868  1.00 26.15 ? 236 LEU A N     1 
ATOM   1755  C CA    . LEU A 1 236 ? 7.352   -36.487 -23.316  1.00 28.66 ? 236 LEU A CA    1 
ATOM   1756  C C     . LEU A 1 236 ? 8.061   -37.640 -24.108  1.00 29.57 ? 236 LEU A C     1 
ATOM   1757  O O     . LEU A 1 236 ? 8.545   -37.468 -25.239  1.00 29.06 ? 236 LEU A O     1 
ATOM   1758  C CB    . LEU A 1 236 ? 7.813   -35.108 -23.764  1.00 28.95 ? 236 LEU A CB    1 
ATOM   1759  C CG    . LEU A 1 236 ? 6.842   -34.295 -24.610  1.00 29.70 ? 236 LEU A CG    1 
ATOM   1760  C CD1   . LEU A 1 236 ? 5.475   -34.247 -23.975  1.00 32.17 ? 236 LEU A CD1   1 
ATOM   1761  C CD2   . LEU A 1 236 ? 7.360   -32.863 -24.774  1.00 28.79 ? 236 LEU A CD2   1 
ATOM   1762  N N     . GLN A 1 237 ? 8.039   -38.827 -23.515  1.00 30.99 ? 237 GLN A N     1 
ATOM   1763  C CA    . GLN A 1 237 ? 8.794   -39.978 -23.983  1.00 31.76 ? 237 GLN A CA    1 
ATOM   1764  C C     . GLN A 1 237 ? 8.038   -40.883 -24.872  1.00 32.64 ? 237 GLN A C     1 
ATOM   1765  O O     . GLN A 1 237 ? 7.124   -41.535 -24.430  1.00 35.00 ? 237 GLN A O     1 
ATOM   1766  C CB    . GLN A 1 237 ? 9.283   -40.811 -22.815  1.00 30.68 ? 237 GLN A CB    1 
ATOM   1767  C CG    . GLN A 1 237 ? 10.641  -40.415 -22.352  1.00 29.92 ? 237 GLN A CG    1 
ATOM   1768  C CD    . GLN A 1 237 ? 11.025  -41.117 -21.070  1.00 27.34 ? 237 GLN A CD    1 
ATOM   1769  O OE1   . GLN A 1 237 ? 10.966  -40.535 -19.993  1.00 23.80 ? 237 GLN A OE1   1 
ATOM   1770  N NE2   . GLN A 1 237 ? 11.444  -42.367 -21.187  1.00 28.71 ? 237 GLN A NE2   1 
ATOM   1771  N N     . PHE A 1 238 ? 8.495   -40.991 -26.109  1.00 33.77 ? 238 PHE A N     1 
ATOM   1772  C CA    . PHE A 1 238 ? 7.836   -41.766 -27.135  1.00 34.68 ? 238 PHE A CA    1 
ATOM   1773  C C     . PHE A 1 238 ? 7.783   -43.254 -26.886  1.00 36.26 ? 238 PHE A C     1 
ATOM   1774  O O     . PHE A 1 238 ? 6.812   -43.910 -27.279  1.00 36.11 ? 238 PHE A O     1 
ATOM   1775  C CB    . PHE A 1 238 ? 8.500   -41.493 -28.477  1.00 34.34 ? 238 PHE A CB    1 
ATOM   1776  C CG    . PHE A 1 238 ? 8.646   -40.057 -28.773  1.00 32.40 ? 238 PHE A CG    1 
ATOM   1777  C CD1   . PHE A 1 238 ? 9.851   -39.572 -29.272  1.00 28.03 ? 238 PHE A CD1   1 
ATOM   1778  C CD2   . PHE A 1 238 ? 7.583   -39.176 -28.533  1.00 29.49 ? 238 PHE A CD2   1 
ATOM   1779  C CE1   . PHE A 1 238 ? 9.989   -38.264 -29.523  1.00 30.90 ? 238 PHE A CE1   1 
ATOM   1780  C CE2   . PHE A 1 238 ? 7.706   -37.826 -28.803  1.00 29.85 ? 238 PHE A CE2   1 
ATOM   1781  C CZ    . PHE A 1 238 ? 8.893   -37.357 -29.288  1.00 33.29 ? 238 PHE A CZ    1 
ATOM   1782  N N     . ASN A 1 239 ? 8.830   -43.788 -26.260  1.00 38.85 ? 239 ASN A N     1 
ATOM   1783  C CA    . ASN A 1 239 ? 8.804   -45.163 -25.740  1.00 40.83 ? 239 ASN A CA    1 
ATOM   1784  C C     . ASN A 1 239 ? 7.832   -45.297 -24.570  1.00 41.97 ? 239 ASN A C     1 
ATOM   1785  O O     . ASN A 1 239 ? 7.842   -44.466 -23.648  1.00 41.87 ? 239 ASN A O     1 
ATOM   1786  C CB    . ASN A 1 239 ? 10.174  -45.569 -25.284  1.00 41.17 ? 239 ASN A CB    1 
ATOM   1787  C CG    . ASN A 1 239 ? 10.338  -47.086 -25.197  1.00 44.62 ? 239 ASN A CG    1 
ATOM   1788  O OD1   . ASN A 1 239 ? 9.347   -47.865 -25.153  1.00 43.53 ? 239 ASN A OD1   1 
ATOM   1789  N ND2   . ASN A 1 239 ? 11.610  -47.522 -25.179  1.00 45.56 ? 239 ASN A ND2   1 
ATOM   1790  N N     . LYS A 1 240 ? 6.984   -46.330 -24.613  1.00 43.15 ? 240 LYS A N     1 
ATOM   1791  C CA    . LYS A 1 240 ? 5.931   -46.498 -23.594  1.00 43.42 ? 240 LYS A CA    1 
ATOM   1792  C C     . LYS A 1 240 ? 6.481   -46.945 -22.232  1.00 42.86 ? 240 LYS A C     1 
ATOM   1793  O O     . LYS A 1 240 ? 5.841   -46.743 -21.214  1.00 42.23 ? 240 LYS A O     1 
ATOM   1794  C CB    . LYS A 1 240 ? 4.771   -47.401 -24.087  1.00 44.68 ? 240 LYS A CB    1 
ATOM   1795  C CG    . LYS A 1 240 ? 3.719   -46.733 -25.068  1.00 44.98 ? 240 LYS A CG    1 
ATOM   1796  C CD    . LYS A 1 240 ? 3.247   -45.330 -24.659  1.00 47.84 ? 240 LYS A CD    1 
ATOM   1797  C CE    . LYS A 1 240 ? 2.123   -44.808 -25.606  1.00 49.18 ? 240 LYS A CE    1 
ATOM   1798  N NZ    . LYS A 1 240 ? 2.197   -43.351 -25.993  1.00 45.17 ? 240 LYS A NZ    1 
ATOM   1799  N N     . PHE A 1 241 ? 7.677   -47.532 -22.206  1.00 42.29 ? 241 PHE A N     1 
ATOM   1800  C CA    . PHE A 1 241 ? 8.383   -47.707 -20.928  1.00 41.53 ? 241 PHE A CA    1 
ATOM   1801  C C     . PHE A 1 241 ? 9.275   -46.529 -20.732  1.00 39.92 ? 241 PHE A C     1 
ATOM   1802  O O     . PHE A 1 241 ? 10.016  -46.170 -21.634  1.00 40.49 ? 241 PHE A O     1 
ATOM   1803  C CB    . PHE A 1 241 ? 9.192   -48.976 -20.917  1.00 42.56 ? 241 PHE A CB    1 
ATOM   1804  C CG    . PHE A 1 241 ? 8.393   -50.154 -21.268  1.00 45.91 ? 241 PHE A CG    1 
ATOM   1805  C CD1   . PHE A 1 241 ? 8.371   -50.621 -22.582  1.00 46.37 ? 241 PHE A CD1   1 
ATOM   1806  C CD2   . PHE A 1 241 ? 7.588   -50.770 -20.295  1.00 48.43 ? 241 PHE A CD2   1 
ATOM   1807  C CE1   . PHE A 1 241 ? 7.590   -51.697 -22.912  1.00 49.00 ? 241 PHE A CE1   1 
ATOM   1808  C CE2   . PHE A 1 241 ? 6.797   -51.860 -20.626  1.00 49.29 ? 241 PHE A CE2   1 
ATOM   1809  C CZ    . PHE A 1 241 ? 6.795   -52.321 -21.916  1.00 47.49 ? 241 PHE A CZ    1 
ATOM   1810  N N     . ARG A 1 242 ? 9.199   -45.922 -19.562  1.00 37.49 ? 242 ARG A N     1 
ATOM   1811  C CA    . ARG A 1 242 ? 9.911   -44.703 -19.333  1.00 35.83 ? 242 ARG A CA    1 
ATOM   1812  C C     . ARG A 1 242 ? 11.229  -45.137 -18.774  1.00 35.37 ? 242 ARG A C     1 
ATOM   1813  O O     . ARG A 1 242 ? 11.269  -45.967 -17.855  1.00 35.08 ? 242 ARG A O     1 
ATOM   1814  C CB    . ARG A 1 242 ? 9.110   -43.768 -18.399  1.00 35.84 ? 242 ARG A CB    1 
ATOM   1815  C CG    . ARG A 1 242 ? 7.944   -43.042 -19.119  1.00 34.61 ? 242 ARG A CG    1 
ATOM   1816  C CD    . ARG A 1 242 ? 7.337   -41.884 -18.325  1.00 36.68 ? 242 ARG A CD    1 
ATOM   1817  N NE    . ARG A 1 242 ? 7.294   -42.195 -16.899  1.00 36.37 ? 242 ARG A NE    1 
ATOM   1818  C CZ    . ARG A 1 242 ? 6.415   -43.007 -16.344  1.00 33.95 ? 242 ARG A CZ    1 
ATOM   1819  N NH1   . ARG A 1 242 ? 5.466   -43.533 -17.091  1.00 28.13 ? 242 ARG A NH1   1 
ATOM   1820  N NH2   . ARG A 1 242 ? 6.495   -43.273 -15.038  1.00 36.49 ? 242 ARG A NH2   1 
ATOM   1821  N N     . VAL A 1 243 ? 12.326  -44.656 -19.377  1.00 34.23 ? 243 VAL A N     1 
ATOM   1822  C CA    . VAL A 1 243 ? 13.662  -45.033 -18.915  1.00 31.83 ? 243 VAL A CA    1 
ATOM   1823  C C     . VAL A 1 243 ? 13.761  -44.616 -17.444  1.00 31.40 ? 243 VAL A C     1 
ATOM   1824  O O     . VAL A 1 243 ? 13.393  -43.471 -17.109  1.00 30.81 ? 243 VAL A O     1 
ATOM   1825  C CB    . VAL A 1 243 ? 14.783  -44.332 -19.681  1.00 31.59 ? 243 VAL A CB    1 
ATOM   1826  C CG1   . VAL A 1 243 ? 16.084  -44.757 -19.059  1.00 32.85 ? 243 VAL A CG1   1 
ATOM   1827  C CG2   . VAL A 1 243 ? 14.791  -44.676 -21.219  1.00 30.56 ? 243 VAL A CG2   1 
ATOM   1828  N N     . PRO A 1 244 ? 14.237  -45.526 -16.563  1.00 30.30 ? 244 PRO A N     1 
ATOM   1829  C CA    . PRO A 1 244 ? 14.432  -45.126 -15.167  1.00 29.95 ? 244 PRO A CA    1 
ATOM   1830  C C     . PRO A 1 244 ? 15.351  -43.933 -15.053  1.00 29.64 ? 244 PRO A C     1 
ATOM   1831  O O     . PRO A 1 244 ? 16.220  -43.724 -15.964  1.00 29.69 ? 244 PRO A O     1 
ATOM   1832  C CB    . PRO A 1 244 ? 15.022  -46.374 -14.517  1.00 30.67 ? 244 PRO A CB    1 
ATOM   1833  C CG    . PRO A 1 244 ? 14.445  -47.511 -15.369  1.00 32.12 ? 244 PRO A CG    1 
ATOM   1834  C CD    . PRO A 1 244 ? 14.559  -46.947 -16.766  1.00 30.64 ? 244 PRO A CD    1 
ATOM   1835  N N     . THR A 1 245 ? 15.087  -43.128 -14.018  1.00 28.00 ? 245 THR A N     1 
ATOM   1836  C CA    . THR A 1 245 ? 15.753  -41.841 -13.794  1.00 28.77 ? 245 THR A CA    1 
ATOM   1837  C C     . THR A 1 245 ? 16.951  -42.042 -12.891  1.00 28.93 ? 245 THR A C     1 
ATOM   1838  O O     . THR A 1 245 ? 17.045  -43.057 -12.222  1.00 29.54 ? 245 THR A O     1 
ATOM   1839  C CB    . THR A 1 245 ? 14.858  -40.911 -13.008  1.00 29.44 ? 245 THR A CB    1 
ATOM   1840  O OG1   . THR A 1 245 ? 14.233  -41.675 -11.965  1.00 31.08 ? 245 THR A OG1   1 
ATOM   1841  C CG2   . THR A 1 245 ? 13.787  -40.270 -13.897  1.00 28.67 ? 245 THR A CG2   1 
ATOM   1842  N N     . PHE A 1 246 ? 17.834  -41.068 -12.827  1.00 28.95 ? 246 PHE A N     1 
ATOM   1843  C CA    . PHE A 1 246 ? 18.958  -41.150 -11.924  1.00 29.68 ? 246 PHE A CA    1 
ATOM   1844  C C     . PHE A 1 246 ? 18.478  -41.147 -10.469  1.00 31.70 ? 246 PHE A C     1 
ATOM   1845  O O     . PHE A 1 246 ? 19.191  -41.628 -9.562   1.00 32.89 ? 246 PHE A O     1 
ATOM   1846  C CB    . PHE A 1 246 ? 19.883  -39.967 -12.122  1.00 28.58 ? 246 PHE A CB    1 
ATOM   1847  C CG    . PHE A 1 246 ? 20.824  -40.075 -13.309  1.00 27.06 ? 246 PHE A CG    1 
ATOM   1848  C CD1   . PHE A 1 246 ? 20.504  -39.479 -14.524  1.00 26.83 ? 246 PHE A CD1   1 
ATOM   1849  C CD2   . PHE A 1 246 ? 22.060  -40.706 -13.174  1.00 25.16 ? 246 PHE A CD2   1 
ATOM   1850  C CE1   . PHE A 1 246 ? 21.393  -39.541 -15.612  1.00 27.25 ? 246 PHE A CE1   1 
ATOM   1851  C CE2   . PHE A 1 246 ? 22.951  -40.769 -14.221  1.00 27.05 ? 246 PHE A CE2   1 
ATOM   1852  C CZ    . PHE A 1 246 ? 22.643  -40.175 -15.443  1.00 25.56 ? 246 PHE A CZ    1 
ATOM   1853  N N     . LEU A 1 247 ? 17.295  -40.585 -10.243  1.00 33.07 ? 247 LEU A N     1 
ATOM   1854  C CA    . LEU A 1 247 ? 16.753  -40.404 -8.895   1.00 34.26 ? 247 LEU A CA    1 
ATOM   1855  C C     . LEU A 1 247 ? 16.228  -41.737 -8.378   1.00 35.85 ? 247 LEU A C     1 
ATOM   1856  O O     . LEU A 1 247 ? 16.323  -42.018 -7.154   1.00 35.62 ? 247 LEU A O     1 
ATOM   1857  C CB    . LEU A 1 247 ? 15.662  -39.312 -8.839   1.00 33.82 ? 247 LEU A CB    1 
ATOM   1858  C CG    . LEU A 1 247 ? 14.852  -39.104 -7.536   1.00 33.34 ? 247 LEU A CG    1 
ATOM   1859  C CD1   . LEU A 1 247 ? 15.565  -38.120 -6.628   1.00 30.07 ? 247 LEU A CD1   1 
ATOM   1860  C CD2   . LEU A 1 247 ? 13.381  -38.661 -7.768   1.00 32.71 ? 247 LEU A CD2   1 
ATOM   1861  N N     . SER A 1 248 ? 15.726  -42.569 -9.305   1.00 36.34 ? 248 SER A N     1 
ATOM   1862  C CA    . SER A 1 248 ? 15.270  -43.911 -8.931   1.00 36.88 ? 248 SER A CA    1 
ATOM   1863  C C     . SER A 1 248 ? 16.445  -44.793 -8.551   1.00 38.10 ? 248 SER A C     1 
ATOM   1864  O O     . SER A 1 248 ? 16.254  -45.898 -8.066   1.00 38.41 ? 248 SER A O     1 
ATOM   1865  C CB    . SER A 1 248 ? 14.440  -44.565 -10.055  1.00 37.57 ? 248 SER A CB    1 
ATOM   1866  O OG    . SER A 1 248 ? 15.211  -45.040 -11.150  1.00 34.35 ? 248 SER A OG    1 
ATOM   1867  N N     . MET A 1 249 ? 17.667  -44.315 -8.774   1.00 39.24 ? 249 MET A N     1 
ATOM   1868  C CA    . MET A 1 249 ? 18.841  -45.112 -8.418   1.00 41.49 ? 249 MET A CA    1 
ATOM   1869  C C     . MET A 1 249 ? 19.836  -44.355 -7.547   1.00 40.91 ? 249 MET A C     1 
ATOM   1870  O O     . MET A 1 249 ? 21.010  -44.729 -7.448   1.00 41.79 ? 249 MET A O     1 
ATOM   1871  C CB    . MET A 1 249 ? 19.522  -45.687 -9.663   1.00 41.22 ? 249 MET A CB    1 
ATOM   1872  C CG    . MET A 1 249 ? 19.654  -44.708 -10.789  1.00 42.20 ? 249 MET A CG    1 
ATOM   1873  S SD    . MET A 1 249 ? 20.482  -45.455 -12.184  1.00 44.74 ? 249 MET A SD    1 
ATOM   1874  C CE    . MET A 1 249 ? 20.699  -44.060 -13.241  1.00 43.88 ? 249 MET A CE    1 
ATOM   1875  N N     . ASP A 1 250 ? 19.348  -43.302 -6.911   1.00 40.02 ? 250 ASP A N     1 
ATOM   1876  C CA    . ASP A 1 250 ? 20.141  -42.508 -5.996   1.00 38.88 ? 250 ASP A CA    1 
ATOM   1877  C C     . ASP A 1 250 ? 20.151  -43.117 -4.604   1.00 38.50 ? 250 ASP A C     1 
ATOM   1878  O O     . ASP A 1 250 ? 19.464  -42.665 -3.715   1.00 36.84 ? 250 ASP A O     1 
ATOM   1879  C CB    . ASP A 1 250 ? 19.611  -41.082 -5.959   1.00 39.11 ? 250 ASP A CB    1 
ATOM   1880  C CG    . ASP A 1 250 ? 20.594  -40.099 -5.408   1.00 39.29 ? 250 ASP A CG    1 
ATOM   1881  O OD1   . ASP A 1 250 ? 21.798  -40.390 -5.403   1.00 41.58 ? 250 ASP A OD1   1 
ATOM   1882  O OD2   . ASP A 1 250 ? 20.261  -39.008 -4.949   1.00 41.07 ? 250 ASP A OD2   1 
ATOM   1883  N N     . VAL A 1 251 ? 20.948  -44.158 -4.434   1.00 37.99 ? 251 VAL A N     1 
ATOM   1884  C CA    . VAL A 1 251 ? 21.107  -44.792 -3.142   1.00 36.76 ? 251 VAL A CA    1 
ATOM   1885  C C     . VAL A 1 251 ? 21.936  -43.903 -2.260   1.00 36.41 ? 251 VAL A C     1 
ATOM   1886  O O     . VAL A 1 251 ? 21.875  -43.994 -1.054   1.00 36.19 ? 251 VAL A O     1 
ATOM   1887  C CB    . VAL A 1 251 ? 21.767  -46.175 -3.245   1.00 36.05 ? 251 VAL A CB    1 
ATOM   1888  C CG1   . VAL A 1 251 ? 20.824  -47.165 -3.826   1.00 32.07 ? 251 VAL A CG1   1 
ATOM   1889  C CG2   . VAL A 1 251 ? 23.013  -46.112 -4.066   1.00 34.90 ? 251 VAL A CG2   1 
ATOM   1890  N N     . ASP A 1 252 ? 22.709  -43.025 -2.876   1.00 37.09 ? 252 ASP A N     1 
ATOM   1891  C CA    . ASP A 1 252 ? 23.603  -42.125 -2.100   1.00 37.31 ? 252 ASP A CA    1 
ATOM   1892  C C     . ASP A 1 252 ? 23.138  -40.740 -1.665   1.00 37.36 ? 252 ASP A C     1 
ATOM   1893  O O     . ASP A 1 252 ? 23.754  -40.175 -0.760   1.00 39.28 ? 252 ASP A O     1 
ATOM   1894  C CB    . ASP A 1 252 ? 24.874  -41.882 -2.901   1.00 37.17 ? 252 ASP A CB    1 
ATOM   1895  C CG    . ASP A 1 252 ? 25.620  -43.131 -3.151   1.00 38.70 ? 252 ASP A CG    1 
ATOM   1896  O OD1   . ASP A 1 252 ? 25.261  -44.183 -2.512   1.00 42.00 ? 252 ASP A OD1   1 
ATOM   1897  O OD2   . ASP A 1 252 ? 26.562  -43.054 -3.967   1.00 34.54 ? 252 ASP A OD2   1 
ATOM   1898  N N     . GLY A 1 253 ? 22.155  -40.137 -2.337   1.00 35.85 ? 253 GLY A N     1 
ATOM   1899  C CA    . GLY A 1 253 ? 21.823  -38.763 -2.048   1.00 34.83 ? 253 GLY A CA    1 
ATOM   1900  C C     . GLY A 1 253 ? 22.729  -37.841 -2.857   1.00 35.92 ? 253 GLY A C     1 
ATOM   1901  O O     . GLY A 1 253 ? 23.260  -36.843 -2.329   1.00 36.15 ? 253 GLY A O     1 
ATOM   1902  N N     . ARG A 1 254 ? 22.909  -38.145 -4.140   1.00 35.25 ? 254 ARG A N     1 
ATOM   1903  C CA    . ARG A 1 254 ? 23.774  -37.318 -4.979   1.00 36.23 ? 254 ARG A CA    1 
ATOM   1904  C C     . ARG A 1 254 ? 23.106  -36.846 -6.278   1.00 35.07 ? 254 ARG A C     1 
ATOM   1905  O O     . ARG A 1 254 ? 23.788  -36.307 -7.177   1.00 34.30 ? 254 ARG A O     1 
ATOM   1906  C CB    . ARG A 1 254 ? 25.103  -38.026 -5.303   1.00 34.79 ? 254 ARG A CB    1 
ATOM   1907  C CG    . ARG A 1 254 ? 24.971  -39.152 -6.257   1.00 37.14 ? 254 ARG A CG    1 
ATOM   1908  C CD    . ARG A 1 254 ? 26.367  -39.699 -6.695   1.00 38.58 ? 254 ARG A CD    1 
ATOM   1909  N NE    . ARG A 1 254 ? 27.153  -40.111 -5.542   1.00 42.07 ? 254 ARG A NE    1 
ATOM   1910  C CZ    . ARG A 1 254 ? 28.060  -39.346 -4.949   1.00 42.99 ? 254 ARG A CZ    1 
ATOM   1911  N NH1   . ARG A 1 254 ? 28.322  -38.137 -5.437   1.00 40.57 ? 254 ARG A NH1   1 
ATOM   1912  N NH2   . ARG A 1 254 ? 28.718  -39.802 -3.883   1.00 41.17 ? 254 ARG A NH2   1 
ATOM   1913  N N     . VAL A 1 255 ? 21.798  -37.092 -6.370   1.00 33.75 ? 255 VAL A N     1 
ATOM   1914  C CA    . VAL A 1 255 ? 21.022  -36.721 -7.540   1.00 32.66 ? 255 VAL A CA    1 
ATOM   1915  C C     . VAL A 1 255 ? 20.169  -35.511 -7.245   1.00 32.15 ? 255 VAL A C     1 
ATOM   1916  O O     . VAL A 1 255 ? 19.534  -35.429 -6.200   1.00 32.36 ? 255 VAL A O     1 
ATOM   1917  C CB    . VAL A 1 255 ? 20.177  -37.885 -8.078   1.00 32.81 ? 255 VAL A CB    1 
ATOM   1918  C CG1   . VAL A 1 255 ? 19.330  -37.440 -9.247   1.00 31.46 ? 255 VAL A CG1   1 
ATOM   1919  C CG2   . VAL A 1 255 ? 21.077  -39.041 -8.506   1.00 31.20 ? 255 VAL A CG2   1 
ATOM   1920  N N     . ILE A 1 256 ? 20.207  -34.535 -8.151   1.00 31.83 ? 256 ILE A N     1 
ATOM   1921  C CA    . ILE A 1 256 ? 19.361  -33.347 -8.059   1.00 30.35 ? 256 ILE A CA    1 
ATOM   1922  C C     . ILE A 1 256 ? 18.564  -33.351 -9.299   1.00 30.83 ? 256 ILE A C     1 
ATOM   1923  O O     . ILE A 1 256 ? 19.094  -33.285 -10.406  1.00 30.93 ? 256 ILE A O     1 
ATOM   1924  C CB    . ILE A 1 256 ? 20.167  -32.041 -7.917   1.00 30.34 ? 256 ILE A CB    1 
ATOM   1925  C CG1   . ILE A 1 256 ? 21.097  -32.167 -6.712   1.00 26.94 ? 256 ILE A CG1   1 
ATOM   1926  C CG2   . ILE A 1 256 ? 19.230  -30.862 -7.763   1.00 30.67 ? 256 ILE A CG2   1 
ATOM   1927  C CD1   . ILE A 1 256 ? 21.755  -30.976 -6.353   1.00 25.39 ? 256 ILE A CD1   1 
ATOM   1928  N N     . ARG A 1 257 ? 17.263  -33.508 -9.113   1.00 30.99 ? 257 ARG A N     1 
ATOM   1929  C CA    . ARG A 1 257 ? 16.381  -33.714 -10.235  1.00 29.75 ? 257 ARG A CA    1 
ATOM   1930  C C     . ARG A 1 257 ? 15.599  -32.456 -10.487  1.00 29.99 ? 257 ARG A C     1 
ATOM   1931  O O     . ARG A 1 257 ? 15.058  -31.857 -9.547   1.00 30.72 ? 257 ARG A O     1 
ATOM   1932  C CB    . ARG A 1 257 ? 15.427  -34.861 -9.963   1.00 29.45 ? 257 ARG A CB    1 
ATOM   1933  C CG    . ARG A 1 257 ? 14.417  -35.047 -11.079  1.00 28.61 ? 257 ARG A CG    1 
ATOM   1934  C CD    . ARG A 1 257 ? 13.674  -36.386 -10.983  1.00 26.38 ? 257 ARG A CD    1 
ATOM   1935  N NE    . ARG A 1 257 ? 12.608  -36.457 -11.985  1.00 26.29 ? 257 ARG A NE    1 
ATOM   1936  C CZ    . ARG A 1 257 ? 12.801  -36.834 -13.250  1.00 23.70 ? 257 ARG A CZ    1 
ATOM   1937  N NH1   . ARG A 1 257 ? 11.783  -36.872 -14.102  1.00 20.37 ? 257 ARG A NH1   1 
ATOM   1938  N NH2   . ARG A 1 257 ? 14.031  -37.182 -13.653  1.00 21.19 ? 257 ARG A NH2   1 
ATOM   1939  N N     . ALA A 1 258 ? 15.545  -32.047 -11.753  1.00 29.28 ? 258 ALA A N     1 
ATOM   1940  C CA    . ALA A 1 258 ? 14.622  -31.003 -12.143  1.00 27.97 ? 258 ALA A CA    1 
ATOM   1941  C C     . ALA A 1 258 ? 13.461  -31.594 -12.995  1.00 27.04 ? 258 ALA A C     1 
ATOM   1942  O O     . ALA A 1 258 ? 13.663  -32.487 -13.826  1.00 25.90 ? 258 ALA A O     1 
ATOM   1943  C CB    . ALA A 1 258 ? 15.354  -29.932 -12.865  1.00 28.27 ? 258 ALA A CB    1 
ATOM   1944  N N     . ASP A 1 259 ? 12.255  -31.128 -12.714  1.00 24.77 ? 259 ASP A N     1 
ATOM   1945  C CA    . ASP A 1 259 ? 11.027  -31.562 -13.351  1.00 24.00 ? 259 ASP A CA    1 
ATOM   1946  C C     . ASP A 1 259 ? 10.280  -30.359 -13.757  1.00 23.41 ? 259 ASP A C     1 
ATOM   1947  O O     . ASP A 1 259 ? 10.330  -29.357 -13.083  1.00 23.32 ? 259 ASP A O     1 
ATOM   1948  C CB    . ASP A 1 259 ? 10.159  -32.287 -12.371  1.00 21.88 ? 259 ASP A CB    1 
ATOM   1949  C CG    . ASP A 1 259 ? 10.425  -33.718 -12.371  1.00 25.17 ? 259 ASP A CG    1 
ATOM   1950  O OD1   . ASP A 1 259 ? 10.086  -34.444 -13.365  1.00 24.17 ? 259 ASP A OD1   1 
ATOM   1951  O OD2   . ASP A 1 259 ? 11.000  -34.129 -11.358  1.00 31.82 ? 259 ASP A OD2   1 
ATOM   1952  N N     . SER A 1 260 ? 9.528   -30.496 -14.825  1.00 24.17 ? 260 SER A N     1 
ATOM   1953  C CA    . SER A 1 260 ? 8.911   -29.366 -15.491  1.00 25.77 ? 260 SER A CA    1 
ATOM   1954  C C     . SER A 1 260 ? 7.472   -29.717 -15.847  1.00 26.46 ? 260 SER A C     1 
ATOM   1955  O O     . SER A 1 260 ? 7.177   -30.819 -16.341  1.00 28.08 ? 260 SER A O     1 
ATOM   1956  C CB    . SER A 1 260 ? 9.708   -29.082 -16.770  1.00 24.51 ? 260 SER A CB    1 
ATOM   1957  O OG    . SER A 1 260 ? 9.372   -27.818 -17.314  1.00 28.60 ? 260 SER A OG    1 
ATOM   1958  N N     . PHE A 1 261 ? 6.573   -28.778 -15.638  1.00 27.56 ? 261 PHE A N     1 
ATOM   1959  C CA    . PHE A 1 261 ? 5.210   -28.890 -16.153  1.00 27.56 ? 261 PHE A CA    1 
ATOM   1960  C C     . PHE A 1 261 ? 5.121   -27.983 -17.377  1.00 27.65 ? 261 PHE A C     1 
ATOM   1961  O O     . PHE A 1 261 ? 4.048   -27.822 -17.970  1.00 27.87 ? 261 PHE A O     1 
ATOM   1962  C CB    . PHE A 1 261 ? 4.206   -28.456 -15.087  1.00 27.30 ? 261 PHE A CB    1 
ATOM   1963  C CG    . PHE A 1 261 ? 4.004   -29.451 -13.989  1.00 26.49 ? 261 PHE A CG    1 
ATOM   1964  C CD1   . PHE A 1 261 ? 3.907   -30.784 -14.261  1.00 29.42 ? 261 PHE A CD1   1 
ATOM   1965  C CD2   . PHE A 1 261 ? 3.849   -29.042 -12.687  1.00 27.12 ? 261 PHE A CD2   1 
ATOM   1966  C CE1   . PHE A 1 261 ? 3.731   -31.685 -13.249  1.00 28.30 ? 261 PHE A CE1   1 
ATOM   1967  C CE2   . PHE A 1 261 ? 3.652   -29.939 -11.682  1.00 26.44 ? 261 PHE A CE2   1 
ATOM   1968  C CZ    . PHE A 1 261 ? 3.609   -31.270 -11.973  1.00 28.53 ? 261 PHE A CZ    1 
ATOM   1969  N N     . SER A 1 262 ? 6.252   -27.435 -17.804  1.00 27.35 ? 262 SER A N     1 
ATOM   1970  C CA    . SER A 1 262 ? 6.236   -26.528 -18.989  1.00 28.05 ? 262 SER A CA    1 
ATOM   1971  C C     . SER A 1 262 ? 5.769   -27.118 -20.343  1.00 29.08 ? 262 SER A C     1 
ATOM   1972  O O     . SER A 1 262 ? 5.238   -26.397 -21.193  1.00 29.99 ? 262 SER A O     1 
ATOM   1973  C CB    . SER A 1 262 ? 7.550   -25.740 -19.122  1.00 26.84 ? 262 SER A CB    1 
ATOM   1974  O OG    . SER A 1 262 ? 7.617   -24.705 -18.132  1.00 22.64 ? 262 SER A OG    1 
HETATM 1975  N N1    . LLP A 1 263 ? 15.352  -27.274 -19.771  1.00 34.20 ? 263 LLP A N1    1 
HETATM 1976  C C2    . LLP A 1 263 ? 15.257  -27.647 -21.077  1.00 33.50 ? 263 LLP A C2    1 
HETATM 1977  C "C2'" . LLP A 1 263 ? 16.464  -28.236 -21.721  1.00 30.49 ? 263 LLP A "C2'" 1 
HETATM 1978  C C3    . LLP A 1 263 ? 14.069  -27.465 -21.770  1.00 33.04 ? 263 LLP A C3    1 
HETATM 1979  O O3    . LLP A 1 263 ? 13.970  -27.786 -22.942  1.00 33.31 ? 263 LLP A O3    1 
HETATM 1980  C C4    . LLP A 1 263 ? 12.973  -26.916 -21.137  1.00 31.64 ? 263 LLP A C4    1 
HETATM 1981  C "C4'" . LLP A 1 263 ? 11.697  -26.742 -21.902  1.00 31.82 ? 263 LLP A "C4'" 1 
HETATM 1982  C C5    . LLP A 1 263 ? 13.078  -26.542 -19.809  1.00 30.66 ? 263 LLP A C5    1 
HETATM 1983  C C6    . LLP A 1 263 ? 14.269  -26.736 -19.148  1.00 32.18 ? 263 LLP A C6    1 
HETATM 1984  C "C5'" . LLP A 1 263 ? 11.932  -25.934 -19.055  1.00 33.24 ? 263 LLP A "C5'" 1 
HETATM 1985  O OP4   . LLP A 1 263 ? 12.075  -24.686 -18.342  1.00 28.89 ? 263 LLP A OP4   1 
HETATM 1986  P P     . LLP A 1 263 ? 11.009  -24.296 -17.246  1.00 27.76 ? 263 LLP A P     1 
HETATM 1987  O OP1   . LLP A 1 263 ? 9.970   -23.632 -17.996  1.00 27.15 ? 263 LLP A OP1   1 
HETATM 1988  O OP2   . LLP A 1 263 ? 10.605  -25.562 -16.685  1.00 23.33 ? 263 LLP A OP2   1 
HETATM 1989  O OP3   . LLP A 1 263 ? 11.739  -23.438 -16.351  1.00 26.65 ? 263 LLP A OP3   1 
HETATM 1990  N N     . LLP A 1 263 ? 5.985   -28.399 -20.578  1.00 30.57 ? 263 LLP A N     1 
HETATM 1991  C CA    . LLP A 1 263 ? 5.668   -28.952 -21.888  1.00 30.88 ? 263 LLP A CA    1 
HETATM 1992  C CB    . LLP A 1 263 ? 6.750   -29.907 -22.374  1.00 31.55 ? 263 LLP A CB    1 
HETATM 1993  C CG    . LLP A 1 263 ? 7.967   -29.230 -22.939  1.00 30.06 ? 263 LLP A CG    1 
HETATM 1994  C CD    . LLP A 1 263 ? 8.957   -28.874 -21.863  1.00 24.65 ? 263 LLP A CD    1 
HETATM 1995  C CE    . LLP A 1 263 ? 9.561   -27.518 -22.102  1.00 29.55 ? 263 LLP A CE    1 
HETATM 1996  N NZ    . LLP A 1 263 ? 10.687  -27.245 -21.211  1.00 28.51 ? 263 LLP A NZ    1 
HETATM 1997  C C     . LLP A 1 263 ? 4.319   -29.623 -21.929  1.00 31.29 ? 263 LLP A C     1 
HETATM 1998  O O     . LLP A 1 263 ? 3.819   -29.950 -22.987  1.00 32.04 ? 263 LLP A O     1 
ATOM   1999  N N     . ILE A 1 264 ? 3.729   -29.827 -20.768  1.00 31.18 ? 264 ILE A N     1 
ATOM   2000  C CA    . ILE A 1 264 ? 2.523   -30.640 -20.675  1.00 30.16 ? 264 ILE A CA    1 
ATOM   2001  C C     . ILE A 1 264 ? 1.382   -29.861 -20.032  1.00 29.82 ? 264 ILE A C     1 
ATOM   2002  O O     . ILE A 1 264 ? 0.234   -29.952 -20.467  1.00 30.81 ? 264 ILE A O     1 
ATOM   2003  C CB    . ILE A 1 264 ? 2.801   -31.927 -19.876  1.00 31.23 ? 264 ILE A CB    1 
ATOM   2004  C CG1   . ILE A 1 264 ? 3.371   -31.587 -18.497  1.00 29.88 ? 264 ILE A CG1   1 
ATOM   2005  C CG2   . ILE A 1 264 ? 3.753   -32.834 -20.641  1.00 31.17 ? 264 ILE A CG2   1 
ATOM   2006  C CD1   . ILE A 1 264 ? 3.225   -32.701 -17.484  1.00 27.72 ? 264 ILE A CD1   1 
ATOM   2007  N N     . ILE A 1 265 ? 1.704   -29.098 -18.994  1.00 27.80 ? 265 ILE A N     1 
ATOM   2008  C CA    . ILE A 1 265 ? 0.687   -28.448 -18.177  1.00 26.83 ? 265 ILE A CA    1 
ATOM   2009  C C     . ILE A 1 265 ? 0.582   -26.963 -18.508  1.00 26.86 ? 265 ILE A C     1 
ATOM   2010  O O     . ILE A 1 265 ? -0.474  -26.482 -18.919  1.00 25.91 ? 265 ILE A O     1 
ATOM   2011  C CB    . ILE A 1 265 ? 0.997   -28.635 -16.680  1.00 28.01 ? 265 ILE A CB    1 
ATOM   2012  C CG1   . ILE A 1 265 ? 0.908   -30.114 -16.298  1.00 28.11 ? 265 ILE A CG1   1 
ATOM   2013  C CG2   . ILE A 1 265 ? 0.048   -27.810 -15.831  1.00 24.91 ? 265 ILE A CG2   1 
ATOM   2014  C CD1   . ILE A 1 265 ? 0.699   -30.351 -14.818  1.00 32.98 ? 265 ILE A CD1   1 
ATOM   2015  N N     . SER A 1 266 ? 1.683   -26.241 -18.326  1.00 26.58 ? 266 SER A N     1 
ATOM   2016  C CA    . SER A 1 266 ? 1.747   -24.841 -18.703  1.00 27.27 ? 266 SER A CA    1 
ATOM   2017  C C     . SER A 1 266 ? 3.175   -24.314 -18.621  1.00 27.34 ? 266 SER A C     1 
ATOM   2018  O O     . SER A 1 266 ? 3.868   -24.520 -17.625  1.00 28.28 ? 266 SER A O     1 
ATOM   2019  C CB    . SER A 1 266 ? 0.826   -24.005 -17.812  1.00 26.56 ? 266 SER A CB    1 
ATOM   2020  O OG    . SER A 1 266 ? 1.090   -22.621 -17.962  1.00 29.82 ? 266 SER A OG    1 
ATOM   2021  N N     . SER A 1 267 ? 3.610   -23.631 -19.676  1.00 27.10 ? 267 SER A N     1 
ATOM   2022  C CA    . SER A 1 267 ? 4.941   -22.989 -19.691  1.00 27.21 ? 267 SER A CA    1 
ATOM   2023  C C     . SER A 1 267 ? 4.817   -21.594 -19.054  1.00 27.30 ? 267 SER A C     1 
ATOM   2024  O O     . SER A 1 267 ? 5.765   -21.061 -18.410  1.00 27.14 ? 267 SER A O     1 
ATOM   2025  C CB    . SER A 1 267 ? 5.504   -22.910 -21.110  1.00 26.82 ? 267 SER A CB    1 
ATOM   2026  O OG    . SER A 1 267 ? 4.746   -22.013 -21.904  1.00 28.35 ? 267 SER A OG    1 
ATOM   2027  N N     . GLY A 1 268 ? 3.601   -21.058 -19.162  1.00 27.17 ? 268 GLY A N     1 
ATOM   2028  C CA    . GLY A 1 268 ? 3.301   -19.664 -18.854  1.00 25.99 ? 268 GLY A CA    1 
ATOM   2029  C C     . GLY A 1 268 ? 3.009   -19.404 -17.404  1.00 25.26 ? 268 GLY A C     1 
ATOM   2030  O O     . GLY A 1 268 ? 3.226   -18.294 -16.943  1.00 26.18 ? 268 GLY A O     1 
ATOM   2031  N N     . LEU A 1 269 ? 2.522   -20.415 -16.691  1.00 24.80 ? 269 LEU A N     1 
ATOM   2032  C CA    . LEU A 1 269 ? 2.202   -20.270 -15.277  1.00 23.80 ? 269 LEU A CA    1 
ATOM   2033  C C     . LEU A 1 269 ? 3.466   -20.254 -14.423  1.00 22.81 ? 269 LEU A C     1 
ATOM   2034  O O     . LEU A 1 269 ? 3.424   -19.907 -13.242  1.00 22.92 ? 269 LEU A O     1 
ATOM   2035  C CB    . LEU A 1 269 ? 1.273   -21.397 -14.820  1.00 22.15 ? 269 LEU A CB    1 
ATOM   2036  C CG    . LEU A 1 269 ? -0.126  -21.414 -15.439  1.00 22.94 ? 269 LEU A CG    1 
ATOM   2037  C CD1   . LEU A 1 269 ? -0.967  -22.527 -14.834  1.00 20.14 ? 269 LEU A CD1   1 
ATOM   2038  C CD2   . LEU A 1 269 ? -0.807  -20.065 -15.265  1.00 20.41 ? 269 LEU A CD2   1 
ATOM   2039  N N     . ARG A 1 270 ? 4.586   -20.631 -15.028  1.00 22.19 ? 270 ARG A N     1 
ATOM   2040  C CA    . ARG A 1 270 ? 5.858   -20.691 -14.316  1.00 21.48 ? 270 ARG A CA    1 
ATOM   2041  C C     . ARG A 1 270 ? 5.733   -21.503 -13.031  1.00 21.06 ? 270 ARG A C     1 
ATOM   2042  O O     . ARG A 1 270 ? 5.648   -20.944 -11.938  1.00 21.99 ? 270 ARG A O     1 
ATOM   2043  C CB    . ARG A 1 270 ? 6.362   -19.282 -14.000  1.00 21.68 ? 270 ARG A CB    1 
ATOM   2044  C CG    . ARG A 1 270 ? 6.588   -18.414 -15.228  1.00 19.55 ? 270 ARG A CG    1 
ATOM   2045  C CD    . ARG A 1 270 ? 7.217   -19.148 -16.400  1.00 17.97 ? 270 ARG A CD    1 
ATOM   2046  N NE    . ARG A 1 270 ? 8.612   -19.492 -16.145  1.00 18.95 ? 270 ARG A NE    1 
ATOM   2047  C CZ    . ARG A 1 270 ? 9.198   -20.601 -16.578  1.00 20.87 ? 270 ARG A CZ    1 
ATOM   2048  N NH1   . ARG A 1 270 ? 8.510   -21.481 -17.292  1.00 17.59 ? 270 ARG A NH1   1 
ATOM   2049  N NH2   . ARG A 1 270 ? 10.473  -20.832 -16.300  1.00 26.00 ? 270 ARG A NH2   1 
ATOM   2050  N N     . ILE A 1 271 ? 5.722   -22.825 -13.171  1.00 21.92 ? 271 ILE A N     1 
ATOM   2051  C CA    . ILE A 1 271 ? 5.587   -23.716 -12.025  1.00 24.17 ? 271 ILE A CA    1 
ATOM   2052  C C     . ILE A 1 271 ? 6.216   -25.075 -12.306  1.00 25.07 ? 271 ILE A C     1 
ATOM   2053  O O     . ILE A 1 271 ? 5.708   -25.849 -13.118  1.00 27.66 ? 271 ILE A O     1 
ATOM   2054  C CB    . ILE A 1 271 ? 4.104   -23.886 -11.647  1.00 24.99 ? 271 ILE A CB    1 
ATOM   2055  C CG1   . ILE A 1 271 ? 3.490   -22.536 -11.275  1.00 25.10 ? 271 ILE A CG1   1 
ATOM   2056  C CG2   . ILE A 1 271 ? 3.957   -24.878 -10.503  1.00 23.47 ? 271 ILE A CG2   1 
ATOM   2057  C CD1   . ILE A 1 271 ? 3.203   -22.382 -9.797   1.00 18.52 ? 271 ILE A CD1   1 
ATOM   2058  N N     . GLY A 1 272 ? 7.323   -25.360 -11.630  1.00 24.69 ? 272 GLY A N     1 
ATOM   2059  C CA    . GLY A 1 272 ? 8.044   -26.607 -11.835  1.00 26.29 ? 272 GLY A CA    1 
ATOM   2060  C C     . GLY A 1 272 ? 8.593   -27.061 -10.486  1.00 27.48 ? 272 GLY A C     1 
ATOM   2061  O O     . GLY A 1 272 ? 8.283   -26.487 -9.430   1.00 27.16 ? 272 GLY A O     1 
ATOM   2062  N N     . PHE A 1 273 ? 9.405   -28.100 -10.506  1.00 27.86 ? 273 PHE A N     1 
ATOM   2063  C CA    . PHE A 1 273 ? 9.711   -28.697 -9.258   1.00 29.24 ? 273 PHE A CA    1 
ATOM   2064  C C     . PHE A 1 273 ? 11.077  -29.335 -9.212   1.00 30.71 ? 273 PHE A C     1 
ATOM   2065  O O     . PHE A 1 273 ? 11.596  -29.793 -10.216  1.00 30.09 ? 273 PHE A O     1 
ATOM   2066  C CB    . PHE A 1 273 ? 8.535   -29.532 -8.698   1.00 27.64 ? 273 PHE A CB    1 
ATOM   2067  C CG    . PHE A 1 273 ? 8.077   -30.658 -9.545   1.00 25.56 ? 273 PHE A CG    1 
ATOM   2068  C CD1   . PHE A 1 273 ? 7.165   -30.455 -10.605  1.00 28.41 ? 273 PHE A CD1   1 
ATOM   2069  C CD2   . PHE A 1 273 ? 8.419   -31.966 -9.193   1.00 24.77 ? 273 PHE A CD2   1 
ATOM   2070  C CE1   . PHE A 1 273 ? 6.687   -31.542 -11.393  1.00 28.15 ? 273 PHE A CE1   1 
ATOM   2071  C CE2   . PHE A 1 273 ? 7.931   -33.072 -9.910   1.00 26.86 ? 273 PHE A CE2   1 
ATOM   2072  C CZ    . PHE A 1 273 ? 7.058   -32.878 -11.048  1.00 27.04 ? 273 PHE A CZ    1 
ATOM   2073  N N     . LEU A 1 274 ? 11.674  -29.281 -8.038   1.00 32.65 ? 274 LEU A N     1 
ATOM   2074  C CA    . LEU A 1 274 ? 13.049  -29.715 -7.879   1.00 35.33 ? 274 LEU A CA    1 
ATOM   2075  C C     . LEU A 1 274 ? 13.091  -30.749 -6.764   1.00 35.73 ? 274 LEU A C     1 
ATOM   2076  O O     . LEU A 1 274 ? 12.708  -30.439 -5.612   1.00 35.19 ? 274 LEU A O     1 
ATOM   2077  C CB    . LEU A 1 274 ? 13.935  -28.520 -7.545   1.00 34.91 ? 274 LEU A CB    1 
ATOM   2078  C CG    . LEU A 1 274 ? 15.437  -28.710 -7.763   1.00 37.70 ? 274 LEU A CG    1 
ATOM   2079  C CD1   . LEU A 1 274 ? 15.773  -28.716 -9.229   1.00 35.14 ? 274 LEU A CD1   1 
ATOM   2080  C CD2   . LEU A 1 274 ? 16.235  -27.594 -7.031   1.00 37.42 ? 274 LEU A CD2   1 
ATOM   2081  N N     . THR A 1 275 ? 13.475  -31.982 -7.113   1.00 35.88 ? 275 THR A N     1 
ATOM   2082  C CA    . THR A 1 275 ? 13.672  -33.003 -6.084   1.00 36.69 ? 275 THR A CA    1 
ATOM   2083  C C     . THR A 1 275 ? 15.164  -33.376 -5.833   1.00 36.30 ? 275 THR A C     1 
ATOM   2084  O O     . THR A 1 275 ? 16.003  -33.311 -6.740   1.00 35.00 ? 275 THR A O     1 
ATOM   2085  C CB    . THR A 1 275 ? 12.722  -34.226 -6.226   1.00 36.63 ? 275 THR A CB    1 
ATOM   2086  O OG1   . THR A 1 275 ? 12.910  -35.080 -5.095   1.00 38.91 ? 275 THR A OG1   1 
ATOM   2087  C CG2   . THR A 1 275 ? 12.999  -35.026 -7.474   1.00 38.40 ? 275 THR A CG2   1 
ATOM   2088  N N     . GLY A 1 276 ? 15.484  -33.720 -4.579   1.00 36.99 ? 276 GLY A N     1 
ATOM   2089  C CA    . GLY A 1 276 ? 16.904  -33.760 -4.128   1.00 36.82 ? 276 GLY A CA    1 
ATOM   2090  C C     . GLY A 1 276 ? 17.163  -33.836 -2.633   1.00 37.11 ? 276 GLY A C     1 
ATOM   2091  O O     . GLY A 1 276 ? 16.204  -33.683 -1.820   1.00 37.66 ? 276 GLY A O     1 
ATOM   2092  N N     . PRO A 1 277 ? 18.457  -34.058 -2.237   1.00 36.25 ? 277 PRO A N     1 
ATOM   2093  C CA    . PRO A 1 277 ? 18.778  -34.128 -0.817   1.00 35.67 ? 277 PRO A CA    1 
ATOM   2094  C C     . PRO A 1 277 ? 18.382  -32.904 -0.055   1.00 34.69 ? 277 PRO A C     1 
ATOM   2095  O O     . PRO A 1 277 ? 18.717  -31.796 -0.458   1.00 36.20 ? 277 PRO A O     1 
ATOM   2096  C CB    . PRO A 1 277 ? 20.320  -34.283 -0.809   1.00 34.99 ? 277 PRO A CB    1 
ATOM   2097  C CG    . PRO A 1 277 ? 20.575  -35.049 -2.021   1.00 35.20 ? 277 PRO A CG    1 
ATOM   2098  C CD    . PRO A 1 277 ? 19.678  -34.307 -3.030   1.00 36.04 ? 277 PRO A CD    1 
ATOM   2099  N N     . LYS A 1 278 ? 17.712  -33.130 1.067    1.00 33.73 ? 278 LYS A N     1 
ATOM   2100  C CA    . LYS A 1 278 ? 17.193  -32.072 1.911    1.00 32.08 ? 278 LYS A CA    1 
ATOM   2101  C C     . LYS A 1 278 ? 18.142  -30.898 2.156    1.00 30.87 ? 278 LYS A C     1 
ATOM   2102  O O     . LYS A 1 278 ? 17.727  -29.749 1.949    1.00 29.57 ? 278 LYS A O     1 
ATOM   2103  C CB    . LYS A 1 278 ? 16.631  -32.646 3.228    1.00 33.05 ? 278 LYS A CB    1 
ATOM   2104  C CG    . LYS A 1 278 ? 15.752  -31.595 4.004    1.00 33.32 ? 278 LYS A CG    1 
ATOM   2105  C CD    . LYS A 1 278 ? 14.653  -32.177 4.891    1.00 32.87 ? 278 LYS A CD    1 
ATOM   2106  C CE    . LYS A 1 278 ? 13.785  -31.003 5.444    1.00 37.30 ? 278 LYS A CE    1 
ATOM   2107  N NZ    . LYS A 1 278 ? 13.012  -31.297 6.705    1.00 38.18 ? 278 LYS A NZ    1 
ATOM   2108  N N     . PRO A 1 279 ? 19.410  -31.178 2.575    1.00 29.72 ? 279 PRO A N     1 
ATOM   2109  C CA    . PRO A 1 279 ? 20.323  -30.106 2.930    1.00 29.01 ? 279 PRO A CA    1 
ATOM   2110  C C     . PRO A 1 279 ? 20.621  -29.234 1.714    1.00 28.37 ? 279 PRO A C     1 
ATOM   2111  O O     . PRO A 1 279 ? 20.912  -28.021 1.860    1.00 27.28 ? 279 PRO A O     1 
ATOM   2112  C CB    . PRO A 1 279 ? 21.634  -30.863 3.323    1.00 30.06 ? 279 PRO A CB    1 
ATOM   2113  C CG    . PRO A 1 279 ? 21.204  -32.226 3.719    1.00 28.86 ? 279 PRO A CG    1 
ATOM   2114  C CD    . PRO A 1 279 ? 20.090  -32.497 2.698    1.00 29.93 ? 279 PRO A CD    1 
ATOM   2115  N N     . LEU A 1 280 ? 20.609  -29.875 0.540    1.00 27.20 ? 280 LEU A N     1 
ATOM   2116  C CA    . LEU A 1 280 ? 20.785  -29.208 -0.695   1.00 26.98 ? 280 LEU A CA    1 
ATOM   2117  C C     . LEU A 1 280 ? 19.559  -28.378 -1.120   1.00 27.77 ? 280 LEU A C     1 
ATOM   2118  O O     . LEU A 1 280 ? 19.691  -27.214 -1.539   1.00 26.27 ? 280 LEU A O     1 
ATOM   2119  C CB    . LEU A 1 280 ? 21.197  -30.211 -1.754   1.00 28.58 ? 280 LEU A CB    1 
ATOM   2120  C CG    . LEU A 1 280 ? 22.599  -30.886 -1.612   1.00 27.81 ? 280 LEU A CG    1 
ATOM   2121  C CD1   . LEU A 1 280 ? 23.018  -31.317 -2.955   1.00 28.47 ? 280 LEU A CD1   1 
ATOM   2122  C CD2   . LEU A 1 280 ? 23.693  -29.992 -1.016   1.00 24.72 ? 280 LEU A CD2   1 
ATOM   2123  N N     . ILE A 1 281 ? 18.370  -28.967 -0.996   1.00 28.19 ? 281 ILE A N     1 
ATOM   2124  C CA    . ILE A 1 281 ? 17.130  -28.275 -1.306   1.00 28.81 ? 281 ILE A CA    1 
ATOM   2125  C C     . ILE A 1 281 ? 16.984  -27.082 -0.369   1.00 28.93 ? 281 ILE A C     1 
ATOM   2126  O O     . ILE A 1 281 ? 16.536  -25.988 -0.756   1.00 29.90 ? 281 ILE A O     1 
ATOM   2127  C CB    . ILE A 1 281 ? 15.991  -29.231 -1.089   1.00 29.33 ? 281 ILE A CB    1 
ATOM   2128  C CG1   . ILE A 1 281 ? 16.062  -30.340 -2.156   1.00 32.65 ? 281 ILE A CG1   1 
ATOM   2129  C CG2   . ILE A 1 281 ? 14.660  -28.498 -1.080   1.00 29.27 ? 281 ILE A CG2   1 
ATOM   2130  C CD1   . ILE A 1 281 ? 15.340  -30.003 -3.474   1.00 31.82 ? 281 ILE A CD1   1 
ATOM   2131  N N     . GLU A 1 282 ? 17.408  -27.296 0.864    1.00 28.21 ? 282 GLU A N     1 
ATOM   2132  C CA    . GLU A 1 282 ? 17.397  -26.281 1.885    1.00 27.99 ? 282 GLU A CA    1 
ATOM   2133  C C     . GLU A 1 282 ? 18.140  -25.009 1.504    1.00 28.09 ? 282 GLU A C     1 
ATOM   2134  O O     . GLU A 1 282 ? 17.583  -23.922 1.673    1.00 28.44 ? 282 GLU A O     1 
ATOM   2135  C CB    . GLU A 1 282 ? 17.969  -26.873 3.159    1.00 27.97 ? 282 GLU A CB    1 
ATOM   2136  C CG    . GLU A 1 282 ? 17.617  -26.094 4.329    1.00 30.28 ? 282 GLU A CG    1 
ATOM   2137  C CD    . GLU A 1 282 ? 18.485  -26.445 5.464    1.00 32.75 ? 282 GLU A CD    1 
ATOM   2138  O OE1   . GLU A 1 282 ? 18.460  -27.621 5.889    1.00 35.44 ? 282 GLU A OE1   1 
ATOM   2139  O OE2   . GLU A 1 282 ? 19.182  -25.539 5.934    1.00 32.55 ? 282 GLU A OE2   1 
ATOM   2140  N N     . ARG A 1 283 ? 19.365  -25.127 0.970    1.00 27.33 ? 283 ARG A N     1 
ATOM   2141  C CA    . ARG A 1 283 ? 20.059  -23.946 0.411    1.00 27.81 ? 283 ARG A CA    1 
ATOM   2142  C C     . ARG A 1 283 ? 19.249  -23.271 -0.721   1.00 27.79 ? 283 ARG A C     1 
ATOM   2143  O O     . ARG A 1 283 ? 19.322  -22.057 -0.906   1.00 28.16 ? 283 ARG A O     1 
ATOM   2144  C CB    . ARG A 1 283 ? 21.526  -24.214 -0.055   1.00 28.45 ? 283 ARG A CB    1 
ATOM   2145  C CG    . ARG A 1 283 ? 22.568  -24.852 0.972    1.00 27.24 ? 283 ARG A CG    1 
ATOM   2146  C CD    . ARG A 1 283 ? 22.212  -24.632 2.481    1.00 31.12 ? 283 ARG A CD    1 
ATOM   2147  N NE    . ARG A 1 283 ? 22.410  -23.256 2.890    1.00 32.76 ? 283 ARG A NE    1 
ATOM   2148  C CZ    . ARG A 1 283 ? 22.119  -22.738 4.086    1.00 36.92 ? 283 ARG A CZ    1 
ATOM   2149  N NH1   . ARG A 1 283 ? 21.571  -23.451 5.070    1.00 37.39 ? 283 ARG A NH1   1 
ATOM   2150  N NH2   . ARG A 1 283 ? 22.383  -21.460 4.301    1.00 39.30 ? 283 ARG A NH2   1 
ATOM   2151  N N     . VAL A 1 284 ? 18.429  -24.033 -1.429   1.00 27.28 ? 284 VAL A N     1 
ATOM   2152  C CA    . VAL A 1 284 ? 17.683  -23.459 -2.559   1.00 27.84 ? 284 VAL A CA    1 
ATOM   2153  C C     . VAL A 1 284 ? 16.419  -22.686 -2.082   1.00 28.17 ? 284 VAL A C     1 
ATOM   2154  O O     . VAL A 1 284 ? 16.039  -21.635 -2.621   1.00 28.55 ? 284 VAL A O     1 
ATOM   2155  C CB    . VAL A 1 284 ? 17.320  -24.563 -3.561   1.00 27.92 ? 284 VAL A CB    1 
ATOM   2156  C CG1   . VAL A 1 284 ? 16.239  -24.082 -4.583   1.00 29.55 ? 284 VAL A CG1   1 
ATOM   2157  C CG2   . VAL A 1 284 ? 18.566  -25.038 -4.272   1.00 26.07 ? 284 VAL A CG2   1 
ATOM   2158  N N     . ILE A 1 285 ? 15.765  -23.237 -1.070   1.00 27.81 ? 285 ILE A N     1 
ATOM   2159  C CA    . ILE A 1 285 ? 14.568  -22.659 -0.533   1.00 26.85 ? 285 ILE A CA    1 
ATOM   2160  C C     . ILE A 1 285 ? 14.980  -21.360 0.128    1.00 27.22 ? 285 ILE A C     1 
ATOM   2161  O O     . ILE A 1 285 ? 14.281  -20.327 -0.029   1.00 27.18 ? 285 ILE A O     1 
ATOM   2162  C CB    . ILE A 1 285 ? 13.919  -23.636 0.430    1.00 27.41 ? 285 ILE A CB    1 
ATOM   2163  C CG1   . ILE A 1 285 ? 13.451  -24.847 -0.382   1.00 25.62 ? 285 ILE A CG1   1 
ATOM   2164  C CG2   . ILE A 1 285 ? 12.806  -22.949 1.266    1.00 27.48 ? 285 ILE A CG2   1 
ATOM   2165  C CD1   . ILE A 1 285 ? 12.812  -25.893 0.408    1.00 29.36 ? 285 ILE A CD1   1 
ATOM   2166  N N     . LEU A 1 286 ? 16.146  -21.371 0.799    1.00 26.55 ? 286 LEU A N     1 
ATOM   2167  C CA    . LEU A 1 286 ? 16.573  -20.161 1.493    1.00 25.12 ? 286 LEU A CA    1 
ATOM   2168  C C     . LEU A 1 286 ? 16.909  -19.093 0.518    1.00 24.35 ? 286 LEU A C     1 
ATOM   2169  O O     . LEU A 1 286 ? 16.652  -17.961 0.808    1.00 25.59 ? 286 LEU A O     1 
ATOM   2170  C CB    . LEU A 1 286 ? 17.679  -20.359 2.524    1.00 23.96 ? 286 LEU A CB    1 
ATOM   2171  C CG    . LEU A 1 286 ? 17.615  -21.216 3.788    1.00 25.89 ? 286 LEU A CG    1 
ATOM   2172  C CD1   . LEU A 1 286 ? 19.022  -21.205 4.477    1.00 20.23 ? 286 LEU A CD1   1 
ATOM   2173  C CD2   . LEU A 1 286 ? 16.533  -20.761 4.781    1.00 28.36 ? 286 LEU A CD2   1 
ATOM   2174  N N     . HIS A 1 287 ? 17.463  -19.440 -0.647   1.00 26.05 ? 287 HIS A N     1 
ATOM   2175  C CA    . HIS A 1 287 ? 17.704  -18.457 -1.732   1.00 26.03 ? 287 HIS A CA    1 
ATOM   2176  C C     . HIS A 1 287 ? 16.395  -17.988 -2.377   1.00 26.52 ? 287 HIS A C     1 
ATOM   2177  O O     . HIS A 1 287 ? 16.253  -16.809 -2.722   1.00 26.52 ? 287 HIS A O     1 
ATOM   2178  C CB    . HIS A 1 287 ? 18.645  -19.017 -2.821   1.00 25.81 ? 287 HIS A CB    1 
ATOM   2179  C CG    . HIS A 1 287 ? 19.146  -17.973 -3.791   1.00 25.88 ? 287 HIS A CG    1 
ATOM   2180  N ND1   . HIS A 1 287 ? 19.904  -18.285 -4.899   1.00 24.50 ? 287 HIS A ND1   1 
ATOM   2181  C CD2   . HIS A 1 287 ? 19.005  -16.624 -3.811   1.00 25.00 ? 287 HIS A CD2   1 
ATOM   2182  C CE1   . HIS A 1 287 ? 20.207  -17.182 -5.558   1.00 22.74 ? 287 HIS A CE1   1 
ATOM   2183  N NE2   . HIS A 1 287 ? 19.673  -16.160 -4.922   1.00 22.97 ? 287 HIS A NE2   1 
ATOM   2184  N N     . ILE A 1 288 ? 15.441  -18.904 -2.555   1.00 26.50 ? 288 ILE A N     1 
ATOM   2185  C CA    . ILE A 1 288 ? 14.092  -18.485 -3.004   1.00 27.76 ? 288 ILE A CA    1 
ATOM   2186  C C     . ILE A 1 288 ? 13.463  -17.420 -2.058   1.00 28.71 ? 288 ILE A C     1 
ATOM   2187  O O     . ILE A 1 288 ? 12.684  -16.564 -2.509   1.00 28.50 ? 288 ILE A O     1 
ATOM   2188  C CB    . ILE A 1 288 ? 13.150  -19.707 -3.180   1.00 27.16 ? 288 ILE A CB    1 
ATOM   2189  C CG1   . ILE A 1 288 ? 13.495  -20.452 -4.494   1.00 27.32 ? 288 ILE A CG1   1 
ATOM   2190  C CG2   . ILE A 1 288 ? 11.754  -19.300 -3.195   1.00 26.23 ? 288 ILE A CG2   1 
ATOM   2191  C CD1   . ILE A 1 288 ? 13.024  -21.915 -4.503   1.00 23.17 ? 288 ILE A CD1   1 
ATOM   2192  N N     . GLN A 1 289 ? 13.803  -17.465 -0.767   1.00 29.00 ? 289 GLN A N     1 
ATOM   2193  C CA    . GLN A 1 289 ? 13.082  -16.651 0.249    1.00 30.44 ? 289 GLN A CA    1 
ATOM   2194  C C     . GLN A 1 289 ? 13.408  -15.167 0.209    1.00 28.99 ? 289 GLN A C     1 
ATOM   2195  O O     . GLN A 1 289 ? 12.741  -14.385 0.819    1.00 28.38 ? 289 GLN A O     1 
ATOM   2196  C CB    . GLN A 1 289 ? 13.349  -17.183 1.655    1.00 30.65 ? 289 GLN A CB    1 
ATOM   2197  C CG    . GLN A 1 289 ? 12.771  -18.588 1.871    1.00 32.46 ? 289 GLN A CG    1 
ATOM   2198  C CD    . GLN A 1 289 ? 12.749  -19.010 3.338    1.00 34.69 ? 289 GLN A CD    1 
ATOM   2199  O OE1   . GLN A 1 289 ? 13.805  -19.064 4.027    1.00 33.12 ? 289 GLN A OE1   1 
ATOM   2200  N NE2   . GLN A 1 289 ? 11.537  -19.397 3.813    1.00 36.72 ? 289 GLN A NE2   1 
ATOM   2201  N N     . VAL A 1 290 ? 14.455  -14.796 -0.513   1.00 28.79 ? 290 VAL A N     1 
ATOM   2202  C CA    . VAL A 1 290 ? 14.894  -13.404 -0.594   1.00 27.33 ? 290 VAL A CA    1 
ATOM   2203  C C     . VAL A 1 290 ? 14.888  -12.943 -2.042   1.00 26.88 ? 290 VAL A C     1 
ATOM   2204  O O     . VAL A 1 290 ? 15.169  -11.797 -2.331   1.00 25.85 ? 290 VAL A O     1 
ATOM   2205  C CB    . VAL A 1 290 ? 16.320  -13.189 0.015    1.00 27.78 ? 290 VAL A CB    1 
ATOM   2206  C CG1   . VAL A 1 290 ? 16.368  -13.603 1.525    1.00 25.99 ? 290 VAL A CG1   1 
ATOM   2207  C CG2   . VAL A 1 290 ? 17.450  -13.877 -0.866   1.00 24.91 ? 290 VAL A CG2   1 
ATOM   2208  N N     . SER A 1 291 ? 14.623  -13.895 -2.938   1.00 27.43 ? 291 SER A N     1 
ATOM   2209  C CA    . SER A 1 291 ? 14.285  -13.633 -4.352   1.00 27.71 ? 291 SER A CA    1 
ATOM   2210  C C     . SER A 1 291 ? 12.776  -13.618 -4.688   1.00 27.59 ? 291 SER A C     1 
ATOM   2211  O O     . SER A 1 291 ? 12.149  -12.549 -4.649   1.00 28.71 ? 291 SER A O     1 
ATOM   2212  C CB    . SER A 1 291 ? 15.028  -14.568 -5.281   1.00 27.59 ? 291 SER A CB    1 
ATOM   2213  O OG    . SER A 1 291 ? 14.829  -15.895 -4.861   1.00 31.20 ? 291 SER A OG    1 
ATOM   2214  N N     . THR A 1 292 ? 12.190  -14.769 -5.003   1.00 26.92 ? 292 THR A N     1 
ATOM   2215  C CA    . THR A 1 292 ? 10.827  -14.796 -5.502   1.00 26.96 ? 292 THR A CA    1 
ATOM   2216  C C     . THR A 1 292 ? 9.793   -14.933 -4.389   1.00 27.19 ? 292 THR A C     1 
ATOM   2217  O O     . THR A 1 292 ? 8.601   -14.776 -4.649   1.00 27.10 ? 292 THR A O     1 
ATOM   2218  C CB    . THR A 1 292 ? 10.574  -15.906 -6.556   1.00 27.12 ? 292 THR A CB    1 
ATOM   2219  O OG1   . THR A 1 292 ? 11.251  -17.111 -6.176   1.00 27.86 ? 292 THR A OG1   1 
ATOM   2220  C CG2   . THR A 1 292 ? 11.087  -15.488 -7.869   1.00 26.26 ? 292 THR A CG2   1 
ATOM   2221  N N     . LEU A 1 293 ? 10.258  -15.157 -3.155   1.00 27.37 ? 293 LEU A N     1 
ATOM   2222  C CA    . LEU A 1 293 ? 9.424   -15.615 -1.999   1.00 26.94 ? 293 LEU A CA    1 
ATOM   2223  C C     . LEU A 1 293 ? 8.817   -17.021 -2.261   1.00 25.98 ? 293 LEU A C     1 
ATOM   2224  O O     . LEU A 1 293 ? 9.203   -18.013 -1.632   1.00 24.68 ? 293 LEU A O     1 
ATOM   2225  C CB    . LEU A 1 293 ? 8.354   -14.580 -1.573   1.00 27.36 ? 293 LEU A CB    1 
ATOM   2226  C CG    . LEU A 1 293 ? 8.852   -13.199 -1.090   1.00 28.97 ? 293 LEU A CG    1 
ATOM   2227  C CD1   . LEU A 1 293 ? 7.812   -12.615 -0.190   1.00 26.56 ? 293 LEU A CD1   1 
ATOM   2228  C CD2   . LEU A 1 293 ? 10.244  -13.201 -0.356   1.00 18.15 ? 293 LEU A CD2   1 
ATOM   2229  N N     . HIS A 1 294 ? 7.926   -17.104 -3.247   1.00 24.90 ? 294 HIS A N     1 
ATOM   2230  C CA    . HIS A 1 294 ? 7.402   -18.412 -3.672   1.00 23.01 ? 294 HIS A CA    1 
ATOM   2231  C C     . HIS A 1 294 ? 6.840   -18.405 -5.091   1.00 22.24 ? 294 HIS A C     1 
ATOM   2232  O O     . HIS A 1 294 ? 6.766   -17.331 -5.733   1.00 20.28 ? 294 HIS A O     1 
ATOM   2233  C CB    . HIS A 1 294 ? 6.303   -18.793 -2.705   1.00 22.07 ? 294 HIS A CB    1 
ATOM   2234  C CG    . HIS A 1 294 ? 5.203   -17.805 -2.667   1.00 21.84 ? 294 HIS A CG    1 
ATOM   2235  N ND1   . HIS A 1 294 ? 5.243   -16.691 -1.863   1.00 21.35 ? 294 HIS A ND1   1 
ATOM   2236  C CD2   . HIS A 1 294 ? 4.040   -17.740 -3.358   1.00 19.30 ? 294 HIS A CD2   1 
ATOM   2237  C CE1   . HIS A 1 294 ? 4.140   -15.991 -2.039   1.00 22.70 ? 294 HIS A CE1   1 
ATOM   2238  N NE2   . HIS A 1 294 ? 3.394   -16.607 -2.940   1.00 21.39 ? 294 HIS A NE2   1 
ATOM   2239  N N     . PRO A 1 295 ? 6.402   -19.595 -5.586   1.00 22.59 ? 295 PRO A N     1 
ATOM   2240  C CA    . PRO A 1 295 ? 5.700   -19.620 -6.886   1.00 22.07 ? 295 PRO A CA    1 
ATOM   2241  C C     . PRO A 1 295 ? 4.336   -18.974 -6.729   1.00 22.24 ? 295 PRO A C     1 
ATOM   2242  O O     . PRO A 1 295 ? 3.747   -19.047 -5.650   1.00 23.15 ? 295 PRO A O     1 
ATOM   2243  C CB    . PRO A 1 295 ? 5.529   -21.115 -7.153   1.00 21.92 ? 295 PRO A CB    1 
ATOM   2244  C CG    . PRO A 1 295 ? 6.451   -21.808 -6.177   1.00 22.75 ? 295 PRO A CG    1 
ATOM   2245  C CD    . PRO A 1 295 ? 6.500   -20.954 -5.001   1.00 22.35 ? 295 PRO A CD    1 
ATOM   2246  N N     . SER A 1 296 ? 3.826   -18.319 -7.754   1.00 21.57 ? 296 SER A N     1 
ATOM   2247  C CA    . SER A 1 296 ? 2.480   -17.760 -7.639   1.00 22.36 ? 296 SER A CA    1 
ATOM   2248  C C     . SER A 1 296 ? 1.505   -18.680 -6.843   1.00 21.50 ? 296 SER A C     1 
ATOM   2249  O O     . SER A 1 296 ? 1.319   -19.833 -7.202   1.00 22.19 ? 296 SER A O     1 
ATOM   2250  C CB    . SER A 1 296 ? 1.926   -17.492 -9.046   1.00 21.86 ? 296 SER A CB    1 
ATOM   2251  O OG    . SER A 1 296 ? 0.570   -17.165 -8.961   1.00 24.32 ? 296 SER A OG    1 
ATOM   2252  N N     . THR A 1 297 ? 0.904   -18.189 -5.773   1.00 21.65 ? 297 THR A N     1 
ATOM   2253  C CA    . THR A 1 297 ? -0.060  -19.010 -4.982   1.00 22.00 ? 297 THR A CA    1 
ATOM   2254  C C     . THR A 1 297 ? -1.238  -19.404 -5.874   1.00 23.03 ? 297 THR A C     1 
ATOM   2255  O O     . THR A 1 297 ? -1.550  -20.558 -6.048   1.00 23.24 ? 297 THR A O     1 
ATOM   2256  C CB    . THR A 1 297 ? -0.561  -18.268 -3.704   1.00 22.23 ? 297 THR A CB    1 
ATOM   2257  O OG1   . THR A 1 297 ? 0.560   -17.659 -3.033   1.00 19.48 ? 297 THR A OG1   1 
ATOM   2258  C CG2   . THR A 1 297 ? -1.295  -19.261 -2.707   1.00 22.05 ? 297 THR A CG2   1 
ATOM   2259  N N     . PHE A 1 298 ? -1.868  -18.411 -6.471   1.00 25.30 ? 298 PHE A N     1 
ATOM   2260  C CA    . PHE A 1 298 ? -2.898  -18.587 -7.510   1.00 25.66 ? 298 PHE A CA    1 
ATOM   2261  C C     . PHE A 1 298 ? -2.708  -19.704 -8.499   1.00 25.21 ? 298 PHE A C     1 
ATOM   2262  O O     . PHE A 1 298 ? -3.669  -20.466 -8.759   1.00 25.04 ? 298 PHE A O     1 
ATOM   2263  C CB    . PHE A 1 298 ? -3.094  -17.307 -8.301   1.00 25.69 ? 298 PHE A CB    1 
ATOM   2264  C CG    . PHE A 1 298 ? -4.330  -17.310 -9.134   1.00 27.98 ? 298 PHE A CG    1 
ATOM   2265  C CD1   . PHE A 1 298 ? -4.324  -17.837 -10.417  1.00 28.57 ? 298 PHE A CD1   1 
ATOM   2266  C CD2   . PHE A 1 298 ? -5.505  -16.775 -8.647   1.00 31.36 ? 298 PHE A CD2   1 
ATOM   2267  C CE1   . PHE A 1 298 ? -5.458  -17.825 -11.181  1.00 28.86 ? 298 PHE A CE1   1 
ATOM   2268  C CE2   . PHE A 1 298 ? -6.651  -16.790 -9.417   1.00 30.34 ? 298 PHE A CE2   1 
ATOM   2269  C CZ    . PHE A 1 298 ? -6.623  -17.322 -10.663  1.00 29.04 ? 298 PHE A CZ    1 
ATOM   2270  N N     . ASN A 1 299 ? -1.498  -19.785 -9.058   1.00 24.95 ? 299 ASN A N     1 
ATOM   2271  C CA    . ASN A 1 299 ? -1.176  -20.750 -10.112  1.00 24.42 ? 299 ASN A CA    1 
ATOM   2272  C C     . ASN A 1 299 ? -0.945  -22.154 -9.583   1.00 24.75 ? 299 ASN A C     1 
ATOM   2273  O O     . ASN A 1 299 ? -1.263  -23.132 -10.237  1.00 24.05 ? 299 ASN A O     1 
ATOM   2274  C CB    . ASN A 1 299 ? 0.043   -20.304 -10.929  1.00 24.70 ? 299 ASN A CB    1 
ATOM   2275  C CG    . ASN A 1 299 ? -0.244  -19.126 -11.854  1.00 24.21 ? 299 ASN A CG    1 
ATOM   2276  O OD1   . ASN A 1 299 ? 0.658   -18.570 -12.496  1.00 23.22 ? 299 ASN A OD1   1 
ATOM   2277  N ND2   . ASN A 1 299 ? -1.482  -18.759 -11.948  1.00 29.65 ? 299 ASN A ND2   1 
ATOM   2278  N N     . GLN A 1 300 ? -0.320  -22.264 -8.421   1.00 25.71 ? 300 GLN A N     1 
ATOM   2279  C CA    . GLN A 1 300 ? -0.270  -23.536 -7.746   1.00 26.98 ? 300 GLN A CA    1 
ATOM   2280  C C     . GLN A 1 300 ? -1.685  -24.081 -7.410   1.00 27.40 ? 300 GLN A C     1 
ATOM   2281  O O     . GLN A 1 300 ? -1.954  -25.280 -7.566   1.00 27.62 ? 300 GLN A O     1 
ATOM   2282  C CB    . GLN A 1 300 ? 0.504   -23.365 -6.466   1.00 27.95 ? 300 GLN A CB    1 
ATOM   2283  C CG    . GLN A 1 300 ? 1.952   -23.184 -6.732   1.00 28.78 ? 300 GLN A CG    1 
ATOM   2284  C CD    . GLN A 1 300 ? 2.633   -22.990 -5.482   1.00 28.69 ? 300 GLN A CD    1 
ATOM   2285  O OE1   . GLN A 1 300 ? 2.740   -23.940 -4.698   1.00 27.79 ? 300 GLN A OE1   1 
ATOM   2286  N NE2   . GLN A 1 300 ? 3.072   -21.737 -5.218   1.00 24.57 ? 300 GLN A NE2   1 
ATOM   2287  N N     . LEU A 1 301 ? -2.578  -23.215 -6.986   1.00 26.97 ? 301 LEU A N     1 
ATOM   2288  C CA    . LEU A 1 301 ? -3.911  -23.651 -6.652   1.00 27.13 ? 301 LEU A CA    1 
ATOM   2289  C C     . LEU A 1 301 ? -4.658  -24.146 -7.887   1.00 26.86 ? 301 LEU A C     1 
ATOM   2290  O O     . LEU A 1 301 ? -5.418  -25.085 -7.816   1.00 25.95 ? 301 LEU A O     1 
ATOM   2291  C CB    . LEU A 1 301 ? -4.658  -22.529 -5.951   1.00 27.31 ? 301 LEU A CB    1 
ATOM   2292  C CG    . LEU A 1 301 ? -4.995  -22.746 -4.489   1.00 29.06 ? 301 LEU A CG    1 
ATOM   2293  C CD1   . LEU A 1 301 ? -4.404  -24.020 -3.988   1.00 31.10 ? 301 LEU A CD1   1 
ATOM   2294  C CD2   . LEU A 1 301 ? -4.591  -21.573 -3.633   1.00 31.65 ? 301 LEU A CD2   1 
ATOM   2295  N N     . MET A 1 302 ? -4.405  -23.517 -9.022   1.00 26.70 ? 302 MET A N     1 
ATOM   2296  C CA    . MET A 1 302 ? -4.946  -23.946 -10.302  1.00 25.53 ? 302 MET A CA    1 
ATOM   2297  C C     . MET A 1 302 ? -4.462  -25.322 -10.599  1.00 24.20 ? 302 MET A C     1 
ATOM   2298  O O     . MET A 1 302 ? -5.244  -26.203 -10.916  1.00 24.91 ? 302 MET A O     1 
ATOM   2299  C CB    . MET A 1 302 ? -4.480  -23.026 -11.426  1.00 24.85 ? 302 MET A CB    1 
ATOM   2300  C CG    . MET A 1 302 ? -5.089  -21.667 -11.416  1.00 25.86 ? 302 MET A CG    1 
ATOM   2301  S SD    . MET A 1 302 ? -4.672  -20.754 -12.940  1.00 29.23 ? 302 MET A SD    1 
ATOM   2302  C CE    . MET A 1 302 ? -4.704  -22.008 -14.167  1.00 19.18 ? 302 MET A CE    1 
ATOM   2303  N N     . ILE A 1 303 ? -3.147  -25.507 -10.520  1.00 23.72 ? 303 ILE A N     1 
ATOM   2304  C CA    . ILE A 1 303 ? -2.532  -26.786 -10.823  1.00 22.82 ? 303 ILE A CA    1 
ATOM   2305  C C     . ILE A 1 303 ? -2.895  -27.866 -9.841   1.00 22.80 ? 303 ILE A C     1 
ATOM   2306  O O     . ILE A 1 303 ? -3.260  -28.974 -10.232  1.00 24.75 ? 303 ILE A O     1 
ATOM   2307  C CB    . ILE A 1 303 ? -1.024  -26.650 -10.986  1.00 23.23 ? 303 ILE A CB    1 
ATOM   2308  C CG1   . ILE A 1 303 ? -0.720  -26.103 -12.390  1.00 22.39 ? 303 ILE A CG1   1 
ATOM   2309  C CG2   . ILE A 1 303 ? -0.294  -27.990 -10.744  1.00 21.40 ? 303 ILE A CG2   1 
ATOM   2310  C CD1   . ILE A 1 303 ? 0.716   -25.530 -12.478  1.00 17.55 ? 303 ILE A CD1   1 
ATOM   2311  N N     . SER A 1 304 ? -2.794  -27.565 -8.571   1.00 23.27 ? 304 SER A N     1 
ATOM   2312  C CA    . SER A 1 304 ? -3.127  -28.513 -7.520   1.00 23.47 ? 304 SER A CA    1 
ATOM   2313  C C     . SER A 1 304 ? -4.539  -29.071 -7.683   1.00 23.94 ? 304 SER A C     1 
ATOM   2314  O O     . SER A 1 304 ? -4.733  -30.255 -7.707   1.00 24.49 ? 304 SER A O     1 
ATOM   2315  C CB    . SER A 1 304 ? -3.048  -27.809 -6.167   1.00 22.35 ? 304 SER A CB    1 
ATOM   2316  O OG    . SER A 1 304 ? -2.745  -28.739 -5.154   1.00 22.89 ? 304 SER A OG    1 
ATOM   2317  N N     . GLN A 1 305 ? -5.542  -28.219 -7.749   1.00 25.16 ? 305 GLN A N     1 
ATOM   2318  C CA    . GLN A 1 305 ? -6.900  -28.708 -7.935   1.00 26.58 ? 305 GLN A CA    1 
ATOM   2319  C C     . GLN A 1 305 ? -7.108  -29.462 -9.251   1.00 27.14 ? 305 GLN A C     1 
ATOM   2320  O O     . GLN A 1 305 ? -8.040  -30.257 -9.317   1.00 29.15 ? 305 GLN A O     1 
ATOM   2321  C CB    . GLN A 1 305 ? -7.916  -27.596 -7.796   1.00 26.12 ? 305 GLN A CB    1 
ATOM   2322  C CG    . GLN A 1 305 ? -7.759  -26.934 -6.482   1.00 30.05 ? 305 GLN A CG    1 
ATOM   2323  C CD    . GLN A 1 305 ? -8.613  -25.760 -6.348   1.00 37.18 ? 305 GLN A CD    1 
ATOM   2324  O OE1   . GLN A 1 305 ? -8.118  -24.654 -6.060   1.00 38.41 ? 305 GLN A OE1   1 
ATOM   2325  N NE2   . GLN A 1 305 ? -9.943  -25.957 -6.537   1.00 39.54 ? 305 GLN A NE2   1 
ATOM   2326  N N     . LEU A 1 306 ? -6.271  -29.224 -10.268  1.00 25.27 ? 306 LEU A N     1 
ATOM   2327  C CA    . LEU A 1 306 ? -6.306  -30.018 -11.491  1.00 24.96 ? 306 LEU A CA    1 
ATOM   2328  C C     . LEU A 1 306 ? -5.809  -31.414 -11.254  1.00 24.75 ? 306 LEU A C     1 
ATOM   2329  O O     . LEU A 1 306 ? -6.425  -32.381 -11.732  1.00 24.05 ? 306 LEU A O     1 
ATOM   2330  C CB    . LEU A 1 306 ? -5.470  -29.372 -12.605  1.00 25.41 ? 306 LEU A CB    1 
ATOM   2331  C CG    . LEU A 1 306 ? -5.169  -30.182 -13.867  1.00 25.38 ? 306 LEU A CG    1 
ATOM   2332  C CD1   . LEU A 1 306 ? -6.268  -30.001 -14.864  1.00 26.58 ? 306 LEU A CD1   1 
ATOM   2333  C CD2   . LEU A 1 306 ? -3.795  -29.827 -14.489  1.00 22.18 ? 306 LEU A CD2   1 
ATOM   2334  N N     . LEU A 1 307 ? -4.734  -31.521 -10.484  1.00 25.27 ? 307 LEU A N     1 
ATOM   2335  C CA    . LEU A 1 307 ? -4.050  -32.770 -10.201  1.00 25.27 ? 307 LEU A CA    1 
ATOM   2336  C C     . LEU A 1 307 ? -4.802  -33.681 -9.241   1.00 26.60 ? 307 LEU A C     1 
ATOM   2337  O O     . LEU A 1 307 ? -4.908  -34.865 -9.469   1.00 26.84 ? 307 LEU A O     1 
ATOM   2338  C CB    . LEU A 1 307 ? -2.679  -32.473 -9.625   1.00 25.85 ? 307 LEU A CB    1 
ATOM   2339  C CG    . LEU A 1 307 ? -1.458  -32.295 -10.514  1.00 25.25 ? 307 LEU A CG    1 
ATOM   2340  C CD1   . LEU A 1 307 ? -1.760  -32.376 -11.982  1.00 21.32 ? 307 LEU A CD1   1 
ATOM   2341  C CD2   . LEU A 1 307 ? -0.674  -31.048 -10.161  1.00 17.63 ? 307 LEU A CD2   1 
ATOM   2342  N N     . HIS A 1 308 ? -5.319  -33.109 -8.165   1.00 27.71 ? 308 HIS A N     1 
ATOM   2343  C CA    . HIS A 1 308 ? -6.189  -33.858 -7.208   1.00 29.46 ? 308 HIS A CA    1 
ATOM   2344  C C     . HIS A 1 308 ? -7.458  -34.399 -7.797   1.00 30.75 ? 308 HIS A C     1 
ATOM   2345  O O     . HIS A 1 308 ? -7.927  -35.462 -7.356   1.00 30.58 ? 308 HIS A O     1 
ATOM   2346  C CB    . HIS A 1 308 ? -6.532  -33.035 -5.939   1.00 28.46 ? 308 HIS A CB    1 
ATOM   2347  C CG    . HIS A 1 308 ? -5.330  -32.791 -5.101   1.00 27.00 ? 308 HIS A CG    1 
ATOM   2348  N ND1   . HIS A 1 308 ? -4.367  -31.863 -5.454   1.00 23.16 ? 308 HIS A ND1   1 
ATOM   2349  C CD2   . HIS A 1 308 ? -4.838  -33.465 -4.036   1.00 26.70 ? 308 HIS A CD2   1 
ATOM   2350  C CE1   . HIS A 1 308 ? -3.356  -31.951 -4.606   1.00 24.20 ? 308 HIS A CE1   1 
ATOM   2351  N NE2   . HIS A 1 308 ? -3.615  -32.917 -3.738   1.00 21.69 ? 308 HIS A NE2   1 
ATOM   2352  N N     . GLU A 1 309 ? -7.987  -33.668 -8.783   1.00 32.63 ? 309 GLU A N     1 
ATOM   2353  C CA    . GLU A 1 309 ? -9.232  -34.020 -9.485   1.00 34.65 ? 309 GLU A CA    1 
ATOM   2354  C C     . GLU A 1 309 ? -8.977  -35.083 -10.583  1.00 34.88 ? 309 GLU A C     1 
ATOM   2355  O O     . GLU A 1 309 ? -9.746  -36.038 -10.767  1.00 34.79 ? 309 GLU A O     1 
ATOM   2356  C CB    . GLU A 1 309 ? -9.864  -32.744 -10.065  1.00 35.20 ? 309 GLU A CB    1 
ATOM   2357  C CG    . GLU A 1 309 ? -11.349 -32.857 -10.456  1.00 39.57 ? 309 GLU A CG    1 
ATOM   2358  C CD    . GLU A 1 309 ? -12.218 -33.442 -9.325   1.00 44.26 ? 309 GLU A CD    1 
ATOM   2359  O OE1   . GLU A 1 309 ? -12.421 -32.760 -8.291   1.00 44.81 ? 309 GLU A OE1   1 
ATOM   2360  O OE2   . GLU A 1 309 ? -12.696 -34.588 -9.476   1.00 46.42 ? 309 GLU A OE2   1 
ATOM   2361  N N     . TRP A 1 310 ? -7.874  -34.933 -11.301  1.00 34.67 ? 310 TRP A N     1 
ATOM   2362  C CA    . TRP A 1 310 ? -7.425  -35.994 -12.183  1.00 33.83 ? 310 TRP A CA    1 
ATOM   2363  C C     . TRP A 1 310 ? -6.977  -37.240 -11.391  1.00 34.37 ? 310 TRP A C     1 
ATOM   2364  O O     . TRP A 1 310 ? -7.347  -38.368 -11.709  1.00 33.11 ? 310 TRP A O     1 
ATOM   2365  C CB    . TRP A 1 310 ? -6.289  -35.482 -13.038  1.00 32.04 ? 310 TRP A CB    1 
ATOM   2366  C CG    . TRP A 1 310 ? -6.681  -34.831 -14.318  1.00 30.24 ? 310 TRP A CG    1 
ATOM   2367  C CD1   . TRP A 1 310 ? -7.944  -34.793 -14.910  1.00 27.03 ? 310 TRP A CD1   1 
ATOM   2368  C CD2   . TRP A 1 310 ? -5.782  -34.170 -15.231  1.00 27.23 ? 310 TRP A CD2   1 
ATOM   2369  N NE1   . TRP A 1 310 ? -7.854  -34.119 -16.111  1.00 28.85 ? 310 TRP A NE1   1 
ATOM   2370  C CE2   . TRP A 1 310 ? -6.546  -33.748 -16.337  1.00 27.16 ? 310 TRP A CE2   1 
ATOM   2371  C CE3   . TRP A 1 310 ? -4.398  -33.915 -15.218  1.00 26.15 ? 310 TRP A CE3   1 
ATOM   2372  C CZ2   . TRP A 1 310 ? -5.974  -33.056 -17.417  1.00 28.69 ? 310 TRP A CZ2   1 
ATOM   2373  C CZ3   . TRP A 1 310 ? -3.846  -33.211 -16.246  1.00 27.47 ? 310 TRP A CZ3   1 
ATOM   2374  C CH2   . TRP A 1 310 ? -4.633  -32.797 -17.354  1.00 29.18 ? 310 TRP A CH2   1 
ATOM   2375  N N     . GLY A 1 311 ? -6.220  -37.028 -10.330  1.00 35.88 ? 311 GLY A N     1 
ATOM   2376  C CA    . GLY A 1 311 ? -5.643  -38.149 -9.590   1.00 37.67 ? 311 GLY A CA    1 
ATOM   2377  C C     . GLY A 1 311 ? -4.391  -38.574 -10.335  1.00 38.85 ? 311 GLY A C     1 
ATOM   2378  O O     . GLY A 1 311 ? -4.126  -38.079 -11.413  1.00 37.65 ? 311 GLY A O     1 
ATOM   2379  N N     . GLU A 1 312 ? -3.632  -39.493 -9.748   1.00 41.24 ? 312 GLU A N     1 
ATOM   2380  C CA    . GLU A 1 312 ? -2.469  -40.065 -10.415  1.00 42.81 ? 312 GLU A CA    1 
ATOM   2381  C C     . GLU A 1 312 ? -2.832  -40.589 -11.801  1.00 42.90 ? 312 GLU A C     1 
ATOM   2382  O O     . GLU A 1 312 ? -2.273  -40.150 -12.806  1.00 43.04 ? 312 GLU A O     1 
ATOM   2383  C CB    . GLU A 1 312 ? -1.866  -41.189 -9.570   1.00 42.69 ? 312 GLU A CB    1 
ATOM   2384  C CG    . GLU A 1 312 ? -1.497  -42.432 -10.362  1.00 44.80 ? 312 GLU A CG    1 
ATOM   2385  C CD    . GLU A 1 312 ? -0.556  -43.348 -9.604   1.00 45.00 ? 312 GLU A CD    1 
ATOM   2386  O OE1   . GLU A 1 312 ? 0.433   -43.815 -10.206  1.00 49.50 ? 312 GLU A OE1   1 
ATOM   2387  O OE2   . GLU A 1 312 ? -0.805  -43.600 -8.407   1.00 44.50 ? 312 GLU A OE2   1 
ATOM   2388  N N     . GLU A 1 313 ? -3.769  -41.529 -11.847  1.00 42.79 ? 313 GLU A N     1 
ATOM   2389  C CA    . GLU A 1 313 ? -4.505  -41.818 -13.072  1.00 42.74 ? 313 GLU A CA    1 
ATOM   2390  C C     . GLU A 1 313 ? -5.364  -40.631 -13.494  1.00 41.75 ? 313 GLU A C     1 
ATOM   2391  O O     . GLU A 1 313 ? -6.138  -40.100 -12.698  1.00 43.00 ? 313 GLU A O     1 
ATOM   2392  C CB    . GLU A 1 313 ? -5.377  -43.062 -12.891  1.00 43.93 ? 313 GLU A CB    1 
ATOM   2393  C CG    . GLU A 1 313 ? -4.594  -44.354 -12.737  1.00 48.70 ? 313 GLU A CG    1 
ATOM   2394  C CD    . GLU A 1 313 ? -5.192  -45.280 -11.698  1.00 54.75 ? 313 GLU A CD    1 
ATOM   2395  O OE1   . GLU A 1 313 ? -4.497  -46.222 -11.265  1.00 54.60 ? 313 GLU A OE1   1 
ATOM   2396  O OE2   . GLU A 1 313 ? -6.361  -45.065 -11.312  1.00 55.91 ? 313 GLU A OE2   1 
ATOM   2397  N N     . GLY A 1 314 ? -5.224  -40.222 -14.750  1.00 39.18 ? 314 GLY A N     1 
ATOM   2398  C CA    . GLY A 1 314 ? -5.809  -38.979 -15.218  1.00 36.27 ? 314 GLY A CA    1 
ATOM   2399  C C     . GLY A 1 314 ? -4.764  -37.925 -15.522  1.00 34.10 ? 314 GLY A C     1 
ATOM   2400  O O     . GLY A 1 314 ? -4.828  -37.255 -16.553  1.00 32.28 ? 314 GLY A O     1 
ATOM   2401  N N     . PHE A 1 315 ? -3.801  -37.776 -14.620  1.00 32.79 ? 315 PHE A N     1 
ATOM   2402  C CA    . PHE A 1 315 ? -2.548  -37.157 -14.950  1.00 31.86 ? 315 PHE A CA    1 
ATOM   2403  C C     . PHE A 1 315 ? -1.939  -37.947 -16.074  1.00 33.42 ? 315 PHE A C     1 
ATOM   2404  O O     . PHE A 1 315 ? -1.504  -37.403 -17.068  1.00 32.51 ? 315 PHE A O     1 
ATOM   2405  C CB    . PHE A 1 315 ? -1.574  -37.229 -13.792  1.00 31.51 ? 315 PHE A CB    1 
ATOM   2406  C CG    . PHE A 1 315 ? -0.258  -36.561 -14.080  1.00 27.64 ? 315 PHE A CG    1 
ATOM   2407  C CD1   . PHE A 1 315 ? -0.212  -35.268 -14.564  1.00 27.73 ? 315 PHE A CD1   1 
ATOM   2408  C CD2   . PHE A 1 315 ? 0.916   -37.206 -13.839  1.00 22.65 ? 315 PHE A CD2   1 
ATOM   2409  C CE1   . PHE A 1 315 ? 1.029   -34.635 -14.802  1.00 29.77 ? 315 PHE A CE1   1 
ATOM   2410  C CE2   . PHE A 1 315 ? 2.135   -36.608 -14.093  1.00 24.06 ? 315 PHE A CE2   1 
ATOM   2411  C CZ    . PHE A 1 315 ? 2.199   -35.308 -14.576  1.00 24.23 ? 315 PHE A CZ    1 
ATOM   2412  N N     . MET A 1 316 ? -1.908  -39.256 -15.901  1.00 35.34 ? 316 MET A N     1 
ATOM   2413  C CA    . MET A 1 316 ? -1.185  -40.093 -16.815  1.00 38.11 ? 316 MET A CA    1 
ATOM   2414  C C     . MET A 1 316 ? -1.917  -40.211 -18.165  1.00 37.94 ? 316 MET A C     1 
ATOM   2415  O O     . MET A 1 316 ? -1.319  -40.053 -19.234  1.00 38.93 ? 316 MET A O     1 
ATOM   2416  C CB    . MET A 1 316 ? -0.807  -41.421 -16.141  1.00 38.79 ? 316 MET A CB    1 
ATOM   2417  C CG    . MET A 1 316 ? 0.118   -41.236 -14.916  1.00 43.32 ? 316 MET A CG    1 
ATOM   2418  S SD    . MET A 1 316 ? 1.906   -41.067 -15.177  1.00 47.77 ? 316 MET A SD    1 
ATOM   2419  C CE    . MET A 1 316 ? 2.010   -39.467 -15.931  1.00 47.85 ? 316 MET A CE    1 
ATOM   2420  N N     . ALA A 1 317 ? -3.227  -40.412 -18.116  1.00 37.72 ? 317 ALA A N     1 
ATOM   2421  C CA    . ALA A 1 317 ? -4.013  -40.350 -19.331  1.00 36.33 ? 317 ALA A CA    1 
ATOM   2422  C C     . ALA A 1 317 ? -3.748  -39.055 -20.132  1.00 35.21 ? 317 ALA A C     1 
ATOM   2423  O O     . ALA A 1 317 ? -3.717  -39.107 -21.353  1.00 36.40 ? 317 ALA A O     1 
ATOM   2424  C CB    . ALA A 1 317 ? -5.493  -40.525 -19.024  1.00 36.05 ? 317 ALA A CB    1 
ATOM   2425  N N     . HIS A 1 318 ? -3.522  -37.955 -19.436  1.00 33.32 ? 318 HIS A N     1 
ATOM   2426  C CA    . HIS A 1 318 ? -3.124  -36.713 -20.060  1.00 32.36 ? 318 HIS A CA    1 
ATOM   2427  C C     . HIS A 1 318 ? -1.766  -36.778 -20.726  1.00 32.29 ? 318 HIS A C     1 
ATOM   2428  O O     . HIS A 1 318 ? -1.649  -36.443 -21.890  1.00 32.93 ? 318 HIS A O     1 
ATOM   2429  C CB    . HIS A 1 318 ? -3.197  -35.566 -19.062  1.00 32.78 ? 318 HIS A CB    1 
ATOM   2430  C CG    . HIS A 1 318 ? -2.995  -34.220 -19.672  1.00 35.05 ? 318 HIS A CG    1 
ATOM   2431  N ND1   . HIS A 1 318 ? -1.809  -33.530 -19.578  1.00 36.16 ? 318 HIS A ND1   1 
ATOM   2432  C CD2   . HIS A 1 318 ? -3.829  -33.434 -20.385  1.00 36.30 ? 318 HIS A CD2   1 
ATOM   2433  C CE1   . HIS A 1 318 ? -1.921  -32.381 -20.214  1.00 38.17 ? 318 HIS A CE1   1 
ATOM   2434  N NE2   . HIS A 1 318 ? -3.136  -32.299 -20.713  1.00 37.13 ? 318 HIS A NE2   1 
ATOM   2435  N N     . VAL A 1 319 ? -0.744  -37.227 -20.007  1.00 29.82 ? 319 VAL A N     1 
ATOM   2436  C CA    . VAL A 1 319 ? 0.587   -37.247 -20.578  1.00 28.98 ? 319 VAL A CA    1 
ATOM   2437  C C     . VAL A 1 319 ? 0.743   -38.235 -21.716  1.00 31.73 ? 319 VAL A C     1 
ATOM   2438  O O     . VAL A 1 319 ? 1.515   -38.013 -22.635  1.00 32.10 ? 319 VAL A O     1 
ATOM   2439  C CB    . VAL A 1 319 ? 1.751   -37.315 -19.548  1.00 28.02 ? 319 VAL A CB    1 
ATOM   2440  C CG1   . VAL A 1 319 ? 1.298   -37.126 -18.159  1.00 24.55 ? 319 VAL A CG1   1 
ATOM   2441  C CG2   . VAL A 1 319 ? 2.547   -38.550 -19.693  1.00 21.80 ? 319 VAL A CG2   1 
ATOM   2442  N N     . ASP A 1 320 ? -0.002  -39.332 -21.650  1.00 33.88 ? 320 ASP A N     1 
ATOM   2443  C CA    . ASP A 1 320 ? -0.203  -40.191 -22.812  1.00 35.54 ? 320 ASP A CA    1 
ATOM   2444  C C     . ASP A 1 320 ? -0.804  -39.412 -23.977  1.00 34.68 ? 320 ASP A C     1 
ATOM   2445  O O     . ASP A 1 320 ? -0.302  -39.469 -25.100  1.00 35.75 ? 320 ASP A O     1 
ATOM   2446  C CB    . ASP A 1 320 ? -1.101  -41.377 -22.453  1.00 36.40 ? 320 ASP A CB    1 
ATOM   2447  C CG    . ASP A 1 320 ? -0.311  -42.609 -22.059  1.00 40.45 ? 320 ASP A CG    1 
ATOM   2448  O OD1   . ASP A 1 320 ? -0.930  -43.675 -21.858  1.00 45.18 ? 320 ASP A OD1   1 
ATOM   2449  O OD2   . ASP A 1 320 ? 0.931   -42.606 -21.925  1.00 43.51 ? 320 ASP A OD2   1 
ATOM   2450  N N     . ARG A 1 321 ? -1.881  -38.684 -23.701  1.00 33.29 ? 321 ARG A N     1 
ATOM   2451  C CA    . ARG A 1 321 ? -2.555  -37.891 -24.716  1.00 32.91 ? 321 ARG A CA    1 
ATOM   2452  C C     . ARG A 1 321 ? -1.588  -36.975 -25.453  1.00 31.38 ? 321 ARG A C     1 
ATOM   2453  O O     . ARG A 1 321 ? -1.720  -36.760 -26.643  1.00 31.52 ? 321 ARG A O     1 
ATOM   2454  C CB    . ARG A 1 321 ? -3.633  -37.035 -24.059  1.00 32.62 ? 321 ARG A CB    1 
ATOM   2455  C CG    . ARG A 1 321 ? -5.056  -37.509 -24.186  1.00 33.41 ? 321 ARG A CG    1 
ATOM   2456  C CD    . ARG A 1 321 ? -6.061  -36.427 -23.815  1.00 34.22 ? 321 ARG A CD    1 
ATOM   2457  N NE    . ARG A 1 321 ? -5.959  -35.288 -24.728  1.00 41.58 ? 321 ARG A NE    1 
ATOM   2458  C CZ    . ARG A 1 321 ? -5.272  -34.181 -24.486  1.00 43.78 ? 321 ARG A CZ    1 
ATOM   2459  N NH1   . ARG A 1 321 ? -4.635  -34.035 -23.341  1.00 44.89 ? 321 ARG A NH1   1 
ATOM   2460  N NH2   . ARG A 1 321 ? -5.219  -33.217 -25.387  1.00 40.83 ? 321 ARG A NH2   1 
ATOM   2461  N N     . VAL A 1 322 ? -0.633  -36.409 -24.732  1.00 29.64 ? 322 VAL A N     1 
ATOM   2462  C CA    . VAL A 1 322 ? 0.279   -35.456 -25.331  1.00 28.46 ? 322 VAL A CA    1 
ATOM   2463  C C     . VAL A 1 322 ? 1.561   -36.058 -25.889  1.00 28.29 ? 322 VAL A C     1 
ATOM   2464  O O     . VAL A 1 322 ? 2.140   -35.527 -26.816  1.00 26.60 ? 322 VAL A O     1 
ATOM   2465  C CB    . VAL A 1 322 ? 0.530   -34.182 -24.470  1.00 29.36 ? 322 VAL A CB    1 
ATOM   2466  C CG1   . VAL A 1 322 ? -0.123  -34.265 -23.135  1.00 27.64 ? 322 VAL A CG1   1 
ATOM   2467  C CG2   . VAL A 1 322 ? 1.983   -33.886 -24.334  1.00 24.63 ? 322 VAL A CG2   1 
ATOM   2468  N N     . ILE A 1 323 ? 1.977   -37.189 -25.343  1.00 28.72 ? 323 ILE A N     1 
ATOM   2469  C CA    . ILE A 1 323 ? 3.017   -37.965 -25.982  1.00 28.40 ? 323 ILE A CA    1 
ATOM   2470  C C     . ILE A 1 323 ? 2.519   -38.428 -27.328  1.00 27.55 ? 323 ILE A C     1 
ATOM   2471  O O     . ILE A 1 323 ? 3.285   -38.546 -28.275  1.00 27.73 ? 323 ILE A O     1 
ATOM   2472  C CB    . ILE A 1 323 ? 3.438   -39.170 -25.119  1.00 27.47 ? 323 ILE A CB    1 
ATOM   2473  C CG1   . ILE A 1 323 ? 4.067   -38.712 -23.820  1.00 28.69 ? 323 ILE A CG1   1 
ATOM   2474  C CG2   . ILE A 1 323 ? 4.430   -40.033 -25.847  1.00 28.71 ? 323 ILE A CG2   1 
ATOM   2475  C CD1   . ILE A 1 323 ? 4.137   -39.784 -22.796  1.00 25.94 ? 323 ILE A CD1   1 
ATOM   2476  N N     . ASP A 1 324 ? 1.225   -38.698 -27.406  1.00 27.92 ? 324 ASP A N     1 
ATOM   2477  C CA    . ASP A 1 324 ? 0.665   -39.256 -28.641  1.00 27.37 ? 324 ASP A CA    1 
ATOM   2478  C C     . ASP A 1 324 ? 0.671   -38.192 -29.618  1.00 25.97 ? 324 ASP A C     1 
ATOM   2479  O O     . ASP A 1 324 ? 0.968   -38.442 -30.778  1.00 26.06 ? 324 ASP A O     1 
ATOM   2480  C CB    . ASP A 1 324 ? -0.779  -39.694 -28.509  1.00 29.03 ? 324 ASP A CB    1 
ATOM   2481  C CG    . ASP A 1 324 ? -0.917  -40.992 -27.765  1.00 32.62 ? 324 ASP A CG    1 
ATOM   2482  O OD1   . ASP A 1 324 ? 0.108   -41.661 -27.549  1.00 35.09 ? 324 ASP A OD1   1 
ATOM   2483  O OD2   . ASP A 1 324 ? -2.067  -41.349 -27.428  1.00 37.34 ? 324 ASP A OD2   1 
ATOM   2484  N N     . PHE A 1 325 ? 0.314   -36.992 -29.163  1.00 25.83 ? 325 PHE A N     1 
ATOM   2485  C CA    . PHE A 1 325 ? 0.333   -35.851 -30.065  1.00 26.12 ? 325 PHE A CA    1 
ATOM   2486  C C     . PHE A 1 325 ? 1.774   -35.587 -30.537  1.00 25.15 ? 325 PHE A C     1 
ATOM   2487  O O     . PHE A 1 325 ? 2.104   -35.671 -31.732  1.00 24.47 ? 325 PHE A O     1 
ATOM   2488  C CB    . PHE A 1 325 ? -0.300  -34.616 -29.464  1.00 26.51 ? 325 PHE A CB    1 
ATOM   2489  C CG    . PHE A 1 325 ? -0.082  -33.399 -30.299  1.00 26.94 ? 325 PHE A CG    1 
ATOM   2490  C CD1   . PHE A 1 325 ? -0.865  -33.187 -31.415  1.00 25.93 ? 325 PHE A CD1   1 
ATOM   2491  C CD2   . PHE A 1 325 ? 0.971   -32.526 -30.017  1.00 25.00 ? 325 PHE A CD2   1 
ATOM   2492  C CE1   . PHE A 1 325 ? -0.662  -32.108 -32.200  1.00 27.59 ? 325 PHE A CE1   1 
ATOM   2493  C CE2   . PHE A 1 325 ? 1.205   -31.439 -30.802  1.00 28.75 ? 325 PHE A CE2   1 
ATOM   2494  C CZ    . PHE A 1 325 ? 0.371   -31.206 -31.900  1.00 27.65 ? 325 PHE A CZ    1 
ATOM   2495  N N     . TYR A 1 326 ? 2.642   -35.295 -29.589  1.00 25.26 ? 326 TYR A N     1 
ATOM   2496  C CA    . TYR A 1 326 ? 4.080   -35.153 -29.924  1.00 25.22 ? 326 TYR A CA    1 
ATOM   2497  C C     . TYR A 1 326 ? 4.682   -36.267 -30.801  1.00 26.67 ? 326 TYR A C     1 
ATOM   2498  O O     . TYR A 1 326 ? 5.426   -35.972 -31.761  1.00 25.64 ? 326 TYR A O     1 
ATOM   2499  C CB    . TYR A 1 326 ? 4.859   -34.928 -28.662  1.00 23.75 ? 326 TYR A CB    1 
ATOM   2500  C CG    . TYR A 1 326 ? 4.750   -33.478 -28.210  1.00 22.45 ? 326 TYR A CG    1 
ATOM   2501  C CD1   . TYR A 1 326 ? 5.361   -32.432 -28.946  1.00 20.52 ? 326 TYR A CD1   1 
ATOM   2502  C CD2   . TYR A 1 326 ? 4.040   -33.148 -27.085  1.00 20.16 ? 326 TYR A CD2   1 
ATOM   2503  C CE1   . TYR A 1 326 ? 5.280   -31.118 -28.522  1.00 21.95 ? 326 TYR A CE1   1 
ATOM   2504  C CE2   . TYR A 1 326 ? 3.948   -31.811 -26.650  1.00 23.20 ? 326 TYR A CE2   1 
ATOM   2505  C CZ    . TYR A 1 326 ? 4.558   -30.816 -27.378  1.00 19.29 ? 326 TYR A CZ    1 
ATOM   2506  O OH    . TYR A 1 326 ? 4.462   -29.553 -26.918  1.00 16.86 ? 326 TYR A OH    1 
ATOM   2507  N N     . SER A 1 327 ? 4.308   -37.526 -30.534  1.00 28.07 ? 327 SER A N     1 
ATOM   2508  C CA    . SER A 1 327 ? 4.735   -38.652 -31.397  1.00 29.66 ? 327 SER A CA    1 
ATOM   2509  C C     . SER A 1 327 ? 4.297   -38.571 -32.855  1.00 30.42 ? 327 SER A C     1 
ATOM   2510  O O     . SER A 1 327 ? 5.146   -38.719 -33.752  1.00 32.49 ? 327 SER A O     1 
ATOM   2511  C CB    . SER A 1 327 ? 4.279   -40.002 -30.856  1.00 30.70 ? 327 SER A CB    1 
ATOM   2512  O OG    . SER A 1 327 ? 5.011   -41.028 -31.524  1.00 33.26 ? 327 SER A OG    1 
ATOM   2513  N N     . ASN A 1 328 ? 3.004   -38.355 -33.112  1.00 29.61 ? 328 ASN A N     1 
ATOM   2514  C CA    . ASN A 1 328 ? 2.535   -38.124 -34.459  1.00 30.27 ? 328 ASN A CA    1 
ATOM   2515  C C     . ASN A 1 328 ? 3.324   -36.949 -35.107  1.00 30.02 ? 328 ASN A C     1 
ATOM   2516  O O     . ASN A 1 328 ? 3.760   -37.055 -36.257  1.00 30.95 ? 328 ASN A O     1 
ATOM   2517  C CB    . ASN A 1 328 ? 1.002   -37.824 -34.524  1.00 30.70 ? 328 ASN A CB    1 
ATOM   2518  C CG    . ASN A 1 328 ? 0.091   -39.041 -34.181  1.00 33.99 ? 328 ASN A CG    1 
ATOM   2519  O OD1   . ASN A 1 328 ? -1.014  -38.863 -33.630  1.00 37.58 ? 328 ASN A OD1   1 
ATOM   2520  N ND2   . ASN A 1 328 ? 0.512   -40.263 -34.541  1.00 31.45 ? 328 ASN A ND2   1 
ATOM   2521  N N     . GLN A 1 329 ? 3.480   -35.826 -34.400  1.00 29.49 ? 329 GLN A N     1 
ATOM   2522  C CA    . GLN A 1 329 ? 4.226   -34.661 -34.966  1.00 29.39 ? 329 GLN A CA    1 
ATOM   2523  C C     . GLN A 1 329 ? 5.603   -35.031 -35.453  1.00 29.57 ? 329 GLN A C     1 
ATOM   2524  O O     . GLN A 1 329 ? 5.992   -34.632 -36.547  1.00 29.87 ? 329 GLN A O     1 
ATOM   2525  C CB    . GLN A 1 329 ? 4.355   -33.517 -33.956  1.00 29.20 ? 329 GLN A CB    1 
ATOM   2526  C CG    . GLN A 1 329 ? 3.040   -32.824 -33.678  1.00 26.25 ? 329 GLN A CG    1 
ATOM   2527  C CD    . GLN A 1 329 ? 2.641   -31.934 -34.796  1.00 26.21 ? 329 GLN A CD    1 
ATOM   2528  O OE1   . GLN A 1 329 ? 1.585   -32.143 -35.437  1.00 29.43 ? 329 GLN A OE1   1 
ATOM   2529  N NE2   . GLN A 1 329 ? 3.495   -30.961 -35.097  1.00 19.13 ? 329 GLN A NE2   1 
ATOM   2530  N N     . LYS A 1 330 ? 6.339   -35.790 -34.648  1.00 29.89 ? 330 LYS A N     1 
ATOM   2531  C CA    . LYS A 1 330 ? 7.696   -36.189 -35.001  1.00 29.92 ? 330 LYS A CA    1 
ATOM   2532  C C     . LYS A 1 330 ? 7.691   -37.282 -36.058  1.00 30.09 ? 330 LYS A C     1 
ATOM   2533  O O     . LYS A 1 330 ? 8.585   -37.350 -36.901  1.00 30.72 ? 330 LYS A O     1 
ATOM   2534  C CB    . LYS A 1 330 ? 8.458   -36.658 -33.759  1.00 30.48 ? 330 LYS A CB    1 
ATOM   2535  C CG    . LYS A 1 330 ? 9.244   -37.943 -33.960  1.00 28.86 ? 330 LYS A CG    1 
ATOM   2536  C CD    . LYS A 1 330 ? 8.458   -39.152 -33.481  1.00 32.00 ? 330 LYS A CD    1 
ATOM   2537  C CE    . LYS A 1 330 ? 9.332   -40.388 -33.431  1.00 32.78 ? 330 LYS A CE    1 
ATOM   2538  N NZ    . LYS A 1 330 ? 8.598   -41.561 -32.882  1.00 34.27 ? 330 LYS A NZ    1 
ATOM   2539  N N     . ASP A 1 331 ? 6.679   -38.141 -36.005  1.00 29.80 ? 331 ASP A N     1 
ATOM   2540  C CA    . ASP A 1 331 ? 6.327   -38.981 -37.144  1.00 29.59 ? 331 ASP A CA    1 
ATOM   2541  C C     . ASP A 1 331 ? 6.237   -38.162 -38.427  1.00 29.76 ? 331 ASP A C     1 
ATOM   2542  O O     . ASP A 1 331 ? 6.858   -38.499 -39.435  1.00 29.01 ? 331 ASP A O     1 
ATOM   2543  C CB    . ASP A 1 331 ? 5.003   -39.704 -36.887  1.00 29.48 ? 331 ASP A CB    1 
ATOM   2544  C CG    . ASP A 1 331 ? 5.184   -40.994 -36.112  1.00 31.51 ? 331 ASP A CG    1 
ATOM   2545  O OD1   . ASP A 1 331 ? 6.338   -41.329 -35.772  1.00 27.82 ? 331 ASP A OD1   1 
ATOM   2546  O OD2   . ASP A 1 331 ? 4.231   -41.738 -35.799  1.00 37.20 ? 331 ASP A OD2   1 
ATOM   2547  N N     . ALA A 1 332 ? 5.462   -37.084 -38.381  1.00 28.88 ? 332 ALA A N     1 
ATOM   2548  C CA    . ALA A 1 332 ? 5.269   -36.230 -39.547  1.00 29.81 ? 332 ALA A CA    1 
ATOM   2549  C C     . ALA A 1 332 ? 6.582   -35.587 -39.984  1.00 30.24 ? 332 ALA A C     1 
ATOM   2550  O O     . ALA A 1 332 ? 6.883   -35.515 -41.176  1.00 30.58 ? 332 ALA A O     1 
ATOM   2551  C CB    . ALA A 1 332 ? 4.225   -35.163 -39.256  1.00 30.21 ? 332 ALA A CB    1 
ATOM   2552  N N     . ILE A 1 333 ? 7.359   -35.122 -39.012  1.00 30.79 ? 333 ILE A N     1 
ATOM   2553  C CA    . ILE A 1 333 ? 8.666   -34.496 -39.296  1.00 29.91 ? 333 ILE A CA    1 
ATOM   2554  C C     . ILE A 1 333 ? 9.685   -35.500 -39.826  1.00 30.43 ? 333 ILE A C     1 
ATOM   2555  O O     . ILE A 1 333 ? 10.577  -35.124 -40.593  1.00 31.68 ? 333 ILE A O     1 
ATOM   2556  C CB    . ILE A 1 333 ? 9.290   -33.637 -38.127  1.00 29.74 ? 333 ILE A CB    1 
ATOM   2557  C CG1   . ILE A 1 333 ? 10.156  -32.533 -38.721  1.00 27.56 ? 333 ILE A CG1   1 
ATOM   2558  C CG2   . ILE A 1 333 ? 10.158  -34.482 -37.154  1.00 26.33 ? 333 ILE A CG2   1 
ATOM   2559  C CD1   . ILE A 1 333 ? 10.379  -31.308 -37.848  1.00 27.48 ? 333 ILE A CD1   1 
ATOM   2560  N N     . LEU A 1 334 ? 9.600   -36.760 -39.421  1.00 28.68 ? 334 LEU A N     1 
ATOM   2561  C CA    . LEU A 1 334 ? 10.605  -37.662 -39.928  1.00 27.94 ? 334 LEU A CA    1 
ATOM   2562  C C     . LEU A 1 334 ? 10.294  -38.010 -41.389  1.00 28.24 ? 334 LEU A C     1 
ATOM   2563  O O     . LEU A 1 334 ? 11.197  -37.984 -42.247  1.00 29.37 ? 334 LEU A O     1 
ATOM   2564  C CB    . LEU A 1 334 ? 10.728  -38.901 -39.044  1.00 28.33 ? 334 LEU A CB    1 
ATOM   2565  C CG    . LEU A 1 334 ? 11.343  -38.681 -37.650  1.00 27.66 ? 334 LEU A CG    1 
ATOM   2566  C CD1   . LEU A 1 334 ? 10.907  -39.785 -36.671  1.00 26.89 ? 334 LEU A CD1   1 
ATOM   2567  C CD2   . LEU A 1 334 ? 12.841  -38.597 -37.746  1.00 22.08 ? 334 LEU A CD2   1 
ATOM   2568  N N     . ALA A 1 335 ? 9.010   -38.296 -41.643  1.00 28.72 ? 335 ALA A N     1 
ATOM   2569  C CA    . ALA A 1 335 ? 8.412   -38.512 -42.947  1.00 29.29 ? 335 ALA A CA    1 
ATOM   2570  C C     . ALA A 1 335 ? 8.909   -37.531 -43.990  1.00 30.15 ? 335 ALA A C     1 
ATOM   2571  O O     . ALA A 1 335 ? 9.305   -37.941 -45.047  1.00 31.33 ? 335 ALA A O     1 
ATOM   2572  C CB    . ALA A 1 335 ? 6.903   -38.458 -42.848  1.00 28.56 ? 335 ALA A CB    1 
ATOM   2573  N N     . ALA A 1 336 ? 8.937   -36.253 -43.646  1.00 31.22 ? 336 ALA A N     1 
ATOM   2574  C CA    . ALA A 1 336 ? 9.275   -35.173 -44.540  1.00 31.64 ? 336 ALA A CA    1 
ATOM   2575  C C     . ALA A 1 336 ? 10.732  -35.017 -44.690  1.00 33.35 ? 336 ALA A C     1 
ATOM   2576  O O     . ALA A 1 336 ? 11.179  -34.495 -45.737  1.00 34.29 ? 336 ALA A O     1 
ATOM   2577  C CB    . ALA A 1 336 ? 8.760   -33.909 -43.999  1.00 31.35 ? 336 ALA A CB    1 
ATOM   2578  N N     . ALA A 1 337 ? 11.474  -35.344 -43.619  1.00 33.42 ? 337 ALA A N     1 
ATOM   2579  C CA    . ALA A 1 337 ? 12.913  -35.361 -43.739  1.00 33.79 ? 337 ALA A CA    1 
ATOM   2580  C C     . ALA A 1 337 ? 13.272  -36.499 -44.675  1.00 34.13 ? 337 ALA A C     1 
ATOM   2581  O O     . ALA A 1 337 ? 14.084  -36.293 -45.571  1.00 34.56 ? 337 ALA A O     1 
ATOM   2582  C CB    . ALA A 1 337 ? 13.637  -35.520 -42.382  1.00 33.40 ? 337 ALA A CB    1 
ATOM   2583  N N     . ASP A 1 338 ? 12.695  -37.694 -44.457  1.00 33.67 ? 338 ASP A N     1 
ATOM   2584  C CA    . ASP A 1 338 ? 12.927  -38.792 -45.373  1.00 33.37 ? 338 ASP A CA    1 
ATOM   2585  C C     . ASP A 1 338 ? 12.694  -38.336 -46.801  1.00 32.67 ? 338 ASP A C     1 
ATOM   2586  O O     . ASP A 1 338 ? 13.432  -38.716 -47.694  1.00 33.01 ? 338 ASP A O     1 
ATOM   2587  C CB    . ASP A 1 338 ? 12.070  -40.003 -45.041  1.00 33.59 ? 338 ASP A CB    1 
ATOM   2588  C CG    . ASP A 1 338 ? 12.523  -40.711 -43.763  1.00 37.56 ? 338 ASP A CG    1 
ATOM   2589  O OD1   . ASP A 1 338 ? 13.598  -40.401 -43.205  1.00 40.50 ? 338 ASP A OD1   1 
ATOM   2590  O OD2   . ASP A 1 338 ? 11.786  -41.602 -43.305  1.00 43.45 ? 338 ASP A OD2   1 
ATOM   2591  N N     . LYS A 1 339 ? 11.664  -37.522 -47.005  1.00 31.64 ? 339 LYS A N     1 
ATOM   2592  C CA    . LYS A 1 339 ? 11.184  -37.214 -48.346  1.00 30.77 ? 339 LYS A CA    1 
ATOM   2593  C C     . LYS A 1 339 ? 12.193  -36.364 -49.112  1.00 30.17 ? 339 LYS A C     1 
ATOM   2594  O O     . LYS A 1 339 ? 12.513  -36.652 -50.265  1.00 30.87 ? 339 LYS A O     1 
ATOM   2595  C CB    . LYS A 1 339 ? 9.834   -36.496 -48.281  1.00 31.38 ? 339 LYS A CB    1 
ATOM   2596  C CG    . LYS A 1 339 ? 9.035   -36.559 -49.572  1.00 31.56 ? 339 LYS A CG    1 
ATOM   2597  C CD    . LYS A 1 339 ? 7.560   -36.290 -49.322  1.00 31.54 ? 339 LYS A CD    1 
ATOM   2598  C CE    . LYS A 1 339 ? 6.866   -35.802 -50.583  1.00 34.57 ? 339 LYS A CE    1 
ATOM   2599  N NZ    . LYS A 1 339 ? 6.681   -34.325 -50.580  1.00 38.22 ? 339 LYS A NZ    1 
ATOM   2600  N N     . TRP A 1 340 ? 12.690  -35.318 -48.463  1.00 27.96 ? 340 TRP A N     1 
ATOM   2601  C CA    . TRP A 1 340 ? 13.372  -34.236 -49.163  1.00 26.67 ? 340 TRP A CA    1 
ATOM   2602  C C     . TRP A 1 340 ? 14.866  -34.237 -48.856  1.00 27.94 ? 340 TRP A C     1 
ATOM   2603  O O     . TRP A 1 340 ? 15.659  -33.637 -49.582  1.00 28.21 ? 340 TRP A O     1 
ATOM   2604  C CB    . TRP A 1 340 ? 12.759  -32.885 -48.789  1.00 24.94 ? 340 TRP A CB    1 
ATOM   2605  C CG    . TRP A 1 340 ? 11.392  -32.668 -49.362  1.00 21.38 ? 340 TRP A CG    1 
ATOM   2606  C CD1   . TRP A 1 340 ? 10.206  -32.694 -48.687  1.00 25.84 ? 340 TRP A CD1   1 
ATOM   2607  C CD2   . TRP A 1 340 ? 11.068  -32.392 -50.729  1.00 19.02 ? 340 TRP A CD2   1 
ATOM   2608  N NE1   . TRP A 1 340 ? 9.164   -32.450 -49.550  1.00 25.43 ? 340 TRP A NE1   1 
ATOM   2609  C CE2   . TRP A 1 340 ? 9.667   -32.262 -50.811  1.00 21.03 ? 340 TRP A CE2   1 
ATOM   2610  C CE3   . TRP A 1 340 ? 11.821  -32.241 -51.898  1.00 19.93 ? 340 TRP A CE3   1 
ATOM   2611  C CZ2   . TRP A 1 340 ? 9.008   -31.989 -52.009  1.00 15.83 ? 340 TRP A CZ2   1 
ATOM   2612  C CZ3   . TRP A 1 340 ? 11.165  -31.969 -53.085  1.00 24.12 ? 340 TRP A CZ3   1 
ATOM   2613  C CH2   . TRP A 1 340 ? 9.774   -31.846 -53.132  1.00 18.94 ? 340 TRP A CH2   1 
ATOM   2614  N N     . LEU A 1 341 ? 15.244  -34.915 -47.776  1.00 28.97 ? 341 LEU A N     1 
ATOM   2615  C CA    . LEU A 1 341 ? 16.535  -34.685 -47.140  1.00 29.48 ? 341 LEU A CA    1 
ATOM   2616  C C     . LEU A 1 341 ? 17.459  -35.886 -47.316  1.00 30.50 ? 341 LEU A C     1 
ATOM   2617  O O     . LEU A 1 341 ? 18.645  -35.821 -46.993  1.00 31.74 ? 341 LEU A O     1 
ATOM   2618  C CB    . LEU A 1 341 ? 16.351  -34.376 -45.652  1.00 28.88 ? 341 LEU A CB    1 
ATOM   2619  C CG    . LEU A 1 341 ? 16.157  -32.905 -45.284  1.00 27.47 ? 341 LEU A CG    1 
ATOM   2620  C CD1   . LEU A 1 341 ? 16.574  -32.653 -43.843  1.00 28.14 ? 341 LEU A CD1   1 
ATOM   2621  C CD2   . LEU A 1 341 ? 16.931  -32.006 -46.237  1.00 19.15 ? 341 LEU A CD2   1 
ATOM   2622  N N     . THR A 1 342 ? 16.907  -36.980 -47.830  1.00 31.53 ? 342 THR A N     1 
ATOM   2623  C CA    . THR A 1 342 ? 17.695  -38.193 -48.088  1.00 31.77 ? 342 THR A CA    1 
ATOM   2624  C C     . THR A 1 342 ? 18.929  -38.003 -48.997  1.00 32.29 ? 342 THR A C     1 
ATOM   2625  O O     . THR A 1 342 ? 18.845  -37.601 -50.213  1.00 33.21 ? 342 THR A O     1 
ATOM   2626  C CB    . THR A 1 342 ? 16.832  -39.376 -48.529  1.00 31.98 ? 342 THR A CB    1 
ATOM   2627  O OG1   . THR A 1 342 ? 15.798  -39.563 -47.548  1.00 30.15 ? 342 THR A OG1   1 
ATOM   2628  C CG2   . THR A 1 342 ? 17.672  -40.648 -48.580  1.00 32.97 ? 342 THR A CG2   1 
ATOM   2629  N N     . GLY A 1 343 ? 20.078  -38.302 -48.373  1.00 31.58 ? 343 GLY A N     1 
ATOM   2630  C CA    . GLY A 1 343 ? 21.397  -38.167 -48.981  1.00 29.47 ? 343 GLY A CA    1 
ATOM   2631  C C     . GLY A 1 343 ? 21.944  -36.766 -48.884  1.00 28.85 ? 343 GLY A C     1 
ATOM   2632  O O     . GLY A 1 343 ? 23.044  -36.541 -49.321  1.00 29.53 ? 343 GLY A O     1 
ATOM   2633  N N     . LEU A 1 344 ? 21.194  -35.822 -48.301  1.00 27.62 ? 344 LEU A N     1 
ATOM   2634  C CA    . LEU A 1 344 ? 21.653  -34.449 -48.150  1.00 25.76 ? 344 LEU A CA    1 
ATOM   2635  C C     . LEU A 1 344 ? 21.986  -34.148 -46.706  1.00 27.12 ? 344 LEU A C     1 
ATOM   2636  O O     . LEU A 1 344 ? 22.570  -33.097 -46.340  1.00 27.73 ? 344 LEU A O     1 
ATOM   2637  C CB    . LEU A 1 344 ? 20.570  -33.500 -48.620  1.00 24.94 ? 344 LEU A CB    1 
ATOM   2638  C CG    . LEU A 1 344 ? 20.142  -33.634 -50.095  1.00 22.05 ? 344 LEU A CG    1 
ATOM   2639  C CD1   . LEU A 1 344 ? 18.901  -32.733 -50.367  1.00 19.84 ? 344 LEU A CD1   1 
ATOM   2640  C CD2   . LEU A 1 344 ? 21.306  -33.346 -51.027  1.00 10.76 ? 344 LEU A CD2   1 
ATOM   2641  N N     . ALA A 1 345 ? 21.595  -35.066 -45.850  1.00 27.52 ? 345 ALA A N     1 
ATOM   2642  C CA    . ALA A 1 345 ? 21.645  -34.790 -44.422  1.00 28.23 ? 345 ALA A CA    1 
ATOM   2643  C C     . ALA A 1 345 ? 21.543  -36.065 -43.654  1.00 28.06 ? 345 ALA A C     1 
ATOM   2644  O O     . ALA A 1 345 ? 21.126  -37.066 -44.177  1.00 29.46 ? 345 ALA A O     1 
ATOM   2645  C CB    . ALA A 1 345 ? 20.526  -33.859 -44.043  1.00 26.87 ? 345 ALA A CB    1 
ATOM   2646  N N     . GLU A 1 346 ? 21.901  -36.033 -42.397  1.00 28.75 ? 346 GLU A N     1 
ATOM   2647  C CA    . GLU A 1 346 ? 21.609  -37.175 -41.548  1.00 29.36 ? 346 GLU A CA    1 
ATOM   2648  C C     . GLU A 1 346 ? 21.210  -36.759 -40.117  1.00 27.76 ? 346 GLU A C     1 
ATOM   2649  O O     . GLU A 1 346 ? 21.556  -35.665 -39.672  1.00 26.23 ? 346 GLU A O     1 
ATOM   2650  C CB    . GLU A 1 346 ? 22.780  -38.139 -41.574  1.00 29.76 ? 346 GLU A CB    1 
ATOM   2651  C CG    . GLU A 1 346 ? 24.201  -37.505 -41.736  1.00 32.25 ? 346 GLU A CG    1 
ATOM   2652  C CD    . GLU A 1 346 ? 25.292  -38.578 -41.717  1.00 34.00 ? 346 GLU A CD    1 
ATOM   2653  O OE1   . GLU A 1 346 ? 24.861  -39.794 -41.749  1.00 37.03 ? 346 GLU A OE1   1 
ATOM   2654  O OE2   . GLU A 1 346 ? 26.536  -38.210 -41.620  1.00 33.50 ? 346 GLU A OE2   1 
ATOM   2655  N N     . TRP A 1 347 ? 20.518  -37.662 -39.416  1.00 25.78 ? 347 TRP A N     1 
ATOM   2656  C CA    . TRP A 1 347 ? 19.779  -37.339 -38.224  1.00 25.32 ? 347 TRP A CA    1 
ATOM   2657  C C     . TRP A 1 347 ? 19.354  -38.608 -37.592  1.00 26.07 ? 347 TRP A C     1 
ATOM   2658  O O     . TRP A 1 347 ? 19.098  -39.596 -38.300  1.00 26.71 ? 347 TRP A O     1 
ATOM   2659  C CB    . TRP A 1 347 ? 18.509  -36.489 -38.531  1.00 24.42 ? 347 TRP A CB    1 
ATOM   2660  C CG    . TRP A 1 347 ? 17.528  -37.167 -39.409  1.00 22.59 ? 347 TRP A CG    1 
ATOM   2661  C CD1   . TRP A 1 347 ? 16.501  -37.972 -39.006  1.00 23.39 ? 347 TRP A CD1   1 
ATOM   2662  C CD2   . TRP A 1 347 ? 17.475  -37.130 -40.866  1.00 21.52 ? 347 TRP A CD2   1 
ATOM   2663  N NE1   . TRP A 1 347 ? 15.814  -38.430 -40.123  1.00 26.87 ? 347 TRP A NE1   1 
ATOM   2664  C CE2   . TRP A 1 347 ? 16.402  -37.941 -41.267  1.00 21.33 ? 347 TRP A CE2   1 
ATOM   2665  C CE3   . TRP A 1 347 ? 18.250  -36.489 -41.866  1.00 25.65 ? 347 TRP A CE3   1 
ATOM   2666  C CZ2   . TRP A 1 347 ? 16.044  -38.122 -42.639  1.00 25.47 ? 347 TRP A CZ2   1 
ATOM   2667  C CZ3   . TRP A 1 347 ? 17.911  -36.666 -43.233  1.00 24.22 ? 347 TRP A CZ3   1 
ATOM   2668  C CH2   . TRP A 1 347 ? 16.809  -37.480 -43.605  1.00 23.72 ? 347 TRP A CH2   1 
ATOM   2669  N N     . HIS A 1 348 ? 19.227  -38.571 -36.263  1.00 26.39 ? 348 HIS A N     1 
ATOM   2670  C CA    . HIS A 1 348 ? 18.603  -39.645 -35.499  1.00 25.87 ? 348 HIS A CA    1 
ATOM   2671  C C     . HIS A 1 348 ? 17.186  -39.321 -35.169  1.00 26.23 ? 348 HIS A C     1 
ATOM   2672  O O     . HIS A 1 348 ? 16.840  -38.136 -34.967  1.00 25.25 ? 348 HIS A O     1 
ATOM   2673  C CB    . HIS A 1 348 ? 19.312  -39.808 -34.178  1.00 26.10 ? 348 HIS A CB    1 
ATOM   2674  C CG    . HIS A 1 348 ? 20.769  -40.128 -34.297  1.00 26.72 ? 348 HIS A CG    1 
ATOM   2675  N ND1   . HIS A 1 348 ? 21.234  -41.290 -34.880  1.00 22.55 ? 348 HIS A ND1   1 
ATOM   2676  C CD2   . HIS A 1 348 ? 21.865  -39.451 -33.862  1.00 27.96 ? 348 HIS A CD2   1 
ATOM   2677  C CE1   . HIS A 1 348 ? 22.559  -41.297 -34.811  1.00 26.75 ? 348 HIS A CE1   1 
ATOM   2678  N NE2   . HIS A 1 348 ? 22.964  -40.207 -34.178  1.00 24.65 ? 348 HIS A NE2   1 
ATOM   2679  N N     . VAL A 1 349 ? 16.373  -40.386 -35.069  1.00 27.36 ? 349 VAL A N     1 
ATOM   2680  C CA    . VAL A 1 349 ? 15.020  -40.330 -34.574  1.00 27.73 ? 349 VAL A CA    1 
ATOM   2681  C C     . VAL A 1 349 ? 15.012  -39.763 -33.133  1.00 28.90 ? 349 VAL A C     1 
ATOM   2682  O O     . VAL A 1 349 ? 15.543  -40.397 -32.226  1.00 29.79 ? 349 VAL A O     1 
ATOM   2683  C CB    . VAL A 1 349 ? 14.435  -41.749 -34.476  1.00 29.04 ? 349 VAL A CB    1 
ATOM   2684  C CG1   . VAL A 1 349 ? 15.170  -42.541 -33.329  1.00 28.73 ? 349 VAL A CG1   1 
ATOM   2685  C CG2   . VAL A 1 349 ? 12.851  -41.728 -34.169  1.00 23.86 ? 349 VAL A CG2   1 
ATOM   2686  N N     . PRO A 1 350 ? 14.361  -38.616 -32.890  1.00 29.63 ? 350 PRO A N     1 
ATOM   2687  C CA    . PRO A 1 350 ? 14.347  -38.179 -31.482  1.00 30.29 ? 350 PRO A CA    1 
ATOM   2688  C C     . PRO A 1 350 ? 13.650  -39.210 -30.581  1.00 30.39 ? 350 PRO A C     1 
ATOM   2689  O O     . PRO A 1 350 ? 12.626  -39.775 -30.945  1.00 30.33 ? 350 PRO A O     1 
ATOM   2690  C CB    . PRO A 1 350 ? 13.522  -36.879 -31.531  1.00 29.88 ? 350 PRO A CB    1 
ATOM   2691  C CG    . PRO A 1 350 ? 13.654  -36.419 -32.979  1.00 28.24 ? 350 PRO A CG    1 
ATOM   2692  C CD    . PRO A 1 350 ? 13.590  -37.691 -33.741  1.00 29.18 ? 350 PRO A CD    1 
ATOM   2693  N N     . ALA A 1 351 ? 14.256  -39.468 -29.432  1.00 30.88 ? 351 ALA A N     1 
ATOM   2694  C CA    . ALA A 1 351 ? 13.713  -40.411 -28.460  1.00 30.16 ? 351 ALA A CA    1 
ATOM   2695  C C     . ALA A 1 351 ? 12.603  -39.776 -27.615  1.00 29.46 ? 351 ALA A C     1 
ATOM   2696  O O     . ALA A 1 351 ? 11.732  -40.489 -27.109  1.00 30.33 ? 351 ALA A O     1 
ATOM   2697  C CB    . ALA A 1 351 ? 14.807  -40.954 -27.605  1.00 29.10 ? 351 ALA A CB    1 
ATOM   2698  N N     . ALA A 1 352 ? 12.586  -38.440 -27.541  1.00 27.75 ? 352 ALA A N     1 
ATOM   2699  C CA    . ALA A 1 352 ? 11.683  -37.681 -26.638  1.00 27.15 ? 352 ALA A CA    1 
ATOM   2700  C C     . ALA A 1 352 ? 11.741  -36.201 -26.967  1.00 27.31 ? 352 ALA A C     1 
ATOM   2701  O O     . ALA A 1 352 ? 12.619  -35.756 -27.728  1.00 28.32 ? 352 ALA A O     1 
ATOM   2702  C CB    . ALA A 1 352 ? 12.007  -37.909 -25.148  1.00 24.56 ? 352 ALA A CB    1 
ATOM   2703  N N     . GLY A 1 353 ? 10.783  -35.435 -26.459  1.00 26.94 ? 353 GLY A N     1 
ATOM   2704  C CA    . GLY A 1 353 ? 10.930  -34.010 -26.558  1.00 28.12 ? 353 GLY A CA    1 
ATOM   2705  C C     . GLY A 1 353 ? 10.263  -33.515 -27.799  1.00 29.53 ? 353 GLY A C     1 
ATOM   2706  O O     . GLY A 1 353 ? 9.452   -34.220 -28.395  1.00 29.66 ? 353 GLY A O     1 
ATOM   2707  N N     . MET A 1 354 ? 10.597  -32.299 -28.204  1.00 30.72 ? 354 MET A N     1 
ATOM   2708  C CA    . MET A 1 354 ? 9.977   -31.722 -29.404  1.00 32.27 ? 354 MET A CA    1 
ATOM   2709  C C     . MET A 1 354 ? 11.000  -31.277 -30.472  1.00 31.19 ? 354 MET A C     1 
ATOM   2710  O O     . MET A 1 354 ? 10.671  -30.424 -31.312  1.00 31.27 ? 354 MET A O     1 
ATOM   2711  C CB    . MET A 1 354 ? 9.117   -30.529 -29.007  1.00 31.84 ? 354 MET A CB    1 
ATOM   2712  C CG    . MET A 1 354 ? 9.923   -29.513 -28.147  1.00 35.29 ? 354 MET A CG    1 
ATOM   2713  S SD    . MET A 1 354 ? 8.878   -28.309 -27.258  1.00 34.41 ? 354 MET A SD    1 
ATOM   2714  C CE    . MET A 1 354 ? 7.820   -29.512 -26.468  1.00 36.69 ? 354 MET A CE    1 
ATOM   2715  N N     . PHE A 1 355 ? 12.216  -31.819 -30.434  1.00 29.59 ? 355 PHE A N     1 
ATOM   2716  C CA    . PHE A 1 355 ? 13.227  -31.358 -31.384  1.00 30.22 ? 355 PHE A CA    1 
ATOM   2717  C C     . PHE A 1 355 ? 13.800  -32.438 -32.288  1.00 29.75 ? 355 PHE A C     1 
ATOM   2718  O O     . PHE A 1 355 ? 13.882  -33.606 -31.897  1.00 30.76 ? 355 PHE A O     1 
ATOM   2719  C CB    . PHE A 1 355 ? 14.354  -30.613 -30.680  1.00 30.03 ? 355 PHE A CB    1 
ATOM   2720  C CG    . PHE A 1 355 ? 13.921  -29.341 -30.025  1.00 30.09 ? 355 PHE A CG    1 
ATOM   2721  C CD1   . PHE A 1 355 ? 13.393  -28.293 -30.800  1.00 30.52 ? 355 PHE A CD1   1 
ATOM   2722  C CD2   . PHE A 1 355 ? 14.049  -29.181 -28.637  1.00 29.24 ? 355 PHE A CD2   1 
ATOM   2723  C CE1   . PHE A 1 355 ? 12.960  -27.113 -30.229  1.00 31.90 ? 355 PHE A CE1   1 
ATOM   2724  C CE2   . PHE A 1 355 ? 13.639  -27.994 -28.032  1.00 34.52 ? 355 PHE A CE2   1 
ATOM   2725  C CZ    . PHE A 1 355 ? 13.082  -26.957 -28.818  1.00 34.09 ? 355 PHE A CZ    1 
ATOM   2726  N N     . LEU A 1 356 ? 14.209  -32.026 -33.480  1.00 28.55 ? 356 LEU A N     1 
ATOM   2727  C CA    . LEU A 1 356 ? 14.980  -32.871 -34.367  1.00 28.35 ? 356 LEU A CA    1 
ATOM   2728  C C     . LEU A 1 356 ? 16.283  -32.190 -34.781  1.00 28.05 ? 356 LEU A C     1 
ATOM   2729  O O     . LEU A 1 356 ? 16.342  -30.994 -35.012  1.00 27.52 ? 356 LEU A O     1 
ATOM   2730  C CB    . LEU A 1 356 ? 14.161  -33.296 -35.563  1.00 29.34 ? 356 LEU A CB    1 
ATOM   2731  C CG    . LEU A 1 356 ? 14.879  -34.088 -36.663  1.00 31.75 ? 356 LEU A CG    1 
ATOM   2732  C CD1   . LEU A 1 356 ? 15.009  -35.610 -36.361  1.00 32.08 ? 356 LEU A CD1   1 
ATOM   2733  C CD2   . LEU A 1 356 ? 14.132  -33.874 -37.921  1.00 28.28 ? 356 LEU A CD2   1 
ATOM   2734  N N     . TRP A 1 357 ? 17.356  -32.971 -34.803  1.00 28.25 ? 357 TRP A N     1 
ATOM   2735  C CA    . TRP A 1 357 ? 18.709  -32.442 -34.888  1.00 27.14 ? 357 TRP A CA    1 
ATOM   2736  C C     . TRP A 1 357 ? 19.322  -33.011 -36.134  1.00 26.49 ? 357 TRP A C     1 
ATOM   2737  O O     . TRP A 1 357 ? 19.547  -34.215 -36.260  1.00 26.87 ? 357 TRP A O     1 
ATOM   2738  C CB    . TRP A 1 357 ? 19.448  -32.826 -33.640  1.00 26.58 ? 357 TRP A CB    1 
ATOM   2739  C CG    . TRP A 1 357 ? 20.864  -32.383 -33.460  1.00 27.01 ? 357 TRP A CG    1 
ATOM   2740  C CD1   . TRP A 1 357 ? 21.973  -33.199 -33.349  1.00 26.72 ? 357 TRP A CD1   1 
ATOM   2741  C CD2   . TRP A 1 357 ? 21.339  -31.048 -33.271  1.00 26.87 ? 357 TRP A CD2   1 
ATOM   2742  N NE1   . TRP A 1 357 ? 23.116  -32.448 -33.150  1.00 25.03 ? 357 TRP A NE1   1 
ATOM   2743  C CE2   . TRP A 1 357 ? 22.766  -31.129 -33.076  1.00 26.24 ? 357 TRP A CE2   1 
ATOM   2744  C CE3   . TRP A 1 357 ? 20.724  -29.792 -33.268  1.00 23.32 ? 357 TRP A CE3   1 
ATOM   2745  C CZ2   . TRP A 1 357 ? 23.573  -29.998 -32.850  1.00 24.46 ? 357 TRP A CZ2   1 
ATOM   2746  C CZ3   . TRP A 1 357 ? 21.535  -28.656 -33.016  1.00 26.04 ? 357 TRP A CZ3   1 
ATOM   2747  C CH2   . TRP A 1 357 ? 22.954  -28.778 -32.823  1.00 26.26 ? 357 TRP A CH2   1 
ATOM   2748  N N     . ILE A 1 358 ? 19.502  -32.134 -37.109  1.00 26.20 ? 358 ILE A N     1 
ATOM   2749  C CA    . ILE A 1 358 ? 19.765  -32.556 -38.487  1.00 24.33 ? 358 ILE A CA    1 
ATOM   2750  C C     . ILE A 1 358 ? 21.149  -32.078 -38.895  1.00 24.56 ? 358 ILE A C     1 
ATOM   2751  O O     . ILE A 1 358 ? 21.444  -30.902 -38.810  1.00 25.57 ? 358 ILE A O     1 
ATOM   2752  C CB    . ILE A 1 358 ? 18.691  -31.925 -39.396  1.00 23.58 ? 358 ILE A CB    1 
ATOM   2753  C CG1   . ILE A 1 358 ? 17.280  -32.429 -39.002  1.00 20.79 ? 358 ILE A CG1   1 
ATOM   2754  C CG2   . ILE A 1 358 ? 19.049  -32.116 -40.875  1.00 22.27 ? 358 ILE A CG2   1 
ATOM   2755  C CD1   . ILE A 1 358 ? 16.161  -31.747 -39.741  1.00 21.37 ? 358 ILE A CD1   1 
ATOM   2756  N N     . LYS A 1 359 ? 21.988  -33.008 -39.338  1.00 25.48 ? 359 LYS A N     1 
ATOM   2757  C CA    . LYS A 1 359 ? 23.358  -32.684 -39.715  1.00 27.41 ? 359 LYS A CA    1 
ATOM   2758  C C     . LYS A 1 359 ? 23.523  -32.654 -41.231  1.00 28.64 ? 359 LYS A C     1 
ATOM   2759  O O     . LYS A 1 359 ? 23.522  -33.700 -41.881  1.00 29.31 ? 359 LYS A O     1 
ATOM   2760  C CB    . LYS A 1 359 ? 24.334  -33.679 -39.095  1.00 26.68 ? 359 LYS A CB    1 
ATOM   2761  C CG    . LYS A 1 359 ? 25.783  -33.224 -39.098  1.00 30.33 ? 359 LYS A CG    1 
ATOM   2762  C CD    . LYS A 1 359 ? 26.672  -34.196 -39.846  1.00 31.78 ? 359 LYS A CD    1 
ATOM   2763  C CE    . LYS A 1 359 ? 27.803  -34.700 -38.964  1.00 35.58 ? 359 LYS A CE    1 
ATOM   2764  N NZ    . LYS A 1 359 ? 28.920  -33.725 -38.879  1.00 38.29 ? 359 LYS A NZ    1 
ATOM   2765  N N     . VAL A 1 360 ? 23.663  -31.456 -41.787  1.00 29.45 ? 360 VAL A N     1 
ATOM   2766  C CA    . VAL A 1 360 ? 23.618  -31.273 -43.233  1.00 31.10 ? 360 VAL A CA    1 
ATOM   2767  C C     . VAL A 1 360 ? 24.976  -31.546 -43.868  1.00 32.92 ? 360 VAL A C     1 
ATOM   2768  O O     . VAL A 1 360 ? 26.001  -31.050 -43.399  1.00 32.87 ? 360 VAL A O     1 
ATOM   2769  C CB    . VAL A 1 360 ? 23.164  -29.849 -43.607  1.00 31.03 ? 360 VAL A CB    1 
ATOM   2770  C CG1   . VAL A 1 360 ? 22.172  -29.327 -42.583  1.00 30.84 ? 360 VAL A CG1   1 
ATOM   2771  C CG2   . VAL A 1 360 ? 24.364  -28.922 -43.727  1.00 29.76 ? 360 VAL A CG2   1 
ATOM   2772  N N     . LYS A 1 361 ? 24.977  -32.335 -44.936  1.00 34.95 ? 361 LYS A N     1 
ATOM   2773  C CA    . LYS A 1 361 ? 26.215  -32.851 -45.507  1.00 36.99 ? 361 LYS A CA    1 
ATOM   2774  C C     . LYS A 1 361 ? 26.917  -31.792 -46.352  1.00 37.02 ? 361 LYS A C     1 
ATOM   2775  O O     . LYS A 1 361 ? 26.272  -31.036 -47.077  1.00 37.23 ? 361 LYS A O     1 
ATOM   2776  C CB    . LYS A 1 361 ? 25.939  -34.097 -46.349  1.00 36.96 ? 361 LYS A CB    1 
ATOM   2777  C CG    . LYS A 1 361 ? 25.485  -35.302 -45.542  1.00 40.77 ? 361 LYS A CG    1 
ATOM   2778  C CD    . LYS A 1 361 ? 25.993  -36.598 -46.154  1.00 45.07 ? 361 LYS A CD    1 
ATOM   2779  C CE    . LYS A 1 361 ? 24.884  -37.337 -46.883  1.00 48.69 ? 361 LYS A CE    1 
ATOM   2780  N NZ    . LYS A 1 361 ? 25.359  -37.930 -48.163  1.00 49.37 ? 361 LYS A NZ    1 
ATOM   2781  N N     . GLY A 1 362 ? 28.241  -31.745 -46.252  1.00 37.61 ? 362 GLY A N     1 
ATOM   2782  C CA    . GLY A 1 362 ? 29.039  -30.882 -47.102  1.00 37.90 ? 362 GLY A CA    1 
ATOM   2783  C C     . GLY A 1 362 ? 28.783  -29.388 -47.047  1.00 38.90 ? 362 GLY A C     1 
ATOM   2784  O O     . GLY A 1 362 ? 28.924  -28.724 -48.071  1.00 39.06 ? 362 GLY A O     1 
ATOM   2785  N N     . ILE A 1 363 ? 28.381  -28.869 -45.878  1.00 39.66 ? 363 ILE A N     1 
ATOM   2786  C CA    . ILE A 1 363 ? 28.364  -27.427 -45.584  1.00 40.41 ? 363 ILE A CA    1 
ATOM   2787  C C     . ILE A 1 363 ? 28.994  -27.284 -44.212  1.00 42.21 ? 363 ILE A C     1 
ATOM   2788  O O     . ILE A 1 363 ? 28.508  -27.890 -43.253  1.00 42.83 ? 363 ILE A O     1 
ATOM   2789  C CB    . ILE A 1 363 ? 26.900  -26.869 -45.584  1.00 40.71 ? 363 ILE A CB    1 
ATOM   2790  C CG1   . ILE A 1 363 ? 26.386  -26.700 -47.014  1.00 37.83 ? 363 ILE A CG1   1 
ATOM   2791  C CG2   . ILE A 1 363 ? 26.749  -25.537 -44.817  1.00 39.00 ? 363 ILE A CG2   1 
ATOM   2792  C CD1   . ILE A 1 363 ? 25.042  -26.107 -47.040  1.00 36.59 ? 363 ILE A CD1   1 
ATOM   2793  N N     . ASN A 1 364 ? 30.077  -26.510 -44.080  1.00 43.74 ? 364 ASN A N     1 
ATOM   2794  C CA    . ASN A 1 364 ? 30.780  -26.484 -42.750  1.00 44.75 ? 364 ASN A CA    1 
ATOM   2795  C C     . ASN A 1 364 ? 30.007  -25.702 -41.662  1.00 44.79 ? 364 ASN A C     1 
ATOM   2796  O O     . ASN A 1 364 ? 29.918  -26.139 -40.502  1.00 43.87 ? 364 ASN A O     1 
ATOM   2797  C CB    . ASN A 1 364 ? 32.305  -26.184 -42.873  1.00 45.12 ? 364 ASN A CB    1 
ATOM   2798  C CG    . ASN A 1 364 ? 32.761  -24.887 -42.170  1.00 47.39 ? 364 ASN A CG    1 
ATOM   2799  O OD1   . ASN A 1 364 ? 33.831  -24.875 -41.528  1.00 48.18 ? 364 ASN A OD1   1 
ATOM   2800  N ND2   . ASN A 1 364 ? 32.001  -23.782 -42.336  1.00 48.82 ? 364 ASN A ND2   1 
ATOM   2801  N N     . ASP A 1 365 ? 29.398  -24.586 -42.083  1.00 44.98 ? 365 ASP A N     1 
ATOM   2802  C CA    . ASP A 1 365 ? 28.547  -23.795 -41.224  1.00 45.34 ? 365 ASP A CA    1 
ATOM   2803  C C     . ASP A 1 365 ? 27.215  -23.488 -41.845  1.00 45.32 ? 365 ASP A C     1 
ATOM   2804  O O     . ASP A 1 365 ? 27.132  -22.982 -42.982  1.00 45.88 ? 365 ASP A O     1 
ATOM   2805  C CB    . ASP A 1 365 ? 29.202  -22.489 -40.770  1.00 45.93 ? 365 ASP A CB    1 
ATOM   2806  C CG    . ASP A 1 365 ? 28.480  -21.880 -39.556  1.00 47.13 ? 365 ASP A CG    1 
ATOM   2807  O OD1   . ASP A 1 365 ? 28.293  -20.632 -39.497  1.00 48.63 ? 365 ASP A OD1   1 
ATOM   2808  O OD2   . ASP A 1 365 ? 28.081  -22.681 -38.667  1.00 46.11 ? 365 ASP A OD2   1 
ATOM   2809  N N     . VAL A 1 366 ? 26.177  -23.783 -41.070  1.00 44.41 ? 366 VAL A N     1 
ATOM   2810  C CA    . VAL A 1 366 ? 24.796  -23.592 -41.491  1.00 44.69 ? 366 VAL A CA    1 
ATOM   2811  C C     . VAL A 1 366 ? 24.206  -22.182 -41.204  1.00 44.77 ? 366 VAL A C     1 
ATOM   2812  O O     . VAL A 1 366 ? 23.040  -21.925 -41.524  1.00 44.72 ? 366 VAL A O     1 
ATOM   2813  C CB    . VAL A 1 366 ? 23.878  -24.764 -40.938  1.00 44.85 ? 366 VAL A CB    1 
ATOM   2814  C CG1   . VAL A 1 366 ? 23.670  -24.668 -39.412  1.00 43.09 ? 366 VAL A CG1   1 
ATOM   2815  C CG2   . VAL A 1 366 ? 22.572  -24.818 -41.662  1.00 43.90 ? 366 VAL A CG2   1 
ATOM   2816  N N     . LYS A 1 367 ? 25.007  -21.282 -40.624  1.00 44.69 ? 367 LYS A N     1 
ATOM   2817  C CA    . LYS A 1 367 ? 24.555  -19.916 -40.312  1.00 44.78 ? 367 LYS A CA    1 
ATOM   2818  C C     . LYS A 1 367 ? 24.184  -19.088 -41.538  1.00 44.44 ? 367 LYS A C     1 
ATOM   2819  O O     . LYS A 1 367 ? 23.141  -18.465 -41.528  1.00 44.98 ? 367 LYS A O     1 
ATOM   2820  C CB    . LYS A 1 367 ? 25.567  -19.158 -39.451  1.00 45.05 ? 367 LYS A CB    1 
ATOM   2821  C CG    . LYS A 1 367 ? 25.220  -19.150 -37.964  1.00 45.61 ? 367 LYS A CG    1 
ATOM   2822  C CD    . LYS A 1 367 ? 26.411  -18.775 -37.082  1.00 46.12 ? 367 LYS A CD    1 
ATOM   2823  C CE    . LYS A 1 367 ? 26.558  -17.299 -36.881  1.00 46.86 ? 367 LYS A CE    1 
ATOM   2824  N NZ    . LYS A 1 367 ? 25.239  -16.635 -36.788  1.00 48.93 ? 367 LYS A NZ    1 
ATOM   2825  N N     . GLU A 1 368 ? 25.014  -19.078 -42.583  1.00 44.01 ? 368 GLU A N     1 
ATOM   2826  C CA    . GLU A 1 368 ? 24.640  -18.451 -43.865  1.00 44.14 ? 368 GLU A CA    1 
ATOM   2827  C C     . GLU A 1 368 ? 23.390  -19.109 -44.453  1.00 43.25 ? 368 GLU A C     1 
ATOM   2828  O O     . GLU A 1 368 ? 22.464  -18.448 -44.880  1.00 43.39 ? 368 GLU A O     1 
ATOM   2829  C CB    . GLU A 1 368 ? 25.762  -18.572 -44.903  1.00 44.25 ? 368 GLU A CB    1 
ATOM   2830  C CG    . GLU A 1 368 ? 27.012  -17.705 -44.640  1.00 48.11 ? 368 GLU A CG    1 
ATOM   2831  C CD    . GLU A 1 368 ? 27.903  -18.220 -43.467  1.00 50.64 ? 368 GLU A CD    1 
ATOM   2832  O OE1   . GLU A 1 368 ? 28.535  -17.360 -42.793  1.00 52.35 ? 368 GLU A OE1   1 
ATOM   2833  O OE2   . GLU A 1 368 ? 27.965  -19.459 -43.223  1.00 47.47 ? 368 GLU A OE2   1 
ATOM   2834  N N     . LEU A 1 369 ? 23.386  -20.433 -44.473  1.00 42.94 ? 369 LEU A N     1 
ATOM   2835  C CA    . LEU A 1 369 ? 22.339  -21.167 -45.112  1.00 41.46 ? 369 LEU A CA    1 
ATOM   2836  C C     . LEU A 1 369 ? 21.014  -20.716 -44.521  1.00 41.26 ? 369 LEU A C     1 
ATOM   2837  O O     . LEU A 1 369 ? 20.111  -20.343 -45.265  1.00 39.44 ? 369 LEU A O     1 
ATOM   2838  C CB    . LEU A 1 369 ? 22.566  -22.685 -45.013  1.00 40.84 ? 369 LEU A CB    1 
ATOM   2839  C CG    . LEU A 1 369 ? 21.321  -23.446 -45.482  1.00 38.72 ? 369 LEU A CG    1 
ATOM   2840  C CD1   . LEU A 1 369 ? 21.116  -23.275 -46.960  1.00 37.01 ? 369 LEU A CD1   1 
ATOM   2841  C CD2   . LEU A 1 369 ? 21.426  -24.874 -45.130  1.00 38.46 ? 369 LEU A CD2   1 
ATOM   2842  N N     . ILE A 1 370 ? 20.932  -20.690 -43.184  1.00 42.42 ? 370 ILE A N     1 
ATOM   2843  C CA    . ILE A 1 370 ? 19.716  -20.217 -42.529  1.00 42.67 ? 370 ILE A CA    1 
ATOM   2844  C C     . ILE A 1 370 ? 19.569  -18.696 -42.501  1.00 43.57 ? 370 ILE A C     1 
ATOM   2845  O O     . ILE A 1 370 ? 18.614  -18.154 -43.055  1.00 43.37 ? 370 ILE A O     1 
ATOM   2846  C CB    . ILE A 1 370 ? 19.510  -20.772 -41.114  1.00 42.66 ? 370 ILE A CB    1 
ATOM   2847  C CG1   . ILE A 1 370 ? 19.553  -22.296 -41.107  1.00 42.46 ? 370 ILE A CG1   1 
ATOM   2848  C CG2   . ILE A 1 370 ? 18.132  -20.313 -40.597  1.00 41.87 ? 370 ILE A CG2   1 
ATOM   2849  C CD1   . ILE A 1 370 ? 18.218  -22.975 -41.602  1.00 42.23 ? 370 ILE A CD1   1 
ATOM   2850  N N     . GLU A 1 371 ? 20.492  -18.004 -41.836  1.00 45.09 ? 371 GLU A N     1 
ATOM   2851  C CA    . GLU A 1 371 ? 20.333  -16.552 -41.636  1.00 46.35 ? 371 GLU A CA    1 
ATOM   2852  C C     . GLU A 1 371 ? 20.329  -15.707 -42.939  1.00 46.26 ? 371 GLU A C     1 
ATOM   2853  O O     . GLU A 1 371 ? 19.991  -14.538 -42.889  1.00 46.67 ? 371 GLU A O     1 
ATOM   2854  C CB    . GLU A 1 371 ? 21.334  -16.014 -40.596  1.00 46.75 ? 371 GLU A CB    1 
ATOM   2855  C CG    . GLU A 1 371 ? 20.854  -16.158 -39.147  1.00 49.02 ? 371 GLU A CG    1 
ATOM   2856  C CD    . GLU A 1 371 ? 21.985  -16.507 -38.165  1.00 53.12 ? 371 GLU A CD    1 
ATOM   2857  O OE1   . GLU A 1 371 ? 21.697  -17.094 -37.081  1.00 53.49 ? 371 GLU A OE1   1 
ATOM   2858  O OE2   . GLU A 1 371 ? 23.160  -16.195 -38.472  1.00 52.80 ? 371 GLU A OE2   1 
ATOM   2859  N N     . GLU A 1 372 ? 20.680  -16.274 -44.095  1.00 45.98 ? 372 GLU A N     1 
ATOM   2860  C CA    . GLU A 1 372 ? 20.600  -15.483 -45.326  1.00 46.20 ? 372 GLU A CA    1 
ATOM   2861  C C     . GLU A 1 372 ? 19.623  -16.054 -46.330  1.00 45.88 ? 372 GLU A C     1 
ATOM   2862  O O     . GLU A 1 372 ? 18.605  -15.437 -46.635  1.00 45.39 ? 372 GLU A O     1 
ATOM   2863  C CB    . GLU A 1 372 ? 21.970  -15.259 -45.966  1.00 45.44 ? 372 GLU A CB    1 
ATOM   2864  C CG    . GLU A 1 372 ? 22.837  -14.276 -45.214  1.00 45.91 ? 372 GLU A CG    1 
ATOM   2865  C CD    . GLU A 1 372 ? 24.186  -14.034 -45.908  1.00 47.98 ? 372 GLU A CD    1 
ATOM   2866  O OE1   . GLU A 1 372 ? 24.153  -13.570 -47.078  1.00 49.81 ? 372 GLU A OE1   1 
ATOM   2867  O OE2   . GLU A 1 372 ? 25.271  -14.293 -45.286  1.00 49.10 ? 372 GLU A OE2   1 
ATOM   2868  N N     . LYS A 1 373 ? 19.950  -17.237 -46.841  1.00 45.74 ? 373 LYS A N     1 
ATOM   2869  C CA    . LYS A 1 373 ? 19.119  -17.928 -47.816  1.00 45.03 ? 373 LYS A CA    1 
ATOM   2870  C C     . LYS A 1 373 ? 17.746  -18.394 -47.276  1.00 44.55 ? 373 LYS A C     1 
ATOM   2871  O O     . LYS A 1 373 ? 16.695  -18.042 -47.843  1.00 43.70 ? 373 LYS A O     1 
ATOM   2872  C CB    . LYS A 1 373 ? 19.897  -19.123 -48.368  1.00 45.42 ? 373 LYS A CB    1 
ATOM   2873  C CG    . LYS A 1 373 ? 21.214  -18.777 -49.061  1.00 46.60 ? 373 LYS A CG    1 
ATOM   2874  C CD    . LYS A 1 373 ? 21.493  -19.726 -50.235  1.00 47.43 ? 373 LYS A CD    1 
ATOM   2875  C CE    . LYS A 1 373 ? 22.886  -19.480 -50.811  1.00 49.12 ? 373 LYS A CE    1 
ATOM   2876  N NZ    . LYS A 1 373 ? 22.851  -19.429 -52.316  1.00 52.02 ? 373 LYS A NZ    1 
ATOM   2877  N N     . ALA A 1 374 ? 17.736  -19.180 -46.210  1.00 43.82 ? 374 ALA A N     1 
ATOM   2878  C CA    . ALA A 1 374 ? 16.482  -19.744 -45.736  1.00 43.11 ? 374 ALA A CA    1 
ATOM   2879  C C     . ALA A 1 374 ? 15.445  -18.669 -45.459  1.00 42.30 ? 374 ALA A C     1 
ATOM   2880  O O     . ALA A 1 374 ? 14.386  -18.672 -46.050  1.00 42.01 ? 374 ALA A O     1 
ATOM   2881  C CB    . ALA A 1 374 ? 16.692  -20.625 -44.542  1.00 42.71 ? 374 ALA A CB    1 
ATOM   2882  N N     . VAL A 1 375 ? 15.762  -17.740 -44.571  1.00 42.27 ? 375 VAL A N     1 
ATOM   2883  C CA    . VAL A 1 375 ? 14.845  -16.655 -44.262  1.00 42.11 ? 375 VAL A CA    1 
ATOM   2884  C C     . VAL A 1 375 ? 14.270  -16.063 -45.518  1.00 43.28 ? 375 VAL A C     1 
ATOM   2885  O O     . VAL A 1 375 ? 13.063  -15.937 -45.651  1.00 43.37 ? 375 VAL A O     1 
ATOM   2886  C CB    . VAL A 1 375 ? 15.516  -15.507 -43.516  1.00 42.11 ? 375 VAL A CB    1 
ATOM   2887  C CG1   . VAL A 1 375 ? 15.039  -15.431 -42.121  1.00 39.76 ? 375 VAL A CG1   1 
ATOM   2888  C CG2   . VAL A 1 375 ? 16.993  -15.609 -43.599  1.00 38.95 ? 375 VAL A CG2   1 
ATOM   2889  N N     . LYS A 1 376 ? 15.142  -15.666 -46.431  1.00 44.06 ? 376 LYS A N     1 
ATOM   2890  C CA    . LYS A 1 376 ? 14.660  -15.016 -47.667  1.00 45.59 ? 376 LYS A CA    1 
ATOM   2891  C C     . LYS A 1 376 ? 13.524  -15.822 -48.369  1.00 45.54 ? 376 LYS A C     1 
ATOM   2892  O O     . LYS A 1 376 ? 12.506  -15.247 -48.839  1.00 45.91 ? 376 LYS A O     1 
ATOM   2893  C CB    . LYS A 1 376 ? 15.828  -14.738 -48.619  1.00 45.44 ? 376 LYS A CB    1 
ATOM   2894  C CG    . LYS A 1 376 ? 15.695  -13.437 -49.423  1.00 47.52 ? 376 LYS A CG    1 
ATOM   2895  C CD    . LYS A 1 376 ? 16.451  -13.480 -50.782  1.00 47.18 ? 376 LYS A CD    1 
ATOM   2896  C CE    . LYS A 1 376 ? 17.988  -13.501 -50.609  1.00 49.02 ? 376 LYS A CE    1 
ATOM   2897  N NZ    . LYS A 1 376 ? 18.729  -13.272 -51.915  1.00 50.66 ? 376 LYS A NZ    1 
ATOM   2898  N N     . MET A 1 377 ? 13.693  -17.148 -48.398  1.00 44.96 ? 377 MET A N     1 
ATOM   2899  C CA    . MET A 1 377 ? 12.708  -18.063 -48.950  1.00 45.15 ? 377 MET A CA    1 
ATOM   2900  C C     . MET A 1 377 ? 11.524  -18.402 -47.994  1.00 44.58 ? 377 MET A C     1 
ATOM   2901  O O     . MET A 1 377 ? 10.708  -19.288 -48.278  1.00 44.14 ? 377 MET A O     1 
ATOM   2902  C CB    . MET A 1 377 ? 13.427  -19.340 -49.437  1.00 46.49 ? 377 MET A CB    1 
ATOM   2903  C CG    . MET A 1 377 ? 14.382  -19.143 -50.647  1.00 48.61 ? 377 MET A CG    1 
ATOM   2904  S SD    . MET A 1 377 ? 13.482  -18.598 -52.130  1.00 55.92 ? 377 MET A SD    1 
ATOM   2905  C CE    . MET A 1 377 ? 12.898  -20.152 -52.840  1.00 55.57 ? 377 MET A CE    1 
ATOM   2906  N N     . GLY A 1 378 ? 11.427  -17.699 -46.864  1.00 43.78 ? 378 GLY A N     1 
ATOM   2907  C CA    . GLY A 1 378 ? 10.299  -17.856 -45.945  1.00 41.99 ? 378 GLY A CA    1 
ATOM   2908  C C     . GLY A 1 378 ? 10.389  -19.070 -45.042  1.00 41.01 ? 378 GLY A C     1 
ATOM   2909  O O     . GLY A 1 378 ? 9.381   -19.511 -44.465  1.00 41.11 ? 378 GLY A O     1 
ATOM   2910  N N     . VAL A 1 379 ? 11.592  -19.611 -44.893  1.00 39.42 ? 379 VAL A N     1 
ATOM   2911  C CA    . VAL A 1 379 ? 11.762  -20.827 -44.110  1.00 37.87 ? 379 VAL A CA    1 
ATOM   2912  C C     . VAL A 1 379 ? 12.800  -20.626 -43.007  1.00 37.72 ? 379 VAL A C     1 
ATOM   2913  O O     . VAL A 1 379 ? 13.760  -19.909 -43.187  1.00 37.22 ? 379 VAL A O     1 
ATOM   2914  C CB    . VAL A 1 379 ? 12.013  -22.046 -45.035  1.00 38.64 ? 379 VAL A CB    1 
ATOM   2915  C CG1   . VAL A 1 379 ? 12.669  -23.206 -44.293  1.00 36.05 ? 379 VAL A CG1   1 
ATOM   2916  C CG2   . VAL A 1 379 ? 10.665  -22.466 -45.725  1.00 35.85 ? 379 VAL A CG2   1 
ATOM   2917  N N     . LEU A 1 380 ? 12.545  -21.199 -41.830  1.00 37.43 ? 380 LEU A N     1 
ATOM   2918  C CA    . LEU A 1 380 ? 13.434  -21.009 -40.684  1.00 36.92 ? 380 LEU A CA    1 
ATOM   2919  C C     . LEU A 1 380 ? 13.675  -22.249 -39.839  1.00 36.63 ? 380 LEU A C     1 
ATOM   2920  O O     . LEU A 1 380 ? 12.711  -22.946 -39.458  1.00 34.82 ? 380 LEU A O     1 
ATOM   2921  C CB    . LEU A 1 380 ? 12.925  -19.895 -39.770  1.00 36.65 ? 380 LEU A CB    1 
ATOM   2922  C CG    . LEU A 1 380 ? 13.545  -18.538 -40.025  1.00 37.27 ? 380 LEU A CG    1 
ATOM   2923  C CD1   . LEU A 1 380 ? 12.889  -17.594 -39.051  1.00 36.34 ? 380 LEU A CD1   1 
ATOM   2924  C CD2   . LEU A 1 380 ? 15.113  -18.595 -39.867  1.00 35.40 ? 380 LEU A CD2   1 
ATOM   2925  N N     . MET A 1 381 ? 14.971  -22.509 -39.579  1.00 35.87 ? 381 MET A N     1 
ATOM   2926  C CA    . MET A 1 381 ? 15.407  -23.479 -38.592  1.00 35.86 ? 381 MET A CA    1 
ATOM   2927  C C     . MET A 1 381 ? 16.587  -22.936 -37.762  1.00 36.16 ? 381 MET A C     1 
ATOM   2928  O O     . MET A 1 381 ? 17.239  -21.941 -38.139  1.00 36.07 ? 381 MET A O     1 
ATOM   2929  C CB    . MET A 1 381 ? 15.794  -24.785 -39.241  1.00 35.87 ? 381 MET A CB    1 
ATOM   2930  C CG    . MET A 1 381 ? 14.968  -25.216 -40.451  1.00 36.72 ? 381 MET A CG    1 
ATOM   2931  S SD    . MET A 1 381 ? 14.563  -27.001 -40.343  1.00 37.52 ? 381 MET A SD    1 
ATOM   2932  C CE    . MET A 1 381 ? 16.134  -27.743 -39.956  1.00 31.94 ? 381 MET A CE    1 
ATOM   2933  N N     . LEU A 1 382 ? 16.862  -23.581 -36.627  1.00 35.17 ? 382 LEU A N     1 
ATOM   2934  C CA    . LEU A 1 382 ? 17.724  -22.969 -35.673  1.00 34.67 ? 382 LEU A CA    1 
ATOM   2935  C C     . LEU A 1 382 ? 19.125  -23.539 -35.801  1.00 34.58 ? 382 LEU A C     1 
ATOM   2936  O O     . LEU A 1 382 ? 19.306  -24.728 -35.577  1.00 34.50 ? 382 LEU A O     1 
ATOM   2937  C CB    . LEU A 1 382 ? 17.157  -23.085 -34.245  1.00 34.13 ? 382 LEU A CB    1 
ATOM   2938  C CG    . LEU A 1 382 ? 17.927  -22.338 -33.131  1.00 33.67 ? 382 LEU A CG    1 
ATOM   2939  C CD1   . LEU A 1 382 ? 17.961  -20.822 -33.434  1.00 31.19 ? 382 LEU A CD1   1 
ATOM   2940  C CD2   . LEU A 1 382 ? 17.317  -22.622 -31.720  1.00 32.78 ? 382 LEU A CD2   1 
ATOM   2941  N N     . PRO A 1 383 ? 20.113  -22.693 -36.185  1.00 34.39 ? 383 PRO A N     1 
ATOM   2942  C CA    . PRO A 1 383 ? 21.538  -23.154 -36.307  1.00 34.65 ? 383 PRO A CA    1 
ATOM   2943  C C     . PRO A 1 383 ? 22.102  -23.648 -34.980  1.00 34.15 ? 383 PRO A C     1 
ATOM   2944  O O     . PRO A 1 383 ? 21.845  -23.064 -33.919  1.00 34.72 ? 383 PRO A O     1 
ATOM   2945  C CB    . PRO A 1 383 ? 22.305  -21.925 -36.821  1.00 33.67 ? 383 PRO A CB    1 
ATOM   2946  C CG    . PRO A 1 383 ? 21.221  -20.995 -37.341  1.00 35.33 ? 383 PRO A CG    1 
ATOM   2947  C CD    . PRO A 1 383 ? 19.970  -21.278 -36.522  1.00 33.96 ? 383 PRO A CD    1 
ATOM   2948  N N     . GLY A 1 384 ? 22.856  -24.738 -35.055  1.00 34.27 ? 384 GLY A N     1 
ATOM   2949  C CA    . GLY A 1 384 ? 23.435  -25.388 -33.865  1.00 33.07 ? 384 GLY A CA    1 
ATOM   2950  C C     . GLY A 1 384 ? 24.424  -24.602 -33.039  1.00 32.12 ? 384 GLY A C     1 
ATOM   2951  O O     . GLY A 1 384 ? 24.640  -24.925 -31.863  1.00 32.19 ? 384 GLY A O     1 
ATOM   2952  N N     . ASN A 1 385 ? 25.027  -23.571 -33.630  1.00 31.80 ? 385 ASN A N     1 
ATOM   2953  C CA    . ASN A 1 385 ? 26.139  -22.862 -32.973  1.00 32.13 ? 385 ASN A CA    1 
ATOM   2954  C C     . ASN A 1 385 ? 26.021  -22.701 -31.484  1.00 32.20 ? 385 ASN A C     1 
ATOM   2955  O O     . ASN A 1 385 ? 26.980  -22.979 -30.747  1.00 33.14 ? 385 ASN A O     1 
ATOM   2956  C CB    . ASN A 1 385 ? 26.367  -21.503 -33.609  1.00 32.07 ? 385 ASN A CB    1 
ATOM   2957  C CG    . ASN A 1 385 ? 26.550  -21.618 -35.069  1.00 34.22 ? 385 ASN A CG    1 
ATOM   2958  O OD1   . ASN A 1 385 ? 25.572  -21.732 -35.812  1.00 39.87 ? 385 ASN A OD1   1 
ATOM   2959  N ND2   . ASN A 1 385 ? 27.799  -21.669 -35.506  1.00 30.57 ? 385 ASN A ND2   1 
ATOM   2960  N N     . ALA A 1 386 ? 24.819  -22.309 -31.061  1.00 31.57 ? 386 ALA A N     1 
ATOM   2961  C CA    . ALA A 1 386 ? 24.520  -21.853 -29.728  1.00 30.50 ? 386 ALA A CA    1 
ATOM   2962  C C     . ALA A 1 386 ? 24.552  -22.935 -28.687  1.00 30.27 ? 386 ALA A C     1 
ATOM   2963  O O     . ALA A 1 386 ? 24.548  -22.649 -27.490  1.00 30.80 ? 386 ALA A O     1 
ATOM   2964  C CB    . ALA A 1 386 ? 23.136  -21.163 -29.742  1.00 30.60 ? 386 ALA A CB    1 
ATOM   2965  N N     . PHE A 1 387 ? 24.548  -24.188 -29.111  1.00 30.77 ? 387 PHE A N     1 
ATOM   2966  C CA    . PHE A 1 387 ? 24.457  -25.291 -28.138  1.00 31.10 ? 387 PHE A CA    1 
ATOM   2967  C C     . PHE A 1 387 ? 25.846  -25.904 -27.739  1.00 32.64 ? 387 PHE A C     1 
ATOM   2968  O O     . PHE A 1 387 ? 25.935  -27.043 -27.216  1.00 33.21 ? 387 PHE A O     1 
ATOM   2969  C CB    . PHE A 1 387 ? 23.505  -26.343 -28.666  1.00 31.08 ? 387 PHE A CB    1 
ATOM   2970  C CG    . PHE A 1 387 ? 22.172  -25.792 -29.116  1.00 30.09 ? 387 PHE A CG    1 
ATOM   2971  C CD1   . PHE A 1 387 ? 22.004  -25.293 -30.416  1.00 31.23 ? 387 PHE A CD1   1 
ATOM   2972  C CD2   . PHE A 1 387 ? 21.084  -25.797 -28.256  1.00 27.60 ? 387 PHE A CD2   1 
ATOM   2973  C CE1   . PHE A 1 387 ? 20.736  -24.789 -30.848  1.00 34.38 ? 387 PHE A CE1   1 
ATOM   2974  C CE2   . PHE A 1 387 ? 19.825  -25.281 -28.650  1.00 30.98 ? 387 PHE A CE2   1 
ATOM   2975  C CZ    . PHE A 1 387 ? 19.632  -24.776 -29.931  1.00 30.80 ? 387 PHE A CZ    1 
ATOM   2976  N N     . TYR A 1 388 ? 26.916  -25.137 -27.963  1.00 32.54 ? 388 TYR A N     1 
ATOM   2977  C CA    . TYR A 1 388 ? 28.253  -25.558 -27.584  1.00 33.81 ? 388 TYR A CA    1 
ATOM   2978  C C     . TYR A 1 388 ? 28.874  -24.420 -26.816  1.00 35.20 ? 388 TYR A C     1 
ATOM   2979  O O     . TYR A 1 388 ? 28.461  -23.254 -26.992  1.00 36.82 ? 388 TYR A O     1 
ATOM   2980  C CB    . TYR A 1 388 ? 29.128  -25.948 -28.811  1.00 32.75 ? 388 TYR A CB    1 
ATOM   2981  C CG    . TYR A 1 388 ? 28.542  -26.996 -29.743  1.00 28.50 ? 388 TYR A CG    1 
ATOM   2982  C CD1   . TYR A 1 388 ? 28.948  -28.303 -29.661  1.00 27.06 ? 388 TYR A CD1   1 
ATOM   2983  C CD2   . TYR A 1 388 ? 27.586  -26.641 -30.740  1.00 28.19 ? 388 TYR A CD2   1 
ATOM   2984  C CE1   . TYR A 1 388 ? 28.447  -29.307 -30.554  1.00 29.24 ? 388 TYR A CE1   1 
ATOM   2985  C CE2   . TYR A 1 388 ? 27.057  -27.608 -31.645  1.00 28.30 ? 388 TYR A CE2   1 
ATOM   2986  C CZ    . TYR A 1 388 ? 27.489  -28.957 -31.540  1.00 31.69 ? 388 TYR A CZ    1 
ATOM   2987  O OH    . TYR A 1 388 ? 26.992  -29.943 -32.391  1.00 28.96 ? 388 TYR A OH    1 
ATOM   2988  N N     . VAL A 1 389 ? 29.819  -24.759 -25.939  1.00 35.74 ? 389 VAL A N     1 
ATOM   2989  C CA    . VAL A 1 389 ? 30.545  -23.769 -25.162  1.00 36.27 ? 389 VAL A CA    1 
ATOM   2990  C C     . VAL A 1 389 ? 31.145  -22.807 -26.152  1.00 36.89 ? 389 VAL A C     1 
ATOM   2991  O O     . VAL A 1 389 ? 30.891  -21.628 -26.081  1.00 37.30 ? 389 VAL A O     1 
ATOM   2992  C CB    . VAL A 1 389 ? 31.599  -24.383 -24.223  1.00 36.01 ? 389 VAL A CB    1 
ATOM   2993  C CG1   . VAL A 1 389 ? 32.484  -23.281 -23.631  1.00 37.74 ? 389 VAL A CG1   1 
ATOM   2994  C CG2   . VAL A 1 389 ? 30.926  -25.182 -23.111  1.00 34.78 ? 389 VAL A CG2   1 
ATOM   2995  N N     . ASP A 1 390 ? 31.862  -23.315 -27.142  1.00 38.50 ? 390 ASP A N     1 
ATOM   2996  C CA    . ASP A 1 390 ? 32.440  -22.434 -28.133  1.00 39.11 ? 390 ASP A CA    1 
ATOM   2997  C C     . ASP A 1 390 ? 31.443  -22.201 -29.264  1.00 39.52 ? 390 ASP A C     1 
ATOM   2998  O O     . ASP A 1 390 ? 31.333  -23.010 -30.197  1.00 39.26 ? 390 ASP A O     1 
ATOM   2999  C CB    . ASP A 1 390 ? 33.791  -22.977 -28.631  1.00 40.01 ? 390 ASP A CB    1 
ATOM   3000  C CG    . ASP A 1 390 ? 34.342  -22.173 -29.807  1.00 40.14 ? 390 ASP A CG    1 
ATOM   3001  O OD1   . ASP A 1 390 ? 34.913  -22.796 -30.704  1.00 40.04 ? 390 ASP A OD1   1 
ATOM   3002  O OD2   . ASP A 1 390 ? 34.167  -20.933 -29.848  1.00 42.07 ? 390 ASP A OD2   1 
ATOM   3003  N N     . SER A 1 391 ? 30.710  -21.092 -29.176  1.00 39.56 ? 391 SER A N     1 
ATOM   3004  C CA    . SER A 1 391 ? 29.588  -20.904 -30.077  1.00 39.94 ? 391 SER A CA    1 
ATOM   3005  C C     . SER A 1 391 ? 30.007  -20.174 -31.341  1.00 40.96 ? 391 SER A C     1 
ATOM   3006  O O     . SER A 1 391 ? 29.176  -19.871 -32.205  1.00 41.17 ? 391 SER A O     1 
ATOM   3007  C CB    . SER A 1 391 ? 28.379  -20.237 -29.366  1.00 39.70 ? 391 SER A CB    1 
ATOM   3008  O OG    . SER A 1 391 ? 28.634  -18.898 -28.986  1.00 38.19 ? 391 SER A OG    1 
ATOM   3009  N N     . SER A 1 392 ? 31.292  -19.868 -31.468  1.00 41.06 ? 392 SER A N     1 
ATOM   3010  C CA    . SER A 1 392 ? 31.704  -19.186 -32.665  1.00 41.13 ? 392 SER A CA    1 
ATOM   3011  C C     . SER A 1 392 ? 32.187  -20.220 -33.650  1.00 40.29 ? 392 SER A C     1 
ATOM   3012  O O     . SER A 1 392 ? 32.444  -19.894 -34.819  1.00 40.64 ? 392 SER A O     1 
ATOM   3013  C CB    . SER A 1 392 ? 32.751  -18.076 -32.391  1.00 42.62 ? 392 SER A CB    1 
ATOM   3014  O OG    . SER A 1 392 ? 33.995  -18.580 -31.930  1.00 42.67 ? 392 SER A OG    1 
ATOM   3015  N N     . ALA A 1 393 ? 32.278  -21.466 -33.180  1.00 39.16 ? 393 ALA A N     1 
ATOM   3016  C CA    . ALA A 1 393 ? 32.724  -22.596 -34.008  1.00 38.35 ? 393 ALA A CA    1 
ATOM   3017  C C     . ALA A 1 393 ? 31.703  -22.870 -35.105  1.00 37.92 ? 393 ALA A C     1 
ATOM   3018  O O     . ALA A 1 393 ? 30.493  -22.801 -34.851  1.00 38.26 ? 393 ALA A O     1 
ATOM   3019  C CB    . ALA A 1 393 ? 32.941  -23.870 -33.155  1.00 36.73 ? 393 ALA A CB    1 
ATOM   3020  N N     . PRO A 1 394 ? 32.179  -23.209 -36.319  1.00 37.23 ? 394 PRO A N     1 
ATOM   3021  C CA    . PRO A 1 394 ? 31.293  -23.664 -37.386  1.00 36.82 ? 394 PRO A CA    1 
ATOM   3022  C C     . PRO A 1 394 ? 30.392  -24.765 -36.881  1.00 35.73 ? 394 PRO A C     1 
ATOM   3023  O O     . PRO A 1 394 ? 30.859  -25.594 -36.116  1.00 36.10 ? 394 PRO A O     1 
ATOM   3024  C CB    . PRO A 1 394 ? 32.274  -24.273 -38.411  1.00 36.28 ? 394 PRO A CB    1 
ATOM   3025  C CG    . PRO A 1 394 ? 33.560  -24.334 -37.734  1.00 36.70 ? 394 PRO A CG    1 
ATOM   3026  C CD    . PRO A 1 394 ? 33.571  -23.217 -36.771  1.00 36.96 ? 394 PRO A CD    1 
ATOM   3027  N N     . SER A 1 395 ? 29.114  -24.757 -37.260  1.00 34.85 ? 395 SER A N     1 
ATOM   3028  C CA    . SER A 1 395 ? 28.259  -25.909 -36.979  1.00 33.77 ? 395 SER A CA    1 
ATOM   3029  C C     . SER A 1 395 ? 27.429  -26.332 -38.163  1.00 32.82 ? 395 SER A C     1 
ATOM   3030  O O     . SER A 1 395 ? 26.635  -25.569 -38.673  1.00 32.84 ? 395 SER A O     1 
ATOM   3031  C CB    . SER A 1 395 ? 27.344  -25.686 -35.776  1.00 34.27 ? 395 SER A CB    1 
ATOM   3032  O OG    . SER A 1 395 ? 26.493  -26.822 -35.624  1.00 36.08 ? 395 SER A OG    1 
ATOM   3033  N N     . PRO A 1 396 ? 27.559  -27.596 -38.558  1.00 31.86 ? 396 PRO A N     1 
ATOM   3034  C CA    . PRO A 1 396 ? 26.793  -28.017 -39.684  1.00 31.22 ? 396 PRO A CA    1 
ATOM   3035  C C     . PRO A 1 396 ? 25.383  -28.495 -39.261  1.00 30.96 ? 396 PRO A C     1 
ATOM   3036  O O     . PRO A 1 396 ? 24.669  -29.078 -40.070  1.00 31.16 ? 396 PRO A O     1 
ATOM   3037  C CB    . PRO A 1 396 ? 27.649  -29.145 -40.247  1.00 31.44 ? 396 PRO A CB    1 
ATOM   3038  C CG    . PRO A 1 396 ? 28.510  -29.622 -39.045  1.00 31.13 ? 396 PRO A CG    1 
ATOM   3039  C CD    . PRO A 1 396 ? 28.321  -28.700 -37.944  1.00 31.03 ? 396 PRO A CD    1 
ATOM   3040  N N     . TYR A 1 397 ? 24.986  -28.241 -38.013  1.00 30.22 ? 397 TYR A N     1 
ATOM   3041  C CA    . TYR A 1 397 ? 23.759  -28.804 -37.459  1.00 30.11 ? 397 TYR A CA    1 
ATOM   3042  C C     . TYR A 1 397 ? 22.600  -27.775 -37.366  1.00 29.20 ? 397 TYR A C     1 
ATOM   3043  O O     . TYR A 1 397 ? 22.800  -26.573 -37.139  1.00 27.30 ? 397 TYR A O     1 
ATOM   3044  C CB    . TYR A 1 397 ? 24.020  -29.446 -36.077  1.00 31.32 ? 397 TYR A CB    1 
ATOM   3045  C CG    . TYR A 1 397 ? 24.816  -30.769 -35.990  1.00 32.40 ? 397 TYR A CG    1 
ATOM   3046  C CD1   . TYR A 1 397 ? 26.189  -30.751 -35.793  1.00 33.61 ? 397 TYR A CD1   1 
ATOM   3047  C CD2   . TYR A 1 397 ? 24.179  -32.034 -36.038  1.00 33.47 ? 397 TYR A CD2   1 
ATOM   3048  C CE1   . TYR A 1 397 ? 26.932  -31.911 -35.698  1.00 29.82 ? 397 TYR A CE1   1 
ATOM   3049  C CE2   . TYR A 1 397 ? 24.916  -33.210 -35.896  1.00 30.91 ? 397 TYR A CE2   1 
ATOM   3050  C CZ    . TYR A 1 397 ? 26.309  -33.120 -35.755  1.00 32.04 ? 397 TYR A CZ    1 
ATOM   3051  O OH    . TYR A 1 397 ? 27.127  -34.240 -35.643  1.00 35.19 ? 397 TYR A OH    1 
ATOM   3052  N N     . LEU A 1 398 ? 21.395  -28.284 -37.576  1.00 28.50 ? 398 LEU A N     1 
ATOM   3053  C CA    . LEU A 1 398 ? 20.142  -27.515 -37.462  1.00 28.80 ? 398 LEU A CA    1 
ATOM   3054  C C     . LEU A 1 398 ? 19.265  -28.074 -36.353  1.00 28.12 ? 398 LEU A C     1 
ATOM   3055  O O     . LEU A 1 398 ? 19.106  -29.297 -36.214  1.00 27.22 ? 398 LEU A O     1 
ATOM   3056  C CB    . LEU A 1 398 ? 19.349  -27.551 -38.787  1.00 28.10 ? 398 LEU A CB    1 
ATOM   3057  C CG    . LEU A 1 398 ? 20.059  -26.850 -39.977  1.00 30.19 ? 398 LEU A CG    1 
ATOM   3058  C CD1   . LEU A 1 398 ? 19.214  -26.801 -41.212  1.00 27.88 ? 398 LEU A CD1   1 
ATOM   3059  C CD2   . LEU A 1 398 ? 20.553  -25.394 -39.635  1.00 30.63 ? 398 LEU A CD2   1 
ATOM   3060  N N     . ARG A 1 399 ? 18.702  -27.190 -35.549  1.00 28.57 ? 399 ARG A N     1 
ATOM   3061  C CA    . ARG A 1 399 ? 17.611  -27.617 -34.665  1.00 28.73 ? 399 ARG A CA    1 
ATOM   3062  C C     . ARG A 1 399 ? 16.288  -27.273 -35.320  1.00 28.28 ? 399 ARG A C     1 
ATOM   3063  O O     . ARG A 1 399 ? 16.078  -26.117 -35.707  1.00 27.73 ? 399 ARG A O     1 
ATOM   3064  C CB    . ARG A 1 399 ? 17.689  -26.950 -33.305  1.00 28.50 ? 399 ARG A CB    1 
ATOM   3065  C CG    . ARG A 1 399 ? 16.790  -27.629 -32.273  1.00 30.46 ? 399 ARG A CG    1 
ATOM   3066  C CD    . ARG A 1 399 ? 16.835  -26.878 -30.978  1.00 29.81 ? 399 ARG A CD    1 
ATOM   3067  N NE    . ARG A 1 399 ? 15.817  -25.819 -30.942  1.00 31.77 ? 399 ARG A NE    1 
ATOM   3068  C CZ    . ARG A 1 399 ? 15.602  -25.025 -29.886  1.00 27.14 ? 399 ARG A CZ    1 
ATOM   3069  N NH1   . ARG A 1 399 ? 16.338  -25.182 -28.773  1.00 16.19 ? 399 ARG A NH1   1 
ATOM   3070  N NH2   . ARG A 1 399 ? 14.646  -24.104 -29.949  1.00 23.13 ? 399 ARG A NH2   1 
ATOM   3071  N N     . ALA A 1 400 ? 15.408  -28.265 -35.403  1.00 28.04 ? 400 ALA A N     1 
ATOM   3072  C CA    . ALA A 1 400 ? 14.062  -28.110 -35.977  1.00 28.91 ? 400 ALA A CA    1 
ATOM   3073  C C     . ALA A 1 400 ? 12.904  -28.502 -34.980  1.00 29.20 ? 400 ALA A C     1 
ATOM   3074  O O     . ALA A 1 400 ? 12.942  -29.556 -34.362  1.00 28.42 ? 400 ALA A O     1 
ATOM   3075  C CB    . ALA A 1 400 ? 13.983  -28.945 -37.291  1.00 28.42 ? 400 ALA A CB    1 
ATOM   3076  N N     . SER A 1 401 ? 11.888  -27.666 -34.811  1.00 30.34 ? 401 SER A N     1 
ATOM   3077  C CA    . SER A 1 401 ? 10.815  -28.048 -33.844  1.00 30.88 ? 401 SER A CA    1 
ATOM   3078  C C     . SER A 1 401 ? 9.578   -28.628 -34.460  1.00 29.52 ? 401 SER A C     1 
ATOM   3079  O O     . SER A 1 401 ? 8.873   -27.993 -35.270  1.00 30.24 ? 401 SER A O     1 
ATOM   3080  C CB    . SER A 1 401 ? 10.343  -26.946 -32.882  1.00 31.59 ? 401 SER A CB    1 
ATOM   3081  O OG    . SER A 1 401 ? 9.515   -27.566 -31.856  1.00 31.96 ? 401 SER A OG    1 
ATOM   3082  N N     . PHE A 1 402 ? 9.304   -29.831 -34.022  1.00 27.23 ? 402 PHE A N     1 
ATOM   3083  C CA    . PHE A 1 402 ? 8.116   -30.442 -34.422  1.00 26.99 ? 402 PHE A CA    1 
ATOM   3084  C C     . PHE A 1 402 ? 6.956   -30.191 -33.524  1.00 26.53 ? 402 PHE A C     1 
ATOM   3085  O O     . PHE A 1 402 ? 5.988   -30.899 -33.644  1.00 27.60 ? 402 PHE A O     1 
ATOM   3086  C CB    . PHE A 1 402 ? 8.303   -31.928 -34.762  1.00 26.93 ? 402 PHE A CB    1 
ATOM   3087  C CG    . PHE A 1 402 ? 8.909   -32.771 -33.679  1.00 27.81 ? 402 PHE A CG    1 
ATOM   3088  C CD1   . PHE A 1 402 ? 8.086   -33.394 -32.740  1.00 28.58 ? 402 PHE A CD1   1 
ATOM   3089  C CD2   . PHE A 1 402 ? 10.282  -33.025 -33.651  1.00 26.27 ? 402 PHE A CD2   1 
ATOM   3090  C CE1   . PHE A 1 402 ? 8.596   -34.233 -31.795  1.00 25.76 ? 402 PHE A CE1   1 
ATOM   3091  C CE2   . PHE A 1 402 ? 10.828  -33.888 -32.702  1.00 26.39 ? 402 PHE A CE2   1 
ATOM   3092  C CZ    . PHE A 1 402 ? 9.993   -34.480 -31.757  1.00 29.00 ? 402 PHE A CZ    1 
ATOM   3093  N N     . SER A 1 403 ? 6.987   -29.160 -32.680  1.00 26.21 ? 403 SER A N     1 
ATOM   3094  C CA    . SER A 1 403 ? 5.873   -28.991 -31.717  1.00 26.82 ? 403 SER A CA    1 
ATOM   3095  C C     . SER A 1 403 ? 4.499   -28.432 -32.245  1.00 27.13 ? 403 SER A C     1 
ATOM   3096  O O     . SER A 1 403 ? 3.432   -28.758 -31.667  1.00 27.85 ? 403 SER A O     1 
ATOM   3097  C CB    . SER A 1 403 ? 6.325   -28.233 -30.469  1.00 25.32 ? 403 SER A CB    1 
ATOM   3098  O OG    . SER A 1 403 ? 6.376   -26.843 -30.729  1.00 26.39 ? 403 SER A OG    1 
ATOM   3099  N N     . SER A 1 404 ? 4.543   -27.642 -33.322  1.00 26.99 ? 404 SER A N     1 
ATOM   3100  C CA    . SER A 1 404 ? 3.408   -26.864 -33.817  1.00 28.36 ? 404 SER A CA    1 
ATOM   3101  C C     . SER A 1 404 ? 3.085   -27.005 -35.288  1.00 28.08 ? 404 SER A C     1 
ATOM   3102  O O     . SER A 1 404 ? 1.882   -26.975 -35.664  1.00 27.89 ? 404 SER A O     1 
ATOM   3103  C CB    . SER A 1 404 ? 3.648   -25.384 -33.570  1.00 27.66 ? 404 SER A CB    1 
ATOM   3104  O OG    . SER A 1 404 ? 3.999   -25.221 -32.207  1.00 33.98 ? 404 SER A OG    1 
ATOM   3105  N N     . ALA A 1 405 ? 4.131   -27.085 -36.116  1.00 27.77 ? 405 ALA A N     1 
ATOM   3106  C CA    . ALA A 1 405 ? 3.984   -27.027 -37.566  1.00 28.62 ? 405 ALA A CA    1 
ATOM   3107  C C     . ALA A 1 405 ? 3.055   -28.129 -37.974  1.00 29.47 ? 405 ALA A C     1 
ATOM   3108  O O     . ALA A 1 405 ? 2.999   -29.158 -37.313  1.00 30.23 ? 405 ALA A O     1 
ATOM   3109  C CB    . ALA A 1 405 ? 5.357   -27.212 -38.306  1.00 28.24 ? 405 ALA A CB    1 
ATOM   3110  N N     . SER A 1 406 ? 2.359   -27.945 -39.090  1.00 30.50 ? 406 SER A N     1 
ATOM   3111  C CA    . SER A 1 406 ? 1.480   -28.987 -39.611  1.00 30.87 ? 406 SER A CA    1 
ATOM   3112  C C     . SER A 1 406 ? 2.266   -29.858 -40.605  1.00 32.11 ? 406 SER A C     1 
ATOM   3113  O O     . SER A 1 406 ? 3.288   -29.398 -41.118  1.00 32.12 ? 406 SER A O     1 
ATOM   3114  C CB    . SER A 1 406 ? 0.260   -28.334 -40.256  1.00 29.45 ? 406 SER A CB    1 
ATOM   3115  O OG    . SER A 1 406 ? 0.504   -28.039 -41.616  1.00 29.59 ? 406 SER A OG    1 
ATOM   3116  N N     . PRO A 1 407 ? 1.805   -31.117 -40.881  1.00 33.25 ? 407 PRO A N     1 
ATOM   3117  C CA    . PRO A 1 407 ? 2.381   -31.881 -41.942  1.00 33.26 ? 407 PRO A CA    1 
ATOM   3118  C C     . PRO A 1 407 ? 2.634   -31.067 -43.214  1.00 33.29 ? 407 PRO A C     1 
ATOM   3119  O O     . PRO A 1 407 ? 3.705   -31.236 -43.796  1.00 33.99 ? 407 PRO A O     1 
ATOM   3120  C CB    . PRO A 1 407 ? 1.300   -32.949 -42.217  1.00 33.13 ? 407 PRO A CB    1 
ATOM   3121  C CG    . PRO A 1 407 ? 0.781   -33.260 -40.943  1.00 32.81 ? 407 PRO A CG    1 
ATOM   3122  C CD    . PRO A 1 407 ? 0.718   -31.891 -40.239  1.00 34.66 ? 407 PRO A CD    1 
ATOM   3123  N N     . GLU A 1 408 ? 1.670   -30.243 -43.659  1.00 32.82 ? 408 GLU A N     1 
ATOM   3124  C CA    . GLU A 1 408 ? 1.896   -29.370 -44.820  1.00 33.09 ? 408 GLU A CA    1 
ATOM   3125  C C     . GLU A 1 408 ? 3.075   -28.398 -44.639  1.00 33.33 ? 408 GLU A C     1 
ATOM   3126  O O     . GLU A 1 408 ? 3.963   -28.341 -45.510  1.00 33.17 ? 408 GLU A O     1 
ATOM   3127  C CB    . GLU A 1 408 ? 0.642   -28.607 -45.280  1.00 33.57 ? 408 GLU A CB    1 
ATOM   3128  C CG    . GLU A 1 408 ? -0.601  -29.486 -45.499  1.00 35.37 ? 408 GLU A CG    1 
ATOM   3129  C CD    . GLU A 1 408 ? -1.216  -30.000 -44.189  1.00 37.84 ? 408 GLU A CD    1 
ATOM   3130  O OE1   . GLU A 1 408 ? -1.398  -29.214 -43.227  1.00 34.06 ? 408 GLU A OE1   1 
ATOM   3131  O OE2   . GLU A 1 408 ? -1.505  -31.211 -44.113  1.00 42.18 ? 408 GLU A OE2   1 
ATOM   3132  N N     . GLN A 1 409 ? 3.103   -27.659 -43.528  1.00 32.95 ? 409 GLN A N     1 
ATOM   3133  C CA    . GLN A 1 409 ? 4.176   -26.664 -43.330  1.00 33.72 ? 409 GLN A CA    1 
ATOM   3134  C C     . GLN A 1 409 ? 5.570   -27.280 -43.245  1.00 33.11 ? 409 GLN A C     1 
ATOM   3135  O O     . GLN A 1 409 ? 6.536   -26.688 -43.746  1.00 34.37 ? 409 GLN A O     1 
ATOM   3136  C CB    . GLN A 1 409 ? 3.929   -25.780 -42.103  1.00 34.61 ? 409 GLN A CB    1 
ATOM   3137  C CG    . GLN A 1 409 ? 2.499   -25.687 -41.738  1.00 33.61 ? 409 GLN A CG    1 
ATOM   3138  C CD    . GLN A 1 409 ? 2.264   -24.771 -40.573  1.00 34.33 ? 409 GLN A CD    1 
ATOM   3139  O OE1   . GLN A 1 409 ? 1.981   -25.230 -39.481  1.00 32.24 ? 409 GLN A OE1   1 
ATOM   3140  N NE2   . GLN A 1 409 ? 2.361   -23.445 -40.807  1.00 35.35 ? 409 GLN A NE2   1 
ATOM   3141  N N     . MET A 1 410 ? 5.672   -28.461 -42.633  1.00 31.73 ? 410 MET A N     1 
ATOM   3142  C CA    . MET A 1 410 ? 6.907   -29.277 -42.679  1.00 30.72 ? 410 MET A CA    1 
ATOM   3143  C C     . MET A 1 410 ? 7.315   -29.761 -44.095  1.00 31.45 ? 410 MET A C     1 
ATOM   3144  O O     . MET A 1 410 ? 8.515   -29.836 -44.456  1.00 29.25 ? 410 MET A O     1 
ATOM   3145  C CB    . MET A 1 410 ? 6.761   -30.477 -41.772  1.00 30.63 ? 410 MET A CB    1 
ATOM   3146  C CG    . MET A 1 410 ? 6.325   -30.145 -40.344  1.00 29.04 ? 410 MET A CG    1 
ATOM   3147  S SD    . MET A 1 410 ? 6.186   -31.706 -39.562  1.00 28.51 ? 410 MET A SD    1 
ATOM   3148  C CE    . MET A 1 410 ? 5.807   -31.412 -37.813  1.00 30.15 ? 410 MET A CE    1 
ATOM   3149  N N     . ASP A 1 411 ? 6.313   -30.119 -44.896  1.00 32.07 ? 411 ASP A N     1 
ATOM   3150  C CA    . ASP A 1 411 ? 6.574   -30.500 -46.325  1.00 31.98 ? 411 ASP A CA    1 
ATOM   3151  C C     . ASP A 1 411 ? 7.312   -29.387 -47.036  1.00 31.17 ? 411 ASP A C     1 
ATOM   3152  O O     . ASP A 1 411 ? 8.349   -29.612 -47.657  1.00 31.14 ? 411 ASP A O     1 
ATOM   3153  C CB    . ASP A 1 411 ? 5.273   -30.795 -47.041  1.00 31.17 ? 411 ASP A CB    1 
ATOM   3154  C CG    . ASP A 1 411 ? 5.441   -31.683 -48.253  1.00 33.54 ? 411 ASP A CG    1 
ATOM   3155  O OD1   . ASP A 1 411 ? 5.278   -31.149 -49.377  1.00 35.93 ? 411 ASP A OD1   1 
ATOM   3156  O OD2   . ASP A 1 411 ? 5.706   -32.909 -48.105  1.00 34.36 ? 411 ASP A OD2   1 
ATOM   3157  N N     . VAL A 1 412 ? 6.787   -28.166 -46.890  1.00 31.21 ? 412 VAL A N     1 
ATOM   3158  C CA    . VAL A 1 412 ? 7.340   -26.985 -47.565  1.00 29.80 ? 412 VAL A CA    1 
ATOM   3159  C C     . VAL A 1 412 ? 8.638   -26.508 -46.916  1.00 29.60 ? 412 VAL A C     1 
ATOM   3160  O O     . VAL A 1 412 ? 9.584   -26.167 -47.616  1.00 30.47 ? 412 VAL A O     1 
ATOM   3161  C CB    . VAL A 1 412 ? 6.276   -25.874 -47.686  1.00 29.67 ? 412 VAL A CB    1 
ATOM   3162  C CG1   . VAL A 1 412 ? 6.777   -24.741 -48.507  1.00 30.29 ? 412 VAL A CG1   1 
ATOM   3163  C CG2   . VAL A 1 412 ? 5.119   -26.411 -48.382  1.00 30.65 ? 412 VAL A CG2   1 
ATOM   3164  N N     . ALA A 1 413 ? 8.690   -26.493 -45.579  1.00 29.71 ? 413 ALA A N     1 
ATOM   3165  C CA    . ALA A 1 413 ? 9.945   -26.246 -44.861  1.00 28.84 ? 413 ALA A CA    1 
ATOM   3166  C C     . ALA A 1 413 ? 11.115  -27.041 -45.424  1.00 28.04 ? 413 ALA A C     1 
ATOM   3167  O O     . ALA A 1 413 ? 12.130  -26.499 -45.783  1.00 27.60 ? 413 ALA A O     1 
ATOM   3168  C CB    . ALA A 1 413 ? 9.787   -26.534 -43.386  1.00 29.64 ? 413 ALA A CB    1 
ATOM   3169  N N     . PHE A 1 414 ? 10.941  -28.338 -45.537  1.00 28.24 ? 414 PHE A N     1 
ATOM   3170  C CA    . PHE A 1 414 ? 12.009  -29.218 -45.936  1.00 28.60 ? 414 PHE A CA    1 
ATOM   3171  C C     . PHE A 1 414 ? 12.380  -29.189 -47.406  1.00 28.73 ? 414 PHE A C     1 
ATOM   3172  O O     . PHE A 1 414 ? 13.575  -29.201 -47.769  1.00 29.27 ? 414 PHE A O     1 
ATOM   3173  C CB    . PHE A 1 414 ? 11.670  -30.628 -45.490  1.00 28.26 ? 414 PHE A CB    1 
ATOM   3174  C CG    . PHE A 1 414 ? 12.051  -30.859 -44.098  1.00 28.16 ? 414 PHE A CG    1 
ATOM   3175  C CD1   . PHE A 1 414 ? 11.116  -30.851 -43.098  1.00 29.90 ? 414 PHE A CD1   1 
ATOM   3176  C CD2   . PHE A 1 414 ? 13.377  -31.001 -43.769  1.00 28.94 ? 414 PHE A CD2   1 
ATOM   3177  C CE1   . PHE A 1 414 ? 11.491  -31.052 -41.777  1.00 29.81 ? 414 PHE A CE1   1 
ATOM   3178  C CE2   . PHE A 1 414 ? 13.777  -31.161 -42.444  1.00 30.63 ? 414 PHE A CE2   1 
ATOM   3179  C CZ    . PHE A 1 414 ? 12.832  -31.192 -41.439  1.00 27.46 ? 414 PHE A CZ    1 
ATOM   3180  N N     . GLN A 1 415 ? 11.369  -29.177 -48.262  1.00 29.23 ? 415 GLN A N     1 
ATOM   3181  C CA    . GLN A 1 415 ? 11.632  -29.145 -49.684  1.00 28.64 ? 415 GLN A CA    1 
ATOM   3182  C C     . GLN A 1 415 ? 12.436  -27.923 -49.985  1.00 27.66 ? 415 GLN A C     1 
ATOM   3183  O O     . GLN A 1 415 ? 13.400  -28.010 -50.752  1.00 26.72 ? 415 GLN A O     1 
ATOM   3184  C CB    . GLN A 1 415 ? 10.364  -29.237 -50.521  1.00 28.23 ? 415 GLN A CB    1 
ATOM   3185  C CG    . GLN A 1 415 ? 9.496   -28.039 -50.510  1.00 33.63 ? 415 GLN A CG    1 
ATOM   3186  C CD    . GLN A 1 415 ? 9.760   -27.108 -51.671  1.00 34.95 ? 415 GLN A CD    1 
ATOM   3187  O OE1   . GLN A 1 415 ? 10.509  -27.417 -52.585  1.00 30.76 ? 415 GLN A OE1   1 
ATOM   3188  N NE2   . GLN A 1 415 ? 9.137   -25.946 -51.624  1.00 39.71 ? 415 GLN A NE2   1 
ATOM   3189  N N     . VAL A 1 416 ? 12.049  -26.815 -49.333  1.00 27.49 ? 416 VAL A N     1 
ATOM   3190  C CA    . VAL A 1 416 ? 12.705  -25.516 -49.492  1.00 27.74 ? 416 VAL A CA    1 
ATOM   3191  C C     . VAL A 1 416 ? 14.133  -25.535 -48.940  1.00 28.59 ? 416 VAL A C     1 
ATOM   3192  O O     . VAL A 1 416 ? 15.053  -24.998 -49.565  1.00 29.14 ? 416 VAL A O     1 
ATOM   3193  C CB    . VAL A 1 416 ? 11.926  -24.372 -48.863  1.00 26.57 ? 416 VAL A CB    1 
ATOM   3194  C CG1   . VAL A 1 416 ? 12.846  -23.269 -48.680  1.00 27.70 ? 416 VAL A CG1   1 
ATOM   3195  C CG2   . VAL A 1 416 ? 10.816  -23.904 -49.761  1.00 26.53 ? 416 VAL A CG2   1 
ATOM   3196  N N     . LEU A 1 417 ? 14.309  -26.198 -47.804  1.00 29.25 ? 417 LEU A N     1 
ATOM   3197  C CA    . LEU A 1 417 ? 15.587  -26.306 -47.142  1.00 30.79 ? 417 LEU A CA    1 
ATOM   3198  C C     . LEU A 1 417 ? 16.546  -27.153 -47.952  1.00 31.72 ? 417 LEU A C     1 
ATOM   3199  O O     . LEU A 1 417 ? 17.693  -26.752 -48.165  1.00 31.61 ? 417 LEU A O     1 
ATOM   3200  C CB    . LEU A 1 417 ? 15.441  -26.876 -45.705  1.00 30.61 ? 417 LEU A CB    1 
ATOM   3201  C CG    . LEU A 1 417 ? 16.755  -27.288 -44.985  1.00 30.66 ? 417 LEU A CG    1 
ATOM   3202  C CD1   . LEU A 1 417 ? 17.640  -26.127 -44.543  1.00 26.26 ? 417 LEU A CD1   1 
ATOM   3203  C CD2   . LEU A 1 417 ? 16.539  -28.242 -43.806  1.00 32.04 ? 417 LEU A CD2   1 
ATOM   3204  N N     . ALA A 1 418 ? 16.085  -28.328 -48.395  1.00 33.00 ? 418 ALA A N     1 
ATOM   3205  C CA    . ALA A 1 418 ? 16.885  -29.195 -49.290  1.00 32.87 ? 418 ALA A CA    1 
ATOM   3206  C C     . ALA A 1 418 ? 17.225  -28.471 -50.581  1.00 33.84 ? 418 ALA A C     1 
ATOM   3207  O O     . ALA A 1 418 ? 18.376  -28.535 -51.049  1.00 34.54 ? 418 ALA A O     1 
ATOM   3208  C CB    . ALA A 1 418 ? 16.161  -30.463 -49.584  1.00 32.72 ? 418 ALA A CB    1 
ATOM   3209  N N     . GLN A 1 419 ? 16.262  -27.741 -51.148  1.00 34.19 ? 419 GLN A N     1 
ATOM   3210  C CA    . GLN A 1 419 ? 16.558  -26.961 -52.366  1.00 35.64 ? 419 GLN A CA    1 
ATOM   3211  C C     . GLN A 1 419 ? 17.853  -26.135 -52.220  1.00 35.41 ? 419 GLN A C     1 
ATOM   3212  O O     . GLN A 1 419 ? 18.726  -26.193 -53.098  1.00 36.19 ? 419 GLN A O     1 
ATOM   3213  C CB    . GLN A 1 419 ? 15.357  -26.075 -52.777  1.00 35.87 ? 419 GLN A CB    1 
ATOM   3214  C CG    . GLN A 1 419 ? 15.607  -25.080 -53.925  1.00 34.70 ? 419 GLN A CG    1 
ATOM   3215  C CD    . GLN A 1 419 ? 14.924  -23.681 -53.711  1.00 37.64 ? 419 GLN A CD    1 
ATOM   3216  O OE1   . GLN A 1 419 ? 13.745  -23.581 -53.277  1.00 39.27 ? 419 GLN A OE1   1 
ATOM   3217  N NE2   . GLN A 1 419 ? 15.674  -22.593 -54.043  1.00 39.26 ? 419 GLN A NE2   1 
ATOM   3218  N N     . LEU A 1 420 ? 17.957  -25.406 -51.103  1.00 34.90 ? 420 LEU A N     1 
ATOM   3219  C CA    . LEU A 1 420 ? 18.990  -24.404 -50.860  1.00 35.06 ? 420 LEU A CA    1 
ATOM   3220  C C     . LEU A 1 420 ? 20.271  -25.037 -50.401  1.00 35.30 ? 420 LEU A C     1 
ATOM   3221  O O     . LEU A 1 420 ? 21.336  -24.468 -50.601  1.00 35.05 ? 420 LEU A O     1 
ATOM   3222  C CB    . LEU A 1 420 ? 18.559  -23.460 -49.749  1.00 35.01 ? 420 LEU A CB    1 
ATOM   3223  C CG    . LEU A 1 420 ? 17.525  -22.437 -50.104  1.00 36.89 ? 420 LEU A CG    1 
ATOM   3224  C CD1   . LEU A 1 420 ? 16.745  -22.089 -48.838  1.00 38.32 ? 420 LEU A CD1   1 
ATOM   3225  C CD2   . LEU A 1 420 ? 18.219  -21.231 -50.762  1.00 38.65 ? 420 LEU A CD2   1 
ATOM   3226  N N     . ILE A 1 421 ? 20.168  -26.171 -49.712  1.00 35.51 ? 421 ILE A N     1 
ATOM   3227  C CA    . ILE A 1 421 ? 21.330  -26.985 -49.422  1.00 35.69 ? 421 ILE A CA    1 
ATOM   3228  C C     . ILE A 1 421 ? 22.011  -27.426 -50.716  1.00 37.90 ? 421 ILE A C     1 
ATOM   3229  O O     . ILE A 1 421 ? 23.242  -27.379 -50.851  1.00 39.03 ? 421 ILE A O     1 
ATOM   3230  C CB    . ILE A 1 421 ? 20.933  -28.192 -48.644  1.00 34.80 ? 421 ILE A CB    1 
ATOM   3231  C CG1   . ILE A 1 421 ? 20.710  -27.796 -47.178  1.00 34.01 ? 421 ILE A CG1   1 
ATOM   3232  C CG2   . ILE A 1 421 ? 21.993  -29.236 -48.757  1.00 31.96 ? 421 ILE A CG2   1 
ATOM   3233  C CD1   . ILE A 1 421 ? 19.768  -28.748 -46.465  1.00 38.01 ? 421 ILE A CD1   1 
ATOM   3234  N N     . LYS A 1 422 ? 21.217  -27.853 -51.679  1.00 39.23 ? 422 LYS A N     1 
ATOM   3235  C CA    . LYS A 1 422 ? 21.781  -28.217 -52.957  1.00 41.30 ? 422 LYS A CA    1 
ATOM   3236  C C     . LYS A 1 422 ? 22.295  -27.004 -53.747  1.00 43.03 ? 422 LYS A C     1 
ATOM   3237  O O     . LYS A 1 422 ? 23.201  -27.145 -54.536  1.00 43.66 ? 422 LYS A O     1 
ATOM   3238  C CB    . LYS A 1 422 ? 20.802  -29.056 -53.771  1.00 40.59 ? 422 LYS A CB    1 
ATOM   3239  C CG    . LYS A 1 422 ? 20.681  -30.470 -53.239  1.00 40.93 ? 422 LYS A CG    1 
ATOM   3240  C CD    . LYS A 1 422 ? 19.832  -31.304 -54.147  1.00 42.19 ? 422 LYS A CD    1 
ATOM   3241  C CE    . LYS A 1 422 ? 18.404  -30.801 -54.240  1.00 38.23 ? 422 LYS A CE    1 
ATOM   3242  N NZ    . LYS A 1 422 ? 18.095  -30.901 -55.679  1.00 40.17 ? 422 LYS A NZ    1 
ATOM   3243  N N     . GLU A 1 423 ? 21.738  -25.817 -53.518  1.00 44.63 ? 423 GLU A N     1 
ATOM   3244  C CA    . GLU A 1 423 ? 22.301  -24.606 -54.111  1.00 45.78 ? 423 GLU A CA    1 
ATOM   3245  C C     . GLU A 1 423 ? 23.633  -24.192 -53.476  1.00 46.63 ? 423 GLU A C     1 
ATOM   3246  O O     . GLU A 1 423 ? 24.474  -23.537 -54.130  1.00 47.11 ? 423 GLU A O     1 
ATOM   3247  C CB    . GLU A 1 423 ? 21.322  -23.452 -54.009  1.00 46.09 ? 423 GLU A CB    1 
ATOM   3248  C CG    . GLU A 1 423 ? 20.075  -23.566 -54.886  1.00 48.19 ? 423 GLU A CG    1 
ATOM   3249  C CD    . GLU A 1 423 ? 19.137  -22.432 -54.589  1.00 50.15 ? 423 GLU A CD    1 
ATOM   3250  O OE1   . GLU A 1 423 ? 19.614  -21.473 -53.935  1.00 53.13 ? 423 GLU A OE1   1 
ATOM   3251  O OE2   . GLU A 1 423 ? 17.948  -22.491 -54.963  1.00 50.14 ? 423 GLU A OE2   1 
ATOM   3252  N N     . SER A 1 424 ? 23.840  -24.567 -52.218  1.00 46.60 ? 424 SER A N     1 
ATOM   3253  C CA    . SER A 1 424 ? 25.013  -24.117 -51.522  1.00 47.28 ? 424 SER A CA    1 
ATOM   3254  C C     . SER A 1 424 ? 26.159  -25.099 -51.613  1.00 47.88 ? 424 SER A C     1 
ATOM   3255  O O     . SER A 1 424 ? 27.251  -24.818 -51.155  1.00 48.69 ? 424 SER A O     1 
ATOM   3256  C CB    . SER A 1 424 ? 24.666  -23.800 -50.072  1.00 47.35 ? 424 SER A CB    1 
ATOM   3257  O OG    . SER A 1 424 ? 23.693  -22.776 -50.051  1.00 48.26 ? 424 SER A OG    1 
ATOM   3258  N N     . LEU A 1 425 ? 25.923  -26.259 -52.200  1.00 49.04 ? 425 LEU A N     1 
ATOM   3259  C CA    . LEU A 1 425 ? 27.015  -27.223 -52.390  1.00 49.85 ? 425 LEU A CA    1 
ATOM   3260  C C     . LEU A 1 425 ? 27.918  -26.812 -53.563  1.00 50.54 ? 425 LEU A C     1 
ATOM   3261  O O     . LEU A 1 425 ? 29.146  -26.935 -53.483  1.00 51.31 ? 425 LEU A O     1 
ATOM   3262  C CB    . LEU A 1 425 ? 26.485  -28.654 -52.590  1.00 49.55 ? 425 LEU A CB    1 
ATOM   3263  C CG    . LEU A 1 425 ? 25.783  -29.332 -51.392  1.00 49.56 ? 425 LEU A CG    1 
ATOM   3264  C CD1   . LEU A 1 425 ? 25.349  -30.740 -51.758  1.00 48.06 ? 425 LEU A CD1   1 
ATOM   3265  C CD2   . LEU A 1 425 ? 26.659  -29.350 -50.115  1.00 47.67 ? 425 LEU A CD2   1 
ATOM   3266  N N     . MET B 1 1   ? 28.615  9.306   -15.679  1.00 41.48 ? 1   MET B N     1 
ATOM   3267  C CA    . MET B 1 1   ? 28.192  8.124   -14.867  1.00 42.24 ? 1   MET B CA    1 
ATOM   3268  C C     . MET B 1 1   ? 28.676  6.754   -15.407  1.00 41.97 ? 1   MET B C     1 
ATOM   3269  O O     . MET B 1 1   ? 28.216  6.286   -16.459  1.00 41.30 ? 1   MET B O     1 
ATOM   3270  C CB    . MET B 1 1   ? 26.679  8.105   -14.739  1.00 42.72 ? 1   MET B CB    1 
ATOM   3271  C CG    . MET B 1 1   ? 26.173  7.079   -13.751  1.00 44.23 ? 1   MET B CG    1 
ATOM   3272  S SD    . MET B 1 1   ? 25.825  7.734   -12.096  1.00 46.56 ? 1   MET B SD    1 
ATOM   3273  C CE    . MET B 1 1   ? 25.896  6.197   -11.179  1.00 41.89 ? 1   MET B CE    1 
ATOM   3274  N N     . ASN B 1 2   ? 29.571  6.116   -14.647  1.00 41.21 ? 2   ASN B N     1 
ATOM   3275  C CA    . ASN B 1 2   ? 30.273  4.897   -15.065  1.00 40.62 ? 2   ASN B CA    1 
ATOM   3276  C C     . ASN B 1 2   ? 29.610  3.741   -14.393  1.00 40.02 ? 2   ASN B C     1 
ATOM   3277  O O     . ASN B 1 2   ? 29.428  3.732   -13.156  1.00 42.11 ? 2   ASN B O     1 
ATOM   3278  C CB    . ASN B 1 2   ? 31.764  4.996   -14.659  1.00 41.14 ? 2   ASN B CB    1 
ATOM   3279  C CG    . ASN B 1 2   ? 32.549  3.678   -14.796  1.00 40.44 ? 2   ASN B CG    1 
ATOM   3280  O OD1   . ASN B 1 2   ? 33.643  3.563   -14.257  1.00 39.45 ? 2   ASN B OD1   1 
ATOM   3281  N ND2   . ASN B 1 2   ? 32.031  2.724   -15.536  1.00 40.67 ? 2   ASN B ND2   1 
ATOM   3282  N N     . TYR B 1 3   ? 29.205  2.768   -15.177  1.00 37.53 ? 3   TYR B N     1 
ATOM   3283  C CA    . TYR B 1 3   ? 28.318  1.767   -14.607  1.00 35.97 ? 3   TYR B CA    1 
ATOM   3284  C C     . TYR B 1 3   ? 29.030  0.529   -14.294  1.00 36.02 ? 3   TYR B C     1 
ATOM   3285  O O     . TYR B 1 3   ? 28.587  -0.250  -13.439  1.00 36.90 ? 3   TYR B O     1 
ATOM   3286  C CB    . TYR B 1 3   ? 27.155  1.437   -15.526  1.00 33.57 ? 3   TYR B CB    1 
ATOM   3287  C CG    . TYR B 1 3   ? 26.048  2.427   -15.448  1.00 31.84 ? 3   TYR B CG    1 
ATOM   3288  C CD1   . TYR B 1 3   ? 25.791  3.299   -16.511  1.00 31.44 ? 3   TYR B CD1   1 
ATOM   3289  C CD2   . TYR B 1 3   ? 25.247  2.498   -14.321  1.00 29.88 ? 3   TYR B CD2   1 
ATOM   3290  C CE1   . TYR B 1 3   ? 24.737  4.209   -16.461  1.00 30.93 ? 3   TYR B CE1   1 
ATOM   3291  C CE2   . TYR B 1 3   ? 24.201  3.401   -14.248  1.00 29.78 ? 3   TYR B CE2   1 
ATOM   3292  C CZ    . TYR B 1 3   ? 23.940  4.239   -15.316  1.00 29.25 ? 3   TYR B CZ    1 
ATOM   3293  O OH    . TYR B 1 3   ? 22.924  5.114   -15.228  1.00 27.38 ? 3   TYR B OH    1 
ATOM   3294  N N     . ALA B 1 4   ? 30.111  0.327   -15.027  1.00 35.87 ? 4   ALA B N     1 
ATOM   3295  C CA    . ALA B 1 4   ? 30.986  -0.789  -14.801  1.00 35.16 ? 4   ALA B CA    1 
ATOM   3296  C C     . ALA B 1 4   ? 31.306  -0.970  -13.309  1.00 34.93 ? 4   ALA B C     1 
ATOM   3297  O O     . ALA B 1 4   ? 31.321  -2.102  -12.834  1.00 34.84 ? 4   ALA B O     1 
ATOM   3298  C CB    . ALA B 1 4   ? 32.243  -0.613  -15.625  1.00 35.41 ? 4   ALA B CB    1 
ATOM   3299  N N     . ARG B 1 5   ? 31.509  0.116   -12.547  1.00 34.73 ? 5   ARG B N     1 
ATOM   3300  C CA    . ARG B 1 5   ? 31.855  -0.086  -11.098  1.00 35.11 ? 5   ARG B CA    1 
ATOM   3301  C C     . ARG B 1 5   ? 30.748  -0.794  -10.330  1.00 35.19 ? 5   ARG B C     1 
ATOM   3302  O O     . ARG B 1 5   ? 31.016  -1.331  -9.262   1.00 36.27 ? 5   ARG B O     1 
ATOM   3303  C CB    . ARG B 1 5   ? 32.182  1.179   -10.290  1.00 33.90 ? 5   ARG B CB    1 
ATOM   3304  C CG    . ARG B 1 5   ? 32.557  2.400   -11.006  1.00 32.74 ? 5   ARG B CG    1 
ATOM   3305  C CD    . ARG B 1 5   ? 32.154  3.612   -10.184  1.00 32.81 ? 5   ARG B CD    1 
ATOM   3306  N NE    . ARG B 1 5   ? 32.341  3.437   -8.742   1.00 33.97 ? 5   ARG B NE    1 
ATOM   3307  C CZ    . ARG B 1 5   ? 31.738  4.199   -7.829   1.00 35.93 ? 5   ARG B CZ    1 
ATOM   3308  N NH1   . ARG B 1 5   ? 31.939  4.007   -6.533   1.00 31.99 ? 5   ARG B NH1   1 
ATOM   3309  N NH2   . ARG B 1 5   ? 30.917  5.168   -8.228   1.00 38.47 ? 5   ARG B NH2   1 
ATOM   3310  N N     . PHE B 1 6   ? 29.523  -0.773  -10.863  1.00 34.58 ? 6   PHE B N     1 
ATOM   3311  C CA    . PHE B 1 6   ? 28.355  -1.334  -10.169  1.00 34.23 ? 6   PHE B CA    1 
ATOM   3312  C C     . PHE B 1 6   ? 27.863  -2.646  -10.754  1.00 34.14 ? 6   PHE B C     1 
ATOM   3313  O O     . PHE B 1 6   ? 26.685  -3.016  -10.587  1.00 35.03 ? 6   PHE B O     1 
ATOM   3314  C CB    . PHE B 1 6   ? 27.195  -0.363  -10.250  1.00 33.85 ? 6   PHE B CB    1 
ATOM   3315  C CG    . PHE B 1 6   ? 27.520  1.002   -9.776   1.00 32.57 ? 6   PHE B CG    1 
ATOM   3316  C CD1   . PHE B 1 6   ? 27.736  2.015   -10.684  1.00 33.12 ? 6   PHE B CD1   1 
ATOM   3317  C CD2   . PHE B 1 6   ? 27.551  1.284   -8.427   1.00 31.62 ? 6   PHE B CD2   1 
ATOM   3318  C CE1   . PHE B 1 6   ? 27.990  3.290   -10.245  1.00 36.99 ? 6   PHE B CE1   1 
ATOM   3319  C CE2   . PHE B 1 6   ? 27.825  2.577   -7.970   1.00 31.57 ? 6   PHE B CE2   1 
ATOM   3320  C CZ    . PHE B 1 6   ? 28.033  3.569   -8.861   1.00 32.15 ? 6   PHE B CZ    1 
ATOM   3321  N N     . ILE B 1 7   ? 28.755  -3.348  -11.438  1.00 33.57 ? 7   ILE B N     1 
ATOM   3322  C CA    . ILE B 1 7   ? 28.390  -4.586  -12.117  1.00 32.89 ? 7   ILE B CA    1 
ATOM   3323  C C     . ILE B 1 7   ? 29.440  -5.669  -11.890  1.00 33.41 ? 7   ILE B C     1 
ATOM   3324  O O     . ILE B 1 7   ? 30.511  -5.646  -12.497  1.00 35.78 ? 7   ILE B O     1 
ATOM   3325  C CB    . ILE B 1 7   ? 28.203  -4.339  -13.626  1.00 32.28 ? 7   ILE B CB    1 
ATOM   3326  C CG1   . ILE B 1 7   ? 27.152  -3.252  -13.862  1.00 31.90 ? 7   ILE B CG1   1 
ATOM   3327  C CG2   . ILE B 1 7   ? 27.810  -5.627  -14.332  1.00 33.29 ? 7   ILE B CG2   1 
ATOM   3328  C CD1   . ILE B 1 7   ? 26.815  -3.034  -15.321  1.00 31.24 ? 7   ILE B CD1   1 
ATOM   3329  N N     . THR B 1 8   ? 29.125  -6.616  -11.012  1.00 32.83 ? 8   THR B N     1 
ATOM   3330  C CA    . THR B 1 8   ? 30.043  -7.705  -10.700  1.00 32.29 ? 8   THR B CA    1 
ATOM   3331  C C     . THR B 1 8   ? 30.668  -8.280  -11.966  1.00 32.39 ? 8   THR B C     1 
ATOM   3332  O O     . THR B 1 8   ? 30.051  -8.275  -13.032  1.00 31.87 ? 8   THR B O     1 
ATOM   3333  C CB    . THR B 1 8   ? 29.316  -8.815  -9.917   1.00 32.68 ? 8   THR B CB    1 
ATOM   3334  O OG1   . THR B 1 8   ? 29.173  -8.422  -8.547   1.00 33.01 ? 8   THR B OG1   1 
ATOM   3335  C CG2   . THR B 1 8   ? 30.180  -10.062 -9.835   1.00 31.27 ? 8   THR B CG2   1 
ATOM   3336  N N     . ALA B 1 9   ? 31.895  -8.776  -11.842  1.00 31.85 ? 9   ALA B N     1 
ATOM   3337  C CA    . ALA B 1 9   ? 32.504  -9.584  -12.892  1.00 32.03 ? 9   ALA B CA    1 
ATOM   3338  C C     . ALA B 1 9   ? 31.500  -10.566 -13.483  1.00 31.15 ? 9   ALA B C     1 
ATOM   3339  O O     . ALA B 1 9   ? 31.238  -10.553 -14.686  1.00 32.28 ? 9   ALA B O     1 
ATOM   3340  C CB    . ALA B 1 9   ? 33.719  -10.323 -12.353  1.00 31.61 ? 9   ALA B CB    1 
ATOM   3341  N N     . ALA B 1 10  ? 30.940  -11.418 -12.630  1.00 29.98 ? 10  ALA B N     1 
ATOM   3342  C CA    . ALA B 1 10  ? 29.888  -12.370 -13.058  1.00 29.88 ? 10  ALA B CA    1 
ATOM   3343  C C     . ALA B 1 10  ? 28.743  -11.710 -13.843  1.00 28.66 ? 10  ALA B C     1 
ATOM   3344  O O     . ALA B 1 10  ? 28.428  -12.109 -14.958  1.00 28.95 ? 10  ALA B O     1 
ATOM   3345  C CB    . ALA B 1 10  ? 29.360  -13.261 -11.844  1.00 28.62 ? 10  ALA B CB    1 
ATOM   3346  N N     . SER B 1 11  ? 28.186  -10.650 -13.301  1.00 29.00 ? 11  SER B N     1 
ATOM   3347  C CA    . SER B 1 11  ? 27.060  -9.936  -13.932  1.00 29.05 ? 11  SER B CA    1 
ATOM   3348  C C     . SER B 1 11  ? 27.341  -9.358  -15.341  1.00 30.08 ? 11  SER B C     1 
ATOM   3349  O O     . SER B 1 11  ? 26.480  -9.436  -16.249  1.00 30.61 ? 11  SER B O     1 
ATOM   3350  C CB    . SER B 1 11  ? 26.549  -8.834  -12.996  1.00 28.97 ? 11  SER B CB    1 
ATOM   3351  O OG    . SER B 1 11  ? 25.314  -8.328  -13.442  1.00 27.93 ? 11  SER B OG    1 
ATOM   3352  N N     . ALA B 1 12  ? 28.501  -8.751  -15.509  1.00 30.27 ? 12  ALA B N     1 
ATOM   3353  C CA    . ALA B 1 12  ? 29.019  -8.347  -16.779  1.00 30.22 ? 12  ALA B CA    1 
ATOM   3354  C C     . ALA B 1 12  ? 29.182  -9.400  -17.855  1.00 30.25 ? 12  ALA B C     1 
ATOM   3355  O O     . ALA B 1 12  ? 29.111  -9.111  -19.014  1.00 29.90 ? 12  ALA B O     1 
ATOM   3356  C CB    . ALA B 1 12  ? 30.255  -7.647  -16.575  1.00 30.73 ? 12  ALA B CB    1 
ATOM   3357  N N     . ALA B 1 13  ? 29.397  -10.621 -17.446  1.00 30.64 ? 13  ALA B N     1 
ATOM   3358  C CA    . ALA B 1 13  ? 29.718  -11.681 -18.316  1.00 31.82 ? 13  ALA B CA    1 
ATOM   3359  C C     . ALA B 1 13  ? 28.498  -12.426 -18.782  1.00 32.84 ? 13  ALA B C     1 
ATOM   3360  O O     . ALA B 1 13  ? 28.594  -13.354 -19.516  1.00 33.17 ? 13  ALA B O     1 
ATOM   3361  C CB    . ALA B 1 13  ? 30.657  -12.587 -17.666  1.00 31.10 ? 13  ALA B CB    1 
ATOM   3362  N N     . ARG B 1 14  ? 27.341  -11.990 -18.352  1.00 33.11 ? 14  ARG B N     1 
ATOM   3363  C CA    . ARG B 1 14  ? 26.101  -12.571 -18.795  1.00 33.90 ? 14  ARG B CA    1 
ATOM   3364  C C     . ARG B 1 14  ? 25.813  -12.180 -20.199  1.00 34.95 ? 14  ARG B C     1 
ATOM   3365  O O     . ARG B 1 14  ? 25.943  -11.058 -20.550  1.00 33.48 ? 14  ARG B O     1 
ATOM   3366  C CB    . ARG B 1 14  ? 24.960  -12.120 -17.912  1.00 33.66 ? 14  ARG B CB    1 
ATOM   3367  C CG    . ARG B 1 14  ? 25.046  -12.613 -16.525  1.00 32.79 ? 14  ARG B CG    1 
ATOM   3368  C CD    . ARG B 1 14  ? 23.772  -12.374 -15.748  1.00 32.48 ? 14  ARG B CD    1 
ATOM   3369  N NE    . ARG B 1 14  ? 23.899  -12.819 -14.360  1.00 20.61 ? 14  ARG B NE    1 
ATOM   3370  C CZ    . ARG B 1 14  ? 23.815  -14.056 -13.928  1.00 9.47  ? 14  ARG B CZ    1 
ATOM   3371  N NH1   . ARG B 1 14  ? 23.599  -15.019 -14.751  1.00 7.61  ? 14  ARG B NH1   1 
ATOM   3372  N NH2   . ARG B 1 14  ? 23.944  -14.288 -12.668  1.00 4.43  ? 14  ARG B NH2   1 
ATOM   3373  N N     . ASN B 1 15  ? 25.412  -13.122 -21.010  1.00 37.88 ? 15  ASN B N     1 
ATOM   3374  C CA    . ASN B 1 15  ? 24.950  -12.798 -22.335  1.00 40.75 ? 15  ASN B CA    1 
ATOM   3375  C C     . ASN B 1 15  ? 23.508  -13.161 -22.402  1.00 43.04 ? 15  ASN B C     1 
ATOM   3376  O O     . ASN B 1 15  ? 23.033  -13.902 -21.562  1.00 43.40 ? 15  ASN B O     1 
ATOM   3377  C CB    . ASN B 1 15  ? 25.756  -13.536 -23.402  1.00 40.41 ? 15  ASN B CB    1 
ATOM   3378  C CG    . ASN B 1 15  ? 27.244  -13.278 -23.299  1.00 42.57 ? 15  ASN B CG    1 
ATOM   3379  O OD1   . ASN B 1 15  ? 27.704  -12.143 -23.336  1.00 44.05 ? 15  ASN B OD1   1 
ATOM   3380  N ND2   . ASN B 1 15  ? 28.002  -14.340 -23.164  1.00 42.98 ? 15  ASN B ND2   1 
ATOM   3381  N N     . PRO B 1 16  ? 22.804  -12.641 -23.402  1.00 45.39 ? 16  PRO B N     1 
ATOM   3382  C CA    . PRO B 1 16  ? 21.345  -12.771 -23.467  1.00 48.22 ? 16  PRO B CA    1 
ATOM   3383  C C     . PRO B 1 16  ? 20.918  -14.183 -23.856  1.00 50.25 ? 16  PRO B C     1 
ATOM   3384  O O     . PRO B 1 16  ? 21.408  -14.723 -24.848  1.00 52.00 ? 16  PRO B O     1 
ATOM   3385  C CB    . PRO B 1 16  ? 20.959  -11.783 -24.568  1.00 46.20 ? 16  PRO B CB    1 
ATOM   3386  C CG    . PRO B 1 16  ? 22.158  -11.719 -25.446  1.00 46.23 ? 16  PRO B CG    1 
ATOM   3387  C CD    . PRO B 1 16  ? 23.342  -11.866 -24.535  1.00 45.38 ? 16  PRO B CD    1 
ATOM   3388  N N     . SER B 1 17  ? 20.014  -14.768 -23.078  1.00 51.74 ? 17  SER B N     1 
ATOM   3389  C CA    . SER B 1 17  ? 19.594  -16.147 -23.295  1.00 53.29 ? 17  SER B CA    1 
ATOM   3390  C C     . SER B 1 17  ? 18.080  -16.251 -23.414  1.00 54.03 ? 17  SER B C     1 
ATOM   3391  O O     . SER B 1 17  ? 17.398  -16.644 -22.467  1.00 53.03 ? 17  SER B O     1 
ATOM   3392  C CB    . SER B 1 17  ? 20.095  -17.044 -22.161  1.00 52.74 ? 17  SER B CB    1 
ATOM   3393  O OG    . SER B 1 17  ? 20.989  -18.031 -22.647  1.00 55.58 ? 17  SER B OG    1 
ATOM   3394  N N     . PRO B 1 18  ? 17.557  -15.895 -24.583  1.00 56.57 ? 18  PRO B N     1 
ATOM   3395  C CA    . PRO B 1 18  ? 16.146  -15.518 -24.713  1.00 57.62 ? 18  PRO B CA    1 
ATOM   3396  C C     . PRO B 1 18  ? 15.273  -16.711 -25.087  1.00 60.28 ? 18  PRO B C     1 
ATOM   3397  O O     . PRO B 1 18  ? 15.779  -17.705 -25.607  1.00 59.68 ? 18  PRO B O     1 
ATOM   3398  C CB    . PRO B 1 18  ? 16.165  -14.501 -25.856  1.00 58.80 ? 18  PRO B CB    1 
ATOM   3399  C CG    . PRO B 1 18  ? 17.342  -14.890 -26.678  1.00 57.84 ? 18  PRO B CG    1 
ATOM   3400  C CD    . PRO B 1 18  ? 18.370  -15.400 -25.708  1.00 55.73 ? 18  PRO B CD    1 
ATOM   3401  N N     . ILE B 1 19  ? 13.975  -16.607 -24.821  1.00 63.30 ? 19  ILE B N     1 
ATOM   3402  C CA    . ILE B 1 19  ? 12.962  -17.093 -25.750  1.00 66.59 ? 19  ILE B CA    1 
ATOM   3403  C C     . ILE B 1 19  ? 12.353  -15.947 -26.551  1.00 69.71 ? 19  ILE B C     1 
ATOM   3404  O O     . ILE B 1 19  ? 11.161  -15.662 -26.437  1.00 70.98 ? 19  ILE B O     1 
ATOM   3405  C CB    . ILE B 1 19  ? 11.858  -17.855 -24.994  1.00 66.64 ? 19  ILE B CB    1 
ATOM   3406  C CG1   . ILE B 1 19  ? 12.056  -17.719 -23.482  1.00 66.15 ? 19  ILE B CG1   1 
ATOM   3407  C CG2   . ILE B 1 19  ? 11.845  -19.317 -25.404  1.00 65.39 ? 19  ILE B CG2   1 
ATOM   3408  C CD1   . ILE B 1 19  ? 10.813  -17.277 -22.741  1.00 62.89 ? 19  ILE B CD1   1 
ATOM   3409  N N     . ARG B 1 20  ? 13.179  -15.293 -27.361  1.00 72.91 ? 20  ARG B N     1 
ATOM   3410  C CA    . ARG B 1 20  ? 13.302  -15.635 -28.759  1.00 75.53 ? 20  ARG B CA    1 
ATOM   3411  C C     . ARG B 1 20  ? 12.792  -17.054 -29.002  1.00 77.48 ? 20  ARG B C     1 
ATOM   3412  O O     . ARG B 1 20  ? 13.006  -17.639 -30.063  1.00 77.90 ? 20  ARG B O     1 
ATOM   3413  C CB    . ARG B 1 20  ? 14.742  -15.520 -29.199  1.00 75.75 ? 20  ARG B CB    1 
ATOM   3414  C CG    . ARG B 1 20  ? 15.105  -16.497 -30.266  1.00 74.70 ? 20  ARG B CG    1 
ATOM   3415  C CD    . ARG B 1 20  ? 16.369  -16.149 -30.985  1.00 74.80 ? 20  ARG B CD    1 
ATOM   3416  N NE    . ARG B 1 20  ? 16.452  -16.813 -32.271  1.00 74.93 ? 20  ARG B NE    1 
ATOM   3417  C CZ    . ARG B 1 20  ? 16.406  -16.179 -33.420  1.00 74.32 ? 20  ARG B CZ    1 
ATOM   3418  N NH1   . ARG B 1 20  ? 16.274  -14.862 -33.431  1.00 74.60 ? 20  ARG B NH1   1 
ATOM   3419  N NH2   . ARG B 1 20  ? 16.491  -16.854 -34.557  1.00 68.46 ? 20  ARG B NH2   1 
ATOM   3420  N N     . GLY B 1 29  ? 13.461  -10.791 -44.632  1.00 77.64 ? 29  GLY B N     1 
ATOM   3421  C CA    . GLY B 1 29  ? 12.339  -11.557 -44.117  1.00 76.93 ? 29  GLY B CA    1 
ATOM   3422  C C     . GLY B 1 29  ? 11.005  -11.403 -44.847  1.00 75.07 ? 29  GLY B C     1 
ATOM   3423  O O     . GLY B 1 29  ? 10.272  -10.444 -44.631  1.00 74.99 ? 29  GLY B O     1 
ATOM   3424  N N     . PRO B 1 30  ? 10.701  -12.362 -45.715  1.00 73.45 ? 30  PRO B N     1 
ATOM   3425  C CA    . PRO B 1 30  ? 9.356   -12.490 -46.284  1.00 72.28 ? 30  PRO B CA    1 
ATOM   3426  C C     . PRO B 1 30  ? 8.317   -12.812 -45.214  1.00 70.65 ? 30  PRO B C     1 
ATOM   3427  O O     . PRO B 1 30  ? 8.620   -12.749 -44.023  1.00 70.01 ? 30  PRO B O     1 
ATOM   3428  C CB    . PRO B 1 30  ? 9.499   -13.668 -47.249  1.00 72.58 ? 30  PRO B CB    1 
ATOM   3429  C CG    . PRO B 1 30  ? 10.595  -14.489 -46.670  1.00 72.26 ? 30  PRO B CG    1 
ATOM   3430  C CD    . PRO B 1 30  ? 11.556  -13.515 -46.050  1.00 73.04 ? 30  PRO B CD    1 
ATOM   3431  N N     . LYS B 1 31  ? 7.106   -13.153 -45.642  1.00 68.00 ? 31  LYS B N     1 
ATOM   3432  C CA    . LYS B 1 31  ? 5.902   -12.520 -45.118  1.00 66.40 ? 31  LYS B CA    1 
ATOM   3433  C C     . LYS B 1 31  ? 5.003   -13.537 -44.424  1.00 64.18 ? 31  LYS B C     1 
ATOM   3434  O O     . LYS B 1 31  ? 4.684   -13.394 -43.243  1.00 63.11 ? 31  LYS B O     1 
ATOM   3435  C CB    . LYS B 1 31  ? 5.134   -11.818 -46.240  1.00 67.06 ? 31  LYS B CB    1 
ATOM   3436  C CG    . LYS B 1 31  ? 4.414   -12.766 -47.186  1.00 68.81 ? 31  LYS B CG    1 
ATOM   3437  C CD    . LYS B 1 31  ? 5.121   -12.848 -48.529  1.00 68.37 ? 31  LYS B CD    1 
ATOM   3438  C CE    . LYS B 1 31  ? 5.431   -11.464 -49.076  1.00 68.61 ? 31  LYS B CE    1 
ATOM   3439  N NZ    . LYS B 1 31  ? 5.906   -10.539 -48.010  1.00 68.92 ? 31  LYS B NZ    1 
ATOM   3440  N N     . SER B 1 32  ? 4.598   -14.564 -45.164  1.00 60.40 ? 32  SER B N     1 
ATOM   3441  C CA    . SER B 1 32  ? 4.433   -15.898 -44.598  1.00 57.10 ? 32  SER B CA    1 
ATOM   3442  C C     . SER B 1 32  ? 5.772   -16.618 -44.485  1.00 55.91 ? 32  SER B C     1 
ATOM   3443  O O     . SER B 1 32  ? 6.702   -16.344 -45.243  1.00 57.39 ? 32  SER B O     1 
ATOM   3444  C CB    . SER B 1 32  ? 3.462   -16.723 -45.446  1.00 56.63 ? 32  SER B CB    1 
ATOM   3445  O OG    . SER B 1 32  ? 3.987   -16.953 -46.742  1.00 51.01 ? 32  SER B OG    1 
ATOM   3446  N N     . MET B 1 33  ? 5.863   -17.541 -43.533  1.00 52.54 ? 33  MET B N     1 
ATOM   3447  C CA    . MET B 1 33  ? 7.061   -17.681 -42.713  1.00 49.25 ? 33  MET B CA    1 
ATOM   3448  C C     . MET B 1 33  ? 6.765   -18.920 -41.876  1.00 46.96 ? 33  MET B C     1 
ATOM   3449  O O     . MET B 1 33  ? 5.714   -19.017 -41.242  1.00 47.82 ? 33  MET B O     1 
ATOM   3450  C CB    . MET B 1 33  ? 7.326   -16.394 -41.928  1.00 48.45 ? 33  MET B CB    1 
ATOM   3451  C CG    . MET B 1 33  ? 8.788   -15.981 -41.889  1.00 52.89 ? 33  MET B CG    1 
ATOM   3452  S SD    . MET B 1 33  ? 9.910   -17.392 -41.877  1.00 56.92 ? 33  MET B SD    1 
ATOM   3453  C CE    . MET B 1 33  ? 11.382  -16.661 -42.589  1.00 56.19 ? 33  MET B CE    1 
ATOM   3454  N N     . ILE B 1 34  ? 7.699   -19.866 -41.878  1.00 44.04 ? 34  ILE B N     1 
ATOM   3455  C CA    . ILE B 1 34  ? 7.401   -21.238 -41.485  1.00 38.81 ? 34  ILE B CA    1 
ATOM   3456  C C     . ILE B 1 34  ? 8.458   -21.664 -40.472  1.00 37.97 ? 34  ILE B C     1 
ATOM   3457  O O     . ILE B 1 34  ? 9.380   -22.411 -40.799  1.00 39.66 ? 34  ILE B O     1 
ATOM   3458  C CB    . ILE B 1 34  ? 7.298   -22.281 -42.613  1.00 37.35 ? 34  ILE B CB    1 
ATOM   3459  C CG1   . ILE B 1 34  ? 5.934   -22.192 -43.300  1.00 35.49 ? 34  ILE B CG1   1 
ATOM   3460  C CG2   . ILE B 1 34  ? 7.534   -23.681 -42.067  1.00 32.19 ? 34  ILE B CG2   1 
ATOM   3461  C CD1   . ILE B 1 34  ? 5.602   -23.393 -44.157  1.00 34.04 ? 34  ILE B CD1   1 
ATOM   3462  N N     . SER B 1 35  ? 8.318   -21.184 -39.240  1.00 37.48 ? 35  SER B N     1 
ATOM   3463  C CA    . SER B 1 35  ? 9.388   -21.278 -38.255  1.00 33.79 ? 35  SER B CA    1 
ATOM   3464  C C     . SER B 1 35  ? 9.407   -22.650 -37.590  1.00 31.45 ? 35  SER B C     1 
ATOM   3465  O O     . SER B 1 35  ? 8.449   -23.040 -36.922  1.00 29.92 ? 35  SER B O     1 
ATOM   3466  C CB    . SER B 1 35  ? 9.240   -20.183 -37.197  1.00 33.97 ? 35  SER B CB    1 
ATOM   3467  O OG    . SER B 1 35  ? 10.502  -19.799 -36.679  1.00 39.38 ? 35  SER B OG    1 
ATOM   3468  N N     . LEU B 1 36  ? 10.503  -23.378 -37.777  1.00 30.65 ? 36  LEU B N     1 
ATOM   3469  C CA    . LEU B 1 36  ? 10.829  -24.507 -36.914  1.00 29.66 ? 36  LEU B CA    1 
ATOM   3470  C C     . LEU B 1 36  ? 11.961  -24.158 -35.953  1.00 28.36 ? 36  LEU B C     1 
ATOM   3471  O O     . LEU B 1 36  ? 12.590  -25.043 -35.373  1.00 29.29 ? 36  LEU B O     1 
ATOM   3472  C CB    . LEU B 1 36  ? 11.209  -25.730 -37.752  1.00 29.35 ? 36  LEU B CB    1 
ATOM   3473  C CG    . LEU B 1 36  ? 10.311  -26.035 -38.952  1.00 28.44 ? 36  LEU B CG    1 
ATOM   3474  C CD1   . LEU B 1 36  ? 10.963  -27.061 -39.865  1.00 17.09 ? 36  LEU B CD1   1 
ATOM   3475  C CD2   . LEU B 1 36  ? 8.942   -26.513 -38.492  1.00 25.80 ? 36  LEU B CD2   1 
ATOM   3476  N N     . ALA B 1 37  ? 12.215  -22.864 -35.791  1.00 30.42 ? 37  ALA B N     1 
ATOM   3477  C CA    . ALA B 1 37  ? 13.441  -22.397 -35.154  1.00 30.04 ? 37  ALA B CA    1 
ATOM   3478  C C     . ALA B 1 37  ? 13.259  -22.254 -33.647  1.00 29.70 ? 37  ALA B C     1 
ATOM   3479  O O     . ALA B 1 37  ? 14.215  -22.381 -32.882  1.00 30.21 ? 37  ALA B O     1 
ATOM   3480  C CB    . ALA B 1 37  ? 13.885  -21.078 -35.765  1.00 29.81 ? 37  ALA B CB    1 
ATOM   3481  N N     . GLY B 1 38  ? 12.026  -21.988 -33.227  1.00 28.86 ? 38  GLY B N     1 
ATOM   3482  C CA    . GLY B 1 38  ? 11.757  -21.578 -31.862  1.00 28.50 ? 38  GLY B CA    1 
ATOM   3483  C C     . GLY B 1 38  ? 11.547  -22.758 -30.933  1.00 27.37 ? 38  GLY B C     1 
ATOM   3484  O O     . GLY B 1 38  ? 11.569  -23.911 -31.363  1.00 26.95 ? 38  GLY B O     1 
ATOM   3485  N N     . GLY B 1 39  ? 11.343  -22.467 -29.652  1.00 28.50 ? 39  GLY B N     1 
ATOM   3486  C CA    . GLY B 1 39  ? 11.376  -23.530 -28.583  1.00 29.46 ? 39  GLY B CA    1 
ATOM   3487  C C     . GLY B 1 39  ? 10.048  -23.833 -27.881  1.00 30.00 ? 39  GLY B C     1 
ATOM   3488  O O     . GLY B 1 39  ? 9.902   -24.886 -27.228  1.00 30.67 ? 39  GLY B O     1 
ATOM   3489  N N     . LEU B 1 40  ? 9.055   -22.959 -28.086  1.00 29.47 ? 40  LEU B N     1 
ATOM   3490  C CA    . LEU B 1 40  ? 7.775   -23.059 -27.407  1.00 28.67 ? 40  LEU B CA    1 
ATOM   3491  C C     . LEU B 1 40  ? 7.084   -24.422 -27.513  1.00 27.88 ? 40  LEU B C     1 
ATOM   3492  O O     . LEU B 1 40  ? 7.033   -25.027 -28.568  1.00 28.24 ? 40  LEU B O     1 
ATOM   3493  C CB    . LEU B 1 40  ? 6.840   -21.934 -27.843  1.00 28.34 ? 40  LEU B CB    1 
ATOM   3494  C CG    . LEU B 1 40  ? 7.390   -20.504 -28.064  1.00 27.74 ? 40  LEU B CG    1 
ATOM   3495  C CD1   . LEU B 1 40  ? 6.330   -19.634 -28.798  1.00 23.56 ? 40  LEU B CD1   1 
ATOM   3496  C CD2   . LEU B 1 40  ? 7.836   -19.837 -26.815  1.00 28.51 ? 40  LEU B CD2   1 
ATOM   3497  N N     . PRO B 1 41  ? 6.556   -24.922 -26.402  1.00 26.44 ? 41  PRO B N     1 
ATOM   3498  C CA    . PRO B 1 41  ? 5.721   -26.108 -26.555  1.00 27.62 ? 41  PRO B CA    1 
ATOM   3499  C C     . PRO B 1 41  ? 4.446   -25.744 -27.306  1.00 28.18 ? 41  PRO B C     1 
ATOM   3500  O O     . PRO B 1 41  ? 4.091   -24.533 -27.414  1.00 28.38 ? 41  PRO B O     1 
ATOM   3501  C CB    . PRO B 1 41  ? 5.303   -26.448 -25.129  1.00 26.91 ? 41  PRO B CB    1 
ATOM   3502  C CG    . PRO B 1 41  ? 6.040   -25.535 -24.233  1.00 25.19 ? 41  PRO B CG    1 
ATOM   3503  C CD    . PRO B 1 41  ? 6.616   -24.440 -25.035  1.00 25.58 ? 41  PRO B CD    1 
ATOM   3504  N N     . ASN B 1 42  ? 3.717   -26.768 -27.744  1.00 28.22 ? 42  ASN B N     1 
ATOM   3505  C CA    . ASN B 1 42  ? 2.431   -26.515 -28.338  1.00 28.74 ? 42  ASN B CA    1 
ATOM   3506  C C     . ASN B 1 42  ? 1.377   -26.213 -27.247  1.00 29.36 ? 42  ASN B C     1 
ATOM   3507  O O     . ASN B 1 42  ? 1.073   -27.064 -26.380  1.00 28.54 ? 42  ASN B O     1 
ATOM   3508  C CB    . ASN B 1 42  ? 2.075   -27.668 -29.255  1.00 29.44 ? 42  ASN B CB    1 
ATOM   3509  C CG    . ASN B 1 42  ? 0.774   -27.466 -30.012  1.00 29.08 ? 42  ASN B CG    1 
ATOM   3510  O OD1   . ASN B 1 42  ? 0.541   -28.175 -30.969  1.00 33.55 ? 42  ASN B OD1   1 
ATOM   3511  N ND2   . ASN B 1 42  ? -0.084  -26.546 -29.578  1.00 28.51 ? 42  ASN B ND2   1 
ATOM   3512  N N     . PRO B 1 43  ? 0.817   -24.986 -27.282  1.00 30.24 ? 43  PRO B N     1 
ATOM   3513  C CA    . PRO B 1 43  ? -0.046  -24.614 -26.154  1.00 31.50 ? 43  PRO B CA    1 
ATOM   3514  C C     . PRO B 1 43  ? -1.457  -25.238 -26.209  1.00 31.50 ? 43  PRO B C     1 
ATOM   3515  O O     . PRO B 1 43  ? -2.282  -24.913 -25.383  1.00 32.56 ? 43  PRO B O     1 
ATOM   3516  C CB    . PRO B 1 43  ? -0.125  -23.080 -26.271  1.00 31.59 ? 43  PRO B CB    1 
ATOM   3517  C CG    . PRO B 1 43  ? -0.037  -22.803 -27.733  1.00 28.36 ? 43  PRO B CG    1 
ATOM   3518  C CD    . PRO B 1 43  ? 0.890   -23.898 -28.287  1.00 30.81 ? 43  PRO B CD    1 
ATOM   3519  N N     . ASN B 1 44  ? -1.718  -26.136 -27.153  1.00 30.88 ? 44  ASN B N     1 
ATOM   3520  C CA    . ASN B 1 44  ? -3.066  -26.706 -27.304  1.00 29.97 ? 44  ASN B CA    1 
ATOM   3521  C C     . ASN B 1 44  ? -3.221  -27.874 -26.392  1.00 29.11 ? 44  ASN B C     1 
ATOM   3522  O O     . ASN B 1 44  ? -4.324  -28.313 -26.093  1.00 29.06 ? 44  ASN B O     1 
ATOM   3523  C CB    . ASN B 1 44  ? -3.349  -27.115 -28.760  1.00 29.49 ? 44  ASN B CB    1 
ATOM   3524  C CG    . ASN B 1 44  ? -3.587  -25.919 -29.635  1.00 30.22 ? 44  ASN B CG    1 
ATOM   3525  O OD1   . ASN B 1 44  ? -4.329  -25.038 -29.259  1.00 30.84 ? 44  ASN B OD1   1 
ATOM   3526  N ND2   . ASN B 1 44  ? -2.941  -25.867 -30.789  1.00 32.38 ? 44  ASN B ND2   1 
ATOM   3527  N N     . MET B 1 45  ? -2.074  -28.328 -25.927  1.00 28.26 ? 45  MET B N     1 
ATOM   3528  C CA    . MET B 1 45  ? -1.957  -29.494 -25.092  1.00 27.65 ? 45  MET B CA    1 
ATOM   3529  C C     . MET B 1 45  ? -2.397  -29.256 -23.656  1.00 27.38 ? 45  MET B C     1 
ATOM   3530  O O     . MET B 1 45  ? -2.653  -30.217 -22.916  1.00 26.66 ? 45  MET B O     1 
ATOM   3531  C CB    . MET B 1 45  ? -0.495  -29.933 -25.119  1.00 27.46 ? 45  MET B CB    1 
ATOM   3532  C CG    . MET B 1 45  ? -0.043  -30.437 -26.479  1.00 29.71 ? 45  MET B CG    1 
ATOM   3533  S SD    . MET B 1 45  ? -0.907  -31.965 -26.834  1.00 35.64 ? 45  MET B SD    1 
ATOM   3534  C CE    . MET B 1 45  ? -2.229  -31.445 -27.926  1.00 32.66 ? 45  MET B CE    1 
ATOM   3535  N N     . PHE B 1 46  ? -2.410  -27.975 -23.261  1.00 26.96 ? 46  PHE B N     1 
ATOM   3536  C CA    . PHE B 1 46  ? -2.567  -27.564 -21.885  1.00 26.03 ? 46  PHE B CA    1 
ATOM   3537  C C     . PHE B 1 46  ? -4.055  -27.592 -21.543  1.00 26.58 ? 46  PHE B C     1 
ATOM   3538  O O     . PHE B 1 46  ? -4.898  -27.324 -22.416  1.00 25.41 ? 46  PHE B O     1 
ATOM   3539  C CB    . PHE B 1 46  ? -2.047  -26.161 -21.757  1.00 25.74 ? 46  PHE B CB    1 
ATOM   3540  C CG    . PHE B 1 46  ? -0.592  -26.028 -21.998  1.00 26.72 ? 46  PHE B CG    1 
ATOM   3541  C CD1   . PHE B 1 46  ? -0.085  -24.835 -22.458  1.00 24.53 ? 46  PHE B CD1   1 
ATOM   3542  C CD2   . PHE B 1 46  ? 0.291   -27.083 -21.722  1.00 25.86 ? 46  PHE B CD2   1 
ATOM   3543  C CE1   . PHE B 1 46  ? 1.262   -24.689 -22.662  1.00 27.55 ? 46  PHE B CE1   1 
ATOM   3544  C CE2   . PHE B 1 46  ? 1.638   -26.916 -21.882  1.00 26.96 ? 46  PHE B CE2   1 
ATOM   3545  C CZ    . PHE B 1 46  ? 2.132   -25.730 -22.380  1.00 25.85 ? 46  PHE B CZ    1 
ATOM   3546  N N     . PRO B 1 47  ? -4.388  -27.921 -20.266  1.00 26.81 ? 47  PRO B N     1 
ATOM   3547  C CA    . PRO B 1 47  ? -5.739  -28.361 -19.918  1.00 26.53 ? 47  PRO B CA    1 
ATOM   3548  C C     . PRO B 1 47  ? -6.731  -27.212 -19.755  1.00 26.28 ? 47  PRO B C     1 
ATOM   3549  O O     . PRO B 1 47  ? -7.874  -27.356 -20.073  1.00 27.32 ? 47  PRO B O     1 
ATOM   3550  C CB    . PRO B 1 47  ? -5.510  -29.057 -18.571  1.00 26.95 ? 47  PRO B CB    1 
ATOM   3551  C CG    . PRO B 1 47  ? -3.988  -29.135 -18.421  1.00 25.32 ? 47  PRO B CG    1 
ATOM   3552  C CD    . PRO B 1 47  ? -3.533  -27.940 -19.072  1.00 26.03 ? 47  PRO B CD    1 
ATOM   3553  N N     . PHE B 1 48  ? -6.280  -26.074 -19.255  1.00 26.24 ? 48  PHE B N     1 
ATOM   3554  C CA    . PHE B 1 48  ? -7.157  -24.965 -18.959  1.00 25.05 ? 48  PHE B CA    1 
ATOM   3555  C C     . PHE B 1 48  ? -7.511  -24.316 -20.288  1.00 26.02 ? 48  PHE B C     1 
ATOM   3556  O O     . PHE B 1 48  ? -6.642  -24.047 -21.121  1.00 27.58 ? 48  PHE B O     1 
ATOM   3557  C CB    . PHE B 1 48  ? -6.447  -23.995 -18.047  1.00 23.87 ? 48  PHE B CB    1 
ATOM   3558  C CG    . PHE B 1 48  ? -5.721  -24.648 -16.868  1.00 23.22 ? 48  PHE B CG    1 
ATOM   3559  C CD1   . PHE B 1 48  ? -4.321  -24.727 -16.838  1.00 25.39 ? 48  PHE B CD1   1 
ATOM   3560  C CD2   . PHE B 1 48  ? -6.421  -25.174 -15.791  1.00 23.35 ? 48  PHE B CD2   1 
ATOM   3561  C CE1   . PHE B 1 48  ? -3.611  -25.333 -15.721  1.00 22.05 ? 48  PHE B CE1   1 
ATOM   3562  C CE2   . PHE B 1 48  ? -5.728  -25.786 -14.680  1.00 24.20 ? 48  PHE B CE2   1 
ATOM   3563  C CZ    . PHE B 1 48  ? -4.297  -25.841 -14.670  1.00 21.02 ? 48  PHE B CZ    1 
ATOM   3564  N N     . LYS B 1 49  ? -8.780  -24.044 -20.510  1.00 26.78 ? 49  LYS B N     1 
ATOM   3565  C CA    . LYS B 1 49  ? -9.169  -23.541 -21.795  1.00 26.76 ? 49  LYS B CA    1 
ATOM   3566  C C     . LYS B 1 49  ? -9.696  -22.108 -21.717  1.00 27.11 ? 49  LYS B C     1 
ATOM   3567  O O     . LYS B 1 49  ? -9.550  -21.353 -22.712  1.00 25.87 ? 49  LYS B O     1 
ATOM   3568  C CB    . LYS B 1 49  ? -10.143 -24.515 -22.481  1.00 27.49 ? 49  LYS B CB    1 
ATOM   3569  C CG    . LYS B 1 49  ? -9.551  -25.918 -22.772  1.00 27.62 ? 49  LYS B CG    1 
ATOM   3570  C CD    . LYS B 1 49  ? -8.319  -25.872 -23.686  1.00 29.63 ? 49  LYS B CD    1 
ATOM   3571  C CE    . LYS B 1 49  ? -7.521  -27.202 -23.677  1.00 27.55 ? 49  LYS B CE    1 
ATOM   3572  N NZ    . LYS B 1 49  ? -6.581  -27.294 -24.892  1.00 28.38 ? 49  LYS B NZ    1 
ATOM   3573  N N     . THR B 1 50  ? -10.308 -21.741 -20.558  1.00 26.96 ? 50  THR B N     1 
ATOM   3574  C CA    . THR B 1 50  ? -10.910 -20.395 -20.389  1.00 25.74 ? 50  THR B CA    1 
ATOM   3575  C C     . THR B 1 50  ? -10.993 -19.952 -18.972  1.00 25.21 ? 50  THR B C     1 
ATOM   3576  O O     . THR B 1 50  ? -10.980 -20.766 -18.092  1.00 25.21 ? 50  THR B O     1 
ATOM   3577  C CB    . THR B 1 50  ? -12.346 -20.299 -20.958  1.00 26.67 ? 50  THR B CB    1 
ATOM   3578  O OG1   . THR B 1 50  ? -13.293 -20.823 -20.006  1.00 26.75 ? 50  THR B OG1   1 
ATOM   3579  C CG2   . THR B 1 50  ? -12.433 -20.986 -22.313  1.00 22.68 ? 50  THR B CG2   1 
ATOM   3580  N N     . ALA B 1 51  ? -11.078 -18.647 -18.748  1.00 25.36 ? 51  ALA B N     1 
ATOM   3581  C CA    . ALA B 1 51  ? -11.281 -18.120 -17.403  1.00 25.45 ? 51  ALA B CA    1 
ATOM   3582  C C     . ALA B 1 51  ? -12.129 -16.840 -17.340  1.00 26.12 ? 51  ALA B C     1 
ATOM   3583  O O     . ALA B 1 51  ? -12.130 -16.003 -18.255  1.00 25.54 ? 51  ALA B O     1 
ATOM   3584  C CB    . ALA B 1 51  ? -9.953  -17.869 -16.740  1.00 26.03 ? 51  ALA B CB    1 
ATOM   3585  N N     . VAL B 1 52  ? -12.816 -16.697 -16.212  1.00 26.65 ? 52  VAL B N     1 
ATOM   3586  C CA    . VAL B 1 52  ? -13.547 -15.505 -15.880  1.00 27.08 ? 52  VAL B CA    1 
ATOM   3587  C C     . VAL B 1 52  ? -13.170 -15.174 -14.469  1.00 27.27 ? 52  VAL B C     1 
ATOM   3588  O O     . VAL B 1 52  ? -13.214 -16.030 -13.583  1.00 27.38 ? 52  VAL B O     1 
ATOM   3589  C CB    . VAL B 1 52  ? -15.065 -15.786 -15.802  1.00 28.02 ? 52  VAL B CB    1 
ATOM   3590  C CG1   . VAL B 1 52  ? -15.866 -14.480 -15.425  1.00 27.20 ? 52  VAL B CG1   1 
ATOM   3591  C CG2   . VAL B 1 52  ? -15.554 -16.458 -17.063  1.00 28.04 ? 52  VAL B CG2   1 
ATOM   3592  N N     . ILE B 1 53  ? -12.833 -13.917 -14.241  1.00 26.99 ? 53  ILE B N     1 
ATOM   3593  C CA    . ILE B 1 53  ? -12.397 -13.503 -12.935  1.00 25.37 ? 53  ILE B CA    1 
ATOM   3594  C C     . ILE B 1 53  ? -13.145 -12.253 -12.584  1.00 26.37 ? 53  ILE B C     1 
ATOM   3595  O O     . ILE B 1 53  ? -13.055 -11.261 -13.312  1.00 26.64 ? 53  ILE B O     1 
ATOM   3596  C CB    . ILE B 1 53  ? -10.839 -13.266 -12.949  1.00 26.38 ? 53  ILE B CB    1 
ATOM   3597  C CG1   . ILE B 1 53  ? -10.101 -14.523 -13.416  1.00 21.38 ? 53  ILE B CG1   1 
ATOM   3598  C CG2   . ILE B 1 53  ? -10.295 -12.791 -11.559  1.00 21.23 ? 53  ILE B CG2   1 
ATOM   3599  C CD1   . ILE B 1 53  ? -8.644  -14.223 -13.643  1.00 25.42 ? 53  ILE B CD1   1 
ATOM   3600  N N     . THR B 1 54  ? -13.897 -12.293 -11.484  1.00 26.91 ? 54  THR B N     1 
ATOM   3601  C CA    . THR B 1 54  ? -14.703 -11.153 -11.146  1.00 28.20 ? 54  THR B CA    1 
ATOM   3602  C C     . THR B 1 54  ? -13.867 -10.211 -10.350  1.00 29.02 ? 54  THR B C     1 
ATOM   3603  O O     . THR B 1 54  ? -13.046 -10.614 -9.575   1.00 29.37 ? 54  THR B O     1 
ATOM   3604  C CB    . THR B 1 54  ? -16.073 -11.478 -10.455  1.00 27.24 ? 54  THR B CB    1 
ATOM   3605  O OG1   . THR B 1 54  ? -15.869 -12.201 -9.240   1.00 29.46 ? 54  THR B OG1   1 
ATOM   3606  C CG2   . THR B 1 54  ? -16.991 -12.267 -11.362  1.00 27.46 ? 54  THR B CG2   1 
ATOM   3607  N N     . VAL B 1 55  ? -14.130 -8.938  -10.555  1.00 31.85 ? 55  VAL B N     1 
ATOM   3608  C CA    . VAL B 1 55  ? -13.452 -7.839  -9.944   1.00 34.63 ? 55  VAL B CA    1 
ATOM   3609  C C     . VAL B 1 55  ? -14.474 -7.040  -9.179   1.00 37.37 ? 55  VAL B C     1 
ATOM   3610  O O     . VAL B 1 55  ? -15.541 -6.722  -9.730   1.00 38.62 ? 55  VAL B O     1 
ATOM   3611  C CB    . VAL B 1 55  ? -12.919 -6.893  -11.052  1.00 34.49 ? 55  VAL B CB    1 
ATOM   3612  C CG1   . VAL B 1 55  ? -12.056 -5.786  -10.474  1.00 35.21 ? 55  VAL B CG1   1 
ATOM   3613  C CG2   . VAL B 1 55  ? -12.169 -7.651  -12.086  1.00 33.68 ? 55  VAL B CG2   1 
ATOM   3614  N N     . GLU B 1 56  ? -14.176 -6.728  -7.914   1.00 40.10 ? 56  GLU B N     1 
ATOM   3615  C CA    . GLU B 1 56  ? -14.836 -5.636  -7.214   1.00 43.31 ? 56  GLU B CA    1 
ATOM   3616  C C     . GLU B 1 56  ? -14.500 -4.345  -7.976   1.00 44.35 ? 56  GLU B C     1 
ATOM   3617  O O     . GLU B 1 56  ? -13.324 -4.120  -8.339   1.00 44.83 ? 56  GLU B O     1 
ATOM   3618  C CB    . GLU B 1 56  ? -14.302 -5.502  -5.763   1.00 42.45 ? 56  GLU B CB    1 
ATOM   3619  C CG    . GLU B 1 56  ? -15.393 -5.188  -4.715   1.00 45.19 ? 56  GLU B CG    1 
ATOM   3620  C CD    . GLU B 1 56  ? -14.873 -4.944  -3.280   1.00 46.41 ? 56  GLU B CD    1 
ATOM   3621  O OE1   . GLU B 1 56  ? -15.356 -5.644  -2.349   1.00 50.38 ? 56  GLU B OE1   1 
ATOM   3622  O OE2   . GLU B 1 56  ? -14.003 -4.053  -3.069   1.00 50.46 ? 56  GLU B OE2   1 
ATOM   3623  N N     . ASN B 1 57  ? -15.493 -3.480  -8.186   1.00 45.56 ? 57  ASN B N     1 
ATOM   3624  C CA    . ASN B 1 57  ? -15.246 -2.107  -8.730   1.00 46.51 ? 57  ASN B CA    1 
ATOM   3625  C C     . ASN B 1 57  ? -14.726 -2.111  -10.184  1.00 45.61 ? 57  ASN B C     1 
ATOM   3626  O O     . ASN B 1 57  ? -14.015 -1.189  -10.621  1.00 44.65 ? 57  ASN B O     1 
ATOM   3627  C CB    . ASN B 1 57  ? -14.247 -1.306  -7.860   1.00 47.95 ? 57  ASN B CB    1 
ATOM   3628  C CG    . ASN B 1 57  ? -14.759 -0.991  -6.411   1.00 50.86 ? 57  ASN B CG    1 
ATOM   3629  O OD1   . ASN B 1 57  ? -14.649 0.154   -5.960   1.00 55.30 ? 57  ASN B OD1   1 
ATOM   3630  N ND2   . ASN B 1 57  ? -15.231 -2.000  -5.682   1.00 50.85 ? 57  ASN B ND2   1 
ATOM   3631  N N     . GLY B 1 58  ? -15.105 -3.150  -10.923  1.00 44.78 ? 58  GLY B N     1 
ATOM   3632  C CA    . GLY B 1 58  ? -14.519 -3.395  -12.225  1.00 44.00 ? 58  GLY B CA    1 
ATOM   3633  C C     . GLY B 1 58  ? -15.377 -4.314  -13.051  1.00 43.36 ? 58  GLY B C     1 
ATOM   3634  O O     . GLY B 1 58  ? -16.380 -4.881  -12.566  1.00 43.38 ? 58  GLY B O     1 
ATOM   3635  N N     . LYS B 1 59  ? -14.962 -4.432  -14.308  1.00 41.79 ? 59  LYS B N     1 
ATOM   3636  C CA    . LYS B 1 59  ? -15.605 -5.236  -15.313  1.00 40.23 ? 59  LYS B CA    1 
ATOM   3637  C C     . LYS B 1 59  ? -14.924 -6.574  -15.164  1.00 38.55 ? 59  LYS B C     1 
ATOM   3638  O O     . LYS B 1 59  ? -13.715 -6.616  -14.895  1.00 38.20 ? 59  LYS B O     1 
ATOM   3639  C CB    . LYS B 1 59  ? -15.315 -4.628  -16.691  1.00 40.92 ? 59  LYS B CB    1 
ATOM   3640  C CG    . LYS B 1 59  ? -15.580 -5.545  -17.895  1.00 42.15 ? 59  LYS B CG    1 
ATOM   3641  C CD    . LYS B 1 59  ? -14.903 -5.047  -19.193  1.00 41.97 ? 59  LYS B CD    1 
ATOM   3642  C CE    . LYS B 1 59  ? -15.940 -4.581  -20.241  1.00 45.77 ? 59  LYS B CE    1 
ATOM   3643  N NZ    . LYS B 1 59  ? -15.325 -4.164  -21.561  1.00 43.44 ? 59  LYS B NZ    1 
ATOM   3644  N N     . THR B 1 60  ? -15.671 -7.670  -15.319  1.00 36.34 ? 60  THR B N     1 
ATOM   3645  C CA    . THR B 1 60  ? -15.034 -8.981  -15.158  1.00 33.69 ? 60  THR B CA    1 
ATOM   3646  C C     . THR B 1 60  ? -13.945 -9.225  -16.236  1.00 32.41 ? 60  THR B C     1 
ATOM   3647  O O     . THR B 1 60  ? -13.964 -8.621  -17.337  1.00 31.50 ? 60  THR B O     1 
ATOM   3648  C CB    . THR B 1 60  ? -16.051 -10.206 -14.981  1.00 34.04 ? 60  THR B CB    1 
ATOM   3649  O OG1   . THR B 1 60  ? -16.167 -10.965 -16.191  1.00 33.43 ? 60  THR B OG1   1 
ATOM   3650  C CG2   . THR B 1 60  ? -17.386 -9.773  -14.484  1.00 30.62 ? 60  THR B CG2   1 
ATOM   3651  N N     . ILE B 1 61  ? -12.976 -10.064 -15.898  1.00 30.19 ? 61  ILE B N     1 
ATOM   3652  C CA    . ILE B 1 61  ? -11.869 -10.285 -16.791  1.00 28.63 ? 61  ILE B CA    1 
ATOM   3653  C C     . ILE B 1 61  ? -12.127 -11.615 -17.490  1.00 29.13 ? 61  ILE B C     1 
ATOM   3654  O O     . ILE B 1 61  ? -12.436 -12.598 -16.842  1.00 28.58 ? 61  ILE B O     1 
ATOM   3655  C CB    . ILE B 1 61  ? -10.560 -10.292 -15.934  1.00 29.78 ? 61  ILE B CB    1 
ATOM   3656  C CG1   . ILE B 1 61  ? -10.344 -8.901  -15.267  1.00 26.28 ? 61  ILE B CG1   1 
ATOM   3657  C CG2   . ILE B 1 61  ? -9.374  -11.006 -16.664  1.00 24.05 ? 61  ILE B CG2   1 
ATOM   3658  C CD1   . ILE B 1 61  ? -8.919  -8.649  -14.773  1.00 27.13 ? 61  ILE B CD1   1 
ATOM   3659  N N     . GLN B 1 62  ? -12.035 -11.648 -18.811  1.00 29.11 ? 62  GLN B N     1 
ATOM   3660  C CA    . GLN B 1 62  ? -12.287 -12.883 -19.528  1.00 30.13 ? 62  GLN B CA    1 
ATOM   3661  C C     . GLN B 1 62  ? -11.038 -13.315 -20.273  1.00 30.66 ? 62  GLN B C     1 
ATOM   3662  O O     . GLN B 1 62  ? -10.519 -12.515 -21.061  1.00 31.09 ? 62  GLN B O     1 
ATOM   3663  C CB    . GLN B 1 62  ? -13.338 -12.635 -20.581  1.00 29.35 ? 62  GLN B CB    1 
ATOM   3664  C CG    . GLN B 1 62  ? -14.604 -12.055 -20.034  1.00 33.22 ? 62  GLN B CG    1 
ATOM   3665  C CD    . GLN B 1 62  ? -15.613 -13.138 -19.755  1.00 35.05 ? 62  GLN B CD    1 
ATOM   3666  O OE1   . GLN B 1 62  ? -16.304 -13.625 -20.669  1.00 36.26 ? 62  GLN B OE1   1 
ATOM   3667  N NE2   . GLN B 1 62  ? -15.674 -13.559 -18.501  1.00 30.55 ? 62  GLN B NE2   1 
ATOM   3668  N N     . PHE B 1 63  ? -10.572 -14.552 -20.064  1.00 30.29 ? 63  PHE B N     1 
ATOM   3669  C CA    . PHE B 1 63  ? -9.648  -15.183 -21.014  1.00 31.32 ? 63  PHE B CA    1 
ATOM   3670  C C     . PHE B 1 63  ? -10.419 -16.128 -21.923  1.00 31.24 ? 63  PHE B C     1 
ATOM   3671  O O     . PHE B 1 63  ? -10.849 -17.210 -21.500  1.00 29.74 ? 63  PHE B O     1 
ATOM   3672  C CB    . PHE B 1 63  ? -8.519  -15.986 -20.342  1.00 32.62 ? 63  PHE B CB    1 
ATOM   3673  C CG    . PHE B 1 63  ? -7.645  -15.193 -19.438  1.00 35.25 ? 63  PHE B CG    1 
ATOM   3674  C CD1   . PHE B 1 63  ? -6.801  -15.852 -18.539  1.00 39.88 ? 63  PHE B CD1   1 
ATOM   3675  C CD2   . PHE B 1 63  ? -7.651  -13.806 -19.461  1.00 35.31 ? 63  PHE B CD2   1 
ATOM   3676  C CE1   . PHE B 1 63  ? -5.972  -15.128 -17.680  1.00 39.78 ? 63  PHE B CE1   1 
ATOM   3677  C CE2   . PHE B 1 63  ? -6.852  -13.091 -18.608  1.00 36.75 ? 63  PHE B CE2   1 
ATOM   3678  C CZ    . PHE B 1 63  ? -6.009  -13.742 -17.713  1.00 38.05 ? 63  PHE B CZ    1 
ATOM   3679  N N     . GLY B 1 64  ? -10.633 -15.683 -23.157  1.00 32.47 ? 64  GLY B N     1 
ATOM   3680  C CA    . GLY B 1 64  ? -11.205 -16.519 -24.214  1.00 33.61 ? 64  GLY B CA    1 
ATOM   3681  C C     . GLY B 1 64  ? -10.195 -17.581 -24.579  1.00 35.07 ? 64  GLY B C     1 
ATOM   3682  O O     . GLY B 1 64  ? -9.023  -17.542 -24.107  1.00 35.27 ? 64  GLY B O     1 
ATOM   3683  N N     . GLU B 1 65  ? -10.619 -18.531 -25.391  1.00 35.81 ? 65  GLU B N     1 
ATOM   3684  C CA    . GLU B 1 65  ? -9.756  -19.683 -25.649  1.00 37.52 ? 65  GLU B CA    1 
ATOM   3685  C C     . GLU B 1 65  ? -8.401  -19.259 -26.220  1.00 37.41 ? 65  GLU B C     1 
ATOM   3686  O O     . GLU B 1 65  ? -7.348  -19.646 -25.686  1.00 35.73 ? 65  GLU B O     1 
ATOM   3687  C CB    . GLU B 1 65  ? -10.442 -20.780 -26.471  1.00 37.58 ? 65  GLU B CB    1 
ATOM   3688  C CG    . GLU B 1 65  ? -11.601 -20.300 -27.327  1.00 42.79 ? 65  GLU B CG    1 
ATOM   3689  C CD    . GLU B 1 65  ? -12.932 -20.260 -26.542  1.00 49.22 ? 65  GLU B CD    1 
ATOM   3690  O OE1   . GLU B 1 65  ? -13.501 -19.138 -26.359  1.00 48.25 ? 65  GLU B OE1   1 
ATOM   3691  O OE2   . GLU B 1 65  ? -13.393 -21.361 -26.116  1.00 51.69 ? 65  GLU B OE2   1 
ATOM   3692  N N     . GLU B 1 66  ? -8.431  -18.441 -27.270  1.00 37.64 ? 66  GLU B N     1 
ATOM   3693  C CA    . GLU B 1 66  ? -7.185  -17.878 -27.803  1.00 38.75 ? 66  GLU B CA    1 
ATOM   3694  C C     . GLU B 1 66  ? -6.269  -17.162 -26.769  1.00 38.55 ? 66  GLU B C     1 
ATOM   3695  O O     . GLU B 1 66  ? -5.047  -17.312 -26.831  1.00 39.33 ? 66  GLU B O     1 
ATOM   3696  C CB    . GLU B 1 66  ? -7.451  -16.971 -29.011  1.00 38.07 ? 66  GLU B CB    1 
ATOM   3697  C CG    . GLU B 1 66  ? -6.365  -17.011 -30.069  1.00 39.23 ? 66  GLU B CG    1 
ATOM   3698  C CD    . GLU B 1 66  ? -6.001  -18.435 -30.538  1.00 42.69 ? 66  GLU B CD    1 
ATOM   3699  O OE1   . GLU B 1 66  ? -4.790  -18.746 -30.556  1.00 43.33 ? 66  GLU B OE1   1 
ATOM   3700  O OE2   . GLU B 1 66  ? -6.900  -19.243 -30.893  1.00 44.44 ? 66  GLU B OE2   1 
ATOM   3701  N N     . MET B 1 67  ? -6.864  -16.408 -25.844  1.00 37.81 ? 67  MET B N     1 
ATOM   3702  C CA    . MET B 1 67  ? -6.127  -15.562 -24.884  1.00 36.72 ? 67  MET B CA    1 
ATOM   3703  C C     . MET B 1 67  ? -5.494  -16.441 -23.792  1.00 35.74 ? 67  MET B C     1 
ATOM   3704  O O     . MET B 1 67  ? -4.400  -16.169 -23.265  1.00 36.62 ? 67  MET B O     1 
ATOM   3705  C CB    . MET B 1 67  ? -7.115  -14.490 -24.326  1.00 36.98 ? 67  MET B CB    1 
ATOM   3706  C CG    . MET B 1 67  ? -6.694  -13.607 -23.117  1.00 38.70 ? 67  MET B CG    1 
ATOM   3707  S SD    . MET B 1 67  ? -5.338  -12.397 -23.315  1.00 46.70 ? 67  MET B SD    1 
ATOM   3708  C CE    . MET B 1 67  ? -6.144  -11.144 -24.343  1.00 43.18 ? 67  MET B CE    1 
ATOM   3709  N N     . MET B 1 68  ? -6.199  -17.509 -23.469  1.00 33.99 ? 68  MET B N     1 
ATOM   3710  C CA    . MET B 1 68  ? -5.786  -18.466 -22.503  1.00 32.24 ? 68  MET B CA    1 
ATOM   3711  C C     . MET B 1 68  ? -4.573  -19.233 -22.975  1.00 32.25 ? 68  MET B C     1 
ATOM   3712  O O     . MET B 1 68  ? -3.646  -19.461 -22.196  1.00 32.14 ? 68  MET B O     1 
ATOM   3713  C CB    . MET B 1 68  ? -6.927  -19.418 -22.216  1.00 32.79 ? 68  MET B CB    1 
ATOM   3714  C CG    . MET B 1 68  ? -6.571  -20.571 -21.278  1.00 33.74 ? 68  MET B CG    1 
ATOM   3715  S SD    . MET B 1 68  ? -6.270  -19.988 -19.618  1.00 38.05 ? 68  MET B SD    1 
ATOM   3716  C CE    . MET B 1 68  ? -7.858  -20.205 -18.890  1.00 36.34 ? 68  MET B CE    1 
ATOM   3717  N N     . LYS B 1 69  ? -4.549  -19.630 -24.236  1.00 30.58 ? 69  LYS B N     1 
ATOM   3718  C CA    . LYS B 1 69  ? -3.338  -20.232 -24.747  1.00 29.91 ? 69  LYS B CA    1 
ATOM   3719  C C     . LYS B 1 69  ? -2.176  -19.249 -24.569  1.00 29.71 ? 69  LYS B C     1 
ATOM   3720  O O     . LYS B 1 69  ? -1.066  -19.666 -24.241  1.00 29.85 ? 69  LYS B O     1 
ATOM   3721  C CB    . LYS B 1 69  ? -3.466  -20.654 -26.215  1.00 29.28 ? 69  LYS B CB    1 
ATOM   3722  C CG    . LYS B 1 69  ? -4.505  -21.705 -26.438  1.00 28.16 ? 69  LYS B CG    1 
ATOM   3723  C CD    . LYS B 1 69  ? -5.170  -21.482 -27.766  1.00 30.01 ? 69  LYS B CD    1 
ATOM   3724  C CE    . LYS B 1 69  ? -4.532  -22.277 -28.911  1.00 30.97 ? 69  LYS B CE    1 
ATOM   3725  N NZ    . LYS B 1 69  ? -5.538  -22.270 -30.049  1.00 32.07 ? 69  LYS B NZ    1 
ATOM   3726  N N     . ARG B 1 70  ? -2.424  -17.961 -24.786  1.00 28.11 ? 70  ARG B N     1 
ATOM   3727  C CA    . ARG B 1 70  ? -1.348  -17.020 -24.664  1.00 26.58 ? 70  ARG B CA    1 
ATOM   3728  C C     . ARG B 1 70  ? -0.938  -17.005 -23.208  1.00 27.52 ? 70  ARG B C     1 
ATOM   3729  O O     . ARG B 1 70  ? 0.266   -16.842 -22.913  1.00 28.02 ? 70  ARG B O     1 
ATOM   3730  C CB    . ARG B 1 70  ? -1.767  -15.609 -25.095  1.00 25.69 ? 70  ARG B CB    1 
ATOM   3731  C CG    . ARG B 1 70  ? -0.683  -14.590 -24.732  1.00 21.99 ? 70  ARG B CG    1 
ATOM   3732  C CD    . ARG B 1 70  ? -0.920  -13.248 -25.291  1.00 16.91 ? 70  ARG B CD    1 
ATOM   3733  N NE    . ARG B 1 70  ? 0.104   -12.280 -24.937  1.00 17.32 ? 70  ARG B NE    1 
ATOM   3734  C CZ    . ARG B 1 70  ? -0.091  -10.961 -24.787  1.00 19.53 ? 70  ARG B CZ    1 
ATOM   3735  N NH1   . ARG B 1 70  ? -1.317  -10.425 -24.922  1.00 15.96 ? 70  ARG B NH1   1 
ATOM   3736  N NH2   . ARG B 1 70  ? 0.956   -10.161 -24.471  1.00 17.62 ? 70  ARG B NH2   1 
ATOM   3737  N N     . ALA B 1 71  ? -1.927  -17.170 -22.299  1.00 26.09 ? 71  ALA B N     1 
ATOM   3738  C CA    . ALA B 1 71  ? -1.667  -17.062 -20.828  1.00 24.86 ? 71  ALA B CA    1 
ATOM   3739  C C     . ALA B 1 71  ? -0.932  -18.248 -20.273  1.00 24.41 ? 71  ALA B C     1 
ATOM   3740  O O     . ALA B 1 71  ? -0.357  -18.179 -19.170  1.00 24.10 ? 71  ALA B O     1 
ATOM   3741  C CB    . ALA B 1 71  ? -2.976  -16.875 -20.019  1.00 23.19 ? 71  ALA B CB    1 
ATOM   3742  N N     . LEU B 1 72  ? -0.998  -19.349 -21.017  1.00 24.35 ? 72  LEU B N     1 
ATOM   3743  C CA    . LEU B 1 72  ? -0.441  -20.617 -20.569  1.00 24.20 ? 72  LEU B CA    1 
ATOM   3744  C C     . LEU B 1 72  ? 0.986   -20.835 -21.152  1.00 24.67 ? 72  LEU B C     1 
ATOM   3745  O O     . LEU B 1 72  ? 1.676   -21.854 -20.834  1.00 23.60 ? 72  LEU B O     1 
ATOM   3746  C CB    . LEU B 1 72  ? -1.393  -21.752 -20.971  1.00 23.49 ? 72  LEU B CB    1 
ATOM   3747  C CG    . LEU B 1 72  ? -2.664  -21.854 -20.124  1.00 24.26 ? 72  LEU B CG    1 
ATOM   3748  C CD1   . LEU B 1 72  ? -3.544  -22.991 -20.534  1.00 21.62 ? 72  LEU B CD1   1 
ATOM   3749  C CD2   . LEU B 1 72  ? -2.397  -21.876 -18.597  1.00 26.62 ? 72  LEU B CD2   1 
ATOM   3750  N N     . GLN B 1 73  ? 1.384   -19.862 -22.006  1.00 23.66 ? 73  GLN B N     1 
ATOM   3751  C CA    . GLN B 1 73  ? 2.515   -19.974 -22.889  1.00 23.45 ? 73  GLN B CA    1 
ATOM   3752  C C     . GLN B 1 73  ? 3.687   -19.063 -22.395  1.00 23.75 ? 73  GLN B C     1 
ATOM   3753  O O     . GLN B 1 73  ? 3.473   -18.043 -21.668  1.00 24.10 ? 73  GLN B O     1 
ATOM   3754  C CB    . GLN B 1 73  ? 2.070   -19.619 -24.339  1.00 23.03 ? 73  GLN B CB    1 
ATOM   3755  C CG    . GLN B 1 73  ? 3.119   -19.796 -25.533  1.00 22.94 ? 73  GLN B CG    1 
ATOM   3756  C CD    . GLN B 1 73  ? 3.787   -21.188 -25.579  1.00 20.11 ? 73  GLN B CD    1 
ATOM   3757  O OE1   . GLN B 1 73  ? 4.399   -21.616 -24.615  1.00 19.88 ? 73  GLN B OE1   1 
ATOM   3758  N NE2   . GLN B 1 73  ? 3.638   -21.900 -26.687  1.00 22.16 ? 73  GLN B NE2   1 
ATOM   3759  N N     . TYR B 1 74  ? 4.908   -19.426 -22.774  1.00 20.91 ? 74  TYR B N     1 
ATOM   3760  C CA    . TYR B 1 74  ? 6.007   -18.526 -22.590  1.00 20.49 ? 74  TYR B CA    1 
ATOM   3761  C C     . TYR B 1 74  ? 5.654   -17.079 -23.078  1.00 20.64 ? 74  TYR B C     1 
ATOM   3762  O O     . TYR B 1 74  ? 5.043   -16.871 -24.178  1.00 19.31 ? 74  TYR B O     1 
ATOM   3763  C CB    . TYR B 1 74  ? 7.237   -19.056 -23.302  1.00 19.97 ? 74  TYR B CB    1 
ATOM   3764  C CG    . TYR B 1 74  ? 7.863   -20.289 -22.628  1.00 21.12 ? 74  TYR B CG    1 
ATOM   3765  C CD1   . TYR B 1 74  ? 8.387   -20.182 -21.376  1.00 20.84 ? 74  TYR B CD1   1 
ATOM   3766  C CD2   . TYR B 1 74  ? 7.896   -21.535 -23.248  1.00 18.17 ? 74  TYR B CD2   1 
ATOM   3767  C CE1   . TYR B 1 74  ? 8.933   -21.227 -20.736  1.00 21.47 ? 74  TYR B CE1   1 
ATOM   3768  C CE2   . TYR B 1 74  ? 8.511   -22.631 -22.614  1.00 20.10 ? 74  TYR B CE2   1 
ATOM   3769  C CZ    . TYR B 1 74  ? 9.034   -22.432 -21.329  1.00 21.97 ? 74  TYR B CZ    1 
ATOM   3770  O OH    . TYR B 1 74  ? 9.656   -23.405 -20.573  1.00 21.80 ? 74  TYR B OH    1 
ATOM   3771  N N     . SER B 1 75  ? 6.027   -16.094 -22.269  1.00 19.68 ? 75  SER B N     1 
ATOM   3772  C CA    . SER B 1 75  ? 5.988   -14.697 -22.705  1.00 21.06 ? 75  SER B CA    1 
ATOM   3773  C C     . SER B 1 75  ? 7.386   -13.962 -22.516  1.00 22.42 ? 75  SER B C     1 
ATOM   3774  O O     . SER B 1 75  ? 8.335   -14.529 -22.014  1.00 22.05 ? 75  SER B O     1 
ATOM   3775  C CB    . SER B 1 75  ? 4.907   -14.009 -21.922  1.00 19.45 ? 75  SER B CB    1 
ATOM   3776  O OG    . SER B 1 75  ? 5.317   -14.133 -20.613  1.00 14.48 ? 75  SER B OG    1 
ATOM   3777  N N     . PRO B 1 76  ? 7.510   -12.711 -22.970  1.00 23.94 ? 76  PRO B N     1 
ATOM   3778  C CA    . PRO B 1 76  ? 8.854   -12.113 -22.952  1.00 24.82 ? 76  PRO B CA    1 
ATOM   3779  C C     . PRO B 1 76  ? 9.422   -11.970 -21.526  1.00 26.33 ? 76  PRO B C     1 
ATOM   3780  O O     . PRO B 1 76  ? 8.625   -11.810 -20.574  1.00 27.31 ? 76  PRO B O     1 
ATOM   3781  C CB    . PRO B 1 76  ? 8.616   -10.721 -23.568  1.00 25.79 ? 76  PRO B CB    1 
ATOM   3782  C CG    . PRO B 1 76  ? 7.361   -10.824 -24.318  1.00 23.23 ? 76  PRO B CG    1 
ATOM   3783  C CD    . PRO B 1 76  ? 6.518   -11.820 -23.593  1.00 23.01 ? 76  PRO B CD    1 
ATOM   3784  N N     . SER B 1 77  ? 10.766  -11.991 -21.423  1.00 25.53 ? 77  SER B N     1 
ATOM   3785  C CA    . SER B 1 77  ? 11.572  -11.890 -20.194  1.00 26.32 ? 77  SER B CA    1 
ATOM   3786  C C     . SER B 1 77  ? 11.271  -10.715 -19.260  1.00 24.90 ? 77  SER B C     1 
ATOM   3787  O O     . SER B 1 77  ? 11.193  -10.851 -18.029  1.00 22.37 ? 77  SER B O     1 
ATOM   3788  C CB    . SER B 1 77  ? 13.054  -11.735 -20.592  1.00 27.08 ? 77  SER B CB    1 
ATOM   3789  O OG    . SER B 1 77  ? 13.502  -12.895 -21.271  1.00 33.78 ? 77  SER B OG    1 
ATOM   3790  N N     . ALA B 1 78  ? 11.167  -9.542  -19.875  1.00 24.06 ? 78  ALA B N     1 
ATOM   3791  C CA    . ALA B 1 78  ? 10.975  -8.326  -19.119  1.00 23.10 ? 78  ALA B CA    1 
ATOM   3792  C C     . ALA B 1 78  ? 9.539   -8.074  -18.733  1.00 22.11 ? 78  ALA B C     1 
ATOM   3793  O O     . ALA B 1 78  ? 9.299   -7.152  -17.980  1.00 24.11 ? 78  ALA B O     1 
ATOM   3794  C CB    . ALA B 1 78  ? 11.615  -7.106  -19.818  1.00 22.03 ? 78  ALA B CB    1 
ATOM   3795  N N     . GLY B 1 79  ? 8.619   -8.961  -19.126  1.00 21.69 ? 79  GLY B N     1 
ATOM   3796  C CA    . GLY B 1 79  ? 7.165   -8.757  -18.950  1.00 21.22 ? 79  GLY B CA    1 
ATOM   3797  C C     . GLY B 1 79  ? 6.345   -8.572  -20.239  1.00 20.63 ? 79  GLY B C     1 
ATOM   3798  O O     . GLY B 1 79  ? 6.869   -8.246  -21.320  1.00 20.58 ? 79  GLY B O     1 
ATOM   3799  N N     . ILE B 1 80  ? 5.037   -8.744  -20.153  1.00 20.47 ? 80  ILE B N     1 
ATOM   3800  C CA    . ILE B 1 80  ? 4.227   -8.516  -21.382  1.00 18.81 ? 80  ILE B CA    1 
ATOM   3801  C C     . ILE B 1 80  ? 4.179   -7.039  -21.749  1.00 19.29 ? 80  ILE B C     1 
ATOM   3802  O O     . ILE B 1 80  ? 4.236   -6.146  -20.833  1.00 18.68 ? 80  ILE B O     1 
ATOM   3803  C CB    . ILE B 1 80  ? 2.864   -9.194  -21.312  1.00 18.23 ? 80  ILE B CB    1 
ATOM   3804  C CG1   . ILE B 1 80  ? 1.966   -8.498  -20.344  1.00 17.69 ? 80  ILE B CG1   1 
ATOM   3805  C CG2   . ILE B 1 80  ? 3.019   -10.688 -20.939  1.00 16.07 ? 80  ILE B CG2   1 
ATOM   3806  C CD1   . ILE B 1 80  ? 0.547   -8.979  -20.499  1.00 21.89 ? 80  ILE B CD1   1 
ATOM   3807  N N     . PRO B 1 81  ? 4.164   -6.741  -23.069  1.00 20.04 ? 81  PRO B N     1 
ATOM   3808  C CA    . PRO B 1 81  ? 4.350   -5.345  -23.509  1.00 21.05 ? 81  PRO B CA    1 
ATOM   3809  C C     . PRO B 1 81  ? 3.247   -4.385  -23.115  1.00 24.29 ? 81  PRO B C     1 
ATOM   3810  O O     . PRO B 1 81  ? 3.527   -3.179  -22.877  1.00 25.34 ? 81  PRO B O     1 
ATOM   3811  C CB    . PRO B 1 81  ? 4.515   -5.437  -25.047  1.00 22.87 ? 81  PRO B CB    1 
ATOM   3812  C CG    . PRO B 1 81  ? 3.978   -6.829  -25.487  1.00 21.53 ? 81  PRO B CG    1 
ATOM   3813  C CD    . PRO B 1 81  ? 4.124   -7.709  -24.189  1.00 21.27 ? 81  PRO B CD    1 
ATOM   3814  N N     . GLU B 1 82  ? 2.008   -4.888  -23.005  1.00 25.00 ? 82  GLU B N     1 
ATOM   3815  C CA    . GLU B 1 82  ? 0.923   -4.057  -22.497  1.00 26.90 ? 82  GLU B CA    1 
ATOM   3816  C C     . GLU B 1 82  ? 1.083   -3.695  -21.007  1.00 26.84 ? 82  GLU B C     1 
ATOM   3817  O O     . GLU B 1 82  ? 0.721   -2.589  -20.576  1.00 27.53 ? 82  GLU B O     1 
ATOM   3818  C CB    . GLU B 1 82  ? -0.488  -4.628  -22.852  1.00 27.19 ? 82  GLU B CB    1 
ATOM   3819  C CG    . GLU B 1 82  ? -0.704  -6.072  -22.548  1.00 29.43 ? 82  GLU B CG    1 
ATOM   3820  C CD    . GLU B 1 82  ? -0.377  -7.022  -23.679  1.00 30.99 ? 82  GLU B CD    1 
ATOM   3821  O OE1   . GLU B 1 82  ? 0.826   -7.340  -23.894  1.00 30.85 ? 82  GLU B OE1   1 
ATOM   3822  O OE2   . GLU B 1 82  ? -1.352  -7.498  -24.333  1.00 34.38 ? 82  GLU B OE2   1 
ATOM   3823  N N     . LEU B 1 83  ? 1.656   -4.595  -20.226  1.00 26.09 ? 83  LEU B N     1 
ATOM   3824  C CA    . LEU B 1 83  ? 1.899   -4.263  -18.824  1.00 26.68 ? 83  LEU B CA    1 
ATOM   3825  C C     . LEU B 1 83  ? 3.190   -3.432  -18.742  1.00 26.98 ? 83  LEU B C     1 
ATOM   3826  O O     . LEU B 1 83  ? 3.324   -2.508  -17.911  1.00 28.40 ? 83  LEU B O     1 
ATOM   3827  C CB    . LEU B 1 83  ? 1.959   -5.545  -17.934  1.00 25.66 ? 83  LEU B CB    1 
ATOM   3828  C CG    . LEU B 1 83  ? 2.031   -5.278  -16.429  1.00 26.92 ? 83  LEU B CG    1 
ATOM   3829  C CD1   . LEU B 1 83  ? 0.702   -4.807  -15.879  1.00 28.69 ? 83  LEU B CD1   1 
ATOM   3830  C CD2   . LEU B 1 83  ? 2.556   -6.466  -15.637  1.00 27.43 ? 83  LEU B CD2   1 
ATOM   3831  N N     . LEU B 1 84  ? 4.145   -3.749  -19.610  1.00 26.51 ? 84  LEU B N     1 
ATOM   3832  C CA    . LEU B 1 84  ? 5.362   -2.978  -19.620  1.00 26.47 ? 84  LEU B CA    1 
ATOM   3833  C C     . LEU B 1 84  ? 5.094   -1.527  -20.002  1.00 25.87 ? 84  LEU B C     1 
ATOM   3834  O O     . LEU B 1 84  ? 5.598   -0.613  -19.342  1.00 25.33 ? 84  LEU B O     1 
ATOM   3835  C CB    . LEU B 1 84  ? 6.382   -3.557  -20.595  1.00 26.21 ? 84  LEU B CB    1 
ATOM   3836  C CG    . LEU B 1 84  ? 7.430   -4.477  -20.070  1.00 25.87 ? 84  LEU B CG    1 
ATOM   3837  C CD1   . LEU B 1 84  ? 8.253   -4.966  -21.218  1.00 26.84 ? 84  LEU B CD1   1 
ATOM   3838  C CD2   . LEU B 1 84  ? 8.283   -3.664  -19.134  1.00 30.84 ? 84  LEU B CD2   1 
ATOM   3839  N N     . SER B 1 85  ? 4.352   -1.319  -21.081  1.00 25.01 ? 85  SER B N     1 
ATOM   3840  C CA    . SER B 1 85  ? 4.095   0.050   -21.525  1.00 25.98 ? 85  SER B CA    1 
ATOM   3841  C C     . SER B 1 85  ? 3.312   0.805   -20.451  1.00 25.95 ? 85  SER B C     1 
ATOM   3842  O O     . SER B 1 85  ? 3.640   1.922   -20.149  1.00 25.30 ? 85  SER B O     1 
ATOM   3843  C CB    . SER B 1 85  ? 3.343   0.078   -22.867  1.00 26.61 ? 85  SER B CB    1 
ATOM   3844  O OG    . SER B 1 85  ? 1.956   -0.285  -22.734  1.00 29.33 ? 85  SER B OG    1 
ATOM   3845  N N     . TRP B 1 86  ? 2.284   0.159   -19.883  1.00 26.44 ? 86  TRP B N     1 
ATOM   3846  C CA    . TRP B 1 86  ? 1.419   0.753   -18.829  1.00 26.35 ? 86  TRP B CA    1 
ATOM   3847  C C     . TRP B 1 86  ? 2.173   1.093   -17.560  1.00 24.91 ? 86  TRP B C     1 
ATOM   3848  O O     . TRP B 1 86  ? 1.935   2.170   -17.000  1.00 24.54 ? 86  TRP B O     1 
ATOM   3849  C CB    . TRP B 1 86  ? 0.207   -0.147  -18.494  1.00 26.69 ? 86  TRP B CB    1 
ATOM   3850  C CG    . TRP B 1 86  ? -1.032  0.508   -17.908  1.00 28.39 ? 86  TRP B CG    1 
ATOM   3851  C CD1   . TRP B 1 86  ? -2.193  0.760   -18.564  1.00 31.58 ? 86  TRP B CD1   1 
ATOM   3852  C CD2   . TRP B 1 86  ? -1.272  0.882   -16.524  1.00 29.52 ? 86  TRP B CD2   1 
ATOM   3853  N NE1   . TRP B 1 86  ? -3.139  1.283   -17.695  1.00 32.05 ? 86  TRP B NE1   1 
ATOM   3854  C CE2   . TRP B 1 86  ? -2.600  1.358   -16.443  1.00 30.10 ? 86  TRP B CE2   1 
ATOM   3855  C CE3   . TRP B 1 86  ? -0.490  0.866   -15.365  1.00 29.65 ? 86  TRP B CE3   1 
ATOM   3856  C CZ2   . TRP B 1 86  ? -3.161  1.841   -15.253  1.00 30.93 ? 86  TRP B CZ2   1 
ATOM   3857  C CZ3   . TRP B 1 86  ? -1.035  1.328   -14.179  1.00 31.64 ? 86  TRP B CZ3   1 
ATOM   3858  C CH2   . TRP B 1 86  ? -2.367  1.815   -14.125  1.00 31.19 ? 86  TRP B CH2   1 
ATOM   3859  N N     . LEU B 1 87  ? 3.066   0.218   -17.108  1.00 23.19 ? 87  LEU B N     1 
ATOM   3860  C CA    . LEU B 1 87  ? 3.896   0.610   -15.926  1.00 23.98 ? 87  LEU B CA    1 
ATOM   3861  C C     . LEU B 1 87  ? 4.901   1.753   -16.210  1.00 23.53 ? 87  LEU B C     1 
ATOM   3862  O O     . LEU B 1 87  ? 5.017   2.699   -15.407  1.00 22.92 ? 87  LEU B O     1 
ATOM   3863  C CB    . LEU B 1 87  ? 4.592   -0.584  -15.269  1.00 23.02 ? 87  LEU B CB    1 
ATOM   3864  C CG    . LEU B 1 87  ? 3.733   -1.821  -14.925  1.00 22.90 ? 87  LEU B CG    1 
ATOM   3865  C CD1   . LEU B 1 87  ? 4.614   -3.048  -14.609  1.00 23.64 ? 87  LEU B CD1   1 
ATOM   3866  C CD2   . LEU B 1 87  ? 2.746   -1.510  -13.777  1.00 18.63 ? 87  LEU B CD2   1 
ATOM   3867  N N     . LYS B 1 88  ? 5.590   1.672   -17.358  1.00 23.83 ? 88  LYS B N     1 
ATOM   3868  C CA    . LYS B 1 88  ? 6.498   2.744   -17.824  1.00 23.62 ? 88  LYS B CA    1 
ATOM   3869  C C     . LYS B 1 88  ? 5.736   4.061   -17.821  1.00 24.43 ? 88  LYS B C     1 
ATOM   3870  O O     . LYS B 1 88  ? 6.219   5.059   -17.242  1.00 25.37 ? 88  LYS B O     1 
ATOM   3871  C CB    . LYS B 1 88  ? 7.076   2.448   -19.225  1.00 22.89 ? 88  LYS B CB    1 
ATOM   3872  C CG    . LYS B 1 88  ? 8.121   1.332   -19.226  1.00 24.71 ? 88  LYS B CG    1 
ATOM   3873  C CD    . LYS B 1 88  ? 8.998   1.424   -20.411  1.00 20.50 ? 88  LYS B CD    1 
ATOM   3874  C CE    . LYS B 1 88  ? 9.708   0.111   -20.713  1.00 22.12 ? 88  LYS B CE    1 
ATOM   3875  N NZ    . LYS B 1 88  ? 10.567  0.313   -21.964  1.00 23.78 ? 88  LYS B NZ    1 
ATOM   3876  N N     . GLN B 1 89  ? 4.555   4.054   -18.444  1.00 22.38 ? 89  GLN B N     1 
ATOM   3877  C CA    . GLN B 1 89  ? 3.668   5.173   -18.485  1.00 24.70 ? 89  GLN B CA    1 
ATOM   3878  C C     . GLN B 1 89  ? 3.139   5.648   -17.096  1.00 24.64 ? 89  GLN B C     1 
ATOM   3879  O O     . GLN B 1 89  ? 3.025   6.855   -16.837  1.00 23.76 ? 89  GLN B O     1 
ATOM   3880  C CB    . GLN B 1 89  ? 2.498   4.870   -19.426  1.00 25.28 ? 89  GLN B CB    1 
ATOM   3881  C CG    . GLN B 1 89  ? 2.010   6.075   -20.152  1.00 28.01 ? 89  GLN B CG    1 
ATOM   3882  C CD    . GLN B 1 89  ? 2.793   6.362   -21.472  1.00 30.66 ? 89  GLN B CD    1 
ATOM   3883  O OE1   . GLN B 1 89  ? 3.489   7.382   -21.568  1.00 31.58 ? 89  GLN B OE1   1 
ATOM   3884  N NE2   . GLN B 1 89  ? 2.609   5.508   -22.504  1.00 25.30 ? 89  GLN B NE2   1 
ATOM   3885  N N     . LEU B 1 90  ? 2.798   4.703   -16.216  1.00 26.00 ? 90  LEU B N     1 
ATOM   3886  C CA    . LEU B 1 90  ? 2.650   5.034   -14.807  1.00 26.15 ? 90  LEU B CA    1 
ATOM   3887  C C     . LEU B 1 90  ? 3.880   5.748   -14.273  1.00 26.68 ? 90  LEU B C     1 
ATOM   3888  O O     . LEU B 1 90  ? 3.744   6.726   -13.561  1.00 25.49 ? 90  LEU B O     1 
ATOM   3889  C CB    . LEU B 1 90  ? 2.324   3.814   -13.943  1.00 26.94 ? 90  LEU B CB    1 
ATOM   3890  C CG    . LEU B 1 90  ? 2.061   3.946   -12.414  1.00 25.85 ? 90  LEU B CG    1 
ATOM   3891  C CD1   . LEU B 1 90  ? 0.668   4.382   -12.098  1.00 24.47 ? 90  LEU B CD1   1 
ATOM   3892  C CD2   . LEU B 1 90  ? 2.289   2.677   -11.708  1.00 25.52 ? 90  LEU B CD2   1 
ATOM   3893  N N     . GLN B 1 91  ? 5.080   5.265   -14.597  1.00 28.13 ? 91  GLN B N     1 
ATOM   3894  C CA    . GLN B 1 91  ? 6.265   5.830   -13.969  1.00 28.71 ? 91  GLN B CA    1 
ATOM   3895  C C     . GLN B 1 91  ? 6.541   7.209   -14.532  1.00 29.31 ? 91  GLN B C     1 
ATOM   3896  O O     . GLN B 1 91  ? 6.855   8.112   -13.791  1.00 28.02 ? 91  GLN B O     1 
ATOM   3897  C CB    . GLN B 1 91  ? 7.482   4.891   -14.070  1.00 29.94 ? 91  GLN B CB    1 
ATOM   3898  C CG    . GLN B 1 91  ? 7.349   3.523   -13.392  1.00 28.26 ? 91  GLN B CG    1 
ATOM   3899  C CD    . GLN B 1 91  ? 7.402   3.583   -11.866  1.00 28.34 ? 91  GLN B CD    1 
ATOM   3900  O OE1   . GLN B 1 91  ? 6.434   4.008   -11.210  1.00 26.31 ? 91  GLN B OE1   1 
ATOM   3901  N NE2   . GLN B 1 91  ? 8.519   3.095   -11.285  1.00 23.33 ? 91  GLN B NE2   1 
ATOM   3902  N N     . ILE B 1 92  ? 6.399   7.387   -15.846  1.00 32.01 ? 92  ILE B N     1 
ATOM   3903  C CA    . ILE B 1 92  ? 6.361   8.761   -16.407  1.00 33.83 ? 92  ILE B CA    1 
ATOM   3904  C C     . ILE B 1 92  ? 5.272   9.687   -15.764  1.00 35.64 ? 92  ILE B C     1 
ATOM   3905  O O     . ILE B 1 92  ? 5.556   10.864  -15.514  1.00 37.11 ? 92  ILE B O     1 
ATOM   3906  C CB    . ILE B 1 92  ? 6.347   8.785   -17.946  1.00 34.27 ? 92  ILE B CB    1 
ATOM   3907  C CG1   . ILE B 1 92  ? 7.762   8.509   -18.497  1.00 32.69 ? 92  ILE B CG1   1 
ATOM   3908  C CG2   . ILE B 1 92  ? 5.968   10.164  -18.496  1.00 34.36 ? 92  ILE B CG2   1 
ATOM   3909  C CD1   . ILE B 1 92  ? 7.714   8.093   -19.951  1.00 33.36 ? 92  ILE B CD1   1 
ATOM   3910  N N     . LYS B 1 93  ? 4.087   9.186   -15.453  1.00 35.62 ? 93  LYS B N     1 
ATOM   3911  C CA    . LYS B 1 93  ? 3.082   10.050  -14.860  1.00 36.86 ? 93  LYS B CA    1 
ATOM   3912  C C     . LYS B 1 93  ? 3.251   10.391  -13.382  1.00 37.38 ? 93  LYS B C     1 
ATOM   3913  O O     . LYS B 1 93  ? 2.776   11.416  -12.931  1.00 39.15 ? 93  LYS B O     1 
ATOM   3914  C CB    . LYS B 1 93  ? 1.673   9.548   -15.136  1.00 37.88 ? 93  LYS B CB    1 
ATOM   3915  C CG    . LYS B 1 93  ? 1.144   9.890   -16.506  1.00 37.26 ? 93  LYS B CG    1 
ATOM   3916  C CD    . LYS B 1 93  ? 0.692   11.327  -16.594  1.00 40.07 ? 93  LYS B CD    1 
ATOM   3917  C CE    . LYS B 1 93  ? -0.132  11.557  -17.834  1.00 42.68 ? 93  LYS B CE    1 
ATOM   3918  N NZ    . LYS B 1 93  ? -1.581  11.337  -17.591  1.00 44.49 ? 93  LYS B NZ    1 
ATOM   3919  N N     . LEU B 1 94  ? 3.913   9.529   -12.630  1.00 36.80 ? 94  LEU B N     1 
ATOM   3920  C CA    . LEU B 1 94  ? 3.968   9.650   -11.187  1.00 36.07 ? 94  LEU B CA    1 
ATOM   3921  C C     . LEU B 1 94  ? 5.199   10.420  -10.813  1.00 35.70 ? 94  LEU B C     1 
ATOM   3922  O O     . LEU B 1 94  ? 5.221   11.117  -9.819   1.00 34.96 ? 94  LEU B O     1 
ATOM   3923  C CB    . LEU B 1 94  ? 4.065   8.276   -10.550  1.00 36.94 ? 94  LEU B CB    1 
ATOM   3924  C CG    . LEU B 1 94  ? 2.809   7.684   -9.940   1.00 38.51 ? 94  LEU B CG    1 
ATOM   3925  C CD1   . LEU B 1 94  ? 1.617   8.164   -10.688  1.00 38.79 ? 94  LEU B CD1   1 
ATOM   3926  C CD2   . LEU B 1 94  ? 2.895   6.193   -9.977   1.00 37.71 ? 94  LEU B CD2   1 
ATOM   3927  N N     . HIS B 1 95  ? 6.241   10.289  -11.627  1.00 34.18 ? 95  HIS B N     1 
ATOM   3928  C CA    . HIS B 1 95  ? 7.599   10.589  -11.189  1.00 34.21 ? 95  HIS B CA    1 
ATOM   3929  C C     . HIS B 1 95  ? 8.342   11.425  -12.226  1.00 35.28 ? 95  HIS B C     1 
ATOM   3930  O O     . HIS B 1 95  ? 9.312   12.112  -11.904  1.00 36.54 ? 95  HIS B O     1 
ATOM   3931  C CB    . HIS B 1 95  ? 8.368   9.297   -10.906  1.00 32.25 ? 95  HIS B CB    1 
ATOM   3932  C CG    . HIS B 1 95  ? 7.724   8.423   -9.874   1.00 30.08 ? 95  HIS B CG    1 
ATOM   3933  N ND1   . HIS B 1 95  ? 7.258   8.911   -8.672   1.00 29.64 ? 95  HIS B ND1   1 
ATOM   3934  C CD2   . HIS B 1 95  ? 7.468   7.094   -9.865   1.00 24.63 ? 95  HIS B CD2   1 
ATOM   3935  C CE1   . HIS B 1 95  ? 6.744   7.920   -7.967   1.00 25.20 ? 95  HIS B CE1   1 
ATOM   3936  N NE2   . HIS B 1 95  ? 6.859   6.806   -8.668   1.00 21.27 ? 95  HIS B NE2   1 
ATOM   3937  N N     . ASN B 1 96  ? 7.879   11.362  -13.470  1.00 36.35 ? 96  ASN B N     1 
ATOM   3938  C CA    . ASN B 1 96  ? 8.566   12.019  -14.576  1.00 36.34 ? 96  ASN B CA    1 
ATOM   3939  C C     . ASN B 1 96  ? 10.076  12.067  -14.371  1.00 36.89 ? 96  ASN B C     1 
ATOM   3940  O O     . ASN B 1 96  ? 10.646  13.131  -14.134  1.00 36.24 ? 96  ASN B O     1 
ATOM   3941  C CB    . ASN B 1 96  ? 8.017   13.432  -14.782  1.00 36.59 ? 96  ASN B CB    1 
ATOM   3942  C CG    . ASN B 1 96  ? 8.729   14.177  -15.896  1.00 35.16 ? 96  ASN B CG    1 
ATOM   3943  O OD1   . ASN B 1 96  ? 8.935   13.640  -16.984  1.00 36.45 ? 96  ASN B OD1   1 
ATOM   3944  N ND2   . ASN B 1 96  ? 9.109   15.421  -15.628  1.00 30.68 ? 96  ASN B ND2   1 
ATOM   3945  N N     . PRO B 1 97  ? 10.717  10.906  -14.465  1.00 38.48 ? 97  PRO B N     1 
ATOM   3946  C CA    . PRO B 1 97  ? 12.152  10.794  -14.183  1.00 38.85 ? 97  PRO B CA    1 
ATOM   3947  C C     . PRO B 1 97  ? 12.984  11.636  -15.144  1.00 39.53 ? 97  PRO B C     1 
ATOM   3948  O O     . PRO B 1 97  ? 12.793  11.557  -16.358  1.00 38.83 ? 97  PRO B O     1 
ATOM   3949  C CB    . PRO B 1 97  ? 12.433  9.307   -14.409  1.00 38.86 ? 97  PRO B CB    1 
ATOM   3950  C CG    . PRO B 1 97  ? 11.138  8.638   -14.114  1.00 37.77 ? 97  PRO B CG    1 
ATOM   3951  C CD    . PRO B 1 97  ? 10.069  9.588   -14.573  1.00 38.11 ? 97  PRO B CD    1 
ATOM   3952  N N     . PRO B 1 98  ? 13.898  12.433  -14.600  1.00 40.57 ? 98  PRO B N     1 
ATOM   3953  C CA    . PRO B 1 98  ? 14.738  13.313  -15.418  1.00 40.71 ? 98  PRO B CA    1 
ATOM   3954  C C     . PRO B 1 98  ? 15.395  12.560  -16.570  1.00 40.70 ? 98  PRO B C     1 
ATOM   3955  O O     . PRO B 1 98  ? 15.801  13.174  -17.557  1.00 40.75 ? 98  PRO B O     1 
ATOM   3956  C CB    . PRO B 1 98  ? 15.803  13.792  -14.429  1.00 40.88 ? 98  PRO B CB    1 
ATOM   3957  C CG    . PRO B 1 98  ? 15.128  13.733  -13.104  1.00 41.26 ? 98  PRO B CG    1 
ATOM   3958  C CD    . PRO B 1 98  ? 14.207  12.548  -13.164  1.00 40.73 ? 98  PRO B CD    1 
ATOM   3959  N N     . THR B 1 99  ? 15.495  11.241  -16.440  1.00 40.96 ? 99  THR B N     1 
ATOM   3960  C CA    . THR B 1 99  ? 16.283  10.436  -17.368  1.00 41.43 ? 99  THR B CA    1 
ATOM   3961  C C     . THR B 1 99  ? 15.543  9.766   -18.517  1.00 41.10 ? 99  THR B C     1 
ATOM   3962  O O     . THR B 1 99  ? 16.194  9.076   -19.291  1.00 41.29 ? 99  THR B O     1 
ATOM   3963  C CB    . THR B 1 99  ? 16.856  9.213   -16.671  1.00 41.73 ? 99  THR B CB    1 
ATOM   3964  O OG1   . THR B 1 99  ? 15.781  8.575   -15.995  1.00 41.41 ? 99  THR B OG1   1 
ATOM   3965  C CG2   . THR B 1 99  ? 18.033  9.531   -15.718  1.00 40.53 ? 99  THR B CG2   1 
ATOM   3966  N N     . ILE B 1 100 ? 14.227  9.899   -18.628  1.00 40.48 ? 100 ILE B N     1 
ATOM   3967  C CA    . ILE B 1 100 ? 13.493  9.074   -19.615  1.00 41.08 ? 100 ILE B CA    1 
ATOM   3968  C C     . ILE B 1 100 ? 13.946  9.219   -21.085  1.00 39.87 ? 100 ILE B C     1 
ATOM   3969  O O     . ILE B 1 100 ? 13.875  8.257   -21.866  1.00 40.16 ? 100 ILE B O     1 
ATOM   3970  C CB    . ILE B 1 100 ? 11.924  9.206   -19.496  1.00 41.81 ? 100 ILE B CB    1 
ATOM   3971  C CG1   . ILE B 1 100 ? 11.470  10.661  -19.686  1.00 42.88 ? 100 ILE B CG1   1 
ATOM   3972  C CG2   . ILE B 1 100 ? 11.450  8.673   -18.140  1.00 42.01 ? 100 ILE B CG2   1 
ATOM   3973  C CD1   . ILE B 1 100 ? 10.003  10.829  -20.144  1.00 43.22 ? 100 ILE B CD1   1 
ATOM   3974  N N     . HIS B 1 101 ? 14.443  10.393  -21.461  1.00 38.83 ? 101 HIS B N     1 
ATOM   3975  C CA    . HIS B 1 101 ? 14.834  10.610  -22.849  1.00 37.56 ? 101 HIS B CA    1 
ATOM   3976  C C     . HIS B 1 101 ? 16.311  10.606  -23.060  1.00 37.76 ? 101 HIS B C     1 
ATOM   3977  O O     . HIS B 1 101 ? 16.737  10.931  -24.152  1.00 36.85 ? 101 HIS B O     1 
ATOM   3978  C CB    . HIS B 1 101 ? 14.224  11.881  -23.445  1.00 36.66 ? 101 HIS B CB    1 
ATOM   3979  C CG    . HIS B 1 101 ? 12.749  11.813  -23.577  1.00 34.86 ? 101 HIS B CG    1 
ATOM   3980  N ND1   . HIS B 1 101 ? 11.926  12.865  -23.243  1.00 36.23 ? 101 HIS B ND1   1 
ATOM   3981  C CD2   . HIS B 1 101 ? 11.938  10.791  -23.944  1.00 34.27 ? 101 HIS B CD2   1 
ATOM   3982  C CE1   . HIS B 1 101 ? 10.668  12.501  -23.419  1.00 35.08 ? 101 HIS B CE1   1 
ATOM   3983  N NE2   . HIS B 1 101 ? 10.650  11.252  -23.860  1.00 35.61 ? 101 HIS B NE2   1 
ATOM   3984  N N     . TYR B 1 102 ? 17.088  10.268  -22.017  1.00 38.15 ? 102 TYR B N     1 
ATOM   3985  C CA    . TYR B 1 102 ? 18.538  10.091  -22.135  1.00 37.64 ? 102 TYR B CA    1 
ATOM   3986  C C     . TYR B 1 102 ? 18.908  8.912   -23.036  1.00 38.87 ? 102 TYR B C     1 
ATOM   3987  O O     . TYR B 1 102 ? 18.163  7.943   -23.138  1.00 38.96 ? 102 TYR B O     1 
ATOM   3988  C CB    . TYR B 1 102 ? 19.142  9.752   -20.779  1.00 37.95 ? 102 TYR B CB    1 
ATOM   3989  C CG    . TYR B 1 102 ? 19.204  10.819  -19.707  1.00 37.26 ? 102 TYR B CG    1 
ATOM   3990  C CD1   . TYR B 1 102 ? 19.882  10.563  -18.519  1.00 37.43 ? 102 TYR B CD1   1 
ATOM   3991  C CD2   . TYR B 1 102 ? 18.629  12.079  -19.881  1.00 36.61 ? 102 TYR B CD2   1 
ATOM   3992  C CE1   . TYR B 1 102 ? 19.944  11.524  -17.492  1.00 38.53 ? 102 TYR B CE1   1 
ATOM   3993  C CE2   . TYR B 1 102 ? 18.683  13.046  -18.873  1.00 37.28 ? 102 TYR B CE2   1 
ATOM   3994  C CZ    . TYR B 1 102 ? 19.342  12.760  -17.677  1.00 36.65 ? 102 TYR B CZ    1 
ATOM   3995  O OH    . TYR B 1 102 ? 19.385  13.705  -16.681  1.00 36.60 ? 102 TYR B OH    1 
ATOM   3996  N N     . PRO B 1 103 ? 20.097  8.961   -23.670  1.00 39.17 ? 103 PRO B N     1 
ATOM   3997  C CA    . PRO B 1 103 ? 20.774  7.811   -24.242  1.00 39.00 ? 103 PRO B CA    1 
ATOM   3998  C C     . PRO B 1 103 ? 20.770  6.493   -23.414  1.00 38.74 ? 103 PRO B C     1 
ATOM   3999  O O     . PRO B 1 103 ? 21.086  6.488   -22.216  1.00 37.49 ? 103 PRO B O     1 
ATOM   4000  C CB    . PRO B 1 103 ? 22.212  8.322   -24.384  1.00 39.36 ? 103 PRO B CB    1 
ATOM   4001  C CG    . PRO B 1 103 ? 22.028  9.740   -24.703  1.00 39.58 ? 103 PRO B CG    1 
ATOM   4002  C CD    . PRO B 1 103 ? 20.836  10.196  -23.947  1.00 39.48 ? 103 PRO B CD    1 
ATOM   4003  N N     . PRO B 1 104 ? 20.479  5.364   -24.077  1.00 38.53 ? 104 PRO B N     1 
ATOM   4004  C CA    . PRO B 1 104 ? 20.511  4.044   -23.417  1.00 38.68 ? 104 PRO B CA    1 
ATOM   4005  C C     . PRO B 1 104 ? 21.733  3.767   -22.509  1.00 38.91 ? 104 PRO B C     1 
ATOM   4006  O O     . PRO B 1 104 ? 21.581  3.205   -21.389  1.00 38.62 ? 104 PRO B O     1 
ATOM   4007  C CB    . PRO B 1 104 ? 20.496  3.066   -24.606  1.00 38.38 ? 104 PRO B CB    1 
ATOM   4008  C CG    . PRO B 1 104 ? 19.751  3.824   -25.658  1.00 38.66 ? 104 PRO B CG    1 
ATOM   4009  C CD    . PRO B 1 104 ? 20.105  5.267   -25.501  1.00 37.39 ? 104 PRO B CD    1 
ATOM   4010  N N     . SER B 1 105 ? 22.920  4.124   -22.987  1.00 38.74 ? 105 SER B N     1 
ATOM   4011  C CA    . SER B 1 105 ? 24.176  3.808   -22.288  1.00 38.28 ? 105 SER B CA    1 
ATOM   4012  C C     . SER B 1 105 ? 24.534  4.819   -21.193  1.00 37.78 ? 105 SER B C     1 
ATOM   4013  O O     . SER B 1 105 ? 25.377  4.531   -20.306  1.00 38.71 ? 105 SER B O     1 
ATOM   4014  C CB    . SER B 1 105 ? 25.288  3.791   -23.292  1.00 38.11 ? 105 SER B CB    1 
ATOM   4015  O OG    . SER B 1 105 ? 25.270  5.047   -23.913  1.00 39.78 ? 105 SER B OG    1 
ATOM   4016  N N     . GLN B 1 106 ? 23.986  6.024   -21.318  1.00 36.15 ? 106 GLN B N     1 
ATOM   4017  C CA    . GLN B 1 106 ? 23.787  6.905   -20.188  1.00 35.99 ? 106 GLN B CA    1 
ATOM   4018  C C     . GLN B 1 106 ? 22.605  6.286   -19.483  1.00 35.57 ? 106 GLN B C     1 
ATOM   4019  O O     . GLN B 1 106 ? 22.227  5.199   -19.843  1.00 37.88 ? 106 GLN B O     1 
ATOM   4020  C CB    . GLN B 1 106 ? 23.496  8.305   -20.677  1.00 35.99 ? 106 GLN B CB    1 
ATOM   4021  C CG    . GLN B 1 106 ? 24.696  8.979   -21.402  1.00 38.02 ? 106 GLN B CG    1 
ATOM   4022  C CD    . GLN B 1 106 ? 24.462  10.464  -21.623  1.00 41.97 ? 106 GLN B CD    1 
ATOM   4023  O OE1   . GLN B 1 106 ? 24.495  10.944  -22.752  1.00 44.69 ? 106 GLN B OE1   1 
ATOM   4024  N NE2   . GLN B 1 106 ? 24.143  11.193  -20.534  1.00 47.42 ? 106 GLN B NE2   1 
ATOM   4025  N N     . GLY B 1 107 ? 21.979  6.880   -18.495  1.00 34.23 ? 107 GLY B N     1 
ATOM   4026  C CA    . GLY B 1 107 ? 20.949  6.057   -17.852  1.00 33.34 ? 107 GLY B CA    1 
ATOM   4027  C C     . GLY B 1 107 ? 19.519  6.053   -18.396  1.00 33.00 ? 107 GLY B C     1 
ATOM   4028  O O     . GLY B 1 107 ? 18.589  6.345   -17.655  1.00 32.52 ? 107 GLY B O     1 
ATOM   4029  N N     . GLN B 1 108 ? 19.278  5.726   -19.658  1.00 32.26 ? 108 GLN B N     1 
ATOM   4030  C CA    . GLN B 1 108 ? 17.876  5.775   -20.049  1.00 31.97 ? 108 GLN B CA    1 
ATOM   4031  C C     . GLN B 1 108 ? 17.008  4.907   -19.123  1.00 31.48 ? 108 GLN B C     1 
ATOM   4032  O O     . GLN B 1 108 ? 17.401  3.777   -18.746  1.00 30.00 ? 108 GLN B O     1 
ATOM   4033  C CB    . GLN B 1 108 ? 17.619  5.419   -21.500  1.00 31.87 ? 108 GLN B CB    1 
ATOM   4034  C CG    . GLN B 1 108 ? 16.241  5.964   -21.908  1.00 32.14 ? 108 GLN B CG    1 
ATOM   4035  C CD    . GLN B 1 108 ? 15.847  5.717   -23.386  1.00 32.87 ? 108 GLN B CD    1 
ATOM   4036  O OE1   . GLN B 1 108 ? 14.726  6.082   -23.817  1.00 38.78 ? 108 GLN B OE1   1 
ATOM   4037  N NE2   . GLN B 1 108 ? 16.738  5.114   -24.152  1.00 27.71 ? 108 GLN B NE2   1 
ATOM   4038  N N     . MET B 1 109 ? 15.850  5.452   -18.761  1.00 30.50 ? 109 MET B N     1 
ATOM   4039  C CA    . MET B 1 109 ? 14.991  4.836   -17.775  1.00 31.07 ? 109 MET B CA    1 
ATOM   4040  C C     . MET B 1 109 ? 14.497  3.610   -18.461  1.00 30.26 ? 109 MET B C     1 
ATOM   4041  O O     . MET B 1 109 ? 14.063  3.680   -19.607  1.00 29.39 ? 109 MET B O     1 
ATOM   4042  C CB    . MET B 1 109 ? 13.784  5.719   -17.388  1.00 30.89 ? 109 MET B CB    1 
ATOM   4043  C CG    . MET B 1 109 ? 12.839  5.122   -16.306  1.00 31.02 ? 109 MET B CG    1 
ATOM   4044  S SD    . MET B 1 109 ? 11.045  5.592   -16.261  1.00 35.38 ? 109 MET B SD    1 
ATOM   4045  C CE    . MET B 1 109 ? 10.524  5.044   -17.876  1.00 32.69 ? 109 MET B CE    1 
ATOM   4046  N N     . ASP B 1 110 ? 14.574  2.485   -17.760  1.00 30.05 ? 110 ASP B N     1 
ATOM   4047  C CA    . ASP B 1 110 ? 14.006  1.283   -18.266  1.00 29.67 ? 110 ASP B CA    1 
ATOM   4048  C C     . ASP B 1 110 ? 13.316  0.578   -17.094  1.00 29.59 ? 110 ASP B C     1 
ATOM   4049  O O     . ASP B 1 110 ? 13.609  0.916   -15.922  1.00 30.53 ? 110 ASP B O     1 
ATOM   4050  C CB    . ASP B 1 110 ? 15.066  0.456   -18.991  1.00 30.35 ? 110 ASP B CB    1 
ATOM   4051  C CG    . ASP B 1 110 ? 14.453  -0.637  -19.900  1.00 31.56 ? 110 ASP B CG    1 
ATOM   4052  O OD1   . ASP B 1 110 ? 13.208  -0.609  -20.164  1.00 33.82 ? 110 ASP B OD1   1 
ATOM   4053  O OD2   . ASP B 1 110 ? 15.216  -1.549  -20.305  1.00 30.91 ? 110 ASP B OD2   1 
ATOM   4054  N N     . LEU B 1 111 ? 12.351  -0.297  -17.422  1.00 28.03 ? 111 LEU B N     1 
ATOM   4055  C CA    . LEU B 1 111 ? 11.540  -1.067  -16.486  1.00 27.71 ? 111 LEU B CA    1 
ATOM   4056  C C     . LEU B 1 111 ? 11.377  -2.553  -16.881  1.00 27.84 ? 111 LEU B C     1 
ATOM   4057  O O     . LEU B 1 111 ? 11.254  -2.912  -18.049  1.00 28.20 ? 111 LEU B O     1 
ATOM   4058  C CB    . LEU B 1 111 ? 10.180  -0.386  -16.258  1.00 28.22 ? 111 LEU B CB    1 
ATOM   4059  C CG    . LEU B 1 111 ? 9.048   -0.852  -15.293  1.00 25.75 ? 111 LEU B CG    1 
ATOM   4060  C CD1   . LEU B 1 111 ? 8.243   0.321   -14.890  1.00 23.21 ? 111 LEU B CD1   1 
ATOM   4061  C CD2   . LEU B 1 111 ? 8.096   -1.854  -15.929  1.00 21.24 ? 111 LEU B CD2   1 
ATOM   4062  N N     . CYS B 1 112 ? 11.368  -3.400  -15.866  1.00 29.65 ? 112 CYS B N     1 
ATOM   4063  C CA    . CYS B 1 112 ? 11.249  -4.845  -15.976  1.00 29.49 ? 112 CYS B CA    1 
ATOM   4064  C C     . CYS B 1 112 ? 10.176  -5.298  -14.979  1.00 29.16 ? 112 CYS B C     1 
ATOM   4065  O O     . CYS B 1 112 ? 10.313  -5.087  -13.789  1.00 29.39 ? 112 CYS B O     1 
ATOM   4066  C CB    . CYS B 1 112 ? 12.569  -5.528  -15.592  1.00 29.98 ? 112 CYS B CB    1 
ATOM   4067  S SG    . CYS B 1 112 ? 12.443  -7.367  -15.511  1.00 33.75 ? 112 CYS B SG    1 
ATOM   4068  N N     . VAL B 1 113 ? 9.124   -5.940  -15.470  1.00 29.28 ? 113 VAL B N     1 
ATOM   4069  C CA    . VAL B 1 113 ? 8.202   -6.660  -14.601  1.00 27.47 ? 113 VAL B CA    1 
ATOM   4070  C C     . VAL B 1 113 ? 8.973   -7.842  -14.032  1.00 27.67 ? 113 VAL B C     1 
ATOM   4071  O O     . VAL B 1 113 ? 9.622   -8.567  -14.793  1.00 26.57 ? 113 VAL B O     1 
ATOM   4072  C CB    . VAL B 1 113 ? 7.024   -7.170  -15.399  1.00 27.41 ? 113 VAL B CB    1 
ATOM   4073  C CG1   . VAL B 1 113 ? 6.078   -7.983  -14.507  1.00 26.07 ? 113 VAL B CG1   1 
ATOM   4074  C CG2   . VAL B 1 113 ? 6.319   -6.005  -16.028  1.00 26.39 ? 113 VAL B CG2   1 
ATOM   4075  N N     . THR B 1 114 ? 8.874   -8.023  -12.697  1.00 27.82 ? 114 THR B N     1 
ATOM   4076  C CA    . THR B 1 114 ? 9.595   -9.041  -11.919  1.00 26.22 ? 114 THR B CA    1 
ATOM   4077  C C     . THR B 1 114 ? 8.609   -9.873  -11.053  1.00 26.66 ? 114 THR B C     1 
ATOM   4078  O O     . THR B 1 114 ? 7.523   -9.415  -10.720  1.00 25.54 ? 114 THR B O     1 
ATOM   4079  C CB    . THR B 1 114 ? 10.742  -8.387  -11.046  1.00 26.70 ? 114 THR B CB    1 
ATOM   4080  O OG1   . THR B 1 114 ? 10.210  -7.476  -10.084  1.00 21.51 ? 114 THR B OG1   1 
ATOM   4081  C CG2   . THR B 1 114 ? 11.777  -7.591  -11.954  1.00 29.70 ? 114 THR B CG2   1 
ATOM   4082  N N     . SER B 1 115 ? 9.017   -11.088 -10.707  1.00 26.22 ? 115 SER B N     1 
ATOM   4083  C CA    . SER B 1 115 ? 8.166   -11.994 -9.944   1.00 26.94 ? 115 SER B CA    1 
ATOM   4084  C C     . SER B 1 115 ? 8.104   -11.588 -8.476   1.00 27.99 ? 115 SER B C     1 
ATOM   4085  O O     . SER B 1 115 ? 8.833   -12.126 -7.642   1.00 28.43 ? 115 SER B O     1 
ATOM   4086  C CB    . SER B 1 115 ? 8.666   -13.434 -10.071  1.00 26.29 ? 115 SER B CB    1 
ATOM   4087  O OG    . SER B 1 115 ? 8.577   -13.889 -11.410  1.00 26.70 ? 115 SER B OG    1 
ATOM   4088  N N     . GLY B 1 116 ? 7.230   -10.638 -8.166   1.00 29.33 ? 116 GLY B N     1 
ATOM   4089  C CA    . GLY B 1 116 ? 7.342   -9.868  -6.941   1.00 30.00 ? 116 GLY B CA    1 
ATOM   4090  C C     . GLY B 1 116 ? 8.583   -8.998  -6.915   1.00 31.19 ? 116 GLY B C     1 
ATOM   4091  O O     . GLY B 1 116 ? 9.577   -9.298  -7.576   1.00 31.73 ? 116 GLY B O     1 
ATOM   4092  N N     . SER B 1 117 ? 8.523   -7.921  -6.149   1.00 31.39 ? 117 SER B N     1 
ATOM   4093  C CA    . SER B 1 117 ? 9.504   -6.848  -6.262   1.00 32.34 ? 117 SER B CA    1 
ATOM   4094  C C     . SER B 1 117 ? 10.797  -7.204  -5.535   1.00 32.45 ? 117 SER B C     1 
ATOM   4095  O O     . SER B 1 117 ? 11.807  -6.516  -5.676   1.00 34.40 ? 117 SER B O     1 
ATOM   4096  C CB    . SER B 1 117 ? 8.932   -5.540  -5.710   1.00 30.52 ? 117 SER B CB    1 
ATOM   4097  O OG    . SER B 1 117 ? 8.776   -5.605  -4.303   1.00 34.69 ? 117 SER B OG    1 
ATOM   4098  N N     . GLN B 1 118 ? 10.756  -8.281  -4.758   1.00 31.51 ? 118 GLN B N     1 
ATOM   4099  C CA    . GLN B 1 118 ? 11.915  -8.727  -4.016   1.00 30.95 ? 118 GLN B CA    1 
ATOM   4100  C C     . GLN B 1 118 ? 12.836  -9.558  -4.920   1.00 31.21 ? 118 GLN B C     1 
ATOM   4101  O O     . GLN B 1 118 ? 14.042  -9.663  -4.652   1.00 29.79 ? 118 GLN B O     1 
ATOM   4102  C CB    . GLN B 1 118 ? 11.528  -9.496  -2.752   1.00 29.36 ? 118 GLN B CB    1 
ATOM   4103  C CG    . GLN B 1 118 ? 11.687  -8.677  -1.464   1.00 30.42 ? 118 GLN B CG    1 
ATOM   4104  C CD    . GLN B 1 118 ? 10.765  -9.190  -0.327   1.00 33.01 ? 118 GLN B CD    1 
ATOM   4105  O OE1   . GLN B 1 118 ? 9.518   -9.144  -0.445   1.00 36.16 ? 118 GLN B OE1   1 
ATOM   4106  N NE2   . GLN B 1 118 ? 11.362  -9.701  0.746    1.00 25.27 ? 118 GLN B NE2   1 
ATOM   4107  N N     . GLN B 1 119 ? 12.253  -10.110 -5.995   1.00 31.70 ? 119 GLN B N     1 
ATOM   4108  C CA    . GLN B 1 119 ? 13.013  -10.819 -7.023   1.00 31.34 ? 119 GLN B CA    1 
ATOM   4109  C C     . GLN B 1 119 ? 13.992  -9.866  -7.652   1.00 31.71 ? 119 GLN B C     1 
ATOM   4110  O O     . GLN B 1 119 ? 15.187  -10.156 -7.691   1.00 32.66 ? 119 GLN B O     1 
ATOM   4111  C CB    . GLN B 1 119 ? 12.125  -11.448 -8.098   1.00 31.51 ? 119 GLN B CB    1 
ATOM   4112  C CG    . GLN B 1 119 ? 12.800  -12.637 -8.778   1.00 30.31 ? 119 GLN B CG    1 
ATOM   4113  C CD    . GLN B 1 119 ? 12.673  -12.663 -10.284  1.00 28.08 ? 119 GLN B CD    1 
ATOM   4114  O OE1   . GLN B 1 119 ? 12.283  -11.677 -10.912  1.00 30.63 ? 119 GLN B OE1   1 
ATOM   4115  N NE2   . GLN B 1 119 ? 13.028  -13.804 -10.885  1.00 25.73 ? 119 GLN B NE2   1 
ATOM   4116  N N     . GLY B 1 120 ? 13.485  -8.730  -8.119   1.00 32.27 ? 120 GLY B N     1 
ATOM   4117  C CA    . GLY B 1 120 ? 14.287  -7.677  -8.719   1.00 32.76 ? 120 GLY B CA    1 
ATOM   4118  C C     . GLY B 1 120 ? 15.350  -7.154  -7.769   1.00 33.62 ? 120 GLY B C     1 
ATOM   4119  O O     . GLY B 1 120 ? 16.522  -6.987  -8.145   1.00 33.91 ? 120 GLY B O     1 
ATOM   4120  N N     . LEU B 1 121 ? 14.946  -6.902  -6.528   1.00 33.54 ? 121 LEU B N     1 
ATOM   4121  C CA    . LEU B 1 121 ? 15.840  -6.331  -5.543   1.00 33.23 ? 121 LEU B CA    1 
ATOM   4122  C C     . LEU B 1 121 ? 17.052  -7.247  -5.227   1.00 32.70 ? 121 LEU B C     1 
ATOM   4123  O O     . LEU B 1 121 ? 18.181  -6.778  -4.994   1.00 32.20 ? 121 LEU B O     1 
ATOM   4124  C CB    . LEU B 1 121 ? 15.040  -6.049  -4.278   1.00 34.14 ? 121 LEU B CB    1 
ATOM   4125  C CG    . LEU B 1 121 ? 15.869  -5.443  -3.136   1.00 36.39 ? 121 LEU B CG    1 
ATOM   4126  C CD1   . LEU B 1 121 ? 16.491  -4.107  -3.583   1.00 38.52 ? 121 LEU B CD1   1 
ATOM   4127  C CD2   . LEU B 1 121 ? 15.049  -5.301  -1.875   1.00 38.16 ? 121 LEU B CD2   1 
ATOM   4128  N N     . CYS B 1 122 ? 16.803  -8.551  -5.224   1.00 32.20 ? 122 CYS B N     1 
ATOM   4129  C CA    . CYS B 1 122 ? 17.808  -9.534  -4.891   1.00 31.58 ? 122 CYS B CA    1 
ATOM   4130  C C     . CYS B 1 122 ? 18.797  -9.535  -6.017   1.00 30.66 ? 122 CYS B C     1 
ATOM   4131  O O     . CYS B 1 122 ? 20.002  -9.411  -5.803   1.00 31.62 ? 122 CYS B O     1 
ATOM   4132  C CB    . CYS B 1 122 ? 17.156  -10.898 -4.790   1.00 32.13 ? 122 CYS B CB    1 
ATOM   4133  S SG    . CYS B 1 122 ? 18.235  -12.254 -4.267   1.00 33.62 ? 122 CYS B SG    1 
ATOM   4134  N N     . LYS B 1 123 ? 18.271  -9.638  -7.227   1.00 29.78 ? 123 LYS B N     1 
ATOM   4135  C CA    . LYS B 1 123 ? 19.082  -9.695  -8.420   1.00 28.66 ? 123 LYS B CA    1 
ATOM   4136  C C     . LYS B 1 123 ? 19.907  -8.436  -8.595   1.00 29.03 ? 123 LYS B C     1 
ATOM   4137  O O     . LYS B 1 123 ? 20.945  -8.436  -9.305   1.00 27.13 ? 123 LYS B O     1 
ATOM   4138  C CB    . LYS B 1 123 ? 18.235  -10.012 -9.628   1.00 28.17 ? 123 LYS B CB    1 
ATOM   4139  C CG    . LYS B 1 123 ? 17.961  -11.540 -9.711   1.00 28.25 ? 123 LYS B CG    1 
ATOM   4140  C CD    . LYS B 1 123 ? 16.981  -11.938 -10.806  1.00 29.08 ? 123 LYS B CD    1 
ATOM   4141  C CE    . LYS B 1 123 ? 16.273  -13.283 -10.521  1.00 31.14 ? 123 LYS B CE    1 
ATOM   4142  N NZ    . LYS B 1 123 ? 17.125  -14.504 -10.626  1.00 31.95 ? 123 LYS B NZ    1 
ATOM   4143  N N     . VAL B 1 124 ? 19.466  -7.385  -7.906   1.00 28.31 ? 124 VAL B N     1 
ATOM   4144  C CA    . VAL B 1 124 ? 20.193  -6.152  -7.921   1.00 28.73 ? 124 VAL B CA    1 
ATOM   4145  C C     . VAL B 1 124 ? 21.403  -6.142  -6.939   1.00 29.31 ? 124 VAL B C     1 
ATOM   4146  O O     . VAL B 1 124 ? 22.483  -5.628  -7.282   1.00 29.04 ? 124 VAL B O     1 
ATOM   4147  C CB    . VAL B 1 124 ? 19.263  -4.983  -7.677   1.00 29.53 ? 124 VAL B CB    1 
ATOM   4148  C CG1   . VAL B 1 124 ? 20.036  -3.796  -7.102   1.00 28.11 ? 124 VAL B CG1   1 
ATOM   4149  C CG2   . VAL B 1 124 ? 18.497  -4.622  -9.002   1.00 28.62 ? 124 VAL B CG2   1 
ATOM   4150  N N     . PHE B 1 125 ? 21.212  -6.695  -5.734   1.00 29.13 ? 125 PHE B N     1 
ATOM   4151  C CA    . PHE B 1 125 ? 22.309  -6.900  -4.818   1.00 28.34 ? 125 PHE B CA    1 
ATOM   4152  C C     . PHE B 1 125 ? 23.403  -7.802  -5.423   1.00 28.62 ? 125 PHE B C     1 
ATOM   4153  O O     . PHE B 1 125 ? 24.603  -7.488  -5.325   1.00 27.30 ? 125 PHE B O     1 
ATOM   4154  C CB    . PHE B 1 125 ? 21.824  -7.501  -3.489   1.00 28.15 ? 125 PHE B CB    1 
ATOM   4155  C CG    . PHE B 1 125 ? 20.797  -6.686  -2.785   1.00 27.04 ? 125 PHE B CG    1 
ATOM   4156  C CD1   . PHE B 1 125 ? 19.754  -7.310  -2.117   1.00 29.87 ? 125 PHE B CD1   1 
ATOM   4157  C CD2   . PHE B 1 125 ? 20.836  -5.300  -2.816   1.00 26.83 ? 125 PHE B CD2   1 
ATOM   4158  C CE1   . PHE B 1 125 ? 18.771  -6.558  -1.494   1.00 28.21 ? 125 PHE B CE1   1 
ATOM   4159  C CE2   . PHE B 1 125 ? 19.893  -4.560  -2.165   1.00 27.20 ? 125 PHE B CE2   1 
ATOM   4160  C CZ    . PHE B 1 125 ? 18.861  -5.192  -1.499   1.00 27.74 ? 125 PHE B CZ    1 
ATOM   4161  N N     . GLU B 1 126 ? 22.958  -8.894  -6.058   1.00 29.16 ? 126 GLU B N     1 
ATOM   4162  C CA    . GLU B 1 126 ? 23.828  -9.921  -6.639   1.00 29.58 ? 126 GLU B CA    1 
ATOM   4163  C C     . GLU B 1 126 ? 24.635  -9.314  -7.750   1.00 28.38 ? 126 GLU B C     1 
ATOM   4164  O O     . GLU B 1 126 ? 25.791  -9.679  -7.957   1.00 27.78 ? 126 GLU B O     1 
ATOM   4165  C CB    . GLU B 1 126 ? 23.037  -11.164 -7.090   1.00 29.02 ? 126 GLU B CB    1 
ATOM   4166  C CG    . GLU B 1 126 ? 22.218  -11.828 -5.957   1.00 31.55 ? 126 GLU B CG    1 
ATOM   4167  C CD    . GLU B 1 126 ? 21.235  -12.920 -6.399   1.00 32.99 ? 126 GLU B CD    1 
ATOM   4168  O OE1   . GLU B 1 126 ? 21.240  -14.024 -5.814   1.00 39.77 ? 126 GLU B OE1   1 
ATOM   4169  O OE2   . GLU B 1 126 ? 20.433  -12.701 -7.320   1.00 36.54 ? 126 GLU B OE2   1 
ATOM   4170  N N     . MET B 1 127 ? 24.026  -8.342  -8.427   1.00 28.29 ? 127 MET B N     1 
ATOM   4171  C CA    . MET B 1 127 ? 24.655  -7.667  -9.560   1.00 28.78 ? 127 MET B CA    1 
ATOM   4172  C C     . MET B 1 127 ? 25.756  -6.715  -9.077   1.00 29.51 ? 127 MET B C     1 
ATOM   4173  O O     . MET B 1 127 ? 26.803  -6.520  -9.766   1.00 30.65 ? 127 MET B O     1 
ATOM   4174  C CB    . MET B 1 127 ? 23.612  -6.951  -10.415  1.00 26.95 ? 127 MET B CB    1 
ATOM   4175  C CG    . MET B 1 127 ? 24.119  -5.906  -11.321  1.00 27.03 ? 127 MET B CG    1 
ATOM   4176  S SD    . MET B 1 127 ? 22.929  -4.719  -12.090  1.00 30.75 ? 127 MET B SD    1 
ATOM   4177  C CE    . MET B 1 127 ? 22.772  -3.528  -10.811  1.00 25.24 ? 127 MET B CE    1 
ATOM   4178  N N     . ILE B 1 128 ? 25.532  -6.110  -7.922   1.00 29.11 ? 128 ILE B N     1 
ATOM   4179  C CA    . ILE B 1 128 ? 26.392  -5.016  -7.466   1.00 29.82 ? 128 ILE B CA    1 
ATOM   4180  C C     . ILE B 1 128 ? 27.556  -5.540  -6.633   1.00 29.63 ? 128 ILE B C     1 
ATOM   4181  O O     . ILE B 1 128 ? 28.712  -5.256  -6.943   1.00 30.90 ? 128 ILE B O     1 
ATOM   4182  C CB    . ILE B 1 128 ? 25.610  -3.922  -6.693   1.00 29.81 ? 128 ILE B CB    1 
ATOM   4183  C CG1   . ILE B 1 128 ? 24.850  -3.020  -7.661   1.00 29.14 ? 128 ILE B CG1   1 
ATOM   4184  C CG2   . ILE B 1 128 ? 26.566  -3.056  -5.804   1.00 30.68 ? 128 ILE B CG2   1 
ATOM   4185  C CD1   . ILE B 1 128 ? 23.385  -2.666  -7.203   1.00 30.31 ? 128 ILE B CD1   1 
ATOM   4186  N N     . ILE B 1 129 ? 27.236  -6.368  -5.650   1.00 29.13 ? 129 ILE B N     1 
ATOM   4187  C CA    . ILE B 1 129 ? 28.058  -6.576  -4.478   1.00 28.89 ? 129 ILE B CA    1 
ATOM   4188  C C     . ILE B 1 129 ? 29.168  -7.556  -4.663   1.00 29.67 ? 129 ILE B C     1 
ATOM   4189  O O     . ILE B 1 129 ? 28.926  -8.729  -4.826   1.00 31.17 ? 129 ILE B O     1 
ATOM   4190  C CB    . ILE B 1 129 ? 27.201  -6.992  -3.258   1.00 27.47 ? 129 ILE B CB    1 
ATOM   4191  C CG1   . ILE B 1 129 ? 26.450  -5.787  -2.737   1.00 26.17 ? 129 ILE B CG1   1 
ATOM   4192  C CG2   . ILE B 1 129 ? 28.049  -7.566  -2.121   1.00 29.43 ? 129 ILE B CG2   1 
ATOM   4193  C CD1   . ILE B 1 129 ? 25.175  -6.166  -1.911   1.00 27.59 ? 129 ILE B CD1   1 
ATOM   4194  N N     . ASN B 1 130 ? 30.400  -7.082  -4.607   1.00 30.71 ? 130 ASN B N     1 
ATOM   4195  C CA    . ASN B 1 130 ? 31.547  -7.990  -4.363   1.00 31.31 ? 130 ASN B CA    1 
ATOM   4196  C C     . ASN B 1 130 ? 31.783  -8.236  -2.876   1.00 31.33 ? 130 ASN B C     1 
ATOM   4197  O O     . ASN B 1 130 ? 31.513  -7.336  -2.072   1.00 31.31 ? 130 ASN B O     1 
ATOM   4198  C CB    . ASN B 1 130 ? 32.773  -7.348  -4.965   1.00 31.07 ? 130 ASN B CB    1 
ATOM   4199  C CG    . ASN B 1 130 ? 32.705  -7.331  -6.479   1.00 31.56 ? 130 ASN B CG    1 
ATOM   4200  O OD1   . ASN B 1 130 ? 32.392  -8.339  -7.087   1.00 32.34 ? 130 ASN B OD1   1 
ATOM   4201  N ND2   . ASN B 1 130 ? 33.000  -6.191  -7.089   1.00 29.37 ? 130 ASN B ND2   1 
ATOM   4202  N N     . PRO B 1 131 ? 32.291  -9.442  -2.486   1.00 31.62 ? 131 PRO B N     1 
ATOM   4203  C CA    . PRO B 1 131 ? 32.578  -9.544  -1.030   1.00 31.53 ? 131 PRO B CA    1 
ATOM   4204  C C     . PRO B 1 131 ? 33.531  -8.438  -0.550   1.00 32.62 ? 131 PRO B C     1 
ATOM   4205  O O     . PRO B 1 131 ? 34.448  -8.060  -1.273   1.00 33.53 ? 131 PRO B O     1 
ATOM   4206  C CB    . PRO B 1 131 ? 33.209  -10.939 -0.864   1.00 31.36 ? 131 PRO B CB    1 
ATOM   4207  C CG    . PRO B 1 131 ? 32.861  -11.706 -2.139   1.00 32.42 ? 131 PRO B CG    1 
ATOM   4208  C CD    . PRO B 1 131 ? 32.597  -10.688 -3.226   1.00 30.30 ? 131 PRO B CD    1 
ATOM   4209  N N     . GLY B 1 132 ? 33.335  -7.915  0.657    1.00 33.53 ? 132 GLY B N     1 
ATOM   4210  C CA    . GLY B 1 132 ? 34.205  -6.831  1.141    1.00 33.83 ? 132 GLY B CA    1 
ATOM   4211  C C     . GLY B 1 132 ? 33.633  -5.449  0.815    1.00 34.42 ? 132 GLY B C     1 
ATOM   4212  O O     . GLY B 1 132 ? 34.080  -4.428  1.359    1.00 34.26 ? 132 GLY B O     1 
ATOM   4213  N N     . ASP B 1 133 ? 32.619  -5.410  -0.056   1.00 34.32 ? 133 ASP B N     1 
ATOM   4214  C CA    . ASP B 1 133 ? 31.982  -4.151  -0.430   1.00 33.51 ? 133 ASP B CA    1 
ATOM   4215  C C     . ASP B 1 133 ? 31.301  -3.460  0.740    1.00 33.10 ? 133 ASP B C     1 
ATOM   4216  O O     . ASP B 1 133 ? 30.800  -4.103  1.655    1.00 33.20 ? 133 ASP B O     1 
ATOM   4217  C CB    . ASP B 1 133 ? 30.974  -4.412  -1.509   1.00 34.75 ? 133 ASP B CB    1 
ATOM   4218  C CG    . ASP B 1 133 ? 31.581  -4.476  -2.875   1.00 37.84 ? 133 ASP B CG    1 
ATOM   4219  O OD1   . ASP B 1 133 ? 32.834  -4.451  -2.990   1.00 38.33 ? 133 ASP B OD1   1 
ATOM   4220  O OD2   . ASP B 1 133 ? 30.779  -4.570  -3.847   1.00 43.19 ? 133 ASP B OD2   1 
ATOM   4221  N N     . ASN B 1 134 ? 31.306  -2.136  0.730    1.00 33.03 ? 134 ASN B N     1 
ATOM   4222  C CA    . ASN B 1 134 ? 30.602  -1.363  1.737    1.00 32.37 ? 134 ASN B CA    1 
ATOM   4223  C C     . ASN B 1 134 ? 29.261  -0.836  1.212    1.00 32.77 ? 134 ASN B C     1 
ATOM   4224  O O     . ASN B 1 134 ? 29.167  -0.356  0.067    1.00 31.92 ? 134 ASN B O     1 
ATOM   4225  C CB    . ASN B 1 134 ? 31.484  -0.213  2.173    1.00 32.59 ? 134 ASN B CB    1 
ATOM   4226  C CG    . ASN B 1 134 ? 32.651  -0.681  3.059    1.00 34.33 ? 134 ASN B CG    1 
ATOM   4227  O OD1   . ASN B 1 134 ? 32.464  -1.478  3.972    1.00 33.86 ? 134 ASN B OD1   1 
ATOM   4228  N ND2   . ASN B 1 134 ? 33.856  -0.183  2.775    1.00 34.01 ? 134 ASN B ND2   1 
ATOM   4229  N N     . VAL B 1 135 ? 28.230  -0.965  2.052    1.00 32.23 ? 135 VAL B N     1 
ATOM   4230  C CA    . VAL B 1 135 ? 26.864  -0.523  1.737    1.00 31.70 ? 135 VAL B CA    1 
ATOM   4231  C C     . VAL B 1 135 ? 26.252  0.305   2.894    1.00 31.28 ? 135 VAL B C     1 
ATOM   4232  O O     . VAL B 1 135 ? 26.469  0.045   4.106    1.00 28.85 ? 135 VAL B O     1 
ATOM   4233  C CB    . VAL B 1 135 ? 25.944  -1.725  1.431    1.00 31.98 ? 135 VAL B CB    1 
ATOM   4234  C CG1   . VAL B 1 135 ? 26.229  -2.314  0.036    1.00 33.93 ? 135 VAL B CG1   1 
ATOM   4235  C CG2   . VAL B 1 135 ? 26.131  -2.808  2.445    1.00 33.18 ? 135 VAL B CG2   1 
ATOM   4236  N N     . LEU B 1 136 ? 25.481  1.312   2.510    1.00 30.66 ? 136 LEU B N     1 
ATOM   4237  C CA    . LEU B 1 136 ? 24.781  2.091   3.482    1.00 30.60 ? 136 LEU B CA    1 
ATOM   4238  C C     . LEU B 1 136 ? 23.302  1.643   3.592    1.00 31.51 ? 136 LEU B C     1 
ATOM   4239  O O     . LEU B 1 136 ? 22.637  1.365   2.596    1.00 30.52 ? 136 LEU B O     1 
ATOM   4240  C CB    . LEU B 1 136 ? 24.932  3.563   3.148    1.00 29.41 ? 136 LEU B CB    1 
ATOM   4241  C CG    . LEU B 1 136 ? 26.384  4.037   3.027    1.00 28.64 ? 136 LEU B CG    1 
ATOM   4242  C CD1   . LEU B 1 136 ? 26.432  5.165   2.052    1.00 29.29 ? 136 LEU B CD1   1 
ATOM   4243  C CD2   . LEU B 1 136 ? 27.033  4.452   4.393    1.00 26.07 ? 136 LEU B CD2   1 
ATOM   4244  N N     . LEU B 1 137 ? 22.828  1.491   4.828    1.00 32.10 ? 137 LEU B N     1 
ATOM   4245  C CA    . LEU B 1 137 ? 21.390  1.448   5.070    1.00 32.27 ? 137 LEU B CA    1 
ATOM   4246  C C     . LEU B 1 137 ? 21.168  1.905   6.480    1.00 33.15 ? 137 LEU B C     1 
ATOM   4247  O O     . LEU B 1 137 ? 22.146  2.001   7.232    1.00 33.42 ? 137 LEU B O     1 
ATOM   4248  C CB    . LEU B 1 137 ? 20.740  0.086   4.781    1.00 31.15 ? 137 LEU B CB    1 
ATOM   4249  C CG    . LEU B 1 137 ? 21.127  -1.241  5.405    1.00 31.71 ? 137 LEU B CG    1 
ATOM   4250  C CD1   . LEU B 1 137 ? 20.750  -1.405  6.876    1.00 30.77 ? 137 LEU B CD1   1 
ATOM   4251  C CD2   . LEU B 1 137 ? 20.512  -2.335  4.609    1.00 31.87 ? 137 LEU B CD2   1 
ATOM   4252  N N     . ASP B 1 138 ? 19.906  2.226   6.809    1.00 33.72 ? 138 ASP B N     1 
ATOM   4253  C CA    . ASP B 1 138 ? 19.492  2.625   8.157    1.00 34.38 ? 138 ASP B CA    1 
ATOM   4254  C C     . ASP B 1 138 ? 18.694  1.527   8.836    1.00 34.54 ? 138 ASP B C     1 
ATOM   4255  O O     . ASP B 1 138 ? 17.975  0.759   8.173    1.00 35.44 ? 138 ASP B O     1 
ATOM   4256  C CB    . ASP B 1 138 ? 18.659  3.909   8.118    1.00 35.44 ? 138 ASP B CB    1 
ATOM   4257  C CG    . ASP B 1 138 ? 17.300  3.717   7.430    1.00 37.09 ? 138 ASP B CG    1 
ATOM   4258  O OD1   . ASP B 1 138 ? 17.293  3.327   6.264    1.00 42.37 ? 138 ASP B OD1   1 
ATOM   4259  O OD2   . ASP B 1 138 ? 16.237  3.960   8.048    1.00 40.49 ? 138 ASP B OD2   1 
ATOM   4260  N N     . GLU B 1 139 ? 18.840  1.468   10.163   1.00 34.39 ? 139 GLU B N     1 
ATOM   4261  C CA    . GLU B 1 139 ? 18.334  0.399   11.027   1.00 33.04 ? 139 GLU B CA    1 
ATOM   4262  C C     . GLU B 1 139 ? 17.503  1.117   12.056   1.00 31.89 ? 139 GLU B C     1 
ATOM   4263  O O     . GLU B 1 139 ? 17.968  2.140   12.577   1.00 32.30 ? 139 GLU B O     1 
ATOM   4264  C CB    . GLU B 1 139 ? 19.470  -0.269  11.777   1.00 33.77 ? 139 GLU B CB    1 
ATOM   4265  C CG    . GLU B 1 139 ? 20.032  -1.564  11.209   1.00 33.70 ? 139 GLU B CG    1 
ATOM   4266  C CD    . GLU B 1 139 ? 21.309  -1.950  11.950   1.00 35.16 ? 139 GLU B CD    1 
ATOM   4267  O OE1   . GLU B 1 139 ? 21.706  -3.147  12.013   1.00 36.83 ? 139 GLU B OE1   1 
ATOM   4268  O OE2   . GLU B 1 139 ? 21.951  -1.006  12.446   1.00 40.21 ? 139 GLU B OE2   1 
ATOM   4269  N N     . PRO B 1 140 ? 16.306  0.556   12.401   1.00 29.37 ? 140 PRO B N     1 
ATOM   4270  C CA    . PRO B 1 140 ? 15.946  -0.807  12.049   1.00 28.24 ? 140 PRO B CA    1 
ATOM   4271  C C     . PRO B 1 140 ? 15.670  -0.987  10.571   1.00 28.43 ? 140 PRO B C     1 
ATOM   4272  O O     . PRO B 1 140 ? 15.149  -0.049  9.910    1.00 28.62 ? 140 PRO B O     1 
ATOM   4273  C CB    . PRO B 1 140 ? 14.703  -1.058  12.889   1.00 27.24 ? 140 PRO B CB    1 
ATOM   4274  C CG    . PRO B 1 140 ? 14.683  0.065   13.853   1.00 27.60 ? 140 PRO B CG    1 
ATOM   4275  C CD    . PRO B 1 140 ? 15.232  1.178   13.167   1.00 28.54 ? 140 PRO B CD    1 
ATOM   4276  N N     . ALA B 1 141 ? 16.042  -2.157  10.046   1.00 27.58 ? 141 ALA B N     1 
ATOM   4277  C CA    . ALA B 1 141 ? 15.934  -2.407  8.590    1.00 27.97 ? 141 ALA B CA    1 
ATOM   4278  C C     . ALA B 1 141 ? 15.192  -3.700  8.268    1.00 28.40 ? 141 ALA B C     1 
ATOM   4279  O O     . ALA B 1 141 ? 15.064  -4.559  9.112    1.00 28.91 ? 141 ALA B O     1 
ATOM   4280  C CB    . ALA B 1 141 ? 17.332  -2.367  7.891    1.00 25.95 ? 141 ALA B CB    1 
ATOM   4281  N N     . TYR B 1 142 ? 14.721  -3.853  7.036    1.00 29.69 ? 142 TYR B N     1 
ATOM   4282  C CA    . TYR B 1 142 ? 13.869  -5.009  6.715    1.00 30.27 ? 142 TYR B CA    1 
ATOM   4283  C C     . TYR B 1 142 ? 14.521  -6.419  6.870    1.00 30.01 ? 142 TYR B C     1 
ATOM   4284  O O     . TYR B 1 142 ? 15.595  -6.711  6.289    1.00 31.38 ? 142 TYR B O     1 
ATOM   4285  C CB    . TYR B 1 142 ? 13.121  -4.797  5.368    1.00 30.94 ? 142 TYR B CB    1 
ATOM   4286  C CG    . TYR B 1 142 ? 12.415  -6.038  4.874    1.00 32.32 ? 142 TYR B CG    1 
ATOM   4287  C CD1   . TYR B 1 142 ? 11.547  -6.739  5.709    1.00 27.03 ? 142 TYR B CD1   1 
ATOM   4288  C CD2   . TYR B 1 142 ? 12.677  -6.541  3.569    1.00 31.92 ? 142 TYR B CD2   1 
ATOM   4289  C CE1   . TYR B 1 142 ? 10.976  -7.881  5.278    1.00 30.57 ? 142 TYR B CE1   1 
ATOM   4290  C CE2   . TYR B 1 142 ? 12.085  -7.677  3.132    1.00 29.12 ? 142 TYR B CE2   1 
ATOM   4291  C CZ    . TYR B 1 142 ? 11.209  -8.326  3.976    1.00 29.45 ? 142 TYR B CZ    1 
ATOM   4292  O OH    . TYR B 1 142 ? 10.606  -9.475  3.553    1.00 31.18 ? 142 TYR B OH    1 
ATOM   4293  N N     . SER B 1 143 ? 13.894  -7.262  7.710    1.00 28.43 ? 143 SER B N     1 
ATOM   4294  C CA    . SER B 1 143 ? 14.345  -8.618  7.914    1.00 27.41 ? 143 SER B CA    1 
ATOM   4295  C C     . SER B 1 143 ? 14.922  -9.169  6.650    1.00 27.56 ? 143 SER B C     1 
ATOM   4296  O O     . SER B 1 143 ? 16.058  -9.661  6.646    1.00 26.50 ? 143 SER B O     1 
ATOM   4297  C CB    . SER B 1 143 ? 13.207  -9.529  8.282    1.00 26.82 ? 143 SER B CB    1 
ATOM   4298  O OG    . SER B 1 143 ? 13.135  -9.683  9.680    1.00 30.63 ? 143 SER B OG    1 
ATOM   4299  N N     . GLY B 1 144 ? 14.105  -9.083  5.578    1.00 27.44 ? 144 GLY B N     1 
ATOM   4300  C CA    . GLY B 1 144 ? 14.338  -9.850  4.370    1.00 27.03 ? 144 GLY B CA    1 
ATOM   4301  C C     . GLY B 1 144 ? 15.624  -9.384  3.698    1.00 27.62 ? 144 GLY B C     1 
ATOM   4302  O O     . GLY B 1 144 ? 16.370  -10.208 3.119    1.00 26.30 ? 144 GLY B O     1 
ATOM   4303  N N     . THR B 1 145 ? 15.846  -8.064  3.759    1.00 27.65 ? 145 THR B N     1 
ATOM   4304  C CA    . THR B 1 145 ? 17.013  -7.441  3.175    1.00 29.25 ? 145 THR B CA    1 
ATOM   4305  C C     . THR B 1 145 ? 18.317  -7.794  3.929    1.00 28.97 ? 145 THR B C     1 
ATOM   4306  O O     . THR B 1 145 ? 19.354  -8.001  3.311    1.00 30.32 ? 145 THR B O     1 
ATOM   4307  C CB    . THR B 1 145 ? 16.817  -5.926  2.946    1.00 29.71 ? 145 THR B CB    1 
ATOM   4308  O OG1   . THR B 1 145 ? 15.614  -5.706  2.180    1.00 31.65 ? 145 THR B OG1   1 
ATOM   4309  C CG2   . THR B 1 145 ? 17.993  -5.356  2.160    1.00 30.67 ? 145 THR B CG2   1 
ATOM   4310  N N     . LEU B 1 146 ? 18.257  -7.930  5.240    1.00 28.08 ? 146 LEU B N     1 
ATOM   4311  C CA    . LEU B 1 146 ? 19.454  -8.336  6.007    1.00 26.85 ? 146 LEU B CA    1 
ATOM   4312  C C     . LEU B 1 146 ? 19.872  -9.781  5.663    1.00 27.92 ? 146 LEU B C     1 
ATOM   4313  O O     . LEU B 1 146 ? 21.087  -10.041 5.420    1.00 27.72 ? 146 LEU B O     1 
ATOM   4314  C CB    . LEU B 1 146 ? 19.274  -8.107  7.518    1.00 24.89 ? 146 LEU B CB    1 
ATOM   4315  C CG    . LEU B 1 146 ? 18.960  -6.635  7.884    1.00 23.43 ? 146 LEU B CG    1 
ATOM   4316  C CD1   . LEU B 1 146 ? 18.680  -6.330  9.344    1.00 22.37 ? 146 LEU B CD1   1 
ATOM   4317  C CD2   . LEU B 1 146 ? 19.988  -5.642  7.405    1.00 18.33 ? 146 LEU B CD2   1 
ATOM   4318  N N     . GLN B 1 147 ? 18.886  -10.696 5.574    1.00 28.18 ? 147 GLN B N     1 
ATOM   4319  C CA    . GLN B 1 147 ? 19.162  -12.099 5.180    1.00 29.36 ? 147 GLN B CA    1 
ATOM   4320  C C     . GLN B 1 147 ? 19.611  -12.207 3.743    1.00 30.47 ? 147 GLN B C     1 
ATOM   4321  O O     . GLN B 1 147 ? 20.139  -13.229 3.293    1.00 31.38 ? 147 GLN B O     1 
ATOM   4322  C CB    . GLN B 1 147 ? 17.961  -13.012 5.442    1.00 28.96 ? 147 GLN B CB    1 
ATOM   4323  C CG    . GLN B 1 147 ? 17.616  -13.140 6.937    1.00 31.93 ? 147 GLN B CG    1 
ATOM   4324  C CD    . GLN B 1 147 ? 18.851  -13.360 7.877    1.00 31.96 ? 147 GLN B CD    1 
ATOM   4325  O OE1   . GLN B 1 147 ? 20.015  -13.508 7.442    1.00 29.07 ? 147 GLN B OE1   1 
ATOM   4326  N NE2   . GLN B 1 147 ? 18.574  -13.383 9.174    1.00 37.72 ? 147 GLN B NE2   1 
ATOM   4327  N N     . SER B 1 148 ? 19.403  -11.116 3.016    1.00 31.48 ? 148 SER B N     1 
ATOM   4328  C CA    . SER B 1 148 ? 19.736  -11.092 1.647    1.00 31.50 ? 148 SER B CA    1 
ATOM   4329  C C     . SER B 1 148 ? 21.167  -10.626 1.469    1.00 32.56 ? 148 SER B C     1 
ATOM   4330  O O     . SER B 1 148 ? 21.916  -11.234 0.705    1.00 31.74 ? 148 SER B O     1 
ATOM   4331  C CB    . SER B 1 148 ? 18.782  -10.211 0.912    1.00 30.64 ? 148 SER B CB    1 
ATOM   4332  O OG    . SER B 1 148 ? 18.567  -10.801 -0.339   1.00 30.59 ? 148 SER B OG    1 
ATOM   4333  N N     . LEU B 1 149 ? 21.518  -9.553  2.182    1.00 33.54 ? 149 LEU B N     1 
ATOM   4334  C CA    . LEU B 1 149 ? 22.808  -8.896  2.050    1.00 35.40 ? 149 LEU B CA    1 
ATOM   4335  C C     . LEU B 1 149 ? 23.917  -9.644  2.772    1.00 35.37 ? 149 LEU B C     1 
ATOM   4336  O O     . LEU B 1 149 ? 25.071  -9.570  2.368    1.00 35.93 ? 149 LEU B O     1 
ATOM   4337  C CB    . LEU B 1 149 ? 22.732  -7.442  2.562    1.00 36.03 ? 149 LEU B CB    1 
ATOM   4338  C CG    . LEU B 1 149 ? 22.103  -6.500  1.522    1.00 36.60 ? 149 LEU B CG    1 
ATOM   4339  C CD1   . LEU B 1 149 ? 22.217  -5.047  1.938    1.00 36.21 ? 149 LEU B CD1   1 
ATOM   4340  C CD2   . LEU B 1 149 ? 22.840  -6.718  0.235    1.00 34.76 ? 149 LEU B CD2   1 
ATOM   4341  N N     . HIS B 1 150 ? 23.542  -10.359 3.825    1.00 35.64 ? 150 HIS B N     1 
ATOM   4342  C CA    . HIS B 1 150 ? 24.461  -11.064 4.696    1.00 35.54 ? 150 HIS B CA    1 
ATOM   4343  C C     . HIS B 1 150 ? 25.330  -12.115 4.029    1.00 36.31 ? 150 HIS B C     1 
ATOM   4344  O O     . HIS B 1 150 ? 26.514  -12.170 4.340    1.00 36.71 ? 150 HIS B O     1 
ATOM   4345  C CB    . HIS B 1 150 ? 23.693  -11.772 5.815    1.00 35.42 ? 150 HIS B CB    1 
ATOM   4346  C CG    . HIS B 1 150 ? 24.542  -12.699 6.618    1.00 34.65 ? 150 HIS B CG    1 
ATOM   4347  N ND1   . HIS B 1 150 ? 24.323  -14.059 6.666    1.00 35.76 ? 150 HIS B ND1   1 
ATOM   4348  C CD2   . HIS B 1 150 ? 25.624  -12.458 7.403    1.00 35.31 ? 150 HIS B CD2   1 
ATOM   4349  C CE1   . HIS B 1 150 ? 25.233  -14.620 7.447    1.00 39.47 ? 150 HIS B CE1   1 
ATOM   4350  N NE2   . HIS B 1 150 ? 26.033  -13.667 7.907    1.00 39.16 ? 150 HIS B NE2   1 
ATOM   4351  N N     . PRO B 1 151 ? 24.734  -13.027 3.202    1.00 36.47 ? 151 PRO B N     1 
ATOM   4352  C CA    . PRO B 1 151 ? 25.556  -14.006 2.511    1.00 36.60 ? 151 PRO B CA    1 
ATOM   4353  C C     . PRO B 1 151 ? 26.492  -13.427 1.450    1.00 37.40 ? 151 PRO B C     1 
ATOM   4354  O O     . PRO B 1 151 ? 27.422  -14.094 1.037    1.00 38.07 ? 151 PRO B O     1 
ATOM   4355  C CB    . PRO B 1 151 ? 24.517  -14.909 1.850    1.00 37.39 ? 151 PRO B CB    1 
ATOM   4356  C CG    . PRO B 1 151 ? 23.317  -14.078 1.728    1.00 35.29 ? 151 PRO B CG    1 
ATOM   4357  C CD    . PRO B 1 151 ? 23.301  -13.274 2.949    1.00 35.61 ? 151 PRO B CD    1 
ATOM   4358  N N     . LEU B 1 152 ? 26.250  -12.194 1.032    1.00 38.28 ? 152 LEU B N     1 
ATOM   4359  C CA    . LEU B 1 152 ? 27.023  -11.540 -0.036   1.00 38.77 ? 152 LEU B CA    1 
ATOM   4360  C C     . LEU B 1 152 ? 28.339  -10.944 0.434    1.00 39.16 ? 152 LEU B C     1 
ATOM   4361  O O     . LEU B 1 152 ? 29.067  -10.276 -0.356   1.00 39.87 ? 152 LEU B O     1 
ATOM   4362  C CB    . LEU B 1 152 ? 26.194  -10.445 -0.711   1.00 37.55 ? 152 LEU B CB    1 
ATOM   4363  C CG    . LEU B 1 152 ? 25.224  -10.862 -1.814   1.00 40.19 ? 152 LEU B CG    1 
ATOM   4364  C CD1   . LEU B 1 152 ? 25.906  -11.554 -3.039   1.00 39.20 ? 152 LEU B CD1   1 
ATOM   4365  C CD2   . LEU B 1 152 ? 24.144  -11.723 -1.254   1.00 39.48 ? 152 LEU B CD2   1 
ATOM   4366  N N     . GLY B 1 153 ? 28.652  -11.138 1.708    1.00 38.70 ? 153 GLY B N     1 
ATOM   4367  C CA    . GLY B 1 153 ? 29.968  -10.673 2.197    1.00 39.28 ? 153 GLY B CA    1 
ATOM   4368  C C     . GLY B 1 153 ? 30.234  -9.174  2.055    1.00 38.32 ? 153 GLY B C     1 
ATOM   4369  O O     . GLY B 1 153 ? 31.374  -8.751  1.853    1.00 38.97 ? 153 GLY B O     1 
ATOM   4370  N N     . CYS B 1 154 ? 29.177  -8.378  2.155    1.00 37.25 ? 154 CYS B N     1 
ATOM   4371  C CA    . CYS B 1 154 ? 29.322  -6.946  2.318    1.00 36.23 ? 154 CYS B CA    1 
ATOM   4372  C C     . CYS B 1 154 ? 29.412  -6.507  3.806    1.00 35.60 ? 154 CYS B C     1 
ATOM   4373  O O     . CYS B 1 154 ? 29.071  -7.233  4.753    1.00 34.06 ? 154 CYS B O     1 
ATOM   4374  C CB    . CYS B 1 154 ? 28.230  -6.194  1.553    1.00 36.38 ? 154 CYS B CB    1 
ATOM   4375  S SG    . CYS B 1 154 ? 26.480  -6.619  1.992    1.00 38.29 ? 154 CYS B SG    1 
ATOM   4376  N N     . ASN B 1 155 ? 29.896  -5.297  3.983    1.00 35.52 ? 155 ASN B N     1 
ATOM   4377  C CA    . ASN B 1 155 ? 29.983  -4.685  5.286    1.00 35.86 ? 155 ASN B CA    1 
ATOM   4378  C C     . ASN B 1 155 ? 28.896  -3.646  5.300    1.00 33.97 ? 155 ASN B C     1 
ATOM   4379  O O     . ASN B 1 155 ? 28.954  -2.665  4.588    1.00 33.92 ? 155 ASN B O     1 
ATOM   4380  C CB    . ASN B 1 155 ? 31.399  -4.094  5.556    1.00 36.55 ? 155 ASN B CB    1 
ATOM   4381  C CG    . ASN B 1 155 ? 31.498  -3.319  6.906    1.00 40.10 ? 155 ASN B CG    1 
ATOM   4382  O OD1   . ASN B 1 155 ? 32.356  -2.404  7.064    1.00 40.96 ? 155 ASN B OD1   1 
ATOM   4383  N ND2   . ASN B 1 155 ? 30.619  -3.669  7.876    1.00 38.51 ? 155 ASN B ND2   1 
ATOM   4384  N N     . ILE B 1 156 ? 27.884  -3.909  6.107    1.00 33.88 ? 156 ILE B N     1 
ATOM   4385  C CA    . ILE B 1 156 ? 26.753  -3.005  6.317    1.00 33.27 ? 156 ILE B CA    1 
ATOM   4386  C C     . ILE B 1 156 ? 27.059  -1.903  7.344    1.00 32.79 ? 156 ILE B C     1 
ATOM   4387  O O     . ILE B 1 156 ? 27.113  -2.163  8.547    1.00 34.15 ? 156 ILE B O     1 
ATOM   4388  C CB    . ILE B 1 156 ? 25.477  -3.809  6.706    1.00 33.31 ? 156 ILE B CB    1 
ATOM   4389  C CG1   . ILE B 1 156 ? 25.182  -4.848  5.607    1.00 31.12 ? 156 ILE B CG1   1 
ATOM   4390  C CG2   . ILE B 1 156 ? 24.268  -2.846  6.959    1.00 34.17 ? 156 ILE B CG2   1 
ATOM   4391  C CD1   . ILE B 1 156 ? 24.056  -5.791  5.910    1.00 29.92 ? 156 ILE B CD1   1 
ATOM   4392  N N     . ILE B 1 157 ? 27.245  -0.692  6.829    1.00 32.32 ? 157 ILE B N     1 
ATOM   4393  C CA    . ILE B 1 157 ? 27.449  0.562   7.561    1.00 31.97 ? 157 ILE B CA    1 
ATOM   4394  C C     . ILE B 1 157 ? 26.132  1.295   7.805    1.00 33.29 ? 157 ILE B C     1 
ATOM   4395  O O     . ILE B 1 157 ? 25.532  1.812   6.860    1.00 33.13 ? 157 ILE B O     1 
ATOM   4396  C CB    . ILE B 1 157 ? 28.320  1.523   6.733    1.00 31.32 ? 157 ILE B CB    1 
ATOM   4397  C CG1   . ILE B 1 157 ? 29.513  0.741   6.149    1.00 28.46 ? 157 ILE B CG1   1 
ATOM   4398  C CG2   . ILE B 1 157 ? 28.625  2.831   7.560    1.00 29.44 ? 157 ILE B CG2   1 
ATOM   4399  C CD1   . ILE B 1 157 ? 30.784  1.519   5.993    1.00 28.79 ? 157 ILE B CD1   1 
ATOM   4400  N N     . ASN B 1 158 ? 25.747  1.361   9.083    1.00 34.55 ? 158 ASN B N     1 
ATOM   4401  C CA    . ASN B 1 158 ? 24.490  1.874   9.551    1.00 35.46 ? 158 ASN B CA    1 
ATOM   4402  C C     . ASN B 1 158 ? 24.496  3.377   9.615    1.00 36.92 ? 158 ASN B C     1 
ATOM   4403  O O     . ASN B 1 158 ? 25.443  3.971   10.161   1.00 37.30 ? 158 ASN B O     1 
ATOM   4404  C CB    . ASN B 1 158 ? 24.160  1.345   10.959   1.00 35.25 ? 158 ASN B CB    1 
ATOM   4405  C CG    . ASN B 1 158 ? 22.652  1.604   11.355   1.00 35.25 ? 158 ASN B CG    1 
ATOM   4406  O OD1   . ASN B 1 158 ? 21.717  1.352   10.559   1.00 33.21 ? 158 ASN B OD1   1 
ATOM   4407  N ND2   . ASN B 1 158 ? 22.434  2.075   12.579   1.00 28.95 ? 158 ASN B ND2   1 
ATOM   4408  N N     . VAL B 1 159 ? 23.438  3.983   9.059    1.00 37.15 ? 159 VAL B N     1 
ATOM   4409  C CA    . VAL B 1 159 ? 23.239  5.413   9.129    1.00 37.70 ? 159 VAL B CA    1 
ATOM   4410  C C     . VAL B 1 159 ? 22.110  5.581   10.139   1.00 38.53 ? 159 VAL B C     1 
ATOM   4411  O O     . VAL B 1 159 ? 21.212  4.743   10.193   1.00 38.99 ? 159 VAL B O     1 
ATOM   4412  C CB    . VAL B 1 159 ? 22.830  6.017   7.770    1.00 38.07 ? 159 VAL B CB    1 
ATOM   4413  C CG1   . VAL B 1 159 ? 22.862  7.555   7.812    1.00 38.81 ? 159 VAL B CG1   1 
ATOM   4414  C CG2   . VAL B 1 159 ? 23.710  5.502   6.629    1.00 37.66 ? 159 VAL B CG2   1 
ATOM   4415  N N     . ALA B 1 160 ? 22.190  6.606   10.984   1.00 38.50 ? 160 ALA B N     1 
ATOM   4416  C CA    . ALA B 1 160 ? 21.135  6.873   11.941   1.00 39.11 ? 160 ALA B CA    1 
ATOM   4417  C C     . ALA B 1 160 ? 19.864  7.263   11.190   1.00 38.89 ? 160 ALA B C     1 
ATOM   4418  O O     . ALA B 1 160 ? 19.919  7.993   10.192   1.00 38.94 ? 160 ALA B O     1 
ATOM   4419  C CB    . ALA B 1 160 ? 21.531  7.983   12.920   1.00 38.89 ? 160 ALA B CB    1 
ATOM   4420  N N     . SER B 1 161 ? 18.741  6.749   11.678   1.00 38.68 ? 161 SER B N     1 
ATOM   4421  C CA    . SER B 1 161 ? 17.402  7.132   11.215   1.00 39.24 ? 161 SER B CA    1 
ATOM   4422  C C     . SER B 1 161 ? 16.628  7.590   12.445   1.00 39.04 ? 161 SER B C     1 
ATOM   4423  O O     . SER B 1 161 ? 16.856  7.062   13.557   1.00 38.80 ? 161 SER B O     1 
ATOM   4424  C CB    . SER B 1 161 ? 16.682  5.944   10.561   1.00 38.73 ? 161 SER B CB    1 
ATOM   4425  O OG    . SER B 1 161 ? 16.679  4.805   11.423   1.00 40.90 ? 161 SER B OG    1 
ATOM   4426  N N     . ASP B 1 162 ? 15.781  8.606   12.264   1.00 38.83 ? 162 ASP B N     1 
ATOM   4427  C CA    . ASP B 1 162 ? 14.797  8.953   13.267   1.00 39.24 ? 162 ASP B CA    1 
ATOM   4428  C C     . ASP B 1 162 ? 13.438  8.912   12.635   1.00 40.01 ? 162 ASP B C     1 
ATOM   4429  O O     . ASP B 1 162 ? 13.305  8.205   11.627   1.00 40.61 ? 162 ASP B O     1 
ATOM   4430  C CB    . ASP B 1 162 ? 15.110  10.259  14.015   1.00 38.90 ? 162 ASP B CB    1 
ATOM   4431  C CG    . ASP B 1 162 ? 15.270  11.455  13.124   1.00 39.61 ? 162 ASP B CG    1 
ATOM   4432  O OD1   . ASP B 1 162 ? 14.622  11.528  12.040   1.00 43.29 ? 162 ASP B OD1   1 
ATOM   4433  O OD2   . ASP B 1 162 ? 16.033  12.368  13.556   1.00 38.22 ? 162 ASP B OD2   1 
ATOM   4434  N N     . GLU B 1 163 ? 12.449  9.646   13.198   1.00 40.34 ? 163 GLU B N     1 
ATOM   4435  C CA    . GLU B 1 163 ? 11.052  9.696   12.686   1.00 39.01 ? 163 GLU B CA    1 
ATOM   4436  C C     . GLU B 1 163 ? 10.941  10.147  11.251   1.00 37.76 ? 163 GLU B C     1 
ATOM   4437  O O     . GLU B 1 163 ? 9.828   10.112  10.634   1.00 36.51 ? 163 GLU B O     1 
ATOM   4438  C CB    . GLU B 1 163 ? 10.181  10.657  13.496   1.00 39.80 ? 163 GLU B CB    1 
ATOM   4439  C CG    . GLU B 1 163 ? 10.542  10.754  14.941   1.00 43.67 ? 163 GLU B CG    1 
ATOM   4440  C CD    . GLU B 1 163 ? 11.336  12.007  15.232   1.00 48.54 ? 163 GLU B CD    1 
ATOM   4441  O OE1   . GLU B 1 163 ? 12.501  12.052  14.776   1.00 50.27 ? 163 GLU B OE1   1 
ATOM   4442  O OE2   . GLU B 1 163 ? 10.791  12.938  15.898   1.00 47.62 ? 163 GLU B OE2   1 
ATOM   4443  N N     . SER B 1 164 ? 12.051  10.640  10.708   1.00 35.63 ? 164 SER B N     1 
ATOM   4444  C CA    . SER B 1 164 ? 11.979  11.055  9.304    1.00 34.32 ? 164 SER B CA    1 
ATOM   4445  C C     . SER B 1 164 ? 12.866  10.205  8.443    1.00 34.27 ? 164 SER B C     1 
ATOM   4446  O O     . SER B 1 164 ? 13.296  10.648  7.417    1.00 35.69 ? 164 SER B O     1 
ATOM   4447  C CB    . SER B 1 164 ? 12.268  12.538  9.141    1.00 33.61 ? 164 SER B CB    1 
ATOM   4448  O OG    . SER B 1 164 ? 11.517  13.284  10.080   1.00 31.02 ? 164 SER B OG    1 
ATOM   4449  N N     . GLY B 1 165 ? 13.172  9.003   8.903    1.00 34.96 ? 165 GLY B N     1 
ATOM   4450  C CA    . GLY B 1 165 ? 14.138  8.152   8.243    1.00 33.99 ? 165 GLY B CA    1 
ATOM   4451  C C     . GLY B 1 165 ? 15.569  8.636   8.326    1.00 34.94 ? 165 GLY B C     1 
ATOM   4452  O O     . GLY B 1 165 ? 15.919  9.424   9.185    1.00 33.57 ? 165 GLY B O     1 
ATOM   4453  N N     . ILE B 1 166 ? 16.392  8.147   7.412    1.00 35.33 ? 166 ILE B N     1 
ATOM   4454  C CA    . ILE B 1 166 ? 17.808  8.452   7.399    1.00 35.57 ? 166 ILE B CA    1 
ATOM   4455  C C     . ILE B 1 166 ? 18.028  9.876   7.856    1.00 35.78 ? 166 ILE B C     1 
ATOM   4456  O O     . ILE B 1 166 ? 17.434  10.796  7.327    1.00 36.12 ? 166 ILE B O     1 
ATOM   4457  C CB    . ILE B 1 166 ? 18.379  8.249   5.981    1.00 36.29 ? 166 ILE B CB    1 
ATOM   4458  C CG1   . ILE B 1 166 ? 18.587  6.770   5.699    1.00 36.93 ? 166 ILE B CG1   1 
ATOM   4459  C CG2   . ILE B 1 166 ? 19.673  8.972   5.796    1.00 33.86 ? 166 ILE B CG2   1 
ATOM   4460  C CD1   . ILE B 1 166 ? 17.682  6.221   4.649    1.00 36.49 ? 166 ILE B CD1   1 
ATOM   4461  N N     . VAL B 1 167 ? 18.888  10.069  8.837    1.00 36.19 ? 167 VAL B N     1 
ATOM   4462  C CA    . VAL B 1 167 ? 19.318  11.414  9.155    1.00 35.97 ? 167 VAL B CA    1 
ATOM   4463  C C     . VAL B 1 167 ? 20.457  11.809  8.227    1.00 36.49 ? 167 VAL B C     1 
ATOM   4464  O O     . VAL B 1 167 ? 21.486  11.168  8.216    1.00 36.89 ? 167 VAL B O     1 
ATOM   4465  C CB    . VAL B 1 167 ? 19.697  11.527  10.642   1.00 35.88 ? 167 VAL B CB    1 
ATOM   4466  C CG1   . VAL B 1 167 ? 20.139  12.907  10.997   1.00 34.04 ? 167 VAL B CG1   1 
ATOM   4467  C CG2   . VAL B 1 167 ? 18.538  11.120  11.493   1.00 32.97 ? 167 VAL B CG2   1 
ATOM   4468  N N     . PRO B 1 168 ? 20.255  12.835  7.412    1.00 37.26 ? 168 PRO B N     1 
ATOM   4469  C CA    . PRO B 1 168 ? 21.316  13.225  6.447    1.00 36.78 ? 168 PRO B CA    1 
ATOM   4470  C C     . PRO B 1 168 ? 22.708  13.484  7.052    1.00 37.08 ? 168 PRO B C     1 
ATOM   4471  O O     . PRO B 1 168 ? 23.725  13.073  6.481    1.00 36.97 ? 168 PRO B O     1 
ATOM   4472  C CB    . PRO B 1 168 ? 20.766  14.482  5.794    1.00 36.18 ? 168 PRO B CB    1 
ATOM   4473  C CG    . PRO B 1 168 ? 19.309  14.413  5.980    1.00 36.85 ? 168 PRO B CG    1 
ATOM   4474  C CD    . PRO B 1 168 ? 19.018  13.621  7.227    1.00 36.52 ? 168 PRO B CD    1 
ATOM   4475  N N     . ASP B 1 169 ? 22.761  14.160  8.187    1.00 38.00 ? 169 ASP B N     1 
ATOM   4476  C CA    . ASP B 1 169 ? 24.053  14.461  8.838    1.00 38.51 ? 169 ASP B CA    1 
ATOM   4477  C C     . ASP B 1 169 ? 24.820  13.203  9.130    1.00 38.66 ? 169 ASP B C     1 
ATOM   4478  O O     . ASP B 1 169 ? 26.044  13.150  8.913    1.00 37.97 ? 169 ASP B O     1 
ATOM   4479  C CB    . ASP B 1 169 ? 23.856  15.242  10.150   1.00 39.32 ? 169 ASP B CB    1 
ATOM   4480  C CG    . ASP B 1 169 ? 23.559  16.701  9.906    1.00 39.81 ? 169 ASP B CG    1 
ATOM   4481  O OD1   . ASP B 1 169 ? 23.905  17.183  8.801    1.00 39.73 ? 169 ASP B OD1   1 
ATOM   4482  O OD2   . ASP B 1 169 ? 22.947  17.345  10.793   1.00 42.37 ? 169 ASP B OD2   1 
ATOM   4483  N N     . SER B 1 170 ? 24.094  12.192  9.634    1.00 38.58 ? 170 SER B N     1 
ATOM   4484  C CA    . SER B 1 170 ? 24.682  10.879  9.874    1.00 38.21 ? 170 SER B CA    1 
ATOM   4485  C C     . SER B 1 170 ? 25.366  10.364  8.600    1.00 39.26 ? 170 SER B C     1 
ATOM   4486  O O     . SER B 1 170 ? 26.461  9.813   8.656    1.00 40.11 ? 170 SER B O     1 
ATOM   4487  C CB    . SER B 1 170 ? 23.644  9.884   10.372   1.00 37.57 ? 170 SER B CB    1 
ATOM   4488  O OG    . SER B 1 170 ? 24.217  8.598   10.536   1.00 32.55 ? 170 SER B OG    1 
ATOM   4489  N N     . LEU B 1 171 ? 24.715  10.548  7.464    1.00 39.53 ? 171 LEU B N     1 
ATOM   4490  C CA    . LEU B 1 171 ? 25.256  10.110  6.191    1.00 40.33 ? 171 LEU B CA    1 
ATOM   4491  C C     . LEU B 1 171 ? 26.558  10.882  5.857    1.00 41.59 ? 171 LEU B C     1 
ATOM   4492  O O     . LEU B 1 171 ? 27.573  10.249  5.518    1.00 42.13 ? 171 LEU B O     1 
ATOM   4493  C CB    . LEU B 1 171 ? 24.179  10.222  5.078    1.00 40.12 ? 171 LEU B CB    1 
ATOM   4494  C CG    . LEU B 1 171 ? 24.450  9.713   3.640    1.00 39.20 ? 171 LEU B CG    1 
ATOM   4495  C CD1   . LEU B 1 171 ? 24.974  8.287   3.563    1.00 36.47 ? 171 LEU B CD1   1 
ATOM   4496  C CD2   . LEU B 1 171 ? 23.235  9.914   2.763    1.00 39.66 ? 171 LEU B CD2   1 
ATOM   4497  N N     . ARG B 1 172 ? 26.534  12.214  5.997    1.00 42.66 ? 172 ARG B N     1 
ATOM   4498  C CA    . ARG B 1 172 ? 27.725  13.086  5.830    1.00 44.67 ? 172 ARG B CA    1 
ATOM   4499  C C     . ARG B 1 172 ? 28.890  12.631  6.702    1.00 44.40 ? 172 ARG B C     1 
ATOM   4500  O O     . ARG B 1 172 ? 29.954  12.248  6.207    1.00 45.46 ? 172 ARG B O     1 
ATOM   4501  C CB    . ARG B 1 172 ? 27.397  14.544  6.166    1.00 44.67 ? 172 ARG B CB    1 
ATOM   4502  C CG    . ARG B 1 172 ? 27.454  15.500  4.999    1.00 46.13 ? 172 ARG B CG    1 
ATOM   4503  C CD    . ARG B 1 172 ? 26.983  16.908  5.402    1.00 47.58 ? 172 ARG B CD    1 
ATOM   4504  N NE    . ARG B 1 172 ? 25.955  17.375  4.448    1.00 54.81 ? 172 ARG B NE    1 
ATOM   4505  C CZ    . ARG B 1 172 ? 24.634  17.325  4.648    1.00 56.13 ? 172 ARG B CZ    1 
ATOM   4506  N NH1   . ARG B 1 172 ? 24.123  16.864  5.800    1.00 55.53 ? 172 ARG B NH1   1 
ATOM   4507  N NH2   . ARG B 1 172 ? 23.812  17.761  3.691    1.00 56.91 ? 172 ARG B NH2   1 
ATOM   4508  N N     . ASP B 1 173 ? 28.665  12.638  8.005    1.00 44.11 ? 173 ASP B N     1 
ATOM   4509  C CA    . ASP B 1 173 ? 29.663  12.184  8.968    1.00 43.27 ? 173 ASP B CA    1 
ATOM   4510  C C     . ASP B 1 173 ? 30.287  10.851  8.584    1.00 42.43 ? 173 ASP B C     1 
ATOM   4511  O O     . ASP B 1 173 ? 31.525  10.745  8.501    1.00 41.47 ? 173 ASP B O     1 
ATOM   4512  C CB    . ASP B 1 173 ? 29.047  12.141  10.361   1.00 43.00 ? 173 ASP B CB    1 
ATOM   4513  C CG    . ASP B 1 173 ? 28.692  13.539  10.879   1.00 44.22 ? 173 ASP B CG    1 
ATOM   4514  O OD1   . ASP B 1 173 ? 28.530  14.475  10.033   1.00 48.59 ? 173 ASP B OD1   1 
ATOM   4515  O OD2   . ASP B 1 173 ? 28.600  13.710  12.123   1.00 39.38 ? 173 ASP B OD2   1 
ATOM   4516  N N     . ILE B 1 174 ? 29.430  9.857   8.314    1.00 41.82 ? 174 ILE B N     1 
ATOM   4517  C CA    . ILE B 1 174 ? 29.889  8.522   7.890    1.00 40.77 ? 174 ILE B CA    1 
ATOM   4518  C C     . ILE B 1 174 ? 30.763  8.582   6.625    1.00 40.83 ? 174 ILE B C     1 
ATOM   4519  O O     . ILE B 1 174 ? 31.719  7.856   6.516    1.00 38.89 ? 174 ILE B O     1 
ATOM   4520  C CB    . ILE B 1 174 ? 28.702  7.520   7.682    1.00 40.62 ? 174 ILE B CB    1 
ATOM   4521  C CG1   . ILE B 1 174 ? 28.178  7.034   9.051    1.00 41.54 ? 174 ILE B CG1   1 
ATOM   4522  C CG2   . ILE B 1 174 ? 29.121  6.330   6.760    1.00 38.24 ? 174 ILE B CG2   1 
ATOM   4523  C CD1   . ILE B 1 174 ? 26.966  6.064   9.037    1.00 40.08 ? 174 ILE B CD1   1 
ATOM   4524  N N     . LEU B 1 175 ? 30.408  9.452   5.678    1.00 41.87 ? 175 LEU B N     1 
ATOM   4525  C CA    . LEU B 1 175 ? 31.032  9.434   4.368    1.00 43.27 ? 175 LEU B CA    1 
ATOM   4526  C C     . LEU B 1 175 ? 32.340  10.214  4.330    1.00 44.78 ? 175 LEU B C     1 
ATOM   4527  O O     . LEU B 1 175 ? 33.021  10.183  3.290    1.00 44.80 ? 175 LEU B O     1 
ATOM   4528  C CB    . LEU B 1 175 ? 30.084  9.989   3.306    1.00 42.80 ? 175 LEU B CB    1 
ATOM   4529  C CG    . LEU B 1 175 ? 28.942  9.121   2.770    1.00 42.58 ? 175 LEU B CG    1 
ATOM   4530  C CD1   . LEU B 1 175 ? 27.706  9.953   2.501    1.00 37.65 ? 175 LEU B CD1   1 
ATOM   4531  C CD2   . LEU B 1 175 ? 29.343  8.416   1.518    1.00 44.49 ? 175 LEU B CD2   1 
ATOM   4532  N N     . SER B 1 176 ? 32.635  10.934  5.430    1.00 45.66 ? 176 SER B N     1 
ATOM   4533  C CA    . SER B 1 176 ? 33.843  11.745  5.613    1.00 46.66 ? 176 SER B CA    1 
ATOM   4534  C C     . SER B 1 176 ? 35.068  10.917  5.988    1.00 47.27 ? 176 SER B C     1 
ATOM   4535  O O     . SER B 1 176 ? 36.105  11.453  6.415    1.00 47.83 ? 176 SER B O     1 
ATOM   4536  C CB    . SER B 1 176 ? 33.627  12.858  6.652    1.00 47.08 ? 176 SER B CB    1 
ATOM   4537  O OG    . SER B 1 176 ? 32.402  12.714  7.358    1.00 48.62 ? 176 SER B OG    1 
ATOM   4538  N N     . ARG B 1 177 ? 34.898  9.603   5.866    1.00 47.69 ? 177 ARG B N     1 
ATOM   4539  C CA    . ARG B 1 177 ? 35.931  8.587   5.964    1.00 47.65 ? 177 ARG B CA    1 
ATOM   4540  C C     . ARG B 1 177 ? 36.656  8.522   4.598    1.00 47.65 ? 177 ARG B C     1 
ATOM   4541  O O     . ARG B 1 177 ? 37.767  7.948   4.467    1.00 46.80 ? 177 ARG B O     1 
ATOM   4542  C CB    . ARG B 1 177 ? 35.260  7.231   6.268    1.00 47.09 ? 177 ARG B CB    1 
ATOM   4543  C CG    . ARG B 1 177 ? 34.447  7.181   7.606    1.00 49.93 ? 177 ARG B CG    1 
ATOM   4544  C CD    . ARG B 1 177 ? 33.328  6.105   7.665    1.00 48.75 ? 177 ARG B CD    1 
ATOM   4545  N NE    . ARG B 1 177 ? 33.847  4.738   7.508    1.00 55.23 ? 177 ARG B NE    1 
ATOM   4546  C CZ    . ARG B 1 177 ? 33.239  3.625   7.938    1.00 56.13 ? 177 ARG B CZ    1 
ATOM   4547  N NH1   . ARG B 1 177 ? 32.077  3.694   8.572    1.00 55.61 ? 177 ARG B NH1   1 
ATOM   4548  N NH2   . ARG B 1 177 ? 33.808  2.436   7.741    1.00 55.39 ? 177 ARG B NH2   1 
ATOM   4549  N N     . TRP B 1 178 ? 35.984  9.095   3.588    1.00 47.08 ? 178 TRP B N     1 
ATOM   4550  C CA    . TRP B 1 178 ? 36.459  9.127   2.225    1.00 45.94 ? 178 TRP B CA    1 
ATOM   4551  C C     . TRP B 1 178 ? 36.450  10.548  1.688    1.00 46.46 ? 178 TRP B C     1 
ATOM   4552  O O     . TRP B 1 178 ? 35.641  11.399  2.062    1.00 44.93 ? 178 TRP B O     1 
ATOM   4553  C CB    . TRP B 1 178 ? 35.616  8.225   1.303    1.00 45.34 ? 178 TRP B CB    1 
ATOM   4554  C CG    . TRP B 1 178 ? 35.525  6.784   1.705    1.00 43.58 ? 178 TRP B CG    1 
ATOM   4555  C CD1   . TRP B 1 178 ? 36.454  5.802   1.489    1.00 43.78 ? 178 TRP B CD1   1 
ATOM   4556  C CD2   . TRP B 1 178 ? 34.422  6.148   2.374    1.00 44.16 ? 178 TRP B CD2   1 
ATOM   4557  N NE1   . TRP B 1 178 ? 36.010  4.600   2.015    1.00 43.95 ? 178 TRP B NE1   1 
ATOM   4558  C CE2   . TRP B 1 178 ? 34.767  4.793   2.563    1.00 42.57 ? 178 TRP B CE2   1 
ATOM   4559  C CE3   . TRP B 1 178 ? 33.172  6.598   2.832    1.00 43.22 ? 178 TRP B CE3   1 
ATOM   4560  C CZ2   . TRP B 1 178 ? 33.912  3.892   3.165    1.00 43.55 ? 178 TRP B CZ2   1 
ATOM   4561  C CZ3   . TRP B 1 178 ? 32.350  5.710   3.472    1.00 43.71 ? 178 TRP B CZ3   1 
ATOM   4562  C CH2   . TRP B 1 178 ? 32.720  4.364   3.625    1.00 43.82 ? 178 TRP B CH2   1 
ATOM   4563  N N     . LYS B 1 179 ? 37.397  10.795  0.798    1.00 48.27 ? 179 LYS B N     1 
ATOM   4564  C CA    . LYS B 1 179 ? 37.331  11.963  -0.049   1.00 49.53 ? 179 LYS B CA    1 
ATOM   4565  C C     . LYS B 1 179 ? 36.420  11.566  -1.208   1.00 49.54 ? 179 LYS B C     1 
ATOM   4566  O O     . LYS B 1 179 ? 36.298  10.369  -1.519   1.00 49.50 ? 179 LYS B O     1 
ATOM   4567  C CB    . LYS B 1 179 ? 38.732  12.372  -0.520   1.00 50.08 ? 179 LYS B CB    1 
ATOM   4568  C CG    . LYS B 1 179 ? 39.756  12.692  0.635    1.00 53.59 ? 179 LYS B CG    1 
ATOM   4569  C CD    . LYS B 1 179 ? 39.511  14.043  1.337    1.00 56.21 ? 179 LYS B CD    1 
ATOM   4570  C CE    . LYS B 1 179 ? 39.264  15.187  0.311    1.00 58.63 ? 179 LYS B CE    1 
ATOM   4571  N NZ    . LYS B 1 179 ? 40.012  16.472  0.608    1.00 60.95 ? 179 LYS B NZ    1 
ATOM   4572  N N     . PRO B 1 180 ? 35.714  12.548  -1.793   1.00 49.45 ? 180 PRO B N     1 
ATOM   4573  C CA    . PRO B 1 180 ? 34.869  12.357  -2.991   1.00 49.94 ? 180 PRO B CA    1 
ATOM   4574  C C     . PRO B 1 180 ? 35.577  11.770  -4.244   1.00 50.90 ? 180 PRO B C     1 
ATOM   4575  O O     . PRO B 1 180 ? 34.896  11.164  -5.106   1.00 50.80 ? 180 PRO B O     1 
ATOM   4576  C CB    . PRO B 1 180 ? 34.344  13.767  -3.286   1.00 49.65 ? 180 PRO B CB    1 
ATOM   4577  C CG    . PRO B 1 180 ? 34.437  14.496  -1.965   1.00 50.28 ? 180 PRO B CG    1 
ATOM   4578  C CD    . PRO B 1 180 ? 35.626  13.918  -1.250   1.00 49.32 ? 180 PRO B CD    1 
ATOM   4579  N N     . GLU B 1 181 ? 36.904  11.963  -4.339   1.00 50.84 ? 181 GLU B N     1 
ATOM   4580  C CA    . GLU B 1 181 ? 37.701  11.557  -5.502   1.00 51.37 ? 181 GLU B CA    1 
ATOM   4581  C C     . GLU B 1 181 ? 38.065  10.084  -5.333   1.00 51.02 ? 181 GLU B C     1 
ATOM   4582  O O     . GLU B 1 181 ? 38.516  9.441   -6.275   1.00 50.58 ? 181 GLU B O     1 
ATOM   4583  C CB    . GLU B 1 181 ? 38.983  12.432  -5.663   1.00 52.35 ? 181 GLU B CB    1 
ATOM   4584  C CG    . GLU B 1 181 ? 38.832  14.021  -5.485   1.00 54.48 ? 181 GLU B CG    1 
ATOM   4585  C CD    . GLU B 1 181 ? 38.607  14.480  -4.006   1.00 57.40 ? 181 GLU B CD    1 
ATOM   4586  O OE1   . GLU B 1 181 ? 37.831  15.444  -3.744   1.00 56.19 ? 181 GLU B OE1   1 
ATOM   4587  O OE2   . GLU B 1 181 ? 39.201  13.857  -3.096   1.00 59.71 ? 181 GLU B OE2   1 
ATOM   4588  N N     . ASP B 1 182 ? 37.858  9.562   -4.117   1.00 50.75 ? 182 ASP B N     1 
ATOM   4589  C CA    . ASP B 1 182 ? 38.003  8.131   -3.811   1.00 50.68 ? 182 ASP B CA    1 
ATOM   4590  C C     . ASP B 1 182 ? 37.020  7.254   -4.578   1.00 50.81 ? 182 ASP B C     1 
ATOM   4591  O O     . ASP B 1 182 ? 37.214  6.028   -4.681   1.00 50.34 ? 182 ASP B O     1 
ATOM   4592  C CB    . ASP B 1 182 ? 37.809  7.856   -2.312   1.00 50.82 ? 182 ASP B CB    1 
ATOM   4593  C CG    . ASP B 1 182 ? 39.073  8.136   -1.460   1.00 51.01 ? 182 ASP B CG    1 
ATOM   4594  O OD1   . ASP B 1 182 ? 40.159  8.371   -2.035   1.00 51.22 ? 182 ASP B OD1   1 
ATOM   4595  O OD2   . ASP B 1 182 ? 38.964  8.110   -0.203   1.00 49.14 ? 182 ASP B OD2   1 
ATOM   4596  N N     . ALA B 1 183 ? 35.954  7.886   -5.085   1.00 51.21 ? 183 ALA B N     1 
ATOM   4597  C CA    . ALA B 1 183 ? 34.889  7.210   -5.823   1.00 51.31 ? 183 ALA B CA    1 
ATOM   4598  C C     . ALA B 1 183 ? 35.405  6.740   -7.157   1.00 51.58 ? 183 ALA B C     1 
ATOM   4599  O O     . ALA B 1 183 ? 34.923  5.748   -7.701   1.00 51.82 ? 183 ALA B O     1 
ATOM   4600  C CB    . ALA B 1 183 ? 33.689  8.131   -6.001   1.00 51.57 ? 183 ALA B CB    1 
ATOM   4601  N N     . LYS B 1 184 ? 36.407  7.443   -7.676   1.00 52.00 ? 184 LYS B N     1 
ATOM   4602  C CA    . LYS B 1 184 ? 37.044  7.039   -8.923   1.00 52.63 ? 184 LYS B CA    1 
ATOM   4603  C C     . LYS B 1 184 ? 38.124  5.952   -8.724   1.00 52.79 ? 184 LYS B C     1 
ATOM   4604  O O     . LYS B 1 184 ? 38.930  5.729   -9.617   1.00 52.11 ? 184 LYS B O     1 
ATOM   4605  C CB    . LYS B 1 184 ? 37.614  8.259   -9.673   1.00 52.86 ? 184 LYS B CB    1 
ATOM   4606  C CG    . LYS B 1 184 ? 36.587  9.119   -10.467  1.00 54.11 ? 184 LYS B CG    1 
ATOM   4607  C CD    . LYS B 1 184 ? 36.461  10.581  -9.935   1.00 55.17 ? 184 LYS B CD    1 
ATOM   4608  C CE    . LYS B 1 184 ? 37.735  11.466  -10.168  1.00 54.44 ? 184 LYS B CE    1 
ATOM   4609  N NZ    . LYS B 1 184 ? 37.721  12.771  -9.373   1.00 54.56 ? 184 LYS B NZ    1 
ATOM   4610  N N     . ASN B 1 185 ? 38.112  5.253   -7.582   1.00 53.58 ? 185 ASN B N     1 
ATOM   4611  C CA    . ASN B 1 185 ? 39.238  4.382   -7.181   1.00 54.52 ? 185 ASN B CA    1 
ATOM   4612  C C     . ASN B 1 185 ? 38.851  3.120   -6.361   1.00 55.21 ? 185 ASN B C     1 
ATOM   4613  O O     . ASN B 1 185 ? 38.805  3.171   -5.141   1.00 55.41 ? 185 ASN B O     1 
ATOM   4614  C CB    . ASN B 1 185 ? 40.308  5.230   -6.445   1.00 53.76 ? 185 ASN B CB    1 
ATOM   4615  C CG    . ASN B 1 185 ? 41.535  4.419   -6.024   1.00 54.71 ? 185 ASN B CG    1 
ATOM   4616  O OD1   . ASN B 1 185 ? 42.350  4.866   -5.193   1.00 51.11 ? 185 ASN B OD1   1 
ATOM   4617  N ND2   . ASN B 1 185 ? 41.675  3.217   -6.596   1.00 55.77 ? 185 ASN B ND2   1 
ATOM   4618  N N     . PRO B 1 186 ? 38.639  1.962   -7.026   1.00 56.17 ? 186 PRO B N     1 
ATOM   4619  C CA    . PRO B 1 186 ? 38.024  0.822   -6.292   1.00 56.50 ? 186 PRO B CA    1 
ATOM   4620  C C     . PRO B 1 186 ? 38.741  0.411   -4.994   1.00 56.43 ? 186 PRO B C     1 
ATOM   4621  O O     . PRO B 1 186 ? 38.069  -0.045  -4.051   1.00 56.13 ? 186 PRO B O     1 
ATOM   4622  C CB    . PRO B 1 186 ? 38.038  -0.333  -7.322   1.00 56.51 ? 186 PRO B CB    1 
ATOM   4623  C CG    . PRO B 1 186 ? 38.092  0.355   -8.668   1.00 55.99 ? 186 PRO B CG    1 
ATOM   4624  C CD    . PRO B 1 186 ? 38.951  1.605   -8.426   1.00 56.15 ? 186 PRO B CD    1 
ATOM   4625  N N     . GLN B 1 187 ? 40.075  0.578   -4.968   1.00 56.18 ? 187 GLN B N     1 
ATOM   4626  C CA    . GLN B 1 187 ? 40.934  0.314   -3.792   1.00 55.74 ? 187 GLN B CA    1 
ATOM   4627  C C     . GLN B 1 187 ? 40.410  0.981   -2.514   1.00 54.74 ? 187 GLN B C     1 
ATOM   4628  O O     . GLN B 1 187 ? 40.563  0.453   -1.395   1.00 55.02 ? 187 GLN B O     1 
ATOM   4629  C CB    . GLN B 1 187 ? 42.372  0.828   -4.009   1.00 56.01 ? 187 GLN B CB    1 
ATOM   4630  C CG    . GLN B 1 187 ? 42.799  1.119   -5.454   1.00 56.89 ? 187 GLN B CG    1 
ATOM   4631  C CD    . GLN B 1 187 ? 44.172  1.841   -5.562   1.00 57.13 ? 187 GLN B CD    1 
ATOM   4632  O OE1   . GLN B 1 187 ? 44.796  1.851   -6.638   1.00 56.25 ? 187 GLN B OE1   1 
ATOM   4633  N NE2   . GLN B 1 187 ? 44.640  2.437   -4.452   1.00 57.92 ? 187 GLN B NE2   1 
ATOM   4634  N N     . LYS B 1 188 ? 39.773  2.123   -2.693   1.00 52.54 ? 188 LYS B N     1 
ATOM   4635  C CA    . LYS B 1 188 ? 39.364  2.950   -1.585   1.00 51.57 ? 188 LYS B CA    1 
ATOM   4636  C C     . LYS B 1 188 ? 38.061  2.464   -0.962   1.00 49.95 ? 188 LYS B C     1 
ATOM   4637  O O     . LYS B 1 188 ? 37.630  2.971   0.066    1.00 49.40 ? 188 LYS B O     1 
ATOM   4638  C CB    . LYS B 1 188 ? 39.222  4.391   -2.060   1.00 52.21 ? 188 LYS B CB    1 
ATOM   4639  C CG    . LYS B 1 188 ? 40.470  5.203   -1.904   1.00 52.40 ? 188 LYS B CG    1 
ATOM   4640  C CD    . LYS B 1 188 ? 41.214  4.781   -0.677   1.00 51.93 ? 188 LYS B CD    1 
ATOM   4641  C CE    . LYS B 1 188 ? 42.694  4.926   -0.869   1.00 55.14 ? 188 LYS B CE    1 
ATOM   4642  N NZ    . LYS B 1 188 ? 43.126  6.340   -0.783   1.00 56.27 ? 188 LYS B NZ    1 
ATOM   4643  N N     . ASN B 1 189 ? 37.447  1.474   -1.595   1.00 47.30 ? 189 ASN B N     1 
ATOM   4644  C CA    . ASN B 1 189 ? 36.169  0.921   -1.163   1.00 45.54 ? 189 ASN B CA    1 
ATOM   4645  C C     . ASN B 1 189 ? 35.125  1.867   -0.570   1.00 43.36 ? 189 ASN B C     1 
ATOM   4646  O O     . ASN B 1 189 ? 34.424  1.542   0.374    1.00 42.15 ? 189 ASN B O     1 
ATOM   4647  C CB    . ASN B 1 189 ? 36.357  -0.340  -0.342   1.00 46.27 ? 189 ASN B CB    1 
ATOM   4648  C CG    . ASN B 1 189 ? 35.631  -1.526  -0.935   1.00 49.36 ? 189 ASN B CG    1 
ATOM   4649  O OD1   . ASN B 1 189 ? 35.551  -1.677  -2.151   1.00 47.72 ? 189 ASN B OD1   1 
ATOM   4650  N ND2   . ASN B 1 189 ? 35.087  -2.372  -0.074   1.00 51.36 ? 189 ASN B ND2   1 
ATOM   4651  N N     . THR B 1 190 ? 35.030  3.040   -1.165   1.00 41.26 ? 190 THR B N     1 
ATOM   4652  C CA    . THR B 1 190 ? 33.801  3.813   -1.207   1.00 39.86 ? 190 THR B CA    1 
ATOM   4653  C C     . THR B 1 190 ? 32.512  2.989   -1.332   1.00 37.75 ? 190 THR B C     1 
ATOM   4654  O O     . THR B 1 190 ? 32.488  1.974   -2.007   1.00 36.20 ? 190 THR B O     1 
ATOM   4655  C CB    . THR B 1 190 ? 33.908  4.821   -2.348   1.00 39.78 ? 190 THR B CB    1 
ATOM   4656  O OG1   . THR B 1 190 ? 34.766  4.294   -3.358   1.00 41.87 ? 190 THR B OG1   1 
ATOM   4657  C CG2   . THR B 1 190 ? 34.641  6.038   -1.890   1.00 39.35 ? 190 THR B CG2   1 
ATOM   4658  N N     . PRO B 1 191 ? 31.437  3.430   -0.690   1.00 36.12 ? 191 PRO B N     1 
ATOM   4659  C CA    . PRO B 1 191 ? 30.208  2.661   -0.741   1.00 35.43 ? 191 PRO B CA    1 
ATOM   4660  C C     . PRO B 1 191 ? 29.641  2.485   -2.156   1.00 34.39 ? 191 PRO B C     1 
ATOM   4661  O O     . PRO B 1 191 ? 29.760  3.371   -3.033   1.00 34.31 ? 191 PRO B O     1 
ATOM   4662  C CB    . PRO B 1 191 ? 29.271  3.443   0.175    1.00 35.97 ? 191 PRO B CB    1 
ATOM   4663  C CG    . PRO B 1 191 ? 30.222  4.257   1.091    1.00 35.05 ? 191 PRO B CG    1 
ATOM   4664  C CD    . PRO B 1 191 ? 31.340  4.609   0.190    1.00 36.16 ? 191 PRO B CD    1 
ATOM   4665  N N     . LYS B 1 192 ? 29.093  1.307   -2.386   1.00 32.65 ? 192 LYS B N     1 
ATOM   4666  C CA    . LYS B 1 192 ? 28.451  1.000   -3.656   1.00 31.93 ? 192 LYS B CA    1 
ATOM   4667  C C     . LYS B 1 192 ? 27.069  1.683   -3.794   1.00 31.10 ? 192 LYS B C     1 
ATOM   4668  O O     . LYS B 1 192 ? 26.727  2.187   -4.866   1.00 30.20 ? 192 LYS B O     1 
ATOM   4669  C CB    . LYS B 1 192 ? 28.328  -0.515  -3.766   1.00 32.36 ? 192 LYS B CB    1 
ATOM   4670  C CG    . LYS B 1 192 ? 29.117  -1.204  -4.903   1.00 33.86 ? 192 LYS B CG    1 
ATOM   4671  C CD    . LYS B 1 192 ? 30.558  -0.794  -5.080   1.00 34.60 ? 192 LYS B CD    1 
ATOM   4672  C CE    . LYS B 1 192 ? 31.122  -1.588  -6.262   1.00 35.04 ? 192 LYS B CE    1 
ATOM   4673  N NZ    . LYS B 1 192 ? 32.382  -2.438  -5.932   1.00 36.10 ? 192 LYS B NZ    1 
ATOM   4674  N N     . PHE B 1 193 ? 26.335  1.754   -2.673   1.00 30.59 ? 193 PHE B N     1 
ATOM   4675  C CA    . PHE B 1 193 ? 24.935  2.089   -2.635   1.00 30.62 ? 193 PHE B CA    1 
ATOM   4676  C C     . PHE B 1 193 ? 24.352  2.265   -1.224   1.00 31.67 ? 193 PHE B C     1 
ATOM   4677  O O     . PHE B 1 193 ? 24.874  1.716   -0.249   1.00 32.03 ? 193 PHE B O     1 
ATOM   4678  C CB    . PHE B 1 193 ? 24.087  1.088   -3.458   1.00 30.37 ? 193 PHE B CB    1 
ATOM   4679  C CG    . PHE B 1 193 ? 23.853  -0.288  -2.819   1.00 29.55 ? 193 PHE B CG    1 
ATOM   4680  C CD1   . PHE B 1 193 ? 24.354  -1.432  -3.426   1.00 26.42 ? 193 PHE B CD1   1 
ATOM   4681  C CD2   . PHE B 1 193 ? 23.058  -0.450  -1.674   1.00 32.11 ? 193 PHE B CD2   1 
ATOM   4682  C CE1   . PHE B 1 193 ? 24.129  -2.711  -2.903   1.00 21.89 ? 193 PHE B CE1   1 
ATOM   4683  C CE2   . PHE B 1 193 ? 22.824  -1.742  -1.104   1.00 30.75 ? 193 PHE B CE2   1 
ATOM   4684  C CZ    . PHE B 1 193 ? 23.339  -2.868  -1.732   1.00 29.60 ? 193 PHE B CZ    1 
ATOM   4685  N N     . LEU B 1 194 ? 23.269  3.045   -1.154   1.00 31.78 ? 194 LEU B N     1 
ATOM   4686  C CA    . LEU B 1 194 ? 22.474  3.273   0.042    1.00 31.44 ? 194 LEU B CA    1 
ATOM   4687  C C     . LEU B 1 194 ? 21.120  2.611   -0.199   1.00 30.49 ? 194 LEU B C     1 
ATOM   4688  O O     . LEU B 1 194 ? 20.482  2.926   -1.186   1.00 30.40 ? 194 LEU B O     1 
ATOM   4689  C CB    . LEU B 1 194 ? 22.297  4.785   0.236    1.00 32.33 ? 194 LEU B CB    1 
ATOM   4690  C CG    . LEU B 1 194 ? 21.485  5.492   1.335    1.00 32.68 ? 194 LEU B CG    1 
ATOM   4691  C CD1   . LEU B 1 194 ? 21.822  6.984   1.292    1.00 35.55 ? 194 LEU B CD1   1 
ATOM   4692  C CD2   . LEU B 1 194 ? 20.005  5.384   1.177    1.00 29.91 ? 194 LEU B CD2   1 
ATOM   4693  N N     . TYR B 1 195 ? 20.725  1.683   0.667    1.00 29.79 ? 195 TYR B N     1 
ATOM   4694  C CA    . TYR B 1 195 ? 19.423  1.013   0.599    1.00 30.01 ? 195 TYR B CA    1 
ATOM   4695  C C     . TYR B 1 195 ? 18.446  1.677   1.541    1.00 30.41 ? 195 TYR B C     1 
ATOM   4696  O O     . TYR B 1 195 ? 18.661  1.679   2.753    1.00 30.79 ? 195 TYR B O     1 
ATOM   4697  C CB    . TYR B 1 195 ? 19.505  -0.485  0.934    1.00 29.81 ? 195 TYR B CB    1 
ATOM   4698  C CG    . TYR B 1 195 ? 18.171  -1.189  1.135    1.00 28.50 ? 195 TYR B CG    1 
ATOM   4699  C CD1   . TYR B 1 195 ? 17.482  -1.745  0.044    1.00 30.41 ? 195 TYR B CD1   1 
ATOM   4700  C CD2   . TYR B 1 195 ? 17.596  -1.319  2.407    1.00 27.03 ? 195 TYR B CD2   1 
ATOM   4701  C CE1   . TYR B 1 195 ? 16.281  -2.411  0.184    1.00 23.09 ? 195 TYR B CE1   1 
ATOM   4702  C CE2   . TYR B 1 195 ? 16.346  -1.952  2.561    1.00 27.36 ? 195 TYR B CE2   1 
ATOM   4703  C CZ    . TYR B 1 195 ? 15.731  -2.494  1.439    1.00 29.25 ? 195 TYR B CZ    1 
ATOM   4704  O OH    . TYR B 1 195 ? 14.549  -3.128  1.572    1.00 34.54 ? 195 TYR B OH    1 
ATOM   4705  N N     . THR B 1 196 ? 17.365  2.216   0.991    1.00 30.18 ? 196 THR B N     1 
ATOM   4706  C CA    . THR B 1 196 ? 16.316  2.760   1.826    1.00 31.28 ? 196 THR B CA    1 
ATOM   4707  C C     . THR B 1 196 ? 14.933  2.266   1.440    1.00 30.58 ? 196 THR B C     1 
ATOM   4708  O O     . THR B 1 196 ? 14.642  2.017   0.251    1.00 31.16 ? 196 THR B O     1 
ATOM   4709  C CB    . THR B 1 196 ? 16.373  4.337   1.882    1.00 31.33 ? 196 THR B CB    1 
ATOM   4710  O OG1   . THR B 1 196 ? 15.240  4.858   2.605    1.00 36.51 ? 196 THR B OG1   1 
ATOM   4711  C CG2   . THR B 1 196 ? 16.394  4.964   0.473    1.00 33.40 ? 196 THR B CG2   1 
ATOM   4712  N N     . VAL B 1 197 ? 14.101  2.092   2.464    1.00 30.50 ? 197 VAL B N     1 
ATOM   4713  C CA    . VAL B 1 197 ? 12.656  1.999   2.313    1.00 30.48 ? 197 VAL B CA    1 
ATOM   4714  C C     . VAL B 1 197 ? 12.017  3.314   2.787    1.00 30.97 ? 197 VAL B C     1 
ATOM   4715  O O     . VAL B 1 197 ? 11.798  3.505   4.001    1.00 31.92 ? 197 VAL B O     1 
ATOM   4716  C CB    . VAL B 1 197 ? 12.086  0.819   3.065    1.00 30.06 ? 197 VAL B CB    1 
ATOM   4717  C CG1   . VAL B 1 197 ? 10.538  0.844   3.034    1.00 29.25 ? 197 VAL B CG1   1 
ATOM   4718  C CG2   . VAL B 1 197 ? 12.598  -0.440  2.448    1.00 31.06 ? 197 VAL B CG2   1 
ATOM   4719  N N     . PRO B 1 198 ? 11.713  4.223   1.833    1.00 30.60 ? 198 PRO B N     1 
ATOM   4720  C CA    . PRO B 1 198 ? 11.383  5.614   2.220    1.00 30.09 ? 198 PRO B CA    1 
ATOM   4721  C C     . PRO B 1 198 ? 9.931   5.932   2.602    1.00 30.13 ? 198 PRO B C     1 
ATOM   4722  O O     . PRO B 1 198 ? 9.643   7.076   2.940    1.00 31.63 ? 198 PRO B O     1 
ATOM   4723  C CB    . PRO B 1 198 ? 11.840  6.444   1.000    1.00 29.44 ? 198 PRO B CB    1 
ATOM   4724  C CG    . PRO B 1 198 ? 12.067  5.452   -0.139   1.00 28.77 ? 198 PRO B CG    1 
ATOM   4725  C CD    . PRO B 1 198 ? 11.722  4.053   0.370    1.00 30.05 ? 198 PRO B CD    1 
ATOM   4726  N N     . ASN B 1 199 ? 9.052   4.937   2.545    1.00 29.53 ? 199 ASN B N     1 
ATOM   4727  C CA    . ASN B 1 199 ? 7.647   5.136   2.880    1.00 29.22 ? 199 ASN B CA    1 
ATOM   4728  C C     . ASN B 1 199 ? 7.109   4.032   3.784    1.00 30.55 ? 199 ASN B C     1 
ATOM   4729  O O     . ASN B 1 199 ? 6.962   2.886   3.361    1.00 31.52 ? 199 ASN B O     1 
ATOM   4730  C CB    . ASN B 1 199 ? 6.802   5.233   1.608    1.00 29.47 ? 199 ASN B CB    1 
ATOM   4731  C CG    . ASN B 1 199 ? 7.068   6.505   0.827    1.00 27.13 ? 199 ASN B CG    1 
ATOM   4732  O OD1   . ASN B 1 199 ? 6.947   7.608   1.357    1.00 26.04 ? 199 ASN B OD1   1 
ATOM   4733  N ND2   . ASN B 1 199 ? 7.433   6.355   -0.441   1.00 27.25 ? 199 ASN B ND2   1 
ATOM   4734  N N     . GLY B 1 200 ? 6.815   4.385   5.031    1.00 29.53 ? 200 GLY B N     1 
ATOM   4735  C CA    . GLY B 1 200 ? 6.395   3.412   6.021    1.00 29.72 ? 200 GLY B CA    1 
ATOM   4736  C C     . GLY B 1 200 ? 7.361   2.249   6.138    1.00 30.25 ? 200 GLY B C     1 
ATOM   4737  O O     . GLY B 1 200 ? 6.990   1.097   5.920    1.00 30.80 ? 200 GLY B O     1 
ATOM   4738  N N     . ASN B 1 201 ? 8.608   2.554   6.482    1.00 29.79 ? 201 ASN B N     1 
ATOM   4739  C CA    . ASN B 1 201 ? 9.621   1.525   6.687    1.00 29.28 ? 201 ASN B CA    1 
ATOM   4740  C C     . ASN B 1 201 ? 9.080   0.333   7.469    1.00 29.76 ? 201 ASN B C     1 
ATOM   4741  O O     . ASN B 1 201 ? 8.514   0.493   8.550    1.00 29.23 ? 201 ASN B O     1 
ATOM   4742  C CB    . ASN B 1 201 ? 10.842  2.109   7.399    1.00 29.01 ? 201 ASN B CB    1 
ATOM   4743  C CG    . ASN B 1 201 ? 12.050  1.194   7.329    1.00 30.06 ? 201 ASN B CG    1 
ATOM   4744  O OD1   . ASN B 1 201 ? 12.832  1.107   8.276    1.00 26.36 ? 201 ASN B OD1   1 
ATOM   4745  N ND2   . ASN B 1 201 ? 12.208  0.509   6.204    1.00 32.71 ? 201 ASN B ND2   1 
ATOM   4746  N N     . ASN B 1 202 ? 9.258   -0.861  6.915    1.00 30.02 ? 202 ASN B N     1 
ATOM   4747  C CA    . ASN B 1 202 ? 9.216   -2.086  7.705    1.00 29.82 ? 202 ASN B CA    1 
ATOM   4748  C C     . ASN B 1 202 ? 10.514  -2.324  8.468    1.00 30.57 ? 202 ASN B C     1 
ATOM   4749  O O     . ASN B 1 202 ? 11.494  -2.814  7.908    1.00 30.51 ? 202 ASN B O     1 
ATOM   4750  C CB    . ASN B 1 202 ? 8.902   -3.288  6.813    1.00 29.67 ? 202 ASN B CB    1 
ATOM   4751  C CG    . ASN B 1 202 ? 8.713   -4.568  7.604    1.00 30.59 ? 202 ASN B CG    1 
ATOM   4752  O OD1   . ASN B 1 202 ? 8.870   -4.585  8.825    1.00 33.47 ? 202 ASN B OD1   1 
ATOM   4753  N ND2   . ASN B 1 202 ? 8.373   -5.647  6.911    1.00 30.36 ? 202 ASN B ND2   1 
ATOM   4754  N N     . PRO B 1 203 ? 10.514  -1.974  9.750    1.00 30.74 ? 203 PRO B N     1 
ATOM   4755  C CA    . PRO B 1 203 ? 9.353   -2.208  10.613   1.00 30.64 ? 203 PRO B CA    1 
ATOM   4756  C C     . PRO B 1 203 ? 8.799   -0.910  11.191   1.00 30.53 ? 203 PRO B C     1 
ATOM   4757  O O     . PRO B 1 203 ? 7.698   -0.901  11.739   1.00 31.44 ? 203 PRO B O     1 
ATOM   4758  C CB    . PRO B 1 203 ? 9.927   -3.068  11.740   1.00 30.35 ? 203 PRO B CB    1 
ATOM   4759  C CG    . PRO B 1 203 ? 11.361  -2.681  11.807   1.00 29.43 ? 203 PRO B CG    1 
ATOM   4760  C CD    . PRO B 1 203 ? 11.774  -2.387  10.393   1.00 30.52 ? 203 PRO B CD    1 
ATOM   4761  N N     . THR B 1 204 ? 9.563   0.171   11.067   1.00 30.99 ? 204 THR B N     1 
ATOM   4762  C CA    . THR B 1 204 ? 9.340   1.391   11.906   1.00 31.90 ? 204 THR B CA    1 
ATOM   4763  C C     . THR B 1 204 ? 8.079   2.201   11.543   1.00 32.71 ? 204 THR B C     1 
ATOM   4764  O O     . THR B 1 204 ? 7.466   2.821   12.423   1.00 33.06 ? 204 THR B O     1 
ATOM   4765  C CB    . THR B 1 204 ? 10.486  2.365   11.889   1.00 30.94 ? 204 THR B CB    1 
ATOM   4766  O OG1   . THR B 1 204 ? 10.452  3.054   10.633   1.00 35.88 ? 204 THR B OG1   1 
ATOM   4767  C CG2   . THR B 1 204 ? 11.806  1.681   12.066   1.00 32.11 ? 204 THR B CG2   1 
ATOM   4768  N N     . GLY B 1 205 ? 7.726   2.208   10.257   1.00 33.91 ? 205 GLY B N     1 
ATOM   4769  C CA    . GLY B 1 205 ? 6.519   2.906   9.745    1.00 35.48 ? 205 GLY B CA    1 
ATOM   4770  C C     . GLY B 1 205 ? 6.722   4.396   9.530    1.00 35.96 ? 205 GLY B C     1 
ATOM   4771  O O     . GLY B 1 205 ? 5.804   5.118   9.146    1.00 35.88 ? 205 GLY B O     1 
ATOM   4772  N N     . ASN B 1 206 ? 7.946   4.842   9.793    1.00 36.96 ? 206 ASN B N     1 
ATOM   4773  C CA    . ASN B 1 206 ? 8.341   6.200   9.524    1.00 37.12 ? 206 ASN B CA    1 
ATOM   4774  C C     . ASN B 1 206 ? 8.605   6.355   8.029    1.00 37.08 ? 206 ASN B C     1 
ATOM   4775  O O     . ASN B 1 206 ? 8.873   5.355   7.344    1.00 35.72 ? 206 ASN B O     1 
ATOM   4776  C CB    . ASN B 1 206 ? 9.611   6.493   10.327   1.00 37.69 ? 206 ASN B CB    1 
ATOM   4777  C CG    . ASN B 1 206 ? 9.389   6.375   11.826   1.00 38.55 ? 206 ASN B CG    1 
ATOM   4778  O OD1   . ASN B 1 206 ? 10.251  5.883   12.538   1.00 40.53 ? 206 ASN B OD1   1 
ATOM   4779  N ND2   . ASN B 1 206 ? 8.223   6.807   12.307   1.00 36.92 ? 206 ASN B ND2   1 
ATOM   4780  N N     . SER B 1 207 ? 8.530   7.591   7.536    1.00 37.51 ? 207 SER B N     1 
ATOM   4781  C CA    . SER B 1 207 ? 8.877   7.912   6.151    1.00 38.04 ? 207 SER B CA    1 
ATOM   4782  C C     . SER B 1 207 ? 9.875   9.065   5.979    1.00 39.09 ? 207 SER B C     1 
ATOM   4783  O O     . SER B 1 207 ? 9.921   9.997   6.791    1.00 39.48 ? 207 SER B O     1 
ATOM   4784  C CB    . SER B 1 207 ? 7.603   8.220   5.366    1.00 37.71 ? 207 SER B CB    1 
ATOM   4785  O OG    . SER B 1 207 ? 6.822   7.057   5.244    1.00 35.92 ? 207 SER B OG    1 
ATOM   4786  N N     . LEU B 1 208 ? 10.625  9.042   4.874    1.00 39.56 ? 208 LEU B N     1 
ATOM   4787  C CA    . LEU B 1 208 ? 11.578  10.097  4.548    1.00 40.08 ? 208 LEU B CA    1 
ATOM   4788  C C     . LEU B 1 208 ? 10.863  11.393  4.194    1.00 39.85 ? 208 LEU B C     1 
ATOM   4789  O O     . LEU B 1 208 ? 9.715   11.388  3.814    1.00 40.09 ? 208 LEU B O     1 
ATOM   4790  C CB    . LEU B 1 208 ? 12.481  9.680   3.398    1.00 40.45 ? 208 LEU B CB    1 
ATOM   4791  C CG    . LEU B 1 208 ? 13.923  9.270   3.698    1.00 42.12 ? 208 LEU B CG    1 
ATOM   4792  C CD1   . LEU B 1 208 ? 14.624  9.043   2.371    1.00 43.41 ? 208 LEU B CD1   1 
ATOM   4793  C CD2   . LEU B 1 208 ? 14.685  10.303  4.533    1.00 41.10 ? 208 LEU B CD2   1 
ATOM   4794  N N     . THR B 1 209 ? 11.531  12.518  4.349    1.00 39.53 ? 209 THR B N     1 
ATOM   4795  C CA    . THR B 1 209 ? 10.903  13.751  3.964    1.00 39.37 ? 209 THR B CA    1 
ATOM   4796  C C     . THR B 1 209 ? 11.409  14.089  2.586    1.00 39.74 ? 209 THR B C     1 
ATOM   4797  O O     . THR B 1 209 ? 12.292  13.391  2.041    1.00 40.38 ? 209 THR B O     1 
ATOM   4798  C CB    . THR B 1 209 ? 11.124  14.921  4.993    1.00 40.01 ? 209 THR B CB    1 
ATOM   4799  O OG1   . THR B 1 209 ? 12.505  15.038  5.356    1.00 36.69 ? 209 THR B OG1   1 
ATOM   4800  C CG2   . THR B 1 209 ? 10.257  14.722  6.236    1.00 38.07 ? 209 THR B CG2   1 
ATOM   4801  N N     . SER B 1 210 ? 10.824  15.134  2.017    1.00 39.13 ? 210 SER B N     1 
ATOM   4802  C CA    . SER B 1 210 ? 11.266  15.700  0.747    1.00 38.90 ? 210 SER B CA    1 
ATOM   4803  C C     . SER B 1 210 ? 12.665  16.371  0.802    1.00 38.49 ? 210 SER B C     1 
ATOM   4804  O O     . SER B 1 210 ? 13.538  16.063  -0.004   1.00 39.21 ? 210 SER B O     1 
ATOM   4805  C CB    . SER B 1 210 ? 10.223  16.666  0.201    1.00 37.22 ? 210 SER B CB    1 
ATOM   4806  O OG    . SER B 1 210 ? 10.654  17.066  -1.085   1.00 40.39 ? 210 SER B OG    1 
ATOM   4807  N N     . GLU B 1 211 ? 12.846  17.304  1.727    1.00 38.34 ? 211 GLU B N     1 
ATOM   4808  C CA    . GLU B 1 211 ? 14.128  17.990  1.958    1.00 38.94 ? 211 GLU B CA    1 
ATOM   4809  C C     . GLU B 1 211 ? 15.238  16.959  2.184    1.00 38.35 ? 211 GLU B C     1 
ATOM   4810  O O     . GLU B 1 211 ? 16.332  17.065  1.625    1.00 38.26 ? 211 GLU B O     1 
ATOM   4811  C CB    . GLU B 1 211 ? 14.023  18.993  3.140    1.00 38.16 ? 211 GLU B CB    1 
ATOM   4812  C CG    . GLU B 1 211 ? 12.866  20.056  3.001    1.00 42.31 ? 211 GLU B CG    1 
ATOM   4813  C CD    . GLU B 1 211 ? 11.435  19.558  3.472    1.00 47.41 ? 211 GLU B CD    1 
ATOM   4814  O OE1   . GLU B 1 211 ? 11.090  18.328  3.329    1.00 42.75 ? 211 GLU B OE1   1 
ATOM   4815  O OE2   . GLU B 1 211 ? 10.662  20.424  4.011    1.00 49.41 ? 211 GLU B OE2   1 
ATOM   4816  N N     . ARG B 1 212 ? 14.929  15.938  2.975    1.00 38.31 ? 212 ARG B N     1 
ATOM   4817  C CA    . ARG B 1 212 ? 15.874  14.856  3.229    1.00 38.90 ? 212 ARG B CA    1 
ATOM   4818  C C     . ARG B 1 212 ? 16.262  14.057  1.981    1.00 39.63 ? 212 ARG B C     1 
ATOM   4819  O O     . ARG B 1 212 ? 17.453  13.772  1.758    1.00 39.83 ? 212 ARG B O     1 
ATOM   4820  C CB    . ARG B 1 212 ? 15.381  13.948  4.348    1.00 38.44 ? 212 ARG B CB    1 
ATOM   4821  C CG    . ARG B 1 212 ? 15.508  14.597  5.730    1.00 37.81 ? 212 ARG B CG    1 
ATOM   4822  C CD    . ARG B 1 212 ? 15.374  13.530  6.758    1.00 37.91 ? 212 ARG B CD    1 
ATOM   4823  N NE    . ARG B 1 212 ? 15.315  14.074  8.105    1.00 37.22 ? 212 ARG B NE    1 
ATOM   4824  C CZ    . ARG B 1 212 ? 15.342  13.333  9.203    1.00 38.73 ? 212 ARG B CZ    1 
ATOM   4825  N NH1   . ARG B 1 212 ? 15.455  12.006  9.122    1.00 37.59 ? 212 ARG B NH1   1 
ATOM   4826  N NH2   . ARG B 1 212 ? 15.241  13.923  10.391   1.00 41.83 ? 212 ARG B NH2   1 
ATOM   4827  N N     . LYS B 1 213 ? 15.269  13.696  1.172    1.00 39.34 ? 213 LYS B N     1 
ATOM   4828  C CA    . LYS B 1 213 ? 15.578  13.029  -0.043   1.00 38.77 ? 213 LYS B CA    1 
ATOM   4829  C C     . LYS B 1 213 ? 16.526  13.866  -0.910   1.00 38.53 ? 213 LYS B C     1 
ATOM   4830  O O     . LYS B 1 213 ? 17.483  13.312  -1.433   1.00 38.01 ? 213 LYS B O     1 
ATOM   4831  C CB    . LYS B 1 213 ? 14.304  12.617  -0.789   1.00 39.39 ? 213 LYS B CB    1 
ATOM   4832  C CG    . LYS B 1 213 ? 13.578  11.399  -0.206   1.00 38.68 ? 213 LYS B CG    1 
ATOM   4833  C CD    . LYS B 1 213 ? 12.237  11.163  -0.892   1.00 38.37 ? 213 LYS B CD    1 
ATOM   4834  C CE    . LYS B 1 213 ? 11.495  9.970   -0.288   1.00 41.67 ? 213 LYS B CE    1 
ATOM   4835  N NZ    . LYS B 1 213 ? 10.337  9.509   -1.126   1.00 38.67 ? 213 LYS B NZ    1 
ATOM   4836  N N     . LYS B 1 214 ? 16.298  15.181  -1.027   1.00 39.24 ? 214 LYS B N     1 
ATOM   4837  C CA    . LYS B 1 214 ? 17.127  16.040  -1.912   1.00 39.94 ? 214 LYS B CA    1 
ATOM   4838  C C     . LYS B 1 214 ? 18.596  16.004  -1.492   1.00 40.58 ? 214 LYS B C     1 
ATOM   4839  O O     . LYS B 1 214 ? 19.497  15.858  -2.358   1.00 40.86 ? 214 LYS B O     1 
ATOM   4840  C CB    . LYS B 1 214 ? 16.628  17.502  -1.968   1.00 40.65 ? 214 LYS B CB    1 
ATOM   4841  C CG    . LYS B 1 214 ? 15.282  17.784  -2.746   1.00 41.02 ? 214 LYS B CG    1 
ATOM   4842  C CD    . LYS B 1 214 ? 14.782  19.241  -2.491   1.00 40.22 ? 214 LYS B CD    1 
ATOM   4843  C CE    . LYS B 1 214 ? 13.333  19.543  -2.983   1.00 40.06 ? 214 LYS B CE    1 
ATOM   4844  N NZ    . LYS B 1 214 ? 12.206  19.048  -2.093   1.00 40.14 ? 214 LYS B NZ    1 
ATOM   4845  N N     . GLU B 1 215 ? 18.816  16.113  -0.173   1.00 40.61 ? 215 GLU B N     1 
ATOM   4846  C CA    . GLU B 1 215 ? 20.139  16.068  0.475    1.00 41.73 ? 215 GLU B CA    1 
ATOM   4847  C C     . GLU B 1 215 ? 20.801  14.729  0.331    1.00 41.25 ? 215 GLU B C     1 
ATOM   4848  O O     . GLU B 1 215 ? 21.989  14.665  -0.031   1.00 41.67 ? 215 GLU B O     1 
ATOM   4849  C CB    . GLU B 1 215 ? 20.047  16.320  1.989    1.00 41.52 ? 215 GLU B CB    1 
ATOM   4850  C CG    . GLU B 1 215 ? 19.684  17.716  2.434    1.00 43.88 ? 215 GLU B CG    1 
ATOM   4851  C CD    . GLU B 1 215 ? 19.709  17.862  3.947    1.00 45.18 ? 215 GLU B CD    1 
ATOM   4852  O OE1   . GLU B 1 215 ? 18.615  17.753  4.581    1.00 49.92 ? 215 GLU B OE1   1 
ATOM   4853  O OE2   . GLU B 1 215 ? 20.830  18.044  4.497    1.00 50.99 ? 215 GLU B OE2   1 
ATOM   4854  N N     . ILE B 1 216 ? 20.081  13.662  0.672    1.00 40.41 ? 216 ILE B N     1 
ATOM   4855  C CA    . ILE B 1 216 ? 20.653  12.330  0.451    1.00 39.63 ? 216 ILE B CA    1 
ATOM   4856  C C     . ILE B 1 216 ? 21.148  12.258  -1.000   1.00 40.02 ? 216 ILE B C     1 
ATOM   4857  O O     . ILE B 1 216 ? 22.305  11.904  -1.254   1.00 39.77 ? 216 ILE B O     1 
ATOM   4858  C CB    . ILE B 1 216 ? 19.683  11.187  0.802    1.00 39.51 ? 216 ILE B CB    1 
ATOM   4859  C CG1   . ILE B 1 216 ? 19.781  10.887  2.291    1.00 37.98 ? 216 ILE B CG1   1 
ATOM   4860  C CG2   . ILE B 1 216 ? 19.978  9.889   -0.023   1.00 38.31 ? 216 ILE B CG2   1 
ATOM   4861  C CD1   . ILE B 1 216 ? 18.457  10.736  2.936    1.00 40.18 ? 216 ILE B CD1   1 
ATOM   4862  N N     . TYR B 1 217 ? 20.286  12.668  -1.930   1.00 39.46 ? 217 TYR B N     1 
ATOM   4863  C CA    . TYR B 1 217 ? 20.638  12.644  -3.329   1.00 39.43 ? 217 TYR B CA    1 
ATOM   4864  C C     . TYR B 1 217 ? 21.996  13.298  -3.684   1.00 40.42 ? 217 TYR B C     1 
ATOM   4865  O O     . TYR B 1 217 ? 22.718  12.793  -4.540   1.00 40.05 ? 217 TYR B O     1 
ATOM   4866  C CB    . TYR B 1 217 ? 19.521  13.226  -4.202   1.00 37.41 ? 217 TYR B CB    1 
ATOM   4867  C CG    . TYR B 1 217 ? 19.710  12.737  -5.610   1.00 36.88 ? 217 TYR B CG    1 
ATOM   4868  C CD1   . TYR B 1 217 ? 19.322  11.429  -5.955   1.00 32.47 ? 217 TYR B CD1   1 
ATOM   4869  C CD2   . TYR B 1 217 ? 20.365  13.532  -6.590   1.00 35.08 ? 217 TYR B CD2   1 
ATOM   4870  C CE1   . TYR B 1 217 ? 19.514  10.941  -7.223   1.00 33.51 ? 217 TYR B CE1   1 
ATOM   4871  C CE2   . TYR B 1 217 ? 20.548  13.045  -7.892   1.00 33.48 ? 217 TYR B CE2   1 
ATOM   4872  C CZ    . TYR B 1 217 ? 20.109  11.742  -8.191   1.00 34.59 ? 217 TYR B CZ    1 
ATOM   4873  O OH    . TYR B 1 217 ? 20.261  11.200  -9.435   1.00 35.38 ? 217 TYR B OH    1 
ATOM   4874  N N     . GLU B 1 218 ? 22.300  14.424  -3.041   1.00 41.65 ? 218 GLU B N     1 
ATOM   4875  C CA    . GLU B 1 218 ? 23.519  15.187  -3.295   1.00 43.82 ? 218 GLU B CA    1 
ATOM   4876  C C     . GLU B 1 218 ? 24.800  14.496  -2.810   1.00 43.71 ? 218 GLU B C     1 
ATOM   4877  O O     . GLU B 1 218 ? 25.819  14.470  -3.527   1.00 43.67 ? 218 GLU B O     1 
ATOM   4878  C CB    . GLU B 1 218 ? 23.407  16.589  -2.683   1.00 44.35 ? 218 GLU B CB    1 
ATOM   4879  C CG    . GLU B 1 218 ? 22.654  17.568  -3.587   1.00 49.18 ? 218 GLU B CG    1 
ATOM   4880  C CD    . GLU B 1 218 ? 23.551  18.363  -4.526   1.00 55.89 ? 218 GLU B CD    1 
ATOM   4881  O OE1   . GLU B 1 218 ? 24.625  17.845  -4.989   1.00 56.68 ? 218 GLU B OE1   1 
ATOM   4882  O OE2   . GLU B 1 218 ? 23.166  19.538  -4.789   1.00 58.18 ? 218 GLU B OE2   1 
ATOM   4883  N N     . LEU B 1 219 ? 24.727  13.974  -1.588   1.00 43.67 ? 219 LEU B N     1 
ATOM   4884  C CA    . LEU B 1 219 ? 25.701  13.059  -1.028   1.00 43.73 ? 219 LEU B CA    1 
ATOM   4885  C C     . LEU B 1 219 ? 25.911  11.863  -1.949   1.00 44.05 ? 219 LEU B C     1 
ATOM   4886  O O     . LEU B 1 219 ? 27.074  11.417  -2.172   1.00 44.53 ? 219 LEU B O     1 
ATOM   4887  C CB    . LEU B 1 219 ? 25.244  12.591  0.357    1.00 43.59 ? 219 LEU B CB    1 
ATOM   4888  C CG    . LEU B 1 219 ? 25.638  13.471  1.550    1.00 44.85 ? 219 LEU B CG    1 
ATOM   4889  C CD1   . LEU B 1 219 ? 24.811  13.140  2.738    1.00 43.69 ? 219 LEU B CD1   1 
ATOM   4890  C CD2   . LEU B 1 219 ? 27.150  13.365  1.927    1.00 45.59 ? 219 LEU B CD2   1 
ATOM   4891  N N     . ALA B 1 220 ? 24.813  11.335  -2.500   1.00 43.01 ? 220 ALA B N     1 
ATOM   4892  C CA    . ALA B 1 220 ? 24.960  10.204  -3.426   1.00 42.77 ? 220 ALA B CA    1 
ATOM   4893  C C     . ALA B 1 220 ? 25.637  10.636  -4.714   1.00 42.64 ? 220 ALA B C     1 
ATOM   4894  O O     . ALA B 1 220 ? 26.351  9.839   -5.332   1.00 42.81 ? 220 ALA B O     1 
ATOM   4895  C CB    . ALA B 1 220 ? 23.658  9.528   -3.719   1.00 42.54 ? 220 ALA B CB    1 
ATOM   4896  N N     . ARG B 1 221 ? 25.412  11.880  -5.122   1.00 42.31 ? 221 ARG B N     1 
ATOM   4897  C CA    . ARG B 1 221 ? 26.146  12.414  -6.248   1.00 43.28 ? 221 ARG B CA    1 
ATOM   4898  C C     . ARG B 1 221 ? 27.635  12.573  -5.892   1.00 42.84 ? 221 ARG B C     1 
ATOM   4899  O O     . ARG B 1 221 ? 28.510  12.020  -6.566   1.00 42.06 ? 221 ARG B O     1 
ATOM   4900  C CB    . ARG B 1 221 ? 25.547  13.725  -6.723   1.00 44.04 ? 221 ARG B CB    1 
ATOM   4901  C CG    . ARG B 1 221 ? 26.291  14.303  -7.904   1.00 45.78 ? 221 ARG B CG    1 
ATOM   4902  C CD    . ARG B 1 221 ? 25.723  15.674  -8.239   1.00 50.22 ? 221 ARG B CD    1 
ATOM   4903  N NE    . ARG B 1 221 ? 24.416  15.582  -8.879   1.00 51.20 ? 221 ARG B NE    1 
ATOM   4904  C CZ    . ARG B 1 221 ? 23.542  16.584  -8.987   1.00 52.59 ? 221 ARG B CZ    1 
ATOM   4905  N NH1   . ARG B 1 221 ? 23.796  17.792  -8.478   1.00 52.83 ? 221 ARG B NH1   1 
ATOM   4906  N NH2   . ARG B 1 221 ? 22.387  16.370  -9.592   1.00 51.78 ? 221 ARG B NH2   1 
ATOM   4907  N N     . LYS B 1 222 ? 27.889  13.283  -4.793   1.00 42.30 ? 222 LYS B N     1 
ATOM   4908  C CA    . LYS B 1 222 ? 29.223  13.682  -4.393   1.00 41.70 ? 222 LYS B CA    1 
ATOM   4909  C C     . LYS B 1 222 ? 30.093  12.456  -4.172   1.00 41.16 ? 222 LYS B C     1 
ATOM   4910  O O     . LYS B 1 222 ? 31.199  12.363  -4.680   1.00 40.34 ? 222 LYS B O     1 
ATOM   4911  C CB    . LYS B 1 222 ? 29.117  14.533  -3.141   1.00 42.17 ? 222 LYS B CB    1 
ATOM   4912  C CG    . LYS B 1 222 ? 30.400  15.023  -2.594   1.00 42.91 ? 222 LYS B CG    1 
ATOM   4913  C CD    . LYS B 1 222 ? 30.110  15.702  -1.286   1.00 44.76 ? 222 LYS B CD    1 
ATOM   4914  C CE    . LYS B 1 222 ? 31.367  15.943  -0.473   1.00 44.19 ? 222 LYS B CE    1 
ATOM   4915  N NZ    . LYS B 1 222 ? 31.091  17.080  0.452    1.00 46.55 ? 222 LYS B NZ    1 
ATOM   4916  N N     . TYR B 1 223 ? 29.572  11.507  -3.402   1.00 40.96 ? 223 TYR B N     1 
ATOM   4917  C CA    . TYR B 1 223 ? 30.235  10.222  -3.215   1.00 39.92 ? 223 TYR B CA    1 
ATOM   4918  C C     . TYR B 1 223 ? 29.694  9.177   -4.184   1.00 39.50 ? 223 TYR B C     1 
ATOM   4919  O O     . TYR B 1 223 ? 29.803  7.975   -3.941   1.00 39.17 ? 223 TYR B O     1 
ATOM   4920  C CB    . TYR B 1 223 ? 30.070  9.738   -1.772   1.00 40.84 ? 223 TYR B CB    1 
ATOM   4921  C CG    . TYR B 1 223 ? 30.702  10.649  -0.745   1.00 39.91 ? 223 TYR B CG    1 
ATOM   4922  C CD1   . TYR B 1 223 ? 32.060  10.601  -0.492   1.00 42.48 ? 223 TYR B CD1   1 
ATOM   4923  C CD2   . TYR B 1 223 ? 29.935  11.556  -0.027   1.00 39.86 ? 223 TYR B CD2   1 
ATOM   4924  C CE1   . TYR B 1 223 ? 32.642  11.432  0.446    1.00 42.39 ? 223 TYR B CE1   1 
ATOM   4925  C CE2   . TYR B 1 223 ? 30.508  12.391  0.914    1.00 40.87 ? 223 TYR B CE2   1 
ATOM   4926  C CZ    . TYR B 1 223 ? 31.865  12.325  1.145    1.00 43.59 ? 223 TYR B CZ    1 
ATOM   4927  O OH    . TYR B 1 223 ? 32.442  13.147  2.081    1.00 43.28 ? 223 TYR B OH    1 
ATOM   4928  N N     . ASP B 1 224 ? 29.107  9.642   -5.282   1.00 38.94 ? 224 ASP B N     1 
ATOM   4929  C CA    . ASP B 1 224 ? 28.893  8.799   -6.452   1.00 38.94 ? 224 ASP B CA    1 
ATOM   4930  C C     . ASP B 1 224 ? 28.640  7.350   -6.048   1.00 38.22 ? 224 ASP B C     1 
ATOM   4931  O O     . ASP B 1 224 ? 29.337  6.442   -6.489   1.00 38.96 ? 224 ASP B O     1 
ATOM   4932  C CB    . ASP B 1 224 ? 30.087  8.879   -7.397   1.00 39.13 ? 224 ASP B CB    1 
ATOM   4933  C CG    . ASP B 1 224 ? 29.814  8.234   -8.741   1.00 40.28 ? 224 ASP B CG    1 
ATOM   4934  O OD1   . ASP B 1 224 ? 28.903  8.704   -9.455   1.00 43.43 ? 224 ASP B OD1   1 
ATOM   4935  O OD2   . ASP B 1 224 ? 30.459  7.253   -9.168   1.00 41.39 ? 224 ASP B OD2   1 
ATOM   4936  N N     . PHE B 1 225 ? 27.638  7.143   -5.212   1.00 36.51 ? 225 PHE B N     1 
ATOM   4937  C CA    . PHE B 1 225 ? 27.055  5.841   -5.066   1.00 34.17 ? 225 PHE B CA    1 
ATOM   4938  C C     . PHE B 1 225 ? 25.654  5.795   -5.628   1.00 32.73 ? 225 PHE B C     1 
ATOM   4939  O O     . PHE B 1 225 ? 25.048  6.812   -5.913   1.00 32.50 ? 225 PHE B O     1 
ATOM   4940  C CB    . PHE B 1 225 ? 27.081  5.377   -3.614   1.00 34.57 ? 225 PHE B CB    1 
ATOM   4941  C CG    . PHE B 1 225 ? 26.562  6.379   -2.635   1.00 34.08 ? 225 PHE B CG    1 
ATOM   4942  C CD1   . PHE B 1 225 ? 25.253  6.331   -2.207   1.00 33.84 ? 225 PHE B CD1   1 
ATOM   4943  C CD2   . PHE B 1 225 ? 27.389  7.349   -2.114   1.00 35.69 ? 225 PHE B CD2   1 
ATOM   4944  C CE1   . PHE B 1 225 ? 24.782  7.239   -1.302   1.00 36.11 ? 225 PHE B CE1   1 
ATOM   4945  C CE2   . PHE B 1 225 ? 26.926  8.251   -1.202   1.00 36.21 ? 225 PHE B CE2   1 
ATOM   4946  C CZ    . PHE B 1 225 ? 25.622  8.198   -0.795   1.00 36.29 ? 225 PHE B CZ    1 
ATOM   4947  N N     . LEU B 1 226 ? 25.154  4.588   -5.782   1.00 31.08 ? 226 LEU B N     1 
ATOM   4948  C CA    . LEU B 1 226 ? 23.787  4.362   -6.175   1.00 29.00 ? 226 LEU B CA    1 
ATOM   4949  C C     . LEU B 1 226 ? 22.861  4.494   -4.971   1.00 29.05 ? 226 LEU B C     1 
ATOM   4950  O O     . LEU B 1 226 ? 23.231  4.162   -3.862   1.00 27.10 ? 226 LEU B O     1 
ATOM   4951  C CB    . LEU B 1 226 ? 23.676  2.970   -6.779   1.00 29.52 ? 226 LEU B CB    1 
ATOM   4952  C CG    . LEU B 1 226 ? 23.739  2.761   -8.286   1.00 25.66 ? 226 LEU B CG    1 
ATOM   4953  C CD1   . LEU B 1 226 ? 24.381  3.865   -9.018   1.00 28.23 ? 226 LEU B CD1   1 
ATOM   4954  C CD2   . LEU B 1 226 ? 24.357  1.475   -8.610   1.00 22.05 ? 226 LEU B CD2   1 
ATOM   4955  N N     . ILE B 1 227 ? 21.661  4.994   -5.208   1.00 28.26 ? 227 ILE B N     1 
ATOM   4956  C CA    . ILE B 1 227 ? 20.574  4.893   -4.251   1.00 28.04 ? 227 ILE B CA    1 
ATOM   4957  C C     . ILE B 1 227 ? 19.675  3.725   -4.584   1.00 28.27 ? 227 ILE B C     1 
ATOM   4958  O O     . ILE B 1 227 ? 19.061  3.706   -5.636   1.00 27.85 ? 227 ILE B O     1 
ATOM   4959  C CB    . ILE B 1 227 ? 19.742  6.184   -4.266   1.00 28.67 ? 227 ILE B CB    1 
ATOM   4960  C CG1   . ILE B 1 227 ? 20.606  7.384   -3.919   1.00 29.99 ? 227 ILE B CG1   1 
ATOM   4961  C CG2   . ILE B 1 227 ? 18.579  6.082   -3.313   1.00 27.78 ? 227 ILE B CG2   1 
ATOM   4962  C CD1   . ILE B 1 227 ? 19.865  8.464   -3.222   1.00 31.63 ? 227 ILE B CD1   1 
ATOM   4963  N N     . ILE B 1 228 ? 19.570  2.757   -3.684   1.00 28.10 ? 228 ILE B N     1 
ATOM   4964  C CA    . ILE B 1 228 ? 18.512  1.751   -3.864   1.00 29.07 ? 228 ILE B CA    1 
ATOM   4965  C C     . ILE B 1 228 ? 17.256  2.089   -3.069   1.00 28.62 ? 228 ILE B C     1 
ATOM   4966  O O     . ILE B 1 228 ? 17.244  2.035   -1.823   1.00 27.51 ? 228 ILE B O     1 
ATOM   4967  C CB    . ILE B 1 228 ? 18.898  0.280   -3.618   1.00 29.96 ? 228 ILE B CB    1 
ATOM   4968  C CG1   . ILE B 1 228 ? 20.178  -0.108  -4.357   1.00 31.04 ? 228 ILE B CG1   1 
ATOM   4969  C CG2   . ILE B 1 228 ? 17.728  -0.665  -4.105   1.00 29.06 ? 228 ILE B CG2   1 
ATOM   4970  C CD1   . ILE B 1 228 ? 20.569  -1.581  -4.123   1.00 29.24 ? 228 ILE B CD1   1 
ATOM   4971  N N     . GLU B 1 229 ? 16.221  2.447   -3.820   1.00 28.38 ? 229 GLU B N     1 
ATOM   4972  C CA    . GLU B 1 229 ? 14.914  2.839   -3.285   1.00 28.57 ? 229 GLU B CA    1 
ATOM   4973  C C     . GLU B 1 229 ? 13.906  1.686   -3.284   1.00 28.97 ? 229 GLU B C     1 
ATOM   4974  O O     . GLU B 1 229 ? 13.207  1.441   -4.304   1.00 27.19 ? 229 GLU B O     1 
ATOM   4975  C CB    . GLU B 1 229 ? 14.365  3.951   -4.158   1.00 29.51 ? 229 GLU B CB    1 
ATOM   4976  C CG    . GLU B 1 229 ? 13.064  4.575   -3.748   1.00 27.88 ? 229 GLU B CG    1 
ATOM   4977  C CD    . GLU B 1 229 ? 12.684  5.781   -4.645   1.00 28.26 ? 229 GLU B CD    1 
ATOM   4978  O OE1   . GLU B 1 229 ? 12.553  5.653   -5.897   1.00 22.97 ? 229 GLU B OE1   1 
ATOM   4979  O OE2   . GLU B 1 229 ? 12.515  6.868   -4.069   1.00 30.38 ? 229 GLU B OE2   1 
ATOM   4980  N N     . ASP B 1 230 ? 13.797  1.006   -2.129   1.00 28.90 ? 230 ASP B N     1 
ATOM   4981  C CA    . ASP B 1 230 ? 12.798  -0.086  -1.989   1.00 28.15 ? 230 ASP B CA    1 
ATOM   4982  C C     . ASP B 1 230 ? 11.501  0.533   -1.494   1.00 28.24 ? 230 ASP B C     1 
ATOM   4983  O O     . ASP B 1 230 ? 11.437  0.928   -0.318   1.00 27.89 ? 230 ASP B O     1 
ATOM   4984  C CB    . ASP B 1 230 ? 13.354  -1.189  -1.074   1.00 27.19 ? 230 ASP B CB    1 
ATOM   4985  C CG    . ASP B 1 230 ? 12.447  -2.412  -0.965   1.00 27.55 ? 230 ASP B CG    1 
ATOM   4986  O OD1   . ASP B 1 230 ? 11.342  -2.389  -1.595   1.00 25.91 ? 230 ASP B OD1   1 
ATOM   4987  O OD2   . ASP B 1 230 ? 12.833  -3.372  -0.211   1.00 22.05 ? 230 ASP B OD2   1 
ATOM   4988  N N     . ASP B 1 231 ? 10.488  0.674   -2.390   1.00 28.29 ? 231 ASP B N     1 
ATOM   4989  C CA    . ASP B 1 231 ? 9.267   1.487   -2.082   1.00 27.32 ? 231 ASP B CA    1 
ATOM   4990  C C     . ASP B 1 231 ? 7.921   0.705   -2.174   1.00 28.41 ? 231 ASP B C     1 
ATOM   4991  O O     . ASP B 1 231 ? 6.898   1.141   -2.837   1.00 25.17 ? 231 ASP B O     1 
ATOM   4992  C CB    . ASP B 1 231 ? 9.271   2.742   -2.945   1.00 27.44 ? 231 ASP B CB    1 
ATOM   4993  C CG    . ASP B 1 231 ? 8.737   3.982   -2.240   1.00 27.34 ? 231 ASP B CG    1 
ATOM   4994  O OD1   . ASP B 1 231 ? 8.204   3.939   -1.076   1.00 27.05 ? 231 ASP B OD1   1 
ATOM   4995  O OD2   . ASP B 1 231 ? 8.874   5.041   -2.898   1.00 21.88 ? 231 ASP B OD2   1 
ATOM   4996  N N     . PRO B 1 232 ? 7.889   -0.445  -1.458   1.00 28.79 ? 232 PRO B N     1 
ATOM   4997  C CA    . PRO B 1 232 ? 6.784   -1.381  -1.508   1.00 28.85 ? 232 PRO B CA    1 
ATOM   4998  C C     . PRO B 1 232 ? 5.495   -0.755  -0.985   1.00 29.24 ? 232 PRO B C     1 
ATOM   4999  O O     . PRO B 1 232 ? 4.418   -1.262  -1.274   1.00 29.18 ? 232 PRO B O     1 
ATOM   5000  C CB    . PRO B 1 232 ? 7.247   -2.493  -0.554   1.00 29.18 ? 232 PRO B CB    1 
ATOM   5001  C CG    . PRO B 1 232 ? 8.091   -1.815  0.452    1.00 28.06 ? 232 PRO B CG    1 
ATOM   5002  C CD    . PRO B 1 232 ? 8.896   -0.885  -0.476   1.00 30.29 ? 232 PRO B CD    1 
ATOM   5003  N N     . TYR B 1 233 ? 5.625   0.351   -0.227   1.00 28.70 ? 233 TYR B N     1 
ATOM   5004  C CA    . TYR B 1 233 ? 4.536   0.946   0.547    1.00 27.03 ? 233 TYR B CA    1 
ATOM   5005  C C     . TYR B 1 233 ? 4.247   2.357   0.044    1.00 27.37 ? 233 TYR B C     1 
ATOM   5006  O O     . TYR B 1 233 ? 3.754   3.186   0.774    1.00 27.95 ? 233 TYR B O     1 
ATOM   5007  C CB    . TYR B 1 233 ? 4.947   1.043   2.044    1.00 27.98 ? 233 TYR B CB    1 
ATOM   5008  C CG    . TYR B 1 233 ? 5.209   -0.274  2.795    1.00 25.32 ? 233 TYR B CG    1 
ATOM   5009  C CD1   . TYR B 1 233 ? 4.167   -1.138  3.048    1.00 25.87 ? 233 TYR B CD1   1 
ATOM   5010  C CD2   . TYR B 1 233 ? 6.460   -0.614  3.290    1.00 26.10 ? 233 TYR B CD2   1 
ATOM   5011  C CE1   . TYR B 1 233 ? 4.330   -2.331  3.718    1.00 27.57 ? 233 TYR B CE1   1 
ATOM   5012  C CE2   . TYR B 1 233 ? 6.662   -1.884  4.007    1.00 25.04 ? 233 TYR B CE2   1 
ATOM   5013  C CZ    . TYR B 1 233 ? 5.552   -2.710  4.182    1.00 29.74 ? 233 TYR B CZ    1 
ATOM   5014  O OH    . TYR B 1 233 ? 5.538   -3.910  4.870    1.00 33.62 ? 233 TYR B OH    1 
ATOM   5015  N N     . TYR B 1 234 ? 4.627   2.649   -1.185   1.00 27.21 ? 234 TYR B N     1 
ATOM   5016  C CA    . TYR B 1 234 ? 4.421   3.933   -1.803   1.00 26.80 ? 234 TYR B CA    1 
ATOM   5017  C C     . TYR B 1 234 ? 2.943   4.261   -2.078   1.00 26.68 ? 234 TYR B C     1 
ATOM   5018  O O     . TYR B 1 234 ? 2.535   5.438   -2.041   1.00 25.78 ? 234 TYR B O     1 
ATOM   5019  C CB    . TYR B 1 234 ? 5.212   3.959   -3.105   1.00 27.44 ? 234 TYR B CB    1 
ATOM   5020  C CG    . TYR B 1 234 ? 4.997   5.165   -3.938   1.00 27.93 ? 234 TYR B CG    1 
ATOM   5021  C CD1   . TYR B 1 234 ? 5.597   6.391   -3.605   1.00 28.49 ? 234 TYR B CD1   1 
ATOM   5022  C CD2   . TYR B 1 234 ? 4.171   5.111   -5.059   1.00 29.23 ? 234 TYR B CD2   1 
ATOM   5023  C CE1   . TYR B 1 234 ? 5.376   7.559   -4.402   1.00 26.72 ? 234 TYR B CE1   1 
ATOM   5024  C CE2   . TYR B 1 234 ? 3.914   6.257   -5.836   1.00 26.52 ? 234 TYR B CE2   1 
ATOM   5025  C CZ    . TYR B 1 234 ? 4.535   7.464   -5.520   1.00 28.78 ? 234 TYR B CZ    1 
ATOM   5026  O OH    . TYR B 1 234 ? 4.288   8.568   -6.320   1.00 27.36 ? 234 TYR B OH    1 
ATOM   5027  N N     . PHE B 1 235 ? 2.127   3.254   -2.378   1.00 26.70 ? 235 PHE B N     1 
ATOM   5028  C CA    . PHE B 1 235 ? 0.716   3.563   -2.540   1.00 27.16 ? 235 PHE B CA    1 
ATOM   5029  C C     . PHE B 1 235 ? -0.021  3.361   -1.237   1.00 28.50 ? 235 PHE B C     1 
ATOM   5030  O O     . PHE B 1 235 ? -1.240  3.313   -1.237   1.00 27.99 ? 235 PHE B O     1 
ATOM   5031  C CB    . PHE B 1 235 ? 0.078   2.783   -3.692   1.00 27.09 ? 235 PHE B CB    1 
ATOM   5032  C CG    . PHE B 1 235 ? 0.755   2.985   -5.024   1.00 23.58 ? 235 PHE B CG    1 
ATOM   5033  C CD1   . PHE B 1 235 ? 1.732   2.093   -5.455   1.00 22.79 ? 235 PHE B CD1   1 
ATOM   5034  C CD2   . PHE B 1 235 ? 0.380   4.026   -5.871   1.00 25.48 ? 235 PHE B CD2   1 
ATOM   5035  C CE1   . PHE B 1 235 ? 2.389   2.235   -6.688   1.00 12.97 ? 235 PHE B CE1   1 
ATOM   5036  C CE2   . PHE B 1 235 ? 1.025   4.193   -7.139   1.00 23.10 ? 235 PHE B CE2   1 
ATOM   5037  C CZ    . PHE B 1 235 ? 2.033   3.267   -7.523   1.00 22.13 ? 235 PHE B CZ    1 
ATOM   5038  N N     . LEU B 1 236 ? 0.708   3.219   -0.115   1.00 30.27 ? 236 LEU B N     1 
ATOM   5039  C CA    . LEU B 1 236 ? 0.011   3.143   1.184    1.00 32.11 ? 236 LEU B CA    1 
ATOM   5040  C C     . LEU B 1 236 ? 0.281   4.339   2.077    1.00 33.99 ? 236 LEU B C     1 
ATOM   5041  O O     . LEU B 1 236 ? 0.132   4.275   3.310    1.00 34.23 ? 236 LEU B O     1 
ATOM   5042  C CB    . LEU B 1 236 ? 0.265   1.840   1.922    1.00 31.83 ? 236 LEU B CB    1 
ATOM   5043  C CG    . LEU B 1 236 ? -0.686  0.659   1.770    1.00 31.24 ? 236 LEU B CG    1 
ATOM   5044  C CD1   . LEU B 1 236 ? -0.786  0.289   0.351    1.00 31.69 ? 236 LEU B CD1   1 
ATOM   5045  C CD2   . LEU B 1 236 ? -0.204  -0.536  2.587    1.00 30.50 ? 236 LEU B CD2   1 
ATOM   5046  N N     . GLN B 1 237 ? 0.634   5.441   1.427    1.00 35.14 ? 237 GLN B N     1 
ATOM   5047  C CA    . GLN B 1 237 ? 0.807   6.720   2.098    1.00 36.04 ? 237 GLN B CA    1 
ATOM   5048  C C     . GLN B 1 237 ? -0.506  7.347   2.571    1.00 37.06 ? 237 GLN B C     1 
ATOM   5049  O O     . GLN B 1 237 ? -1.389  7.611   1.766    1.00 38.65 ? 237 GLN B O     1 
ATOM   5050  C CB    . GLN B 1 237 ? 1.540   7.660   1.163    1.00 35.32 ? 237 GLN B CB    1 
ATOM   5051  C CG    . GLN B 1 237 ? 2.986   7.241   0.929    1.00 34.89 ? 237 GLN B CG    1 
ATOM   5052  C CD    . GLN B 1 237 ? 3.749   8.244   0.103    1.00 34.60 ? 237 GLN B CD    1 
ATOM   5053  O OE1   . GLN B 1 237 ? 4.104   7.992   -1.062   1.00 31.93 ? 237 GLN B OE1   1 
ATOM   5054  N NE2   . GLN B 1 237 ? 4.027   9.388   0.707    1.00 33.58 ? 237 GLN B NE2   1 
ATOM   5055  N N     . PHE B 1 238 ? -0.603  7.644   3.870    1.00 37.87 ? 238 PHE B N     1 
ATOM   5056  C CA    . PHE B 1 238 ? -1.814  8.205   4.483    1.00 37.46 ? 238 PHE B CA    1 
ATOM   5057  C C     . PHE B 1 238 ? -1.994  9.691   4.253    1.00 38.96 ? 238 PHE B C     1 
ATOM   5058  O O     . PHE B 1 238 ? -3.119  10.210  4.363    1.00 38.95 ? 238 PHE B O     1 
ATOM   5059  C CB    . PHE B 1 238 ? -1.842  7.951   5.988    1.00 36.86 ? 238 PHE B CB    1 
ATOM   5060  C CG    . PHE B 1 238 ? -1.437  6.583   6.369    1.00 34.55 ? 238 PHE B CG    1 
ATOM   5061  C CD1   . PHE B 1 238 ? -0.441  6.394   7.338    1.00 32.91 ? 238 PHE B CD1   1 
ATOM   5062  C CD2   . PHE B 1 238 ? -2.024  5.476   5.754    1.00 29.00 ? 238 PHE B CD2   1 
ATOM   5063  C CE1   . PHE B 1 238 ? -0.052  5.107   7.694    1.00 32.17 ? 238 PHE B CE1   1 
ATOM   5064  C CE2   . PHE B 1 238 ? -1.638  4.193   6.098    1.00 31.31 ? 238 PHE B CE2   1 
ATOM   5065  C CZ    . PHE B 1 238 ? -0.634  4.003   7.064    1.00 33.32 ? 238 PHE B CZ    1 
ATOM   5066  N N     . ASN B 1 239 ? -0.879  10.364  3.969    1.00 40.23 ? 239 ASN B N     1 
ATOM   5067  C CA    . ASN B 1 239 ? -0.843  11.748  3.514    1.00 41.43 ? 239 ASN B CA    1 
ATOM   5068  C C     . ASN B 1 239 ? -1.248  11.941  2.046    1.00 41.65 ? 239 ASN B C     1 
ATOM   5069  O O     . ASN B 1 239 ? -0.844  11.153  1.190    1.00 41.21 ? 239 ASN B O     1 
ATOM   5070  C CB    . ASN B 1 239 ? 0.574   12.253  3.684    1.00 41.57 ? 239 ASN B CB    1 
ATOM   5071  C CG    . ASN B 1 239 ? 0.637   13.743  3.768    1.00 43.82 ? 239 ASN B CG    1 
ATOM   5072  O OD1   . ASN B 1 239 ? -0.312  14.462  3.347    1.00 44.63 ? 239 ASN B OD1   1 
ATOM   5073  N ND2   . ASN B 1 239 ? 1.738   14.246  4.349    1.00 44.33 ? 239 ASN B ND2   1 
ATOM   5074  N N     . LYS B 1 240 ? -2.027  12.980  1.737    1.00 43.06 ? 240 LYS B N     1 
ATOM   5075  C CA    . LYS B 1 240 ? -2.621  13.064  0.383    1.00 43.37 ? 240 LYS B CA    1 
ATOM   5076  C C     . LYS B 1 240 ? -1.574  13.442  -0.629   1.00 43.55 ? 240 LYS B C     1 
ATOM   5077  O O     . LYS B 1 240 ? -1.457  12.787  -1.677   1.00 42.88 ? 240 LYS B O     1 
ATOM   5078  C CB    . LYS B 1 240 ? -3.877  13.941  0.300    1.00 44.60 ? 240 LYS B CB    1 
ATOM   5079  C CG    . LYS B 1 240 ? -5.166  13.260  0.885    1.00 46.12 ? 240 LYS B CG    1 
ATOM   5080  C CD    . LYS B 1 240 ? -5.864  12.274  -0.075   1.00 48.79 ? 240 LYS B CD    1 
ATOM   5081  C CE    . LYS B 1 240 ? -6.839  11.294  0.643    1.00 48.52 ? 240 LYS B CE    1 
ATOM   5082  N NZ    . LYS B 1 240 ? -6.232  9.949   1.077    1.00 49.91 ? 240 LYS B NZ    1 
ATOM   5083  N N     . PHE B 1 241 ? -0.791  14.472  -0.297   1.00 43.11 ? 241 PHE B N     1 
ATOM   5084  C CA    . PHE B 1 241 ? 0.368   14.839  -1.097   1.00 42.91 ? 241 PHE B CA    1 
ATOM   5085  C C     . PHE B 1 241 ? 1.428   13.748  -0.922   1.00 40.86 ? 241 PHE B C     1 
ATOM   5086  O O     . PHE B 1 241 ? 2.018   13.639  0.155    1.00 40.58 ? 241 PHE B O     1 
ATOM   5087  C CB    . PHE B 1 241 ? 0.942   16.187  -0.640   1.00 45.22 ? 241 PHE B CB    1 
ATOM   5088  C CG    . PHE B 1 241 ? 0.330   17.409  -1.316   1.00 48.71 ? 241 PHE B CG    1 
ATOM   5089  C CD1   . PHE B 1 241 ? -1.073  17.648  -1.284   1.00 53.72 ? 241 PHE B CD1   1 
ATOM   5090  C CD2   . PHE B 1 241 ? 1.164   18.364  -1.937   1.00 51.20 ? 241 PHE B CD2   1 
ATOM   5091  C CE1   . PHE B 1 241 ? -1.642  18.799  -1.893   1.00 50.47 ? 241 PHE B CE1   1 
ATOM   5092  C CE2   . PHE B 1 241 ? 0.618   19.520  -2.535   1.00 52.68 ? 241 PHE B CE2   1 
ATOM   5093  C CZ    . PHE B 1 241 ? -0.799  19.733  -2.512   1.00 51.68 ? 241 PHE B CZ    1 
ATOM   5094  N N     . ARG B 1 242 ? 1.631   12.929  -1.966   1.00 38.28 ? 242 ARG B N     1 
ATOM   5095  C CA    . ARG B 1 242 ? 2.658   11.893  -1.974   1.00 35.68 ? 242 ARG B CA    1 
ATOM   5096  C C     . ARG B 1 242 ? 4.014   12.561  -2.044   1.00 34.78 ? 242 ARG B C     1 
ATOM   5097  O O     . ARG B 1 242 ? 4.211   13.506  -2.846   1.00 34.16 ? 242 ARG B O     1 
ATOM   5098  C CB    . ARG B 1 242 ? 2.497   10.968  -3.179   1.00 35.63 ? 242 ARG B CB    1 
ATOM   5099  C CG    . ARG B 1 242 ? 2.015   9.580   -2.883   1.00 34.47 ? 242 ARG B CG    1 
ATOM   5100  C CD    . ARG B 1 242 ? 1.664   8.827   -4.166   1.00 36.36 ? 242 ARG B CD    1 
ATOM   5101  N NE    . ARG B 1 242 ? 0.289   9.149   -4.531   1.00 32.71 ? 242 ARG B NE    1 
ATOM   5102  C CZ    . ARG B 1 242 ? -0.038  9.792   -5.619   1.00 28.09 ? 242 ARG B CZ    1 
ATOM   5103  N NH1   . ARG B 1 242 ? 0.894   10.070  -6.493   1.00 28.62 ? 242 ARG B NH1   1 
ATOM   5104  N NH2   . ARG B 1 242 ? -1.307  10.084  -5.850   1.00 29.69 ? 242 ARG B NH2   1 
ATOM   5105  N N     . VAL B 1 243 ? 4.936   12.101  -1.201   1.00 33.17 ? 243 VAL B N     1 
ATOM   5106  C CA    . VAL B 1 243 ? 6.313   12.622  -1.192   1.00 32.46 ? 243 VAL B CA    1 
ATOM   5107  C C     . VAL B 1 243 ? 7.040   12.279  -2.498   1.00 32.45 ? 243 VAL B C     1 
ATOM   5108  O O     . VAL B 1 243 ? 6.913   11.155  -2.988   1.00 31.39 ? 243 VAL B O     1 
ATOM   5109  C CB    . VAL B 1 243 ? 7.129   12.030  -0.033   1.00 32.92 ? 243 VAL B CB    1 
ATOM   5110  C CG1   . VAL B 1 243 ? 8.466   12.632  -0.004   1.00 31.32 ? 243 VAL B CG1   1 
ATOM   5111  C CG2   . VAL B 1 243 ? 6.404   12.230  1.344    1.00 31.86 ? 243 VAL B CG2   1 
ATOM   5112  N N     . PRO B 1 244 ? 7.807   13.239  -3.063   1.00 32.94 ? 244 PRO B N     1 
ATOM   5113  C CA    . PRO B 1 244 ? 8.502   12.913  -4.307   1.00 33.05 ? 244 PRO B CA    1 
ATOM   5114  C C     . PRO B 1 244 ? 9.485   11.800  -4.059   1.00 32.77 ? 244 PRO B C     1 
ATOM   5115  O O     . PRO B 1 244 ? 10.066  11.730  -2.952   1.00 32.87 ? 244 PRO B O     1 
ATOM   5116  C CB    . PRO B 1 244 ? 9.249   14.209  -4.679   1.00 32.96 ? 244 PRO B CB    1 
ATOM   5117  C CG    . PRO B 1 244 ? 8.698   15.274  -3.785   1.00 33.73 ? 244 PRO B CG    1 
ATOM   5118  C CD    . PRO B 1 244 ? 8.101   14.612  -2.597   1.00 33.22 ? 244 PRO B CD    1 
ATOM   5119  N N     . THR B 1 245 ? 9.662   10.935  -5.062   1.00 32.39 ? 245 THR B N     1 
ATOM   5120  C CA    . THR B 1 245 ? 10.558  9.759   -4.927   1.00 32.65 ? 245 THR B CA    1 
ATOM   5121  C C     . THR B 1 245 ? 12.022  10.110  -5.194   1.00 32.14 ? 245 THR B C     1 
ATOM   5122  O O     . THR B 1 245 ? 12.292  11.244  -5.640   1.00 33.39 ? 245 THR B O     1 
ATOM   5123  C CB    . THR B 1 245 ? 10.098  8.668   -5.875   1.00 32.96 ? 245 THR B CB    1 
ATOM   5124  O OG1   . THR B 1 245 ? 10.321  9.088   -7.223   1.00 34.30 ? 245 THR B OG1   1 
ATOM   5125  C CG2   . THR B 1 245 ? 8.615   8.449   -5.675   1.00 31.44 ? 245 THR B CG2   1 
ATOM   5126  N N     . PHE B 1 246 ? 12.970  9.187   -4.977   1.00 30.38 ? 246 PHE B N     1 
ATOM   5127  C CA    . PHE B 1 246 ? 14.314  9.443   -5.493   1.00 28.99 ? 246 PHE B CA    1 
ATOM   5128  C C     . PHE B 1 246 ? 14.282  9.402   -7.020   1.00 29.40 ? 246 PHE B C     1 
ATOM   5129  O O     . PHE B 1 246 ? 14.891  10.254  -7.690   1.00 28.83 ? 246 PHE B O     1 
ATOM   5130  C CB    . PHE B 1 246 ? 15.401  8.502   -4.942   1.00 29.17 ? 246 PHE B CB    1 
ATOM   5131  C CG    . PHE B 1 246 ? 15.715  8.688   -3.468   1.00 26.26 ? 246 PHE B CG    1 
ATOM   5132  C CD1   . PHE B 1 246 ? 15.185  7.809   -2.513   1.00 22.75 ? 246 PHE B CD1   1 
ATOM   5133  C CD2   . PHE B 1 246 ? 16.581  9.697   -3.055   1.00 24.52 ? 246 PHE B CD2   1 
ATOM   5134  C CE1   . PHE B 1 246 ? 15.435  7.971   -1.136   1.00 24.61 ? 246 PHE B CE1   1 
ATOM   5135  C CE2   . PHE B 1 246 ? 16.877  9.872   -1.698   1.00 27.00 ? 246 PHE B CE2   1 
ATOM   5136  C CZ    . PHE B 1 246 ? 16.310  9.000   -0.716   1.00 27.08 ? 246 PHE B CZ    1 
ATOM   5137  N N     . LEU B 1 247 ? 13.581  8.406   -7.580   1.00 30.69 ? 247 LEU B N     1 
ATOM   5138  C CA    . LEU B 1 247 ? 13.332  8.330   -9.063   1.00 31.20 ? 247 LEU B CA    1 
ATOM   5139  C C     . LEU B 1 247 ? 13.072  9.673   -9.756   1.00 31.70 ? 247 LEU B C     1 
ATOM   5140  O O     . LEU B 1 247 ? 13.726  9.985   -10.767  1.00 32.34 ? 247 LEU B O     1 
ATOM   5141  C CB    . LEU B 1 247 ? 12.198  7.352   -9.430   1.00 31.10 ? 247 LEU B CB    1 
ATOM   5142  C CG    . LEU B 1 247 ? 12.154  6.969   -10.933  1.00 31.33 ? 247 LEU B CG    1 
ATOM   5143  C CD1   . LEU B 1 247 ? 13.535  6.522   -11.451  1.00 23.79 ? 247 LEU B CD1   1 
ATOM   5144  C CD2   . LEU B 1 247 ? 11.054  5.967   -11.321  1.00 30.51 ? 247 LEU B CD2   1 
ATOM   5145  N N     . SER B 1 248 ? 12.135  10.460  -9.211   1.00 32.19 ? 248 SER B N     1 
ATOM   5146  C CA    . SER B 1 248 ? 11.788  11.802  -9.756   1.00 32.35 ? 248 SER B CA    1 
ATOM   5147  C C     . SER B 1 248 ? 12.867  12.887  -9.630   1.00 32.66 ? 248 SER B C     1 
ATOM   5148  O O     . SER B 1 248 ? 12.728  13.991  -10.171  1.00 32.51 ? 248 SER B O     1 
ATOM   5149  C CB    . SER B 1 248 ? 10.511  12.334  -9.100   1.00 31.99 ? 248 SER B CB    1 
ATOM   5150  O OG    . SER B 1 248 ? 10.741  12.664  -7.746   1.00 31.74 ? 248 SER B OG    1 
ATOM   5151  N N     . MET B 1 249 ? 13.904  12.616  -8.868   1.00 33.66 ? 249 MET B N     1 
ATOM   5152  C CA    . MET B 1 249 ? 14.992  13.592  -8.737   1.00 35.52 ? 249 MET B CA    1 
ATOM   5153  C C     . MET B 1 249 ? 16.312  13.040  -9.296   1.00 35.65 ? 249 MET B C     1 
ATOM   5154  O O     . MET B 1 249 ? 17.377  13.594  -9.065   1.00 37.60 ? 249 MET B O     1 
ATOM   5155  C CB    . MET B 1 249 ? 15.088  14.163  -7.300   1.00 35.31 ? 249 MET B CB    1 
ATOM   5156  C CG    . MET B 1 249 ? 15.053  13.156  -6.148   1.00 36.00 ? 249 MET B CG    1 
ATOM   5157  S SD    . MET B 1 249 ? 14.978  13.883  -4.481   1.00 37.29 ? 249 MET B SD    1 
ATOM   5158  C CE    . MET B 1 249 ? 13.200  14.177  -4.252   1.00 40.67 ? 249 MET B CE    1 
ATOM   5159  N N     . ASP B 1 250 ? 16.204  11.973  -10.078  1.00 35.49 ? 250 ASP B N     1 
ATOM   5160  C CA    . ASP B 1 250 ? 17.338  11.241  -10.577  1.00 35.23 ? 250 ASP B CA    1 
ATOM   5161  C C     . ASP B 1 250 ? 17.891  11.823  -11.895  1.00 36.33 ? 250 ASP B C     1 
ATOM   5162  O O     . ASP B 1 250 ? 17.808  11.214  -12.973  1.00 35.09 ? 250 ASP B O     1 
ATOM   5163  C CB    . ASP B 1 250 ? 16.964  9.750   -10.711  1.00 35.49 ? 250 ASP B CB    1 
ATOM   5164  C CG    . ASP B 1 250 ? 18.162  8.850   -10.950  1.00 32.30 ? 250 ASP B CG    1 
ATOM   5165  O OD1   . ASP B 1 250 ? 19.288  9.174   -10.562  1.00 30.40 ? 250 ASP B OD1   1 
ATOM   5166  O OD2   . ASP B 1 250 ? 17.971  7.783   -11.525  1.00 33.70 ? 250 ASP B OD2   1 
ATOM   5167  N N     . VAL B 1 251 ? 18.496  13.003  -11.789  1.00 36.95 ? 251 VAL B N     1 
ATOM   5168  C CA    . VAL B 1 251 ? 19.114  13.609  -12.953  1.00 37.60 ? 251 VAL B CA    1 
ATOM   5169  C C     . VAL B 1 251 ? 20.350  12.826  -13.366  1.00 37.09 ? 251 VAL B C     1 
ATOM   5170  O O     . VAL B 1 251 ? 20.733  12.875  -14.526  1.00 37.15 ? 251 VAL B O     1 
ATOM   5171  C CB    . VAL B 1 251 ? 19.384  15.134  -12.778  1.00 37.72 ? 251 VAL B CB    1 
ATOM   5172  C CG1   . VAL B 1 251 ? 20.174  15.388  -11.532  1.00 39.11 ? 251 VAL B CG1   1 
ATOM   5173  C CG2   . VAL B 1 251 ? 20.123  15.709  -13.986  1.00 38.42 ? 251 VAL B CG2   1 
ATOM   5174  N N     . ASP B 1 252 ? 20.954  12.061  -12.451  1.00 36.99 ? 252 ASP B N     1 
ATOM   5175  C CA    . ASP B 1 252 ? 22.138  11.224  -12.833  1.00 36.10 ? 252 ASP B CA    1 
ATOM   5176  C C     . ASP B 1 252 ? 21.919  9.806   -13.414  1.00 34.70 ? 252 ASP B C     1 
ATOM   5177  O O     . ASP B 1 252 ? 22.780  9.288   -14.113  1.00 35.97 ? 252 ASP B O     1 
ATOM   5178  C CB    . ASP B 1 252 ? 23.078  11.118  -11.659  1.00 36.73 ? 252 ASP B CB    1 
ATOM   5179  C CG    . ASP B 1 252 ? 23.572  12.448  -11.236  1.00 39.53 ? 252 ASP B CG    1 
ATOM   5180  O OD1   . ASP B 1 252 ? 23.587  13.362  -12.100  1.00 43.70 ? 252 ASP B OD1   1 
ATOM   5181  O OD2   . ASP B 1 252 ? 23.900  12.590  -10.050  1.00 38.44 ? 252 ASP B OD2   1 
ATOM   5182  N N     . GLY B 1 253 ? 20.818  9.148   -13.104  1.00 32.32 ? 253 GLY B N     1 
ATOM   5183  C CA    . GLY B 1 253 ? 20.744  7.750   -13.407  1.00 30.63 ? 253 GLY B CA    1 
ATOM   5184  C C     . GLY B 1 253 ? 21.452  6.897   -12.360  1.00 29.88 ? 253 GLY B C     1 
ATOM   5185  O O     . GLY B 1 253 ? 21.924  5.809   -12.671  1.00 28.91 ? 253 GLY B O     1 
ATOM   5186  N N     . ARG B 1 254 ? 21.482  7.362   -11.115  1.00 29.87 ? 254 ARG B N     1 
ATOM   5187  C CA    . ARG B 1 254 ? 21.998  6.560   -9.998   1.00 30.66 ? 254 ARG B CA    1 
ATOM   5188  C C     . ARG B 1 254 ? 20.900  5.907   -9.121   1.00 31.06 ? 254 ARG B C     1 
ATOM   5189  O O     . ARG B 1 254 ? 21.201  5.436   -7.991   1.00 30.44 ? 254 ARG B O     1 
ATOM   5190  C CB    . ARG B 1 254 ? 22.907  7.423   -9.124   1.00 30.55 ? 254 ARG B CB    1 
ATOM   5191  C CG    . ARG B 1 254 ? 22.241  8.694   -8.597   1.00 31.29 ? 254 ARG B CG    1 
ATOM   5192  C CD    . ARG B 1 254 ? 23.178  9.534   -7.743   1.00 31.62 ? 254 ARG B CD    1 
ATOM   5193  N NE    . ARG B 1 254 ? 24.307  9.976   -8.542   1.00 33.50 ? 254 ARG B NE    1 
ATOM   5194  C CZ    . ARG B 1 254 ? 25.481  9.351   -8.604   1.00 33.81 ? 254 ARG B CZ    1 
ATOM   5195  N NH1   . ARG B 1 254 ? 25.684  8.280   -7.854   1.00 35.05 ? 254 ARG B NH1   1 
ATOM   5196  N NH2   . ARG B 1 254 ? 26.452  9.803   -9.413   1.00 28.42 ? 254 ARG B NH2   1 
ATOM   5197  N N     . VAL B 1 255 ? 19.642  5.895   -9.613   1.00 30.41 ? 255 VAL B N     1 
ATOM   5198  C CA    . VAL B 1 255 ? 18.529  5.343   -8.825   1.00 30.32 ? 255 VAL B CA    1 
ATOM   5199  C C     . VAL B 1 255 ? 17.874  4.089   -9.390   1.00 29.47 ? 255 VAL B C     1 
ATOM   5200  O O     . VAL B 1 255 ? 17.494  4.021   -10.531  1.00 31.66 ? 255 VAL B O     1 
ATOM   5201  C CB    . VAL B 1 255 ? 17.438  6.395   -8.476   1.00 30.77 ? 255 VAL B CB    1 
ATOM   5202  C CG1   . VAL B 1 255 ? 16.327  5.766   -7.632   1.00 30.84 ? 255 VAL B CG1   1 
ATOM   5203  C CG2   . VAL B 1 255 ? 18.039  7.590   -7.692   1.00 31.99 ? 255 VAL B CG2   1 
ATOM   5204  N N     . ILE B 1 256 ? 17.751  3.078   -8.536   1.00 28.60 ? 256 ILE B N     1 
ATOM   5205  C CA    . ILE B 1 256 ? 16.967  1.893   -8.860   1.00 26.69 ? 256 ILE B CA    1 
ATOM   5206  C C     . ILE B 1 256 ? 15.737  1.784   -7.965   1.00 26.50 ? 256 ILE B C     1 
ATOM   5207  O O     . ILE B 1 256 ? 15.843  1.437   -6.788   1.00 24.90 ? 256 ILE B O     1 
ATOM   5208  C CB    . ILE B 1 256 ? 17.828  0.624   -8.733   1.00 26.27 ? 256 ILE B CB    1 
ATOM   5209  C CG1   . ILE B 1 256 ? 19.054  0.718   -9.642   1.00 24.22 ? 256 ILE B CG1   1 
ATOM   5210  C CG2   . ILE B 1 256 ? 17.007  -0.613  -9.064   1.00 29.01 ? 256 ILE B CG2   1 
ATOM   5211  C CD1   . ILE B 1 256 ? 20.182  -0.210  -9.246   1.00 10.11 ? 256 ILE B CD1   1 
ATOM   5212  N N     . ARG B 1 257 ? 14.572  2.083   -8.529   1.00 26.38 ? 257 ARG B N     1 
ATOM   5213  C CA    . ARG B 1 257 ? 13.312  1.926   -7.813   1.00 26.03 ? 257 ARG B CA    1 
ATOM   5214  C C     . ARG B 1 257 ? 12.814  0.486   -7.882   1.00 26.28 ? 257 ARG B C     1 
ATOM   5215  O O     . ARG B 1 257 ? 12.867  -0.150  -8.935   1.00 27.29 ? 257 ARG B O     1 
ATOM   5216  C CB    . ARG B 1 257 ? 12.253  2.875   -8.377   1.00 25.65 ? 257 ARG B CB    1 
ATOM   5217  C CG    . ARG B 1 257 ? 10.829  2.524   -7.977   1.00 27.79 ? 257 ARG B CG    1 
ATOM   5218  C CD    . ARG B 1 257 ? 9.819   3.627   -8.247   1.00 26.95 ? 257 ARG B CD    1 
ATOM   5219  N NE    . ARG B 1 257 ? 9.793   4.619   -7.176   1.00 29.30 ? 257 ARG B NE    1 
ATOM   5220  C CZ    . ARG B 1 257 ? 8.852   4.685   -6.245   1.00 24.34 ? 257 ARG B CZ    1 
ATOM   5221  N NH1   . ARG B 1 257 ? 7.852   3.814   -6.247   1.00 19.28 ? 257 ARG B NH1   1 
ATOM   5222  N NH2   . ARG B 1 257 ? 8.908   5.621   -5.307   1.00 27.31 ? 257 ARG B NH2   1 
ATOM   5223  N N     . ALA B 1 258 ? 12.331  -0.023  -6.754   1.00 26.26 ? 258 ALA B N     1 
ATOM   5224  C CA    . ALA B 1 258 ? 11.502  -1.222  -6.746   1.00 25.63 ? 258 ALA B CA    1 
ATOM   5225  C C     . ALA B 1 258 ? 10.076  -0.904  -6.308   1.00 25.36 ? 258 ALA B C     1 
ATOM   5226  O O     . ALA B 1 258 ? 9.860   -0.276  -5.271   1.00 25.83 ? 258 ALA B O     1 
ATOM   5227  C CB    . ALA B 1 258 ? 12.112  -2.284  -5.845   1.00 25.42 ? 258 ALA B CB    1 
ATOM   5228  N N     . ASP B 1 259 ? 9.106   -1.342  -7.104   1.00 25.21 ? 259 ASP B N     1 
ATOM   5229  C CA    . ASP B 1 259 ? 7.734   -1.114  -6.805   1.00 23.68 ? 259 ASP B CA    1 
ATOM   5230  C C     . ASP B 1 259 ? 7.033   -2.442  -6.652   1.00 25.24 ? 259 ASP B C     1 
ATOM   5231  O O     . ASP B 1 259 ? 7.322   -3.389  -7.359   1.00 25.19 ? 259 ASP B O     1 
ATOM   5232  C CB    . ASP B 1 259 ? 7.144   -0.476  -7.975   1.00 22.56 ? 259 ASP B CB    1 
ATOM   5233  C CG    . ASP B 1 259 ? 7.315   0.959   -7.959   1.00 23.36 ? 259 ASP B CG    1 
ATOM   5234  O OD1   . ASP B 1 259 ? 6.596   1.621   -7.159   1.00 22.10 ? 259 ASP B OD1   1 
ATOM   5235  O OD2   . ASP B 1 259 ? 8.109   1.447   -8.802   1.00 23.81 ? 259 ASP B OD2   1 
ATOM   5236  N N     . SER B 1 260 ? 6.067   -2.503  -5.747   1.00 26.87 ? 260 SER B N     1 
ATOM   5237  C CA    . SER B 1 260 ? 5.371   -3.747  -5.447   1.00 26.73 ? 260 SER B CA    1 
ATOM   5238  C C     . SER B 1 260 ? 3.865   -3.577  -5.698   1.00 26.62 ? 260 SER B C     1 
ATOM   5239  O O     . SER B 1 260 ? 3.336   -2.487  -5.474   1.00 26.82 ? 260 SER B O     1 
ATOM   5240  C CB    . SER B 1 260 ? 5.628   -4.069  -3.992   1.00 25.83 ? 260 SER B CB    1 
ATOM   5241  O OG    . SER B 1 260 ? 5.043   -5.306  -3.653   1.00 29.43 ? 260 SER B OG    1 
ATOM   5242  N N     . PHE B 1 261 ? 3.179   -4.632  -6.133   1.00 26.76 ? 261 PHE B N     1 
ATOM   5243  C CA    . PHE B 1 261 ? 1.709   -4.628  -6.189   1.00 28.03 ? 261 PHE B CA    1 
ATOM   5244  C C     . PHE B 1 261 ? 1.159   -5.472  -5.055   1.00 27.49 ? 261 PHE B C     1 
ATOM   5245  O O     . PHE B 1 261 ? -0.008  -5.888  -5.085   1.00 28.05 ? 261 PHE B O     1 
ATOM   5246  C CB    . PHE B 1 261 ? 1.170   -5.169  -7.531   1.00 29.00 ? 261 PHE B CB    1 
ATOM   5247  C CG    . PHE B 1 261 ? 1.111   -4.130  -8.623   1.00 30.73 ? 261 PHE B CG    1 
ATOM   5248  C CD1   . PHE B 1 261 ? 1.028   -2.747  -8.294   1.00 32.70 ? 261 PHE B CD1   1 
ATOM   5249  C CD2   . PHE B 1 261 ? 1.173   -4.495  -9.963   1.00 28.86 ? 261 PHE B CD2   1 
ATOM   5250  C CE1   . PHE B 1 261 ? 1.024   -1.745  -9.321   1.00 30.54 ? 261 PHE B CE1   1 
ATOM   5251  C CE2   . PHE B 1 261 ? 1.160   -3.511  -11.004  1.00 27.78 ? 261 PHE B CE2   1 
ATOM   5252  C CZ    . PHE B 1 261 ? 1.087   -2.152  -10.684  1.00 30.06 ? 261 PHE B CZ    1 
ATOM   5253  N N     . SER B 1 262 ? 1.997   -5.724  -4.059   1.00 26.32 ? 262 SER B N     1 
ATOM   5254  C CA    . SER B 1 262 ? 1.734   -6.780  -3.063   1.00 25.73 ? 262 SER B CA    1 
ATOM   5255  C C     . SER B 1 262 ? 0.792   -6.363  -1.909   1.00 26.97 ? 262 SER B C     1 
ATOM   5256  O O     . SER B 1 262 ? 0.008   -7.184  -1.408   1.00 26.90 ? 262 SER B O     1 
ATOM   5257  C CB    . SER B 1 262 ? 3.074   -7.357  -2.518   1.00 24.90 ? 262 SER B CB    1 
ATOM   5258  O OG    . SER B 1 262 ? 3.476   -8.524  -3.265   1.00 20.46 ? 262 SER B OG    1 
HETATM 5259  N N1    . LLP B 1 263 ? 9.887   -4.899  0.806    1.00 33.18 ? 263 LLP B N1    1 
HETATM 5260  C C2    . LLP B 1 263 ? 9.261   -4.641  2.009    1.00 32.34 ? 263 LLP B C2    1 
HETATM 5261  C "C2'" . LLP B 1 263 ? 9.996   -3.913  3.095    1.00 29.57 ? 263 LLP B "C2'" 1 
HETATM 5262  C C3    . LLP B 1 263 ? 7.951   -5.057  2.216    1.00 31.83 ? 263 LLP B C3    1 
HETATM 5263  O O3    . LLP B 1 263 ? 7.394   -4.828  3.288    1.00 35.34 ? 263 LLP B O3    1 
HETATM 5264  C C4    . LLP B 1 263 ? 7.272   -5.732  1.209    1.00 31.67 ? 263 LLP B C4    1 
HETATM 5265  C "C4'" . LLP B 1 263 ? 5.857   -6.183  1.427    1.00 30.94 ? 263 LLP B "C4'" 1 
HETATM 5266  C C5    . LLP B 1 263 ? 7.906   -5.988  -0.001   1.00 34.90 ? 263 LLP B C5    1 
HETATM 5267  C C6    . LLP B 1 263 ? 9.217   -5.569  -0.198   1.00 34.46 ? 263 LLP B C6    1 
HETATM 5268  C "C5'" . LLP B 1 263 ? 7.178   -6.716  -1.092   1.00 32.39 ? 263 LLP B "C5'" 1 
HETATM 5269  O OP4   . LLP B 1 263 ? 7.851   -7.757  -1.843   1.00 32.19 ? 263 LLP B OP4   1 
HETATM 5270  P P     . LLP B 1 263 ? 7.092   -8.492  -3.058   1.00 33.16 ? 263 LLP B P     1 
HETATM 5271  O OP1   . LLP B 1 263 ? 6.023   -9.269  -2.393   1.00 28.82 ? 263 LLP B OP1   1 
HETATM 5272  O OP2   . LLP B 1 263 ? 6.604   -7.377  -3.900   1.00 29.50 ? 263 LLP B OP2   1 
HETATM 5273  O OP3   . LLP B 1 263 ? 8.146   -9.318  -3.689   1.00 29.68 ? 263 LLP B OP3   1 
HETATM 5274  N N     . LLP B 1 263 ? 0.878   -5.100  -1.503   1.00 26.89 ? 263 LLP B N     1 
HETATM 5275  C CA    . LLP B 1 263 ? 0.017   -4.573  -0.452   1.00 28.22 ? 263 LLP B CA    1 
HETATM 5276  C CB    . LLP B 1 263 ? 0.719   -3.439  0.297    1.00 28.63 ? 263 LLP B CB    1 
HETATM 5277  C CG    . LLP B 1 263 ? 2.225   -3.610  0.412    1.00 24.04 ? 263 LLP B CG    1 
HETATM 5278  C CD    . LLP B 1 263 ? 2.582   -4.729  1.378    1.00 13.96 ? 263 LLP B CD    1 
HETATM 5279  C CE    . LLP B 1 263 ? 3.712   -5.586  0.835    1.00 15.85 ? 263 LLP B CE    1 
HETATM 5280  N NZ    . LLP B 1 263 ? 5.040   -5.138  1.338    1.00 25.00 ? 263 LLP B NZ    1 
HETATM 5281  C C     . LLP B 1 263 ? -1.310  -4.083  -1.020   1.00 29.72 ? 263 LLP B C     1 
HETATM 5282  O O     . LLP B 1 263 ? -2.238  -3.768  -0.274   1.00 30.19 ? 263 LLP B O     1 
ATOM   5283  N N     . ILE B 1 264 ? -1.393  -4.020  -2.345   1.00 30.23 ? 264 ILE B N     1 
ATOM   5284  C CA    . ILE B 1 264 ? -2.423  -3.232  -3.012   1.00 31.55 ? 264 ILE B CA    1 
ATOM   5285  C C     . ILE B 1 264 ? -3.270  -4.100  -3.936   1.00 33.00 ? 264 ILE B C     1 
ATOM   5286  O O     . ILE B 1 264 ? -4.499  -4.046  -3.899   1.00 34.80 ? 264 ILE B O     1 
ATOM   5287  C CB    . ILE B 1 264 ? -1.788  -2.076  -3.807   1.00 32.27 ? 264 ILE B CB    1 
ATOM   5288  C CG1   . ILE B 1 264 ? -2.262  -2.106  -5.262   1.00 30.92 ? 264 ILE B CG1   1 
ATOM   5289  C CG2   . ILE B 1 264 ? -0.271  -2.151  -3.734   1.00 30.08 ? 264 ILE B CG2   1 
ATOM   5290  C CD1   . ILE B 1 264 ? -1.716  -0.975  -6.105   1.00 34.90 ? 264 ILE B CD1   1 
ATOM   5291  N N     . ILE B 1 265 ? -2.605  -4.900  -4.763   1.00 33.21 ? 265 ILE B N     1 
ATOM   5292  C CA    . ILE B 1 265 ? -3.274  -5.608  -5.847   1.00 32.95 ? 265 ILE B CA    1 
ATOM   5293  C C     . ILE B 1 265 ? -3.301  -7.111  -5.590   1.00 31.67 ? 265 ILE B C     1 
ATOM   5294  O O     . ILE B 1 265 ? -4.369  -7.722  -5.536   1.00 30.30 ? 265 ILE B O     1 
ATOM   5295  C CB    . ILE B 1 265 ? -2.582  -5.314  -7.191   1.00 33.59 ? 265 ILE B CB    1 
ATOM   5296  C CG1   . ILE B 1 265 ? -3.253  -4.128  -7.888   1.00 36.49 ? 265 ILE B CG1   1 
ATOM   5297  C CG2   . ILE B 1 265 ? -2.607  -6.539  -8.084   1.00 33.96 ? 265 ILE B CG2   1 
ATOM   5298  C CD1   . ILE B 1 265 ? -2.282  -3.197  -8.578   1.00 41.06 ? 265 ILE B CD1   1 
ATOM   5299  N N     . SER B 1 266 ? -2.121  -7.701  -5.431   1.00 31.15 ? 266 SER B N     1 
ATOM   5300  C CA    . SER B 1 266 ? -2.008  -9.089  -4.952   1.00 30.60 ? 266 SER B CA    1 
ATOM   5301  C C     . SER B 1 266 ? -0.602  -9.455  -4.578   1.00 30.41 ? 266 SER B C     1 
ATOM   5302  O O     . SER B 1 266 ? 0.318   -9.240  -5.378   1.00 30.03 ? 266 SER B O     1 
ATOM   5303  C CB    . SER B 1 266 ? -2.497  -10.093 -5.973   1.00 30.81 ? 266 SER B CB    1 
ATOM   5304  O OG    . SER B 1 266 ? -1.974  -11.378 -5.666   1.00 29.54 ? 266 SER B OG    1 
ATOM   5305  N N     . SER B 1 267 ? -0.451  -9.996  -3.360   1.00 29.54 ? 267 SER B N     1 
ATOM   5306  C CA    . SER B 1 267 ? 0.817   -10.561 -2.871   1.00 28.58 ? 267 SER B CA    1 
ATOM   5307  C C     . SER B 1 267 ? 1.089   -11.955 -3.452   1.00 28.22 ? 267 SER B C     1 
ATOM   5308  O O     . SER B 1 267 ? 2.277   -12.338 -3.722   1.00 28.42 ? 267 SER B O     1 
ATOM   5309  C CB    . SER B 1 267 ? 0.828   -10.613 -1.351   1.00 28.71 ? 267 SER B CB    1 
ATOM   5310  O OG    . SER B 1 267 ? -0.061  -11.623 -0.871   1.00 31.71 ? 267 SER B OG    1 
ATOM   5311  N N     . GLY B 1 268 ? 0.021   -12.722 -3.649   1.00 26.80 ? 268 GLY B N     1 
ATOM   5312  C CA    . GLY B 1 268 ? 0.136   -14.064 -4.189   1.00 25.88 ? 268 GLY B CA    1 
ATOM   5313  C C     . GLY B 1 268 ? 0.740   -14.079 -5.579   1.00 25.94 ? 268 GLY B C     1 
ATOM   5314  O O     . GLY B 1 268 ? 1.568   -14.931 -5.896   1.00 24.65 ? 268 GLY B O     1 
ATOM   5315  N N     . LEU B 1 269 ? 0.324   -13.130 -6.411   1.00 25.48 ? 269 LEU B N     1 
ATOM   5316  C CA    . LEU B 1 269 ? 0.495   -13.247 -7.854   1.00 25.49 ? 269 LEU B CA    1 
ATOM   5317  C C     . LEU B 1 269 ? 1.959   -13.092 -8.251   1.00 24.78 ? 269 LEU B C     1 
ATOM   5318  O O     . LEU B 1 269 ? 2.324   -13.304 -9.407   1.00 26.60 ? 269 LEU B O     1 
ATOM   5319  C CB    . LEU B 1 269 ? -0.360  -12.207 -8.581   1.00 24.76 ? 269 LEU B CB    1 
ATOM   5320  C CG    . LEU B 1 269 ? -1.860  -12.498 -8.662   1.00 27.23 ? 269 LEU B CG    1 
ATOM   5321  C CD1   . LEU B 1 269 ? -2.573  -11.422 -9.466   1.00 26.32 ? 269 LEU B CD1   1 
ATOM   5322  C CD2   . LEU B 1 269 ? -2.108  -13.874 -9.261   1.00 21.24 ? 269 LEU B CD2   1 
ATOM   5323  N N     . ARG B 1 270 ? 2.793   -12.722 -7.285   1.00 24.92 ? 270 ARG B N     1 
ATOM   5324  C CA    . ARG B 1 270 ? 4.214   -12.517 -7.536   1.00 24.03 ? 270 ARG B CA    1 
ATOM   5325  C C     . ARG B 1 270 ? 4.436   -11.656 -8.776   1.00 24.04 ? 270 ARG B C     1 
ATOM   5326  O O     . ARG B 1 270 ? 4.909   -12.140 -9.803   1.00 23.20 ? 270 ARG B O     1 
ATOM   5327  C CB    . ARG B 1 270 ? 4.930   -13.859 -7.694   1.00 23.01 ? 270 ARG B CB    1 
ATOM   5328  C CG    . ARG B 1 270 ? 4.824   -14.765 -6.478   1.00 21.19 ? 270 ARG B CG    1 
ATOM   5329  C CD    . ARG B 1 270 ? 4.867   -14.030 -5.149   1.00 18.97 ? 270 ARG B CD    1 
ATOM   5330  N NE    . ARG B 1 270 ? 6.176   -13.439 -4.893   1.00 18.74 ? 270 ARG B NE    1 
ATOM   5331  C CZ    . ARG B 1 270 ? 6.365   -12.286 -4.267   1.00 18.60 ? 270 ARG B CZ    1 
ATOM   5332  N NH1   . ARG B 1 270 ? 5.325   -11.590 -3.827   1.00 19.22 ? 270 ARG B NH1   1 
ATOM   5333  N NH2   . ARG B 1 270 ? 7.593   -11.824 -4.078   1.00 24.96 ? 270 ARG B NH2   1 
ATOM   5334  N N     . ILE B 1 271 ? 4.092   -10.378 -8.671   1.00 25.23 ? 271 ILE B N     1 
ATOM   5335  C CA    . ILE B 1 271 ? 4.236   -9.462  -9.773   1.00 26.64 ? 271 ILE B CA    1 
ATOM   5336  C C     . ILE B 1 271 ? 4.601   -8.095  -9.204   1.00 28.59 ? 271 ILE B C     1 
ATOM   5337  O O     . ILE B 1 271 ? 3.818   -7.484  -8.429   1.00 29.43 ? 271 ILE B O     1 
ATOM   5338  C CB    . ILE B 1 271 ? 2.944   -9.377  -10.650  1.00 25.83 ? 271 ILE B CB    1 
ATOM   5339  C CG1   . ILE B 1 271 ? 2.462   -10.787 -11.076  1.00 20.51 ? 271 ILE B CG1   1 
ATOM   5340  C CG2   . ILE B 1 271 ? 3.179   -8.382  -11.844  1.00 24.22 ? 271 ILE B CG2   1 
ATOM   5341  C CD1   . ILE B 1 271 ? 2.946   -11.260 -12.474  1.00 15.69 ? 271 ILE B CD1   1 
ATOM   5342  N N     . GLY B 1 272 ? 5.784   -7.631  -9.599   1.00 28.65 ? 272 GLY B N     1 
ATOM   5343  C CA    . GLY B 1 272 ? 6.341   -6.350  -9.139   1.00 28.58 ? 272 GLY B CA    1 
ATOM   5344  C C     . GLY B 1 272 ? 7.212   -5.830  -10.268  1.00 28.75 ? 272 GLY B C     1 
ATOM   5345  O O     . GLY B 1 272 ? 7.377   -6.502  -11.317  1.00 29.17 ? 272 GLY B O     1 
ATOM   5346  N N     . PHE B 1 273 ? 7.754   -4.644  -10.118  1.00 27.05 ? 273 PHE B N     1 
ATOM   5347  C CA    . PHE B 1 273 ? 8.600   -4.203  -11.178  1.00 27.29 ? 273 PHE B CA    1 
ATOM   5348  C C     . PHE B 1 273 ? 9.791   -3.355  -10.765  1.00 27.63 ? 273 PHE B C     1 
ATOM   5349  O O     . PHE B 1 273 ? 9.782   -2.750  -9.685   1.00 27.91 ? 273 PHE B O     1 
ATOM   5350  C CB    . PHE B 1 273 ? 7.787   -3.495  -12.208  1.00 25.81 ? 273 PHE B CB    1 
ATOM   5351  C CG    . PHE B 1 273 ? 6.892   -2.472  -11.663  1.00 27.28 ? 273 PHE B CG    1 
ATOM   5352  C CD1   . PHE B 1 273 ? 5.619   -2.822  -11.192  1.00 27.86 ? 273 PHE B CD1   1 
ATOM   5353  C CD2   . PHE B 1 273 ? 7.248   -1.133  -11.746  1.00 24.16 ? 273 PHE B CD2   1 
ATOM   5354  C CE1   . PHE B 1 273 ? 4.725   -1.865  -10.780  1.00 27.42 ? 273 PHE B CE1   1 
ATOM   5355  C CE2   . PHE B 1 273 ? 6.385   -0.176  -11.336  1.00 28.63 ? 273 PHE B CE2   1 
ATOM   5356  C CZ    . PHE B 1 273 ? 5.108   -0.526  -10.833  1.00 28.02 ? 273 PHE B CZ    1 
ATOM   5357  N N     . LEU B 1 274 ? 10.777  -3.280  -11.656  1.00 27.40 ? 274 LEU B N     1 
ATOM   5358  C CA    . LEU B 1 274 ? 12.068  -2.695  -11.340  1.00 27.70 ? 274 LEU B CA    1 
ATOM   5359  C C     . LEU B 1 274 ? 12.303  -1.582  -12.370  1.00 28.02 ? 274 LEU B C     1 
ATOM   5360  O O     . LEU B 1 274 ? 12.272  -1.837  -13.614  1.00 26.75 ? 274 LEU B O     1 
ATOM   5361  C CB    . LEU B 1 274 ? 13.131  -3.771  -11.355  1.00 26.81 ? 274 LEU B CB    1 
ATOM   5362  C CG    . LEU B 1 274 ? 14.535  -3.608  -10.768  1.00 29.09 ? 274 LEU B CG    1 
ATOM   5363  C CD1   . LEU B 1 274 ? 14.566  -3.028  -9.331   1.00 23.94 ? 274 LEU B CD1   1 
ATOM   5364  C CD2   . LEU B 1 274 ? 15.219  -4.976  -10.770  1.00 28.46 ? 274 LEU B CD2   1 
ATOM   5365  N N     . THR B 1 275 ? 12.428  -0.346  -11.852  1.00 27.47 ? 275 THR B N     1 
ATOM   5366  C CA    . THR B 1 275 ? 12.695  0.852   -12.655  1.00 28.83 ? 275 THR B CA    1 
ATOM   5367  C C     . THR B 1 275 ? 14.141  1.395   -12.364  1.00 29.78 ? 275 THR B C     1 
ATOM   5368  O O     . THR B 1 275 ? 14.577  1.559   -11.197  1.00 29.77 ? 275 THR B O     1 
ATOM   5369  C CB    . THR B 1 275 ? 11.569  1.915   -12.499  1.00 29.34 ? 275 THR B CB    1 
ATOM   5370  O OG1   . THR B 1 275 ? 10.288  1.307   -12.747  1.00 30.01 ? 275 THR B OG1   1 
ATOM   5371  C CG2   . THR B 1 275 ? 11.726  3.067   -13.476  1.00 28.63 ? 275 THR B CG2   1 
ATOM   5372  N N     . GLY B 1 276 ? 14.908  1.586   -13.438  1.00 30.18 ? 276 GLY B N     1 
ATOM   5373  C CA    . GLY B 1 276 ? 16.299  2.082   -13.335  1.00 29.77 ? 276 GLY B CA    1 
ATOM   5374  C C     . GLY B 1 276 ? 16.953  2.240   -14.685  1.00 29.65 ? 276 GLY B C     1 
ATOM   5375  O O     . GLY B 1 276 ? 16.296  2.045   -15.729  1.00 30.59 ? 276 GLY B O     1 
ATOM   5376  N N     . PRO B 1 277 ? 18.259  2.582   -14.686  1.00 29.34 ? 277 PRO B N     1 
ATOM   5377  C CA    . PRO B 1 277 ? 19.022  2.780   -15.910  1.00 28.03 ? 277 PRO B CA    1 
ATOM   5378  C C     . PRO B 1 277 ? 19.215  1.495   -16.681  1.00 27.74 ? 277 PRO B C     1 
ATOM   5379  O O     . PRO B 1 277 ? 19.321  0.405   -16.075  1.00 27.01 ? 277 PRO B O     1 
ATOM   5380  C CB    . PRO B 1 277 ? 20.374  3.298   -15.405  1.00 27.62 ? 277 PRO B CB    1 
ATOM   5381  C CG    . PRO B 1 277 ? 20.138  3.779   -14.106  1.00 27.15 ? 277 PRO B CG    1 
ATOM   5382  C CD    . PRO B 1 277 ? 19.103  2.852   -13.518  1.00 28.73 ? 277 PRO B CD    1 
ATOM   5383  N N     . LYS B 1 278 ? 19.329  1.652   -18.003  1.00 27.71 ? 278 LYS B N     1 
ATOM   5384  C CA    . LYS B 1 278 ? 19.193  0.579   -18.956  1.00 28.59 ? 278 LYS B CA    1 
ATOM   5385  C C     . LYS B 1 278 ? 20.233  -0.446  -18.626  1.00 28.87 ? 278 LYS B C     1 
ATOM   5386  O O     . LYS B 1 278 ? 19.827  -1.618  -18.324  1.00 28.93 ? 278 LYS B O     1 
ATOM   5387  C CB    . LYS B 1 278 ? 19.239  1.121   -20.420  1.00 30.47 ? 278 LYS B CB    1 
ATOM   5388  C CG    . LYS B 1 278 ? 19.932  0.259   -21.507  1.00 34.06 ? 278 LYS B CG    1 
ATOM   5389  C CD    . LYS B 1 278 ? 18.979  -0.602  -22.327  1.00 41.47 ? 278 LYS B CD    1 
ATOM   5390  C CE    . LYS B 1 278 ? 19.675  -1.889  -22.830  1.00 43.76 ? 278 LYS B CE    1 
ATOM   5391  N NZ    . LYS B 1 278 ? 20.572  -1.681  -24.022  1.00 45.81 ? 278 LYS B NZ    1 
ATOM   5392  N N     . PRO B 1 279 ? 21.545  -0.005  -18.540  1.00 26.65 ? 279 PRO B N     1 
ATOM   5393  C CA    . PRO B 1 279 ? 22.579  -0.977  -18.374  1.00 26.41 ? 279 PRO B CA    1 
ATOM   5394  C C     . PRO B 1 279 ? 22.398  -1.786  -17.136  1.00 25.28 ? 279 PRO B C     1 
ATOM   5395  O O     . PRO B 1 279 ? 22.810  -2.949  -17.163  1.00 26.20 ? 279 PRO B O     1 
ATOM   5396  C CB    . PRO B 1 279 ? 23.911  -0.151  -18.326  1.00 26.36 ? 279 PRO B CB    1 
ATOM   5397  C CG    . PRO B 1 279 ? 23.551  1.161   -18.898  1.00 26.78 ? 279 PRO B CG    1 
ATOM   5398  C CD    . PRO B 1 279 ? 22.105  1.355   -18.532  1.00 26.24 ? 279 PRO B CD    1 
ATOM   5399  N N     . LEU B 1 280 ? 21.844  -1.201  -16.067  1.00 24.34 ? 280 LEU B N     1 
ATOM   5400  C CA    . LEU B 1 280 ? 21.658  -1.920  -14.787  1.00 24.08 ? 280 LEU B CA    1 
ATOM   5401  C C     . LEU B 1 280 ? 20.490  -2.896  -14.897  1.00 24.29 ? 280 LEU B C     1 
ATOM   5402  O O     . LEU B 1 280 ? 20.630  -4.079  -14.583  1.00 23.38 ? 280 LEU B O     1 
ATOM   5403  C CB    . LEU B 1 280 ? 21.454  -0.937  -13.624  1.00 24.84 ? 280 LEU B CB    1 
ATOM   5404  C CG    . LEU B 1 280 ? 22.656  -0.072  -13.206  1.00 28.73 ? 280 LEU B CG    1 
ATOM   5405  C CD1   . LEU B 1 280 ? 22.564  0.334   -11.773  1.00 32.27 ? 280 LEU B CD1   1 
ATOM   5406  C CD2   . LEU B 1 280 ? 24.044  -0.790  -13.429  1.00 32.20 ? 280 LEU B CD2   1 
ATOM   5407  N N     . ILE B 1 281 ? 19.342  -2.394  -15.402  1.00 24.80 ? 281 ILE B N     1 
ATOM   5408  C CA    . ILE B 1 281 ? 18.155  -3.189  -15.609  1.00 23.53 ? 281 ILE B CA    1 
ATOM   5409  C C     . ILE B 1 281 ? 18.499  -4.389  -16.479  1.00 25.46 ? 281 ILE B C     1 
ATOM   5410  O O     . ILE B 1 281 ? 18.190  -5.536  -16.129  1.00 27.64 ? 281 ILE B O     1 
ATOM   5411  C CB    . ILE B 1 281 ? 17.019  -2.324  -16.254  1.00 23.75 ? 281 ILE B CB    1 
ATOM   5412  C CG1   . ILE B 1 281 ? 16.573  -1.212  -15.280  1.00 20.73 ? 281 ILE B CG1   1 
ATOM   5413  C CG2   . ILE B 1 281 ? 15.884  -3.203  -16.785  1.00 18.48 ? 281 ILE B CG2   1 
ATOM   5414  C CD1   . ILE B 1 281 ? 16.141  -1.731  -13.838  1.00 22.02 ? 281 ILE B CD1   1 
ATOM   5415  N N     . GLU B 1 282 ? 19.120  -4.133  -17.615  1.00 25.73 ? 282 GLU B N     1 
ATOM   5416  C CA    . GLU B 1 282 ? 19.675  -5.166  -18.478  1.00 27.09 ? 282 GLU B CA    1 
ATOM   5417  C C     . GLU B 1 282 ? 20.427  -6.301  -17.756  1.00 26.85 ? 282 GLU B C     1 
ATOM   5418  O O     . GLU B 1 282 ? 20.299  -7.464  -18.135  1.00 27.93 ? 282 GLU B O     1 
ATOM   5419  C CB    . GLU B 1 282 ? 20.555  -4.487  -19.538  1.00 25.53 ? 282 GLU B CB    1 
ATOM   5420  C CG    . GLU B 1 282 ? 21.298  -5.426  -20.418  1.00 28.44 ? 282 GLU B CG    1 
ATOM   5421  C CD    . GLU B 1 282 ? 22.419  -4.745  -21.240  1.00 30.42 ? 282 GLU B CD    1 
ATOM   5422  O OE1   . GLU B 1 282 ? 22.225  -3.593  -21.741  1.00 31.18 ? 282 GLU B OE1   1 
ATOM   5423  O OE2   . GLU B 1 282 ? 23.516  -5.389  -21.348  1.00 34.22 ? 282 GLU B OE2   1 
ATOM   5424  N N     . ARG B 1 283 ? 21.192  -6.010  -16.700  1.00 27.49 ? 283 ARG B N     1 
ATOM   5425  C CA    . ARG B 1 283 ? 21.846  -7.114  -15.979  1.00 26.39 ? 283 ARG B CA    1 
ATOM   5426  C C     . ARG B 1 283 ? 20.801  -7.933  -15.259  1.00 25.67 ? 283 ARG B C     1 
ATOM   5427  O O     . ARG B 1 283 ? 20.957  -9.157  -15.052  1.00 24.59 ? 283 ARG B O     1 
ATOM   5428  C CB    . ARG B 1 283 ? 22.930  -6.657  -14.986  1.00 27.98 ? 283 ARG B CB    1 
ATOM   5429  C CG    . ARG B 1 283 ? 24.151  -5.886  -15.584  1.00 28.60 ? 283 ARG B CG    1 
ATOM   5430  C CD    . ARG B 1 283 ? 24.329  -6.119  -17.101  1.00 34.22 ? 283 ARG B CD    1 
ATOM   5431  N NE    . ARG B 1 283 ? 25.113  -7.289  -17.469  1.00 36.45 ? 283 ARG B NE    1 
ATOM   5432  C CZ    . ARG B 1 283 ? 25.339  -7.680  -18.729  1.00 38.12 ? 283 ARG B CZ    1 
ATOM   5433  N NH1   . ARG B 1 283 ? 24.856  -7.006  -19.775  1.00 40.96 ? 283 ARG B NH1   1 
ATOM   5434  N NH2   . ARG B 1 283 ? 26.066  -8.751  -18.956  1.00 37.40 ? 283 ARG B NH2   1 
ATOM   5435  N N     . VAL B 1 284 ? 19.714  -7.291  -14.850  1.00 24.81 ? 284 VAL B N     1 
ATOM   5436  C CA    . VAL B 1 284 ? 18.710  -8.082  -14.108  1.00 24.12 ? 284 VAL B CA    1 
ATOM   5437  C C     . VAL B 1 284 ? 17.877  -8.903  -15.058  1.00 23.64 ? 284 VAL B C     1 
ATOM   5438  O O     . VAL B 1 284 ? 17.549  -10.062 -14.775  1.00 23.67 ? 284 VAL B O     1 
ATOM   5439  C CB    . VAL B 1 284 ? 17.883  -7.259  -13.165  1.00 24.73 ? 284 VAL B CB    1 
ATOM   5440  C CG1   . VAL B 1 284 ? 18.821  -6.606  -12.073  1.00 24.20 ? 284 VAL B CG1   1 
ATOM   5441  C CG2   . VAL B 1 284 ? 17.164  -6.214  -13.919  1.00 24.78 ? 284 VAL B CG2   1 
ATOM   5442  N N     . ILE B 1 285 ? 17.609  -8.328  -16.225  1.00 23.39 ? 285 ILE B N     1 
ATOM   5443  C CA    . ILE B 1 285 ? 16.809  -8.987  -17.205  1.00 23.23 ? 285 ILE B CA    1 
ATOM   5444  C C     . ILE B 1 285 ? 17.583  -10.251 -17.491  1.00 24.34 ? 285 ILE B C     1 
ATOM   5445  O O     . ILE B 1 285 ? 17.040  -11.335 -17.318  1.00 24.96 ? 285 ILE B O     1 
ATOM   5446  C CB    . ILE B 1 285 ? 16.564  -8.074  -18.439  1.00 23.38 ? 285 ILE B CB    1 
ATOM   5447  C CG1   . ILE B 1 285 ? 15.617  -6.927  -18.073  1.00 23.62 ? 285 ILE B CG1   1 
ATOM   5448  C CG2   . ILE B 1 285 ? 15.939  -8.800  -19.536  1.00 20.27 ? 285 ILE B CG2   1 
ATOM   5449  C CD1   . ILE B 1 285 ? 15.384  -5.975  -19.280  1.00 22.37 ? 285 ILE B CD1   1 
ATOM   5450  N N     . LEU B 1 286 ? 18.873  -10.116 -17.854  1.00 25.81 ? 286 LEU B N     1 
ATOM   5451  C CA    . LEU B 1 286 ? 19.732  -11.262 -18.180  1.00 24.59 ? 286 LEU B CA    1 
ATOM   5452  C C     . LEU B 1 286 ? 19.855  -12.261 -17.062  1.00 24.26 ? 286 LEU B C     1 
ATOM   5453  O O     . LEU B 1 286 ? 19.899  -13.438 -17.316  1.00 25.28 ? 286 LEU B O     1 
ATOM   5454  C CB    . LEU B 1 286 ? 21.098  -10.801 -18.598  1.00 24.51 ? 286 LEU B CB    1 
ATOM   5455  C CG    . LEU B 1 286 ? 21.231  -9.924  -19.859  1.00 26.55 ? 286 LEU B CG    1 
ATOM   5456  C CD1   . LEU B 1 286 ? 22.731  -9.826  -20.294  1.00 17.68 ? 286 LEU B CD1   1 
ATOM   5457  C CD2   . LEU B 1 286 ? 20.316  -10.413 -20.980  1.00 27.37 ? 286 LEU B CD2   1 
ATOM   5458  N N     . HIS B 1 287 ? 19.919  -11.833 -15.814  1.00 24.27 ? 287 HIS B N     1 
ATOM   5459  C CA    . HIS B 1 287 ? 19.861  -12.836 -14.754  1.00 25.31 ? 287 HIS B CA    1 
ATOM   5460  C C     . HIS B 1 287 ? 18.498  -13.597 -14.797  1.00 26.16 ? 287 HIS B C     1 
ATOM   5461  O O     . HIS B 1 287 ? 18.479  -14.849 -14.795  1.00 25.31 ? 287 HIS B O     1 
ATOM   5462  C CB    . HIS B 1 287 ? 20.102  -12.199 -13.393  1.00 24.95 ? 287 HIS B CB    1 
ATOM   5463  C CG    . HIS B 1 287 ? 20.484  -13.162 -12.311  1.00 25.08 ? 287 HIS B CG    1 
ATOM   5464  N ND1   . HIS B 1 287 ? 20.783  -12.741 -11.025  1.00 23.18 ? 287 HIS B ND1   1 
ATOM   5465  C CD2   . HIS B 1 287 ? 20.538  -14.520 -12.286  1.00 22.42 ? 287 HIS B CD2   1 
ATOM   5466  C CE1   . HIS B 1 287 ? 20.991  -13.799 -10.257  1.00 23.33 ? 287 HIS B CE1   1 
ATOM   5467  N NE2   . HIS B 1 287 ? 20.863  -14.890 -10.996  1.00 22.25 ? 287 HIS B NE2   1 
ATOM   5468  N N     . ILE B 1 288 ? 17.381  -12.846 -14.865  1.00 26.47 ? 288 ILE B N     1 
ATOM   5469  C CA    . ILE B 1 288 ? 16.037  -13.464 -15.019  1.00 26.94 ? 288 ILE B CA    1 
ATOM   5470  C C     . ILE B 1 288 ? 15.980  -14.546 -16.127  1.00 27.94 ? 288 ILE B C     1 
ATOM   5471  O O     . ILE B 1 288 ? 15.425  -15.643 -15.903  1.00 29.11 ? 288 ILE B O     1 
ATOM   5472  C CB    . ILE B 1 288 ? 14.908  -12.406 -15.126  1.00 27.34 ? 288 ILE B CB    1 
ATOM   5473  C CG1   . ILE B 1 288 ? 14.629  -11.832 -13.736  1.00 26.91 ? 288 ILE B CG1   1 
ATOM   5474  C CG2   . ILE B 1 288 ? 13.588  -12.963 -15.760  1.00 25.54 ? 288 ILE B CG2   1 
ATOM   5475  C CD1   . ILE B 1 288 ? 14.145  -10.462 -13.773  1.00 28.57 ? 288 ILE B CD1   1 
ATOM   5476  N N     . GLN B 1 289 ? 16.591  -14.265 -17.286  1.00 26.69 ? 289 GLN B N     1 
ATOM   5477  C CA    . GLN B 1 289 ? 16.587  -15.182 -18.419  1.00 25.45 ? 289 GLN B CA    1 
ATOM   5478  C C     . GLN B 1 289 ? 17.166  -16.588 -18.214  1.00 24.78 ? 289 GLN B C     1 
ATOM   5479  O O     . GLN B 1 289 ? 16.939  -17.494 -19.030  1.00 24.22 ? 289 GLN B O     1 
ATOM   5480  C CB    . GLN B 1 289 ? 17.310  -14.513 -19.551  1.00 25.97 ? 289 GLN B CB    1 
ATOM   5481  C CG    . GLN B 1 289 ? 16.434  -13.552 -20.241  1.00 27.04 ? 289 GLN B CG    1 
ATOM   5482  C CD    . GLN B 1 289 ? 17.063  -12.953 -21.457  1.00 28.15 ? 289 GLN B CD    1 
ATOM   5483  O OE1   . GLN B 1 289 ? 18.218  -13.222 -21.805  1.00 29.31 ? 289 GLN B OE1   1 
ATOM   5484  N NE2   . GLN B 1 289 ? 16.313  -12.103 -22.107  1.00 30.71 ? 289 GLN B NE2   1 
ATOM   5485  N N     . VAL B 1 290 ? 17.937  -16.778 -17.153  1.00 24.10 ? 290 VAL B N     1 
ATOM   5486  C CA    . VAL B 1 290 ? 18.531  -18.089 -16.838  1.00 23.31 ? 290 VAL B CA    1 
ATOM   5487  C C     . VAL B 1 290 ? 17.997  -18.585 -15.499  1.00 24.16 ? 290 VAL B C     1 
ATOM   5488  O O     . VAL B 1 290 ? 18.397  -19.602 -14.975  1.00 24.87 ? 290 VAL B O     1 
ATOM   5489  C CB    . VAL B 1 290 ? 20.090  -18.060 -16.839  1.00 23.63 ? 290 VAL B CB    1 
ATOM   5490  C CG1   . VAL B 1 290 ? 20.660  -17.889 -18.257  1.00 21.79 ? 290 VAL B CG1   1 
ATOM   5491  C CG2   . VAL B 1 290 ? 20.676  -17.013 -15.775  1.00 23.92 ? 290 VAL B CG2   1 
ATOM   5492  N N     . SER B 1 291 ? 17.046  -17.870 -14.928  1.00 26.15 ? 291 SER B N     1 
ATOM   5493  C CA    . SER B 1 291 ? 16.369  -18.391 -13.734  1.00 26.84 ? 291 SER B CA    1 
ATOM   5494  C C     . SER B 1 291 ? 14.822  -18.529 -13.898  1.00 26.27 ? 291 SER B C     1 
ATOM   5495  O O     . SER B 1 291 ? 14.381  -19.562 -14.376  1.00 24.93 ? 291 SER B O     1 
ATOM   5496  C CB    . SER B 1 291 ? 16.760  -17.576 -12.525  1.00 26.16 ? 291 SER B CB    1 
ATOM   5497  O OG    . SER B 1 291 ? 16.471  -16.236 -12.856  1.00 28.34 ? 291 SER B OG    1 
ATOM   5498  N N     . THR B 1 292 ? 14.065  -17.509 -13.506  1.00 26.60 ? 292 THR B N     1 
ATOM   5499  C CA    . THR B 1 292 ? 12.612  -17.545 -13.622  1.00 27.42 ? 292 THR B CA    1 
ATOM   5500  C C     . THR B 1 292 ? 12.125  -17.408 -15.061  1.00 26.82 ? 292 THR B C     1 
ATOM   5501  O O     . THR B 1 292 ? 11.053  -17.899 -15.413  1.00 26.66 ? 292 THR B O     1 
ATOM   5502  C CB    . THR B 1 292 ? 11.979  -16.391 -12.822  1.00 27.02 ? 292 THR B CB    1 
ATOM   5503  O OG1   . THR B 1 292 ? 12.779  -15.211 -12.965  1.00 28.25 ? 292 THR B OG1   1 
ATOM   5504  C CG2   . THR B 1 292 ? 12.043  -16.679 -11.330  1.00 26.43 ? 292 THR B CG2   1 
ATOM   5505  N N     . LEU B 1 293 ? 12.920  -16.736 -15.887  1.00 26.58 ? 293 LEU B N     1 
ATOM   5506  C CA    . LEU B 1 293 ? 12.554  -16.500 -17.279  1.00 27.51 ? 293 LEU B CA    1 
ATOM   5507  C C     . LEU B 1 293 ? 11.618  -15.325 -17.537  1.00 27.85 ? 293 LEU B C     1 
ATOM   5508  O O     . LEU B 1 293 ? 11.947  -14.408 -18.288  1.00 28.08 ? 293 LEU B O     1 
ATOM   5509  C CB    . LEU B 1 293 ? 11.868  -17.749 -17.835  1.00 26.88 ? 293 LEU B CB    1 
ATOM   5510  C CG    . LEU B 1 293 ? 12.763  -18.967 -18.070  1.00 26.33 ? 293 LEU B CG    1 
ATOM   5511  C CD1   . LEU B 1 293 ? 11.932  -20.177 -18.468  1.00 23.87 ? 293 LEU B CD1   1 
ATOM   5512  C CD2   . LEU B 1 293 ? 13.816  -18.664 -19.125  1.00 24.86 ? 293 LEU B CD2   1 
ATOM   5513  N N     . HIS B 1 294 ? 10.448  -15.358 -16.908  1.00 27.90 ? 294 HIS B N     1 
ATOM   5514  C CA    . HIS B 1 294 ? 9.572   -14.194 -16.855  1.00 28.09 ? 294 HIS B CA    1 
ATOM   5515  C C     . HIS B 1 294 ? 8.649   -14.305 -15.646  1.00 28.02 ? 294 HIS B C     1 
ATOM   5516  O O     . HIS B 1 294 ? 8.723   -15.269 -14.884  1.00 27.74 ? 294 HIS B O     1 
ATOM   5517  C CB    . HIS B 1 294 ? 8.747   -14.009 -18.131  1.00 28.57 ? 294 HIS B CB    1 
ATOM   5518  C CG    . HIS B 1 294 ? 7.930   -15.207 -18.500  1.00 26.66 ? 294 HIS B CG    1 
ATOM   5519  N ND1   . HIS B 1 294 ? 8.393   -16.193 -19.344  1.00 32.90 ? 294 HIS B ND1   1 
ATOM   5520  C CD2   . HIS B 1 294 ? 6.678   -15.578 -18.141  1.00 31.89 ? 294 HIS B CD2   1 
ATOM   5521  C CE1   . HIS B 1 294 ? 7.462   -17.119 -19.488  1.00 31.86 ? 294 HIS B CE1   1 
ATOM   5522  N NE2   . HIS B 1 294 ? 6.412   -16.769 -18.768  1.00 32.19 ? 294 HIS B NE2   1 
ATOM   5523  N N     . PRO B 1 295 ? 7.780   -13.315 -15.478  1.00 27.68 ? 295 PRO B N     1 
ATOM   5524  C CA    . PRO B 1 295 ? 6.712   -13.398 -14.508  1.00 28.00 ? 295 PRO B CA    1 
ATOM   5525  C C     . PRO B 1 295 ? 5.589   -14.208 -15.123  1.00 27.07 ? 295 PRO B C     1 
ATOM   5526  O O     . PRO B 1 295 ? 5.354   -14.076 -16.301  1.00 26.36 ? 295 PRO B O     1 
ATOM   5527  C CB    . PRO B 1 295 ? 6.254   -11.941 -14.377  1.00 28.68 ? 295 PRO B CB    1 
ATOM   5528  C CG    . PRO B 1 295 ? 7.408   -11.138 -14.960  1.00 27.72 ? 295 PRO B CG    1 
ATOM   5529  C CD    . PRO B 1 295 ? 7.874   -11.959 -16.052  1.00 26.73 ? 295 PRO B CD    1 
ATOM   5530  N N     . SER B 1 296 ? 4.921   -15.042 -14.337  1.00 25.12 ? 296 SER B N     1 
ATOM   5531  C CA    . SER B 1 296 ? 3.740   -15.702 -14.835  1.00 23.18 ? 296 SER B CA    1 
ATOM   5532  C C     . SER B 1 296 ? 2.980   -14.893 -15.887  1.00 22.01 ? 296 SER B C     1 
ATOM   5533  O O     . SER B 1 296 ? 2.611   -13.768 -15.646  1.00 22.06 ? 296 SER B O     1 
ATOM   5534  C CB    . SER B 1 296 ? 2.802   -15.970 -13.684  1.00 23.16 ? 296 SER B CB    1 
ATOM   5535  O OG    . SER B 1 296 ? 1.634   -16.571 -14.203  1.00 24.82 ? 296 SER B OG    1 
ATOM   5536  N N     . THR B 1 297 ? 2.732   -15.479 -17.048  1.00 21.18 ? 297 THR B N     1 
ATOM   5537  C CA    . THR B 1 297 ? 2.007   -14.803 -18.123  1.00 21.20 ? 297 THR B CA    1 
ATOM   5538  C C     . THR B 1 297 ? 0.505   -14.578 -17.725  1.00 21.95 ? 297 THR B C     1 
ATOM   5539  O O     . THR B 1 297 ? 0.023   -13.453 -17.683  1.00 20.59 ? 297 THR B O     1 
ATOM   5540  C CB    . THR B 1 297 ? 2.122   -15.558 -19.496  1.00 20.45 ? 297 THR B CB    1 
ATOM   5541  O OG1   . THR B 1 297 ? 3.479   -16.035 -19.718  1.00 22.56 ? 297 THR B OG1   1 
ATOM   5542  C CG2   . THR B 1 297 ? 1.781   -14.625 -20.579  1.00 18.01 ? 297 THR B CG2   1 
ATOM   5543  N N     . PHE B 1 298 ? -0.207  -15.650 -17.409  1.00 23.31 ? 298 PHE B N     1 
ATOM   5544  C CA    . PHE B 1 298 ? -1.535  -15.549 -16.778  1.00 24.30 ? 298 PHE B CA    1 
ATOM   5545  C C     . PHE B 1 298 ? -1.693  -14.344 -15.855  1.00 23.62 ? 298 PHE B C     1 
ATOM   5546  O O     . PHE B 1 298 ? -2.581  -13.517 -16.037  1.00 23.91 ? 298 PHE B O     1 
ATOM   5547  C CB    . PHE B 1 298 ? -1.833  -16.838 -16.002  1.00 25.24 ? 298 PHE B CB    1 
ATOM   5548  C CG    . PHE B 1 298 ? -3.329  -17.167 -15.864  1.00 26.35 ? 298 PHE B CG    1 
ATOM   5549  C CD1   . PHE B 1 298 ? -4.106  -16.580 -14.868  1.00 20.85 ? 298 PHE B CD1   1 
ATOM   5550  C CD2   . PHE B 1 298 ? -3.905  -18.140 -16.662  1.00 25.63 ? 298 PHE B CD2   1 
ATOM   5551  C CE1   . PHE B 1 298 ? -5.430  -16.893 -14.736  1.00 25.39 ? 298 PHE B CE1   1 
ATOM   5552  C CE2   . PHE B 1 298 ? -5.269  -18.457 -16.520  1.00 30.45 ? 298 PHE B CE2   1 
ATOM   5553  C CZ    . PHE B 1 298 ? -6.035  -17.816 -15.564  1.00 23.18 ? 298 PHE B CZ    1 
ATOM   5554  N N     . ASN B 1 299 ? -0.822  -14.213 -14.881  1.00 23.90 ? 299 ASN B N     1 
ATOM   5555  C CA    . ASN B 1 299 ? -1.093  -13.232 -13.819  1.00 24.69 ? 299 ASN B CA    1 
ATOM   5556  C C     . ASN B 1 299 ? -0.791  -11.832 -14.306  1.00 24.22 ? 299 ASN B C     1 
ATOM   5557  O O     . ASN B 1 299 ? -1.391  -10.901 -13.836  1.00 23.58 ? 299 ASN B O     1 
ATOM   5558  C CB    . ASN B 1 299 ? -0.300  -13.480 -12.528  1.00 23.84 ? 299 ASN B CB    1 
ATOM   5559  C CG    . ASN B 1 299 ? -0.475  -14.859 -11.951  1.00 26.79 ? 299 ASN B CG    1 
ATOM   5560  O OD1   . ASN B 1 299 ? 0.146   -15.172 -10.918  1.00 32.63 ? 299 ASN B OD1   1 
ATOM   5561  N ND2   . ASN B 1 299 ? -1.317  -15.686 -12.556  1.00 28.25 ? 299 ASN B ND2   1 
ATOM   5562  N N     . GLN B 1 300 ? 0.178   -11.689 -15.217  1.00 24.76 ? 300 GLN B N     1 
ATOM   5563  C CA    . GLN B 1 300 ? 0.492   -10.367 -15.785  1.00 24.30 ? 300 GLN B CA    1 
ATOM   5564  C C     . GLN B 1 300 ? -0.739  -9.878  -16.536  1.00 24.53 ? 300 GLN B C     1 
ATOM   5565  O O     . GLN B 1 300 ? -0.973  -8.650  -16.655  1.00 26.05 ? 300 GLN B O     1 
ATOM   5566  C CB    . GLN B 1 300 ? 1.683   -10.416 -16.750  1.00 23.09 ? 300 GLN B CB    1 
ATOM   5567  C CG    . GLN B 1 300 ? 2.932   -10.578 -16.059  1.00 22.10 ? 300 GLN B CG    1 
ATOM   5568  C CD    . GLN B 1 300 ? 4.132   -10.497 -16.952  1.00 22.86 ? 300 GLN B CD    1 
ATOM   5569  O OE1   . GLN B 1 300 ? 4.480   -9.430  -17.466  1.00 21.82 ? 300 GLN B OE1   1 
ATOM   5570  N NE2   . GLN B 1 300 ? 4.781   -11.634 -17.154  1.00 16.97 ? 300 GLN B NE2   1 
ATOM   5571  N N     . LEU B 1 301 ? -1.507  -10.820 -17.065  1.00 23.45 ? 301 LEU B N     1 
ATOM   5572  C CA    . LEU B 1 301 ? -2.615  -10.467 -17.950  1.00 23.41 ? 301 LEU B CA    1 
ATOM   5573  C C     . LEU B 1 301 ? -3.848  -10.111 -17.119  1.00 24.03 ? 301 LEU B C     1 
ATOM   5574  O O     . LEU B 1 301 ? -4.640  -9.249  -17.488  1.00 23.81 ? 301 LEU B O     1 
ATOM   5575  C CB    . LEU B 1 301 ? -2.903  -11.577 -18.951  1.00 22.22 ? 301 LEU B CB    1 
ATOM   5576  C CG    . LEU B 1 301 ? -2.128  -11.631 -20.276  1.00 19.04 ? 301 LEU B CG    1 
ATOM   5577  C CD1   . LEU B 1 301 ? -2.381  -12.946 -20.893  1.00 16.92 ? 301 LEU B CD1   1 
ATOM   5578  C CD2   . LEU B 1 301 ? -2.501  -10.541 -21.247  1.00 12.91 ? 301 LEU B CD2   1 
ATOM   5579  N N     . MET B 1 302 ? -3.969  -10.747 -15.970  1.00 24.21 ? 302 MET B N     1 
ATOM   5580  C CA    . MET B 1 302 ? -4.979  -10.363 -15.005  1.00 25.06 ? 302 MET B CA    1 
ATOM   5581  C C     . MET B 1 302 ? -4.726  -8.925  -14.622  1.00 23.78 ? 302 MET B C     1 
ATOM   5582  O O     . MET B 1 302 ? -5.597  -8.092  -14.735  1.00 24.95 ? 302 MET B O     1 
ATOM   5583  C CB    . MET B 1 302 ? -4.903  -11.280 -13.788  1.00 24.11 ? 302 MET B CB    1 
ATOM   5584  C CG    . MET B 1 302 ? -5.551  -12.627 -13.988  1.00 26.67 ? 302 MET B CG    1 
ATOM   5585  S SD    . MET B 1 302 ? -5.182  -13.857 -12.694  1.00 30.89 ? 302 MET B SD    1 
ATOM   5586  C CE    . MET B 1 302 ? -5.854  -13.052 -11.265  1.00 22.78 ? 302 MET B CE    1 
ATOM   5587  N N     . ILE B 1 303 ? -3.504  -8.617  -14.207  1.00 24.29 ? 303 ILE B N     1 
ATOM   5588  C CA    . ILE B 1 303 ? -3.141  -7.238  -13.833  1.00 23.34 ? 303 ILE B CA    1 
ATOM   5589  C C     . ILE B 1 303 ? -3.210  -6.243  -14.991  1.00 23.19 ? 303 ILE B C     1 
ATOM   5590  O O     . ILE B 1 303 ? -3.779  -5.174  -14.834  1.00 25.27 ? 303 ILE B O     1 
ATOM   5591  C CB    . ILE B 1 303 ? -1.799  -7.175  -13.086  1.00 22.85 ? 303 ILE B CB    1 
ATOM   5592  C CG1   . ILE B 1 303 ? -1.895  -7.984  -11.801  1.00 23.11 ? 303 ILE B CG1   1 
ATOM   5593  C CG2   . ILE B 1 303 ? -1.417  -5.724  -12.766  1.00 20.76 ? 303 ILE B CG2   1 
ATOM   5594  C CD1   . ILE B 1 303 ? -0.511  -8.132  -11.128  1.00 23.33 ? 303 ILE B CD1   1 
ATOM   5595  N N     . SER B 1 304 ? -2.673  -6.595  -16.139  1.00 22.80 ? 304 SER B N     1 
ATOM   5596  C CA    . SER B 1 304 ? -2.660  -5.711  -17.296  1.00 24.11 ? 304 SER B CA    1 
ATOM   5597  C C     . SER B 1 304 ? -4.073  -5.348  -17.762  1.00 23.92 ? 304 SER B C     1 
ATOM   5598  O O     . SER B 1 304 ? -4.410  -4.196  -17.939  1.00 24.01 ? 304 SER B O     1 
ATOM   5599  C CB    . SER B 1 304 ? -1.865  -6.400  -18.421  1.00 24.26 ? 304 SER B CB    1 
ATOM   5600  O OG    . SER B 1 304 ? -1.677  -5.606  -19.558  1.00 24.22 ? 304 SER B OG    1 
ATOM   5601  N N     . GLN B 1 305 ? -4.937  -6.334  -17.918  1.00 25.15 ? 305 GLN B N     1 
ATOM   5602  C CA    . GLN B 1 305 ? -6.334  -6.055  -18.276  1.00 24.10 ? 305 GLN B CA    1 
ATOM   5603  C C     . GLN B 1 305 ? -7.051  -5.309  -17.194  1.00 24.07 ? 305 GLN B C     1 
ATOM   5604  O O     . GLN B 1 305 ? -7.771  -4.355  -17.478  1.00 24.48 ? 305 GLN B O     1 
ATOM   5605  C CB    . GLN B 1 305 ? -7.074  -7.323  -18.529  1.00 24.04 ? 305 GLN B CB    1 
ATOM   5606  C CG    . GLN B 1 305 ? -6.659  -7.979  -19.753  1.00 24.36 ? 305 GLN B CG    1 
ATOM   5607  C CD    . GLN B 1 305 ? -7.743  -8.908  -20.162  1.00 28.51 ? 305 GLN B CD    1 
ATOM   5608  O OE1   . GLN B 1 305 ? -7.486  -10.104 -20.459  1.00 28.47 ? 305 GLN B OE1   1 
ATOM   5609  N NE2   . GLN B 1 305 ? -9.011  -8.374  -20.187  1.00 21.39 ? 305 GLN B NE2   1 
ATOM   5610  N N     . LEU B 1 306 ? -6.865  -5.734  -15.945  1.00 23.91 ? 306 LEU B N     1 
ATOM   5611  C CA    . LEU B 1 306 ? -7.415  -4.995  -14.824  1.00 22.97 ? 306 LEU B CA    1 
ATOM   5612  C C     . LEU B 1 306 ? -7.044  -3.508  -14.904  1.00 22.20 ? 306 LEU B C     1 
ATOM   5613  O O     . LEU B 1 306 ? -7.924  -2.639  -14.915  1.00 20.95 ? 306 LEU B O     1 
ATOM   5614  C CB    . LEU B 1 306 ? -6.873  -5.551  -13.504  1.00 22.69 ? 306 LEU B CB    1 
ATOM   5615  C CG    . LEU B 1 306 ? -7.105  -4.661  -12.272  1.00 22.92 ? 306 LEU B CG    1 
ATOM   5616  C CD1   . LEU B 1 306 ? -8.476  -4.864  -11.687  1.00 19.38 ? 306 LEU B CD1   1 
ATOM   5617  C CD2   . LEU B 1 306 ? -5.982  -5.006  -11.236  1.00 21.61 ? 306 LEU B CD2   1 
ATOM   5618  N N     . LEU B 1 307 ? -5.737  -3.234  -14.955  1.00 21.32 ? 307 LEU B N     1 
ATOM   5619  C CA    . LEU B 1 307 ? -5.243  -1.863  -15.020  1.00 21.33 ? 307 LEU B CA    1 
ATOM   5620  C C     . LEU B 1 307 ? -5.659  -1.041  -16.211  1.00 23.28 ? 307 LEU B C     1 
ATOM   5621  O O     . LEU B 1 307 ? -5.891  0.172   -16.052  1.00 24.59 ? 307 LEU B O     1 
ATOM   5622  C CB    . LEU B 1 307 ? -3.726  -1.840  -14.955  1.00 22.10 ? 307 LEU B CB    1 
ATOM   5623  C CG    . LEU B 1 307 ? -3.150  -2.560  -13.774  1.00 16.27 ? 307 LEU B CG    1 
ATOM   5624  C CD1   . LEU B 1 307 ? -1.718  -2.634  -14.095  1.00 17.26 ? 307 LEU B CD1   1 
ATOM   5625  C CD2   . LEU B 1 307 ? -3.458  -1.873  -12.432  1.00 12.09 ? 307 LEU B CD2   1 
ATOM   5626  N N     . HIS B 1 308 ? -5.721  -1.639  -17.399  1.00 24.65 ? 308 HIS B N     1 
ATOM   5627  C CA    . HIS B 1 308 ? -6.161  -0.889  -18.611  1.00 27.40 ? 308 HIS B CA    1 
ATOM   5628  C C     . HIS B 1 308 ? -7.672  -0.592  -18.672  1.00 29.46 ? 308 HIS B C     1 
ATOM   5629  O O     . HIS B 1 308 ? -8.137  0.267   -19.465  1.00 30.15 ? 308 HIS B O     1 
ATOM   5630  C CB    . HIS B 1 308 ? -5.841  -1.670  -19.893  1.00 26.17 ? 308 HIS B CB    1 
ATOM   5631  C CG    . HIS B 1 308 ? -4.398  -1.673  -20.256  1.00 27.53 ? 308 HIS B CG    1 
ATOM   5632  N ND1   . HIS B 1 308 ? -3.889  -0.861  -21.239  1.00 27.25 ? 308 HIS B ND1   1 
ATOM   5633  C CD2   . HIS B 1 308 ? -3.360  -2.413  -19.796  1.00 26.12 ? 308 HIS B CD2   1 
ATOM   5634  C CE1   . HIS B 1 308 ? -2.591  -1.085  -21.359  1.00 28.73 ? 308 HIS B CE1   1 
ATOM   5635  N NE2   . HIS B 1 308 ? -2.247  -2.025  -20.496  1.00 29.64 ? 308 HIS B NE2   1 
ATOM   5636  N N     . GLU B 1 309 ? -8.428  -1.364  -17.906  1.00 30.54 ? 309 GLU B N     1 
ATOM   5637  C CA    . GLU B 1 309 ? -9.849  -1.207  -17.827  1.00 32.94 ? 309 GLU B CA    1 
ATOM   5638  C C     . GLU B 1 309 ? -10.150 -0.119  -16.804  1.00 33.21 ? 309 GLU B C     1 
ATOM   5639  O O     . GLU B 1 309 ? -11.081 0.669   -16.971  1.00 34.37 ? 309 GLU B O     1 
ATOM   5640  C CB    . GLU B 1 309 ? -10.469 -2.542  -17.414  1.00 32.82 ? 309 GLU B CB    1 
ATOM   5641  C CG    . GLU B 1 309 ? -11.865 -2.401  -16.846  1.00 39.85 ? 309 GLU B CG    1 
ATOM   5642  C CD    . GLU B 1 309 ? -12.877 -1.901  -17.876  1.00 43.54 ? 309 GLU B CD    1 
ATOM   5643  O OE1   . GLU B 1 309 ? -12.732 -2.251  -19.080  1.00 46.03 ? 309 GLU B OE1   1 
ATOM   5644  O OE2   . GLU B 1 309 ? -13.808 -1.176  -17.468  1.00 45.23 ? 309 GLU B OE2   1 
ATOM   5645  N N     . TRP B 1 310 ? -9.345  -0.063  -15.746  1.00 33.64 ? 310 TRP B N     1 
ATOM   5646  C CA    . TRP B 1 310 ? -9.379  1.061   -14.817  1.00 33.26 ? 310 TRP B CA    1 
ATOM   5647  C C     . TRP B 1 310 ? -8.787  2.338   -15.397  1.00 34.05 ? 310 TRP B C     1 
ATOM   5648  O O     . TRP B 1 310 ? -9.217  3.424   -15.043  1.00 34.49 ? 310 TRP B O     1 
ATOM   5649  C CB    . TRP B 1 310 ? -8.590  0.753   -13.547  1.00 31.88 ? 310 TRP B CB    1 
ATOM   5650  C CG    . TRP B 1 310 ? -9.315  -0.026  -12.481  1.00 30.65 ? 310 TRP B CG    1 
ATOM   5651  C CD1   . TRP B 1 310 ? -10.666 -0.294  -12.408  1.00 29.58 ? 310 TRP B CD1   1 
ATOM   5652  C CD2   . TRP B 1 310 ? -8.726  -0.589  -11.308  1.00 25.23 ? 310 TRP B CD2   1 
ATOM   5653  N NE1   . TRP B 1 310 ? -10.923 -1.026  -11.253  1.00 29.67 ? 310 TRP B NE1   1 
ATOM   5654  C CE2   . TRP B 1 310 ? -9.749  -1.217  -10.578  1.00 26.10 ? 310 TRP B CE2   1 
ATOM   5655  C CE3   . TRP B 1 310 ? -7.412  -0.628  -10.808  1.00 28.12 ? 310 TRP B CE3   1 
ATOM   5656  C CZ2   . TRP B 1 310 ? -9.509  -1.874  -9.369   1.00 29.67 ? 310 TRP B CZ2   1 
ATOM   5657  C CZ3   . TRP B 1 310 ? -7.165  -1.287  -9.627   1.00 27.82 ? 310 TRP B CZ3   1 
ATOM   5658  C CH2   . TRP B 1 310 ? -8.203  -1.900  -8.914   1.00 30.27 ? 310 TRP B CH2   1 
ATOM   5659  N N     . GLY B 1 311 ? -7.766  2.240   -16.236  1.00 35.06 ? 311 GLY B N     1 
ATOM   5660  C CA    . GLY B 1 311 ? -6.998  3.444   -16.573  1.00 37.03 ? 311 GLY B CA    1 
ATOM   5661  C C     . GLY B 1 311 ? -6.349  4.023   -15.321  1.00 38.65 ? 311 GLY B C     1 
ATOM   5662  O O     . GLY B 1 311 ? -6.389  3.402   -14.228  1.00 39.51 ? 311 GLY B O     1 
ATOM   5663  N N     . GLU B 1 312 ? -5.748  5.200   -15.434  1.00 39.38 ? 312 GLU B N     1 
ATOM   5664  C CA    . GLU B 1 312 ? -5.050  5.724   -14.265  1.00 40.80 ? 312 GLU B CA    1 
ATOM   5665  C C     . GLU B 1 312 ? -6.023  6.263   -13.200  1.00 40.82 ? 312 GLU B C     1 
ATOM   5666  O O     . GLU B 1 312 ? -5.713  6.287   -12.037  1.00 41.35 ? 312 GLU B O     1 
ATOM   5667  C CB    . GLU B 1 312 ? -3.845  6.622   -14.648  1.00 40.72 ? 312 GLU B CB    1 
ATOM   5668  C CG    . GLU B 1 312 ? -2.646  5.726   -15.172  1.00 40.79 ? 312 GLU B CG    1 
ATOM   5669  C CD    . GLU B 1 312 ? -1.617  6.386   -16.185  1.00 42.40 ? 312 GLU B CD    1 
ATOM   5670  O OE1   . GLU B 1 312 ? -0.968  5.626   -16.979  1.00 39.78 ? 312 GLU B OE1   1 
ATOM   5671  O OE2   . GLU B 1 312 ? -1.430  7.636   -16.167  1.00 44.46 ? 312 GLU B OE2   1 
ATOM   5672  N N     . GLU B 1 313 ? -7.236  6.606   -13.606  1.00 41.39 ? 313 GLU B N     1 
ATOM   5673  C CA    . GLU B 1 313 ? -8.246  7.086   -12.677  1.00 40.94 ? 313 GLU B CA    1 
ATOM   5674  C C     . GLU B 1 313 ? -8.785  6.017   -11.722  1.00 39.61 ? 313 GLU B C     1 
ATOM   5675  O O     . GLU B 1 313 ? -8.982  6.290   -10.537  1.00 40.09 ? 313 GLU B O     1 
ATOM   5676  C CB    . GLU B 1 313 ? -9.395  7.682   -13.461  1.00 41.82 ? 313 GLU B CB    1 
ATOM   5677  C CG    . GLU B 1 313 ? -10.528 8.200   -12.619  1.00 43.24 ? 313 GLU B CG    1 
ATOM   5678  C CD    . GLU B 1 313 ? -11.074 9.503   -13.152  1.00 46.27 ? 313 GLU B CD    1 
ATOM   5679  O OE1   . GLU B 1 313 ? -10.616 9.920   -14.253  1.00 45.54 ? 313 GLU B OE1   1 
ATOM   5680  O OE2   . GLU B 1 313 ? -11.958 10.102  -12.465  1.00 46.78 ? 313 GLU B OE2   1 
ATOM   5681  N N     . GLY B 1 314 ? -9.035  4.826   -12.253  1.00 38.26 ? 314 GLY B N     1 
ATOM   5682  C CA    . GLY B 1 314 ? -9.535  3.684   -11.496  1.00 35.85 ? 314 GLY B CA    1 
ATOM   5683  C C     . GLY B 1 314 ? -8.443  3.136   -10.585  1.00 34.74 ? 314 GLY B C     1 
ATOM   5684  O O     . GLY B 1 314 ? -8.705  2.677   -9.452   1.00 33.73 ? 314 GLY B O     1 
ATOM   5685  N N     . PHE B 1 315 ? -7.206  3.214   -11.068  1.00 33.40 ? 315 PHE B N     1 
ATOM   5686  C CA    . PHE B 1 315 ? -6.100  2.655   -10.323  1.00 31.43 ? 315 PHE B CA    1 
ATOM   5687  C C     . PHE B 1 315 ? -5.888  3.484   -9.109   1.00 32.36 ? 315 PHE B C     1 
ATOM   5688  O O     . PHE B 1 315 ? -5.875  2.943   -7.989   1.00 30.62 ? 315 PHE B O     1 
ATOM   5689  C CB    . PHE B 1 315 ? -4.831  2.632   -11.123  1.00 30.34 ? 315 PHE B CB    1 
ATOM   5690  C CG    . PHE B 1 315 ? -3.645  2.157   -10.356  1.00 27.86 ? 315 PHE B CG    1 
ATOM   5691  C CD1   . PHE B 1 315 ? -3.546  0.847   -9.948   1.00 25.34 ? 315 PHE B CD1   1 
ATOM   5692  C CD2   . PHE B 1 315 ? -2.622  3.015   -10.064  1.00 25.15 ? 315 PHE B CD2   1 
ATOM   5693  C CE1   . PHE B 1 315 ? -2.453  0.419   -9.293   1.00 28.72 ? 315 PHE B CE1   1 
ATOM   5694  C CE2   . PHE B 1 315 ? -1.533  2.595   -9.410   1.00 28.04 ? 315 PHE B CE2   1 
ATOM   5695  C CZ    . PHE B 1 315 ? -1.432  1.301   -9.009   1.00 29.09 ? 315 PHE B CZ    1 
ATOM   5696  N N     . MET B 1 316 ? -5.722  4.800   -9.334   1.00 33.32 ? 316 MET B N     1 
ATOM   5697  C CA    . MET B 1 316 ? -5.479  5.750   -8.226   1.00 33.65 ? 316 MET B CA    1 
ATOM   5698  C C     . MET B 1 316 ? -6.646  5.793   -7.225   1.00 33.83 ? 316 MET B C     1 
ATOM   5699  O O     . MET B 1 316 ? -6.441  5.945   -6.013   1.00 35.09 ? 316 MET B O     1 
ATOM   5700  C CB    . MET B 1 316 ? -5.114  7.142   -8.744   1.00 33.48 ? 316 MET B CB    1 
ATOM   5701  C CG    . MET B 1 316 ? -3.742  7.212   -9.431   1.00 32.83 ? 316 MET B CG    1 
ATOM   5702  S SD    . MET B 1 316 ? -2.270  6.579   -8.519   1.00 35.54 ? 316 MET B SD    1 
ATOM   5703  C CE    . MET B 1 316 ? -2.188  7.730   -7.151   1.00 30.79 ? 316 MET B CE    1 
ATOM   5704  N N     . ALA B 1 317 ? -7.864  5.632   -7.726   1.00 33.09 ? 317 ALA B N     1 
ATOM   5705  C CA    . ALA B 1 317 ? -9.027  5.622   -6.833   1.00 32.20 ? 317 ALA B CA    1 
ATOM   5706  C C     . ALA B 1 317 ? -9.014  4.374   -5.979   1.00 30.70 ? 317 ALA B C     1 
ATOM   5707  O O     . ALA B 1 317 ? -9.333  4.456   -4.827   1.00 31.04 ? 317 ALA B O     1 
ATOM   5708  C CB    . ALA B 1 317 ? -10.347 5.700   -7.633   1.00 31.47 ? 317 ALA B CB    1 
ATOM   5709  N N     . HIS B 1 318 ? -8.708  3.217   -6.580   1.00 29.95 ? 318 HIS B N     1 
ATOM   5710  C CA    . HIS B 1 318 ? -8.525  1.986   -5.842   1.00 28.98 ? 318 HIS B CA    1 
ATOM   5711  C C     . HIS B 1 318 ? -7.493  2.254   -4.737   1.00 29.51 ? 318 HIS B C     1 
ATOM   5712  O O     . HIS B 1 318 ? -7.796  2.083   -3.562   1.00 29.60 ? 318 HIS B O     1 
ATOM   5713  C CB    . HIS B 1 318 ? -8.118  0.816   -6.741   1.00 27.64 ? 318 HIS B CB    1 
ATOM   5714  C CG    . HIS B 1 318 ? -7.578  -0.368  -5.990   1.00 26.20 ? 318 HIS B CG    1 
ATOM   5715  N ND1   . HIS B 1 318 ? -8.388  -1.362  -5.479   1.00 22.96 ? 318 HIS B ND1   1 
ATOM   5716  C CD2   . HIS B 1 318 ? -6.306  -0.713  -5.664   1.00 27.53 ? 318 HIS B CD2   1 
ATOM   5717  C CE1   . HIS B 1 318 ? -7.643  -2.267  -4.870   1.00 28.53 ? 318 HIS B CE1   1 
ATOM   5718  N NE2   . HIS B 1 318 ? -6.375  -1.893  -4.957   1.00 31.66 ? 318 HIS B NE2   1 
ATOM   5719  N N     . VAL B 1 319 ? -6.304  2.710   -5.105   1.00 30.06 ? 319 VAL B N     1 
ATOM   5720  C CA    . VAL B 1 319 ? -5.304  3.013   -4.111   1.00 31.31 ? 319 VAL B CA    1 
ATOM   5721  C C     . VAL B 1 319 ? -5.771  3.995   -3.075   1.00 33.47 ? 319 VAL B C     1 
ATOM   5722  O O     . VAL B 1 319 ? -5.321  3.957   -1.944   1.00 34.54 ? 319 VAL B O     1 
ATOM   5723  C CB    . VAL B 1 319 ? -3.882  3.327   -4.669   1.00 30.86 ? 319 VAL B CB    1 
ATOM   5724  C CG1   . VAL B 1 319 ? -3.770  3.044   -6.110   1.00 28.95 ? 319 VAL B CG1   1 
ATOM   5725  C CG2   . VAL B 1 319 ? -3.413  4.723   -4.329   1.00 29.91 ? 319 VAL B CG2   1 
ATOM   5726  N N     . ASP B 1 320 ? -6.704  4.856   -3.439   1.00 35.34 ? 320 ASP B N     1 
ATOM   5727  C CA    . ASP B 1 320 ? -7.300  5.704   -2.416   1.00 37.70 ? 320 ASP B CA    1 
ATOM   5728  C C     . ASP B 1 320 ? -8.218  4.989   -1.426   1.00 37.04 ? 320 ASP B C     1 
ATOM   5729  O O     . ASP B 1 320 ? -8.227  5.315   -0.251   1.00 37.63 ? 320 ASP B O     1 
ATOM   5730  C CB    . ASP B 1 320 ? -8.036  6.882   -3.057   1.00 40.32 ? 320 ASP B CB    1 
ATOM   5731  C CG    . ASP B 1 320 ? -7.537  8.216   -2.565   1.00 42.70 ? 320 ASP B CG    1 
ATOM   5732  O OD1   . ASP B 1 320 ? -8.086  8.739   -1.578   1.00 44.90 ? 320 ASP B OD1   1 
ATOM   5733  O OD2   . ASP B 1 320 ? -6.593  8.817   -3.106   1.00 47.29 ? 320 ASP B OD2   1 
ATOM   5734  N N     . ARG B 1 321 ? -8.992  4.024   -1.896   1.00 35.19 ? 321 ARG B N     1 
ATOM   5735  C CA    . ARG B 1 321 ? -9.703  3.134   -0.983   1.00 33.19 ? 321 ARG B CA    1 
ATOM   5736  C C     . ARG B 1 321 ? -8.798  2.239   -0.100   1.00 32.18 ? 321 ARG B C     1 
ATOM   5737  O O     . ARG B 1 321 ? -9.081  2.094   1.084    1.00 31.65 ? 321 ARG B O     1 
ATOM   5738  C CB    . ARG B 1 321 ? -10.775 2.340   -1.716   1.00 33.86 ? 321 ARG B CB    1 
ATOM   5739  C CG    . ARG B 1 321 ? -11.922 3.253   -2.291   1.00 35.27 ? 321 ARG B CG    1 
ATOM   5740  C CD    . ARG B 1 321 ? -12.947 2.492   -3.101   1.00 33.33 ? 321 ARG B CD    1 
ATOM   5741  N NE    . ARG B 1 321 ? -12.386 1.583   -4.103   1.00 37.90 ? 321 ARG B NE    1 
ATOM   5742  C CZ    . ARG B 1 321 ? -12.081 1.881   -5.374   1.00 37.06 ? 321 ARG B CZ    1 
ATOM   5743  N NH1   . ARG B 1 321 ? -12.258 3.108   -5.870   1.00 39.37 ? 321 ARG B NH1   1 
ATOM   5744  N NH2   . ARG B 1 321 ? -11.604 0.923   -6.164   1.00 34.11 ? 321 ARG B NH2   1 
ATOM   5745  N N     . VAL B 1 322 ? -7.726  1.632   -0.641   1.00 31.34 ? 322 VAL B N     1 
ATOM   5746  C CA    . VAL B 1 322 ? -6.750  0.939   0.258    1.00 31.48 ? 322 VAL B CA    1 
ATOM   5747  C C     . VAL B 1 322 ? -6.184  1.821   1.366    1.00 30.10 ? 322 VAL B C     1 
ATOM   5748  O O     . VAL B 1 322 ? -6.214  1.433   2.539    1.00 30.24 ? 322 VAL B O     1 
ATOM   5749  C CB    . VAL B 1 322 ? -5.564  0.169   -0.441   1.00 31.12 ? 322 VAL B CB    1 
ATOM   5750  C CG1   . VAL B 1 322 ? -6.100  -0.820  -1.516   1.00 31.33 ? 322 VAL B CG1   1 
ATOM   5751  C CG2   . VAL B 1 322 ? -4.558  1.152   -1.012   1.00 32.42 ? 322 VAL B CG2   1 
ATOM   5752  N N     . ILE B 1 323 ? -5.664  2.982   0.989    1.00 29.58 ? 323 ILE B N     1 
ATOM   5753  C CA    . ILE B 1 323 ? -5.126  3.918   1.957    1.00 30.03 ? 323 ILE B CA    1 
ATOM   5754  C C     . ILE B 1 323 ? -6.205  4.208   3.056    1.00 30.69 ? 323 ILE B C     1 
ATOM   5755  O O     . ILE B 1 323 ? -5.935  4.135   4.274    1.00 30.93 ? 323 ILE B O     1 
ATOM   5756  C CB    . ILE B 1 323 ? -4.614  5.222   1.266    1.00 28.88 ? 323 ILE B CB    1 
ATOM   5757  C CG1   . ILE B 1 323 ? -3.479  4.895   0.297    1.00 31.77 ? 323 ILE B CG1   1 
ATOM   5758  C CG2   . ILE B 1 323 ? -4.180  6.226   2.270    1.00 24.89 ? 323 ILE B CG2   1 
ATOM   5759  C CD1   . ILE B 1 323 ? -3.089  6.003   -0.624   1.00 33.07 ? 323 ILE B CD1   1 
ATOM   5760  N N     . ASP B 1 324 ? -7.418  4.524   2.615    1.00 31.33 ? 324 ASP B N     1 
ATOM   5761  C CA    . ASP B 1 324 ? -8.514  4.818   3.529    1.00 31.74 ? 324 ASP B CA    1 
ATOM   5762  C C     . ASP B 1 324 ? -8.760  3.751   4.561    1.00 30.34 ? 324 ASP B C     1 
ATOM   5763  O O     . ASP B 1 324 ? -8.900  4.055   5.779    1.00 31.40 ? 324 ASP B O     1 
ATOM   5764  C CB    . ASP B 1 324 ? -9.783  5.193   2.778    1.00 32.90 ? 324 ASP B CB    1 
ATOM   5765  C CG    . ASP B 1 324 ? -9.884  6.685   2.585    1.00 36.86 ? 324 ASP B CG    1 
ATOM   5766  O OD1   . ASP B 1 324 ? -9.344  7.410   3.453    1.00 44.69 ? 324 ASP B OD1   1 
ATOM   5767  O OD2   . ASP B 1 324 ? -10.490 7.151   1.609    1.00 39.06 ? 324 ASP B OD2   1 
ATOM   5768  N N     . PHE B 1 325 ? -8.778  2.512   4.090    1.00 28.07 ? 325 PHE B N     1 
ATOM   5769  C CA    . PHE B 1 325 ? -8.858  1.361   4.965    1.00 26.88 ? 325 PHE B CA    1 
ATOM   5770  C C     . PHE B 1 325 ? -7.666  1.301   5.928    1.00 27.40 ? 325 PHE B C     1 
ATOM   5771  O O     . PHE B 1 325 ? -7.838  1.221   7.180    1.00 24.90 ? 325 PHE B O     1 
ATOM   5772  C CB    . PHE B 1 325 ? -8.971  0.063   4.174    1.00 26.45 ? 325 PHE B CB    1 
ATOM   5773  C CG    . PHE B 1 325 ? -8.806  -1.150  5.024    1.00 27.80 ? 325 PHE B CG    1 
ATOM   5774  C CD1   . PHE B 1 325 ? -9.861  -1.614  5.788    1.00 26.86 ? 325 PHE B CD1   1 
ATOM   5775  C CD2   . PHE B 1 325 ? -7.554  -1.761  5.158    1.00 24.00 ? 325 PHE B CD2   1 
ATOM   5776  C CE1   . PHE B 1 325 ? -9.700  -2.690  6.605    1.00 22.35 ? 325 PHE B CE1   1 
ATOM   5777  C CE2   . PHE B 1 325 ? -7.407  -2.823  5.942    1.00 25.14 ? 325 PHE B CE2   1 
ATOM   5778  C CZ    . PHE B 1 325 ? -8.478  -3.299  6.676    1.00 25.84 ? 325 PHE B CZ    1 
ATOM   5779  N N     . TYR B 1 326 ? -6.460  1.306   5.345    1.00 28.32 ? 326 TYR B N     1 
ATOM   5780  C CA    . TYR B 1 326 ? -5.239  1.215   6.169    1.00 29.35 ? 326 TYR B CA    1 
ATOM   5781  C C     . TYR B 1 326 ? -5.045  2.341   7.226    1.00 30.32 ? 326 TYR B C     1 
ATOM   5782  O O     . TYR B 1 326 ? -4.454  2.068   8.285    1.00 31.52 ? 326 TYR B O     1 
ATOM   5783  C CB    . TYR B 1 326 ? -4.017  1.044   5.293    1.00 30.44 ? 326 TYR B CB    1 
ATOM   5784  C CG    . TYR B 1 326 ? -3.784  -0.396  4.814    1.00 30.48 ? 326 TYR B CG    1 
ATOM   5785  C CD1   . TYR B 1 326 ? -3.650  -1.421  5.705    1.00 29.68 ? 326 TYR B CD1   1 
ATOM   5786  C CD2   . TYR B 1 326 ? -3.708  -0.700  3.473    1.00 31.98 ? 326 TYR B CD2   1 
ATOM   5787  C CE1   . TYR B 1 326 ? -3.439  -2.702  5.290    1.00 33.52 ? 326 TYR B CE1   1 
ATOM   5788  C CE2   . TYR B 1 326 ? -3.495  -2.007  3.033    1.00 31.84 ? 326 TYR B CE2   1 
ATOM   5789  C CZ    . TYR B 1 326 ? -3.347  -2.988  3.958    1.00 32.92 ? 326 TYR B CZ    1 
ATOM   5790  O OH    . TYR B 1 326 ? -3.126  -4.283  3.569    1.00 34.29 ? 326 TYR B OH    1 
ATOM   5791  N N     . SER B 1 327 ? -5.520  3.569   6.953    1.00 29.53 ? 327 SER B N     1 
ATOM   5792  C CA    . SER B 1 327 ? -5.512  4.664   7.933    1.00 29.48 ? 327 SER B CA    1 
ATOM   5793  C C     . SER B 1 327 ? -6.461  4.416   9.081    1.00 30.02 ? 327 SER B C     1 
ATOM   5794  O O     . SER B 1 327 ? -5.973  4.407   10.223   1.00 31.73 ? 327 SER B O     1 
ATOM   5795  C CB    . SER B 1 327 ? -5.904  6.015   7.344    1.00 29.93 ? 327 SER B CB    1 
ATOM   5796  O OG    . SER B 1 327 ? -5.169  6.376   6.194    1.00 32.17 ? 327 SER B OG    1 
ATOM   5797  N N     . ASN B 1 328 ? -7.786  4.256   8.845    1.00 29.02 ? 328 ASN B N     1 
ATOM   5798  C CA    . ASN B 1 328 ? -8.666  3.903   9.948    1.00 29.50 ? 328 ASN B CA    1 
ATOM   5799  C C     . ASN B 1 328 ? -8.028  2.771   10.701   1.00 29.17 ? 328 ASN B C     1 
ATOM   5800  O O     . ASN B 1 328 ? -8.137  2.729   11.930   1.00 30.04 ? 328 ASN B O     1 
ATOM   5801  C CB    . ASN B 1 328 ? -10.153 3.440   9.646    1.00 31.14 ? 328 ASN B CB    1 
ATOM   5802  C CG    . ASN B 1 328 ? -10.898 4.307   8.645    1.00 34.57 ? 328 ASN B CG    1 
ATOM   5803  O OD1   . ASN B 1 328 ? -11.455 3.779   7.672    1.00 41.44 ? 328 ASN B OD1   1 
ATOM   5804  N ND2   . ASN B 1 328 ? -10.901 5.624   8.847    1.00 38.09 ? 328 ASN B ND2   1 
ATOM   5805  N N     . GLN B 1 329 ? -7.405  1.814   10.013   1.00 28.97 ? 329 GLN B N     1 
ATOM   5806  C CA    . GLN B 1 329 ? -6.857  0.658   10.766   1.00 28.76 ? 329 GLN B CA    1 
ATOM   5807  C C     . GLN B 1 329 ? -5.771  1.189   11.692   1.00 28.49 ? 329 GLN B C     1 
ATOM   5808  O O     . GLN B 1 329 ? -5.655  0.733   12.830   1.00 29.06 ? 329 GLN B O     1 
ATOM   5809  C CB    . GLN B 1 329 ? -6.314  -0.484  9.875    1.00 28.82 ? 329 GLN B CB    1 
ATOM   5810  C CG    . GLN B 1 329 ? -7.379  -1.481  9.303    1.00 26.76 ? 329 GLN B CG    1 
ATOM   5811  C CD    . GLN B 1 329 ? -8.036  -2.360  10.361   1.00 29.28 ? 329 GLN B CD    1 
ATOM   5812  O OE1   . GLN B 1 329 ? -9.269  -2.307  10.568   1.00 29.46 ? 329 GLN B OE1   1 
ATOM   5813  N NE2   . GLN B 1 329 ? -7.224  -3.161  11.061   1.00 26.77 ? 329 GLN B NE2   1 
ATOM   5814  N N     . LYS B 1 330 ? -5.033  2.187   11.202   1.00 27.41 ? 330 LYS B N     1 
ATOM   5815  C CA    . LYS B 1 330 ? -3.937  2.862   11.929   1.00 27.16 ? 330 LYS B CA    1 
ATOM   5816  C C     . LYS B 1 330 ? -4.429  3.800   13.067   1.00 26.79 ? 330 LYS B C     1 
ATOM   5817  O O     . LYS B 1 330 ? -3.788  3.947   14.102   1.00 27.92 ? 330 LYS B O     1 
ATOM   5818  C CB    . LYS B 1 330 ? -3.026  3.633   10.924   1.00 25.55 ? 330 LYS B CB    1 
ATOM   5819  C CG    . LYS B 1 330 ? -2.377  4.827   11.491   1.00 21.79 ? 330 LYS B CG    1 
ATOM   5820  C CD    . LYS B 1 330 ? -2.540  5.913   10.439   1.00 26.83 ? 330 LYS B CD    1 
ATOM   5821  C CE    . LYS B 1 330 ? -2.738  7.339   10.993   1.00 25.87 ? 330 LYS B CE    1 
ATOM   5822  N NZ    . LYS B 1 330 ? -2.395  8.395   9.981    1.00 25.79 ? 330 LYS B NZ    1 
ATOM   5823  N N     . ASP B 1 331 ? -5.567  4.436   12.846   1.00 25.95 ? 331 ASP B N     1 
ATOM   5824  C CA    . ASP B 1 331 ? -6.273  5.165   13.906   1.00 24.29 ? 331 ASP B CA    1 
ATOM   5825  C C     . ASP B 1 331 ? -6.618  4.294   15.088   1.00 22.69 ? 331 ASP B C     1 
ATOM   5826  O O     . ASP B 1 331 ? -6.510  4.740   16.268   1.00 22.79 ? 331 ASP B O     1 
ATOM   5827  C CB    . ASP B 1 331 ? -7.529  5.780   13.343   1.00 24.11 ? 331 ASP B CB    1 
ATOM   5828  C CG    . ASP B 1 331 ? -7.257  6.998   12.427   1.00 27.69 ? 331 ASP B CG    1 
ATOM   5829  O OD1   . ASP B 1 331 ? -6.094  7.426   12.241   1.00 26.42 ? 331 ASP B OD1   1 
ATOM   5830  O OD2   . ASP B 1 331 ? -8.256  7.558   11.876   1.00 34.65 ? 331 ASP B OD2   1 
ATOM   5831  N N     . ALA B 1 332 ? -7.015  3.058   14.782   1.00 21.62 ? 332 ALA B N     1 
ATOM   5832  C CA    . ALA B 1 332 ? -7.450  2.065   15.782   1.00 22.12 ? 332 ALA B CA    1 
ATOM   5833  C C     . ALA B 1 332 ? -6.260  1.450   16.586   1.00 23.56 ? 332 ALA B C     1 
ATOM   5834  O O     . ALA B 1 332 ? -6.390  1.195   17.788   1.00 24.27 ? 332 ALA B O     1 
ATOM   5835  C CB    . ALA B 1 332 ? -8.200  1.002   15.128   1.00 20.34 ? 332 ALA B CB    1 
ATOM   5836  N N     . ILE B 1 333 ? -5.131  1.212   15.915   1.00 24.00 ? 333 ILE B N     1 
ATOM   5837  C CA    . ILE B 1 333 ? -3.946  0.701   16.568   1.00 25.02 ? 333 ILE B CA    1 
ATOM   5838  C C     . ILE B 1 333 ? -3.464  1.766   17.574   1.00 25.13 ? 333 ILE B C     1 
ATOM   5839  O O     . ILE B 1 333 ? -3.117  1.430   18.712   1.00 25.05 ? 333 ILE B O     1 
ATOM   5840  C CB    . ILE B 1 333 ? -2.828  0.329   15.545   1.00 24.61 ? 333 ILE B CB    1 
ATOM   5841  C CG1   . ILE B 1 333 ? -1.901  -0.763  16.097   1.00 26.08 ? 333 ILE B CG1   1 
ATOM   5842  C CG2   . ILE B 1 333 ? -1.992  1.557   15.227   1.00 22.25 ? 333 ILE B CG2   1 
ATOM   5843  C CD1   . ILE B 1 333 ? -2.343  -2.184  15.958   1.00 24.09 ? 333 ILE B CD1   1 
ATOM   5844  N N     . LEU B 1 334 ? -3.539  3.048   17.190   1.00 25.92 ? 334 LEU B N     1 
ATOM   5845  C CA    . LEU B 1 334 ? -2.980  4.133   18.024   1.00 26.44 ? 334 LEU B CA    1 
ATOM   5846  C C     . LEU B 1 334 ? -3.876  4.517   19.252   1.00 27.56 ? 334 LEU B C     1 
ATOM   5847  O O     . LEU B 1 334 ? -3.377  4.696   20.399   1.00 29.02 ? 334 LEU B O     1 
ATOM   5848  C CB    . LEU B 1 334 ? -2.695  5.342   17.152   1.00 26.25 ? 334 LEU B CB    1 
ATOM   5849  C CG    . LEU B 1 334 ? -1.558  5.391   16.087   1.00 25.38 ? 334 LEU B CG    1 
ATOM   5850  C CD1   . LEU B 1 334 ? -1.867  6.655   15.347   1.00 23.70 ? 334 LEU B CD1   1 
ATOM   5851  C CD2   . LEU B 1 334 ? -0.139  5.468   16.663   1.00 16.03 ? 334 LEU B CD2   1 
ATOM   5852  N N     . ALA B 1 335 ? -5.174  4.645   18.994   1.00 26.83 ? 335 ALA B N     1 
ATOM   5853  C CA    . ALA B 1 335 ? -6.228  4.671   19.995   1.00 26.27 ? 335 ALA B CA    1 
ATOM   5854  C C     . ALA B 1 335 ? -5.965  3.580   20.969   1.00 26.51 ? 335 ALA B C     1 
ATOM   5855  O O     . ALA B 1 335 ? -5.857  3.859   22.112   1.00 26.93 ? 335 ALA B O     1 
ATOM   5856  C CB    . ALA B 1 335 ? -7.617  4.482   19.360   1.00 24.41 ? 335 ALA B CB    1 
ATOM   5857  N N     . ALA B 1 336 ? -5.818  2.340   20.513   1.00 27.13 ? 336 ALA B N     1 
ATOM   5858  C CA    . ALA B 1 336 ? -5.648  1.226   21.418   1.00 28.08 ? 336 ALA B CA    1 
ATOM   5859  C C     . ALA B 1 336 ? -4.397  1.399   22.226   1.00 29.27 ? 336 ALA B C     1 
ATOM   5860  O O     . ALA B 1 336 ? -4.346  0.980   23.377   1.00 29.74 ? 336 ALA B O     1 
ATOM   5861  C CB    . ALA B 1 336 ? -5.561  -0.086  20.645   1.00 28.78 ? 336 ALA B CB    1 
ATOM   5862  N N     . ALA B 1 337 ? -3.362  1.970   21.616   1.00 29.67 ? 337 ALA B N     1 
ATOM   5863  C CA    . ALA B 1 337 ? -2.097  2.120   22.335   1.00 30.22 ? 337 ALA B CA    1 
ATOM   5864  C C     . ALA B 1 337 ? -2.198  3.311   23.263   1.00 30.55 ? 337 ALA B C     1 
ATOM   5865  O O     . ALA B 1 337 ? -1.571  3.349   24.332   1.00 30.91 ? 337 ALA B O     1 
ATOM   5866  C CB    . ALA B 1 337 ? -0.911  2.304   21.353   1.00 30.02 ? 337 ALA B CB    1 
ATOM   5867  N N     . ASP B 1 338 ? -2.922  4.324   22.815   1.00 31.09 ? 338 ASP B N     1 
ATOM   5868  C CA    . ASP B 1 338 ? -3.029  5.518   23.590   1.00 31.65 ? 338 ASP B CA    1 
ATOM   5869  C C     . ASP B 1 338 ? -3.841  5.084   24.760   1.00 30.81 ? 338 ASP B C     1 
ATOM   5870  O O     . ASP B 1 338 ? -3.613  5.513   25.860   1.00 31.28 ? 338 ASP B O     1 
ATOM   5871  C CB    . ASP B 1 338 ? -3.630  6.661   22.773   1.00 32.23 ? 338 ASP B CB    1 
ATOM   5872  C CG    . ASP B 1 338 ? -2.540  7.453   22.046   1.00 36.17 ? 338 ASP B CG    1 
ATOM   5873  O OD1   . ASP B 1 338 ? -2.505  7.564   20.782   1.00 34.60 ? 338 ASP B OD1   1 
ATOM   5874  O OD2   . ASP B 1 338 ? -1.641  7.928   22.784   1.00 40.94 ? 338 ASP B OD2   1 
ATOM   5875  N N     . LYS B 1 339 ? -4.688  4.101   24.537   1.00 30.32 ? 339 LYS B N     1 
ATOM   5876  C CA    . LYS B 1 339 ? -5.527  3.644   25.582   1.00 30.27 ? 339 LYS B CA    1 
ATOM   5877  C C     . LYS B 1 339 ? -4.726  2.885   26.681   1.00 30.22 ? 339 LYS B C     1 
ATOM   5878  O O     . LYS B 1 339 ? -4.959  3.134   27.877   1.00 30.95 ? 339 LYS B O     1 
ATOM   5879  C CB    . LYS B 1 339 ? -6.743  2.841   25.050   1.00 30.27 ? 339 LYS B CB    1 
ATOM   5880  C CG    . LYS B 1 339 ? -7.803  2.648   26.116   1.00 29.08 ? 339 LYS B CG    1 
ATOM   5881  C CD    . LYS B 1 339 ? -8.784  1.596   25.734   1.00 26.95 ? 339 LYS B CD    1 
ATOM   5882  C CE    . LYS B 1 339 ? -9.893  1.546   26.762   1.00 23.37 ? 339 LYS B CE    1 
ATOM   5883  N NZ    . LYS B 1 339 ? -10.948 0.813   26.112   1.00 27.34 ? 339 LYS B NZ    1 
ATOM   5884  N N     . TRP B 1 340 ? -3.812  1.999   26.296   1.00 28.54 ? 340 TRP B N     1 
ATOM   5885  C CA    . TRP B 1 340 ? -3.220  1.081   27.276   1.00 28.28 ? 340 TRP B CA    1 
ATOM   5886  C C     . TRP B 1 340 ? -1.753  1.272   27.488   1.00 27.80 ? 340 TRP B C     1 
ATOM   5887  O O     . TRP B 1 340 ? -1.272  0.959   28.564   1.00 27.89 ? 340 TRP B O     1 
ATOM   5888  C CB    . TRP B 1 340 ? -3.454  -0.395  26.928   1.00 27.73 ? 340 TRP B CB    1 
ATOM   5889  C CG    . TRP B 1 340 ? -4.824  -0.696  26.829   1.00 27.53 ? 340 TRP B CG    1 
ATOM   5890  C CD1   . TRP B 1 340 ? -5.588  -0.684  25.683   1.00 28.29 ? 340 TRP B CD1   1 
ATOM   5891  C CD2   . TRP B 1 340 ? -5.704  -0.997  27.909   1.00 28.77 ? 340 TRP B CD2   1 
ATOM   5892  N NE1   . TRP B 1 340 ? -6.891  -1.000  25.989   1.00 30.78 ? 340 TRP B NE1   1 
ATOM   5893  C CE2   . TRP B 1 340 ? -7.000  -1.184  27.347   1.00 28.53 ? 340 TRP B CE2   1 
ATOM   5894  C CE3   . TRP B 1 340 ? -5.533  -1.130  29.300   1.00 27.62 ? 340 TRP B CE3   1 
ATOM   5895  C CZ2   . TRP B 1 340 ? -8.110  -1.524  28.124   1.00 26.90 ? 340 TRP B CZ2   1 
ATOM   5896  C CZ3   . TRP B 1 340 ? -6.634  -1.471  30.071   1.00 28.93 ? 340 TRP B CZ3   1 
ATOM   5897  C CH2   . TRP B 1 340 ? -7.912  -1.665  29.483   1.00 27.81 ? 340 TRP B CH2   1 
ATOM   5898  N N     . LEU B 1 341 ? -1.049  1.777   26.484   1.00 26.39 ? 341 LEU B N     1 
ATOM   5899  C CA    . LEU B 1 341 ? 0.408   1.843   26.585   1.00 27.08 ? 341 LEU B CA    1 
ATOM   5900  C C     . LEU B 1 341 ? 0.897   3.149   27.167   1.00 27.22 ? 341 LEU B C     1 
ATOM   5901  O O     . LEU B 1 341 ? 2.076   3.294   27.427   1.00 27.81 ? 341 LEU B O     1 
ATOM   5902  C CB    . LEU B 1 341 ? 1.097   1.594   25.219   1.00 26.22 ? 341 LEU B CB    1 
ATOM   5903  C CG    . LEU B 1 341 ? 1.483   0.154   24.875   1.00 25.25 ? 341 LEU B CG    1 
ATOM   5904  C CD1   . LEU B 1 341 ? 0.613   -0.880  25.547   1.00 25.19 ? 341 LEU B CD1   1 
ATOM   5905  C CD2   . LEU B 1 341 ? 1.513   -0.101  23.366   1.00 25.11 ? 341 LEU B CD2   1 
ATOM   5906  N N     . THR B 1 342 ? -0.008  4.098   27.343   1.00 27.05 ? 342 THR B N     1 
ATOM   5907  C CA    . THR B 1 342 ? 0.370   5.425   27.777   1.00 27.38 ? 342 THR B CA    1 
ATOM   5908  C C     . THR B 1 342 ? 1.307   5.439   28.961   1.00 27.44 ? 342 THR B C     1 
ATOM   5909  O O     . THR B 1 342 ? 0.976   4.969   30.109   1.00 28.08 ? 342 THR B O     1 
ATOM   5910  C CB    . THR B 1 342 ? -0.836  6.203   28.126   1.00 27.36 ? 342 THR B CB    1 
ATOM   5911  O OG1   . THR B 1 342 ? -1.773  5.269   28.746   1.00 29.60 ? 342 THR B OG1   1 
ATOM   5912  C CG2   . THR B 1 342 ? -1.396  6.811   26.815   1.00 25.29 ? 342 THR B CG2   1 
ATOM   5913  N N     . GLY B 1 343 ? 2.485   5.983   28.702   1.00 27.09 ? 343 GLY B N     1 
ATOM   5914  C CA    . GLY B 1 343 ? 3.454   6.121   29.796   1.00 26.22 ? 343 GLY B CA    1 
ATOM   5915  C C     . GLY B 1 343 ? 4.224   4.856   30.031   1.00 25.94 ? 343 GLY B C     1 
ATOM   5916  O O     . GLY B 1 343 ? 5.135   4.894   30.808   1.00 27.51 ? 343 GLY B O     1 
ATOM   5917  N N     . LEU B 1 344 ? 3.871   3.757   29.338   1.00 26.46 ? 344 LEU B N     1 
ATOM   5918  C CA    . LEU B 1 344 ? 4.542   2.435   29.401   1.00 25.21 ? 344 LEU B CA    1 
ATOM   5919  C C     . LEU B 1 344 ? 5.314   2.091   28.158   1.00 25.87 ? 344 LEU B C     1 
ATOM   5920  O O     . LEU B 1 344 ? 6.103   1.156   28.159   1.00 24.50 ? 344 LEU B O     1 
ATOM   5921  C CB    . LEU B 1 344 ? 3.540   1.319   29.554   1.00 25.13 ? 344 LEU B CB    1 
ATOM   5922  C CG    . LEU B 1 344 ? 2.710   1.328   30.792   1.00 24.32 ? 344 LEU B CG    1 
ATOM   5923  C CD1   . LEU B 1 344 ? 1.515   0.517   30.423   1.00 28.02 ? 344 LEU B CD1   1 
ATOM   5924  C CD2   . LEU B 1 344 ? 3.509   0.738   31.910   1.00 21.65 ? 344 LEU B CD2   1 
ATOM   5925  N N     . ALA B 1 345 ? 5.099   2.849   27.089   1.00 27.23 ? 345 ALA B N     1 
ATOM   5926  C CA    . ALA B 1 345 ? 5.813   2.616   25.820   1.00 27.87 ? 345 ALA B CA    1 
ATOM   5927  C C     . ALA B 1 345 ? 5.875   3.856   24.963   1.00 28.62 ? 345 ALA B C     1 
ATOM   5928  O O     . ALA B 1 345 ? 5.107   4.763   25.121   1.00 27.67 ? 345 ALA B O     1 
ATOM   5929  C CB    . ALA B 1 345 ? 5.130   1.474   25.038   1.00 27.90 ? 345 ALA B CB    1 
ATOM   5930  N N     . GLU B 1 346 ? 6.783   3.888   24.007   1.00 30.69 ? 346 GLU B N     1 
ATOM   5931  C CA    . GLU B 1 346 ? 6.877   5.058   23.144   1.00 32.40 ? 346 GLU B CA    1 
ATOM   5932  C C     . GLU B 1 346 ? 6.794   4.688   21.653   1.00 31.02 ? 346 GLU B C     1 
ATOM   5933  O O     . GLU B 1 346 ? 7.296   3.676   21.260   1.00 31.20 ? 346 GLU B O     1 
ATOM   5934  C CB    . GLU B 1 346 ? 8.176   5.818   23.493   1.00 32.13 ? 346 GLU B CB    1 
ATOM   5935  C CG    . GLU B 1 346 ? 7.986   6.817   24.670   1.00 35.34 ? 346 GLU B CG    1 
ATOM   5936  C CD    . GLU B 1 346 ? 9.166   7.787   24.874   1.00 37.74 ? 346 GLU B CD    1 
ATOM   5937  O OE1   . GLU B 1 346 ? 8.869   9.014   24.946   1.00 41.36 ? 346 GLU B OE1   1 
ATOM   5938  O OE2   . GLU B 1 346 ? 10.366  7.324   24.970   1.00 41.51 ? 346 GLU B OE2   1 
ATOM   5939  N N     . TRP B 1 347 ? 6.151   5.502   20.816   1.00 30.26 ? 347 TRP B N     1 
ATOM   5940  C CA    . TRP B 1 347 ? 6.047   5.176   19.409   1.00 27.91 ? 347 TRP B CA    1 
ATOM   5941  C C     . TRP B 1 347 ? 5.763   6.444   18.685   1.00 28.29 ? 347 TRP B C     1 
ATOM   5942  O O     . TRP B 1 347 ? 5.293   7.373   19.287   1.00 30.83 ? 347 TRP B O     1 
ATOM   5943  C CB    . TRP B 1 347 ? 4.951   4.142   19.160   1.00 27.19 ? 347 TRP B CB    1 
ATOM   5944  C CG    . TRP B 1 347 ? 3.621   4.613   19.605   1.00 27.54 ? 347 TRP B CG    1 
ATOM   5945  C CD1   . TRP B 1 347 ? 2.694   5.329   18.867   1.00 28.78 ? 347 TRP B CD1   1 
ATOM   5946  C CD2   . TRP B 1 347 ? 3.078   4.493   20.915   1.00 24.88 ? 347 TRP B CD2   1 
ATOM   5947  N NE1   . TRP B 1 347 ? 1.594   5.613   19.648   1.00 28.64 ? 347 TRP B NE1   1 
ATOM   5948  C CE2   . TRP B 1 347 ? 1.817   5.131   20.911   1.00 28.06 ? 347 TRP B CE2   1 
ATOM   5949  C CE3   . TRP B 1 347 ? 3.528   3.900   22.094   1.00 24.69 ? 347 TRP B CE3   1 
ATOM   5950  C CZ2   . TRP B 1 347 ? 1.001   5.186   22.054   1.00 30.48 ? 347 TRP B CZ2   1 
ATOM   5951  C CZ3   . TRP B 1 347 ? 2.708   3.960   23.234   1.00 28.81 ? 347 TRP B CZ3   1 
ATOM   5952  C CH2   . TRP B 1 347 ? 1.467   4.586   23.201   1.00 27.12 ? 347 TRP B CH2   1 
ATOM   5953  N N     . HIS B 1 348 ? 6.065   6.505   17.397   1.00 28.84 ? 348 HIS B N     1 
ATOM   5954  C CA    . HIS B 1 348 ? 5.657   7.600   16.524   1.00 28.21 ? 348 HIS B CA    1 
ATOM   5955  C C     . HIS B 1 348 ? 4.582   7.087   15.647   1.00 27.72 ? 348 HIS B C     1 
ATOM   5956  O O     . HIS B 1 348 ? 4.472   5.869   15.465   1.00 29.30 ? 348 HIS B O     1 
ATOM   5957  C CB    . HIS B 1 348 ? 6.766   8.009   15.578   1.00 27.76 ? 348 HIS B CB    1 
ATOM   5958  C CG    . HIS B 1 348 ? 8.067   8.254   16.242   1.00 30.56 ? 348 HIS B CG    1 
ATOM   5959  N ND1   . HIS B 1 348 ? 8.366   9.446   16.869   1.00 35.88 ? 348 HIS B ND1   1 
ATOM   5960  C CD2   . HIS B 1 348 ? 9.179   7.494   16.318   1.00 27.54 ? 348 HIS B CD2   1 
ATOM   5961  C CE1   . HIS B 1 348 ? 9.612   9.402   17.310   1.00 30.50 ? 348 HIS B CE1   1 
ATOM   5962  N NE2   . HIS B 1 348 ? 10.116  8.221   17.004   1.00 30.35 ? 348 HIS B NE2   1 
ATOM   5963  N N     . VAL B 1 349 ? 3.793   7.985   15.082   1.00 27.02 ? 349 VAL B N     1 
ATOM   5964  C CA    . VAL B 1 349 ? 2.736   7.583   14.177   1.00 26.85 ? 349 VAL B CA    1 
ATOM   5965  C C     . VAL B 1 349 ? 3.153   7.345   12.733   1.00 27.30 ? 349 VAL B C     1 
ATOM   5966  O O     . VAL B 1 349 ? 3.686   8.215   12.072   1.00 27.69 ? 349 VAL B O     1 
ATOM   5967  C CB    . VAL B 1 349 ? 1.461   8.432   14.309   1.00 26.58 ? 349 VAL B CB    1 
ATOM   5968  C CG1   . VAL B 1 349 ? 1.674   9.575   15.221   1.00 25.55 ? 349 VAL B CG1   1 
ATOM   5969  C CG2   . VAL B 1 349 ? 0.939   8.871   12.978   1.00 24.48 ? 349 VAL B CG2   1 
ATOM   5970  N N     . PRO B 1 350 ? 2.899   6.128   12.277   1.00 27.91 ? 350 PRO B N     1 
ATOM   5971  C CA    . PRO B 1 350 ? 3.270   5.652   10.951   1.00 27.21 ? 350 PRO B CA    1 
ATOM   5972  C C     . PRO B 1 350 ? 2.853   6.602   9.880    1.00 27.22 ? 350 PRO B C     1 
ATOM   5973  O O     . PRO B 1 350 ? 1.786   7.198   9.948    1.00 26.84 ? 350 PRO B O     1 
ATOM   5974  C CB    . PRO B 1 350 ? 2.478   4.381   10.799   1.00 27.67 ? 350 PRO B CB    1 
ATOM   5975  C CG    . PRO B 1 350 ? 2.259   3.912   12.242   1.00 27.67 ? 350 PRO B CG    1 
ATOM   5976  C CD    . PRO B 1 350 ? 2.098   5.127   13.022   1.00 28.21 ? 350 PRO B CD    1 
ATOM   5977  N N     . ALA B 1 351 ? 3.756   6.803   8.928    1.00 27.46 ? 351 ALA B N     1 
ATOM   5978  C CA    . ALA B 1 351 ? 3.500   7.675   7.797    1.00 26.76 ? 351 ALA B CA    1 
ATOM   5979  C C     . ALA B 1 351 ? 2.932   6.870   6.633    1.00 26.45 ? 351 ALA B C     1 
ATOM   5980  O O     . ALA B 1 351 ? 2.287   7.400   5.734    1.00 27.94 ? 351 ALA B O     1 
ATOM   5981  C CB    . ALA B 1 351 ? 4.772   8.326   7.401    1.00 26.63 ? 351 ALA B CB    1 
ATOM   5982  N N     . ALA B 1 352 ? 3.163   5.574   6.653    1.00 25.12 ? 352 ALA B N     1 
ATOM   5983  C CA    . ALA B 1 352 ? 2.648   4.728   5.602    1.00 25.30 ? 352 ALA B CA    1 
ATOM   5984  C C     . ALA B 1 352 ? 2.701   3.307   6.085    1.00 25.43 ? 352 ALA B C     1 
ATOM   5985  O O     . ALA B 1 352 ? 3.144   3.032   7.237    1.00 24.41 ? 352 ALA B O     1 
ATOM   5986  C CB    . ALA B 1 352 ? 3.435   4.923   4.275    1.00 23.93 ? 352 ALA B CB    1 
ATOM   5987  N N     . GLY B 1 353 ? 2.197   2.412   5.237    1.00 25.33 ? 353 GLY B N     1 
ATOM   5988  C CA    . GLY B 1 353 ? 2.403   0.992   5.453    1.00 25.78 ? 353 GLY B CA    1 
ATOM   5989  C C     . GLY B 1 353 ? 1.459   0.451   6.476    1.00 26.67 ? 353 GLY B C     1 
ATOM   5990  O O     . GLY B 1 353 ? 0.417   1.062   6.723    1.00 27.10 ? 353 GLY B O     1 
ATOM   5991  N N     . MET B 1 354 ? 1.809   -0.698  7.063    1.00 27.13 ? 354 MET B N     1 
ATOM   5992  C CA    . MET B 1 354 ? 0.875   -1.430  7.937    1.00 27.24 ? 354 MET B CA    1 
ATOM   5993  C C     . MET B 1 354 ? 1.431   -1.855  9.302    1.00 26.29 ? 354 MET B C     1 
ATOM   5994  O O     . MET B 1 354 ? 0.998   -2.871  9.855    1.00 26.09 ? 354 MET B O     1 
ATOM   5995  C CB    . MET B 1 354 ? 0.323   -2.664  7.200    1.00 27.82 ? 354 MET B CB    1 
ATOM   5996  C CG    . MET B 1 354 ? 1.331   -3.801  6.936    1.00 28.18 ? 354 MET B CG    1 
ATOM   5997  S SD    . MET B 1 354 ? 0.762   -4.954  5.614    1.00 29.04 ? 354 MET B SD    1 
ATOM   5998  C CE    . MET B 1 354 ? 0.503   -3.806  4.258    1.00 31.03 ? 354 MET B CE    1 
ATOM   5999  N N     . PHE B 1 355 ? 2.369   -1.078  9.834    1.00 25.16 ? 355 PHE B N     1 
ATOM   6000  C CA    . PHE B 1 355 ? 3.211   -1.515  10.907   1.00 24.78 ? 355 PHE B CA    1 
ATOM   6001  C C     . PHE B 1 355 ? 3.393   -0.362  11.885   1.00 25.49 ? 355 PHE B C     1 
ATOM   6002  O O     . PHE B 1 355 ? 3.703   0.757   11.486   1.00 27.56 ? 355 PHE B O     1 
ATOM   6003  C CB    . PHE B 1 355 ? 4.566   -2.008  10.362   1.00 25.08 ? 355 PHE B CB    1 
ATOM   6004  C CG    . PHE B 1 355 ? 4.519   -3.367  9.681    1.00 22.70 ? 355 PHE B CG    1 
ATOM   6005  C CD1   . PHE B 1 355 ? 3.891   -4.468  10.297   1.00 27.91 ? 355 PHE B CD1   1 
ATOM   6006  C CD2   . PHE B 1 355 ? 5.162   -3.566  8.477    1.00 25.45 ? 355 PHE B CD2   1 
ATOM   6007  C CE1   . PHE B 1 355 ? 3.860   -5.728  9.688    1.00 25.29 ? 355 PHE B CE1   1 
ATOM   6008  C CE2   . PHE B 1 355 ? 5.157   -4.823  7.839    1.00 28.20 ? 355 PHE B CE2   1 
ATOM   6009  C CZ    . PHE B 1 355 ? 4.509   -5.904  8.446    1.00 28.00 ? 355 PHE B CZ    1 
ATOM   6010  N N     . LEU B 1 356 ? 3.093   -0.622  13.149   1.00 25.61 ? 356 LEU B N     1 
ATOM   6011  C CA    . LEU B 1 356 ? 3.406   0.265   14.243   1.00 25.37 ? 356 LEU B CA    1 
ATOM   6012  C C     . LEU B 1 356 ? 4.627   -0.282  14.979   1.00 25.02 ? 356 LEU B C     1 
ATOM   6013  O O     . LEU B 1 356 ? 4.797   -1.468  15.100   1.00 25.02 ? 356 LEU B O     1 
ATOM   6014  C CB    . LEU B 1 356 ? 2.254   0.312   15.231   1.00 25.86 ? 356 LEU B CB    1 
ATOM   6015  C CG    . LEU B 1 356 ? 2.538   1.221   16.418   1.00 24.35 ? 356 LEU B CG    1 
ATOM   6016  C CD1   . LEU B 1 356 ? 2.758   2.710   16.009   1.00 19.23 ? 356 LEU B CD1   1 
ATOM   6017  C CD2   . LEU B 1 356 ? 1.426   1.050   17.453   1.00 26.51 ? 356 LEU B CD2   1 
ATOM   6018  N N     . TRP B 1 357 ? 5.460   0.609   15.478   1.00 24.56 ? 357 TRP B N     1 
ATOM   6019  C CA    . TRP B 1 357 ? 6.737   0.236   15.978   1.00 24.57 ? 357 TRP B CA    1 
ATOM   6020  C C     . TRP B 1 357 ? 6.848   0.853   17.363   1.00 25.68 ? 357 TRP B C     1 
ATOM   6021  O O     . TRP B 1 357 ? 6.771   2.094   17.521   1.00 25.48 ? 357 TRP B O     1 
ATOM   6022  C CB    . TRP B 1 357 ? 7.775   0.731   14.993   1.00 23.38 ? 357 TRP B CB    1 
ATOM   6023  C CG    . TRP B 1 357 ? 9.239   0.533   15.314   1.00 22.93 ? 357 TRP B CG    1 
ATOM   6024  C CD1   . TRP B 1 357 ? 10.187  1.545   15.489   1.00 22.53 ? 357 TRP B CD1   1 
ATOM   6025  C CD2   . TRP B 1 357 ? 9.957   -0.701  15.441   1.00 19.05 ? 357 TRP B CD2   1 
ATOM   6026  N NE1   . TRP B 1 357 ? 11.427  1.003   15.704   1.00 20.32 ? 357 TRP B NE1   1 
ATOM   6027  C CE2   . TRP B 1 357 ? 11.330  -0.364  15.710   1.00 19.97 ? 357 TRP B CE2   1 
ATOM   6028  C CE3   . TRP B 1 357 ? 9.590   -2.049  15.370   1.00 19.12 ? 357 TRP B CE3   1 
ATOM   6029  C CZ2   . TRP B 1 357 ? 12.356  -1.351  15.917   1.00 20.05 ? 357 TRP B CZ2   1 
ATOM   6030  C CZ3   . TRP B 1 357 ? 10.599  -3.041  15.539   1.00 21.47 ? 357 TRP B CZ3   1 
ATOM   6031  C CH2   . TRP B 1 357 ? 11.992  -2.663  15.825   1.00 20.70 ? 357 TRP B CH2   1 
ATOM   6032  N N     . ILE B 1 358 ? 6.991   -0.026  18.367   1.00 25.90 ? 358 ILE B N     1 
ATOM   6033  C CA    . ILE B 1 358 ? 6.672   0.327   19.731   1.00 26.61 ? 358 ILE B CA    1 
ATOM   6034  C C     . ILE B 1 358 ? 7.852   0.040   20.637   1.00 27.66 ? 358 ILE B C     1 
ATOM   6035  O O     . ILE B 1 358 ? 8.201   -1.124  20.841   1.00 28.15 ? 358 ILE B O     1 
ATOM   6036  C CB    . ILE B 1 358 ? 5.465   -0.497  20.210   1.00 26.56 ? 358 ILE B CB    1 
ATOM   6037  C CG1   . ILE B 1 358 ? 4.153   -0.040  19.569   1.00 25.25 ? 358 ILE B CG1   1 
ATOM   6038  C CG2   . ILE B 1 358 ? 5.361   -0.539  21.735   1.00 27.89 ? 358 ILE B CG2   1 
ATOM   6039  C CD1   . ILE B 1 358 ? 3.072   -1.110  19.756   1.00 26.12 ? 358 ILE B CD1   1 
ATOM   6040  N N     . LYS B 1 359 ? 8.437   1.103   21.188   1.00 28.39 ? 359 LYS B N     1 
ATOM   6041  C CA    . LYS B 1 359 ? 9.496   1.012   22.137   1.00 30.74 ? 359 LYS B CA    1 
ATOM   6042  C C     . LYS B 1 359 ? 8.978   0.820   23.554   1.00 32.95 ? 359 LYS B C     1 
ATOM   6043  O O     . LYS B 1 359 ? 8.494   1.782   24.189   1.00 33.54 ? 359 LYS B O     1 
ATOM   6044  C CB    . LYS B 1 359 ? 10.387  2.252   22.091   1.00 31.45 ? 359 LYS B CB    1 
ATOM   6045  C CG    . LYS B 1 359 ? 11.753  2.039   22.840   1.00 30.86 ? 359 LYS B CG    1 
ATOM   6046  C CD    . LYS B 1 359 ? 12.488  3.342   23.062   1.00 30.39 ? 359 LYS B CD    1 
ATOM   6047  C CE    . LYS B 1 359 ? 14.009  3.079   23.126   1.00 33.90 ? 359 LYS B CE    1 
ATOM   6048  N NZ    . LYS B 1 359 ? 14.633  4.166   23.970   1.00 34.36 ? 359 LYS B NZ    1 
ATOM   6049  N N     . VAL B 1 360 ? 9.055   -0.399  24.056   1.00 34.64 ? 360 VAL B N     1 
ATOM   6050  C CA    . VAL B 1 360 ? 8.648   -0.599  25.413   1.00 36.74 ? 360 VAL B CA    1 
ATOM   6051  C C     . VAL B 1 360 ? 9.662   -0.139  26.406   1.00 38.67 ? 360 VAL B C     1 
ATOM   6052  O O     . VAL B 1 360 ? 10.852  -0.356  26.270   1.00 39.11 ? 360 VAL B O     1 
ATOM   6053  C CB    . VAL B 1 360 ? 8.063   -1.969  25.730   1.00 37.75 ? 360 VAL B CB    1 
ATOM   6054  C CG1   . VAL B 1 360 ? 7.750   -2.743  24.476   1.00 36.33 ? 360 VAL B CG1   1 
ATOM   6055  C CG2   . VAL B 1 360 ? 8.928   -2.720  26.692   1.00 33.93 ? 360 VAL B CG2   1 
ATOM   6056  N N     . LYS B 1 361 ? 9.144   0.559   27.391   1.00 40.36 ? 361 LYS B N     1 
ATOM   6057  C CA    . LYS B 1 361 ? 9.926   1.350   28.316   1.00 42.03 ? 361 LYS B CA    1 
ATOM   6058  C C     . LYS B 1 361 ? 10.191  0.460   29.499   1.00 42.81 ? 361 LYS B C     1 
ATOM   6059  O O     . LYS B 1 361 ? 9.242   -0.080  30.084   1.00 42.81 ? 361 LYS B O     1 
ATOM   6060  C CB    . LYS B 1 361 ? 9.083   2.510   28.773   1.00 42.23 ? 361 LYS B CB    1 
ATOM   6061  C CG    . LYS B 1 361 ? 9.800   3.812   29.023   1.00 43.47 ? 361 LYS B CG    1 
ATOM   6062  C CD    . LYS B 1 361 ? 8.723   4.849   29.229   1.00 43.86 ? 361 LYS B CD    1 
ATOM   6063  C CE    . LYS B 1 361 ? 9.215   6.129   29.875   1.00 46.47 ? 361 LYS B CE    1 
ATOM   6064  N NZ    . LYS B 1 361 ? 7.960   6.960   30.131   1.00 49.33 ? 361 LYS B NZ    1 
ATOM   6065  N N     . GLY B 1 362 ? 11.473  0.282   29.823   1.00 43.12 ? 362 GLY B N     1 
ATOM   6066  C CA    . GLY B 1 362 ? 11.873  -0.277  31.115   1.00 43.06 ? 362 GLY B CA    1 
ATOM   6067  C C     . GLY B 1 362 ? 11.898  -1.790  31.145   1.00 43.75 ? 362 GLY B C     1 
ATOM   6068  O O     . GLY B 1 362 ? 11.872  -2.400  32.226   1.00 43.36 ? 362 GLY B O     1 
ATOM   6069  N N     . ILE B 1 363 ? 11.908  -2.373  29.938   1.00 43.82 ? 363 ILE B N     1 
ATOM   6070  C CA    . ILE B 1 363 ? 12.136  -3.786  29.700   1.00 43.41 ? 363 ILE B CA    1 
ATOM   6071  C C     . ILE B 1 363 ? 13.220  -3.786  28.651   1.00 43.71 ? 363 ILE B C     1 
ATOM   6072  O O     . ILE B 1 363 ? 13.180  -2.956  27.729   1.00 44.26 ? 363 ILE B O     1 
ATOM   6073  C CB    . ILE B 1 363 ? 10.871  -4.462  29.172   1.00 43.63 ? 363 ILE B CB    1 
ATOM   6074  C CG1   . ILE B 1 363 ? 9.884   -4.573  30.315   1.00 42.69 ? 363 ILE B CG1   1 
ATOM   6075  C CG2   . ILE B 1 363 ? 11.149  -5.885  28.629   1.00 42.64 ? 363 ILE B CG2   1 
ATOM   6076  C CD1   . ILE B 1 363 ? 8.517   -4.851  29.851   1.00 42.20 ? 363 ILE B CD1   1 
ATOM   6077  N N     . ASN B 1 364 ? 14.203  -4.673  28.809   1.00 43.20 ? 364 ASN B N     1 
ATOM   6078  C CA    . ASN B 1 364 ? 15.390  -4.648  27.961   1.00 43.42 ? 364 ASN B CA    1 
ATOM   6079  C C     . ASN B 1 364 ? 15.266  -5.415  26.664   1.00 42.35 ? 364 ASN B C     1 
ATOM   6080  O O     . ASN B 1 364 ? 15.678  -4.926  25.610   1.00 40.67 ? 364 ASN B O     1 
ATOM   6081  C CB    . ASN B 1 364 ? 16.615  -5.214  28.690   1.00 43.62 ? 364 ASN B CB    1 
ATOM   6082  C CG    . ASN B 1 364 ? 17.903  -4.608  28.162   1.00 46.73 ? 364 ASN B CG    1 
ATOM   6083  O OD1   . ASN B 1 364 ? 18.816  -5.307  27.675   1.00 50.83 ? 364 ASN B OD1   1 
ATOM   6084  N ND2   . ASN B 1 364 ? 17.983  -3.275  28.247   1.00 48.32 ? 364 ASN B ND2   1 
ATOM   6085  N N     . ASP B 1 365 ? 14.828  -6.672  26.810   1.00 42.09 ? 365 ASP B N     1 
ATOM   6086  C CA    . ASP B 1 365 ? 14.519  -7.538  25.705   1.00 41.97 ? 365 ASP B CA    1 
ATOM   6087  C C     . ASP B 1 365 ? 13.049  -7.968  25.780   1.00 41.95 ? 365 ASP B C     1 
ATOM   6088  O O     . ASP B 1 365 ? 12.591  -8.553  26.782   1.00 40.34 ? 365 ASP B O     1 
ATOM   6089  C CB    . ASP B 1 365 ? 15.459  -8.736  25.643   1.00 41.18 ? 365 ASP B CB    1 
ATOM   6090  C CG    . ASP B 1 365 ? 15.444  -9.416  24.270   1.00 41.63 ? 365 ASP B CG    1 
ATOM   6091  O OD1   . ASP B 1 365 ? 15.408  -10.671 24.225   1.00 39.70 ? 365 ASP B OD1   1 
ATOM   6092  O OD2   . ASP B 1 365 ? 15.472  -8.674  23.239   1.00 41.46 ? 365 ASP B OD2   1 
ATOM   6093  N N     . VAL B 1 366 ? 12.321  -7.640  24.715   1.00 42.65 ? 366 VAL B N     1 
ATOM   6094  C CA    . VAL B 1 366 ? 10.893  -8.004  24.616   1.00 43.92 ? 366 VAL B CA    1 
ATOM   6095  C C     . VAL B 1 366 ? 10.683  -9.406  24.073   1.00 44.35 ? 366 VAL B C     1 
ATOM   6096  O O     . VAL B 1 366 ? 9.544   -9.830  23.863   1.00 45.20 ? 366 VAL B O     1 
ATOM   6097  C CB    . VAL B 1 366 ? 10.060  -6.996  23.783   1.00 43.86 ? 366 VAL B CB    1 
ATOM   6098  C CG1   . VAL B 1 366 ? 10.008  -5.666  24.527   1.00 43.89 ? 366 VAL B CG1   1 
ATOM   6099  C CG2   . VAL B 1 366 ? 10.634  -6.835  22.365   1.00 42.25 ? 366 VAL B CG2   1 
ATOM   6100  N N     . LYS B 1 367 ? 11.775  -10.120 23.862   1.00 44.64 ? 367 LYS B N     1 
ATOM   6101  C CA    . LYS B 1 367 ? 11.669  -11.482 23.372   1.00 45.21 ? 367 LYS B CA    1 
ATOM   6102  C C     . LYS B 1 367 ? 11.025  -12.411 24.392   1.00 45.31 ? 367 LYS B C     1 
ATOM   6103  O O     . LYS B 1 367 ? 10.192  -13.213 24.025   1.00 46.46 ? 367 LYS B O     1 
ATOM   6104  C CB    . LYS B 1 367 ? 13.017  -12.007 22.887   1.00 45.36 ? 367 LYS B CB    1 
ATOM   6105  C CG    . LYS B 1 367 ? 13.186  -11.921 21.395   1.00 46.06 ? 367 LYS B CG    1 
ATOM   6106  C CD    . LYS B 1 367 ? 14.581  -12.370 20.951   1.00 49.17 ? 367 LYS B CD    1 
ATOM   6107  C CE    . LYS B 1 367 ? 14.854  -13.840 21.249   1.00 50.28 ? 367 LYS B CE    1 
ATOM   6108  N NZ    . LYS B 1 367 ? 13.871  -14.712 20.554   1.00 50.55 ? 367 LYS B NZ    1 
ATOM   6109  N N     . GLU B 1 368 ? 11.382  -12.268 25.664   1.00 45.78 ? 368 GLU B N     1 
ATOM   6110  C CA    . GLU B 1 368 ? 10.855  -13.083 26.774   1.00 45.98 ? 368 GLU B CA    1 
ATOM   6111  C C     . GLU B 1 368 ? 9.408   -12.723 26.978   1.00 45.65 ? 368 GLU B C     1 
ATOM   6112  O O     . GLU B 1 368 ? 8.515   -13.567 27.061   1.00 45.73 ? 368 GLU B O     1 
ATOM   6113  C CB    . GLU B 1 368 ? 11.620  -12.756 28.067   1.00 46.53 ? 368 GLU B CB    1 
ATOM   6114  C CG    . GLU B 1 368 ? 13.097  -13.254 28.129   1.00 51.26 ? 368 GLU B CG    1 
ATOM   6115  C CD    . GLU B 1 368 ? 13.989  -12.719 26.996   1.00 56.18 ? 368 GLU B CD    1 
ATOM   6116  O OE1   . GLU B 1 368 ? 13.790  -11.546 26.587   1.00 55.75 ? 368 GLU B OE1   1 
ATOM   6117  O OE2   . GLU B 1 368 ? 14.882  -13.472 26.521   1.00 58.61 ? 368 GLU B OE2   1 
ATOM   6118  N N     . LEU B 1 369 ? 9.189   -11.419 27.052   1.00 45.18 ? 369 LEU B N     1 
ATOM   6119  C CA    . LEU B 1 369 ? 7.886   -10.863 27.165   1.00 44.05 ? 369 LEU B CA    1 
ATOM   6120  C C     . LEU B 1 369 ? 6.963   -11.502 26.152   1.00 44.55 ? 369 LEU B C     1 
ATOM   6121  O O     . LEU B 1 369 ? 5.859   -11.958 26.501   1.00 44.57 ? 369 LEU B O     1 
ATOM   6122  C CB    . LEU B 1 369 ? 7.990   -9.375  26.906   1.00 44.09 ? 369 LEU B CB    1 
ATOM   6123  C CG    . LEU B 1 369 ? 6.758   -8.563  27.238   1.00 41.84 ? 369 LEU B CG    1 
ATOM   6124  C CD1   . LEU B 1 369 ? 6.785   -8.376  28.707   1.00 39.40 ? 369 LEU B CD1   1 
ATOM   6125  C CD2   . LEU B 1 369 ? 6.798   -7.246  26.492   1.00 37.23 ? 369 LEU B CD2   1 
ATOM   6126  N N     . ILE B 1 370 ? 7.411   -11.536 24.897   1.00 44.72 ? 370 ILE B N     1 
ATOM   6127  C CA    . ILE B 1 370 ? 6.551   -12.031 23.810   1.00 45.05 ? 370 ILE B CA    1 
ATOM   6128  C C     . ILE B 1 370 ? 6.528   -13.569 23.739   1.00 45.80 ? 370 ILE B C     1 
ATOM   6129  O O     . ILE B 1 370 ? 5.479   -14.186 23.961   1.00 45.20 ? 370 ILE B O     1 
ATOM   6130  C CB    . ILE B 1 370 ? 6.924   -11.402 22.433   1.00 44.79 ? 370 ILE B CB    1 
ATOM   6131  C CG1   . ILE B 1 370 ? 6.675   -9.897  22.435   1.00 43.43 ? 370 ILE B CG1   1 
ATOM   6132  C CG2   . ILE B 1 370 ? 6.232   -12.121 21.272   1.00 42.95 ? 370 ILE B CG2   1 
ATOM   6133  C CD1   . ILE B 1 370 ? 5.236   -9.512  22.332   1.00 46.66 ? 370 ILE B CD1   1 
ATOM   6134  N N     . GLU B 1 371 ? 7.695   -14.165 23.464   1.00 46.84 ? 371 GLU B N     1 
ATOM   6135  C CA    . GLU B 1 371 ? 7.795   -15.595 23.198   1.00 48.05 ? 371 GLU B CA    1 
ATOM   6136  C C     . GLU B 1 371 ? 7.443   -16.481 24.410   1.00 48.94 ? 371 GLU B C     1 
ATOM   6137  O O     . GLU B 1 371 ? 7.175   -17.669 24.222   1.00 49.91 ? 371 GLU B O     1 
ATOM   6138  C CB    . GLU B 1 371 ? 9.161   -15.963 22.573   1.00 47.85 ? 371 GLU B CB    1 
ATOM   6139  C CG    . GLU B 1 371 ? 9.258   -15.697 21.041   1.00 49.60 ? 371 GLU B CG    1 
ATOM   6140  C CD    . GLU B 1 371 ? 10.627  -15.168 20.602   1.00 52.74 ? 371 GLU B CD    1 
ATOM   6141  O OE1   . GLU B 1 371 ? 11.570  -15.365 21.407   1.00 53.79 ? 371 GLU B OE1   1 
ATOM   6142  O OE2   . GLU B 1 371 ? 10.759  -14.567 19.478   1.00 48.94 ? 371 GLU B OE2   1 
ATOM   6143  N N     . GLU B 1 372 ? 7.423   -15.929 25.630   1.00 48.70 ? 372 GLU B N     1 
ATOM   6144  C CA    . GLU B 1 372 ? 7.017   -16.721 26.798   1.00 49.10 ? 372 GLU B CA    1 
ATOM   6145  C C     . GLU B 1 372 ? 5.655   -16.373 27.429   1.00 48.52 ? 372 GLU B C     1 
ATOM   6146  O O     . GLU B 1 372 ? 4.763   -17.234 27.502   1.00 48.49 ? 372 GLU B O     1 
ATOM   6147  C CB    . GLU B 1 372 ? 8.104   -16.768 27.849   1.00 48.86 ? 372 GLU B CB    1 
ATOM   6148  C CG    . GLU B 1 372 ? 8.900   -18.058 27.777   1.00 53.67 ? 372 GLU B CG    1 
ATOM   6149  C CD    . GLU B 1 372 ? 10.416  -17.842 27.942   1.00 59.06 ? 372 GLU B CD    1 
ATOM   6150  O OE1   . GLU B 1 372 ? 11.128  -18.837 28.252   1.00 61.16 ? 372 GLU B OE1   1 
ATOM   6151  O OE2   . GLU B 1 372 ? 10.894  -16.685 27.757   1.00 58.80 ? 372 GLU B OE2   1 
ATOM   6152  N N     . LYS B 1 373 ? 5.501   -15.118 27.849   1.00 47.09 ? 373 LYS B N     1 
ATOM   6153  C CA    . LYS B 1 373 ? 4.340   -14.687 28.602   1.00 46.23 ? 373 LYS B CA    1 
ATOM   6154  C C     . LYS B 1 373 ? 3.133   -14.303 27.719   1.00 45.01 ? 373 LYS B C     1 
ATOM   6155  O O     . LYS B 1 373 ? 2.020   -14.778 27.930   1.00 44.67 ? 373 LYS B O     1 
ATOM   6156  C CB    . LYS B 1 373 ? 4.767   -13.531 29.531   1.00 46.79 ? 373 LYS B CB    1 
ATOM   6157  C CG    . LYS B 1 373 ? 5.767   -13.950 30.630   1.00 45.73 ? 373 LYS B CG    1 
ATOM   6158  C CD    . LYS B 1 373 ? 5.989   -12.853 31.658   1.00 47.51 ? 373 LYS B CD    1 
ATOM   6159  C CE    . LYS B 1 373 ? 7.109   -13.237 32.657   1.00 48.65 ? 373 LYS B CE    1 
ATOM   6160  N NZ    . LYS B 1 373 ? 7.275   -12.225 33.763   1.00 49.22 ? 373 LYS B NZ    1 
ATOM   6161  N N     . ALA B 1 374 ? 3.380   -13.448 26.735   1.00 43.85 ? 374 ALA B N     1 
ATOM   6162  C CA    . ALA B 1 374 ? 2.349   -12.925 25.860   1.00 43.36 ? 374 ALA B CA    1 
ATOM   6163  C C     . ALA B 1 374 ? 1.673   -14.024 25.057   1.00 43.13 ? 374 ALA B C     1 
ATOM   6164  O O     . ALA B 1 374 ? 0.460   -14.020 24.902   1.00 42.06 ? 374 ALA B O     1 
ATOM   6165  C CB    . ALA B 1 374 ? 2.905   -11.853 24.937   1.00 42.66 ? 374 ALA B CB    1 
ATOM   6166  N N     . VAL B 1 375 ? 2.462   -14.959 24.533   1.00 43.00 ? 375 VAL B N     1 
ATOM   6167  C CA    . VAL B 1 375 ? 1.867   -16.081 23.836   1.00 42.60 ? 375 VAL B CA    1 
ATOM   6168  C C     . VAL B 1 375 ? 0.988   -16.900 24.820   1.00 42.44 ? 375 VAL B C     1 
ATOM   6169  O O     . VAL B 1 375 ? -0.139  -17.240 24.487   1.00 42.28 ? 375 VAL B O     1 
ATOM   6170  C CB    . VAL B 1 375 ? 2.924   -16.915 23.051   1.00 42.57 ? 375 VAL B CB    1 
ATOM   6171  C CG1   . VAL B 1 375 ? 3.790   -17.739 23.981   1.00 42.34 ? 375 VAL B CG1   1 
ATOM   6172  C CG2   . VAL B 1 375 ? 2.256   -17.807 21.991   1.00 42.96 ? 375 VAL B CG2   1 
ATOM   6173  N N     . LYS B 1 376 ? 1.467   -17.174 26.041   1.00 42.32 ? 376 LYS B N     1 
ATOM   6174  C CA    . LYS B 1 376 ? 0.630   -17.897 27.006   1.00 42.34 ? 376 LYS B CA    1 
ATOM   6175  C C     . LYS B 1 376 ? -0.784  -17.247 27.197   1.00 42.43 ? 376 LYS B C     1 
ATOM   6176  O O     . LYS B 1 376 ? -1.786  -17.960 27.311   1.00 42.63 ? 376 LYS B O     1 
ATOM   6177  C CB    . LYS B 1 376 ? 1.384   -18.189 28.324   1.00 42.37 ? 376 LYS B CB    1 
ATOM   6178  C CG    . LYS B 1 376 ? 2.293   -19.474 28.287   1.00 41.79 ? 376 LYS B CG    1 
ATOM   6179  C CD    . LYS B 1 376 ? 2.912   -19.792 29.631   1.00 43.95 ? 376 LYS B CD    1 
ATOM   6180  C CE    . LYS B 1 376 ? 4.308   -19.173 29.829   1.00 47.57 ? 376 LYS B CE    1 
ATOM   6181  N NZ    . LYS B 1 376 ? 5.460   -20.002 29.244   1.00 43.75 ? 376 LYS B NZ    1 
ATOM   6182  N N     . MET B 1 377 ? -0.858  -15.906 27.177   1.00 42.11 ? 377 MET B N     1 
ATOM   6183  C CA    . MET B 1 377 ? -2.129  -15.166 27.282   1.00 41.41 ? 377 MET B CA    1 
ATOM   6184  C C     . MET B 1 377 ? -2.909  -15.003 25.968   1.00 41.04 ? 377 MET B C     1 
ATOM   6185  O O     . MET B 1 377 ? -4.006  -14.440 25.974   1.00 41.28 ? 377 MET B O     1 
ATOM   6186  C CB    . MET B 1 377 ? -1.918  -13.780 27.872   1.00 42.37 ? 377 MET B CB    1 
ATOM   6187  C CG    . MET B 1 377 ? -1.414  -13.695 29.324   1.00 44.30 ? 377 MET B CG    1 
ATOM   6188  S SD    . MET B 1 377 ? -2.632  -14.452 30.392   1.00 49.61 ? 377 MET B SD    1 
ATOM   6189  C CE    . MET B 1 377 ? -3.037  -13.147 31.581   1.00 46.30 ? 377 MET B CE    1 
ATOM   6190  N N     . GLY B 1 378 ? -2.357  -15.479 24.850   1.00 40.43 ? 378 GLY B N     1 
ATOM   6191  C CA    . GLY B 1 378 ? -3.096  -15.523 23.579   1.00 38.92 ? 378 GLY B CA    1 
ATOM   6192  C C     . GLY B 1 378 ? -2.940  -14.232 22.774   1.00 37.70 ? 378 GLY B C     1 
ATOM   6193  O O     . GLY B 1 378 ? -3.829  -13.848 21.968   1.00 35.91 ? 378 GLY B O     1 
ATOM   6194  N N     . VAL B 1 379 ? -1.891  -13.491 23.068   1.00 35.13 ? 379 VAL B N     1 
ATOM   6195  C CA    . VAL B 1 379 ? -1.560  -12.367 22.239   1.00 33.80 ? 379 VAL B CA    1 
ATOM   6196  C C     . VAL B 1 379 ? -0.140  -12.374 21.787   1.00 34.15 ? 379 VAL B C     1 
ATOM   6197  O O     . VAL B 1 379 ? 0.741   -12.918 22.428   1.00 32.04 ? 379 VAL B O     1 
ATOM   6198  C CB    . VAL B 1 379 ? -1.959  -11.001 22.814   1.00 33.77 ? 379 VAL B CB    1 
ATOM   6199  C CG1   . VAL B 1 379 ? -3.194  -11.097 23.645   1.00 34.46 ? 379 VAL B CG1   1 
ATOM   6200  C CG2   . VAL B 1 379 ? -0.842  -10.376 23.564   1.00 33.55 ? 379 VAL B CG2   1 
ATOM   6201  N N     . LEU B 1 380 ? 0.085   -11.757 20.643   1.00 34.63 ? 380 LEU B N     1 
ATOM   6202  C CA    . LEU B 1 380 ? 1.292   -11.977 19.882   1.00 34.41 ? 380 LEU B CA    1 
ATOM   6203  C C     . LEU B 1 380 ? 1.634   -10.724 19.103   1.00 34.63 ? 380 LEU B C     1 
ATOM   6204  O O     . LEU B 1 380 ? 0.767   -10.055 18.588   1.00 35.09 ? 380 LEU B O     1 
ATOM   6205  C CB    . LEU B 1 380 ? 1.105   -13.143 18.924   1.00 34.73 ? 380 LEU B CB    1 
ATOM   6206  C CG    . LEU B 1 380 ? 2.053   -14.334 18.967   1.00 35.12 ? 380 LEU B CG    1 
ATOM   6207  C CD1   . LEU B 1 380 ? 2.313   -14.807 17.575   1.00 32.13 ? 380 LEU B CD1   1 
ATOM   6208  C CD2   . LEU B 1 380 ? 3.338   -14.014 19.677   1.00 33.49 ? 380 LEU B CD2   1 
ATOM   6209  N N     . MET B 1 381 ? 2.913   -10.409 19.032   1.00 34.37 ? 381 MET B N     1 
ATOM   6210  C CA    . MET B 1 381 ? 3.367   -9.369  18.135   1.00 34.10 ? 381 MET B CA    1 
ATOM   6211  C C     . MET B 1 381 ? 4.902   -9.457  18.043   1.00 32.75 ? 381 MET B C     1 
ATOM   6212  O O     . MET B 1 381 ? 5.515   -10.207 18.793   1.00 33.32 ? 381 MET B O     1 
ATOM   6213  C CB    . MET B 1 381 ? 2.810   -7.982  18.493   1.00 33.26 ? 381 MET B CB    1 
ATOM   6214  C CG    . MET B 1 381 ? 2.820   -7.635  19.933   1.00 33.81 ? 381 MET B CG    1 
ATOM   6215  S SD    . MET B 1 381 ? 2.049   -6.047  20.164   1.00 36.01 ? 381 MET B SD    1 
ATOM   6216  C CE    . MET B 1 381 ? 3.310   -4.837  19.946   1.00 28.60 ? 381 MET B CE    1 
ATOM   6217  N N     . LEU B 1 382 ? 5.502   -8.751  17.096   1.00 31.16 ? 382 LEU B N     1 
ATOM   6218  C CA    . LEU B 1 382 ? 6.812   -9.167  16.631   1.00 30.05 ? 382 LEU B CA    1 
ATOM   6219  C C     . LEU B 1 382 ? 7.980   -8.499  17.372   1.00 29.23 ? 382 LEU B C     1 
ATOM   6220  O O     . LEU B 1 382 ? 8.185   -7.286  17.249   1.00 27.08 ? 382 LEU B O     1 
ATOM   6221  C CB    . LEU B 1 382 ? 6.916   -9.028  15.101   1.00 29.62 ? 382 LEU B CB    1 
ATOM   6222  C CG    . LEU B 1 382 ? 8.155   -9.713  14.521   1.00 29.77 ? 382 LEU B CG    1 
ATOM   6223  C CD1   . LEU B 1 382 ? 8.103   -11.253 14.692   1.00 28.95 ? 382 LEU B CD1   1 
ATOM   6224  C CD2   . LEU B 1 382 ? 8.354   -9.334  13.074   1.00 33.33 ? 382 LEU B CD2   1 
ATOM   6225  N N     . PRO B 1 383 ? 8.735   -9.294  18.147   1.00 29.41 ? 383 PRO B N     1 
ATOM   6226  C CA    . PRO B 1 383 ? 9.995   -8.759  18.701   1.00 31.43 ? 383 PRO B CA    1 
ATOM   6227  C C     . PRO B 1 383 ? 10.874  -8.109  17.611   1.00 31.09 ? 383 PRO B C     1 
ATOM   6228  O O     . PRO B 1 383 ? 10.979  -8.618  16.483   1.00 30.49 ? 383 PRO B O     1 
ATOM   6229  C CB    . PRO B 1 383 ? 10.679  -9.988  19.324   1.00 31.32 ? 383 PRO B CB    1 
ATOM   6230  C CG    . PRO B 1 383 ? 9.524   -10.906 19.669   1.00 32.04 ? 383 PRO B CG    1 
ATOM   6231  C CD    . PRO B 1 383 ? 8.549   -10.703 18.509   1.00 30.69 ? 383 PRO B CD    1 
ATOM   6232  N N     . GLY B 1 384 ? 11.462  -6.969  17.967   1.00 31.64 ? 384 GLY B N     1 
ATOM   6233  C CA    . GLY B 1 384 ? 12.333  -6.194  17.057   1.00 31.58 ? 384 GLY B CA    1 
ATOM   6234  C C     . GLY B 1 384 ? 13.723  -6.683  16.736   1.00 31.98 ? 384 GLY B C     1 
ATOM   6235  O O     . GLY B 1 384 ? 14.483  -5.974  16.048   1.00 32.77 ? 384 GLY B O     1 
ATOM   6236  N N     . ASN B 1 385 ? 14.092  -7.866  17.206   1.00 31.93 ? 385 ASN B N     1 
ATOM   6237  C CA    . ASN B 1 385 ? 15.509  -8.268  17.113   1.00 33.56 ? 385 ASN B CA    1 
ATOM   6238  C C     . ASN B 1 385 ? 16.001  -8.475  15.692   1.00 32.99 ? 385 ASN B C     1 
ATOM   6239  O O     . ASN B 1 385 ? 17.109  -8.043  15.342   1.00 32.88 ? 385 ASN B O     1 
ATOM   6240  C CB    . ASN B 1 385 ? 15.789  -9.512  17.932   1.00 33.26 ? 385 ASN B CB    1 
ATOM   6241  C CG    . ASN B 1 385 ? 15.177  -9.427  19.275   1.00 37.39 ? 385 ASN B CG    1 
ATOM   6242  O OD1   . ASN B 1 385 ? 13.934  -9.325  19.409   1.00 40.09 ? 385 ASN B OD1   1 
ATOM   6243  N ND2   . ASN B 1 385 ? 16.028  -9.438  20.307   1.00 37.92 ? 385 ASN B ND2   1 
ATOM   6244  N N     . ALA B 1 386 ? 15.145  -9.120  14.900   1.00 32.88 ? 386 ALA B N     1 
ATOM   6245  C CA    . ALA B 1 386 ? 15.394  -9.467  13.505   1.00 32.61 ? 386 ALA B CA    1 
ATOM   6246  C C     . ALA B 1 386 ? 15.682  -8.291  12.607   1.00 32.73 ? 386 ALA B C     1 
ATOM   6247  O O     . ALA B 1 386 ? 16.132  -8.496  11.468   1.00 33.16 ? 386 ALA B O     1 
ATOM   6248  C CB    . ALA B 1 386 ? 14.200  -10.221 12.951   1.00 32.07 ? 386 ALA B CB    1 
ATOM   6249  N N     . PHE B 1 387 ? 15.392  -7.068  13.062   1.00 32.36 ? 387 PHE B N     1 
ATOM   6250  C CA    . PHE B 1 387 ? 15.494  -5.933  12.141   1.00 32.22 ? 387 PHE B CA    1 
ATOM   6251  C C     . PHE B 1 387 ? 16.798  -5.184  12.225   1.00 32.72 ? 387 PHE B C     1 
ATOM   6252  O O     . PHE B 1 387 ? 16.880  -4.027  11.789   1.00 33.38 ? 387 PHE B O     1 
ATOM   6253  C CB    . PHE B 1 387 ? 14.311  -5.010  12.286   1.00 31.70 ? 387 PHE B CB    1 
ATOM   6254  C CG    . PHE B 1 387 ? 13.008  -5.688  12.083   1.00 32.04 ? 387 PHE B CG    1 
ATOM   6255  C CD1   . PHE B 1 387 ? 12.413  -5.729  10.838   1.00 29.87 ? 387 PHE B CD1   1 
ATOM   6256  C CD2   . PHE B 1 387 ? 12.362  -6.295  13.136   1.00 31.54 ? 387 PHE B CD2   1 
ATOM   6257  C CE1   . PHE B 1 387 ? 11.186  -6.331  10.673   1.00 30.00 ? 387 PHE B CE1   1 
ATOM   6258  C CE2   . PHE B 1 387 ? 11.155  -6.929  12.935   1.00 30.62 ? 387 PHE B CE2   1 
ATOM   6259  C CZ    . PHE B 1 387 ? 10.573  -6.927  11.732   1.00 30.72 ? 387 PHE B CZ    1 
ATOM   6260  N N     . TYR B 1 388 ? 17.829  -5.865  12.724   1.00 32.79 ? 388 TYR B N     1 
ATOM   6261  C CA    . TYR B 1 388 ? 19.158  -5.286  12.878   1.00 32.81 ? 388 TYR B CA    1 
ATOM   6262  C C     . TYR B 1 388 ? 20.182  -6.273  12.379   1.00 33.20 ? 388 TYR B C     1 
ATOM   6263  O O     . TYR B 1 388 ? 19.985  -7.491  12.528   1.00 32.74 ? 388 TYR B O     1 
ATOM   6264  C CB    . TYR B 1 388 ? 19.442  -5.002  14.355   1.00 33.80 ? 388 TYR B CB    1 
ATOM   6265  C CG    . TYR B 1 388 ? 18.536  -3.976  15.000   1.00 33.25 ? 388 TYR B CG    1 
ATOM   6266  C CD1   . TYR B 1 388 ? 17.334  -4.372  15.616   1.00 37.11 ? 388 TYR B CD1   1 
ATOM   6267  C CD2   . TYR B 1 388 ? 18.866  -2.619  15.002   1.00 31.95 ? 388 TYR B CD2   1 
ATOM   6268  C CE1   . TYR B 1 388 ? 16.439  -3.415  16.192   1.00 34.97 ? 388 TYR B CE1   1 
ATOM   6269  C CE2   . TYR B 1 388 ? 18.000  -1.666  15.576   1.00 32.84 ? 388 TYR B CE2   1 
ATOM   6270  C CZ    . TYR B 1 388 ? 16.802  -2.080  16.189   1.00 34.19 ? 388 TYR B CZ    1 
ATOM   6271  O OH    . TYR B 1 388 ? 15.939  -1.178  16.776   1.00 35.95 ? 388 TYR B OH    1 
ATOM   6272  N N     . VAL B 1 389 ? 21.273  -5.758  11.789   1.00 33.79 ? 389 VAL B N     1 
ATOM   6273  C CA    . VAL B 1 389 ? 22.400  -6.605  11.363   1.00 34.42 ? 389 VAL B CA    1 
ATOM   6274  C C     . VAL B 1 389 ? 22.784  -7.549  12.493   1.00 33.96 ? 389 VAL B C     1 
ATOM   6275  O O     . VAL B 1 389 ? 22.951  -8.727  12.272   1.00 33.30 ? 389 VAL B O     1 
ATOM   6276  C CB    . VAL B 1 389 ? 23.646  -5.808  10.890   1.00 35.13 ? 389 VAL B CB    1 
ATOM   6277  C CG1   . VAL B 1 389 ? 24.771  -6.761  10.481   1.00 34.11 ? 389 VAL B CG1   1 
ATOM   6278  C CG2   . VAL B 1 389 ? 23.288  -4.884  9.723    1.00 35.58 ? 389 VAL B CG2   1 
ATOM   6279  N N     . ASP B 1 390 ? 22.858  -7.040  13.715   1.00 34.18 ? 390 ASP B N     1 
ATOM   6280  C CA    . ASP B 1 390 ? 23.143  -7.905  14.842   1.00 35.07 ? 390 ASP B CA    1 
ATOM   6281  C C     . ASP B 1 390 ? 21.869  -8.359  15.561   1.00 34.97 ? 390 ASP B C     1 
ATOM   6282  O O     . ASP B 1 390 ? 21.401  -7.711  16.480   1.00 34.24 ? 390 ASP B O     1 
ATOM   6283  C CB    . ASP B 1 390 ? 24.117  -7.218  15.799   1.00 35.73 ? 390 ASP B CB    1 
ATOM   6284  C CG    . ASP B 1 390 ? 24.447  -8.071  17.018   1.00 38.33 ? 390 ASP B CG    1 
ATOM   6285  O OD1   . ASP B 1 390 ? 24.292  -9.319  16.947   1.00 36.74 ? 390 ASP B OD1   1 
ATOM   6286  O OD2   . ASP B 1 390 ? 24.859  -7.471  18.049   1.00 43.38 ? 390 ASP B OD2   1 
ATOM   6287  N N     . SER B 1 391 ? 21.319  -9.492  15.148   1.00 35.11 ? 391 SER B N     1 
ATOM   6288  C CA    . SER B 1 391 ? 19.955  -9.816  15.581   1.00 36.20 ? 391 SER B CA    1 
ATOM   6289  C C     . SER B 1 391 ? 19.970  -10.358 16.986   1.00 37.17 ? 391 SER B C     1 
ATOM   6290  O O     . SER B 1 391 ? 18.907  -10.676 17.536   1.00 38.09 ? 391 SER B O     1 
ATOM   6291  C CB    . SER B 1 391 ? 19.279  -10.799 14.645   1.00 35.25 ? 391 SER B CB    1 
ATOM   6292  O OG    . SER B 1 391 ? 20.032  -11.990 14.523   1.00 37.84 ? 391 SER B OG    1 
ATOM   6293  N N     . SER B 1 392 ? 21.167  -10.467 17.572   1.00 37.14 ? 392 SER B N     1 
ATOM   6294  C CA    . SER B 1 392 ? 21.290  -11.115 18.863   1.00 37.61 ? 392 SER B CA    1 
ATOM   6295  C C     . SER B 1 392 ? 21.381  -10.067 19.943   1.00 37.43 ? 392 SER B C     1 
ATOM   6296  O O     . SER B 1 392 ? 21.324  -10.390 21.128   1.00 37.76 ? 392 SER B O     1 
ATOM   6297  C CB    . SER B 1 392 ? 22.432  -12.165 18.937   1.00 38.79 ? 392 SER B CB    1 
ATOM   6298  O OG    . SER B 1 392 ? 23.494  -11.924 18.014   1.00 39.38 ? 392 SER B OG    1 
ATOM   6299  N N     . ALA B 1 393 ? 21.432  -8.806  19.515   1.00 36.66 ? 393 ALA B N     1 
ATOM   6300  C CA    . ALA B 1 393 ? 21.414  -7.682  20.419   1.00 36.46 ? 393 ALA B CA    1 
ATOM   6301  C C     . ALA B 1 393 ? 20.041  -7.501  21.072   1.00 37.74 ? 393 ALA B C     1 
ATOM   6302  O O     . ALA B 1 393 ? 19.006  -7.787  20.467   1.00 39.02 ? 393 ALA B O     1 
ATOM   6303  C CB    . ALA B 1 393 ? 21.806  -6.450  19.696   1.00 35.28 ? 393 ALA B CB    1 
ATOM   6304  N N     . PRO B 1 394 ? 20.008  -7.029  22.321   1.00 38.17 ? 394 PRO B N     1 
ATOM   6305  C CA    . PRO B 1 394 ? 18.686  -6.831  22.934   1.00 38.03 ? 394 PRO B CA    1 
ATOM   6306  C C     . PRO B 1 394 ? 17.821  -5.753  22.262   1.00 37.78 ? 394 PRO B C     1 
ATOM   6307  O O     . PRO B 1 394 ? 18.292  -4.630  21.991   1.00 38.70 ? 394 PRO B O     1 
ATOM   6308  C CB    . PRO B 1 394 ? 19.049  -6.424  24.372   1.00 37.91 ? 394 PRO B CB    1 
ATOM   6309  C CG    . PRO B 1 394 ? 20.432  -7.022  24.565   1.00 37.49 ? 394 PRO B CG    1 
ATOM   6310  C CD    . PRO B 1 394 ? 21.087  -6.714  23.270   1.00 37.13 ? 394 PRO B CD    1 
ATOM   6311  N N     . SER B 1 395 ? 16.555  -6.073  22.009   1.00 36.85 ? 395 SER B N     1 
ATOM   6312  C CA    . SER B 1 395 ? 15.646  -5.036  21.525   1.00 35.26 ? 395 SER B CA    1 
ATOM   6313  C C     . SER B 1 395 ? 14.492  -4.711  22.471   1.00 33.06 ? 395 SER B C     1 
ATOM   6314  O O     . SER B 1 395 ? 13.819  -5.616  22.980   1.00 33.13 ? 395 SER B O     1 
ATOM   6315  C CB    . SER B 1 395 ? 15.110  -5.390  20.143   1.00 36.45 ? 395 SER B CB    1 
ATOM   6316  O OG    . SER B 1 395 ? 14.281  -4.345  19.683   1.00 39.93 ? 395 SER B OG    1 
ATOM   6317  N N     . PRO B 1 396 ? 14.257  -3.412  22.718   1.00 31.52 ? 396 PRO B N     1 
ATOM   6318  C CA    . PRO B 1 396 ? 13.067  -3.133  23.475   1.00 30.10 ? 396 PRO B CA    1 
ATOM   6319  C C     . PRO B 1 396 ? 11.818  -2.878  22.559   1.00 28.77 ? 396 PRO B C     1 
ATOM   6320  O O     . PRO B 1 396 ? 10.771  -2.463  23.075   1.00 27.24 ? 396 PRO B O     1 
ATOM   6321  C CB    . PRO B 1 396 ? 13.460  -1.888  24.261   1.00 30.50 ? 396 PRO B CB    1 
ATOM   6322  C CG    . PRO B 1 396 ? 14.401  -1.120  23.297   1.00 31.27 ? 396 PRO B CG    1 
ATOM   6323  C CD    . PRO B 1 396 ? 14.972  -2.168  22.343   1.00 31.54 ? 396 PRO B CD    1 
ATOM   6324  N N     . TYR B 1 397 ? 11.931  -3.195  21.255   1.00 27.83 ? 397 TYR B N     1 
ATOM   6325  C CA    . TYR B 1 397 ? 10.898  -2.905  20.256   1.00 27.66 ? 397 TYR B CA    1 
ATOM   6326  C C     . TYR B 1 397 ? 10.023  -4.080  19.855   1.00 27.79 ? 397 TYR B C     1 
ATOM   6327  O O     . TYR B 1 397 ? 10.514  -5.201  19.638   1.00 25.72 ? 397 TYR B O     1 
ATOM   6328  C CB    . TYR B 1 397 ? 11.513  -2.306  18.971   1.00 28.99 ? 397 TYR B CB    1 
ATOM   6329  C CG    . TYR B 1 397 ? 12.134  -0.940  19.158   1.00 28.68 ? 397 TYR B CG    1 
ATOM   6330  C CD1   . TYR B 1 397 ? 11.347  0.229   19.169   1.00 29.75 ? 397 TYR B CD1   1 
ATOM   6331  C CD2   . TYR B 1 397 ? 13.495  -0.809  19.322   1.00 25.72 ? 397 TYR B CD2   1 
ATOM   6332  C CE1   . TYR B 1 397 ? 11.936  1.496   19.355   1.00 29.76 ? 397 TYR B CE1   1 
ATOM   6333  C CE2   . TYR B 1 397 ? 14.079  0.450   19.508   1.00 27.44 ? 397 TYR B CE2   1 
ATOM   6334  C CZ    . TYR B 1 397 ? 13.297  1.579   19.526   1.00 29.04 ? 397 TYR B CZ    1 
ATOM   6335  O OH    . TYR B 1 397 ? 13.921  2.796   19.737   1.00 33.17 ? 397 TYR B OH    1 
ATOM   6336  N N     . LEU B 1 398 ? 8.716   -3.784  19.771   1.00 28.94 ? 398 LEU B N     1 
ATOM   6337  C CA    . LEU B 1 398 ? 7.696   -4.606  19.074   1.00 30.15 ? 398 LEU B CA    1 
ATOM   6338  C C     . LEU B 1 398 ? 7.309   -3.977  17.760   1.00 31.24 ? 398 LEU B C     1 
ATOM   6339  O O     . LEU B 1 398 ? 7.209   -2.748  17.649   1.00 33.02 ? 398 LEU B O     1 
ATOM   6340  C CB    . LEU B 1 398 ? 6.422   -4.695  19.907   1.00 30.26 ? 398 LEU B CB    1 
ATOM   6341  C CG    . LEU B 1 398 ? 6.735   -5.160  21.342   1.00 32.07 ? 398 LEU B CG    1 
ATOM   6342  C CD1   . LEU B 1 398 ? 5.531   -5.098  22.215   1.00 28.86 ? 398 LEU B CD1   1 
ATOM   6343  C CD2   . LEU B 1 398 ? 7.373   -6.577  21.354   1.00 35.25 ? 398 LEU B CD2   1 
ATOM   6344  N N     . ARG B 1 399 ? 7.093   -4.811  16.751   1.00 30.81 ? 399 ARG B N     1 
ATOM   6345  C CA    . ARG B 1 399 ? 6.387   -4.373  15.569   1.00 30.31 ? 399 ARG B CA    1 
ATOM   6346  C C     . ARG B 1 399 ? 4.961   -4.979  15.602   1.00 30.65 ? 399 ARG B C     1 
ATOM   6347  O O     . ARG B 1 399 ? 4.759   -6.169  15.871   1.00 31.20 ? 399 ARG B O     1 
ATOM   6348  C CB    . ARG B 1 399 ? 7.125   -4.830  14.330   1.00 30.22 ? 399 ARG B CB    1 
ATOM   6349  C CG    . ARG B 1 399 ? 6.512   -4.347  13.035   1.00 32.65 ? 399 ARG B CG    1 
ATOM   6350  C CD    . ARG B 1 399 ? 7.043   -5.150  11.829   1.00 32.39 ? 399 ARG B CD    1 
ATOM   6351  N NE    . ARG B 1 399 ? 6.359   -6.440  11.749   1.00 30.40 ? 399 ARG B NE    1 
ATOM   6352  C CZ    . ARG B 1 399 ? 6.492   -7.313  10.753   1.00 29.27 ? 399 ARG B CZ    1 
ATOM   6353  N NH1   . ARG B 1 399 ? 7.294   -7.026  9.712    1.00 30.35 ? 399 ARG B NH1   1 
ATOM   6354  N NH2   . ARG B 1 399 ? 5.808   -8.460  10.801   1.00 22.25 ? 399 ARG B NH2   1 
ATOM   6355  N N     . ALA B 1 400 ? 3.981   -4.160  15.298   1.00 29.89 ? 400 ALA B N     1 
ATOM   6356  C CA    . ALA B 1 400 ? 2.600   -4.547  15.463   1.00 30.52 ? 400 ALA B CA    1 
ATOM   6357  C C     . ALA B 1 400 ? 1.907   -4.329  14.142   1.00 30.21 ? 400 ALA B C     1 
ATOM   6358  O O     . ALA B 1 400 ? 2.022   -3.235  13.544   1.00 30.56 ? 400 ALA B O     1 
ATOM   6359  C CB    . ALA B 1 400 ? 1.931   -3.709  16.634   1.00 29.21 ? 400 ALA B CB    1 
ATOM   6360  N N     . SER B 1 401 ? 1.265   -5.374  13.630   1.00 30.96 ? 401 SER B N     1 
ATOM   6361  C CA    . SER B 1 401 ? 0.563   -5.219  12.353   1.00 31.86 ? 401 SER B CA    1 
ATOM   6362  C C     . SER B 1 401 ? -0.835  -4.651  12.509   1.00 31.77 ? 401 SER B C     1 
ATOM   6363  O O     . SER B 1 401 ? -1.719  -5.301  13.114   1.00 33.38 ? 401 SER B O     1 
ATOM   6364  C CB    . SER B 1 401 ? 0.451   -6.480  11.519   1.00 31.75 ? 401 SER B CB    1 
ATOM   6365  O OG    . SER B 1 401 ? 0.010   -6.042  10.209   1.00 31.73 ? 401 SER B OG    1 
ATOM   6366  N N     . PHE B 1 402 ? -1.036  -3.461  11.955   1.00 30.51 ? 402 PHE B N     1 
ATOM   6367  C CA    . PHE B 1 402 ? -2.378  -2.931  11.890   1.00 30.27 ? 402 PHE B CA    1 
ATOM   6368  C C     . PHE B 1 402 ? -3.172  -3.287  10.645   1.00 29.51 ? 402 PHE B C     1 
ATOM   6369  O O     . PHE B 1 402 ? -4.179  -2.640  10.339   1.00 29.38 ? 402 PHE B O     1 
ATOM   6370  C CB    . PHE B 1 402 ? -2.444  -1.449  12.250   1.00 29.21 ? 402 PHE B CB    1 
ATOM   6371  C CG    . PHE B 1 402 ? -1.735  -0.530  11.309   1.00 30.43 ? 402 PHE B CG    1 
ATOM   6372  C CD1   . PHE B 1 402 ? -2.261  -0.230  10.073   1.00 29.20 ? 402 PHE B CD1   1 
ATOM   6373  C CD2   . PHE B 1 402 ? -0.592  0.117   11.710   1.00 29.91 ? 402 PHE B CD2   1 
ATOM   6374  C CE1   . PHE B 1 402 ? -1.655  0.662   9.275    1.00 29.08 ? 402 PHE B CE1   1 
ATOM   6375  C CE2   . PHE B 1 402 ? 0.014   1.004   10.903   1.00 29.97 ? 402 PHE B CE2   1 
ATOM   6376  C CZ    . PHE B 1 402 ? -0.518  1.297   9.694    1.00 29.22 ? 402 PHE B CZ    1 
ATOM   6377  N N     . SER B 1 403 ? -2.775  -4.361  9.970    1.00 29.73 ? 403 SER B N     1 
ATOM   6378  C CA    . SER B 1 403 ? -3.447  -4.745  8.707    1.00 29.27 ? 403 SER B CA    1 
ATOM   6379  C C     . SER B 1 403 ? -4.771  -5.525  8.770    1.00 28.89 ? 403 SER B C     1 
ATOM   6380  O O     . SER B 1 403 ? -5.616  -5.326  7.919    1.00 29.13 ? 403 SER B O     1 
ATOM   6381  C CB    . SER B 1 403 ? -2.492  -5.455  7.781    1.00 28.30 ? 403 SER B CB    1 
ATOM   6382  O OG    . SER B 1 403 ? -2.566  -6.827  8.018    1.00 30.31 ? 403 SER B OG    1 
ATOM   6383  N N     . SER B 1 404 ? -4.933  -6.439  9.717    1.00 29.54 ? 404 SER B N     1 
ATOM   6384  C CA    . SER B 1 404 ? -6.103  -7.313  9.713    1.00 30.75 ? 404 SER B CA    1 
ATOM   6385  C C     . SER B 1 404 ? -7.052  -7.070  10.862   1.00 30.20 ? 404 SER B C     1 
ATOM   6386  O O     . SER B 1 404 ? -8.291  -7.112  10.660   1.00 29.13 ? 404 SER B O     1 
ATOM   6387  C CB    . SER B 1 404 ? -5.707  -8.766  9.791    1.00 31.97 ? 404 SER B CB    1 
ATOM   6388  O OG    . SER B 1 404 ? -4.574  -9.045  8.981    1.00 40.40 ? 404 SER B OG    1 
ATOM   6389  N N     . ALA B 1 405 ? -6.476  -6.814  12.047   1.00 29.23 ? 405 ALA B N     1 
ATOM   6390  C CA    . ALA B 1 405 ? -7.216  -6.827  13.319   1.00 29.70 ? 405 ALA B CA    1 
ATOM   6391  C C     . ALA B 1 405 ? -8.362  -5.828  13.422   1.00 30.34 ? 405 ALA B C     1 
ATOM   6392  O O     . ALA B 1 405 ? -8.307  -4.736  12.873   1.00 30.74 ? 405 ALA B O     1 
ATOM   6393  C CB    . ALA B 1 405 ? -6.258  -6.672  14.507   1.00 29.37 ? 405 ALA B CB    1 
ATOM   6394  N N     . SER B 1 406 ? -9.414  -6.228  14.117   1.00 31.57 ? 406 SER B N     1 
ATOM   6395  C CA    . SER B 1 406 ? -10.564 -5.371  14.355   1.00 33.44 ? 406 SER B CA    1 
ATOM   6396  C C     . SER B 1 406 ? -10.343 -4.545  15.625   1.00 35.24 ? 406 SER B C     1 
ATOM   6397  O O     . SER B 1 406 ? -9.538  -4.936  16.498   1.00 36.14 ? 406 SER B O     1 
ATOM   6398  C CB    . SER B 1 406 ? -11.819 -6.207  14.473   1.00 32.04 ? 406 SER B CB    1 
ATOM   6399  O OG    . SER B 1 406 ? -11.708 -7.070  15.559   1.00 31.89 ? 406 SER B OG    1 
ATOM   6400  N N     . PRO B 1 407 ? -11.026 -3.379  15.728   1.00 36.24 ? 407 PRO B N     1 
ATOM   6401  C CA    . PRO B 1 407 ? -10.802 -2.558  16.890   1.00 36.43 ? 407 PRO B CA    1 
ATOM   6402  C C     . PRO B 1 407 ? -10.780 -3.340  18.196   1.00 36.69 ? 407 PRO B C     1 
ATOM   6403  O O     . PRO B 1 407 ? -10.062 -2.968  19.108   1.00 36.13 ? 407 PRO B O     1 
ATOM   6404  C CB    . PRO B 1 407 ? -11.986 -1.604  16.851   1.00 36.40 ? 407 PRO B CB    1 
ATOM   6405  C CG    . PRO B 1 407 ? -12.188 -1.356  15.422   1.00 35.18 ? 407 PRO B CG    1 
ATOM   6406  C CD    . PRO B 1 407 ? -12.011 -2.749  14.823   1.00 36.48 ? 407 PRO B CD    1 
ATOM   6407  N N     . GLU B 1 408 ? -11.569 -4.394  18.306   1.00 37.33 ? 408 GLU B N     1 
ATOM   6408  C CA    . GLU B 1 408 ? -11.629 -5.103  19.602   1.00 37.98 ? 408 GLU B CA    1 
ATOM   6409  C C     . GLU B 1 408 ? -10.418 -6.020  19.803   1.00 37.13 ? 408 GLU B C     1 
ATOM   6410  O O     . GLU B 1 408 ? -9.924  -6.233  20.923   1.00 37.25 ? 408 GLU B O     1 
ATOM   6411  C CB    . GLU B 1 408 ? -12.972 -5.827  19.832   1.00 37.74 ? 408 GLU B CB    1 
ATOM   6412  C CG    . GLU B 1 408 ? -13.517 -6.553  18.677   1.00 40.76 ? 408 GLU B CG    1 
ATOM   6413  C CD    . GLU B 1 408 ? -14.115 -5.649  17.580   1.00 45.35 ? 408 GLU B CD    1 
ATOM   6414  O OE1   . GLU B 1 408 ? -14.633 -6.249  16.614   1.00 47.27 ? 408 GLU B OE1   1 
ATOM   6415  O OE2   . GLU B 1 408 ? -14.042 -4.383  17.629   1.00 43.50 ? 408 GLU B OE2   1 
ATOM   6416  N N     . GLN B 1 409 ? -9.970  -6.580  18.696   1.00 35.53 ? 409 GLN B N     1 
ATOM   6417  C CA    . GLN B 1 409 ? -8.823  -7.446  18.684   1.00 34.20 ? 409 GLN B CA    1 
ATOM   6418  C C     . GLN B 1 409 ? -7.596  -6.729  19.276   1.00 33.19 ? 409 GLN B C     1 
ATOM   6419  O O     . GLN B 1 409 ? -6.966  -7.250  20.173   1.00 31.50 ? 409 GLN B O     1 
ATOM   6420  C CB    . GLN B 1 409 ? -8.595  -7.955  17.236   1.00 34.14 ? 409 GLN B CB    1 
ATOM   6421  C CG    . GLN B 1 409 ? -9.456  -9.149  16.889   1.00 33.10 ? 409 GLN B CG    1 
ATOM   6422  C CD    . GLN B 1 409 ? -9.283  -9.625  15.472   1.00 33.37 ? 409 GLN B CD    1 
ATOM   6423  O OE1   . GLN B 1 409 ? -9.120  -8.839  14.574   1.00 34.38 ? 409 GLN B OE1   1 
ATOM   6424  N NE2   . GLN B 1 409 ? -9.331  -10.921 15.266   1.00 32.68 ? 409 GLN B NE2   1 
ATOM   6425  N N     . MET B 1 410 ? -7.318  -5.521  18.770   1.00 32.88 ? 410 MET B N     1 
ATOM   6426  C CA    . MET B 1 410 ? -6.271  -4.623  19.231   1.00 32.28 ? 410 MET B CA    1 
ATOM   6427  C C     . MET B 1 410 ? -6.397  -4.176  20.697   1.00 32.51 ? 410 MET B C     1 
ATOM   6428  O O     . MET B 1 410 ? -5.366  -4.064  21.456   1.00 31.07 ? 410 MET B O     1 
ATOM   6429  C CB    . MET B 1 410 ? -6.309  -3.401  18.345   1.00 32.70 ? 410 MET B CB    1 
ATOM   6430  C CG    . MET B 1 410 ? -5.742  -3.604  16.905   1.00 32.70 ? 410 MET B CG    1 
ATOM   6431  S SD    . MET B 1 410 ? -6.314  -2.216  15.896   1.00 34.51 ? 410 MET B SD    1 
ATOM   6432  C CE    . MET B 1 410 ? -6.075  -2.872  14.249   1.00 32.04 ? 410 MET B CE    1 
ATOM   6433  N N     . ASP B 1 411 ? -7.640  -3.884  21.094   1.00 30.35 ? 411 ASP B N     1 
ATOM   6434  C CA    . ASP B 1 411 ? -7.978  -3.584  22.494   1.00 30.04 ? 411 ASP B CA    1 
ATOM   6435  C C     . ASP B 1 411 ? -7.532  -4.644  23.508   1.00 28.86 ? 411 ASP B C     1 
ATOM   6436  O O     . ASP B 1 411 ? -6.994  -4.312  24.571   1.00 29.35 ? 411 ASP B O     1 
ATOM   6437  C CB    . ASP B 1 411 ? -9.499  -3.317  22.597   1.00 31.24 ? 411 ASP B CB    1 
ATOM   6438  C CG    . ASP B 1 411 ? -9.949  -2.849  23.961   1.00 33.81 ? 411 ASP B CG    1 
ATOM   6439  O OD1   . ASP B 1 411 ? -10.593 -3.691  24.619   1.00 38.16 ? 411 ASP B OD1   1 
ATOM   6440  O OD2   . ASP B 1 411 ? -9.692  -1.669  24.374   1.00 38.53 ? 411 ASP B OD2   1 
ATOM   6441  N N     . VAL B 1 412 ? -7.749  -5.912  23.193   1.00 27.69 ? 412 VAL B N     1 
ATOM   6442  C CA    . VAL B 1 412 ? -7.328  -7.000  24.061   1.00 27.42 ? 412 VAL B CA    1 
ATOM   6443  C C     . VAL B 1 412 ? -5.797  -7.240  23.926   1.00 28.84 ? 412 VAL B C     1 
ATOM   6444  O O     . VAL B 1 412 ? -5.066  -7.504  24.915   1.00 29.28 ? 412 VAL B O     1 
ATOM   6445  C CB    . VAL B 1 412 ? -8.097  -8.296  23.710   1.00 28.77 ? 412 VAL B CB    1 
ATOM   6446  C CG1   . VAL B 1 412 ? -7.619  -9.485  24.607   1.00 27.45 ? 412 VAL B CG1   1 
ATOM   6447  C CG2   . VAL B 1 412 ? -9.668  -8.086  23.832   1.00 26.23 ? 412 VAL B CG2   1 
ATOM   6448  N N     . ALA B 1 413 ? -5.334  -7.090  22.687   1.00 27.60 ? 413 ALA B N     1 
ATOM   6449  C CA    . ALA B 1 413 ? -3.996  -7.168  22.327   1.00 26.36 ? 413 ALA B CA    1 
ATOM   6450  C C     . ALA B 1 413 ? -3.177  -6.184  23.161   1.00 26.03 ? 413 ALA B C     1 
ATOM   6451  O O     . ALA B 1 413 ? -2.111  -6.529  23.680   1.00 25.63 ? 413 ALA B O     1 
ATOM   6452  C CB    . ALA B 1 413 ? -3.881  -6.890  20.815   1.00 25.84 ? 413 ALA B CB    1 
ATOM   6453  N N     . PHE B 1 414 ? -3.687  -4.977  23.338   1.00 25.81 ? 414 PHE B N     1 
ATOM   6454  C CA    . PHE B 1 414 ? -2.932  -3.984  24.087   1.00 25.64 ? 414 PHE B CA    1 
ATOM   6455  C C     . PHE B 1 414 ? -3.298  -3.994  25.576   1.00 26.69 ? 414 PHE B C     1 
ATOM   6456  O O     . PHE B 1 414 ? -2.494  -3.622  26.434   1.00 26.48 ? 414 PHE B O     1 
ATOM   6457  C CB    . PHE B 1 414 ? -3.053  -2.616  23.478   1.00 25.06 ? 414 PHE B CB    1 
ATOM   6458  C CG    . PHE B 1 414 ? -2.296  -2.471  22.203   1.00 25.11 ? 414 PHE B CG    1 
ATOM   6459  C CD1   . PHE B 1 414 ? -2.722  -3.103  21.046   1.00 26.10 ? 414 PHE B CD1   1 
ATOM   6460  C CD2   . PHE B 1 414 ? -1.165  -1.700  22.154   1.00 28.38 ? 414 PHE B CD2   1 
ATOM   6461  C CE1   . PHE B 1 414 ? -2.051  -2.965  19.861   1.00 24.60 ? 414 PHE B CE1   1 
ATOM   6462  C CE2   . PHE B 1 414 ? -0.422  -1.570  20.967   1.00 33.03 ? 414 PHE B CE2   1 
ATOM   6463  C CZ    . PHE B 1 414 ? -0.866  -2.209  19.809   1.00 30.49 ? 414 PHE B CZ    1 
ATOM   6464  N N     . GLN B 1 415 ? -4.497  -4.456  25.910   1.00 27.41 ? 415 GLN B N     1 
ATOM   6465  C CA    . GLN B 1 415 ? -4.783  -4.622  27.313   1.00 27.71 ? 415 GLN B CA    1 
ATOM   6466  C C     . GLN B 1 415 ? -3.786  -5.651  27.912   1.00 27.75 ? 415 GLN B C     1 
ATOM   6467  O O     . GLN B 1 415 ? -3.304  -5.487  29.020   1.00 27.14 ? 415 GLN B O     1 
ATOM   6468  C CB    . GLN B 1 415 ? -6.255  -5.000  27.496   1.00 27.81 ? 415 GLN B CB    1 
ATOM   6469  C CG    . GLN B 1 415 ? -6.708  -5.174  28.903   1.00 27.48 ? 415 GLN B CG    1 
ATOM   6470  C CD    . GLN B 1 415 ? -6.675  -6.614  29.312   1.00 31.79 ? 415 GLN B CD    1 
ATOM   6471  O OE1   . GLN B 1 415 ? -7.390  -7.438  28.745   1.00 37.26 ? 415 GLN B OE1   1 
ATOM   6472  N NE2   . GLN B 1 415 ? -5.879  -6.933  30.320   1.00 31.06 ? 415 GLN B NE2   1 
ATOM   6473  N N     . VAL B 1 416 ? -3.427  -6.656  27.127   1.00 28.82 ? 416 VAL B N     1 
ATOM   6474  C CA    . VAL B 1 416 ? -2.752  -7.836  27.648   1.00 29.65 ? 416 VAL B CA    1 
ATOM   6475  C C     . VAL B 1 416 ? -1.263  -7.548  27.694   1.00 31.44 ? 416 VAL B C     1 
ATOM   6476  O O     . VAL B 1 416 ? -0.559  -7.854  28.689   1.00 31.55 ? 416 VAL B O     1 
ATOM   6477  C CB    . VAL B 1 416 ? -3.147  -9.122  26.842   1.00 29.55 ? 416 VAL B CB    1 
ATOM   6478  C CG1   . VAL B 1 416 ? -2.438  -10.290 27.309   1.00 26.97 ? 416 VAL B CG1   1 
ATOM   6479  C CG2   . VAL B 1 416 ? -4.711  -9.399  26.974   1.00 30.37 ? 416 VAL B CG2   1 
ATOM   6480  N N     . LEU B 1 417 ? -0.823  -6.861  26.655   1.00 32.11 ? 417 LEU B N     1 
ATOM   6481  C CA    . LEU B 1 417 ? 0.539   -6.432  26.542   1.00 32.37 ? 417 LEU B CA    1 
ATOM   6482  C C     . LEU B 1 417 ? 0.907   -5.476  27.638   1.00 33.29 ? 417 LEU B C     1 
ATOM   6483  O O     . LEU B 1 417 ? 1.990   -5.575  28.239   1.00 33.46 ? 417 LEU B O     1 
ATOM   6484  C CB    . LEU B 1 417 ? 0.766   -5.742  25.185   1.00 33.09 ? 417 LEU B CB    1 
ATOM   6485  C CG    . LEU B 1 417 ? 2.250   -5.683  24.886   1.00 28.43 ? 417 LEU B CG    1 
ATOM   6486  C CD1   . LEU B 1 417 ? 2.593   -7.105  24.579   1.00 33.95 ? 417 LEU B CD1   1 
ATOM   6487  C CD2   . LEU B 1 417 ? 2.594   -4.719  23.724   1.00 25.67 ? 417 LEU B CD2   1 
ATOM   6488  N N     . ALA B 1 418 ? 0.050   -4.510  27.883   1.00 34.29 ? 418 ALA B N     1 
ATOM   6489  C CA    . ALA B 1 418 ? 0.382   -3.527  28.915   1.00 35.53 ? 418 ALA B CA    1 
ATOM   6490  C C     . ALA B 1 418 ? 0.520   -4.266  30.262   1.00 36.29 ? 418 ALA B C     1 
ATOM   6491  O O     . ALA B 1 418 ? 1.479   -4.034  31.003   1.00 36.60 ? 418 ALA B O     1 
ATOM   6492  C CB    . ALA B 1 418 ? -0.661  -2.425  28.978   1.00 35.09 ? 418 ALA B CB    1 
ATOM   6493  N N     . GLN B 1 419 ? -0.402  -5.185  30.541   1.00 36.36 ? 419 GLN B N     1 
ATOM   6494  C CA    . GLN B 1 419 ? -0.369  -5.983  31.769   1.00 37.44 ? 419 GLN B CA    1 
ATOM   6495  C C     . GLN B 1 419 ? 0.954   -6.734  31.989   1.00 37.01 ? 419 GLN B C     1 
ATOM   6496  O O     . GLN B 1 419 ? 1.390   -6.925  33.136   1.00 37.00 ? 419 GLN B O     1 
ATOM   6497  C CB    . GLN B 1 419 ? -1.526  -6.979  31.744   1.00 37.53 ? 419 GLN B CB    1 
ATOM   6498  C CG    . GLN B 1 419 ? -1.645  -7.963  32.923   1.00 39.64 ? 419 GLN B CG    1 
ATOM   6499  C CD    . GLN B 1 419 ? -2.114  -9.393  32.495   1.00 40.57 ? 419 GLN B CD    1 
ATOM   6500  O OE1   . GLN B 1 419 ? -2.134  -9.745  31.287   1.00 41.58 ? 419 GLN B OE1   1 
ATOM   6501  N NE2   . GLN B 1 419 ? -2.478  -10.221 33.500   1.00 42.88 ? 419 GLN B NE2   1 
ATOM   6502  N N     . LEU B 1 420 ? 1.590   -7.131  30.887   1.00 36.37 ? 420 LEU B N     1 
ATOM   6503  C CA    . LEU B 1 420 ? 2.636   -8.098  30.933   1.00 35.97 ? 420 LEU B CA    1 
ATOM   6504  C C     . LEU B 1 420 ? 3.893   -7.341  31.180   1.00 36.14 ? 420 LEU B C     1 
ATOM   6505  O O     . LEU B 1 420 ? 4.775   -7.820  31.908   1.00 36.51 ? 420 LEU B O     1 
ATOM   6506  C CB    . LEU B 1 420 ? 2.698   -8.886  29.634   1.00 35.98 ? 420 LEU B CB    1 
ATOM   6507  C CG    . LEU B 1 420 ? 1.665   -10.006 29.697   1.00 38.12 ? 420 LEU B CG    1 
ATOM   6508  C CD1   . LEU B 1 420 ? 1.354   -10.552 28.323   1.00 38.59 ? 420 LEU B CD1   1 
ATOM   6509  C CD2   . LEU B 1 420 ? 2.081   -11.123 30.677   1.00 38.18 ? 420 LEU B CD2   1 
ATOM   6510  N N     . ILE B 1 421 ? 3.947   -6.163  30.560   1.00 35.28 ? 421 ILE B N     1 
ATOM   6511  C CA    . ILE B 1 421 ? 4.860   -5.084  30.871   1.00 34.73 ? 421 ILE B CA    1 
ATOM   6512  C C     . ILE B 1 421 ? 4.812   -4.573  32.325   1.00 36.47 ? 421 ILE B C     1 
ATOM   6513  O O     . ILE B 1 421 ? 5.865   -4.470  32.974   1.00 35.22 ? 421 ILE B O     1 
ATOM   6514  C CB    . ILE B 1 421 ? 4.624   -3.919  29.946   1.00 33.32 ? 421 ILE B CB    1 
ATOM   6515  C CG1   . ILE B 1 421 ? 4.853   -4.388  28.511   1.00 33.00 ? 421 ILE B CG1   1 
ATOM   6516  C CG2   . ILE B 1 421 ? 5.558   -2.791  30.312   1.00 32.19 ? 421 ILE B CG2   1 
ATOM   6517  C CD1   . ILE B 1 421 ? 4.402   -3.424  27.425   1.00 29.95 ? 421 ILE B CD1   1 
ATOM   6518  N N     . LYS B 1 422 ? 3.632   -4.256  32.842   1.00 37.93 ? 422 LYS B N     1 
ATOM   6519  C CA    . LYS B 1 422 ? 3.517   -3.838  34.239   1.00 39.69 ? 422 LYS B CA    1 
ATOM   6520  C C     . LYS B 1 422 ? 3.987   -4.947  35.176   1.00 41.38 ? 422 LYS B C     1 
ATOM   6521  O O     . LYS B 1 422 ? 4.612   -4.695  36.186   1.00 42.13 ? 422 LYS B O     1 
ATOM   6522  C CB    . LYS B 1 422 ? 2.087   -3.432  34.573   1.00 39.43 ? 422 LYS B CB    1 
ATOM   6523  C CG    . LYS B 1 422 ? 1.708   -2.051  34.099   1.00 40.11 ? 422 LYS B CG    1 
ATOM   6524  C CD    . LYS B 1 422 ? 0.742   -1.353  35.050   1.00 42.86 ? 422 LYS B CD    1 
ATOM   6525  C CE    . LYS B 1 422 ? -0.703  -1.501  34.637   1.00 40.39 ? 422 LYS B CE    1 
ATOM   6526  N NZ    . LYS B 1 422 ? -1.008  -2.894  34.277   1.00 41.69 ? 422 LYS B NZ    1 
ATOM   6527  N N     . GLU B 1 423 ? 3.680   -6.173  34.792   1.00 42.39 ? 423 GLU B N     1 
ATOM   6528  C CA    . GLU B 1 423 ? 3.963   -7.399  35.527   1.00 43.29 ? 423 GLU B CA    1 
ATOM   6529  C C     . GLU B 1 423 ? 5.451   -7.743  35.465   1.00 44.96 ? 423 GLU B C     1 
ATOM   6530  O O     . GLU B 1 423 ? 5.965   -8.519  36.266   1.00 45.02 ? 423 GLU B O     1 
ATOM   6531  C CB    . GLU B 1 423 ? 3.149   -8.544  34.903   1.00 42.66 ? 423 GLU B CB    1 
ATOM   6532  C CG    . GLU B 1 423 ? 2.294   -9.340  35.870   1.00 41.80 ? 423 GLU B CG    1 
ATOM   6533  C CD    . GLU B 1 423 ? 0.868   -9.586  35.390   1.00 43.35 ? 423 GLU B CD    1 
ATOM   6534  O OE1   . GLU B 1 423 ? 0.579   -10.668 34.850   1.00 37.52 ? 423 GLU B OE1   1 
ATOM   6535  O OE2   . GLU B 1 423 ? 0.014   -8.704  35.589   1.00 40.90 ? 423 GLU B OE2   1 
ATOM   6536  N N     . SER B 1 424 ? 6.123   -7.156  34.490   1.00 46.50 ? 424 SER B N     1 
ATOM   6537  C CA    . SER B 1 424 ? 7.517   -7.395  34.196   1.00 47.33 ? 424 SER B CA    1 
ATOM   6538  C C     . SER B 1 424 ? 8.355   -6.198  34.570   1.00 48.11 ? 424 SER B C     1 
ATOM   6539  O O     . SER B 1 424 ? 9.546   -6.154  34.270   1.00 48.91 ? 424 SER B O     1 
ATOM   6540  C CB    . SER B 1 424 ? 7.681   -7.655  32.707   1.00 47.68 ? 424 SER B CB    1 
ATOM   6541  O OG    . SER B 1 424 ? 7.079   -8.875  32.325   1.00 49.36 ? 424 SER B OG    1 
ATOM   6542  N N     . LEU B 1 425 ? 7.753   -5.194  35.198   1.00 49.43 ? 425 LEU B N     1 
ATOM   6543  C CA    . LEU B 1 425 ? 8.567   -4.063  35.677   1.00 50.49 ? 425 LEU B CA    1 
ATOM   6544  C C     . LEU B 1 425 ? 9.176   -4.334  37.071   1.00 51.45 ? 425 LEU B C     1 
ATOM   6545  O O     . LEU B 1 425 ? 9.383   -5.494  37.493   1.00 51.54 ? 425 LEU B O     1 
ATOM   6546  C CB    . LEU B 1 425 ? 7.781   -2.749  35.671   1.00 49.78 ? 425 LEU B CB    1 
ATOM   6547  C CG    . LEU B 1 425 ? 7.394   -2.082  34.340   1.00 50.36 ? 425 LEU B CG    1 
ATOM   6548  C CD1   . LEU B 1 425 ? 7.205   -0.577  34.546   1.00 48.99 ? 425 LEU B CD1   1 
ATOM   6549  C CD2   . LEU B 1 425 ? 8.382   -2.364  33.201   1.00 49.40 ? 425 LEU B CD2   1 
ATOM   6550  O OXT   . LEU B 1 425 ? 9.485   -3.380  37.812   1.00 52.59 ? 425 LEU B OXT   1 
ATOM   6551  N N     . MET C 1 1   ? -10.111 -31.604 -61.778  1.00 43.16 ? 1   MET C N     1 
ATOM   6552  C CA    . MET C 1 1   ? -11.290 -31.249 -60.934  1.00 43.58 ? 1   MET C CA    1 
ATOM   6553  C C     . MET C 1 1   ? -12.111 -32.491 -60.555  1.00 42.29 ? 1   MET C C     1 
ATOM   6554  O O     . MET C 1 1   ? -12.085 -32.922 -59.418  1.00 42.59 ? 1   MET C O     1 
ATOM   6555  C CB    . MET C 1 1   ? -12.170 -30.202 -61.618  1.00 44.80 ? 1   MET C CB    1 
ATOM   6556  C CG    . MET C 1 1   ? -11.765 -28.753 -61.399  1.00 46.66 ? 1   MET C CG    1 
ATOM   6557  S SD    . MET C 1 1   ? -12.566 -28.022 -59.961  1.00 54.88 ? 1   MET C SD    1 
ATOM   6558  C CE    . MET C 1 1   ? -12.851 -26.297 -60.509  1.00 47.54 ? 1   MET C CE    1 
ATOM   6559  N N     . ASN C 1 2   ? -12.849 -33.059 -61.494  1.00 40.90 ? 2   ASN C N     1 
ATOM   6560  C CA    . ASN C 1 2   ? -13.476 -34.349 -61.247  1.00 39.95 ? 2   ASN C CA    1 
ATOM   6561  C C     . ASN C 1 2   ? -12.617 -35.525 -61.708  1.00 40.00 ? 2   ASN C C     1 
ATOM   6562  O O     . ASN C 1 2   ? -12.963 -36.206 -62.702  1.00 39.96 ? 2   ASN C O     1 
ATOM   6563  C CB    . ASN C 1 2   ? -14.857 -34.436 -61.885  1.00 39.51 ? 2   ASN C CB    1 
ATOM   6564  C CG    . ASN C 1 2   ? -15.579 -35.734 -61.547  1.00 37.86 ? 2   ASN C CG    1 
ATOM   6565  O OD1   . ASN C 1 2   ? -15.123 -36.523 -60.714  1.00 33.05 ? 2   ASN C OD1   1 
ATOM   6566  N ND2   . ASN C 1 2   ? -16.727 -35.955 -62.196  1.00 33.61 ? 2   ASN C ND2   1 
ATOM   6567  N N     . TYR C 1 3   ? -11.551 -35.803 -60.945  1.00 38.48 ? 3   TYR C N     1 
ATOM   6568  C CA    . TYR C 1 3   ? -10.630 -36.913 -61.259  1.00 37.57 ? 3   TYR C CA    1 
ATOM   6569  C C     . TYR C 1 3   ? -11.290 -38.281 -61.382  1.00 38.64 ? 3   TYR C C     1 
ATOM   6570  O O     . TYR C 1 3   ? -10.663 -39.198 -61.883  1.00 39.41 ? 3   TYR C O     1 
ATOM   6571  C CB    . TYR C 1 3   ? -9.454  -36.980 -60.268  1.00 34.81 ? 3   TYR C CB    1 
ATOM   6572  C CG    . TYR C 1 3   ? -8.540  -35.802 -60.364  1.00 31.40 ? 3   TYR C CG    1 
ATOM   6573  C CD1   . TYR C 1 3   ? -8.455  -34.858 -59.333  1.00 32.47 ? 3   TYR C CD1   1 
ATOM   6574  C CD2   . TYR C 1 3   ? -7.766  -35.612 -61.488  1.00 26.49 ? 3   TYR C CD2   1 
ATOM   6575  C CE1   . TYR C 1 3   ? -7.599  -33.745 -59.432  1.00 27.30 ? 3   TYR C CE1   1 
ATOM   6576  C CE2   . TYR C 1 3   ? -6.945  -34.550 -61.611  1.00 23.82 ? 3   TYR C CE2   1 
ATOM   6577  C CZ    . TYR C 1 3   ? -6.850  -33.617 -60.607  1.00 28.44 ? 3   TYR C CZ    1 
ATOM   6578  O OH    . TYR C 1 3   ? -6.014  -32.549 -60.819  1.00 29.12 ? 3   TYR C OH    1 
ATOM   6579  N N     . ALA C 1 4   ? -12.535 -38.432 -60.928  1.00 39.67 ? 4   ALA C N     1 
ATOM   6580  C CA    . ALA C 1 4   ? -13.249 -39.729 -61.083  1.00 40.62 ? 4   ALA C CA    1 
ATOM   6581  C C     . ALA C 1 4   ? -13.641 -40.000 -62.520  1.00 40.85 ? 4   ALA C C     1 
ATOM   6582  O O     . ALA C 1 4   ? -13.955 -41.135 -62.873  1.00 40.92 ? 4   ALA C O     1 
ATOM   6583  C CB    . ALA C 1 4   ? -14.480 -39.819 -60.164  1.00 40.84 ? 4   ALA C CB    1 
ATOM   6584  N N     . ARG C 1 5   ? -13.611 -38.964 -63.369  1.00 41.56 ? 5   ARG C N     1 
ATOM   6585  C CA    . ARG C 1 5   ? -13.969 -39.131 -64.783  1.00 41.17 ? 5   ARG C CA    1 
ATOM   6586  C C     . ARG C 1 5   ? -13.008 -40.025 -65.527  1.00 41.42 ? 5   ARG C C     1 
ATOM   6587  O O     . ARG C 1 5   ? -13.418 -40.996 -66.164  1.00 41.49 ? 5   ARG C O     1 
ATOM   6588  C CB    . ARG C 1 5   ? -14.057 -37.787 -65.487  1.00 41.40 ? 5   ARG C CB    1 
ATOM   6589  C CG    . ARG C 1 5   ? -15.396 -37.048 -65.309  1.00 39.24 ? 5   ARG C CG    1 
ATOM   6590  C CD    . ARG C 1 5   ? -15.391 -35.800 -66.168  1.00 37.10 ? 5   ARG C CD    1 
ATOM   6591  N NE    . ARG C 1 5   ? -15.324 -36.178 -67.580  1.00 31.87 ? 5   ARG C NE    1 
ATOM   6592  C CZ    . ARG C 1 5   ? -14.967 -35.359 -68.554  1.00 32.75 ? 5   ARG C CZ    1 
ATOM   6593  N NH1   . ARG C 1 5   ? -14.948 -35.826 -69.798  1.00 35.75 ? 5   ARG C NH1   1 
ATOM   6594  N NH2   . ARG C 1 5   ? -14.606 -34.094 -68.289  1.00 32.08 ? 5   ARG C NH2   1 
ATOM   6595  N N     . PHE C 1 6   ? -11.722 -39.686 -65.396  1.00 41.85 ? 6   PHE C N     1 
ATOM   6596  C CA    . PHE C 1 6   ? -10.620 -40.225 -66.185  1.00 41.26 ? 6   PHE C CA    1 
ATOM   6597  C C     . PHE C 1 6   ? -9.970  -41.402 -65.488  1.00 41.03 ? 6   PHE C C     1 
ATOM   6598  O O     . PHE C 1 6   ? -8.740  -41.631 -65.643  1.00 41.40 ? 6   PHE C O     1 
ATOM   6599  C CB    . PHE C 1 6   ? -9.526  -39.143 -66.372  1.00 42.08 ? 6   PHE C CB    1 
ATOM   6600  C CG    . PHE C 1 6   ? -10.063 -37.750 -66.556  1.00 40.42 ? 6   PHE C CG    1 
ATOM   6601  C CD1   . PHE C 1 6   ? -10.416 -36.989 -65.462  1.00 37.04 ? 6   PHE C CD1   1 
ATOM   6602  C CD2   . PHE C 1 6   ? -10.217 -37.216 -67.837  1.00 40.55 ? 6   PHE C CD2   1 
ATOM   6603  C CE1   . PHE C 1 6   ? -10.937 -35.720 -65.630  1.00 38.65 ? 6   PHE C CE1   1 
ATOM   6604  C CE2   . PHE C 1 6   ? -10.726 -35.926 -68.013  1.00 39.11 ? 6   PHE C CE2   1 
ATOM   6605  C CZ    . PHE C 1 6   ? -11.086 -35.183 -66.911  1.00 38.14 ? 6   PHE C CZ    1 
ATOM   6606  N N     . ILE C 1 7   ? -10.763 -42.127 -64.701  1.00 39.82 ? 7   ILE C N     1 
ATOM   6607  C CA    . ILE C 1 7   ? -10.280 -43.296 -63.975  1.00 39.22 ? 7   ILE C CA    1 
ATOM   6608  C C     . ILE C 1 7   ? -11.201 -44.473 -64.254  1.00 39.96 ? 7   ILE C C     1 
ATOM   6609  O O     . ILE C 1 7   ? -12.364 -44.430 -63.904  1.00 41.41 ? 7   ILE C O     1 
ATOM   6610  C CB    . ILE C 1 7   ? -10.146 -43.008 -62.442  1.00 38.52 ? 7   ILE C CB    1 
ATOM   6611  C CG1   . ILE C 1 7   ? -8.928  -42.143 -62.169  1.00 36.50 ? 7   ILE C CG1   1 
ATOM   6612  C CG2   . ILE C 1 7   ? -9.971  -44.258 -61.653  1.00 37.03 ? 7   ILE C CG2   1 
ATOM   6613  C CD1   . ILE C 1 7   ? -8.973  -41.406 -60.855  1.00 36.10 ? 7   ILE C CD1   1 
ATOM   6614  N N     . THR C 1 8   ? -10.684 -45.523 -64.894  1.00 40.76 ? 8   THR C N     1 
ATOM   6615  C CA    . THR C 1 8   ? -11.465 -46.747 -65.191  1.00 40.66 ? 8   THR C CA    1 
ATOM   6616  C C     . THR C 1 8   ? -12.057 -47.345 -63.910  1.00 40.17 ? 8   THR C C     1 
ATOM   6617  O O     . THR C 1 8   ? -11.697 -46.924 -62.813  1.00 39.78 ? 8   THR C O     1 
ATOM   6618  C CB    . THR C 1 8   ? -10.594 -47.735 -65.938  1.00 40.07 ? 8   THR C CB    1 
ATOM   6619  O OG1   . THR C 1 8   ? -10.239 -47.130 -67.178  1.00 41.88 ? 8   THR C OG1   1 
ATOM   6620  C CG2   . THR C 1 8   ? -11.331 -49.034 -66.255  1.00 41.91 ? 8   THR C CG2   1 
ATOM   6621  N N     . ALA C 1 9   ? -12.980 -48.299 -64.033  1.00 39.62 ? 9   ALA C N     1 
ATOM   6622  C CA    . ALA C 1 9   ? -13.550 -48.891 -62.809  1.00 38.63 ? 9   ALA C CA    1 
ATOM   6623  C C     . ALA C 1 9   ? -12.501 -49.816 -62.222  1.00 36.64 ? 9   ALA C C     1 
ATOM   6624  O O     . ALA C 1 9   ? -12.213 -49.747 -61.051  1.00 37.68 ? 9   ALA C O     1 
ATOM   6625  C CB    . ALA C 1 9   ? -14.906 -49.618 -63.051  1.00 37.72 ? 9   ALA C CB    1 
ATOM   6626  N N     . ALA C 1 10  ? -11.912 -50.648 -63.063  1.00 35.06 ? 10  ALA C N     1 
ATOM   6627  C CA    . ALA C 1 10  ? -10.755 -51.488 -62.667  1.00 34.06 ? 10  ALA C CA    1 
ATOM   6628  C C     . ALA C 1 10  ? -9.646  -50.695 -61.933  1.00 32.95 ? 10  ALA C C     1 
ATOM   6629  O O     . ALA C 1 10  ? -9.136  -51.089 -60.874  1.00 33.13 ? 10  ALA C O     1 
ATOM   6630  C CB    . ALA C 1 10  ? -10.192 -52.174 -63.913  1.00 33.37 ? 10  ALA C CB    1 
ATOM   6631  N N     . SER C 1 11  ? -9.322  -49.548 -62.496  1.00 31.47 ? 11  SER C N     1 
ATOM   6632  C CA    . SER C 1 11  ? -8.291  -48.707 -61.934  1.00 30.84 ? 11  SER C CA    1 
ATOM   6633  C C     . SER C 1 11  ? -8.671  -48.069 -60.590  1.00 29.46 ? 11  SER C C     1 
ATOM   6634  O O     . SER C 1 11  ? -7.844  -48.007 -59.629  1.00 28.76 ? 11  SER C O     1 
ATOM   6635  C CB    . SER C 1 11  ? -7.859  -47.656 -62.962  1.00 30.20 ? 11  SER C CB    1 
ATOM   6636  O OG    . SER C 1 11  ? -7.079  -46.696 -62.317  1.00 31.60 ? 11  SER C OG    1 
ATOM   6637  N N     . ALA C 1 12  ? -9.923  -47.616 -60.539  1.00 28.08 ? 12  ALA C N     1 
ATOM   6638  C CA    . ALA C 1 12  ? -10.537 -47.126 -59.330  1.00 26.57 ? 12  ALA C CA    1 
ATOM   6639  C C     . ALA C 1 12  ? -10.496 -48.189 -58.217  1.00 25.40 ? 12  ALA C C     1 
ATOM   6640  O O     . ALA C 1 12  ? -10.421 -47.862 -57.033  1.00 24.52 ? 12  ALA C O     1 
ATOM   6641  C CB    . ALA C 1 12  ? -11.940 -46.771 -59.631  1.00 27.51 ? 12  ALA C CB    1 
ATOM   6642  N N     . ALA C 1 13  ? -10.554 -49.456 -58.624  1.00 24.73 ? 13  ALA C N     1 
ATOM   6643  C CA    . ALA C 1 13  ? -10.453 -50.578 -57.702  1.00 25.51 ? 13  ALA C CA    1 
ATOM   6644  C C     . ALA C 1 13  ? -9.023  -50.988 -57.256  1.00 26.66 ? 13  ALA C C     1 
ATOM   6645  O O     . ALA C 1 13  ? -8.898  -52.018 -56.582  1.00 28.80 ? 13  ALA C O     1 
ATOM   6646  C CB    . ALA C 1 13  ? -11.173 -51.790 -58.275  1.00 23.01 ? 13  ALA C CB    1 
ATOM   6647  N N     . ARG C 1 14  ? -7.963  -50.314 -57.663  1.00 24.15 ? 14  ARG C N     1 
ATOM   6648  C CA    . ARG C 1 14  ? -6.653  -50.630 -57.126  1.00 24.15 ? 14  ARG C CA    1 
ATOM   6649  C C     . ARG C 1 14  ? -6.548  -50.302 -55.660  1.00 25.81 ? 14  ARG C C     1 
ATOM   6650  O O     . ARG C 1 14  ? -6.958  -49.289 -55.218  1.00 27.03 ? 14  ARG C O     1 
ATOM   6651  C CB    . ARG C 1 14  ? -5.461  -50.055 -57.913  1.00 22.27 ? 14  ARG C CB    1 
ATOM   6652  C CG    . ARG C 1 14  ? -5.490  -50.088 -59.425  1.00 22.77 ? 14  ARG C CG    1 
ATOM   6653  C CD    . ARG C 1 14  ? -4.629  -51.168 -60.025  1.00 24.22 ? 14  ARG C CD    1 
ATOM   6654  N NE    . ARG C 1 14  ? -4.693  -51.274 -61.468  1.00 17.20 ? 14  ARG C NE    1 
ATOM   6655  C CZ    . ARG C 1 14  ? -4.474  -52.382 -62.145  1.00 16.79 ? 14  ARG C CZ    1 
ATOM   6656  N NH1   . ARG C 1 14  ? -4.176  -53.463 -61.527  1.00 20.75 ? 14  ARG C NH1   1 
ATOM   6657  N NH2   . ARG C 1 14  ? -4.528  -52.409 -63.433  1.00 10.30 ? 14  ARG C NH2   1 
ATOM   6658  N N     . ASN C 1 15  ? -5.976  -51.240 -54.924  1.00 27.10 ? 15  ASN C N     1 
ATOM   6659  C CA    . ASN C 1 15  ? -5.593  -51.019 -53.545  1.00 29.82 ? 15  ASN C CA    1 
ATOM   6660  C C     . ASN C 1 15  ? -4.091  -51.145 -53.351  1.00 33.12 ? 15  ASN C C     1 
ATOM   6661  O O     . ASN C 1 15  ? -3.447  -51.999 -53.928  1.00 30.89 ? 15  ASN C O     1 
ATOM   6662  C CB    . ASN C 1 15  ? -6.338  -51.989 -52.623  1.00 28.75 ? 15  ASN C CB    1 
ATOM   6663  C CG    . ASN C 1 15  ? -7.833  -51.744 -52.591  1.00 24.82 ? 15  ASN C CG    1 
ATOM   6664  O OD1   . ASN C 1 15  ? -8.285  -50.648 -52.310  1.00 23.91 ? 15  ASN C OD1   1 
ATOM   6665  N ND2   . ASN C 1 15  ? -8.597  -52.773 -52.851  1.00 13.81 ? 15  ASN C ND2   1 
ATOM   6666  N N     . PRO C 1 16  ? -3.537  -50.272 -52.529  1.00 37.89 ? 16  PRO C N     1 
ATOM   6667  C CA    . PRO C 1 16  ? -2.139  -50.368 -52.114  1.00 40.21 ? 16  PRO C CA    1 
ATOM   6668  C C     . PRO C 1 16  ? -1.659  -51.795 -51.985  1.00 43.33 ? 16  PRO C C     1 
ATOM   6669  O O     . PRO C 1 16  ? -2.319  -52.601 -51.355  1.00 45.01 ? 16  PRO C O     1 
ATOM   6670  C CB    . PRO C 1 16  ? -2.149  -49.702 -50.752  1.00 39.32 ? 16  PRO C CB    1 
ATOM   6671  C CG    . PRO C 1 16  ? -3.228  -48.733 -50.831  1.00 38.89 ? 16  PRO C CG    1 
ATOM   6672  C CD    . PRO C 1 16  ? -4.262  -49.244 -51.773  1.00 37.20 ? 16  PRO C CD    1 
ATOM   6673  N N     . SER C 1 17  ? -0.510  -52.100 -52.574  1.00 46.83 ? 17  SER C N     1 
ATOM   6674  C CA    . SER C 1 17  ? 0.116   -53.409 -52.412  1.00 50.94 ? 17  SER C CA    1 
ATOM   6675  C C     . SER C 1 17  ? 1.636   -53.327 -52.354  1.00 52.19 ? 17  SER C C     1 
ATOM   6676  O O     . SER C 1 17  ? 2.318   -53.753 -53.269  1.00 51.21 ? 17  SER C O     1 
ATOM   6677  C CB    . SER C 1 17  ? -0.316  -54.366 -53.521  1.00 50.10 ? 17  SER C CB    1 
ATOM   6678  O OG    . SER C 1 17  ? 0.062   -55.694 -53.221  1.00 47.76 ? 17  SER C OG    1 
ATOM   6679  N N     . PRO C 1 18  ? 2.152   -52.787 -51.261  1.00 54.25 ? 18  PRO C N     1 
ATOM   6680  C CA    . PRO C 1 18  ? 3.571   -52.438 -51.162  1.00 56.36 ? 18  PRO C CA    1 
ATOM   6681  C C     . PRO C 1 18  ? 4.387   -53.602 -50.630  1.00 58.15 ? 18  PRO C C     1 
ATOM   6682  O O     . PRO C 1 18  ? 3.813   -54.544 -50.103  1.00 58.58 ? 18  PRO C O     1 
ATOM   6683  C CB    . PRO C 1 18  ? 3.582   -51.286 -50.163  1.00 56.01 ? 18  PRO C CB    1 
ATOM   6684  C CG    . PRO C 1 18  ? 2.271   -51.323 -49.500  1.00 55.30 ? 18  PRO C CG    1 
ATOM   6685  C CD    . PRO C 1 18  ? 1.299   -51.901 -50.458  1.00 54.14 ? 18  PRO C CD    1 
ATOM   6686  N N     . ILE C 1 19  ? 5.704   -53.545 -50.771  1.00 60.45 ? 19  ILE C N     1 
ATOM   6687  C CA    . ILE C 1 19  ? 6.573   -54.541 -50.138  1.00 62.98 ? 19  ILE C CA    1 
ATOM   6688  C C     . ILE C 1 19  ? 6.618   -54.290 -48.629  1.00 64.80 ? 19  ILE C C     1 
ATOM   6689  O O     . ILE C 1 19  ? 6.570   -55.229 -47.830  1.00 65.46 ? 19  ILE C O     1 
ATOM   6690  C CB    . ILE C 1 19  ? 8.018   -54.525 -50.725  1.00 62.37 ? 19  ILE C CB    1 
ATOM   6691  C CG1   . ILE C 1 19  ? 8.004   -54.504 -52.259  1.00 62.70 ? 19  ILE C CG1   1 
ATOM   6692  C CG2   . ILE C 1 19  ? 8.822   -55.723 -50.229  1.00 61.40 ? 19  ILE C CG2   1 
ATOM   6693  C CD1   . ILE C 1 19  ? 8.157   -53.119 -52.870  1.00 55.56 ? 19  ILE C CD1   1 
ATOM   6694  N N     . ARG C 1 20  ? 6.703   -53.019 -48.256  1.00 67.47 ? 20  ARG C N     1 
ATOM   6695  C CA    . ARG C 1 20  ? 6.697   -52.601 -46.858  1.00 69.80 ? 20  ARG C CA    1 
ATOM   6696  C C     . ARG C 1 20  ? 5.263   -52.373 -46.378  1.00 72.53 ? 20  ARG C C     1 
ATOM   6697  O O     . ARG C 1 20  ? 4.589   -51.438 -46.820  1.00 72.93 ? 20  ARG C O     1 
ATOM   6698  C CB    . ARG C 1 20  ? 7.556   -51.340 -46.682  1.00 70.48 ? 20  ARG C CB    1 
ATOM   6699  C CG    . ARG C 1 20  ? 7.592   -50.771 -45.267  1.00 70.86 ? 20  ARG C CG    1 
ATOM   6700  C CD    . ARG C 1 20  ? 8.884   -50.004 -45.002  1.00 71.20 ? 20  ARG C CD    1 
ATOM   6701  N NE    . ARG C 1 20  ? 9.040   -48.839 -45.875  1.00 73.33 ? 20  ARG C NE    1 
ATOM   6702  C CZ    . ARG C 1 20  ? 10.114  -48.053 -45.903  1.00 71.92 ? 20  ARG C CZ    1 
ATOM   6703  N NH1   . ARG C 1 20  ? 11.149  -48.295 -45.107  1.00 66.69 ? 20  ARG C NH1   1 
ATOM   6704  N NH2   . ARG C 1 20  ? 10.155  -47.019 -46.734  1.00 70.51 ? 20  ARG C NH2   1 
ATOM   6705  N N     . THR C 1 21  ? 4.812   -53.235 -45.471  1.00 74.99 ? 21  THR C N     1 
ATOM   6706  C CA    . THR C 1 21  ? 3.459   -53.165 -44.940  1.00 76.65 ? 21  THR C CA    1 
ATOM   6707  C C     . THR C 1 21  ? 3.467   -52.934 -43.432  1.00 78.36 ? 21  THR C C     1 
ATOM   6708  O O     . THR C 1 21  ? 3.173   -51.834 -42.964  1.00 78.03 ? 21  THR C O     1 
ATOM   6709  C CB    . THR C 1 21  ? 2.681   -54.452 -45.275  1.00 76.35 ? 21  THR C CB    1 
ATOM   6710  O OG1   . THR C 1 21  ? 1.649   -54.657 -44.302  1.00 74.35 ? 21  THR C OG1   1 
ATOM   6711  C CG2   . THR C 1 21  ? 3.572   -55.672 -45.103  1.00 77.50 ? 21  THR C CG2   1 
ATOM   6712  N N     . MET C 1 22  ? 3.803   -53.974 -42.673  1.00 80.57 ? 22  MET C N     1 
ATOM   6713  C CA    . MET C 1 22  ? 3.886   -53.855 -41.215  1.00 82.62 ? 22  MET C CA    1 
ATOM   6714  C C     . MET C 1 22  ? 5.280   -53.426 -40.756  1.00 83.42 ? 22  MET C C     1 
ATOM   6715  O O     . MET C 1 22  ? 5.514   -53.206 -39.564  1.00 84.26 ? 22  MET C O     1 
ATOM   6716  C CB    . MET C 1 22  ? 3.457   -55.159 -40.534  1.00 82.72 ? 22  MET C CB    1 
ATOM   6717  C CG    . MET C 1 22  ? 2.017   -55.161 -40.023  1.00 85.57 ? 22  MET C CG    1 
ATOM   6718  S SD    . MET C 1 22  ? 0.772   -54.775 -41.274  1.00 93.63 ? 22  MET C SD    1 
ATOM   6719  C CE    . MET C 1 22  ? -0.728  -54.872 -40.299  1.00 87.27 ? 22  MET C CE    1 
ATOM   6720  N N     . THR C 1 23  ? 6.190   -53.308 -41.717  1.00 84.12 ? 23  THR C N     1 
ATOM   6721  C CA    . THR C 1 23  ? 7.524   -52.760 -41.472  1.00 84.23 ? 23  THR C CA    1 
ATOM   6722  C C     . THR C 1 23  ? 7.538   -51.240 -41.672  1.00 85.58 ? 23  THR C C     1 
ATOM   6723  O O     . THR C 1 23  ? 8.598   -50.609 -41.657  1.00 85.80 ? 23  THR C O     1 
ATOM   6724  C CB    . THR C 1 23  ? 8.593   -53.427 -42.372  1.00 84.21 ? 23  THR C CB    1 
ATOM   6725  O OG1   . THR C 1 23  ? 8.082   -53.576 -43.703  1.00 81.63 ? 23  THR C OG1   1 
ATOM   6726  C CG2   . THR C 1 23  ? 8.973   -54.794 -41.830  1.00 83.44 ? 23  THR C CG2   1 
ATOM   6727  N N     . ASP C 1 24  ? 6.348   -50.669 -41.856  1.00 85.74 ? 24  ASP C N     1 
ATOM   6728  C CA    . ASP C 1 24  ? 6.179   -49.226 -42.009  1.00 85.68 ? 24  ASP C CA    1 
ATOM   6729  C C     . ASP C 1 24  ? 6.377   -48.498 -40.679  1.00 85.99 ? 24  ASP C C     1 
ATOM   6730  O O     . ASP C 1 24  ? 6.869   -47.366 -40.649  1.00 85.63 ? 24  ASP C O     1 
ATOM   6731  C CB    . ASP C 1 24  ? 4.789   -48.920 -42.580  1.00 85.85 ? 24  ASP C CB    1 
ATOM   6732  C CG    . ASP C 1 24  ? 4.611   -47.456 -42.953  1.00 85.40 ? 24  ASP C CG    1 
ATOM   6733  O OD1   . ASP C 1 24  ? 3.552   -46.884 -42.617  1.00 84.35 ? 24  ASP C OD1   1 
ATOM   6734  O OD2   . ASP C 1 24  ? 5.523   -46.876 -43.582  1.00 83.51 ? 24  ASP C OD2   1 
ATOM   6735  N N     . ILE C 1 25  ? 5.996   -49.189 -39.608  1.00 86.67 ? 25  ILE C N     1 
ATOM   6736  C CA    . ILE C 1 25  ? 6.115   -48.703 -38.243  1.00 86.68 ? 25  ILE C CA    1 
ATOM   6737  C C     . ILE C 1 25  ? 7.314   -49.316 -37.551  1.00 86.21 ? 25  ILE C C     1 
ATOM   6738  O O     . ILE C 1 25  ? 7.372   -49.331 -36.332  1.00 85.30 ? 25  ILE C O     1 
ATOM   6739  C CB    . ILE C 1 25  ? 4.829   -49.026 -37.456  1.00 87.01 ? 25  ILE C CB    1 
ATOM   6740  C CG1   . ILE C 1 25  ? 4.614   -50.534 -37.358  1.00 86.90 ? 25  ILE C CG1   1 
ATOM   6741  C CG2   . ILE C 1 25  ? 3.628   -48.415 -38.143  1.00 86.64 ? 25  ILE C CG2   1 
ATOM   6742  C CD1   . ILE C 1 25  ? 3.164   -50.928 -37.214  1.00 86.34 ? 25  ILE C CD1   1 
ATOM   6743  N N     . LEU C 1 26  ? 8.244   -49.829 -38.357  1.00 86.72 ? 26  LEU C N     1 
ATOM   6744  C CA    . LEU C 1 26  ? 9.598   -50.223 -37.964  1.00 87.02 ? 26  LEU C CA    1 
ATOM   6745  C C     . LEU C 1 26  ? 10.608  -49.083 -38.122  1.00 87.93 ? 26  LEU C C     1 
ATOM   6746  O O     . LEU C 1 26  ? 11.493  -48.909 -37.280  1.00 88.53 ? 26  LEU C O     1 
ATOM   6747  C CB    . LEU C 1 26  ? 10.041  -51.452 -38.774  1.00 86.73 ? 26  LEU C CB    1 
ATOM   6748  C CG    . LEU C 1 26  ? 11.522  -51.844 -38.886  1.00 86.09 ? 26  LEU C CG    1 
ATOM   6749  C CD1   . LEU C 1 26  ? 12.054  -52.437 -37.588  1.00 84.66 ? 26  LEU C CD1   1 
ATOM   6750  C CD2   . LEU C 1 26  ? 11.729  -52.818 -40.035  1.00 86.16 ? 26  LEU C CD2   1 
ATOM   6751  N N     . SER C 1 27  ? 10.461  -48.312 -39.198  1.00 88.11 ? 27  SER C N     1 
ATOM   6752  C CA    . SER C 1 27  ? 11.425  -47.272 -39.570  1.00 87.63 ? 27  SER C CA    1 
ATOM   6753  C C     . SER C 1 27  ? 11.481  -46.089 -38.601  1.00 87.32 ? 27  SER C C     1 
ATOM   6754  O O     . SER C 1 27  ? 12.545  -45.497 -38.407  1.00 87.26 ? 27  SER C O     1 
ATOM   6755  C CB    . SER C 1 27  ? 11.144  -46.771 -40.991  1.00 87.91 ? 27  SER C CB    1 
ATOM   6756  O OG    . SER C 1 27  ? 12.141  -45.862 -41.423  1.00 87.18 ? 27  SER C OG    1 
ATOM   6757  N N     . ARG C 1 28  ? 10.341  -45.752 -37.997  1.00 86.82 ? 28  ARG C N     1 
ATOM   6758  C CA    . ARG C 1 28  ? 10.250  -44.570 -37.133  1.00 85.62 ? 28  ARG C CA    1 
ATOM   6759  C C     . ARG C 1 28  ? 9.559   -44.806 -35.782  1.00 85.64 ? 28  ARG C C     1 
ATOM   6760  O O     . ARG C 1 28  ? 8.966   -43.888 -35.211  1.00 85.77 ? 28  ARG C O     1 
ATOM   6761  C CB    . ARG C 1 28  ? 9.611   -43.387 -37.887  1.00 86.29 ? 28  ARG C CB    1 
ATOM   6762  C CG    . ARG C 1 28  ? 8.455   -43.745 -38.822  1.00 87.33 ? 28  ARG C CG    1 
ATOM   6763  C CD    . ARG C 1 28  ? 7.144   -43.943 -38.075  1.00 87.70 ? 28  ARG C CD    1 
ATOM   6764  N NE    . ARG C 1 28  ? 6.067   -44.365 -38.969  1.00 87.55 ? 28  ARG C NE    1 
ATOM   6765  C CZ    . ARG C 1 28  ? 4.827   -44.651 -38.579  1.00 90.66 ? 28  ARG C CZ    1 
ATOM   6766  N NH1   . ARG C 1 28  ? 4.483   -44.563 -37.298  1.00 90.99 ? 28  ARG C NH1   1 
ATOM   6767  N NH2   . ARG C 1 28  ? 3.924   -45.025 -39.476  1.00 88.97 ? 28  ARG C NH2   1 
ATOM   6768  N N     . GLY C 1 29  ? 9.649   -46.037 -35.279  1.00 84.28 ? 29  GLY C N     1 
ATOM   6769  C CA    . GLY C 1 29  ? 9.155   -46.370 -33.947  1.00 81.71 ? 29  GLY C CA    1 
ATOM   6770  C C     . GLY C 1 29  ? 10.305  -46.562 -32.979  1.00 80.47 ? 29  GLY C C     1 
ATOM   6771  O O     . GLY C 1 29  ? 11.277  -45.803 -33.024  1.00 80.37 ? 29  GLY C O     1 
ATOM   6772  N N     . PRO C 1 30  ? 10.202  -47.563 -32.081  1.00 78.30 ? 30  PRO C N     1 
ATOM   6773  C CA    . PRO C 1 30  ? 11.340  -47.955 -31.243  1.00 76.10 ? 30  PRO C CA    1 
ATOM   6774  C C     . PRO C 1 30  ? 12.496  -48.456 -32.108  1.00 74.51 ? 30  PRO C C     1 
ATOM   6775  O O     . PRO C 1 30  ? 12.291  -49.304 -32.987  1.00 75.28 ? 30  PRO C O     1 
ATOM   6776  C CB    . PRO C 1 30  ? 10.775  -49.097 -30.388  1.00 76.21 ? 30  PRO C CB    1 
ATOM   6777  C CG    . PRO C 1 30  ? 9.303   -48.907 -30.419  1.00 77.35 ? 30  PRO C CG    1 
ATOM   6778  C CD    . PRO C 1 30  ? 9.009   -48.365 -31.781  1.00 77.03 ? 30  PRO C CD    1 
ATOM   6779  N N     . LYS C 1 31  ? 13.701  -48.012 -31.794  1.00 71.60 ? 31  LYS C N     1 
ATOM   6780  C CA    . LYS C 1 31  ? 14.817  -48.271 -32.642  1.00 69.15 ? 31  LYS C CA    1 
ATOM   6781  C C     . LYS C 1 31  ? 15.632  -49.421 -32.222  1.00 65.16 ? 31  LYS C C     1 
ATOM   6782  O O     . LYS C 1 31  ? 16.738  -49.557 -32.679  1.00 63.76 ? 31  LYS C O     1 
ATOM   6783  C CB    . LYS C 1 31  ? 15.756  -47.106 -32.673  1.00 69.31 ? 31  LYS C CB    1 
ATOM   6784  C CG    . LYS C 1 31  ? 17.018  -47.396 -33.401  1.00 70.58 ? 31  LYS C CG    1 
ATOM   6785  C CD    . LYS C 1 31  ? 17.142  -46.548 -34.648  1.00 70.97 ? 31  LYS C CD    1 
ATOM   6786  C CE    . LYS C 1 31  ? 18.524  -46.670 -35.258  1.00 70.77 ? 31  LYS C CE    1 
ATOM   6787  N NZ    . LYS C 1 31  ? 18.520  -47.316 -36.598  1.00 70.73 ? 31  LYS C NZ    1 
ATOM   6788  N N     . SER C 1 32  ? 15.094  -50.219 -31.307  1.00 62.04 ? 32  SER C N     1 
ATOM   6789  C CA    . SER C 1 32  ? 15.522  -51.579 -30.972  1.00 57.11 ? 32  SER C CA    1 
ATOM   6790  C C     . SER C 1 32  ? 14.479  -52.631 -31.371  1.00 56.29 ? 32  SER C C     1 
ATOM   6791  O O     . SER C 1 32  ? 14.346  -53.671 -30.717  1.00 56.74 ? 32  SER C O     1 
ATOM   6792  C CB    . SER C 1 32  ? 15.852  -51.679 -29.477  1.00 56.36 ? 32  SER C CB    1 
ATOM   6793  O OG    . SER C 1 32  ? 14.723  -51.361 -28.681  1.00 50.05 ? 32  SER C OG    1 
ATOM   6794  N N     . MET C 1 33  ? 13.753  -52.355 -32.452  1.00 52.74 ? 33  MET C N     1 
ATOM   6795  C CA    . MET C 1 33  ? 12.712  -53.249 -32.952  1.00 50.63 ? 33  MET C CA    1 
ATOM   6796  C C     . MET C 1 33  ? 13.311  -54.413 -33.739  1.00 47.79 ? 33  MET C C     1 
ATOM   6797  O O     . MET C 1 33  ? 14.176  -54.217 -34.597  1.00 49.65 ? 33  MET C O     1 
ATOM   6798  C CB    . MET C 1 33  ? 11.724  -52.474 -33.833  1.00 50.85 ? 33  MET C CB    1 
ATOM   6799  C CG    . MET C 1 33  ? 10.491  -53.264 -34.262  1.00 53.38 ? 33  MET C CG    1 
ATOM   6800  S SD    . MET C 1 33  ? 9.090   -53.098 -33.140  1.00 60.92 ? 33  MET C SD    1 
ATOM   6801  C CE    . MET C 1 33  ? 8.418   -51.526 -33.669  1.00 54.90 ? 33  MET C CE    1 
ATOM   6802  N N     . ILE C 1 34  ? 12.844  -55.622 -33.434  1.00 43.09 ? 34  ILE C N     1 
ATOM   6803  C CA    . ILE C 1 34  ? 13.208  -56.817 -34.192  1.00 36.70 ? 34  ILE C CA    1 
ATOM   6804  C C     . ILE C 1 34  ? 11.993  -57.258 -35.008  1.00 36.62 ? 34  ILE C C     1 
ATOM   6805  O O     . ILE C 1 34  ? 11.059  -57.865 -34.477  1.00 37.53 ? 34  ILE C O     1 
ATOM   6806  C CB    . ILE C 1 34  ? 13.703  -57.964 -33.271  1.00 35.95 ? 34  ILE C CB    1 
ATOM   6807  C CG1   . ILE C 1 34  ? 14.816  -57.468 -32.339  1.00 32.28 ? 34  ILE C CG1   1 
ATOM   6808  C CG2   . ILE C 1 34  ? 14.181  -59.156 -34.106  1.00 33.67 ? 34  ILE C CG2   1 
ATOM   6809  C CD1   . ILE C 1 34  ? 15.028  -58.327 -31.100  1.00 26.38 ? 34  ILE C CD1   1 
ATOM   6810  N N     . SER C 1 35  ? 12.013  -56.935 -36.299  1.00 33.50 ? 35  SER C N     1 
ATOM   6811  C CA    . SER C 1 35  ? 10.873  -57.182 -37.180  1.00 29.72 ? 35  SER C CA    1 
ATOM   6812  C C     . SER C 1 35  ? 11.036  -58.450 -38.014  1.00 27.94 ? 35  SER C C     1 
ATOM   6813  O O     . SER C 1 35  ? 12.123  -58.739 -38.522  1.00 27.31 ? 35  SER C O     1 
ATOM   6814  C CB    . SER C 1 35  ? 10.634  -55.977 -38.093  1.00 29.92 ? 35  SER C CB    1 
ATOM   6815  O OG    . SER C 1 35  ? 9.430   -56.125 -38.825  1.00 25.46 ? 35  SER C OG    1 
ATOM   6816  N N     . LEU C 1 36  ? 9.950   -59.204 -38.152  1.00 25.57 ? 36  LEU C N     1 
ATOM   6817  C CA    . LEU C 1 36  ? 9.939   -60.381 -39.012  1.00 24.51 ? 36  LEU C CA    1 
ATOM   6818  C C     . LEU C 1 36  ? 8.808   -60.306 -40.033  1.00 24.77 ? 36  LEU C C     1 
ATOM   6819  O O     . LEU C 1 36  ? 8.504   -61.288 -40.710  1.00 24.93 ? 36  LEU C O     1 
ATOM   6820  C CB    . LEU C 1 36  ? 9.808   -61.655 -38.176  1.00 25.10 ? 36  LEU C CB    1 
ATOM   6821  C CG    . LEU C 1 36  ? 10.813  -61.823 -37.034  1.00 24.94 ? 36  LEU C CG    1 
ATOM   6822  C CD1   . LEU C 1 36  ? 10.312  -62.842 -36.022  1.00 24.94 ? 36  LEU C CD1   1 
ATOM   6823  C CD2   . LEU C 1 36  ? 12.177  -62.224 -37.574  1.00 22.94 ? 36  LEU C CD2   1 
ATOM   6824  N N     . ALA C 1 37  ? 8.190   -59.134 -40.140  1.00 27.17 ? 37  ALA C N     1 
ATOM   6825  C CA    . ALA C 1 37  ? 7.018   -58.960 -40.989  1.00 26.65 ? 37  ALA C CA    1 
ATOM   6826  C C     . ALA C 1 37  ? 7.411   -58.879 -42.461  1.00 27.10 ? 37  ALA C C     1 
ATOM   6827  O O     . ALA C 1 37  ? 6.657   -59.298 -43.338  1.00 27.96 ? 37  ALA C O     1 
ATOM   6828  C CB    . ALA C 1 37  ? 6.243   -57.719 -40.576  1.00 25.36 ? 37  ALA C CB    1 
ATOM   6829  N N     . GLY C 1 38  ? 8.594   -58.335 -42.723  1.00 26.28 ? 38  GLY C N     1 
ATOM   6830  C CA    . GLY C 1 38  ? 8.957   -57.905 -44.060  1.00 26.16 ? 38  GLY C CA    1 
ATOM   6831  C C     . GLY C 1 38  ? 9.093   -59.064 -45.026  1.00 25.89 ? 38  GLY C C     1 
ATOM   6832  O O     . GLY C 1 38  ? 9.223   -60.216 -44.612  1.00 26.90 ? 38  GLY C O     1 
ATOM   6833  N N     . GLY C 1 39  ? 9.062   -58.758 -46.319  1.00 25.07 ? 39  GLY C N     1 
ATOM   6834  C CA    . GLY C 1 39  ? 9.282   -59.773 -47.357  1.00 25.32 ? 39  GLY C CA    1 
ATOM   6835  C C     . GLY C 1 39  ? 10.603  -59.751 -48.144  1.00 25.02 ? 39  GLY C C     1 
ATOM   6836  O O     . GLY C 1 39  ? 10.780  -60.598 -49.030  1.00 25.69 ? 39  GLY C O     1 
ATOM   6837  N N     . LEU C 1 40  ? 11.554  -58.848 -47.814  1.00 24.63 ? 40  LEU C N     1 
ATOM   6838  C CA    . LEU C 1 40  ? 12.791  -58.694 -48.635  1.00 22.83 ? 40  LEU C CA    1 
ATOM   6839  C C     . LEU C 1 40  ? 13.547  -59.991 -48.564  1.00 22.53 ? 40  LEU C C     1 
ATOM   6840  O O     . LEU C 1 40  ? 13.619  -60.584 -47.490  1.00 23.34 ? 40  LEU C O     1 
ATOM   6841  C CB    . LEU C 1 40  ? 13.684  -57.574 -48.116  1.00 21.51 ? 40  LEU C CB    1 
ATOM   6842  C CG    . LEU C 1 40  ? 13.009  -56.283 -47.570  1.00 22.43 ? 40  LEU C CG    1 
ATOM   6843  C CD1   . LEU C 1 40  ? 14.047  -55.096 -47.028  1.00 7.18  ? 40  LEU C CD1   1 
ATOM   6844  C CD2   . LEU C 1 40  ? 11.986  -55.788 -48.578  1.00 11.43 ? 40  LEU C CD2   1 
ATOM   6845  N N     . PRO C 1 41  ? 14.132  -60.438 -49.680  1.00 21.65 ? 41  PRO C N     1 
ATOM   6846  C CA    . PRO C 1 41  ? 15.031  -61.550 -49.499  1.00 21.79 ? 41  PRO C CA    1 
ATOM   6847  C C     . PRO C 1 41  ? 16.334  -61.073 -48.749  1.00 22.22 ? 41  PRO C C     1 
ATOM   6848  O O     . PRO C 1 41  ? 16.615  -59.863 -48.664  1.00 21.82 ? 41  PRO C O     1 
ATOM   6849  C CB    . PRO C 1 41  ? 15.337  -61.996 -50.948  1.00 21.65 ? 41  PRO C CB    1 
ATOM   6850  C CG    . PRO C 1 41  ? 15.092  -60.845 -51.818  1.00 21.24 ? 41  PRO C CG    1 
ATOM   6851  C CD    . PRO C 1 41  ? 14.104  -59.958 -51.081  1.00 22.88 ? 41  PRO C CD    1 
ATOM   6852  N N     . ASN C 1 42  ? 17.111  -62.008 -48.209  1.00 21.31 ? 42  ASN C N     1 
ATOM   6853  C CA    . ASN C 1 42  ? 18.376  -61.639 -47.577  1.00 21.41 ? 42  ASN C CA    1 
ATOM   6854  C C     . ASN C 1 42  ? 19.382  -61.141 -48.652  1.00 20.17 ? 42  ASN C C     1 
ATOM   6855  O O     . ASN C 1 42  ? 19.783  -61.920 -49.531  1.00 18.42 ? 42  ASN C O     1 
ATOM   6856  C CB    . ASN C 1 42  ? 18.916  -62.843 -46.788  1.00 21.19 ? 42  ASN C CB    1 
ATOM   6857  C CG    . ASN C 1 42  ? 20.152  -62.510 -45.973  1.00 23.69 ? 42  ASN C CG    1 
ATOM   6858  O OD1   . ASN C 1 42  ? 21.183  -62.043 -46.508  1.00 28.21 ? 42  ASN C OD1   1 
ATOM   6859  N ND2   . ASN C 1 42  ? 20.085  -62.803 -44.679  1.00 22.16 ? 42  ASN C ND2   1 
ATOM   6860  N N     . PRO C 1 43  ? 19.787  -59.856 -48.582  1.00 19.82 ? 43  PRO C N     1 
ATOM   6861  C CA    . PRO C 1 43  ? 20.672  -59.319 -49.648  1.00 20.84 ? 43  PRO C CA    1 
ATOM   6862  C C     . PRO C 1 43  ? 22.144  -59.883 -49.654  1.00 20.97 ? 43  PRO C C     1 
ATOM   6863  O O     . PRO C 1 43  ? 22.792  -59.834 -50.676  1.00 19.57 ? 43  PRO C O     1 
ATOM   6864  C CB    . PRO C 1 43  ? 20.680  -57.829 -49.412  1.00 19.90 ? 43  PRO C CB    1 
ATOM   6865  C CG    . PRO C 1 43  ? 20.236  -57.610 -47.967  1.00 19.01 ? 43  PRO C CG    1 
ATOM   6866  C CD    . PRO C 1 43  ? 19.570  -58.896 -47.484  1.00 20.68 ? 43  PRO C CD    1 
ATOM   6867  N N     . ASN C 1 44  ? 22.641  -60.423 -48.538  1.00 21.78 ? 44  ASN C N     1 
ATOM   6868  C CA    . ASN C 1 44  ? 24.029  -60.968 -48.541  1.00 22.78 ? 44  ASN C CA    1 
ATOM   6869  C C     . ASN C 1 44  ? 24.176  -62.145 -49.465  1.00 23.14 ? 44  ASN C C     1 
ATOM   6870  O O     . ASN C 1 44  ? 25.296  -62.613 -49.626  1.00 25.37 ? 44  ASN C O     1 
ATOM   6871  C CB    . ASN C 1 44  ? 24.511  -61.435 -47.147  1.00 22.66 ? 44  ASN C CB    1 
ATOM   6872  C CG    . ASN C 1 44  ? 24.609  -60.331 -46.167  1.00 24.21 ? 44  ASN C CG    1 
ATOM   6873  O OD1   . ASN C 1 44  ? 24.469  -59.200 -46.518  1.00 28.64 ? 44  ASN C OD1   1 
ATOM   6874  N ND2   . ASN C 1 44  ? 24.858  -60.654 -44.903  1.00 33.01 ? 44  ASN C ND2   1 
ATOM   6875  N N     . MET C 1 45  ? 23.069  -62.647 -50.030  1.00 23.00 ? 45  MET C N     1 
ATOM   6876  C CA    . MET C 1 45  ? 23.086  -63.897 -50.824  1.00 23.53 ? 45  MET C CA    1 
ATOM   6877  C C     . MET C 1 45  ? 23.436  -63.651 -52.286  1.00 23.32 ? 45  MET C C     1 
ATOM   6878  O O     . MET C 1 45  ? 23.724  -64.594 -53.073  1.00 23.55 ? 45  MET C O     1 
ATOM   6879  C CB    . MET C 1 45  ? 21.786  -64.691 -50.721  1.00 22.72 ? 45  MET C CB    1 
ATOM   6880  C CG    . MET C 1 45  ? 21.564  -65.454 -49.398  1.00 28.13 ? 45  MET C CG    1 
ATOM   6881  S SD    . MET C 1 45  ? 22.688  -66.865 -49.137  1.00 33.10 ? 45  MET C SD    1 
ATOM   6882  C CE    . MET C 1 45  ? 23.879  -66.080 -48.066  1.00 32.28 ? 45  MET C CE    1 
ATOM   6883  N N     . PHE C 1 46  ? 23.409  -62.378 -52.624  1.00 21.90 ? 46  PHE C N     1 
ATOM   6884  C CA    . PHE C 1 46  ? 23.618  -61.909 -53.959  1.00 21.23 ? 46  PHE C CA    1 
ATOM   6885  C C     . PHE C 1 46  ? 25.149  -61.770 -54.242  1.00 23.47 ? 46  PHE C C     1 
ATOM   6886  O O     . PHE C 1 46  ? 25.933  -61.355 -53.344  1.00 25.33 ? 46  PHE C O     1 
ATOM   6887  C CB    . PHE C 1 46  ? 22.956  -60.571 -54.122  1.00 18.96 ? 46  PHE C CB    1 
ATOM   6888  C CG    . PHE C 1 46  ? 21.475  -60.556 -53.863  1.00 13.91 ? 46  PHE C CG    1 
ATOM   6889  C CD1   . PHE C 1 46  ? 20.645  -61.675 -54.132  1.00 10.60 ? 46  PHE C CD1   1 
ATOM   6890  C CD2   . PHE C 1 46  ? 20.899  -59.399 -53.424  1.00 10.28 ? 46  PHE C CD2   1 
ATOM   6891  C CE1   . PHE C 1 46  ? 19.223  -61.628 -53.930  1.00 9.42  ? 46  PHE C CE1   1 
ATOM   6892  C CE2   . PHE C 1 46  ? 19.431  -59.321 -53.230  1.00 12.90 ? 46  PHE C CE2   1 
ATOM   6893  C CZ    . PHE C 1 46  ? 18.637  -60.446 -53.482  1.00 12.07 ? 46  PHE C CZ    1 
ATOM   6894  N N     . PRO C 1 47  ? 25.550  -62.058 -55.489  1.00 22.79 ? 47  PRO C N     1 
ATOM   6895  C CA    . PRO C 1 47  ? 26.906  -62.317 -55.886  1.00 23.44 ? 47  PRO C CA    1 
ATOM   6896  C C     . PRO C 1 47  ? 27.701  -61.048 -56.132  1.00 23.45 ? 47  PRO C C     1 
ATOM   6897  O O     . PRO C 1 47  ? 28.896  -61.060 -55.926  1.00 24.20 ? 47  PRO C O     1 
ATOM   6898  C CB    . PRO C 1 47  ? 26.737  -63.122 -57.185  1.00 23.88 ? 47  PRO C CB    1 
ATOM   6899  C CG    . PRO C 1 47  ? 25.153  -63.220 -57.413  1.00 22.67 ? 47  PRO C CG    1 
ATOM   6900  C CD    . PRO C 1 47  ? 24.617  -62.130 -56.629  1.00 22.64 ? 47  PRO C CD    1 
ATOM   6901  N N     . PHE C 1 48  ? 27.037  -59.970 -56.528  1.00 22.47 ? 48  PHE C N     1 
ATOM   6902  C CA    . PHE C 1 48  ? 27.707  -58.723 -56.864  1.00 22.28 ? 48  PHE C CA    1 
ATOM   6903  C C     . PHE C 1 48  ? 27.973  -57.971 -55.588  1.00 22.69 ? 48  PHE C C     1 
ATOM   6904  O O     . PHE C 1 48  ? 27.094  -57.882 -54.739  1.00 23.44 ? 48  PHE C O     1 
ATOM   6905  C CB    . PHE C 1 48  ? 26.863  -57.876 -57.850  1.00 23.16 ? 48  PHE C CB    1 
ATOM   6906  C CG    . PHE C 1 48  ? 26.233  -58.679 -59.000  1.00 21.56 ? 48  PHE C CG    1 
ATOM   6907  C CD1   . PHE C 1 48  ? 26.997  -59.105 -60.070  1.00 18.29 ? 48  PHE C CD1   1 
ATOM   6908  C CD2   . PHE C 1 48  ? 24.874  -59.017 -58.974  1.00 25.97 ? 48  PHE C CD2   1 
ATOM   6909  C CE1   . PHE C 1 48  ? 26.441  -59.828 -61.116  1.00 22.41 ? 48  PHE C CE1   1 
ATOM   6910  C CE2   . PHE C 1 48  ? 24.260  -59.744 -60.050  1.00 23.02 ? 48  PHE C CE2   1 
ATOM   6911  C CZ    . PHE C 1 48  ? 25.063  -60.154 -61.112  1.00 25.03 ? 48  PHE C CZ    1 
ATOM   6912  N N     . LYS C 1 49  ? 29.187  -57.422 -55.442  1.00 22.19 ? 49  LYS C N     1 
ATOM   6913  C CA    . LYS C 1 49  ? 29.619  -56.891 -54.169  1.00 21.35 ? 49  LYS C CA    1 
ATOM   6914  C C     . LYS C 1 49  ? 29.955  -55.353 -54.216  1.00 21.05 ? 49  LYS C C     1 
ATOM   6915  O O     . LYS C 1 49  ? 29.693  -54.620 -53.216  1.00 17.58 ? 49  LYS C O     1 
ATOM   6916  C CB    . LYS C 1 49  ? 30.790  -57.743 -53.639  1.00 21.83 ? 49  LYS C CB    1 
ATOM   6917  C CG    . LYS C 1 49  ? 30.433  -59.207 -53.310  1.00 22.60 ? 49  LYS C CG    1 
ATOM   6918  C CD    . LYS C 1 49  ? 29.342  -59.291 -52.179  1.00 20.51 ? 49  LYS C CD    1 
ATOM   6919  C CE    . LYS C 1 49  ? 28.569  -60.613 -52.152  1.00 23.48 ? 49  LYS C CE    1 
ATOM   6920  N NZ    . LYS C 1 49  ? 27.612  -60.662 -50.892  1.00 26.72 ? 49  LYS C NZ    1 
ATOM   6921  N N     . THR C 1 50  ? 30.524  -54.893 -55.360  1.00 19.09 ? 50  THR C N     1 
ATOM   6922  C CA    . THR C 1 50  ? 30.962  -53.504 -55.503  1.00 18.53 ? 50  THR C CA    1 
ATOM   6923  C C     . THR C 1 50  ? 30.922  -53.141 -56.953  1.00 19.44 ? 50  THR C C     1 
ATOM   6924  O O     . THR C 1 50  ? 31.029  -53.994 -57.831  1.00 19.40 ? 50  THR C O     1 
ATOM   6925  C CB    . THR C 1 50  ? 32.505  -53.244 -54.986  1.00 21.55 ? 50  THR C CB    1 
ATOM   6926  O OG1   . THR C 1 50  ? 33.509  -53.763 -55.898  1.00 15.46 ? 50  THR C OG1   1 
ATOM   6927  C CG2   . THR C 1 50  ? 32.750  -53.726 -53.553  1.00 16.89 ? 50  THR C CG2   1 
ATOM   6928  N N     . ALA C 1 51  ? 30.757  -51.864 -57.238  1.00 20.12 ? 51  ALA C N     1 
ATOM   6929  C CA    . ALA C 1 51  ? 30.777  -51.414 -58.612  1.00 19.53 ? 51  ALA C CA    1 
ATOM   6930  C C     . ALA C 1 51  ? 31.550  -50.106 -58.667  1.00 20.63 ? 51  ALA C C     1 
ATOM   6931  O O     . ALA C 1 51  ? 31.417  -49.229 -57.753  1.00 19.53 ? 51  ALA C O     1 
ATOM   6932  C CB    . ALA C 1 51  ? 29.392  -51.185 -59.105  1.00 20.79 ? 51  ALA C CB    1 
ATOM   6933  N N     . VAL C 1 52  ? 32.318  -49.977 -59.740  1.00 19.67 ? 52  VAL C N     1 
ATOM   6934  C CA    . VAL C 1 52  ? 32.958  -48.723 -60.088  1.00 21.98 ? 52  VAL C CA    1 
ATOM   6935  C C     . VAL C 1 52  ? 32.452  -48.342 -61.455  1.00 22.07 ? 52  VAL C C     1 
ATOM   6936  O O     . VAL C 1 52  ? 32.533  -49.141 -62.369  1.00 24.00 ? 52  VAL C O     1 
ATOM   6937  C CB    . VAL C 1 52  ? 34.552  -48.880 -60.129  1.00 22.59 ? 52  VAL C CB    1 
ATOM   6938  C CG1   . VAL C 1 52  ? 35.237  -47.612 -60.575  1.00 22.17 ? 52  VAL C CG1   1 
ATOM   6939  C CG2   . VAL C 1 52  ? 35.067  -49.356 -58.759  1.00 22.27 ? 52  VAL C CG2   1 
ATOM   6940  N N     . ILE C 1 53  ? 31.945  -47.126 -61.623  1.00 21.62 ? 53  ILE C N     1 
ATOM   6941  C CA    . ILE C 1 53  ? 31.306  -46.724 -62.895  1.00 20.54 ? 53  ILE C CA    1 
ATOM   6942  C C     . ILE C 1 53  ? 31.910  -45.390 -63.185  1.00 20.99 ? 53  ILE C C     1 
ATOM   6943  O O     . ILE C 1 53  ? 31.894  -44.478 -62.323  1.00 20.11 ? 53  ILE C O     1 
ATOM   6944  C CB    . ILE C 1 53  ? 29.706  -46.664 -62.751  1.00 21.17 ? 53  ILE C CB    1 
ATOM   6945  C CG1   . ILE C 1 53  ? 29.155  -48.046 -62.393  1.00 17.24 ? 53  ILE C CG1   1 
ATOM   6946  C CG2   . ILE C 1 53  ? 28.978  -46.149 -64.064  1.00 21.24 ? 53  ILE C CG2   1 
ATOM   6947  C CD1   . ILE C 1 53  ? 27.700  -48.046 -61.703  1.00 20.68 ? 53  ILE C CD1   1 
ATOM   6948  N N     . THR C 1 54  ? 32.556  -45.291 -64.345  1.00 22.37 ? 54  THR C N     1 
ATOM   6949  C CA    . THR C 1 54  ? 33.242  -44.077 -64.703  1.00 23.05 ? 54  THR C CA    1 
ATOM   6950  C C     . THR C 1 54  ? 32.306  -43.195 -65.467  1.00 24.28 ? 54  THR C C     1 
ATOM   6951  O O     . THR C 1 54  ? 31.682  -43.612 -66.466  1.00 22.81 ? 54  THR C O     1 
ATOM   6952  C CB    . THR C 1 54  ? 34.576  -44.286 -65.518  1.00 24.01 ? 54  THR C CB    1 
ATOM   6953  O OG1   . THR C 1 54  ? 34.338  -44.911 -66.793  1.00 25.31 ? 54  THR C OG1   1 
ATOM   6954  C CG2   . THR C 1 54  ? 35.687  -45.053 -64.679  1.00 25.87 ? 54  THR C CG2   1 
ATOM   6955  N N     . VAL C 1 55  ? 32.238  -41.954 -64.997  1.00 26.22 ? 55  VAL C N     1 
ATOM   6956  C CA    . VAL C 1 55  ? 31.532  -40.895 -65.678  1.00 28.15 ? 55  VAL C CA    1 
ATOM   6957  C C     . VAL C 1 55  ? 32.476  -39.912 -66.370  1.00 30.76 ? 55  VAL C C     1 
ATOM   6958  O O     . VAL C 1 55  ? 33.528  -39.509 -65.794  1.00 31.48 ? 55  VAL C O     1 
ATOM   6959  C CB    . VAL C 1 55  ? 30.611  -40.166 -64.722  1.00 27.50 ? 55  VAL C CB    1 
ATOM   6960  C CG1   . VAL C 1 55  ? 29.863  -39.097 -65.448  1.00 25.71 ? 55  VAL C CG1   1 
ATOM   6961  C CG2   . VAL C 1 55  ? 29.613  -41.157 -64.076  1.00 28.17 ? 55  VAL C CG2   1 
ATOM   6962  N N     . GLU C 1 56  ? 32.105  -39.553 -67.609  1.00 32.66 ? 56  GLU C N     1 
ATOM   6963  C CA    . GLU C 1 56  ? 32.699  -38.426 -68.348  1.00 35.47 ? 56  GLU C CA    1 
ATOM   6964  C C     . GLU C 1 56  ? 32.103  -37.095 -67.876  1.00 36.12 ? 56  GLU C C     1 
ATOM   6965  O O     . GLU C 1 56  ? 30.897  -36.928 -67.928  1.00 38.58 ? 56  GLU C O     1 
ATOM   6966  C CB    . GLU C 1 56  ? 32.479  -38.617 -69.866  1.00 35.08 ? 56  GLU C CB    1 
ATOM   6967  C CG    . GLU C 1 56  ? 33.222  -37.609 -70.774  1.00 35.41 ? 56  GLU C CG    1 
ATOM   6968  C CD    . GLU C 1 56  ? 33.149  -37.940 -72.277  1.00 37.57 ? 56  GLU C CD    1 
ATOM   6969  O OE1   . GLU C 1 56  ? 33.385  -39.128 -72.685  1.00 41.48 ? 56  GLU C OE1   1 
ATOM   6970  O OE2   . GLU C 1 56  ? 32.873  -37.006 -73.061  1.00 37.03 ? 56  GLU C OE2   1 
ATOM   6971  N N     . ASN C 1 57  ? 32.928  -36.147 -67.437  1.00 37.53 ? 57  ASN C N     1 
ATOM   6972  C CA    . ASN C 1 57  ? 32.469  -34.860 -66.838  1.00 38.25 ? 57  ASN C CA    1 
ATOM   6973  C C     . ASN C 1 57  ? 31.932  -34.962 -65.386  1.00 38.25 ? 57  ASN C C     1 
ATOM   6974  O O     . ASN C 1 57  ? 31.269  -34.041 -64.913  1.00 37.36 ? 57  ASN C O     1 
ATOM   6975  C CB    . ASN C 1 57  ? 31.388  -34.169 -67.700  1.00 38.93 ? 57  ASN C CB    1 
ATOM   6976  C CG    . ASN C 1 57  ? 31.953  -33.448 -68.970  1.00 41.14 ? 57  ASN C CG    1 
ATOM   6977  O OD1   . ASN C 1 57  ? 31.940  -34.005 -70.079  1.00 39.59 ? 57  ASN C OD1   1 
ATOM   6978  N ND2   . ASN C 1 57  ? 32.366  -32.189 -68.809  1.00 41.63 ? 57  ASN C ND2   1 
ATOM   6979  N N     . GLY C 1 58  ? 32.204  -36.064 -64.690  1.00 38.15 ? 58  GLY C N     1 
ATOM   6980  C CA    . GLY C 1 58  ? 31.666  -36.263 -63.344  1.00 38.99 ? 58  GLY C CA    1 
ATOM   6981  C C     . GLY C 1 58  ? 32.591  -37.078 -62.453  1.00 39.52 ? 58  GLY C C     1 
ATOM   6982  O O     . GLY C 1 58  ? 33.566  -37.666 -62.938  1.00 39.76 ? 58  GLY C O     1 
ATOM   6983  N N     . LYS C 1 59  ? 32.298  -37.100 -61.153  1.00 39.68 ? 59  LYS C N     1 
ATOM   6984  C CA    . LYS C 1 59  ? 32.972  -38.010 -60.224  1.00 39.64 ? 59  LYS C CA    1 
ATOM   6985  C C     . LYS C 1 59  ? 32.595  -39.434 -60.597  1.00 39.03 ? 59  LYS C C     1 
ATOM   6986  O O     . LYS C 1 59  ? 31.444  -39.718 -60.995  1.00 38.85 ? 59  LYS C O     1 
ATOM   6987  C CB    . LYS C 1 59  ? 32.504  -37.789 -58.774  1.00 40.59 ? 59  LYS C CB    1 
ATOM   6988  C CG    . LYS C 1 59  ? 32.968  -36.526 -58.070  1.00 43.33 ? 59  LYS C CG    1 
ATOM   6989  C CD    . LYS C 1 59  ? 34.294  -36.716 -57.322  1.00 47.68 ? 59  LYS C CD    1 
ATOM   6990  C CE    . LYS C 1 59  ? 34.942  -35.341 -57.007  1.00 49.30 ? 59  LYS C CE    1 
ATOM   6991  N NZ    . LYS C 1 59  ? 35.046  -34.503 -58.264  1.00 51.55 ? 59  LYS C NZ    1 
ATOM   6992  N N     . THR C 1 60  ? 33.573  -40.317 -60.452  1.00 37.86 ? 60  THR C N     1 
ATOM   6993  C CA    . THR C 1 60  ? 33.405  -41.751 -60.618  1.00 36.64 ? 60  THR C CA    1 
ATOM   6994  C C     . THR C 1 60  ? 32.339  -42.242 -59.668  1.00 35.82 ? 60  THR C C     1 
ATOM   6995  O O     . THR C 1 60  ? 32.380  -41.960 -58.473  1.00 35.42 ? 60  THR C O     1 
ATOM   6996  C CB    . THR C 1 60  ? 34.708  -42.424 -60.254  1.00 35.84 ? 60  THR C CB    1 
ATOM   6997  O OG1   . THR C 1 60  ? 35.687  -41.841 -61.083  1.00 37.73 ? 60  THR C OG1   1 
ATOM   6998  C CG2   . THR C 1 60  ? 34.691  -43.929 -60.486  1.00 35.00 ? 60  THR C CG2   1 
ATOM   6999  N N     . ILE C 1 61  ? 31.380  -42.981 -60.198  1.00 34.52 ? 61  ILE C N     1 
ATOM   7000  C CA    . ILE C 1 61  ? 30.330  -43.493 -59.326  1.00 33.16 ? 61  ILE C CA    1 
ATOM   7001  C C     . ILE C 1 61  ? 30.781  -44.786 -58.606  1.00 32.10 ? 61  ILE C C     1 
ATOM   7002  O O     . ILE C 1 61  ? 31.256  -45.712 -59.229  1.00 31.78 ? 61  ILE C O     1 
ATOM   7003  C CB    . ILE C 1 61  ? 29.025  -43.610 -60.081  1.00 32.01 ? 61  ILE C CB    1 
ATOM   7004  C CG1   . ILE C 1 61  ? 28.545  -42.183 -60.396  1.00 30.78 ? 61  ILE C CG1   1 
ATOM   7005  C CG2   . ILE C 1 61  ? 28.011  -44.477 -59.264  1.00 32.81 ? 61  ILE C CG2   1 
ATOM   7006  C CD1   . ILE C 1 61  ? 27.237  -42.053 -61.170  1.00 24.68 ? 61  ILE C CD1   1 
ATOM   7007  N N     . GLN C 1 62  ? 30.669  -44.856 -57.294  1.00 31.18 ? 62  GLN C N     1 
ATOM   7008  C CA    . GLN C 1 62  ? 31.115  -46.110 -56.669  1.00 30.41 ? 62  GLN C CA    1 
ATOM   7009  C C     . GLN C 1 62  ? 30.108  -46.659 -55.727  1.00 29.57 ? 62  GLN C C     1 
ATOM   7010  O O     . GLN C 1 62  ? 29.515  -45.940 -54.967  1.00 28.77 ? 62  GLN C O     1 
ATOM   7011  C CB    . GLN C 1 62  ? 32.427  -45.949 -55.900  1.00 30.06 ? 62  GLN C CB    1 
ATOM   7012  C CG    . GLN C 1 62  ? 33.594  -45.567 -56.747  1.00 32.07 ? 62  GLN C CG    1 
ATOM   7013  C CD    . GLN C 1 62  ? 34.940  -45.784 -56.049  1.00 38.05 ? 62  GLN C CD    1 
ATOM   7014  O OE1   . GLN C 1 62  ? 35.015  -46.235 -54.887  1.00 38.65 ? 62  GLN C OE1   1 
ATOM   7015  N NE2   . GLN C 1 62  ? 36.013  -45.493 -56.769  1.00 38.03 ? 62  GLN C NE2   1 
ATOM   7016  N N     . PHE C 1 63  ? 29.977  -47.976 -55.734  1.00 29.44 ? 63  PHE C N     1 
ATOM   7017  C CA    . PHE C 1 63  ? 29.126  -48.642 -54.812  1.00 28.67 ? 63  PHE C CA    1 
ATOM   7018  C C     . PHE C 1 63  ? 29.933  -49.495 -53.860  1.00 29.03 ? 63  PHE C C     1 
ATOM   7019  O O     . PHE C 1 63  ? 30.467  -50.490 -54.291  1.00 29.40 ? 63  PHE C O     1 
ATOM   7020  C CB    . PHE C 1 63  ? 28.207  -49.535 -55.613  1.00 29.01 ? 63  PHE C CB    1 
ATOM   7021  C CG    . PHE C 1 63  ? 27.127  -48.816 -56.330  1.00 26.06 ? 63  PHE C CG    1 
ATOM   7022  C CD1   . PHE C 1 63  ? 27.189  -47.459 -56.553  1.00 26.86 ? 63  PHE C CD1   1 
ATOM   7023  C CD2   . PHE C 1 63  ? 26.058  -49.507 -56.818  1.00 24.30 ? 63  PHE C CD2   1 
ATOM   7024  C CE1   . PHE C 1 63  ? 26.150  -46.774 -57.227  1.00 25.69 ? 63  PHE C CE1   1 
ATOM   7025  C CE2   . PHE C 1 63  ? 25.044  -48.837 -57.513  1.00 25.47 ? 63  PHE C CE2   1 
ATOM   7026  C CZ    . PHE C 1 63  ? 25.102  -47.470 -57.701  1.00 24.87 ? 63  PHE C CZ    1 
ATOM   7027  N N     . GLY C 1 64  ? 30.030  -49.127 -52.564  1.00 29.93 ? 64  GLY C N     1 
ATOM   7028  C CA    . GLY C 1 64  ? 30.702  -49.977 -51.568  1.00 29.33 ? 64  GLY C CA    1 
ATOM   7029  C C     . GLY C 1 64  ? 29.780  -51.134 -51.232  1.00 30.51 ? 64  GLY C C     1 
ATOM   7030  O O     . GLY C 1 64  ? 28.658  -51.209 -51.756  1.00 31.49 ? 64  GLY C O     1 
ATOM   7031  N N     . GLU C 1 65  ? 30.204  -52.032 -50.353  1.00 30.45 ? 65  GLU C N     1 
ATOM   7032  C CA    . GLU C 1 65  ? 29.361  -53.179 -50.022  1.00 32.22 ? 65  GLU C CA    1 
ATOM   7033  C C     . GLU C 1 65  ? 27.920  -52.829 -49.572  1.00 31.49 ? 65  GLU C C     1 
ATOM   7034  O O     . GLU C 1 65  ? 26.970  -53.488 -49.973  1.00 28.70 ? 65  GLU C O     1 
ATOM   7035  C CB    . GLU C 1 65  ? 30.028  -54.119 -49.031  1.00 32.21 ? 65  GLU C CB    1 
ATOM   7036  C CG    . GLU C 1 65  ? 31.237  -53.517 -48.332  1.00 40.78 ? 65  GLU C CG    1 
ATOM   7037  C CD    . GLU C 1 65  ? 32.418  -53.241 -49.279  1.00 47.46 ? 65  GLU C CD    1 
ATOM   7038  O OE1   . GLU C 1 65  ? 32.736  -52.051 -49.556  1.00 49.88 ? 65  GLU C OE1   1 
ATOM   7039  O OE2   . GLU C 1 65  ? 33.010  -54.232 -49.771  1.00 53.12 ? 65  GLU C OE2   1 
ATOM   7040  N N     . GLU C 1 66  ? 27.781  -51.802 -48.743  1.00 31.95 ? 66  GLU C N     1 
ATOM   7041  C CA    . GLU C 1 66  ? 26.507  -51.545 -48.131  1.00 32.08 ? 66  GLU C CA    1 
ATOM   7042  C C     . GLU C 1 66  ? 25.568  -50.945 -49.183  1.00 33.00 ? 66  GLU C C     1 
ATOM   7043  O O     . GLU C 1 66  ? 24.440  -51.430 -49.355  1.00 32.44 ? 66  GLU C O     1 
ATOM   7044  C CB    . GLU C 1 66  ? 26.619  -50.684 -46.886  1.00 31.53 ? 66  GLU C CB    1 
ATOM   7045  C CG    . GLU C 1 66  ? 27.098  -51.403 -45.637  1.00 35.24 ? 66  GLU C CG    1 
ATOM   7046  C CD    . GLU C 1 66  ? 26.472  -52.782 -45.410  1.00 38.23 ? 66  GLU C CD    1 
ATOM   7047  O OE1   . GLU C 1 66  ? 25.220  -52.896 -45.256  1.00 41.10 ? 66  GLU C OE1   1 
ATOM   7048  O OE2   . GLU C 1 66  ? 27.257  -53.759 -45.377  1.00 37.45 ? 66  GLU C OE2   1 
ATOM   7049  N N     . MET C 1 67  ? 26.074  -49.946 -49.909  1.00 32.87 ? 67  MET C N     1 
ATOM   7050  C CA    . MET C 1 67  ? 25.402  -49.332 -51.042  1.00 33.19 ? 67  MET C CA    1 
ATOM   7051  C C     . MET C 1 67  ? 25.010  -50.356 -52.117  1.00 33.19 ? 67  MET C C     1 
ATOM   7052  O O     . MET C 1 67  ? 23.876  -50.338 -52.633  1.00 33.49 ? 67  MET C O     1 
ATOM   7053  C CB    . MET C 1 67  ? 26.312  -48.224 -51.580  1.00 32.64 ? 67  MET C CB    1 
ATOM   7054  C CG    . MET C 1 67  ? 25.793  -47.327 -52.687  1.00 36.09 ? 67  MET C CG    1 
ATOM   7055  S SD    . MET C 1 67  ? 24.117  -46.665 -52.693  1.00 42.55 ? 67  MET C SD    1 
ATOM   7056  C CE    . MET C 1 67  ? 24.182  -45.513 -51.303  1.00 43.22 ? 67  MET C CE    1 
ATOM   7057  N N     . MET C 1 68  ? 25.947  -51.240 -52.458  1.00 32.97 ? 68  MET C N     1 
ATOM   7058  C CA    . MET C 1 68  ? 25.702  -52.325 -53.417  1.00 32.19 ? 68  MET C CA    1 
ATOM   7059  C C     . MET C 1 68  ? 24.572  -53.241 -52.970  1.00 31.14 ? 68  MET C C     1 
ATOM   7060  O O     . MET C 1 68  ? 23.806  -53.756 -53.809  1.00 32.40 ? 68  MET C O     1 
ATOM   7061  C CB    . MET C 1 68  ? 26.985  -53.124 -53.693  1.00 32.23 ? 68  MET C CB    1 
ATOM   7062  C CG    . MET C 1 68  ? 26.852  -54.312 -54.679  1.00 33.45 ? 68  MET C CG    1 
ATOM   7063  S SD    . MET C 1 68  ? 26.425  -53.926 -56.410  1.00 36.04 ? 68  MET C SD    1 
ATOM   7064  C CE    . MET C 1 68  ? 27.512  -52.529 -56.592  1.00 34.43 ? 68  MET C CE    1 
ATOM   7065  N N     . LYS C 1 69  ? 24.423  -53.393 -51.661  1.00 28.79 ? 69  LYS C N     1 
ATOM   7066  C CA    . LYS C 1 69  ? 23.356  -54.203 -51.118  1.00 26.97 ? 69  LYS C CA    1 
ATOM   7067  C C     . LYS C 1 69  ? 21.978  -53.519 -51.265  1.00 25.12 ? 69  LYS C C     1 
ATOM   7068  O O     . LYS C 1 69  ? 20.954  -54.173 -51.438  1.00 22.93 ? 69  LYS C O     1 
ATOM   7069  C CB    . LYS C 1 69  ? 23.635  -54.533 -49.657  1.00 26.17 ? 69  LYS C CB    1 
ATOM   7070  C CG    . LYS C 1 69  ? 24.607  -55.686 -49.411  1.00 26.85 ? 69  LYS C CG    1 
ATOM   7071  C CD    . LYS C 1 69  ? 24.602  -55.994 -47.878  1.00 28.76 ? 69  LYS C CD    1 
ATOM   7072  C CE    . LYS C 1 69  ? 25.884  -56.670 -47.431  1.00 34.52 ? 69  LYS C CE    1 
ATOM   7073  N NZ    . LYS C 1 69  ? 26.196  -56.315 -46.028  1.00 37.43 ? 69  LYS C NZ    1 
ATOM   7074  N N     . ARG C 1 70  ? 21.968  -52.207 -51.125  1.00 24.78 ? 70  ARG C N     1 
ATOM   7075  C CA    . ARG C 1 70  ? 20.791  -51.458 -51.317  1.00 24.64 ? 70  ARG C CA    1 
ATOM   7076  C C     . ARG C 1 70  ? 20.455  -51.506 -52.802  1.00 25.61 ? 70  ARG C C     1 
ATOM   7077  O O     . ARG C 1 70  ? 19.290  -51.738 -53.153  1.00 26.03 ? 70  ARG C O     1 
ATOM   7078  C CB    . ARG C 1 70  ? 20.984  -50.056 -50.844  1.00 24.48 ? 70  ARG C CB    1 
ATOM   7079  C CG    . ARG C 1 70  ? 19.858  -49.108 -51.347  1.00 23.32 ? 70  ARG C CG    1 
ATOM   7080  C CD    . ARG C 1 70  ? 19.903  -47.831 -50.621  1.00 19.97 ? 70  ARG C CD    1 
ATOM   7081  N NE    . ARG C 1 70  ? 18.809  -46.932 -50.979  1.00 27.17 ? 70  ARG C NE    1 
ATOM   7082  C CZ    . ARG C 1 70  ? 18.917  -45.596 -51.021  1.00 29.18 ? 70  ARG C CZ    1 
ATOM   7083  N NH1   . ARG C 1 70  ? 20.086  -44.969 -50.760  1.00 27.07 ? 70  ARG C NH1   1 
ATOM   7084  N NH2   . ARG C 1 70  ? 17.854  -44.881 -51.342  1.00 27.99 ? 70  ARG C NH2   1 
ATOM   7085  N N     . ALA C 1 71  ? 21.480  -51.402 -53.664  1.00 25.11 ? 71  ALA C N     1 
ATOM   7086  C CA    . ALA C 1 71  ? 21.250  -51.355 -55.125  1.00 25.31 ? 71  ALA C CA    1 
ATOM   7087  C C     . ALA C 1 71  ? 20.615  -52.620 -55.696  1.00 24.96 ? 71  ALA C C     1 
ATOM   7088  O O     . ALA C 1 71  ? 20.053  -52.577 -56.802  1.00 26.16 ? 71  ALA C O     1 
ATOM   7089  C CB    . ALA C 1 71  ? 22.584  -51.052 -55.917  1.00 25.66 ? 71  ALA C CB    1 
ATOM   7090  N N     . LEU C 1 72  ? 20.741  -53.725 -54.957  1.00 23.57 ? 72  LEU C N     1 
ATOM   7091  C CA    . LEU C 1 72  ? 20.401  -55.090 -55.395  1.00 21.73 ? 72  LEU C CA    1 
ATOM   7092  C C     . LEU C 1 72  ? 19.123  -55.595 -54.669  1.00 21.84 ? 72  LEU C C     1 
ATOM   7093  O O     . LEU C 1 72  ? 18.637  -56.741 -54.965  1.00 19.30 ? 72  LEU C O     1 
ATOM   7094  C CB    . LEU C 1 72  ? 21.581  -56.062 -55.092  1.00 20.69 ? 72  LEU C CB    1 
ATOM   7095  C CG    . LEU C 1 72  ? 22.889  -56.029 -55.916  1.00 21.02 ? 72  LEU C CG    1 
ATOM   7096  C CD1   . LEU C 1 72  ? 23.918  -57.126 -55.496  1.00 19.17 ? 72  LEU C CD1   1 
ATOM   7097  C CD2   . LEU C 1 72  ? 22.702  -55.900 -57.525  1.00 16.01 ? 72  LEU C CD2   1 
ATOM   7098  N N     . GLN C 1 73  ? 18.612  -54.739 -53.726  1.00 20.36 ? 73  GLN C N     1 
ATOM   7099  C CA    . GLN C 1 73  ? 17.428  -55.053 -52.918  1.00 19.65 ? 73  GLN C CA    1 
ATOM   7100  C C     . GLN C 1 73  ? 16.125  -54.398 -53.474  1.00 20.12 ? 73  GLN C C     1 
ATOM   7101  O O     . GLN C 1 73  ? 16.178  -53.362 -54.175  1.00 19.52 ? 73  GLN C O     1 
ATOM   7102  C CB    . GLN C 1 73  ? 17.629  -54.606 -51.467  1.00 18.05 ? 73  GLN C CB    1 
ATOM   7103  C CG    . GLN C 1 73  ? 16.531  -55.093 -50.451  1.00 18.90 ? 73  GLN C CG    1 
ATOM   7104  C CD    . GLN C 1 73  ? 16.154  -56.596 -50.573  1.00 19.06 ? 73  GLN C CD    1 
ATOM   7105  O OE1   . GLN C 1 73  ? 15.469  -57.046 -51.518  1.00 19.73 ? 73  GLN C OE1   1 
ATOM   7106  N NE2   . GLN C 1 73  ? 16.632  -57.361 -49.658  1.00 17.98 ? 73  GLN C NE2   1 
ATOM   7107  N N     . TYR C 1 74  ? 14.977  -54.959 -53.113  1.00 18.68 ? 74  TYR C N     1 
ATOM   7108  C CA    . TYR C 1 74  ? 13.716  -54.299 -53.382  1.00 19.19 ? 74  TYR C CA    1 
ATOM   7109  C C     . TYR C 1 74  ? 13.887  -52.872 -52.836  1.00 20.68 ? 74  TYR C C     1 
ATOM   7110  O O     . TYR C 1 74  ? 14.558  -52.673 -51.739  1.00 19.78 ? 74  TYR C O     1 
ATOM   7111  C CB    . TYR C 1 74  ? 12.572  -55.009 -52.647  1.00 19.31 ? 74  TYR C CB    1 
ATOM   7112  C CG    . TYR C 1 74  ? 12.114  -56.291 -53.299  1.00 16.50 ? 74  TYR C CG    1 
ATOM   7113  C CD1   . TYR C 1 74  ? 11.572  -56.259 -54.598  1.00 19.18 ? 74  TYR C CD1   1 
ATOM   7114  C CD2   . TYR C 1 74  ? 12.217  -57.500 -52.654  1.00 14.06 ? 74  TYR C CD2   1 
ATOM   7115  C CE1   . TYR C 1 74  ? 11.152  -57.396 -55.284  1.00 15.07 ? 74  TYR C CE1   1 
ATOM   7116  C CE2   . TYR C 1 74  ? 11.777  -58.723 -53.324  1.00 19.17 ? 74  TYR C CE2   1 
ATOM   7117  C CZ    . TYR C 1 74  ? 11.218  -58.624 -54.650  1.00 20.79 ? 74  TYR C CZ    1 
ATOM   7118  O OH    . TYR C 1 74  ? 10.750  -59.724 -55.374  1.00 19.85 ? 74  TYR C OH    1 
ATOM   7119  N N     . SER C 1 75  ? 13.349  -51.902 -53.600  1.00 19.21 ? 75  SER C N     1 
ATOM   7120  C CA    . SER C 1 75  ? 13.178  -50.515 -53.123  1.00 20.01 ? 75  SER C CA    1 
ATOM   7121  C C     . SER C 1 75  ? 11.699  -49.943 -53.353  1.00 19.71 ? 75  SER C C     1 
ATOM   7122  O O     . SER C 1 75  ? 10.797  -50.682 -53.818  1.00 19.78 ? 75  SER C O     1 
ATOM   7123  C CB    . SER C 1 75  ? 14.317  -49.586 -53.663  1.00 19.32 ? 75  SER C CB    1 
ATOM   7124  O OG    . SER C 1 75  ? 14.202  -49.387 -55.073  1.00 20.03 ? 75  SER C OG    1 
ATOM   7125  N N     . PRO C 1 76  ? 11.452  -48.667 -53.001  1.00 19.75 ? 76  PRO C N     1 
ATOM   7126  C CA    . PRO C 1 76  ? 10.065  -48.204 -52.943  1.00 20.89 ? 76  PRO C CA    1 
ATOM   7127  C C     . PRO C 1 76  ? 9.420   -48.126 -54.323  1.00 23.31 ? 76  PRO C C     1 
ATOM   7128  O O     . PRO C 1 76  ? 10.128  -47.983 -55.345  1.00 25.28 ? 76  PRO C O     1 
ATOM   7129  C CB    . PRO C 1 76  ? 10.179  -46.830 -52.291  1.00 20.96 ? 76  PRO C CB    1 
ATOM   7130  C CG    . PRO C 1 76  ? 11.654  -46.797 -51.633  1.00 20.49 ? 76  PRO C CG    1 
ATOM   7131  C CD    . PRO C 1 76  ? 12.415  -47.611 -52.602  1.00 20.31 ? 76  PRO C CD    1 
ATOM   7132  N N     . SER C 1 77  ? 8.089   -48.259 -54.344  1.00 24.82 ? 77  SER C N     1 
ATOM   7133  C CA    . SER C 1 77  ? 7.276   -48.346 -55.551  1.00 25.80 ? 77  SER C CA    1 
ATOM   7134  C C     . SER C 1 77  ? 7.477   -47.187 -56.511  1.00 25.76 ? 77  SER C C     1 
ATOM   7135  O O     . SER C 1 77  ? 7.564   -47.406 -57.711  1.00 26.19 ? 77  SER C O     1 
ATOM   7136  C CB    . SER C 1 77  ? 5.779   -48.429 -55.190  1.00 27.28 ? 77  SER C CB    1 
ATOM   7137  O OG    . SER C 1 77  ? 5.515   -49.481 -54.243  1.00 30.51 ? 77  SER C OG    1 
ATOM   7138  N N     . ALA C 1 78  ? 7.545   -45.951 -56.006  1.00 25.46 ? 78  ALA C N     1 
ATOM   7139  C CA    . ALA C 1 78  ? 7.525   -44.781 -56.932  1.00 24.28 ? 78  ALA C CA    1 
ATOM   7140  C C     . ALA C 1 78  ? 8.870   -44.151 -57.203  1.00 22.89 ? 78  ALA C C     1 
ATOM   7141  O O     . ALA C 1 78  ? 8.940   -43.132 -57.872  1.00 23.58 ? 78  ALA C O     1 
ATOM   7142  C CB    . ALA C 1 78  ? 6.512   -43.740 -56.487  1.00 23.05 ? 78  ALA C CB    1 
ATOM   7143  N N     . GLY C 1 79  ? 9.923   -44.743 -56.673  1.00 22.04 ? 79  GLY C N     1 
ATOM   7144  C CA    . GLY C 1 79  ? 11.313  -44.377 -56.992  1.00 21.84 ? 79  GLY C CA    1 
ATOM   7145  C C     . GLY C 1 79  ? 12.024  -44.254 -55.674  1.00 21.77 ? 79  GLY C C     1 
ATOM   7146  O O     . GLY C 1 79  ? 11.391  -44.068 -54.680  1.00 23.26 ? 79  GLY C O     1 
ATOM   7147  N N     . ILE C 1 80  ? 13.334  -44.364 -55.628  1.00 21.79 ? 80  ILE C N     1 
ATOM   7148  C CA    . ILE C 1 80  ? 14.061  -43.999 -54.422  1.00 21.01 ? 80  ILE C CA    1 
ATOM   7149  C C     . ILE C 1 80  ? 13.918  -42.516 -53.963  1.00 22.05 ? 80  ILE C C     1 
ATOM   7150  O O     . ILE C 1 80  ? 13.762  -41.628 -54.809  1.00 23.21 ? 80  ILE C O     1 
ATOM   7151  C CB    . ILE C 1 80  ? 15.469  -44.375 -54.584  1.00 19.53 ? 80  ILE C CB    1 
ATOM   7152  C CG1   . ILE C 1 80  ? 16.162  -43.616 -55.691  1.00 15.90 ? 80  ILE C CG1   1 
ATOM   7153  C CG2   . ILE C 1 80  ? 15.541  -45.889 -54.838  1.00 21.97 ? 80  ILE C CG2   1 
ATOM   7154  C CD1   . ILE C 1 80  ? 17.729  -44.040 -55.773  1.00 11.46 ? 80  ILE C CD1   1 
ATOM   7155  N N     . PRO C 1 81  ? 13.973  -42.230 -52.639  1.00 22.27 ? 81  PRO C N     1 
ATOM   7156  C CA    . PRO C 1 81  ? 13.752  -40.843 -52.152  1.00 22.68 ? 81  PRO C CA    1 
ATOM   7157  C C     . PRO C 1 81  ? 14.703  -39.797 -52.711  1.00 23.82 ? 81  PRO C C     1 
ATOM   7158  O O     . PRO C 1 81  ? 14.287  -38.701 -52.995  1.00 25.40 ? 81  PRO C O     1 
ATOM   7159  C CB    . PRO C 1 81  ? 13.968  -40.956 -50.621  1.00 22.51 ? 81  PRO C CB    1 
ATOM   7160  C CG    . PRO C 1 81  ? 13.717  -42.343 -50.327  1.00 22.44 ? 81  PRO C CG    1 
ATOM   7161  C CD    . PRO C 1 81  ? 14.269  -43.125 -51.511  1.00 22.47 ? 81  PRO C CD    1 
ATOM   7162  N N     . GLU C 1 82  ? 15.963  -40.136 -52.898  1.00 24.13 ? 82  GLU C N     1 
ATOM   7163  C CA    . GLU C 1 82  ? 16.910  -39.201 -53.422  1.00 25.24 ? 82  GLU C CA    1 
ATOM   7164  C C     . GLU C 1 82  ? 16.541  -38.724 -54.841  1.00 27.23 ? 82  GLU C C     1 
ATOM   7165  O O     . GLU C 1 82  ? 16.634  -37.502 -55.170  1.00 28.36 ? 82  GLU C O     1 
ATOM   7166  C CB    . GLU C 1 82  ? 18.291  -39.872 -53.496  1.00 26.15 ? 82  GLU C CB    1 
ATOM   7167  C CG    . GLU C 1 82  ? 18.885  -40.268 -52.177  1.00 26.30 ? 82  GLU C CG    1 
ATOM   7168  C CD    . GLU C 1 82  ? 18.834  -41.762 -51.876  1.00 29.56 ? 82  GLU C CD    1 
ATOM   7169  O OE1   . GLU C 1 82  ? 17.760  -42.378 -52.074  1.00 25.13 ? 82  GLU C OE1   1 
ATOM   7170  O OE2   . GLU C 1 82  ? 19.880  -42.301 -51.364  1.00 32.78 ? 82  GLU C OE2   1 
ATOM   7171  N N     . LEU C 1 83  ? 16.204  -39.679 -55.710  1.00 26.24 ? 83  LEU C N     1 
ATOM   7172  C CA    . LEU C 1 83  ? 16.025  -39.369 -57.119  1.00 25.88 ? 83  LEU C CA    1 
ATOM   7173  C C     . LEU C 1 83  ? 14.684  -38.697 -57.197  1.00 27.08 ? 83  LEU C C     1 
ATOM   7174  O O     . LEU C 1 83  ? 14.386  -37.952 -58.126  1.00 27.63 ? 83  LEU C O     1 
ATOM   7175  C CB    . LEU C 1 83  ? 16.037  -40.665 -57.952  1.00 25.74 ? 83  LEU C CB    1 
ATOM   7176  C CG    . LEU C 1 83  ? 15.543  -40.721 -59.408  1.00 25.35 ? 83  LEU C CG    1 
ATOM   7177  C CD1   . LEU C 1 83  ? 16.272  -39.716 -60.352  1.00 26.85 ? 83  LEU C CD1   1 
ATOM   7178  C CD2   . LEU C 1 83  ? 15.650  -42.092 -59.927  1.00 24.14 ? 83  LEU C CD2   1 
ATOM   7179  N N     . LEU C 1 84  ? 13.862  -38.944 -56.195  1.00 27.81 ? 84  LEU C N     1 
ATOM   7180  C CA    . LEU C 1 84  ? 12.480  -38.535 -56.305  1.00 28.70 ? 84  LEU C CA    1 
ATOM   7181  C C     . LEU C 1 84  ? 12.409  -37.061 -55.882  1.00 29.31 ? 84  LEU C C     1 
ATOM   7182  O O     . LEU C 1 84  ? 11.611  -36.301 -56.425  1.00 29.48 ? 84  LEU C O     1 
ATOM   7183  C CB    . LEU C 1 84  ? 11.649  -39.440 -55.427  1.00 28.24 ? 84  LEU C CB    1 
ATOM   7184  C CG    . LEU C 1 84  ? 10.161  -39.626 -55.526  1.00 31.73 ? 84  LEU C CG    1 
ATOM   7185  C CD1   . LEU C 1 84  ? 9.641   -40.172 -56.928  1.00 31.12 ? 84  LEU C CD1   1 
ATOM   7186  C CD2   . LEU C 1 84  ? 9.835   -40.597 -54.376  1.00 33.49 ? 84  LEU C CD2   1 
ATOM   7187  N N     . SER C 1 85  ? 13.255  -36.645 -54.925  1.00 28.86 ? 85  SER C N     1 
ATOM   7188  C CA    . SER C 1 85  ? 13.262  -35.252 -54.555  1.00 28.53 ? 85  SER C CA    1 
ATOM   7189  C C     . SER C 1 85  ? 13.962  -34.446 -55.589  1.00 28.59 ? 85  SER C C     1 
ATOM   7190  O O     . SER C 1 85  ? 13.574  -33.313 -55.845  1.00 28.95 ? 85  SER C O     1 
ATOM   7191  C CB    . SER C 1 85  ? 13.923  -34.990 -53.204  1.00 29.30 ? 85  SER C CB    1 
ATOM   7192  O OG    . SER C 1 85  ? 14.433  -36.167 -52.646  1.00 29.21 ? 85  SER C OG    1 
ATOM   7193  N N     . TRP C 1 86  ? 14.989  -35.029 -56.180  1.00 28.27 ? 86  TRP C N     1 
ATOM   7194  C CA    . TRP C 1 86  ? 15.827  -34.304 -57.105  1.00 29.08 ? 86  TRP C CA    1 
ATOM   7195  C C     . TRP C 1 86  ? 15.065  -34.167 -58.427  1.00 29.73 ? 86  TRP C C     1 
ATOM   7196  O O     . TRP C 1 86  ? 15.059  -33.096 -59.044  1.00 29.56 ? 86  TRP C O     1 
ATOM   7197  C CB    . TRP C 1 86  ? 17.182  -35.020 -57.253  1.00 29.35 ? 86  TRP C CB    1 
ATOM   7198  C CG    . TRP C 1 86  ? 18.284  -34.235 -57.816  1.00 29.32 ? 86  TRP C CG    1 
ATOM   7199  C CD1   . TRP C 1 86  ? 19.363  -33.776 -57.145  1.00 31.78 ? 86  TRP C CD1   1 
ATOM   7200  C CD2   . TRP C 1 86  ? 18.469  -33.846 -59.201  1.00 28.28 ? 86  TRP C CD2   1 
ATOM   7201  N NE1   . TRP C 1 86  ? 20.225  -33.118 -58.016  1.00 32.32 ? 86  TRP C NE1   1 
ATOM   7202  C CE2   . TRP C 1 86  ? 19.700  -33.154 -59.280  1.00 28.71 ? 86  TRP C CE2   1 
ATOM   7203  C CE3   . TRP C 1 86  ? 17.709  -34.009 -60.368  1.00 30.06 ? 86  TRP C CE3   1 
ATOM   7204  C CZ2   . TRP C 1 86  ? 20.202  -32.612 -60.490  1.00 30.65 ? 86  TRP C CZ2   1 
ATOM   7205  C CZ3   . TRP C 1 86  ? 18.202  -33.465 -61.590  1.00 31.81 ? 86  TRP C CZ3   1 
ATOM   7206  C CH2   . TRP C 1 86  ? 19.448  -32.772 -61.626  1.00 31.57 ? 86  TRP C CH2   1 
ATOM   7207  N N     . LEU C 1 87  ? 14.366  -35.220 -58.826  1.00 30.07 ? 87  LEU C N     1 
ATOM   7208  C CA    . LEU C 1 87  ? 13.338  -35.063 -59.880  1.00 30.99 ? 87  LEU C CA    1 
ATOM   7209  C C     . LEU C 1 87  ? 12.166  -34.093 -59.530  1.00 31.10 ? 87  LEU C C     1 
ATOM   7210  O O     . LEU C 1 87  ? 11.766  -33.291 -60.354  1.00 30.17 ? 87  LEU C O     1 
ATOM   7211  C CB    . LEU C 1 87  ? 12.794  -36.423 -60.310  1.00 31.11 ? 87  LEU C CB    1 
ATOM   7212  C CG    . LEU C 1 87  ? 13.858  -37.288 -60.950  1.00 29.98 ? 87  LEU C CG    1 
ATOM   7213  C CD1   . LEU C 1 87  ? 13.272  -38.625 -61.245  1.00 27.78 ? 87  LEU C CD1   1 
ATOM   7214  C CD2   . LEU C 1 87  ? 14.415  -36.614 -62.217  1.00 27.66 ? 87  LEU C CD2   1 
ATOM   7215  N N     . LYS C 1 88  ? 11.619  -34.137 -58.323  1.00 30.83 ? 88  LYS C N     1 
ATOM   7216  C CA    . LYS C 1 88  ? 10.588  -33.102 -57.998  1.00 31.02 ? 88  LYS C CA    1 
ATOM   7217  C C     . LYS C 1 88  ? 11.194  -31.687 -57.921  1.00 30.69 ? 88  LYS C C     1 
ATOM   7218  O O     . LYS C 1 88  ? 10.617  -30.743 -58.394  1.00 31.22 ? 88  LYS C O     1 
ATOM   7219  C CB    . LYS C 1 88  ? 9.823   -33.432 -56.731  1.00 30.23 ? 88  LYS C CB    1 
ATOM   7220  C CG    . LYS C 1 88  ? 8.927   -34.674 -56.824  1.00 31.25 ? 88  LYS C CG    1 
ATOM   7221  C CD    . LYS C 1 88  ? 8.512   -35.070 -55.417  1.00 28.23 ? 88  LYS C CD    1 
ATOM   7222  C CE    . LYS C 1 88  ? 7.477   -36.125 -55.439  1.00 32.43 ? 88  LYS C CE    1 
ATOM   7223  N NZ    . LYS C 1 88  ? 7.013   -36.475 -54.058  1.00 36.42 ? 88  LYS C NZ    1 
ATOM   7224  N N     . GLN C 1 89  ? 12.397  -31.550 -57.377  1.00 30.50 ? 89  GLN C N     1 
ATOM   7225  C CA    . GLN C 1 89  ? 13.027  -30.263 -57.359  1.00 30.14 ? 89  GLN C CA    1 
ATOM   7226  C C     . GLN C 1 89  ? 13.313  -29.726 -58.771  1.00 29.99 ? 89  GLN C C     1 
ATOM   7227  O O     . GLN C 1 89  ? 13.431  -28.523 -58.952  1.00 30.63 ? 89  GLN C O     1 
ATOM   7228  C CB    . GLN C 1 89  ? 14.303  -30.276 -56.479  1.00 30.56 ? 89  GLN C CB    1 
ATOM   7229  C CG    . GLN C 1 89  ? 14.767  -28.852 -56.063  1.00 32.00 ? 89  GLN C CG    1 
ATOM   7230  C CD    . GLN C 1 89  ? 13.565  -27.865 -55.935  1.00 33.77 ? 89  GLN C CD    1 
ATOM   7231  O OE1   . GLN C 1 89  ? 13.478  -26.850 -56.675  1.00 31.37 ? 89  GLN C OE1   1 
ATOM   7232  N NE2   . GLN C 1 89  ? 12.627  -28.184 -55.009  1.00 32.00 ? 89  GLN C NE2   1 
ATOM   7233  N N     . LEU C 1 90  ? 13.475  -30.599 -59.756  1.00 28.93 ? 90  LEU C N     1 
ATOM   7234  C CA    . LEU C 1 90  ? 13.835  -30.135 -61.057  1.00 28.37 ? 90  LEU C CA    1 
ATOM   7235  C C     . LEU C 1 90  ? 12.579  -29.648 -61.778  1.00 28.92 ? 90  LEU C C     1 
ATOM   7236  O O     . LEU C 1 90  ? 12.577  -28.616 -62.428  1.00 28.28 ? 90  LEU C O     1 
ATOM   7237  C CB    . LEU C 1 90  ? 14.617  -31.211 -61.821  1.00 29.25 ? 90  LEU C CB    1 
ATOM   7238  C CG    . LEU C 1 90  ? 14.869  -31.121 -63.352  1.00 26.43 ? 90  LEU C CG    1 
ATOM   7239  C CD1   . LEU C 1 90  ? 16.191  -30.496 -63.644  1.00 24.26 ? 90  LEU C CD1   1 
ATOM   7240  C CD2   . LEU C 1 90  ? 14.786  -32.516 -63.935  1.00 23.85 ? 90  LEU C CD2   1 
ATOM   7241  N N     . GLN C 1 91  ? 11.483  -30.352 -61.567  1.00 28.77 ? 91  GLN C N     1 
ATOM   7242  C CA    . GLN C 1 91  ? 10.216  -29.930 -62.063  1.00 28.11 ? 91  GLN C CA    1 
ATOM   7243  C C     . GLN C 1 91  ? 9.796   -28.524 -61.552  1.00 29.84 ? 91  GLN C C     1 
ATOM   7244  O O     . GLN C 1 91  ? 9.247   -27.697 -62.333  1.00 29.93 ? 91  GLN C O     1 
ATOM   7245  C CB    . GLN C 1 91  ? 9.183   -30.981 -61.710  1.00 27.32 ? 91  GLN C CB    1 
ATOM   7246  C CG    . GLN C 1 91  ? 9.326   -32.385 -62.357  1.00 24.84 ? 91  GLN C CG    1 
ATOM   7247  C CD    . GLN C 1 91  ? 9.318   -32.468 -63.907  1.00 25.64 ? 91  GLN C CD    1 
ATOM   7248  O OE1   . GLN C 1 91  ? 8.595   -33.300 -64.457  1.00 28.04 ? 91  GLN C OE1   1 
ATOM   7249  N NE2   . GLN C 1 91  ? 10.161  -31.681 -64.595  1.00 21.97 ? 91  GLN C NE2   1 
ATOM   7250  N N     . ILE C 1 92  ? 10.046  -28.261 -60.267  1.00 30.03 ? 92  ILE C N     1 
ATOM   7251  C CA    . ILE C 1 92  ? 9.860   -26.937 -59.666  1.00 30.46 ? 92  ILE C CA    1 
ATOM   7252  C C     . ILE C 1 92  ? 10.798  -25.855 -60.216  1.00 32.23 ? 92  ILE C C     1 
ATOM   7253  O O     . ILE C 1 92  ? 10.325  -24.733 -60.507  1.00 33.18 ? 92  ILE C O     1 
ATOM   7254  C CB    . ILE C 1 92  ? 9.954   -26.991 -58.108  1.00 30.69 ? 92  ILE C CB    1 
ATOM   7255  C CG1   . ILE C 1 92  ? 8.641   -27.516 -57.516  1.00 28.54 ? 92  ILE C CG1   1 
ATOM   7256  C CG2   . ILE C 1 92  ? 10.281  -25.619 -57.515  1.00 28.65 ? 92  ILE C CG2   1 
ATOM   7257  C CD1   . ILE C 1 92  ? 8.817   -28.392 -56.291  1.00 31.09 ? 92  ILE C CD1   1 
ATOM   7258  N N     . LYS C 1 93  ? 12.072  -26.159 -60.401  1.00 31.97 ? 93  LYS C N     1 
ATOM   7259  C CA    . LYS C 1 93  ? 12.966  -25.178 -60.983  1.00 34.24 ? 93  LYS C CA    1 
ATOM   7260  C C     . LYS C 1 93  ? 12.652  -24.880 -62.439  1.00 34.89 ? 93  LYS C C     1 
ATOM   7261  O O     . LYS C 1 93  ? 12.663  -23.736 -62.863  1.00 35.61 ? 93  LYS C O     1 
ATOM   7262  C CB    . LYS C 1 93  ? 14.430  -25.555 -60.807  1.00 34.75 ? 93  LYS C CB    1 
ATOM   7263  C CG    . LYS C 1 93  ? 15.038  -25.084 -59.496  1.00 35.97 ? 93  LYS C CG    1 
ATOM   7264  C CD    . LYS C 1 93  ? 15.628  -23.701 -59.593  1.00 36.83 ? 93  LYS C CD    1 
ATOM   7265  C CE    . LYS C 1 93  ? 16.072  -23.193 -58.235  1.00 40.57 ? 93  LYS C CE    1 
ATOM   7266  N NZ    . LYS C 1 93  ? 17.428  -23.664 -57.807  1.00 42.58 ? 93  LYS C NZ    1 
ATOM   7267  N N     . LEU C 1 94  ? 12.347  -25.929 -63.189  1.00 34.71 ? 94  LEU C N     1 
ATOM   7268  C CA    . LEU C 1 94  ? 12.338  -25.919 -64.634  1.00 33.93 ? 94  LEU C CA    1 
ATOM   7269  C C     . LEU C 1 94  ? 10.979  -25.425 -65.088  1.00 34.80 ? 94  LEU C C     1 
ATOM   7270  O O     . LEU C 1 94  ? 10.801  -24.957 -66.201  1.00 34.93 ? 94  LEU C O     1 
ATOM   7271  C CB    . LEU C 1 94  ? 12.512  -27.347 -65.126  1.00 33.51 ? 94  LEU C CB    1 
ATOM   7272  C CG    . LEU C 1 94  ? 13.566  -27.703 -66.155  1.00 33.21 ? 94  LEU C CG    1 
ATOM   7273  C CD1   . LEU C 1 94  ? 14.817  -26.955 -65.922  1.00 33.24 ? 94  LEU C CD1   1 
ATOM   7274  C CD2   . LEU C 1 94  ? 13.825  -29.175 -66.134  1.00 31.55 ? 94  LEU C CD2   1 
ATOM   7275  N N     . HIS C 1 95  ? 10.009  -25.547 -64.207  1.00 34.33 ? 95  HIS C N     1 
ATOM   7276  C CA    . HIS C 1 95  ? 8.619   -25.585 -64.643  1.00 34.39 ? 95  HIS C CA    1 
ATOM   7277  C C     . HIS C 1 95  ? 7.717   -24.815 -63.684  1.00 34.37 ? 95  HIS C C     1 
ATOM   7278  O O     . HIS C 1 95  ? 6.704   -24.247 -64.091  1.00 36.10 ? 95  HIS C O     1 
ATOM   7279  C CB    . HIS C 1 95  ? 8.136   -27.032 -64.770  1.00 33.95 ? 95  HIS C CB    1 
ATOM   7280  C CG    . HIS C 1 95  ? 8.600   -27.716 -66.018  1.00 33.47 ? 95  HIS C CG    1 
ATOM   7281  N ND1   . HIS C 1 95  ? 8.820   -29.075 -66.084  1.00 27.55 ? 95  HIS C ND1   1 
ATOM   7282  C CD2   . HIS C 1 95  ? 8.885   -27.229 -67.249  1.00 28.50 ? 95  HIS C CD2   1 
ATOM   7283  C CE1   . HIS C 1 95  ? 9.221   -29.395 -67.301  1.00 28.67 ? 95  HIS C CE1   1 
ATOM   7284  N NE2   . HIS C 1 95  ? 9.268   -28.293 -68.028  1.00 30.13 ? 95  HIS C NE2   1 
ATOM   7285  N N     . ASN C 1 96  ? 8.094   -24.799 -62.408  1.00 34.34 ? 96  ASN C N     1 
ATOM   7286  C CA    . ASN C 1 96  ? 7.244   -24.236 -61.360  1.00 34.65 ? 96  ASN C CA    1 
ATOM   7287  C C     . ASN C 1 96  ? 5.743   -24.487 -61.452  1.00 34.92 ? 96  ASN C C     1 
ATOM   7288  O O     . ASN C 1 96  ? 4.942   -23.571 -61.276  1.00 34.09 ? 96  ASN C O     1 
ATOM   7289  C CB    . ASN C 1 96  ? 7.512   -22.737 -61.203  1.00 35.20 ? 96  ASN C CB    1 
ATOM   7290  C CG    . ASN C 1 96  ? 6.803   -22.143 -60.002  1.00 36.97 ? 96  ASN C CG    1 
ATOM   7291  O OD1   . ASN C 1 96  ? 6.761   -22.746 -58.930  1.00 42.36 ? 96  ASN C OD1   1 
ATOM   7292  N ND2   . ASN C 1 96  ? 6.241   -20.953 -60.176  1.00 35.75 ? 96  ASN C ND2   1 
ATOM   7293  N N     . PRO C 1 97  ? 5.372   -25.734 -61.726  1.00 35.35 ? 97  PRO C N     1 
ATOM   7294  C CA    . PRO C 1 97  ? 3.966   -26.113 -61.829  1.00 35.56 ? 97  PRO C CA    1 
ATOM   7295  C C     . PRO C 1 97  ? 3.032   -25.428 -60.836  1.00 35.69 ? 97  PRO C C     1 
ATOM   7296  O O     . PRO C 1 97  ? 3.250   -25.507 -59.627  1.00 35.61 ? 97  PRO C O     1 
ATOM   7297  C CB    . PRO C 1 97  ? 3.964   -27.624 -61.593  1.00 34.92 ? 97  PRO C CB    1 
ATOM   7298  C CG    . PRO C 1 97  ? 5.340   -28.053 -61.934  1.00 34.85 ? 97  PRO C CG    1 
ATOM   7299  C CD    . PRO C 1 97  ? 6.237   -26.924 -61.511  1.00 33.76 ? 97  PRO C CD    1 
ATOM   7300  N N     . PRO C 1 98  ? 2.002   -24.762 -61.348  1.00 36.40 ? 98  PRO C N     1 
ATOM   7301  C CA    . PRO C 1 98  ? 1.087   -23.977 -60.499  1.00 37.38 ? 98  PRO C CA    1 
ATOM   7302  C C     . PRO C 1 98  ? 0.478   -24.778 -59.359  1.00 37.38 ? 98  PRO C C     1 
ATOM   7303  O O     . PRO C 1 98  ? -0.028  -24.173 -58.399  1.00 39.95 ? 98  PRO C O     1 
ATOM   7304  C CB    . PRO C 1 98  ? -0.025  -23.548 -61.488  1.00 37.95 ? 98  PRO C CB    1 
ATOM   7305  C CG    . PRO C 1 98  ? 0.690   -23.555 -62.854  1.00 37.54 ? 98  PRO C CG    1 
ATOM   7306  C CD    . PRO C 1 98  ? 1.551   -24.772 -62.765  1.00 36.30 ? 98  PRO C CD    1 
ATOM   7307  N N     . THR C 1 99  ? 0.558   -26.108 -59.438  1.00 35.88 ? 99  THR C N     1 
ATOM   7308  C CA    . THR C 1 99  ? -0.155  -26.981 -58.527  1.00 34.85 ? 99  THR C CA    1 
ATOM   7309  C C     . THR C 1 99  ? 0.645   -27.485 -57.329  1.00 34.68 ? 99  THR C C     1 
ATOM   7310  O O     . THR C 1 99  ? 0.130   -28.266 -56.525  1.00 33.77 ? 99  THR C O     1 
ATOM   7311  C CB    . THR C 1 99  ? -0.619  -28.233 -59.253  1.00 35.58 ? 99  THR C CB    1 
ATOM   7312  O OG1   . THR C 1 99  ? 0.504   -28.802 -59.941  1.00 33.76 ? 99  THR C OG1   1 
ATOM   7313  C CG2   . THR C 1 99  ? -1.829  -27.954 -60.237  1.00 33.84 ? 99  THR C CG2   1 
ATOM   7314  N N     . ILE C 1 100 ? 1.898   -27.069 -57.209  1.00 33.47 ? 100 ILE C N     1 
ATOM   7315  C CA    . ILE C 1 100 ? 2.772   -27.617 -56.182  1.00 33.18 ? 100 ILE C CA    1 
ATOM   7316  C C     . ILE C 1 100 ? 2.222   -27.684 -54.727  1.00 33.01 ? 100 ILE C C     1 
ATOM   7317  O O     . ILE C 1 100 ? 2.366   -28.705 -54.063  1.00 31.19 ? 100 ILE C O     1 
ATOM   7318  C CB    . ILE C 1 100 ? 4.228   -26.988 -56.216  1.00 33.07 ? 100 ILE C CB    1 
ATOM   7319  C CG1   . ILE C 1 100 ? 4.175   -25.458 -56.118  1.00 34.37 ? 100 ILE C CG1   1 
ATOM   7320  C CG2   . ILE C 1 100 ? 4.985   -27.497 -57.443  1.00 32.24 ? 100 ILE C CG2   1 
ATOM   7321  C CD1   . ILE C 1 100 ? 5.548   -24.698 -56.171  1.00 33.73 ? 100 ILE C CD1   1 
ATOM   7322  N N     . HIS C 1 101 ? 1.608   -26.597 -54.252  1.00 33.69 ? 101 HIS C N     1 
ATOM   7323  C CA    . HIS C 1 101 ? 1.214   -26.491 -52.859  1.00 33.70 ? 101 HIS C CA    1 
ATOM   7324  C C     . HIS C 1 101 ? -0.292  -26.627 -52.714  1.00 34.65 ? 101 HIS C C     1 
ATOM   7325  O O     . HIS C 1 101 ? -0.826  -26.429 -51.629  1.00 32.76 ? 101 HIS C O     1 
ATOM   7326  C CB    . HIS C 1 101 ? 1.757   -25.207 -52.246  1.00 33.34 ? 101 HIS C CB    1 
ATOM   7327  C CG    . HIS C 1 101 ? 3.251   -25.179 -52.196  1.00 36.02 ? 101 HIS C CG    1 
ATOM   7328  N ND1   . HIS C 1 101 ? 3.993   -24.111 -52.639  1.00 37.21 ? 101 HIS C ND1   1 
ATOM   7329  C CD2   . HIS C 1 101 ? 4.146   -26.130 -51.827  1.00 38.04 ? 101 HIS C CD2   1 
ATOM   7330  C CE1   . HIS C 1 101 ? 5.281   -24.384 -52.504  1.00 39.51 ? 101 HIS C CE1   1 
ATOM   7331  N NE2   . HIS C 1 101 ? 5.400   -25.610 -52.029  1.00 38.86 ? 101 HIS C NE2   1 
ATOM   7332  N N     . TYR C 1 102 ? -0.969  -26.980 -53.819  1.00 35.06 ? 102 TYR C N     1 
ATOM   7333  C CA    . TYR C 1 102 ? -2.374  -27.390 -53.734  1.00 36.06 ? 102 TYR C CA    1 
ATOM   7334  C C     . TYR C 1 102 ? -2.516  -28.472 -52.680  1.00 37.48 ? 102 TYR C C     1 
ATOM   7335  O O     . TYR C 1 102 ? -1.491  -28.996 -52.199  1.00 39.09 ? 102 TYR C O     1 
ATOM   7336  C CB    . TYR C 1 102 ? -2.931  -27.914 -55.075  1.00 34.68 ? 102 TYR C CB    1 
ATOM   7337  C CG    . TYR C 1 102 ? -3.148  -26.830 -56.108  1.00 31.51 ? 102 TYR C CG    1 
ATOM   7338  C CD1   . TYR C 1 102 ? -3.715  -27.119 -57.355  1.00 32.11 ? 102 TYR C CD1   1 
ATOM   7339  C CD2   . TYR C 1 102 ? -2.802  -25.513 -55.829  1.00 28.13 ? 102 TYR C CD2   1 
ATOM   7340  C CE1   . TYR C 1 102 ? -3.899  -26.086 -58.331  1.00 31.53 ? 102 TYR C CE1   1 
ATOM   7341  C CE2   . TYR C 1 102 ? -2.973  -24.500 -56.755  1.00 30.40 ? 102 TYR C CE2   1 
ATOM   7342  C CZ    . TYR C 1 102 ? -3.518  -24.786 -58.004  1.00 31.43 ? 102 TYR C CZ    1 
ATOM   7343  O OH    . TYR C 1 102 ? -3.672  -23.746 -58.891  1.00 33.31 ? 102 TYR C OH    1 
ATOM   7344  N N     . PRO C 1 103 ? -3.778  -28.756 -52.271  1.00 37.80 ? 103 PRO C N     1 
ATOM   7345  C CA    . PRO C 1 103 ? -4.161  -29.949 -51.548  1.00 37.57 ? 103 PRO C CA    1 
ATOM   7346  C C     . PRO C 1 103 ? -4.031  -31.237 -52.380  1.00 37.75 ? 103 PRO C C     1 
ATOM   7347  O O     . PRO C 1 103 ? -4.315  -31.260 -53.576  1.00 37.35 ? 103 PRO C O     1 
ATOM   7348  C CB    . PRO C 1 103 ? -5.635  -29.661 -51.153  1.00 37.99 ? 103 PRO C CB    1 
ATOM   7349  C CG    . PRO C 1 103 ? -5.725  -28.112 -51.196  1.00 37.51 ? 103 PRO C CG    1 
ATOM   7350  C CD    . PRO C 1 103 ? -4.915  -27.821 -52.407  1.00 37.17 ? 103 PRO C CD    1 
ATOM   7351  N N     . PRO C 1 104 ? -3.625  -32.337 -51.727  1.00 38.44 ? 104 PRO C N     1 
ATOM   7352  C CA    . PRO C 1 104 ? -3.531  -33.586 -52.473  1.00 38.01 ? 104 PRO C CA    1 
ATOM   7353  C C     . PRO C 1 104 ? -4.777  -33.883 -53.305  1.00 38.07 ? 104 PRO C C     1 
ATOM   7354  O O     . PRO C 1 104 ? -4.647  -34.044 -54.521  1.00 39.52 ? 104 PRO C O     1 
ATOM   7355  C CB    . PRO C 1 104 ? -3.292  -34.620 -51.380  1.00 38.30 ? 104 PRO C CB    1 
ATOM   7356  C CG    . PRO C 1 104 ? -2.597  -33.875 -50.319  1.00 38.02 ? 104 PRO C CG    1 
ATOM   7357  C CD    . PRO C 1 104 ? -3.233  -32.505 -50.312  1.00 37.08 ? 104 PRO C CD    1 
ATOM   7358  N N     . SER C 1 105 ? -5.941  -33.952 -52.669  1.00 38.07 ? 105 SER C N     1 
ATOM   7359  C CA    . SER C 1 105 ? -7.185  -34.226 -53.377  1.00 38.22 ? 105 SER C CA    1 
ATOM   7360  C C     . SER C 1 105 ? -7.413  -33.224 -54.504  1.00 38.25 ? 105 SER C C     1 
ATOM   7361  O O     . SER C 1 105 ? -8.099  -33.520 -55.482  1.00 38.05 ? 105 SER C O     1 
ATOM   7362  C CB    . SER C 1 105 ? -8.369  -34.204 -52.407  1.00 38.39 ? 105 SER C CB    1 
ATOM   7363  O OG    . SER C 1 105 ? -8.701  -32.876 -52.038  1.00 38.15 ? 105 SER C OG    1 
ATOM   7364  N N     . GLN C 1 106 ? -6.832  -32.038 -54.359  1.00 38.12 ? 106 GLN C N     1 
ATOM   7365  C CA    . GLN C 1 106 ? -7.069  -30.949 -55.300  1.00 39.23 ? 106 GLN C CA    1 
ATOM   7366  C C     . GLN C 1 106 ? -6.002  -30.918 -56.388  1.00 38.58 ? 106 GLN C C     1 
ATOM   7367  O O     . GLN C 1 106 ? -5.833  -29.911 -57.076  1.00 39.61 ? 106 GLN C O     1 
ATOM   7368  C CB    . GLN C 1 106 ? -7.112  -29.607 -54.566  1.00 38.97 ? 106 GLN C CB    1 
ATOM   7369  C CG    . GLN C 1 106 ? -8.489  -28.964 -54.528  1.00 40.22 ? 106 GLN C CG    1 
ATOM   7370  C CD    . GLN C 1 106 ? -8.428  -27.470 -54.282  1.00 41.57 ? 106 GLN C CD    1 
ATOM   7371  O OE1   . GLN C 1 106 ? -7.344  -26.904 -54.144  1.00 44.09 ? 106 GLN C OE1   1 
ATOM   7372  N NE2   . GLN C 1 106 ? -9.589  -26.829 -54.226  1.00 40.80 ? 106 GLN C NE2   1 
ATOM   7373  N N     . GLY C 1 107 ? -5.285  -32.026 -56.538  1.00 37.72 ? 107 GLY C N     1 
ATOM   7374  C CA    . GLY C 1 107 ? -4.501  -32.271 -57.734  1.00 35.62 ? 107 GLY C CA    1 
ATOM   7375  C C     . GLY C 1 107 ? -3.041  -31.902 -57.557  1.00 34.20 ? 107 GLY C C     1 
ATOM   7376  O O     . GLY C 1 107 ? -2.337  -31.631 -58.529  1.00 34.00 ? 107 GLY C O     1 
ATOM   7377  N N     . GLN C 1 108 ? -2.586  -31.893 -56.308  1.00 32.20 ? 108 GLN C N     1 
ATOM   7378  C CA    . GLN C 1 108 ? -1.216  -31.505 -55.995  1.00 32.32 ? 108 GLN C CA    1 
ATOM   7379  C C     . GLN C 1 108 ? -0.219  -32.224 -56.898  1.00 31.61 ? 108 GLN C C     1 
ATOM   7380  O O     . GLN C 1 108 ? -0.363  -33.416 -57.172  1.00 29.59 ? 108 GLN C O     1 
ATOM   7381  C CB    . GLN C 1 108 ? -0.899  -31.793 -54.527  1.00 31.70 ? 108 GLN C CB    1 
ATOM   7382  C CG    . GLN C 1 108 ? 0.548   -31.535 -54.141  1.00 32.71 ? 108 GLN C CG    1 
ATOM   7383  C CD    . GLN C 1 108 ? 0.783   -31.647 -52.647  1.00 33.68 ? 108 GLN C CD    1 
ATOM   7384  O OE1   . GLN C 1 108 ? 1.572   -30.892 -52.079  1.00 36.55 ? 108 GLN C OE1   1 
ATOM   7385  N NE2   . GLN C 1 108 ? 0.099   -32.589 -52.007  1.00 32.28 ? 108 GLN C NE2   1 
ATOM   7386  N N     . MET C 1 109 ? 0.792   -31.493 -57.356  1.00 31.14 ? 109 MET C N     1 
ATOM   7387  C CA    . MET C 1 109 ? 1.793   -32.049 -58.258  1.00 31.40 ? 109 MET C CA    1 
ATOM   7388  C C     . MET C 1 109 ? 2.516   -33.230 -57.617  1.00 30.74 ? 109 MET C C     1 
ATOM   7389  O O     . MET C 1 109 ? 3.188   -33.081 -56.597  1.00 29.91 ? 109 MET C O     1 
ATOM   7390  C CB    . MET C 1 109 ? 2.802   -30.975 -58.668  1.00 31.47 ? 109 MET C CB    1 
ATOM   7391  C CG    . MET C 1 109 ? 3.669   -31.357 -59.856  1.00 31.41 ? 109 MET C CG    1 
ATOM   7392  S SD    . MET C 1 109 ? 5.420   -31.108 -59.543  1.00 33.25 ? 109 MET C SD    1 
ATOM   7393  C CE    . MET C 1 109 ? 5.594   -31.891 -57.942  1.00 32.04 ? 109 MET C CE    1 
ATOM   7394  N N     . ASP C 1 110 ? 2.373   -34.404 -58.225  1.00 30.43 ? 110 ASP C N     1 
ATOM   7395  C CA    . ASP C 1 110 ? 3.087   -35.599 -57.768  1.00 30.24 ? 110 ASP C CA    1 
ATOM   7396  C C     . ASP C 1 110 ? 4.012   -36.147 -58.927  1.00 29.71 ? 110 ASP C C     1 
ATOM   7397  O O     . ASP C 1 110 ? 3.889   -35.742 -60.086  1.00 28.80 ? 110 ASP C O     1 
ATOM   7398  C CB    . ASP C 1 110 ? 2.048   -36.616 -57.284  1.00 30.48 ? 110 ASP C CB    1 
ATOM   7399  C CG    . ASP C 1 110 ? 2.590   -37.616 -56.251  1.00 34.80 ? 110 ASP C CG    1 
ATOM   7400  O OD1   . ASP C 1 110 ? 3.774   -37.551 -55.819  1.00 35.68 ? 110 ASP C OD1   1 
ATOM   7401  O OD2   . ASP C 1 110 ? 1.782   -38.509 -55.879  1.00 40.71 ? 110 ASP C OD2   1 
ATOM   7402  N N     . LEU C 1 111 ? 4.983   -36.992 -58.558  1.00 29.35 ? 111 LEU C N     1 
ATOM   7403  C CA    . LEU C 1 111 ? 5.973   -37.606 -59.435  1.00 28.36 ? 111 LEU C CA    1 
ATOM   7404  C C     . LEU C 1 111 ? 6.250   -39.019 -58.953  1.00 28.10 ? 111 LEU C C     1 
ATOM   7405  O O     . LEU C 1 111 ? 6.407   -39.251 -57.746  1.00 26.50 ? 111 LEU C O     1 
ATOM   7406  C CB    . LEU C 1 111 ? 7.280   -36.817 -59.470  1.00 28.75 ? 111 LEU C CB    1 
ATOM   7407  C CG    . LEU C 1 111 ? 8.341   -37.173 -60.532  1.00 29.85 ? 111 LEU C CG    1 
ATOM   7408  C CD1   . LEU C 1 111 ? 9.177   -35.959 -61.014  1.00 30.87 ? 111 LEU C CD1   1 
ATOM   7409  C CD2   . LEU C 1 111 ? 9.290   -38.269 -60.044  1.00 30.46 ? 111 LEU C CD2   1 
ATOM   7410  N N     . CYS C 1 112 ? 6.252   -39.960 -59.909  1.00 28.54 ? 112 CYS C N     1 
ATOM   7411  C CA    . CYS C 1 112 ? 6.885   -41.281 -59.731  1.00 28.84 ? 112 CYS C CA    1 
ATOM   7412  C C     . CYS C 1 112 ? 7.966   -41.587 -60.781  1.00 26.60 ? 112 CYS C C     1 
ATOM   7413  O O     . CYS C 1 112 ? 7.777   -41.354 -61.982  1.00 25.86 ? 112 CYS C O     1 
ATOM   7414  C CB    . CYS C 1 112 ? 5.846   -42.387 -59.767  1.00 28.75 ? 112 CYS C CB    1 
ATOM   7415  S SG    . CYS C 1 112 ? 4.761   -42.195 -61.127  1.00 38.36 ? 112 CYS C SG    1 
ATOM   7416  N N     . VAL C 1 113 ? 9.083   -42.153 -60.327  1.00 25.52 ? 113 VAL C N     1 
ATOM   7417  C CA    . VAL C 1 113 ? 10.036  -42.748 -61.251  1.00 24.43 ? 113 VAL C CA    1 
ATOM   7418  C C     . VAL C 1 113 ? 9.360   -43.950 -61.920  1.00 24.38 ? 113 VAL C C     1 
ATOM   7419  O O     . VAL C 1 113 ? 8.690   -44.767 -61.239  1.00 23.92 ? 113 VAL C O     1 
ATOM   7420  C CB    . VAL C 1 113 ? 11.356  -43.121 -60.567  1.00 25.55 ? 113 VAL C CB    1 
ATOM   7421  C CG1   . VAL C 1 113 ? 12.422  -43.568 -61.611  1.00 25.53 ? 113 VAL C CG1   1 
ATOM   7422  C CG2   . VAL C 1 113 ? 11.930  -41.915 -59.784  1.00 22.49 ? 113 VAL C CG2   1 
ATOM   7423  N N     . THR C 1 114 ? 9.481   -44.022 -63.264  1.00 23.28 ? 114 THR C N     1 
ATOM   7424  C CA    . THR C 1 114 ? 8.966   -45.141 -64.052  1.00 21.63 ? 114 THR C CA    1 
ATOM   7425  C C     . THR C 1 114 ? 10.108  -45.873 -64.815  1.00 22.89 ? 114 THR C C     1 
ATOM   7426  O O     . THR C 1 114 ? 11.203  -45.357 -64.954  1.00 23.84 ? 114 THR C O     1 
ATOM   7427  C CB    . THR C 1 114 ? 7.783   -44.699 -65.042  1.00 21.59 ? 114 THR C CB    1 
ATOM   7428  O OG1   . THR C 1 114 ? 8.241   -43.690 -65.951  1.00 18.49 ? 114 THR C OG1   1 
ATOM   7429  C CG2   . THR C 1 114 ? 6.562   -44.171 -64.282  1.00 17.92 ? 114 THR C CG2   1 
ATOM   7430  N N     . SER C 1 115 ? 9.859   -47.100 -65.254  1.00 22.82 ? 115 SER C N     1 
ATOM   7431  C CA    . SER C 1 115 ? 10.795  -47.826 -66.043  1.00 23.62 ? 115 SER C CA    1 
ATOM   7432  C C     . SER C 1 115 ? 10.889  -47.280 -67.466  1.00 24.54 ? 115 SER C C     1 
ATOM   7433  O O     . SER C 1 115 ? 10.447  -47.909 -68.351  1.00 24.26 ? 115 SER C O     1 
ATOM   7434  C CB    . SER C 1 115 ? 10.355  -49.279 -66.099  1.00 22.57 ? 115 SER C CB    1 
ATOM   7435  O OG    . SER C 1 115 ? 10.449  -49.825 -64.823  1.00 20.46 ? 115 SER C OG    1 
ATOM   7436  N N     . GLY C 1 116 ? 11.444  -46.094 -67.664  1.00 26.94 ? 116 GLY C N     1 
ATOM   7437  C CA    . GLY C 1 116 ? 11.456  -45.455 -68.971  1.00 29.11 ? 116 GLY C CA    1 
ATOM   7438  C C     . GLY C 1 116 ? 10.100  -44.805 -69.114  1.00 31.34 ? 116 GLY C C     1 
ATOM   7439  O O     . GLY C 1 116 ? 9.084   -45.358 -68.654  1.00 33.05 ? 116 GLY C O     1 
ATOM   7440  N N     . SER C 1 117 ? 10.065  -43.637 -69.746  1.00 31.85 ? 117 SER C N     1 
ATOM   7441  C CA    . SER C 1 117 ? 8.866   -42.814 -69.777  1.00 31.78 ? 117 SER C CA    1 
ATOM   7442  C C     . SER C 1 117 ? 7.612   -43.541 -70.307  1.00 31.24 ? 117 SER C C     1 
ATOM   7443  O O     . SER C 1 117 ? 6.469   -43.193 -69.991  1.00 30.36 ? 117 SER C O     1 
ATOM   7444  C CB    . SER C 1 117 ? 9.154   -41.517 -70.541  1.00 32.21 ? 117 SER C CB    1 
ATOM   7445  O OG    . SER C 1 117 ? 8.627   -41.543 -71.855  1.00 33.37 ? 117 SER C OG    1 
ATOM   7446  N N     . GLN C 1 118 ? 7.816   -44.563 -71.112  1.00 31.12 ? 118 GLN C N     1 
ATOM   7447  C CA    . GLN C 1 118 ? 6.660   -45.145 -71.801  1.00 30.80 ? 118 GLN C CA    1 
ATOM   7448  C C     . GLN C 1 118 ? 5.870   -46.070 -70.905  1.00 30.23 ? 118 GLN C C     1 
ATOM   7449  O O     . GLN C 1 118 ? 4.704   -46.410 -71.218  1.00 31.29 ? 118 GLN C O     1 
ATOM   7450  C CB    . GLN C 1 118 ? 7.066   -45.801 -73.105  1.00 30.48 ? 118 GLN C CB    1 
ATOM   7451  C CG    . GLN C 1 118 ? 7.189   -44.789 -74.265  1.00 33.30 ? 118 GLN C CG    1 
ATOM   7452  C CD    . GLN C 1 118 ? 7.916   -45.371 -75.481  1.00 34.37 ? 118 GLN C CD    1 
ATOM   7453  O OE1   . GLN C 1 118 ? 9.101   -45.099 -75.705  1.00 37.38 ? 118 GLN C OE1   1 
ATOM   7454  N NE2   . GLN C 1 118 ? 7.232   -46.214 -76.227  1.00 33.80 ? 118 GLN C NE2   1 
ATOM   7455  N N     . GLN C 1 119 ? 6.477   -46.431 -69.770  1.00 28.37 ? 119 GLN C N     1 
ATOM   7456  C CA    . GLN C 1 119 ? 5.821   -47.296 -68.819  1.00 27.14 ? 119 GLN C CA    1 
ATOM   7457  C C     . GLN C 1 119 ? 4.764   -46.500 -68.176  1.00 26.45 ? 119 GLN C C     1 
ATOM   7458  O O     . GLN C 1 119 ? 3.642   -46.982 -67.991  1.00 27.24 ? 119 GLN C O     1 
ATOM   7459  C CB    . GLN C 1 119 ? 6.728   -47.838 -67.714  1.00 26.21 ? 119 GLN C CB    1 
ATOM   7460  C CG    . GLN C 1 119 ? 5.981   -48.898 -66.928  1.00 27.12 ? 119 GLN C CG    1 
ATOM   7461  C CD    . GLN C 1 119 ? 6.617   -49.288 -65.604  1.00 30.52 ? 119 GLN C CD    1 
ATOM   7462  O OE1   . GLN C 1 119 ? 7.285   -48.478 -64.941  1.00 29.84 ? 119 GLN C OE1   1 
ATOM   7463  N NE2   . GLN C 1 119 ? 6.396   -50.549 -65.202  1.00 27.58 ? 119 GLN C NE2   1 
ATOM   7464  N N     . GLY C 1 120 ? 5.090   -45.262 -67.819  1.00 26.20 ? 120 GLY C N     1 
ATOM   7465  C CA    . GLY C 1 120 ? 4.122   -44.360 -67.224  1.00 26.55 ? 120 GLY C CA    1 
ATOM   7466  C C     . GLY C 1 120 ? 3.111   -43.849 -68.231  1.00 26.45 ? 120 GLY C C     1 
ATOM   7467  O O     . GLY C 1 120 ? 1.941   -43.648 -67.904  1.00 25.58 ? 120 GLY C O     1 
ATOM   7468  N N     . LEU C 1 121 ? 3.564   -43.636 -69.462  1.00 28.12 ? 121 LEU C N     1 
ATOM   7469  C CA    . LEU C 1 121 ? 2.661   -43.383 -70.579  1.00 28.78 ? 121 LEU C CA    1 
ATOM   7470  C C     . LEU C 1 121 ? 1.594   -44.468 -70.682  1.00 28.50 ? 121 LEU C C     1 
ATOM   7471  O O     . LEU C 1 121 ? 0.408   -44.174 -70.828  1.00 28.82 ? 121 LEU C O     1 
ATOM   7472  C CB    . LEU C 1 121 ? 3.443   -43.287 -71.890  1.00 28.98 ? 121 LEU C CB    1 
ATOM   7473  C CG    . LEU C 1 121 ? 2.790   -42.477 -73.011  1.00 28.22 ? 121 LEU C CG    1 
ATOM   7474  C CD1   . LEU C 1 121 ? 2.989   -40.986 -72.783  1.00 28.14 ? 121 LEU C CD1   1 
ATOM   7475  C CD2   . LEU C 1 121 ? 3.341   -42.894 -74.367  1.00 29.90 ? 121 LEU C CD2   1 
ATOM   7476  N N     . CYS C 1 122 ? 2.025   -45.723 -70.604  1.00 27.73 ? 122 CYS C N     1 
ATOM   7477  C CA    . CYS C 1 122 ? 1.138   -46.854 -70.844  1.00 27.18 ? 122 CYS C CA    1 
ATOM   7478  C C     . CYS C 1 122 ? 0.065   -46.952 -69.763  1.00 27.51 ? 122 CYS C C     1 
ATOM   7479  O O     . CYS C 1 122 ? -1.120  -47.095 -70.063  1.00 28.17 ? 122 CYS C O     1 
ATOM   7480  C CB    . CYS C 1 122 ? 1.936   -48.157 -70.911  1.00 26.78 ? 122 CYS C CB    1 
ATOM   7481  S SG    . CYS C 1 122 ? 1.025   -49.557 -71.604  1.00 27.65 ? 122 CYS C SG    1 
ATOM   7482  N N     . LYS C 1 123 ? 0.489   -46.873 -68.506  1.00 26.32 ? 123 LYS C N     1 
ATOM   7483  C CA    . LYS C 1 123 ? -0.415  -47.028 -67.389  1.00 26.52 ? 123 LYS C CA    1 
ATOM   7484  C C     . LYS C 1 123 ? -1.345  -45.821 -67.244  1.00 26.24 ? 123 LYS C C     1 
ATOM   7485  O O     . LYS C 1 123 ? -2.380  -45.928 -66.640  1.00 25.89 ? 123 LYS C O     1 
ATOM   7486  C CB    . LYS C 1 123 ? 0.371   -47.336 -66.120  1.00 26.20 ? 123 LYS C CB    1 
ATOM   7487  C CG    . LYS C 1 123 ? 0.969   -48.728 -66.238  1.00 26.71 ? 123 LYS C CG    1 
ATOM   7488  C CD    . LYS C 1 123 ? 2.157   -49.002 -65.311  1.00 27.74 ? 123 LYS C CD    1 
ATOM   7489  C CE    . LYS C 1 123 ? 2.647   -50.460 -65.445  1.00 28.98 ? 123 LYS C CE    1 
ATOM   7490  N NZ    . LYS C 1 123 ? 1.562   -51.427 -65.104  1.00 31.41 ? 123 LYS C NZ    1 
ATOM   7491  N N     . VAL C 1 124 ? -0.988  -44.693 -67.848  1.00 26.33 ? 124 VAL C N     1 
ATOM   7492  C CA    . VAL C 1 124 ? -1.903  -43.592 -67.967  1.00 26.82 ? 124 VAL C CA    1 
ATOM   7493  C C     . VAL C 1 124 ? -3.123  -43.831 -68.939  1.00 27.18 ? 124 VAL C C     1 
ATOM   7494  O O     . VAL C 1 124 ? -4.277  -43.591 -68.526  1.00 23.92 ? 124 VAL C O     1 
ATOM   7495  C CB    . VAL C 1 124 ? -1.219  -42.301 -68.290  1.00 27.29 ? 124 VAL C CB    1 
ATOM   7496  C CG1   . VAL C 1 124 ? -2.325  -41.295 -68.788  1.00 26.07 ? 124 VAL C CG1   1 
ATOM   7497  C CG2   . VAL C 1 124 ? -0.435  -41.784 -67.024  1.00 24.88 ? 124 VAL C CG2   1 
ATOM   7498  N N     . PHE C 1 125 ? -2.858  -44.336 -70.166  1.00 27.45 ? 125 PHE C N     1 
ATOM   7499  C CA    . PHE C 1 125 ? -3.948  -44.726 -71.101  1.00 28.33 ? 125 PHE C CA    1 
ATOM   7500  C C     . PHE C 1 125 ? -4.836  -45.775 -70.453  1.00 29.34 ? 125 PHE C C     1 
ATOM   7501  O O     . PHE C 1 125 ? -6.072  -45.709 -70.611  1.00 29.05 ? 125 PHE C O     1 
ATOM   7502  C CB    . PHE C 1 125 ? -3.489  -45.319 -72.488  1.00 29.01 ? 125 PHE C CB    1 
ATOM   7503  C CG    . PHE C 1 125 ? -2.532  -44.472 -73.273  1.00 28.75 ? 125 PHE C CG    1 
ATOM   7504  C CD1   . PHE C 1 125 ? -1.622  -45.066 -74.103  1.00 31.15 ? 125 PHE C CD1   1 
ATOM   7505  C CD2   . PHE C 1 125 ? -2.549  -43.077 -73.206  1.00 31.31 ? 125 PHE C CD2   1 
ATOM   7506  C CE1   . PHE C 1 125 ? -0.704  -44.276 -74.850  1.00 33.91 ? 125 PHE C CE1   1 
ATOM   7507  C CE2   . PHE C 1 125 ? -1.672  -42.302 -73.950  1.00 28.66 ? 125 PHE C CE2   1 
ATOM   7508  C CZ    . PHE C 1 125 ? -0.741  -42.895 -74.753  1.00 30.12 ? 125 PHE C CZ    1 
ATOM   7509  N N     . GLU C 1 126 ? -4.222  -46.764 -69.773  1.00 29.66 ? 126 GLU C N     1 
ATOM   7510  C CA    . GLU C 1 126 ? -4.997  -47.870 -69.118  1.00 30.62 ? 126 GLU C CA    1 
ATOM   7511  C C     . GLU C 1 126 ? -5.891  -47.381 -67.940  1.00 29.40 ? 126 GLU C C     1 
ATOM   7512  O O     . GLU C 1 126 ? -6.979  -47.889 -67.693  1.00 29.74 ? 126 GLU C O     1 
ATOM   7513  C CB    . GLU C 1 126 ? -4.095  -49.032 -68.670  1.00 30.39 ? 126 GLU C CB    1 
ATOM   7514  C CG    . GLU C 1 126 ? -3.329  -49.773 -69.826  1.00 33.07 ? 126 GLU C CG    1 
ATOM   7515  C CD    . GLU C 1 126 ? -2.165  -50.628 -69.310  1.00 32.56 ? 126 GLU C CD    1 
ATOM   7516  O OE1   . GLU C 1 126 ? -1.756  -51.616 -69.955  1.00 32.13 ? 126 GLU C OE1   1 
ATOM   7517  O OE2   . GLU C 1 126 ? -1.654  -50.304 -68.227  1.00 39.69 ? 126 GLU C OE2   1 
ATOM   7518  N N     . MET C 1 127 ? -5.442  -46.367 -67.231  1.00 27.95 ? 127 MET C N     1 
ATOM   7519  C CA    . MET C 1 127 ? -6.296  -45.717 -66.253  1.00 26.19 ? 127 MET C CA    1 
ATOM   7520  C C     . MET C 1 127 ? -7.535  -45.098 -66.870  1.00 26.98 ? 127 MET C C     1 
ATOM   7521  O O     . MET C 1 127 ? -8.654  -45.105 -66.292  1.00 26.12 ? 127 MET C O     1 
ATOM   7522  C CB    . MET C 1 127 ? -5.541  -44.536 -65.732  1.00 25.31 ? 127 MET C CB    1 
ATOM   7523  C CG    . MET C 1 127 ? -5.030  -44.745 -64.439  1.00 22.11 ? 127 MET C CG    1 
ATOM   7524  S SD    . MET C 1 127 ? -5.118  -43.201 -63.565  1.00 25.28 ? 127 MET C SD    1 
ATOM   7525  C CE    . MET C 1 127 ? -4.251  -41.996 -64.600  1.00 22.07 ? 127 MET C CE    1 
ATOM   7526  N N     . ILE C 1 128 ? -7.301  -44.482 -68.027  1.00 27.05 ? 128 ILE C N     1 
ATOM   7527  C CA    . ILE C 1 128 ? -8.136  -43.400 -68.451  1.00 26.81 ? 128 ILE C CA    1 
ATOM   7528  C C     . ILE C 1 128 ? -9.264  -43.983 -69.251  1.00 27.79 ? 128 ILE C C     1 
ATOM   7529  O O     . ILE C 1 128 ? -10.431 -43.692 -68.945  1.00 28.42 ? 128 ILE C O     1 
ATOM   7530  C CB    . ILE C 1 128 ? -7.368  -42.347 -69.233  1.00 25.89 ? 128 ILE C CB    1 
ATOM   7531  C CG1   . ILE C 1 128 ? -6.494  -41.538 -68.292  1.00 23.68 ? 128 ILE C CG1   1 
ATOM   7532  C CG2   . ILE C 1 128 ? -8.359  -41.393 -70.003  1.00 29.35 ? 128 ILE C CG2   1 
ATOM   7533  C CD1   . ILE C 1 128 ? -5.759  -40.354 -68.943  1.00 23.18 ? 128 ILE C CD1   1 
ATOM   7534  N N     . ILE C 1 129 ? -8.899  -44.875 -70.181  1.00 27.13 ? 129 ILE C N     1 
ATOM   7535  C CA    . ILE C 1 129 ? -9.683  -45.238 -71.332  1.00 25.94 ? 129 ILE C CA    1 
ATOM   7536  C C     . ILE C 1 129 ? -10.658 -46.420 -71.147  1.00 27.70 ? 129 ILE C C     1 
ATOM   7537  O O     . ILE C 1 129 ? -10.217 -47.529 -70.844  1.00 26.49 ? 129 ILE C O     1 
ATOM   7538  C CB    . ILE C 1 129 ? -8.769  -45.561 -72.515  1.00 25.16 ? 129 ILE C CB    1 
ATOM   7539  C CG1   . ILE C 1 129 ? -8.037  -44.293 -72.990  1.00 26.31 ? 129 ILE C CG1   1 
ATOM   7540  C CG2   . ILE C 1 129 ? -9.571  -46.222 -73.687  1.00 24.94 ? 129 ILE C CG2   1 
ATOM   7541  C CD1   . ILE C 1 129 ? -6.869  -44.566 -74.008  1.00 24.61 ? 129 ILE C CD1   1 
ATOM   7542  N N     . ASN C 1 130 ? -11.963 -46.174 -71.398  1.00 27.96 ? 130 ASN C N     1 
ATOM   7543  C CA    . ASN C 1 130 ? -12.938 -47.270 -71.698  1.00 28.68 ? 130 ASN C CA    1 
ATOM   7544  C C     . ASN C 1 130 ? -13.225 -47.439 -73.176  1.00 28.68 ? 130 ASN C C     1 
ATOM   7545  O O     . ASN C 1 130 ? -13.263 -46.430 -73.884  1.00 28.66 ? 130 ASN C O     1 
ATOM   7546  C CB    . ASN C 1 130 ? -14.248 -47.041 -70.987  1.00 28.87 ? 130 ASN C CB    1 
ATOM   7547  C CG    . ASN C 1 130 ? -14.080 -47.102 -69.485  1.00 29.43 ? 130 ASN C CG    1 
ATOM   7548  O OD1   . ASN C 1 130 ? -13.606 -48.104 -68.965  1.00 27.67 ? 130 ASN C OD1   1 
ATOM   7549  N ND2   . ASN C 1 130 ? -14.412 -46.015 -68.792  1.00 28.71 ? 130 ASN C ND2   1 
ATOM   7550  N N     . PRO C 1 131 ? -13.423 -48.706 -73.648  1.00 27.96 ? 131 PRO C N     1 
ATOM   7551  C CA    . PRO C 1 131 ? -13.648 -48.832 -75.068  1.00 28.94 ? 131 PRO C CA    1 
ATOM   7552  C C     . PRO C 1 131 ? -14.843 -47.959 -75.635  1.00 30.45 ? 131 PRO C C     1 
ATOM   7553  O O     . PRO C 1 131 ? -15.890 -47.765 -75.001  1.00 29.55 ? 131 PRO C O     1 
ATOM   7554  C CB    . PRO C 1 131 ? -13.798 -50.359 -75.289  1.00 29.12 ? 131 PRO C CB    1 
ATOM   7555  C CG    . PRO C 1 131 ? -13.439 -51.016 -74.020  1.00 28.36 ? 131 PRO C CG    1 
ATOM   7556  C CD    . PRO C 1 131 ? -13.485 -50.000 -72.943  1.00 27.11 ? 131 PRO C CD    1 
ATOM   7557  N N     . GLY C 1 132 ? -14.631 -47.363 -76.802  1.00 32.68 ? 132 GLY C N     1 
ATOM   7558  C CA    . GLY C 1 132 ? -15.613 -46.395 -77.320  1.00 33.87 ? 132 GLY C CA    1 
ATOM   7559  C C     . GLY C 1 132 ? -15.338 -44.974 -76.874  1.00 33.83 ? 132 GLY C C     1 
ATOM   7560  O O     . GLY C 1 132 ? -15.917 -44.041 -77.400  1.00 34.59 ? 132 GLY C O     1 
ATOM   7561  N N     . ASP C 1 133 ? -14.444 -44.763 -75.926  1.00 34.69 ? 133 ASP C N     1 
ATOM   7562  C CA    . ASP C 1 133 ? -14.119 -43.356 -75.605  1.00 35.93 ? 133 ASP C CA    1 
ATOM   7563  C C     . ASP C 1 133 ? -13.436 -42.618 -76.757  1.00 35.70 ? 133 ASP C C     1 
ATOM   7564  O O     . ASP C 1 133 ? -12.850 -43.221 -77.680  1.00 35.32 ? 133 ASP C O     1 
ATOM   7565  C CB    . ASP C 1 133 ? -13.211 -43.215 -74.397  1.00 36.52 ? 133 ASP C CB    1 
ATOM   7566  C CG    . ASP C 1 133 ? -13.861 -43.589 -73.130  1.00 37.07 ? 133 ASP C CG    1 
ATOM   7567  O OD1   . ASP C 1 133 ? -15.110 -43.625 -73.079  1.00 40.44 ? 133 ASP C OD1   1 
ATOM   7568  O OD2   . ASP C 1 133 ? -13.090 -43.831 -72.169  1.00 40.55 ? 133 ASP C OD2   1 
ATOM   7569  N N     . ASN C 1 134 ? -13.474 -41.295 -76.655  1.00 35.43 ? 134 ASN C N     1 
ATOM   7570  C CA    . ASN C 1 134 ? -12.847 -40.451 -77.635  1.00 34.19 ? 134 ASN C CA    1 
ATOM   7571  C C     . ASN C 1 134 ? -11.596 -39.844 -77.095  1.00 34.44 ? 134 ASN C C     1 
ATOM   7572  O O     . ASN C 1 134 ? -11.611 -39.235 -75.992  1.00 33.63 ? 134 ASN C O     1 
ATOM   7573  C CB    . ASN C 1 134 ? -13.825 -39.376 -78.036  1.00 33.32 ? 134 ASN C CB    1 
ATOM   7574  C CG    . ASN C 1 134 ? -15.043 -39.957 -78.695  1.00 33.61 ? 134 ASN C CG    1 
ATOM   7575  O OD1   . ASN C 1 134 ? -14.954 -40.653 -79.725  1.00 32.43 ? 134 ASN C OD1   1 
ATOM   7576  N ND2   . ASN C 1 134 ? -16.192 -39.689 -78.116  1.00 34.38 ? 134 ASN C ND2   1 
ATOM   7577  N N     . VAL C 1 135 ? -10.508 -40.009 -77.860  1.00 34.10 ? 135 VAL C N     1 
ATOM   7578  C CA    . VAL C 1 135 ? -9.276  -39.267 -77.587  1.00 33.42 ? 135 VAL C CA    1 
ATOM   7579  C C     . VAL C 1 135 ? -8.765  -38.417 -78.746  1.00 33.87 ? 135 VAL C C     1 
ATOM   7580  O O     . VAL C 1 135 ? -8.955  -38.757 -79.943  1.00 33.52 ? 135 VAL C O     1 
ATOM   7581  C CB    . VAL C 1 135 ? -8.163  -40.163 -76.976  1.00 34.25 ? 135 VAL C CB    1 
ATOM   7582  C CG1   . VAL C 1 135 ? -8.648  -40.753 -75.631  1.00 31.02 ? 135 VAL C CG1   1 
ATOM   7583  C CG2   . VAL C 1 135 ? -7.719  -41.276 -77.973  1.00 32.75 ? 135 VAL C CG2   1 
ATOM   7584  N N     . LEU C 1 136 ? -8.116  -37.312 -78.367  1.00 32.82 ? 136 LEU C N     1 
ATOM   7585  C CA    . LEU C 1 136 ? -7.578  -36.359 -79.303  1.00 32.86 ? 136 LEU C CA    1 
ATOM   7586  C C     . LEU C 1 136 ? -6.015  -36.450 -79.401  1.00 32.93 ? 136 LEU C C     1 
ATOM   7587  O O     . LEU C 1 136 ? -5.304  -36.491 -78.366  1.00 31.77 ? 136 LEU C O     1 
ATOM   7588  C CB    . LEU C 1 136 ? -8.031  -34.922 -78.936  1.00 32.74 ? 136 LEU C CB    1 
ATOM   7589  C CG    . LEU C 1 136 ? -9.502  -34.471 -78.796  1.00 34.34 ? 136 LEU C CG    1 
ATOM   7590  C CD1   . LEU C 1 136 ? -9.618  -33.222 -77.896  1.00 34.93 ? 136 LEU C CD1   1 
ATOM   7591  C CD2   . LEU C 1 136 ? -10.188 -34.204 -80.128  1.00 36.58 ? 136 LEU C CD2   1 
ATOM   7592  N N     . LEU C 1 137 ? -5.514  -36.492 -80.650  1.00 32.20 ? 137 LEU C N     1 
ATOM   7593  C CA    . LEU C 1 137 ? -4.079  -36.307 -80.963  1.00 31.36 ? 137 LEU C CA    1 
ATOM   7594  C C     . LEU C 1 137 ? -3.826  -35.840 -82.404  1.00 31.46 ? 137 LEU C C     1 
ATOM   7595  O O     . LEU C 1 137 ? -4.717  -35.703 -83.177  1.00 29.78 ? 137 LEU C O     1 
ATOM   7596  C CB    . LEU C 1 137 ? -3.255  -37.582 -80.653  1.00 31.28 ? 137 LEU C CB    1 
ATOM   7597  C CG    . LEU C 1 137 ? -3.538  -38.966 -81.266  1.00 26.88 ? 137 LEU C CG    1 
ATOM   7598  C CD1   . LEU C 1 137 ? -3.125  -39.085 -82.767  1.00 24.33 ? 137 LEU C CD1   1 
ATOM   7599  C CD2   . LEU C 1 137 ? -2.789  -39.933 -80.465  1.00 28.28 ? 137 LEU C CD2   1 
ATOM   7600  N N     . ASP C 1 138 ? -2.558  -35.644 -82.765  1.00 33.98 ? 138 ASP C N     1 
ATOM   7601  C CA    . ASP C 1 138 ? -2.201  -35.252 -84.128  1.00 34.60 ? 138 ASP C CA    1 
ATOM   7602  C C     . ASP C 1 138 ? -1.386  -36.323 -84.857  1.00 35.45 ? 138 ASP C C     1 
ATOM   7603  O O     . ASP C 1 138 ? -0.309  -36.751 -84.385  1.00 34.73 ? 138 ASP C O     1 
ATOM   7604  C CB    . ASP C 1 138 ? -1.518  -33.897 -84.140  1.00 35.55 ? 138 ASP C CB    1 
ATOM   7605  C CG    . ASP C 1 138 ? -0.218  -33.860 -83.287  1.00 38.42 ? 138 ASP C CG    1 
ATOM   7606  O OD1   . ASP C 1 138 ? -0.325  -34.067 -82.055  1.00 41.16 ? 138 ASP C OD1   1 
ATOM   7607  O OD2   . ASP C 1 138 ? 0.889   -33.581 -83.855  1.00 38.87 ? 138 ASP C OD2   1 
ATOM   7608  N N     . GLU C 1 139 ? -1.944  -36.791 -85.987  1.00 35.98 ? 139 GLU C N     1 
ATOM   7609  C CA    . GLU C 1 139 ? -1.192  -37.562 -86.978  1.00 36.70 ? 139 GLU C CA    1 
ATOM   7610  C C     . GLU C 1 139 ? -0.367  -36.499 -87.708  1.00 35.49 ? 139 GLU C C     1 
ATOM   7611  O O     . GLU C 1 139 ? -0.860  -35.383 -87.883  1.00 36.69 ? 139 GLU C O     1 
ATOM   7612  C CB    . GLU C 1 139 ? -2.124  -38.286 -87.964  1.00 37.16 ? 139 GLU C CB    1 
ATOM   7613  C CG    . GLU C 1 139 ? -3.182  -39.284 -87.363  1.00 39.46 ? 139 GLU C CG    1 
ATOM   7614  C CD    . GLU C 1 139 ? -4.114  -39.924 -88.458  1.00 39.74 ? 139 GLU C CD    1 
ATOM   7615  O OE1   . GLU C 1 139 ? -4.045  -41.163 -88.685  1.00 40.70 ? 139 GLU C OE1   1 
ATOM   7616  O OE2   . GLU C 1 139 ? -4.901  -39.176 -89.116  1.00 41.90 ? 139 GLU C OE2   1 
ATOM   7617  N N     . PRO C 1 140 ? 0.897   -36.800 -88.100  1.00 34.78 ? 140 PRO C N     1 
ATOM   7618  C CA    . PRO C 1 140 ? 1.655   -38.028 -87.832  1.00 34.10 ? 140 PRO C CA    1 
ATOM   7619  C C     . PRO C 1 140 ? 1.873   -38.082 -86.356  1.00 34.23 ? 140 PRO C C     1 
ATOM   7620  O O     . PRO C 1 140 ? 2.153   -37.023 -85.753  1.00 34.70 ? 140 PRO C O     1 
ATOM   7621  C CB    . PRO C 1 140 ? 2.988   -37.769 -88.519  1.00 33.23 ? 140 PRO C CB    1 
ATOM   7622  C CG    . PRO C 1 140 ? 2.710   -36.656 -89.495  1.00 32.37 ? 140 PRO C CG    1 
ATOM   7623  C CD    . PRO C 1 140 ? 1.693   -35.834 -88.886  1.00 34.24 ? 140 PRO C CD    1 
ATOM   7624  N N     . ALA C 1 141 ? 1.673   -39.259 -85.767  1.00 33.64 ? 141 ALA C N     1 
ATOM   7625  C CA    . ALA C 1 141 ? 1.910   -39.472 -84.322  1.00 33.84 ? 141 ALA C CA    1 
ATOM   7626  C C     . ALA C 1 141 ? 2.873   -40.631 -84.120  1.00 33.09 ? 141 ALA C C     1 
ATOM   7627  O O     . ALA C 1 141 ? 3.111   -41.392 -85.048  1.00 32.99 ? 141 ALA C O     1 
ATOM   7628  C CB    . ALA C 1 141 ? 0.549   -39.743 -83.565  1.00 33.15 ? 141 ALA C CB    1 
ATOM   7629  N N     . TYR C 1 142 ? 3.412   -40.827 -82.918  1.00 33.52 ? 142 TYR C N     1 
ATOM   7630  C CA    . TYR C 1 142 ? 4.425   -41.895 -82.826  1.00 32.83 ? 142 TYR C CA    1 
ATOM   7631  C C     . TYR C 1 142 ? 3.860   -43.318 -82.838  1.00 32.17 ? 142 TYR C C     1 
ATOM   7632  O O     . TYR C 1 142 ? 2.872   -43.641 -82.146  1.00 30.35 ? 142 TYR C O     1 
ATOM   7633  C CB    . TYR C 1 142 ? 5.440   -41.606 -81.751  1.00 34.48 ? 142 TYR C CB    1 
ATOM   7634  C CG    . TYR C 1 142 ? 6.169   -42.755 -81.103  1.00 35.54 ? 142 TYR C CG    1 
ATOM   7635  C CD1   . TYR C 1 142 ? 5.910   -43.075 -79.756  1.00 39.51 ? 142 TYR C CD1   1 
ATOM   7636  C CD2   . TYR C 1 142 ? 7.159   -43.454 -81.768  1.00 35.55 ? 142 TYR C CD2   1 
ATOM   7637  C CE1   . TYR C 1 142 ? 6.585   -44.088 -79.110  1.00 38.24 ? 142 TYR C CE1   1 
ATOM   7638  C CE2   . TYR C 1 142 ? 7.838   -44.484 -81.137  1.00 37.65 ? 142 TYR C CE2   1 
ATOM   7639  C CZ    . TYR C 1 142 ? 7.528   -44.787 -79.812  1.00 37.49 ? 142 TYR C CZ    1 
ATOM   7640  O OH    . TYR C 1 142 ? 8.168   -45.774 -79.168  1.00 38.60 ? 142 TYR C OH    1 
ATOM   7641  N N     . SER C 1 143 ? 4.471   -44.143 -83.700  1.00 31.17 ? 143 SER C N     1 
ATOM   7642  C CA    . SER C 1 143 ? 4.020   -45.514 -83.915  1.00 30.72 ? 143 SER C CA    1 
ATOM   7643  C C     . SER C 1 143 ? 3.600   -46.217 -82.611  1.00 29.97 ? 143 SER C C     1 
ATOM   7644  O O     . SER C 1 143 ? 2.482   -46.690 -82.500  1.00 29.64 ? 143 SER C O     1 
ATOM   7645  C CB    . SER C 1 143 ? 5.132   -46.280 -84.608  1.00 32.24 ? 143 SER C CB    1 
ATOM   7646  O OG    . SER C 1 143 ? 6.350   -46.197 -83.855  1.00 33.51 ? 143 SER C OG    1 
ATOM   7647  N N     . GLY C 1 144 ? 4.492   -46.254 -81.609  1.00 28.65 ? 144 GLY C N     1 
ATOM   7648  C CA    . GLY C 1 144 ? 4.250   -47.025 -80.387  1.00 27.02 ? 144 GLY C CA    1 
ATOM   7649  C C     . GLY C 1 144 ? 3.071   -46.578 -79.558  1.00 27.56 ? 144 GLY C C     1 
ATOM   7650  O O     . GLY C 1 144 ? 2.468   -47.400 -78.851  1.00 26.65 ? 144 GLY C O     1 
ATOM   7651  N N     . THR C 1 145 ? 2.784   -45.266 -79.605  1.00 27.22 ? 145 THR C N     1 
ATOM   7652  C CA    . THR C 1 145 ? 1.609   -44.724 -79.007  1.00 28.46 ? 145 THR C CA    1 
ATOM   7653  C C     . THR C 1 145 ? 0.317   -45.183 -79.703  1.00 28.16 ? 145 THR C C     1 
ATOM   7654  O O     . THR C 1 145 ? -0.682  -45.346 -79.044  1.00 27.07 ? 145 THR C O     1 
ATOM   7655  C CB    . THR C 1 145 ? 1.555   -43.205 -79.061  1.00 29.23 ? 145 THR C CB    1 
ATOM   7656  O OG1   . THR C 1 145 ? 2.581   -42.634 -78.244  1.00 31.24 ? 145 THR C OG1   1 
ATOM   7657  C CG2   . THR C 1 145 ? 0.195   -42.767 -78.523  1.00 29.61 ? 145 THR C CG2   1 
ATOM   7658  N N     . LEU C 1 146 ? 0.370   -45.335 -81.029  1.00 28.86 ? 146 LEU C N     1 
ATOM   7659  C CA    . LEU C 1 146 ? -0.741  -45.809 -81.858  1.00 29.94 ? 146 LEU C CA    1 
ATOM   7660  C C     . LEU C 1 146 ? -0.998  -47.270 -81.544  1.00 30.84 ? 146 LEU C C     1 
ATOM   7661  O O     . LEU C 1 146 ? -2.150  -47.674 -81.287  1.00 31.56 ? 146 LEU C O     1 
ATOM   7662  C CB    . LEU C 1 146 ? -0.431  -45.658 -83.355  1.00 28.26 ? 146 LEU C CB    1 
ATOM   7663  C CG    . LEU C 1 146 ? -0.449  -44.206 -83.822  1.00 29.85 ? 146 LEU C CG    1 
ATOM   7664  C CD1   . LEU C 1 146 ? -0.538  -44.185 -85.334  1.00 30.53 ? 146 LEU C CD1   1 
ATOM   7665  C CD2   . LEU C 1 146 ? -1.602  -43.363 -83.236  1.00 26.44 ? 146 LEU C CD2   1 
ATOM   7666  N N     . GLN C 1 147 ? 0.081   -48.046 -81.477  1.00 30.40 ? 147 GLN C N     1 
ATOM   7667  C CA    . GLN C 1 147 ? -0.118  -49.454 -81.287  1.00 31.64 ? 147 GLN C CA    1 
ATOM   7668  C C     . GLN C 1 147 ? -0.545  -49.755 -79.830  1.00 30.87 ? 147 GLN C C     1 
ATOM   7669  O O     . GLN C 1 147 ? -1.119  -50.810 -79.515  1.00 30.16 ? 147 GLN C O     1 
ATOM   7670  C CB    . GLN C 1 147 ? 1.069   -50.264 -81.824  1.00 32.07 ? 147 GLN C CB    1 
ATOM   7671  C CG    . GLN C 1 147 ? 1.225   -50.170 -83.388  1.00 34.40 ? 147 GLN C CG    1 
ATOM   7672  C CD    . GLN C 1 147 ? 0.074   -50.872 -84.209  1.00 40.62 ? 147 GLN C CD    1 
ATOM   7673  O OE1   . GLN C 1 147 ? -0.998  -51.222 -83.668  1.00 40.91 ? 147 GLN C OE1   1 
ATOM   7674  N NE2   . GLN C 1 147 ? 0.304   -51.050 -85.523  1.00 40.18 ? 147 GLN C NE2   1 
ATOM   7675  N N     . SER C 1 148 ? -0.336  -48.740 -78.998  1.00 30.58 ? 148 SER C N     1 
ATOM   7676  C CA    . SER C 1 148 ? -0.729  -48.730 -77.604  1.00 30.69 ? 148 SER C CA    1 
ATOM   7677  C C     . SER C 1 148 ? -2.171  -48.318 -77.386  1.00 31.81 ? 148 SER C C     1 
ATOM   7678  O O     . SER C 1 148 ? -2.850  -48.982 -76.631  1.00 30.92 ? 148 SER C O     1 
ATOM   7679  C CB    . SER C 1 148 ? 0.168   -47.809 -76.789  1.00 30.42 ? 148 SER C CB    1 
ATOM   7680  O OG    . SER C 1 148 ? 0.117   -48.174 -75.416  1.00 29.20 ? 148 SER C OG    1 
ATOM   7681  N N     . LEU C 1 149 ? -2.597  -47.199 -78.000  1.00 32.96 ? 149 LEU C N     1 
ATOM   7682  C CA    . LEU C 1 149 ? -3.997  -46.740 -77.976  1.00 34.00 ? 149 LEU C CA    1 
ATOM   7683  C C     . LEU C 1 149 ? -4.920  -47.717 -78.727  1.00 34.55 ? 149 LEU C C     1 
ATOM   7684  O O     . LEU C 1 149 ? -5.985  -47.994 -78.262  1.00 34.13 ? 149 LEU C O     1 
ATOM   7685  C CB    . LEU C 1 149 ? -4.136  -45.320 -78.564  1.00 33.29 ? 149 LEU C CB    1 
ATOM   7686  C CG    . LEU C 1 149 ? -3.658  -44.120 -77.733  1.00 34.41 ? 149 LEU C CG    1 
ATOM   7687  C CD1   . LEU C 1 149 ? -3.995  -42.853 -78.431  1.00 34.63 ? 149 LEU C CD1   1 
ATOM   7688  C CD2   . LEU C 1 149 ? -4.280  -44.071 -76.372  1.00 32.90 ? 149 LEU C CD2   1 
ATOM   7689  N N     . HIS C 1 150 ? -4.471  -48.242 -79.881  1.00 36.39 ? 150 HIS C N     1 
ATOM   7690  C CA    . HIS C 1 150 ? -5.272  -49.161 -80.721  1.00 36.61 ? 150 HIS C CA    1 
ATOM   7691  C C     . HIS C 1 150 ? -6.083  -50.188 -79.936  1.00 36.96 ? 150 HIS C C     1 
ATOM   7692  O O     . HIS C 1 150 ? -7.289  -50.232 -80.093  1.00 36.91 ? 150 HIS C O     1 
ATOM   7693  C CB    . HIS C 1 150 ? -4.395  -49.893 -81.742  1.00 36.84 ? 150 HIS C CB    1 
ATOM   7694  C CG    . HIS C 1 150 ? -5.093  -51.014 -82.476  1.00 37.61 ? 150 HIS C CG    1 
ATOM   7695  N ND1   . HIS C 1 150 ? -4.611  -52.317 -82.493  1.00 36.36 ? 150 HIS C ND1   1 
ATOM   7696  C CD2   . HIS C 1 150 ? -6.210  -51.020 -83.241  1.00 33.39 ? 150 HIS C CD2   1 
ATOM   7697  C CE1   . HIS C 1 150 ? -5.407  -53.070 -83.234  1.00 34.34 ? 150 HIS C CE1   1 
ATOM   7698  N NE2   . HIS C 1 150 ? -6.382  -52.308 -83.697  1.00 33.88 ? 150 HIS C NE2   1 
ATOM   7699  N N     . PRO C 1 151 ? -5.411  -51.006 -79.082  1.00 36.50 ? 151 PRO C N     1 
ATOM   7700  C CA    . PRO C 1 151 ? -6.077  -52.176 -78.540  1.00 35.50 ? 151 PRO C CA    1 
ATOM   7701  C C     . PRO C 1 151 ? -6.876  -51.804 -77.318  1.00 35.23 ? 151 PRO C C     1 
ATOM   7702  O O     . PRO C 1 151 ? -7.609  -52.620 -76.784  1.00 34.89 ? 151 PRO C O     1 
ATOM   7703  C CB    . PRO C 1 151 ? -4.901  -53.085 -78.170  1.00 36.37 ? 151 PRO C CB    1 
ATOM   7704  C CG    . PRO C 1 151 ? -3.777  -52.151 -77.781  1.00 34.79 ? 151 PRO C CG    1 
ATOM   7705  C CD    . PRO C 1 151 ? -4.037  -50.859 -78.548  1.00 36.33 ? 151 PRO C CD    1 
ATOM   7706  N N     . LEU C 1 152 ? -6.698  -50.570 -76.855  1.00 35.30 ? 152 LEU C N     1 
ATOM   7707  C CA    . LEU C 1 152 ? -7.549  -50.012 -75.827  1.00 35.66 ? 152 LEU C CA    1 
ATOM   7708  C C     . LEU C 1 152 ? -9.010  -49.687 -76.340  1.00 36.88 ? 152 LEU C C     1 
ATOM   7709  O O     . LEU C 1 152 ? -9.938  -49.468 -75.537  1.00 37.03 ? 152 LEU C O     1 
ATOM   7710  C CB    . LEU C 1 152 ? -6.839  -48.834 -75.162  1.00 34.58 ? 152 LEU C CB    1 
ATOM   7711  C CG    . LEU C 1 152 ? -6.215  -49.183 -73.753  1.00 36.43 ? 152 LEU C CG    1 
ATOM   7712  C CD1   . LEU C 1 152 ? -4.997  -50.140 -73.790  1.00 27.68 ? 152 LEU C CD1   1 
ATOM   7713  C CD2   . LEU C 1 152 ? -5.813  -47.934 -73.044  1.00 33.48 ? 152 LEU C CD2   1 
ATOM   7714  N N     . GLY C 1 153 ? -9.216  -49.681 -77.654  1.00 36.67 ? 153 GLY C N     1 
ATOM   7715  C CA    . GLY C 1 153 ? -10.573 -49.550 -78.194  1.00 38.52 ? 153 GLY C CA    1 
ATOM   7716  C C     . GLY C 1 153 ? -11.173 -48.164 -78.045  1.00 39.08 ? 153 GLY C C     1 
ATOM   7717  O O     . GLY C 1 153 ? -12.379 -48.011 -77.922  1.00 38.78 ? 153 GLY C O     1 
ATOM   7718  N N     . CYS C 1 154 ? -10.304 -47.151 -78.016  1.00 40.09 ? 154 CYS C N     1 
ATOM   7719  C CA    . CYS C 1 154 ? -10.744 -45.774 -78.118  1.00 39.61 ? 154 CYS C CA    1 
ATOM   7720  C C     . CYS C 1 154 ? -10.959 -45.419 -79.593  1.00 39.60 ? 154 CYS C C     1 
ATOM   7721  O O     . CYS C 1 154 ? -10.473 -46.116 -80.489  1.00 38.53 ? 154 CYS C O     1 
ATOM   7722  C CB    . CYS C 1 154 ? -9.788  -44.792 -77.396  1.00 39.82 ? 154 CYS C CB    1 
ATOM   7723  S SG    . CYS C 1 154 ? -7.942  -44.814 -77.751  1.00 42.06 ? 154 CYS C SG    1 
ATOM   7724  N N     . ASN C 1 155 ? -11.765 -44.377 -79.827  1.00 39.77 ? 155 ASN C N     1 
ATOM   7725  C CA    . ASN C 1 155 ? -11.838 -43.701 -81.119  1.00 39.02 ? 155 ASN C CA    1 
ATOM   7726  C C     . ASN C 1 155 ? -10.825 -42.583 -81.029  1.00 37.23 ? 155 ASN C C     1 
ATOM   7727  O O     . ASN C 1 155 ? -10.930 -41.708 -80.191  1.00 35.87 ? 155 ASN C O     1 
ATOM   7728  C CB    . ASN C 1 155 ? -13.238 -43.096 -81.384  1.00 39.72 ? 155 ASN C CB    1 
ATOM   7729  C CG    . ASN C 1 155 ? -14.357 -44.132 -81.325  1.00 43.61 ? 155 ASN C CG    1 
ATOM   7730  O OD1   . ASN C 1 155 ? -14.299 -45.178 -81.984  1.00 44.55 ? 155 ASN C OD1   1 
ATOM   7731  N ND2   . ASN C 1 155 ? -15.391 -43.843 -80.523  1.00 47.04 ? 155 ASN C ND2   1 
ATOM   7732  N N     . ILE C 1 156 ? -9.838  -42.627 -81.904  1.00 37.08 ? 156 ILE C N     1 
ATOM   7733  C CA    . ILE C 1 156 ? -8.823  -41.563 -81.990  1.00 35.85 ? 156 ILE C CA    1 
ATOM   7734  C C     . ILE C 1 156 ? -9.363  -40.417 -82.860  1.00 33.70 ? 156 ILE C C     1 
ATOM   7735  O O     . ILE C 1 156 ? -9.863  -40.698 -83.920  1.00 32.99 ? 156 ILE C O     1 
ATOM   7736  C CB    . ILE C 1 156 ? -7.507  -42.138 -82.583  1.00 35.39 ? 156 ILE C CB    1 
ATOM   7737  C CG1   . ILE C 1 156 ? -7.134  -43.430 -81.813  1.00 37.96 ? 156 ILE C CG1   1 
ATOM   7738  C CG2   . ILE C 1 156 ? -6.428  -41.073 -82.562  1.00 36.24 ? 156 ILE C CG2   1 
ATOM   7739  C CD1   . ILE C 1 156 ? -5.714  -44.002 -82.032  1.00 35.35 ? 156 ILE C CD1   1 
ATOM   7740  N N     . ILE C 1 157 ? -9.277  -39.155 -82.407  1.00 32.07 ? 157 ILE C N     1 
ATOM   7741  C CA    . ILE C 1 157 ? -9.595  -38.006 -83.277  1.00 30.92 ? 157 ILE C CA    1 
ATOM   7742  C C     . ILE C 1 157 ? -8.392  -37.110 -83.605  1.00 30.65 ? 157 ILE C C     1 
ATOM   7743  O O     . ILE C 1 157 ? -7.768  -36.463 -82.748  1.00 29.51 ? 157 ILE C O     1 
ATOM   7744  C CB    . ILE C 1 157 ? -10.777 -37.151 -82.760  1.00 30.83 ? 157 ILE C CB    1 
ATOM   7745  C CG1   . ILE C 1 157 ? -11.964 -38.024 -82.355  1.00 29.52 ? 157 ILE C CG1   1 
ATOM   7746  C CG2   . ILE C 1 157 ? -11.160 -36.046 -83.769  1.00 27.28 ? 157 ILE C CG2   1 
ATOM   7747  C CD1   . ILE C 1 157 ? -12.676 -37.400 -81.142  1.00 29.40 ? 157 ILE C CD1   1 
ATOM   7748  N N     . ASN C 1 158 ? -8.137  -37.047 -84.894  1.00 31.46 ? 158 ASN C N     1 
ATOM   7749  C CA    . ASN C 1 158 ? -6.934  -36.473 -85.459  1.00 32.19 ? 158 ASN C CA    1 
ATOM   7750  C C     . ASN C 1 158 ? -7.118  -34.974 -85.461  1.00 32.96 ? 158 ASN C C     1 
ATOM   7751  O O     . ASN C 1 158 ? -8.189  -34.461 -85.830  1.00 34.31 ? 158 ASN C O     1 
ATOM   7752  C CB    . ASN C 1 158 ? -6.759  -37.018 -86.890  1.00 31.49 ? 158 ASN C CB    1 
ATOM   7753  C CG    . ASN C 1 158 ? -5.568  -36.372 -87.660  1.00 34.65 ? 158 ASN C CG    1 
ATOM   7754  O OD1   . ASN C 1 158 ? -4.732  -35.641 -87.102  1.00 35.73 ? 158 ASN C OD1   1 
ATOM   7755  N ND2   . ASN C 1 158 ? -5.496  -36.668 -88.947  1.00 37.00 ? 158 ASN C ND2   1 
ATOM   7756  N N     . VAL C 1 159 ? -6.090  -34.254 -85.047  1.00 33.41 ? 159 VAL C N     1 
ATOM   7757  C CA    . VAL C 1 159 ? -6.149  -32.795 -85.065  1.00 33.57 ? 159 VAL C CA    1 
ATOM   7758  C C     . VAL C 1 159 ? -5.201  -32.356 -86.158  1.00 33.39 ? 159 VAL C C     1 
ATOM   7759  O O     . VAL C 1 159 ? -4.140  -32.868 -86.242  1.00 33.45 ? 159 VAL C O     1 
ATOM   7760  C CB    . VAL C 1 159 ? -5.749  -32.206 -83.708  1.00 32.73 ? 159 VAL C CB    1 
ATOM   7761  C CG1   . VAL C 1 159 ? -5.845  -30.708 -83.725  1.00 34.45 ? 159 VAL C CG1   1 
ATOM   7762  C CG2   . VAL C 1 159 ? -6.653  -32.752 -82.595  1.00 32.94 ? 159 VAL C CG2   1 
ATOM   7763  N N     . ALA C 1 160 ? -5.578  -31.417 -87.014  1.00 34.25 ? 160 ALA C N     1 
ATOM   7764  C CA    . ALA C 1 160 ? -4.652  -31.042 -88.063  1.00 34.45 ? 160 ALA C CA    1 
ATOM   7765  C C     . ALA C 1 160 ? -3.389  -30.569 -87.362  1.00 34.82 ? 160 ALA C C     1 
ATOM   7766  O O     . ALA C 1 160 ? -3.446  -29.926 -86.290  1.00 33.01 ? 160 ALA C O     1 
ATOM   7767  C CB    . ALA C 1 160 ? -5.224  -29.944 -88.937  1.00 35.23 ? 160 ALA C CB    1 
ATOM   7768  N N     . SER C 1 161 ? -2.239  -30.905 -87.929  1.00 35.19 ? 161 SER C N     1 
ATOM   7769  C CA    . SER C 1 161 ? -0.999  -30.411 -87.323  1.00 36.49 ? 161 SER C CA    1 
ATOM   7770  C C     . SER C 1 161 ? -0.260  -29.764 -88.444  1.00 37.78 ? 161 SER C C     1 
ATOM   7771  O O     . SER C 1 161 ? -0.623  -29.999 -89.620  1.00 38.08 ? 161 SER C O     1 
ATOM   7772  C CB    . SER C 1 161 ? -0.180  -31.522 -86.676  1.00 35.40 ? 161 SER C CB    1 
ATOM   7773  O OG    . SER C 1 161 ? 0.137   -32.527 -87.634  1.00 36.60 ? 161 SER C OG    1 
ATOM   7774  N N     . ASP C 1 162 ? 0.734   -28.935 -88.111  1.00 38.21 ? 162 ASP C N     1 
ATOM   7775  C CA    . ASP C 1 162 ? 1.652   -28.444 -89.136  1.00 39.17 ? 162 ASP C CA    1 
ATOM   7776  C C     . ASP C 1 162 ? 3.066   -28.249 -88.571  1.00 40.69 ? 162 ASP C C     1 
ATOM   7777  O O     . ASP C 1 162 ? 3.432   -28.925 -87.597  1.00 41.37 ? 162 ASP C O     1 
ATOM   7778  C CB    . ASP C 1 162 ? 1.086   -27.203 -89.862  1.00 38.92 ? 162 ASP C CB    1 
ATOM   7779  C CG    . ASP C 1 162 ? 0.843   -26.005 -88.941  1.00 37.40 ? 162 ASP C CG    1 
ATOM   7780  O OD1   . ASP C 1 162 ? 1.562   -25.823 -87.940  1.00 39.10 ? 162 ASP C OD1   1 
ATOM   7781  O OD2   . ASP C 1 162 ? -0.046  -25.196 -89.254  1.00 35.05 ? 162 ASP C OD2   1 
ATOM   7782  N N     . GLU C 1 163 ? 3.847   -27.357 -89.185  1.00 41.35 ? 163 GLU C N     1 
ATOM   7783  C CA    . GLU C 1 163 ? 5.209   -27.042 -88.741  1.00 42.91 ? 163 GLU C CA    1 
ATOM   7784  C C     . GLU C 1 163 ? 5.286   -26.486 -87.319  1.00 41.60 ? 163 GLU C C     1 
ATOM   7785  O O     . GLU C 1 163 ? 6.348   -26.574 -86.704  1.00 41.92 ? 163 GLU C O     1 
ATOM   7786  C CB    . GLU C 1 163 ? 5.950   -26.118 -89.726  1.00 42.73 ? 163 GLU C CB    1 
ATOM   7787  C CG    . GLU C 1 163 ? 5.245   -24.806 -90.085  1.00 45.82 ? 163 GLU C CG    1 
ATOM   7788  C CD    . GLU C 1 163 ? 5.946   -24.022 -91.226  1.00 47.16 ? 163 GLU C CD    1 
ATOM   7789  O OE1   . GLU C 1 163 ? 5.234   -23.229 -91.900  1.00 50.94 ? 163 GLU C OE1   1 
ATOM   7790  O OE2   . GLU C 1 163 ? 7.192   -24.178 -91.442  1.00 50.36 ? 163 GLU C OE2   1 
ATOM   7791  N N     . SER C 1 164 ? 4.168   -25.955 -86.807  1.00 39.70 ? 164 SER C N     1 
ATOM   7792  C CA    . SER C 1 164 ? 4.066   -25.517 -85.388  1.00 38.16 ? 164 SER C CA    1 
ATOM   7793  C C     . SER C 1 164 ? 3.285   -26.473 -84.443  1.00 37.19 ? 164 SER C C     1 
ATOM   7794  O O     . SER C 1 164 ? 2.843   -26.036 -83.399  1.00 36.39 ? 164 SER C O     1 
ATOM   7795  C CB    . SER C 1 164 ? 3.424   -24.120 -85.298  1.00 37.87 ? 164 SER C CB    1 
ATOM   7796  O OG    . SER C 1 164 ? 4.249   -23.092 -85.836  1.00 37.65 ? 164 SER C OG    1 
ATOM   7797  N N     . GLY C 1 165 ? 3.162   -27.763 -84.788  1.00 36.21 ? 165 GLY C N     1 
ATOM   7798  C CA    . GLY C 1 165 ? 2.342   -28.712 -84.041  1.00 35.43 ? 165 GLY C CA    1 
ATOM   7799  C C     . GLY C 1 165 ? 0.834   -28.564 -84.282  1.00 35.95 ? 165 GLY C C     1 
ATOM   7800  O O     . GLY C 1 165 ? 0.366   -28.131 -85.358  1.00 35.51 ? 165 GLY C O     1 
ATOM   7801  N N     . ILE C 1 166 ? 0.069   -28.876 -83.245  1.00 35.93 ? 166 ILE C N     1 
ATOM   7802  C CA    . ILE C 1 166 ? -1.379  -28.895 -83.317  1.00 35.36 ? 166 ILE C CA    1 
ATOM   7803  C C     . ILE C 1 166 ? -1.894  -27.521 -83.732  1.00 33.96 ? 166 ILE C C     1 
ATOM   7804  O O     . ILE C 1 166 ? -1.486  -26.479 -83.181  1.00 33.87 ? 166 ILE C O     1 
ATOM   7805  C CB    . ILE C 1 166 ? -1.964  -29.391 -81.960  1.00 36.23 ? 166 ILE C CB    1 
ATOM   7806  C CG1   . ILE C 1 166 ? -1.899  -30.910 -81.904  1.00 38.36 ? 166 ILE C CG1   1 
ATOM   7807  C CG2   . ILE C 1 166 ? -3.427  -28.966 -81.739  1.00 37.21 ? 166 ILE C CG2   1 
ATOM   7808  C CD1   . ILE C 1 166 ? -1.944  -31.444 -80.462  1.00 40.01 ? 166 ILE C CD1   1 
ATOM   7809  N N     . VAL C 1 167 ? -2.757  -27.513 -84.743  1.00 32.26 ? 167 VAL C N     1 
ATOM   7810  C CA    . VAL C 1 167 ? -3.428  -26.275 -85.146  1.00 30.18 ? 167 VAL C CA    1 
ATOM   7811  C C     . VAL C 1 167 ? -4.619  -26.136 -84.167  1.00 30.15 ? 167 VAL C C     1 
ATOM   7812  O O     . VAL C 1 167 ? -5.529  -26.973 -84.195  1.00 29.98 ? 167 VAL C O     1 
ATOM   7813  C CB    . VAL C 1 167 ? -3.829  -26.333 -86.667  1.00 31.62 ? 167 VAL C CB    1 
ATOM   7814  C CG1   . VAL C 1 167 ? -4.731  -25.114 -87.133  1.00 30.22 ? 167 VAL C CG1   1 
ATOM   7815  C CG2   . VAL C 1 167 ? -2.535  -26.529 -87.607  1.00 27.07 ? 167 VAL C CG2   1 
ATOM   7816  N N     . PRO C 1 168 ? -4.607  -25.090 -83.300  1.00 28.59 ? 168 PRO C N     1 
ATOM   7817  C CA    . PRO C 1 168 ? -5.596  -24.917 -82.275  1.00 28.92 ? 168 PRO C CA    1 
ATOM   7818  C C     . PRO C 1 168 ? -6.988  -24.715 -82.851  1.00 30.54 ? 168 PRO C C     1 
ATOM   7819  O O     . PRO C 1 168 ? -7.976  -25.202 -82.252  1.00 29.82 ? 168 PRO C O     1 
ATOM   7820  C CB    . PRO C 1 168 ? -5.150  -23.648 -81.541  1.00 29.41 ? 168 PRO C CB    1 
ATOM   7821  C CG    . PRO C 1 168 ? -3.751  -23.339 -82.018  1.00 26.79 ? 168 PRO C CG    1 
ATOM   7822  C CD    . PRO C 1 168 ? -3.635  -23.976 -83.337  1.00 28.56 ? 168 PRO C CD    1 
ATOM   7823  N N     . ASP C 1 169 ? -7.072  -24.046 -84.007  1.00 31.31 ? 169 ASP C N     1 
ATOM   7824  C CA    . ASP C 1 169 ? -8.345  -23.950 -84.730  1.00 32.94 ? 169 ASP C CA    1 
ATOM   7825  C C     . ASP C 1 169 ? -8.887  -25.277 -85.159  1.00 34.48 ? 169 ASP C C     1 
ATOM   7826  O O     . ASP C 1 169 ? -10.106 -25.436 -85.261  1.00 35.79 ? 169 ASP C O     1 
ATOM   7827  C CB    . ASP C 1 169 ? -8.264  -23.065 -85.981  1.00 32.05 ? 169 ASP C CB    1 
ATOM   7828  C CG    . ASP C 1 169 ? -8.180  -21.642 -85.634  1.00 30.76 ? 169 ASP C CG    1 
ATOM   7829  O OD1   . ASP C 1 169 ? -8.411  -21.314 -84.424  1.00 30.60 ? 169 ASP C OD1   1 
ATOM   7830  O OD2   . ASP C 1 169 ? -7.828  -20.879 -86.542  1.00 28.28 ? 169 ASP C OD2   1 
ATOM   7831  N N     . SER C 1 170 ? -8.012  -26.211 -85.490  1.00 35.45 ? 170 SER C N     1 
ATOM   7832  C CA    . SER C 1 170 ? -8.516  -27.514 -85.864  1.00 36.94 ? 170 SER C CA    1 
ATOM   7833  C C     . SER C 1 170 ? -9.032  -28.130 -84.548  1.00 37.74 ? 170 SER C C     1 
ATOM   7834  O O     . SER C 1 170 ? -9.950  -28.947 -84.541  1.00 38.20 ? 170 SER C O     1 
ATOM   7835  C CB    . SER C 1 170 ? -7.406  -28.328 -86.498  1.00 37.52 ? 170 SER C CB    1 
ATOM   7836  O OG    . SER C 1 170 ? -7.768  -29.678 -86.717  1.00 39.04 ? 170 SER C OG    1 
ATOM   7837  N N     . LEU C 1 171 ? -8.464  -27.680 -83.434  1.00 37.15 ? 171 LEU C N     1 
ATOM   7838  C CA    . LEU C 1 171 ? -8.866  -28.187 -82.150  1.00 37.79 ? 171 LEU C CA    1 
ATOM   7839  C C     . LEU C 1 171 ? -10.270 -27.633 -81.759  1.00 38.57 ? 171 LEU C C     1 
ATOM   7840  O O     . LEU C 1 171 ? -11.181 -28.403 -81.469  1.00 37.89 ? 171 LEU C O     1 
ATOM   7841  C CB    . LEU C 1 171 ? -7.771  -27.962 -81.066  1.00 36.92 ? 171 LEU C CB    1 
ATOM   7842  C CG    . LEU C 1 171 ? -8.098  -28.568 -79.691  1.00 36.17 ? 171 LEU C CG    1 
ATOM   7843  C CD1   . LEU C 1 171 ? -8.417  -30.066 -79.828  1.00 33.76 ? 171 LEU C CD1   1 
ATOM   7844  C CD2   . LEU C 1 171 ? -7.022  -28.304 -78.603  1.00 36.82 ? 171 LEU C CD2   1 
ATOM   7845  N N     . ARG C 1 172 ? -10.408 -26.310 -81.768  1.00 39.21 ? 172 ARG C N     1 
ATOM   7846  C CA    . ARG C 1 172 ? -11.677 -25.630 -81.550  1.00 40.51 ? 172 ARG C CA    1 
ATOM   7847  C C     . ARG C 1 172 ? -12.795 -26.214 -82.418  1.00 40.90 ? 172 ARG C C     1 
ATOM   7848  O O     . ARG C 1 172 ? -13.826 -26.694 -81.875  1.00 40.16 ? 172 ARG C O     1 
ATOM   7849  C CB    . ARG C 1 172 ? -11.508 -24.127 -81.805  1.00 41.17 ? 172 ARG C CB    1 
ATOM   7850  C CG    . ARG C 1 172 ? -12.616 -23.242 -81.268  1.00 43.52 ? 172 ARG C CG    1 
ATOM   7851  C CD    . ARG C 1 172 ? -12.123 -21.821 -80.919  1.00 48.57 ? 172 ARG C CD    1 
ATOM   7852  N NE    . ARG C 1 172 ? -11.116 -21.849 -79.849  1.00 52.92 ? 172 ARG C NE    1 
ATOM   7853  C CZ    . ARG C 1 172 ? -9.803  -21.678 -80.044  1.00 53.46 ? 172 ARG C CZ    1 
ATOM   7854  N NH1   . ARG C 1 172 ? -9.328  -21.429 -81.266  1.00 53.67 ? 172 ARG C NH1   1 
ATOM   7855  N NH2   . ARG C 1 172 ? -8.964  -21.744 -79.014  1.00 53.83 ? 172 ARG C NH2   1 
ATOM   7856  N N     . ASP C 1 173 ? -12.572 -26.228 -83.738  1.00 40.56 ? 173 ASP C N     1 
ATOM   7857  C CA    . ASP C 1 173 ? -13.588 -26.696 -84.665  1.00 41.85 ? 173 ASP C CA    1 
ATOM   7858  C C     . ASP C 1 173 ? -14.001 -28.156 -84.418  1.00 42.91 ? 173 ASP C C     1 
ATOM   7859  O O     . ASP C 1 173 ? -15.175 -28.540 -84.674  1.00 43.28 ? 173 ASP C O     1 
ATOM   7860  C CB    . ASP C 1 173 ? -13.176 -26.492 -86.131  1.00 42.14 ? 173 ASP C CB    1 
ATOM   7861  C CG    . ASP C 1 173 ? -12.852 -25.020 -86.479  1.00 43.23 ? 173 ASP C CG    1 
ATOM   7862  O OD1   . ASP C 1 173 ? -12.631 -24.745 -87.687  1.00 44.67 ? 173 ASP C OD1   1 
ATOM   7863  O OD2   . ASP C 1 173 ? -12.792 -24.137 -85.577  1.00 43.03 ? 173 ASP C OD2   1 
ATOM   7864  N N     . ILE C 1 174 ? -13.060 -28.972 -83.937  1.00 43.14 ? 174 ILE C N     1 
ATOM   7865  C CA    . ILE C 1 174 ? -13.367 -30.383 -83.622  1.00 43.78 ? 174 ILE C CA    1 
ATOM   7866  C C     . ILE C 1 174 ? -14.249 -30.491 -82.377  1.00 44.28 ? 174 ILE C C     1 
ATOM   7867  O O     . ILE C 1 174 ? -15.210 -31.273 -82.350  1.00 44.34 ? 174 ILE C O     1 
ATOM   7868  C CB    . ILE C 1 174 ? -12.074 -31.245 -83.481  1.00 44.28 ? 174 ILE C CB    1 
ATOM   7869  C CG1   . ILE C 1 174 ? -11.620 -31.685 -84.868  1.00 43.66 ? 174 ILE C CG1   1 
ATOM   7870  C CG2   . ILE C 1 174 ? -12.294 -32.496 -82.595  1.00 43.21 ? 174 ILE C CG2   1 
ATOM   7871  C CD1   . ILE C 1 174 ? -10.291 -32.302 -84.840  1.00 48.36 ? 174 ILE C CD1   1 
ATOM   7872  N N     . LEU C 1 175 ? -13.924 -29.661 -81.385  1.00 43.84 ? 175 LEU C N     1 
ATOM   7873  C CA    . LEU C 1 175 ? -14.559 -29.664 -80.093  1.00 43.94 ? 175 LEU C CA    1 
ATOM   7874  C C     . LEU C 1 175 ? -15.949 -29.039 -80.166  1.00 44.57 ? 175 LEU C C     1 
ATOM   7875  O O     . LEU C 1 175 ? -16.787 -29.289 -79.291  1.00 44.78 ? 175 LEU C O     1 
ATOM   7876  C CB    . LEU C 1 175 ? -13.675 -28.908 -79.079  1.00 43.67 ? 175 LEU C CB    1 
ATOM   7877  C CG    . LEU C 1 175 ? -12.322 -29.547 -78.687  1.00 43.42 ? 175 LEU C CG    1 
ATOM   7878  C CD1   . LEU C 1 175 ? -11.431 -28.582 -77.913  1.00 41.61 ? 175 LEU C CD1   1 
ATOM   7879  C CD2   . LEU C 1 175 ? -12.543 -30.830 -77.917  1.00 42.54 ? 175 LEU C CD2   1 
ATOM   7880  N N     . SER C 1 176 ? -16.188 -28.235 -81.197  1.00 44.78 ? 176 SER C N     1 
ATOM   7881  C CA    . SER C 1 176 ? -17.498 -27.631 -81.410  1.00 44.58 ? 176 SER C CA    1 
ATOM   7882  C C     . SER C 1 176 ? -18.567 -28.694 -81.631  1.00 44.75 ? 176 SER C C     1 
ATOM   7883  O O     . SER C 1 176 ? -19.761 -28.425 -81.501  1.00 45.42 ? 176 SER C O     1 
ATOM   7884  C CB    . SER C 1 176 ? -17.458 -26.670 -82.601  1.00 44.28 ? 176 SER C CB    1 
ATOM   7885  O OG    . SER C 1 176 ? -16.960 -27.316 -83.760  1.00 44.99 ? 176 SER C OG    1 
ATOM   7886  N N     . ARG C 1 177 ? -18.131 -29.904 -81.964  1.00 45.34 ? 177 ARG C N     1 
ATOM   7887  C CA    . ARG C 1 177 ? -18.980 -31.084 -81.849  1.00 45.83 ? 177 ARG C CA    1 
ATOM   7888  C C     . ARG C 1 177 ? -19.842 -31.022 -80.592  1.00 45.95 ? 177 ARG C C     1 
ATOM   7889  O O     . ARG C 1 177 ? -20.959 -31.540 -80.568  1.00 46.79 ? 177 ARG C O     1 
ATOM   7890  C CB    . ARG C 1 177 ? -18.131 -32.357 -81.841  1.00 45.64 ? 177 ARG C CB    1 
ATOM   7891  C CG    . ARG C 1 177 ? -18.848 -33.584 -82.379  1.00 47.20 ? 177 ARG C CG    1 
ATOM   7892  C CD    . ARG C 1 177 ? -18.139 -34.896 -82.084  1.00 46.97 ? 177 ARG C CD    1 
ATOM   7893  N NE    . ARG C 1 177 ? -17.419 -35.403 -83.249  1.00 49.43 ? 177 ARG C NE    1 
ATOM   7894  C CZ    . ARG C 1 177 ? -16.440 -34.751 -83.861  1.00 47.70 ? 177 ARG C CZ    1 
ATOM   7895  N NH1   . ARG C 1 177 ? -16.058 -33.559 -83.422  1.00 47.25 ? 177 ARG C NH1   1 
ATOM   7896  N NH2   . ARG C 1 177 ? -15.841 -35.287 -84.915  1.00 42.94 ? 177 ARG C NH2   1 
ATOM   7897  N N     . TRP C 1 178 ? -19.316 -30.386 -79.551  1.00 44.85 ? 178 TRP C N     1 
ATOM   7898  C CA    . TRP C 1 178 ? -19.942 -30.425 -78.234  1.00 43.65 ? 178 TRP C CA    1 
ATOM   7899  C C     . TRP C 1 178 ? -20.220 -29.018 -77.715  1.00 44.27 ? 178 TRP C C     1 
ATOM   7900  O O     . TRP C 1 178 ? -19.711 -28.036 -78.254  1.00 43.85 ? 178 TRP C O     1 
ATOM   7901  C CB    . TRP C 1 178 ? -19.059 -31.187 -77.244  1.00 43.31 ? 178 TRP C CB    1 
ATOM   7902  C CG    . TRP C 1 178 ? -18.863 -32.627 -77.600  1.00 40.82 ? 178 TRP C CG    1 
ATOM   7903  C CD1   . TRP C 1 178 ? -19.747 -33.649 -77.404  1.00 40.61 ? 178 TRP C CD1   1 
ATOM   7904  C CD2   . TRP C 1 178 ? -17.710 -33.211 -78.216  1.00 40.72 ? 178 TRP C CD2   1 
ATOM   7905  N NE1   . TRP C 1 178 ? -19.214 -34.831 -77.859  1.00 41.12 ? 178 TRP C NE1   1 
ATOM   7906  C CE2   . TRP C 1 178 ? -17.964 -34.590 -78.364  1.00 40.46 ? 178 TRP C CE2   1 
ATOM   7907  C CE3   . TRP C 1 178 ? -16.483 -32.708 -78.661  1.00 39.43 ? 178 TRP C CE3   1 
ATOM   7908  C CZ2   . TRP C 1 178 ? -17.041 -35.465 -78.933  1.00 41.28 ? 178 TRP C CZ2   1 
ATOM   7909  C CZ3   . TRP C 1 178 ? -15.569 -33.579 -79.226  1.00 41.57 ? 178 TRP C CZ3   1 
ATOM   7910  C CH2   . TRP C 1 178 ? -15.852 -34.941 -79.357  1.00 41.28 ? 178 TRP C CH2   1 
ATOM   7911  N N     . LYS C 1 179 ? -21.030 -28.930 -76.665  1.00 44.40 ? 179 LYS C N     1 
ATOM   7912  C CA    . LYS C 1 179 ? -21.129 -27.717 -75.879  1.00 44.80 ? 179 LYS C CA    1 
ATOM   7913  C C     . LYS C 1 179 ? -20.161 -28.029 -74.759  1.00 44.09 ? 179 LYS C C     1 
ATOM   7914  O O     . LYS C 1 179 ? -19.973 -29.200 -74.473  1.00 43.60 ? 179 LYS C O     1 
ATOM   7915  C CB    . LYS C 1 179 ? -22.561 -27.565 -75.304  1.00 44.51 ? 179 LYS C CB    1 
ATOM   7916  C CG    . LYS C 1 179 ? -23.675 -27.391 -76.358  1.00 45.78 ? 179 LYS C CG    1 
ATOM   7917  C CD    . LYS C 1 179 ? -25.116 -27.427 -75.788  1.00 45.39 ? 179 LYS C CD    1 
ATOM   7918  C CE    . LYS C 1 179 ? -25.735 -28.877 -75.737  1.00 45.27 ? 179 LYS C CE    1 
ATOM   7919  N NZ    . LYS C 1 179 ? -25.638 -29.622 -77.043  1.00 43.79 ? 179 LYS C NZ    1 
ATOM   7920  N N     . PRO C 1 180 ? -19.537 -26.999 -74.138  1.00 44.59 ? 180 PRO C N     1 
ATOM   7921  C CA    . PRO C 1 180 ? -18.749 -27.183 -72.901  1.00 44.90 ? 180 PRO C CA    1 
ATOM   7922  C C     . PRO C 1 180 ? -19.472 -27.956 -71.796  1.00 46.69 ? 180 PRO C C     1 
ATOM   7923  O O     . PRO C 1 180 ? -18.855 -28.860 -71.162  1.00 46.78 ? 180 PRO C O     1 
ATOM   7924  C CB    . PRO C 1 180 ? -18.511 -25.744 -72.422  1.00 44.72 ? 180 PRO C CB    1 
ATOM   7925  C CG    . PRO C 1 180 ? -18.603 -24.893 -73.627  1.00 44.44 ? 180 PRO C CG    1 
ATOM   7926  C CD    . PRO C 1 180 ? -19.500 -25.605 -74.622  1.00 44.26 ? 180 PRO C CD    1 
ATOM   7927  N N     . GLU C 1 181 ? -20.752 -27.601 -71.559  1.00 47.65 ? 181 GLU C N     1 
ATOM   7928  C CA    . GLU C 1 181 ? -21.609 -28.237 -70.535  1.00 49.57 ? 181 GLU C CA    1 
ATOM   7929  C C     . GLU C 1 181 ? -21.699 -29.749 -70.720  1.00 48.79 ? 181 GLU C C     1 
ATOM   7930  O O     . GLU C 1 181 ? -22.053 -30.477 -69.775  1.00 48.44 ? 181 GLU C O     1 
ATOM   7931  C CB    . GLU C 1 181 ? -23.037 -27.609 -70.479  1.00 50.34 ? 181 GLU C CB    1 
ATOM   7932  C CG    . GLU C 1 181 ? -23.756 -27.425 -71.839  1.00 52.54 ? 181 GLU C CG    1 
ATOM   7933  C CD    . GLU C 1 181 ? -25.297 -27.349 -71.725  1.00 52.90 ? 181 GLU C CD    1 
ATOM   7934  O OE1   . GLU C 1 181 ? -25.995 -27.967 -72.569  1.00 54.55 ? 181 GLU C OE1   1 
ATOM   7935  O OE2   . GLU C 1 181 ? -25.814 -26.666 -70.809  1.00 57.26 ? 181 GLU C OE2   1 
ATOM   7936  N N     . ASP C 1 182 ? -21.382 -30.192 -71.941  1.00 48.08 ? 182 ASP C N     1 
ATOM   7937  C CA    . ASP C 1 182 ? -21.368 -31.603 -72.305  1.00 47.87 ? 182 ASP C CA    1 
ATOM   7938  C C     . ASP C 1 182 ? -20.240 -32.401 -71.530  1.00 47.98 ? 182 ASP C C     1 
ATOM   7939  O O     . ASP C 1 182 ? -20.343 -33.619 -71.323  1.00 46.99 ? 182 ASP C O     1 
ATOM   7940  C CB    . ASP C 1 182 ? -21.228 -31.721 -73.843  1.00 48.39 ? 182 ASP C CB    1 
ATOM   7941  C CG    . ASP C 1 182 ? -22.539 -31.310 -74.639  1.00 49.07 ? 182 ASP C CG    1 
ATOM   7942  O OD1   . ASP C 1 182 ? -22.500 -31.303 -75.899  1.00 49.75 ? 182 ASP C OD1   1 
ATOM   7943  O OD2   . ASP C 1 182 ? -23.600 -31.026 -74.036  1.00 45.19 ? 182 ASP C OD2   1 
ATOM   7944  N N     . ALA C 1 183 ? -19.179 -31.701 -71.106  1.00 47.29 ? 183 ALA C N     1 
ATOM   7945  C CA    . ALA C 1 183 ? -18.085 -32.320 -70.349  1.00 47.41 ? 183 ALA C CA    1 
ATOM   7946  C C     . ALA C 1 183 ? -18.510 -32.942 -68.994  1.00 47.22 ? 183 ALA C C     1 
ATOM   7947  O O     . ALA C 1 183 ? -17.961 -33.987 -68.588  1.00 46.87 ? 183 ALA C O     1 
ATOM   7948  C CB    . ALA C 1 183 ? -16.929 -31.321 -70.151  1.00 47.78 ? 183 ALA C CB    1 
ATOM   7949  N N     . LYS C 1 184 ? -19.474 -32.317 -68.304  1.00 46.75 ? 184 LYS C N     1 
ATOM   7950  C CA    . LYS C 1 184 ? -20.005 -32.871 -67.045  1.00 46.26 ? 184 LYS C CA    1 
ATOM   7951  C C     . LYS C 1 184 ? -20.998 -33.972 -67.299  1.00 45.94 ? 184 LYS C C     1 
ATOM   7952  O O     . LYS C 1 184 ? -21.466 -34.631 -66.375  1.00 45.44 ? 184 LYS C O     1 
ATOM   7953  C CB    . LYS C 1 184 ? -20.554 -31.795 -66.091  1.00 46.36 ? 184 LYS C CB    1 
ATOM   7954  C CG    . LYS C 1 184 ? -19.488 -31.339 -65.031  1.00 45.73 ? 184 LYS C CG    1 
ATOM   7955  C CD    . LYS C 1 184 ? -19.995 -30.304 -63.993  1.00 47.04 ? 184 LYS C CD    1 
ATOM   7956  C CE    . LYS C 1 184 ? -19.487 -28.892 -64.229  1.00 46.53 ? 184 LYS C CE    1 
ATOM   7957  N NZ    . LYS C 1 184 ? -20.176 -28.283 -65.419  1.00 47.65 ? 184 LYS C NZ    1 
ATOM   7958  N N     . ASN C 1 185 ? -21.243 -34.215 -68.578  1.00 45.56 ? 185 ASN C N     1 
ATOM   7959  C CA    . ASN C 1 185 ? -22.307 -35.078 -69.012  1.00 45.80 ? 185 ASN C CA    1 
ATOM   7960  C C     . ASN C 1 185 ? -21.637 -36.285 -69.637  1.00 45.46 ? 185 ASN C C     1 
ATOM   7961  O O     . ASN C 1 185 ? -21.231 -36.249 -70.806  1.00 46.16 ? 185 ASN C O     1 
ATOM   7962  C CB    . ASN C 1 185 ? -23.242 -34.298 -69.992  1.00 45.80 ? 185 ASN C CB    1 
ATOM   7963  C CG    . ASN C 1 185 ? -24.472 -35.094 -70.434  1.00 46.11 ? 185 ASN C CG    1 
ATOM   7964  O OD1   . ASN C 1 185 ? -25.474 -34.500 -70.852  1.00 46.47 ? 185 ASN C OD1   1 
ATOM   7965  N ND2   . ASN C 1 185 ? -24.405 -36.431 -70.349  1.00 44.00 ? 185 ASN C ND2   1 
ATOM   7966  N N     . PRO C 1 186 ? -21.479 -37.355 -68.844  1.00 45.52 ? 186 PRO C N     1 
ATOM   7967  C CA    . PRO C 1 186 ? -20.664 -38.509 -69.289  1.00 44.97 ? 186 PRO C CA    1 
ATOM   7968  C C     . PRO C 1 186 ? -21.131 -39.171 -70.590  1.00 44.80 ? 186 PRO C C     1 
ATOM   7969  O O     . PRO C 1 186 ? -20.308 -39.710 -71.343  1.00 44.32 ? 186 PRO C O     1 
ATOM   7970  C CB    . PRO C 1 186 ? -20.741 -39.492 -68.087  1.00 44.84 ? 186 PRO C CB    1 
ATOM   7971  C CG    . PRO C 1 186 ? -21.072 -38.613 -66.888  1.00 44.49 ? 186 PRO C CG    1 
ATOM   7972  C CD    . PRO C 1 186 ? -22.002 -37.542 -67.467  1.00 45.68 ? 186 PRO C CD    1 
ATOM   7973  N N     . GLN C 1 187 ? -22.434 -39.125 -70.861  1.00 44.54 ? 187 GLN C N     1 
ATOM   7974  C CA    . GLN C 1 187 ? -22.990 -39.969 -71.913  1.00 44.43 ? 187 GLN C CA    1 
ATOM   7975  C C     . GLN C 1 187 ? -22.758 -39.317 -73.312  1.00 44.37 ? 187 GLN C C     1 
ATOM   7976  O O     . GLN C 1 187 ? -22.931 -39.952 -74.364  1.00 42.92 ? 187 GLN C O     1 
ATOM   7977  C CB    . GLN C 1 187 ? -24.460 -40.393 -71.597  1.00 44.05 ? 187 GLN C CB    1 
ATOM   7978  C CG    . GLN C 1 187 ? -24.702 -41.019 -70.152  1.00 44.47 ? 187 GLN C CG    1 
ATOM   7979  C CD    . GLN C 1 187 ? -24.588 -42.628 -69.978  1.00 46.67 ? 187 GLN C CD    1 
ATOM   7980  O OE1   . GLN C 1 187 ? -24.485 -43.138 -68.825  1.00 43.75 ? 187 GLN C OE1   1 
ATOM   7981  N NE2   . GLN C 1 187 ? -24.630 -43.390 -71.098  1.00 45.43 ? 187 GLN C NE2   1 
ATOM   7982  N N     . LYS C 1 188 ? -22.300 -38.068 -73.301  1.00 44.37 ? 188 LYS C N     1 
ATOM   7983  C CA    . LYS C 1 188 ? -22.010 -37.316 -74.523  1.00 44.09 ? 188 LYS C CA    1 
ATOM   7984  C C     . LYS C 1 188 ? -20.739 -37.735 -75.247  1.00 43.58 ? 188 LYS C C     1 
ATOM   7985  O O     . LYS C 1 188 ? -20.632 -37.570 -76.451  1.00 43.41 ? 188 LYS C O     1 
ATOM   7986  C CB    . LYS C 1 188 ? -21.931 -35.819 -74.233  1.00 44.83 ? 188 LYS C CB    1 
ATOM   7987  C CG    . LYS C 1 188 ? -23.200 -35.191 -73.707  1.00 46.59 ? 188 LYS C CG    1 
ATOM   7988  C CD    . LYS C 1 188 ? -24.355 -35.327 -74.667  1.00 51.13 ? 188 LYS C CD    1 
ATOM   7989  C CE    . LYS C 1 188 ? -24.645 -34.027 -75.360  1.00 53.41 ? 188 LYS C CE    1 
ATOM   7990  N NZ    . LYS C 1 188 ? -23.784 -33.873 -76.556  1.00 55.37 ? 188 LYS C NZ    1 
ATOM   7991  N N     . ASN C 1 189 ? -19.770 -38.256 -74.510  1.00 42.36 ? 189 ASN C N     1 
ATOM   7992  C CA    . ASN C 1 189 ? -18.571 -38.806 -75.118  1.00 41.52 ? 189 ASN C CA    1 
ATOM   7993  C C     . ASN C 1 189 ? -17.543 -37.742 -75.402  1.00 39.90 ? 189 ASN C C     1 
ATOM   7994  O O     . ASN C 1 189 ? -16.727 -37.875 -76.292  1.00 39.71 ? 189 ASN C O     1 
ATOM   7995  C CB    . ASN C 1 189 ? -18.926 -39.515 -76.413  1.00 41.75 ? 189 ASN C CB    1 
ATOM   7996  C CG    . ASN C 1 189 ? -18.858 -41.002 -76.288  1.00 43.47 ? 189 ASN C CG    1 
ATOM   7997  O OD1   . ASN C 1 189 ? -19.255 -41.561 -75.273  1.00 44.57 ? 189 ASN C OD1   1 
ATOM   7998  N ND2   . ASN C 1 189 ? -18.361 -41.659 -77.317  1.00 44.62 ? 189 ASN C ND2   1 
ATOM   7999  N N     . THR C 1 190 ? -17.596 -36.676 -74.638  1.00 38.49 ? 190 THR C N     1 
ATOM   8000  C CA    . THR C 1 190 ? -16.518 -35.731 -74.657  1.00 38.91 ? 190 THR C CA    1 
ATOM   8001  C C     . THR C 1 190 ? -15.163 -36.429 -74.551  1.00 38.23 ? 190 THR C C     1 
ATOM   8002  O O     . THR C 1 190 ? -14.983 -37.385 -73.802  1.00 38.10 ? 190 THR C O     1 
ATOM   8003  C CB    . THR C 1 190 ? -16.704 -34.684 -73.561  1.00 39.15 ? 190 THR C CB    1 
ATOM   8004  O OG1   . THR C 1 190 ? -17.490 -35.228 -72.501  1.00 38.12 ? 190 THR C OG1   1 
ATOM   8005  C CG2   . THR C 1 190 ? -17.546 -33.558 -74.070  1.00 37.55 ? 190 THR C CG2   1 
ATOM   8006  N N     . PRO C 1 191 ? -14.207 -35.950 -75.323  1.00 37.31 ? 191 PRO C N     1 
ATOM   8007  C CA    . PRO C 1 191 ? -12.872 -36.521 -75.279  1.00 36.40 ? 191 PRO C CA    1 
ATOM   8008  C C     . PRO C 1 191 ? -12.369 -36.616 -73.850  1.00 35.29 ? 191 PRO C C     1 
ATOM   8009  O O     . PRO C 1 191 ? -12.693 -35.778 -73.029  1.00 35.21 ? 191 PRO C O     1 
ATOM   8010  C CB    . PRO C 1 191 ? -12.059 -35.528 -76.091  1.00 35.48 ? 191 PRO C CB    1 
ATOM   8011  C CG    . PRO C 1 191 ? -13.008 -35.007 -77.042  1.00 36.64 ? 191 PRO C CG    1 
ATOM   8012  C CD    . PRO C 1 191 ? -14.303 -34.885 -76.326  1.00 37.91 ? 191 PRO C CD    1 
ATOM   8013  N N     . LYS C 1 192 ? -11.589 -37.642 -73.562  1.00 34.41 ? 192 LYS C N     1 
ATOM   8014  C CA    . LYS C 1 192 ? -10.998 -37.801 -72.245  1.00 33.89 ? 192 LYS C CA    1 
ATOM   8015  C C     . LYS C 1 192 ? -9.706  -37.026 -72.123  1.00 32.25 ? 192 LYS C C     1 
ATOM   8016  O O     . LYS C 1 192 ? -9.371  -36.540 -71.061  1.00 32.24 ? 192 LYS C O     1 
ATOM   8017  C CB    . LYS C 1 192 ? -10.750 -39.279 -71.947  1.00 34.03 ? 192 LYS C CB    1 
ATOM   8018  C CG    . LYS C 1 192 ? -11.622 -39.864 -70.859  1.00 33.73 ? 192 LYS C CG    1 
ATOM   8019  C CD    . LYS C 1 192 ? -13.074 -39.637 -71.140  1.00 33.00 ? 192 LYS C CD    1 
ATOM   8020  C CE    . LYS C 1 192 ? -13.943 -40.349 -70.145  1.00 34.19 ? 192 LYS C CE    1 
ATOM   8021  N NZ    . LYS C 1 192 ? -13.730 -41.802 -70.154  1.00 36.11 ? 192 LYS C NZ    1 
ATOM   8022  N N     . PHE C 1 193 ? -8.978  -36.930 -73.221  1.00 30.36 ? 193 PHE C N     1 
ATOM   8023  C CA    . PHE C 1 193 ? -7.680  -36.234 -73.224  1.00 30.75 ? 193 PHE C CA    1 
ATOM   8024  C C     . PHE C 1 193 ? -7.136  -35.920 -74.622  1.00 30.26 ? 193 PHE C C     1 
ATOM   8025  O O     . PHE C 1 193 ? -7.447  -36.604 -75.574  1.00 30.31 ? 193 PHE C O     1 
ATOM   8026  C CB    . PHE C 1 193 ? -6.570  -37.029 -72.439  1.00 30.84 ? 193 PHE C CB    1 
ATOM   8027  C CG    . PHE C 1 193 ? -6.206  -38.396 -73.075  1.00 29.90 ? 193 PHE C CG    1 
ATOM   8028  C CD1   . PHE C 1 193 ? -6.740  -39.571 -72.575  1.00 25.66 ? 193 PHE C CD1   1 
ATOM   8029  C CD2   . PHE C 1 193 ? -5.354  -38.476 -74.179  1.00 32.03 ? 193 PHE C CD2   1 
ATOM   8030  C CE1   . PHE C 1 193 ? -6.441  -40.810 -73.116  1.00 26.09 ? 193 PHE C CE1   1 
ATOM   8031  C CE2   . PHE C 1 193 ? -5.031  -39.736 -74.777  1.00 31.58 ? 193 PHE C CE2   1 
ATOM   8032  C CZ    . PHE C 1 193 ? -5.600  -40.914 -74.239  1.00 30.61 ? 193 PHE C CZ    1 
ATOM   8033  N N     . LEU C 1 194 ? -6.318  -34.863 -74.701  1.00 30.55 ? 194 LEU C N     1 
ATOM   8034  C CA    . LEU C 1 194 ? -5.407  -34.569 -75.817  1.00 30.15 ? 194 LEU C CA    1 
ATOM   8035  C C     . LEU C 1 194 ? -3.978  -35.038 -75.559  1.00 30.46 ? 194 LEU C C     1 
ATOM   8036  O O     . LEU C 1 194 ? -3.260  -34.449 -74.707  1.00 30.70 ? 194 LEU C O     1 
ATOM   8037  C CB    . LEU C 1 194 ? -5.351  -33.071 -76.046  1.00 30.55 ? 194 LEU C CB    1 
ATOM   8038  C CG    . LEU C 1 194 ? -4.321  -32.619 -77.065  1.00 32.21 ? 194 LEU C CG    1 
ATOM   8039  C CD1   . LEU C 1 194 ? -4.920  -32.763 -78.431  1.00 32.43 ? 194 LEU C CD1   1 
ATOM   8040  C CD2   . LEU C 1 194 ? -3.822  -31.186 -76.792  1.00 33.70 ? 194 LEU C CD2   1 
ATOM   8041  N N     . TYR C 1 195 ? -3.587  -36.087 -76.288  1.00 29.42 ? 195 TYR C N     1 
ATOM   8042  C CA    . TYR C 1 195 ? -2.227  -36.587 -76.334  1.00 29.75 ? 195 TYR C CA    1 
ATOM   8043  C C     . TYR C 1 195 ? -1.379  -35.813 -77.321  1.00 29.59 ? 195 TYR C C     1 
ATOM   8044  O O     . TYR C 1 195 ? -1.703  -35.803 -78.502  1.00 30.64 ? 195 TYR C O     1 
ATOM   8045  C CB    . TYR C 1 195 ? -2.181  -38.074 -76.746  1.00 29.96 ? 195 TYR C CB    1 
ATOM   8046  C CG    . TYR C 1 195 ? -0.775  -38.602 -77.001  1.00 31.31 ? 195 TYR C CG    1 
ATOM   8047  C CD1   . TYR C 1 195 ? 0.068   -38.970 -75.920  1.00 33.32 ? 195 TYR C CD1   1 
ATOM   8048  C CD2   . TYR C 1 195 ? -0.259  -38.712 -78.288  1.00 31.45 ? 195 TYR C CD2   1 
ATOM   8049  C CE1   . TYR C 1 195 ? 1.371   -39.451 -76.122  1.00 28.05 ? 195 TYR C CE1   1 
ATOM   8050  C CE2   . TYR C 1 195 ? 1.084   -39.171 -78.499  1.00 32.56 ? 195 TYR C CE2   1 
ATOM   8051  C CZ    . TYR C 1 195 ? 1.863   -39.552 -77.393  1.00 30.83 ? 195 TYR C CZ    1 
ATOM   8052  O OH    . TYR C 1 195 ? 3.130   -40.030 -77.572  1.00 29.98 ? 195 TYR C OH    1 
ATOM   8053  N N     . THR C 1 196 ? -0.260  -35.245 -76.856  1.00 28.88 ? 196 THR C N     1 
ATOM   8054  C CA    . THR C 1 196 ? 0.686   -34.540 -77.711  1.00 28.21 ? 196 THR C CA    1 
ATOM   8055  C C     . THR C 1 196 ? 2.170   -34.764 -77.303  1.00 27.80 ? 196 THR C C     1 
ATOM   8056  O O     . THR C 1 196 ? 2.492   -34.864 -76.118  1.00 27.22 ? 196 THR C O     1 
ATOM   8057  C CB    . THR C 1 196 ? 0.377   -33.026 -77.666  1.00 28.69 ? 196 THR C CB    1 
ATOM   8058  O OG1   . THR C 1 196 ? 1.359   -32.273 -78.397  1.00 30.62 ? 196 THR C OG1   1 
ATOM   8059  C CG2   . THR C 1 196 ? 0.334   -32.508 -76.209  1.00 27.78 ? 196 THR C CG2   1 
ATOM   8060  N N     . VAL C 1 197 ? 3.046   -34.839 -78.300  1.00 26.78 ? 197 VAL C N     1 
ATOM   8061  C CA    . VAL C 1 197 ? 4.462   -34.552 -78.099  1.00 27.35 ? 197 VAL C CA    1 
ATOM   8062  C C     . VAL C 1 197 ? 4.811   -33.146 -78.570  1.00 27.76 ? 197 VAL C C     1 
ATOM   8063  O O     . VAL C 1 197 ? 4.875   -32.879 -79.770  1.00 28.12 ? 197 VAL C O     1 
ATOM   8064  C CB    . VAL C 1 197 ? 5.354   -35.567 -78.837  1.00 27.97 ? 197 VAL C CB    1 
ATOM   8065  C CG1   . VAL C 1 197 ? 6.824   -35.232 -78.633  1.00 29.71 ? 197 VAL C CG1   1 
ATOM   8066  C CG2   . VAL C 1 197 ? 5.052   -36.982 -78.368  1.00 28.27 ? 197 VAL C CG2   1 
ATOM   8067  N N     . PRO C 1 198 ? 5.037   -32.247 -77.617  1.00 25.79 ? 198 PRO C N     1 
ATOM   8068  C CA    . PRO C 1 198 ? 5.047   -30.809 -77.901  1.00 26.33 ? 198 PRO C CA    1 
ATOM   8069  C C     . PRO C 1 198 ? 6.384   -30.354 -78.477  1.00 26.81 ? 198 PRO C C     1 
ATOM   8070  O O     . PRO C 1 198 ? 6.458   -29.298 -79.105  1.00 27.64 ? 198 PRO C O     1 
ATOM   8071  C CB    . PRO C 1 198 ? 4.828   -30.184 -76.522  1.00 26.48 ? 198 PRO C CB    1 
ATOM   8072  C CG    . PRO C 1 198 ? 5.384   -31.182 -75.571  1.00 23.64 ? 198 PRO C CG    1 
ATOM   8073  C CD    . PRO C 1 198 ? 5.095   -32.527 -76.172  1.00 26.46 ? 198 PRO C CD    1 
ATOM   8074  N N     . ASN C 1 199 ? 7.427   -31.149 -78.261  1.00 26.19 ? 199 ASN C N     1 
ATOM   8075  C CA    . ASN C 1 199 ? 8.751   -30.836 -78.786  1.00 25.21 ? 199 ASN C CA    1 
ATOM   8076  C C     . ASN C 1 199 ? 9.262   -31.914 -79.735  1.00 25.98 ? 199 ASN C C     1 
ATOM   8077  O O     . ASN C 1 199 ? 9.232   -33.102 -79.415  1.00 26.98 ? 199 ASN C O     1 
ATOM   8078  C CB    . ASN C 1 199 ? 9.745   -30.627 -77.642  1.00 24.79 ? 199 ASN C CB    1 
ATOM   8079  C CG    . ASN C 1 199 ? 9.395   -29.432 -76.777  1.00 24.00 ? 199 ASN C CG    1 
ATOM   8080  O OD1   . ASN C 1 199 ? 9.615   -28.285 -77.165  1.00 19.32 ? 199 ASN C OD1   1 
ATOM   8081  N ND2   . ASN C 1 199 ? 8.845   -29.697 -75.598  1.00 15.49 ? 199 ASN C ND2   1 
ATOM   8082  N N     . GLY C 1 200 ? 9.732   -31.491 -80.904  1.00 26.71 ? 200 GLY C N     1 
ATOM   8083  C CA    . GLY C 1 200 ? 10.285  -32.413 -81.886  1.00 27.85 ? 200 GLY C CA    1 
ATOM   8084  C C     . GLY C 1 200 ? 9.501   -33.713 -81.951  1.00 27.82 ? 200 GLY C C     1 
ATOM   8085  O O     . GLY C 1 200 ? 9.946   -34.745 -81.474  1.00 29.96 ? 200 GLY C O     1 
ATOM   8086  N N     . ASN C 1 201 ? 8.310   -33.673 -82.504  1.00 27.36 ? 201 ASN C N     1 
ATOM   8087  C CA    . ASN C 1 201 ? 7.492   -34.845 -82.498  1.00 26.19 ? 201 ASN C CA    1 
ATOM   8088  C C     . ASN C 1 201 ? 8.312   -35.949 -83.108  1.00 26.42 ? 201 ASN C C     1 
ATOM   8089  O O     . ASN C 1 201 ? 9.117   -35.701 -84.047  1.00 25.96 ? 201 ASN C O     1 
ATOM   8090  C CB    . ASN C 1 201 ? 6.298   -34.542 -83.377  1.00 26.49 ? 201 ASN C CB    1 
ATOM   8091  C CG    . ASN C 1 201 ? 5.162   -35.503 -83.187  1.00 28.43 ? 201 ASN C CG    1 
ATOM   8092  O OD1   . ASN C 1 201 ? 4.522   -35.916 -84.156  1.00 31.30 ? 201 ASN C OD1   1 
ATOM   8093  N ND2   . ASN C 1 201 ? 4.855   -35.820 -81.947  1.00 30.27 ? 201 ASN C ND2   1 
ATOM   8094  N N     . ASN C 1 202 ? 8.138   -37.176 -82.610  1.00 26.35 ? 202 ASN C N     1 
ATOM   8095  C CA    . ASN C 1 202 ? 8.439   -38.364 -83.455  1.00 25.67 ? 202 ASN C CA    1 
ATOM   8096  C C     . ASN C 1 202 ? 7.207   -38.680 -84.281  1.00 26.85 ? 202 ASN C C     1 
ATOM   8097  O O     . ASN C 1 202 ? 6.177   -39.065 -83.668  1.00 26.58 ? 202 ASN C O     1 
ATOM   8098  C CB    . ASN C 1 202 ? 8.669   -39.576 -82.597  1.00 25.24 ? 202 ASN C CB    1 
ATOM   8099  C CG    . ASN C 1 202 ? 9.150   -40.721 -83.351  1.00 21.93 ? 202 ASN C CG    1 
ATOM   8100  O OD1   . ASN C 1 202 ? 9.301   -40.687 -84.571  1.00 27.85 ? 202 ASN C OD1   1 
ATOM   8101  N ND2   . ASN C 1 202 ? 9.453   -41.757 -82.645  1.00 26.78 ? 202 ASN C ND2   1 
ATOM   8102  N N     . PRO C 1 203 ? 7.298   -38.620 -85.644  1.00 27.31 ? 203 PRO C N     1 
ATOM   8103  C CA    . PRO C 1 203 ? 8.405   -38.513 -86.605  1.00 27.55 ? 203 PRO C CA    1 
ATOM   8104  C C     . PRO C 1 203 ? 8.697   -37.137 -87.282  1.00 28.61 ? 203 PRO C C     1 
ATOM   8105  O O     . PRO C 1 203 ? 9.722   -37.015 -87.942  1.00 28.81 ? 203 PRO C O     1 
ATOM   8106  C CB    . PRO C 1 203 ? 7.932   -39.450 -87.695  1.00 27.35 ? 203 PRO C CB    1 
ATOM   8107  C CG    . PRO C 1 203 ? 6.483   -39.139 -87.792  1.00 26.46 ? 203 PRO C CG    1 
ATOM   8108  C CD    . PRO C 1 203 ? 6.021   -38.713 -86.389  1.00 27.33 ? 203 PRO C CD    1 
ATOM   8109  N N     . THR C 1 204 ? 7.836   -36.123 -87.106  1.00 29.65 ? 204 THR C N     1 
ATOM   8110  C CA    . THR C 1 204 ? 7.937   -34.840 -87.833  1.00 29.54 ? 204 THR C CA    1 
ATOM   8111  C C     . THR C 1 204 ? 9.080   -33.950 -87.372  1.00 29.57 ? 204 THR C C     1 
ATOM   8112  O O     . THR C 1 204 ? 9.645   -33.152 -88.160  1.00 28.88 ? 204 THR C O     1 
ATOM   8113  C CB    . THR C 1 204 ? 6.643   -33.998 -87.689  1.00 30.45 ? 204 THR C CB    1 
ATOM   8114  O OG1   . THR C 1 204 ? 6.481   -33.628 -86.307  1.00 31.28 ? 204 THR C OG1   1 
ATOM   8115  C CG2   . THR C 1 204 ? 5.406   -34.767 -88.201  1.00 27.84 ? 204 THR C CG2   1 
ATOM   8116  N N     . GLY C 1 205 ? 9.399   -34.064 -86.088  1.00 29.61 ? 205 GLY C N     1 
ATOM   8117  C CA    . GLY C 1 205 ? 10.318  -33.134 -85.442  1.00 29.06 ? 205 GLY C CA    1 
ATOM   8118  C C     . GLY C 1 205 ? 9.826   -31.702 -85.302  1.00 29.67 ? 205 GLY C C     1 
ATOM   8119  O O     . GLY C 1 205 ? 10.616  -30.796 -84.967  1.00 29.86 ? 205 GLY C O     1 
ATOM   8120  N N     . ASN C 1 206 ? 8.532   -31.480 -85.575  1.00 30.26 ? 206 ASN C N     1 
ATOM   8121  C CA    . ASN C 1 206 ? 7.856   -30.196 -85.268  1.00 30.01 ? 206 ASN C CA    1 
ATOM   8122  C C     . ASN C 1 206 ? 7.603   -30.043 -83.787  1.00 29.49 ? 206 ASN C C     1 
ATOM   8123  O O     . ASN C 1 206 ? 7.438   -31.045 -83.084  1.00 30.08 ? 206 ASN C O     1 
ATOM   8124  C CB    . ASN C 1 206 ? 6.511   -30.050 -86.044  1.00 30.16 ? 206 ASN C CB    1 
ATOM   8125  C CG    . ASN C 1 206 ? 6.698   -30.047 -87.557  1.00 29.37 ? 206 ASN C CG    1 
ATOM   8126  O OD1   . ASN C 1 206 ? 5.855   -30.586 -88.305  1.00 31.58 ? 206 ASN C OD1   1 
ATOM   8127  N ND2   . ASN C 1 206 ? 7.835   -29.496 -88.018  1.00 26.36 ? 206 ASN C ND2   1 
ATOM   8128  N N     . SER C 1 207 ? 7.581   -28.792 -83.320  1.00 29.63 ? 207 SER C N     1 
ATOM   8129  C CA    . SER C 1 207 ? 7.310   -28.484 -81.927  1.00 28.84 ? 207 SER C CA    1 
ATOM   8130  C C     . SER C 1 207 ? 6.222   -27.458 -81.913  1.00 29.02 ? 207 SER C C     1 
ATOM   8131  O O     . SER C 1 207 ? 6.221   -26.553 -82.743  1.00 27.76 ? 207 SER C O     1 
ATOM   8132  C CB    . SER C 1 207 ? 8.515   -27.851 -81.223  1.00 28.67 ? 207 SER C CB    1 
ATOM   8133  O OG    . SER C 1 207 ? 9.615   -28.716 -81.119  1.00 31.82 ? 207 SER C OG    1 
ATOM   8134  N N     . LEU C 1 208 ? 5.353   -27.578 -80.908  1.00 30.02 ? 208 LEU C N     1 
ATOM   8135  C CA    . LEU C 1 208 ? 4.356   -26.563 -80.526  1.00 31.13 ? 208 LEU C CA    1 
ATOM   8136  C C     . LEU C 1 208 ? 4.975   -25.211 -80.157  1.00 31.80 ? 208 LEU C C     1 
ATOM   8137  O O     . LEU C 1 208 ? 6.164   -25.118 -79.823  1.00 32.64 ? 208 LEU C O     1 
ATOM   8138  C CB    . LEU C 1 208 ? 3.539   -27.075 -79.347  1.00 30.67 ? 208 LEU C CB    1 
ATOM   8139  C CG    . LEU C 1 208 ? 2.189   -27.714 -79.695  1.00 31.37 ? 208 LEU C CG    1 
ATOM   8140  C CD1   . LEU C 1 208 ? 1.540   -28.175 -78.436  1.00 31.23 ? 208 LEU C CD1   1 
ATOM   8141  C CD2   . LEU C 1 208 ? 1.206   -26.748 -80.460  1.00 29.06 ? 208 LEU C CD2   1 
ATOM   8142  N N     . THR C 1 209 ? 4.198   -24.147 -80.236  1.00 32.22 ? 209 THR C N     1 
ATOM   8143  C CA    . THR C 1 209 ? 4.771   -22.860 -79.849  1.00 33.60 ? 209 THR C CA    1 
ATOM   8144  C C     . THR C 1 209 ? 4.215   -22.489 -78.509  1.00 33.52 ? 209 THR C C     1 
ATOM   8145  O O     . THR C 1 209 ? 3.327   -23.155 -78.002  1.00 34.30 ? 209 THR C O     1 
ATOM   8146  C CB    . THR C 1 209 ? 4.485   -21.722 -80.843  1.00 33.88 ? 209 THR C CB    1 
ATOM   8147  O OG1   . THR C 1 209 ? 3.068   -21.642 -81.089  1.00 34.56 ? 209 THR C OG1   1 
ATOM   8148  C CG2   . THR C 1 209 ? 5.244   -21.951 -82.140  1.00 33.99 ? 209 THR C CG2   1 
ATOM   8149  N N     . SER C 1 210 ? 4.742   -21.418 -77.952  1.00 33.58 ? 210 SER C N     1 
ATOM   8150  C CA    . SER C 1 210 ? 4.241   -20.881 -76.732  1.00 33.68 ? 210 SER C CA    1 
ATOM   8151  C C     . SER C 1 210 ? 2.810   -20.369 -76.876  1.00 34.34 ? 210 SER C C     1 
ATOM   8152  O O     . SER C 1 210 ? 1.968   -20.706 -76.049  1.00 35.47 ? 210 SER C O     1 
ATOM   8153  C CB    . SER C 1 210 ? 5.137   -19.775 -76.223  1.00 32.80 ? 210 SER C CB    1 
ATOM   8154  O OG    . SER C 1 210 ? 4.793   -19.617 -74.873  1.00 33.27 ? 210 SER C OG    1 
ATOM   8155  N N     . GLU C 1 211 ? 2.551   -19.572 -77.908  1.00 34.37 ? 211 GLU C N     1 
ATOM   8156  C CA    . GLU C 1 211 ? 1.205   -19.082 -78.180  1.00 34.98 ? 211 GLU C CA    1 
ATOM   8157  C C     . GLU C 1 211 ? 0.206   -20.231 -78.255  1.00 33.29 ? 211 GLU C C     1 
ATOM   8158  O O     . GLU C 1 211 ? -0.898  -20.137 -77.730  1.00 35.25 ? 211 GLU C O     1 
ATOM   8159  C CB    . GLU C 1 211 ? 1.180   -18.277 -79.480  1.00 34.23 ? 211 GLU C CB    1 
ATOM   8160  C CG    . GLU C 1 211 ? 1.964   -16.976 -79.420  1.00 39.86 ? 211 GLU C CG    1 
ATOM   8161  C CD    . GLU C 1 211 ? 3.411   -17.149 -79.837  1.00 48.18 ? 211 GLU C CD    1 
ATOM   8162  O OE1   . GLU C 1 211 ? 4.145   -17.890 -79.149  1.00 50.17 ? 211 GLU C OE1   1 
ATOM   8163  O OE2   . GLU C 1 211 ? 3.814   -16.544 -80.852  1.00 50.01 ? 211 GLU C OE2   1 
ATOM   8164  N N     . ARG C 1 212 ? 0.605   -21.315 -78.911  1.00 31.04 ? 212 ARG C N     1 
ATOM   8165  C CA    . ARG C 1 212 ? -0.324  -22.371 -79.275  1.00 30.56 ? 212 ARG C CA    1 
ATOM   8166  C C     . ARG C 1 212 ? -0.663  -23.239 -78.069  1.00 31.96 ? 212 ARG C C     1 
ATOM   8167  O O     . ARG C 1 212 ? -1.815  -23.623 -77.876  1.00 32.68 ? 212 ARG C O     1 
ATOM   8168  C CB    . ARG C 1 212 ? 0.260   -23.234 -80.395  1.00 30.08 ? 212 ARG C CB    1 
ATOM   8169  C CG    . ARG C 1 212 ? -0.061  -22.736 -81.795  1.00 29.90 ? 212 ARG C CG    1 
ATOM   8170  C CD    . ARG C 1 212 ? 0.103   -23.784 -82.881  1.00 28.50 ? 212 ARG C CD    1 
ATOM   8171  N NE    . ARG C 1 212 ? 0.139   -23.190 -84.215  1.00 20.54 ? 212 ARG C NE    1 
ATOM   8172  C CZ    . ARG C 1 212 ? 0.130   -23.889 -85.342  1.00 25.48 ? 212 ARG C CZ    1 
ATOM   8173  N NH1   . ARG C 1 212 ? 0.087   -25.214 -85.302  1.00 19.26 ? 212 ARG C NH1   1 
ATOM   8174  N NH2   . ARG C 1 212 ? 0.165   -23.265 -86.511  1.00 25.12 ? 212 ARG C NH2   1 
ATOM   8175  N N     . LYS C 1 213 ? 0.340   -23.544 -77.259  1.00 33.23 ? 213 LYS C N     1 
ATOM   8176  C CA    . LYS C 1 213 ? 0.130   -24.290 -76.020  1.00 33.54 ? 213 LYS C CA    1 
ATOM   8177  C C     . LYS C 1 213 ? -0.862  -23.578 -75.114  1.00 35.01 ? 213 LYS C C     1 
ATOM   8178  O O     . LYS C 1 213 ? -1.692  -24.215 -74.466  1.00 34.50 ? 213 LYS C O     1 
ATOM   8179  C CB    . LYS C 1 213 ? 1.457   -24.490 -75.284  1.00 32.83 ? 213 LYS C CB    1 
ATOM   8180  C CG    . LYS C 1 213 ? 2.326   -25.589 -75.861  1.00 33.28 ? 213 LYS C CG    1 
ATOM   8181  C CD    . LYS C 1 213 ? 3.730   -25.550 -75.278  1.00 31.55 ? 213 LYS C CD    1 
ATOM   8182  C CE    . LYS C 1 213 ? 4.528   -26.779 -75.676  1.00 31.99 ? 213 LYS C CE    1 
ATOM   8183  N NZ    . LYS C 1 213 ? 5.781   -26.909 -74.882  1.00 29.92 ? 213 LYS C NZ    1 
ATOM   8184  N N     . LYS C 1 214 ? -0.775  -22.252 -75.073  1.00 35.79 ? 214 LYS C N     1 
ATOM   8185  C CA    . LYS C 1 214 ? -1.684  -21.445 -74.252  1.00 38.83 ? 214 LYS C CA    1 
ATOM   8186  C C     . LYS C 1 214 ? -3.158  -21.598 -74.741  1.00 38.95 ? 214 LYS C C     1 
ATOM   8187  O O     . LYS C 1 214 ? -4.038  -21.869 -73.933  1.00 38.75 ? 214 LYS C O     1 
ATOM   8188  C CB    . LYS C 1 214 ? -1.228  -19.983 -74.136  1.00 38.49 ? 214 LYS C CB    1 
ATOM   8189  C CG    . LYS C 1 214 ? -1.634  -19.312 -72.842  1.00 40.04 ? 214 LYS C CG    1 
ATOM   8190  C CD    . LYS C 1 214 ? -1.729  -17.749 -72.963  1.00 41.81 ? 214 LYS C CD    1 
ATOM   8191  C CE    . LYS C 1 214 ? -0.406  -17.026 -72.487  1.00 46.29 ? 214 LYS C CE    1 
ATOM   8192  N NZ    . LYS C 1 214 ? 0.845   -17.393 -73.294  1.00 40.69 ? 214 LYS C NZ    1 
ATOM   8193  N N     . GLU C 1 215 ? -3.398  -21.513 -76.057  1.00 39.88 ? 215 GLU C N     1 
ATOM   8194  C CA    . GLU C 1 215 ? -4.768  -21.719 -76.610  1.00 40.77 ? 215 GLU C CA    1 
ATOM   8195  C C     . GLU C 1 215 ? -5.309  -23.124 -76.414  1.00 40.64 ? 215 GLU C C     1 
ATOM   8196  O O     . GLU C 1 215 ? -6.455  -23.280 -75.989  1.00 39.45 ? 215 GLU C O     1 
ATOM   8197  C CB    . GLU C 1 215 ? -4.827  -21.423 -78.096  1.00 40.72 ? 215 GLU C CB    1 
ATOM   8198  C CG    . GLU C 1 215 ? -4.582  -20.014 -78.382  1.00 44.58 ? 215 GLU C CG    1 
ATOM   8199  C CD    . GLU C 1 215 ? -5.067  -19.630 -79.735  1.00 50.08 ? 215 GLU C CD    1 
ATOM   8200  O OE1   . GLU C 1 215 ? -4.593  -18.566 -80.216  1.00 50.33 ? 215 GLU C OE1   1 
ATOM   8201  O OE2   . GLU C 1 215 ? -5.934  -20.368 -80.284  1.00 51.86 ? 215 GLU C OE2   1 
ATOM   8202  N N     . ILE C 1 216 ? -4.477  -24.127 -76.727  1.00 40.74 ? 216 ILE C N     1 
ATOM   8203  C CA    . ILE C 1 216 ? -4.806  -25.540 -76.417  1.00 40.82 ? 216 ILE C CA    1 
ATOM   8204  C C     . ILE C 1 216 ? -5.152  -25.738 -74.932  1.00 40.28 ? 216 ILE C C     1 
ATOM   8205  O O     . ILE C 1 216 ? -6.059  -26.489 -74.604  1.00 40.18 ? 216 ILE C O     1 
ATOM   8206  C CB    . ILE C 1 216 ? -3.688  -26.523 -76.832  1.00 40.47 ? 216 ILE C CB    1 
ATOM   8207  C CG1   . ILE C 1 216 ? -3.514  -26.554 -78.354  1.00 41.90 ? 216 ILE C CG1   1 
ATOM   8208  C CG2   . ILE C 1 216 ? -3.989  -27.916 -76.358  1.00 39.82 ? 216 ILE C CG2   1 
ATOM   8209  C CD1   . ILE C 1 216 ? -2.120  -27.160 -78.790  1.00 41.51 ? 216 ILE C CD1   1 
ATOM   8210  N N     . TYR C 1 217 ? -4.460  -25.027 -74.047  1.00 39.64 ? 217 TYR C N     1 
ATOM   8211  C CA    . TYR C 1 217 ? -4.788  -25.119 -72.637  1.00 39.76 ? 217 TYR C CA    1 
ATOM   8212  C C     . TYR C 1 217 ? -6.208  -24.611 -72.400  1.00 39.98 ? 217 TYR C C     1 
ATOM   8213  O O     . TYR C 1 217 ? -7.025  -25.311 -71.778  1.00 39.10 ? 217 TYR C O     1 
ATOM   8214  C CB    . TYR C 1 217 ? -3.776  -24.420 -71.707  1.00 39.30 ? 217 TYR C CB    1 
ATOM   8215  C CG    . TYR C 1 217 ? -3.942  -24.901 -70.277  1.00 40.20 ? 217 TYR C CG    1 
ATOM   8216  C CD1   . TYR C 1 217 ? -3.131  -25.919 -69.769  1.00 41.40 ? 217 TYR C CD1   1 
ATOM   8217  C CD2   . TYR C 1 217 ? -4.964  -24.385 -69.444  1.00 39.55 ? 217 TYR C CD2   1 
ATOM   8218  C CE1   . TYR C 1 217 ? -3.308  -26.394 -68.453  1.00 42.77 ? 217 TYR C CE1   1 
ATOM   8219  C CE2   . TYR C 1 217 ? -5.148  -24.831 -68.131  1.00 39.04 ? 217 TYR C CE2   1 
ATOM   8220  C CZ    . TYR C 1 217 ? -4.318  -25.838 -67.632  1.00 41.44 ? 217 TYR C CZ    1 
ATOM   8221  O OH    . TYR C 1 217 ? -4.484  -26.327 -66.343  1.00 38.85 ? 217 TYR C OH    1 
ATOM   8222  N N     . GLU C 1 218 ? -6.499  -23.420 -72.938  1.00 40.36 ? 218 GLU C N     1 
ATOM   8223  C CA    . GLU C 1 218 ? -7.854  -22.835 -72.854  1.00 40.28 ? 218 GLU C CA    1 
ATOM   8224  C C     . GLU C 1 218 ? -8.901  -23.781 -73.416  1.00 39.41 ? 218 GLU C C     1 
ATOM   8225  O O     . GLU C 1 218 ? -9.930  -23.973 -72.817  1.00 40.16 ? 218 GLU C O     1 
ATOM   8226  C CB    . GLU C 1 218 ? -7.932  -21.423 -73.461  1.00 39.32 ? 218 GLU C CB    1 
ATOM   8227  C CG    . GLU C 1 218 ? -8.867  -20.460 -72.734  1.00 43.44 ? 218 GLU C CG    1 
ATOM   8228  C CD    . GLU C 1 218 ? -8.830  -20.559 -71.164  1.00 48.16 ? 218 GLU C CD    1 
ATOM   8229  O OE1   . GLU C 1 218 ? -9.907  -20.708 -70.527  1.00 49.56 ? 218 GLU C OE1   1 
ATOM   8230  O OE2   . GLU C 1 218 ? -7.735  -20.464 -70.570  1.00 48.59 ? 218 GLU C OE2   1 
ATOM   8231  N N     . LEU C 1 219 ? -8.610  -24.417 -74.532  1.00 40.00 ? 219 LEU C N     1 
ATOM   8232  C CA    . LEU C 1 219 ? -9.497  -25.438 -75.056  1.00 40.02 ? 219 LEU C CA    1 
ATOM   8233  C C     . LEU C 1 219 ? -9.727  -26.597 -74.100  1.00 40.29 ? 219 LEU C C     1 
ATOM   8234  O O     . LEU C 1 219 ? -10.851 -27.009 -73.891  1.00 40.66 ? 219 LEU C O     1 
ATOM   8235  C CB    . LEU C 1 219 ? -8.985  -25.949 -76.387  1.00 39.02 ? 219 LEU C CB    1 
ATOM   8236  C CG    . LEU C 1 219 ? -9.734  -25.609 -77.674  1.00 38.27 ? 219 LEU C CG    1 
ATOM   8237  C CD1   . LEU C 1 219 ? -10.938 -24.751 -77.455  1.00 38.34 ? 219 LEU C CD1   1 
ATOM   8238  C CD2   . LEU C 1 219 ? -8.805  -24.972 -78.665  1.00 35.71 ? 219 LEU C CD2   1 
ATOM   8239  N N     . ALA C 1 220 ? -8.653  -27.119 -73.533  1.00 40.89 ? 220 ALA C N     1 
ATOM   8240  C CA    . ALA C 1 220 ? -8.752  -28.228 -72.608  1.00 40.84 ? 220 ALA C CA    1 
ATOM   8241  C C     . ALA C 1 220 ? -9.606  -27.875 -71.417  1.00 41.44 ? 220 ALA C C     1 
ATOM   8242  O O     . ALA C 1 220 ? -10.414 -28.668 -70.958  1.00 39.80 ? 220 ALA C O     1 
ATOM   8243  C CB    . ALA C 1 220 ? -7.397  -28.647 -72.160  1.00 40.72 ? 220 ALA C CB    1 
ATOM   8244  N N     . ARG C 1 221 ? -9.413  -26.665 -70.918  1.00 42.85 ? 221 ARG C N     1 
ATOM   8245  C CA    . ARG C 1 221 ? -10.191 -26.168 -69.806  1.00 45.09 ? 221 ARG C CA    1 
ATOM   8246  C C     . ARG C 1 221 ? -11.668 -25.905 -70.123  1.00 45.79 ? 221 ARG C C     1 
ATOM   8247  O O     . ARG C 1 221 ? -12.534 -26.207 -69.317  1.00 46.52 ? 221 ARG C O     1 
ATOM   8248  C CB    . ARG C 1 221 ? -9.499  -24.963 -69.175  1.00 44.42 ? 221 ARG C CB    1 
ATOM   8249  C CG    . ARG C 1 221 ? -10.290 -23.693 -69.196  1.00 46.21 ? 221 ARG C CG    1 
ATOM   8250  C CD    . ARG C 1 221 ? -10.129 -22.830 -67.963  1.00 47.20 ? 221 ARG C CD    1 
ATOM   8251  N NE    . ARG C 1 221 ? -8.733  -22.553 -67.665  1.00 50.64 ? 221 ARG C NE    1 
ATOM   8252  C CZ    . ARG C 1 221 ? -8.270  -22.297 -66.464  1.00 52.38 ? 221 ARG C CZ    1 
ATOM   8253  N NH1   . ARG C 1 221 ? -9.088  -22.274 -65.434  1.00 53.81 ? 221 ARG C NH1   1 
ATOM   8254  N NH2   . ARG C 1 221 ? -6.987  -22.065 -66.286  1.00 53.68 ? 221 ARG C NH2   1 
ATOM   8255  N N     . LYS C 1 222 ? -11.955 -25.368 -71.304  1.00 45.56 ? 222 LYS C N     1 
ATOM   8256  C CA    . LYS C 1 222 ? -13.323 -25.051 -71.687  1.00 45.92 ? 222 LYS C CA    1 
ATOM   8257  C C     . LYS C 1 222 ? -14.120 -26.325 -71.830  1.00 45.36 ? 222 LYS C C     1 
ATOM   8258  O O     . LYS C 1 222 ? -15.339 -26.307 -71.816  1.00 45.36 ? 222 LYS C O     1 
ATOM   8259  C CB    . LYS C 1 222 ? -13.359 -24.275 -73.007  1.00 45.87 ? 222 LYS C CB    1 
ATOM   8260  C CG    . LYS C 1 222 ? -14.391 -23.159 -73.083  1.00 46.94 ? 222 LYS C CG    1 
ATOM   8261  C CD    . LYS C 1 222 ? -14.412 -22.505 -74.473  1.00 46.59 ? 222 LYS C CD    1 
ATOM   8262  C CE    . LYS C 1 222 ? -15.494 -21.427 -74.626  1.00 44.05 ? 222 LYS C CE    1 
ATOM   8263  N NZ    . LYS C 1 222 ? -15.058 -20.051 -74.229  1.00 38.72 ? 222 LYS C NZ    1 
ATOM   8264  N N     . TYR C 1 223 ? -13.413 -27.433 -71.968  1.00 44.10 ? 223 TYR C N     1 
ATOM   8265  C CA    . TYR C 1 223 ? -14.029 -28.681 -72.338  1.00 43.38 ? 223 TYR C CA    1 
ATOM   8266  C C     . TYR C 1 223 ? -13.617 -29.773 -71.350  1.00 43.04 ? 223 TYR C C     1 
ATOM   8267  O O     . TYR C 1 223 ? -13.974 -30.933 -71.504  1.00 41.81 ? 223 TYR C O     1 
ATOM   8268  C CB    . TYR C 1 223 ? -13.639 -29.052 -73.765  1.00 42.44 ? 223 TYR C CB    1 
ATOM   8269  C CG    . TYR C 1 223 ? -14.348 -28.271 -74.838  1.00 41.28 ? 223 TYR C CG    1 
ATOM   8270  C CD1   . TYR C 1 223 ? -15.591 -28.660 -75.300  1.00 44.71 ? 223 TYR C CD1   1 
ATOM   8271  C CD2   . TYR C 1 223 ? -13.772 -27.165 -75.404  1.00 40.12 ? 223 TYR C CD2   1 
ATOM   8272  C CE1   . TYR C 1 223 ? -16.240 -27.959 -76.276  1.00 39.68 ? 223 TYR C CE1   1 
ATOM   8273  C CE2   . TYR C 1 223 ? -14.412 -26.464 -76.380  1.00 38.57 ? 223 TYR C CE2   1 
ATOM   8274  C CZ    . TYR C 1 223 ? -15.645 -26.861 -76.815  1.00 40.71 ? 223 TYR C CZ    1 
ATOM   8275  O OH    . TYR C 1 223 ? -16.287 -26.152 -77.795  1.00 40.19 ? 223 TYR C OH    1 
ATOM   8276  N N     . ASP C 1 224 ? -12.874 -29.377 -70.325  1.00 43.35 ? 224 ASP C N     1 
ATOM   8277  C CA    . ASP C 1 224 ? -12.424 -30.269 -69.260  1.00 43.56 ? 224 ASP C CA    1 
ATOM   8278  C C     . ASP C 1 224 ? -11.964 -31.634 -69.721  1.00 42.34 ? 224 ASP C C     1 
ATOM   8279  O O     . ASP C 1 224 ? -12.391 -32.640 -69.185  1.00 43.89 ? 224 ASP C O     1 
ATOM   8280  C CB    . ASP C 1 224 ? -13.483 -30.407 -68.172  1.00 43.98 ? 224 ASP C CB    1 
ATOM   8281  C CG    . ASP C 1 224 ? -12.888 -30.606 -66.792  1.00 46.03 ? 224 ASP C CG    1 
ATOM   8282  O OD1   . ASP C 1 224 ? -11.726 -30.217 -66.579  1.00 45.36 ? 224 ASP C OD1   1 
ATOM   8283  O OD2   . ASP C 1 224 ? -13.515 -31.140 -65.860  1.00 46.64 ? 224 ASP C OD2   1 
ATOM   8284  N N     . PHE C 1 225 ? -11.071 -31.671 -70.694  1.00 39.98 ? 225 PHE C N     1 
ATOM   8285  C CA    . PHE C 1 225 ? -10.257 -32.845 -70.897  1.00 37.98 ? 225 PHE C CA    1 
ATOM   8286  C C     . PHE C 1 225 ? -8.840  -32.737 -70.340  1.00 36.25 ? 225 PHE C C     1 
ATOM   8287  O O     . PHE C 1 225 ? -8.346  -31.660 -70.059  1.00 36.20 ? 225 PHE C O     1 
ATOM   8288  C CB    . PHE C 1 225 ? -10.279 -33.285 -72.356  1.00 37.96 ? 225 PHE C CB    1 
ATOM   8289  C CG    . PHE C 1 225 ? -9.790  -32.248 -73.323  1.00 38.54 ? 225 PHE C CG    1 
ATOM   8290  C CD1   . PHE C 1 225 ? -8.442  -32.151 -73.649  1.00 37.34 ? 225 PHE C CD1   1 
ATOM   8291  C CD2   . PHE C 1 225 ? -10.684 -31.373 -73.928  1.00 37.88 ? 225 PHE C CD2   1 
ATOM   8292  C CE1   . PHE C 1 225 ? -8.012  -31.206 -74.539  1.00 35.66 ? 225 PHE C CE1   1 
ATOM   8293  C CE2   . PHE C 1 225 ? -10.253 -30.429 -74.821  1.00 35.14 ? 225 PHE C CE2   1 
ATOM   8294  C CZ    . PHE C 1 225 ? -8.918  -30.343 -75.129  1.00 36.63 ? 225 PHE C CZ    1 
ATOM   8295  N N     . LEU C 1 226 ? -8.204  -33.878 -70.159  1.00 34.11 ? 226 LEU C N     1 
ATOM   8296  C CA    . LEU C 1 226 ? -6.822  -33.931 -69.697  1.00 32.97 ? 226 LEU C CA    1 
ATOM   8297  C C     . LEU C 1 226 ? -5.850  -33.603 -70.826  1.00 31.69 ? 226 LEU C C     1 
ATOM   8298  O O     . LEU C 1 226 ? -6.194  -33.706 -72.004  1.00 31.46 ? 226 LEU C O     1 
ATOM   8299  C CB    . LEU C 1 226 ? -6.504  -35.310 -69.115  1.00 31.97 ? 226 LEU C CB    1 
ATOM   8300  C CG    . LEU C 1 226 ? -7.272  -35.705 -67.852  1.00 29.17 ? 226 LEU C CG    1 
ATOM   8301  C CD1   . LEU C 1 226 ? -6.867  -37.096 -67.389  1.00 26.48 ? 226 LEU C CD1   1 
ATOM   8302  C CD2   . LEU C 1 226 ? -7.052  -34.683 -66.747  1.00 20.11 ? 226 LEU C CD2   1 
ATOM   8303  N N     . ILE C 1 227 ? -4.636  -33.207 -70.459  1.00 33.15 ? 227 ILE C N     1 
ATOM   8304  C CA    . ILE C 1 227 ? -3.526  -33.091 -71.436  1.00 32.68 ? 227 ILE C CA    1 
ATOM   8305  C C     . ILE C 1 227 ? -2.460  -34.118 -71.089  1.00 33.32 ? 227 ILE C C     1 
ATOM   8306  O O     . ILE C 1 227 ? -1.863  -34.079 -69.995  1.00 34.58 ? 227 ILE C O     1 
ATOM   8307  C CB    . ILE C 1 227 ? -2.963  -31.630 -71.532  1.00 33.00 ? 227 ILE C CB    1 
ATOM   8308  C CG1   . ILE C 1 227 ? -4.030  -30.645 -72.078  1.00 33.41 ? 227 ILE C CG1   1 
ATOM   8309  C CG2   . ILE C 1 227 ? -1.687  -31.574 -72.378  1.00 33.47 ? 227 ILE C CG2   1 
ATOM   8310  C CD1   . ILE C 1 227 ? -3.692  -29.138 -71.984  1.00 31.43 ? 227 ILE C CD1   1 
ATOM   8311  N N     . ILE C 1 228 ? -2.221  -35.073 -71.981  1.00 33.37 ? 228 ILE C N     1 
ATOM   8312  C CA    . ILE C 1 228 ? -1.020  -35.887 -71.802  1.00 32.28 ? 228 ILE C CA    1 
ATOM   8313  C C     . ILE C 1 228 ? 0.092   -35.338 -72.680  1.00 32.95 ? 228 ILE C C     1 
ATOM   8314  O O     . ILE C 1 228 ? 0.063   -35.509 -73.899  1.00 32.36 ? 228 ILE C O     1 
ATOM   8315  C CB    . ILE C 1 228 ? -1.229  -37.361 -72.138  1.00 31.75 ? 228 ILE C CB    1 
ATOM   8316  C CG1   . ILE C 1 228 ? -2.532  -37.882 -71.536  1.00 31.34 ? 228 ILE C CG1   1 
ATOM   8317  C CG2   . ILE C 1 228 ? 0.004   -38.184 -71.658  1.00 30.68 ? 228 ILE C CG2   1 
ATOM   8318  C CD1   . ILE C 1 228 ? -2.846  -39.300 -71.968  1.00 28.70 ? 228 ILE C CD1   1 
ATOM   8319  N N     . GLU C 1 229 ? 1.087   -34.719 -72.043  1.00 32.82 ? 229 GLU C N     1 
ATOM   8320  C CA    . GLU C 1 229 ? 2.203   -34.099 -72.739  1.00 31.92 ? 229 GLU C CA    1 
ATOM   8321  C C     . GLU C 1 229 ? 3.406   -35.072 -72.725  1.00 32.51 ? 229 GLU C C     1 
ATOM   8322  O O     . GLU C 1 229 ? 4.038   -35.282 -71.671  1.00 31.96 ? 229 GLU C O     1 
ATOM   8323  C CB    . GLU C 1 229 ? 2.511   -32.773 -72.020  1.00 32.76 ? 229 GLU C CB    1 
ATOM   8324  C CG    . GLU C 1 229 ? 3.896   -32.085 -72.263  1.00 32.54 ? 229 GLU C CG    1 
ATOM   8325  C CD    . GLU C 1 229 ? 4.058   -30.768 -71.464  1.00 31.91 ? 229 GLU C CD    1 
ATOM   8326  O OE1   . GLU C 1 229 ? 4.062   -29.684 -72.095  1.00 30.83 ? 229 GLU C OE1   1 
ATOM   8327  O OE2   . GLU C 1 229 ? 4.147   -30.813 -70.211  1.00 30.16 ? 229 GLU C OE2   1 
ATOM   8328  N N     . ASP C 1 230 ? 3.710   -35.652 -73.881  1.00 31.61 ? 230 ASP C N     1 
ATOM   8329  C CA    . ASP C 1 230 ? 4.754   -36.666 -73.979  1.00 31.17 ? 230 ASP C CA    1 
ATOM   8330  C C     . ASP C 1 230 ? 6.048   -36.072 -74.527  1.00 30.71 ? 230 ASP C C     1 
ATOM   8331  O O     . ASP C 1 230 ? 6.178   -35.843 -75.729  1.00 32.35 ? 230 ASP C O     1 
ATOM   8332  C CB    . ASP C 1 230 ? 4.294   -37.825 -74.864  1.00 31.10 ? 230 ASP C CB    1 
ATOM   8333  C CG    . ASP C 1 230 ? 5.267   -38.987 -74.854  1.00 31.11 ? 230 ASP C CG    1 
ATOM   8334  O OD1   . ASP C 1 230 ? 6.035   -39.113 -73.877  1.00 32.07 ? 230 ASP C OD1   1 
ATOM   8335  O OD2   . ASP C 1 230 ? 5.335   -39.826 -75.778  1.00 34.83 ? 230 ASP C OD2   1 
ATOM   8336  N N     . ASP C 1 231 ? 7.003   -35.827 -73.635  1.00 27.99 ? 231 ASP C N     1 
ATOM   8337  C CA    . ASP C 1 231 ? 8.025   -34.813 -73.867  1.00 26.37 ? 231 ASP C CA    1 
ATOM   8338  C C     . ASP C 1 231 ? 9.423   -35.377 -73.638  1.00 23.54 ? 231 ASP C C     1 
ATOM   8339  O O     . ASP C 1 231 ? 10.168  -34.888 -72.788  1.00 21.34 ? 231 ASP C O     1 
ATOM   8340  C CB    . ASP C 1 231 ? 7.792   -33.601 -72.965  1.00 26.68 ? 231 ASP C CB    1 
ATOM   8341  C CG    . ASP C 1 231 ? 8.101   -32.290 -73.660  1.00 30.84 ? 231 ASP C CG    1 
ATOM   8342  O OD1   . ASP C 1 231 ? 8.524   -32.323 -74.835  1.00 25.15 ? 231 ASP C OD1   1 
ATOM   8343  O OD2   . ASP C 1 231 ? 7.951   -31.179 -73.111  1.00 33.46 ? 231 ASP C OD2   1 
ATOM   8344  N N     . PRO C 1 232 ? 9.773   -36.408 -74.399  1.00 21.97 ? 232 PRO C N     1 
ATOM   8345  C CA    . PRO C 1 232 ? 11.070  -37.073 -74.247  1.00 22.19 ? 232 PRO C CA    1 
ATOM   8346  C C     . PRO C 1 232 ? 12.180  -36.324 -74.977  1.00 21.79 ? 232 PRO C C     1 
ATOM   8347  O O     . PRO C 1 232 ? 13.353  -36.663 -74.827  1.00 19.95 ? 232 PRO C O     1 
ATOM   8348  C CB    . PRO C 1 232 ? 10.837  -38.435 -74.900  1.00 21.79 ? 232 PRO C CB    1 
ATOM   8349  C CG    . PRO C 1 232 ? 9.776   -38.184 -75.911  1.00 22.31 ? 232 PRO C CG    1 
ATOM   8350  C CD    . PRO C 1 232 ? 8.880   -37.139 -75.315  1.00 23.03 ? 232 PRO C CD    1 
ATOM   8351  N N     . TYR C 1 233 ? 11.805  -35.316 -75.758  1.00 20.85 ? 233 TYR C N     1 
ATOM   8352  C CA    . TYR C 1 233 ? 12.797  -34.467 -76.468  1.00 20.16 ? 233 TYR C CA    1 
ATOM   8353  C C     . TYR C 1 233 ? 12.830  -33.064 -75.831  1.00 20.29 ? 233 TYR C C     1 
ATOM   8354  O O     . TYR C 1 233 ? 13.416  -32.112 -76.380  1.00 18.98 ? 233 TYR C O     1 
ATOM   8355  C CB    . TYR C 1 233 ? 12.492  -34.381 -77.995  1.00 18.73 ? 233 TYR C CB    1 
ATOM   8356  C CG    . TYR C 1 233 ? 12.421  -35.774 -78.614  1.00 17.16 ? 233 TYR C CG    1 
ATOM   8357  C CD1   . TYR C 1 233 ? 11.192  -36.395 -78.972  1.00 17.84 ? 233 TYR C CD1   1 
ATOM   8358  C CD2   . TYR C 1 233 ? 13.581  -36.485 -78.802  1.00 13.01 ? 233 TYR C CD2   1 
ATOM   8359  C CE1   . TYR C 1 233 ? 11.188  -37.731 -79.517  1.00 17.79 ? 233 TYR C CE1   1 
ATOM   8360  C CE2   . TYR C 1 233 ? 13.596  -37.754 -79.336  1.00 14.15 ? 233 TYR C CE2   1 
ATOM   8361  C CZ    . TYR C 1 233 ? 12.438  -38.391 -79.668  1.00 17.47 ? 233 TYR C CZ    1 
ATOM   8362  O OH    . TYR C 1 233 ? 12.617  -39.687 -80.147  1.00 21.51 ? 233 TYR C OH    1 
ATOM   8363  N N     . TYR C 1 234 ? 12.202  -32.939 -74.664  1.00 20.79 ? 234 TYR C N     1 
ATOM   8364  C CA    . TYR C 1 234 ? 12.180  -31.664 -73.968  1.00 22.09 ? 234 TYR C CA    1 
ATOM   8365  C C     . TYR C 1 234 ? 13.604  -31.099 -73.755  1.00 22.42 ? 234 TYR C C     1 
ATOM   8366  O O     . TYR C 1 234 ? 13.776  -29.868 -73.692  1.00 21.19 ? 234 TYR C O     1 
ATOM   8367  C CB    . TYR C 1 234 ? 11.436  -31.770 -72.635  1.00 22.70 ? 234 TYR C CB    1 
ATOM   8368  C CG    . TYR C 1 234 ? 11.559  -30.511 -71.816  1.00 23.45 ? 234 TYR C CG    1 
ATOM   8369  C CD1   . TYR C 1 234 ? 10.703  -29.419 -72.069  1.00 26.83 ? 234 TYR C CD1   1 
ATOM   8370  C CD2   . TYR C 1 234 ? 12.555  -30.380 -70.815  1.00 20.70 ? 234 TYR C CD2   1 
ATOM   8371  C CE1   . TYR C 1 234 ? 10.844  -28.176 -71.332  1.00 26.97 ? 234 TYR C CE1   1 
ATOM   8372  C CE2   . TYR C 1 234 ? 12.724  -29.182 -70.087  1.00 20.97 ? 234 TYR C CE2   1 
ATOM   8373  C CZ    . TYR C 1 234 ? 11.833  -28.082 -70.346  1.00 27.03 ? 234 TYR C CZ    1 
ATOM   8374  O OH    . TYR C 1 234 ? 11.940  -26.891 -69.680  1.00 27.69 ? 234 TYR C OH    1 
ATOM   8375  N N     . PHE C 1 235 ? 14.592  -31.991 -73.575  1.00 22.35 ? 235 PHE C N     1 
ATOM   8376  C CA    . PHE C 1 235 ? 16.006  -31.569 -73.450  1.00 23.20 ? 235 PHE C CA    1 
ATOM   8377  C C     . PHE C 1 235 ? 16.841  -31.615 -74.739  1.00 24.01 ? 235 PHE C C     1 
ATOM   8378  O O     . PHE C 1 235 ? 18.053  -31.253 -74.770  1.00 24.53 ? 235 PHE C O     1 
ATOM   8379  C CB    . PHE C 1 235 ? 16.706  -32.323 -72.355  1.00 22.09 ? 235 PHE C CB    1 
ATOM   8380  C CG    . PHE C 1 235 ? 16.008  -32.247 -71.033  1.00 21.11 ? 235 PHE C CG    1 
ATOM   8381  C CD1   . PHE C 1 235 ? 16.088  -31.102 -70.263  1.00 15.57 ? 235 PHE C CD1   1 
ATOM   8382  C CD2   . PHE C 1 235 ? 15.306  -33.346 -70.543  1.00 17.75 ? 235 PHE C CD2   1 
ATOM   8383  C CE1   . PHE C 1 235 ? 15.488  -31.055 -68.993  1.00 15.13 ? 235 PHE C CE1   1 
ATOM   8384  C CE2   . PHE C 1 235 ? 14.654  -33.292 -69.262  1.00 12.12 ? 235 PHE C CE2   1 
ATOM   8385  C CZ    . PHE C 1 235 ? 14.744  -32.142 -68.504  1.00 13.73 ? 235 PHE C CZ    1 
ATOM   8386  N N     . LEU C 1 236 ? 16.193  -32.011 -75.817  1.00 24.29 ? 236 LEU C N     1 
ATOM   8387  C CA    . LEU C 1 236 ? 16.826  -31.874 -77.116  1.00 25.37 ? 236 LEU C CA    1 
ATOM   8388  C C     . LEU C 1 236 ? 16.290  -30.683 -77.955  1.00 26.31 ? 236 LEU C C     1 
ATOM   8389  O O     . LEU C 1 236 ? 16.279  -30.708 -79.184  1.00 26.49 ? 236 LEU C O     1 
ATOM   8390  C CB    . LEU C 1 236 ? 16.771  -33.202 -77.832  1.00 25.17 ? 236 LEU C CB    1 
ATOM   8391  C CG    . LEU C 1 236 ? 18.002  -34.091 -77.759  1.00 26.69 ? 236 LEU C CG    1 
ATOM   8392  C CD1   . LEU C 1 236 ? 18.510  -34.270 -76.380  1.00 24.62 ? 236 LEU C CD1   1 
ATOM   8393  C CD2   . LEU C 1 236 ? 17.608  -35.457 -78.315  1.00 31.82 ? 236 LEU C CD2   1 
ATOM   8394  N N     . GLN C 1 237 ? 15.859  -29.622 -77.280  1.00 27.55 ? 237 GLN C N     1 
ATOM   8395  C CA    . GLN C 1 237 ? 15.480  -28.410 -78.001  1.00 28.37 ? 237 GLN C CA    1 
ATOM   8396  C C     . GLN C 1 237 ? 16.678  -27.594 -78.445  1.00 30.58 ? 237 GLN C C     1 
ATOM   8397  O O     . GLN C 1 237 ? 17.538  -27.276 -77.640  1.00 30.60 ? 237 GLN C O     1 
ATOM   8398  C CB    . GLN C 1 237 ? 14.516  -27.546 -77.174  1.00 29.33 ? 237 GLN C CB    1 
ATOM   8399  C CG    . GLN C 1 237 ? 13.195  -28.217 -76.780  1.00 23.29 ? 237 GLN C CG    1 
ATOM   8400  C CD    . GLN C 1 237 ? 12.341  -27.306 -75.958  1.00 27.66 ? 237 GLN C CD    1 
ATOM   8401  O OE1   . GLN C 1 237 ? 12.020  -27.604 -74.779  1.00 25.28 ? 237 GLN C OE1   1 
ATOM   8402  N NE2   . GLN C 1 237 ? 11.957  -26.152 -76.557  1.00 24.72 ? 237 GLN C NE2   1 
ATOM   8403  N N     . PHE C 1 238 ? 16.696  -27.244 -79.739  1.00 33.21 ? 238 PHE C N     1 
ATOM   8404  C CA    . PHE C 1 238 ? 17.735  -26.437 -80.390  1.00 34.62 ? 238 PHE C CA    1 
ATOM   8405  C C     . PHE C 1 238 ? 17.686  -24.941 -80.127  1.00 37.48 ? 238 PHE C C     1 
ATOM   8406  O O     . PHE C 1 238 ? 18.764  -24.259 -80.079  1.00 37.72 ? 238 PHE C O     1 
ATOM   8407  C CB    . PHE C 1 238 ? 17.719  -26.668 -81.896  1.00 32.73 ? 238 PHE C CB    1 
ATOM   8408  C CG    . PHE C 1 238 ? 17.765  -28.104 -82.259  1.00 30.61 ? 238 PHE C CG    1 
ATOM   8409  C CD1   . PHE C 1 238 ? 16.853  -28.636 -83.152  1.00 25.75 ? 238 PHE C CD1   1 
ATOM   8410  C CD2   . PHE C 1 238 ? 18.728  -28.942 -81.682  1.00 24.44 ? 238 PHE C CD2   1 
ATOM   8411  C CE1   . PHE C 1 238 ? 16.889  -29.959 -83.409  1.00 22.31 ? 238 PHE C CE1   1 
ATOM   8412  C CE2   . PHE C 1 238 ? 18.778  -30.261 -81.974  1.00 18.75 ? 238 PHE C CE2   1 
ATOM   8413  C CZ    . PHE C 1 238 ? 17.872  -30.779 -82.794  1.00 21.35 ? 238 PHE C CZ    1 
ATOM   8414  N N     . ASN C 1 239 ? 16.467  -24.407 -80.016  1.00 39.86 ? 239 ASN C N     1 
ATOM   8415  C CA    . ASN C 1 239 ? 16.334  -23.051 -79.498  1.00 41.80 ? 239 ASN C CA    1 
ATOM   8416  C C     . ASN C 1 239 ? 16.707  -23.049 -78.023  1.00 42.46 ? 239 ASN C C     1 
ATOM   8417  O O     . ASN C 1 239 ? 16.027  -23.637 -77.185  1.00 41.86 ? 239 ASN C O     1 
ATOM   8418  C CB    . ASN C 1 239 ? 14.943  -22.469 -79.684  1.00 42.56 ? 239 ASN C CB    1 
ATOM   8419  C CG    . ASN C 1 239 ? 14.888  -20.976 -79.349  1.00 44.34 ? 239 ASN C CG    1 
ATOM   8420  O OD1   . ASN C 1 239 ? 15.411  -20.530 -78.324  1.00 45.60 ? 239 ASN C OD1   1 
ATOM   8421  N ND2   . ASN C 1 239 ? 14.243  -20.198 -80.218  1.00 45.16 ? 239 ASN C ND2   1 
ATOM   8422  N N     . LYS C 1 240 ? 17.813  -22.373 -77.746  1.00 43.39 ? 240 LYS C N     1 
ATOM   8423  C CA    . LYS C 1 240 ? 18.340  -22.187 -76.411  1.00 43.54 ? 240 LYS C CA    1 
ATOM   8424  C C     . LYS C 1 240 ? 17.290  -21.786 -75.395  1.00 43.57 ? 240 LYS C C     1 
ATOM   8425  O O     . LYS C 1 240 ? 17.343  -22.201 -74.218  1.00 43.24 ? 240 LYS C O     1 
ATOM   8426  C CB    . LYS C 1 240 ? 19.460  -21.150 -76.484  1.00 44.87 ? 240 LYS C CB    1 
ATOM   8427  C CG    . LYS C 1 240 ? 20.763  -21.686 -77.163  1.00 45.12 ? 240 LYS C CG    1 
ATOM   8428  C CD    . LYS C 1 240 ? 21.340  -22.920 -76.443  1.00 49.21 ? 240 LYS C CD    1 
ATOM   8429  C CE    . LYS C 1 240 ? 22.910  -22.876 -76.357  1.00 52.25 ? 240 LYS C CE    1 
ATOM   8430  N NZ    . LYS C 1 240 ? 23.451  -21.707 -75.561  1.00 52.44 ? 240 LYS C NZ    1 
ATOM   8431  N N     . PHE C 1 241 ? 16.318  -21.000 -75.850  1.00 43.26 ? 241 PHE C N     1 
ATOM   8432  C CA    . PHE C 1 241 ? 15.187  -20.631 -75.018  1.00 43.09 ? 241 PHE C CA    1 
ATOM   8433  C C     . PHE C 1 241 ? 14.086  -21.681 -75.220  1.00 41.83 ? 241 PHE C C     1 
ATOM   8434  O O     . PHE C 1 241 ? 13.567  -21.860 -76.323  1.00 42.63 ? 241 PHE C O     1 
ATOM   8435  C CB    . PHE C 1 241 ? 14.742  -19.187 -75.290  1.00 44.53 ? 241 PHE C CB    1 
ATOM   8436  C CG    . PHE C 1 241 ? 15.787  -18.115 -74.888  1.00 48.13 ? 241 PHE C CG    1 
ATOM   8437  C CD1   . PHE C 1 241 ? 17.168  -18.341 -75.041  1.00 50.96 ? 241 PHE C CD1   1 
ATOM   8438  C CD2   . PHE C 1 241 ? 15.380  -16.872 -74.382  1.00 51.18 ? 241 PHE C CD2   1 
ATOM   8439  C CE1   . PHE C 1 241 ? 18.117  -17.365 -74.700  1.00 49.64 ? 241 PHE C CE1   1 
ATOM   8440  C CE2   . PHE C 1 241 ? 16.326  -15.890 -74.030  1.00 50.84 ? 241 PHE C CE2   1 
ATOM   8441  C CZ    . PHE C 1 241 ? 17.698  -16.143 -74.201  1.00 49.10 ? 241 PHE C CZ    1 
ATOM   8442  N N     . ARG C 1 242 ? 13.775  -22.404 -74.144  1.00 39.53 ? 242 ARG C N     1 
ATOM   8443  C CA    . ARG C 1 242 ? 12.855  -23.520 -74.185  1.00 36.86 ? 242 ARG C CA    1 
ATOM   8444  C C     . ARG C 1 242 ? 11.419  -23.041 -74.114  1.00 35.83 ? 242 ARG C C     1 
ATOM   8445  O O     . ARG C 1 242 ? 11.069  -22.123 -73.330  1.00 35.01 ? 242 ARG C O     1 
ATOM   8446  C CB    . ARG C 1 242 ? 13.156  -24.517 -73.051  1.00 36.74 ? 242 ARG C CB    1 
ATOM   8447  C CG    . ARG C 1 242 ? 14.423  -25.371 -73.254  1.00 34.72 ? 242 ARG C CG    1 
ATOM   8448  C CD    . ARG C 1 242 ? 14.581  -26.424 -72.172  1.00 37.10 ? 242 ARG C CD    1 
ATOM   8449  N NE    . ARG C 1 242 ? 14.365  -25.878 -70.825  1.00 39.02 ? 242 ARG C NE    1 
ATOM   8450  C CZ    . ARG C 1 242 ? 15.315  -25.296 -70.085  1.00 38.29 ? 242 ARG C CZ    1 
ATOM   8451  N NH1   . ARG C 1 242 ? 16.553  -25.162 -70.540  1.00 30.98 ? 242 ARG C NH1   1 
ATOM   8452  N NH2   . ARG C 1 242 ? 15.009  -24.831 -68.880  1.00 40.32 ? 242 ARG C NH2   1 
ATOM   8453  N N     . VAL C 1 243 ? 10.583  -23.643 -74.958  1.00 33.67 ? 243 VAL C N     1 
ATOM   8454  C CA    . VAL C 1 243 ? 9.195   -23.337 -74.914  1.00 31.90 ? 243 VAL C CA    1 
ATOM   8455  C C     . VAL C 1 243 ? 8.683   -23.878 -73.596  1.00 32.46 ? 243 VAL C C     1 
ATOM   8456  O O     . VAL C 1 243 ? 8.971   -25.057 -73.269  1.00 30.23 ? 243 VAL C O     1 
ATOM   8457  C CB    . VAL C 1 243 ? 8.379   -23.995 -76.006  1.00 32.42 ? 243 VAL C CB    1 
ATOM   8458  C CG1   . VAL C 1 243 ? 7.018   -23.416 -75.962  1.00 29.46 ? 243 VAL C CG1   1 
ATOM   8459  C CG2   . VAL C 1 243 ? 9.049   -23.833 -77.444  1.00 32.07 ? 243 VAL C CG2   1 
ATOM   8460  N N     . PRO C 1 244 ? 7.945   -23.014 -72.834  1.00 32.17 ? 244 PRO C N     1 
ATOM   8461  C CA    . PRO C 1 244 ? 7.131   -23.347 -71.673  1.00 32.44 ? 244 PRO C CA    1 
ATOM   8462  C C     . PRO C 1 244 ? 6.289   -24.580 -71.928  1.00 31.71 ? 244 PRO C C     1 
ATOM   8463  O O     . PRO C 1 244 ? 5.815   -24.740 -73.047  1.00 32.02 ? 244 PRO C O     1 
ATOM   8464  C CB    . PRO C 1 244 ? 6.210   -22.115 -71.525  1.00 33.17 ? 244 PRO C CB    1 
ATOM   8465  C CG    . PRO C 1 244 ? 7.063   -20.960 -72.000  1.00 34.43 ? 244 PRO C CG    1 
ATOM   8466  C CD    . PRO C 1 244 ? 7.940   -21.557 -73.106  1.00 32.77 ? 244 PRO C CD    1 
ATOM   8467  N N     . THR C 1 245 ? 6.148   -25.450 -70.921  1.00 30.43 ? 245 THR C N     1 
ATOM   8468  C CA    . THR C 1 245 ? 5.420   -26.715 -71.062  1.00 29.74 ? 245 THR C CA    1 
ATOM   8469  C C     . THR C 1 245 ? 3.958   -26.558 -70.762  1.00 29.99 ? 245 THR C C     1 
ATOM   8470  O O     . THR C 1 245 ? 3.512   -25.514 -70.277  1.00 31.63 ? 245 THR C O     1 
ATOM   8471  C CB    . THR C 1 245 ? 5.882   -27.732 -70.024  1.00 30.00 ? 245 THR C CB    1 
ATOM   8472  O OG1   . THR C 1 245 ? 5.953   -27.099 -68.729  1.00 29.60 ? 245 THR C OG1   1 
ATOM   8473  C CG2   . THR C 1 245 ? 7.239   -28.333 -70.420  1.00 29.54 ? 245 THR C CG2   1 
ATOM   8474  N N     . PHE C 1 246 ? 3.195   -27.615 -70.963  1.00 28.71 ? 246 PHE C N     1 
ATOM   8475  C CA    . PHE C 1 246 ? 1.843   -27.566 -70.496  1.00 27.13 ? 246 PHE C CA    1 
ATOM   8476  C C     . PHE C 1 246 ? 1.820   -27.542 -68.978  1.00 27.90 ? 246 PHE C C     1 
ATOM   8477  O O     . PHE C 1 246 ? 0.870   -27.001 -68.402  1.00 26.36 ? 246 PHE C O     1 
ATOM   8478  C CB    . PHE C 1 246 ? 1.033   -28.720 -71.058  1.00 26.67 ? 246 PHE C CB    1 
ATOM   8479  C CG    . PHE C 1 246 ? 0.499   -28.475 -72.503  1.00 26.57 ? 246 PHE C CG    1 
ATOM   8480  C CD1   . PHE C 1 246 ? 0.899   -29.295 -73.545  1.00 26.64 ? 246 PHE C CD1   1 
ATOM   8481  C CD2   . PHE C 1 246 ? -0.445  -27.496 -72.766  1.00 23.45 ? 246 PHE C CD2   1 
ATOM   8482  C CE1   . PHE C 1 246 ? 0.413   -29.114 -74.869  1.00 28.21 ? 246 PHE C CE1   1 
ATOM   8483  C CE2   . PHE C 1 246 ? -0.961  -27.309 -74.053  1.00 24.83 ? 246 PHE C CE2   1 
ATOM   8484  C CZ    . PHE C 1 246 ? -0.523  -28.127 -75.124  1.00 24.92 ? 246 PHE C CZ    1 
ATOM   8485  N N     . LEU C 1 247 ? 2.860   -28.145 -68.338  1.00 27.90 ? 247 LEU C N     1 
ATOM   8486  C CA    . LEU C 1 247 ? 2.868   -28.395 -66.906  1.00 27.70 ? 247 LEU C CA    1 
ATOM   8487  C C     . LEU C 1 247 ? 3.023   -27.088 -66.178  1.00 29.92 ? 247 LEU C C     1 
ATOM   8488  O O     . LEU C 1 247 ? 2.275   -26.815 -65.228  1.00 30.39 ? 247 LEU C O     1 
ATOM   8489  C CB    . LEU C 1 247 ? 3.940   -29.434 -66.475  1.00 28.29 ? 247 LEU C CB    1 
ATOM   8490  C CG    . LEU C 1 247 ? 4.039   -29.837 -64.987  1.00 26.59 ? 247 LEU C CG    1 
ATOM   8491  C CD1   . LEU C 1 247 ? 2.719   -30.426 -64.499  1.00 20.41 ? 247 LEU C CD1   1 
ATOM   8492  C CD2   . LEU C 1 247 ? 5.234   -30.792 -64.648  1.00 25.67 ? 247 LEU C CD2   1 
ATOM   8493  N N     . SER C 1 248 ? 3.927   -26.238 -66.678  1.00 31.49 ? 248 SER C N     1 
ATOM   8494  C CA    . SER C 1 248 ? 4.061   -24.846 -66.183  1.00 33.14 ? 248 SER C CA    1 
ATOM   8495  C C     . SER C 1 248 ? 2.793   -23.980 -66.229  1.00 33.48 ? 248 SER C C     1 
ATOM   8496  O O     . SER C 1 248 ? 2.767   -22.906 -65.633  1.00 34.17 ? 248 SER C O     1 
ATOM   8497  C CB    . SER C 1 248 ? 5.181   -24.092 -66.936  1.00 33.51 ? 248 SER C CB    1 
ATOM   8498  O OG    . SER C 1 248 ? 4.900   -23.983 -68.340  1.00 33.40 ? 248 SER C OG    1 
ATOM   8499  N N     . MET C 1 249 ? 1.754   -24.427 -66.922  1.00 34.69 ? 249 MET C N     1 
ATOM   8500  C CA    . MET C 1 249 ? 0.523   -23.604 -67.129  1.00 36.55 ? 249 MET C CA    1 
ATOM   8501  C C     . MET C 1 249 ? -0.770  -24.356 -66.700  1.00 36.84 ? 249 MET C C     1 
ATOM   8502  O O     . MET C 1 249 ? -1.919  -23.965 -66.999  1.00 37.48 ? 249 MET C O     1 
ATOM   8503  C CB    . MET C 1 249 ? 0.462   -23.016 -68.564  1.00 35.14 ? 249 MET C CB    1 
ATOM   8504  C CG    . MET C 1 249 ? 0.389   -24.025 -69.744  1.00 36.15 ? 249 MET C CG    1 
ATOM   8505  S SD    . MET C 1 249 ? 0.315   -23.340 -71.469  1.00 39.12 ? 249 MET C SD    1 
ATOM   8506  C CE    . MET C 1 249 ? 2.022   -22.810 -71.721  1.00 36.84 ? 249 MET C CE    1 
ATOM   8507  N N     . ASP C 1 250 ? -0.545  -25.427 -65.963  1.00 37.60 ? 250 ASP C N     1 
ATOM   8508  C CA    . ASP C 1 250 ? -1.585  -26.310 -65.519  1.00 38.43 ? 250 ASP C CA    1 
ATOM   8509  C C     . ASP C 1 250 ? -2.072  -25.873 -64.135  1.00 39.75 ? 250 ASP C C     1 
ATOM   8510  O O     . ASP C 1 250 ? -1.872  -26.550 -63.122  1.00 39.56 ? 250 ASP C O     1 
ATOM   8511  C CB    . ASP C 1 250 ? -1.059  -27.735 -65.537  1.00 38.79 ? 250 ASP C CB    1 
ATOM   8512  C CG    . ASP C 1 250 ? -2.081  -28.748 -65.125  1.00 38.41 ? 250 ASP C CG    1 
ATOM   8513  O OD1   . ASP C 1 250 ? -3.202  -28.702 -65.633  1.00 34.28 ? 250 ASP C OD1   1 
ATOM   8514  O OD2   . ASP C 1 250 ? -1.730  -29.625 -64.307  1.00 39.66 ? 250 ASP C OD2   1 
ATOM   8515  N N     . VAL C 1 251 ? -2.757  -24.730 -64.121  1.00 40.85 ? 251 VAL C N     1 
ATOM   8516  C CA    . VAL C 1 251 ? -3.323  -24.190 -62.884  1.00 41.42 ? 251 VAL C CA    1 
ATOM   8517  C C     . VAL C 1 251 ? -4.514  -25.025 -62.401  1.00 40.08 ? 251 VAL C C     1 
ATOM   8518  O O     . VAL C 1 251 ? -4.865  -24.989 -61.213  1.00 39.86 ? 251 VAL C O     1 
ATOM   8519  C CB    . VAL C 1 251 ? -3.564  -22.635 -62.997  1.00 41.19 ? 251 VAL C CB    1 
ATOM   8520  C CG1   . VAL C 1 251 ? -4.067  -22.306 -64.339  1.00 43.92 ? 251 VAL C CG1   1 
ATOM   8521  C CG2   . VAL C 1 251 ? -4.519  -22.096 -61.915  1.00 43.21 ? 251 VAL C CG2   1 
ATOM   8522  N N     . ASP C 1 252 ? -5.056  -25.840 -63.319  1.00 39.36 ? 252 ASP C N     1 
ATOM   8523  C CA    . ASP C 1 252 ? -6.191  -26.781 -63.043  1.00 38.57 ? 252 ASP C CA    1 
ATOM   8524  C C     . ASP C 1 252 ? -5.904  -28.168 -62.409  1.00 37.60 ? 252 ASP C C     1 
ATOM   8525  O O     . ASP C 1 252 ? -6.821  -28.789 -61.833  1.00 38.24 ? 252 ASP C O     1 
ATOM   8526  C CB    . ASP C 1 252 ? -6.959  -27.053 -64.340  1.00 38.81 ? 252 ASP C CB    1 
ATOM   8527  C CG    . ASP C 1 252 ? -7.790  -25.892 -64.765  1.00 40.80 ? 252 ASP C CG    1 
ATOM   8528  O OD1   . ASP C 1 252 ? -8.183  -25.151 -63.855  1.00 45.60 ? 252 ASP C OD1   1 
ATOM   8529  O OD2   . ASP C 1 252 ? -8.052  -25.713 -65.985  1.00 41.37 ? 252 ASP C OD2   1 
ATOM   8530  N N     . GLY C 1 253 ? -4.676  -28.661 -62.563  1.00 35.98 ? 253 GLY C N     1 
ATOM   8531  C CA    . GLY C 1 253 ? -4.344  -30.035 -62.301  1.00 34.69 ? 253 GLY C CA    1 
ATOM   8532  C C     . GLY C 1 253 ? -4.893  -30.925 -63.417  1.00 34.91 ? 253 GLY C C     1 
ATOM   8533  O O     . GLY C 1 253 ? -5.485  -31.989 -63.146  1.00 34.89 ? 253 GLY C O     1 
ATOM   8534  N N     . ARG C 1 254 ? -4.722  -30.533 -64.672  1.00 34.70 ? 254 ARG C N     1 
ATOM   8535  C CA    . ARG C 1 254 ? -5.298  -31.357 -65.757  1.00 35.13 ? 254 ARG C CA    1 
ATOM   8536  C C     . ARG C 1 254 ? -4.235  -31.935 -66.727  1.00 34.76 ? 254 ARG C C     1 
ATOM   8537  O O     . ARG C 1 254 ? -4.579  -32.518 -67.785  1.00 34.47 ? 254 ARG C O     1 
ATOM   8538  C CB    . ARG C 1 254 ? -6.463  -30.636 -66.490  1.00 33.61 ? 254 ARG C CB    1 
ATOM   8539  C CG    . ARG C 1 254 ? -6.001  -29.611 -67.527  1.00 35.09 ? 254 ARG C CG    1 
ATOM   8540  C CD    . ARG C 1 254 ? -7.150  -29.122 -68.487  1.00 35.25 ? 254 ARG C CD    1 
ATOM   8541  N NE    . ARG C 1 254 ? -8.125  -28.310 -67.767  1.00 32.37 ? 254 ARG C NE    1 
ATOM   8542  C CZ    . ARG C 1 254 ? -9.263  -28.789 -67.293  1.00 32.64 ? 254 ARG C CZ    1 
ATOM   8543  N NH1   . ARG C 1 254 ? -9.580  -30.050 -67.497  1.00 31.53 ? 254 ARG C NH1   1 
ATOM   8544  N NH2   . ARG C 1 254 ? -10.088 -28.000 -66.625  1.00 35.66 ? 254 ARG C NH2   1 
ATOM   8545  N N     . VAL C 1 255 ? -2.959  -31.771 -66.345  1.00 34.17 ? 255 VAL C N     1 
ATOM   8546  C CA    . VAL C 1 255 ? -1.805  -32.132 -67.203  1.00 32.45 ? 255 VAL C CA    1 
ATOM   8547  C C     . VAL C 1 255 ? -1.008  -33.280 -66.594  1.00 32.25 ? 255 VAL C C     1 
ATOM   8548  O O     . VAL C 1 255 ? -0.523  -33.195 -65.487  1.00 32.38 ? 255 VAL C O     1 
ATOM   8549  C CB    . VAL C 1 255 ? -0.875  -30.935 -67.432  1.00 32.54 ? 255 VAL C CB    1 
ATOM   8550  C CG1   . VAL C 1 255 ? 0.480   -31.344 -68.155  1.00 33.41 ? 255 VAL C CG1   1 
ATOM   8551  C CG2   . VAL C 1 255 ? -1.578  -29.834 -68.184  1.00 31.96 ? 255 VAL C CG2   1 
ATOM   8552  N N     . ILE C 1 256 ? -0.884  -34.360 -67.338  1.00 31.68 ? 256 ILE C N     1 
ATOM   8553  C CA    . ILE C 1 256 ? -0.001  -35.460 -66.981  1.00 30.38 ? 256 ILE C CA    1 
ATOM   8554  C C     . ILE C 1 256 ? 1.281   -35.313 -67.849  1.00 28.80 ? 256 ILE C C     1 
ATOM   8555  O O     . ILE C 1 256 ? 1.271   -35.403 -69.079  1.00 29.84 ? 256 ILE C O     1 
ATOM   8556  C CB    . ILE C 1 256 ? -0.774  -36.809 -67.214  1.00 31.21 ? 256 ILE C CB    1 
ATOM   8557  C CG1   . ILE C 1 256 ? -2.177  -36.709 -66.559  1.00 32.04 ? 256 ILE C CG1   1 
ATOM   8558  C CG2   . ILE C 1 256 ? 0.000   -38.018 -66.647  1.00 30.45 ? 256 ILE C CG2   1 
ATOM   8559  C CD1   . ILE C 1 256 ? -2.983  -37.960 -66.574  1.00 29.23 ? 256 ILE C CD1   1 
ATOM   8560  N N     . ARG C 1 257 ? 2.392   -35.039 -67.217  1.00 27.64 ? 257 ARG C N     1 
ATOM   8561  C CA    . ARG C 1 257 ? 3.687   -35.010 -67.932  1.00 25.83 ? 257 ARG C CA    1 
ATOM   8562  C C     . ARG C 1 257 ? 4.371   -36.359 -67.977  1.00 24.26 ? 257 ARG C C     1 
ATOM   8563  O O     . ARG C 1 257 ? 4.550   -36.965 -66.940  1.00 22.01 ? 257 ARG C O     1 
ATOM   8564  C CB    . ARG C 1 257 ? 4.632   -33.989 -67.299  1.00 25.17 ? 257 ARG C CB    1 
ATOM   8565  C CG    . ARG C 1 257 ? 5.698   -33.656 -68.211  1.00 25.60 ? 257 ARG C CG    1 
ATOM   8566  C CD    . ARG C 1 257 ? 6.335   -32.382 -67.916  1.00 22.91 ? 257 ARG C CD    1 
ATOM   8567  N NE    . ARG C 1 257 ? 7.655   -32.330 -68.550  1.00 25.91 ? 257 ARG C NE    1 
ATOM   8568  C CZ    . ARG C 1 257 ? 7.920   -31.791 -69.738  1.00 27.05 ? 257 ARG C CZ    1 
ATOM   8569  N NH1   . ARG C 1 257 ? 6.932   -31.234 -70.474  1.00 24.92 ? 257 ARG C NH1   1 
ATOM   8570  N NH2   . ARG C 1 257 ? 9.191   -31.758 -70.149  1.00 19.76 ? 257 ARG C NH2   1 
ATOM   8571  N N     . ALA C 1 258 ? 4.755   -36.828 -69.178  1.00 24.67 ? 258 ALA C N     1 
ATOM   8572  C CA    . ALA C 1 258 ? 5.817   -37.885 -69.267  1.00 24.59 ? 258 ALA C CA    1 
ATOM   8573  C C     . ALA C 1 258 ? 7.137   -37.244 -69.661  1.00 24.00 ? 258 ALA C C     1 
ATOM   8574  O O     . ALA C 1 258 ? 7.154   -36.445 -70.584  1.00 23.67 ? 258 ALA C O     1 
ATOM   8575  C CB    . ALA C 1 258 ? 5.452   -38.999 -70.249  1.00 24.70 ? 258 ALA C CB    1 
ATOM   8576  N N     . ASP C 1 259 ? 8.223   -37.638 -68.968  1.00 24.88 ? 259 ASP C N     1 
ATOM   8577  C CA    . ASP C 1 259 ? 9.602   -37.084 -69.084  1.00 24.88 ? 259 ASP C CA    1 
ATOM   8578  C C     . ASP C 1 259 ? 10.552  -38.226 -69.220  1.00 24.66 ? 259 ASP C C     1 
ATOM   8579  O O     . ASP C 1 259 ? 10.370  -39.254 -68.573  1.00 23.74 ? 259 ASP C O     1 
ATOM   8580  C CB    . ASP C 1 259 ? 10.082  -36.404 -67.804  1.00 24.62 ? 259 ASP C CB    1 
ATOM   8581  C CG    . ASP C 1 259 ? 9.997   -34.880 -67.871  1.00 28.01 ? 259 ASP C CG    1 
ATOM   8582  O OD1   . ASP C 1 259 ? 10.674  -34.222 -68.685  1.00 30.28 ? 259 ASP C OD1   1 
ATOM   8583  O OD2   . ASP C 1 259 ? 9.257   -34.317 -67.047  1.00 31.53 ? 259 ASP C OD2   1 
ATOM   8584  N N     . SER C 1 260 ? 11.626  -37.993 -69.990  1.00 22.29 ? 260 SER C N     1 
ATOM   8585  C CA    . SER C 1 260 ? 12.442  -39.060 -70.445  1.00 21.08 ? 260 SER C CA    1 
ATOM   8586  C C     . SER C 1 260 ? 13.961  -38.785 -70.241  1.00 19.81 ? 260 SER C C     1 
ATOM   8587  O O     . SER C 1 260 ? 14.475  -37.681 -70.404  1.00 19.93 ? 260 SER C O     1 
ATOM   8588  C CB    . SER C 1 260 ? 12.057  -39.388 -71.906  1.00 20.80 ? 260 SER C CB    1 
ATOM   8589  O OG    . SER C 1 260 ? 12.473  -40.695 -72.284  1.00 21.83 ? 260 SER C OG    1 
ATOM   8590  N N     . PHE C 1 261 ? 14.643  -39.826 -69.884  1.00 19.33 ? 261 PHE C N     1 
ATOM   8591  C CA    . PHE C 1 261 ? 16.110  -39.871 -69.809  1.00 20.25 ? 261 PHE C CA    1 
ATOM   8592  C C     . PHE C 1 261 ? 16.755  -40.608 -70.976  1.00 21.05 ? 261 PHE C C     1 
ATOM   8593  O O     . PHE C 1 261 ? 17.944  -40.512 -71.193  1.00 22.38 ? 261 PHE C O     1 
ATOM   8594  C CB    . PHE C 1 261 ? 16.481  -40.487 -68.509  1.00 19.02 ? 261 PHE C CB    1 
ATOM   8595  C CG    . PHE C 1 261 ? 16.434  -39.512 -67.415  1.00 19.19 ? 261 PHE C CG    1 
ATOM   8596  C CD1   . PHE C 1 261 ? 16.637  -38.161 -67.695  1.00 20.82 ? 261 PHE C CD1   1 
ATOM   8597  C CD2   . PHE C 1 261 ? 16.209  -39.886 -66.133  1.00 18.51 ? 261 PHE C CD2   1 
ATOM   8598  C CE1   . PHE C 1 261 ? 16.612  -37.222 -66.696  1.00 17.99 ? 261 PHE C CE1   1 
ATOM   8599  C CE2   . PHE C 1 261 ? 16.200  -38.932 -65.100  1.00 20.27 ? 261 PHE C CE2   1 
ATOM   8600  C CZ    . PHE C 1 261 ? 16.391  -37.610 -65.400  1.00 21.37 ? 261 PHE C CZ    1 
ATOM   8601  N N     . SER C 1 262 ? 15.939  -41.246 -71.794  1.00 21.91 ? 262 SER C N     1 
ATOM   8602  C CA    . SER C 1 262 ? 16.411  -42.015 -72.939  1.00 23.41 ? 262 SER C CA    1 
ATOM   8603  C C     . SER C 1 262 ? 17.337  -41.336 -74.035  1.00 24.09 ? 262 SER C C     1 
ATOM   8604  O O     . SER C 1 262 ? 18.032  -42.013 -74.815  1.00 24.32 ? 262 SER C O     1 
ATOM   8605  C CB    . SER C 1 262 ? 15.199  -42.749 -73.534  1.00 23.13 ? 262 SER C CB    1 
ATOM   8606  O OG    . SER C 1 262 ? 14.741  -43.743 -72.587  1.00 20.88 ? 262 SER C OG    1 
HETATM 8607  N N1    . LLP C 1 263 ? 8.232   -41.112 -76.861  1.00 29.65 ? 263 LLP C N1    1 
HETATM 8608  C C2    . LLP C 1 263 ? 8.797   -40.698 -78.031  1.00 32.82 ? 263 LLP C C2    1 
HETATM 8609  C "C2'" . LLP C 1 263 ? 7.908   -40.076 -79.056  1.00 33.94 ? 263 LLP C "C2'" 1 
HETATM 8610  C C3    . LLP C 1 263 ? 10.156  -40.862 -78.260  1.00 34.56 ? 263 LLP C C3    1 
HETATM 8611  O O3    . LLP C 1 263 ? 10.642  -40.485 -79.317  1.00 32.80 ? 263 LLP C O3    1 
HETATM 8612  C C4    . LLP C 1 263 ? 10.957  -41.443 -77.284  1.00 32.72 ? 263 LLP C C4    1 
HETATM 8613  C "C4'" . LLP C 1 263 ? 12.432  -41.617 -77.511  1.00 32.59 ? 263 LLP C "C4'" 1 
HETATM 8614  C C5    . LLP C 1 263 ? 10.368  -41.859 -76.096  1.00 32.60 ? 263 LLP C C5    1 
HETATM 8615  C C6    . LLP C 1 263 ? 9.015   -41.675 -75.898  1.00 33.35 ? 263 LLP C C6    1 
HETATM 8616  C "C5'" . LLP C 1 263 ? 11.166  -42.491 -75.006  1.00 32.25 ? 263 LLP C "C5'" 1 
HETATM 8617  O OP4   . LLP C 1 263 ? 10.776  -43.750 -74.401  1.00 29.91 ? 263 LLP C OP4   1 
HETATM 8618  P P     . LLP C 1 263 ? 11.355  -44.169 -72.986  1.00 22.56 ? 263 LLP C P     1 
HETATM 8619  O OP1   . LLP C 1 263 ? 12.662  -44.715 -73.244  1.00 30.31 ? 263 LLP C OP1   1 
HETATM 8620  O OP2   . LLP C 1 263 ? 11.366  -42.933 -72.233  1.00 17.57 ? 263 LLP C OP2   1 
HETATM 8621  O OP3   . LLP C 1 263 ? 10.435  -45.170 -72.524  1.00 28.33 ? 263 LLP C OP3   1 
HETATM 8622  N N     . LLP C 1 263 ? 17.346  -40.021 -74.118  1.00 25.08 ? 263 LLP C N     1 
HETATM 8623  C CA    . LLP C 1 263 ? 18.187  -39.388 -75.116  1.00 25.71 ? 263 LLP C CA    1 
HETATM 8624  C CB    . LLP C 1 263 ? 17.393  -38.455 -76.024  1.00 26.87 ? 263 LLP C CB    1 
HETATM 8625  C CG    . LLP C 1 263 ? 16.484  -39.165 -77.019  1.00 27.81 ? 263 LLP C CG    1 
HETATM 8626  C CD    . LLP C 1 263 ? 15.230  -39.660 -76.343  1.00 27.32 ? 263 LLP C CD    1 
HETATM 8627  C CE    . LLP C 1 263 ? 14.533  -40.727 -77.124  1.00 28.38 ? 263 LLP C CE    1 
HETATM 8628  N NZ    . LLP C 1 263 ? 13.113  -40.778 -76.744  1.00 30.17 ? 263 LLP C NZ    1 
HETATM 8629  C C     . LLP C 1 263 ? 19.358  -38.694 -74.488  1.00 25.93 ? 263 LLP C C     1 
HETATM 8630  O O     . LLP C 1 263 ? 20.307  -38.341 -75.160  1.00 25.25 ? 263 LLP C O     1 
ATOM   8631  N N     . ILE C 1 264 ? 19.279  -38.528 -73.178  1.00 27.26 ? 264 ILE C N     1 
ATOM   8632  C CA    . ILE C 1 264 ? 20.238  -37.756 -72.420  1.00 27.69 ? 264 ILE C CA    1 
ATOM   8633  C C     . ILE C 1 264 ? 21.141  -38.624 -71.568  1.00 29.13 ? 264 ILE C C     1 
ATOM   8634  O O     . ILE C 1 264 ? 22.351  -38.511 -71.644  1.00 29.58 ? 264 ILE C O     1 
ATOM   8635  C CB    . ILE C 1 264 ? 19.529  -36.722 -71.560  1.00 28.86 ? 264 ILE C CB    1 
ATOM   8636  C CG1   . ILE C 1 264 ? 18.704  -35.805 -72.433  1.00 30.31 ? 264 ILE C CG1   1 
ATOM   8637  C CG2   . ILE C 1 264 ? 20.495  -35.911 -70.788  1.00 28.63 ? 264 ILE C CG2   1 
ATOM   8638  C CD1   . ILE C 1 264 ? 17.271  -35.873 -72.151  1.00 32.04 ? 264 ILE C CD1   1 
ATOM   8639  N N     . ILE C 1 265 ? 20.570  -39.491 -70.754  1.00 28.11 ? 265 ILE C N     1 
ATOM   8640  C CA    . ILE C 1 265 ? 21.404  -40.330 -69.922  1.00 28.55 ? 265 ILE C CA    1 
ATOM   8641  C C     . ILE C 1 265 ? 21.385  -41.838 -70.144  1.00 28.02 ? 265 ILE C C     1 
ATOM   8642  O O     . ILE C 1 265 ? 22.353  -42.508 -69.858  1.00 27.42 ? 265 ILE C O     1 
ATOM   8643  C CB    . ILE C 1 265 ? 21.408  -39.897 -68.437  1.00 28.92 ? 265 ILE C CB    1 
ATOM   8644  C CG1   . ILE C 1 265 ? 20.872  -40.984 -67.526  1.00 30.18 ? 265 ILE C CG1   1 
ATOM   8645  C CG2   . ILE C 1 265 ? 20.653  -38.626 -68.243  1.00 30.38 ? 265 ILE C CG2   1 
ATOM   8646  C CD1   . ILE C 1 265 ? 19.937  -40.471 -66.525  1.00 34.93 ? 265 ILE C CD1   1 
ATOM   8647  N N     . SER C 1 266 ? 20.272  -42.350 -70.656  1.00 26.66 ? 266 SER C N     1 
ATOM   8648  C CA    . SER C 1 266 ? 20.200  -43.735 -71.106  1.00 26.28 ? 266 SER C CA    1 
ATOM   8649  C C     . SER C 1 266 ? 18.820  -44.063 -71.667  1.00 27.06 ? 266 SER C C     1 
ATOM   8650  O O     . SER C 1 266 ? 17.804  -43.609 -71.143  1.00 25.89 ? 266 SER C O     1 
ATOM   8651  C CB    . SER C 1 266 ? 20.541  -44.689 -69.959  1.00 24.89 ? 266 SER C CB    1 
ATOM   8652  O OG    . SER C 1 266 ? 20.928  -45.960 -70.451  1.00 23.86 ? 266 SER C OG    1 
ATOM   8653  N N     . SER C 1 267 ? 18.794  -44.854 -72.734  1.00 27.41 ? 267 SER C N     1 
ATOM   8654  C CA    . SER C 1 267 ? 17.610  -45.630 -73.083  1.00 27.09 ? 267 SER C CA    1 
ATOM   8655  C C     . SER C 1 267 ? 17.586  -46.964 -72.344  1.00 26.97 ? 267 SER C C     1 
ATOM   8656  O O     . SER C 1 267 ? 16.523  -47.457 -71.967  1.00 24.82 ? 267 SER C O     1 
ATOM   8657  C CB    . SER C 1 267 ? 17.550  -45.865 -74.594  1.00 27.68 ? 267 SER C CB    1 
ATOM   8658  O OG    . SER C 1 267 ? 18.820  -46.229 -75.105  1.00 26.87 ? 267 SER C OG    1 
ATOM   8659  N N     . GLY C 1 268 ? 18.765  -47.543 -72.141  1.00 27.18 ? 268 GLY C N     1 
ATOM   8660  C CA    . GLY C 1 268 ? 18.872  -48.931 -71.731  1.00 26.96 ? 268 GLY C CA    1 
ATOM   8661  C C     . GLY C 1 268 ? 18.642  -49.116 -70.244  1.00 26.58 ? 268 GLY C C     1 
ATOM   8662  O O     . GLY C 1 268 ? 18.250  -50.193 -69.797  1.00 29.02 ? 268 GLY C O     1 
ATOM   8663  N N     . LEU C 1 269 ? 18.890  -48.060 -69.477  1.00 25.58 ? 269 LEU C N     1 
ATOM   8664  C CA    . LEU C 1 269 ? 18.796  -48.130 -68.023  1.00 24.55 ? 269 LEU C CA    1 
ATOM   8665  C C     . LEU C 1 269 ? 17.342  -48.179 -67.566  1.00 24.56 ? 269 LEU C C     1 
ATOM   8666  O O     . LEU C 1 269 ? 17.047  -48.596 -66.446  1.00 24.81 ? 269 LEU C O     1 
ATOM   8667  C CB    . LEU C 1 269 ? 19.510  -46.939 -67.382  1.00 23.79 ? 269 LEU C CB    1 
ATOM   8668  C CG    . LEU C 1 269 ? 21.029  -47.055 -67.238  1.00 20.91 ? 269 LEU C CG    1 
ATOM   8669  C CD1   . LEU C 1 269 ? 21.566  -45.975 -66.311  1.00 17.23 ? 269 LEU C CD1   1 
ATOM   8670  C CD2   . LEU C 1 269 ? 21.417  -48.438 -66.737  1.00 15.37 ? 269 LEU C CD2   1 
ATOM   8671  N N     . ARG C 1 270 ? 16.438  -47.749 -68.440  1.00 23.91 ? 270 ARG C N     1 
ATOM   8672  C CA    . ARG C 1 270 ? 15.009  -47.846 -68.173  1.00 23.95 ? 270 ARG C CA    1 
ATOM   8673  C C     . ARG C 1 270 ? 14.615  -47.009 -66.960  1.00 24.98 ? 270 ARG C C     1 
ATOM   8674  O O     . ARG C 1 270 ? 14.154  -47.542 -65.950  1.00 23.29 ? 270 ARG C O     1 
ATOM   8675  C CB    . ARG C 1 270 ? 14.602  -49.305 -67.959  1.00 22.24 ? 270 ARG C CB    1 
ATOM   8676  C CG    . ARG C 1 270 ? 14.452  -50.103 -69.245  1.00 21.28 ? 270 ARG C CG    1 
ATOM   8677  C CD    . ARG C 1 270 ? 14.436  -49.252 -70.504  1.00 24.52 ? 270 ARG C CD    1 
ATOM   8678  N NE    . ARG C 1 270 ? 13.088  -49.102 -71.047  1.00 24.86 ? 270 ARG C NE    1 
ATOM   8679  C CZ    . ARG C 1 270 ? 12.606  -47.970 -71.540  1.00 24.32 ? 270 ARG C CZ    1 
ATOM   8680  N NH1   . ARG C 1 270 ? 13.360  -46.879 -71.562  1.00 26.68 ? 270 ARG C NH1   1 
ATOM   8681  N NH2   . ARG C 1 270 ? 11.368  -47.925 -72.013  1.00 29.94 ? 270 ARG C NH2   1 
ATOM   8682  N N     . ILE C 1 271 ? 14.803  -45.699 -67.065  1.00 27.09 ? 271 ILE C N     1 
ATOM   8683  C CA    . ILE C 1 271 ? 14.503  -44.798 -65.975  1.00 29.60 ? 271 ILE C CA    1 
ATOM   8684  C C     . ILE C 1 271 ? 13.986  -43.474 -66.540  1.00 31.09 ? 271 ILE C C     1 
ATOM   8685  O O     . ILE C 1 271 ? 14.794  -42.618 -66.994  1.00 32.15 ? 271 ILE C O     1 
ATOM   8686  C CB    . ILE C 1 271 ? 15.742  -44.555 -65.076  1.00 29.04 ? 271 ILE C CB    1 
ATOM   8687  C CG1   . ILE C 1 271 ? 16.242  -45.874 -64.429  1.00 28.19 ? 271 ILE C CG1   1 
ATOM   8688  C CG2   . ILE C 1 271 ? 15.471  -43.428 -64.096  1.00 29.69 ? 271 ILE C CG2   1 
ATOM   8689  C CD1   . ILE C 1 271 ? 15.523  -46.347 -63.149  1.00 21.13 ? 271 ILE C CD1   1 
ATOM   8690  N N     . GLY C 1 272 ? 12.650  -43.333 -66.503  1.00 31.18 ? 272 GLY C N     1 
ATOM   8691  C CA    . GLY C 1 272 ? 11.927  -42.112 -66.849  1.00 32.36 ? 272 GLY C CA    1 
ATOM   8692  C C     . GLY C 1 272 ? 10.952  -41.779 -65.707  1.00 33.09 ? 272 GLY C C     1 
ATOM   8693  O O     . GLY C 1 272 ? 10.928  -42.469 -64.679  1.00 33.62 ? 272 GLY C O     1 
ATOM   8694  N N     . PHE C 1 273 ? 10.145  -40.735 -65.877  1.00 32.17 ? 273 PHE C N     1 
ATOM   8695  C CA    . PHE C 1 273 ? 9.286   -40.285 -64.796  1.00 32.01 ? 273 PHE C CA    1 
ATOM   8696  C C     . PHE C 1 273 ? 7.979   -39.616 -65.239  1.00 31.96 ? 273 PHE C C     1 
ATOM   8697  O O     . PHE C 1 273 ? 7.872   -39.077 -66.337  1.00 30.99 ? 273 PHE C O     1 
ATOM   8698  C CB    . PHE C 1 273 ? 10.033  -39.387 -63.803  1.00 31.88 ? 273 PHE C CB    1 
ATOM   8699  C CG    . PHE C 1 273 ? 10.874  -38.275 -64.427  1.00 29.72 ? 273 PHE C CG    1 
ATOM   8700  C CD1   . PHE C 1 273 ? 12.141  -38.531 -64.925  1.00 29.62 ? 273 PHE C CD1   1 
ATOM   8701  C CD2   . PHE C 1 273 ? 10.421  -36.965 -64.419  1.00 30.49 ? 273 PHE C CD2   1 
ATOM   8702  C CE1   . PHE C 1 273 ? 12.954  -37.490 -65.455  1.00 31.57 ? 273 PHE C CE1   1 
ATOM   8703  C CE2   . PHE C 1 273 ? 11.208  -35.932 -64.925  1.00 30.42 ? 273 PHE C CE2   1 
ATOM   8704  C CZ    . PHE C 1 273 ? 12.484  -36.177 -65.438  1.00 30.28 ? 273 PHE C CZ    1 
ATOM   8705  N N     . LEU C 1 274 ? 7.000   -39.654 -64.341  1.00 31.89 ? 274 LEU C N     1 
ATOM   8706  C CA    . LEU C 1 274 ? 5.687   -39.085 -64.592  1.00 31.45 ? 274 LEU C CA    1 
ATOM   8707  C C     . LEU C 1 274 ? 5.382   -38.012 -63.563  1.00 31.72 ? 274 LEU C C     1 
ATOM   8708  O O     . LEU C 1 274 ? 5.676   -38.182 -62.333  1.00 32.60 ? 274 LEU C O     1 
ATOM   8709  C CB    . LEU C 1 274 ? 4.693   -40.194 -64.532  1.00 31.52 ? 274 LEU C CB    1 
ATOM   8710  C CG    . LEU C 1 274 ? 3.411   -40.048 -65.308  1.00 34.23 ? 274 LEU C CG    1 
ATOM   8711  C CD1   . LEU C 1 274 ? 3.627   -40.117 -66.840  1.00 35.31 ? 274 LEU C CD1   1 
ATOM   8712  C CD2   . LEU C 1 274 ? 2.531   -41.187 -64.810  1.00 33.88 ? 274 LEU C CD2   1 
ATOM   8713  N N     . THR C 1 275 ? 4.858   -36.905 -64.057  1.00 31.00 ? 275 THR C N     1 
ATOM   8714  C CA    . THR C 1 275 ? 4.457   -35.798 -63.232  1.00 30.86 ? 275 THR C CA    1 
ATOM   8715  C C     . THR C 1 275 ? 2.961   -35.421 -63.560  1.00 31.49 ? 275 THR C C     1 
ATOM   8716  O O     . THR C 1 275 ? 2.589   -35.163 -64.730  1.00 30.43 ? 275 THR C O     1 
ATOM   8717  C CB    . THR C 1 275 ? 5.411   -34.612 -63.397  1.00 31.86 ? 275 THR C CB    1 
ATOM   8718  O OG1   . THR C 1 275 ? 6.786   -35.076 -63.480  1.00 35.20 ? 275 THR C OG1   1 
ATOM   8719  C CG2   . THR C 1 275 ? 5.279   -33.650 -62.222  1.00 30.42 ? 275 THR C CG2   1 
ATOM   8720  N N     . GLY C 1 276 ? 2.152   -35.399 -62.494  1.00 29.68 ? 276 GLY C N     1 
ATOM   8721  C CA    . GLY C 1 276 ? 0.734   -35.238 -62.547  1.00 29.39 ? 276 GLY C CA    1 
ATOM   8722  C C     . GLY C 1 276 ? 0.129   -35.124 -61.141  1.00 30.44 ? 276 GLY C C     1 
ATOM   8723  O O     . GLY C 1 276 ? 0.842   -35.291 -60.110  1.00 30.01 ? 276 GLY C O     1 
ATOM   8724  N N     . PRO C 1 277 ? -1.199  -34.876 -61.091  1.00 29.30 ? 277 PRO C N     1 
ATOM   8725  C CA    . PRO C 1 277 ? -1.996  -34.720 -59.904  1.00 27.77 ? 277 PRO C CA    1 
ATOM   8726  C C     . PRO C 1 277 ? -2.012  -36.027 -59.114  1.00 27.68 ? 277 PRO C C     1 
ATOM   8727  O O     . PRO C 1 277 ? -2.212  -37.107 -59.702  1.00 28.08 ? 277 PRO C O     1 
ATOM   8728  C CB    . PRO C 1 277 ? -3.417  -34.415 -60.469  1.00 28.05 ? 277 PRO C CB    1 
ATOM   8729  C CG    . PRO C 1 277 ? -3.244  -33.969 -61.845  1.00 27.44 ? 277 PRO C CG    1 
ATOM   8730  C CD    . PRO C 1 277 ? -2.031  -34.787 -62.325  1.00 29.58 ? 277 PRO C CD    1 
ATOM   8731  N N     . LYS C 1 278 ? -1.813  -35.917 -57.793  1.00 27.82 ? 278 LYS C N     1 
ATOM   8732  C CA    . LYS C 1 278 ? -1.659  -37.039 -56.842  1.00 26.98 ? 278 LYS C CA    1 
ATOM   8733  C C     . LYS C 1 278 ? -2.623  -38.158 -57.191  1.00 26.75 ? 278 LYS C C     1 
ATOM   8734  O O     . LYS C 1 278 ? -2.179  -39.299 -57.394  1.00 25.13 ? 278 LYS C O     1 
ATOM   8735  C CB    . LYS C 1 278 ? -1.942  -36.544 -55.392  1.00 29.26 ? 278 LYS C CB    1 
ATOM   8736  C CG    . LYS C 1 278 ? -1.526  -37.420 -54.168  1.00 29.09 ? 278 LYS C CG    1 
ATOM   8737  C CD    . LYS C 1 278 ? -0.111  -36.991 -53.656  1.00 32.96 ? 278 LYS C CD    1 
ATOM   8738  C CE    . LYS C 1 278 ? 0.410   -37.827 -52.419  1.00 34.54 ? 278 LYS C CE    1 
ATOM   8739  N NZ    . LYS C 1 278 ? 0.077   -37.211 -51.040  1.00 35.76 ? 278 LYS C NZ    1 
ATOM   8740  N N     . PRO C 1 279 ? -3.954  -37.830 -57.297  1.00 26.67 ? 279 PRO C N     1 
ATOM   8741  C CA    . PRO C 1 279 ? -4.948  -38.884 -57.413  1.00 25.74 ? 279 PRO C CA    1 
ATOM   8742  C C     . PRO C 1 279 ? -4.689  -39.745 -58.648  1.00 25.93 ? 279 PRO C C     1 
ATOM   8743  O O     . PRO C 1 279 ? -4.915  -40.950 -58.587  1.00 25.17 ? 279 PRO C O     1 
ATOM   8744  C CB    . PRO C 1 279 ? -6.304  -38.113 -57.514  1.00 26.70 ? 279 PRO C CB    1 
ATOM   8745  C CG    . PRO C 1 279 ? -6.036  -36.775 -56.968  1.00 27.64 ? 279 PRO C CG    1 
ATOM   8746  C CD    . PRO C 1 279 ? -4.583  -36.487 -57.341  1.00 26.00 ? 279 PRO C CD    1 
ATOM   8747  N N     . LEU C 1 280 ? -4.196  -39.147 -59.744  1.00 26.20 ? 280 LEU C N     1 
ATOM   8748  C CA    . LEU C 1 280 ? -3.868  -39.872 -60.984  1.00 27.39 ? 280 LEU C CA    1 
ATOM   8749  C C     . LEU C 1 280 ? -2.549  -40.675 -60.926  1.00 28.67 ? 280 LEU C C     1 
ATOM   8750  O O     . LEU C 1 280 ? -2.456  -41.811 -61.423  1.00 27.41 ? 280 LEU C O     1 
ATOM   8751  C CB    . LEU C 1 280 ? -3.854  -38.886 -62.182  1.00 27.84 ? 280 LEU C CB    1 
ATOM   8752  C CG    . LEU C 1 280 ? -5.107  -38.000 -62.368  1.00 28.81 ? 280 LEU C CG    1 
ATOM   8753  C CD1   . LEU C 1 280 ? -4.978  -37.079 -63.552  1.00 33.78 ? 280 LEU C CD1   1 
ATOM   8754  C CD2   . LEU C 1 280 ? -6.392  -38.809 -62.501  1.00 27.79 ? 280 LEU C CD2   1 
ATOM   8755  N N     . ILE C 1 281 ? -1.534  -40.089 -60.315  1.00 31.19 ? 281 ILE C N     1 
ATOM   8756  C CA    . ILE C 1 281 ? -0.237  -40.751 -60.141  1.00 33.73 ? 281 ILE C CA    1 
ATOM   8757  C C     . ILE C 1 281 ? -0.401  -41.978 -59.290  1.00 34.13 ? 281 ILE C C     1 
ATOM   8758  O O     . ILE C 1 281 ? 0.158   -43.048 -59.575  1.00 35.40 ? 281 ILE C O     1 
ATOM   8759  C CB    . ILE C 1 281 ? 0.785   -39.839 -59.463  1.00 33.62 ? 281 ILE C CB    1 
ATOM   8760  C CG1   . ILE C 1 281 ? 0.897   -38.558 -60.264  1.00 32.93 ? 281 ILE C CG1   1 
ATOM   8761  C CG2   . ILE C 1 281 ? 2.147   -40.538 -59.389  1.00 34.29 ? 281 ILE C CG2   1 
ATOM   8762  C CD1   . ILE C 1 281 ? 1.021   -38.849 -61.734  1.00 37.04 ? 281 ILE C CD1   1 
ATOM   8763  N N     . GLU C 1 282 ? -1.178  -41.838 -58.221  1.00 34.51 ? 282 GLU C N     1 
ATOM   8764  C CA    . GLU C 1 282 ? -1.500  -42.965 -57.354  1.00 35.49 ? 282 GLU C CA    1 
ATOM   8765  C C     . GLU C 1 282 ? -1.854  -44.198 -58.168  1.00 35.18 ? 282 GLU C C     1 
ATOM   8766  O O     . GLU C 1 282 ? -1.218  -45.243 -58.034  1.00 36.63 ? 282 GLU C O     1 
ATOM   8767  C CB    . GLU C 1 282 ? -2.654  -42.606 -56.415  1.00 35.61 ? 282 GLU C CB    1 
ATOM   8768  C CG    . GLU C 1 282 ? -2.384  -42.918 -54.952  1.00 41.04 ? 282 GLU C CG    1 
ATOM   8769  C CD    . GLU C 1 282 ? -3.484  -42.419 -54.037  1.00 44.16 ? 282 GLU C CD    1 
ATOM   8770  O OE1   . GLU C 1 282 ? -3.379  -41.274 -53.548  1.00 42.62 ? 282 GLU C OE1   1 
ATOM   8771  O OE2   . GLU C 1 282 ? -4.455  -43.170 -53.806  1.00 47.55 ? 282 GLU C OE2   1 
ATOM   8772  N N     . ARG C 1 283 ? -2.873  -44.074 -59.013  1.00 34.09 ? 283 ARG C N     1 
ATOM   8773  C CA    . ARG C 1 283 ? -3.435  -45.225 -59.709  1.00 33.21 ? 283 ARG C CA    1 
ATOM   8774  C C     . ARG C 1 283 ? -2.371  -45.948 -60.527  1.00 32.19 ? 283 ARG C C     1 
ATOM   8775  O O     . ARG C 1 283 ? -2.380  -47.174 -60.626  1.00 31.39 ? 283 ARG C O     1 
ATOM   8776  C CB    . ARG C 1 283 ? -4.589  -44.791 -60.615  1.00 32.91 ? 283 ARG C CB    1 
ATOM   8777  C CG    . ARG C 1 283 ? -5.622  -43.913 -59.928  1.00 31.00 ? 283 ARG C CG    1 
ATOM   8778  C CD    . ARG C 1 283 ? -5.770  -44.178 -58.438  1.00 24.61 ? 283 ARG C CD    1 
ATOM   8779  N NE    . ARG C 1 283 ? -6.226  -45.539 -58.168  1.00 22.99 ? 283 ARG C NE    1 
ATOM   8780  C CZ    . ARG C 1 283 ? -6.714  -45.943 -57.003  1.00 20.48 ? 283 ARG C CZ    1 
ATOM   8781  N NH1   . ARG C 1 283 ? -6.814  -45.098 -55.992  1.00 12.73 ? 283 ARG C NH1   1 
ATOM   8782  N NH2   . ARG C 1 283 ? -7.105  -47.201 -56.847  1.00 22.40 ? 283 ARG C NH2   1 
ATOM   8783  N N     . VAL C 1 284 ? -1.455  -45.181 -61.109  1.00 32.12 ? 284 VAL C N     1 
ATOM   8784  C CA    . VAL C 1 284 ? -0.296  -45.751 -61.785  1.00 30.87 ? 284 VAL C CA    1 
ATOM   8785  C C     . VAL C 1 284 ? 0.633   -46.440 -60.793  1.00 30.69 ? 284 VAL C C     1 
ATOM   8786  O O     . VAL C 1 284 ? 1.065   -47.568 -61.020  1.00 30.81 ? 284 VAL C O     1 
ATOM   8787  C CB    . VAL C 1 284 ? 0.492   -44.676 -62.555  1.00 31.37 ? 284 VAL C CB    1 
ATOM   8788  C CG1   . VAL C 1 284 ? 1.716   -45.285 -63.219  1.00 31.82 ? 284 VAL C CG1   1 
ATOM   8789  C CG2   . VAL C 1 284 ? -0.393  -44.001 -63.596  1.00 31.33 ? 284 VAL C CG2   1 
ATOM   8790  N N     . ILE C 1 285 ? 0.935   -45.757 -59.695  1.00 29.58 ? 285 ILE C N     1 
ATOM   8791  C CA    . ILE C 1 285 ? 1.754   -46.319 -58.649  1.00 29.35 ? 285 ILE C CA    1 
ATOM   8792  C C     . ILE C 1 285 ? 1.268   -47.672 -58.218  1.00 29.17 ? 285 ILE C C     1 
ATOM   8793  O O     . ILE C 1 285 ? 2.081   -48.622 -58.119  1.00 28.61 ? 285 ILE C O     1 
ATOM   8794  C CB    . ILE C 1 285 ? 1.892   -45.352 -57.473  1.00 28.93 ? 285 ILE C CB    1 
ATOM   8795  C CG1   . ILE C 1 285 ? 2.565   -44.069 -58.007  1.00 28.55 ? 285 ILE C CG1   1 
ATOM   8796  C CG2   . ILE C 1 285 ? 2.658   -45.992 -56.397  1.00 28.79 ? 285 ILE C CG2   1 
ATOM   8797  C CD1   . ILE C 1 285 ? 2.952   -43.072 -56.970  1.00 29.79 ? 285 ILE C CD1   1 
ATOM   8798  N N     . LEU C 1 286 ? -0.059  -47.793 -58.027  1.00 28.01 ? 286 LEU C N     1 
ATOM   8799  C CA    . LEU C 1 286 ? -0.581  -49.019 -57.462  1.00 26.77 ? 286 LEU C CA    1 
ATOM   8800  C C     . LEU C 1 286 ? -0.621  -50.075 -58.525  1.00 25.87 ? 286 LEU C C     1 
ATOM   8801  O O     . LEU C 1 286 ? -0.593  -51.244 -58.212  1.00 27.23 ? 286 LEU C O     1 
ATOM   8802  C CB    . LEU C 1 286 ? -1.962  -48.864 -56.812  1.00 26.61 ? 286 LEU C CB    1 
ATOM   8803  C CG    . LEU C 1 286 ? -2.311  -47.725 -55.877  1.00 28.18 ? 286 LEU C CG    1 
ATOM   8804  C CD1   . LEU C 1 286 ? -3.853  -47.801 -55.462  1.00 27.74 ? 286 LEU C CD1   1 
ATOM   8805  C CD2   . LEU C 1 286 ? -1.366  -47.529 -54.647  1.00 25.88 ? 286 LEU C CD2   1 
ATOM   8806  N N     . HIS C 1 287 ? -0.734  -49.658 -59.778  1.00 25.60 ? 287 HIS C N     1 
ATOM   8807  C CA    . HIS C 1 287 ? -0.653  -50.549 -60.931  1.00 25.08 ? 287 HIS C CA    1 
ATOM   8808  C C     . HIS C 1 287 ? 0.773   -51.033 -61.095  1.00 24.89 ? 287 HIS C C     1 
ATOM   8809  O O     . HIS C 1 287 ? 1.007   -52.143 -61.586  1.00 24.70 ? 287 HIS C O     1 
ATOM   8810  C CB    . HIS C 1 287 ? -1.051  -49.804 -62.222  1.00 24.41 ? 287 HIS C CB    1 
ATOM   8811  C CG    . HIS C 1 287 ? -1.258  -50.699 -63.419  1.00 24.59 ? 287 HIS C CG    1 
ATOM   8812  N ND1   . HIS C 1 287 ? -1.434  -50.206 -64.697  1.00 26.31 ? 287 HIS C ND1   1 
ATOM   8813  C CD2   . HIS C 1 287 ? -1.316  -52.050 -63.532  1.00 23.84 ? 287 HIS C CD2   1 
ATOM   8814  C CE1   . HIS C 1 287 ? -1.642  -51.208 -65.538  1.00 24.19 ? 287 HIS C CE1   1 
ATOM   8815  N NE2   . HIS C 1 287 ? -1.556  -52.340 -64.862  1.00 25.92 ? 287 HIS C NE2   1 
ATOM   8816  N N     . ILE C 1 288 ? 1.724   -50.162 -60.773  1.00 24.46 ? 288 ILE C N     1 
ATOM   8817  C CA    . ILE C 1 288 ? 3.123   -50.571 -60.773  1.00 25.49 ? 288 ILE C CA    1 
ATOM   8818  C C     . ILE C 1 288 ? 3.399   -51.635 -59.693  1.00 26.24 ? 288 ILE C C     1 
ATOM   8819  O O     . ILE C 1 288 ? 4.156   -52.565 -59.960  1.00 26.60 ? 288 ILE C O     1 
ATOM   8820  C CB    . ILE C 1 288 ? 4.092   -49.357 -60.658  1.00 25.38 ? 288 ILE C CB    1 
ATOM   8821  C CG1   . ILE C 1 288 ? 4.293   -48.714 -62.043  1.00 25.26 ? 288 ILE C CG1   1 
ATOM   8822  C CG2   . ILE C 1 288 ? 5.370   -49.789 -60.065  1.00 23.61 ? 288 ILE C CG2   1 
ATOM   8823  C CD1   . ILE C 1 288 ? 4.732   -47.266 -62.026  1.00 25.40 ? 288 ILE C CD1   1 
ATOM   8824  N N     . GLN C 1 289 ? 2.765   -51.503 -58.505  1.00 26.02 ? 289 GLN C N     1 
ATOM   8825  C CA    . GLN C 1 289 ? 2.924   -52.437 -57.401  1.00 25.48 ? 289 GLN C CA    1 
ATOM   8826  C C     . GLN C 1 289 ? 2.494   -53.869 -57.720  1.00 26.45 ? 289 GLN C C     1 
ATOM   8827  O O     . GLN C 1 289 ? 2.714   -54.788 -56.906  1.00 26.36 ? 289 GLN C O     1 
ATOM   8828  C CB    . GLN C 1 289 ? 2.155   -51.961 -56.171  1.00 26.25 ? 289 GLN C CB    1 
ATOM   8829  C CG    . GLN C 1 289 ? 2.537   -50.595 -55.788  1.00 26.63 ? 289 GLN C CG    1 
ATOM   8830  C CD    . GLN C 1 289 ? 2.083   -50.173 -54.489  1.00 26.91 ? 289 GLN C CD    1 
ATOM   8831  O OE1   . GLN C 1 289 ? 0.988   -50.493 -54.063  1.00 35.19 ? 289 GLN C OE1   1 
ATOM   8832  N NE2   . GLN C 1 289 ? 2.884   -49.358 -53.838  1.00 29.89 ? 289 GLN C NE2   1 
ATOM   8833  N N     . VAL C 1 290 ? 1.893   -54.100 -58.889  1.00 25.44 ? 290 VAL C N     1 
ATOM   8834  C CA    . VAL C 1 290 ? 1.432   -55.450 -59.135  1.00 25.05 ? 290 VAL C CA    1 
ATOM   8835  C C     . VAL C 1 290 ? 2.110   -55.912 -60.374  1.00 25.68 ? 290 VAL C C     1 
ATOM   8836  O O     . VAL C 1 290 ? 1.975   -57.049 -60.792  1.00 26.44 ? 290 VAL C O     1 
ATOM   8837  C CB    . VAL C 1 290 ? -0.191  -55.629 -59.115  1.00 25.38 ? 290 VAL C CB    1 
ATOM   8838  C CG1   . VAL C 1 290 ? -0.751  -55.357 -57.683  1.00 23.11 ? 290 VAL C CG1   1 
ATOM   8839  C CG2   . VAL C 1 290 ? -0.901  -54.796 -60.179  1.00 23.62 ? 290 VAL C CG2   1 
ATOM   8840  N N     . SER C 1 291 ? 2.883   -55.025 -60.967  1.00 26.41 ? 291 SER C N     1 
ATOM   8841  C CA    . SER C 1 291 ? 3.640   -55.414 -62.153  1.00 26.21 ? 291 SER C CA    1 
ATOM   8842  C C     . SER C 1 291 ? 5.156   -55.337 -61.888  1.00 26.09 ? 291 SER C C     1 
ATOM   8843  O O     . SER C 1 291 ? 5.757   -56.300 -61.378  1.00 26.67 ? 291 SER C O     1 
ATOM   8844  C CB    . SER C 1 291 ? 3.171   -54.644 -63.414  1.00 25.39 ? 291 SER C CB    1 
ATOM   8845  O OG    . SER C 1 291 ? 3.327   -53.267 -63.227  1.00 27.03 ? 291 SER C OG    1 
ATOM   8846  N N     . THR C 1 292 ? 5.778   -54.208 -62.225  1.00 24.43 ? 292 THR C N     1 
ATOM   8847  C CA    . THR C 1 292 ? 7.207   -54.143 -62.098  1.00 23.23 ? 292 THR C CA    1 
ATOM   8848  C C     . THR C 1 292 ? 7.662   -53.934 -60.638  1.00 22.55 ? 292 THR C C     1 
ATOM   8849  O O     . THR C 1 292 ? 8.864   -53.966 -60.371  1.00 21.34 ? 292 THR C O     1 
ATOM   8850  C CB    . THR C 1 292 ? 7.810   -53.068 -63.008  1.00 22.33 ? 292 THR C CB    1 
ATOM   8851  O OG1   . THR C 1 292 ? 7.059   -51.868 -62.854  1.00 21.26 ? 292 THR C OG1   1 
ATOM   8852  C CG2   . THR C 1 292 ? 7.701   -53.507 -64.395  1.00 22.42 ? 292 THR C CG2   1 
ATOM   8853  N N     . LEU C 1 293 ? 6.707   -53.747 -59.724  1.00 21.82 ? 293 LEU C N     1 
ATOM   8854  C CA    . LEU C 1 293 ? 7.000   -53.293 -58.345  1.00 21.85 ? 293 LEU C CA    1 
ATOM   8855  C C     . LEU C 1 293 ? 7.656   -51.884 -58.380  1.00 20.73 ? 293 LEU C C     1 
ATOM   8856  O O     . LEU C 1 293 ? 7.065   -50.962 -57.958  1.00 19.86 ? 293 LEU C O     1 
ATOM   8857  C CB    . LEU C 1 293 ? 7.732   -54.404 -57.529  1.00 22.78 ? 293 LEU C CB    1 
ATOM   8858  C CG    . LEU C 1 293 ? 7.053   -55.790 -57.552  1.00 25.65 ? 293 LEU C CG    1 
ATOM   8859  C CD1   . LEU C 1 293 ? 7.904   -56.936 -56.882  1.00 27.14 ? 293 LEU C CD1   1 
ATOM   8860  C CD2   . LEU C 1 293 ? 5.682   -55.677 -56.916  1.00 23.05 ? 293 LEU C CD2   1 
ATOM   8861  N N     . HIS C 1 294 ? 8.862   -51.726 -58.933  1.00 21.36 ? 294 HIS C N     1 
ATOM   8862  C CA    . HIS C 1 294 ? 9.518   -50.390 -59.051  1.00 21.67 ? 294 HIS C CA    1 
ATOM   8863  C C     . HIS C 1 294 ? 10.557  -50.394 -60.090  1.00 19.95 ? 294 HIS C C     1 
ATOM   8864  O O     . HIS C 1 294 ? 10.891  -51.477 -60.593  1.00 19.38 ? 294 HIS C O     1 
ATOM   8865  C CB    . HIS C 1 294 ? 10.268  -50.092 -57.753  1.00 21.62 ? 294 HIS C CB    1 
ATOM   8866  C CG    . HIS C 1 294 ? 11.223  -51.172 -57.362  1.00 26.16 ? 294 HIS C CG    1 
ATOM   8867  N ND1   . HIS C 1 294 ? 10.845  -52.238 -56.568  1.00 25.62 ? 294 HIS C ND1   1 
ATOM   8868  C CD2   . HIS C 1 294 ? 12.532  -51.362 -57.657  1.00 23.45 ? 294 HIS C CD2   1 
ATOM   8869  C CE1   . HIS C 1 294 ? 11.880  -53.042 -56.399  1.00 25.67 ? 294 HIS C CE1   1 
ATOM   8870  N NE2   . HIS C 1 294 ? 12.913  -52.531 -57.041  1.00 24.37 ? 294 HIS C NE2   1 
ATOM   8871  N N     . PRO C 1 295 ? 11.119  -49.191 -60.403  1.00 19.63 ? 295 PRO C N     1 
ATOM   8872  C CA    . PRO C 1 295 ? 12.202  -49.273 -61.435  1.00 18.91 ? 295 PRO C CA    1 
ATOM   8873  C C     . PRO C 1 295 ? 13.494  -49.838 -60.781  1.00 17.98 ? 295 PRO C C     1 
ATOM   8874  O O     . PRO C 1 295 ? 13.610  -49.866 -59.552  1.00 19.17 ? 295 PRO C O     1 
ATOM   8875  C CB    . PRO C 1 295 ? 12.336  -47.816 -61.967  1.00 18.26 ? 295 PRO C CB    1 
ATOM   8876  C CG    . PRO C 1 295 ? 11.346  -46.948 -61.068  1.00 21.88 ? 295 PRO C CG    1 
ATOM   8877  C CD    . PRO C 1 295 ? 10.898  -47.811 -59.905  1.00 17.88 ? 295 PRO C CD    1 
ATOM   8878  N N     . SER C 1 296 ? 14.369  -50.405 -61.569  1.00 18.39 ? 296 SER C N     1 
ATOM   8879  C CA    . SER C 1 296 ? 15.642  -50.936 -61.108  1.00 21.86 ? 296 SER C CA    1 
ATOM   8880  C C     . SER C 1 296 ? 16.267  -50.088 -60.024  1.00 21.74 ? 296 SER C C     1 
ATOM   8881  O O     . SER C 1 296 ? 16.484  -48.919 -60.239  1.00 23.72 ? 296 SER C O     1 
ATOM   8882  C CB    . SER C 1 296 ? 16.644  -51.034 -62.274  1.00 21.70 ? 296 SER C CB    1 
ATOM   8883  O OG    . SER C 1 296 ? 17.902  -51.436 -61.753  1.00 27.40 ? 296 SER C OG    1 
ATOM   8884  N N     . THR C 1 297 ? 16.525  -50.638 -58.856  1.00 21.92 ? 297 THR C N     1 
ATOM   8885  C CA    . THR C 1 297 ? 17.019  -49.795 -57.784  1.00 22.43 ? 297 THR C CA    1 
ATOM   8886  C C     . THR C 1 297 ? 18.480  -49.406 -58.053  1.00 23.87 ? 297 THR C C     1 
ATOM   8887  O O     . THR C 1 297 ? 18.815  -48.252 -57.935  1.00 24.77 ? 297 THR C O     1 
ATOM   8888  C CB    . THR C 1 297 ? 16.792  -50.398 -56.342  1.00 22.98 ? 297 THR C CB    1 
ATOM   8889  O OG1   . THR C 1 297 ? 17.991  -50.969 -55.881  1.00 24.54 ? 297 THR C OG1   1 
ATOM   8890  C CG2   . THR C 1 297 ? 15.687  -51.482 -56.293  1.00 19.14 ? 297 THR C CG2   1 
ATOM   8891  N N     . PHE C 1 298 ? 19.332  -50.360 -58.426  1.00 25.58 ? 298 PHE C N     1 
ATOM   8892  C CA    . PHE C 1 298 ? 20.703  -50.113 -59.000  1.00 26.84 ? 298 PHE C CA    1 
ATOM   8893  C C     . PHE C 1 298 ? 20.816  -48.956 -60.023  1.00 28.08 ? 298 PHE C C     1 
ATOM   8894  O O     . PHE C 1 298 ? 21.670  -48.026 -59.901  1.00 28.43 ? 298 PHE C O     1 
ATOM   8895  C CB    . PHE C 1 298 ? 21.239  -51.407 -59.660  1.00 26.27 ? 298 PHE C CB    1 
ATOM   8896  C CG    . PHE C 1 298 ? 22.696  -51.354 -60.024  1.00 25.14 ? 298 PHE C CG    1 
ATOM   8897  C CD1   . PHE C 1 298 ? 23.109  -50.761 -61.196  1.00 27.19 ? 298 PHE C CD1   1 
ATOM   8898  C CD2   . PHE C 1 298 ? 23.670  -51.920 -59.177  1.00 26.31 ? 298 PHE C CD2   1 
ATOM   8899  C CE1   . PHE C 1 298 ? 24.467  -50.718 -61.532  1.00 24.68 ? 298 PHE C CE1   1 
ATOM   8900  C CE2   . PHE C 1 298 ? 24.984  -51.847 -59.468  1.00 25.98 ? 298 PHE C CE2   1 
ATOM   8901  C CZ    . PHE C 1 298 ? 25.394  -51.249 -60.670  1.00 25.49 ? 298 PHE C CZ    1 
ATOM   8902  N N     . ASN C 1 299 ? 19.961  -49.009 -61.035  1.00 28.06 ? 299 ASN C N     1 
ATOM   8903  C CA    . ASN C 1 299 ? 20.063  -48.067 -62.145  1.00 27.94 ? 299 ASN C CA    1 
ATOM   8904  C C     . ASN C 1 299 ? 19.626  -46.678 -61.737  1.00 28.07 ? 299 ASN C C     1 
ATOM   8905  O O     . ASN C 1 299 ? 20.080  -45.723 -62.339  1.00 28.45 ? 299 ASN C O     1 
ATOM   8906  C CB    . ASN C 1 299 ? 19.206  -48.511 -63.293  1.00 28.08 ? 299 ASN C CB    1 
ATOM   8907  C CG    . ASN C 1 299 ? 19.755  -49.685 -64.008  1.00 29.40 ? 299 ASN C CG    1 
ATOM   8908  O OD1   . ASN C 1 299 ? 19.238  -50.057 -65.062  1.00 28.19 ? 299 ASN C OD1   1 
ATOM   8909  N ND2   . ASN C 1 299 ? 20.807  -50.299 -63.460  1.00 30.58 ? 299 ASN C ND2   1 
ATOM   8910  N N     . GLN C 1 300 ? 18.738  -46.575 -60.738  1.00 27.35 ? 300 GLN C N     1 
ATOM   8911  C CA    . GLN C 1 300 ? 18.346  -45.275 -60.145  1.00 26.28 ? 300 GLN C CA    1 
ATOM   8912  C C     . GLN C 1 300 ? 19.413  -44.604 -59.217  1.00 26.18 ? 300 GLN C C     1 
ATOM   8913  O O     . GLN C 1 300 ? 19.441  -43.385 -59.109  1.00 24.85 ? 300 GLN C O     1 
ATOM   8914  C CB    . GLN C 1 300 ? 17.076  -45.472 -59.314  1.00 27.09 ? 300 GLN C CB    1 
ATOM   8915  C CG    . GLN C 1 300 ? 15.794  -45.487 -60.039  1.00 24.12 ? 300 GLN C CG    1 
ATOM   8916  C CD    . GLN C 1 300 ? 14.665  -45.738 -59.099  1.00 23.42 ? 300 GLN C CD    1 
ATOM   8917  O OE1   . GLN C 1 300 ? 14.186  -44.811 -58.408  1.00 21.29 ? 300 GLN C OE1   1 
ATOM   8918  N NE2   . GLN C 1 300 ? 14.237  -46.995 -59.026  1.00 16.66 ? 300 GLN C NE2   1 
ATOM   8919  N N     . LEU C 1 301 ? 20.224  -45.405 -58.509  1.00 25.07 ? 301 LEU C N     1 
ATOM   8920  C CA    . LEU C 1 301 ? 21.346  -44.918 -57.723  1.00 25.49 ? 301 LEU C CA    1 
ATOM   8921  C C     . LEU C 1 301 ? 22.455  -44.365 -58.616  1.00 25.87 ? 301 LEU C C     1 
ATOM   8922  O O     . LEU C 1 301 ? 22.988  -43.289 -58.379  1.00 27.18 ? 301 LEU C O     1 
ATOM   8923  C CB    . LEU C 1 301 ? 21.872  -46.025 -56.774  1.00 25.30 ? 301 LEU C CB    1 
ATOM   8924  C CG    . LEU C 1 301 ? 20.894  -46.117 -55.577  1.00 26.25 ? 301 LEU C CG    1 
ATOM   8925  C CD1   . LEU C 1 301 ? 20.853  -47.462 -54.855  1.00 24.54 ? 301 LEU C CD1   1 
ATOM   8926  C CD2   . LEU C 1 301 ? 21.115  -44.957 -54.589  1.00 24.80 ? 301 LEU C CD2   1 
ATOM   8927  N N     . MET C 1 302 ? 22.795  -45.102 -59.655  1.00 24.95 ? 302 MET C N     1 
ATOM   8928  C CA    . MET C 1 302 ? 23.652  -44.606 -60.689  1.00 23.91 ? 302 MET C CA    1 
ATOM   8929  C C     . MET C 1 302 ? 23.211  -43.225 -61.134  1.00 22.37 ? 302 MET C C     1 
ATOM   8930  O O     . MET C 1 302 ? 24.028  -42.285 -61.297  1.00 17.74 ? 302 MET C O     1 
ATOM   8931  C CB    . MET C 1 302 ? 23.542  -45.535 -61.888  1.00 22.74 ? 302 MET C CB    1 
ATOM   8932  C CG    . MET C 1 302 ? 24.201  -46.836 -61.681  1.00 25.21 ? 302 MET C CG    1 
ATOM   8933  S SD    . MET C 1 302 ? 24.172  -47.839 -63.168  1.00 30.14 ? 302 MET C SD    1 
ATOM   8934  C CE    . MET C 1 302 ? 24.783  -46.673 -64.372  1.00 28.54 ? 302 MET C CE    1 
ATOM   8935  N N     . ILE C 1 303 ? 21.904  -43.124 -61.421  1.00 22.80 ? 303 ILE C N     1 
ATOM   8936  C CA    . ILE C 1 303 ? 21.407  -41.910 -62.043  1.00 22.77 ? 303 ILE C CA    1 
ATOM   8937  C C     . ILE C 1 303 ? 21.384  -40.836 -61.019  1.00 23.81 ? 303 ILE C C     1 
ATOM   8938  O O     . ILE C 1 303 ? 21.788  -39.718 -61.311  1.00 26.19 ? 303 ILE C O     1 
ATOM   8939  C CB    . ILE C 1 303 ? 20.027  -42.063 -62.747  1.00 23.26 ? 303 ILE C CB    1 
ATOM   8940  C CG1   . ILE C 1 303 ? 20.233  -42.741 -64.107  1.00 23.07 ? 303 ILE C CG1   1 
ATOM   8941  C CG2   . ILE C 1 303 ? 19.422  -40.695 -63.024  1.00 20.25 ? 303 ILE C CG2   1 
ATOM   8942  C CD1   . ILE C 1 303 ? 19.118  -43.621 -64.512  1.00 23.83 ? 303 ILE C CD1   1 
ATOM   8943  N N     . SER C 1 304 ? 20.960  -41.191 -59.817  1.00 23.06 ? 304 SER C N     1 
ATOM   8944  C CA    . SER C 1 304 ? 20.778  -40.206 -58.746  1.00 24.39 ? 304 SER C CA    1 
ATOM   8945  C C     . SER C 1 304 ? 22.080  -39.615 -58.168  1.00 24.77 ? 304 SER C C     1 
ATOM   8946  O O     . SER C 1 304 ? 22.135  -38.446 -57.843  1.00 26.33 ? 304 SER C O     1 
ATOM   8947  C CB    . SER C 1 304 ? 19.868  -40.802 -57.631  1.00 23.51 ? 304 SER C CB    1 
ATOM   8948  O OG    . SER C 1 304 ? 19.972  -40.071 -56.444  1.00 19.95 ? 304 SER C OG    1 
ATOM   8949  N N     . GLN C 1 305 ? 23.121  -40.420 -58.059  1.00 25.55 ? 305 GLN C N     1 
ATOM   8950  C CA    . GLN C 1 305 ? 24.428  -39.909 -57.711  1.00 26.20 ? 305 GLN C CA    1 
ATOM   8951  C C     . GLN C 1 305 ? 25.116  -39.177 -58.843  1.00 25.86 ? 305 GLN C C     1 
ATOM   8952  O O     . GLN C 1 305 ? 25.893  -38.273 -58.601  1.00 26.69 ? 305 GLN C O     1 
ATOM   8953  C CB    . GLN C 1 305 ? 25.329  -41.018 -57.190  1.00 26.28 ? 305 GLN C CB    1 
ATOM   8954  C CG    . GLN C 1 305 ? 24.773  -41.747 -56.013  1.00 31.62 ? 305 GLN C CG    1 
ATOM   8955  C CD    . GLN C 1 305 ? 25.629  -42.899 -55.591  1.00 36.46 ? 305 GLN C CD    1 
ATOM   8956  O OE1   . GLN C 1 305 ? 25.123  -43.987 -55.352  1.00 40.79 ? 305 GLN C OE1   1 
ATOM   8957  N NE2   . GLN C 1 305 ? 26.931  -42.668 -55.488  1.00 36.57 ? 305 GLN C NE2   1 
ATOM   8958  N N     . LEU C 1 306 ? 24.836  -39.576 -60.076  1.00 24.49 ? 306 LEU C N     1 
ATOM   8959  C CA    . LEU C 1 306 ? 25.233  -38.805 -61.238  1.00 23.09 ? 306 LEU C CA    1 
ATOM   8960  C C     . LEU C 1 306 ? 24.727  -37.401 -61.074  1.00 22.55 ? 306 LEU C C     1 
ATOM   8961  O O     . LEU C 1 306 ? 25.481  -36.446 -61.139  1.00 21.54 ? 306 LEU C O     1 
ATOM   8962  C CB    . LEU C 1 306 ? 24.630  -39.398 -62.504  1.00 23.07 ? 306 LEU C CB    1 
ATOM   8963  C CG    . LEU C 1 306 ? 25.050  -39.104 -63.952  1.00 22.71 ? 306 LEU C CG    1 
ATOM   8964  C CD1   . LEU C 1 306 ? 23.920  -38.573 -64.766  1.00 14.53 ? 306 LEU C CD1   1 
ATOM   8965  C CD2   . LEU C 1 306 ? 26.277  -38.280 -64.124  1.00 13.67 ? 306 LEU C CD2   1 
ATOM   8966  N N     . LEU C 1 307 ? 23.428  -37.300 -60.864  1.00 21.97 ? 307 LEU C N     1 
ATOM   8967  C CA    . LEU C 1 307 ? 22.746  -36.027 -60.859  1.00 22.38 ? 307 LEU C CA    1 
ATOM   8968  C C     . LEU C 1 307 ? 23.027  -35.147 -59.630  1.00 24.24 ? 307 LEU C C     1 
ATOM   8969  O O     . LEU C 1 307 ? 23.245  -33.925 -59.785  1.00 24.96 ? 307 LEU C O     1 
ATOM   8970  C CB    . LEU C 1 307 ? 21.287  -36.264 -60.983  1.00 21.62 ? 307 LEU C CB    1 
ATOM   8971  C CG    . LEU C 1 307 ? 20.651  -37.069 -62.106  1.00 22.08 ? 307 LEU C CG    1 
ATOM   8972  C CD1   . LEU C 1 307 ? 19.160  -37.039 -61.836  1.00 21.19 ? 307 LEU C CD1   1 
ATOM   8973  C CD2   . LEU C 1 307 ? 20.973  -36.569 -63.578  1.00 16.09 ? 307 LEU C CD2   1 
ATOM   8974  N N     . HIS C 1 308 ? 22.995  -35.725 -58.427  1.00 24.49 ? 308 HIS C N     1 
ATOM   8975  C CA    . HIS C 1 308 ? 23.358  -34.979 -57.210  1.00 26.94 ? 308 HIS C CA    1 
ATOM   8976  C C     . HIS C 1 308 ? 24.815  -34.471 -57.244  1.00 27.97 ? 308 HIS C C     1 
ATOM   8977  O O     . HIS C 1 308 ? 25.083  -33.403 -56.745  1.00 28.78 ? 308 HIS C O     1 
ATOM   8978  C CB    . HIS C 1 308 ? 23.162  -35.804 -55.903  1.00 25.11 ? 308 HIS C CB    1 
ATOM   8979  C CG    . HIS C 1 308 ? 21.728  -35.966 -55.473  1.00 25.94 ? 308 HIS C CG    1 
ATOM   8980  N ND1   . HIS C 1 308 ? 20.893  -36.937 -55.990  1.00 21.40 ? 308 HIS C ND1   1 
ATOM   8981  C CD2   . HIS C 1 308 ? 20.990  -35.286 -54.559  1.00 25.64 ? 308 HIS C CD2   1 
ATOM   8982  C CE1   . HIS C 1 308 ? 19.717  -36.871 -55.381  1.00 23.72 ? 308 HIS C CE1   1 
ATOM   8983  N NE2   . HIS C 1 308 ? 19.749  -35.873 -54.515  1.00 23.14 ? 308 HIS C NE2   1 
ATOM   8984  N N     . GLU C 1 309 ? 25.730  -35.282 -57.767  1.00 29.46 ? 309 GLU C N     1 
ATOM   8985  C CA    . GLU C 1 309 ? 27.122  -34.904 -57.964  1.00 31.43 ? 309 GLU C CA    1 
ATOM   8986  C C     . GLU C 1 309 ? 27.267  -33.733 -58.940  1.00 31.50 ? 309 GLU C C     1 
ATOM   8987  O O     . GLU C 1 309 ? 27.856  -32.718 -58.590  1.00 33.12 ? 309 GLU C O     1 
ATOM   8988  C CB    . GLU C 1 309 ? 27.934  -36.101 -58.434  1.00 31.62 ? 309 GLU C CB    1 
ATOM   8989  C CG    . GLU C 1 309 ? 29.417  -35.957 -58.194  1.00 36.32 ? 309 GLU C CG    1 
ATOM   8990  C CD    . GLU C 1 309 ? 29.743  -35.228 -56.876  1.00 42.24 ? 309 GLU C CD    1 
ATOM   8991  O OE1   . GLU C 1 309 ? 30.420  -34.175 -56.965  1.00 43.96 ? 309 GLU C OE1   1 
ATOM   8992  O OE2   . GLU C 1 309 ? 29.321  -35.691 -55.770  1.00 42.64 ? 309 GLU C OE2   1 
ATOM   8993  N N     . TRP C 1 310 ? 26.676  -33.868 -60.122  1.00 30.67 ? 310 TRP C N     1 
ATOM   8994  C CA    . TRP C 1 310 ? 26.457  -32.767 -61.083  1.00 29.45 ? 310 TRP C CA    1 
ATOM   8995  C C     . TRP C 1 310 ? 25.796  -31.456 -60.632  1.00 30.44 ? 310 TRP C C     1 
ATOM   8996  O O     . TRP C 1 310 ? 26.245  -30.369 -61.023  1.00 30.16 ? 310 TRP C O     1 
ATOM   8997  C CB    . TRP C 1 310 ? 25.654  -33.288 -62.256  1.00 26.48 ? 310 TRP C CB    1 
ATOM   8998  C CG    . TRP C 1 310 ? 26.489  -33.888 -63.349  1.00 25.43 ? 310 TRP C CG    1 
ATOM   8999  C CD1   . TRP C 1 310 ? 27.875  -33.905 -63.431  1.00 24.10 ? 310 TRP C CD1   1 
ATOM   9000  C CD2   . TRP C 1 310 ? 26.014  -34.543 -64.527  1.00 22.73 ? 310 TRP C CD2   1 
ATOM   9001  N NE1   . TRP C 1 310 ? 28.259  -34.525 -64.596  1.00 22.49 ? 310 TRP C NE1   1 
ATOM   9002  C CE2   . TRP C 1 310 ? 27.144  -34.935 -65.276  1.00 21.95 ? 310 TRP C CE2   1 
ATOM   9003  C CE3   . TRP C 1 310 ? 24.744  -34.844 -65.021  1.00 23.47 ? 310 TRP C CE3   1 
ATOM   9004  C CZ2   . TRP C 1 310 ? 27.032  -35.585 -66.494  1.00 23.69 ? 310 TRP C CZ2   1 
ATOM   9005  C CZ3   . TRP C 1 310 ? 24.642  -35.513 -66.228  1.00 21.65 ? 310 TRP C CZ3   1 
ATOM   9006  C CH2   . TRP C 1 310 ? 25.765  -35.859 -66.955  1.00 23.51 ? 310 TRP C CH2   1 
ATOM   9007  N N     . GLY C 1 311 ? 24.723  -31.548 -59.845  1.00 31.90 ? 311 GLY C N     1 
ATOM   9008  C CA    . GLY C 1 311 ? 23.884  -30.391 -59.579  1.00 33.26 ? 311 GLY C CA    1 
ATOM   9009  C C     . GLY C 1 311 ? 22.984  -30.105 -60.774  1.00 35.00 ? 311 GLY C C     1 
ATOM   9010  O O     . GLY C 1 311 ? 23.139  -30.730 -61.824  1.00 34.25 ? 311 GLY C O     1 
ATOM   9011  N N     . GLU C 1 312 ? 22.028  -29.179 -60.628  1.00 36.88 ? 312 GLU C N     1 
ATOM   9012  C CA    . GLU C 1 312 ? 21.274  -28.718 -61.813  1.00 39.14 ? 312 GLU C CA    1 
ATOM   9013  C C     . GLU C 1 312 ? 22.261  -28.068 -62.771  1.00 39.57 ? 312 GLU C C     1 
ATOM   9014  O O     . GLU C 1 312 ? 22.002  -27.950 -63.978  1.00 39.93 ? 312 GLU C O     1 
ATOM   9015  C CB    . GLU C 1 312 ? 20.121  -27.759 -61.475  1.00 38.50 ? 312 GLU C CB    1 
ATOM   9016  C CG    . GLU C 1 312 ? 20.504  -26.274 -61.205  1.00 40.70 ? 312 GLU C CG    1 
ATOM   9017  C CD    . GLU C 1 312 ? 19.279  -25.334 -61.117  1.00 41.75 ? 312 GLU C CD    1 
ATOM   9018  O OE1   . GLU C 1 312 ? 19.249  -24.431 -60.210  1.00 43.81 ? 312 GLU C OE1   1 
ATOM   9019  O OE2   . GLU C 1 312 ? 18.333  -25.540 -61.940  1.00 43.76 ? 312 GLU C OE2   1 
ATOM   9020  N N     . GLU C 1 313 ? 23.406  -27.683 -62.207  1.00 39.87 ? 313 GLU C N     1 
ATOM   9021  C CA    . GLU C 1 313 ? 24.422  -26.950 -62.908  1.00 40.78 ? 313 GLU C CA    1 
ATOM   9022  C C     . GLU C 1 313 ? 24.970  -27.796 -64.049  1.00 40.32 ? 313 GLU C C     1 
ATOM   9023  O O     . GLU C 1 313 ? 24.928  -27.395 -65.222  1.00 41.06 ? 313 GLU C O     1 
ATOM   9024  C CB    . GLU C 1 313 ? 25.550  -26.668 -61.918  1.00 42.31 ? 313 GLU C CB    1 
ATOM   9025  C CG    . GLU C 1 313 ? 26.523  -25.618 -62.369  1.00 45.60 ? 313 GLU C CG    1 
ATOM   9026  C CD    . GLU C 1 313 ? 25.939  -24.246 -62.234  1.00 50.42 ? 313 GLU C CD    1 
ATOM   9027  O OE1   . GLU C 1 313 ? 25.585  -23.652 -63.284  1.00 51.36 ? 313 GLU C OE1   1 
ATOM   9028  O OE2   . GLU C 1 313 ? 25.810  -23.784 -61.065  1.00 51.25 ? 313 GLU C OE2   1 
ATOM   9029  N N     . GLY C 1 314 ? 25.495  -28.967 -63.676  1.00 38.65 ? 314 GLY C N     1 
ATOM   9030  C CA    . GLY C 1 314 ? 26.176  -29.870 -64.576  1.00 35.89 ? 314 GLY C CA    1 
ATOM   9031  C C     . GLY C 1 314 ? 25.164  -30.732 -65.308  1.00 35.07 ? 314 GLY C C     1 
ATOM   9032  O O     . GLY C 1 314 ? 25.487  -31.347 -66.364  1.00 33.23 ? 314 GLY C O     1 
ATOM   9033  N N     . PHE C 1 315 ? 23.952  -30.804 -64.742  1.00 33.64 ? 315 PHE C N     1 
ATOM   9034  C CA    . PHE C 1 315 ? 22.903  -31.512 -65.432  1.00 33.39 ? 315 PHE C CA    1 
ATOM   9035  C C     . PHE C 1 315 ? 22.572  -30.754 -66.661  1.00 32.81 ? 315 PHE C C     1 
ATOM   9036  O O     . PHE C 1 315 ? 22.619  -31.318 -67.722  1.00 32.81 ? 315 PHE C O     1 
ATOM   9037  C CB    . PHE C 1 315 ? 21.599  -31.759 -64.652  1.00 33.99 ? 315 PHE C CB    1 
ATOM   9038  C CG    . PHE C 1 315 ? 20.483  -32.283 -65.539  1.00 32.07 ? 315 PHE C CG    1 
ATOM   9039  C CD1   . PHE C 1 315 ? 20.619  -33.477 -66.219  1.00 35.72 ? 315 PHE C CD1   1 
ATOM   9040  C CD2   . PHE C 1 315 ? 19.350  -31.577 -65.727  1.00 33.00 ? 315 PHE C CD2   1 
ATOM   9041  C CE1   . PHE C 1 315 ? 19.607  -33.961 -67.060  1.00 34.98 ? 315 PHE C CE1   1 
ATOM   9042  C CE2   . PHE C 1 315 ? 18.340  -32.058 -66.570  1.00 35.36 ? 315 PHE C CE2   1 
ATOM   9043  C CZ    . PHE C 1 315 ? 18.484  -33.258 -67.233  1.00 32.44 ? 315 PHE C CZ    1 
ATOM   9044  N N     . MET C 1 316 ? 22.242  -29.475 -66.508  1.00 33.43 ? 316 MET C N     1 
ATOM   9045  C CA    . MET C 1 316 ? 21.798  -28.633 -67.620  1.00 33.70 ? 316 MET C CA    1 
ATOM   9046  C C     . MET C 1 316 ? 22.948  -28.346 -68.605  1.00 34.05 ? 316 MET C C     1 
ATOM   9047  O O     . MET C 1 316 ? 22.704  -28.045 -69.780  1.00 34.90 ? 316 MET C O     1 
ATOM   9048  C CB    . MET C 1 316 ? 21.226  -27.318 -67.102  1.00 34.68 ? 316 MET C CB    1 
ATOM   9049  C CG    . MET C 1 316 ? 19.866  -27.422 -66.358  1.00 36.06 ? 316 MET C CG    1 
ATOM   9050  S SD    . MET C 1 316 ? 18.575  -28.172 -67.371  1.00 44.78 ? 316 MET C SD    1 
ATOM   9051  C CE    . MET C 1 316 ? 18.701  -27.324 -68.978  1.00 34.83 ? 316 MET C CE    1 
ATOM   9052  N N     . ALA C 1 317 ? 24.188  -28.407 -68.119  1.00 32.49 ? 317 ALA C N     1 
ATOM   9053  C CA    . ALA C 1 317 ? 25.334  -28.146 -68.960  1.00 31.81 ? 317 ALA C CA    1 
ATOM   9054  C C     . ALA C 1 317 ? 25.647  -29.362 -69.851  1.00 31.11 ? 317 ALA C C     1 
ATOM   9055  O O     . ALA C 1 317 ? 26.196  -29.207 -70.963  1.00 30.84 ? 317 ALA C O     1 
ATOM   9056  C CB    . ALA C 1 317 ? 26.561  -27.755 -68.087  1.00 32.74 ? 317 ALA C CB    1 
ATOM   9057  N N     . HIS C 1 318 ? 25.329  -30.563 -69.348  1.00 29.30 ? 318 HIS C N     1 
ATOM   9058  C CA    . HIS C 1 318 ? 25.384  -31.771 -70.137  1.00 28.21 ? 318 HIS C CA    1 
ATOM   9059  C C     . HIS C 1 318 ? 24.276  -31.721 -71.176  1.00 29.07 ? 318 HIS C C     1 
ATOM   9060  O O     . HIS C 1 318 ? 24.479  -32.119 -72.286  1.00 30.68 ? 318 HIS C O     1 
ATOM   9061  C CB    . HIS C 1 318 ? 25.289  -33.014 -69.245  1.00 27.74 ? 318 HIS C CB    1 
ATOM   9062  C CG    . HIS C 1 318 ? 24.988  -34.289 -69.979  1.00 26.63 ? 318 HIS C CG    1 
ATOM   9063  N ND1   . HIS C 1 318 ? 23.793  -34.979 -69.828  1.00 25.10 ? 318 HIS C ND1   1 
ATOM   9064  C CD2   . HIS C 1 318 ? 25.726  -34.998 -70.865  1.00 22.49 ? 318 HIS C CD2   1 
ATOM   9065  C CE1   . HIS C 1 318 ? 23.816  -36.052 -70.598  1.00 27.98 ? 318 HIS C CE1   1 
ATOM   9066  N NE2   . HIS C 1 318 ? 24.979  -36.088 -71.235  1.00 24.70 ? 318 HIS C NE2   1 
ATOM   9067  N N     . VAL C 1 319 ? 23.118  -31.183 -70.834  1.00 29.90 ? 319 VAL C N     1 
ATOM   9068  C CA    . VAL C 1 319 ? 22.042  -31.138 -71.769  1.00 30.46 ? 319 VAL C CA    1 
ATOM   9069  C C     . VAL C 1 319 ? 22.397  -30.258 -72.953  1.00 32.34 ? 319 VAL C C     1 
ATOM   9070  O O     . VAL C 1 319 ? 21.989  -30.559 -74.085  1.00 32.18 ? 319 VAL C O     1 
ATOM   9071  C CB    . VAL C 1 319 ? 20.686  -30.713 -71.125  1.00 31.21 ? 319 VAL C CB    1 
ATOM   9072  C CG1   . VAL C 1 319 ? 19.659  -30.356 -72.231  1.00 26.01 ? 319 VAL C CG1   1 
ATOM   9073  C CG2   . VAL C 1 319 ? 20.130  -31.856 -70.220  1.00 28.25 ? 319 VAL C CG2   1 
ATOM   9074  N N     . ASP C 1 320 ? 23.131  -29.173 -72.678  1.00 33.38 ? 320 ASP C N     1 
ATOM   9075  C CA    . ASP C 1 320 ? 23.621  -28.239 -73.693  1.00 35.00 ? 320 ASP C CA    1 
ATOM   9076  C C     . ASP C 1 320 ? 24.564  -28.919 -74.677  1.00 33.86 ? 320 ASP C C     1 
ATOM   9077  O O     . ASP C 1 320 ? 24.378  -28.836 -75.892  1.00 34.88 ? 320 ASP C O     1 
ATOM   9078  C CB    . ASP C 1 320 ? 24.421  -27.112 -73.041  1.00 36.63 ? 320 ASP C CB    1 
ATOM   9079  C CG    . ASP C 1 320 ? 23.612  -25.873 -72.787  1.00 39.32 ? 320 ASP C CG    1 
ATOM   9080  O OD1   . ASP C 1 320 ? 22.822  -25.456 -73.669  1.00 42.77 ? 320 ASP C OD1   1 
ATOM   9081  O OD2   . ASP C 1 320 ? 23.827  -25.295 -71.702  1.00 44.51 ? 320 ASP C OD2   1 
ATOM   9082  N N     . ARG C 1 321 ? 25.582  -29.560 -74.136  1.00 33.03 ? 321 ARG C N     1 
ATOM   9083  C CA    . ARG C 1 321 ? 26.588  -30.310 -74.905  1.00 32.63 ? 321 ARG C CA    1 
ATOM   9084  C C     . ARG C 1 321 ? 25.884  -31.386 -75.749  1.00 31.62 ? 321 ARG C C     1 
ATOM   9085  O O     . ARG C 1 321 ? 26.356  -31.730 -76.818  1.00 31.13 ? 321 ARG C O     1 
ATOM   9086  C CB    . ARG C 1 321 ? 27.518  -31.082 -73.954  1.00 32.97 ? 321 ARG C CB    1 
ATOM   9087  C CG    . ARG C 1 321 ? 28.752  -30.424 -73.297  1.00 34.96 ? 321 ARG C CG    1 
ATOM   9088  C CD    . ARG C 1 321 ? 29.492  -31.593 -72.489  1.00 32.59 ? 321 ARG C CD    1 
ATOM   9089  N NE    . ARG C 1 321 ? 29.828  -32.678 -73.446  1.00 39.78 ? 321 ARG C NE    1 
ATOM   9090  C CZ    . ARG C 1 321 ? 29.268  -33.903 -73.532  1.00 44.18 ? 321 ARG C CZ    1 
ATOM   9091  N NH1   . ARG C 1 321 ? 28.312  -34.321 -72.677  1.00 45.05 ? 321 ARG C NH1   1 
ATOM   9092  N NH2   . ARG C 1 321 ? 29.693  -34.740 -74.489  1.00 44.82 ? 321 ARG C NH2   1 
ATOM   9093  N N     . VAL C 1 322 ? 24.814  -31.991 -75.231  1.00 29.87 ? 322 VAL C N     1 
ATOM   9094  C CA    . VAL C 1 322 ? 24.087  -32.900 -76.102  1.00 29.62 ? 322 VAL C CA    1 
ATOM   9095  C C     . VAL C 1 322 ? 23.119  -32.184 -77.081  1.00 28.55 ? 322 VAL C C     1 
ATOM   9096  O O     . VAL C 1 322 ? 22.819  -32.748 -78.144  1.00 28.25 ? 322 VAL C O     1 
ATOM   9097  C CB    . VAL C 1 322 ? 23.415  -34.142 -75.412  1.00 29.94 ? 322 VAL C CB    1 
ATOM   9098  C CG1   . VAL C 1 322 ? 24.114  -34.531 -74.138  1.00 31.19 ? 322 VAL C CG1   1 
ATOM   9099  C CG2   . VAL C 1 322 ? 21.956  -33.935 -75.194  1.00 27.27 ? 322 VAL C CG2   1 
ATOM   9100  N N     . ILE C 1 323 ? 22.644  -30.978 -76.743  1.00 27.06 ? 323 ILE C N     1 
ATOM   9101  C CA    . ILE C 1 323 ? 21.891  -30.212 -77.743  1.00 27.40 ? 323 ILE C CA    1 
ATOM   9102  C C     . ILE C 1 323 ? 22.848  -29.796 -78.876  1.00 27.75 ? 323 ILE C C     1 
ATOM   9103  O O     . ILE C 1 323 ? 22.511  -29.931 -80.037  1.00 27.32 ? 323 ILE C O     1 
ATOM   9104  C CB    . ILE C 1 323 ? 21.082  -29.034 -77.166  1.00 27.30 ? 323 ILE C CB    1 
ATOM   9105  C CG1   . ILE C 1 323 ? 19.784  -29.536 -76.482  1.00 25.84 ? 323 ILE C CG1   1 
ATOM   9106  C CG2   . ILE C 1 323 ? 20.635  -28.108 -78.267  1.00 28.60 ? 323 ILE C CG2   1 
ATOM   9107  C CD1   . ILE C 1 323 ? 19.395  -28.726 -75.239  1.00 21.96 ? 323 ILE C CD1   1 
ATOM   9108  N N     . ASP C 1 324 ? 24.075  -29.382 -78.527  1.00 28.47 ? 324 ASP C N     1 
ATOM   9109  C CA    . ASP C 1 324 ? 25.012  -28.917 -79.518  1.00 28.44 ? 324 ASP C CA    1 
ATOM   9110  C C     . ASP C 1 324 ? 25.399  -30.013 -80.456  1.00 27.64 ? 324 ASP C C     1 
ATOM   9111  O O     . ASP C 1 324 ? 25.569  -29.776 -81.660  1.00 27.08 ? 324 ASP C O     1 
ATOM   9112  C CB    . ASP C 1 324 ? 26.190  -28.156 -78.886  1.00 30.12 ? 324 ASP C CB    1 
ATOM   9113  C CG    . ASP C 1 324 ? 25.742  -26.744 -78.352  1.00 33.94 ? 324 ASP C CG    1 
ATOM   9114  O OD1   . ASP C 1 324 ? 24.933  -26.026 -79.055  1.00 35.10 ? 324 ASP C OD1   1 
ATOM   9115  O OD2   . ASP C 1 324 ? 26.174  -26.373 -77.239  1.00 31.78 ? 324 ASP C OD2   1 
ATOM   9116  N N     . PHE C 1 325 ? 25.473  -31.236 -79.954  1.00 26.80 ? 325 PHE C N     1 
ATOM   9117  C CA    . PHE C 1 325 ? 25.793  -32.332 -80.887  1.00 25.71 ? 325 PHE C CA    1 
ATOM   9118  C C     . PHE C 1 325 ? 24.686  -32.596 -81.898  1.00 25.80 ? 325 PHE C C     1 
ATOM   9119  O O     . PHE C 1 325 ? 24.933  -32.603 -83.119  1.00 24.57 ? 325 PHE C O     1 
ATOM   9120  C CB    . PHE C 1 325 ? 26.299  -33.586 -80.167  1.00 25.72 ? 325 PHE C CB    1 
ATOM   9121  C CG    . PHE C 1 325 ? 26.305  -34.816 -81.027  1.00 23.94 ? 325 PHE C CG    1 
ATOM   9122  C CD1   . PHE C 1 325 ? 27.420  -35.144 -81.760  1.00 20.61 ? 325 PHE C CD1   1 
ATOM   9123  C CD2   . PHE C 1 325 ? 25.145  -35.636 -81.098  1.00 20.42 ? 325 PHE C CD2   1 
ATOM   9124  C CE1   . PHE C 1 325 ? 27.413  -36.282 -82.554  1.00 18.77 ? 325 PHE C CE1   1 
ATOM   9125  C CE2   . PHE C 1 325 ? 25.071  -36.738 -81.851  1.00 14.36 ? 325 PHE C CE2   1 
ATOM   9126  C CZ    . PHE C 1 325 ? 26.209  -37.096 -82.611  1.00 25.59 ? 325 PHE C CZ    1 
ATOM   9127  N N     . TYR C 1 326 ? 23.469  -32.801 -81.382  1.00 26.67 ? 326 TYR C N     1 
ATOM   9128  C CA    . TYR C 1 326 ? 22.251  -33.042 -82.196  1.00 26.95 ? 326 TYR C CA    1 
ATOM   9129  C C     . TYR C 1 326 ? 21.983  -31.935 -83.187  1.00 28.74 ? 326 TYR C C     1 
ATOM   9130  O O     . TYR C 1 326 ? 21.382  -32.162 -84.221  1.00 30.17 ? 326 TYR C O     1 
ATOM   9131  C CB    . TYR C 1 326 ? 21.028  -33.280 -81.295  1.00 25.33 ? 326 TYR C CB    1 
ATOM   9132  C CG    . TYR C 1 326 ? 20.959  -34.717 -80.779  1.00 26.10 ? 326 TYR C CG    1 
ATOM   9133  C CD1   . TYR C 1 326 ? 20.709  -35.790 -81.658  1.00 26.50 ? 326 TYR C CD1   1 
ATOM   9134  C CD2   . TYR C 1 326 ? 21.198  -35.029 -79.441  1.00 25.19 ? 326 TYR C CD2   1 
ATOM   9135  C CE1   . TYR C 1 326 ? 20.694  -37.129 -81.192  1.00 25.06 ? 326 TYR C CE1   1 
ATOM   9136  C CE2   . TYR C 1 326 ? 21.137  -36.401 -78.971  1.00 21.71 ? 326 TYR C CE2   1 
ATOM   9137  C CZ    . TYR C 1 326 ? 20.912  -37.400 -79.873  1.00 19.57 ? 326 TYR C CZ    1 
ATOM   9138  O OH    . TYR C 1 326 ? 20.822  -38.683 -79.472  1.00 20.16 ? 326 TYR C OH    1 
ATOM   9139  N N     . SER C 1 327 ? 22.468  -30.739 -82.885  1.00 30.41 ? 327 SER C N     1 
ATOM   9140  C CA    . SER C 1 327 ? 22.423  -29.616 -83.820  1.00 31.92 ? 327 SER C CA    1 
ATOM   9141  C C     . SER C 1 327 ? 23.385  -29.763 -85.013  1.00 32.72 ? 327 SER C C     1 
ATOM   9142  O O     . SER C 1 327 ? 22.970  -29.591 -86.185  1.00 33.72 ? 327 SER C O     1 
ATOM   9143  C CB    . SER C 1 327 ? 22.709  -28.300 -83.083  1.00 33.09 ? 327 SER C CB    1 
ATOM   9144  O OG    . SER C 1 327 ? 21.637  -27.928 -82.239  1.00 31.05 ? 327 SER C OG    1 
ATOM   9145  N N     . ASN C 1 328 ? 24.651  -30.069 -84.752  1.00 32.26 ? 328 ASN C N     1 
ATOM   9146  C CA    . ASN C 1 328 ? 25.549  -30.321 -85.862  1.00 33.75 ? 328 ASN C CA    1 
ATOM   9147  C C     . ASN C 1 328 ? 24.929  -31.388 -86.749  1.00 32.62 ? 328 ASN C C     1 
ATOM   9148  O O     . ASN C 1 328 ? 24.806  -31.200 -87.957  1.00 33.67 ? 328 ASN C O     1 
ATOM   9149  C CB    . ASN C 1 328 ? 26.992  -30.648 -85.404  1.00 34.83 ? 328 ASN C CB    1 
ATOM   9150  C CG    . ASN C 1 328 ? 27.528  -29.640 -84.383  1.00 38.59 ? 328 ASN C CG    1 
ATOM   9151  O OD1   . ASN C 1 328 ? 28.170  -30.011 -83.364  1.00 45.43 ? 328 ASN C OD1   1 
ATOM   9152  N ND2   . ASN C 1 328 ? 27.262  -28.360 -84.635  1.00 38.65 ? 328 ASN C ND2   1 
ATOM   9153  N N     . GLN C 1 329 ? 24.448  -32.461 -86.127  1.00 32.35 ? 329 GLN C N     1 
ATOM   9154  C CA    . GLN C 1 329 ? 23.769  -33.551 -86.847  1.00 31.59 ? 329 GLN C CA    1 
ATOM   9155  C C     . GLN C 1 329 ? 22.612  -33.051 -87.670  1.00 31.77 ? 329 GLN C C     1 
ATOM   9156  O O     . GLN C 1 329 ? 22.501  -33.430 -88.823  1.00 31.23 ? 329 GLN C O     1 
ATOM   9157  C CB    . GLN C 1 329 ? 23.324  -34.685 -85.913  1.00 30.50 ? 329 GLN C CB    1 
ATOM   9158  C CG    . GLN C 1 329 ? 24.498  -35.362 -85.117  1.00 28.45 ? 329 GLN C CG    1 
ATOM   9159  C CD    . GLN C 1 329 ? 25.372  -36.201 -86.011  1.00 26.30 ? 329 GLN C CD    1 
ATOM   9160  O OE1   . GLN C 1 329 ? 26.465  -35.791 -86.392  1.00 24.19 ? 329 GLN C OE1   1 
ATOM   9161  N NE2   . GLN C 1 329 ? 24.880  -37.370 -86.393  1.00 24.68 ? 329 GLN C NE2   1 
ATOM   9162  N N     . LYS C 1 330 ? 21.763  -32.207 -87.071  1.00 32.52 ? 330 LYS C N     1 
ATOM   9163  C CA    . LYS C 1 330 ? 20.605  -31.599 -87.759  1.00 33.02 ? 330 LYS C CA    1 
ATOM   9164  C C     . LYS C 1 330 ? 21.082  -30.674 -88.891  1.00 32.58 ? 330 LYS C C     1 
ATOM   9165  O O     . LYS C 1 330 ? 20.542  -30.681 -90.008  1.00 33.64 ? 330 LYS C O     1 
ATOM   9166  C CB    . LYS C 1 330 ? 19.714  -30.806 -86.774  1.00 33.16 ? 330 LYS C CB    1 
ATOM   9167  C CG    . LYS C 1 330 ? 18.795  -29.791 -87.445  1.00 34.14 ? 330 LYS C CG    1 
ATOM   9168  C CD    . LYS C 1 330 ? 18.481  -28.683 -86.472  1.00 37.96 ? 330 LYS C CD    1 
ATOM   9169  C CE    . LYS C 1 330 ? 18.807  -27.280 -86.995  1.00 38.31 ? 330 LYS C CE    1 
ATOM   9170  N NZ    . LYS C 1 330 ? 18.150  -26.272 -86.089  1.00 39.56 ? 330 LYS C NZ    1 
ATOM   9171  N N     . ASP C 1 331 ? 22.111  -29.894 -88.610  1.00 31.94 ? 331 ASP C N     1 
ATOM   9172  C CA    . ASP C 1 331 ? 22.741  -29.077 -89.650  1.00 30.60 ? 331 ASP C CA    1 
ATOM   9173  C C     . ASP C 1 331 ? 23.144  -29.872 -90.884  1.00 29.30 ? 331 ASP C C     1 
ATOM   9174  O O     . ASP C 1 331 ? 22.876  -29.439 -92.003  1.00 28.32 ? 331 ASP C O     1 
ATOM   9175  C CB    . ASP C 1 331 ? 23.975  -28.396 -89.090  1.00 30.81 ? 331 ASP C CB    1 
ATOM   9176  C CG    . ASP C 1 331 ? 23.644  -27.148 -88.310  1.00 31.59 ? 331 ASP C CG    1 
ATOM   9177  O OD1   . ASP C 1 331 ? 22.475  -26.937 -87.857  1.00 27.80 ? 331 ASP C OD1   1 
ATOM   9178  O OD2   . ASP C 1 331 ? 24.605  -26.380 -88.145  1.00 34.05 ? 331 ASP C OD2   1 
ATOM   9179  N N     . ALA C 1 332 ? 23.781  -31.027 -90.664  1.00 28.21 ? 332 ALA C N     1 
ATOM   9180  C CA    . ALA C 1 332 ? 24.305  -31.875 -91.754  1.00 26.42 ? 332 ALA C CA    1 
ATOM   9181  C C     . ALA C 1 332 ? 23.231  -32.648 -92.488  1.00 25.50 ? 332 ALA C C     1 
ATOM   9182  O O     . ALA C 1 332 ? 23.256  -32.710 -93.737  1.00 25.48 ? 332 ALA C O     1 
ATOM   9183  C CB    . ALA C 1 332 ? 25.359  -32.825 -91.245  1.00 26.34 ? 332 ALA C CB    1 
ATOM   9184  N N     . ILE C 1 333 ? 22.305  -33.268 -91.756  1.00 23.93 ? 333 ILE C N     1 
ATOM   9185  C CA    . ILE C 1 333 ? 21.157  -33.882 -92.441  1.00 22.69 ? 333 ILE C CA    1 
ATOM   9186  C C     . ILE C 1 333 ? 20.501  -32.755 -93.263  1.00 23.67 ? 333 ILE C C     1 
ATOM   9187  O O     . ILE C 1 333 ? 19.899  -33.007 -94.306  1.00 24.52 ? 333 ILE C O     1 
ATOM   9188  C CB    . ILE C 1 333 ? 20.118  -34.525 -91.494  1.00 21.81 ? 333 ILE C CB    1 
ATOM   9189  C CG1   . ILE C 1 333 ? 19.277  -35.608 -92.228  1.00 22.49 ? 333 ILE C CG1   1 
ATOM   9190  C CG2   . ILE C 1 333 ? 19.195  -33.467 -90.921  1.00 17.85 ? 333 ILE C CG2   1 
ATOM   9191  C CD1   . ILE C 1 333 ? 19.622  -37.101 -91.925  1.00 21.39 ? 333 ILE C CD1   1 
ATOM   9192  N N     . LEU C 1 334 ? 20.618  -31.514 -92.802  1.00 23.60 ? 334 LEU C N     1 
ATOM   9193  C CA    . LEU C 1 334 ? 19.863  -30.463 -93.427  1.00 24.94 ? 334 LEU C CA    1 
ATOM   9194  C C     . LEU C 1 334 ? 20.550  -29.991 -94.729  1.00 25.63 ? 334 LEU C C     1 
ATOM   9195  O O     . LEU C 1 334 ? 19.883  -29.731 -95.818  1.00 27.20 ? 334 LEU C O     1 
ATOM   9196  C CB    . LEU C 1 334 ? 19.679  -29.371 -92.412  1.00 25.49 ? 334 LEU C CB    1 
ATOM   9197  C CG    . LEU C 1 334 ? 18.313  -28.725 -92.294  1.00 25.61 ? 334 LEU C CG    1 
ATOM   9198  C CD1   . LEU C 1 334 ? 17.215  -29.674 -91.885  1.00 23.26 ? 334 LEU C CD1   1 
ATOM   9199  C CD2   . LEU C 1 334 ? 18.439  -27.597 -91.316  1.00 27.21 ? 334 LEU C CD2   1 
ATOM   9200  N N     . ALA C 1 335 ? 21.876  -29.990 -94.634  1.00 23.30 ? 335 ALA C N     1 
ATOM   9201  C CA    . ALA C 1 335 ? 22.748  -29.593 -95.667  1.00 22.42 ? 335 ALA C CA    1 
ATOM   9202  C C     . ALA C 1 335 ? 22.672  -30.667 -96.774  1.00 22.63 ? 335 ALA C C     1 
ATOM   9203  O O     . ALA C 1 335 ? 22.548  -30.340 -97.953  1.00 21.85 ? 335 ALA C O     1 
ATOM   9204  C CB    . ALA C 1 335 ? 24.239  -29.418 -95.072  1.00 21.20 ? 335 ALA C CB    1 
ATOM   9205  N N     . ALA C 1 336 ? 22.801  -31.937 -96.390  1.00 22.06 ? 336 ALA C N     1 
ATOM   9206  C CA    . ALA C 1 336 ? 22.672  -33.033 -97.304  1.00 22.29 ? 336 ALA C CA    1 
ATOM   9207  C C     . ALA C 1 336 ? 21.373  -32.924 -98.065  1.00 23.94 ? 336 ALA C C     1 
ATOM   9208  O O     . ALA C 1 336 ? 21.335  -33.253 -99.228  1.00 23.65 ? 336 ALA C O     1 
ATOM   9209  C CB    . ALA C 1 336 ? 22.676  -34.332 -96.552  1.00 22.01 ? 336 ALA C CB    1 
ATOM   9210  N N     . ALA C 1 337 ? 20.295  -32.525 -97.374  1.00 25.16 ? 337 ALA C N     1 
ATOM   9211  C CA    . ALA C 1 337 ? 18.995  -32.479 -97.985  1.00 26.30 ? 337 ALA C CA    1 
ATOM   9212  C C     . ALA C 1 337 ? 18.917  -31.315 -98.958  1.00 27.14 ? 337 ALA C C     1 
ATOM   9213  O O     . ALA C 1 337 ? 18.320  -31.459 -100.038 1.00 29.66 ? 337 ALA C O     1 
ATOM   9214  C CB    . ALA C 1 337 ? 17.867  -32.381 -96.923  1.00 26.25 ? 337 ALA C CB    1 
ATOM   9215  N N     . ASP C 1 338 ? 19.495  -30.179 -98.583  1.00 26.60 ? 338 ASP C N     1 
ATOM   9216  C CA    . ASP C 1 338 ? 19.525  -29.047 -99.469  1.00 25.76 ? 338 ASP C CA    1 
ATOM   9217  C C     . ASP C 1 338 ? 20.296  -29.399 -100.685 1.00 25.81 ? 338 ASP C C     1 
ATOM   9218  O O     . ASP C 1 338 ? 19.964  -28.927 -101.765 1.00 25.23 ? 338 ASP C O     1 
ATOM   9219  C CB    . ASP C 1 338 ? 20.009  -27.759 -98.770  1.00 25.72 ? 338 ASP C CB    1 
ATOM   9220  C CG    . ASP C 1 338 ? 18.840  -27.048 -98.004  1.00 29.37 ? 338 ASP C CG    1 
ATOM   9221  O OD1   . ASP C 1 338 ? 17.679  -26.903 -98.571  1.00 29.40 ? 338 ASP C OD1   1 
ATOM   9222  O OD2   . ASP C 1 338 ? 19.070  -26.641 -96.852  1.00 26.62 ? 338 ASP C OD2   1 
ATOM   9223  N N     . LYS C 1 339 ? 21.222  -30.348 -100.538 1.00 26.30 ? 339 LYS C N     1 
ATOM   9224  C CA    . LYS C 1 339 ? 22.174  -30.657 -101.586 1.00 27.58 ? 339 LYS C CA    1 
ATOM   9225  C C     . LYS C 1 339 ? 21.702  -31.547 -102.708 1.00 27.97 ? 339 LYS C C     1 
ATOM   9226  O O     . LYS C 1 339 ? 22.077  -31.264 -103.858 1.00 27.62 ? 339 LYS C O     1 
ATOM   9227  C CB    . LYS C 1 339 ? 23.530  -31.176 -100.983 1.00 28.45 ? 339 LYS C CB    1 
ATOM   9228  C CG    . LYS C 1 339 ? 24.700  -31.510 -101.992 1.00 26.23 ? 339 LYS C CG    1 
ATOM   9229  C CD    . LYS C 1 339 ? 26.034  -31.377 -101.202 1.00 29.98 ? 339 LYS C CD    1 
ATOM   9230  C CE    . LYS C 1 339 ? 27.283  -31.588 -102.047 1.00 29.72 ? 339 LYS C CE    1 
ATOM   9231  N NZ    . LYS C 1 339 ? 27.584  -33.017 -102.099 1.00 28.54 ? 339 LYS C NZ    1 
ATOM   9232  N N     . TRP C 1 340 ? 20.952  -32.624 -102.390 1.00 29.42 ? 340 TRP C N     1 
ATOM   9233  C CA    . TRP C 1 340 ? 20.431  -33.621 -103.385 1.00 30.47 ? 340 TRP C CA    1 
ATOM   9234  C C     . TRP C 1 340 ? 18.920  -33.658 -103.610 1.00 31.74 ? 340 TRP C C     1 
ATOM   9235  O O     . TRP C 1 340 ? 18.454  -34.247 -104.586 1.00 32.23 ? 340 TRP C O     1 
ATOM   9236  C CB    . TRP C 1 340 ? 20.848  -35.070 -103.013 1.00 32.25 ? 340 TRP C CB    1 
ATOM   9237  C CG    . TRP C 1 340 ? 22.314  -35.218 -102.937 1.00 32.00 ? 340 TRP C CG    1 
ATOM   9238  C CD1   . TRP C 1 340 ? 23.079  -35.226 -101.820 1.00 31.76 ? 340 TRP C CD1   1 
ATOM   9239  C CD2   . TRP C 1 340 ? 23.201  -35.246 -104.044 1.00 32.77 ? 340 TRP C CD2   1 
ATOM   9240  N NE1   . TRP C 1 340 ? 24.422  -35.302 -102.156 1.00 35.31 ? 340 TRP C NE1   1 
ATOM   9241  C CE2   . TRP C 1 340 ? 24.522  -35.302 -103.524 1.00 33.37 ? 340 TRP C CE2   1 
ATOM   9242  C CE3   . TRP C 1 340 ? 23.013  -35.251 -105.428 1.00 34.18 ? 340 TRP C CE3   1 
ATOM   9243  C CZ2   . TRP C 1 340 ? 25.642  -35.376 -104.336 1.00 32.20 ? 340 TRP C CZ2   1 
ATOM   9244  C CZ3   . TRP C 1 340 ? 24.137  -35.321 -106.243 1.00 35.16 ? 340 TRP C CZ3   1 
ATOM   9245  C CH2   . TRP C 1 340 ? 25.438  -35.371 -105.690 1.00 32.20 ? 340 TRP C CH2   1 
ATOM   9246  N N     . LEU C 1 341 ? 18.140  -33.105 -102.695 1.00 32.84 ? 341 LEU C N     1 
ATOM   9247  C CA    . LEU C 1 341 ? 16.689  -33.350 -102.701 1.00 32.90 ? 341 LEU C CA    1 
ATOM   9248  C C     . LEU C 1 341 ? 15.963  -32.129 -103.166 1.00 33.72 ? 341 LEU C C     1 
ATOM   9249  O O     . LEU C 1 341 ? 14.754  -32.123 -103.441 1.00 33.59 ? 341 LEU C O     1 
ATOM   9250  C CB    . LEU C 1 341 ? 16.206  -33.695 -101.303 1.00 33.74 ? 341 LEU C CB    1 
ATOM   9251  C CG    . LEU C 1 341 ? 16.658  -35.042 -100.733 1.00 32.82 ? 341 LEU C CG    1 
ATOM   9252  C CD1   . LEU C 1 341 ? 15.863  -35.321 -99.464  1.00 32.76 ? 341 LEU C CD1   1 
ATOM   9253  C CD2   . LEU C 1 341 ? 16.383  -36.098 -101.796 1.00 35.95 ? 341 LEU C CD2   1 
ATOM   9254  N N     . THR C 1 342 ? 16.752  -31.084 -103.280 1.00 34.08 ? 342 THR C N     1 
ATOM   9255  C CA    . THR C 1 342 ? 16.271  -29.774 -103.495 1.00 33.71 ? 342 THR C CA    1 
ATOM   9256  C C     . THR C 1 342 ? 15.472  -29.747 -104.793 1.00 33.43 ? 342 THR C C     1 
ATOM   9257  O O     . THR C 1 342 ? 16.019  -29.965 -105.893 1.00 34.56 ? 342 THR C O     1 
ATOM   9258  C CB    . THR C 1 342 ? 17.443  -28.845 -103.464 1.00 33.89 ? 342 THR C CB    1 
ATOM   9259  O OG1   . THR C 1 342 ? 16.991  -27.507 -103.507 1.00 34.60 ? 342 THR C OG1   1 
ATOM   9260  C CG2   . THR C 1 342 ? 18.445  -29.178 -104.657 1.00 35.60 ? 342 THR C CG2   1 
ATOM   9261  N N     . GLY C 1 343 ? 14.160  -29.517 -104.631 1.00 32.32 ? 343 GLY C N     1 
ATOM   9262  C CA    . GLY C 1 343 ? 13.162  -29.506 -105.713 1.00 30.53 ? 343 GLY C CA    1 
ATOM   9263  C C     . GLY C 1 343 ? 12.429  -30.835 -105.917 1.00 29.45 ? 343 GLY C C     1 
ATOM   9264  O O     . GLY C 1 343 ? 11.515  -30.913 -106.710 1.00 28.97 ? 343 GLY C O     1 
ATOM   9265  N N     . LEU C 1 344 ? 12.875  -31.885 -105.223 1.00 28.53 ? 344 LEU C N     1 
ATOM   9266  C CA    . LEU C 1 344 ? 12.345  -33.235 -105.351 1.00 26.63 ? 344 LEU C CA    1 
ATOM   9267  C C     . LEU C 1 344 ? 11.564  -33.684 -104.123 1.00 25.84 ? 344 LEU C C     1 
ATOM   9268  O O     . LEU C 1 344 ? 11.002  -34.801 -104.139 1.00 26.21 ? 344 LEU C O     1 
ATOM   9269  C CB    . LEU C 1 344 ? 13.494  -34.231 -105.529 1.00 27.03 ? 344 LEU C CB    1 
ATOM   9270  C CG    . LEU C 1 344 ? 14.395  -34.265 -106.745 1.00 24.95 ? 344 LEU C CG    1 
ATOM   9271  C CD1   . LEU C 1 344 ? 15.490  -35.289 -106.475 1.00 25.00 ? 344 LEU C CD1   1 
ATOM   9272  C CD2   . LEU C 1 344 ? 13.565  -34.687 -107.840 1.00 17.42 ? 344 LEU C CD2   1 
ATOM   9273  N N     . ALA C 1 345 ? 11.542  -32.839 -103.081 1.00 24.40 ? 345 ALA C N     1 
ATOM   9274  C CA    . ALA C 1 345 ? 10.890  -33.107 -101.785 1.00 23.82 ? 345 ALA C CA    1 
ATOM   9275  C C     . ALA C 1 345 ? 10.881  -31.867 -100.906 1.00 24.31 ? 345 ALA C C     1 
ATOM   9276  O O     . ALA C 1 345 ? 11.666  -30.958 -101.121 1.00 25.41 ? 345 ALA C O     1 
ATOM   9277  C CB    . ALA C 1 345 ? 11.594  -34.210 -101.059 1.00 24.20 ? 345 ALA C CB    1 
ATOM   9278  N N     . GLU C 1 346 ? 9.989   -31.842 -99.921  1.00 24.36 ? 346 GLU C N     1 
ATOM   9279  C CA    . GLU C 1 346 ? 9.902   -30.719 -98.995  1.00 25.67 ? 346 GLU C CA    1 
ATOM   9280  C C     . GLU C 1 346 ? 9.964   -31.200 -97.547  1.00 25.00 ? 346 GLU C C     1 
ATOM   9281  O O     . GLU C 1 346 ? 9.812   -32.382 -97.266  1.00 24.54 ? 346 GLU C O     1 
ATOM   9282  C CB    . GLU C 1 346 ? 8.616   -29.932 -99.234  1.00 26.49 ? 346 GLU C CB    1 
ATOM   9283  C CG    . GLU C 1 346 ? 8.572   -29.200 -100.569 1.00 32.48 ? 346 GLU C CG    1 
ATOM   9284  C CD    . GLU C 1 346 ? 7.296   -28.412 -100.760 1.00 37.16 ? 346 GLU C CD    1 
ATOM   9285  O OE1   . GLU C 1 346 ? 7.250   -27.244 -100.318 1.00 36.73 ? 346 GLU C OE1   1 
ATOM   9286  O OE2   . GLU C 1 346 ? 6.338   -28.947 -101.351 1.00 41.37 ? 346 GLU C OE2   1 
ATOM   9287  N N     . TRP C 1 347 ? 10.187  -30.262 -96.632  1.00 24.63 ? 347 TRP C N     1 
ATOM   9288  C CA    . TRP C 1 347 ? 10.562  -30.600 -95.264  1.00 23.83 ? 347 TRP C CA    1 
ATOM   9289  C C     . TRP C 1 347 ? 10.639  -29.284 -94.498  1.00 24.17 ? 347 TRP C C     1 
ATOM   9290  O O     . TRP C 1 347 ? 10.942  -28.238 -95.073  1.00 24.16 ? 347 TRP C O     1 
ATOM   9291  C CB    . TRP C 1 347 ? 11.777  -31.529 -95.255  1.00 22.54 ? 347 TRP C CB    1 
ATOM   9292  C CG    . TRP C 1 347 ? 13.042  -30.866 -95.708  1.00 19.86 ? 347 TRP C CG    1 
ATOM   9293  C CD1   . TRP C 1 347 ? 13.873  -30.084 -94.959  1.00 19.73 ? 347 TRP C CD1   1 
ATOM   9294  C CD2   . TRP C 1 347 ? 13.623  -30.926 -97.016  1.00 20.46 ? 347 TRP C CD2   1 
ATOM   9295  N NE1   . TRP C 1 347 ? 14.933  -29.654 -95.720  1.00 23.00 ? 347 TRP C NE1   1 
ATOM   9296  C CE2   . TRP C 1 347 ? 14.804  -30.157 -96.988  1.00 22.71 ? 347 TRP C CE2   1 
ATOM   9297  C CE3   . TRP C 1 347 ? 13.264  -31.547 -98.214  1.00 20.35 ? 347 TRP C CE3   1 
ATOM   9298  C CZ2   . TRP C 1 347 ? 15.622  -30.000 -98.104  1.00 25.38 ? 347 TRP C CZ2   1 
ATOM   9299  C CZ3   . TRP C 1 347 ? 14.078  -31.390 -99.320  1.00 23.79 ? 347 TRP C CZ3   1 
ATOM   9300  C CH2   . TRP C 1 347 ? 15.242  -30.619 -99.258  1.00 21.83 ? 347 TRP C CH2   1 
ATOM   9301  N N     . HIS C 1 348 ? 10.363  -29.343 -93.199  1.00 25.23 ? 348 HIS C N     1 
ATOM   9302  C CA    . HIS C 1 348 ? 10.553  -28.194 -92.323  1.00 26.28 ? 348 HIS C CA    1 
ATOM   9303  C C     . HIS C 1 348 ? 11.826  -28.506 -91.543  1.00 27.25 ? 348 HIS C C     1 
ATOM   9304  O O     . HIS C 1 348 ? 12.131  -29.668 -91.275  1.00 28.87 ? 348 HIS C O     1 
ATOM   9305  C CB    . HIS C 1 348 ? 9.385   -27.977 -91.358  1.00 26.56 ? 348 HIS C CB    1 
ATOM   9306  C CG    . HIS C 1 348 ? 8.043   -27.989 -92.021  1.00 27.85 ? 348 HIS C CG    1 
ATOM   9307  N ND1   . HIS C 1 348 ? 7.480   -26.863 -92.582  1.00 30.03 ? 348 HIS C ND1   1 
ATOM   9308  C CD2   . HIS C 1 348 ? 7.153   -28.990 -92.214  1.00 28.31 ? 348 HIS C CD2   1 
ATOM   9309  C CE1   . HIS C 1 348 ? 6.300   -27.171 -93.091  1.00 28.61 ? 348 HIS C CE1   1 
ATOM   9310  N NE2   . HIS C 1 348 ? 6.078   -28.456 -92.881  1.00 29.79 ? 348 HIS C NE2   1 
ATOM   9311  N N     . VAL C 1 349 ? 12.564  -27.462 -91.182  1.00 26.04 ? 349 VAL C N     1 
ATOM   9312  C CA    . VAL C 1 349 ? 13.634  -27.591 -90.284  1.00 27.23 ? 349 VAL C CA    1 
ATOM   9313  C C     . VAL C 1 349 ? 13.172  -27.953 -88.863  1.00 26.63 ? 349 VAL C C     1 
ATOM   9314  O O     . VAL C 1 349 ? 12.521  -27.141 -88.188  1.00 25.44 ? 349 VAL C O     1 
ATOM   9315  C CB    . VAL C 1 349 ? 14.492  -26.319 -90.262  1.00 28.23 ? 349 VAL C CB    1 
ATOM   9316  C CG1   . VAL C 1 349 ? 13.591  -25.092 -90.041  1.00 27.81 ? 349 VAL C CG1   1 
ATOM   9317  C CG2   . VAL C 1 349 ? 15.521  -26.453 -89.125  1.00 25.88 ? 349 VAL C CG2   1 
ATOM   9318  N N     . PRO C 1 350 ? 13.559  -29.166 -88.412  1.00 27.52 ? 350 PRO C N     1 
ATOM   9319  C CA    . PRO C 1 350 ? 13.194  -29.834 -87.142  1.00 27.31 ? 350 PRO C CA    1 
ATOM   9320  C C     . PRO C 1 350 ? 13.536  -28.917 -86.035  1.00 28.32 ? 350 PRO C C     1 
ATOM   9321  O O     . PRO C 1 350 ? 14.678  -28.443 -85.958  1.00 28.59 ? 350 PRO C O     1 
ATOM   9322  C CB    . PRO C 1 350 ? 14.206  -30.980 -87.020  1.00 27.19 ? 350 PRO C CB    1 
ATOM   9323  C CG    . PRO C 1 350 ? 15.036  -30.947 -88.250  1.00 25.73 ? 350 PRO C CG    1 
ATOM   9324  C CD    . PRO C 1 350 ? 14.535  -29.959 -89.202  1.00 26.83 ? 350 PRO C CD    1 
ATOM   9325  N N     . ALA C 1 351 ? 12.564  -28.691 -85.164  1.00 28.89 ? 351 ALA C N     1 
ATOM   9326  C CA    . ALA C 1 351 ? 12.699  -27.777 -84.043  1.00 27.60 ? 351 ALA C CA    1 
ATOM   9327  C C     . ALA C 1 351 ? 13.437  -28.381 -82.807  1.00 26.42 ? 351 ALA C C     1 
ATOM   9328  O O     . ALA C 1 351 ? 13.908  -27.647 -81.921  1.00 26.82 ? 351 ALA C O     1 
ATOM   9329  C CB    . ALA C 1 351 ? 11.314  -27.327 -83.658  1.00 27.49 ? 351 ALA C CB    1 
ATOM   9330  N N     . ALA C 1 352 ? 13.500  -29.705 -82.744  1.00 24.35 ? 352 ALA C N     1 
ATOM   9331  C CA    . ALA C 1 352 ? 13.991  -30.423 -81.580  1.00 23.44 ? 352 ALA C CA    1 
ATOM   9332  C C     . ALA C 1 352 ? 14.131  -31.871 -82.036  1.00 24.36 ? 352 ALA C C     1 
ATOM   9333  O O     . ALA C 1 352 ? 13.526  -32.255 -83.097  1.00 23.52 ? 352 ALA C O     1 
ATOM   9334  C CB    . ALA C 1 352 ? 12.974  -30.336 -80.428  1.00 23.31 ? 352 ALA C CB    1 
ATOM   9335  N N     . GLY C 1 353 ? 14.847  -32.689 -81.238  1.00 22.76 ? 353 GLY C N     1 
ATOM   9336  C CA    . GLY C 1 353 ? 14.760  -34.140 -81.430  1.00 23.17 ? 353 GLY C CA    1 
ATOM   9337  C C     . GLY C 1 353 ? 15.856  -34.635 -82.361  1.00 25.46 ? 353 GLY C C     1 
ATOM   9338  O O     . GLY C 1 353 ? 16.941  -33.976 -82.511  1.00 24.41 ? 353 GLY C O     1 
ATOM   9339  N N     . MET C 1 354 ? 15.604  -35.814 -82.942  1.00 26.53 ? 354 MET C N     1 
ATOM   9340  C CA    . MET C 1 354 ? 16.581  -36.518 -83.815  1.00 28.34 ? 354 MET C CA    1 
ATOM   9341  C C     . MET C 1 354 ? 15.952  -37.002 -85.137  1.00 26.82 ? 354 MET C C     1 
ATOM   9342  O O     . MET C 1 354 ? 16.410  -37.980 -85.726  1.00 26.67 ? 354 MET C O     1 
ATOM   9343  C CB    . MET C 1 354 ? 17.296  -37.681 -83.101  1.00 27.12 ? 354 MET C CB    1 
ATOM   9344  C CG    . MET C 1 354 ? 16.401  -38.835 -82.677  1.00 30.21 ? 354 MET C CG    1 
ATOM   9345  S SD    . MET C 1 354 ? 16.779  -39.637 -81.063  1.00 33.60 ? 354 MET C SD    1 
ATOM   9346  C CE    . MET C 1 354 ? 15.718  -41.057 -81.016  1.00 30.48 ? 354 MET C CE    1 
ATOM   9347  N N     . PHE C 1 355 ? 14.927  -36.334 -85.635  1.00 25.30 ? 355 PHE C N     1 
ATOM   9348  C CA    . PHE C 1 355 ? 14.410  -36.869 -86.864  1.00 25.28 ? 355 PHE C CA    1 
ATOM   9349  C C     . PHE C 1 355 ? 14.113  -35.771 -87.779  1.00 25.25 ? 355 PHE C C     1 
ATOM   9350  O O     . PHE C 1 355 ? 13.865  -34.657 -87.332  1.00 25.78 ? 355 PHE C O     1 
ATOM   9351  C CB    . PHE C 1 355 ? 13.166  -37.701 -86.656  1.00 25.60 ? 355 PHE C CB    1 
ATOM   9352  C CG    . PHE C 1 355 ? 13.393  -38.990 -85.949  1.00 24.89 ? 355 PHE C CG    1 
ATOM   9353  C CD1   . PHE C 1 355 ? 13.955  -40.093 -86.628  1.00 28.36 ? 355 PHE C CD1   1 
ATOM   9354  C CD2   . PHE C 1 355 ? 12.961  -39.149 -84.634  1.00 27.06 ? 355 PHE C CD2   1 
ATOM   9355  C CE1   . PHE C 1 355 ? 14.149  -41.323 -85.981  1.00 27.90 ? 355 PHE C CE1   1 
ATOM   9356  C CE2   . PHE C 1 355 ? 13.144  -40.367 -83.975  1.00 29.26 ? 355 PHE C CE2   1 
ATOM   9357  C CZ    . PHE C 1 355 ? 13.738  -41.458 -84.649  1.00 28.46 ? 355 PHE C CZ    1 
ATOM   9358  N N     . LEU C 1 356 ? 14.204  -36.077 -89.067  1.00 25.26 ? 356 LEU C N     1 
ATOM   9359  C CA    . LEU C 1 356 ? 13.916  -35.119 -90.111  1.00 25.54 ? 356 LEU C CA    1 
ATOM   9360  C C     . LEU C 1 356 ? 12.898  -35.821 -90.956  1.00 25.88 ? 356 LEU C C     1 
ATOM   9361  O O     . LEU C 1 356 ? 12.966  -37.000 -91.118  1.00 26.43 ? 356 LEU C O     1 
ATOM   9362  C CB    . LEU C 1 356 ? 15.156  -34.803 -90.936  1.00 25.91 ? 356 LEU C CB    1 
ATOM   9363  C CG    . LEU C 1 356 ? 14.805  -34.102 -92.245  1.00 24.65 ? 356 LEU C CG    1 
ATOM   9364  C CD1   . LEU C 1 356 ? 14.564  -32.633 -92.013  1.00 27.05 ? 356 LEU C CD1   1 
ATOM   9365  C CD2   . LEU C 1 356 ? 15.839  -34.337 -93.278  1.00 24.65 ? 356 LEU C CD2   1 
ATOM   9366  N N     . TRP C 1 357 ? 11.930  -35.102 -91.486  1.00 26.38 ? 357 TRP C N     1 
ATOM   9367  C CA    . TRP C 1 357 ? 10.763  -35.765 -92.021  1.00 24.72 ? 357 TRP C CA    1 
ATOM   9368  C C     . TRP C 1 357 ? 10.414  -35.051 -93.281  1.00 24.40 ? 357 TRP C C     1 
ATOM   9369  O O     . TRP C 1 357 ? 10.159  -33.836 -93.294  1.00 23.97 ? 357 TRP C O     1 
ATOM   9370  C CB    . TRP C 1 357 ? 9.684   -35.659 -90.989  1.00 24.60 ? 357 TRP C CB    1 
ATOM   9371  C CG    . TRP C 1 357 ? 8.278   -35.904 -91.376  1.00 22.08 ? 357 TRP C CG    1 
ATOM   9372  C CD1   . TRP C 1 357 ? 7.342   -34.952 -91.591  1.00 23.96 ? 357 TRP C CD1   1 
ATOM   9373  C CD2   . TRP C 1 357 ? 7.601   -37.156 -91.431  1.00 18.51 ? 357 TRP C CD2   1 
ATOM   9374  N NE1   . TRP C 1 357 ? 6.103   -35.520 -91.767  1.00 23.65 ? 357 TRP C NE1   1 
ATOM   9375  C CE2   . TRP C 1 357 ? 6.231   -36.877 -91.692  1.00 23.20 ? 357 TRP C CE2   1 
ATOM   9376  C CE3   . TRP C 1 357 ? 8.001   -38.486 -91.270  1.00 17.67 ? 357 TRP C CE3   1 
ATOM   9377  C CZ2   . TRP C 1 357 ? 5.255   -37.890 -91.841  1.00 25.04 ? 357 TRP C CZ2   1 
ATOM   9378  C CZ3   . TRP C 1 357 ? 7.029   -39.496 -91.417  1.00 22.31 ? 357 TRP C CZ3   1 
ATOM   9379  C CH2   . TRP C 1 357 ? 5.686   -39.192 -91.708  1.00 24.61 ? 357 TRP C CH2   1 
ATOM   9380  N N     . ILE C 1 358 ? 10.404  -35.848 -94.336  1.00 23.99 ? 358 ILE C N     1 
ATOM   9381  C CA    . ILE C 1 358 ? 10.597  -35.406 -95.685  1.00 23.56 ? 358 ILE C CA    1 
ATOM   9382  C C     . ILE C 1 358 ? 9.408   -35.826 -96.506  1.00 23.77 ? 358 ILE C C     1 
ATOM   9383  O O     . ILE C 1 358 ? 9.022   -36.978 -96.484  1.00 25.13 ? 358 ILE C O     1 
ATOM   9384  C CB    . ILE C 1 358 ? 11.829  -36.110 -96.309  1.00 23.07 ? 358 ILE C CB    1 
ATOM   9385  C CG1   . ILE C 1 358 ? 13.121  -35.781 -95.557  1.00 23.25 ? 358 ILE C CG1   1 
ATOM   9386  C CG2   . ILE C 1 358 ? 12.020  -35.673 -97.720  1.00 22.66 ? 358 ILE C CG2   1 
ATOM   9387  C CD1   . ILE C 1 358 ? 14.310  -36.469 -96.135  1.00 23.42 ? 358 ILE C CD1   1 
ATOM   9388  N N     . LYS C 1 359 ? 8.860   -34.902 -97.270  1.00 22.85 ? 359 LYS C N     1 
ATOM   9389  C CA    . LYS C 1 359 ? 7.766   -35.212 -98.129  1.00 23.26 ? 359 LYS C CA    1 
ATOM   9390  C C     . LYS C 1 359 ? 8.320   -35.231 -99.590  1.00 24.37 ? 359 LYS C C     1 
ATOM   9391  O O     . LYS C 1 359 ? 8.585   -34.174 -100.165 1.00 23.46 ? 359 LYS C O     1 
ATOM   9392  C CB    . LYS C 1 359 ? 6.636   -34.215 -97.908  1.00 21.09 ? 359 LYS C CB    1 
ATOM   9393  C CG    . LYS C 1 359 ? 5.365   -34.449 -98.751  1.00 24.49 ? 359 LYS C CG    1 
ATOM   9394  C CD    . LYS C 1 359 ? 4.609   -33.143 -98.972  1.00 25.35 ? 359 LYS C CD    1 
ATOM   9395  C CE    . LYS C 1 359 ? 3.052   -33.352 -99.034  1.00 30.87 ? 359 LYS C CE    1 
ATOM   9396  N NZ    . LYS C 1 359 ? 2.665   -34.390 -99.989  1.00 34.78 ? 359 LYS C NZ    1 
ATOM   9397  N N     . VAL C 1 360 ? 8.508   -36.449 -100.116 1.00 25.19 ? 360 VAL C N     1 
ATOM   9398  C CA    . VAL C 1 360 ? 8.863   -36.769 -101.513 1.00 26.91 ? 360 VAL C CA    1 
ATOM   9399  C C     . VAL C 1 360 ? 7.748   -36.277 -102.521 1.00 27.83 ? 360 VAL C C     1 
ATOM   9400  O O     . VAL C 1 360 ? 6.588   -36.532 -102.303 1.00 27.07 ? 360 VAL C O     1 
ATOM   9401  C CB    . VAL C 1 360 ? 9.161   -38.321 -101.647 1.00 24.77 ? 360 VAL C CB    1 
ATOM   9402  C CG1   . VAL C 1 360 ? 9.881   -38.682 -103.005 1.00 19.93 ? 360 VAL C CG1   1 
ATOM   9403  C CG2   . VAL C 1 360 ? 10.021  -38.815 -100.447 1.00 26.26 ? 360 VAL C CG2   1 
ATOM   9404  N N     . LYS C 1 361 ? 8.128   -35.553 -103.580 1.00 30.27 ? 361 LYS C N     1 
ATOM   9405  C CA    . LYS C 1 361 ? 7.172   -34.951 -104.584 1.00 31.69 ? 361 LYS C CA    1 
ATOM   9406  C C     . LYS C 1 361 ? 6.825   -35.905 -105.694 1.00 32.58 ? 361 LYS C C     1 
ATOM   9407  O O     . LYS C 1 361 ? 7.715   -36.536 -106.250 1.00 33.28 ? 361 LYS C O     1 
ATOM   9408  C CB    . LYS C 1 361 ? 7.790   -33.740 -105.308 1.00 32.26 ? 361 LYS C CB    1 
ATOM   9409  C CG    . LYS C 1 361 ? 7.915   -32.438 -104.463 1.00 34.38 ? 361 LYS C CG    1 
ATOM   9410  C CD    . LYS C 1 361 ? 8.408   -31.235 -105.341 1.00 32.62 ? 361 LYS C CD    1 
ATOM   9411  C CE    . LYS C 1 361 ? 8.923   -30.063 -104.467 1.00 34.37 ? 361 LYS C CE    1 
ATOM   9412  N NZ    . LYS C 1 361 ? 8.770   -28.638 -105.040 1.00 33.38 ? 361 LYS C NZ    1 
ATOM   9413  N N     . GLY C 1 362 ? 5.544   -35.996 -106.051 1.00 33.51 ? 362 GLY C N     1 
ATOM   9414  C CA    . GLY C 1 362 ? 5.168   -36.725 -107.262 1.00 33.52 ? 362 GLY C CA    1 
ATOM   9415  C C     . GLY C 1 362 ? 5.331   -38.234 -107.192 1.00 34.37 ? 362 GLY C C     1 
ATOM   9416  O O     . GLY C 1 362 ? 5.413   -38.888 -108.221 1.00 35.43 ? 362 GLY C O     1 
ATOM   9417  N N     . ILE C 1 363 ? 5.354   -38.789 -105.984 1.00 35.08 ? 363 ILE C N     1 
ATOM   9418  C CA    . ILE C 1 363 ? 5.299   -40.244 -105.743 1.00 36.66 ? 363 ILE C CA    1 
ATOM   9419  C C     . ILE C 1 363 ? 4.210   -40.520 -104.690 1.00 38.05 ? 363 ILE C C     1 
ATOM   9420  O O     . ILE C 1 363 ? 4.058   -39.765 -103.711 1.00 38.12 ? 363 ILE C O     1 
ATOM   9421  C CB    . ILE C 1 363 ? 6.640   -40.817 -105.262 1.00 36.73 ? 363 ILE C CB    1 
ATOM   9422  C CG1   . ILE C 1 363 ? 7.658   -40.797 -106.410 1.00 36.21 ? 363 ILE C CG1   1 
ATOM   9423  C CG2   . ILE C 1 363 ? 6.463   -42.230 -104.721 1.00 36.58 ? 363 ILE C CG2   1 
ATOM   9424  C CD1   . ILE C 1 363 ? 9.000   -41.115 -105.985 1.00 34.08 ? 363 ILE C CD1   1 
ATOM   9425  N N     . ASN C 1 364 ? 3.424   -41.565 -104.920 1.00 38.81 ? 364 ASN C N     1 
ATOM   9426  C CA    . ASN C 1 364 ? 2.157   -41.678 -104.211 1.00 39.87 ? 364 ASN C CA    1 
ATOM   9427  C C     . ASN C 1 364 ? 2.372   -42.282 -102.846 1.00 40.38 ? 364 ASN C C     1 
ATOM   9428  O O     . ASN C 1 364 ? 1.988   -41.685 -101.832 1.00 39.64 ? 364 ASN C O     1 
ATOM   9429  C CB    . ASN C 1 364 ? 1.122   -42.446 -105.060 1.00 39.54 ? 364 ASN C CB    1 
ATOM   9430  C CG    . ASN C 1 364 ? 0.094   -43.169 -104.226 1.00 40.62 ? 364 ASN C CG    1 
ATOM   9431  O OD1   . ASN C 1 364 ? -0.810  -42.546 -103.619 1.00 36.56 ? 364 ASN C OD1   1 
ATOM   9432  N ND2   . ASN C 1 364 ? 0.213   -44.512 -104.188 1.00 40.27 ? 364 ASN C ND2   1 
ATOM   9433  N N     . ASP C 1 365 ? 3.009   -43.459 -102.845 1.00 41.42 ? 365 ASP C N     1 
ATOM   9434  C CA    . ASP C 1 365 ? 3.392   -44.152 -101.637 1.00 42.44 ? 365 ASP C CA    1 
ATOM   9435  C C     . ASP C 1 365 ? 4.869   -44.491 -101.700 1.00 42.81 ? 365 ASP C C     1 
ATOM   9436  O O     . ASP C 1 365 ? 5.363   -45.014 -102.680 1.00 43.36 ? 365 ASP C O     1 
ATOM   9437  C CB    . ASP C 1 365 ? 2.576   -45.440 -101.425 1.00 42.38 ? 365 ASP C CB    1 
ATOM   9438  C CG    . ASP C 1 365 ? 2.956   -46.147 -100.105 1.00 43.26 ? 365 ASP C CG    1 
ATOM   9439  O OD1   . ASP C 1 365 ? 3.668   -47.176 -100.133 1.00 43.64 ? 365 ASP C OD1   1 
ATOM   9440  O OD2   . ASP C 1 365 ? 2.597   -45.624 -99.032  1.00 43.33 ? 365 ASP C OD2   1 
ATOM   9441  N N     . VAL C 1 366 ? 5.557   -44.222 -100.616 1.00 43.89 ? 366 VAL C N     1 
ATOM   9442  C CA    . VAL C 1 366 ? 7.002   -44.269 -100.602 1.00 44.66 ? 366 VAL C CA    1 
ATOM   9443  C C     . VAL C 1 366 ? 7.614   -45.628 -100.161 1.00 44.95 ? 366 VAL C C     1 
ATOM   9444  O O     . VAL C 1 366 ? 8.842   -45.752 -100.082 1.00 45.29 ? 366 VAL C O     1 
ATOM   9445  C CB    . VAL C 1 366 ? 7.502   -43.080 -99.757  1.00 44.47 ? 366 VAL C CB    1 
ATOM   9446  C CG1   . VAL C 1 366 ? 7.505   -43.415 -98.250  1.00 44.63 ? 366 VAL C CG1   1 
ATOM   9447  C CG2   . VAL C 1 366 ? 8.849   -42.586 -100.253 1.00 46.10 ? 366 VAL C CG2   1 
ATOM   9448  N N     . LYS C 1 367 ? 6.760   -46.608 -99.886  1.00 45.53 ? 367 LYS C N     1 
ATOM   9449  C CA    . LYS C 1 367 ? 7.215   -47.909 -99.409  1.00 45.27 ? 367 LYS C CA    1 
ATOM   9450  C C     . LYS C 1 367 ? 8.114   -48.589 -100.436 1.00 45.57 ? 367 LYS C C     1 
ATOM   9451  O O     . LYS C 1 367 ? 9.272   -48.897 -100.154 1.00 46.00 ? 367 LYS C O     1 
ATOM   9452  C CB    . LYS C 1 367 ? 6.020   -48.806 -99.079  1.00 45.25 ? 367 LYS C CB    1 
ATOM   9453  C CG    . LYS C 1 367 ? 5.760   -48.970 -97.590  1.00 46.07 ? 367 LYS C CG    1 
ATOM   9454  C CD    . LYS C 1 367 ? 4.525   -49.819 -97.336  1.00 45.89 ? 367 LYS C CD    1 
ATOM   9455  C CE    . LYS C 1 367 ? 4.859   -51.302 -97.363  1.00 48.11 ? 367 LYS C CE    1 
ATOM   9456  N NZ    . LYS C 1 367 ? 3.637   -52.148 -97.282  1.00 47.79 ? 367 LYS C NZ    1 
ATOM   9457  N N     . GLU C 1 368 ? 7.573   -48.820 -101.627 1.00 45.77 ? 368 GLU C N     1 
ATOM   9458  C CA    . GLU C 1 368 ? 8.347   -49.394 -102.722 1.00 45.97 ? 368 GLU C CA    1 
ATOM   9459  C C     . GLU C 1 368 ? 9.719   -48.739 -102.829 1.00 45.81 ? 368 GLU C C     1 
ATOM   9460  O O     . GLU C 1 368 ? 10.744  -49.422 -102.852 1.00 45.94 ? 368 GLU C O     1 
ATOM   9461  C CB    . GLU C 1 368 ? 7.591   -49.251 -104.045 1.00 45.87 ? 368 GLU C CB    1 
ATOM   9462  C CG    . GLU C 1 368 ? 6.167   -49.780 -104.006 1.00 49.00 ? 368 GLU C CG    1 
ATOM   9463  C CD    . GLU C 1 368 ? 5.194   -48.792 -103.394 1.00 50.77 ? 368 GLU C CD    1 
ATOM   9464  O OE1   . GLU C 1 368 ? 4.602   -49.113 -102.342 1.00 49.38 ? 368 GLU C OE1   1 
ATOM   9465  O OE2   . GLU C 1 368 ? 5.022   -47.695 -103.964 1.00 48.39 ? 368 GLU C OE2   1 
ATOM   9466  N N     . LEU C 1 369 ? 9.733   -47.412 -102.894 1.00 45.31 ? 369 LEU C N     1 
ATOM   9467  C CA    . LEU C 1 369 ? 10.977  -46.663 -103.025 1.00 44.41 ? 369 LEU C CA    1 
ATOM   9468  C C     . LEU C 1 369 ? 12.006  -47.120 -101.997 1.00 45.11 ? 369 LEU C C     1 
ATOM   9469  O O     . LEU C 1 369 ? 13.180  -47.306 -102.319 1.00 45.39 ? 369 LEU C O     1 
ATOM   9470  C CB    . LEU C 1 369 ? 10.718  -45.163 -102.880 1.00 44.26 ? 369 LEU C CB    1 
ATOM   9471  C CG    . LEU C 1 369 ? 11.954  -44.264 -102.811 1.00 44.59 ? 369 LEU C CG    1 
ATOM   9472  C CD1   . LEU C 1 369 ? 12.584  -44.111 -104.187 1.00 42.15 ? 369 LEU C CD1   1 
ATOM   9473  C CD2   . LEU C 1 369 ? 11.600  -42.906 -102.225 1.00 43.96 ? 369 LEU C CD2   1 
ATOM   9474  N N     . ILE C 1 370 ? 11.559  -47.298 -100.758 1.00 45.02 ? 370 ILE C N     1 
ATOM   9475  C CA    . ILE C 1 370 ? 12.438  -47.746 -99.682  1.00 44.46 ? 370 ILE C CA    1 
ATOM   9476  C C     . ILE C 1 370 ? 12.769  -49.251 -99.634  1.00 45.35 ? 370 ILE C C     1 
ATOM   9477  O O     . ILE C 1 370 ? 13.930  -49.619 -99.465  1.00 45.81 ? 370 ILE C O     1 
ATOM   9478  C CB    . ILE C 1 370 ? 11.937  -47.274 -98.327  1.00 43.66 ? 370 ILE C CB    1 
ATOM   9479  C CG1   . ILE C 1 370 ? 12.069  -45.761 -98.186  1.00 42.71 ? 370 ILE C CG1   1 
ATOM   9480  C CG2   . ILE C 1 370 ? 12.652  -47.998 -97.223  1.00 45.05 ? 370 ILE C CG2   1 
ATOM   9481  C CD1   . ILE C 1 370 ? 13.452  -45.155 -98.426  1.00 39.66 ? 370 ILE C CD1   1 
ATOM   9482  N N     . GLU C 1 371 ? 11.782  -50.119 -99.784  1.00 46.24 ? 371 GLU C N     1 
ATOM   9483  C CA    . GLU C 1 371 ? 12.042  -51.525 -99.554  1.00 46.84 ? 371 GLU C CA    1 
ATOM   9484  C C     . GLU C 1 371 ? 12.234  -52.377 -100.782 1.00 46.43 ? 371 GLU C C     1 
ATOM   9485  O O     . GLU C 1 371 ? 12.567  -53.540 -100.674 1.00 46.03 ? 371 GLU C O     1 
ATOM   9486  C CB    . GLU C 1 371 ? 11.030  -52.163 -98.613  1.00 47.35 ? 371 GLU C CB    1 
ATOM   9487  C CG    . GLU C 1 371 ? 9.835   -51.315 -98.264  1.00 49.50 ? 371 GLU C CG    1 
ATOM   9488  C CD    . GLU C 1 371 ? 8.669   -52.150 -97.792  1.00 52.77 ? 371 GLU C CD    1 
ATOM   9489  O OE1   . GLU C 1 371 ? 8.006   -51.747 -96.815  1.00 53.03 ? 371 GLU C OE1   1 
ATOM   9490  O OE2   . GLU C 1 371 ? 8.426   -53.211 -98.399  1.00 53.80 ? 371 GLU C OE2   1 
ATOM   9491  N N     . GLU C 1 372 ? 12.053  -51.808 -101.956 1.00 46.24 ? 372 GLU C N     1 
ATOM   9492  C CA    . GLU C 1 372 ? 12.406  -52.544 -103.142 1.00 47.31 ? 372 GLU C CA    1 
ATOM   9493  C C     . GLU C 1 372 ? 13.577  -51.978 -103.930 1.00 46.43 ? 372 GLU C C     1 
ATOM   9494  O O     . GLU C 1 372 ? 14.114  -52.625 -104.814 1.00 47.40 ? 372 GLU C O     1 
ATOM   9495  C CB    . GLU C 1 372 ? 11.185  -52.826 -104.006 1.00 46.70 ? 372 GLU C CB    1 
ATOM   9496  C CG    . GLU C 1 372 ? 10.651  -54.236 -103.844 1.00 48.61 ? 372 GLU C CG    1 
ATOM   9497  C CD    . GLU C 1 372 ? 9.150   -54.334 -104.008 1.00 49.47 ? 372 GLU C CD    1 
ATOM   9498  O OE1   . GLU C 1 372 ? 8.707   -54.732 -105.092 1.00 52.34 ? 372 GLU C OE1   1 
ATOM   9499  O OE2   . GLU C 1 372 ? 8.415   -54.010 -103.061 1.00 50.96 ? 372 GLU C OE2   1 
ATOM   9500  N N     . LYS C 1 373 ? 13.990  -50.772 -103.585 1.00 45.64 ? 373 LYS C N     1 
ATOM   9501  C CA    . LYS C 1 373 ? 14.853  -49.993 -104.443 1.00 44.18 ? 373 LYS C CA    1 
ATOM   9502  C C     . LYS C 1 373 ? 15.999  -49.426 -103.628 1.00 43.98 ? 373 LYS C C     1 
ATOM   9503  O O     . LYS C 1 373 ? 17.157  -49.528 -104.004 1.00 43.60 ? 373 LYS C O     1 
ATOM   9504  C CB    . LYS C 1 373 ? 14.060  -48.863 -105.068 1.00 44.64 ? 373 LYS C CB    1 
ATOM   9505  C CG    . LYS C 1 373 ? 13.363  -49.215 -106.337 1.00 45.18 ? 373 LYS C CG    1 
ATOM   9506  C CD    . LYS C 1 373 ? 12.891  -47.979 -107.058 1.00 48.75 ? 373 LYS C CD    1 
ATOM   9507  C CE    . LYS C 1 373 ? 12.575  -48.271 -108.507 1.00 50.63 ? 373 LYS C CE    1 
ATOM   9508  N NZ    . LYS C 1 373 ? 11.140  -48.076 -108.815 1.00 49.58 ? 373 LYS C NZ    1 
ATOM   9509  N N     . ALA C 1 374 ? 15.666  -48.825 -102.499 1.00 43.19 ? 374 ALA C N     1 
ATOM   9510  C CA    . ALA C 1 374 ? 16.665  -48.223 -101.649 1.00 42.80 ? 374 ALA C CA    1 
ATOM   9511  C C     . ALA C 1 374 ? 17.533  -49.254 -100.953 1.00 42.57 ? 374 ALA C C     1 
ATOM   9512  O O     . ALA C 1 374 ? 18.740  -49.213 -101.081 1.00 42.96 ? 374 ALA C O     1 
ATOM   9513  C CB    . ALA C 1 374 ? 16.032  -47.302 -100.660 1.00 42.43 ? 374 ALA C CB    1 
ATOM   9514  N N     . VAL C 1 375 ? 16.922  -50.183 -100.227 1.00 42.45 ? 375 VAL C N     1 
ATOM   9515  C CA    . VAL C 1 375 ? 17.688  -51.328 -99.683  1.00 42.17 ? 375 VAL C CA    1 
ATOM   9516  C C     . VAL C 1 375 ? 18.643  -51.963 -100.692 1.00 41.93 ? 375 VAL C C     1 
ATOM   9517  O O     . VAL C 1 375 ? 19.783  -52.226 -100.335 1.00 42.24 ? 375 VAL C O     1 
ATOM   9518  C CB    . VAL C 1 375 ? 16.821  -52.481 -99.061  1.00 42.72 ? 375 VAL C CB    1 
ATOM   9519  C CG1   . VAL C 1 375 ? 15.987  -51.990 -97.869  1.00 43.19 ? 375 VAL C CG1   1 
ATOM   9520  C CG2   . VAL C 1 375 ? 15.958  -53.234 -100.145 1.00 41.27 ? 375 VAL C CG2   1 
ATOM   9521  N N     . LYS C 1 376 ? 18.198  -52.222 -101.929 1.00 41.54 ? 376 LYS C N     1 
ATOM   9522  C CA    . LYS C 1 376 ? 19.121  -52.755 -102.962 1.00 41.47 ? 376 LYS C CA    1 
ATOM   9523  C C     . LYS C 1 376 ? 20.368  -51.852 -103.163 1.00 40.18 ? 376 LYS C C     1 
ATOM   9524  O O     . LYS C 1 376 ? 21.509  -52.333 -103.154 1.00 40.26 ? 376 LYS C O     1 
ATOM   9525  C CB    . LYS C 1 376 ? 18.407  -53.014 -104.295 1.00 41.67 ? 376 LYS C CB    1 
ATOM   9526  C CG    . LYS C 1 376 ? 17.990  -54.463 -104.559 1.00 43.01 ? 376 LYS C CG    1 
ATOM   9527  C CD    . LYS C 1 376 ? 17.704  -54.745 -106.076 1.00 43.25 ? 376 LYS C CD    1 
ATOM   9528  C CE    . LYS C 1 376 ? 16.850  -53.666 -106.811 1.00 46.58 ? 376 LYS C CE    1 
ATOM   9529  N NZ    . LYS C 1 376 ? 16.350  -54.094 -108.188 1.00 46.44 ? 376 LYS C NZ    1 
ATOM   9530  N N     . MET C 1 377 ? 20.131  -50.548 -103.283 1.00 39.07 ? 377 MET C N     1 
ATOM   9531  C CA    . MET C 1 377 ? 21.189  -49.532 -103.387 1.00 38.58 ? 377 MET C CA    1 
ATOM   9532  C C     . MET C 1 377 ? 22.015  -49.249 -102.111 1.00 37.53 ? 377 MET C C     1 
ATOM   9533  O O     . MET C 1 377 ? 22.944  -48.442 -102.151 1.00 38.32 ? 377 MET C O     1 
ATOM   9534  C CB    . MET C 1 377 ? 20.582  -48.216 -103.896 1.00 39.70 ? 377 MET C CB    1 
ATOM   9535  C CG    . MET C 1 377 ? 20.095  -48.242 -105.369 1.00 40.47 ? 377 MET C CG    1 
ATOM   9536  S SD    . MET C 1 377 ? 21.487  -48.676 -106.436 1.00 47.11 ? 377 MET C SD    1 
ATOM   9537  C CE    . MET C 1 377 ? 22.282  -47.060 -106.705 1.00 43.45 ? 377 MET C CE    1 
ATOM   9538  N N     . GLY C 1 378 ? 21.699  -49.893 -100.991 1.00 35.87 ? 378 GLY C N     1 
ATOM   9539  C CA    . GLY C 1 378 ? 22.540  -49.766 -99.781  1.00 34.13 ? 378 GLY C CA    1 
ATOM   9540  C C     . GLY C 1 378 ? 22.156  -48.670 -98.791  1.00 33.00 ? 378 GLY C C     1 
ATOM   9541  O O     . GLY C 1 378 ? 22.955  -48.336 -97.947  1.00 31.87 ? 378 GLY C O     1 
ATOM   9542  N N     . VAL C 1 379 ? 20.938  -48.105 -98.921  1.00 32.74 ? 379 VAL C N     1 
ATOM   9543  C CA    . VAL C 1 379 ? 20.412  -47.051 -98.053  1.00 32.36 ? 379 VAL C CA    1 
ATOM   9544  C C     . VAL C 1 379 ? 18.940  -47.237 -97.586  1.00 32.57 ? 379 VAL C C     1 
ATOM   9545  O O     . VAL C 1 379 ? 18.078  -47.706 -98.313  1.00 31.76 ? 379 VAL C O     1 
ATOM   9546  C CB    . VAL C 1 379 ? 20.617  -45.624 -98.646  1.00 33.01 ? 379 VAL C CB    1 
ATOM   9547  C CG1   . VAL C 1 379 ? 22.011  -45.495 -99.308  1.00 32.68 ? 379 VAL C CG1   1 
ATOM   9548  C CG2   . VAL C 1 379 ? 19.525  -45.249 -99.633  1.00 32.23 ? 379 VAL C CG2   1 
ATOM   9549  N N     . LEU C 1 380 ? 18.701  -46.875 -96.335  1.00 32.19 ? 380 LEU C N     1 
ATOM   9550  C CA    . LEU C 1 380 ? 17.461  -47.136 -95.639  1.00 31.23 ? 380 LEU C CA    1 
ATOM   9551  C C     . LEU C 1 380 ? 16.963  -45.858 -94.999  1.00 31.74 ? 380 LEU C C     1 
ATOM   9552  O O     . LEU C 1 380 ? 17.767  -45.147 -94.399  1.00 30.79 ? 380 LEU C O     1 
ATOM   9553  C CB    . LEU C 1 380 ? 17.676  -48.149 -94.540  1.00 31.01 ? 380 LEU C CB    1 
ATOM   9554  C CG    . LEU C 1 380 ? 17.402  -49.553 -95.002  1.00 30.59 ? 380 LEU C CG    1 
ATOM   9555  C CD1   . LEU C 1 380 ? 17.259  -50.462 -93.781  1.00 29.63 ? 380 LEU C CD1   1 
ATOM   9556  C CD2   . LEU C 1 380 ? 16.112  -49.445 -95.808  1.00 32.29 ? 380 LEU C CD2   1 
ATOM   9557  N N     . MET C 1 381 ? 15.676  -45.532 -95.226  1.00 31.63 ? 381 MET C N     1 
ATOM   9558  C CA    . MET C 1 381 ? 14.983  -44.578 -94.386  1.00 33.04 ? 381 MET C CA    1 
ATOM   9559  C C     . MET C 1 381 ? 13.659  -45.244 -93.973  1.00 32.53 ? 381 MET C C     1 
ATOM   9560  O O     . MET C 1 381 ? 13.355  -46.369 -94.408  1.00 32.51 ? 381 MET C O     1 
ATOM   9561  C CB    . MET C 1 381 ? 14.744  -43.248 -95.079  1.00 33.11 ? 381 MET C CB    1 
ATOM   9562  C CG    . MET C 1 381 ? 15.881  -42.707 -95.949  1.00 34.88 ? 381 MET C CG    1 
ATOM   9563  S SD    . MET C 1 381 ? 16.074  -40.939 -95.643  1.00 37.34 ? 381 MET C SD    1 
ATOM   9564  C CE    . MET C 1 381 ? 14.745  -40.205 -96.600  1.00 35.12 ? 381 MET C CE    1 
ATOM   9565  N N     . LEU C 1 382 ? 12.883  -44.585 -93.118  1.00 30.58 ? 382 LEU C N     1 
ATOM   9566  C CA    . LEU C 1 382 ? 11.723  -45.262 -92.607  1.00 29.87 ? 382 LEU C CA    1 
ATOM   9567  C C     . LEU C 1 382 ? 10.533  -44.698 -93.302  1.00 29.08 ? 382 LEU C C     1 
ATOM   9568  O O     . LEU C 1 382 ? 10.309  -43.515 -93.218  1.00 28.56 ? 382 LEU C O     1 
ATOM   9569  C CB    . LEU C 1 382 ? 11.624  -45.106 -91.094  1.00 29.29 ? 382 LEU C CB    1 
ATOM   9570  C CG    . LEU C 1 382 ? 10.508  -45.933 -90.477  1.00 29.17 ? 382 LEU C CG    1 
ATOM   9571  C CD1   . LEU C 1 382 ? 10.881  -47.405 -90.556  1.00 23.97 ? 382 LEU C CD1   1 
ATOM   9572  C CD2   . LEU C 1 382 ? 10.283  -45.486 -89.018  1.00 29.38 ? 382 LEU C CD2   1 
ATOM   9573  N N     . PRO C 1 383 ? 9.784   -45.533 -94.032  1.00 29.59 ? 383 PRO C N     1 
ATOM   9574  C CA    . PRO C 1 383 ? 8.571   -44.982 -94.654  1.00 30.15 ? 383 PRO C CA    1 
ATOM   9575  C C     . PRO C 1 383 ? 7.604   -44.501 -93.592  1.00 30.56 ? 383 PRO C C     1 
ATOM   9576  O O     . PRO C 1 383 ? 7.564   -45.055 -92.468  1.00 31.12 ? 383 PRO C O     1 
ATOM   9577  C CB    . PRO C 1 383 ? 7.989   -46.161 -95.461  1.00 29.91 ? 383 PRO C CB    1 
ATOM   9578  C CG    . PRO C 1 383 ? 9.154   -47.098 -95.639  1.00 29.96 ? 383 PRO C CG    1 
ATOM   9579  C CD    . PRO C 1 383 ? 9.965   -46.958 -94.356  1.00 29.38 ? 383 PRO C CD    1 
ATOM   9580  N N     . GLY C 1 384 ? 6.864   -43.450 -93.935  1.00 30.51 ? 384 GLY C N     1 
ATOM   9581  C CA    . GLY C 1 384 ? 5.918   -42.841 -93.002  1.00 30.21 ? 384 GLY C CA    1 
ATOM   9582  C C     . GLY C 1 384 ? 4.634   -43.556 -92.653  1.00 29.33 ? 384 GLY C C     1 
ATOM   9583  O O     . GLY C 1 384 ? 3.920   -43.102 -91.784  1.00 29.50 ? 384 GLY C O     1 
ATOM   9584  N N     . ASN C 1 385 ? 4.316   -44.655 -93.326  1.00 29.92 ? 385 ASN C N     1 
ATOM   9585  C CA    . ASN C 1 385 ? 2.986   -45.305 -93.167  1.00 30.39 ? 385 ASN C CA    1 
ATOM   9586  C C     . ASN C 1 385 ? 2.518   -45.540 -91.704  1.00 29.86 ? 385 ASN C C     1 
ATOM   9587  O O     . ASN C 1 385 ? 1.317   -45.339 -91.382  1.00 29.16 ? 385 ASN C O     1 
ATOM   9588  C CB    . ASN C 1 385 ? 2.953   -46.645 -93.895  1.00 30.03 ? 385 ASN C CB    1 
ATOM   9589  C CG    . ASN C 1 385 ? 3.353   -46.521 -95.355  1.00 35.17 ? 385 ASN C CG    1 
ATOM   9590  O OD1   . ASN C 1 385 ? 4.545   -46.336 -95.686  1.00 35.94 ? 385 ASN C OD1   1 
ATOM   9591  N ND2   . ASN C 1 385 ? 2.350   -46.595 -96.249  1.00 36.54 ? 385 ASN C ND2   1 
ATOM   9592  N N     . ALA C 1 386 ? 3.465   -45.983 -90.857  1.00 28.94 ? 386 ALA C N     1 
ATOM   9593  C CA    . ALA C 1 386 ? 3.201   -46.444 -89.492  1.00 28.18 ? 386 ALA C CA    1 
ATOM   9594  C C     . ALA C 1 386 ? 2.948   -45.310 -88.560  1.00 28.27 ? 386 ALA C C     1 
ATOM   9595  O O     . ALA C 1 386 ? 2.514   -45.529 -87.438  1.00 28.60 ? 386 ALA C O     1 
ATOM   9596  C CB    . ALA C 1 386 ? 4.352   -47.275 -88.973  1.00 28.61 ? 386 ALA C CB    1 
ATOM   9597  N N     . PHE C 1 387 ? 3.184   -44.074 -88.995  1.00 27.99 ? 387 PHE C N     1 
ATOM   9598  C CA    . PHE C 1 387 ? 2.843   -42.959 -88.092  1.00 27.51 ? 387 PHE C CA    1 
ATOM   9599  C C     . PHE C 1 387 ? 1.371   -42.440 -88.217  1.00 27.47 ? 387 PHE C C     1 
ATOM   9600  O O     . PHE C 1 387 ? 1.053   -41.312 -87.879  1.00 26.33 ? 387 PHE C O     1 
ATOM   9601  C CB    . PHE C 1 387 ? 3.926   -41.896 -88.176  1.00 27.32 ? 387 PHE C CB    1 
ATOM   9602  C CG    . PHE C 1 387 ? 5.326   -42.451 -87.956  1.00 25.47 ? 387 PHE C CG    1 
ATOM   9603  C CD1   . PHE C 1 387 ? 6.115   -42.793 -89.014  1.00 27.59 ? 387 PHE C CD1   1 
ATOM   9604  C CD2   . PHE C 1 387 ? 5.839   -42.620 -86.688  1.00 23.88 ? 387 PHE C CD2   1 
ATOM   9605  C CE1   . PHE C 1 387 ? 7.407   -43.295 -88.804  1.00 30.05 ? 387 PHE C CE1   1 
ATOM   9606  C CE2   . PHE C 1 387 ? 7.123   -43.101 -86.474  1.00 25.49 ? 387 PHE C CE2   1 
ATOM   9607  C CZ    . PHE C 1 387 ? 7.899   -43.442 -87.524  1.00 25.56 ? 387 PHE C CZ    1 
ATOM   9608  N N     . TYR C 1 388 ? 0.465   -43.309 -88.645  1.00 28.20 ? 388 TYR C N     1 
ATOM   9609  C CA    . TYR C 1 388 ? -0.969  -42.942 -88.718  1.00 29.60 ? 388 TYR C CA    1 
ATOM   9610  C C     . TYR C 1 388 ? -1.858  -44.109 -88.243  1.00 29.89 ? 388 TYR C C     1 
ATOM   9611  O O     . TYR C 1 388 ? -1.526  -45.281 -88.452  1.00 30.47 ? 388 TYR C O     1 
ATOM   9612  C CB    . TYR C 1 388 ? -1.380  -42.539 -90.176  1.00 29.94 ? 388 TYR C CB    1 
ATOM   9613  C CG    . TYR C 1 388 ? -0.548  -41.433 -90.881  1.00 29.93 ? 388 TYR C CG    1 
ATOM   9614  C CD1   . TYR C 1 388 ? -1.043  -40.131 -91.005  1.00 30.50 ? 388 TYR C CD1   1 
ATOM   9615  C CD2   . TYR C 1 388 ? 0.712   -41.714 -91.448  1.00 29.87 ? 388 TYR C CD2   1 
ATOM   9616  C CE1   . TYR C 1 388 ? -0.305  -39.101 -91.656  1.00 30.13 ? 388 TYR C CE1   1 
ATOM   9617  C CE2   . TYR C 1 388 ? 1.470   -40.702 -92.114  1.00 30.56 ? 388 TYR C CE2   1 
ATOM   9618  C CZ    . TYR C 1 388 ? 0.951   -39.397 -92.202  1.00 31.63 ? 388 TYR C CZ    1 
ATOM   9619  O OH    . TYR C 1 388 ? 1.674   -38.395 -92.835  1.00 32.59 ? 388 TYR C OH    1 
ATOM   9620  N N     . VAL C 1 389 ? -2.989  -43.779 -87.633  1.00 29.85 ? 389 VAL C N     1 
ATOM   9621  C CA    . VAL C 1 389 ? -4.057  -44.729 -87.329  1.00 30.58 ? 389 VAL C CA    1 
ATOM   9622  C C     . VAL C 1 389 ? -4.315  -45.658 -88.502  1.00 32.14 ? 389 VAL C C     1 
ATOM   9623  O O     . VAL C 1 389 ? -4.185  -46.887 -88.395  1.00 31.26 ? 389 VAL C O     1 
ATOM   9624  C CB    . VAL C 1 389 ? -5.302  -43.949 -86.967  1.00 31.68 ? 389 VAL C CB    1 
ATOM   9625  C CG1   . VAL C 1 389 ? -6.267  -44.800 -86.082  1.00 30.10 ? 389 VAL C CG1   1 
ATOM   9626  C CG2   . VAL C 1 389 ? -4.862  -42.598 -86.261  1.00 30.08 ? 389 VAL C CG2   1 
ATOM   9627  N N     . ASP C 1 390 ? -4.575  -45.078 -89.673  1.00 33.55 ? 390 ASP C N     1 
ATOM   9628  C CA    . ASP C 1 390 ? -4.681  -45.912 -90.853  1.00 34.53 ? 390 ASP C CA    1 
ATOM   9629  C C     . ASP C 1 390 ? -3.304  -46.159 -91.565  1.00 35.41 ? 390 ASP C C     1 
ATOM   9630  O O     . ASP C 1 390 ? -2.911  -45.482 -92.505  1.00 34.27 ? 390 ASP C O     1 
ATOM   9631  C CB    . ASP C 1 390 ? -5.793  -45.410 -91.779  1.00 34.66 ? 390 ASP C CB    1 
ATOM   9632  C CG    . ASP C 1 390 ? -5.997  -46.307 -92.966  1.00 35.80 ? 390 ASP C CG    1 
ATOM   9633  O OD1   . ASP C 1 390 ? -6.186  -45.737 -94.075  1.00 38.17 ? 390 ASP C OD1   1 
ATOM   9634  O OD2   . ASP C 1 390 ? -5.934  -47.561 -92.794  1.00 31.21 ? 390 ASP C OD2   1 
ATOM   9635  N N     . SER C 1 391 ? -2.570  -47.156 -91.098  1.00 36.80 ? 391 SER C N     1 
ATOM   9636  C CA    . SER C 1 391 ? -1.221  -47.336 -91.593  1.00 38.12 ? 391 SER C CA    1 
ATOM   9637  C C     . SER C 1 391 ? -1.227  -48.000 -92.980  1.00 39.37 ? 391 SER C C     1 
ATOM   9638  O O     . SER C 1 391 ? -0.157  -48.262 -93.568  1.00 38.99 ? 391 SER C O     1 
ATOM   9639  C CB    . SER C 1 391 ? -0.394  -48.117 -90.596  1.00 37.14 ? 391 SER C CB    1 
ATOM   9640  O OG    . SER C 1 391 ? -0.902  -49.424 -90.498  1.00 38.77 ? 391 SER C OG    1 
ATOM   9641  N N     . SER C 1 392 ? -2.425  -48.266 -93.507  1.00 39.14 ? 392 SER C N     1 
ATOM   9642  C CA    . SER C 1 392 ? -2.511  -49.020 -94.747  1.00 39.69 ? 392 SER C CA    1 
ATOM   9643  C C     . SER C 1 392 ? -2.594  -48.019 -95.896  1.00 38.64 ? 392 SER C C     1 
ATOM   9644  O O     . SER C 1 392 ? -2.292  -48.320 -97.062  1.00 39.21 ? 392 SER C O     1 
ATOM   9645  C CB    . SER C 1 392 ? -3.697  -49.996 -94.698  1.00 40.81 ? 392 SER C CB    1 
ATOM   9646  O OG    . SER C 1 392 ? -4.910  -49.314 -94.339  1.00 43.47 ? 392 SER C OG    1 
ATOM   9647  N N     . ALA C 1 393 ? -2.928  -46.802 -95.511  1.00 37.48 ? 393 ALA C N     1 
ATOM   9648  C CA    . ALA C 1 393 ? -3.070  -45.670 -96.383  1.00 36.78 ? 393 ALA C CA    1 
ATOM   9649  C C     . ALA C 1 393 ? -1.739  -45.324 -97.034  1.00 37.35 ? 393 ALA C C     1 
ATOM   9650  O O     . ALA C 1 393 ? -0.698  -45.453 -96.424  1.00 37.81 ? 393 ALA C O     1 
ATOM   9651  C CB    . ALA C 1 393 ? -3.585  -44.479 -95.571  1.00 35.70 ? 393 ALA C CB    1 
ATOM   9652  N N     . PRO C 1 394 ? -1.768  -44.795 -98.259  1.00 37.24 ? 394 PRO C N     1 
ATOM   9653  C CA    . PRO C 1 394 ? -0.476  -44.535 -98.910  1.00 36.28 ? 394 PRO C CA    1 
ATOM   9654  C C     . PRO C 1 394 ? 0.252   -43.374 -98.205  1.00 35.43 ? 394 PRO C C     1 
ATOM   9655  O O     . PRO C 1 394 ? -0.403  -42.414 -97.825  1.00 35.94 ? 394 PRO C O     1 
ATOM   9656  C CB    . PRO C 1 394 ? -0.891  -44.121 -100.338 1.00 36.94 ? 394 PRO C CB    1 
ATOM   9657  C CG    . PRO C 1 394 ? -2.322  -43.516 -100.161 1.00 36.28 ? 394 PRO C CG    1 
ATOM   9658  C CD    . PRO C 1 394 ? -2.934  -44.340 -99.051  1.00 36.63 ? 394 PRO C CD    1 
ATOM   9659  N N     . SER C 1 395 ? 1.575   -43.450 -98.009  1.00 34.12 ? 395 SER C N     1 
ATOM   9660  C CA    . SER C 1 395 ? 2.298   -42.271 -97.469  1.00 32.89 ? 395 SER C CA    1 
ATOM   9661  C C     . SER C 1 395 ? 3.527   -41.792 -98.269  1.00 32.12 ? 395 SER C C     1 
ATOM   9662  O O     . SER C 1 395 ? 4.491   -42.537 -98.475  1.00 32.24 ? 395 SER C O     1 
ATOM   9663  C CB    . SER C 1 395 ? 2.652   -42.440 -95.986  1.00 32.81 ? 395 SER C CB    1 
ATOM   9664  O OG    . SER C 1 395 ? 3.352   -41.302 -95.508  1.00 30.79 ? 395 SER C OG    1 
ATOM   9665  N N     . PRO C 1 396 ? 3.479   -40.547 -98.727  1.00 31.29 ? 396 PRO C N     1 
ATOM   9666  C CA    . PRO C 1 396 ? 4.570   -39.887 -99.470  1.00 31.43 ? 396 PRO C CA    1 
ATOM   9667  C C     . PRO C 1 396 ? 5.796   -39.578 -98.611  1.00 31.45 ? 396 PRO C C     1 
ATOM   9668  O O     . PRO C 1 396 ? 6.826   -39.146 -99.144  1.00 32.42 ? 396 PRO C O     1 
ATOM   9669  C CB    . PRO C 1 396 ? 3.930   -38.584 -99.944  1.00 30.90 ? 396 PRO C CB    1 
ATOM   9670  C CG    . PRO C 1 396 ? 2.864   -38.308 -98.863  1.00 31.78 ? 396 PRO C CG    1 
ATOM   9671  C CD    . PRO C 1 396 ? 2.303   -39.676 -98.569  1.00 30.96 ? 396 PRO C CD    1 
ATOM   9672  N N     . TYR C 1 397 ? 5.697   -39.821 -97.304  1.00 31.17 ? 397 TYR C N     1 
ATOM   9673  C CA    . TYR C 1 397 ? 6.695   -39.334 -96.332  1.00 30.68 ? 397 TYR C CA    1 
ATOM   9674  C C     . TYR C 1 397 ? 7.748   -40.354 -95.874  1.00 30.63 ? 397 TYR C C     1 
ATOM   9675  O O     . TYR C 1 397 ? 7.450   -41.545 -95.731  1.00 30.22 ? 397 TYR C O     1 
ATOM   9676  C CB    . TYR C 1 397 ? 5.998   -38.856 -95.068  1.00 31.15 ? 397 TYR C CB    1 
ATOM   9677  C CG    . TYR C 1 397 ? 5.300   -37.550 -95.142  1.00 29.51 ? 397 TYR C CG    1 
ATOM   9678  C CD1   . TYR C 1 397 ? 3.935   -37.525 -95.333  1.00 29.89 ? 397 TYR C CD1   1 
ATOM   9679  C CD2   . TYR C 1 397 ? 5.981   -36.334 -94.952  1.00 25.76 ? 397 TYR C CD2   1 
ATOM   9680  C CE1   . TYR C 1 397 ? 3.265   -36.366 -95.392  1.00 27.99 ? 397 TYR C CE1   1 
ATOM   9681  C CE2   . TYR C 1 397 ? 5.287   -35.141 -94.997  1.00 27.17 ? 397 TYR C CE2   1 
ATOM   9682  C CZ    . TYR C 1 397 ? 3.920   -35.191 -95.232  1.00 28.39 ? 397 TYR C CZ    1 
ATOM   9683  O OH    . TYR C 1 397 ? 3.114   -34.091 -95.313  1.00 33.49 ? 397 TYR C OH    1 
ATOM   9684  N N     . LEU C 1 398 ? 8.954   -39.841 -95.592  1.00 30.45 ? 398 LEU C N     1 
ATOM   9685  C CA    . LEU C 1 398 ? 10.104  -40.613 -95.097  1.00 29.83 ? 398 LEU C CA    1 
ATOM   9686  C C     . LEU C 1 398 ? 10.580  -40.006 -93.769  1.00 29.70 ? 398 LEU C C     1 
ATOM   9687  O O     . LEU C 1 398 ? 10.786  -38.776 -93.682  1.00 30.80 ? 398 LEU C O     1 
ATOM   9688  C CB    . LEU C 1 398 ? 11.248  -40.510 -96.097  1.00 30.00 ? 398 LEU C CB    1 
ATOM   9689  C CG    . LEU C 1 398 ? 11.094  -41.162 -97.476  1.00 30.89 ? 398 LEU C CG    1 
ATOM   9690  C CD1   . LEU C 1 398 ? 12.272  -40.898 -98.313  1.00 26.64 ? 398 LEU C CD1   1 
ATOM   9691  C CD2   . LEU C 1 398 ? 10.923  -42.683 -97.311  1.00 35.75 ? 398 LEU C CD2   1 
ATOM   9692  N N     . ARG C 1 399 ? 10.753  -40.823 -92.732  1.00 28.42 ? 399 ARG C N     1 
ATOM   9693  C CA    . ARG C 1 399 ? 11.427  -40.330 -91.520  1.00 27.51 ? 399 ARG C CA    1 
ATOM   9694  C C     . ARG C 1 399 ? 12.912  -40.564 -91.632  1.00 27.47 ? 399 ARG C C     1 
ATOM   9695  O O     . ARG C 1 399 ? 13.392  -41.684 -91.919  1.00 26.54 ? 399 ARG C O     1 
ATOM   9696  C CB    . ARG C 1 399 ? 10.912  -41.035 -90.282  1.00 28.38 ? 399 ARG C CB    1 
ATOM   9697  C CG    . ARG C 1 399 ? 11.291  -40.342 -88.951  1.00 27.92 ? 399 ARG C CG    1 
ATOM   9698  C CD    . ARG C 1 399 ? 10.891  -41.199 -87.760  1.00 26.35 ? 399 ARG C CD    1 
ATOM   9699  N NE    . ARG C 1 399 ? 11.755  -42.358 -87.542  1.00 25.09 ? 399 ARG C NE    1 
ATOM   9700  C CZ    . ARG C 1 399 ? 11.588  -43.249 -86.551  1.00 24.22 ? 399 ARG C CZ    1 
ATOM   9701  N NH1   . ARG C 1 399 ? 10.591  -43.135 -85.655  1.00 18.88 ? 399 ARG C NH1   1 
ATOM   9702  N NH2   . ARG C 1 399 ? 12.457  -44.217 -86.426  1.00 24.04 ? 399 ARG C NH2   1 
ATOM   9703  N N     . ALA C 1 400 ? 13.665  -39.512 -91.414  1.00 27.58 ? 400 ALA C N     1 
ATOM   9704  C CA    . ALA C 1 400 ? 15.097  -39.649 -91.556  1.00 29.30 ? 400 ALA C CA    1 
ATOM   9705  C C     . ALA C 1 400 ? 15.800  -39.485 -90.195  1.00 28.82 ? 400 ALA C C     1 
ATOM   9706  O O     . ALA C 1 400 ? 15.660  -38.471 -89.568  1.00 29.02 ? 400 ALA C O     1 
ATOM   9707  C CB    . ALA C 1 400 ? 15.612  -38.661 -92.622  1.00 28.69 ? 400 ALA C CB    1 
ATOM   9708  N N     . SER C 1 401 ? 16.519  -40.480 -89.711  1.00 29.67 ? 401 SER C N     1 
ATOM   9709  C CA    . SER C 1 401 ? 17.261  -40.270 -88.437  1.00 29.51 ? 401 SER C CA    1 
ATOM   9710  C C     . SER C 1 401 ? 18.624  -39.627 -88.630  1.00 28.10 ? 401 SER C C     1 
ATOM   9711  O O     . SER C 1 401 ? 19.454  -40.150 -89.362  1.00 27.80 ? 401 SER C O     1 
ATOM   9712  C CB    . SER C 1 401 ? 17.452  -41.515 -87.574  1.00 29.79 ? 401 SER C CB    1 
ATOM   9713  O OG    . SER C 1 401 ? 17.835  -41.092 -86.227  1.00 32.84 ? 401 SER C OG    1 
ATOM   9714  N N     . PHE C 1 402 ? 18.817  -38.488 -87.957  1.00 26.74 ? 402 PHE C N     1 
ATOM   9715  C CA    . PHE C 1 402 ? 20.103  -37.855 -87.845  1.00 26.14 ? 402 PHE C CA    1 
ATOM   9716  C C     . PHE C 1 402 ? 20.860  -38.033 -86.540  1.00 26.39 ? 402 PHE C C     1 
ATOM   9717  O O     . PHE C 1 402 ? 21.705  -37.195 -86.227  1.00 27.95 ? 402 PHE C O     1 
ATOM   9718  C CB    . PHE C 1 402 ? 20.041  -36.380 -88.197  1.00 25.00 ? 402 PHE C CB    1 
ATOM   9719  C CG    . PHE C 1 402 ? 19.191  -35.528 -87.293  1.00 25.84 ? 402 PHE C CG    1 
ATOM   9720  C CD1   . PHE C 1 402 ? 19.718  -34.972 -86.123  1.00 24.55 ? 402 PHE C CD1   1 
ATOM   9721  C CD2   . PHE C 1 402 ? 17.907  -35.169 -87.688  1.00 21.25 ? 402 PHE C CD2   1 
ATOM   9722  C CE1   . PHE C 1 402 ? 18.968  -34.150 -85.347  1.00 26.48 ? 402 PHE C CE1   1 
ATOM   9723  C CE2   . PHE C 1 402 ? 17.149  -34.318 -86.948  1.00 24.23 ? 402 PHE C CE2   1 
ATOM   9724  C CZ    . PHE C 1 402 ? 17.634  -33.800 -85.769  1.00 26.17 ? 402 PHE C CZ    1 
ATOM   9725  N N     . SER C 1 403 ? 20.564  -39.096 -85.800  1.00 25.41 ? 403 SER C N     1 
ATOM   9726  C CA    . SER C 1 403 ? 21.135  -39.289 -84.473  1.00 25.39 ? 403 SER C CA    1 
ATOM   9727  C C     . SER C 1 403 ? 22.616  -39.642 -84.556  1.00 24.98 ? 403 SER C C     1 
ATOM   9728  O O     . SER C 1 403 ? 23.389  -39.340 -83.646  1.00 24.48 ? 403 SER C O     1 
ATOM   9729  C CB    . SER C 1 403 ? 20.376  -40.381 -83.716  1.00 23.32 ? 403 SER C CB    1 
ATOM   9730  O OG    . SER C 1 403 ? 21.072  -41.614 -83.766  1.00 21.61 ? 403 SER C OG    1 
ATOM   9731  N N     . SER C 1 404 ? 23.006  -40.284 -85.652  1.00 25.42 ? 404 SER C N     1 
ATOM   9732  C CA    . SER C 1 404 ? 24.094  -41.254 -85.627  1.00 26.56 ? 404 SER C CA    1 
ATOM   9733  C C     . SER C 1 404 ? 25.067  -41.100 -86.791  1.00 27.00 ? 404 SER C C     1 
ATOM   9734  O O     . SER C 1 404 ? 26.278  -41.002 -86.591  1.00 26.60 ? 404 SER C O     1 
ATOM   9735  C CB    . SER C 1 404 ? 23.541  -42.680 -85.654  1.00 25.58 ? 404 SER C CB    1 
ATOM   9736  O OG    . SER C 1 404 ? 23.342  -43.176 -84.342  1.00 31.51 ? 404 SER C OG    1 
ATOM   9737  N N     . ALA C 1 405 ? 24.530  -41.079 -88.006  1.00 26.41 ? 405 ALA C N     1 
ATOM   9738  C CA    . ALA C 1 405 ? 25.349  -41.175 -89.208  1.00 28.66 ? 405 ALA C CA    1 
ATOM   9739  C C     . ALA C 1 405 ? 26.264  -39.966 -89.305  1.00 29.71 ? 405 ALA C C     1 
ATOM   9740  O O     . ALA C 1 405 ? 25.973  -38.911 -88.740  1.00 31.16 ? 405 ALA C O     1 
ATOM   9741  C CB    . ALA C 1 405 ? 24.480  -41.288 -90.451  1.00 27.09 ? 405 ALA C CB    1 
ATOM   9742  N N     . SER C 1 406 ? 27.371  -40.112 -90.024  1.00 31.14 ? 406 SER C N     1 
ATOM   9743  C CA    . SER C 1 406 ? 28.291  -38.965 -90.316  1.00 32.57 ? 406 SER C CA    1 
ATOM   9744  C C     . SER C 1 406 ? 27.866  -38.176 -91.581  1.00 33.64 ? 406 SER C C     1 
ATOM   9745  O O     . SER C 1 406 ? 27.181  -38.718 -92.442  1.00 33.71 ? 406 SER C O     1 
ATOM   9746  C CB    . SER C 1 406 ? 29.728  -39.420 -90.456  1.00 30.92 ? 406 SER C CB    1 
ATOM   9747  O OG    . SER C 1 406 ? 29.810  -40.229 -91.584  1.00 32.05 ? 406 SER C OG    1 
ATOM   9748  N N     . PRO C 1 407 ? 28.263  -36.889 -91.688  1.00 34.85 ? 407 PRO C N     1 
ATOM   9749  C CA    . PRO C 1 407 ? 28.045  -36.179 -92.933  1.00 34.69 ? 407 PRO C CA    1 
ATOM   9750  C C     . PRO C 1 407 ? 28.401  -36.990 -94.162  1.00 35.35 ? 407 PRO C C     1 
ATOM   9751  O O     . PRO C 1 407 ? 27.585  -37.065 -95.070  1.00 37.24 ? 407 PRO C O     1 
ATOM   9752  C CB    . PRO C 1 407 ? 28.972  -34.968 -92.829  1.00 34.46 ? 407 PRO C CB    1 
ATOM   9753  C CG    . PRO C 1 407 ? 29.180  -34.738 -91.397  1.00 35.35 ? 407 PRO C CG    1 
ATOM   9754  C CD    . PRO C 1 407 ? 28.933  -36.046 -90.674  1.00 35.34 ? 407 PRO C CD    1 
ATOM   9755  N N     . GLU C 1 408 ? 29.591  -37.581 -94.245  1.00 35.77 ? 408 GLU C N     1 
ATOM   9756  C CA    . GLU C 1 408 ? 29.893  -38.427 -95.404  1.00 36.37 ? 408 GLU C CA    1 
ATOM   9757  C C     . GLU C 1 408 ? 28.729  -39.390 -95.565  1.00 36.13 ? 408 GLU C C     1 
ATOM   9758  O O     . GLU C 1 408 ? 28.075  -39.395 -96.610  1.00 37.41 ? 408 GLU C O     1 
ATOM   9759  C CB    . GLU C 1 408 ? 31.218  -39.204 -95.299  1.00 37.04 ? 408 GLU C CB    1 
ATOM   9760  C CG    . GLU C 1 408 ? 32.460  -38.383 -94.919  1.00 41.28 ? 408 GLU C CG    1 
ATOM   9761  C CD    . GLU C 1 408 ? 32.332  -37.741 -93.533  1.00 45.13 ? 408 GLU C CD    1 
ATOM   9762  O OE1   . GLU C 1 408 ? 32.076  -38.475 -92.572  1.00 44.27 ? 408 GLU C OE1   1 
ATOM   9763  O OE2   . GLU C 1 408 ? 32.450  -36.503 -93.409  1.00 49.34 ? 408 GLU C OE2   1 
ATOM   9764  N N     . GLN C 1 409 ? 28.401  -40.157 -94.522  1.00 35.07 ? 409 GLN C N     1 
ATOM   9765  C CA    . GLN C 1 409 ? 27.348  -41.184 -94.698  1.00 34.10 ? 409 GLN C CA    1 
ATOM   9766  C C     . GLN C 1 409 ? 25.977  -40.587 -95.124  1.00 33.90 ? 409 GLN C C     1 
ATOM   9767  O O     . GLN C 1 409 ? 25.192  -41.271 -95.795  1.00 34.33 ? 409 GLN C O     1 
ATOM   9768  C CB    . GLN C 1 409 ? 27.161  -42.046 -93.436  1.00 34.39 ? 409 GLN C CB    1 
ATOM   9769  C CG    . GLN C 1 409 ? 28.421  -42.583 -92.770  1.00 33.34 ? 409 GLN C CG    1 
ATOM   9770  C CD    . GLN C 1 409 ? 28.075  -43.482 -91.590  1.00 34.45 ? 409 GLN C CD    1 
ATOM   9771  O OE1   . GLN C 1 409 ? 27.694  -43.000 -90.495  1.00 31.93 ? 409 GLN C OE1   1 
ATOM   9772  N NE2   . GLN C 1 409 ? 28.199  -44.802 -91.802  1.00 31.96 ? 409 GLN C NE2   1 
ATOM   9773  N N     . MET C 1 410 ? 25.704  -39.336 -94.718  1.00 32.91 ? 410 MET C N     1 
ATOM   9774  C CA    . MET C 1 410 ? 24.414  -38.632 -94.971  1.00 31.61 ? 410 MET C CA    1 
ATOM   9775  C C     . MET C 1 410 ? 24.265  -38.137 -96.427  1.00 31.88 ? 410 MET C C     1 
ATOM   9776  O O     . MET C 1 410 ? 23.217  -38.286 -97.037  1.00 30.58 ? 410 MET C O     1 
ATOM   9777  C CB    . MET C 1 410 ? 24.294  -37.466 -94.009  1.00 31.76 ? 410 MET C CB    1 
ATOM   9778  C CG    . MET C 1 410 ? 24.026  -37.851 -92.551  1.00 29.09 ? 410 MET C CG    1 
ATOM   9779  S SD    . MET C 1 410 ? 23.823  -36.316 -91.695  1.00 26.93 ? 410 MET C SD    1 
ATOM   9780  C CE    . MET C 1 410 ? 23.485  -36.905 -90.042  1.00 32.97 ? 410 MET C CE    1 
ATOM   9781  N N     . ASP C 1 411 ? 25.357  -37.559 -96.937  1.00 32.27 ? 411 ASP C N     1 
ATOM   9782  C CA    . ASP C 1 411 ? 25.611  -37.209 -98.358  1.00 32.66 ? 411 ASP C CA    1 
ATOM   9783  C C     . ASP C 1 411 ? 25.366  -38.345 -99.293  1.00 32.77 ? 411 ASP C C     1 
ATOM   9784  O O     . ASP C 1 411 ? 24.739  -38.164 -100.336 1.00 34.31 ? 411 ASP C O     1 
ATOM   9785  C CB    . ASP C 1 411 ? 27.099  -36.809 -98.539  1.00 32.96 ? 411 ASP C CB    1 
ATOM   9786  C CG    . ASP C 1 411 ? 27.384  -36.091 -99.846  1.00 33.18 ? 411 ASP C CG    1 
ATOM   9787  O OD1   . ASP C 1 411 ? 27.974  -36.694 -100.769 1.00 38.30 ? 411 ASP C OD1   1 
ATOM   9788  O OD2   . ASP C 1 411 ? 27.043  -34.906 -99.971  1.00 38.90 ? 411 ASP C OD2   1 
ATOM   9789  N N     . VAL C 1 412 ? 25.926  -39.512 -98.977  1.00 32.53 ? 412 VAL C N     1 
ATOM   9790  C CA    . VAL C 1 412 ? 25.730  -40.688 -99.840  1.00 31.16 ? 412 VAL C CA    1 
ATOM   9791  C C     . VAL C 1 412 ? 24.279  -41.162 -99.832  1.00 29.98 ? 412 VAL C C     1 
ATOM   9792  O O     . VAL C 1 412 ? 23.672  -41.207 -100.878 1.00 31.60 ? 412 VAL C O     1 
ATOM   9793  C CB    . VAL C 1 412 ? 26.728  -41.767 -99.523  1.00 31.00 ? 412 VAL C CB    1 
ATOM   9794  C CG1   . VAL C 1 412 ? 26.616  -42.876 -100.512 1.00 30.64 ? 412 VAL C CG1   1 
ATOM   9795  C CG2   . VAL C 1 412 ? 28.118  -41.169 -99.614  1.00 34.02 ? 412 VAL C CG2   1 
ATOM   9796  N N     . ALA C 1 413 ? 23.737  -41.490 -98.659  1.00 28.46 ? 413 ALA C N     1 
ATOM   9797  C CA    . ALA C 1 413 ? 22.310  -41.693 -98.423  1.00 26.23 ? 413 ALA C CA    1 
ATOM   9798  C C     . ALA C 1 413 ? 21.402  -40.818 -99.281  1.00 25.22 ? 413 ALA C C     1 
ATOM   9799  O O     . ALA C 1 413 ? 20.592  -41.301 -100.027 1.00 24.58 ? 413 ALA C O     1 
ATOM   9800  C CB    . ALA C 1 413 ? 22.010  -41.439 -96.968  1.00 25.93 ? 413 ALA C CB    1 
ATOM   9801  N N     . PHE C 1 414 ? 21.572  -39.521 -99.184  1.00 25.87 ? 414 PHE C N     1 
ATOM   9802  C CA    . PHE C 1 414 ? 20.771  -38.588 -99.914  1.00 26.24 ? 414 PHE C CA    1 
ATOM   9803  C C     . PHE C 1 414 ? 21.043  -38.550 -101.391 1.00 27.06 ? 414 PHE C C     1 
ATOM   9804  O O     . PHE C 1 414 ? 20.079  -38.460 -102.145 1.00 27.31 ? 414 PHE C O     1 
ATOM   9805  C CB    . PHE C 1 414 ? 20.828  -37.218 -99.282  1.00 26.29 ? 414 PHE C CB    1 
ATOM   9806  C CG    . PHE C 1 414 ? 19.864  -37.086 -98.117  1.00 27.75 ? 414 PHE C CG    1 
ATOM   9807  C CD1   . PHE C 1 414 ? 20.296  -37.259 -96.815  1.00 26.52 ? 414 PHE C CD1   1 
ATOM   9808  C CD2   . PHE C 1 414 ? 18.536  -36.846 -98.335  1.00 24.29 ? 414 PHE C CD2   1 
ATOM   9809  C CE1   . PHE C 1 414 ? 19.412  -37.145 -95.744  1.00 25.95 ? 414 PHE C CE1   1 
ATOM   9810  C CE2   . PHE C 1 414 ? 17.631  -36.762 -97.252  1.00 30.09 ? 414 PHE C CE2   1 
ATOM   9811  C CZ    . PHE C 1 414 ? 18.070  -36.895 -95.959  1.00 24.68 ? 414 PHE C CZ    1 
ATOM   9812  N N     . GLN C 1 415 ? 22.316  -38.644 -101.821 1.00 27.29 ? 415 GLN C N     1 
ATOM   9813  C CA    . GLN C 1 415 ? 22.578  -38.685 -103.245 1.00 28.24 ? 415 GLN C CA    1 
ATOM   9814  C C     . GLN C 1 415 ? 21.979  -39.914 -103.853 1.00 29.03 ? 415 GLN C C     1 
ATOM   9815  O O     . GLN C 1 415 ? 21.465  -39.856 -104.971 1.00 29.00 ? 415 GLN C O     1 
ATOM   9816  C CB    . GLN C 1 415 ? 24.045  -38.472 -103.664 1.00 27.30 ? 415 GLN C CB    1 
ATOM   9817  C CG    . GLN C 1 415 ? 24.861  -39.681 -103.812 1.00 31.56 ? 415 GLN C CG    1 
ATOM   9818  C CD    . GLN C 1 415 ? 24.784  -40.306 -105.164 1.00 28.96 ? 415 GLN C CD    1 
ATOM   9819  O OE1   . GLN C 1 415 ? 24.410  -39.682 -106.105 1.00 31.42 ? 415 GLN C OE1   1 
ATOM   9820  N NE2   . GLN C 1 415 ? 25.174  -41.563 -105.257 1.00 32.40 ? 415 GLN C NE2   1 
ATOM   9821  N N     . VAL C 1 416 ? 22.000  -41.020 -103.105 1.00 30.01 ? 416 VAL C N     1 
ATOM   9822  C CA    . VAL C 1 416 ? 21.484  -42.277 -103.657 1.00 30.02 ? 416 VAL C CA    1 
ATOM   9823  C C     . VAL C 1 416 ? 19.960  -42.271 -103.687 1.00 30.14 ? 416 VAL C C     1 
ATOM   9824  O O     . VAL C 1 416 ? 19.341  -42.714 -104.642 1.00 29.99 ? 416 VAL C O     1 
ATOM   9825  C CB    . VAL C 1 416 ? 22.035  -43.499 -102.902 1.00 30.26 ? 416 VAL C CB    1 
ATOM   9826  C CG1   . VAL C 1 416 ? 21.178  -44.691 -103.164 1.00 27.67 ? 416 VAL C CG1   1 
ATOM   9827  C CG2   . VAL C 1 416 ? 23.479  -43.782 -103.319 1.00 27.93 ? 416 VAL C CG2   1 
ATOM   9828  N N     . LEU C 1 417 ? 19.376  -41.715 -102.641 1.00 30.72 ? 417 LEU C N     1 
ATOM   9829  C CA    . LEU C 1 417 ? 17.951  -41.680 -102.463 1.00 30.76 ? 417 LEU C CA    1 
ATOM   9830  C C     . LEU C 1 417 ? 17.303  -40.755 -103.505 1.00 32.18 ? 417 LEU C C     1 
ATOM   9831  O O     . LEU C 1 417 ? 16.164  -40.974 -103.905 1.00 32.49 ? 417 LEU C O     1 
ATOM   9832  C CB    . LEU C 1 417 ? 17.631  -41.196 -101.028 1.00 30.54 ? 417 LEU C CB    1 
ATOM   9833  C CG    . LEU C 1 417 ? 16.188  -41.289 -100.465 1.00 31.07 ? 417 LEU C CG    1 
ATOM   9834  C CD1   . LEU C 1 417 ? 15.371  -40.023 -100.659 1.00 31.88 ? 417 LEU C CD1   1 
ATOM   9835  C CD2   . LEU C 1 417 ? 15.438  -42.458 -101.013 1.00 24.35 ? 417 LEU C CD2   1 
ATOM   9836  N N     . ALA C 1 418 ? 18.008  -39.696 -103.908 1.00 32.51 ? 418 ALA C N     1 
ATOM   9837  C CA    . ALA C 1 418 ? 17.487  -38.759 -104.899 1.00 31.97 ? 418 ALA C CA    1 
ATOM   9838  C C     . ALA C 1 418 ? 17.673  -39.339 -106.293 1.00 32.59 ? 418 ALA C C     1 
ATOM   9839  O O     . ALA C 1 418 ? 16.871  -39.069 -107.224 1.00 33.88 ? 418 ALA C O     1 
ATOM   9840  C CB    . ALA C 1 418 ? 18.182  -37.403 -104.777 1.00 31.32 ? 418 ALA C CB    1 
ATOM   9841  N N     . GLN C 1 419 ? 18.711  -40.136 -106.480 1.00 30.80 ? 419 GLN C N     1 
ATOM   9842  C CA    . GLN C 1 419 ? 18.751  -40.855 -107.719 1.00 31.17 ? 419 GLN C CA    1 
ATOM   9843  C C     . GLN C 1 419 ? 17.589  -41.869 -107.858 1.00 31.11 ? 419 GLN C C     1 
ATOM   9844  O O     . GLN C 1 419 ? 17.188  -42.181 -108.954 1.00 32.81 ? 419 GLN C O     1 
ATOM   9845  C CB    . GLN C 1 419 ? 20.121  -41.471 -107.962 1.00 30.51 ? 419 GLN C CB    1 
ATOM   9846  C CG    . GLN C 1 419 ? 20.157  -42.576 -108.997 1.00 31.58 ? 419 GLN C CG    1 
ATOM   9847  C CD    . GLN C 1 419 ? 20.148  -44.006 -108.404 1.00 36.06 ? 419 GLN C CD    1 
ATOM   9848  O OE1   . GLN C 1 419 ? 20.245  -44.995 -109.161 1.00 37.47 ? 419 GLN C OE1   1 
ATOM   9849  N NE2   . GLN C 1 419 ? 20.017  -44.125 -107.052 1.00 34.42 ? 419 GLN C NE2   1 
ATOM   9850  N N     . LEU C 1 420 ? 17.051  -42.396 -106.775 1.00 31.23 ? 420 LEU C N     1 
ATOM   9851  C CA    . LEU C 1 420 ? 15.977  -43.419 -106.919 1.00 30.64 ? 420 LEU C CA    1 
ATOM   9852  C C     . LEU C 1 420 ? 14.661  -42.734 -107.079 1.00 29.81 ? 420 LEU C C     1 
ATOM   9853  O O     . LEU C 1 420 ? 13.892  -43.139 -107.916 1.00 31.69 ? 420 LEU C O     1 
ATOM   9854  C CB    . LEU C 1 420 ? 15.907  -44.346 -105.721 1.00 29.66 ? 420 LEU C CB    1 
ATOM   9855  C CG    . LEU C 1 420 ? 17.085  -45.258 -105.461 1.00 30.05 ? 420 LEU C CG    1 
ATOM   9856  C CD1   . LEU C 1 420 ? 17.185  -45.611 -104.005 1.00 27.52 ? 420 LEU C CD1   1 
ATOM   9857  C CD2   . LEU C 1 420 ? 16.945  -46.512 -106.319 1.00 31.55 ? 420 LEU C CD2   1 
ATOM   9858  N N     . ILE C 1 421 ? 14.427  -41.693 -106.294 1.00 29.63 ? 421 ILE C N     1 
ATOM   9859  C CA    . ILE C 1 421 ? 13.313  -40.764 -106.453 1.00 30.80 ? 421 ILE C CA    1 
ATOM   9860  C C     . ILE C 1 421 ? 13.200  -40.321 -107.906 1.00 33.77 ? 421 ILE C C     1 
ATOM   9861  O O     . ILE C 1 421 ? 12.144  -40.511 -108.543 1.00 34.35 ? 421 ILE C O     1 
ATOM   9862  C CB    . ILE C 1 421 ? 13.430  -39.517 -105.539 1.00 30.77 ? 421 ILE C CB    1 
ATOM   9863  C CG1   . ILE C 1 421 ? 13.262  -39.898 -104.068 1.00 28.39 ? 421 ILE C CG1   1 
ATOM   9864  C CG2   . ILE C 1 421 ? 12.409  -38.431 -105.938 1.00 29.09 ? 421 ILE C CG2   1 
ATOM   9865  C CD1   . ILE C 1 421 ? 13.296  -38.676 -103.143 1.00 27.84 ? 421 ILE C CD1   1 
ATOM   9866  N N     . LYS C 1 422 ? 14.293  -39.800 -108.460 1.00 35.89 ? 422 LYS C N     1 
ATOM   9867  C CA    . LYS C 1 422 ? 14.258  -39.415 -109.879 1.00 37.62 ? 422 LYS C CA    1 
ATOM   9868  C C     . LYS C 1 422 ? 13.992  -40.594 -110.789 1.00 38.83 ? 422 LYS C C     1 
ATOM   9869  O O     . LYS C 1 422 ? 13.241  -40.485 -111.751 1.00 38.41 ? 422 LYS C O     1 
ATOM   9870  C CB    . LYS C 1 422 ? 15.516  -38.673 -110.313 1.00 37.52 ? 422 LYS C CB    1 
ATOM   9871  C CG    . LYS C 1 422 ? 15.395  -37.172 -110.184 1.00 36.89 ? 422 LYS C CG    1 
ATOM   9872  C CD    . LYS C 1 422 ? 16.649  -36.517 -110.735 1.00 39.62 ? 422 LYS C CD    1 
ATOM   9873  C CE    . LYS C 1 422 ? 17.855  -36.763 -109.871 1.00 37.10 ? 422 LYS C CE    1 
ATOM   9874  N NZ    . LYS C 1 422 ? 18.779  -35.736 -110.302 1.00 43.05 ? 422 LYS C NZ    1 
ATOM   9875  N N     . GLU C 1 423 ? 14.596  -41.739 -110.504 1.00 40.77 ? 423 GLU C N     1 
ATOM   9876  C CA    . GLU C 1 423 ? 14.229  -42.917 -111.309 1.00 42.45 ? 423 GLU C CA    1 
ATOM   9877  C C     . GLU C 1 423 ? 12.746  -43.355 -111.210 1.00 43.32 ? 423 GLU C C     1 
ATOM   9878  O O     . GLU C 1 423 ? 12.225  -43.940 -112.153 1.00 43.67 ? 423 GLU C O     1 
ATOM   9879  C CB    . GLU C 1 423 ? 15.173  -44.062 -111.048 1.00 42.12 ? 423 GLU C CB    1 
ATOM   9880  C CG    . GLU C 1 423 ? 16.370  -43.953 -111.942 1.00 44.25 ? 423 GLU C CG    1 
ATOM   9881  C CD    . GLU C 1 423 ? 17.625  -44.500 -111.330 1.00 44.38 ? 423 GLU C CD    1 
ATOM   9882  O OE1   . GLU C 1 423 ? 17.518  -45.254 -110.332 1.00 42.11 ? 423 GLU C OE1   1 
ATOM   9883  O OE2   . GLU C 1 423 ? 18.710  -44.147 -111.861 1.00 45.11 ? 423 GLU C OE2   1 
ATOM   9884  N N     . SER C 1 424 ? 12.070  -43.051 -110.097 1.00 44.03 ? 424 SER C N     1 
ATOM   9885  C CA    . SER C 1 424 ? 10.672  -43.459 -109.930 1.00 44.92 ? 424 SER C CA    1 
ATOM   9886  C C     . SER C 1 424 ? 9.645   -42.443 -110.456 1.00 45.12 ? 424 SER C C     1 
ATOM   9887  O O     . SER C 1 424 ? 8.497   -42.469 -110.039 1.00 45.45 ? 424 SER C O     1 
ATOM   9888  C CB    . SER C 1 424 ? 10.359  -43.720 -108.446 1.00 45.08 ? 424 SER C CB    1 
ATOM   9889  O OG    . SER C 1 424 ? 11.364  -44.470 -107.794 1.00 47.27 ? 424 SER C OG    1 
ATOM   9890  N N     . LEU C 1 425 ? 10.026  -41.536 -111.337 1.00 46.02 ? 425 LEU C N     1 
ATOM   9891  C CA    . LEU C 1 425 ? 9.038   -40.532 -111.818 1.00 47.01 ? 425 LEU C CA    1 
ATOM   9892  C C     . LEU C 1 425 ? 8.256   -40.890 -113.107 1.00 47.12 ? 425 LEU C C     1 
ATOM   9893  O O     . LEU C 1 425 ? 8.365   -42.009 -113.659 1.00 47.37 ? 425 LEU C O     1 
ATOM   9894  C CB    . LEU C 1 425 ? 9.681   -39.123 -111.916 1.00 47.13 ? 425 LEU C CB    1 
ATOM   9895  C CG    . LEU C 1 425 ? 10.031  -38.406 -110.585 1.00 46.49 ? 425 LEU C CG    1 
ATOM   9896  C CD1   . LEU C 1 425 ? 10.034  -36.889 -110.781 1.00 45.67 ? 425 LEU C CD1   1 
ATOM   9897  C CD2   . LEU C 1 425 ? 9.051   -38.782 -109.469 1.00 43.84 ? 425 LEU C CD2   1 
ATOM   9898  N N     . MET D 1 1   ? -5.041  -75.805 -76.054  1.00 50.62 ? 1   MET D N     1 
ATOM   9899  C CA    . MET D 1 1   ? -4.727  -75.823 -77.511  1.00 50.67 ? 1   MET D CA    1 
ATOM   9900  C C     . MET D 1 1   ? -5.732  -75.067 -78.402  1.00 48.90 ? 1   MET D C     1 
ATOM   9901  O O     . MET D 1 1   ? -5.696  -75.187 -79.633  1.00 48.78 ? 1   MET D O     1 
ATOM   9902  C CB    . MET D 1 1   ? -4.508  -77.257 -78.006  1.00 51.37 ? 1   MET D CB    1 
ATOM   9903  C CG    . MET D 1 1   ? -5.735  -78.118 -78.117  1.00 50.97 ? 1   MET D CG    1 
ATOM   9904  S SD    . MET D 1 1   ? -5.234  -79.756 -78.706  1.00 54.23 ? 1   MET D SD    1 
ATOM   9905  C CE    . MET D 1 1   ? -4.038  -79.345 -80.003  1.00 52.20 ? 1   MET D CE    1 
ATOM   9906  N N     . ASN D 1 2   ? -6.637  -74.328 -77.776  1.00 46.69 ? 2   ASN D N     1 
ATOM   9907  C CA    . ASN D 1 2   ? -7.225  -73.184 -78.422  1.00 44.92 ? 2   ASN D CA    1 
ATOM   9908  C C     . ASN D 1 2   ? -6.870  -71.930 -77.655  1.00 44.48 ? 2   ASN D C     1 
ATOM   9909  O O     . ASN D 1 2   ? -7.528  -71.605 -76.652  1.00 43.99 ? 2   ASN D O     1 
ATOM   9910  C CB    . ASN D 1 2   ? -8.749  -73.283 -78.605  1.00 44.40 ? 2   ASN D CB    1 
ATOM   9911  C CG    . ASN D 1 2   ? -9.325  -72.017 -79.237  1.00 42.26 ? 2   ASN D CG    1 
ATOM   9912  O OD1   . ASN D 1 2   ? -10.403 -71.603 -78.912  1.00 43.23 ? 2   ASN D OD1   1 
ATOM   9913  N ND2   . ASN D 1 2   ? -8.564  -71.381 -80.120  1.00 41.44 ? 2   ASN D ND2   1 
ATOM   9914  N N     . TYR D 1 3   ? -5.865  -71.203 -78.144  1.00 43.28 ? 3   TYR D N     1 
ATOM   9915  C CA    . TYR D 1 3   ? -5.303  -70.116 -77.341  1.00 43.26 ? 3   TYR D CA    1 
ATOM   9916  C C     . TYR D 1 3   ? -6.168  -68.888 -77.342  1.00 42.97 ? 3   TYR D C     1 
ATOM   9917  O O     . TYR D 1 3   ? -6.146  -68.124 -76.388  1.00 43.53 ? 3   TYR D O     1 
ATOM   9918  C CB    . TYR D 1 3   ? -3.843  -69.807 -77.701  1.00 42.61 ? 3   TYR D CB    1 
ATOM   9919  C CG    . TYR D 1 3   ? -2.926  -70.922 -77.299  1.00 42.98 ? 3   TYR D CG    1 
ATOM   9920  C CD1   . TYR D 1 3   ? -2.376  -71.776 -78.247  1.00 42.06 ? 3   TYR D CD1   1 
ATOM   9921  C CD2   . TYR D 1 3   ? -2.637  -71.173 -75.946  1.00 44.35 ? 3   TYR D CD2   1 
ATOM   9922  C CE1   . TYR D 1 3   ? -1.522  -72.836 -77.865  1.00 39.93 ? 3   TYR D CE1   1 
ATOM   9923  C CE2   . TYR D 1 3   ? -1.796  -72.243 -75.556  1.00 41.12 ? 3   TYR D CE2   1 
ATOM   9924  C CZ    . TYR D 1 3   ? -1.244  -73.060 -76.527  1.00 40.92 ? 3   TYR D CZ    1 
ATOM   9925  O OH    . TYR D 1 3   ? -0.417  -74.108 -76.165  1.00 42.16 ? 3   TYR D OH    1 
ATOM   9926  N N     . ALA D 1 4   ? -6.939  -68.717 -78.408  1.00 43.22 ? 4   ALA D N     1 
ATOM   9927  C CA    . ALA D 1 4   ? -8.015  -67.734 -78.466  1.00 43.26 ? 4   ALA D CA    1 
ATOM   9928  C C     . ALA D 1 4   ? -8.728  -67.566 -77.137  1.00 43.68 ? 4   ALA D C     1 
ATOM   9929  O O     . ALA D 1 4   ? -8.871  -66.449 -76.657  1.00 44.44 ? 4   ALA D O     1 
ATOM   9930  C CB    . ALA D 1 4   ? -9.010  -68.119 -79.550  1.00 43.37 ? 4   ALA D CB    1 
ATOM   9931  N N     . ARG D 1 5   ? -9.141  -68.683 -76.535  1.00 44.03 ? 5   ARG D N     1 
ATOM   9932  C CA    . ARG D 1 5   ? -9.907  -68.696 -75.274  1.00 44.03 ? 5   ARG D CA    1 
ATOM   9933  C C     . ARG D 1 5   ? -9.296  -67.890 -74.170  1.00 43.37 ? 5   ARG D C     1 
ATOM   9934  O O     . ARG D 1 5   ? -10.022 -67.293 -73.348  1.00 43.28 ? 5   ARG D O     1 
ATOM   9935  C CB    . ARG D 1 5   ? -10.052 -70.127 -74.739  1.00 44.69 ? 5   ARG D CB    1 
ATOM   9936  C CG    . ARG D 1 5   ? -11.030 -71.028 -75.528  1.00 46.75 ? 5   ARG D CG    1 
ATOM   9937  C CD    . ARG D 1 5   ? -11.181 -72.291 -74.749  1.00 48.59 ? 5   ARG D CD    1 
ATOM   9938  N NE    . ARG D 1 5   ? -11.681 -71.950 -73.425  1.00 49.29 ? 5   ARG D NE    1 
ATOM   9939  C CZ    . ARG D 1 5   ? -11.504 -72.693 -72.346  1.00 48.86 ? 5   ARG D CZ    1 
ATOM   9940  N NH1   . ARG D 1 5   ? -12.012 -72.286 -71.196  1.00 48.80 ? 5   ARG D NH1   1 
ATOM   9941  N NH2   . ARG D 1 5   ? -10.835 -73.837 -72.427  1.00 46.49 ? 5   ARG D NH2   1 
ATOM   9942  N N     . PHE D 1 6   ? -7.962  -67.912 -74.126  1.00 42.13 ? 6   PHE D N     1 
ATOM   9943  C CA    . PHE D 1 6   ? -7.234  -67.391 -72.985  1.00 41.22 ? 6   PHE D CA    1 
ATOM   9944  C C     . PHE D 1 6   ? -6.659  -66.000 -73.259  1.00 40.79 ? 6   PHE D C     1 
ATOM   9945  O O     . PHE D 1 6   ? -5.673  -65.597 -72.637  1.00 41.57 ? 6   PHE D O     1 
ATOM   9946  C CB    . PHE D 1 6   ? -6.136  -68.388 -72.542  1.00 40.77 ? 6   PHE D CB    1 
ATOM   9947  C CG    . PHE D 1 6   ? -6.595  -69.825 -72.482  1.00 39.25 ? 6   PHE D CG    1 
ATOM   9948  C CD1   . PHE D 1 6   ? -6.251  -70.721 -73.491  1.00 36.74 ? 6   PHE D CD1   1 
ATOM   9949  C CD2   . PHE D 1 6   ? -7.379  -70.279 -71.425  1.00 39.10 ? 6   PHE D CD2   1 
ATOM   9950  C CE1   . PHE D 1 6   ? -6.647  -72.055 -73.450  1.00 34.47 ? 6   PHE D CE1   1 
ATOM   9951  C CE2   . PHE D 1 6   ? -7.814  -71.629 -71.376  1.00 37.56 ? 6   PHE D CE2   1 
ATOM   9952  C CZ    . PHE D 1 6   ? -7.447  -72.514 -72.386  1.00 36.19 ? 6   PHE D CZ    1 
ATOM   9953  N N     . ILE D 1 7   ? -7.271  -65.257 -74.176  1.00 39.72 ? 7   ILE D N     1 
ATOM   9954  C CA    . ILE D 1 7   ? -6.670  -64.020 -74.662  1.00 38.54 ? 7   ILE D CA    1 
ATOM   9955  C C     . ILE D 1 7   ? -7.751  -63.019 -74.789  1.00 38.40 ? 7   ILE D C     1 
ATOM   9956  O O     . ILE D 1 7   ? -8.630  -63.193 -75.630  1.00 39.86 ? 7   ILE D O     1 
ATOM   9957  C CB    . ILE D 1 7   ? -5.976  -64.209 -76.072  1.00 38.62 ? 7   ILE D CB    1 
ATOM   9958  C CG1   . ILE D 1 7   ? -4.802  -65.175 -75.994  1.00 36.79 ? 7   ILE D CG1   1 
ATOM   9959  C CG2   . ILE D 1 7   ? -5.475  -62.887 -76.640  1.00 39.18 ? 7   ILE D CG2   1 
ATOM   9960  C CD1   . ILE D 1 7   ? -4.390  -65.707 -77.314  1.00 36.69 ? 7   ILE D CD1   1 
ATOM   9961  N N     . THR D 1 8   ? -7.714  -61.972 -73.963  1.00 37.62 ? 8   THR D N     1 
ATOM   9962  C CA    . THR D 1 8   ? -8.658  -60.867 -74.083  1.00 37.29 ? 8   THR D CA    1 
ATOM   9963  C C     . THR D 1 8   ? -8.650  -60.256 -75.507  1.00 37.59 ? 8   THR D C     1 
ATOM   9964  O O     . THR D 1 8   ? -7.590  -60.218 -76.181  1.00 38.02 ? 8   THR D O     1 
ATOM   9965  C CB    . THR D 1 8   ? -8.404  -59.788 -73.022  1.00 36.93 ? 8   THR D CB    1 
ATOM   9966  O OG1   . THR D 1 8   ? -8.770  -60.306 -71.735  1.00 35.41 ? 8   THR D OG1   1 
ATOM   9967  C CG2   . THR D 1 8   ? -9.257  -58.550 -73.286  1.00 38.97 ? 8   THR D CG2   1 
ATOM   9968  N N     . ALA D 1 9   ? -9.821  -59.796 -75.954  1.00 36.59 ? 9   ALA D N     1 
ATOM   9969  C CA    . ALA D 1 9   ? -9.958  -59.077 -77.233  1.00 36.91 ? 9   ALA D CA    1 
ATOM   9970  C C     . ALA D 1 9   ? -8.921  -57.959 -77.351  1.00 36.09 ? 9   ALA D C     1 
ATOM   9971  O O     . ALA D 1 9   ? -8.198  -57.912 -78.340  1.00 37.01 ? 9   ALA D O     1 
ATOM   9972  C CB    . ALA D 1 9   ? -11.419 -58.489 -77.413  1.00 36.61 ? 9   ALA D CB    1 
ATOM   9973  N N     . ALA D 1 10  ? -8.862  -57.068 -76.364  1.00 34.48 ? 10  ALA D N     1 
ATOM   9974  C CA    . ALA D 1 10  ? -7.797  -56.050 -76.290  1.00 34.73 ? 10  ALA D CA    1 
ATOM   9975  C C     . ALA D 1 10  ? -6.380  -56.633 -76.596  1.00 34.30 ? 10  ALA D C     1 
ATOM   9976  O O     . ALA D 1 10  ? -5.610  -56.093 -77.392  1.00 34.84 ? 10  ALA D O     1 
ATOM   9977  C CB    . ALA D 1 10  ? -7.815  -55.402 -74.893  1.00 34.21 ? 10  ALA D CB    1 
ATOM   9978  N N     . SER D 1 11  ? -6.117  -57.758 -75.984  1.00 32.99 ? 11  SER D N     1 
ATOM   9979  C CA    . SER D 1 11  ? -4.884  -58.447 -76.082  1.00 32.96 ? 11  SER D CA    1 
ATOM   9980  C C     . SER D 1 11  ? -4.607  -59.050 -77.460  1.00 33.38 ? 11  SER D C     1 
ATOM   9981  O O     . SER D 1 11  ? -3.529  -58.983 -77.959  1.00 33.08 ? 11  SER D O     1 
ATOM   9982  C CB    . SER D 1 11  ? -4.834  -59.484 -74.964  1.00 32.88 ? 11  SER D CB    1 
ATOM   9983  O OG    . SER D 1 11  ? -3.626  -60.136 -74.848  1.00 29.17 ? 11  SER D OG    1 
ATOM   9984  N N     . ALA D 1 12  ? -5.608  -59.647 -78.064  1.00 34.25 ? 12  ALA D N     1 
ATOM   9985  C CA    . ALA D 1 12  ? -5.499  -60.133 -79.405  1.00 33.58 ? 12  ALA D CA    1 
ATOM   9986  C C     . ALA D 1 12  ? -5.383  -59.054 -80.436  1.00 33.35 ? 12  ALA D C     1 
ATOM   9987  O O     . ALA D 1 12  ? -4.900  -59.295 -81.516  1.00 32.77 ? 12  ALA D O     1 
ATOM   9988  C CB    . ALA D 1 12  ? -6.627  -60.968 -79.700  1.00 34.65 ? 12  ALA D CB    1 
ATOM   9989  N N     . ALA D 1 13  ? -5.846  -57.872 -80.079  1.00 32.67 ? 13  ALA D N     1 
ATOM   9990  C CA    . ALA D 1 13  ? -5.786  -56.715 -80.901  1.00 32.70 ? 13  ALA D CA    1 
ATOM   9991  C C     . ALA D 1 13  ? -4.442  -56.038 -80.952  1.00 32.88 ? 13  ALA D C     1 
ATOM   9992  O O     . ALA D 1 13  ? -4.274  -55.075 -81.621  1.00 33.02 ? 13  ALA D O     1 
ATOM   9993  C CB    . ALA D 1 13  ? -6.795  -55.787 -80.486  1.00 31.95 ? 13  ALA D CB    1 
ATOM   9994  N N     . ARG D 1 14  ? -3.486  -56.571 -80.238  1.00 30.68 ? 14  ARG D N     1 
ATOM   9995  C CA    . ARG D 1 14  ? -2.203  -55.959 -80.086  1.00 30.85 ? 14  ARG D CA    1 
ATOM   9996  C C     . ARG D 1 14  ? -1.378  -56.244 -81.290  1.00 31.37 ? 14  ARG D C     1 
ATOM   9997  O O     . ARG D 1 14  ? -1.323  -57.335 -81.737  1.00 31.66 ? 14  ARG D O     1 
ATOM   9998  C CB    . ARG D 1 14  ? -1.519  -56.503 -78.839  1.00 30.10 ? 14  ARG D CB    1 
ATOM   9999  C CG    . ARG D 1 14  ? -1.841  -55.748 -77.592  1.00 31.52 ? 14  ARG D CG    1 
ATOM   10000 C CD    . ARG D 1 14  ? -1.217  -56.320 -76.352  1.00 30.35 ? 14  ARG D CD    1 
ATOM   10001 N NE    . ARG D 1 14  ? -1.860  -55.876 -75.122  1.00 21.44 ? 14  ARG D NE    1 
ATOM   10002 C CZ    . ARG D 1 14  ? -1.822  -54.662 -74.624  1.00 18.65 ? 14  ARG D CZ    1 
ATOM   10003 N NH1   . ARG D 1 14  ? -1.161  -53.762 -75.220  1.00 14.36 ? 14  ARG D NH1   1 
ATOM   10004 N NH2   . ARG D 1 14  ? -2.415  -54.358 -73.513  1.00 7.06  ? 14  ARG D NH2   1 
ATOM   10005 N N     . ASN D 1 15  ? -0.727  -55.235 -81.815  1.00 33.81 ? 15  ASN D N     1 
ATOM   10006 C CA    . ASN D 1 15  ? 0.168   -55.399 -82.935  1.00 35.18 ? 15  ASN D CA    1 
ATOM   10007 C C     . ASN D 1 15  ? 1.567   -55.028 -82.548  1.00 36.87 ? 15  ASN D C     1 
ATOM   10008 O O     . ASN D 1 15  ? 1.784   -54.037 -81.880  1.00 36.27 ? 15  ASN D O     1 
ATOM   10009 C CB    . ASN D 1 15  ? -0.267  -54.522 -84.103  1.00 34.88 ? 15  ASN D CB    1 
ATOM   10010 C CG    . ASN D 1 15  ? -1.552  -54.972 -84.720  1.00 30.70 ? 15  ASN D CG    1 
ATOM   10011 O OD1   . ASN D 1 15  ? -1.722  -56.135 -85.043  1.00 27.56 ? 15  ASN D OD1   1 
ATOM   10012 N ND2   . ASN D 1 15  ? -2.464  -54.047 -84.892  1.00 20.73 ? 15  ASN D ND2   1 
ATOM   10013 N N     . PRO D 1 16  ? 2.516   -55.836 -82.986  1.00 40.33 ? 16  PRO D N     1 
ATOM   10014 C CA    . PRO D 1 16  ? 3.935   -55.569 -82.770  1.00 41.83 ? 16  PRO D CA    1 
ATOM   10015 C C     . PRO D 1 16  ? 4.278   -54.103 -82.872  1.00 44.09 ? 16  PRO D C     1 
ATOM   10016 O O     . PRO D 1 16  ? 4.115   -53.515 -83.916  1.00 45.53 ? 16  PRO D O     1 
ATOM   10017 C CB    . PRO D 1 16  ? 4.600   -56.341 -83.900  1.00 41.28 ? 16  PRO D CB    1 
ATOM   10018 C CG    . PRO D 1 16  ? 3.571   -56.514 -84.894  1.00 40.85 ? 16  PRO D CG    1 
ATOM   10019 C CD    . PRO D 1 16  ? 2.294   -56.675 -84.169  1.00 41.16 ? 16  PRO D CD    1 
ATOM   10020 N N     . SER D 1 17  ? 4.773   -53.523 -81.794  1.00 45.92 ? 17  SER D N     1 
ATOM   10021 C CA    . SER D 1 17  ? 5.330   -52.180 -81.859  1.00 49.84 ? 17  SER D CA    1 
ATOM   10022 C C     . SER D 1 17  ? 6.818   -52.200 -81.600  1.00 50.14 ? 17  SER D C     1 
ATOM   10023 O O     . SER D 1 17  ? 7.284   -51.799 -80.543  1.00 48.92 ? 17  SER D O     1 
ATOM   10024 C CB    . SER D 1 17  ? 4.633   -51.238 -80.869  1.00 49.51 ? 17  SER D CB    1 
ATOM   10025 O OG    . SER D 1 17  ? 4.316   -49.996 -81.470  1.00 49.31 ? 17  SER D OG    1 
ATOM   10026 N N     . PRO D 1 18  ? 7.562   -52.673 -82.585  1.00 52.38 ? 18  PRO D N     1 
ATOM   10027 C CA    . PRO D 1 18  ? 8.965   -52.990 -82.375  1.00 54.42 ? 18  PRO D CA    1 
ATOM   10028 C C     . PRO D 1 18  ? 9.806   -51.742 -82.421  1.00 56.84 ? 18  PRO D C     1 
ATOM   10029 O O     . PRO D 1 18  ? 9.377   -50.704 -82.896  1.00 55.26 ? 18  PRO D O     1 
ATOM   10030 C CB    . PRO D 1 18  ? 9.295   -53.896 -83.560  1.00 54.46 ? 18  PRO D CB    1 
ATOM   10031 C CG    . PRO D 1 18  ? 7.983   -54.293 -84.111  1.00 54.34 ? 18  PRO D CG    1 
ATOM   10032 C CD    . PRO D 1 18  ? 7.102   -53.129 -83.904  1.00 52.29 ? 18  PRO D CD    1 
ATOM   10033 N N     . ILE D 1 19  ? 11.019  -51.873 -81.909  1.00 60.69 ? 19  ILE D N     1 
ATOM   10034 C CA    . ILE D 1 19  ? 12.047  -50.849 -82.002  1.00 65.55 ? 19  ILE D CA    1 
ATOM   10035 C C     . ILE D 1 19  ? 12.929  -51.024 -83.235  1.00 67.62 ? 19  ILE D C     1 
ATOM   10036 O O     . ILE D 1 19  ? 13.941  -50.358 -83.376  1.00 69.16 ? 19  ILE D O     1 
ATOM   10037 C CB    . ILE D 1 19  ? 12.943  -50.914 -80.763  1.00 64.93 ? 19  ILE D CB    1 
ATOM   10038 C CG1   . ILE D 1 19  ? 12.339  -50.122 -79.611  1.00 65.11 ? 19  ILE D CG1   1 
ATOM   10039 C CG2   . ILE D 1 19  ? 14.329  -50.435 -81.110  1.00 62.89 ? 19  ILE D CG2   1 
ATOM   10040 C CD1   . ILE D 1 19  ? 13.321  -49.193 -78.965  1.00 62.96 ? 19  ILE D CD1   1 
ATOM   10041 N N     . ARG D 1 20  ? 12.537  -51.934 -84.116  1.00 70.55 ? 20  ARG D N     1 
ATOM   10042 C CA    . ARG D 1 20  ? 13.281  -52.227 -85.342  1.00 72.27 ? 20  ARG D CA    1 
ATOM   10043 C C     . ARG D 1 20  ? 12.695  -51.568 -86.597  1.00 74.07 ? 20  ARG D C     1 
ATOM   10044 O O     . ARG D 1 20  ? 13.255  -50.598 -87.109  1.00 74.87 ? 20  ARG D O     1 
ATOM   10045 C CB    . ARG D 1 20  ? 13.399  -53.738 -85.548  1.00 72.61 ? 20  ARG D CB    1 
ATOM   10046 C CG    . ARG D 1 20  ? 14.232  -54.137 -86.755  1.00 71.75 ? 20  ARG D CG    1 
ATOM   10047 C CD    . ARG D 1 20  ? 14.922  -55.484 -86.616  1.00 72.77 ? 20  ARG D CD    1 
ATOM   10048 N NE    . ARG D 1 20  ? 15.832  -55.518 -85.475  1.00 73.96 ? 20  ARG D NE    1 
ATOM   10049 C CZ    . ARG D 1 20  ? 17.121  -55.214 -85.541  1.00 73.15 ? 20  ARG D CZ    1 
ATOM   10050 N NH1   . ARG D 1 20  ? 17.661  -54.852 -86.697  1.00 71.99 ? 20  ARG D NH1   1 
ATOM   10051 N NH2   . ARG D 1 20  ? 17.875  -55.273 -84.452  1.00 75.17 ? 20  ARG D NH2   1 
ATOM   10052 N N     . ARG D 1 28  ? 18.309  -57.237 -97.538  1.00 70.85 ? 28  ARG D N     1 
ATOM   10053 C CA    . ARG D 1 28  ? 17.768  -57.384 -98.884  1.00 69.39 ? 28  ARG D CA    1 
ATOM   10054 C C     . ARG D 1 28  ? 18.687  -56.750 -99.921  1.00 68.39 ? 28  ARG D C     1 
ATOM   10055 O O     . ARG D 1 28  ? 18.661  -57.118 -101.095 1.00 67.79 ? 28  ARG D O     1 
ATOM   10056 C CB    . ARG D 1 28  ? 16.371  -56.765 -98.970  1.00 68.72 ? 28  ARG D CB    1 
ATOM   10057 C CG    . ARG D 1 28  ? 15.331  -57.457 -98.103  1.00 68.73 ? 28  ARG D CG    1 
ATOM   10058 C CD    . ARG D 1 28  ? 13.913  -56.951 -98.313  1.00 68.58 ? 28  ARG D CD    1 
ATOM   10059 N NE    . ARG D 1 28  ? 13.411  -57.270 -99.647  1.00 69.51 ? 28  ARG D NE    1 
ATOM   10060 C CZ    . ARG D 1 28  ? 12.811  -58.409 -99.965  1.00 70.05 ? 28  ARG D CZ    1 
ATOM   10061 N NH1   . ARG D 1 28  ? 12.634  -59.347 -99.044  1.00 68.87 ? 28  ARG D NH1   1 
ATOM   10062 N NH2   . ARG D 1 28  ? 12.386  -58.608 -101.204 1.00 68.74 ? 28  ARG D NH2   1 
ATOM   10063 N N     . GLY D 1 29  ? 19.498  -55.794 -99.479  1.00 67.63 ? 29  GLY D N     1 
ATOM   10064 C CA    . GLY D 1 29  ? 20.845  -55.645 -99.987  1.00 66.91 ? 29  GLY D CA    1 
ATOM   10065 C C     . GLY D 1 29  ? 21.888  -55.877 -98.921  1.00 65.87 ? 29  GLY D C     1 
ATOM   10066 O O     . GLY D 1 29  ? 21.743  -56.768 -98.098  1.00 66.01 ? 29  GLY D O     1 
ATOM   10067 N N     . PRO D 1 30  ? 22.936  -55.062 -98.933  1.00 65.53 ? 30  PRO D N     1 
ATOM   10068 C CA    . PRO D 1 30  ? 24.315  -55.553 -98.850  1.00 65.22 ? 30  PRO D CA    1 
ATOM   10069 C C     . PRO D 1 30  ? 24.923  -55.318 -97.469  1.00 65.05 ? 30  PRO D C     1 
ATOM   10070 O O     . PRO D 1 30  ? 24.247  -54.772 -96.602  1.00 65.10 ? 30  PRO D O     1 
ATOM   10071 C CB    . PRO D 1 30  ? 25.042  -54.703 -99.889  1.00 65.24 ? 30  PRO D CB    1 
ATOM   10072 C CG    . PRO D 1 30  ? 24.203  -53.511 -100.048 1.00 65.01 ? 30  PRO D CG    1 
ATOM   10073 C CD    . PRO D 1 30  ? 22.803  -53.968 -99.905  1.00 65.17 ? 30  PRO D CD    1 
ATOM   10074 N N     . LYS D 1 31  ? 26.176  -55.723 -97.272  1.00 63.75 ? 31  LYS D N     1 
ATOM   10075 C CA    . LYS D 1 31  ? 26.831  -55.586 -95.969  1.00 62.56 ? 31  LYS D CA    1 
ATOM   10076 C C     . LYS D 1 31  ? 26.947  -54.124 -95.530  1.00 61.14 ? 31  LYS D C     1 
ATOM   10077 O O     . LYS D 1 31  ? 26.471  -53.758 -94.453  1.00 60.63 ? 31  LYS D O     1 
ATOM   10078 C CB    . LYS D 1 31  ? 28.211  -56.264 -95.990  1.00 63.07 ? 31  LYS D CB    1 
ATOM   10079 C CG    . LYS D 1 31  ? 29.104  -55.989 -94.773  1.00 62.23 ? 31  LYS D CG    1 
ATOM   10080 C CD    . LYS D 1 31  ? 28.585  -56.659 -93.505  1.00 63.04 ? 31  LYS D CD    1 
ATOM   10081 C CE    . LYS D 1 31  ? 29.491  -56.387 -92.312  1.00 60.93 ? 31  LYS D CE    1 
ATOM   10082 N NZ    . LYS D 1 31  ? 30.805  -57.085 -92.417  1.00 61.10 ? 31  LYS D NZ    1 
ATOM   10083 N N     . SER D 1 32  ? 27.579  -53.302 -96.366  1.00 59.73 ? 32  SER D N     1 
ATOM   10084 C CA    . SER D 1 32  ? 27.769  -51.884 -96.071  1.00 57.55 ? 32  SER D CA    1 
ATOM   10085 C C     . SER D 1 32  ? 26.457  -51.114 -96.230  1.00 56.82 ? 32  SER D C     1 
ATOM   10086 O O     . SER D 1 32  ? 26.149  -50.589 -97.309  1.00 57.36 ? 32  SER D O     1 
ATOM   10087 C CB    . SER D 1 32  ? 28.868  -51.285 -96.955  1.00 57.09 ? 32  SER D CB    1 
ATOM   10088 O OG    . SER D 1 32  ? 28.550  -51.419 -98.331  1.00 53.61 ? 32  SER D OG    1 
ATOM   10089 N N     . MET D 1 33  ? 25.687  -51.066 -95.143  1.00 54.51 ? 33  MET D N     1 
ATOM   10090 C CA    . MET D 1 33  ? 24.375  -50.426 -95.143  1.00 52.20 ? 33  MET D CA    1 
ATOM   10091 C C     . MET D 1 33  ? 24.395  -49.117 -94.360  1.00 49.36 ? 33  MET D C     1 
ATOM   10092 O O     . MET D 1 33  ? 24.794  -49.086 -93.193  1.00 51.36 ? 33  MET D O     1 
ATOM   10093 C CB    . MET D 1 33  ? 23.321  -51.378 -94.562  1.00 52.18 ? 33  MET D CB    1 
ATOM   10094 C CG    . MET D 1 33  ? 21.879  -50.891 -94.691  1.00 58.71 ? 33  MET D CG    1 
ATOM   10095 S SD    . MET D 1 33  ? 21.196  -51.062 -96.353  1.00 64.44 ? 33  MET D SD    1 
ATOM   10096 C CE    . MET D 1 33  ? 20.840  -52.819 -96.405  1.00 65.42 ? 33  MET D CE    1 
ATOM   10097 N N     . ILE D 1 34  ? 23.970  -48.042 -95.018  1.00 44.98 ? 34  ILE D N     1 
ATOM   10098 C CA    . ILE D 1 34  ? 23.813  -46.742 -94.371  1.00 39.12 ? 34  ILE D CA    1 
ATOM   10099 C C     . ILE D 1 34  ? 22.355  -46.601 -93.934  1.00 37.39 ? 34  ILE D C     1 
ATOM   10100 O O     . ILE D 1 34  ? 21.467  -46.362 -94.760  1.00 36.69 ? 34  ILE D O     1 
ATOM   10101 C CB    . ILE D 1 34  ? 24.230  -45.572 -95.303  1.00 38.54 ? 34  ILE D CB    1 
ATOM   10102 C CG1   . ILE D 1 34  ? 25.642  -45.801 -95.858  1.00 37.23 ? 34  ILE D CG1   1 
ATOM   10103 C CG2   . ILE D 1 34  ? 24.147  -44.234 -94.561  1.00 33.97 ? 34  ILE D CG2   1 
ATOM   10104 C CD1   . ILE D 1 34  ? 25.957  -45.013 -97.120  1.00 39.67 ? 34  ILE D CD1   1 
ATOM   10105 N N     . SER D 1 35  ? 22.050  -46.800 -92.679  1.00 35.37 ? 35  SER D N     1 
ATOM   10106 C CA    . SER D 1 35  ? 20.684  -46.632 -92.259  1.00 31.52 ? 35  SER D CA    1 
ATOM   10107 C C     . SER D 1 35  ? 20.315  -45.370 -91.517  1.00 29.81 ? 35  SER D C     1 
ATOM   10108 O O     . SER D 1 35  ? 20.949  -44.959 -90.616  1.00 28.44 ? 35  SER D O     1 
ATOM   10109 C CB    . SER D 1 35  ? 20.179  -47.852 -91.561  1.00 30.22 ? 35  SER D CB    1 
ATOM   10110 O OG    . SER D 1 35  ? 18.883  -47.641 -91.139  1.00 28.15 ? 35  SER D OG    1 
ATOM   10111 N N     . LEU D 1 36  ? 19.243  -44.776 -91.943  1.00 29.86 ? 36  LEU D N     1 
ATOM   10112 C CA    . LEU D 1 36  ? 18.655  -43.672 -91.264  1.00 30.60 ? 36  LEU D CA    1 
ATOM   10113 C C     . LEU D 1 36  ? 17.193  -43.978 -90.908  1.00 30.11 ? 36  LEU D C     1 
ATOM   10114 O O     . LEU D 1 36  ? 16.444  -43.136 -90.576  1.00 30.95 ? 36  LEU D O     1 
ATOM   10115 C CB    . LEU D 1 36  ? 18.823  -42.406 -92.112  1.00 32.04 ? 36  LEU D CB    1 
ATOM   10116 C CG    . LEU D 1 36  ? 20.182  -42.040 -92.721  1.00 29.21 ? 36  LEU D CG    1 
ATOM   10117 C CD1   . LEU D 1 36  ? 20.032  -41.246 -93.926  1.00 28.18 ? 36  LEU D CD1   1 
ATOM   10118 C CD2   . LEU D 1 36  ? 21.087  -41.356 -91.824  1.00 27.37 ? 36  LEU D CD2   1 
ATOM   10119 N N     . ALA D 1 37  ? 16.814  -45.225 -90.961  1.00 30.58 ? 37  ALA D N     1 
ATOM   10120 C CA    . ALA D 1 37  ? 15.480  -45.603 -90.710  1.00 29.53 ? 37  ALA D CA    1 
ATOM   10121 C C     . ALA D 1 37  ? 15.307  -45.849 -89.260  1.00 29.41 ? 37  ALA D C     1 
ATOM   10122 O O     . ALA D 1 37  ? 14.209  -45.856 -88.806  1.00 30.44 ? 37  ALA D O     1 
ATOM   10123 C CB    . ALA D 1 37  ? 15.157  -46.803 -91.467  1.00 30.81 ? 37  ALA D CB    1 
ATOM   10124 N N     . GLY D 1 38  ? 16.405  -46.033 -88.532  1.00 27.72 ? 38  GLY D N     1 
ATOM   10125 C CA    . GLY D 1 38  ? 16.353  -46.383 -87.102  1.00 25.22 ? 38  GLY D CA    1 
ATOM   10126 C C     . GLY D 1 38  ? 15.860  -45.313 -86.139  1.00 23.97 ? 38  GLY D C     1 
ATOM   10127 O O     . GLY D 1 38  ? 15.750  -44.159 -86.502  1.00 22.75 ? 38  GLY D O     1 
ATOM   10128 N N     . GLY D 1 39  ? 15.591  -45.688 -84.892  1.00 23.83 ? 39  GLY D N     1 
ATOM   10129 C CA    . GLY D 1 39  ? 15.147  -44.715 -83.888  1.00 24.63 ? 39  GLY D CA    1 
ATOM   10130 C C     . GLY D 1 39  ? 15.959  -44.681 -82.609  1.00 25.75 ? 39  GLY D C     1 
ATOM   10131 O O     . GLY D 1 39  ? 15.559  -44.047 -81.609  1.00 26.38 ? 39  GLY D O     1 
ATOM   10132 N N     . LEU D 1 40  ? 17.138  -45.322 -82.637  1.00 25.69 ? 40  LEU D N     1 
ATOM   10133 C CA    . LEU D 1 40  ? 17.958  -45.442 -81.459  1.00 24.46 ? 40  LEU D CA    1 
ATOM   10134 C C     . LEU D 1 40  ? 18.588  -44.095 -81.270  1.00 24.88 ? 40  LEU D C     1 
ATOM   10135 O O     . LEU D 1 40  ? 18.951  -43.483 -82.272  1.00 26.95 ? 40  LEU D O     1 
ATOM   10136 C CB    . LEU D 1 40  ? 19.012  -46.487 -81.732  1.00 25.08 ? 40  LEU D CB    1 
ATOM   10137 C CG    . LEU D 1 40  ? 18.580  -47.939 -81.945  1.00 22.28 ? 40  LEU D CG    1 
ATOM   10138 C CD1   . LEU D 1 40  ? 19.854  -48.841 -82.045  1.00 18.65 ? 40  LEU D CD1   1 
ATOM   10139 C CD2   . LEU D 1 40  ? 17.656  -48.378 -80.852  1.00 18.84 ? 40  LEU D CD2   1 
ATOM   10140 N N     . PRO D 1 41  ? 18.705  -43.580 -80.033  1.00 23.75 ? 41  PRO D N     1 
ATOM   10141 C CA    . PRO D 1 41  ? 19.478  -42.350 -80.059  1.00 23.70 ? 41  PRO D CA    1 
ATOM   10142 C C     . PRO D 1 41  ? 21.019  -42.590 -79.927  1.00 23.70 ? 41  PRO D C     1 
ATOM   10143 O O     . PRO D 1 41  ? 21.489  -43.658 -79.489  1.00 23.63 ? 41  PRO D O     1 
ATOM   10144 C CB    . PRO D 1 41  ? 18.971  -41.635 -78.811  1.00 23.56 ? 41  PRO D CB    1 
ATOM   10145 C CG    . PRO D 1 41  ? 18.791  -42.680 -77.833  1.00 21.58 ? 41  PRO D CG    1 
ATOM   10146 C CD    . PRO D 1 41  ? 18.282  -43.891 -78.653  1.00 24.12 ? 41  PRO D CD    1 
ATOM   10147 N N     . ASN D 1 42  ? 21.797  -41.576 -80.247  1.00 22.49 ? 42  ASN D N     1 
ATOM   10148 C CA    . ASN D 1 42  ? 23.258  -41.713 -80.152  1.00 23.40 ? 42  ASN D CA    1 
ATOM   10149 C C     . ASN D 1 42  ? 23.795  -42.157 -78.750  1.00 22.06 ? 42  ASN D C     1 
ATOM   10150 O O     . ASN D 1 42  ? 23.756  -41.372 -77.774  1.00 19.59 ? 42  ASN D O     1 
ATOM   10151 C CB    . ASN D 1 42  ? 23.948  -40.430 -80.636  1.00 21.96 ? 42  ASN D CB    1 
ATOM   10152 C CG    . ASN D 1 42  ? 25.353  -40.687 -81.069  1.00 25.61 ? 42  ASN D CG    1 
ATOM   10153 O OD1   . ASN D 1 42  ? 25.742  -40.394 -82.248  1.00 26.70 ? 42  ASN D OD1   1 
ATOM   10154 N ND2   . ASN D 1 42  ? 26.158  -41.276 -80.142  1.00 23.94 ? 42  ASN D ND2   1 
ATOM   10155 N N     . PRO D 1 43  ? 24.367  -43.371 -78.666  1.00 23.18 ? 43  PRO D N     1 
ATOM   10156 C CA    . PRO D 1 43  ? 24.770  -43.873 -77.316  1.00 23.79 ? 43  PRO D CA    1 
ATOM   10157 C C     . PRO D 1 43  ? 26.008  -43.134 -76.776  1.00 24.49 ? 43  PRO D C     1 
ATOM   10158 O O     . PRO D 1 43  ? 26.247  -43.171 -75.578  1.00 25.76 ? 43  PRO D O     1 
ATOM   10159 C CB    . PRO D 1 43  ? 25.069  -45.354 -77.542  1.00 22.06 ? 43  PRO D CB    1 
ATOM   10160 C CG    . PRO D 1 43  ? 25.599  -45.423 -78.882  1.00 22.50 ? 43  PRO D CG    1 
ATOM   10161 C CD    . PRO D 1 43  ? 24.835  -44.298 -79.723  1.00 23.98 ? 43  PRO D CD    1 
ATOM   10162 N N     . ASN D 1 44  ? 26.712  -42.379 -77.622  1.00 25.14 ? 44  ASN D N     1 
ATOM   10163 C CA    . ASN D 1 44  ? 27.944  -41.669 -77.188  1.00 26.06 ? 44  ASN D CA    1 
ATOM   10164 C C     . ASN D 1 44  ? 27.665  -40.486 -76.333  1.00 25.79 ? 44  ASN D C     1 
ATOM   10165 O O     . ASN D 1 44  ? 28.591  -39.801 -75.920  1.00 24.82 ? 44  ASN D O     1 
ATOM   10166 C CB    . ASN D 1 44  ? 28.772  -41.191 -78.380  1.00 25.41 ? 44  ASN D CB    1 
ATOM   10167 C CG    . ASN D 1 44  ? 29.308  -42.309 -79.139  1.00 29.76 ? 44  ASN D CG    1 
ATOM   10168 O OD1   . ASN D 1 44  ? 30.215  -42.970 -78.662  1.00 33.66 ? 44  ASN D OD1   1 
ATOM   10169 N ND2   . ASN D 1 44  ? 28.701  -42.615 -80.302  1.00 33.24 ? 44  ASN D ND2   1 
ATOM   10170 N N     . MET D 1 45  ? 26.383  -40.207 -76.119  1.00 26.03 ? 45  MET D N     1 
ATOM   10171 C CA    . MET D 1 45  ? 26.000  -39.037 -75.311  1.00 26.76 ? 45  MET D CA    1 
ATOM   10172 C C     . MET D 1 45  ? 25.805  -39.326 -73.832  1.00 24.62 ? 45  MET D C     1 
ATOM   10173 O O     . MET D 1 45  ? 25.719  -38.421 -73.024  1.00 24.37 ? 45  MET D O     1 
ATOM   10174 C CB    . MET D 1 45  ? 24.761  -38.361 -75.895  1.00 26.79 ? 45  MET D CB    1 
ATOM   10175 C CG    . MET D 1 45  ? 24.975  -37.820 -77.275  1.00 35.48 ? 45  MET D CG    1 
ATOM   10176 S SD    . MET D 1 45  ? 25.663  -36.155 -77.442  1.00 47.04 ? 45  MET D SD    1 
ATOM   10177 C CE    . MET D 1 45  ? 27.428  -36.413 -77.185  1.00 45.12 ? 45  MET D CE    1 
ATOM   10178 N N     . PHE D 1 46  ? 25.686  -40.598 -73.491  1.00 24.21 ? 46  PHE D N     1 
ATOM   10179 C CA    . PHE D 1 46  ? 25.519  -41.012 -72.140  1.00 22.49 ? 46  PHE D CA    1 
ATOM   10180 C C     . PHE D 1 46  ? 26.830  -40.881 -71.360  1.00 23.40 ? 46  PHE D C     1 
ATOM   10181 O O     . PHE D 1 46  ? 27.962  -41.066 -71.906  1.00 21.61 ? 46  PHE D O     1 
ATOM   10182 C CB    . PHE D 1 46  ? 25.001  -42.434 -72.124  1.00 23.19 ? 46  PHE D CB    1 
ATOM   10183 C CG    . PHE D 1 46  ? 23.751  -42.640 -72.960  1.00 22.53 ? 46  PHE D CG    1 
ATOM   10184 C CD1   . PHE D 1 46  ? 23.520  -43.888 -73.577  1.00 20.64 ? 46  PHE D CD1   1 
ATOM   10185 C CD2   . PHE D 1 46  ? 22.835  -41.585 -73.179  1.00 19.87 ? 46  PHE D CD2   1 
ATOM   10186 C CE1   . PHE D 1 46  ? 22.394  -44.104 -74.363  1.00 17.80 ? 46  PHE D CE1   1 
ATOM   10187 C CE2   . PHE D 1 46  ? 21.669  -41.790 -73.977  1.00 20.83 ? 46  PHE D CE2   1 
ATOM   10188 C CZ    . PHE D 1 46  ? 21.458  -43.043 -74.570  1.00 19.21 ? 46  PHE D CZ    1 
ATOM   10189 N N     . PRO D 1 47  ? 26.691  -40.501 -70.077  1.00 23.19 ? 47  PRO D N     1 
ATOM   10190 C CA    . PRO D 1 47  ? 27.832  -40.098 -69.296  1.00 22.60 ? 47  PRO D CA    1 
ATOM   10191 C C     . PRO D 1 47  ? 28.610  -41.254 -68.715  1.00 23.26 ? 47  PRO D C     1 
ATOM   10192 O O     . PRO D 1 47  ? 29.793  -41.083 -68.356  1.00 23.35 ? 47  PRO D O     1 
ATOM   10193 C CB    . PRO D 1 47  ? 27.216  -39.226 -68.206  1.00 22.90 ? 47  PRO D CB    1 
ATOM   10194 C CG    . PRO D 1 47  ? 25.684  -39.043 -68.647  1.00 24.57 ? 47  PRO D CG    1 
ATOM   10195 C CD    . PRO D 1 47  ? 25.427  -40.334 -69.344  1.00 23.48 ? 47  PRO D CD    1 
ATOM   10196 N N     . PHE D 1 48  ? 27.974  -42.429 -68.605  1.00 22.80 ? 48  PHE D N     1 
ATOM   10197 C CA    . PHE D 1 48  ? 28.652  -43.558 -67.981  1.00 21.05 ? 48  PHE D CA    1 
ATOM   10198 C C     . PHE D 1 48  ? 29.430  -44.274 -69.048  1.00 21.39 ? 48  PHE D C     1 
ATOM   10199 O O     . PHE D 1 48  ? 28.907  -44.497 -70.153  1.00 22.40 ? 48  PHE D O     1 
ATOM   10200 C CB    . PHE D 1 48  ? 27.707  -44.520 -67.300  1.00 20.76 ? 48  PHE D CB    1 
ATOM   10201 C CG    . PHE D 1 48  ? 26.556  -43.884 -66.598  1.00 19.11 ? 48  PHE D CG    1 
ATOM   10202 C CD1   . PHE D 1 48  ? 25.358  -43.626 -67.291  1.00 21.08 ? 48  PHE D CD1   1 
ATOM   10203 C CD2   . PHE D 1 48  ? 26.629  -43.590 -65.257  1.00 17.19 ? 48  PHE D CD2   1 
ATOM   10204 C CE1   . PHE D 1 48  ? 24.254  -43.090 -66.657  1.00 12.19 ? 48  PHE D CE1   1 
ATOM   10205 C CE2   . PHE D 1 48  ? 25.559  -43.058 -64.613  1.00 19.69 ? 48  PHE D CE2   1 
ATOM   10206 C CZ    . PHE D 1 48  ? 24.360  -42.793 -65.312  1.00 19.91 ? 48  PHE D CZ    1 
ATOM   10207 N N     . LYS D 1 49  ? 30.686  -44.618 -68.710  1.00 21.41 ? 49  LYS D N     1 
ATOM   10208 C CA    . LYS D 1 49  ? 31.696  -45.019 -69.671  1.00 20.97 ? 49  LYS D CA    1 
ATOM   10209 C C     . LYS D 1 49  ? 32.198  -46.466 -69.486  1.00 20.14 ? 49  LYS D C     1 
ATOM   10210 O O     . LYS D 1 49  ? 32.405  -47.181 -70.481  1.00 19.20 ? 49  LYS D O     1 
ATOM   10211 C CB    . LYS D 1 49  ? 32.867  -44.017 -69.647  1.00 21.05 ? 49  LYS D CB    1 
ATOM   10212 C CG    . LYS D 1 49  ? 32.522  -42.635 -70.169  1.00 22.00 ? 49  LYS D CG    1 
ATOM   10213 C CD    . LYS D 1 49  ? 31.684  -42.668 -71.509  1.00 24.20 ? 49  LYS D CD    1 
ATOM   10214 C CE    . LYS D 1 49  ? 31.185  -41.276 -71.890  1.00 19.99 ? 49  LYS D CE    1 
ATOM   10215 N NZ    . LYS D 1 49  ? 30.439  -41.203 -73.229  1.00 23.13 ? 49  LYS D NZ    1 
ATOM   10216 N N     . THR D 1 50  ? 32.447  -46.868 -68.229  1.00 19.93 ? 50  THR D N     1 
ATOM   10217 C CA    . THR D 1 50  ? 32.953  -48.209 -67.931  1.00 19.69 ? 50  THR D CA    1 
ATOM   10218 C C     . THR D 1 50  ? 32.405  -48.638 -66.596  1.00 20.84 ? 50  THR D C     1 
ATOM   10219 O O     . THR D 1 50  ? 32.163  -47.802 -65.707  1.00 21.63 ? 50  THR D O     1 
ATOM   10220 C CB    . THR D 1 50  ? 34.495  -48.327 -67.932  1.00 20.37 ? 50  THR D CB    1 
ATOM   10221 O OG1   . THR D 1 50  ? 35.076  -47.543 -66.871  1.00 22.83 ? 50  THR D OG1   1 
ATOM   10222 C CG2   . THR D 1 50  ? 35.135  -47.939 -69.313  1.00 17.34 ? 50  THR D CG2   1 
ATOM   10223 N N     . ALA D 1 51  ? 32.137  -49.933 -66.455  1.00 21.41 ? 51  ALA D N     1 
ATOM   10224 C CA    . ALA D 1 51  ? 31.770  -50.430 -65.167  1.00 22.56 ? 51  ALA D CA    1 
ATOM   10225 C C     . ALA D 1 51  ? 32.684  -51.556 -64.729  1.00 23.21 ? 51  ALA D C     1 
ATOM   10226 O O     . ALA D 1 51  ? 33.203  -52.296 -65.549  1.00 24.29 ? 51  ALA D O     1 
ATOM   10227 C CB    . ALA D 1 51  ? 30.291  -50.825 -65.126  1.00 21.98 ? 51  ALA D CB    1 
ATOM   10228 N N     . VAL D 1 52  ? 32.884  -51.672 -63.427  1.00 23.51 ? 52  VAL D N     1 
ATOM   10229 C CA    . VAL D 1 52  ? 33.617  -52.769 -62.868  1.00 25.18 ? 52  VAL D CA    1 
ATOM   10230 C C     . VAL D 1 52  ? 32.755  -53.248 -61.734  1.00 24.90 ? 52  VAL D C     1 
ATOM   10231 O O     . VAL D 1 52  ? 32.405  -52.476 -60.863  1.00 26.01 ? 52  VAL D O     1 
ATOM   10232 C CB    . VAL D 1 52  ? 35.034  -52.307 -62.323  1.00 25.53 ? 52  VAL D CB    1 
ATOM   10233 C CG1   . VAL D 1 52  ? 35.680  -53.386 -61.421  1.00 27.11 ? 52  VAL D CG1   1 
ATOM   10234 C CG2   . VAL D 1 52  ? 35.989  -51.926 -63.495  1.00 25.57 ? 52  VAL D CG2   1 
ATOM   10235 N N     . ILE D 1 53  ? 32.433  -54.529 -61.715  1.00 25.53 ? 53  ILE D N     1 
ATOM   10236 C CA    . ILE D 1 53  ? 31.513  -55.082 -60.693  1.00 25.34 ? 53  ILE D CA    1 
ATOM   10237 C C     . ILE D 1 53  ? 32.125  -56.349 -60.204  1.00 25.31 ? 53  ILE D C     1 
ATOM   10238 O O     . ILE D 1 53  ? 32.482  -57.203 -61.006  1.00 24.89 ? 53  ILE D O     1 
ATOM   10239 C CB    . ILE D 1 53  ? 30.009  -55.282 -61.253  1.00 25.49 ? 53  ILE D CB    1 
ATOM   10240 C CG1   . ILE D 1 53  ? 29.359  -53.953 -61.463  1.00 19.75 ? 53  ILE D CG1   1 
ATOM   10241 C CG2   . ILE D 1 53  ? 29.068  -56.002 -60.236  1.00 24.89 ? 53  ILE D CG2   1 
ATOM   10242 C CD1   . ILE D 1 53  ? 29.700  -53.336 -62.689  1.00 29.42 ? 53  ILE D CD1   1 
ATOM   10243 N N     . THR D 1 54  ? 32.319  -56.432 -58.888  1.00 26.68 ? 54  THR D N     1 
ATOM   10244 C CA    . THR D 1 54  ? 33.018  -57.566 -58.309  1.00 26.98 ? 54  THR D CA    1 
ATOM   10245 C C     . THR D 1 54  ? 31.982  -58.559 -57.882  1.00 27.63 ? 54  THR D C     1 
ATOM   10246 O O     . THR D 1 54  ? 30.930  -58.198 -57.346  1.00 26.72 ? 54  THR D O     1 
ATOM   10247 C CB    . THR D 1 54  ? 33.886  -57.215 -57.087  1.00 27.76 ? 54  THR D CB    1 
ATOM   10248 O OG1   . THR D 1 54  ? 33.092  -56.522 -56.106  1.00 29.94 ? 54  THR D OG1   1 
ATOM   10249 C CG2   . THR D 1 54  ? 35.222  -56.414 -57.480  1.00 26.17 ? 54  THR D CG2   1 
ATOM   10250 N N     . VAL D 1 55  ? 32.311  -59.819 -58.130  1.00 28.45 ? 55  VAL D N     1 
ATOM   10251 C CA    . VAL D 1 55  ? 31.485  -60.951 -57.840  1.00 28.97 ? 55  VAL D CA    1 
ATOM   10252 C C     . VAL D 1 55  ? 32.208  -61.732 -56.766  1.00 30.50 ? 55  VAL D C     1 
ATOM   10253 O O     . VAL D 1 55  ? 33.454  -61.907 -56.858  1.00 31.22 ? 55  VAL D O     1 
ATOM   10254 C CB    . VAL D 1 55  ? 31.412  -61.834 -59.057  1.00 28.45 ? 55  VAL D CB    1 
ATOM   10255 C CG1   . VAL D 1 55  ? 30.599  -63.105 -58.762  1.00 29.61 ? 55  VAL D CG1   1 
ATOM   10256 C CG2   . VAL D 1 55  ? 30.793  -61.075 -60.188  1.00 29.87 ? 55  VAL D CG2   1 
ATOM   10257 N N     . GLU D 1 56  ? 31.461  -62.166 -55.744  1.00 30.50 ? 56  GLU D N     1 
ATOM   10258 C CA    . GLU D 1 56  ? 31.985  -63.049 -54.737  1.00 32.70 ? 56  GLU D CA    1 
ATOM   10259 C C     . GLU D 1 56  ? 31.987  -64.453 -55.332  1.00 34.23 ? 56  GLU D C     1 
ATOM   10260 O O     . GLU D 1 56  ? 30.968  -64.914 -55.912  1.00 32.82 ? 56  GLU D O     1 
ATOM   10261 C CB    . GLU D 1 56  ? 31.135  -62.991 -53.451  1.00 32.05 ? 56  GLU D CB    1 
ATOM   10262 C CG    . GLU D 1 56  ? 31.367  -64.101 -52.424  1.00 31.98 ? 56  GLU D CG    1 
ATOM   10263 C CD    . GLU D 1 56  ? 30.539  -63.946 -51.137  1.00 36.39 ? 56  GLU D CD    1 
ATOM   10264 O OE1   . GLU D 1 56  ? 30.587  -62.847 -50.494  1.00 41.21 ? 56  GLU D OE1   1 
ATOM   10265 O OE2   . GLU D 1 56  ? 29.843  -64.936 -50.750  1.00 39.39 ? 56  GLU D OE2   1 
ATOM   10266 N N     . ASN D 1 57  ? 33.109  -65.155 -55.154  1.00 36.10 ? 57  ASN D N     1 
ATOM   10267 C CA    . ASN D 1 57  ? 33.219  -66.517 -55.688  1.00 39.20 ? 57  ASN D CA    1 
ATOM   10268 C C     . ASN D 1 57  ? 33.147  -66.464 -57.216  1.00 39.45 ? 57  ASN D C     1 
ATOM   10269 O O     . ASN D 1 57  ? 32.328  -67.172 -57.830  1.00 39.50 ? 57  ASN D O     1 
ATOM   10270 C CB    . ASN D 1 57  ? 32.049  -67.426 -55.180  1.00 39.64 ? 57  ASN D CB    1 
ATOM   10271 C CG    . ASN D 1 57  ? 32.060  -67.664 -53.646  1.00 41.44 ? 57  ASN D CG    1 
ATOM   10272 O OD1   . ASN D 1 57  ? 33.117  -67.656 -52.978  1.00 45.58 ? 57  ASN D OD1   1 
ATOM   10273 N ND2   . ASN D 1 57  ? 30.871  -67.900 -53.093  1.00 41.65 ? 57  ASN D ND2   1 
ATOM   10274 N N     . GLY D 1 58  ? 33.951  -65.609 -57.844  1.00 39.91 ? 58  GLY D N     1 
ATOM   10275 C CA    . GLY D 1 58  ? 33.680  -65.360 -59.269  1.00 40.22 ? 58  GLY D CA    1 
ATOM   10276 C C     . GLY D 1 58  ? 34.516  -64.296 -59.942  1.00 40.24 ? 58  GLY D C     1 
ATOM   10277 O O     . GLY D 1 58  ? 35.108  -63.451 -59.266  1.00 40.54 ? 58  GLY D O     1 
ATOM   10278 N N     . LYS D 1 59  ? 34.545  -64.341 -61.280  1.00 39.81 ? 59  LYS D N     1 
ATOM   10279 C CA    . LYS D 1 59  ? 35.325  -63.406 -62.090  1.00 38.40 ? 59  LYS D CA    1 
ATOM   10280 C C     . LYS D 1 59  ? 34.701  -62.013 -62.022  1.00 36.94 ? 59  LYS D C     1 
ATOM   10281 O O     . LYS D 1 59  ? 33.494  -61.891 -61.828  1.00 36.90 ? 59  LYS D O     1 
ATOM   10282 C CB    . LYS D 1 59  ? 35.419  -63.924 -63.530  1.00 39.43 ? 59  LYS D CB    1 
ATOM   10283 C CG    . LYS D 1 59  ? 36.219  -63.061 -64.521  1.00 40.35 ? 59  LYS D CG    1 
ATOM   10284 C CD    . LYS D 1 59  ? 36.898  -63.954 -65.573  1.00 42.73 ? 59  LYS D CD    1 
ATOM   10285 C CE    . LYS D 1 59  ? 37.450  -63.165 -66.775  1.00 44.20 ? 59  LYS D CE    1 
ATOM   10286 N NZ    . LYS D 1 59  ? 37.376  -64.001 -68.037  1.00 46.30 ? 59  LYS D NZ    1 
ATOM   10287 N N     . THR D 1 60  ? 35.526  -60.978 -62.161  1.00 34.21 ? 60  THR D N     1 
ATOM   10288 C CA    . THR D 1 60  ? 35.053  -59.601 -62.110  1.00 31.72 ? 60  THR D CA    1 
ATOM   10289 C C     . THR D 1 60  ? 34.229  -59.298 -63.376  1.00 30.99 ? 60  THR D C     1 
ATOM   10290 O O     . THR D 1 60  ? 34.494  -59.849 -64.453  1.00 31.11 ? 60  THR D O     1 
ATOM   10291 C CB    . THR D 1 60  ? 36.224  -58.633 -61.860  1.00 31.00 ? 60  THR D CB    1 
ATOM   10292 O OG1   . THR D 1 60  ? 36.619  -58.813 -60.507  1.00 30.21 ? 60  THR D OG1   1 
ATOM   10293 C CG2   . THR D 1 60  ? 35.840  -57.225 -61.992  1.00 28.98 ? 60  THR D CG2   1 
ATOM   10294 N N     . ILE D 1 61  ? 33.160  -58.524 -63.240  1.00 28.61 ? 61  ILE D N     1 
ATOM   10295 C CA    . ILE D 1 61  ? 32.434  -58.197 -64.457  1.00 26.77 ? 61  ILE D CA    1 
ATOM   10296 C C     . ILE D 1 61  ? 32.955  -56.869 -65.024  1.00 26.34 ? 61  ILE D C     1 
ATOM   10297 O O     . ILE D 1 61  ? 32.974  -55.853 -64.330  1.00 27.10 ? 61  ILE D O     1 
ATOM   10298 C CB    . ILE D 1 61  ? 30.893  -58.282 -64.265  1.00 25.50 ? 61  ILE D CB    1 
ATOM   10299 C CG1   . ILE D 1 61  ? 30.491  -59.750 -64.027  1.00 23.95 ? 61  ILE D CG1   1 
ATOM   10300 C CG2   . ILE D 1 61  ? 30.163  -57.596 -65.429  1.00 23.14 ? 61  ILE D CG2   1 
ATOM   10301 C CD1   . ILE D 1 61  ? 28.972  -60.068 -63.769  1.00 25.89 ? 61  ILE D CD1   1 
ATOM   10302 N N     . GLN D 1 62  ? 33.413  -56.868 -66.255  1.00 24.92 ? 62  GLN D N     1 
ATOM   10303 C CA    . GLN D 1 62  ? 33.837  -55.589 -66.820  1.00 25.80 ? 62  GLN D CA    1 
ATOM   10304 C C     . GLN D 1 62  ? 33.088  -55.150 -68.053  1.00 24.23 ? 62  GLN D C     1 
ATOM   10305 O O     . GLN D 1 62  ? 32.967  -55.881 -68.989  1.00 23.02 ? 62  GLN D O     1 
ATOM   10306 C CB    . GLN D 1 62  ? 35.325  -55.579 -67.108  1.00 25.53 ? 62  GLN D CB    1 
ATOM   10307 C CG    . GLN D 1 62  ? 36.131  -55.651 -65.796  1.00 32.26 ? 62  GLN D CG    1 
ATOM   10308 C CD    . GLN D 1 62  ? 37.586  -55.279 -66.000  1.00 41.31 ? 62  GLN D CD    1 
ATOM   10309 O OE1   . GLN D 1 62  ? 37.923  -54.554 -66.941  1.00 46.16 ? 62  GLN D OE1   1 
ATOM   10310 N NE2   . GLN D 1 62  ? 38.463  -55.781 -65.133  1.00 43.50 ? 62  GLN D NE2   1 
ATOM   10311 N N     . PHE D 1 63  ? 32.613  -53.926 -68.040  1.00 24.68 ? 63  PHE D N     1 
ATOM   10312 C CA    . PHE D 1 63  ? 32.125  -53.296 -69.224  1.00 25.61 ? 63  PHE D CA    1 
ATOM   10313 C C     . PHE D 1 63  ? 33.165  -52.344 -69.747  1.00 26.10 ? 63  PHE D C     1 
ATOM   10314 O O     . PHE D 1 63  ? 33.318  -51.261 -69.208  1.00 27.12 ? 63  PHE D O     1 
ATOM   10315 C CB    . PHE D 1 63  ? 30.868  -52.500 -68.883  1.00 26.76 ? 63  PHE D CB    1 
ATOM   10316 C CG    . PHE D 1 63  ? 29.697  -53.337 -68.537  1.00 27.76 ? 63  PHE D CG    1 
ATOM   10317 C CD1   . PHE D 1 63  ? 28.430  -52.777 -68.508  1.00 33.71 ? 63  PHE D CD1   1 
ATOM   10318 C CD2   . PHE D 1 63  ? 29.834  -54.692 -68.276  1.00 29.05 ? 63  PHE D CD2   1 
ATOM   10319 C CE1   . PHE D 1 63  ? 27.309  -53.562 -68.184  1.00 34.87 ? 63  PHE D CE1   1 
ATOM   10320 C CE2   . PHE D 1 63  ? 28.750  -55.481 -67.967  1.00 30.31 ? 63  PHE D CE2   1 
ATOM   10321 C CZ    . PHE D 1 63  ? 27.489  -54.925 -67.901  1.00 33.22 ? 63  PHE D CZ    1 
ATOM   10322 N N     . GLY D 1 64  ? 33.896  -52.721 -70.792  1.00 26.71 ? 64  GLY D N     1 
ATOM   10323 C CA    . GLY D 1 64  ? 34.714  -51.733 -71.489  1.00 27.17 ? 64  GLY D CA    1 
ATOM   10324 C C     . GLY D 1 64  ? 33.782  -50.779 -72.229  1.00 28.77 ? 64  GLY D C     1 
ATOM   10325 O O     . GLY D 1 64  ? 32.512  -50.858 -72.087  1.00 29.38 ? 64  GLY D O     1 
ATOM   10326 N N     . GLU D 1 65  ? 34.378  -49.898 -73.021  1.00 27.88 ? 65  GLU D N     1 
ATOM   10327 C CA    . GLU D 1 65  ? 33.643  -48.831 -73.639  1.00 30.38 ? 65  GLU D CA    1 
ATOM   10328 C C     . GLU D 1 65  ? 32.562  -49.253 -74.641  1.00 29.71 ? 65  GLU D C     1 
ATOM   10329 O O     . GLU D 1 65  ? 31.525  -48.620 -74.697  1.00 28.01 ? 65  GLU D O     1 
ATOM   10330 C CB    . GLU D 1 65  ? 34.531  -47.725 -74.236  1.00 29.92 ? 65  GLU D CB    1 
ATOM   10331 C CG    . GLU D 1 65  ? 35.959  -48.033 -74.322  1.00 37.04 ? 65  GLU D CG    1 
ATOM   10332 C CD    . GLU D 1 65  ? 36.659  -47.897 -72.968  1.00 41.35 ? 65  GLU D CD    1 
ATOM   10333 O OE1   . GLU D 1 65  ? 37.228  -48.918 -72.472  1.00 37.07 ? 65  GLU D OE1   1 
ATOM   10334 O OE2   . GLU D 1 65  ? 36.587  -46.763 -72.403  1.00 47.43 ? 65  GLU D OE2   1 
ATOM   10335 N N     . GLU D 1 66  ? 32.809  -50.285 -75.431  1.00 31.25 ? 66  GLU D N     1 
ATOM   10336 C CA    . GLU D 1 66  ? 31.821  -50.675 -76.443  1.00 33.01 ? 66  GLU D CA    1 
ATOM   10337 C C     . GLU D 1 66  ? 30.587  -51.325 -75.800  1.00 33.00 ? 66  GLU D C     1 
ATOM   10338 O O     . GLU D 1 66  ? 29.439  -51.019 -76.151  1.00 33.50 ? 66  GLU D O     1 
ATOM   10339 C CB    . GLU D 1 66  ? 32.413  -51.484 -77.599  1.00 32.42 ? 66  GLU D CB    1 
ATOM   10340 C CG    . GLU D 1 66  ? 32.930  -50.581 -78.749  1.00 36.77 ? 66  GLU D CG    1 
ATOM   10341 C CD    . GLU D 1 66  ? 31.859  -49.603 -79.368  1.00 44.67 ? 66  GLU D CD    1 
ATOM   10342 O OE1   . GLU D 1 66  ? 30.702  -50.034 -79.759  1.00 40.61 ? 66  GLU D OE1   1 
ATOM   10343 O OE2   . GLU D 1 66  ? 32.219  -48.390 -79.476  1.00 45.84 ? 66  GLU D OE2   1 
ATOM   10344 N N     . MET D 1 67  ? 30.865  -52.173 -74.827  1.00 33.53 ? 67  MET D N     1 
ATOM   10345 C CA    . MET D 1 67  ? 29.886  -52.850 -73.998  1.00 33.38 ? 67  MET D CA    1 
ATOM   10346 C C     . MET D 1 67  ? 29.019  -51.858 -73.175  1.00 33.37 ? 67  MET D C     1 
ATOM   10347 O O     . MET D 1 67  ? 27.800  -52.022 -73.067  1.00 34.71 ? 67  MET D O     1 
ATOM   10348 C CB    . MET D 1 67  ? 30.692  -53.812 -73.114  1.00 33.38 ? 67  MET D CB    1 
ATOM   10349 C CG    . MET D 1 67  ? 29.916  -54.686 -72.129  1.00 34.33 ? 67  MET D CG    1 
ATOM   10350 S SD    . MET D 1 67  ? 28.756  -55.815 -72.891  1.00 33.34 ? 67  MET D SD    1 
ATOM   10351 C CE    . MET D 1 67  ? 29.807  -57.119 -73.500  1.00 29.15 ? 67  MET D CE    1 
ATOM   10352 N N     . MET D 1 68  ? 29.632  -50.823 -72.594  1.00 32.40 ? 68  MET D N     1 
ATOM   10353 C CA    . MET D 1 68  ? 28.868  -49.835 -71.883  1.00 30.98 ? 68  MET D CA    1 
ATOM   10354 C C     . MET D 1 68  ? 27.839  -49.148 -72.809  1.00 30.88 ? 68  MET D C     1 
ATOM   10355 O O     . MET D 1 68  ? 26.697  -48.916 -72.409  1.00 30.34 ? 68  MET D O     1 
ATOM   10356 C CB    . MET D 1 68  ? 29.783  -48.795 -71.295  1.00 31.11 ? 68  MET D CB    1 
ATOM   10357 C CG    . MET D 1 68  ? 29.120  -47.857 -70.288  1.00 31.08 ? 68  MET D CG    1 
ATOM   10358 S SD    . MET D 1 68  ? 28.248  -48.616 -68.880  1.00 33.11 ? 68  MET D SD    1 
ATOM   10359 C CE    . MET D 1 68  ? 29.458  -48.507 -67.580  1.00 30.42 ? 68  MET D CE    1 
ATOM   10360 N N     . LYS D 1 69  ? 28.259  -48.834 -74.030  1.00 28.71 ? 69  LYS D N     1 
ATOM   10361 C CA    . LYS D 1 69  ? 27.372  -48.222 -75.012  1.00 27.96 ? 69  LYS D CA    1 
ATOM   10362 C C     . LYS D 1 69  ? 26.159  -49.106 -75.285  1.00 27.54 ? 69  LYS D C     1 
ATOM   10363 O O     . LYS D 1 69  ? 25.021  -48.636 -75.272  1.00 27.28 ? 69  LYS D O     1 
ATOM   10364 C CB    . LYS D 1 69  ? 28.124  -47.945 -76.315  1.00 28.54 ? 69  LYS D CB    1 
ATOM   10365 C CG    . LYS D 1 69  ? 29.176  -46.853 -76.204  1.00 26.43 ? 69  LYS D CG    1 
ATOM   10366 C CD    . LYS D 1 69  ? 29.822  -46.569 -77.550  1.00 26.87 ? 69  LYS D CD    1 
ATOM   10367 C CE    . LYS D 1 69  ? 31.097  -45.757 -77.391  1.00 28.66 ? 69  LYS D CE    1 
ATOM   10368 N NZ    . LYS D 1 69  ? 31.811  -45.586 -78.685  1.00 27.47 ? 69  LYS D NZ    1 
ATOM   10369 N N     . ARG D 1 70  ? 26.410  -50.387 -75.533  1.00 26.48 ? 70  ARG D N     1 
ATOM   10370 C CA    . ARG D 1 70  ? 25.339  -51.369 -75.653  1.00 24.87 ? 70  ARG D CA    1 
ATOM   10371 C C     . ARG D 1 70  ? 24.519  -51.449 -74.370  1.00 26.41 ? 70  ARG D C     1 
ATOM   10372 O O     . ARG D 1 70  ? 23.307  -51.662 -74.409  1.00 25.44 ? 70  ARG D O     1 
ATOM   10373 C CB    . ARG D 1 70  ? 25.910  -52.745 -75.999  1.00 24.79 ? 70  ARG D CB    1 
ATOM   10374 C CG    . ARG D 1 70  ? 24.858  -53.829 -76.168  1.00 23.74 ? 70  ARG D CG    1 
ATOM   10375 C CD    . ARG D 1 70  ? 25.427  -55.230 -76.257  1.00 20.07 ? 70  ARG D CD    1 
ATOM   10376 N NE    . ARG D 1 70  ? 24.379  -56.232 -76.432  1.00 13.69 ? 70  ARG D NE    1 
ATOM   10377 C CZ    . ARG D 1 70  ? 24.567  -57.537 -76.294  1.00 16.00 ? 70  ARG D CZ    1 
ATOM   10378 N NH1   . ARG D 1 70  ? 25.765  -58.006 -75.977  1.00 4.95  ? 70  ARG D NH1   1 
ATOM   10379 N NH2   . ARG D 1 70  ? 23.556  -58.377 -76.473  1.00 5.49  ? 70  ARG D NH2   1 
ATOM   10380 N N     . ALA D 1 71  ? 25.187  -51.276 -73.234  1.00 25.84 ? 71  ALA D N     1 
ATOM   10381 C CA    . ALA D 1 71  ? 24.539  -51.414 -71.935  1.00 25.63 ? 71  ALA D CA    1 
ATOM   10382 C C     . ALA D 1 71  ? 23.558  -50.273 -71.685  1.00 24.71 ? 71  ALA D C     1 
ATOM   10383 O O     . ALA D 1 71  ? 22.571  -50.437 -70.968  1.00 25.21 ? 71  ALA D O     1 
ATOM   10384 C CB    . ALA D 1 71  ? 25.580  -51.474 -70.828  1.00 25.64 ? 71  ALA D CB    1 
ATOM   10385 N N     . LEU D 1 72  ? 23.837  -49.118 -72.280  1.00 22.70 ? 72  LEU D N     1 
ATOM   10386 C CA    . LEU D 1 72  ? 23.117  -47.894 -71.952  1.00 22.17 ? 72  LEU D CA    1 
ATOM   10387 C C     . LEU D 1 72  ? 22.023  -47.640 -72.997  1.00 21.44 ? 72  LEU D C     1 
ATOM   10388 O O     . LEU D 1 72  ? 21.305  -46.644 -72.929  1.00 21.87 ? 72  LEU D O     1 
ATOM   10389 C CB    . LEU D 1 72  ? 24.089  -46.707 -71.786  1.00 21.43 ? 72  LEU D CB    1 
ATOM   10390 C CG    . LEU D 1 72  ? 25.028  -46.668 -70.532  1.00 22.31 ? 72  LEU D CG    1 
ATOM   10391 C CD1   . LEU D 1 72  ? 26.281  -45.681 -70.643  1.00 10.98 ? 72  LEU D CD1   1 
ATOM   10392 C CD2   . LEU D 1 72  ? 24.228  -46.422 -69.261  1.00 18.83 ? 72  LEU D CD2   1 
ATOM   10393 N N     . GLN D 1 73  ? 21.931  -48.562 -73.958  1.00 21.11 ? 73  GLN D N     1 
ATOM   10394 C CA    . GLN D 1 73  ? 21.137  -48.439 -75.143  1.00 21.24 ? 73  GLN D CA    1 
ATOM   10395 C C     . GLN D 1 73  ? 19.842  -49.352 -75.167  1.00 21.09 ? 73  GLN D C     1 
ATOM   10396 O O     . GLN D 1 73  ? 19.761  -50.384 -74.520  1.00 22.46 ? 73  GLN D O     1 
ATOM   10397 C CB    . GLN D 1 73  ? 22.068  -48.716 -76.340  1.00 21.26 ? 73  GLN D CB    1 
ATOM   10398 C CG    . GLN D 1 73  ? 21.444  -48.608 -77.752  1.00 20.19 ? 73  GLN D CG    1 
ATOM   10399 C CD    . GLN D 1 73  ? 20.740  -47.259 -78.010  1.00 19.56 ? 73  GLN D CD    1 
ATOM   10400 O OE1   . GLN D 1 73  ? 19.679  -46.988 -77.465  1.00 21.71 ? 73  GLN D OE1   1 
ATOM   10401 N NE2   . GLN D 1 73  ? 21.344  -46.419 -78.830  1.00 18.04 ? 73  GLN D NE2   1 
ATOM   10402 N N     . TYR D 1 74  ? 18.860  -49.008 -75.966  1.00 20.82 ? 74  TYR D N     1 
ATOM   10403 C CA    . TYR D 1 74  ? 17.736  -49.911 -76.134  1.00 20.23 ? 74  TYR D CA    1 
ATOM   10404 C C     . TYR D 1 74  ? 18.292  -51.262 -76.547  1.00 20.69 ? 74  TYR D C     1 
ATOM   10405 O O     . TYR D 1 74  ? 19.297  -51.345 -77.304  1.00 21.30 ? 74  TYR D O     1 
ATOM   10406 C CB    . TYR D 1 74  ? 16.754  -49.364 -77.165  1.00 19.94 ? 74  TYR D CB    1 
ATOM   10407 C CG    . TYR D 1 74  ? 15.944  -48.110 -76.759  1.00 18.67 ? 74  TYR D CG    1 
ATOM   10408 C CD1   . TYR D 1 74  ? 14.956  -48.189 -75.786  1.00 21.31 ? 74  TYR D CD1   1 
ATOM   10409 C CD2   . TYR D 1 74  ? 16.085  -46.907 -77.435  1.00 21.25 ? 74  TYR D CD2   1 
ATOM   10410 C CE1   . TYR D 1 74  ? 14.136  -47.085 -75.424  1.00 14.20 ? 74  TYR D CE1   1 
ATOM   10411 C CE2   . TYR D 1 74  ? 15.301  -45.772 -77.091  1.00 19.80 ? 74  TYR D CE2   1 
ATOM   10412 C CZ    . TYR D 1 74  ? 14.299  -45.887 -76.050  1.00 20.19 ? 74  TYR D CZ    1 
ATOM   10413 O OH    . TYR D 1 74  ? 13.489  -44.802 -75.631  1.00 14.92 ? 74  TYR D OH    1 
ATOM   10414 N N     . SER D 1 75  ? 17.678  -52.324 -76.024  1.00 19.82 ? 75  SER D N     1 
ATOM   10415 C CA    . SER D 1 75  ? 17.903  -53.724 -76.497  1.00 17.94 ? 75  SER D CA    1 
ATOM   10416 C C     . SER D 1 75  ? 16.527  -54.410 -76.849  1.00 16.68 ? 75  SER D C     1 
ATOM   10417 O O     . SER D 1 75  ? 15.501  -53.814 -76.609  1.00 16.28 ? 75  SER D O     1 
ATOM   10418 C CB    . SER D 1 75  ? 18.591  -54.501 -75.377  1.00 16.87 ? 75  SER D CB    1 
ATOM   10419 O OG    . SER D 1 75  ? 17.962  -54.243 -74.126  1.00 13.72 ? 75  SER D OG    1 
ATOM   10420 N N     . PRO D 1 76  ? 16.521  -55.674 -77.323  1.00 16.46 ? 76  PRO D N     1 
ATOM   10421 C CA    . PRO D 1 76  ? 15.333  -56.407 -77.759  1.00 18.15 ? 76  PRO D CA    1 
ATOM   10422 C C     . PRO D 1 76  ? 14.336  -56.565 -76.644  1.00 20.83 ? 76  PRO D C     1 
ATOM   10423 O O     . PRO D 1 76  ? 14.727  -56.598 -75.450  1.00 22.72 ? 76  PRO D O     1 
ATOM   10424 C CB    . PRO D 1 76  ? 15.886  -57.808 -78.136  1.00 19.27 ? 76  PRO D CB    1 
ATOM   10425 C CG    . PRO D 1 76  ? 17.347  -57.609 -78.407  1.00 15.16 ? 76  PRO D CG    1 
ATOM   10426 C CD    . PRO D 1 76  ? 17.748  -56.502 -77.466  1.00 17.09 ? 76  PRO D CD    1 
ATOM   10427 N N     . SER D 1 77  ? 13.055  -56.650 -77.001  1.00 21.99 ? 77  SER D N     1 
ATOM   10428 C CA    . SER D 1 77  ? 11.979  -56.548 -75.989  1.00 22.40 ? 77  SER D CA    1 
ATOM   10429 C C     . SER D 1 77  ? 11.812  -57.797 -75.143  1.00 21.81 ? 77  SER D C     1 
ATOM   10430 O O     . SER D 1 77  ? 11.449  -57.726 -73.977  1.00 20.37 ? 77  SER D O     1 
ATOM   10431 C CB    . SER D 1 77  ? 10.666  -56.268 -76.676  1.00 23.18 ? 77  SER D CB    1 
ATOM   10432 O OG    . SER D 1 77  ? 10.763  -56.808 -77.932  1.00 23.87 ? 77  SER D OG    1 
ATOM   10433 N N     . ALA D 1 78  ? 12.037  -58.933 -75.784  1.00 22.15 ? 78  ALA D N     1 
ATOM   10434 C CA    . ALA D 1 78  ? 11.997  -60.236 -75.137  1.00 22.32 ? 78  ALA D CA    1 
ATOM   10435 C C     . ALA D 1 78  ? 13.206  -60.520 -74.236  1.00 22.17 ? 78  ALA D C     1 
ATOM   10436 O O     . ALA D 1 78  ? 13.088  -61.280 -73.294  1.00 23.60 ? 78  ALA D O     1 
ATOM   10437 C CB    . ALA D 1 78  ? 11.900  -61.285 -76.178  1.00 22.45 ? 78  ALA D CB    1 
ATOM   10438 N N     . GLY D 1 79  ? 14.346  -59.896 -74.493  1.00 22.84 ? 79  GLY D N     1 
ATOM   10439 C CA    . GLY D 1 79  ? 15.547  -60.016 -73.608  1.00 21.96 ? 79  GLY D CA    1 
ATOM   10440 C C     . GLY D 1 79  ? 16.757  -59.927 -74.478  1.00 22.03 ? 79  GLY D C     1 
ATOM   10441 O O     . GLY D 1 79  ? 16.671  -60.095 -75.675  1.00 23.81 ? 79  GLY D O     1 
ATOM   10442 N N     . ILE D 1 80  ? 17.922  -59.706 -73.922  1.00 22.27 ? 80  ILE D N     1 
ATOM   10443 C CA    . ILE D 1 80  ? 19.107  -59.885 -74.754  1.00 20.02 ? 80  ILE D CA    1 
ATOM   10444 C C     . ILE D 1 80  ? 19.325  -61.344 -75.183  1.00 20.46 ? 80  ILE D C     1 
ATOM   10445 O O     . ILE D 1 80  ? 19.053  -62.282 -74.413  1.00 20.88 ? 80  ILE D O     1 
ATOM   10446 C CB    . ILE D 1 80  ? 20.352  -59.320 -74.089  1.00 19.65 ? 80  ILE D CB    1 
ATOM   10447 C CG1   . ILE D 1 80  ? 20.668  -60.086 -72.810  1.00 20.00 ? 80  ILE D CG1   1 
ATOM   10448 C CG2   . ILE D 1 80  ? 20.198  -57.825 -73.882  1.00 15.80 ? 80  ILE D CG2   1 
ATOM   10449 C CD1   . ILE D 1 80  ? 22.017  -59.668 -72.160  1.00 17.63 ? 80  ILE D CD1   1 
ATOM   10450 N N     . PRO D 1 81  ? 19.862  -61.551 -76.394  1.00 20.39 ? 81  PRO D N     1 
ATOM   10451 C CA    . PRO D 1 81  ? 20.020  -62.927 -76.887  1.00 21.21 ? 81  PRO D CA    1 
ATOM   10452 C C     . PRO D 1 81  ? 20.932  -63.841 -76.030  1.00 23.80 ? 81  PRO D C     1 
ATOM   10453 O O     . PRO D 1 81  ? 20.701  -65.051 -75.954  1.00 25.95 ? 81  PRO D O     1 
ATOM   10454 C CB    . PRO D 1 81  ? 20.623  -62.762 -78.319  1.00 20.74 ? 81  PRO D CB    1 
ATOM   10455 C CG    . PRO D 1 81  ? 21.013  -61.310 -78.492  1.00 19.82 ? 81  PRO D CG    1 
ATOM   10456 C CD    . PRO D 1 81  ? 20.327  -60.517 -77.350  1.00 20.67 ? 81  PRO D CD    1 
ATOM   10457 N N     . GLU D 1 82  ? 21.989  -63.328 -75.426  1.00 24.44 ? 82  GLU D N     1 
ATOM   10458 C CA    . GLU D 1 82  ? 22.742  -64.213 -74.567  1.00 26.11 ? 82  GLU D CA    1 
ATOM   10459 C C     . GLU D 1 82  ? 21.959  -64.659 -73.296  1.00 27.11 ? 82  GLU D C     1 
ATOM   10460 O O     . GLU D 1 82  ? 22.138  -65.786 -72.770  1.00 27.67 ? 82  GLU D O     1 
ATOM   10461 C CB    . GLU D 1 82  ? 24.184  -63.724 -74.334  1.00 26.27 ? 82  GLU D CB    1 
ATOM   10462 C CG    . GLU D 1 82  ? 24.426  -62.256 -74.043  1.00 30.51 ? 82  GLU D CG    1 
ATOM   10463 C CD    . GLU D 1 82  ? 24.457  -61.344 -75.247  1.00 34.30 ? 82  GLU D CD    1 
ATOM   10464 O OE1   . GLU D 1 82  ? 23.354  -60.956 -75.710  1.00 36.79 ? 82  GLU D OE1   1 
ATOM   10465 O OE2   . GLU D 1 82  ? 25.580  -60.990 -75.711  1.00 37.62 ? 82  GLU D OE2   1 
ATOM   10466 N N     . LEU D 1 83  ? 21.035  -63.820 -72.827  1.00 26.66 ? 83  LEU D N     1 
ATOM   10467 C CA    . LEU D 1 83  ? 20.315  -64.192 -71.636  1.00 26.27 ? 83  LEU D CA    1 
ATOM   10468 C C     . LEU D 1 83  ? 19.095  -65.044 -72.008  1.00 27.19 ? 83  LEU D C     1 
ATOM   10469 O O     . LEU D 1 83  ? 18.630  -65.864 -71.208  1.00 28.53 ? 83  LEU D O     1 
ATOM   10470 C CB    . LEU D 1 83  ? 19.975  -62.946 -70.766  1.00 26.48 ? 83  LEU D CB    1 
ATOM   10471 C CG    . LEU D 1 83  ? 19.132  -63.059 -69.454  1.00 27.22 ? 83  LEU D CG    1 
ATOM   10472 C CD1   . LEU D 1 83  ? 19.926  -63.816 -68.370  1.00 23.71 ? 83  LEU D CD1   1 
ATOM   10473 C CD2   . LEU D 1 83  ? 18.596  -61.704 -68.892  1.00 26.03 ? 83  LEU D CD2   1 
ATOM   10474 N N     . LEU D 1 84  ? 18.581  -64.889 -73.223  1.00 27.24 ? 84  LEU D N     1 
ATOM   10475 C CA    . LEU D 1 84  ? 17.426  -65.695 -73.623  1.00 26.81 ? 84  LEU D CA    1 
ATOM   10476 C C     . LEU D 1 84  ? 17.817  -67.084 -73.991  1.00 26.41 ? 84  LEU D C     1 
ATOM   10477 O O     . LEU D 1 84  ? 17.071  -68.037 -73.724  1.00 27.39 ? 84  LEU D O     1 
ATOM   10478 C CB    . LEU D 1 84  ? 16.706  -65.133 -74.842  1.00 27.01 ? 84  LEU D CB    1 
ATOM   10479 C CG    . LEU D 1 84  ? 15.809  -63.956 -74.635  1.00 25.56 ? 84  LEU D CG    1 
ATOM   10480 C CD1   . LEU D 1 84  ? 15.656  -63.437 -76.015  1.00 24.18 ? 84  LEU D CD1   1 
ATOM   10481 C CD2   . LEU D 1 84  ? 14.452  -64.398 -74.021  1.00 25.71 ? 84  LEU D CD2   1 
ATOM   10482 N N     . SER D 1 85  ? 18.945  -67.231 -74.661  1.00 25.51 ? 85  SER D N     1 
ATOM   10483 C CA    . SER D 1 85  ? 19.367  -68.590 -74.983  1.00 25.18 ? 85  SER D CA    1 
ATOM   10484 C C     . SER D 1 85  ? 19.817  -69.341 -73.739  1.00 23.26 ? 85  SER D C     1 
ATOM   10485 O O     . SER D 1 85  ? 19.508  -70.516 -73.609  1.00 22.73 ? 85  SER D O     1 
ATOM   10486 C CB    . SER D 1 85  ? 20.437  -68.598 -76.086  1.00 26.20 ? 85  SER D CB    1 
ATOM   10487 O OG    . SER D 1 85  ? 21.635  -68.009 -75.625  1.00 30.99 ? 85  SER D OG    1 
ATOM   10488 N N     . TRP D 1 86  ? 20.541  -68.659 -72.847  1.00 22.95 ? 86  TRP D N     1 
ATOM   10489 C CA    . TRP D 1 86  ? 20.961  -69.215 -71.511  1.00 24.05 ? 86  TRP D CA    1 
ATOM   10490 C C     . TRP D 1 86  ? 19.760  -69.568 -70.578  1.00 25.00 ? 86  TRP D C     1 
ATOM   10491 O O     . TRP D 1 86  ? 19.870  -70.505 -69.822  1.00 26.26 ? 86  TRP D O     1 
ATOM   10492 C CB    . TRP D 1 86  ? 21.959  -68.288 -70.776  1.00 22.45 ? 86  TRP D CB    1 
ATOM   10493 C CG    . TRP D 1 86  ? 22.906  -68.957 -69.762  1.00 23.01 ? 86  TRP D CG    1 
ATOM   10494 C CD1   . TRP D 1 86  ? 24.222  -69.245 -69.962  1.00 21.85 ? 86  TRP D CD1   1 
ATOM   10495 C CD2   . TRP D 1 86  ? 22.615  -69.385 -68.400  1.00 22.05 ? 86  TRP D CD2   1 
ATOM   10496 N NE1   . TRP D 1 86  ? 24.753  -69.829 -68.849  1.00 22.51 ? 86  TRP D NE1   1 
ATOM   10497 C CE2   . TRP D 1 86  ? 23.802  -69.910 -67.872  1.00 20.59 ? 86  TRP D CE2   1 
ATOM   10498 C CE3   . TRP D 1 86  ? 21.470  -69.349 -67.584  1.00 22.72 ? 86  TRP D CE3   1 
ATOM   10499 C CZ2   . TRP D 1 86  ? 23.893  -70.403 -66.565  1.00 24.08 ? 86  TRP D CZ2   1 
ATOM   10500 C CZ3   . TRP D 1 86  ? 21.543  -69.856 -66.284  1.00 24.08 ? 86  TRP D CZ3   1 
ATOM   10501 C CH2   . TRP D 1 86  ? 22.739  -70.388 -65.788  1.00 25.29 ? 86  TRP D CH2   1 
ATOM   10502 N N     . LEU D 1 87  ? 18.616  -68.880 -70.652  1.00 25.13 ? 87  LEU D N     1 
ATOM   10503 C CA    . LEU D 1 87  ? 17.466  -69.325 -69.795  1.00 25.33 ? 87  LEU D CA    1 
ATOM   10504 C C     . LEU D 1 87  ? 16.674  -70.455 -70.427  1.00 26.50 ? 87  LEU D C     1 
ATOM   10505 O O     . LEU D 1 87  ? 16.217  -71.405 -69.760  1.00 26.58 ? 87  LEU D O     1 
ATOM   10506 C CB    . LEU D 1 87  ? 16.526  -68.180 -69.446  1.00 24.40 ? 87  LEU D CB    1 
ATOM   10507 C CG    . LEU D 1 87  ? 17.259  -67.113 -68.634  1.00 21.78 ? 87  LEU D CG    1 
ATOM   10508 C CD1   . LEU D 1 87  ? 16.600  -65.791 -68.679  1.00 23.96 ? 87  LEU D CD1   1 
ATOM   10509 C CD2   . LEU D 1 87  ? 17.429  -67.574 -67.262  1.00 20.60 ? 87  LEU D CD2   1 
ATOM   10510 N N     . LYS D 1 88  ? 16.545  -70.378 -71.737  1.00 27.45 ? 88  LYS D N     1 
ATOM   10511 C CA    . LYS D 1 88  ? 15.873  -71.430 -72.456  1.00 27.87 ? 88  LYS D CA    1 
ATOM   10512 C C     . LYS D 1 88  ? 16.667  -72.712 -72.263  1.00 28.36 ? 88  LYS D C     1 
ATOM   10513 O O     . LYS D 1 88  ? 16.113  -73.766 -71.955  1.00 29.70 ? 88  LYS D O     1 
ATOM   10514 C CB    . LYS D 1 88  ? 15.660  -71.033 -73.912  1.00 26.84 ? 88  LYS D CB    1 
ATOM   10515 C CG    . LYS D 1 88  ? 14.744  -69.826 -74.077  1.00 27.41 ? 88  LYS D CG    1 
ATOM   10516 C CD    . LYS D 1 88  ? 14.209  -69.764 -75.527  1.00 23.37 ? 88  LYS D CD    1 
ATOM   10517 C CE    . LYS D 1 88  ? 13.983  -68.359 -76.014  1.00 22.66 ? 88  LYS D CE    1 
ATOM   10518 N NZ    . LYS D 1 88  ? 13.593  -68.372 -77.512  1.00 26.96 ? 88  LYS D NZ    1 
ATOM   10519 N N     . GLN D 1 89  ? 17.980  -72.600 -72.329  1.00 29.58 ? 89  GLN D N     1 
ATOM   10520 C CA    . GLN D 1 89  ? 18.861  -73.738 -72.134  1.00 29.62 ? 89  GLN D CA    1 
ATOM   10521 C C     . GLN D 1 89  ? 18.749  -74.292 -70.713  1.00 29.93 ? 89  GLN D C     1 
ATOM   10522 O O     . GLN D 1 89  ? 18.731  -75.517 -70.502  1.00 29.95 ? 89  GLN D O     1 
ATOM   10523 C CB    . GLN D 1 89  ? 20.267  -73.268 -72.408  1.00 31.08 ? 89  GLN D CB    1 
ATOM   10524 C CG    . GLN D 1 89  ? 21.177  -74.296 -73.019  1.00 34.90 ? 89  GLN D CG    1 
ATOM   10525 C CD    . GLN D 1 89  ? 20.538  -75.029 -74.212  1.00 37.73 ? 89  GLN D CD    1 
ATOM   10526 O OE1   . GLN D 1 89  ? 19.814  -76.042 -73.999  1.00 38.63 ? 89  GLN D OE1   1 
ATOM   10527 N NE2   . GLN D 1 89  ? 20.847  -74.564 -75.473  1.00 27.52 ? 89  GLN D NE2   1 
ATOM   10528 N N     . LEU D 1 90  ? 18.675  -73.390 -69.739  1.00 29.56 ? 90  LEU D N     1 
ATOM   10529 C CA    . LEU D 1 90  ? 18.539  -73.783 -68.342  1.00 28.70 ? 90  LEU D CA    1 
ATOM   10530 C C     . LEU D 1 90  ? 17.228  -74.525 -68.102  1.00 29.66 ? 90  LEU D C     1 
ATOM   10531 O O     . LEU D 1 90  ? 17.215  -75.610 -67.521  1.00 28.91 ? 90  LEU D O     1 
ATOM   10532 C CB    . LEU D 1 90  ? 18.622  -72.556 -67.431  1.00 29.37 ? 90  LEU D CB    1 
ATOM   10533 C CG    . LEU D 1 90  ? 18.386  -72.802 -65.939  1.00 29.00 ? 90  LEU D CG    1 
ATOM   10534 C CD1   . LEU D 1 90  ? 19.655  -73.304 -65.268  1.00 20.01 ? 90  LEU D CD1   1 
ATOM   10535 C CD2   . LEU D 1 90  ? 17.879  -71.539 -65.261  1.00 26.14 ? 90  LEU D CD2   1 
ATOM   10536 N N     . GLN D 1 91  ? 16.150  -73.982 -68.659  1.00 30.85 ? 91  GLN D N     1 
ATOM   10537 C CA    . GLN D 1 91  ? 14.834  -74.617 -68.698  1.00 31.10 ? 91  GLN D CA    1 
ATOM   10538 C C     . GLN D 1 91  ? 14.794  -76.011 -69.289  1.00 31.85 ? 91  GLN D C     1 
ATOM   10539 O O     . GLN D 1 91  ? 14.082  -76.861 -68.797  1.00 32.65 ? 91  GLN D O     1 
ATOM   10540 C CB    . GLN D 1 91  ? 13.808  -73.744 -69.420  1.00 30.43 ? 91  GLN D CB    1 
ATOM   10541 C CG    . GLN D 1 91  ? 13.507  -72.398 -68.792  1.00 30.86 ? 91  GLN D CG    1 
ATOM   10542 C CD    . GLN D 1 91  ? 13.127  -72.468 -67.332  1.00 29.12 ? 91  GLN D CD    1 
ATOM   10543 O OE1   . GLN D 1 91  ? 13.827  -73.059 -66.530  1.00 25.58 ? 91  GLN D OE1   1 
ATOM   10544 N NE2   . GLN D 1 91  ? 12.030  -71.839 -66.988  1.00 30.52 ? 91  GLN D NE2   1 
ATOM   10545 N N     . ILE D 1 92  ? 15.554  -76.237 -70.350  1.00 32.61 ? 92  ILE D N     1 
ATOM   10546 C CA    . ILE D 1 92  ? 15.737  -77.571 -70.896  1.00 33.86 ? 92  ILE D CA    1 
ATOM   10547 C C     . ILE D 1 92  ? 16.602  -78.520 -70.067  1.00 35.15 ? 92  ILE D C     1 
ATOM   10548 O O     . ILE D 1 92  ? 16.567  -79.724 -70.277  1.00 36.00 ? 92  ILE D O     1 
ATOM   10549 C CB    . ILE D 1 92  ? 16.256  -77.511 -72.344  1.00 33.58 ? 92  ILE D CB    1 
ATOM   10550 C CG1   . ILE D 1 92  ? 15.125  -77.157 -73.306  1.00 31.91 ? 92  ILE D CG1   1 
ATOM   10551 C CG2   . ILE D 1 92  ? 16.843  -78.834 -72.735  1.00 32.08 ? 92  ILE D CG2   1 
ATOM   10552 C CD1   . ILE D 1 92  ? 15.572  -76.513 -74.579  1.00 34.27 ? 92  ILE D CD1   1 
ATOM   10553 N N     . LYS D 1 93  ? 17.370  -77.991 -69.130  1.00 36.41 ? 93  LYS D N     1 
ATOM   10554 C CA    . LYS D 1 93  ? 18.054  -78.844 -68.190  1.00 38.70 ? 93  LYS D CA    1 
ATOM   10555 C C     . LYS D 1 93  ? 17.266  -79.094 -66.917  1.00 39.32 ? 93  LYS D C     1 
ATOM   10556 O O     . LYS D 1 93  ? 17.262  -80.197 -66.410  1.00 39.90 ? 93  LYS D O     1 
ATOM   10557 C CB    . LYS D 1 93  ? 19.461  -78.332 -67.886  1.00 38.58 ? 93  LYS D CB    1 
ATOM   10558 C CG    . LYS D 1 93  ? 20.442  -78.447 -69.032  1.00 41.71 ? 93  LYS D CG    1 
ATOM   10559 C CD    . LYS D 1 93  ? 21.124  -79.796 -69.069  1.00 40.70 ? 93  LYS D CD    1 
ATOM   10560 C CE    . LYS D 1 93  ? 22.026  -79.905 -70.271  1.00 41.61 ? 93  LYS D CE    1 
ATOM   10561 N NZ    . LYS D 1 93  ? 23.472  -79.889 -69.946  1.00 41.79 ? 93  LYS D NZ    1 
ATOM   10562 N N     . LEU D 1 94  ? 16.539  -78.098 -66.448  1.00 39.66 ? 94  LEU D N     1 
ATOM   10563 C CA    . LEU D 1 94  ? 15.744  -78.269 -65.253  1.00 39.91 ? 94  LEU D CA    1 
ATOM   10564 C C     . LEU D 1 94  ? 14.345  -78.839 -65.458  1.00 40.45 ? 94  LEU D C     1 
ATOM   10565 O O     . LEU D 1 94  ? 13.700  -79.211 -64.499  1.00 39.51 ? 94  LEU D O     1 
ATOM   10566 C CB    . LEU D 1 94  ? 15.682  -76.981 -64.449  1.00 39.88 ? 94  LEU D CB    1 
ATOM   10567 C CG    . LEU D 1 94  ? 17.016  -76.278 -64.267  1.00 41.72 ? 94  LEU D CG    1 
ATOM   10568 C CD1   . LEU D 1 94  ? 16.875  -75.116 -63.347  1.00 41.22 ? 94  LEU D CD1   1 
ATOM   10569 C CD2   . LEU D 1 94  ? 18.045  -77.230 -63.767  1.00 41.30 ? 94  LEU D CD2   1 
ATOM   10570 N N     . HIS D 1 95  ? 13.863  -78.908 -66.691  1.00 40.58 ? 95  HIS D N     1 
ATOM   10571 C CA    . HIS D 1 95  ? 12.461  -79.219 -66.893  1.00 40.67 ? 95  HIS D CA    1 
ATOM   10572 C C     . HIS D 1 95  ? 12.122  -80.051 -68.112  1.00 41.81 ? 95  HIS D C     1 
ATOM   10573 O O     . HIS D 1 95  ? 10.987  -80.464 -68.284  1.00 42.17 ? 95  HIS D O     1 
ATOM   10574 C CB    . HIS D 1 95  ? 11.602  -77.964 -66.860  1.00 39.45 ? 95  HIS D CB    1 
ATOM   10575 C CG    . HIS D 1 95  ? 11.758  -77.162 -65.614  1.00 35.61 ? 95  HIS D CG    1 
ATOM   10576 N ND1   . HIS D 1 95  ? 11.869  -77.737 -64.370  1.00 35.12 ? 95  HIS D ND1   1 
ATOM   10577 C CD2   . HIS D 1 95  ? 11.831  -75.827 -65.419  1.00 30.10 ? 95  HIS D CD2   1 
ATOM   10578 C CE1   . HIS D 1 95  ? 11.994  -76.790 -63.462  1.00 32.72 ? 95  HIS D CE1   1 
ATOM   10579 N NE2   . HIS D 1 95  ? 11.978  -75.623 -64.073  1.00 31.75 ? 95  HIS D NE2   1 
ATOM   10580 N N     . ASN D 1 96  ? 13.087  -80.293 -68.975  1.00 42.67 ? 96  ASN D N     1 
ATOM   10581 C CA    . ASN D 1 96  ? 12.743  -80.805 -70.289  1.00 43.38 ? 96  AS