data_3DC5
# 
_entry.id   3DC5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3DC5         
RCSB  RCSB047853   
WWPDB D_1000047853 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3DC6 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3DC5 
_pdbx_database_status.recvd_initial_deposition_date   2008-06-03 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Trinh, C.H.'      1 
'Hunter, T.'       2 
'Stewart, E.E.'    3 
'Phillips, S.E.V.' 4 
'Hunter, G.J.'     5 
# 
_citation.id                        primary 
_citation.title                     
'Purification, crystallization and X-ray structures of the two manganese superoxide dismutases from Caenorhabditis elegans' 
_citation.journal_abbrev            'Acta Crystallogr.,Sect.F' 
_citation.journal_volume            64 
_citation.page_first                1110 
_citation.page_last                 1114 
_citation.year                      2008 
_citation.journal_id_ASTM           ? 
_citation.country                   DK 
_citation.journal_id_ISSN           1744-3091 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19052361 
_citation.pdbx_database_id_DOI      10.1107/S1744309108037056 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Trinh, C.H.'    1 
primary 'Hunter, T.'     2 
primary 'Stewart, E.E.'  3 
primary 'Phillips, S.E.' 4 
primary 'Hunter, G.J.'   5 
# 
_cell.entry_id           3DC5 
_cell.length_a           81.780 
_cell.length_b           81.780 
_cell.length_c           136.031 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3DC5 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Superoxide dismutase [Mn] 2' 22359.479 2   1.15.1.1 ? ? ? 
2 non-polymer syn 'MANGANESE (II) ION'          54.938    2   ?        ? ? ? 
3 non-polymer syn 'MALONATE ION'                102.046   1   ?        ? ? ? 
4 water       nat water                         18.015    420 ?        ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MKHTLPDLPFDYADLEPVISHEIMQLHHQKHHATYVNNLNQIEEKLHEAVSKGNLKEAIALQPALKFNGGGHINHSIFWT
NLAKDGGEPSKELMDTIKRDFGSLDNLQKRLSDITIAVQGSGWGWLGYCKKDKILKIATCANQDPLEGMVPLFGIDVWEH
AYYLQYKNVRPDYVHAIWKIANWKNISERFANARQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MKHTLPDLPFDYADLEPVISHEIMQLHHQKHHATYVNNLNQIEEKLHEAVSKGNLKEAIALQPALKFNGGGHINHSIFWT
NLAKDGGEPSKELMDTIKRDFGSLDNLQKRLSDITIAVQGSGWGWLGYCKKDKILKIATCANQDPLEGMVPLFGIDVWEH
AYYLQYKNVRPDYVHAIWKIANWKNISERFANARQ
;
_entity_poly.pdbx_strand_id                 A,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   HIS n 
1 4   THR n 
1 5   LEU n 
1 6   PRO n 
1 7   ASP n 
1 8   LEU n 
1 9   PRO n 
1 10  PHE n 
1 11  ASP n 
1 12  TYR n 
1 13  ALA n 
1 14  ASP n 
1 15  LEU n 
1 16  GLU n 
1 17  PRO n 
1 18  VAL n 
1 19  ILE n 
1 20  SER n 
1 21  HIS n 
1 22  GLU n 
1 23  ILE n 
1 24  MET n 
1 25  GLN n 
1 26  LEU n 
1 27  HIS n 
1 28  HIS n 
1 29  GLN n 
1 30  LYS n 
1 31  HIS n 
1 32  HIS n 
1 33  ALA n 
1 34  THR n 
1 35  TYR n 
1 36  VAL n 
1 37  ASN n 
1 38  ASN n 
1 39  LEU n 
1 40  ASN n 
1 41  GLN n 
1 42  ILE n 
1 43  GLU n 
1 44  GLU n 
1 45  LYS n 
1 46  LEU n 
1 47  HIS n 
1 48  GLU n 
1 49  ALA n 
1 50  VAL n 
1 51  SER n 
1 52  LYS n 
1 53  GLY n 
1 54  ASN n 
1 55  LEU n 
1 56  LYS n 
1 57  GLU n 
1 58  ALA n 
1 59  ILE n 
1 60  ALA n 
1 61  LEU n 
1 62  GLN n 
1 63  PRO n 
1 64  ALA n 
1 65  LEU n 
1 66  LYS n 
1 67  PHE n 
1 68  ASN n 
1 69  GLY n 
1 70  GLY n 
1 71  GLY n 
1 72  HIS n 
1 73  ILE n 
1 74  ASN n 
1 75  HIS n 
1 76  SER n 
1 77  ILE n 
1 78  PHE n 
1 79  TRP n 
1 80  THR n 
1 81  ASN n 
1 82  LEU n 
1 83  ALA n 
1 84  LYS n 
1 85  ASP n 
1 86  GLY n 
1 87  GLY n 
1 88  GLU n 
1 89  PRO n 
1 90  SER n 
1 91  LYS n 
1 92  GLU n 
1 93  LEU n 
1 94  MET n 
1 95  ASP n 
1 96  THR n 
1 97  ILE n 
1 98  LYS n 
1 99  ARG n 
1 100 ASP n 
1 101 PHE n 
1 102 GLY n 
1 103 SER n 
1 104 LEU n 
1 105 ASP n 
1 106 ASN n 
1 107 LEU n 
1 108 GLN n 
1 109 LYS n 
1 110 ARG n 
1 111 LEU n 
1 112 SER n 
1 113 ASP n 
1 114 ILE n 
1 115 THR n 
1 116 ILE n 
1 117 ALA n 
1 118 VAL n 
1 119 GLN n 
1 120 GLY n 
1 121 SER n 
1 122 GLY n 
1 123 TRP n 
1 124 GLY n 
1 125 TRP n 
1 126 LEU n 
1 127 GLY n 
1 128 TYR n 
1 129 CYS n 
1 130 LYS n 
1 131 LYS n 
1 132 ASP n 
1 133 LYS n 
1 134 ILE n 
1 135 LEU n 
1 136 LYS n 
1 137 ILE n 
1 138 ALA n 
1 139 THR n 
1 140 CYS n 
1 141 ALA n 
1 142 ASN n 
1 143 GLN n 
1 144 ASP n 
1 145 PRO n 
1 146 LEU n 
1 147 GLU n 
1 148 GLY n 
1 149 MET n 
1 150 VAL n 
1 151 PRO n 
1 152 LEU n 
1 153 PHE n 
1 154 GLY n 
1 155 ILE n 
1 156 ASP n 
1 157 VAL n 
1 158 TRP n 
1 159 GLU n 
1 160 HIS n 
1 161 ALA n 
1 162 TYR n 
1 163 TYR n 
1 164 LEU n 
1 165 GLN n 
1 166 TYR n 
1 167 LYS n 
1 168 ASN n 
1 169 VAL n 
1 170 ARG n 
1 171 PRO n 
1 172 ASP n 
1 173 TYR n 
1 174 VAL n 
1 175 HIS n 
1 176 ALA n 
1 177 ILE n 
1 178 TRP n 
1 179 LYS n 
1 180 ILE n 
1 181 ALA n 
1 182 ASN n 
1 183 TRP n 
1 184 LYS n 
1 185 ASN n 
1 186 ILE n 
1 187 SER n 
1 188 GLU n 
1 189 ARG n 
1 190 PHE n 
1 191 ALA n 
1 192 ASN n 
1 193 ALA n 
1 194 ARG n 
1 195 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               nematode 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'sod-3, C08A9.1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Caenorhabditis elegans' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     6239 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               OX326A 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pTrc-99A 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SODM2_CAEEL 
_struct_ref.pdbx_db_accession          P41977 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;KHTLPDLPFDYADLEPVISHEIMQLHHQKHHATYVNNLNQIEEKLHEAVSKGNLKEAIALQPALKFNGGGHINHSIFWTN
LAKDGGEPSKELMDTIKRDFGSLDNLQKRLSDITIAVQGSGWGWLGYCKKDKILKIATCANQDPLEGMVPLFGIDVWEHA
YYLQYKNVRPDYVHAIWKIANWKNISERFANARQ
;
_struct_ref.pdbx_align_begin           25 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3DC5 A 2 ? 195 ? P41977 25 ? 218 ? 1 194 
2 1 3DC5 C 2 ? 195 ? P41977 25 ? 218 ? 1 194 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3DC5 MET A 1 ? UNP P41977 ? ? 'INITIATING METHIONINE' 0 1 
2 3DC5 MET C 1 ? UNP P41977 ? ? 'INITIATING METHIONINE' 0 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE              ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE             ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE           ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'      ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE             ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE            ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'      ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE              ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE            ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE           ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE              ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE               ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE           ? 'C5 H11 N O2 S'  149.211 
MLI non-polymer         . 'MALONATE ION'       ? 'C3 H2 O4 -2'    102.046 
MN  non-polymer         . 'MANGANESE (II) ION' ? 'Mn 2'           54.938  
PHE 'L-peptide linking' y PHENYLALANINE        ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE              ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE               ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE            ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN           ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE             ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE               ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3DC5 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.54 
_exptl_crystal.density_percent_sol   51.63 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              9.2 
_exptl_crystal_grow.pdbx_details    '2.7M ammonium sulphate, 0.1M bicine, pH9.2, VAPOR DIFFUSION, SITTING DROP, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2007-05-25 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si (111) double crystal' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.060 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I03' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I03 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.060 
# 
_reflns.entry_id                     3DC5 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            1.70 
_reflns.d_resolution_low             44.07 
_reflns.number_all                   51295 
_reflns.number_obs                   49346 
_reflns.percent_possible_obs         96.2 
_reflns.pdbx_Rmerge_I_obs            0.076 
_reflns.pdbx_Rsym_value              0.076 
_reflns.pdbx_netI_over_sigmaI        5.0 
_reflns.B_iso_Wilson_estimate        21.4 
_reflns.pdbx_redundancy              3.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.70 
_reflns_shell.d_res_low              1.79 
_reflns_shell.percent_possible_all   95.8 
_reflns_shell.Rmerge_I_obs           0.364 
_reflns_shell.pdbx_Rsym_value        0.364 
_reflns_shell.meanI_over_sigI_obs    2.9 
_reflns_shell.pdbx_redundancy        3.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      7335 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3DC5 
_refine.ls_number_reflns_obs                     49346 
_refine.ls_number_reflns_all                     51295 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             44.07 
_refine.ls_d_res_high                            1.70 
_refine.ls_percent_reflns_obs                    95.82 
_refine.ls_R_factor_obs                          0.1912 
_refine.ls_R_factor_all                          0.1912 
_refine.ls_R_factor_R_work                       0.18936 
_refine.ls_R_factor_R_free                       0.22596 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  2502 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.956 
_refine.correlation_coeff_Fo_to_Fc_free          0.941 
_refine.B_iso_mean                               19.396 
_refine.aniso_B[1][1]                            0.06 
_refine.aniso_B[2][2]                            0.06 
_refine.aniso_B[3][3]                            -0.13 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1N0J' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             Isotropic 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.110 
_refine.pdbx_overall_ESU_R_Free                  0.109 
_refine.overall_SU_ML                            0.073 
_refine.overall_SU_B                             3.923 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3138 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         9 
_refine_hist.number_atoms_solvent             420 
_refine_hist.number_atoms_total               3567 
_refine_hist.d_res_high                       1.70 
_refine_hist.d_res_low                        44.07 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.013  0.021  ? 3230 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.398  1.928  ? 4377 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       4.430  5.000  ? 387  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       30.043 25.000 ? 160  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       11.321 15.000 ? 553  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       11.874 15.000 ? 10   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.101  0.200  ? 459  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.006  0.020  ? 2478 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.209  0.200  ? 1646 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.307  0.200  ? 2219 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.121  0.200  ? 332  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.167  0.200  ? 61   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.081  0.200  ? 27   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.855  1.500  ? 2014 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.149  2.000  ? 3102 'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.022  3.000  ? 1440 'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.029  4.500  ? 1275 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.700 
_refine_ls_shell.d_res_low                        1.744 
_refine_ls_shell.number_reflns_R_work             3348 
_refine_ls_shell.R_factor_R_work                  0.267 
_refine_ls_shell.percent_reflns_obs               95.46 
_refine_ls_shell.R_factor_R_free                  0.282 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             209 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                3557 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3DC5 
_struct.title                     'Crystal Structure of a manganese superoxide dismutases from Caenorhabditis elegans' 
_struct.pdbx_descriptor           'Manganese superoxide dismutase (E.C.1.15.11)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3DC5 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            
'alpha hairpin N domain, alpha/beta C domain, OXIDOREDUCTASE, Manganese, Metal-binding, Mitochondrion, Transit peptide' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 4 ? 
G N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 20  ? LYS A 30  ? SER A 19  LYS A 29  1 ? 11 
HELX_P HELX_P2  2  LYS A 30  ? GLY A 53  ? LYS A 29  GLY A 52  1 ? 24 
HELX_P HELX_P3  3  ASN A 54  ? LEU A 61  ? ASN A 53  LEU A 60  1 ? 8  
HELX_P HELX_P4  4  LEU A 61  ? ASN A 81  ? LEU A 60  ASN A 80  1 ? 21 
HELX_P HELX_P5  5  SER A 90  ? GLY A 102 ? SER A 89  GLY A 101 1 ? 13 
HELX_P HELX_P6  6  SER A 103 ? ALA A 117 ? SER A 102 ALA A 116 1 ? 15 
HELX_P HELX_P7  7  TRP A 158 ? ALA A 161 ? TRP A 157 ALA A 160 5 ? 4  
HELX_P HELX_P8  8  TYR A 162 ? LYS A 167 ? TYR A 161 LYS A 166 1 ? 6  
HELX_P HELX_P9  9  VAL A 169 ? TRP A 178 ? VAL A 168 TRP A 177 1 ? 10 
HELX_P HELX_P10 10 LYS A 179 ? ALA A 181 ? LYS A 178 ALA A 180 5 ? 3  
HELX_P HELX_P11 11 ASN A 182 ? GLN A 195 ? ASN A 181 GLN A 194 1 ? 14 
HELX_P HELX_P12 12 SER B 20  ? LYS B 30  ? SER C 19  LYS C 29  1 ? 11 
HELX_P HELX_P13 13 LYS B 30  ? GLY B 53  ? LYS C 29  GLY C 52  1 ? 24 
HELX_P HELX_P14 14 ASN B 54  ? LEU B 61  ? ASN C 53  LEU C 60  1 ? 8  
HELX_P HELX_P15 15 LEU B 61  ? ASN B 81  ? LEU C 60  ASN C 80  1 ? 21 
HELX_P HELX_P16 16 SER B 90  ? GLY B 102 ? SER C 89  GLY C 101 1 ? 13 
HELX_P HELX_P17 17 SER B 103 ? ALA B 117 ? SER C 102 ALA C 116 1 ? 15 
HELX_P HELX_P18 18 TRP B 158 ? ALA B 161 ? TRP C 157 ALA C 160 5 ? 4  
HELX_P HELX_P19 19 TYR B 162 ? LYS B 167 ? TYR C 161 LYS C 166 1 ? 6  
HELX_P HELX_P20 20 VAL B 169 ? TRP B 178 ? VAL C 168 TRP C 177 1 ? 10 
HELX_P HELX_P21 21 LYS B 179 ? ALA B 181 ? LYS C 178 ALA C 180 5 ? 3  
HELX_P HELX_P22 22 ASN B 182 ? ARG B 194 ? ASN C 181 ARG C 193 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 156 OD1 ? ? ? 1_555 C MN  . MN ? ? A ASP 155 A MN  195 1_555 ? ? ? ? ? ? ? 2.052 ? 
metalc2  metalc ? ? B ASP 156 OD1 ? ? ? 1_555 E MN  . MN ? ? C ASP 155 C MN  195 1_555 ? ? ? ? ? ? ? 2.073 ? 
metalc3  metalc ? ? A HIS 27  NE2 ? ? ? 1_555 C MN  . MN ? ? A HIS 26  A MN  195 1_555 ? ? ? ? ? ? ? 2.237 ? 
metalc4  metalc ? ? B HIS 27  NE2 ? ? ? 1_555 E MN  . MN ? ? C HIS 26  C MN  195 1_555 ? ? ? ? ? ? ? 2.219 ? 
metalc5  metalc ? ? A HIS 75  NE2 ? ? ? 1_555 C MN  . MN ? ? A HIS 74  A MN  195 1_555 ? ? ? ? ? ? ? 2.179 ? 
metalc6  metalc ? ? B HIS 75  NE2 ? ? ? 1_555 E MN  . MN ? ? C HIS 74  C MN  195 1_555 ? ? ? ? ? ? ? 2.192 ? 
metalc7  metalc ? ? A HIS 160 NE2 ? ? ? 1_555 C MN  . MN ? ? A HIS 159 A MN  195 1_555 ? ? ? ? ? ? ? 2.231 ? 
metalc8  metalc ? ? B HIS 160 NE2 ? ? ? 1_555 E MN  . MN ? ? C HIS 159 C MN  195 1_555 ? ? ? ? ? ? ? 2.128 ? 
metalc9  metalc ? ? C MN  .   MN  ? ? ? 1_555 F HOH . O  ? ? A MN  195 A HOH 197 1_555 ? ? ? ? ? ? ? 2.254 ? 
metalc10 metalc ? ? E MN  .   MN  ? ? ? 1_555 G HOH . O  ? ? C MN  195 C HOH 196 1_555 ? ? ? ? ? ? ? 2.260 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 16 A . ? GLU 15 A PRO 17 A ? PRO 16 A 1 2.67 
2 GLU 16 B . ? GLU 15 C PRO 17 B ? PRO 16 C 1 2.87 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 134 ? ALA A 141 ? ILE A 133 ALA A 140 
A 2 GLY A 122 ? CYS A 129 ? GLY A 121 CYS A 128 
A 3 VAL A 150 ? ASP A 156 ? VAL A 149 ASP A 155 
B 1 ILE B 134 ? ALA B 141 ? ILE C 133 ALA C 140 
B 2 GLY B 122 ? CYS B 129 ? GLY C 121 CYS C 128 
B 3 VAL B 150 ? ASP B 156 ? VAL C 149 ASP C 155 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ALA A 138 ? O ALA A 137 N TRP A 125 ? N TRP A 124 
A 2 3 N TYR A 128 ? N TYR A 127 O VAL A 150 ? O VAL A 149 
B 1 2 O LYS B 136 ? O LYS C 135 N GLY B 127 ? N GLY C 126 
B 2 3 N LEU B 126 ? N LEU C 125 O LEU B 152 ? O LEU C 151 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MN C 195'  
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MN A 195'  
AC3 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MLI A 196' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 HIS B 27  ? HIS C 26  . ? 1_555 ? 
2 AC1 4 HIS B 75  ? HIS C 74  . ? 1_555 ? 
3 AC1 4 ASP B 156 ? ASP C 155 . ? 1_555 ? 
4 AC1 4 HIS B 160 ? HIS C 159 . ? 1_555 ? 
5 AC2 4 HIS A 27  ? HIS A 26  . ? 1_555 ? 
6 AC2 4 HIS A 75  ? HIS A 74  . ? 1_555 ? 
7 AC2 4 ASP A 156 ? ASP A 155 . ? 1_555 ? 
8 AC2 4 HIS A 160 ? HIS A 159 . ? 1_555 ? 
9 AC3 1 ASN A 168 ? ASN A 167 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3DC5 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3DC5 
_atom_sites.fract_transf_matrix[1][1]   0.012228 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012228 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007351 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . LYS A 1 2   ? 27.309  3.210   20.869  1.00 24.51 ? 1   LYS A N   1 
ATOM   2    C  CA  . LYS A 1 2   ? 28.217  2.128   20.352  1.00 23.65 ? 1   LYS A CA  1 
ATOM   3    C  C   . LYS A 1 2   ? 28.803  2.476   18.959  1.00 22.59 ? 1   LYS A C   1 
ATOM   4    O  O   . LYS A 1 2   ? 30.016  2.444   18.783  1.00 22.27 ? 1   LYS A O   1 
ATOM   5    C  CB  . LYS A 1 2   ? 27.469  0.788   20.305  1.00 24.10 ? 1   LYS A CB  1 
ATOM   6    N  N   . HIS A 1 3   ? 27.942  2.797   17.982  1.00 21.07 ? 2   HIS A N   1 
ATOM   7    C  CA  . HIS A 1 3   ? 28.398  3.166   16.625  1.00 19.93 ? 2   HIS A CA  1 
ATOM   8    C  C   . HIS A 1 3   ? 29.298  4.395   16.676  1.00 18.55 ? 2   HIS A C   1 
ATOM   9    O  O   . HIS A 1 3   ? 29.105  5.277   17.506  1.00 19.25 ? 2   HIS A O   1 
ATOM   10   C  CB  . HIS A 1 3   ? 27.207  3.449   15.688  1.00 19.78 ? 2   HIS A CB  1 
ATOM   11   C  CG  . HIS A 1 3   ? 26.302  2.271   15.488  1.00 19.84 ? 2   HIS A CG  1 
ATOM   12   N  ND1 . HIS A 1 3   ? 26.622  1.216   14.660  1.00 18.70 ? 2   HIS A ND1 1 
ATOM   13   C  CD2 . HIS A 1 3   ? 25.080  1.990   15.999  1.00 19.09 ? 2   HIS A CD2 1 
ATOM   14   C  CE1 . HIS A 1 3   ? 25.639  0.334   14.673  1.00 21.86 ? 2   HIS A CE1 1 
ATOM   15   N  NE2 . HIS A 1 3   ? 24.687  0.785   15.474  1.00 20.78 ? 2   HIS A NE2 1 
ATOM   16   N  N   . THR A 1 4   ? 30.271  4.472   15.781  1.00 17.46 ? 3   THR A N   1 
ATOM   17   C  CA  . THR A 1 4   ? 31.200  5.602   15.778  1.00 17.09 ? 3   THR A CA  1 
ATOM   18   C  C   . THR A 1 4   ? 31.421  6.158   14.384  1.00 16.30 ? 3   THR A C   1 
ATOM   19   O  O   . THR A 1 4   ? 31.296  5.441   13.385  1.00 17.13 ? 3   THR A O   1 
ATOM   20   C  CB  . THR A 1 4   ? 32.577  5.179   16.325  1.00 17.36 ? 3   THR A CB  1 
ATOM   21   O  OG1 . THR A 1 4   ? 33.112  4.144   15.488  1.00 17.58 ? 3   THR A OG1 1 
ATOM   22   C  CG2 . THR A 1 4   ? 32.441  4.671   17.742  1.00 16.88 ? 3   THR A CG2 1 
ATOM   23   N  N   . LEU A 1 5   ? 31.787  7.426   14.336  1.00 15.26 ? 4   LEU A N   1 
ATOM   24   C  CA  . LEU A 1 5   ? 32.117  8.084   13.087  1.00 14.48 ? 4   LEU A CA  1 
ATOM   25   C  C   . LEU A 1 5   ? 33.460  7.575   12.551  1.00 14.67 ? 4   LEU A C   1 
ATOM   26   O  O   . LEU A 1 5   ? 34.501  7.747   13.200  1.00 14.89 ? 4   LEU A O   1 
ATOM   27   C  CB  . LEU A 1 5   ? 32.125  9.599   13.269  1.00 14.17 ? 4   LEU A CB  1 
ATOM   28   C  CG  . LEU A 1 5   ? 32.437  10.390  12.000  1.00 13.03 ? 4   LEU A CG  1 
ATOM   29   C  CD1 . LEU A 1 5   ? 31.250  10.309  11.013  1.00 15.23 ? 4   LEU A CD1 1 
ATOM   30   C  CD2 . LEU A 1 5   ? 32.717  11.852  12.339  1.00 15.73 ? 4   LEU A CD2 1 
ATOM   31   N  N   . PRO A 1 6   ? 33.449  6.924   11.378  1.00 14.96 ? 5   PRO A N   1 
ATOM   32   C  CA  . PRO A 1 6   ? 34.733  6.454   10.859  1.00 14.99 ? 5   PRO A CA  1 
ATOM   33   C  C   . PRO A 1 6   ? 35.609  7.580   10.332  1.00 15.22 ? 5   PRO A C   1 
ATOM   34   O  O   . PRO A 1 6   ? 35.093  8.520   9.757   1.00 16.22 ? 5   PRO A O   1 
ATOM   35   C  CB  . PRO A 1 6   ? 34.330  5.570   9.687   1.00 15.47 ? 5   PRO A CB  1 
ATOM   36   C  CG  . PRO A 1 6   ? 33.031  6.115   9.222   1.00 14.57 ? 5   PRO A CG  1 
ATOM   37   C  CD  . PRO A 1 6   ? 32.328  6.590   10.473  1.00 14.22 ? 5   PRO A CD  1 
ATOM   38   N  N   . ASP A 1 7   ? 36.933  7.478   10.498  1.00 15.77 ? 6   ASP A N   1 
ATOM   39   C  CA  . ASP A 1 7   ? 37.794  8.471   9.883   1.00 16.19 ? 6   ASP A CA  1 
ATOM   40   C  C   . ASP A 1 7   ? 37.715  8.305   8.374   1.00 15.54 ? 6   ASP A C   1 
ATOM   41   O  O   . ASP A 1 7   ? 37.593  7.177   7.884   1.00 15.33 ? 6   ASP A O   1 
ATOM   42   C  CB  . ASP A 1 7   ? 39.256  8.256   10.302  1.00 17.15 ? 6   ASP A CB  1 
ATOM   43   C  CG  . ASP A 1 7   ? 39.521  8.600   11.749  1.00 18.36 ? 6   ASP A CG  1 
ATOM   44   O  OD1 . ASP A 1 7   ? 40.554  8.111   12.267  1.00 21.35 ? 6   ASP A OD1 1 
ATOM   45   O  OD2 . ASP A 1 7   ? 38.751  9.374   12.358  1.00 19.95 ? 6   ASP A OD2 1 
ATOM   46   N  N   . LEU A 1 8   ? 37.844  9.412   7.640   1.00 14.93 ? 7   LEU A N   1 
ATOM   47   C  CA  . LEU A 1 8   ? 37.942  9.355   6.178   1.00 15.06 ? 7   LEU A CA  1 
ATOM   48   C  C   . LEU A 1 8   ? 39.270  8.673   5.822   1.00 15.34 ? 7   LEU A C   1 
ATOM   49   O  O   . LEU A 1 8   ? 40.199  8.716   6.615   1.00 14.94 ? 7   LEU A O   1 
ATOM   50   C  CB  . LEU A 1 8   ? 37.932  10.765  5.564   1.00 15.03 ? 7   LEU A CB  1 
ATOM   51   C  CG  . LEU A 1 8   ? 36.742  11.700  5.774   1.00 14.18 ? 7   LEU A CG  1 
ATOM   52   C  CD1 . LEU A 1 8   ? 36.941  12.976  4.973   1.00 17.85 ? 7   LEU A CD1 1 
ATOM   53   C  CD2 . LEU A 1 8   ? 35.486  11.067  5.258   1.00 14.64 ? 7   LEU A CD2 1 
ATOM   54   N  N   . PRO A 1 9   ? 39.345  8.016   4.647   1.00 15.63 ? 8   PRO A N   1 
ATOM   55   C  CA  . PRO A 1 9   ? 40.611  7.411   4.198   1.00 16.56 ? 8   PRO A CA  1 
ATOM   56   C  C   . PRO A 1 9   ? 41.542  8.394   3.484   1.00 16.43 ? 8   PRO A C   1 
ATOM   57   O  O   . PRO A 1 9   ? 42.529  7.981   2.867   1.00 17.33 ? 8   PRO A O   1 
ATOM   58   C  CB  . PRO A 1 9   ? 40.158  6.297   3.240   1.00 16.97 ? 8   PRO A CB  1 
ATOM   59   C  CG  . PRO A 1 9   ? 38.701  6.537   2.948   1.00 16.78 ? 8   PRO A CG  1 
ATOM   60   C  CD  . PRO A 1 9   ? 38.233  7.753   3.712   1.00 17.16 ? 8   PRO A CD  1 
ATOM   61   N  N   . PHE A 1 10  ? 41.244  9.688   3.590   1.00 16.74 ? 9   PHE A N   1 
ATOM   62   C  CA  . PHE A 1 10  ? 42.031  10.730  2.945   1.00 16.70 ? 9   PHE A CA  1 
ATOM   63   C  C   . PHE A 1 10  ? 41.817  12.022  3.712   1.00 16.82 ? 9   PHE A C   1 
ATOM   64   O  O   . PHE A 1 10  ? 40.950  12.066  4.586   1.00 17.66 ? 9   PHE A O   1 
ATOM   65   C  CB  . PHE A 1 10  ? 41.576  10.893  1.491   1.00 16.77 ? 9   PHE A CB  1 
ATOM   66   C  CG  . PHE A 1 10  ? 40.086  10.963  1.343   1.00 16.29 ? 9   PHE A CG  1 
ATOM   67   C  CD1 . PHE A 1 10  ? 39.357  9.818   1.036   1.00 17.19 ? 9   PHE A CD1 1 
ATOM   68   C  CD2 . PHE A 1 10  ? 39.408  12.154  1.549   1.00 17.44 ? 9   PHE A CD2 1 
ATOM   69   C  CE1 . PHE A 1 10  ? 37.965  9.858   0.915   1.00 15.14 ? 9   PHE A CE1 1 
ATOM   70   C  CE2 . PHE A 1 10  ? 38.003  12.202  1.431   1.00 15.19 ? 9   PHE A CE2 1 
ATOM   71   C  CZ  . PHE A 1 10  ? 37.293  11.043  1.122   1.00 15.15 ? 9   PHE A CZ  1 
ATOM   72   N  N   . ASP A 1 11  ? 42.584  13.070  3.393   1.00 16.84 ? 10  ASP A N   1 
ATOM   73   C  CA  . ASP A 1 11  ? 42.405  14.369  4.049   1.00 17.27 ? 10  ASP A CA  1 
ATOM   74   C  C   . ASP A 1 11  ? 41.252  15.139  3.393   1.00 16.84 ? 10  ASP A C   1 
ATOM   75   O  O   . ASP A 1 11  ? 40.884  14.856  2.245   1.00 15.87 ? 10  ASP A O   1 
ATOM   76   C  CB  . ASP A 1 11  ? 43.677  15.203  3.993   1.00 17.82 ? 10  ASP A CB  1 
ATOM   77   C  CG  . ASP A 1 11  ? 44.803  14.606  4.784   1.00 20.37 ? 10  ASP A CG  1 
ATOM   78   O  OD1 . ASP A 1 11  ? 44.561  13.980  5.847   1.00 23.20 ? 10  ASP A OD1 1 
ATOM   79   O  OD2 . ASP A 1 11  ? 45.936  14.784  4.328   1.00 21.77 ? 10  ASP A OD2 1 
ATOM   80   N  N   . TYR A 1 12  ? 40.706  16.114  4.119   1.00 16.40 ? 11  TYR A N   1 
ATOM   81   C  CA  . TYR A 1 12  ? 39.487  16.831  3.682   1.00 16.78 ? 11  TYR A CA  1 
ATOM   82   C  C   . TYR A 1 12  ? 39.555  17.501  2.305   1.00 16.11 ? 11  TYR A C   1 
ATOM   83   O  O   . TYR A 1 12  ? 38.533  17.585  1.622   1.00 15.24 ? 11  TYR A O   1 
ATOM   84   C  CB  . TYR A 1 12  ? 39.001  17.813  4.759   1.00 17.06 ? 11  TYR A CB  1 
ATOM   85   C  CG  . TYR A 1 12  ? 38.467  17.112  5.982   1.00 17.54 ? 11  TYR A CG  1 
ATOM   86   C  CD1 . TYR A 1 12  ? 37.260  16.418  5.933   1.00 17.07 ? 11  TYR A CD1 1 
ATOM   87   C  CD2 . TYR A 1 12  ? 39.190  17.097  7.178   1.00 19.93 ? 11  TYR A CD2 1 
ATOM   88   C  CE1 . TYR A 1 12  ? 36.755  15.753  7.042   1.00 18.64 ? 11  TYR A CE1 1 
ATOM   89   C  CE2 . TYR A 1 12  ? 38.706  16.420  8.303   1.00 21.52 ? 11  TYR A CE2 1 
ATOM   90   C  CZ  . TYR A 1 12  ? 37.471  15.757  8.224   1.00 18.67 ? 11  TYR A CZ  1 
ATOM   91   O  OH  . TYR A 1 12  ? 36.957  15.069  9.311   1.00 18.43 ? 11  TYR A OH  1 
ATOM   92   N  N   . ALA A 1 13  ? 40.755  17.925  1.885   1.00 16.79 ? 12  ALA A N   1 
ATOM   93   C  CA  . ALA A 1 13  ? 40.935  18.633  0.601   1.00 16.58 ? 12  ALA A CA  1 
ATOM   94   C  C   . ALA A 1 13  ? 41.405  17.745  -0.551  1.00 17.23 ? 12  ALA A C   1 
ATOM   95   O  O   . ALA A 1 13  ? 41.665  18.245  -1.662  1.00 16.55 ? 12  ALA A O   1 
ATOM   96   C  CB  . ALA A 1 13  ? 41.917  19.826  0.765   1.00 16.96 ? 12  ALA A CB  1 
ATOM   97   N  N   . ASP A 1 14  ? 41.548  16.443  -0.285  1.00 16.83 ? 13  ASP A N   1 
ATOM   98   C  CA  . ASP A 1 14  ? 42.156  15.515  -1.251  1.00 16.81 ? 13  ASP A CA  1 
ATOM   99   C  C   . ASP A 1 14  ? 41.308  15.225  -2.481  1.00 17.31 ? 13  ASP A C   1 
ATOM   100  O  O   . ASP A 1 14  ? 41.813  14.696  -3.474  1.00 17.13 ? 13  ASP A O   1 
ATOM   101  C  CB  . ASP A 1 14  ? 42.493  14.192  -0.568  1.00 16.90 ? 13  ASP A CB  1 
ATOM   102  C  CG  . ASP A 1 14  ? 43.778  14.248  0.249   1.00 17.80 ? 13  ASP A CG  1 
ATOM   103  O  OD1 . ASP A 1 14  ? 44.440  15.316  0.323   1.00 18.48 ? 13  ASP A OD1 1 
ATOM   104  O  OD2 . ASP A 1 14  ? 44.147  13.190  0.809   1.00 16.40 ? 13  ASP A OD2 1 
ATOM   105  N  N   . LEU A 1 15  ? 40.014  15.530  -2.400  1.00 15.68 ? 14  LEU A N   1 
ATOM   106  C  CA  . LEU A 1 15  ? 39.093  15.284  -3.524  1.00 15.88 ? 14  LEU A CA  1 
ATOM   107  C  C   . LEU A 1 15  ? 38.883  16.506  -4.416  1.00 16.49 ? 14  LEU A C   1 
ATOM   108  O  O   . LEU A 1 15  ? 38.120  16.458  -5.402  1.00 16.87 ? 14  LEU A O   1 
ATOM   109  C  CB  . LEU A 1 15  ? 37.744  14.782  -2.998  1.00 15.05 ? 14  LEU A CB  1 
ATOM   110  C  CG  . LEU A 1 15  ? 37.862  13.473  -2.194  1.00 15.73 ? 14  LEU A CG  1 
ATOM   111  C  CD1 . LEU A 1 15  ? 36.461  12.933  -1.876  1.00 14.96 ? 14  LEU A CD1 1 
ATOM   112  C  CD2 . LEU A 1 15  ? 38.693  12.402  -2.938  1.00 15.56 ? 14  LEU A CD2 1 
ATOM   113  N  N   . GLU A 1 16  ? 39.530  17.601  -4.050  1.00 17.25 ? 15  GLU A N   1 
ATOM   114  C  CA  . GLU A 1 16  ? 39.491  18.806  -4.866  1.00 19.24 ? 15  GLU A CA  1 
ATOM   115  C  C   . GLU A 1 16  ? 40.205  18.496  -6.183  1.00 19.61 ? 15  GLU A C   1 
ATOM   116  O  O   . GLU A 1 16  ? 41.204  17.748  -6.197  1.00 20.00 ? 15  GLU A O   1 
ATOM   117  C  CB  . GLU A 1 16  ? 40.160  19.973  -4.134  1.00 19.07 ? 15  GLU A CB  1 
ATOM   118  C  CG  . GLU A 1 16  ? 39.452  20.356  -2.829  1.00 18.15 ? 15  GLU A CG  1 
ATOM   119  C  CD  . GLU A 1 16  ? 39.934  21.655  -2.210  1.00 20.56 ? 15  GLU A CD  1 
ATOM   120  O  OE1 . GLU A 1 16  ? 41.058  22.128  -2.549  1.00 21.16 ? 15  GLU A OE1 1 
ATOM   121  O  OE2 . GLU A 1 16  ? 39.185  22.228  -1.387  1.00 20.71 ? 15  GLU A OE2 1 
ATOM   122  N  N   . PRO A 1 17  ? 39.754  19.097  -7.295  1.00 20.35 ? 16  PRO A N   1 
ATOM   123  C  CA  . PRO A 1 17  ? 38.688  20.073  -7.465  1.00 20.09 ? 16  PRO A CA  1 
ATOM   124  C  C   . PRO A 1 17  ? 37.269  19.526  -7.626  1.00 19.89 ? 16  PRO A C   1 
ATOM   125  O  O   . PRO A 1 17  ? 36.361  20.308  -7.933  1.00 20.19 ? 16  PRO A O   1 
ATOM   126  C  CB  . PRO A 1 17  ? 39.120  20.789  -8.751  1.00 20.89 ? 16  PRO A CB  1 
ATOM   127  C  CG  . PRO A 1 17  ? 39.724  19.711  -9.565  1.00 20.05 ? 16  PRO A CG  1 
ATOM   128  C  CD  . PRO A 1 17  ? 40.441  18.812  -8.577  1.00 20.41 ? 16  PRO A CD  1 
ATOM   129  N  N   . VAL A 1 18  ? 37.071  18.227  -7.409  1.00 18.62 ? 17  VAL A N   1 
ATOM   130  C  CA  . VAL A 1 18  ? 35.748  17.589  -7.598  1.00 18.90 ? 17  VAL A CA  1 
ATOM   131  C  C   . VAL A 1 18  ? 34.795  17.845  -6.421  1.00 18.70 ? 17  VAL A C   1 
ATOM   132  O  O   . VAL A 1 18  ? 33.633  18.134  -6.632  1.00 19.45 ? 17  VAL A O   1 
ATOM   133  C  CB  . VAL A 1 18  ? 35.855  16.079  -7.949  1.00 19.48 ? 17  VAL A CB  1 
ATOM   134  C  CG1 . VAL A 1 18  ? 34.472  15.435  -8.114  1.00 19.03 ? 17  VAL A CG1 1 
ATOM   135  C  CG2 . VAL A 1 18  ? 36.664  15.905  -9.236  1.00 19.73 ? 17  VAL A CG2 1 
ATOM   136  N  N   . ILE A 1 19  ? 35.288  17.724  -5.194  1.00 17.60 ? 18  ILE A N   1 
ATOM   137  C  CA  . ILE A 1 19  ? 34.486  18.035  -4.006  1.00 16.90 ? 18  ILE A CA  1 
ATOM   138  C  C   . ILE A 1 19  ? 35.372  18.825  -3.066  1.00 16.41 ? 18  ILE A C   1 
ATOM   139  O  O   . ILE A 1 19  ? 36.488  18.406  -2.750  1.00 16.40 ? 18  ILE A O   1 
ATOM   140  C  CB  . ILE A 1 19  ? 33.942  16.787  -3.255  1.00 16.57 ? 18  ILE A CB  1 
ATOM   141  C  CG1 . ILE A 1 19  ? 33.253  15.796  -4.202  1.00 17.00 ? 18  ILE A CG1 1 
ATOM   142  C  CG2 . ILE A 1 19  ? 33.029  17.252  -2.107  1.00 14.81 ? 18  ILE A CG2 1 
ATOM   143  C  CD1 . ILE A 1 19  ? 32.823  14.466  -3.538  1.00 16.81 ? 18  ILE A CD1 1 
ATOM   144  N  N   . SER A 1 20  ? 34.854  19.962  -2.612  1.00 16.82 ? 19  SER A N   1 
ATOM   145  C  CA  . SER A 1 20  ? 35.632  20.928  -1.842  1.00 15.43 ? 19  SER A CA  1 
ATOM   146  C  C   . SER A 1 20  ? 35.951  20.486  -0.428  1.00 15.83 ? 19  SER A C   1 
ATOM   147  O  O   . SER A 1 20  ? 35.251  19.639  0.138   1.00 15.31 ? 19  SER A O   1 
ATOM   148  C  CB  . SER A 1 20  ? 34.864  22.246  -1.763  1.00 16.03 ? 19  SER A CB  1 
ATOM   149  O  OG  . SER A 1 20  ? 33.704  22.095  -0.954  1.00 14.00 ? 19  SER A OG  1 
ATOM   150  N  N   . HIS A 1 21  ? 37.031  21.063  0.125   1.00 15.60 ? 20  HIS A N   1 
ATOM   151  C  CA  . HIS A 1 21  ? 37.354  20.905  1.536   1.00 15.92 ? 20  HIS A CA  1 
ATOM   152  C  C   . HIS A 1 21  ? 36.144  21.192  2.453   1.00 16.28 ? 20  HIS A C   1 
ATOM   153  O  O   . HIS A 1 21  ? 35.844  20.386  3.337   1.00 14.24 ? 20  HIS A O   1 
ATOM   154  C  CB  . HIS A 1 21  ? 38.544  21.815  1.919   1.00 17.05 ? 20  HIS A CB  1 
ATOM   155  C  CG  . HIS A 1 21  ? 38.845  21.830  3.388   1.00 19.60 ? 20  HIS A CG  1 
ATOM   156  N  ND1 . HIS A 1 21  ? 39.810  21.029  3.962   1.00 24.50 ? 20  HIS A ND1 1 
ATOM   157  C  CD2 . HIS A 1 21  ? 38.319  22.564  4.398   1.00 22.39 ? 20  HIS A CD2 1 
ATOM   158  C  CE1 . HIS A 1 21  ? 39.865  21.267  5.261   1.00 24.00 ? 20  HIS A CE1 1 
ATOM   159  N  NE2 . HIS A 1 21  ? 38.966  22.191  5.551   1.00 25.36 ? 20  HIS A NE2 1 
ATOM   160  N  N   . GLU A 1 22  ? 35.475  22.349  2.266   1.00 15.67 ? 21  GLU A N   1 
ATOM   161  C  CA  . GLU A 1 22  ? 34.339  22.681  3.143   1.00 16.40 ? 21  GLU A CA  1 
ATOM   162  C  C   . GLU A 1 22  ? 33.244  21.620  3.104   1.00 14.93 ? 21  GLU A C   1 
ATOM   163  O  O   . GLU A 1 22  ? 32.666  21.256  4.144   1.00 15.60 ? 21  GLU A O   1 
ATOM   164  C  CB  . GLU A 1 22  ? 33.760  24.073  2.860   1.00 17.20 ? 21  GLU A CB  1 
ATOM   165  C  CG  . GLU A 1 22  ? 32.650  24.399  3.859   1.00 19.33 ? 21  GLU A CG  1 
ATOM   166  C  CD  . GLU A 1 22  ? 32.155  25.851  3.809   1.00 20.44 ? 21  GLU A CD  1 
ATOM   167  O  OE1 . GLU A 1 22  ? 32.320  26.528  2.773   1.00 21.55 ? 21  GLU A OE1 1 
ATOM   168  O  OE2 . GLU A 1 22  ? 31.575  26.285  4.823   1.00 23.15 ? 21  GLU A OE2 1 
ATOM   169  N  N   . ILE A 1 23  ? 32.950  21.111  1.914   1.00 15.03 ? 22  ILE A N   1 
ATOM   170  C  CA  . ILE A 1 23  ? 31.937  20.041  1.779   1.00 13.57 ? 22  ILE A CA  1 
ATOM   171  C  C   . ILE A 1 23  ? 32.369  18.766  2.526   1.00 13.09 ? 22  ILE A C   1 
ATOM   172  O  O   . ILE A 1 23  ? 31.636  18.252  3.374   1.00 11.43 ? 22  ILE A O   1 
ATOM   173  C  CB  . ILE A 1 23  ? 31.648  19.694  0.312   1.00 14.39 ? 22  ILE A CB  1 
ATOM   174  C  CG1 . ILE A 1 23  ? 30.961  20.881  -0.387  1.00 13.17 ? 22  ILE A CG1 1 
ATOM   175  C  CG2 . ILE A 1 23  ? 30.784  18.459  0.222   1.00 14.43 ? 22  ILE A CG2 1 
ATOM   176  C  CD1 . ILE A 1 23  ? 30.632  20.613  -1.834  1.00 15.68 ? 22  ILE A CD1 1 
ATOM   177  N  N   . MET A 1 24  ? 33.593  18.290  2.248   1.00 12.01 ? 23  MET A N   1 
ATOM   178  C  CA  . MET A 1 24  ? 34.076  17.087  2.950   1.00 12.80 ? 23  MET A CA  1 
ATOM   179  C  C   . MET A 1 24  ? 34.012  17.267  4.453   1.00 12.27 ? 23  MET A C   1 
ATOM   180  O  O   . MET A 1 24  ? 33.553  16.377  5.168   1.00 12.33 ? 23  MET A O   1 
ATOM   181  C  CB  . MET A 1 24  ? 35.503  16.680  2.519   1.00 13.61 ? 23  MET A CB  1 
ATOM   182  C  CG  . MET A 1 24  ? 35.600  16.254  1.064   1.00 15.18 ? 23  MET A CG  1 
ATOM   183  S  SD  . MET A 1 24  ? 34.328  15.076  0.561   1.00 17.43 ? 23  MET A SD  1 
ATOM   184  C  CE  . MET A 1 24  ? 34.588  13.700  1.657   1.00 18.34 ? 23  MET A CE  1 
ATOM   185  N  N   . GLN A 1 25  ? 34.421  18.440  4.928   1.00 12.96 ? 24  GLN A N   1 
ATOM   186  C  CA  . GLN A 1 25  ? 34.449  18.706  6.350   1.00 14.01 ? 24  GLN A CA  1 
ATOM   187  C  C   . GLN A 1 25  ? 33.064  18.671  6.959   1.00 12.87 ? 24  GLN A C   1 
ATOM   188  O  O   . GLN A 1 25  ? 32.837  17.985  7.955   1.00 12.88 ? 24  GLN A O   1 
ATOM   189  C  CB  . GLN A 1 25  ? 35.075  20.052  6.618   1.00 15.75 ? 24  GLN A CB  1 
ATOM   190  C  CG  . GLN A 1 25  ? 35.260  20.357  8.079   1.00 20.98 ? 24  GLN A CG  1 
ATOM   191  C  CD  . GLN A 1 25  ? 36.258  21.493  8.275   1.00 25.96 ? 24  GLN A CD  1 
ATOM   192  O  OE1 . GLN A 1 25  ? 36.201  22.511  7.568   1.00 29.54 ? 24  GLN A OE1 1 
ATOM   193  N  NE2 . GLN A 1 25  ? 37.176  21.327  9.227   1.00 31.84 ? 24  GLN A NE2 1 
ATOM   194  N  N   . LEU A 1 26  ? 32.142  19.421  6.367   1.00 11.15 ? 25  LEU A N   1 
ATOM   195  C  CA  . LEU A 1 26  ? 30.775  19.443  6.862   1.00 11.74 ? 25  LEU A CA  1 
ATOM   196  C  C   . LEU A 1 26  ? 30.126  18.061  6.710   1.00 11.85 ? 25  LEU A C   1 
ATOM   197  O  O   . LEU A 1 26  ? 29.437  17.549  7.614   1.00 12.06 ? 25  LEU A O   1 
ATOM   198  C  CB  . LEU A 1 26  ? 29.970  20.457  6.058   1.00 10.84 ? 25  LEU A CB  1 
ATOM   199  C  CG  . LEU A 1 26  ? 30.282  21.900  6.454   1.00 14.38 ? 25  LEU A CG  1 
ATOM   200  C  CD1 . LEU A 1 26  ? 29.799  22.848  5.359   1.00 15.89 ? 25  LEU A CD1 1 
ATOM   201  C  CD2 . LEU A 1 26  ? 29.662  22.218  7.815   1.00 15.71 ? 25  LEU A CD2 1 
ATOM   202  N  N   . HIS A 1 27  ? 30.309  17.484  5.539   1.00 11.96 ? 26  HIS A N   1 
ATOM   203  C  CA  . HIS A 1 27  ? 29.642  16.234  5.224   1.00 11.63 ? 26  HIS A CA  1 
ATOM   204  C  C   . HIS A 1 27  ? 30.043  15.154  6.238   1.00 12.21 ? 26  HIS A C   1 
ATOM   205  O  O   . HIS A 1 27  ? 29.219  14.422  6.732   1.00 12.98 ? 26  HIS A O   1 
ATOM   206  C  CB  . HIS A 1 27  ? 30.040  15.769  3.839   1.00 13.00 ? 26  HIS A CB  1 
ATOM   207  C  CG  . HIS A 1 27  ? 29.034  14.883  3.190   1.00 11.82 ? 26  HIS A CG  1 
ATOM   208  N  ND1 . HIS A 1 27  ? 29.184  14.435  1.898   1.00 12.12 ? 26  HIS A ND1 1 
ATOM   209  C  CD2 . HIS A 1 27  ? 27.815  14.429  3.614   1.00 10.99 ? 26  HIS A CD2 1 
ATOM   210  C  CE1 . HIS A 1 27  ? 28.125  13.720  1.560   1.00 12.76 ? 26  HIS A CE1 1 
ATOM   211  N  NE2 . HIS A 1 27  ? 27.302  13.678  2.588   1.00 10.72 ? 26  HIS A NE2 1 
ATOM   212  N  N   . HIS A 1 28  ? 31.330  15.114  6.581   1.00 11.53 ? 27  HIS A N   1 
ATOM   213  C  CA  . HIS A 1 28  ? 31.817  14.095  7.499   1.00 12.52 ? 27  HIS A CA  1 
ATOM   214  C  C   . HIS A 1 28  ? 31.556  14.454  8.974   1.00 12.31 ? 27  HIS A C   1 
ATOM   215  O  O   . HIS A 1 28  ? 30.895  13.691  9.682   1.00 13.24 ? 27  HIS A O   1 
ATOM   216  C  CB  . HIS A 1 28  ? 33.297  13.868  7.218   1.00 13.07 ? 27  HIS A CB  1 
ATOM   217  C  CG  . HIS A 1 28  ? 33.971  12.938  8.175   1.00 13.06 ? 27  HIS A CG  1 
ATOM   218  N  ND1 . HIS A 1 28  ? 33.752  11.576  8.185   1.00 16.41 ? 27  HIS A ND1 1 
ATOM   219  C  CD2 . HIS A 1 28  ? 34.907  13.176  9.119   1.00 10.88 ? 27  HIS A CD2 1 
ATOM   220  C  CE1 . HIS A 1 28  ? 34.517  11.020  9.112   1.00 9.08  ? 27  HIS A CE1 1 
ATOM   221  N  NE2 . HIS A 1 28  ? 35.228  11.967  9.692   1.00 15.09 ? 27  HIS A NE2 1 
ATOM   222  N  N   . GLN A 1 29  ? 32.006  15.642  9.399   1.00 11.95 ? 28  GLN A N   1 
ATOM   223  C  CA  . GLN A 1 29  ? 31.985  16.050  10.805  1.00 12.98 ? 28  GLN A CA  1 
ATOM   224  C  C   . GLN A 1 29  ? 30.634  16.490  11.360  1.00 12.56 ? 28  GLN A C   1 
ATOM   225  O  O   . GLN A 1 29  ? 30.449  16.496  12.570  1.00 12.42 ? 28  GLN A O   1 
ATOM   226  C  CB  . GLN A 1 29  ? 32.991  17.183  11.056  1.00 13.20 ? 28  GLN A CB  1 
ATOM   227  C  CG  . GLN A 1 29  ? 34.422  16.825  10.689  1.00 15.06 ? 28  GLN A CG  1 
ATOM   228  C  CD  . GLN A 1 29  ? 35.421  17.940  10.986  1.00 16.11 ? 28  GLN A CD  1 
ATOM   229  O  OE1 . GLN A 1 29  ? 36.641  17.719  10.928  1.00 21.83 ? 28  GLN A OE1 1 
ATOM   230  N  NE2 . GLN A 1 29  ? 34.918  19.135  11.308  1.00 17.38 ? 28  GLN A NE2 1 
ATOM   231  N  N   . LYS A 1 30  ? 29.734  16.891  10.469  1.00 12.09 ? 29  LYS A N   1 
ATOM   232  C  CA  . LYS A 1 30  ? 28.385  17.318  10.864  1.00 12.63 ? 29  LYS A CA  1 
ATOM   233  C  C   . LYS A 1 30  ? 27.323  16.321  10.429  1.00 12.53 ? 29  LYS A C   1 
ATOM   234  O  O   . LYS A 1 30  ? 26.680  15.689  11.268  1.00 11.63 ? 29  LYS A O   1 
ATOM   235  C  CB  . LYS A 1 30  ? 28.085  18.727  10.312  1.00 12.94 ? 29  LYS A CB  1 
ATOM   236  C  CG  . LYS A 1 30  ? 28.974  19.855  10.905  1.00 12.62 ? 29  LYS A CG  1 
ATOM   237  C  CD  . LYS A 1 30  ? 28.800  19.945  12.411  1.00 14.32 ? 29  LYS A CD  1 
ATOM   238  C  CE  . LYS A 1 30  ? 29.481  21.160  12.963  1.00 15.06 ? 29  LYS A CE  1 
ATOM   239  N  NZ  . LYS A 1 30  ? 29.222  21.301  14.427  1.00 14.61 ? 29  LYS A NZ  1 
ATOM   240  N  N   . HIS A 1 31  ? 27.165  16.137  9.121   1.00 12.65 ? 30  HIS A N   1 
ATOM   241  C  CA  . HIS A 1 31  ? 26.100  15.288  8.610   1.00 12.74 ? 30  HIS A CA  1 
ATOM   242  C  C   . HIS A 1 31  ? 26.258  13.831  9.021   1.00 11.93 ? 30  HIS A C   1 
ATOM   243  O  O   . HIS A 1 31  ? 25.369  13.269  9.637   1.00 11.54 ? 30  HIS A O   1 
ATOM   244  C  CB  . HIS A 1 31  ? 25.986  15.422  7.090   1.00 13.24 ? 30  HIS A CB  1 
ATOM   245  C  CG  . HIS A 1 31  ? 25.486  16.764  6.650   1.00 14.55 ? 30  HIS A CG  1 
ATOM   246  N  ND1 . HIS A 1 31  ? 24.138  17.057  6.571   1.00 12.06 ? 30  HIS A ND1 1 
ATOM   247  C  CD2 . HIS A 1 31  ? 26.143  17.884  6.278   1.00 16.87 ? 30  HIS A CD2 1 
ATOM   248  C  CE1 . HIS A 1 31  ? 23.993  18.310  6.167   1.00 17.02 ? 30  HIS A CE1 1 
ATOM   249  N  NE2 . HIS A 1 31  ? 25.191  18.826  5.967   1.00 15.12 ? 30  HIS A NE2 1 
ATOM   250  N  N   . HIS A 1 32  ? 27.410  13.231  8.719   1.00 11.78 ? 31  HIS A N   1 
ATOM   251  C  CA  . HIS A 1 32  ? 27.544  11.806  9.051   1.00 11.97 ? 31  HIS A CA  1 
ATOM   252  C  C   . HIS A 1 32  ? 27.558  11.681  10.585  1.00 12.60 ? 31  HIS A C   1 
ATOM   253  O  O   . HIS A 1 32  ? 26.906  10.802  11.149  1.00 12.88 ? 31  HIS A O   1 
ATOM   254  C  CB  . HIS A 1 32  ? 28.823  11.219  8.433   1.00 12.38 ? 31  HIS A CB  1 
ATOM   255  C  CG  . HIS A 1 32  ? 28.947  9.720   8.615   1.00 12.05 ? 31  HIS A CG  1 
ATOM   256  N  ND1 . HIS A 1 32  ? 29.949  8.976   8.035   1.00 14.21 ? 31  HIS A ND1 1 
ATOM   257  C  CD2 . HIS A 1 32  ? 28.148  8.832   9.256   1.00 11.54 ? 31  HIS A CD2 1 
ATOM   258  C  CE1 . HIS A 1 32  ? 29.793  7.700   8.349   1.00 15.50 ? 31  HIS A CE1 1 
ATOM   259  N  NE2 . HIS A 1 32  ? 28.690  7.581   9.075   1.00 14.57 ? 31  HIS A NE2 1 
ATOM   260  N  N   . ALA A 1 33  ? 28.282  12.575  11.267  1.00 12.65 ? 32  ALA A N   1 
ATOM   261  C  CA  . ALA A 1 33  ? 28.317  12.557  12.738  1.00 12.55 ? 32  ALA A CA  1 
ATOM   262  C  C   . ALA A 1 33  ? 26.898  12.555  13.341  1.00 12.05 ? 32  ALA A C   1 
ATOM   263  O  O   . ALA A 1 33  ? 26.615  11.814  14.289  1.00 12.03 ? 32  ALA A O   1 
ATOM   264  C  CB  . ALA A 1 33  ? 29.123  13.739  13.274  1.00 12.47 ? 32  ALA A CB  1 
ATOM   265  N  N   . THR A 1 34  ? 26.017  13.390  12.804  1.00 12.03 ? 33  THR A N   1 
ATOM   266  C  CA  . THR A 1 34  ? 24.653  13.488  13.326  1.00 12.28 ? 33  THR A CA  1 
ATOM   267  C  C   . THR A 1 34  ? 23.904  12.161  13.135  1.00 12.32 ? 33  THR A C   1 
ATOM   268  O  O   . THR A 1 34  ? 23.163  11.721  14.038  1.00 13.34 ? 33  THR A O   1 
ATOM   269  C  CB  . THR A 1 34  ? 23.912  14.700  12.711  1.00 11.85 ? 33  THR A CB  1 
ATOM   270  O  OG1 . THR A 1 34  ? 24.500  15.893  13.253  1.00 12.03 ? 33  THR A OG1 1 
ATOM   271  C  CG2 . THR A 1 34  ? 22.374  14.667  13.029  1.00 13.08 ? 33  THR A CG2 1 
ATOM   272  N  N   . TYR A 1 35  ? 24.100  11.505  11.994  1.00 12.06 ? 34  TYR A N   1 
ATOM   273  C  CA  . TYR A 1 35  ? 23.440  10.195  11.815  1.00 12.03 ? 34  TYR A CA  1 
ATOM   274  C  C   . TYR A 1 35  ? 23.928  9.192   12.854  1.00 12.30 ? 34  TYR A C   1 
ATOM   275  O  O   . TYR A 1 35  ? 23.145  8.428   13.421  1.00 12.17 ? 34  TYR A O   1 
ATOM   276  C  CB  . TYR A 1 35  ? 23.627  9.607   10.401  1.00 12.75 ? 34  TYR A CB  1 
ATOM   277  C  CG  . TYR A 1 35  ? 22.981  10.410  9.299   1.00 12.20 ? 34  TYR A CG  1 
ATOM   278  C  CD1 . TYR A 1 35  ? 21.601  10.685  9.316   1.00 12.39 ? 34  TYR A CD1 1 
ATOM   279  C  CD2 . TYR A 1 35  ? 23.733  10.849  8.218   1.00 13.14 ? 34  TYR A CD2 1 
ATOM   280  C  CE1 . TYR A 1 35  ? 21.008  11.456  8.288   1.00 12.71 ? 34  TYR A CE1 1 
ATOM   281  C  CE2 . TYR A 1 35  ? 23.152  11.593  7.179   1.00 11.63 ? 34  TYR A CE2 1 
ATOM   282  C  CZ  . TYR A 1 35  ? 21.772  11.876  7.221   1.00 13.52 ? 34  TYR A CZ  1 
ATOM   283  O  OH  . TYR A 1 35  ? 21.169  12.621  6.227   1.00 16.05 ? 34  TYR A OH  1 
ATOM   284  N  N   . VAL A 1 36  ? 25.232  9.178   13.102  1.00 12.46 ? 35  VAL A N   1 
ATOM   285  C  CA  . VAL A 1 36  ? 25.789  8.288   14.113  1.00 13.43 ? 35  VAL A CA  1 
ATOM   286  C  C   . VAL A 1 36  ? 25.216  8.570   15.499  1.00 13.76 ? 35  VAL A C   1 
ATOM   287  O  O   . VAL A 1 36  ? 24.794  7.641   16.197  1.00 14.64 ? 35  VAL A O   1 
ATOM   288  C  CB  . VAL A 1 36  ? 27.328  8.383   14.162  1.00 13.86 ? 35  VAL A CB  1 
ATOM   289  C  CG1 . VAL A 1 36  ? 27.890  7.638   15.430  1.00 15.07 ? 35  VAL A CG1 1 
ATOM   290  C  CG2 . VAL A 1 36  ? 27.931  7.836   12.863  1.00 13.68 ? 35  VAL A CG2 1 
ATOM   291  N  N   . ASN A 1 37  ? 25.214  9.840   15.905  1.00 14.58 ? 36  ASN A N   1 
ATOM   292  C  CA  . ASN A 1 37  ? 24.707  10.205  17.222  1.00 15.75 ? 36  ASN A CA  1 
ATOM   293  C  C   . ASN A 1 37  ? 23.237  9.834   17.400  1.00 15.28 ? 36  ASN A C   1 
ATOM   294  O  O   . ASN A 1 37  ? 22.856  9.215   18.411  1.00 15.92 ? 36  ASN A O   1 
ATOM   295  C  CB  . ASN A 1 37  ? 24.947  11.691  17.500  1.00 15.98 ? 36  ASN A CB  1 
ATOM   296  C  CG  . ASN A 1 37  ? 26.425  12.065  17.433  1.00 19.89 ? 36  ASN A CG  1 
ATOM   297  O  OD1 . ASN A 1 37  ? 27.310  11.216  17.627  1.00 22.49 ? 36  ASN A OD1 1 
ATOM   298  N  ND2 . ASN A 1 37  ? 26.701  13.341  17.149  1.00 22.03 ? 36  ASN A ND2 1 
ATOM   299  N  N   . ASN A 1 38  ? 22.431  10.165  16.398  1.00 14.87 ? 37  ASN A N   1 
ATOM   300  C  CA  . ASN A 1 38  ? 21.001  9.877   16.449  1.00 15.74 ? 37  ASN A CA  1 
ATOM   301  C  C   . ASN A 1 38  ? 20.758  8.361   16.394  1.00 15.88 ? 37  ASN A C   1 
ATOM   302  O  O   . ASN A 1 38  ? 19.885  7.845   17.091  1.00 17.07 ? 37  ASN A O   1 
ATOM   303  C  CB  . ASN A 1 38  ? 20.242  10.639  15.357  1.00 14.75 ? 37  ASN A CB  1 
ATOM   304  C  CG  . ASN A 1 38  ? 20.193  12.149  15.613  1.00 17.28 ? 37  ASN A CG  1 
ATOM   305  O  OD1 . ASN A 1 38  ? 19.965  12.945  14.689  1.00 21.02 ? 37  ASN A OD1 1 
ATOM   306  N  ND2 . ASN A 1 38  ? 20.437  12.549  16.848  1.00 14.86 ? 37  ASN A ND2 1 
ATOM   307  N  N   . LEU A 1 39  ? 21.557  7.656   15.594  1.00 15.20 ? 38  LEU A N   1 
ATOM   308  C  CA  . LEU A 1 39  ? 21.460  6.201   15.488  1.00 15.49 ? 38  LEU A CA  1 
ATOM   309  C  C   . LEU A 1 39  ? 21.642  5.542   16.860  1.00 16.00 ? 38  LEU A C   1 
ATOM   310  O  O   . LEU A 1 39  ? 20.858  4.680   17.267  1.00 15.73 ? 38  LEU A O   1 
ATOM   311  C  CB  . LEU A 1 39  ? 22.518  5.665   14.513  1.00 14.62 ? 38  LEU A CB  1 
ATOM   312  C  CG  . LEU A 1 39  ? 22.687  4.145   14.466  1.00 15.30 ? 38  LEU A CG  1 
ATOM   313  C  CD1 . LEU A 1 39  ? 21.377  3.452   14.137  1.00 14.68 ? 38  LEU A CD1 1 
ATOM   314  C  CD2 . LEU A 1 39  ? 23.773  3.784   13.459  1.00 16.37 ? 38  LEU A CD2 1 
ATOM   315  N  N   . ASN A 1 40  ? 22.680  5.965   17.575  1.00 16.86 ? 39  ASN A N   1 
ATOM   316  C  CA  . ASN A 1 40  ? 22.908  5.468   18.926  1.00 18.13 ? 39  ASN A CA  1 
ATOM   317  C  C   . ASN A 1 40  ? 21.712  5.727   19.858  1.00 18.91 ? 39  ASN A C   1 
ATOM   318  O  O   . ASN A 1 40  ? 21.313  4.842   20.614  1.00 19.66 ? 39  ASN A O   1 
ATOM   319  C  CB  . ASN A 1 40  ? 24.219  6.052   19.480  1.00 18.04 ? 39  ASN A CB  1 
ATOM   320  C  CG  . ASN A 1 40  ? 25.447  5.430   18.823  1.00 18.88 ? 39  ASN A CG  1 
ATOM   321  O  OD1 . ASN A 1 40  ? 25.467  4.232   18.536  1.00 21.31 ? 39  ASN A OD1 1 
ATOM   322  N  ND2 . ASN A 1 40  ? 26.478  6.242   18.580  1.00 20.01 ? 39  ASN A ND2 1 
ATOM   323  N  N   . GLN A 1 41  ? 21.133  6.921   19.770  1.00 20.55 ? 40  GLN A N   1 
ATOM   324  C  CA  . GLN A 1 41  ? 19.969  7.290   20.585  1.00 22.60 ? 40  GLN A CA  1 
ATOM   325  C  C   . GLN A 1 41  ? 18.726  6.485   20.224  1.00 22.71 ? 40  GLN A C   1 
ATOM   326  O  O   . GLN A 1 41  ? 17.943  6.109   21.107  1.00 22.96 ? 40  GLN A O   1 
ATOM   327  C  CB  . GLN A 1 41  ? 19.671  8.784   20.468  1.00 22.50 ? 40  GLN A CB  1 
ATOM   328  C  CG  . GLN A 1 41  ? 20.697  9.690   21.165  1.00 25.19 ? 40  GLN A CG  1 
ATOM   329  C  CD  . GLN A 1 41  ? 20.530  11.158  20.779  1.00 25.99 ? 40  GLN A CD  1 
ATOM   330  O  OE1 . GLN A 1 41  ? 19.629  11.511  20.001  1.00 31.11 ? 40  GLN A OE1 1 
ATOM   331  N  NE2 . GLN A 1 41  ? 21.410  12.016  21.297  1.00 29.04 ? 40  GLN A NE2 1 
ATOM   332  N  N   . ILE A 1 42  ? 18.551  6.208   18.934  1.00 22.69 ? 41  ILE A N   1 
ATOM   333  C  CA  . ILE A 1 42  ? 17.377  5.455   18.467  1.00 23.33 ? 41  ILE A CA  1 
ATOM   334  C  C   . ILE A 1 42  ? 17.444  4.007   18.902  1.00 23.52 ? 41  ILE A C   1 
ATOM   335  O  O   . ILE A 1 42  ? 16.457  3.451   19.398  1.00 23.35 ? 41  ILE A O   1 
ATOM   336  C  CB  . ILE A 1 42  ? 17.202  5.547   16.947  1.00 23.29 ? 41  ILE A CB  1 
ATOM   337  C  CG1 . ILE A 1 42  ? 16.867  6.983   16.587  1.00 23.07 ? 41  ILE A CG1 1 
ATOM   338  C  CG2 . ILE A 1 42  ? 16.065  4.607   16.469  1.00 24.62 ? 41  ILE A CG2 1 
ATOM   339  C  CD1 . ILE A 1 42  ? 17.442  7.379   15.281  1.00 27.47 ? 41  ILE A CD1 1 
ATOM   340  N  N   . GLU A 1 43  ? 18.600  3.384   18.722  1.00 23.68 ? 42  GLU A N   1 
ATOM   341  C  CA  . GLU A 1 43  ? 18.762  2.043   19.234  1.00 25.28 ? 42  GLU A CA  1 
ATOM   342  C  C   . GLU A 1 43  ? 18.382  2.015   20.720  1.00 25.16 ? 42  GLU A C   1 
ATOM   343  O  O   . GLU A 1 43  ? 17.730  1.076   21.172  1.00 24.73 ? 42  GLU A O   1 
ATOM   344  C  CB  . GLU A 1 43  ? 20.177  1.546   18.986  1.00 25.09 ? 42  GLU A CB  1 
ATOM   345  C  CG  . GLU A 1 43  ? 20.488  1.329   17.513  1.00 27.05 ? 42  GLU A CG  1 
ATOM   346  C  CD  . GLU A 1 43  ? 21.916  0.865   17.270  1.00 32.60 ? 42  GLU A CD  1 
ATOM   347  O  OE1 . GLU A 1 43  ? 22.790  1.180   18.115  1.00 34.23 ? 42  GLU A OE1 1 
ATOM   348  O  OE2 . GLU A 1 43  ? 22.172  0.188   16.240  1.00 32.77 ? 42  GLU A OE2 1 
ATOM   349  N  N   . GLU A 1 44  ? 18.729  3.069   21.465  1.00 25.21 ? 43  GLU A N   1 
ATOM   350  C  CA  . GLU A 1 44  ? 18.380  3.132   22.895  1.00 26.15 ? 43  GLU A CA  1 
ATOM   351  C  C   . GLU A 1 44  ? 16.862  3.132   23.123  1.00 25.23 ? 43  GLU A C   1 
ATOM   352  O  O   . GLU A 1 44  ? 16.343  2.337   23.917  1.00 24.97 ? 43  GLU A O   1 
ATOM   353  C  CB  . GLU A 1 44  ? 19.025  4.352   23.577  1.00 26.27 ? 43  GLU A CB  1 
ATOM   354  C  CG  . GLU A 1 44  ? 20.552  4.255   23.751  1.00 28.06 ? 43  GLU A CG  1 
ATOM   355  C  CD  . GLU A 1 44  ? 21.217  5.593   24.097  1.00 28.74 ? 43  GLU A CD  1 
ATOM   356  O  OE1 . GLU A 1 44  ? 20.525  6.645   24.134  1.00 31.89 ? 43  GLU A OE1 1 
ATOM   357  O  OE2 . GLU A 1 44  ? 22.451  5.593   24.320  1.00 31.08 ? 43  GLU A OE2 1 
ATOM   358  N  N   . LYS A 1 45  ? 16.155  4.035   22.441  1.00 24.88 ? 44  LYS A N   1 
ATOM   359  C  CA  . LYS A 1 45  ? 14.707  4.126   22.578  1.00 24.86 ? 44  LYS A CA  1 
ATOM   360  C  C   . LYS A 1 45  ? 14.026  2.816   22.165  1.00 24.84 ? 44  LYS A C   1 
ATOM   361  O  O   . LYS A 1 45  ? 13.059  2.372   22.806  1.00 24.72 ? 44  LYS A O   1 
ATOM   362  C  CB  . LYS A 1 45  ? 14.154  5.319   21.785  1.00 24.71 ? 44  LYS A CB  1 
ATOM   363  C  CG  . LYS A 1 45  ? 14.550  6.687   22.337  1.00 26.45 ? 44  LYS A CG  1 
ATOM   364  C  CD  . LYS A 1 45  ? 13.983  6.888   23.729  1.00 29.83 ? 44  LYS A CD  1 
ATOM   365  C  CE  . LYS A 1 45  ? 14.136  8.324   24.197  1.00 31.14 ? 44  LYS A CE  1 
ATOM   366  N  NZ  . LYS A 1 45  ? 13.404  8.532   25.484  1.00 31.73 ? 44  LYS A NZ  1 
ATOM   367  N  N   . LEU A 1 46  ? 14.557  2.199   21.108  1.00 24.98 ? 45  LEU A N   1 
ATOM   368  C  CA  . LEU A 1 46  ? 14.037  0.937   20.571  1.00 25.26 ? 45  LEU A CA  1 
ATOM   369  C  C   . LEU A 1 46  ? 14.155  -0.184  21.581  1.00 24.36 ? 45  LEU A C   1 
ATOM   370  O  O   . LEU A 1 46  ? 13.214  -0.950  21.760  1.00 24.07 ? 45  LEU A O   1 
ATOM   371  C  CB  . LEU A 1 46  ? 14.795  0.526   19.305  1.00 25.15 ? 45  LEU A CB  1 
ATOM   372  C  CG  . LEU A 1 46  ? 14.136  -0.463  18.344  1.00 27.06 ? 45  LEU A CG  1 
ATOM   373  C  CD1 . LEU A 1 46  ? 12.789  0.079   17.834  1.00 23.22 ? 45  LEU A CD1 1 
ATOM   374  C  CD2 . LEU A 1 46  ? 15.067  -0.749  17.168  1.00 26.56 ? 45  LEU A CD2 1 
ATOM   375  N  N   . HIS A 1 47  ? 15.319  -0.297  22.212  1.00 24.58 ? 46  HIS A N   1 
ATOM   376  C  CA  . HIS A 1 47  ? 15.531  -1.372  23.200  1.00 24.52 ? 46  HIS A CA  1 
ATOM   377  C  C   . HIS A 1 47  ? 14.538  -1.269  24.350  1.00 24.66 ? 46  HIS A C   1 
ATOM   378  O  O   . HIS A 1 47  ? 13.999  -2.283  24.795  1.00 24.31 ? 46  HIS A O   1 
ATOM   379  C  CB  . HIS A 1 47  ? 16.955  -1.403  23.748  1.00 24.64 ? 46  HIS A CB  1 
ATOM   380  C  CG  . HIS A 1 47  ? 17.142  -2.396  24.860  1.00 25.46 ? 46  HIS A CG  1 
ATOM   381  N  ND1 . HIS A 1 47  ? 17.117  -2.038  26.194  1.00 26.29 ? 46  HIS A ND1 1 
ATOM   382  C  CD2 . HIS A 1 47  ? 17.322  -3.737  24.835  1.00 25.74 ? 46  HIS A CD2 1 
ATOM   383  C  CE1 . HIS A 1 47  ? 17.291  -3.115  26.941  1.00 26.75 ? 46  HIS A CE1 1 
ATOM   384  N  NE2 . HIS A 1 47  ? 17.413  -4.160  26.140  1.00 26.97 ? 46  HIS A NE2 1 
ATOM   385  N  N   . GLU A 1 48  ? 14.314  -0.040  24.822  1.00 24.87 ? 47  GLU A N   1 
ATOM   386  C  CA  . GLU A 1 48  ? 13.381  0.221   25.926  1.00 25.60 ? 47  GLU A CA  1 
ATOM   387  C  C   . GLU A 1 48  ? 11.978  -0.237  25.537  1.00 24.90 ? 47  GLU A C   1 
ATOM   388  O  O   . GLU A 1 48  ? 11.287  -0.886  26.330  1.00 24.77 ? 47  GLU A O   1 
ATOM   389  C  CB  . GLU A 1 48  ? 13.326  1.708   26.274  1.00 25.71 ? 47  GLU A CB  1 
ATOM   390  C  CG  . GLU A 1 48  ? 14.636  2.336   26.697  1.00 27.38 ? 47  GLU A CG  1 
ATOM   391  C  CD  . GLU A 1 48  ? 14.447  3.772   27.176  1.00 28.16 ? 47  GLU A CD  1 
ATOM   392  O  OE1 . GLU A 1 48  ? 14.751  4.715   26.398  1.00 30.54 ? 47  GLU A OE1 1 
ATOM   393  O  OE2 . GLU A 1 48  ? 13.958  3.948   28.319  1.00 31.57 ? 47  GLU A OE2 1 
ATOM   394  N  N   . ALA A 1 49  ? 11.576  0.099   24.312  1.00 24.16 ? 48  ALA A N   1 
ATOM   395  C  CA  . ALA A 1 49  ? 10.266  -0.289  23.791  1.00 23.95 ? 48  ALA A CA  1 
ATOM   396  C  C   . ALA A 1 49  ? 10.144  -1.810  23.638  1.00 23.82 ? 48  ALA A C   1 
ATOM   397  O  O   . ALA A 1 49  ? 9.152   -2.401  24.087  1.00 24.23 ? 48  ALA A O   1 
ATOM   398  C  CB  . ALA A 1 49  ? 9.987   0.415   22.458  1.00 23.59 ? 48  ALA A CB  1 
ATOM   399  N  N   . VAL A 1 50  ? 11.149  -2.440  23.013  1.00 23.37 ? 49  VAL A N   1 
ATOM   400  C  CA  . VAL A 1 50  ? 11.121  -3.900  22.822  1.00 23.31 ? 49  VAL A CA  1 
ATOM   401  C  C   . VAL A 1 50  ? 11.232  -4.650  24.160  1.00 23.59 ? 49  VAL A C   1 
ATOM   402  O  O   . VAL A 1 50  ? 10.489  -5.615  24.408  1.00 24.03 ? 49  VAL A O   1 
ATOM   403  C  CB  . VAL A 1 50  ? 12.187  -4.393  21.783  1.00 22.94 ? 49  VAL A CB  1 
ATOM   404  C  CG1 . VAL A 1 50  ? 13.550  -3.903  22.136  1.00 24.09 ? 49  VAL A CG1 1 
ATOM   405  C  CG2 . VAL A 1 50  ? 12.187  -5.919  21.677  1.00 23.71 ? 49  VAL A CG2 1 
ATOM   406  N  N   . SER A 1 51  ? 12.130  -4.201  25.037  1.00 23.78 ? 50  SER A N   1 
ATOM   407  C  CA  . SER A 1 51  ? 12.290  -4.882  26.335  1.00 24.25 ? 50  SER A CA  1 
ATOM   408  C  C   . SER A 1 51  ? 11.070  -4.725  27.256  1.00 24.08 ? 50  SER A C   1 
ATOM   409  O  O   . SER A 1 51  ? 10.769  -5.621  28.033  1.00 24.14 ? 50  SER A O   1 
ATOM   410  C  CB  . SER A 1 51  ? 13.559  -4.423  27.053  1.00 24.20 ? 50  SER A CB  1 
ATOM   411  O  OG  . SER A 1 51  ? 13.426  -3.087  27.502  1.00 25.54 ? 50  SER A OG  1 
ATOM   412  N  N   . LYS A 1 52  ? 10.366  -3.596  27.160  1.00 24.29 ? 51  LYS A N   1 
ATOM   413  C  CA  . LYS A 1 52  ? 9.156   -3.369  27.971  1.00 24.75 ? 51  LYS A CA  1 
ATOM   414  C  C   . LYS A 1 52  ? 7.884   -3.923  27.305  1.00 23.97 ? 51  LYS A C   1 
ATOM   415  O  O   . LYS A 1 52  ? 6.797   -3.887  27.891  1.00 22.90 ? 51  LYS A O   1 
ATOM   416  C  CB  . LYS A 1 52  ? 8.984   -1.883  28.316  1.00 24.96 ? 51  LYS A CB  1 
ATOM   417  C  CG  . LYS A 1 52  ? 10.063  -1.328  29.241  1.00 26.22 ? 51  LYS A CG  1 
ATOM   418  C  CD  . LYS A 1 52  ? 10.009  0.193   29.337  1.00 26.54 ? 51  LYS A CD  1 
ATOM   419  C  CE  . LYS A 1 52  ? 8.950   0.668   30.339  1.00 29.45 ? 51  LYS A CE  1 
ATOM   420  N  NZ  . LYS A 1 52  ? 8.839   2.163   30.334  1.00 31.02 ? 51  LYS A NZ  1 
ATOM   421  N  N   . GLY A 1 53  ? 8.032   -4.427  26.080  1.00 23.46 ? 52  GLY A N   1 
ATOM   422  C  CA  . GLY A 1 53  ? 6.931   -5.042  25.346  1.00 22.63 ? 52  GLY A CA  1 
ATOM   423  C  C   . GLY A 1 53  ? 6.004   -4.063  24.651  1.00 22.61 ? 52  GLY A C   1 
ATOM   424  O  O   . GLY A 1 53  ? 4.829   -4.375  24.410  1.00 22.65 ? 52  GLY A O   1 
ATOM   425  N  N   . ASN A 1 54  ? 6.516   -2.876  24.335  1.00 21.97 ? 53  ASN A N   1 
ATOM   426  C  CA  . ASN A 1 54  ? 5.712   -1.904  23.606  1.00 21.66 ? 53  ASN A CA  1 
ATOM   427  C  C   . ASN A 1 54  ? 5.964   -2.032  22.108  1.00 20.45 ? 53  ASN A C   1 
ATOM   428  O  O   . ASN A 1 54  ? 6.687   -1.223  21.502  1.00 19.67 ? 53  ASN A O   1 
ATOM   429  C  CB  . ASN A 1 54  ? 5.959   -0.475  24.086  1.00 22.14 ? 53  ASN A CB  1 
ATOM   430  C  CG  . ASN A 1 54  ? 4.834   0.480   23.675  1.00 24.77 ? 53  ASN A CG  1 
ATOM   431  O  OD1 . ASN A 1 54  ? 4.310   0.414   22.552  1.00 25.63 ? 53  ASN A OD1 1 
ATOM   432  N  ND2 . ASN A 1 54  ? 4.456   1.373   24.594  1.00 27.10 ? 53  ASN A ND2 1 
ATOM   433  N  N   . LEU A 1 55  ? 5.378   -3.082  21.533  1.00 18.73 ? 54  LEU A N   1 
ATOM   434  C  CA  . LEU A 1 55  ? 5.479   -3.362  20.103  1.00 16.77 ? 54  LEU A CA  1 
ATOM   435  C  C   . LEU A 1 55  ? 5.099   -2.138  19.257  1.00 16.66 ? 54  LEU A C   1 
ATOM   436  O  O   . LEU A 1 55  ? 5.758   -1.823  18.258  1.00 14.18 ? 54  LEU A O   1 
ATOM   437  C  CB  . LEU A 1 55  ? 4.579   -4.557  19.768  1.00 17.33 ? 54  LEU A CB  1 
ATOM   438  C  CG  . LEU A 1 55  ? 4.401   -4.980  18.311  1.00 15.80 ? 54  LEU A CG  1 
ATOM   439  C  CD1 . LEU A 1 55  ? 5.717   -5.392  17.669  1.00 15.56 ? 54  LEU A CD1 1 
ATOM   440  C  CD2 . LEU A 1 55  ? 3.377   -6.101  18.267  1.00 15.56 ? 54  LEU A CD2 1 
ATOM   441  N  N   . LYS A 1 56  ? 4.052   -1.436  19.677  1.00 16.88 ? 55  LYS A N   1 
ATOM   442  C  CA  . LYS A 1 56  ? 3.586   -0.265  18.932  1.00 18.31 ? 55  LYS A CA  1 
ATOM   443  C  C   . LYS A 1 56  ? 4.677   0.813   18.875  1.00 18.58 ? 55  LYS A C   1 
ATOM   444  O  O   . LYS A 1 56  ? 4.973   1.381   17.799  1.00 17.71 ? 55  LYS A O   1 
ATOM   445  C  CB  . LYS A 1 56  ? 2.265   0.267   19.537  1.00 18.38 ? 55  LYS A CB  1 
ATOM   446  C  CG  . LYS A 1 56  ? 1.558   1.243   18.620  1.00 20.26 ? 55  LYS A CG  1 
ATOM   447  C  CD  . LYS A 1 56  ? 0.254   1.810   19.203  1.00 20.81 ? 55  LYS A CD  1 
ATOM   448  C  CE  . LYS A 1 56  ? -0.172  3.018   18.339  1.00 24.95 ? 55  LYS A CE  1 
ATOM   449  N  NZ  . LYS A 1 56  ? -1.497  3.601   18.747  1.00 27.95 ? 55  LYS A NZ  1 
ATOM   450  N  N   . GLU A 1 57  ? 5.309   1.073   20.017  1.00 19.08 ? 56  GLU A N   1 
ATOM   451  C  CA  . GLU A 1 57  ? 6.374   2.071   20.063  1.00 19.59 ? 56  GLU A CA  1 
ATOM   452  C  C   . GLU A 1 57  ? 7.605   1.621   19.262  1.00 18.70 ? 56  GLU A C   1 
ATOM   453  O  O   . GLU A 1 57  ? 8.214   2.433   18.568  1.00 18.86 ? 56  GLU A O   1 
ATOM   454  C  CB  . GLU A 1 57  ? 6.724   2.457   21.509  1.00 20.20 ? 56  GLU A CB  1 
ATOM   455  C  CG  . GLU A 1 57  ? 7.659   3.674   21.636  1.00 23.29 ? 56  GLU A CG  1 
ATOM   456  C  CD  . GLU A 1 57  ? 7.233   4.853   20.772  1.00 27.25 ? 56  GLU A CD  1 
ATOM   457  O  OE1 . GLU A 1 57  ? 6.059   5.278   20.837  1.00 29.87 ? 56  GLU A OE1 1 
ATOM   458  O  OE2 . GLU A 1 57  ? 8.081   5.350   20.015  1.00 30.96 ? 56  GLU A OE2 1 
ATOM   459  N  N   . ALA A 1 58  ? 7.950   0.331   19.351  1.00 17.36 ? 57  ALA A N   1 
ATOM   460  C  CA  . ALA A 1 58  ? 9.032   -0.254  18.543  1.00 15.73 ? 57  ALA A CA  1 
ATOM   461  C  C   . ALA A 1 58  ? 8.819   -0.063  17.014  1.00 14.75 ? 57  ALA A C   1 
ATOM   462  O  O   . ALA A 1 58  ? 9.761   0.223   16.255  1.00 15.03 ? 57  ALA A O   1 
ATOM   463  C  CB  . ALA A 1 58  ? 9.195   -1.696  18.873  1.00 15.74 ? 57  ALA A CB  1 
ATOM   464  N  N   . ILE A 1 59  ? 7.578   -0.247  16.570  1.00 13.74 ? 58  ILE A N   1 
ATOM   465  C  CA  . ILE A 1 59  ? 7.222   0.005   15.176  1.00 12.30 ? 58  ILE A CA  1 
ATOM   466  C  C   . ILE A 1 59  ? 7.352   1.490   14.862  1.00 13.43 ? 58  ILE A C   1 
ATOM   467  O  O   . ILE A 1 59  ? 7.889   1.861   13.820  1.00 13.22 ? 58  ILE A O   1 
ATOM   468  C  CB  . ILE A 1 59  ? 5.789   -0.505  14.859  1.00 11.34 ? 58  ILE A CB  1 
ATOM   469  C  CG1 . ILE A 1 59  ? 5.784   -2.029  14.958  1.00 10.00 ? 58  ILE A CG1 1 
ATOM   470  C  CG2 . ILE A 1 59  ? 5.312   -0.021  13.462  1.00 9.07  ? 58  ILE A CG2 1 
ATOM   471  C  CD1 . ILE A 1 59  ? 4.393   -2.648  14.924  1.00 7.90  ? 58  ILE A CD1 1 
ATOM   472  N  N   . ALA A 1 60  ? 6.894   2.330   15.795  1.00 14.53 ? 59  ALA A N   1 
ATOM   473  C  CA  . ALA A 1 60  ? 6.984   3.800   15.602  1.00 15.58 ? 59  ALA A CA  1 
ATOM   474  C  C   . ALA A 1 60  ? 8.424   4.292   15.434  1.00 16.47 ? 59  ALA A C   1 
ATOM   475  O  O   . ALA A 1 60  ? 8.667   5.304   14.759  1.00 16.39 ? 59  ALA A O   1 
ATOM   476  C  CB  . ALA A 1 60  ? 6.291   4.535   16.769  1.00 15.92 ? 59  ALA A CB  1 
ATOM   477  N  N   . LEU A 1 61  ? 9.376   3.577   16.031  1.00 16.41 ? 60  LEU A N   1 
ATOM   478  C  CA  . LEU A 1 61  ? 10.797  3.946   15.972  1.00 17.52 ? 60  LEU A CA  1 
ATOM   479  C  C   . LEU A 1 61  ? 11.522  3.500   14.684  1.00 16.47 ? 60  LEU A C   1 
ATOM   480  O  O   . LEU A 1 61  ? 12.673  3.898   14.412  1.00 16.78 ? 60  LEU A O   1 
ATOM   481  C  CB  . LEU A 1 61  ? 11.516  3.460   17.233  1.00 18.14 ? 60  LEU A CB  1 
ATOM   482  C  CG  . LEU A 1 61  ? 10.997  4.083   18.538  1.00 17.56 ? 60  LEU A CG  1 
ATOM   483  C  CD1 . LEU A 1 61  ? 11.452  3.326   19.773  1.00 19.07 ? 60  LEU A CD1 1 
ATOM   484  C  CD2 . LEU A 1 61  ? 11.369  5.574   18.630  1.00 20.02 ? 60  LEU A CD2 1 
ATOM   485  N  N   . GLN A 1 62  ? 10.842  2.693   13.870  1.00 15.59 ? 61  GLN A N   1 
ATOM   486  C  CA  . GLN A 1 62  ? 11.448  2.174   12.640  1.00 15.89 ? 61  GLN A CA  1 
ATOM   487  C  C   . GLN A 1 62  ? 11.934  3.224   11.652  1.00 15.18 ? 61  GLN A C   1 
ATOM   488  O  O   . GLN A 1 62  ? 13.070  3.119   11.157  1.00 15.75 ? 61  GLN A O   1 
ATOM   489  C  CB  . GLN A 1 62  ? 10.524  1.178   11.945  1.00 16.07 ? 61  GLN A CB  1 
ATOM   490  C  CG  . GLN A 1 62  ? 10.342  -0.045  12.763  1.00 16.91 ? 61  GLN A CG  1 
ATOM   491  C  CD  . GLN A 1 62  ? 9.481   -1.075  12.071  1.00 19.28 ? 61  GLN A CD  1 
ATOM   492  O  OE1 . GLN A 1 62  ? 8.701   -0.745  11.182  1.00 18.46 ? 61  GLN A OE1 1 
ATOM   493  N  NE2 . GLN A 1 62  ? 9.598   -2.316  12.490  1.00 20.66 ? 61  GLN A NE2 1 
ATOM   494  N  N   . PRO A 1 63  ? 11.089  4.211   11.324  1.00 15.70 ? 62  PRO A N   1 
ATOM   495  C  CA  . PRO A 1 63  ? 11.601  5.192   10.376  1.00 16.31 ? 62  PRO A CA  1 
ATOM   496  C  C   . PRO A 1 63  ? 12.905  5.841   10.840  1.00 15.80 ? 62  PRO A C   1 
ATOM   497  O  O   . PRO A 1 63  ? 13.801  6.099   10.007  1.00 15.73 ? 62  PRO A O   1 
ATOM   498  C  CB  . PRO A 1 63  ? 10.472  6.209   10.296  1.00 16.96 ? 62  PRO A CB  1 
ATOM   499  C  CG  . PRO A 1 63  ? 9.255   5.374   10.531  1.00 17.34 ? 62  PRO A CG  1 
ATOM   500  C  CD  . PRO A 1 63  ? 9.672   4.476   11.654  1.00 15.78 ? 62  PRO A CD  1 
ATOM   501  N  N   . ALA A 1 64  ? 13.018  6.113   12.145  1.00 15.84 ? 63  ALA A N   1 
ATOM   502  C  CA  . ALA A 1 64  ? 14.224  6.778   12.666  1.00 15.60 ? 63  ALA A CA  1 
ATOM   503  C  C   . ALA A 1 64  ? 15.448  5.858   12.575  1.00 15.62 ? 63  ALA A C   1 
ATOM   504  O  O   . ALA A 1 64  ? 16.557  6.319   12.268  1.00 16.11 ? 63  ALA A O   1 
ATOM   505  C  CB  . ALA A 1 64  ? 14.016  7.291   14.070  1.00 15.46 ? 63  ALA A CB  1 
ATOM   506  N  N   . LEU A 1 65  ? 15.252  4.558   12.818  1.00 13.86 ? 64  LEU A N   1 
ATOM   507  C  CA  . LEU A 1 65  ? 16.362  3.613   12.661  1.00 13.99 ? 64  LEU A CA  1 
ATOM   508  C  C   . LEU A 1 65  ? 16.772  3.514   11.191  1.00 13.37 ? 64  LEU A C   1 
ATOM   509  O  O   . LEU A 1 65  ? 17.947  3.529   10.863  1.00 12.64 ? 64  LEU A O   1 
ATOM   510  C  CB  . LEU A 1 65  ? 16.037  2.225   13.241  1.00 14.13 ? 64  LEU A CB  1 
ATOM   511  C  CG  . LEU A 1 65  ? 17.280  1.308   13.174  1.00 15.87 ? 64  LEU A CG  1 
ATOM   512  C  CD1 . LEU A 1 65  ? 18.217  1.590   14.332  1.00 17.10 ? 64  LEU A CD1 1 
ATOM   513  C  CD2 . LEU A 1 65  ? 16.938  -0.170  13.135  1.00 18.31 ? 64  LEU A CD2 1 
ATOM   514  N  N   . LYS A 1 66  ? 15.797  3.425   10.284  1.00 13.43 ? 65  LYS A N   1 
ATOM   515  C  CA  . LYS A 1 66  ? 16.137  3.329   8.884   1.00 13.28 ? 65  LYS A CA  1 
ATOM   516  C  C   . LYS A 1 66  ? 16.899  4.572   8.424   1.00 13.03 ? 65  LYS A C   1 
ATOM   517  O  O   . LYS A 1 66  ? 17.881  4.489   7.715   1.00 13.51 ? 65  LYS A O   1 
ATOM   518  C  CB  . LYS A 1 66  ? 14.874  3.099   8.019   1.00 12.44 ? 65  LYS A CB  1 
ATOM   519  C  CG  . LYS A 1 66  ? 15.241  2.951   6.548   1.00 14.02 ? 65  LYS A CG  1 
ATOM   520  C  CD  . LYS A 1 66  ? 14.085  2.509   5.616   1.00 16.77 ? 65  LYS A CD  1 
ATOM   521  C  CE  . LYS A 1 66  ? 12.768  3.231   5.812   1.00 25.71 ? 65  LYS A CE  1 
ATOM   522  N  NZ  . LYS A 1 66  ? 12.784  4.669   5.370   1.00 27.87 ? 65  LYS A NZ  1 
ATOM   523  N  N   . PHE A 1 67  ? 16.425  5.738   8.851   1.00 13.01 ? 66  PHE A N   1 
ATOM   524  C  CA  . PHE A 1 67  ? 16.988  6.986   8.373   1.00 13.25 ? 66  PHE A CA  1 
ATOM   525  C  C   . PHE A 1 67  ? 18.411  7.150   8.893   1.00 12.55 ? 66  PHE A C   1 
ATOM   526  O  O   . PHE A 1 67  ? 19.353  7.372   8.126   1.00 13.04 ? 66  PHE A O   1 
ATOM   527  C  CB  . PHE A 1 67  ? 16.112  8.127   8.917   1.00 13.42 ? 66  PHE A CB  1 
ATOM   528  C  CG  . PHE A 1 67  ? 16.516  9.484   8.421   1.00 13.74 ? 66  PHE A CG  1 
ATOM   529  C  CD1 . PHE A 1 67  ? 16.926  10.481  9.312   1.00 14.20 ? 66  PHE A CD1 1 
ATOM   530  C  CD2 . PHE A 1 67  ? 16.510  9.747   7.047   1.00 16.02 ? 66  PHE A CD2 1 
ATOM   531  C  CE1 . PHE A 1 67  ? 17.267  11.744  8.837   1.00 16.02 ? 66  PHE A CE1 1 
ATOM   532  C  CE2 . PHE A 1 67  ? 16.835  10.999  6.561   1.00 13.54 ? 66  PHE A CE2 1 
ATOM   533  C  CZ  . PHE A 1 67  ? 17.230  12.014  7.472   1.00 15.51 ? 66  PHE A CZ  1 
ATOM   534  N  N   . ASN A 1 68  ? 18.573  7.001   10.203  1.00 13.13 ? 67  ASN A N   1 
ATOM   535  C  CA  . ASN A 1 68  ? 19.892  7.197   10.821  1.00 13.04 ? 67  ASN A CA  1 
ATOM   536  C  C   . ASN A 1 68  ? 20.853  6.043   10.588  1.00 13.14 ? 67  ASN A C   1 
ATOM   537  O  O   . ASN A 1 68  ? 22.066  6.264   10.334  1.00 12.42 ? 67  ASN A O   1 
ATOM   538  C  CB  . ASN A 1 68  ? 19.746  7.516   12.292  1.00 13.36 ? 67  ASN A CB  1 
ATOM   539  C  CG  . ASN A 1 68  ? 19.033  8.818   12.506  1.00 14.69 ? 67  ASN A CG  1 
ATOM   540  O  OD1 . ASN A 1 68  ? 17.861  8.852   12.939  1.00 17.39 ? 67  ASN A OD1 1 
ATOM   541  N  ND2 . ASN A 1 68  ? 19.686  9.887   12.137  1.00 11.88 ? 67  ASN A ND2 1 
ATOM   542  N  N   . GLY A 1 69  ? 20.320  4.829   10.706  1.00 13.02 ? 68  GLY A N   1 
ATOM   543  C  CA  . GLY A 1 69  ? 21.072  3.630   10.408  1.00 13.40 ? 68  GLY A CA  1 
ATOM   544  C  C   . GLY A 1 69  ? 21.491  3.620   8.953   1.00 14.31 ? 68  GLY A C   1 
ATOM   545  O  O   . GLY A 1 69  ? 22.660  3.397   8.621   1.00 12.88 ? 68  GLY A O   1 
ATOM   546  N  N   . GLY A 1 70  ? 20.524  3.851   8.066   1.00 13.82 ? 69  GLY A N   1 
ATOM   547  C  CA  . GLY A 1 70  ? 20.844  4.043   6.655   1.00 14.91 ? 69  GLY A CA  1 
ATOM   548  C  C   . GLY A 1 70  ? 21.871  5.152   6.407   1.00 14.37 ? 69  GLY A C   1 
ATOM   549  O  O   . GLY A 1 70  ? 22.798  4.942   5.629   1.00 14.88 ? 69  GLY A O   1 
ATOM   550  N  N   . GLY A 1 71  ? 21.779  6.301   7.098   1.00 13.60 ? 70  GLY A N   1 
ATOM   551  C  CA  . GLY A 1 71  ? 22.717  7.400   6.868   1.00 14.24 ? 70  GLY A CA  1 
ATOM   552  C  C   . GLY A 1 71  ? 24.128  6.943   7.235   1.00 12.79 ? 70  GLY A C   1 
ATOM   553  O  O   . GLY A 1 71  ? 25.096  7.212   6.510   1.00 12.80 ? 70  GLY A O   1 
ATOM   554  N  N   . HIS A 1 72  ? 24.230  6.135   8.299   1.00 12.96 ? 71  HIS A N   1 
ATOM   555  C  CA  . HIS A 1 72  ? 25.547  5.669   8.768   1.00 13.50 ? 71  HIS A CA  1 
ATOM   556  C  C   . HIS A 1 72  ? 26.094  4.656   7.765   1.00 12.81 ? 71  HIS A C   1 
ATOM   557  O  O   . HIS A 1 72  ? 27.224  4.761   7.339   1.00 12.85 ? 71  HIS A O   1 
ATOM   558  C  CB  . HIS A 1 72  ? 25.421  5.021   10.157  1.00 13.53 ? 71  HIS A CB  1 
ATOM   559  C  CG  . HIS A 1 72  ? 26.711  4.501   10.703  1.00 15.01 ? 71  HIS A CG  1 
ATOM   560  N  ND1 . HIS A 1 72  ? 27.899  5.194   10.604  1.00 15.00 ? 71  HIS A ND1 1 
ATOM   561  C  CD2 . HIS A 1 72  ? 26.996  3.355   11.368  1.00 15.58 ? 71  HIS A CD2 1 
ATOM   562  C  CE1 . HIS A 1 72  ? 28.865  4.501   11.180  1.00 13.79 ? 71  HIS A CE1 1 
ATOM   563  N  NE2 . HIS A 1 72  ? 28.351  3.372   11.648  1.00 14.53 ? 71  HIS A NE2 1 
ATOM   564  N  N   . ILE A 1 73  ? 25.260  3.690   7.376   1.00 12.21 ? 72  ILE A N   1 
ATOM   565  C  CA  . ILE A 1 73  ? 25.654  2.715   6.351   1.00 12.70 ? 72  ILE A CA  1 
ATOM   566  C  C   . ILE A 1 73  ? 26.124  3.375   5.042   1.00 13.20 ? 72  ILE A C   1 
ATOM   567  O  O   . ILE A 1 73  ? 27.231  3.053   4.518   1.00 12.65 ? 72  ILE A O   1 
ATOM   568  C  CB  . ILE A 1 73  ? 24.500  1.733   6.020   1.00 12.96 ? 72  ILE A CB  1 
ATOM   569  C  CG1 . ILE A 1 73  ? 24.207  0.783   7.194   1.00 12.96 ? 72  ILE A CG1 1 
ATOM   570  C  CG2 . ILE A 1 73  ? 24.848  0.875   4.771   1.00 13.35 ? 72  ILE A CG2 1 
ATOM   571  C  CD1 . ILE A 1 73  ? 22.797  0.179   7.160   1.00 14.75 ? 72  ILE A CD1 1 
ATOM   572  N  N   . ASN A 1 74  ? 25.274  4.257   4.516   1.00 12.75 ? 73  ASN A N   1 
ATOM   573  C  CA  . ASN A 1 74  ? 25.529  4.908   3.233   1.00 13.61 ? 73  ASN A CA  1 
ATOM   574  C  C   . ASN A 1 74  ? 26.796  5.740   3.230   1.00 13.30 ? 73  ASN A C   1 
ATOM   575  O  O   . ASN A 1 74  ? 27.654  5.585   2.358   1.00 11.99 ? 73  ASN A O   1 
ATOM   576  C  CB  . ASN A 1 74  ? 24.326  5.755   2.820   1.00 13.99 ? 73  ASN A CB  1 
ATOM   577  C  CG  . ASN A 1 74  ? 23.065  4.940   2.674   1.00 13.93 ? 73  ASN A CG  1 
ATOM   578  O  OD1 . ASN A 1 74  ? 23.094  3.689   2.488   1.00 13.89 ? 73  ASN A OD1 1 
ATOM   579  N  ND2 . ASN A 1 74  ? 21.932  5.626   2.768   1.00 14.46 ? 73  ASN A ND2 1 
ATOM   580  N  N   . HIS A 1 75  ? 26.903  6.663   4.189   1.00 12.76 ? 74  HIS A N   1 
ATOM   581  C  CA  . HIS A 1 75  ? 28.085  7.509   4.236   1.00 13.18 ? 74  HIS A CA  1 
ATOM   582  C  C   . HIS A 1 75  ? 29.359  6.685   4.511   1.00 13.76 ? 74  HIS A C   1 
ATOM   583  O  O   . HIS A 1 75  ? 30.419  6.967   3.938   1.00 11.88 ? 74  HIS A O   1 
ATOM   584  C  CB  . HIS A 1 75  ? 27.889  8.665   5.226   1.00 13.24 ? 74  HIS A CB  1 
ATOM   585  C  CG  . HIS A 1 75  ? 26.806  9.624   4.816   1.00 13.48 ? 74  HIS A CG  1 
ATOM   586  N  ND1 . HIS A 1 75  ? 25.481  9.381   5.083   1.00 13.26 ? 74  HIS A ND1 1 
ATOM   587  C  CD2 . HIS A 1 75  ? 26.845  10.782  4.107   1.00 14.36 ? 74  HIS A CD2 1 
ATOM   588  C  CE1 . HIS A 1 75  ? 24.739  10.362  4.584   1.00 14.26 ? 74  HIS A CE1 1 
ATOM   589  N  NE2 . HIS A 1 75  ? 25.547  11.235  4.002   1.00 12.25 ? 74  HIS A NE2 1 
ATOM   590  N  N   . SER A 1 76  ? 29.255  5.642   5.344   1.00 12.77 ? 75  SER A N   1 
ATOM   591  C  CA  . SER A 1 76  ? 30.453  4.818   5.589   1.00 13.88 ? 75  SER A CA  1 
ATOM   592  C  C   . SER A 1 76  ? 30.991  4.225   4.274   1.00 12.94 ? 75  SER A C   1 
ATOM   593  O  O   . SER A 1 76  ? 32.197  4.254   4.020   1.00 15.12 ? 75  SER A O   1 
ATOM   594  C  CB  . SER A 1 76  ? 30.207  3.740   6.651   1.00 13.41 ? 75  SER A CB  1 
ATOM   595  O  OG  . SER A 1 76  ? 29.941  4.346   7.906   1.00 13.85 ? 75  SER A OG  1 
ATOM   596  N  N   . ILE A 1 77  ? 30.085  3.736   3.429   1.00 13.49 ? 76  ILE A N   1 
ATOM   597  C  CA  . ILE A 1 77  ? 30.468  3.160   2.138   1.00 13.81 ? 76  ILE A CA  1 
ATOM   598  C  C   . ILE A 1 77  ? 31.028  4.270   1.243   1.00 12.73 ? 76  ILE A C   1 
ATOM   599  O  O   . ILE A 1 77  ? 32.095  4.123   0.629   1.00 12.57 ? 76  ILE A O   1 
ATOM   600  C  CB  . ILE A 1 77  ? 29.248  2.460   1.443   1.00 13.96 ? 76  ILE A CB  1 
ATOM   601  C  CG1 . ILE A 1 77  ? 28.862  1.181   2.242   1.00 13.15 ? 76  ILE A CG1 1 
ATOM   602  C  CG2 . ILE A 1 77  ? 29.586  2.029   0.019   1.00 16.01 ? 76  ILE A CG2 1 
ATOM   603  C  CD1 . ILE A 1 77  ? 27.468  0.653   1.898   1.00 15.43 ? 76  ILE A CD1 1 
ATOM   604  N  N   . PHE A 1 78  ? 30.309  5.389   1.209   1.00 13.06 ? 77  PHE A N   1 
ATOM   605  C  CA  . PHE A 1 78  ? 30.641  6.514   0.351   1.00 13.02 ? 77  PHE A CA  1 
ATOM   606  C  C   . PHE A 1 78  ? 32.097  6.937   0.506   1.00 13.74 ? 77  PHE A C   1 
ATOM   607  O  O   . PHE A 1 78  ? 32.803  7.131   -0.500  1.00 14.28 ? 77  PHE A O   1 
ATOM   608  C  CB  . PHE A 1 78  ? 29.699  7.694   0.650   1.00 13.71 ? 77  PHE A CB  1 
ATOM   609  C  CG  . PHE A 1 78  ? 29.743  8.771   -0.391  1.00 10.70 ? 77  PHE A CG  1 
ATOM   610  C  CD1 . PHE A 1 78  ? 29.639  8.458   -1.753  1.00 11.50 ? 77  PHE A CD1 1 
ATOM   611  C  CD2 . PHE A 1 78  ? 29.807  10.109  -0.005  1.00 14.73 ? 77  PHE A CD2 1 
ATOM   612  C  CE1 . PHE A 1 78  ? 29.631  9.497   -2.737  1.00 11.95 ? 77  PHE A CE1 1 
ATOM   613  C  CE2 . PHE A 1 78  ? 29.797  11.125  -0.958  1.00 14.30 ? 77  PHE A CE2 1 
ATOM   614  C  CZ  . PHE A 1 78  ? 29.704  10.816  -2.326  1.00 13.23 ? 77  PHE A CZ  1 
ATOM   615  N  N   . TRP A 1 79  ? 32.564  7.063   1.749   1.00 13.68 ? 78  TRP A N   1 
ATOM   616  C  CA  . TRP A 1 79  ? 33.947  7.571   1.937   1.00 13.90 ? 78  TRP A CA  1 
ATOM   617  C  C   . TRP A 1 79  ? 34.963  6.633   1.334   1.00 14.50 ? 78  TRP A C   1 
ATOM   618  O  O   . TRP A 1 79  ? 35.989  7.090   0.790   1.00 14.47 ? 78  TRP A O   1 
ATOM   619  C  CB  . TRP A 1 79  ? 34.322  7.892   3.387   1.00 13.29 ? 78  TRP A CB  1 
ATOM   620  C  CG  . TRP A 1 79  ? 33.264  8.611   4.218   1.00 14.74 ? 78  TRP A CG  1 
ATOM   621  C  CD1 . TRP A 1 79  ? 32.826  8.247   5.446   1.00 13.51 ? 78  TRP A CD1 1 
ATOM   622  C  CD2 . TRP A 1 79  ? 32.572  9.819   3.883   1.00 13.21 ? 78  TRP A CD2 1 
ATOM   623  N  NE1 . TRP A 1 79  ? 31.887  9.139   5.909   1.00 12.58 ? 78  TRP A NE1 1 
ATOM   624  C  CE2 . TRP A 1 79  ? 31.711  10.121  4.968   1.00 12.83 ? 78  TRP A CE2 1 
ATOM   625  C  CE3 . TRP A 1 79  ? 32.594  10.680  2.773   1.00 14.80 ? 78  TRP A CE3 1 
ATOM   626  C  CZ2 . TRP A 1 79  ? 30.861  11.249  4.977   1.00 13.83 ? 78  TRP A CZ2 1 
ATOM   627  C  CZ3 . TRP A 1 79  ? 31.744  11.817  2.785   1.00 14.29 ? 78  TRP A CZ3 1 
ATOM   628  C  CH2 . TRP A 1 79  ? 30.881  12.073  3.879   1.00 14.72 ? 78  TRP A CH2 1 
ATOM   629  N  N   . THR A 1 80  ? 34.714  5.324   1.471   1.00 14.12 ? 79  THR A N   1 
ATOM   630  C  CA  . THR A 1 80  ? 35.601  4.329   0.909   1.00 15.17 ? 79  THR A CA  1 
ATOM   631  C  C   . THR A 1 80  ? 35.552  4.277   -0.614  1.00 14.81 ? 79  THR A C   1 
ATOM   632  O  O   . THR A 1 80  ? 36.475  3.735   -1.239  1.00 13.50 ? 79  THR A O   1 
ATOM   633  C  CB  . THR A 1 80  ? 35.327  2.897   1.461   1.00 14.25 ? 79  THR A CB  1 
ATOM   634  O  OG1 . THR A 1 80  ? 34.062  2.418   0.969   1.00 13.40 ? 79  THR A OG1 1 
ATOM   635  C  CG2 . THR A 1 80  ? 35.346  2.911   2.981   1.00 15.53 ? 79  THR A CG2 1 
ATOM   636  N  N   . ASN A 1 81  ? 34.463  4.808   -1.179  1.00 14.11 ? 80  ASN A N   1 
ATOM   637  C  CA  . ASN A 1 81  ? 34.217  4.810   -2.620  1.00 14.34 ? 80  ASN A CA  1 
ATOM   638  C  C   . ASN A 1 81  ? 34.896  5.955   -3.361  1.00 15.15 ? 80  ASN A C   1 
ATOM   639  O  O   . ASN A 1 81  ? 34.783  6.018   -4.581  1.00 15.67 ? 80  ASN A O   1 
ATOM   640  C  CB  . ASN A 1 81  ? 32.709  4.967   -2.915  1.00 14.12 ? 80  ASN A CB  1 
ATOM   641  C  CG  . ASN A 1 81  ? 31.912  3.682   -2.749  1.00 15.70 ? 80  ASN A CG  1 
ATOM   642  O  OD1 . ASN A 1 81  ? 30.668  3.725   -2.808  1.00 17.84 ? 80  ASN A OD1 1 
ATOM   643  N  ND2 . ASN A 1 81  ? 32.599  2.550   -2.553  1.00 15.61 ? 80  ASN A ND2 1 
ATOM   644  N  N   . LEU A 1 82  ? 35.536  6.876   -2.633  1.00 14.55 ? 81  LEU A N   1 
ATOM   645  C  CA  . LEU A 1 82  ? 36.138  8.077   -3.235  1.00 14.69 ? 81  LEU A CA  1 
ATOM   646  C  C   . LEU A 1 82  ? 37.638  8.068   -2.987  1.00 15.41 ? 81  LEU A C   1 
ATOM   647  O  O   . LEU A 1 82  ? 38.098  7.588   -1.949  1.00 15.08 ? 81  LEU A O   1 
ATOM   648  C  CB  . LEU A 1 82  ? 35.539  9.352   -2.644  1.00 14.48 ? 81  LEU A CB  1 
ATOM   649  C  CG  . LEU A 1 82  ? 34.013  9.425   -2.717  1.00 13.86 ? 81  LEU A CG  1 
ATOM   650  C  CD1 . LEU A 1 82  ? 33.566  10.577  -1.852  1.00 16.29 ? 81  LEU A CD1 1 
ATOM   651  C  CD2 . LEU A 1 82  ? 33.565  9.538   -4.201  1.00 14.37 ? 81  LEU A CD2 1 
ATOM   652  N  N   . ALA A 1 83  ? 38.384  8.599   -3.945  1.00 16.25 ? 82  ALA A N   1 
ATOM   653  C  CA  . ALA A 1 83  ? 39.856  8.645   -3.848  1.00 16.68 ? 82  ALA A CA  1 
ATOM   654  C  C   . ALA A 1 83  ? 40.380  9.703   -4.805  1.00 18.11 ? 82  ALA A C   1 
ATOM   655  O  O   . ALA A 1 83  ? 39.799  9.945   -5.865  1.00 16.98 ? 82  ALA A O   1 
ATOM   656  C  CB  . ALA A 1 83  ? 40.494  7.261   -4.156  1.00 17.08 ? 82  ALA A CB  1 
ATOM   657  N  N   . LYS A 1 84  ? 41.491  10.331  -4.427  1.00 19.61 ? 83  LYS A N   1 
ATOM   658  C  CA  . LYS A 1 84  ? 42.159  11.282  -5.303  1.00 21.52 ? 83  LYS A CA  1 
ATOM   659  C  C   . LYS A 1 84  ? 42.671  10.561  -6.551  1.00 22.30 ? 83  LYS A C   1 
ATOM   660  O  O   . LYS A 1 84  ? 42.547  11.071  -7.670  1.00 22.53 ? 83  LYS A O   1 
ATOM   661  C  CB  . LYS A 1 84  ? 43.290  11.985  -4.557  1.00 22.10 ? 83  LYS A CB  1 
ATOM   662  C  CG  . LYS A 1 84  ? 44.091  12.951  -5.433  1.00 24.66 ? 83  LYS A CG  1 
ATOM   663  C  CD  . LYS A 1 84  ? 44.685  14.114  -4.641  1.00 29.58 ? 83  LYS A CD  1 
ATOM   664  C  CE  . LYS A 1 84  ? 45.723  13.680  -3.636  1.00 31.11 ? 83  LYS A CE  1 
ATOM   665  N  NZ  . LYS A 1 84  ? 46.410  14.872  -3.052  1.00 34.10 ? 83  LYS A NZ  1 
ATOM   666  N  N   . ASP A 1 85  ? 43.247  9.378   -6.336  1.00 23.58 ? 84  ASP A N   1 
ATOM   667  C  CA  . ASP A 1 85  ? 43.756  8.503   -7.387  1.00 24.90 ? 84  ASP A CA  1 
ATOM   668  C  C   . ASP A 1 85  ? 43.072  7.143   -7.207  1.00 25.29 ? 84  ASP A C   1 
ATOM   669  O  O   . ASP A 1 85  ? 43.569  6.274   -6.501  1.00 26.60 ? 84  ASP A O   1 
ATOM   670  C  CB  . ASP A 1 85  ? 45.292  8.411   -7.286  1.00 24.81 ? 84  ASP A CB  1 
ATOM   671  C  CG  . ASP A 1 85  ? 45.907  7.387   -8.246  1.00 26.78 ? 84  ASP A CG  1 
ATOM   672  O  OD1 . ASP A 1 85  ? 47.060  6.963   -7.984  1.00 27.86 ? 84  ASP A OD1 1 
ATOM   673  O  OD2 . ASP A 1 85  ? 45.262  6.998   -9.245  1.00 28.03 ? 84  ASP A OD2 1 
ATOM   674  N  N   . GLY A 1 86  ? 41.913  6.986   -7.844  1.00 26.21 ? 85  GLY A N   1 
ATOM   675  C  CA  . GLY A 1 86  ? 41.076  5.793   -7.684  1.00 26.59 ? 85  GLY A CA  1 
ATOM   676  C  C   . GLY A 1 86  ? 41.490  4.593   -8.514  1.00 26.50 ? 85  GLY A C   1 
ATOM   677  O  O   . GLY A 1 86  ? 41.087  3.462   -8.223  1.00 27.12 ? 85  GLY A O   1 
ATOM   678  N  N   . GLY A 1 87  ? 42.311  4.829   -9.536  1.00 26.37 ? 86  GLY A N   1 
ATOM   679  C  CA  . GLY A 1 87  ? 42.731  3.759   -10.429 1.00 26.04 ? 86  GLY A CA  1 
ATOM   680  C  C   . GLY A 1 87  ? 41.643  3.453   -11.446 1.00 25.70 ? 86  GLY A C   1 
ATOM   681  O  O   . GLY A 1 87  ? 40.847  4.324   -11.806 1.00 26.61 ? 86  GLY A O   1 
ATOM   682  N  N   . GLU A 1 88  ? 41.626  2.209   -11.910 1.00 25.62 ? 87  GLU A N   1 
ATOM   683  C  CA  . GLU A 1 88  ? 40.644  1.734   -12.885 1.00 24.71 ? 87  GLU A CA  1 
ATOM   684  C  C   . GLU A 1 88  ? 40.021  0.437   -12.372 1.00 22.94 ? 87  GLU A C   1 
ATOM   685  O  O   . GLU A 1 88  ? 40.588  -0.209  -11.480 1.00 21.95 ? 87  GLU A O   1 
ATOM   686  C  CB  . GLU A 1 88  ? 41.327  1.447   -14.235 1.00 25.22 ? 87  GLU A CB  1 
ATOM   687  C  CG  . GLU A 1 88  ? 41.722  2.682   -15.034 1.00 28.40 ? 87  GLU A CG  1 
ATOM   688  C  CD  . GLU A 1 88  ? 43.035  3.291   -14.574 1.00 33.04 ? 87  GLU A CD  1 
ATOM   689  O  OE1 . GLU A 1 88  ? 43.961  2.522   -14.214 1.00 34.48 ? 87  GLU A OE1 1 
ATOM   690  O  OE2 . GLU A 1 88  ? 43.146  4.539   -14.591 1.00 36.04 ? 87  GLU A OE2 1 
ATOM   691  N  N   . PRO A 1 89  ? 38.863  0.036   -12.937 1.00 21.65 ? 88  PRO A N   1 
ATOM   692  C  CA  . PRO A 1 89  ? 38.309  -1.256  -12.525 1.00 20.77 ? 88  PRO A CA  1 
ATOM   693  C  C   . PRO A 1 89  ? 39.286  -2.400  -12.761 1.00 20.34 ? 88  PRO A C   1 
ATOM   694  O  O   . PRO A 1 89  ? 40.146  -2.315  -13.663 1.00 19.03 ? 88  PRO A O   1 
ATOM   695  C  CB  . PRO A 1 89  ? 37.087  -1.418  -13.446 1.00 21.36 ? 88  PRO A CB  1 
ATOM   696  C  CG  . PRO A 1 89  ? 36.721  -0.041  -13.862 1.00 20.68 ? 88  PRO A CG  1 
ATOM   697  C  CD  . PRO A 1 89  ? 38.009  0.718   -13.933 1.00 21.64 ? 88  PRO A CD  1 
ATOM   698  N  N   . SER A 1 90  ? 39.177  -3.449  -11.947 1.00 19.11 ? 89  SER A N   1 
ATOM   699  C  CA  . SER A 1 90  ? 39.968  -4.658  -12.148 1.00 19.06 ? 89  SER A CA  1 
ATOM   700  C  C   . SER A 1 90  ? 39.517  -5.277  -13.471 1.00 18.97 ? 89  SER A C   1 
ATOM   701  O  O   . SER A 1 90  ? 38.491  -4.850  -14.033 1.00 19.12 ? 89  SER A O   1 
ATOM   702  C  CB  . SER A 1 90  ? 39.711  -5.637  -11.001 1.00 18.84 ? 89  SER A CB  1 
ATOM   703  O  OG  . SER A 1 90  ? 38.291  -5.908  -10.930 1.00 16.66 ? 89  SER A OG  1 
ATOM   704  N  N   . LYS A 1 91  ? 40.273  -6.260  -13.969 1.00 19.47 ? 90  LYS A N   1 
ATOM   705  C  CA  . LYS A 1 91  ? 39.910  -6.946  -15.205 1.00 19.14 ? 90  LYS A CA  1 
ATOM   706  C  C   . LYS A 1 91  ? 38.546  -7.636  -15.042 1.00 19.27 ? 90  LYS A C   1 
ATOM   707  O  O   . LYS A 1 91  ? 37.681  -7.507  -15.921 1.00 19.60 ? 90  LYS A O   1 
ATOM   708  C  CB  . LYS A 1 91  ? 41.018  -7.908  -15.671 1.00 19.23 ? 90  LYS A CB  1 
ATOM   709  N  N   . GLU A 1 92  ? 38.335  -8.323  -13.898 1.00 19.50 ? 91  GLU A N   1 
ATOM   710  C  CA  . GLU A 1 92  ? 37.074  -9.049  -13.630 1.00 19.87 ? 91  GLU A CA  1 
ATOM   711  C  C   . GLU A 1 92  ? 35.858  -8.106  -13.622 1.00 19.23 ? 91  GLU A C   1 
ATOM   712  O  O   . GLU A 1 92  ? 34.820  -8.421  -14.203 1.00 19.83 ? 91  GLU A O   1 
ATOM   713  C  CB  . GLU A 1 92  ? 37.146  -9.896  -12.337 1.00 19.79 ? 91  GLU A CB  1 
ATOM   714  C  CG  . GLU A 1 92  ? 37.558  -9.121  -11.072 1.00 21.25 ? 91  GLU A CG  1 
ATOM   715  C  CD  . GLU A 1 92  ? 37.634  -9.955  -9.784  1.00 22.27 ? 91  GLU A CD  1 
ATOM   716  O  OE1 . GLU A 1 92  ? 37.086  -11.084 -9.727  1.00 26.00 ? 91  GLU A OE1 1 
ATOM   717  O  OE2 . GLU A 1 92  ? 38.258  -9.468  -8.810  1.00 24.20 ? 91  GLU A OE2 1 
ATOM   718  N  N   . LEU A 1 93  ? 36.006  -6.947  -12.989 1.00 18.46 ? 92  LEU A N   1 
ATOM   719  C  CA  . LEU A 1 93  ? 34.917  -5.968  -12.913 1.00 17.29 ? 92  LEU A CA  1 
ATOM   720  C  C   . LEU A 1 93  ? 34.631  -5.311  -14.273 1.00 17.04 ? 92  LEU A C   1 
ATOM   721  O  O   . LEU A 1 93  ? 33.475  -5.220  -14.685 1.00 16.17 ? 92  LEU A O   1 
ATOM   722  C  CB  . LEU A 1 93  ? 35.199  -4.912  -11.841 1.00 17.75 ? 92  LEU A CB  1 
ATOM   723  C  CG  . LEU A 1 93  ? 34.094  -3.859  -11.659 1.00 16.43 ? 92  LEU A CG  1 
ATOM   724  C  CD1 . LEU A 1 93  ? 32.743  -4.527  -11.362 1.00 16.89 ? 92  LEU A CD1 1 
ATOM   725  C  CD2 . LEU A 1 93  ? 34.444  -2.863  -10.567 1.00 17.04 ? 92  LEU A CD2 1 
ATOM   726  N  N   . MET A 1 94  ? 35.680  -4.880  -14.975 1.00 17.26 ? 93  MET A N   1 
ATOM   727  C  CA  . MET A 1 94  ? 35.513  -4.311  -16.308 1.00 17.45 ? 93  MET A CA  1 
ATOM   728  C  C   . MET A 1 94  ? 34.757  -5.273  -17.229 1.00 17.23 ? 93  MET A C   1 
ATOM   729  O  O   . MET A 1 94  ? 33.817  -4.857  -17.922 1.00 16.74 ? 93  MET A O   1 
ATOM   730  C  CB  . MET A 1 94  ? 36.858  -3.912  -16.924 1.00 17.82 ? 93  MET A CB  1 
ATOM   731  C  CG  . MET A 1 94  ? 36.712  -3.097  -18.213 1.00 19.26 ? 93  MET A CG  1 
ATOM   732  S  SD  . MET A 1 94  ? 35.896  -1.499  -17.941 1.00 21.74 ? 93  MET A SD  1 
ATOM   733  C  CE  . MET A 1 94  ? 37.299  -0.494  -17.468 1.00 22.41 ? 93  MET A CE  1 
ATOM   734  N  N   . ASP A 1 95  ? 35.168  -6.548  -17.215 1.00 17.21 ? 94  ASP A N   1 
ATOM   735  C  CA  . ASP A 1 95  ? 34.527  -7.613  -17.996 1.00 16.86 ? 94  ASP A CA  1 
ATOM   736  C  C   . ASP A 1 95  ? 33.050  -7.746  -17.636 1.00 16.73 ? 94  ASP A C   1 
ATOM   737  O  O   . ASP A 1 95  ? 32.187  -7.871  -18.509 1.00 16.39 ? 94  ASP A O   1 
ATOM   738  C  CB  . ASP A 1 95  ? 35.245  -8.956  -17.778 1.00 17.54 ? 94  ASP A CB  1 
ATOM   739  C  CG  . ASP A 1 95  ? 36.595  -9.025  -18.472 1.00 18.34 ? 94  ASP A CG  1 
ATOM   740  O  OD1 . ASP A 1 95  ? 36.919  -8.113  -19.268 1.00 21.92 ? 94  ASP A OD1 1 
ATOM   741  O  OD2 . ASP A 1 95  ? 37.336  -10.006 -18.232 1.00 18.88 ? 94  ASP A OD2 1 
ATOM   742  N  N   . THR A 1 96  ? 32.763  -7.684  -16.338 1.00 16.52 ? 95  THR A N   1 
ATOM   743  C  CA  . THR A 1 96  ? 31.405  -7.831  -15.869 1.00 16.42 ? 95  THR A CA  1 
ATOM   744  C  C   . THR A 1 96  ? 30.596  -6.585  -16.276 1.00 16.25 ? 95  THR A C   1 
ATOM   745  O  O   . THR A 1 96  ? 29.443  -6.702  -16.696 1.00 16.14 ? 95  THR A O   1 
ATOM   746  C  CB  . THR A 1 96  ? 31.377  -8.100  -14.367 1.00 16.16 ? 95  THR A CB  1 
ATOM   747  O  OG1 . THR A 1 96  ? 32.214  -9.239  -14.088 1.00 16.77 ? 95  THR A OG1 1 
ATOM   748  C  CG2 . THR A 1 96  ? 29.961  -8.395  -13.919 1.00 16.08 ? 95  THR A CG2 1 
ATOM   749  N  N   . ILE A 1 97  ? 31.219  -5.410  -16.181 1.00 17.38 ? 96  ILE A N   1 
ATOM   750  C  CA  . ILE A 1 97  ? 30.596  -4.145  -16.608 1.00 17.33 ? 96  ILE A CA  1 
ATOM   751  C  C   . ILE A 1 97  ? 30.219  -4.219  -18.094 1.00 17.12 ? 96  ILE A C   1 
ATOM   752  O  O   . ILE A 1 97  ? 29.083  -3.905  -18.474 1.00 16.32 ? 96  ILE A O   1 
ATOM   753  C  CB  . ILE A 1 97  ? 31.500  -2.899  -16.308 1.00 17.80 ? 96  ILE A CB  1 
ATOM   754  C  CG1 . ILE A 1 97  ? 31.596  -2.665  -14.793 1.00 17.87 ? 96  ILE A CG1 1 
ATOM   755  C  CG2 . ILE A 1 97  ? 30.952  -1.619  -16.994 1.00 16.68 ? 96  ILE A CG2 1 
ATOM   756  C  CD1 . ILE A 1 97  ? 32.544  -1.544  -14.374 1.00 18.74 ? 96  ILE A CD1 1 
ATOM   757  N  N   . LYS A 1 98  ? 31.167  -4.684  -18.911 1.00 17.32 ? 97  LYS A N   1 
ATOM   758  C  CA  . LYS A 1 98  ? 30.947  -4.890  -20.338 1.00 17.77 ? 97  LYS A CA  1 
ATOM   759  C  C   . LYS A 1 98  ? 29.822  -5.884  -20.605 1.00 17.52 ? 97  LYS A C   1 
ATOM   760  O  O   . LYS A 1 98  ? 29.022  -5.684  -21.517 1.00 17.49 ? 97  LYS A O   1 
ATOM   761  C  CB  . LYS A 1 98  ? 32.237  -5.357  -21.026 1.00 17.09 ? 97  LYS A CB  1 
ATOM   762  C  CG  . LYS A 1 98  ? 33.293  -4.267  -21.143 1.00 18.37 ? 97  LYS A CG  1 
ATOM   763  C  CD  . LYS A 1 98  ? 34.617  -4.801  -21.666 1.00 19.44 ? 97  LYS A CD  1 
ATOM   764  C  CE  . LYS A 1 98  ? 35.614  -3.663  -21.849 1.00 21.82 ? 97  LYS A CE  1 
ATOM   765  N  NZ  . LYS A 1 98  ? 36.928  -4.136  -22.354 1.00 24.60 ? 97  LYS A NZ  1 
ATOM   766  N  N   . ARG A 1 99  ? 29.756  -6.941  -19.799 1.00 17.67 ? 98  ARG A N   1 
ATOM   767  C  CA  . ARG A 1 99  ? 28.729  -7.959  -19.951 1.00 18.46 ? 98  ARG A CA  1 
ATOM   768  C  C   . ARG A 1 99  ? 27.328  -7.401  -19.707 1.00 18.09 ? 98  ARG A C   1 
ATOM   769  O  O   . ARG A 1 99  ? 26.429  -7.587  -20.529 1.00 17.99 ? 98  ARG A O   1 
ATOM   770  C  CB  . ARG A 1 99  ? 29.009  -9.158  -19.027 1.00 18.64 ? 98  ARG A CB  1 
ATOM   771  C  CG  . ARG A 1 99  ? 28.182  -10.391 -19.335 1.00 18.95 ? 98  ARG A CG  1 
ATOM   772  C  CD  . ARG A 1 99  ? 28.506  -11.600 -18.437 1.00 20.88 ? 98  ARG A CD  1 
ATOM   773  N  NE  . ARG A 1 99  ? 29.921  -11.681 -18.045 1.00 26.23 ? 98  ARG A NE  1 
ATOM   774  C  CZ  . ARG A 1 99  ? 30.365  -11.559 -16.791 1.00 26.52 ? 98  ARG A CZ  1 
ATOM   775  N  NH1 . ARG A 1 99  ? 29.508  -11.391 -15.786 1.00 27.90 ? 98  ARG A NH1 1 
ATOM   776  N  NH2 . ARG A 1 99  ? 31.666  -11.634 -16.534 1.00 26.72 ? 98  ARG A NH2 1 
ATOM   777  N  N   . ASP A 1 100 ? 27.161  -6.671  -18.605 1.00 17.61 ? 99  ASP A N   1 
ATOM   778  C  CA  . ASP A 1 100 ? 25.835  -6.256  -18.184 1.00 17.25 ? 99  ASP A CA  1 
ATOM   779  C  C   . ASP A 1 100 ? 25.417  -4.871  -18.655 1.00 17.28 ? 99  ASP A C   1 
ATOM   780  O  O   . ASP A 1 100 ? 24.233  -4.557  -18.604 1.00 17.85 ? 99  ASP A O   1 
ATOM   781  C  CB  . ASP A 1 100 ? 25.686  -6.377  -16.665 1.00 17.38 ? 99  ASP A CB  1 
ATOM   782  C  CG  . ASP A 1 100 ? 25.971  -7.787  -16.146 1.00 16.46 ? 99  ASP A CG  1 
ATOM   783  O  OD1 . ASP A 1 100 ? 25.779  -8.793  -16.883 1.00 17.46 ? 99  ASP A OD1 1 
ATOM   784  O  OD2 . ASP A 1 100 ? 26.395  -7.892  -14.979 1.00 14.96 ? 99  ASP A OD2 1 
ATOM   785  N  N   . PHE A 1 101 ? 26.370  -4.057  -19.120 1.00 16.88 ? 100 PHE A N   1 
ATOM   786  C  CA  . PHE A 1 101 ? 26.071  -2.687  -19.577 1.00 16.49 ? 100 PHE A CA  1 
ATOM   787  C  C   . PHE A 1 101 ? 26.658  -2.336  -20.944 1.00 16.55 ? 100 PHE A C   1 
ATOM   788  O  O   . PHE A 1 101 ? 26.417  -1.246  -21.457 1.00 15.89 ? 100 PHE A O   1 
ATOM   789  C  CB  . PHE A 1 101 ? 26.527  -1.649  -18.547 1.00 16.78 ? 100 PHE A CB  1 
ATOM   790  C  CG  . PHE A 1 101 ? 25.823  -1.756  -17.227 1.00 16.41 ? 100 PHE A CG  1 
ATOM   791  C  CD1 . PHE A 1 101 ? 26.424  -2.425  -16.167 1.00 15.03 ? 100 PHE A CD1 1 
ATOM   792  C  CD2 . PHE A 1 101 ? 24.553  -1.208  -17.049 1.00 19.03 ? 100 PHE A CD2 1 
ATOM   793  C  CE1 . PHE A 1 101 ? 25.773  -2.537  -14.944 1.00 17.04 ? 100 PHE A CE1 1 
ATOM   794  C  CE2 . PHE A 1 101 ? 23.904  -1.328  -15.834 1.00 18.15 ? 100 PHE A CE2 1 
ATOM   795  C  CZ  . PHE A 1 101 ? 24.522  -2.006  -14.786 1.00 16.43 ? 100 PHE A CZ  1 
ATOM   796  N  N   . GLY A 1 102 ? 27.415  -3.254  -21.537 1.00 16.34 ? 101 GLY A N   1 
ATOM   797  C  CA  . GLY A 1 102 ? 28.063  -2.971  -22.810 1.00 16.29 ? 101 GLY A CA  1 
ATOM   798  C  C   . GLY A 1 102 ? 29.459  -2.395  -22.649 1.00 16.28 ? 101 GLY A C   1 
ATOM   799  O  O   . GLY A 1 102 ? 30.419  -2.940  -23.202 1.00 16.37 ? 101 GLY A O   1 
ATOM   800  N  N   . SER A 1 103 ? 29.565  -1.303  -21.888 1.00 16.50 ? 102 SER A N   1 
ATOM   801  C  CA  . SER A 1 103 ? 30.829  -0.589  -21.679 1.00 16.57 ? 102 SER A CA  1 
ATOM   802  C  C   . SER A 1 103 ? 30.798  0.192   -20.369 1.00 16.50 ? 102 SER A C   1 
ATOM   803  O  O   . SER A 1 103 ? 29.720  0.426   -19.826 1.00 16.41 ? 102 SER A O   1 
ATOM   804  C  CB  . SER A 1 103 ? 31.045  0.403   -22.826 1.00 16.70 ? 102 SER A CB  1 
ATOM   805  O  OG  . SER A 1 103 ? 30.069  1.437   -22.797 1.00 15.46 ? 102 SER A OG  1 
ATOM   806  N  N   . LEU A 1 104 ? 31.962  0.609   -19.865 1.00 16.74 ? 103 LEU A N   1 
ATOM   807  C  CA  . LEU A 1 104 ? 31.975  1.496   -18.686 1.00 17.44 ? 103 LEU A CA  1 
ATOM   808  C  C   . LEU A 1 104 ? 31.239  2.819   -18.980 1.00 18.05 ? 103 LEU A C   1 
ATOM   809  O  O   . LEU A 1 104 ? 30.511  3.327   -18.128 1.00 18.02 ? 103 LEU A O   1 
ATOM   810  C  CB  . LEU A 1 104 ? 33.396  1.783   -18.200 1.00 17.54 ? 103 LEU A CB  1 
ATOM   811  C  CG  . LEU A 1 104 ? 33.642  2.759   -17.035 1.00 17.05 ? 103 LEU A CG  1 
ATOM   812  C  CD1 . LEU A 1 104 ? 32.839  2.444   -15.751 1.00 17.83 ? 103 LEU A CD1 1 
ATOM   813  C  CD2 . LEU A 1 104 ? 35.133  2.847   -16.718 1.00 18.08 ? 103 LEU A CD2 1 
ATOM   814  N  N   . ASP A 1 105 ? 31.440  3.356   -20.183 1.00 18.19 ? 104 ASP A N   1 
ATOM   815  C  CA  . ASP A 1 105 ? 30.753  4.577   -20.625 1.00 18.91 ? 104 ASP A CA  1 
ATOM   816  C  C   . ASP A 1 105 ? 29.228  4.460   -20.514 1.00 18.09 ? 104 ASP A C   1 
ATOM   817  O  O   . ASP A 1 105 ? 28.581  5.381   -20.026 1.00 18.51 ? 104 ASP A O   1 
ATOM   818  C  CB  . ASP A 1 105 ? 31.180  4.953   -22.053 1.00 19.73 ? 104 ASP A CB  1 
ATOM   819  C  CG  . ASP A 1 105 ? 32.516  5.711   -22.092 1.00 22.47 ? 104 ASP A CG  1 
ATOM   820  O  OD1 . ASP A 1 105 ? 33.208  5.660   -23.133 1.00 27.42 ? 104 ASP A OD1 1 
ATOM   821  O  OD2 . ASP A 1 105 ? 32.875  6.360   -21.078 1.00 26.81 ? 104 ASP A OD2 1 
ATOM   822  N  N   . ASN A 1 106 ? 28.668  3.328   -20.950 1.00 17.52 ? 105 ASN A N   1 
ATOM   823  C  CA  . ASN A 1 106 ? 27.221  3.089   -20.854 1.00 16.96 ? 105 ASN A CA  1 
ATOM   824  C  C   . ASN A 1 106 ? 26.785  2.994   -19.402 1.00 16.39 ? 105 ASN A C   1 
ATOM   825  O  O   . ASN A 1 106 ? 25.753  3.557   -19.021 1.00 15.31 ? 105 ASN A O   1 
ATOM   826  C  CB  . ASN A 1 106 ? 26.798  1.811   -21.605 1.00 17.37 ? 105 ASN A CB  1 
ATOM   827  C  CG  . ASN A 1 106 ? 26.901  1.937   -23.138 1.00 18.65 ? 105 ASN A CG  1 
ATOM   828  O  OD1 . ASN A 1 106 ? 27.112  3.026   -23.690 1.00 20.27 ? 105 ASN A OD1 1 
ATOM   829  N  ND2 . ASN A 1 106 ? 26.741  0.805   -23.829 1.00 18.84 ? 105 ASN A ND2 1 
ATOM   830  N  N   . LEU A 1 107 ? 27.556  2.280   -18.583 1.00 15.56 ? 106 LEU A N   1 
ATOM   831  C  CA  . LEU A 1 107 ? 27.222  2.210   -17.159 1.00 15.20 ? 106 LEU A CA  1 
ATOM   832  C  C   . LEU A 1 107 ? 27.212  3.610   -16.530 1.00 14.63 ? 106 LEU A C   1 
ATOM   833  O  O   . LEU A 1 107 ? 26.269  3.964   -15.828 1.00 12.97 ? 106 LEU A O   1 
ATOM   834  C  CB  . LEU A 1 107 ? 28.155  1.287   -16.362 1.00 15.05 ? 106 LEU A CB  1 
ATOM   835  C  CG  . LEU A 1 107 ? 28.089  1.454   -14.820 1.00 14.91 ? 106 LEU A CG  1 
ATOM   836  C  CD1 . LEU A 1 107 ? 26.730  1.088   -14.201 1.00 14.98 ? 106 LEU A CD1 1 
ATOM   837  C  CD2 . LEU A 1 107 ? 29.206  0.649   -14.148 1.00 16.22 ? 106 LEU A CD2 1 
ATOM   838  N  N   . GLN A 1 108 ? 28.254  4.400   -16.800 1.00 15.12 ? 107 GLN A N   1 
ATOM   839  C  CA  . GLN A 1 108 ? 28.381  5.723   -16.207 1.00 15.55 ? 107 GLN A CA  1 
ATOM   840  C  C   . GLN A 1 108 ? 27.222  6.598   -16.630 1.00 15.50 ? 107 GLN A C   1 
ATOM   841  O  O   . GLN A 1 108 ? 26.598  7.256   -15.785 1.00 15.16 ? 107 GLN A O   1 
ATOM   842  C  CB  . GLN A 1 108 ? 29.730  6.365   -16.564 1.00 15.79 ? 107 GLN A CB  1 
ATOM   843  C  CG  . GLN A 1 108 ? 30.885  5.728   -15.823 1.00 18.18 ? 107 GLN A CG  1 
ATOM   844  C  CD  . GLN A 1 108 ? 32.224  6.283   -16.231 1.00 19.70 ? 107 GLN A CD  1 
ATOM   845  O  OE1 . GLN A 1 108 ? 32.399  6.764   -17.352 1.00 21.97 ? 107 GLN A OE1 1 
ATOM   846  N  NE2 . GLN A 1 108 ? 33.182  6.234   -15.312 1.00 19.26 ? 107 GLN A NE2 1 
ATOM   847  N  N   . LYS A 1 109 ? 26.892  6.573   -17.916 1.00 15.43 ? 108 LYS A N   1 
ATOM   848  C  CA  . LYS A 1 109 ? 25.761  7.355   -18.414 1.00 17.14 ? 108 LYS A CA  1 
ATOM   849  C  C   . LYS A 1 109 ? 24.447  6.935   -17.743 1.00 15.55 ? 108 LYS A C   1 
ATOM   850  O  O   . LYS A 1 109 ? 23.698  7.784   -17.257 1.00 15.59 ? 108 LYS A O   1 
ATOM   851  C  CB  . LYS A 1 109 ? 25.643  7.263   -19.939 1.00 17.26 ? 108 LYS A CB  1 
ATOM   852  C  CG  . LYS A 1 109 ? 24.415  7.990   -20.496 1.00 19.63 ? 108 LYS A CG  1 
ATOM   853  C  CD  . LYS A 1 109 ? 24.414  8.040   -22.034 1.00 19.70 ? 108 LYS A CD  1 
ATOM   854  C  CE  . LYS A 1 109 ? 25.480  9.002   -22.598 1.00 24.71 ? 108 LYS A CE  1 
ATOM   855  N  NZ  . LYS A 1 109 ? 25.411  9.144   -24.093 1.00 24.87 ? 108 LYS A NZ  1 
ATOM   856  N  N   . ARG A 1 110 ? 24.187  5.630   -17.705 1.00 14.95 ? 109 ARG A N   1 
ATOM   857  C  CA  . ARG A 1 110 ? 22.936  5.134   -17.137 1.00 14.31 ? 109 ARG A CA  1 
ATOM   858  C  C   . ARG A 1 110 ? 22.806  5.420   -15.634 1.00 14.36 ? 109 ARG A C   1 
ATOM   859  O  O   . ARG A 1 110 ? 21.734  5.856   -15.166 1.00 14.53 ? 109 ARG A O   1 
ATOM   860  C  CB  . ARG A 1 110 ? 22.740  3.653   -17.486 1.00 14.43 ? 109 ARG A CB  1 
ATOM   861  C  CG  . ARG A 1 110 ? 22.467  3.457   -18.973 1.00 14.99 ? 109 ARG A CG  1 
ATOM   862  C  CD  . ARG A 1 110 ? 22.349  2.002   -19.344 1.00 17.39 ? 109 ARG A CD  1 
ATOM   863  N  NE  . ARG A 1 110 ? 21.353  1.290   -18.546 1.00 18.56 ? 109 ARG A NE  1 
ATOM   864  C  CZ  . ARG A 1 110 ? 21.110  -0.011  -18.657 1.00 20.11 ? 109 ARG A CZ  1 
ATOM   865  N  NH1 . ARG A 1 110 ? 21.775  -0.750  -19.537 1.00 18.42 ? 109 ARG A NH1 1 
ATOM   866  N  NH2 . ARG A 1 110 ? 20.186  -0.577  -17.889 1.00 21.73 ? 109 ARG A NH2 1 
ATOM   867  N  N   . LEU A 1 111 ? 23.888  5.211   -14.883 1.00 13.87 ? 110 LEU A N   1 
ATOM   868  C  CA  . LEU A 1 111 ? 23.846  5.474   -13.443 1.00 13.48 ? 110 LEU A CA  1 
ATOM   869  C  C   . LEU A 1 111 ? 23.783  6.960   -13.195 1.00 13.37 ? 110 LEU A C   1 
ATOM   870  O  O   . LEU A 1 111 ? 23.034  7.403   -12.343 1.00 11.98 ? 110 LEU A O   1 
ATOM   871  C  CB  . LEU A 1 111 ? 25.039  4.842   -12.700 1.00 13.48 ? 110 LEU A CB  1 
ATOM   872  C  CG  . LEU A 1 111 ? 25.068  5.071   -11.161 1.00 13.48 ? 110 LEU A CG  1 
ATOM   873  C  CD1 . LEU A 1 111 ? 23.760  4.680   -10.438 1.00 13.46 ? 110 LEU A CD1 1 
ATOM   874  C  CD2 . LEU A 1 111 ? 26.259  4.357   -10.529 1.00 15.11 ? 110 LEU A CD2 1 
ATOM   875  N  N   . SER A 1 112 ? 24.555  7.742   -13.956 1.00 12.84 ? 111 SER A N   1 
ATOM   876  C  CA  . SER A 1 112 ? 24.457  9.200   -13.810 1.00 13.74 ? 111 SER A CA  1 
ATOM   877  C  C   . SER A 1 112 ? 23.032  9.684   -14.069 1.00 14.10 ? 111 SER A C   1 
ATOM   878  O  O   . SER A 1 112 ? 22.502  10.492  -13.291 1.00 13.70 ? 111 SER A O   1 
ATOM   879  C  CB  . SER A 1 112 ? 25.453  9.901   -14.723 1.00 14.83 ? 111 SER A CB  1 
ATOM   880  O  OG  . SER A 1 112 ? 26.783  9.615   -14.310 1.00 15.91 ? 111 SER A OG  1 
ATOM   881  N  N   . ASP A 1 113 ? 22.399  9.149   -15.115 1.00 13.61 ? 112 ASP A N   1 
ATOM   882  C  CA  . ASP A 1 113 ? 21.056  9.587   -15.478 1.00 14.17 ? 112 ASP A CA  1 
ATOM   883  C  C   . ASP A 1 113 ? 20.051  9.326   -14.376 1.00 13.46 ? 112 ASP A C   1 
ATOM   884  O  O   . ASP A 1 113 ? 19.336  10.237  -13.966 1.00 13.99 ? 112 ASP A O   1 
ATOM   885  C  CB  . ASP A 1 113 ? 20.613  8.994   -16.816 1.00 13.36 ? 112 ASP A CB  1 
ATOM   886  C  CG  . ASP A 1 113 ? 21.252  9.713   -18.020 1.00 15.86 ? 112 ASP A CG  1 
ATOM   887  O  OD1 . ASP A 1 113 ? 21.918  10.764  -17.832 1.00 16.28 ? 112 ASP A OD1 1 
ATOM   888  O  OD2 . ASP A 1 113 ? 21.091  9.211   -19.163 1.00 18.82 ? 112 ASP A OD2 1 
ATOM   889  N  N   . ILE A 1 114 ? 19.992  8.095   -13.868 1.00 12.81 ? 113 ILE A N   1 
ATOM   890  C  CA  . ILE A 1 114 ? 18.997  7.820   -12.825 1.00 12.60 ? 113 ILE A CA  1 
ATOM   891  C  C   . ILE A 1 114 ? 19.322  8.555   -11.525 1.00 12.19 ? 113 ILE A C   1 
ATOM   892  O  O   . ILE A 1 114 ? 18.435  8.931   -10.778 1.00 12.60 ? 113 ILE A O   1 
ATOM   893  C  CB  . ILE A 1 114 ? 18.742  6.307   -12.565 1.00 13.04 ? 113 ILE A CB  1 
ATOM   894  C  CG1 . ILE A 1 114 ? 19.988  5.613   -11.963 1.00 12.21 ? 113 ILE A CG1 1 
ATOM   895  C  CG2 . ILE A 1 114 ? 18.264  5.603   -13.853 1.00 14.62 ? 113 ILE A CG2 1 
ATOM   896  C  CD1 . ILE A 1 114 ? 19.751  4.111   -11.479 1.00 13.52 ? 113 ILE A CD1 1 
ATOM   897  N  N   . THR A 1 115 ? 20.609  8.755   -11.256 1.00 11.15 ? 114 THR A N   1 
ATOM   898  C  CA  . THR A 1 115 ? 21.019  9.455   -10.032 1.00 12.27 ? 114 THR A CA  1 
ATOM   899  C  C   . THR A 1 115 ? 20.613  10.949  -10.126 1.00 12.99 ? 114 THR A C   1 
ATOM   900  O  O   . THR A 1 115 ? 20.023  11.538  -9.184  1.00 12.49 ? 114 THR A O   1 
ATOM   901  C  CB  . THR A 1 115 ? 22.551  9.276   -9.807  1.00 11.25 ? 114 THR A CB  1 
ATOM   902  O  OG1 . THR A 1 115 ? 22.861  7.877   -9.663  1.00 12.58 ? 114 THR A OG1 1 
ATOM   903  C  CG2 . THR A 1 115 ? 23.034  10.054  -8.581  1.00 13.33 ? 114 THR A CG2 1 
ATOM   904  N  N   . ILE A 1 116 ? 20.870  11.544  -11.280 1.00 12.37 ? 115 ILE A N   1 
ATOM   905  C  CA  . ILE A 1 116 ? 20.486  12.946  -11.514 1.00 12.53 ? 115 ILE A CA  1 
ATOM   906  C  C   . ILE A 1 116 ? 18.951  13.125  -11.342 1.00 13.75 ? 115 ILE A C   1 
ATOM   907  O  O   . ILE A 1 116 ? 18.471  14.153  -10.846 1.00 14.34 ? 115 ILE A O   1 
ATOM   908  C  CB  . ILE A 1 116 ? 20.976  13.420  -12.900 1.00 12.99 ? 115 ILE A CB  1 
ATOM   909  C  CG1 . ILE A 1 116 ? 22.511  13.612  -12.849 1.00 12.93 ? 115 ILE A CG1 1 
ATOM   910  C  CG2 . ILE A 1 116 ? 20.269  14.716  -13.357 1.00 12.26 ? 115 ILE A CG2 1 
ATOM   911  C  CD1 . ILE A 1 116 ? 23.170  13.700  -14.230 1.00 14.26 ? 115 ILE A CD1 1 
ATOM   912  N  N   . ALA A 1 117 ? 18.210  12.116  -11.791 1.00 13.89 ? 116 ALA A N   1 
ATOM   913  C  CA  . ALA A 1 117 ? 16.757  12.143  -11.795 1.00 14.22 ? 116 ALA A CA  1 
ATOM   914  C  C   . ALA A 1 117 ? 16.082  11.925  -10.436 1.00 13.97 ? 116 ALA A C   1 
ATOM   915  O  O   . ALA A 1 117 ? 14.861  12.064  -10.335 1.00 14.56 ? 116 ALA A O   1 
ATOM   916  C  CB  . ALA A 1 117 ? 16.222  11.122  -12.832 1.00 15.02 ? 116 ALA A CB  1 
ATOM   917  N  N   . VAL A 1 118 ? 16.844  11.565  -9.400  1.00 14.64 ? 117 VAL A N   1 
ATOM   918  C  CA  . VAL A 1 118 ? 16.280  11.396  -8.051  1.00 14.70 ? 117 VAL A CA  1 
ATOM   919  C  C   . VAL A 1 118 ? 15.497  12.672  -7.680  1.00 15.77 ? 117 VAL A C   1 
ATOM   920  O  O   . VAL A 1 118 ? 16.028  13.782  -7.791  1.00 15.84 ? 117 VAL A O   1 
ATOM   921  C  CB  . VAL A 1 118 ? 17.428  11.107  -7.010  1.00 15.16 ? 117 VAL A CB  1 
ATOM   922  C  CG1 . VAL A 1 118 ? 16.929  11.266  -5.580  1.00 17.74 ? 117 VAL A CG1 1 
ATOM   923  C  CG2 . VAL A 1 118 ? 17.994  9.679   -7.264  1.00 16.02 ? 117 VAL A CG2 1 
ATOM   924  N  N   . GLN A 1 119 ? 14.227  12.503  -7.295  1.00 14.59 ? 118 GLN A N   1 
ATOM   925  C  CA  . GLN A 1 119 ? 13.417  13.650  -6.858  1.00 15.57 ? 118 GLN A CA  1 
ATOM   926  C  C   . GLN A 1 119 ? 13.634  13.840  -5.375  1.00 16.40 ? 118 GLN A C   1 
ATOM   927  O  O   . GLN A 1 119 ? 13.267  12.949  -4.584  1.00 16.22 ? 118 GLN A O   1 
ATOM   928  C  CB  . GLN A 1 119 ? 11.943  13.389  -7.148  1.00 16.24 ? 118 GLN A CB  1 
ATOM   929  C  CG  . GLN A 1 119 ? 11.652  13.309  -8.620  1.00 18.58 ? 118 GLN A CG  1 
ATOM   930  C  CD  . GLN A 1 119 ? 10.179  13.054  -8.909  1.00 18.99 ? 118 GLN A CD  1 
ATOM   931  O  OE1 . GLN A 1 119 ? 9.741   13.240  -10.037 1.00 25.12 ? 118 GLN A OE1 1 
ATOM   932  N  NE2 . GLN A 1 119 ? 9.418   12.658  -7.890  1.00 18.87 ? 118 GLN A NE2 1 
ATOM   933  N  N   . GLY A 1 120 ? 14.171  14.995  -4.975  1.00 15.55 ? 119 GLY A N   1 
ATOM   934  C  CA  . GLY A 1 120 ? 14.502  15.226  -3.567  1.00 14.97 ? 119 GLY A CA  1 
ATOM   935  C  C   . GLY A 1 120 ? 15.859  14.644  -3.188  1.00 14.97 ? 119 GLY A C   1 
ATOM   936  O  O   . GLY A 1 120 ? 16.791  14.595  -4.006  1.00 14.19 ? 119 GLY A O   1 
ATOM   937  N  N   . SER A 1 121 ? 15.971  14.186  -1.963  1.00 13.67 ? 120 SER A N   1 
ATOM   938  C  CA  . SER A 1 121 ? 17.199  13.611  -1.439  1.00 12.25 ? 120 SER A CA  1 
ATOM   939  C  C   . SER A 1 121 ? 17.308  12.101  -1.710  1.00 12.49 ? 120 SER A C   1 
ATOM   940  O  O   . SER A 1 121 ? 16.309  11.394  -1.701  1.00 13.22 ? 120 SER A O   1 
ATOM   941  C  CB  . SER A 1 121 ? 17.296  13.812  0.068   1.00 14.51 ? 120 SER A CB  1 
ATOM   942  O  OG  . SER A 1 121 ? 17.339  15.197  0.378   1.00 11.51 ? 120 SER A OG  1 
ATOM   943  N  N   . GLY A 1 122 ? 18.508  11.596  -1.980  1.00 11.56 ? 121 GLY A N   1 
ATOM   944  C  CA  . GLY A 1 122 ? 18.654  10.214  -2.305  1.00 12.39 ? 121 GLY A CA  1 
ATOM   945  C  C   . GLY A 1 122 ? 20.088  9.851   -2.678  1.00 13.28 ? 121 GLY A C   1 
ATOM   946  O  O   . GLY A 1 122 ? 21.023  10.634  -2.478  1.00 12.36 ? 121 GLY A O   1 
ATOM   947  N  N   . TRP A 1 123 ? 20.199  8.646   -3.211  1.00 12.42 ? 122 TRP A N   1 
ATOM   948  C  CA  . TRP A 1 123 ? 21.481  8.040   -3.590  1.00 12.47 ? 122 TRP A CA  1 
ATOM   949  C  C   . TRP A 1 123 ? 21.351  7.246   -4.877  1.00 13.36 ? 122 TRP A C   1 
ATOM   950  O  O   . TRP A 1 123 ? 20.294  6.692   -5.151  1.00 13.23 ? 122 TRP A O   1 
ATOM   951  C  CB  . TRP A 1 123 ? 21.968  7.049   -2.514  1.00 13.29 ? 122 TRP A CB  1 
ATOM   952  C  CG  . TRP A 1 123 ? 22.372  7.662   -1.208  1.00 12.83 ? 122 TRP A CG  1 
ATOM   953  C  CD1 . TRP A 1 123 ? 21.574  8.156   -0.209  1.00 13.18 ? 122 TRP A CD1 1 
ATOM   954  C  CD2 . TRP A 1 123 ? 23.718  7.852   -0.764  1.00 13.52 ? 122 TRP A CD2 1 
ATOM   955  N  NE1 . TRP A 1 123 ? 22.347  8.633   0.826   1.00 15.02 ? 122 TRP A NE1 1 
ATOM   956  C  CE2 . TRP A 1 123 ? 23.667  8.446   0.509   1.00 14.82 ? 122 TRP A CE2 1 
ATOM   957  C  CE3 . TRP A 1 123 ? 24.972  7.548   -1.311  1.00 13.94 ? 122 TRP A CE3 1 
ATOM   958  C  CZ2 . TRP A 1 123 ? 24.828  8.768   1.229   1.00 13.97 ? 122 TRP A CZ2 1 
ATOM   959  C  CZ3 . TRP A 1 123 ? 26.104  7.877   -0.606  1.00 13.84 ? 122 TRP A CZ3 1 
ATOM   960  C  CH2 . TRP A 1 123 ? 26.018  8.479   0.662   1.00 15.12 ? 122 TRP A CH2 1 
ATOM   961  N  N   . GLY A 1 124 ? 22.416  7.172   -5.625  1.00 12.67 ? 123 GLY A N   1 
ATOM   962  C  CA  . GLY A 1 124 ? 22.424  6.353   -6.813  1.00 13.34 ? 123 GLY A CA  1 
ATOM   963  C  C   . GLY A 1 124 ? 23.381  5.232   -6.478  1.00 12.64 ? 123 GLY A C   1 
ATOM   964  O  O   . GLY A 1 124 ? 24.343  5.477   -5.767  1.00 13.99 ? 123 GLY A O   1 
ATOM   965  N  N   . TRP A 1 125 ? 23.136  3.999   -6.965  1.00 13.45 ? 124 TRP A N   1 
ATOM   966  C  CA  . TRP A 1 125 ? 24.033  2.888   -6.662  1.00 13.44 ? 124 TRP A CA  1 
ATOM   967  C  C   . TRP A 1 125 ? 24.352  1.911   -7.800  1.00 13.14 ? 124 TRP A C   1 
ATOM   968  O  O   . TRP A 1 125 ? 23.522  1.596   -8.621  1.00 13.53 ? 124 TRP A O   1 
ATOM   969  C  CB  . TRP A 1 125 ? 23.418  2.000   -5.601  1.00 14.48 ? 124 TRP A CB  1 
ATOM   970  C  CG  . TRP A 1 125 ? 23.369  2.589   -4.231  1.00 14.02 ? 124 TRP A CG  1 
ATOM   971  C  CD1 . TRP A 1 125 ? 22.284  3.139   -3.630  1.00 13.74 ? 124 TRP A CD1 1 
ATOM   972  C  CD2 . TRP A 1 125 ? 24.456  2.673   -3.312  1.00 14.22 ? 124 TRP A CD2 1 
ATOM   973  N  NE1 . TRP A 1 125 ? 22.629  3.599   -2.384  1.00 15.26 ? 124 TRP A NE1 1 
ATOM   974  C  CE2 . TRP A 1 125 ? 23.961  3.344   -2.165  1.00 13.51 ? 124 TRP A CE2 1 
ATOM   975  C  CE3 . TRP A 1 125 ? 25.804  2.279   -3.346  1.00 14.33 ? 124 TRP A CE3 1 
ATOM   976  C  CZ2 . TRP A 1 125 ? 24.773  3.626   -1.052  1.00 14.42 ? 124 TRP A CZ2 1 
ATOM   977  C  CZ3 . TRP A 1 125 ? 26.611  2.546   -2.244  1.00 14.68 ? 124 TRP A CZ3 1 
ATOM   978  C  CH2 . TRP A 1 125 ? 26.089  3.220   -1.109  1.00 14.46 ? 124 TRP A CH2 1 
ATOM   979  N  N   . LEU A 1 126 ? 25.564  1.476   -7.819  1.00 13.11 ? 125 LEU A N   1 
ATOM   980  C  CA  . LEU A 1 126 ? 25.995  0.404   -8.629  1.00 12.50 ? 125 LEU A CA  1 
ATOM   981  C  C   . LEU A 1 126 ? 26.027  -0.729  -7.629  1.00 13.20 ? 125 LEU A C   1 
ATOM   982  O  O   . LEU A 1 126 ? 26.676  -0.594  -6.626  1.00 12.68 ? 125 LEU A O   1 
ATOM   983  C  CB  . LEU A 1 126 ? 27.343  0.581   -9.305  1.00 12.92 ? 125 LEU A CB  1 
ATOM   984  C  CG  . LEU A 1 126 ? 27.952  -0.706  -9.856  1.00 11.16 ? 125 LEU A CG  1 
ATOM   985  C  CD1 . LEU A 1 126 ? 27.155  -1.210  -11.047 1.00 13.20 ? 125 LEU A CD1 1 
ATOM   986  C  CD2 . LEU A 1 126 ? 29.395  -0.499  -10.266 1.00 14.46 ? 125 LEU A CD2 1 
ATOM   987  N  N   . GLY A 1 127 ? 25.336  -1.805  -7.865  1.00 13.60 ? 126 GLY A N   1 
ATOM   988  C  CA  . GLY A 1 127 ? 25.306  -2.929  -6.964  1.00 13.79 ? 126 GLY A CA  1 
ATOM   989  C  C   . GLY A 1 127 ? 25.467  -4.287  -7.672  1.00 14.78 ? 126 GLY A C   1 
ATOM   990  O  O   . GLY A 1 127 ? 25.407  -4.384  -8.907  1.00 13.63 ? 126 GLY A O   1 
ATOM   991  N  N   . TYR A 1 128 ? 25.671  -5.339  -6.877  1.00 15.03 ? 127 TYR A N   1 
ATOM   992  C  CA  . TYR A 1 128 ? 25.813  -6.687  -7.413  1.00 16.79 ? 127 TYR A CA  1 
ATOM   993  C  C   . TYR A 1 128 ? 24.703  -7.539  -6.854  1.00 17.82 ? 127 TYR A C   1 
ATOM   994  O  O   . TYR A 1 128 ? 24.534  -7.652  -5.628  1.00 18.61 ? 127 TYR A O   1 
ATOM   995  C  CB  . TYR A 1 128 ? 27.175  -7.305  -7.053  1.00 16.02 ? 127 TYR A CB  1 
ATOM   996  C  CG  . TYR A 1 128 ? 27.365  -8.680  -7.661  1.00 16.46 ? 127 TYR A CG  1 
ATOM   997  C  CD1 . TYR A 1 128 ? 27.651  -8.812  -9.017  1.00 15.15 ? 127 TYR A CD1 1 
ATOM   998  C  CD2 . TYR A 1 128 ? 27.238  -9.834  -6.888  1.00 16.41 ? 127 TYR A CD2 1 
ATOM   999  C  CE1 . TYR A 1 128 ? 27.814  -10.067 -9.602  1.00 18.15 ? 127 TYR A CE1 1 
ATOM   1000 C  CE2 . TYR A 1 128 ? 27.411  -11.070 -7.458  1.00 17.03 ? 127 TYR A CE2 1 
ATOM   1001 C  CZ  . TYR A 1 128 ? 27.702  -11.200 -8.816  1.00 16.98 ? 127 TYR A CZ  1 
ATOM   1002 O  OH  . TYR A 1 128 ? 27.869  -12.453 -9.374  1.00 17.91 ? 127 TYR A OH  1 
ATOM   1003 N  N   . CYS A 1 129 ? 23.935  -8.158  -7.749  1.00 19.59 ? 128 CYS A N   1 
ATOM   1004 C  CA  . CYS A 1 129 ? 22.831  -9.017  -7.350  1.00 20.05 ? 128 CYS A CA  1 
ATOM   1005 C  C   . CYS A 1 129 ? 23.338  -10.467 -7.315  1.00 20.22 ? 128 CYS A C   1 
ATOM   1006 O  O   . CYS A 1 129 ? 23.699  -11.045 -8.345  1.00 19.08 ? 128 CYS A O   1 
ATOM   1007 C  CB  . CYS A 1 129 ? 21.661  -8.872  -8.323  1.00 20.23 ? 128 CYS A CB  1 
ATOM   1008 S  SG  . CYS A 1 129 ? 20.132  -9.652  -7.762  1.00 24.26 ? 128 CYS A SG  1 
ATOM   1009 N  N   . LYS A 1 130 ? 23.378  -11.036 -6.114  1.00 20.77 ? 129 LYS A N   1 
ATOM   1010 C  CA  . LYS A 1 130 ? 23.939  -12.362 -5.913  1.00 21.75 ? 129 LYS A CA  1 
ATOM   1011 C  C   . LYS A 1 130 ? 23.068  -13.480 -6.484  1.00 21.49 ? 129 LYS A C   1 
ATOM   1012 O  O   . LYS A 1 130 ? 23.584  -14.502 -6.930  1.00 21.30 ? 129 LYS A O   1 
ATOM   1013 C  CB  . LYS A 1 130 ? 24.250  -12.604 -4.433  1.00 21.57 ? 129 LYS A CB  1 
ATOM   1014 C  CG  . LYS A 1 130 ? 25.309  -11.648 -3.852  1.00 24.24 ? 129 LYS A CG  1 
ATOM   1015 C  CD  . LYS A 1 130 ? 25.804  -12.064 -2.452  1.00 23.14 ? 129 LYS A CD  1 
ATOM   1016 C  CE  . LYS A 1 130 ? 26.384  -13.489 -2.404  1.00 25.69 ? 129 LYS A CE  1 
ATOM   1017 N  NZ  . LYS A 1 130 ? 27.397  -13.852 -3.462  1.00 23.49 ? 129 LYS A NZ  1 
ATOM   1018 N  N   . LYS A 1 131 ? 21.751  -13.286 -6.475  1.00 21.62 ? 130 LYS A N   1 
ATOM   1019 C  CA  . LYS A 1 131 ? 20.832  -14.320 -6.986  1.00 21.12 ? 130 LYS A CA  1 
ATOM   1020 C  C   . LYS A 1 131 ? 20.984  -14.504 -8.499  1.00 20.42 ? 130 LYS A C   1 
ATOM   1021 O  O   . LYS A 1 131 ? 21.217  -15.624 -8.982  1.00 20.59 ? 130 LYS A O   1 
ATOM   1022 C  CB  . LYS A 1 131 ? 19.373  -13.984 -6.609  1.00 22.09 ? 130 LYS A CB  1 
ATOM   1023 C  CG  . LYS A 1 131 ? 18.296  -14.995 -7.103  1.00 22.15 ? 130 LYS A CG  1 
ATOM   1024 C  CD  . LYS A 1 131 ? 18.360  -16.326 -6.387  1.00 26.66 ? 130 LYS A CD  1 
ATOM   1025 C  CE  . LYS A 1 131 ? 17.260  -17.290 -6.857  1.00 27.50 ? 130 LYS A CE  1 
ATOM   1026 N  NZ  . LYS A 1 131 ? 15.904  -16.915 -6.323  1.00 31.81 ? 130 LYS A NZ  1 
ATOM   1027 N  N   . ASP A 1 132 ? 20.856  -13.407 -9.242  1.00 19.76 ? 131 ASP A N   1 
ATOM   1028 C  CA  . ASP A 1 132 ? 20.948  -13.442 -10.698 1.00 19.78 ? 131 ASP A CA  1 
ATOM   1029 C  C   . ASP A 1 132 ? 22.370  -13.221 -11.224 1.00 19.18 ? 131 ASP A C   1 
ATOM   1030 O  O   . ASP A 1 132 ? 22.618  -13.357 -12.446 1.00 19.53 ? 131 ASP A O   1 
ATOM   1031 C  CB  . ASP A 1 132 ? 19.917  -12.494 -11.331 1.00 20.40 ? 131 ASP A CB  1 
ATOM   1032 C  CG  . ASP A 1 132 ? 18.509  -13.101 -11.338 1.00 20.99 ? 131 ASP A CG  1 
ATOM   1033 O  OD1 . ASP A 1 132 ? 18.373  -14.324 -11.615 1.00 23.86 ? 131 ASP A OD1 1 
ATOM   1034 O  OD2 . ASP A 1 132 ? 17.544  -12.363 -11.068 1.00 23.75 ? 131 ASP A OD2 1 
ATOM   1035 N  N   . LYS A 1 133 ? 23.292  -12.903 -10.284 1.00 18.07 ? 132 LYS A N   1 
ATOM   1036 C  CA  . LYS A 1 133 ? 24.731  -12.780 -10.572 1.00 17.83 ? 132 LYS A CA  1 
ATOM   1037 C  C   . LYS A 1 133 ? 25.018  -11.756 -11.666 1.00 16.63 ? 132 LYS A C   1 
ATOM   1038 O  O   . LYS A 1 133 ? 25.722  -12.029 -12.644 1.00 16.23 ? 132 LYS A O   1 
ATOM   1039 C  CB  . LYS A 1 133 ? 25.317  -14.155 -10.926 1.00 16.99 ? 132 LYS A CB  1 
ATOM   1040 C  CG  . LYS A 1 133 ? 25.484  -15.076 -9.712  1.00 19.56 ? 132 LYS A CG  1 
ATOM   1041 C  CD  . LYS A 1 133 ? 25.567  -16.538 -10.105 1.00 20.26 ? 132 LYS A CD  1 
ATOM   1042 C  CE  . LYS A 1 133 ? 24.164  -17.129 -10.290 1.00 23.69 ? 132 LYS A CE  1 
ATOM   1043 N  NZ  . LYS A 1 133 ? 24.152  -18.592 -10.581 1.00 22.53 ? 132 LYS A NZ  1 
ATOM   1044 N  N   . ILE A 1 134 ? 24.450  -10.563 -11.486 1.00 16.83 ? 133 ILE A N   1 
ATOM   1045 C  CA  . ILE A 1 134 ? 24.592  -9.496  -12.455 1.00 16.75 ? 133 ILE A CA  1 
ATOM   1046 C  C   . ILE A 1 134 ? 24.769  -8.189  -11.705 1.00 15.73 ? 133 ILE A C   1 
ATOM   1047 O  O   . ILE A 1 134 ? 24.311  -8.065  -10.565 1.00 15.57 ? 133 ILE A O   1 
ATOM   1048 C  CB  . ILE A 1 134 ? 23.335  -9.378  -13.374 1.00 17.35 ? 133 ILE A CB  1 
ATOM   1049 C  CG1 . ILE A 1 134 ? 22.049  -9.198  -12.543 1.00 18.38 ? 133 ILE A CG1 1 
ATOM   1050 C  CG2 . ILE A 1 134 ? 23.219  -10.576 -14.313 1.00 17.55 ? 133 ILE A CG2 1 
ATOM   1051 C  CD1 . ILE A 1 134 ? 20.770  -9.194  -13.375 1.00 19.17 ? 133 ILE A CD1 1 
ATOM   1052 N  N   . LEU A 1 135 ? 25.463  -7.248  -12.333 1.00 14.96 ? 134 LEU A N   1 
ATOM   1053 C  CA  . LEU A 1 135 ? 25.536  -5.879  -11.815 1.00 14.66 ? 134 LEU A CA  1 
ATOM   1054 C  C   . LEU A 1 135 ? 24.212  -5.203  -12.123 1.00 14.84 ? 134 LEU A C   1 
ATOM   1055 O  O   . LEU A 1 135 ? 23.586  -5.484  -13.153 1.00 15.07 ? 134 LEU A O   1 
ATOM   1056 C  CB  . LEU A 1 135 ? 26.661  -5.105  -12.500 1.00 15.30 ? 134 LEU A CB  1 
ATOM   1057 C  CG  . LEU A 1 135 ? 28.092  -5.593  -12.238 1.00 16.30 ? 134 LEU A CG  1 
ATOM   1058 C  CD1 . LEU A 1 135 ? 29.064  -4.933  -13.206 1.00 15.78 ? 134 LEU A CD1 1 
ATOM   1059 C  CD2 . LEU A 1 135 ? 28.466  -5.338  -10.777 1.00 16.27 ? 134 LEU A CD2 1 
ATOM   1060 N  N   . LYS A 1 136 ? 23.782  -4.314  -11.235 1.00 14.02 ? 135 LYS A N   1 
ATOM   1061 C  CA  . LYS A 1 136 ? 22.552  -3.579  -11.467 1.00 14.73 ? 135 LYS A CA  1 
ATOM   1062 C  C   . LYS A 1 136 ? 22.759  -2.146  -10.997 1.00 14.15 ? 135 LYS A C   1 
ATOM   1063 O  O   . LYS A 1 136 ? 23.675  -1.868  -10.228 1.00 14.01 ? 135 LYS A O   1 
ATOM   1064 C  CB  . LYS A 1 136 ? 21.391  -4.189  -10.668 1.00 14.74 ? 135 LYS A CB  1 
ATOM   1065 C  CG  . LYS A 1 136 ? 20.959  -5.628  -11.053 1.00 17.97 ? 135 LYS A CG  1 
ATOM   1066 C  CD  . LYS A 1 136 ? 19.638  -5.995  -10.369 1.00 18.28 ? 135 LYS A CD  1 
ATOM   1067 C  CE  . LYS A 1 136 ? 19.810  -6.303  -8.876  1.00 25.84 ? 135 LYS A CE  1 
ATOM   1068 N  NZ  . LYS A 1 136 ? 18.545  -6.724  -8.102  1.00 26.66 ? 135 LYS A NZ  1 
ATOM   1069 N  N   . ILE A 1 137 ? 21.930  -1.241  -11.486 1.00 13.58 ? 136 ILE A N   1 
ATOM   1070 C  CA  . ILE A 1 137 ? 21.925  0.121   -10.951 1.00 13.01 ? 136 ILE A CA  1 
ATOM   1071 C  C   . ILE A 1 137 ? 20.570  0.404   -10.355 1.00 12.95 ? 136 ILE A C   1 
ATOM   1072 O  O   . ILE A 1 137 ? 19.550  -0.152  -10.795 1.00 13.47 ? 136 ILE A O   1 
ATOM   1073 C  CB  . ILE A 1 137 ? 22.285  1.167   -12.010 1.00 13.53 ? 136 ILE A CB  1 
ATOM   1074 C  CG1 . ILE A 1 137 ? 21.374  1.048   -13.243 1.00 13.71 ? 136 ILE A CG1 1 
ATOM   1075 C  CG2 . ILE A 1 137 ? 23.741  0.998   -12.406 1.00 13.67 ? 136 ILE A CG2 1 
ATOM   1076 C  CD1 . ILE A 1 137 ? 21.666  2.055   -14.357 1.00 13.78 ? 136 ILE A CD1 1 
ATOM   1077 N  N   . ALA A 1 138 ? 20.571  1.274   -9.355  1.00 11.98 ? 137 ALA A N   1 
ATOM   1078 C  CA  . ALA A 1 138 ? 19.375  1.563   -8.612  1.00 12.97 ? 137 ALA A CA  1 
ATOM   1079 C  C   . ALA A 1 138 ? 19.523  2.912   -7.944  1.00 13.00 ? 137 ALA A C   1 
ATOM   1080 O  O   . ALA A 1 138 ? 20.633  3.426   -7.800  1.00 14.25 ? 137 ALA A O   1 
ATOM   1081 C  CB  . ALA A 1 138 ? 19.195  0.483   -7.544  1.00 13.17 ? 137 ALA A CB  1 
ATOM   1082 N  N   . THR A 1 139 ? 18.395  3.443   -7.496  1.00 12.82 ? 138 THR A N   1 
ATOM   1083 C  CA  . THR A 1 139 ? 18.431  4.615   -6.635  1.00 13.19 ? 138 THR A CA  1 
ATOM   1084 C  C   . THR A 1 139 ? 17.682  4.308   -5.342  1.00 13.61 ? 138 THR A C   1 
ATOM   1085 O  O   . THR A 1 139 ? 16.830  3.376   -5.283  1.00 14.26 ? 138 THR A O   1 
ATOM   1086 C  CB  . THR A 1 139 ? 17.840  5.889   -7.305  1.00 13.28 ? 138 THR A CB  1 
ATOM   1087 O  OG1 . THR A 1 139 ? 16.438  5.690   -7.570  1.00 16.69 ? 138 THR A OG1 1 
ATOM   1088 C  CG2 . THR A 1 139 ? 18.606  6.275   -8.592  1.00 14.30 ? 138 THR A CG2 1 
ATOM   1089 N  N   . CYS A 1 140 ? 17.995  5.092   -4.313  1.00 14.10 ? 139 CYS A N   1 
ATOM   1090 C  CA  . CYS A 1 140 ? 17.332  4.991   -3.017  1.00 13.47 ? 139 CYS A CA  1 
ATOM   1091 C  C   . CYS A 1 140 ? 16.934  6.385   -2.573  1.00 13.53 ? 139 CYS A C   1 
ATOM   1092 O  O   . CYS A 1 140 ? 17.654  7.360   -2.788  1.00 13.85 ? 139 CYS A O   1 
ATOM   1093 C  CB  . CYS A 1 140 ? 18.279  4.394   -1.974  1.00 14.06 ? 139 CYS A CB  1 
ATOM   1094 S  SG  . CYS A 1 140 ? 18.801  2.717   -2.367  1.00 15.85 ? 139 CYS A SG  1 
ATOM   1095 N  N   . ALA A 1 141 ? 15.761  6.454   -1.958  1.00 12.91 ? 140 ALA A N   1 
ATOM   1096 C  CA  . ALA A 1 141 ? 15.288  7.701   -1.386  1.00 13.08 ? 140 ALA A CA  1 
ATOM   1097 C  C   . ALA A 1 141 ? 15.933  7.985   -0.031  1.00 13.08 ? 140 ALA A C   1 
ATOM   1098 O  O   . ALA A 1 141 ? 16.108  7.063   0.772   1.00 14.62 ? 140 ALA A O   1 
ATOM   1099 C  CB  . ALA A 1 141 ? 13.780  7.619   -1.227  1.00 13.61 ? 140 ALA A CB  1 
ATOM   1100 N  N   . ASN A 1 142 ? 16.173  9.264   0.257   1.00 13.07 ? 141 ASN A N   1 
ATOM   1101 C  CA  . ASN A 1 142 ? 16.609  9.709   1.597   1.00 13.83 ? 141 ASN A CA  1 
ATOM   1102 C  C   . ASN A 1 142 ? 17.828  8.940   2.062   1.00 12.98 ? 141 ASN A C   1 
ATOM   1103 O  O   . ASN A 1 142 ? 18.815  8.996   1.353   1.00 13.12 ? 141 ASN A O   1 
ATOM   1104 C  CB  . ASN A 1 142 ? 15.404  9.662   2.566   1.00 13.29 ? 141 ASN A CB  1 
ATOM   1105 C  CG  . ASN A 1 142 ? 14.304  10.546  2.084   1.00 16.91 ? 141 ASN A CG  1 
ATOM   1106 O  OD1 . ASN A 1 142 ? 14.578  11.626  1.577   1.00 14.21 ? 141 ASN A OD1 1 
ATOM   1107 N  ND2 . ASN A 1 142 ? 13.070  10.059  2.215   1.00 18.59 ? 141 ASN A ND2 1 
ATOM   1108 N  N   . GLN A 1 143 ? 17.771  8.217   3.187   1.00 12.86 ? 142 GLN A N   1 
ATOM   1109 C  CA  . GLN A 1 143 ? 18.915  7.383   3.581   1.00 13.54 ? 142 GLN A CA  1 
ATOM   1110 C  C   . GLN A 1 143 ? 18.587  5.881   3.501   1.00 13.25 ? 142 GLN A C   1 
ATOM   1111 O  O   . GLN A 1 143 ? 19.286  5.060   4.079   1.00 13.97 ? 142 GLN A O   1 
ATOM   1112 C  CB  . GLN A 1 143 ? 19.427  7.725   4.985   1.00 15.10 ? 142 GLN A CB  1 
ATOM   1113 C  CG  . GLN A 1 143 ? 19.992  9.133   5.163   1.00 14.43 ? 142 GLN A CG  1 
ATOM   1114 C  CD  . GLN A 1 143 ? 21.176  9.468   4.247   1.00 13.13 ? 142 GLN A CD  1 
ATOM   1115 O  OE1 . GLN A 1 143 ? 21.807  8.587   3.660   1.00 14.80 ? 142 GLN A OE1 1 
ATOM   1116 N  NE2 . GLN A 1 143 ? 21.454  10.796  4.096   1.00 13.24 ? 142 GLN A NE2 1 
ATOM   1117 N  N   . ASP A 1 144 ? 17.531  5.530   2.775   1.00 12.95 ? 143 ASP A N   1 
ATOM   1118 C  CA  . ASP A 1 144 ? 17.203  4.104   2.631   1.00 13.37 ? 143 ASP A CA  1 
ATOM   1119 C  C   . ASP A 1 144 ? 18.437  3.343   2.132   1.00 14.15 ? 143 ASP A C   1 
ATOM   1120 O  O   . ASP A 1 144 ? 18.995  3.704   1.097   1.00 13.63 ? 143 ASP A O   1 
ATOM   1121 C  CB  . ASP A 1 144 ? 16.053  3.904   1.627   1.00 13.99 ? 143 ASP A CB  1 
ATOM   1122 C  CG  . ASP A 1 144 ? 14.746  4.514   2.075   1.00 15.24 ? 143 ASP A CG  1 
ATOM   1123 O  OD1 . ASP A 1 144 ? 13.761  4.435   1.295   1.00 17.63 ? 143 ASP A OD1 1 
ATOM   1124 O  OD2 . ASP A 1 144 ? 14.663  5.066   3.191   1.00 15.48 ? 143 ASP A OD2 1 
ATOM   1125 N  N   . PRO A 1 145 ? 18.870  2.298   2.869   1.00 14.67 ? 144 PRO A N   1 
ATOM   1126 C  CA  . PRO A 1 145 ? 20.010  1.576   2.307   1.00 14.88 ? 144 PRO A CA  1 
ATOM   1127 C  C   . PRO A 1 145 ? 19.660  0.742   1.097   1.00 14.62 ? 144 PRO A C   1 
ATOM   1128 O  O   . PRO A 1 145 ? 18.505  0.352   0.863   1.00 16.40 ? 144 PRO A O   1 
ATOM   1129 C  CB  . PRO A 1 145 ? 20.515  0.683   3.465   1.00 16.05 ? 144 PRO A CB  1 
ATOM   1130 C  CG  . PRO A 1 145 ? 19.407  0.635   4.432   1.00 15.98 ? 144 PRO A CG  1 
ATOM   1131 C  CD  . PRO A 1 145 ? 18.490  1.805   4.203   1.00 13.42 ? 144 PRO A CD  1 
ATOM   1132 N  N   . LEU A 1 146 ? 20.666  0.513   0.282   1.00 15.45 ? 145 LEU A N   1 
ATOM   1133 C  CA  . LEU A 1 146 ? 20.473  -0.319  -0.877  1.00 16.03 ? 145 LEU A CA  1 
ATOM   1134 C  C   . LEU A 1 146 ? 20.202  -1.731  -0.379  1.00 18.70 ? 145 LEU A C   1 
ATOM   1135 O  O   . LEU A 1 146 ? 21.010  -2.285  0.367   1.00 19.89 ? 145 LEU A O   1 
ATOM   1136 C  CB  . LEU A 1 146 ? 21.747  -0.352  -1.697  1.00 15.73 ? 145 LEU A CB  1 
ATOM   1137 C  CG  . LEU A 1 146 ? 21.599  -1.158  -2.981  1.00 13.32 ? 145 LEU A CG  1 
ATOM   1138 C  CD1 . LEU A 1 146 ? 20.664  -0.503  -3.978  1.00 14.55 ? 145 LEU A CD1 1 
ATOM   1139 C  CD2 . LEU A 1 146 ? 22.958  -1.306  -3.601  1.00 16.12 ? 145 LEU A CD2 1 
ATOM   1140 N  N   . GLU A 1 147 ? 19.089  -2.284  -0.815  1.00 20.50 ? 146 GLU A N   1 
ATOM   1141 C  CA  . GLU A 1 147 ? 18.661  -3.603  -0.398  1.00 22.94 ? 146 GLU A CA  1 
ATOM   1142 C  C   . GLU A 1 147 ? 18.522  -4.497  -1.620  1.00 22.98 ? 146 GLU A C   1 
ATOM   1143 O  O   . GLU A 1 147 ? 18.326  -4.024  -2.753  1.00 23.89 ? 146 GLU A O   1 
ATOM   1144 C  CB  . GLU A 1 147 ? 17.342  -3.538  0.390   1.00 22.97 ? 146 GLU A CB  1 
ATOM   1145 C  CG  . GLU A 1 147 ? 17.486  -2.941  1.797   1.00 24.70 ? 146 GLU A CG  1 
ATOM   1146 C  CD  . GLU A 1 147 ? 16.186  -2.977  2.621   1.00 25.30 ? 146 GLU A CD  1 
ATOM   1147 O  OE1 . GLU A 1 147 ? 15.293  -3.819  2.307   1.00 30.39 ? 146 GLU A OE1 1 
ATOM   1148 O  OE2 . GLU A 1 147 ? 16.067  -2.170  3.589   1.00 25.31 ? 146 GLU A OE2 1 
ATOM   1149 N  N   . GLY A 1 148 ? 18.668  -5.790  -1.396  1.00 23.29 ? 147 GLY A N   1 
ATOM   1150 C  CA  . GLY A 1 148 ? 18.476  -6.755  -2.473  1.00 23.18 ? 147 GLY A CA  1 
ATOM   1151 C  C   . GLY A 1 148 ? 19.703  -6.965  -3.338  1.00 22.80 ? 147 GLY A C   1 
ATOM   1152 O  O   . GLY A 1 148 ? 19.688  -7.803  -4.233  1.00 22.78 ? 147 GLY A O   1 
ATOM   1153 N  N   . MET A 1 149 ? 20.752  -6.185  -3.092  1.00 21.99 ? 148 MET A N   1 
ATOM   1154 C  CA  . MET A 1 149 ? 22.007  -6.331  -3.819  1.00 22.25 ? 148 MET A CA  1 
ATOM   1155 C  C   . MET A 1 149 ? 23.141  -5.745  -2.985  1.00 19.64 ? 148 MET A C   1 
ATOM   1156 O  O   . MET A 1 149 ? 22.903  -4.932  -2.082  1.00 19.65 ? 148 MET A O   1 
ATOM   1157 C  CB  . MET A 1 149 ? 21.935  -5.674  -5.209  1.00 21.68 ? 148 MET A CB  1 
ATOM   1158 C  CG  . MET A 1 149 ? 21.896  -4.147  -5.165  1.00 25.16 ? 148 MET A CG  1 
ATOM   1159 S  SD  . MET A 1 149 ? 21.699  -3.347  -6.768  1.00 29.14 ? 148 MET A SD  1 
ATOM   1160 C  CE  . MET A 1 149 ? 19.910  -3.384  -6.978  1.00 29.59 ? 148 MET A CE  1 
ATOM   1161 N  N   . VAL A 1 150 ? 24.361  -6.171  -3.285  1.00 17.84 ? 149 VAL A N   1 
ATOM   1162 C  CA  . VAL A 1 150 ? 25.539  -5.724  -2.549  1.00 16.35 ? 149 VAL A CA  1 
ATOM   1163 C  C   . VAL A 1 150 ? 25.957  -4.341  -3.089  1.00 15.35 ? 149 VAL A C   1 
ATOM   1164 O  O   . VAL A 1 150 ? 26.178  -4.198  -4.279  1.00 15.34 ? 149 VAL A O   1 
ATOM   1165 C  CB  . VAL A 1 150 ? 26.715  -6.734  -2.681  1.00 16.77 ? 149 VAL A CB  1 
ATOM   1166 C  CG1 . VAL A 1 150 ? 27.978  -6.195  -1.977  1.00 18.41 ? 149 VAL A CG1 1 
ATOM   1167 C  CG2 . VAL A 1 150 ? 26.312  -8.158  -2.143  1.00 15.54 ? 149 VAL A CG2 1 
ATOM   1168 N  N   . PRO A 1 151 ? 26.107  -3.333  -2.209  1.00 14.68 ? 150 PRO A N   1 
ATOM   1169 C  CA  . PRO A 1 151 ? 26.550  -2.036  -2.755  1.00 14.49 ? 150 PRO A CA  1 
ATOM   1170 C  C   . PRO A 1 151 ? 28.011  -2.045  -3.221  1.00 14.22 ? 150 PRO A C   1 
ATOM   1171 O  O   . PRO A 1 151 ? 28.871  -2.541  -2.519  1.00 15.00 ? 150 PRO A O   1 
ATOM   1172 C  CB  . PRO A 1 151 ? 26.391  -1.068  -1.574  1.00 14.84 ? 150 PRO A CB  1 
ATOM   1173 C  CG  . PRO A 1 151 ? 26.309  -1.933  -0.357  1.00 14.46 ? 150 PRO A CG  1 
ATOM   1174 C  CD  . PRO A 1 151 ? 25.853  -3.283  -0.759  1.00 15.31 ? 150 PRO A CD  1 
ATOM   1175 N  N   . LEU A 1 152 ? 28.270  -1.462  -4.389  1.00 13.93 ? 151 LEU A N   1 
ATOM   1176 C  CA  . LEU A 1 152 ? 29.638  -1.361  -4.904  1.00 13.68 ? 151 LEU A CA  1 
ATOM   1177 C  C   . LEU A 1 152 ? 30.097  0.098   -4.981  1.00 14.10 ? 151 LEU A C   1 
ATOM   1178 O  O   . LEU A 1 152 ? 31.190  0.442   -4.537  1.00 13.54 ? 151 LEU A O   1 
ATOM   1179 C  CB  . LEU A 1 152 ? 29.738  -2.022  -6.271  1.00 13.86 ? 151 LEU A CB  1 
ATOM   1180 C  CG  . LEU A 1 152 ? 29.327  -3.479  -6.383  1.00 15.23 ? 151 LEU A CG  1 
ATOM   1181 C  CD1 . LEU A 1 152 ? 29.596  -3.916  -7.821  1.00 16.98 ? 151 LEU A CD1 1 
ATOM   1182 C  CD2 . LEU A 1 152 ? 30.117  -4.359  -5.423  1.00 16.79 ? 151 LEU A CD2 1 
ATOM   1183 N  N   . PHE A 1 153 ? 29.248  0.944   -5.550  1.00 12.56 ? 152 PHE A N   1 
ATOM   1184 C  CA  . PHE A 1 153 ? 29.585  2.358   -5.670  1.00 13.71 ? 152 PHE A CA  1 
ATOM   1185 C  C   . PHE A 1 153 ? 28.343  3.194   -5.511  1.00 13.14 ? 152 PHE A C   1 
ATOM   1186 O  O   . PHE A 1 153 ? 27.354  2.967   -6.209  1.00 14.40 ? 152 PHE A O   1 
ATOM   1187 C  CB  . PHE A 1 153 ? 30.257  2.622   -7.011  1.00 14.05 ? 152 PHE A CB  1 
ATOM   1188 C  CG  . PHE A 1 153 ? 30.569  4.075   -7.265  1.00 13.93 ? 152 PHE A CG  1 
ATOM   1189 C  CD1 . PHE A 1 153 ? 31.440  4.776   -6.427  1.00 13.77 ? 152 PHE A CD1 1 
ATOM   1190 C  CD2 . PHE A 1 153 ? 30.038  4.724   -8.372  1.00 13.37 ? 152 PHE A CD2 1 
ATOM   1191 C  CE1 . PHE A 1 153 ? 31.751  6.132   -6.687  1.00 14.67 ? 152 PHE A CE1 1 
ATOM   1192 C  CE2 . PHE A 1 153 ? 30.355  6.057   -8.643  1.00 16.49 ? 152 PHE A CE2 1 
ATOM   1193 C  CZ  . PHE A 1 153 ? 31.211  6.764   -7.795  1.00 15.48 ? 152 PHE A CZ  1 
ATOM   1194 N  N   . GLY A 1 154 ? 28.392  4.166   -4.594  1.00 13.18 ? 153 GLY A N   1 
ATOM   1195 C  CA  . GLY A 1 154 ? 27.249  5.028   -4.329  1.00 12.73 ? 153 GLY A CA  1 
ATOM   1196 C  C   . GLY A 1 154 ? 27.560  6.491   -4.651  1.00 13.88 ? 153 GLY A C   1 
ATOM   1197 O  O   . GLY A 1 154 ? 28.714  6.934   -4.536  1.00 13.95 ? 153 GLY A O   1 
ATOM   1198 N  N   . ILE A 1 155 ? 26.542  7.205   -5.090  1.00 13.04 ? 154 ILE A N   1 
ATOM   1199 C  CA  . ILE A 1 155 ? 26.641  8.636   -5.413  1.00 13.36 ? 154 ILE A CA  1 
ATOM   1200 C  C   . ILE A 1 155 ? 25.563  9.324   -4.589  1.00 13.48 ? 154 ILE A C   1 
ATOM   1201 O  O   . ILE A 1 155 ? 24.356  9.113   -4.798  1.00 14.40 ? 154 ILE A O   1 
ATOM   1202 C  CB  . ILE A 1 155 ? 26.457  8.937   -6.921  1.00 13.11 ? 154 ILE A CB  1 
ATOM   1203 C  CG1 . ILE A 1 155 ? 27.428  8.096   -7.788  1.00 12.70 ? 154 ILE A CG1 1 
ATOM   1204 C  CG2 . ILE A 1 155 ? 26.578  10.450  -7.225  1.00 14.17 ? 154 ILE A CG2 1 
ATOM   1205 C  CD1 . ILE A 1 155 ? 27.162  8.249   -9.257  1.00 15.17 ? 154 ILE A CD1 1 
ATOM   1206 N  N   . ASP A 1 156 ? 26.007  10.115  -3.627  1.00 13.44 ? 155 ASP A N   1 
ATOM   1207 C  CA  . ASP A 1 156 ? 25.109  10.836  -2.746  1.00 13.10 ? 155 ASP A CA  1 
ATOM   1208 C  C   . ASP A 1 156 ? 24.573  12.060  -3.473  1.00 14.04 ? 155 ASP A C   1 
ATOM   1209 O  O   . ASP A 1 156 ? 25.366  12.921  -3.864  1.00 13.76 ? 155 ASP A O   1 
ATOM   1210 C  CB  . ASP A 1 156 ? 25.886  11.243  -1.483  1.00 13.74 ? 155 ASP A CB  1 
ATOM   1211 C  CG  . ASP A 1 156 ? 25.115  11.923  -0.364  1.00 10.84 ? 155 ASP A CG  1 
ATOM   1212 O  OD1 . ASP A 1 156 ? 25.750  12.301  0.650   1.00 15.36 ? 155 ASP A OD1 1 
ATOM   1213 O  OD2 . ASP A 1 156 ? 23.881  12.072  -0.487  1.00 12.61 ? 155 ASP A OD2 1 
ATOM   1214 N  N   . VAL A 1 157 ? 23.231  12.147  -3.653  1.00 13.87 ? 156 VAL A N   1 
ATOM   1215 C  CA  . VAL A 1 157 ? 22.709  13.401  -4.292  1.00 14.58 ? 156 VAL A CA  1 
ATOM   1216 C  C   . VAL A 1 157 ? 21.830  14.233  -3.354  1.00 14.33 ? 156 VAL A C   1 
ATOM   1217 O  O   . VAL A 1 157 ? 20.985  14.994  -3.805  1.00 13.63 ? 156 VAL A O   1 
ATOM   1218 C  CB  . VAL A 1 157 ? 22.104  13.178  -5.681  1.00 15.68 ? 156 VAL A CB  1 
ATOM   1219 C  CG1 . VAL A 1 157 ? 23.224  13.007  -6.689  1.00 16.46 ? 156 VAL A CG1 1 
ATOM   1220 C  CG2 . VAL A 1 157 ? 21.190  11.975  -5.693  1.00 15.16 ? 156 VAL A CG2 1 
ATOM   1221 N  N   . TRP A 1 158 ? 22.060  14.061  -2.074  1.00 13.43 ? 157 TRP A N   1 
ATOM   1222 C  CA  . TRP A 1 158 ? 21.451  14.964  -1.161  1.00 13.75 ? 157 TRP A CA  1 
ATOM   1223 C  C   . TRP A 1 158 ? 22.087  16.272  -1.531  1.00 13.06 ? 157 TRP A C   1 
ATOM   1224 O  O   . TRP A 1 158 ? 23.263  16.294  -1.922  1.00 11.68 ? 157 TRP A O   1 
ATOM   1225 C  CB  . TRP A 1 158 ? 21.799  14.664  0.302   1.00 13.85 ? 157 TRP A CB  1 
ATOM   1226 C  CG  . TRP A 1 158 ? 20.906  13.636  0.908   1.00 12.80 ? 157 TRP A CG  1 
ATOM   1227 C  CD1 . TRP A 1 158 ? 20.746  12.348  0.482   1.00 13.12 ? 157 TRP A CD1 1 
ATOM   1228 C  CD2 . TRP A 1 158 ? 20.094  13.789  2.071   1.00 13.52 ? 157 TRP A CD2 1 
ATOM   1229 N  NE1 . TRP A 1 158 ? 19.880  11.681  1.303   1.00 12.95 ? 157 TRP A NE1 1 
ATOM   1230 C  CE2 . TRP A 1 158 ? 19.460  12.541  2.289   1.00 12.69 ? 157 TRP A CE2 1 
ATOM   1231 C  CE3 . TRP A 1 158 ? 19.820  14.814  2.977   1.00 13.49 ? 157 TRP A CE3 1 
ATOM   1232 C  CZ2 . TRP A 1 158 ? 18.584  12.312  3.349   1.00 14.34 ? 157 TRP A CZ2 1 
ATOM   1233 C  CZ3 . TRP A 1 158 ? 18.954  14.610  4.040   1.00 10.23 ? 157 TRP A CZ3 1 
ATOM   1234 C  CH2 . TRP A 1 158 ? 18.345  13.364  4.217   1.00 12.81 ? 157 TRP A CH2 1 
ATOM   1235 N  N   . GLU A 1 159 ? 21.374  17.385  -1.416  1.00 12.36 ? 158 GLU A N   1 
ATOM   1236 C  CA  . GLU A 1 159 ? 21.936  18.669  -1.785  1.00 11.87 ? 158 GLU A CA  1 
ATOM   1237 C  C   . GLU A 1 159 ? 23.184  18.990  -0.963  1.00 11.99 ? 158 GLU A C   1 
ATOM   1238 O  O   . GLU A 1 159 ? 24.076  19.692  -1.456  1.00 12.34 ? 158 GLU A O   1 
ATOM   1239 C  CB  . GLU A 1 159 ? 20.854  19.742  -1.695  1.00 11.88 ? 158 GLU A CB  1 
ATOM   1240 C  CG  . GLU A 1 159 ? 19.857  19.621  -2.833  1.00 13.68 ? 158 GLU A CG  1 
ATOM   1241 C  CD  . GLU A 1 159 ? 18.706  20.627  -2.811  1.00 13.92 ? 158 GLU A CD  1 
ATOM   1242 O  OE1 . GLU A 1 159 ? 18.181  20.886  -1.715  1.00 11.86 ? 158 GLU A OE1 1 
ATOM   1243 O  OE2 . GLU A 1 159 ? 18.348  21.131  -3.891  1.00 15.08 ? 158 GLU A OE2 1 
ATOM   1244 N  N   . HIS A 1 160 ? 23.281  18.517  0.262   1.00 12.48 ? 159 HIS A N   1 
ATOM   1245 C  CA  . HIS A 1 160 ? 24.474  18.828  1.023   1.00 12.01 ? 159 HIS A CA  1 
ATOM   1246 C  C   . HIS A 1 160 ? 25.738  18.152  0.471   1.00 11.70 ? 159 HIS A C   1 
ATOM   1247 O  O   . HIS A 1 160 ? 26.841  18.502  0.870   1.00 13.43 ? 159 HIS A O   1 
ATOM   1248 C  CB  . HIS A 1 160 ? 24.287  18.506  2.501   1.00 12.76 ? 159 HIS A CB  1 
ATOM   1249 C  CG  . HIS A 1 160 ? 24.155  17.007  2.840   1.00 9.55  ? 159 HIS A CG  1 
ATOM   1250 N  ND1 . HIS A 1 160 ? 23.076  16.489  3.492   1.00 12.74 ? 159 HIS A ND1 1 
ATOM   1251 C  CD2 . HIS A 1 160 ? 24.995  15.963  2.584   1.00 12.25 ? 159 HIS A CD2 1 
ATOM   1252 C  CE1 . HIS A 1 160 ? 23.225  15.172  3.609   1.00 12.18 ? 159 HIS A CE1 1 
ATOM   1253 N  NE2 . HIS A 1 160 ? 24.383  14.841  3.062   1.00 10.73 ? 159 HIS A NE2 1 
ATOM   1254 N  N   . ALA A 1 161 ? 25.572  17.178  -0.423  1.00 11.01 ? 160 ALA A N   1 
ATOM   1255 C  CA  . ALA A 1 161 ? 26.734  16.500  -0.965  1.00 12.72 ? 160 ALA A CA  1 
ATOM   1256 C  C   . ALA A 1 161 ? 27.477  17.371  -1.984  1.00 13.07 ? 160 ALA A C   1 
ATOM   1257 O  O   . ALA A 1 161 ? 28.658  17.119  -2.269  1.00 12.48 ? 160 ALA A O   1 
ATOM   1258 C  CB  . ALA A 1 161 ? 26.312  15.172  -1.582  1.00 12.38 ? 160 ALA A CB  1 
ATOM   1259 N  N   . TYR A 1 162 ? 26.801  18.376  -2.530  1.00 12.95 ? 161 TYR A N   1 
ATOM   1260 C  CA  . TYR A 1 162 ? 27.441  19.194  -3.592  1.00 12.99 ? 161 TYR A CA  1 
ATOM   1261 C  C   . TYR A 1 162 ? 27.068  20.695  -3.603  1.00 12.64 ? 161 TYR A C   1 
ATOM   1262 O  O   . TYR A 1 162 ? 27.712  21.477  -4.285  1.00 12.56 ? 161 TYR A O   1 
ATOM   1263 C  CB  . TYR A 1 162 ? 26.971  18.677  -4.973  1.00 12.77 ? 161 TYR A CB  1 
ATOM   1264 C  CG  . TYR A 1 162 ? 25.467  18.625  -5.211  1.00 13.49 ? 161 TYR A CG  1 
ATOM   1265 C  CD1 . TYR A 1 162 ? 24.696  17.470  -4.943  1.00 13.88 ? 161 TYR A CD1 1 
ATOM   1266 C  CD2 . TYR A 1 162 ? 24.781  19.743  -5.699  1.00 12.73 ? 161 TYR A CD2 1 
ATOM   1267 C  CE1 . TYR A 1 162 ? 23.323  17.439  -5.143  1.00 13.03 ? 161 TYR A CE1 1 
ATOM   1268 C  CE2 . TYR A 1 162 ? 23.396  19.728  -5.895  1.00 12.40 ? 161 TYR A CE2 1 
ATOM   1269 C  CZ  . TYR A 1 162 ? 22.658  18.580  -5.635  1.00 14.87 ? 161 TYR A CZ  1 
ATOM   1270 O  OH  . TYR A 1 162 ? 21.304  18.531  -5.835  1.00 13.72 ? 161 TYR A OH  1 
ATOM   1271 N  N   . TYR A 1 163 ? 26.038  21.084  -2.853  1.00 11.80 ? 162 TYR A N   1 
ATOM   1272 C  CA  . TYR A 1 163 ? 25.539  22.468  -3.004  1.00 12.84 ? 162 TYR A CA  1 
ATOM   1273 C  C   . TYR A 1 163 ? 26.533  23.592  -2.811  1.00 12.86 ? 162 TYR A C   1 
ATOM   1274 O  O   . TYR A 1 163 ? 26.531  24.538  -3.602  1.00 12.69 ? 162 TYR A O   1 
ATOM   1275 C  CB  . TYR A 1 163 ? 24.306  22.721  -2.123  1.00 12.47 ? 162 TYR A CB  1 
ATOM   1276 C  CG  . TYR A 1 163 ? 23.369  23.746  -2.805  1.00 13.00 ? 162 TYR A CG  1 
ATOM   1277 C  CD1 . TYR A 1 163 ? 22.420  23.353  -3.737  1.00 12.49 ? 162 TYR A CD1 1 
ATOM   1278 C  CD2 . TYR A 1 163 ? 23.477  25.128  -2.550  1.00 11.83 ? 162 TYR A CD2 1 
ATOM   1279 C  CE1 . TYR A 1 163 ? 21.596  24.260  -4.376  1.00 12.94 ? 162 TYR A CE1 1 
ATOM   1280 C  CE2 . TYR A 1 163 ? 22.648  26.049  -3.183  1.00 11.93 ? 162 TYR A CE2 1 
ATOM   1281 C  CZ  . TYR A 1 163 ? 21.697  25.602  -4.100  1.00 11.05 ? 162 TYR A CZ  1 
ATOM   1282 O  OH  . TYR A 1 163 ? 20.851  26.505  -4.719  1.00 12.13 ? 162 TYR A OH  1 
ATOM   1283 N  N   . LEU A 1 164 ? 27.376  23.529  -1.798  1.00 13.89 ? 163 LEU A N   1 
ATOM   1284 C  CA  . LEU A 1 164 ? 28.308  24.648  -1.574  1.00 13.97 ? 163 LEU A CA  1 
ATOM   1285 C  C   . LEU A 1 164 ? 29.178  24.934  -2.798  1.00 14.32 ? 163 LEU A C   1 
ATOM   1286 O  O   . LEU A 1 164 ? 29.556  26.074  -3.040  1.00 14.20 ? 163 LEU A O   1 
ATOM   1287 C  CB  . LEU A 1 164 ? 29.169  24.351  -0.347  1.00 13.95 ? 163 LEU A CB  1 
ATOM   1288 C  CG  . LEU A 1 164 ? 28.470  24.451  0.998   1.00 13.62 ? 163 LEU A CG  1 
ATOM   1289 C  CD1 . LEU A 1 164 ? 29.319  23.864  2.118   1.00 12.93 ? 163 LEU A CD1 1 
ATOM   1290 C  CD2 . LEU A 1 164 ? 28.105  25.906  1.306   1.00 15.94 ? 163 LEU A CD2 1 
ATOM   1291 N  N   . GLN A 1 165 ? 29.483  23.900  -3.584  1.00 13.83 ? 164 GLN A N   1 
ATOM   1292 C  CA  . GLN A 1 165 ? 30.377  24.075  -4.742  1.00 14.38 ? 164 GLN A CA  1 
ATOM   1293 C  C   . GLN A 1 165 ? 29.643  24.190  -6.079  1.00 13.29 ? 164 GLN A C   1 
ATOM   1294 O  O   . GLN A 1 165 ? 29.965  25.043  -6.912  1.00 12.83 ? 164 GLN A O   1 
ATOM   1295 C  CB  . GLN A 1 165 ? 31.385  22.929  -4.766  1.00 14.34 ? 164 GLN A CB  1 
ATOM   1296 C  CG  . GLN A 1 165 ? 32.111  22.722  -6.115  1.00 14.88 ? 164 GLN A CG  1 
ATOM   1297 C  CD  . GLN A 1 165 ? 33.350  21.814  -6.097  1.00 15.52 ? 164 GLN A CD  1 
ATOM   1298 O  OE1 . GLN A 1 165 ? 33.930  21.553  -7.148  1.00 18.32 ? 164 GLN A OE1 1 
ATOM   1299 N  NE2 . GLN A 1 165 ? 33.911  21.255  -5.029  1.00 15.36 ? 164 GLN A NE2 1 
ATOM   1300 N  N   . TYR A 1 166 ? 28.644  23.333  -6.287  1.00 13.24 ? 165 TYR A N   1 
ATOM   1301 C  CA  . TYR A 1 166 ? 27.924  23.204  -7.551  1.00 12.93 ? 165 TYR A CA  1 
ATOM   1302 C  C   . TYR A 1 166 ? 26.614  23.958  -7.606  1.00 13.63 ? 165 TYR A C   1 
ATOM   1303 O  O   . TYR A 1 166 ? 25.999  24.116  -8.692  1.00 11.38 ? 165 TYR A O   1 
ATOM   1304 C  CB  . TYR A 1 166 ? 27.664  21.699  -7.822  1.00 13.54 ? 165 TYR A CB  1 
ATOM   1305 C  CG  . TYR A 1 166 ? 28.909  20.914  -8.097  1.00 15.47 ? 165 TYR A CG  1 
ATOM   1306 C  CD1 . TYR A 1 166 ? 29.663  20.379  -7.057  1.00 12.65 ? 165 TYR A CD1 1 
ATOM   1307 C  CD2 . TYR A 1 166 ? 29.320  20.666  -9.418  1.00 15.53 ? 165 TYR A CD2 1 
ATOM   1308 C  CE1 . TYR A 1 166 ? 30.848  19.664  -7.317  1.00 14.83 ? 165 TYR A CE1 1 
ATOM   1309 C  CE2 . TYR A 1 166 ? 30.467  19.946  -9.688  1.00 15.40 ? 165 TYR A CE2 1 
ATOM   1310 C  CZ  . TYR A 1 166 ? 31.229  19.437  -8.639  1.00 14.37 ? 165 TYR A CZ  1 
ATOM   1311 O  OH  . TYR A 1 166 ? 32.369  18.715  -8.914  1.00 15.17 ? 165 TYR A OH  1 
ATOM   1312 N  N   . LYS A 1 167 ? 26.178  24.384  -6.421  1.00 13.66 ? 166 LYS A N   1 
ATOM   1313 C  CA  . LYS A 1 167 ? 24.876  24.993  -6.234  1.00 13.87 ? 166 LYS A CA  1 
ATOM   1314 C  C   . LYS A 1 167 ? 23.787  24.104  -6.849  1.00 12.79 ? 166 LYS A C   1 
ATOM   1315 O  O   . LYS A 1 167 ? 23.775  22.892  -6.592  1.00 12.26 ? 166 LYS A O   1 
ATOM   1316 C  CB  . LYS A 1 167 ? 24.863  26.441  -6.795  1.00 14.08 ? 166 LYS A CB  1 
ATOM   1317 C  CG  . LYS A 1 167 ? 25.654  27.463  -5.889  1.00 18.03 ? 166 LYS A CG  1 
ATOM   1318 C  CD  . LYS A 1 167 ? 27.102  27.205  -5.704  1.00 21.54 ? 166 LYS A CD  1 
ATOM   1319 C  CE  . LYS A 1 167 ? 27.688  28.297  -4.799  1.00 20.18 ? 166 LYS A CE  1 
ATOM   1320 N  NZ  . LYS A 1 167 ? 29.153  28.258  -4.762  1.00 24.12 ? 166 LYS A NZ  1 
ATOM   1321 N  N   . ASN A 1 168 ? 22.908  24.691  -7.663  1.00 13.42 ? 167 ASN A N   1 
ATOM   1322 C  CA  . ASN A 1 168 ? 21.810  23.940  -8.295  1.00 13.99 ? 167 ASN A CA  1 
ATOM   1323 C  C   . ASN A 1 168 ? 22.257  22.905  -9.326  1.00 13.19 ? 167 ASN A C   1 
ATOM   1324 O  O   . ASN A 1 168 ? 21.449  22.100  -9.794  1.00 13.10 ? 167 ASN A O   1 
ATOM   1325 C  CB  . ASN A 1 168 ? 20.866  24.891  -9.020  1.00 14.17 ? 167 ASN A CB  1 
ATOM   1326 C  CG  . ASN A 1 168 ? 21.605  25.810  -9.989  1.00 17.23 ? 167 ASN A CG  1 
ATOM   1327 O  OD1 . ASN A 1 168 ? 22.378  26.691  -9.559  1.00 17.79 ? 167 ASN A OD1 1 
ATOM   1328 N  ND2 . ASN A 1 168 ? 21.328  25.656  -11.284 1.00 15.39 ? 167 ASN A ND2 1 
ATOM   1329 N  N   . VAL A 1 169 ? 23.515  22.988  -9.742  1.00 12.46 ? 168 VAL A N   1 
ATOM   1330 C  CA  . VAL A 1 169 ? 23.956  22.159  -10.880 1.00 12.98 ? 168 VAL A CA  1 
ATOM   1331 C  C   . VAL A 1 169 ? 24.381  20.735  -10.490 1.00 12.88 ? 168 VAL A C   1 
ATOM   1332 O  O   . VAL A 1 169 ? 25.527  20.315  -10.692 1.00 12.78 ? 168 VAL A O   1 
ATOM   1333 C  CB  . VAL A 1 169 ? 24.994  22.907  -11.787 1.00 12.57 ? 168 VAL A CB  1 
ATOM   1334 C  CG1 . VAL A 1 169 ? 25.044  22.220  -13.150 1.00 13.95 ? 168 VAL A CG1 1 
ATOM   1335 C  CG2 . VAL A 1 169 ? 24.580  24.360  -11.968 1.00 13.58 ? 168 VAL A CG2 1 
ATOM   1336 N  N   . ARG A 1 170 ? 23.425  20.008  -9.919  1.00 12.49 ? 169 ARG A N   1 
ATOM   1337 C  CA  . ARG A 1 170 ? 23.601  18.588  -9.595  1.00 12.90 ? 169 ARG A CA  1 
ATOM   1338 C  C   . ARG A 1 170 ? 24.195  17.722  -10.728 1.00 12.93 ? 169 ARG A C   1 
ATOM   1339 O  O   . ARG A 1 170 ? 25.075  16.900  -10.447 1.00 14.02 ? 169 ARG A O   1 
ATOM   1340 C  CB  . ARG A 1 170 ? 22.257  17.990  -9.115  1.00 13.19 ? 169 ARG A CB  1 
ATOM   1341 C  CG  . ARG A 1 170 ? 22.403  16.538  -8.692  1.00 14.77 ? 169 ARG A CG  1 
ATOM   1342 C  CD  . ARG A 1 170 ? 21.064  15.835  -8.619  1.00 15.57 ? 169 ARG A CD  1 
ATOM   1343 N  NE  . ARG A 1 170 ? 20.379  16.077  -7.354  1.00 14.47 ? 169 ARG A NE  1 
ATOM   1344 C  CZ  . ARG A 1 170 ? 19.209  15.524  -7.045  1.00 17.79 ? 169 ARG A CZ  1 
ATOM   1345 N  NH1 . ARG A 1 170 ? 18.625  14.705  -7.913  1.00 16.42 ? 169 ARG A NH1 1 
ATOM   1346 N  NH2 . ARG A 1 170 ? 18.640  15.777  -5.871  1.00 17.71 ? 169 ARG A NH2 1 
ATOM   1347 N  N   . PRO A 1 171 ? 23.741  17.894  -11.992 1.00 11.88 ? 170 PRO A N   1 
ATOM   1348 C  CA  . PRO A 1 171 ? 24.337  17.028  -13.035 1.00 12.07 ? 170 PRO A CA  1 
ATOM   1349 C  C   . PRO A 1 171 ? 25.864  17.155  -13.159 1.00 12.05 ? 170 PRO A C   1 
ATOM   1350 O  O   . PRO A 1 171 ? 26.550  16.131  -13.375 1.00 11.96 ? 170 PRO A O   1 
ATOM   1351 C  CB  . PRO A 1 171 ? 23.626  17.481  -14.310 1.00 12.61 ? 170 PRO A CB  1 
ATOM   1352 C  CG  . PRO A 1 171 ? 22.329  18.013  -13.826 1.00 13.30 ? 170 PRO A CG  1 
ATOM   1353 C  CD  . PRO A 1 171 ? 22.721  18.779  -12.578 1.00 12.36 ? 170 PRO A CD  1 
ATOM   1354 N  N   . ASP A 1 172 ? 26.395  18.368  -12.972 1.00 11.50 ? 171 ASP A N   1 
ATOM   1355 C  CA  . ASP A 1 172 ? 27.863  18.551  -13.093 1.00 12.11 ? 171 ASP A CA  1 
ATOM   1356 C  C   . ASP A 1 172 ? 28.581  17.779  -11.992 1.00 13.22 ? 171 ASP A C   1 
ATOM   1357 O  O   . ASP A 1 172 ? 29.612  17.196  -12.228 1.00 12.30 ? 171 ASP A O   1 
ATOM   1358 C  CB  . ASP A 1 172 ? 28.273  20.026  -13.044 1.00 12.69 ? 171 ASP A CB  1 
ATOM   1359 C  CG  . ASP A 1 172 ? 27.882  20.799  -14.286 1.00 13.11 ? 171 ASP A CG  1 
ATOM   1360 O  OD1 . ASP A 1 172 ? 27.213  20.266  -15.211 1.00 11.74 ? 171 ASP A OD1 1 
ATOM   1361 O  OD2 . ASP A 1 172 ? 28.250  21.994  -14.337 1.00 10.40 ? 171 ASP A OD2 1 
ATOM   1362 N  N   . TYR A 1 173 ? 28.021  17.790  -10.790 1.00 13.79 ? 172 TYR A N   1 
ATOM   1363 C  CA  . TYR A 1 173 ? 28.606  17.018  -9.688  1.00 13.80 ? 172 TYR A CA  1 
ATOM   1364 C  C   . TYR A 1 173 ? 28.529  15.495  -9.969  1.00 13.81 ? 172 TYR A C   1 
ATOM   1365 O  O   . TYR A 1 173 ? 29.533  14.777  -9.807  1.00 13.74 ? 172 TYR A O   1 
ATOM   1366 C  CB  . TYR A 1 173 ? 27.891  17.401  -8.374  1.00 14.66 ? 172 TYR A CB  1 
ATOM   1367 C  CG  . TYR A 1 173 ? 27.942  16.325  -7.292  1.00 13.90 ? 172 TYR A CG  1 
ATOM   1368 C  CD1 . TYR A 1 173 ? 26.807  15.551  -6.994  1.00 13.64 ? 172 TYR A CD1 1 
ATOM   1369 C  CD2 . TYR A 1 173 ? 29.114  16.102  -6.564  1.00 11.58 ? 172 TYR A CD2 1 
ATOM   1370 C  CE1 . TYR A 1 173 ? 26.844  14.581  -5.997  1.00 13.66 ? 172 TYR A CE1 1 
ATOM   1371 C  CE2 . TYR A 1 173 ? 29.152  15.114  -5.555  1.00 11.73 ? 172 TYR A CE2 1 
ATOM   1372 C  CZ  . TYR A 1 173 ? 28.010  14.388  -5.274  1.00 12.34 ? 172 TYR A CZ  1 
ATOM   1373 O  OH  . TYR A 1 173 ? 28.025  13.390  -4.304  1.00 15.14 ? 172 TYR A OH  1 
ATOM   1374 N  N   . VAL A 1 174 ? 27.367  15.001  -10.394 1.00 12.73 ? 173 VAL A N   1 
ATOM   1375 C  CA  . VAL A 1 174 ? 27.213  13.575  -10.714 1.00 13.39 ? 173 VAL A CA  1 
ATOM   1376 C  C   . VAL A 1 174 ? 28.177  13.107  -11.833 1.00 13.16 ? 173 VAL A C   1 
ATOM   1377 O  O   . VAL A 1 174 ? 28.804  12.031  -11.766 1.00 13.50 ? 173 VAL A O   1 
ATOM   1378 C  CB  . VAL A 1 174 ? 25.775  13.218  -11.055 1.00 12.58 ? 173 VAL A CB  1 
ATOM   1379 C  CG1 . VAL A 1 174 ? 25.695  11.703  -11.451 1.00 14.67 ? 173 VAL A CG1 1 
ATOM   1380 C  CG2 . VAL A 1 174 ? 24.920  13.476  -9.828  1.00 13.25 ? 173 VAL A CG2 1 
ATOM   1381 N  N   . HIS A 1 175 ? 28.302  13.929  -12.869 1.00 13.72 ? 174 HIS A N   1 
ATOM   1382 C  CA  . HIS A 1 175 ? 29.223  13.586  -13.937 1.00 14.86 ? 174 HIS A CA  1 
ATOM   1383 C  C   . HIS A 1 175 ? 30.689  13.631  -13.479 1.00 15.34 ? 174 HIS A C   1 
ATOM   1384 O  O   . HIS A 1 175 ? 31.507  12.786  -13.887 1.00 16.70 ? 174 HIS A O   1 
ATOM   1385 C  CB  . HIS A 1 175 ? 28.977  14.434  -15.178 1.00 14.28 ? 174 HIS A CB  1 
ATOM   1386 C  CG  . HIS A 1 175 ? 27.666  14.150  -15.845 1.00 15.52 ? 174 HIS A CG  1 
ATOM   1387 N  ND1 . HIS A 1 175 ? 26.819  15.145  -16.278 1.00 16.63 ? 174 HIS A ND1 1 
ATOM   1388 C  CD2 . HIS A 1 175 ? 27.068  12.976  -16.166 1.00 17.58 ? 174 HIS A CD2 1 
ATOM   1389 C  CE1 . HIS A 1 175 ? 25.751  14.601  -16.835 1.00 17.97 ? 174 HIS A CE1 1 
ATOM   1390 N  NE2 . HIS A 1 175 ? 25.876  13.283  -16.777 1.00 17.64 ? 174 HIS A NE2 1 
ATOM   1391 N  N   . ALA A 1 176 ? 30.997  14.597  -12.615 1.00 15.39 ? 175 ALA A N   1 
ATOM   1392 C  CA  . ALA A 1 176 ? 32.357  14.821  -12.142 1.00 15.91 ? 175 ALA A CA  1 
ATOM   1393 C  C   . ALA A 1 176 ? 32.821  13.824  -11.084 1.00 15.63 ? 175 ALA A C   1 
ATOM   1394 O  O   . ALA A 1 176 ? 34.020  13.595  -10.947 1.00 15.16 ? 175 ALA A O   1 
ATOM   1395 C  CB  . ALA A 1 176 ? 32.559  16.234  -11.660 1.00 16.44 ? 175 ALA A CB  1 
ATOM   1396 N  N   . ILE A 1 177 ? 31.879  13.251  -10.334 1.00 15.10 ? 176 ILE A N   1 
ATOM   1397 C  CA  . ILE A 1 177 ? 32.252  12.303  -9.288  1.00 15.60 ? 176 ILE A CA  1 
ATOM   1398 C  C   . ILE A 1 177 ? 32.975  11.055  -9.835  1.00 15.71 ? 176 ILE A C   1 
ATOM   1399 O  O   . ILE A 1 177 ? 33.768  10.422  -9.123  1.00 15.35 ? 176 ILE A O   1 
ATOM   1400 C  CB  . ILE A 1 177 ? 31.059  11.917  -8.357  1.00 15.73 ? 176 ILE A CB  1 
ATOM   1401 C  CG1 . ILE A 1 177 ? 31.610  11.457  -7.006  1.00 17.31 ? 176 ILE A CG1 1 
ATOM   1402 C  CG2 . ILE A 1 177 ? 30.157  10.858  -9.039  1.00 15.93 ? 176 ILE A CG2 1 
ATOM   1403 C  CD1 . ILE A 1 177 ? 30.594  11.357  -5.875  1.00 14.96 ? 176 ILE A CD1 1 
ATOM   1404 N  N   . TRP A 1 178 ? 32.717  10.714  -11.097 1.00 15.27 ? 177 TRP A N   1 
ATOM   1405 C  CA  . TRP A 1 178 ? 33.375  9.563   -11.712 1.00 15.49 ? 177 TRP A CA  1 
ATOM   1406 C  C   . TRP A 1 178 ? 34.896  9.746   -11.751 1.00 15.79 ? 177 TRP A C   1 
ATOM   1407 O  O   . TRP A 1 178 ? 35.631  8.748   -11.804 1.00 15.43 ? 177 TRP A O   1 
ATOM   1408 C  CB  . TRP A 1 178 ? 32.802  9.302   -13.105 1.00 15.89 ? 177 TRP A CB  1 
ATOM   1409 C  CG  . TRP A 1 178 ? 31.403  8.787   -13.035 1.00 16.00 ? 177 TRP A CG  1 
ATOM   1410 C  CD1 . TRP A 1 178 ? 30.253  9.499   -13.238 1.00 16.98 ? 177 TRP A CD1 1 
ATOM   1411 C  CD2 . TRP A 1 178 ? 31.000  7.461   -12.673 1.00 16.80 ? 177 TRP A CD2 1 
ATOM   1412 N  NE1 . TRP A 1 178 ? 29.155  8.686   -13.061 1.00 16.69 ? 177 TRP A NE1 1 
ATOM   1413 C  CE2 . TRP A 1 178 ? 29.580  7.434   -12.706 1.00 16.08 ? 177 TRP A CE2 1 
ATOM   1414 C  CE3 . TRP A 1 178 ? 31.695  6.288   -12.334 1.00 16.09 ? 177 TRP A CE3 1 
ATOM   1415 C  CZ2 . TRP A 1 178 ? 28.841  6.279   -12.422 1.00 15.43 ? 177 TRP A CZ2 1 
ATOM   1416 C  CZ3 . TRP A 1 178 ? 30.959  5.132   -12.042 1.00 17.16 ? 177 TRP A CZ3 1 
ATOM   1417 C  CH2 . TRP A 1 178 ? 29.539  5.142   -12.088 1.00 16.43 ? 177 TRP A CH2 1 
ATOM   1418 N  N   . LYS A 1 179 ? 35.357  11.004  -11.701 1.00 14.19 ? 178 LYS A N   1 
ATOM   1419 C  CA  . LYS A 1 179 ? 36.800  11.322  -11.719 1.00 16.04 ? 178 LYS A CA  1 
ATOM   1420 C  C   . LYS A 1 179 ? 37.492  10.849  -10.442 1.00 15.97 ? 178 LYS A C   1 
ATOM   1421 O  O   . LYS A 1 179 ? 38.714  10.616  -10.417 1.00 16.52 ? 178 LYS A O   1 
ATOM   1422 C  CB  . LYS A 1 179 ? 37.057  12.825  -11.869 1.00 15.42 ? 178 LYS A CB  1 
ATOM   1423 C  CG  . LYS A 1 179 ? 36.679  13.428  -13.202 1.00 15.66 ? 178 LYS A CG  1 
ATOM   1424 C  CD  . LYS A 1 179 ? 37.083  14.912  -13.240 1.00 17.51 ? 178 LYS A CD  1 
ATOM   1425 C  CE  . LYS A 1 179 ? 36.425  15.639  -14.396 1.00 19.42 ? 178 LYS A CE  1 
ATOM   1426 N  NZ  . LYS A 1 179 ? 36.918  17.054  -14.506 1.00 20.96 ? 178 LYS A NZ  1 
ATOM   1427 N  N   . ILE A 1 180 ? 36.701  10.723  -9.381  1.00 15.64 ? 179 ILE A N   1 
ATOM   1428 C  CA  . ILE A 1 180 ? 37.234  10.367  -8.087  1.00 16.59 ? 179 ILE A CA  1 
ATOM   1429 C  C   . ILE A 1 180 ? 36.666  9.040   -7.588  1.00 16.96 ? 179 ILE A C   1 
ATOM   1430 O  O   . ILE A 1 180 ? 36.860  8.680   -6.421  1.00 17.88 ? 179 ILE A O   1 
ATOM   1431 C  CB  . ILE A 1 180 ? 37.046  11.480  -7.036  1.00 16.47 ? 179 ILE A CB  1 
ATOM   1432 C  CG1 . ILE A 1 180 ? 35.541  11.782  -6.833  1.00 16.15 ? 179 ILE A CG1 1 
ATOM   1433 C  CG2 . ILE A 1 180 ? 37.927  12.712  -7.402  1.00 16.41 ? 179 ILE A CG2 1 
ATOM   1434 C  CD1 . ILE A 1 180 ? 35.208  12.882  -5.792  1.00 15.84 ? 179 ILE A CD1 1 
ATOM   1435 N  N   . ALA A 1 181 ? 36.006  8.300   -8.478  1.00 17.97 ? 180 ALA A N   1 
ATOM   1436 C  CA  . ALA A 1 181 ? 35.505  6.958   -8.127  1.00 16.83 ? 180 ALA A CA  1 
ATOM   1437 C  C   . ALA A 1 181 ? 36.691  6.109   -7.703  1.00 16.98 ? 180 ALA A C   1 
ATOM   1438 O  O   . ALA A 1 181 ? 37.708  6.051   -8.401  1.00 16.11 ? 180 ALA A O   1 
ATOM   1439 C  CB  . ALA A 1 181 ? 34.765  6.293   -9.310  1.00 18.06 ? 180 ALA A CB  1 
ATOM   1440 N  N   . ASN A 1 182 ? 36.589  5.474   -6.540  1.00 15.87 ? 181 ASN A N   1 
ATOM   1441 C  CA  . ASN A 1 182 ? 37.720  4.665   -6.073  1.00 15.74 ? 181 ASN A CA  1 
ATOM   1442 C  C   . ASN A 1 182 ? 37.570  3.237   -6.578  1.00 15.25 ? 181 ASN A C   1 
ATOM   1443 O  O   . ASN A 1 182 ? 37.087  2.368   -5.880  1.00 14.09 ? 181 ASN A O   1 
ATOM   1444 C  CB  . ASN A 1 182 ? 37.851  4.729   -4.548  1.00 16.34 ? 181 ASN A CB  1 
ATOM   1445 C  CG  . ASN A 1 182 ? 39.065  3.949   -4.011  1.00 15.63 ? 181 ASN A CG  1 
ATOM   1446 O  OD1 . ASN A 1 182 ? 39.889  3.409   -4.764  1.00 18.15 ? 181 ASN A OD1 1 
ATOM   1447 N  ND2 . ASN A 1 182 ? 39.179  3.912   -2.693  1.00 16.59 ? 181 ASN A ND2 1 
ATOM   1448 N  N   . TRP A 1 183 ? 38.001  3.018   -7.811  1.00 15.59 ? 182 TRP A N   1 
ATOM   1449 C  CA  . TRP A 1 183 ? 37.898  1.726   -8.440  1.00 15.60 ? 182 TRP A CA  1 
ATOM   1450 C  C   . TRP A 1 183 ? 38.622  0.591   -7.687  1.00 15.55 ? 182 TRP A C   1 
ATOM   1451 O  O   . TRP A 1 183 ? 38.202  -0.568  -7.751  1.00 14.64 ? 182 TRP A O   1 
ATOM   1452 C  CB  . TRP A 1 183 ? 38.356  1.841   -9.879  1.00 16.83 ? 182 TRP A CB  1 
ATOM   1453 C  CG  . TRP A 1 183 ? 37.357  2.540   -10.698 1.00 15.65 ? 182 TRP A CG  1 
ATOM   1454 C  CD1 . TRP A 1 183 ? 37.472  3.777   -11.270 1.00 17.17 ? 182 TRP A CD1 1 
ATOM   1455 C  CD2 . TRP A 1 183 ? 36.039  2.068   -11.004 1.00 15.25 ? 182 TRP A CD2 1 
ATOM   1456 N  NE1 . TRP A 1 183 ? 36.327  4.082   -11.952 1.00 17.01 ? 182 TRP A NE1 1 
ATOM   1457 C  CE2 . TRP A 1 183 ? 35.423  3.058   -11.796 1.00 15.91 ? 182 TRP A CE2 1 
ATOM   1458 C  CE3 . TRP A 1 183 ? 35.333  0.885   -10.711 1.00 17.08 ? 182 TRP A CE3 1 
ATOM   1459 C  CZ2 . TRP A 1 183 ? 34.126  2.913   -12.310 1.00 17.49 ? 182 TRP A CZ2 1 
ATOM   1460 C  CZ3 . TRP A 1 183 ? 34.015  0.743   -11.206 1.00 17.21 ? 182 TRP A CZ3 1 
ATOM   1461 C  CH2 . TRP A 1 183 ? 33.434  1.760   -11.999 1.00 15.90 ? 182 TRP A CH2 1 
ATOM   1462 N  N   . LYS A 1 184 ? 39.681  0.924   -6.952  1.00 15.24 ? 183 LYS A N   1 
ATOM   1463 C  CA  . LYS A 1 184 ? 40.308  -0.069  -6.086  1.00 15.91 ? 183 LYS A CA  1 
ATOM   1464 C  C   . LYS A 1 184 ? 39.297  -0.597  -5.080  1.00 15.25 ? 183 LYS A C   1 
ATOM   1465 O  O   . LYS A 1 184 ? 39.153  -1.811  -4.912  1.00 16.25 ? 183 LYS A O   1 
ATOM   1466 C  CB  . LYS A 1 184 ? 41.491  0.513   -5.328  1.00 16.18 ? 183 LYS A CB  1 
ATOM   1467 C  CG  . LYS A 1 184 ? 42.257  -0.543  -4.518  1.00 18.65 ? 183 LYS A CG  1 
ATOM   1468 C  CD  . LYS A 1 184 ? 43.330  0.122   -3.701  1.00 23.40 ? 183 LYS A CD  1 
ATOM   1469 C  CE  . LYS A 1 184 ? 43.917  -0.802  -2.662  1.00 25.04 ? 183 LYS A CE  1 
ATOM   1470 N  NZ  . LYS A 1 184 ? 45.073  -0.097  -2.045  1.00 29.07 ? 183 LYS A NZ  1 
ATOM   1471 N  N   . ASN A 1 185 ? 38.589  0.317   -4.419  1.00 15.08 ? 184 ASN A N   1 
ATOM   1472 C  CA  . ASN A 1 185 ? 37.614  -0.085  -3.428  1.00 14.36 ? 184 ASN A CA  1 
ATOM   1473 C  C   . ASN A 1 185 ? 36.412  -0.779  -4.058  1.00 13.94 ? 184 ASN A C   1 
ATOM   1474 O  O   . ASN A 1 185 ? 35.951  -1.811  -3.562  1.00 13.80 ? 184 ASN A O   1 
ATOM   1475 C  CB  . ASN A 1 185 ? 37.164  1.106   -2.596  1.00 13.83 ? 184 ASN A CB  1 
ATOM   1476 C  CG  . ASN A 1 185 ? 36.066  0.741   -1.643  1.00 14.98 ? 184 ASN A CG  1 
ATOM   1477 O  OD1 . ASN A 1 185 ? 34.878  0.903   -1.962  1.00 13.93 ? 184 ASN A OD1 1 
ATOM   1478 N  ND2 . ASN A 1 185 ? 36.440  0.187   -0.485  1.00 15.40 ? 184 ASN A ND2 1 
ATOM   1479 N  N   . ILE A 1 186 ? 35.942  -0.232  -5.171  1.00 13.79 ? 185 ILE A N   1 
ATOM   1480 C  CA  . ILE A 1 186 ? 34.771  -0.782  -5.859  1.00 14.14 ? 185 ILE A CA  1 
ATOM   1481 C  C   . ILE A 1 186 ? 35.068  -2.213  -6.329  1.00 15.13 ? 185 ILE A C   1 
ATOM   1482 O  O   . ILE A 1 186 ? 34.252  -3.127  -6.145  1.00 16.15 ? 185 ILE A O   1 
ATOM   1483 C  CB  . ILE A 1 186 ? 34.358  0.120   -7.047  1.00 13.69 ? 185 ILE A CB  1 
ATOM   1484 C  CG1 . ILE A 1 186 ? 34.045  1.535   -6.533  1.00 12.75 ? 185 ILE A CG1 1 
ATOM   1485 C  CG2 . ILE A 1 186 ? 33.151  -0.472  -7.795  1.00 14.66 ? 185 ILE A CG2 1 
ATOM   1486 C  CD1 . ILE A 1 186 ? 33.897  2.613   -7.617  1.00 13.31 ? 185 ILE A CD1 1 
ATOM   1487 N  N   . SER A 1 187 ? 36.253  -2.414  -6.908  1.00 16.17 ? 186 SER A N   1 
ATOM   1488 C  CA  . SER A 1 187 ? 36.633  -3.742  -7.397  1.00 16.90 ? 186 SER A CA  1 
ATOM   1489 C  C   . SER A 1 187 ? 36.759  -4.745  -6.256  1.00 17.87 ? 186 SER A C   1 
ATOM   1490 O  O   . SER A 1 187 ? 36.431  -5.910  -6.430  1.00 18.63 ? 186 SER A O   1 
ATOM   1491 C  CB  . SER A 1 187 ? 37.914  -3.686  -8.239  1.00 16.73 ? 186 SER A CB  1 
ATOM   1492 O  OG  . SER A 1 187 ? 37.759  -2.725  -9.290  1.00 15.58 ? 186 SER A OG  1 
ATOM   1493 N  N   . GLU A 1 188 ? 37.207  -4.276  -5.090  1.00 18.32 ? 187 GLU A N   1 
ATOM   1494 C  CA  . GLU A 1 188 ? 37.341  -5.119  -3.897  1.00 19.07 ? 187 GLU A CA  1 
ATOM   1495 C  C   . GLU A 1 188 ? 35.968  -5.558  -3.386  1.00 19.02 ? 187 GLU A C   1 
ATOM   1496 O  O   . GLU A 1 188 ? 35.788  -6.712  -2.991  1.00 18.21 ? 187 GLU A O   1 
ATOM   1497 C  CB  . GLU A 1 188 ? 38.108  -4.367  -2.801  1.00 19.38 ? 187 GLU A CB  1 
ATOM   1498 C  CG  . GLU A 1 188 ? 39.634  -4.381  -2.990  1.00 18.29 ? 187 GLU A CG  1 
ATOM   1499 C  CD  . GLU A 1 188 ? 40.369  -3.382  -2.092  1.00 20.15 ? 187 GLU A CD  1 
ATOM   1500 O  OE1 . GLU A 1 188 ? 39.725  -2.760  -1.216  1.00 21.91 ? 187 GLU A OE1 1 
ATOM   1501 O  OE2 . GLU A 1 188 ? 41.600  -3.204  -2.267  1.00 21.95 ? 187 GLU A OE2 1 
ATOM   1502 N  N   . ARG A 1 189 ? 35.019  -4.625  -3.403  1.00 18.95 ? 188 ARG A N   1 
ATOM   1503 C  CA  . ARG A 1 189 ? 33.628  -4.878  -3.009  1.00 18.75 ? 188 ARG A CA  1 
ATOM   1504 C  C   . ARG A 1 189 ? 32.970  -5.872  -3.985  1.00 18.98 ? 188 ARG A C   1 
ATOM   1505 O  O   . ARG A 1 189 ? 32.233  -6.772  -3.568  1.00 19.38 ? 188 ARG A O   1 
ATOM   1506 C  CB  . ARG A 1 189 ? 32.846  -3.561  -2.898  1.00 19.30 ? 188 ARG A CB  1 
ATOM   1507 C  CG  . ARG A 1 189 ? 33.303  -2.670  -1.734  1.00 18.31 ? 188 ARG A CG  1 
ATOM   1508 C  CD  . ARG A 1 189 ? 32.502  -1.388  -1.655  1.00 18.23 ? 188 ARG A CD  1 
ATOM   1509 N  NE  . ARG A 1 189 ? 32.846  -0.559  -0.491  1.00 17.12 ? 188 ARG A NE  1 
ATOM   1510 C  CZ  . ARG A 1 189 ? 32.278  -0.668  0.712   1.00 18.49 ? 188 ARG A CZ  1 
ATOM   1511 N  NH1 . ARG A 1 189 ? 31.346  -1.593  0.944   1.00 19.12 ? 188 ARG A NH1 1 
ATOM   1512 N  NH2 . ARG A 1 189 ? 32.653  0.139   1.697   1.00 16.48 ? 188 ARG A NH2 1 
ATOM   1513 N  N   . PHE A 1 190 ? 33.281  -5.730  -5.273  1.00 18.66 ? 189 PHE A N   1 
ATOM   1514 C  CA  . PHE A 1 190 ? 32.819  -6.661  -6.300  1.00 18.44 ? 189 PHE A CA  1 
ATOM   1515 C  C   . PHE A 1 190 ? 33.312  -8.081  -6.007  1.00 18.71 ? 189 PHE A C   1 
ATOM   1516 O  O   . PHE A 1 190 ? 32.504  -9.018  -5.923  1.00 18.43 ? 189 PHE A O   1 
ATOM   1517 C  CB  . PHE A 1 190 ? 33.296  -6.207  -7.675  1.00 18.17 ? 189 PHE A CB  1 
ATOM   1518 C  CG  . PHE A 1 190 ? 32.880  -7.112  -8.800  1.00 17.94 ? 189 PHE A CG  1 
ATOM   1519 C  CD1 . PHE A 1 190 ? 31.530  -7.268  -9.134  1.00 18.45 ? 189 PHE A CD1 1 
ATOM   1520 C  CD2 . PHE A 1 190 ? 33.841  -7.775  -9.559  1.00 17.02 ? 189 PHE A CD2 1 
ATOM   1521 C  CE1 . PHE A 1 190 ? 31.147  -8.102  -10.183 1.00 17.68 ? 189 PHE A CE1 1 
ATOM   1522 C  CE2 . PHE A 1 190 ? 33.470  -8.591  -10.615 1.00 17.45 ? 189 PHE A CE2 1 
ATOM   1523 C  CZ  . PHE A 1 190 ? 32.122  -8.748  -10.928 1.00 17.49 ? 189 PHE A CZ  1 
ATOM   1524 N  N   . ALA A 1 191 ? 34.631  -8.221  -5.841  1.00 18.28 ? 190 ALA A N   1 
ATOM   1525 C  CA  . ALA A 1 191 ? 35.262  -9.505  -5.523  1.00 19.83 ? 190 ALA A CA  1 
ATOM   1526 C  C   . ALA A 1 191 ? 34.593  -10.157 -4.312  1.00 20.88 ? 190 ALA A C   1 
ATOM   1527 O  O   . ALA A 1 191 ? 34.182  -11.310 -4.387  1.00 20.80 ? 190 ALA A O   1 
ATOM   1528 C  CB  . ALA A 1 191 ? 36.768  -9.324  -5.305  1.00 18.39 ? 190 ALA A CB  1 
ATOM   1529 N  N   . ASN A 1 192 ? 34.418  -9.395  -3.228  1.00 22.74 ? 191 ASN A N   1 
ATOM   1530 C  CA  . ASN A 1 192 ? 33.787  -9.917  -2.001  1.00 24.11 ? 191 ASN A CA  1 
ATOM   1531 C  C   . ASN A 1 192 ? 32.311  -10.274 -2.181  1.00 25.04 ? 191 ASN A C   1 
ATOM   1532 O  O   . ASN A 1 192 ? 31.816  -11.210 -1.554  1.00 25.13 ? 191 ASN A O   1 
ATOM   1533 C  CB  . ASN A 1 192 ? 33.927  -8.925  -0.838  1.00 24.62 ? 191 ASN A CB  1 
ATOM   1534 C  CG  . ASN A 1 192 ? 35.375  -8.582  -0.512  1.00 25.56 ? 191 ASN A CG  1 
ATOM   1535 O  OD1 . ASN A 1 192 ? 36.312  -9.234  -0.979  1.00 29.41 ? 191 ASN A OD1 1 
ATOM   1536 N  ND2 . ASN A 1 192 ? 35.560  -7.551  0.301   1.00 26.99 ? 191 ASN A ND2 1 
ATOM   1537 N  N   . ALA A 1 193 ? 31.617  -9.531  -3.039  1.00 25.65 ? 192 ALA A N   1 
ATOM   1538 C  CA  . ALA A 1 193 ? 30.197  -9.765  -3.321  1.00 26.67 ? 192 ALA A CA  1 
ATOM   1539 C  C   . ALA A 1 193 ? 29.993  -11.060 -4.110  1.00 27.88 ? 192 ALA A C   1 
ATOM   1540 O  O   . ALA A 1 193 ? 28.956  -11.721 -3.983  1.00 27.83 ? 192 ALA A O   1 
ATOM   1541 C  CB  . ALA A 1 193 ? 29.610  -8.580  -4.079  1.00 26.57 ? 192 ALA A CB  1 
ATOM   1542 N  N   . ARG A 1 194 ? 30.992  -11.403 -4.921  1.00 28.83 ? 193 ARG A N   1 
ATOM   1543 C  CA  . ARG A 1 194 ? 30.998  -12.630 -5.715  1.00 30.48 ? 193 ARG A CA  1 
ATOM   1544 C  C   . ARG A 1 194 ? 31.234  -13.899 -4.899  1.00 31.73 ? 193 ARG A C   1 
ATOM   1545 O  O   . ARG A 1 194 ? 30.631  -14.937 -5.186  1.00 32.25 ? 193 ARG A O   1 
ATOM   1546 C  CB  . ARG A 1 194 ? 32.076  -12.550 -6.783  1.00 29.95 ? 193 ARG A CB  1 
ATOM   1547 C  CG  . ARG A 1 194 ? 31.673  -11.813 -8.016  1.00 31.17 ? 193 ARG A CG  1 
ATOM   1548 C  CD  . ARG A 1 194 ? 32.839  -11.800 -8.947  1.00 33.19 ? 193 ARG A CD  1 
ATOM   1549 N  NE  . ARG A 1 194 ? 32.400  -11.767 -10.333 1.00 35.05 ? 193 ARG A NE  1 
ATOM   1550 C  CZ  . ARG A 1 194 ? 33.184  -12.020 -11.375 1.00 34.44 ? 193 ARG A CZ  1 
ATOM   1551 N  NH1 . ARG A 1 194 ? 34.467  -12.328 -11.203 1.00 34.48 ? 193 ARG A NH1 1 
ATOM   1552 N  NH2 . ARG A 1 194 ? 32.678  -11.959 -12.598 1.00 36.23 ? 193 ARG A NH2 1 
ATOM   1553 N  N   . GLN A 1 195 ? 32.135  -13.824 -3.915  1.00 32.99 ? 194 GLN A N   1 
ATOM   1554 C  CA  . GLN A 1 195 ? 32.521  -14.989 -3.106  1.00 34.20 ? 194 GLN A CA  1 
ATOM   1555 C  C   . GLN A 1 195 ? 31.366  -15.638 -2.344  1.00 34.28 ? 194 GLN A C   1 
ATOM   1556 O  O   . GLN A 1 195 ? 31.336  -16.868 -2.199  1.00 34.85 ? 194 GLN A O   1 
ATOM   1557 C  CB  . GLN A 1 195 ? 33.664  -14.632 -2.149  1.00 34.27 ? 194 GLN A CB  1 
ATOM   1558 C  CG  . GLN A 1 195 ? 35.043  -14.624 -2.813  1.00 35.26 ? 194 GLN A CG  1 
ATOM   1559 C  CD  . GLN A 1 195 ? 36.143  -14.156 -1.878  1.00 35.11 ? 194 GLN A CD  1 
ATOM   1560 O  OE1 . GLN A 1 195 ? 36.056  -13.078 -1.282  1.00 37.12 ? 194 GLN A OE1 1 
ATOM   1561 N  NE2 . GLN A 1 195 ? 37.192  -14.962 -1.753  1.00 36.60 ? 194 GLN A NE2 1 
ATOM   1562 N  N   . MET B 1 1   ? 8.223   -11.093 26.011  1.00 30.84 ? 0   MET C N   1 
ATOM   1563 C  CA  . MET B 1 1   ? 7.966   -12.553 25.866  1.00 31.29 ? 0   MET C CA  1 
ATOM   1564 C  C   . MET B 1 1   ? 7.136   -12.815 24.606  1.00 28.93 ? 0   MET C C   1 
ATOM   1565 O  O   . MET B 1 1   ? 6.748   -11.876 23.903  1.00 29.71 ? 0   MET C O   1 
ATOM   1566 C  CB  . MET B 1 1   ? 7.245   -13.099 27.102  1.00 31.36 ? 0   MET C CB  1 
ATOM   1567 C  CG  . MET B 1 1   ? 5.845   -12.537 27.301  1.00 33.48 ? 0   MET C CG  1 
ATOM   1568 S  SD  . MET B 1 1   ? 4.938   -13.452 28.553  1.00 36.91 ? 0   MET C SD  1 
ATOM   1569 C  CE  . MET B 1 1   ? 5.773   -12.931 30.062  1.00 36.12 ? 0   MET C CE  1 
ATOM   1570 N  N   . LYS B 1 2   ? 6.816   -14.084 24.362  1.00 26.06 ? 1   LYS C N   1 
ATOM   1571 C  CA  . LYS B 1 2   ? 6.143   -14.500 23.140  1.00 23.50 ? 1   LYS C CA  1 
ATOM   1572 C  C   . LYS B 1 2   ? 4.710   -13.982 23.016  1.00 22.05 ? 1   LYS C C   1 
ATOM   1573 O  O   . LYS B 1 2   ? 3.920   -14.092 23.949  1.00 22.33 ? 1   LYS C O   1 
ATOM   1574 C  CB  . LYS B 1 2   ? 6.130   -16.019 23.095  1.00 23.85 ? 1   LYS C CB  1 
ATOM   1575 C  CG  . LYS B 1 2   ? 5.556   -16.654 21.855  1.00 25.58 ? 1   LYS C CG  1 
ATOM   1576 C  CD  . LYS B 1 2   ? 5.147   -18.086 22.201  1.00 27.82 ? 1   LYS C CD  1 
ATOM   1577 C  CE  . LYS B 1 2   ? 4.856   -18.909 20.959  1.00 30.67 ? 1   LYS C CE  1 
ATOM   1578 N  NZ  . LYS B 1 2   ? 3.978   -20.063 21.299  1.00 32.06 ? 1   LYS C NZ  1 
ATOM   1579 N  N   . HIS B 1 3   ? 4.384   -13.452 21.847  1.00 19.96 ? 2   HIS C N   1 
ATOM   1580 C  CA  . HIS B 1 3   ? 3.026   -13.028 21.557  1.00 18.92 ? 2   HIS C CA  1 
ATOM   1581 C  C   . HIS B 1 3   ? 2.112   -14.226 21.362  1.00 17.96 ? 2   HIS C C   1 
ATOM   1582 O  O   . HIS B 1 3   ? 2.523   -15.243 20.790  1.00 17.99 ? 2   HIS C O   1 
ATOM   1583 C  CB  . HIS B 1 3   ? 3.006   -12.165 20.296  1.00 18.33 ? 2   HIS C CB  1 
ATOM   1584 C  CG  . HIS B 1 3   ? 3.830   -10.936 20.417  1.00 20.15 ? 2   HIS C CG  1 
ATOM   1585 N  ND1 . HIS B 1 3   ? 3.371   -9.788  21.034  1.00 18.93 ? 2   HIS C ND1 1 
ATOM   1586 C  CD2 . HIS B 1 3   ? 5.088   -10.671 20.002  1.00 19.37 ? 2   HIS C CD2 1 
ATOM   1587 C  CE1 . HIS B 1 3   ? 4.320   -8.871  20.995  1.00 18.46 ? 2   HIS C CE1 1 
ATOM   1588 N  NE2 . HIS B 1 3   ? 5.370   -9.380  20.373  1.00 19.77 ? 2   HIS C NE2 1 
ATOM   1589 N  N   . THR B 1 4   ? 0.874   -14.109 21.844  1.00 17.74 ? 3   THR C N   1 
ATOM   1590 C  CA  . THR B 1 4   ? -0.116  -15.178 21.685  1.00 17.92 ? 3   THR C CA  1 
ATOM   1591 C  C   . THR B 1 4   ? -1.411  -14.638 21.072  1.00 17.42 ? 3   THR C C   1 
ATOM   1592 O  O   . THR B 1 4   ? -1.741  -13.454 21.216  1.00 17.87 ? 3   THR C O   1 
ATOM   1593 C  CB  . THR B 1 4   ? -0.438  -15.882 23.022  1.00 19.13 ? 3   THR C CB  1 
ATOM   1594 O  OG1 . THR B 1 4   ? -1.105  -14.958 23.892  1.00 21.43 ? 3   THR C OG1 1 
ATOM   1595 C  CG2 . THR B 1 4   ? 0.842   -16.392 23.683  1.00 19.06 ? 3   THR C CG2 1 
ATOM   1596 N  N   . LEU B 1 5   ? -2.097  -15.501 20.337  1.00 16.79 ? 4   LEU C N   1 
ATOM   1597 C  CA  . LEU B 1 5   ? -3.401  -15.179 19.783  1.00 16.52 ? 4   LEU C CA  1 
ATOM   1598 C  C   . LEU B 1 5   ? -4.400  -15.022 20.936  1.00 16.43 ? 4   LEU C C   1 
ATOM   1599 O  O   . LEU B 1 5   ? -4.678  -15.996 21.656  1.00 16.27 ? 4   LEU C O   1 
ATOM   1600 C  CB  . LEU B 1 5   ? -3.883  -16.326 18.894  1.00 16.33 ? 4   LEU C CB  1 
ATOM   1601 C  CG  . LEU B 1 5   ? -5.220  -16.082 18.206  1.00 16.88 ? 4   LEU C CG  1 
ATOM   1602 C  CD1 . LEU B 1 5   ? -5.104  -14.936 17.185  1.00 18.70 ? 4   LEU C CD1 1 
ATOM   1603 C  CD2 . LEU B 1 5   ? -5.704  -17.343 17.554  1.00 18.50 ? 4   LEU C CD2 1 
ATOM   1604 N  N   . PRO B 1 6   ? -4.952  -13.816 21.125  1.00 16.48 ? 5   PRO C N   1 
ATOM   1605 C  CA  . PRO B 1 6   ? -5.908  -13.734 22.223  1.00 16.65 ? 5   PRO C CA  1 
ATOM   1606 C  C   . PRO B 1 6   ? -7.235  -14.402 21.876  1.00 17.91 ? 5   PRO C C   1 
ATOM   1607 O  O   . PRO B 1 6   ? -7.686  -14.338 20.729  1.00 17.58 ? 5   PRO C O   1 
ATOM   1608 C  CB  . PRO B 1 6   ? -6.153  -12.236 22.344  1.00 17.20 ? 5   PRO C CB  1 
ATOM   1609 C  CG  . PRO B 1 6   ? -6.028  -11.736 20.877  1.00 16.61 ? 5   PRO C CG  1 
ATOM   1610 C  CD  . PRO B 1 6   ? -4.805  -12.519 20.420  1.00 15.83 ? 5   PRO C CD  1 
ATOM   1611 N  N   . ASP B 1 7   ? -7.851  -15.033 22.867  1.00 18.27 ? 6   ASP C N   1 
ATOM   1612 C  CA  . ASP B 1 7   ? -9.221  -15.508 22.708  1.00 20.34 ? 6   ASP C CA  1 
ATOM   1613 C  C   . ASP B 1 7   ? -10.133 -14.332 22.382  1.00 20.77 ? 6   ASP C C   1 
ATOM   1614 O  O   . ASP B 1 7   ? -9.945  -13.213 22.893  1.00 21.76 ? 6   ASP C O   1 
ATOM   1615 C  CB  . ASP B 1 7   ? -9.716  -16.165 24.006  1.00 19.68 ? 6   ASP C CB  1 
ATOM   1616 C  CG  . ASP B 1 7   ? -9.083  -17.523 24.278  1.00 21.75 ? 6   ASP C CG  1 
ATOM   1617 O  OD1 . ASP B 1 7   ? -9.388  -18.086 25.347  1.00 22.02 ? 6   ASP C OD1 1 
ATOM   1618 O  OD2 . ASP B 1 7   ? -8.314  -18.055 23.450  1.00 22.06 ? 6   ASP C OD2 1 
ATOM   1619 N  N   . LEU B 1 8   ? -11.113 -14.584 21.520  1.00 21.51 ? 7   LEU C N   1 
ATOM   1620 C  CA  . LEU B 1 8   ? -12.187 -13.629 21.264  1.00 21.77 ? 7   LEU C CA  1 
ATOM   1621 C  C   . LEU B 1 8   ? -13.020 -13.451 22.529  1.00 21.76 ? 7   LEU C C   1 
ATOM   1622 O  O   . LEU B 1 8   ? -13.148 -14.397 23.311  1.00 21.61 ? 7   LEU C O   1 
ATOM   1623 C  CB  . LEU B 1 8   ? -13.098 -14.141 20.157  1.00 21.85 ? 7   LEU C CB  1 
ATOM   1624 C  CG  . LEU B 1 8   ? -12.619 -14.308 18.718  1.00 21.94 ? 7   LEU C CG  1 
ATOM   1625 C  CD1 . LEU B 1 8   ? -13.873 -14.648 17.918  1.00 23.30 ? 7   LEU C CD1 1 
ATOM   1626 C  CD2 . LEU B 1 8   ? -11.987 -13.017 18.179  1.00 22.20 ? 7   LEU C CD2 1 
ATOM   1627 N  N   . PRO B 1 9   ? -13.593 -12.242 22.736  1.00 22.08 ? 8   PRO C N   1 
ATOM   1628 C  CA  . PRO B 1 9   ? -14.452 -12.018 23.906  1.00 22.19 ? 8   PRO C CA  1 
ATOM   1629 C  C   . PRO B 1 9   ? -15.890 -12.534 23.725  1.00 21.86 ? 8   PRO C C   1 
ATOM   1630 O  O   . PRO B 1 9   ? -16.766 -12.247 24.545  1.00 21.93 ? 8   PRO C O   1 
ATOM   1631 C  CB  . PRO B 1 9   ? -14.438 -10.491 24.076  1.00 22.00 ? 8   PRO C CB  1 
ATOM   1632 C  CG  . PRO B 1 9   ? -13.911 -9.922  22.793  1.00 22.96 ? 8   PRO C CG  1 
ATOM   1633 C  CD  . PRO B 1 9   ? -13.448 -11.034 21.903  1.00 22.64 ? 8   PRO C CD  1 
ATOM   1634 N  N   . PHE B 1 10  ? -16.107 -13.304 22.662  1.00 21.83 ? 9   PHE C N   1 
ATOM   1635 C  CA  . PHE B 1 10  ? -17.407 -13.876 22.314  1.00 21.09 ? 9   PHE C CA  1 
ATOM   1636 C  C   . PHE B 1 10  ? -17.172 -15.106 21.445  1.00 21.03 ? 9   PHE C C   1 
ATOM   1637 O  O   . PHE B 1 10  ? -16.022 -15.371 21.036  1.00 21.19 ? 9   PHE C O   1 
ATOM   1638 C  CB  . PHE B 1 10  ? -18.279 -12.850 21.563  1.00 21.45 ? 9   PHE C CB  1 
ATOM   1639 C  CG  . PHE B 1 10  ? -17.543 -12.118 20.471  1.00 20.80 ? 9   PHE C CG  1 
ATOM   1640 C  CD1 . PHE B 1 10  ? -16.959 -10.874 20.725  1.00 20.91 ? 9   PHE C CD1 1 
ATOM   1641 C  CD2 . PHE B 1 10  ? -17.399 -12.680 19.203  1.00 20.63 ? 9   PHE C CD2 1 
ATOM   1642 C  CE1 . PHE B 1 10  ? -16.244 -10.204 19.733  1.00 21.12 ? 9   PHE C CE1 1 
ATOM   1643 C  CE2 . PHE B 1 10  ? -16.683 -12.004 18.198  1.00 22.36 ? 9   PHE C CE2 1 
ATOM   1644 C  CZ  . PHE B 1 10  ? -16.115 -10.762 18.471  1.00 21.98 ? 9   PHE C CZ  1 
ATOM   1645 N  N   . ASP B 1 11  ? -18.252 -15.847 21.177  1.00 20.74 ? 10  ASP C N   1 
ATOM   1646 C  CA  . ASP B 1 11  ? -18.221 -17.038 20.326  1.00 20.11 ? 10  ASP C CA  1 
ATOM   1647 C  C   . ASP B 1 11  ? -18.277 -16.660 18.854  1.00 19.57 ? 10  ASP C C   1 
ATOM   1648 O  O   . ASP B 1 11  ? -18.776 -15.588 18.505  1.00 17.60 ? 10  ASP C O   1 
ATOM   1649 C  CB  . ASP B 1 11  ? -19.353 -17.999 20.703  1.00 20.89 ? 10  ASP C CB  1 
ATOM   1650 C  CG  . ASP B 1 11  ? -19.165 -18.586 22.092  1.00 22.17 ? 10  ASP C CG  1 
ATOM   1651 O  OD1 . ASP B 1 11  ? -17.996 -18.767 22.510  1.00 25.95 ? 10  ASP C OD1 1 
ATOM   1652 O  OD2 . ASP B 1 11  ? -20.167 -18.842 22.767  1.00 24.35 ? 10  ASP C OD2 1 
ATOM   1653 N  N   . TYR B 1 12  ? -17.792 -17.551 17.992  1.00 19.37 ? 11  TYR C N   1 
ATOM   1654 C  CA  . TYR B 1 12  ? -17.633 -17.199 16.574  1.00 19.82 ? 11  TYR C CA  1 
ATOM   1655 C  C   . TYR B 1 12  ? -18.916 -16.750 15.869  1.00 19.18 ? 11  TYR C C   1 
ATOM   1656 O  O   . TYR B 1 12  ? -18.856 -15.921 14.957  1.00 18.99 ? 11  TYR C O   1 
ATOM   1657 C  CB  . TYR B 1 12  ? -16.940 -18.318 15.793  1.00 20.84 ? 11  TYR C CB  1 
ATOM   1658 C  CG  . TYR B 1 12  ? -15.481 -18.502 16.168  1.00 21.31 ? 11  TYR C CG  1 
ATOM   1659 C  CD1 . TYR B 1 12  ? -14.591 -17.441 16.086  1.00 21.00 ? 11  TYR C CD1 1 
ATOM   1660 C  CD2 . TYR B 1 12  ? -14.992 -19.744 16.594  1.00 22.51 ? 11  TYR C CD2 1 
ATOM   1661 C  CE1 . TYR B 1 12  ? -13.261 -17.588 16.435  1.00 23.87 ? 11  TYR C CE1 1 
ATOM   1662 C  CE2 . TYR B 1 12  ? -13.645 -19.906 16.937  1.00 23.13 ? 11  TYR C CE2 1 
ATOM   1663 C  CZ  . TYR B 1 12  ? -12.793 -18.818 16.859  1.00 21.94 ? 11  TYR C CZ  1 
ATOM   1664 O  OH  . TYR B 1 12  ? -11.460 -18.930 17.192  1.00 22.79 ? 11  TYR C OH  1 
ATOM   1665 N  N   . ALA B 1 13  ? -20.057 -17.298 16.300  1.00 18.47 ? 12  ALA C N   1 
ATOM   1666 C  CA  . ALA B 1 13  ? -21.349 -16.972 15.689  1.00 18.15 ? 12  ALA C CA  1 
ATOM   1667 C  C   . ALA B 1 13  ? -22.083 -15.810 16.364  1.00 17.87 ? 12  ALA C C   1 
ATOM   1668 O  O   . ALA B 1 13  ? -23.184 -15.457 15.949  1.00 18.35 ? 12  ALA C O   1 
ATOM   1669 C  CB  . ALA B 1 13  ? -22.252 -18.219 15.669  1.00 18.36 ? 12  ALA C CB  1 
ATOM   1670 N  N   . ASP B 1 14  ? -21.482 -15.222 17.397  1.00 17.37 ? 13  ASP C N   1 
ATOM   1671 C  CA  . ASP B 1 14  ? -22.169 -14.202 18.203  1.00 17.16 ? 13  ASP C CA  1 
ATOM   1672 C  C   . ASP B 1 14  ? -22.506 -12.895 17.480  1.00 16.98 ? 13  ASP C C   1 
ATOM   1673 O  O   . ASP B 1 14  ? -23.370 -12.153 17.942  1.00 17.31 ? 13  ASP C O   1 
ATOM   1674 C  CB  . ASP B 1 14  ? -21.435 -13.932 19.531  1.00 16.94 ? 13  ASP C CB  1 
ATOM   1675 C  CG  . ASP B 1 14  ? -21.597 -15.068 20.549  1.00 18.26 ? 13  ASP C CG  1 
ATOM   1676 O  OD1 . ASP B 1 14  ? -22.293 -16.075 20.242  1.00 17.43 ? 13  ASP C OD1 1 
ATOM   1677 O  OD2 . ASP B 1 14  ? -21.040 -14.951 21.670  1.00 19.56 ? 13  ASP C OD2 1 
ATOM   1678 N  N   . LEU B 1 15  ? -21.885 -12.665 16.329  1.00 16.23 ? 14  LEU C N   1 
ATOM   1679 C  CA  . LEU B 1 15  ? -22.050 -11.407 15.585  1.00 16.45 ? 14  LEU C CA  1 
ATOM   1680 C  C   . LEU B 1 15  ? -22.964 -11.505 14.370  1.00 16.51 ? 14  LEU C C   1 
ATOM   1681 O  O   . LEU B 1 15  ? -23.150 -10.516 13.647  1.00 17.32 ? 14  LEU C O   1 
ATOM   1682 C  CB  . LEU B 1 15  ? -20.676 -10.854 15.157  1.00 15.94 ? 14  LEU C CB  1 
ATOM   1683 C  CG  . LEU B 1 15  ? -19.626 -10.594 16.247  1.00 17.06 ? 14  LEU C CG  1 
ATOM   1684 C  CD1 . LEU B 1 15  ? -18.363 -9.976  15.611  1.00 16.02 ? 14  LEU C CD1 1 
ATOM   1685 C  CD2 . LEU B 1 15  ? -20.180 -9.685  17.374  1.00 17.71 ? 14  LEU C CD2 1 
ATOM   1686 N  N   . GLU B 1 16  ? -23.517 -12.695 14.127  1.00 17.46 ? 15  GLU C N   1 
ATOM   1687 C  CA  . GLU B 1 16  ? -24.491 -12.864 13.048  1.00 18.07 ? 15  GLU C CA  1 
ATOM   1688 C  C   . GLU B 1 16  ? -25.737 -12.029 13.366  1.00 17.83 ? 15  GLU C C   1 
ATOM   1689 O  O   . GLU B 1 16  ? -26.102 -11.891 14.540  1.00 18.61 ? 15  GLU C O   1 
ATOM   1690 C  CB  . GLU B 1 16  ? -24.826 -14.357 12.833  1.00 18.58 ? 15  GLU C CB  1 
ATOM   1691 C  CG  . GLU B 1 16  ? -23.608 -15.121 12.337  1.00 20.08 ? 15  GLU C CG  1 
ATOM   1692 C  CD  . GLU B 1 16  ? -23.918 -16.435 11.674  1.00 21.93 ? 15  GLU C CD  1 
ATOM   1693 O  OE1 . GLU B 1 16  ? -25.037 -16.977 11.858  1.00 26.00 ? 15  GLU C OE1 1 
ATOM   1694 O  OE2 . GLU B 1 16  ? -23.025 -16.946 10.972  1.00 20.03 ? 15  GLU C OE2 1 
ATOM   1695 N  N   . PRO B 1 17  ? -26.400 -11.478 12.332  1.00 17.53 ? 16  PRO C N   1 
ATOM   1696 C  CA  . PRO B 1 17  ? -26.096 -11.634 10.911  1.00 17.45 ? 16  PRO C CA  1 
ATOM   1697 C  C   . PRO B 1 17  ? -25.141 -10.582 10.350  1.00 17.45 ? 16  PRO C C   1 
ATOM   1698 O  O   . PRO B 1 17  ? -25.036 -10.464 9.125   1.00 18.13 ? 16  PRO C O   1 
ATOM   1699 C  CB  . PRO B 1 17  ? -27.468 -11.437 10.259  1.00 17.68 ? 16  PRO C CB  1 
ATOM   1700 C  CG  . PRO B 1 17  ? -28.114 -10.410 11.123  1.00 17.68 ? 16  PRO C CG  1 
ATOM   1701 C  CD  . PRO B 1 17  ? -27.613 -10.657 12.532  1.00 17.59 ? 16  PRO C CD  1 
ATOM   1702 N  N   . VAL B 1 18  ? -24.479 -9.809  11.211  1.00 17.01 ? 17  VAL C N   1 
ATOM   1703 C  CA  . VAL B 1 18  ? -23.609 -8.710  10.711  1.00 16.68 ? 17  VAL C CA  1 
ATOM   1704 C  C   . VAL B 1 18  ? -22.293 -9.240  10.151  1.00 16.19 ? 17  VAL C C   1 
ATOM   1705 O  O   . VAL B 1 18  ? -21.827 -8.775  9.102   1.00 15.49 ? 17  VAL C O   1 
ATOM   1706 C  CB  . VAL B 1 18  ? -23.388 -7.563  11.737  1.00 16.72 ? 17  VAL C CB  1 
ATOM   1707 C  CG1 . VAL B 1 18  ? -22.481 -6.453  11.153  1.00 16.66 ? 17  VAL C CG1 1 
ATOM   1708 C  CG2 . VAL B 1 18  ? -24.711 -6.942  12.120  1.00 17.91 ? 17  VAL C CG2 1 
ATOM   1709 N  N   . ILE B 1 19  ? -21.708 -10.222 10.834  1.00 15.64 ? 18  ILE C N   1 
ATOM   1710 C  CA  . ILE B 1 19  ? -20.497 -10.869 10.341  1.00 15.19 ? 18  ILE C CA  1 
ATOM   1711 C  C   . ILE B 1 19  ? -20.694 -12.334 10.617  1.00 15.65 ? 18  ILE C C   1 
ATOM   1712 O  O   . ILE B 1 19  ? -21.016 -12.705 11.749  1.00 14.83 ? 18  ILE C O   1 
ATOM   1713 C  CB  . ILE B 1 19  ? -19.187 -10.404 11.039  1.00 15.33 ? 18  ILE C CB  1 
ATOM   1714 C  CG1 . ILE B 1 19  ? -19.006 -8.878  10.939  1.00 13.94 ? 18  ILE C CG1 1 
ATOM   1715 C  CG2 . ILE B 1 19  ? -18.008 -11.160 10.428  1.00 14.12 ? 18  ILE C CG2 1 
ATOM   1716 C  CD1 . ILE B 1 19  ? -17.788 -8.323  11.723  1.00 15.04 ? 18  ILE C CD1 1 
ATOM   1717 N  N   . SER B 1 20  ? -20.492 -13.154 9.590   1.00 15.86 ? 19  SER C N   1 
ATOM   1718 C  CA  . SER B 1 20  ? -20.802 -14.596 9.670   1.00 15.87 ? 19  SER C CA  1 
ATOM   1719 C  C   . SER B 1 20  ? -19.845 -15.372 10.556  1.00 16.07 ? 19  SER C C   1 
ATOM   1720 O  O   . SER B 1 20  ? -18.688 -14.967 10.744  1.00 15.64 ? 19  SER C O   1 
ATOM   1721 C  CB  . SER B 1 20  ? -20.814 -15.206 8.266   1.00 15.72 ? 19  SER C CB  1 
ATOM   1722 O  OG  . SER B 1 20  ? -19.497 -15.283 7.728   1.00 19.44 ? 19  SER C OG  1 
ATOM   1723 N  N   . HIS B 1 21  ? -20.307 -16.508 11.091  1.00 16.17 ? 20  HIS C N   1 
ATOM   1724 C  CA  . HIS B 1 21  ? -19.410 -17.348 11.874  1.00 17.63 ? 20  HIS C CA  1 
ATOM   1725 C  C   . HIS B 1 21  ? -18.207 -17.835 11.039  1.00 18.31 ? 20  HIS C C   1 
ATOM   1726 O  O   . HIS B 1 21  ? -17.096 -17.969 11.581  1.00 18.08 ? 20  HIS C O   1 
ATOM   1727 C  CB  . HIS B 1 21  ? -20.149 -18.518 12.547  1.00 18.12 ? 20  HIS C CB  1 
ATOM   1728 C  CG  . HIS B 1 21  ? -20.508 -19.630 11.619  1.00 18.85 ? 20  HIS C CG  1 
ATOM   1729 N  ND1 . HIS B 1 21  ? -21.680 -19.643 10.891  1.00 23.63 ? 20  HIS C ND1 1 
ATOM   1730 C  CD2 . HIS B 1 21  ? -19.863 -20.784 11.323  1.00 21.40 ? 20  HIS C CD2 1 
ATOM   1731 C  CE1 . HIS B 1 21  ? -21.736 -20.754 10.177  1.00 23.74 ? 20  HIS C CE1 1 
ATOM   1732 N  NE2 . HIS B 1 21  ? -20.650 -21.464 10.424  1.00 24.03 ? 20  HIS C NE2 1 
ATOM   1733 N  N   . GLU B 1 22  ? -18.402 -18.085 9.736   1.00 18.79 ? 21  GLU C N   1 
ATOM   1734 C  CA  . GLU B 1 22  ? -17.254 -18.532 8.926   1.00 19.89 ? 21  GLU C CA  1 
ATOM   1735 C  C   . GLU B 1 22  ? -16.159 -17.468 8.824   1.00 18.46 ? 21  GLU C C   1 
ATOM   1736 O  O   . GLU B 1 22  ? -14.973 -17.766 8.970   1.00 16.67 ? 21  GLU C O   1 
ATOM   1737 C  CB  . GLU B 1 22  ? -17.616 -19.054 7.528   1.00 20.27 ? 21  GLU C CB  1 
ATOM   1738 C  CG  . GLU B 1 22  ? -16.354 -19.755 6.934   1.00 23.68 ? 21  GLU C CG  1 
ATOM   1739 C  CD  . GLU B 1 22  ? -16.497 -20.359 5.532   1.00 24.18 ? 21  GLU C CD  1 
ATOM   1740 O  OE1 . GLU B 1 22  ? -17.491 -20.079 4.820   1.00 25.33 ? 21  GLU C OE1 1 
ATOM   1741 O  OE2 . GLU B 1 22  ? -15.561 -21.110 5.143   1.00 28.98 ? 21  GLU C OE2 1 
ATOM   1742 N  N   . ILE B 1 23  ? -16.584 -16.235 8.598   1.00 17.21 ? 22  ILE C N   1 
ATOM   1743 C  CA  . ILE B 1 23  ? -15.677 -15.126 8.576   1.00 16.82 ? 22  ILE C CA  1 
ATOM   1744 C  C   . ILE B 1 23  ? -14.953 -15.015 9.923   1.00 17.00 ? 22  ILE C C   1 
ATOM   1745 O  O   . ILE B 1 23  ? -13.735 -15.014 9.957   1.00 14.75 ? 22  ILE C O   1 
ATOM   1746 C  CB  . ILE B 1 23  ? -16.371 -13.809 8.229   1.00 16.54 ? 22  ILE C CB  1 
ATOM   1747 C  CG1 . ILE B 1 23  ? -16.814 -13.831 6.761   1.00 16.85 ? 22  ILE C CG1 1 
ATOM   1748 C  CG2 . ILE B 1 23  ? -15.389 -12.650 8.494   1.00 15.49 ? 22  ILE C CG2 1 
ATOM   1749 C  CD1 . ILE B 1 23  ? -17.456 -12.512 6.261   1.00 17.22 ? 22  ILE C CD1 1 
ATOM   1750 N  N   . MET B 1 24  ? -15.708 -14.994 11.025  1.00 16.85 ? 23  MET C N   1 
ATOM   1751 C  CA  . MET B 1 24  ? -15.086 -14.860 12.347  1.00 16.79 ? 23  MET C CA  1 
ATOM   1752 C  C   . MET B 1 24  ? -14.070 -15.960 12.612  1.00 17.07 ? 23  MET C C   1 
ATOM   1753 O  O   . MET B 1 24  ? -13.018 -15.685 13.153  1.00 15.85 ? 23  MET C O   1 
ATOM   1754 C  CB  . MET B 1 24  ? -16.131 -14.859 13.480  1.00 17.51 ? 23  MET C CB  1 
ATOM   1755 C  CG  . MET B 1 24  ? -17.040 -13.627 13.520  1.00 18.22 ? 23  MET C CG  1 
ATOM   1756 S  SD  . MET B 1 24  ? -16.151 -12.041 13.376  1.00 20.05 ? 23  MET C SD  1 
ATOM   1757 C  CE  . MET B 1 24  ? -15.078 -12.074 14.784  1.00 19.32 ? 23  MET C CE  1 
ATOM   1758 N  N   . GLN B 1 25  ? -14.397 -17.198 12.236  1.00 17.13 ? 24  GLN C N   1 
ATOM   1759 C  CA  . GLN B 1 25  ? -13.488 -18.314 12.503  1.00 17.25 ? 24  GLN C CA  1 
ATOM   1760 C  C   . GLN B 1 25  ? -12.211 -18.201 11.683  1.00 17.00 ? 24  GLN C C   1 
ATOM   1761 O  O   . GLN B 1 25  ? -11.115 -18.335 12.225  1.00 17.38 ? 24  GLN C O   1 
ATOM   1762 C  CB  . GLN B 1 25  ? -14.134 -19.669 12.255  1.00 18.01 ? 24  GLN C CB  1 
ATOM   1763 C  CG  . GLN B 1 25  ? -13.208 -20.774 12.730  1.00 20.49 ? 24  GLN C CG  1 
ATOM   1764 C  CD  . GLN B 1 25  ? -13.896 -22.114 12.924  1.00 26.17 ? 24  GLN C CD  1 
ATOM   1765 O  OE1 . GLN B 1 25  ? -15.004 -22.351 12.419  1.00 30.22 ? 24  GLN C OE1 1 
ATOM   1766 N  NE2 . GLN B 1 25  ? -13.247 -22.999 13.673  1.00 30.18 ? 24  GLN C NE2 1 
ATOM   1767 N  N   . LEU B 1 26  ? -12.344 -17.924 10.383  1.00 16.84 ? 25  LEU C N   1 
ATOM   1768 C  CA  . LEU B 1 26  ? -11.129 -17.759 9.538   1.00 16.71 ? 25  LEU C CA  1 
ATOM   1769 C  C   . LEU B 1 26  ? -10.316 -16.554 9.973   1.00 16.50 ? 25  LEU C C   1 
ATOM   1770 O  O   . LEU B 1 26  ? -9.086  -16.605 10.109  1.00 16.56 ? 25  LEU C O   1 
ATOM   1771 C  CB  . LEU B 1 26  ? -11.513 -17.606 8.068   1.00 16.54 ? 25  LEU C CB  1 
ATOM   1772 C  CG  . LEU B 1 26  ? -12.010 -18.859 7.358   1.00 17.83 ? 25  LEU C CG  1 
ATOM   1773 C  CD1 . LEU B 1 26  ? -12.897 -18.472 6.182   1.00 19.56 ? 25  LEU C CD1 1 
ATOM   1774 C  CD2 . LEU B 1 26  ? -10.857 -19.758 6.940   1.00 18.79 ? 25  LEU C CD2 1 
ATOM   1775 N  N   . HIS B 1 27  ? -11.023 -15.480 10.249  1.00 16.25 ? 26  HIS C N   1 
ATOM   1776 C  CA  . HIS B 1 27  ? -10.387 -14.215 10.572  1.00 15.66 ? 26  HIS C CA  1 
ATOM   1777 C  C   . HIS B 1 27  ? -9.506  -14.319 11.827  1.00 15.61 ? 26  HIS C C   1 
ATOM   1778 O  O   . HIS B 1 27  ? -8.388  -13.817 11.870  1.00 14.79 ? 26  HIS C O   1 
ATOM   1779 C  CB  . HIS B 1 27  ? -11.458 -13.132 10.695  1.00 14.70 ? 26  HIS C CB  1 
ATOM   1780 C  CG  . HIS B 1 27  ? -10.953 -11.744 10.423  1.00 15.41 ? 26  HIS C CG  1 
ATOM   1781 N  ND1 . HIS B 1 27  ? -11.739 -10.629 10.598  1.00 16.75 ? 26  HIS C ND1 1 
ATOM   1782 C  CD2 . HIS B 1 27  ? -9.731  -11.289 10.037  1.00 15.94 ? 26  HIS C CD2 1 
ATOM   1783 C  CE1 . HIS B 1 27  ? -11.047 -9.550  10.283  1.00 16.65 ? 26  HIS C CE1 1 
ATOM   1784 N  NE2 . HIS B 1 27  ? -9.832  -9.925  9.932   1.00 12.69 ? 26  HIS C NE2 1 
ATOM   1785 N  N   . HIS B 1 28  ? -10.002 -15.010 12.841  1.00 15.55 ? 27  HIS C N   1 
ATOM   1786 C  CA  . HIS B 1 28  ? -9.278  -15.160 14.090  1.00 16.37 ? 27  HIS C CA  1 
ATOM   1787 C  C   . HIS B 1 28  ? -8.263  -16.316 14.043  1.00 16.29 ? 27  HIS C C   1 
ATOM   1788 O  O   . HIS B 1 28  ? -7.061  -16.137 14.313  1.00 16.01 ? 27  HIS C O   1 
ATOM   1789 C  CB  . HIS B 1 28  ? -10.292 -15.325 15.234  1.00 16.27 ? 27  HIS C CB  1 
ATOM   1790 C  CG  . HIS B 1 28  ? -9.693  -15.705 16.550  1.00 16.95 ? 27  HIS C CG  1 
ATOM   1791 N  ND1 . HIS B 1 28  ? -9.069  -14.804 17.386  1.00 18.80 ? 27  HIS C ND1 1 
ATOM   1792 C  CD2 . HIS B 1 28  ? -9.671  -16.890 17.199  1.00 15.63 ? 27  HIS C CD2 1 
ATOM   1793 C  CE1 . HIS B 1 28  ? -8.675  -15.420 18.483  1.00 15.61 ? 27  HIS C CE1 1 
ATOM   1794 N  NE2 . HIS B 1 28  ? -9.026  -16.689 18.394  1.00 20.58 ? 27  HIS C NE2 1 
ATOM   1795 N  N   . GLN B 1 29  ? -8.738  -17.491 13.639  1.00 17.33 ? 28  GLN C N   1 
ATOM   1796 C  CA  . GLN B 1 29  ? -7.936  -18.694 13.708  1.00 17.79 ? 28  GLN C CA  1 
ATOM   1797 C  C   . GLN B 1 29  ? -6.895  -18.825 12.626  1.00 17.73 ? 28  GLN C C   1 
ATOM   1798 O  O   . GLN B 1 29  ? -5.888  -19.514 12.837  1.00 18.10 ? 28  GLN C O   1 
ATOM   1799 C  CB  . GLN B 1 29  ? -8.830  -19.936 13.699  1.00 17.51 ? 28  GLN C CB  1 
ATOM   1800 C  CG  . GLN B 1 29  ? -9.634  -20.131 14.942  1.00 21.34 ? 28  GLN C CG  1 
ATOM   1801 C  CD  . GLN B 1 29  ? -10.157 -21.548 14.986  1.00 25.38 ? 28  GLN C CD  1 
ATOM   1802 O  OE1 . GLN B 1 29  ? -10.411 -22.105 16.061  1.00 30.70 ? 28  GLN C OE1 1 
ATOM   1803 N  NE2 . GLN B 1 29  ? -10.280 -22.161 13.803  1.00 25.17 ? 28  GLN C NE2 1 
ATOM   1804 N  N   . LYS B 1 30  ? -7.122  -18.166 11.484  1.00 17.80 ? 29  LYS C N   1 
ATOM   1805 C  CA  . LYS B 1 30  ? -6.145  -18.201 10.364  1.00 17.51 ? 29  LYS C CA  1 
ATOM   1806 C  C   . LYS B 1 30  ? -5.420  -16.881 10.141  1.00 17.12 ? 29  LYS C C   1 
ATOM   1807 O  O   . LYS B 1 30  ? -4.201  -16.844 10.160  1.00 15.01 ? 29  LYS C O   1 
ATOM   1808 C  CB  . LYS B 1 30  ? -6.810  -18.648 9.063   1.00 17.87 ? 29  LYS C CB  1 
ATOM   1809 C  CG  . LYS B 1 30  ? -7.474  -20.010 9.127   1.00 18.17 ? 29  LYS C CG  1 
ATOM   1810 C  CD  . LYS B 1 30  ? -6.530  -21.152 9.446   1.00 20.17 ? 29  LYS C CD  1 
ATOM   1811 C  CE  . LYS B 1 30  ? -7.299  -22.493 9.413   1.00 19.91 ? 29  LYS C CE  1 
ATOM   1812 N  NZ  . LYS B 1 30  ? -6.322  -23.621 9.460   1.00 23.63 ? 29  LYS C NZ  1 
ATOM   1813 N  N   . HIS B 1 31  ? -6.143  -15.789 9.971   1.00 16.12 ? 30  HIS C N   1 
ATOM   1814 C  CA  . HIS B 1 31  ? -5.484  -14.534 9.638   1.00 16.95 ? 30  HIS C CA  1 
ATOM   1815 C  C   . HIS B 1 31  ? -4.750  -13.959 10.850  1.00 15.95 ? 30  HIS C C   1 
ATOM   1816 O  O   . HIS B 1 31  ? -3.562  -13.695 10.760  1.00 16.10 ? 30  HIS C O   1 
ATOM   1817 C  CB  . HIS B 1 31  ? -6.486  -13.526 9.053   1.00 16.50 ? 30  HIS C CB  1 
ATOM   1818 C  CG  . HIS B 1 31  ? -7.033  -13.946 7.725   1.00 18.82 ? 30  HIS C CG  1 
ATOM   1819 N  ND1 . HIS B 1 31  ? -6.420  -13.632 6.524   1.00 17.61 ? 30  HIS C ND1 1 
ATOM   1820 C  CD2 . HIS B 1 31  ? -8.161  -14.632 7.409   1.00 17.76 ? 30  HIS C CD2 1 
ATOM   1821 C  CE1 . HIS B 1 31  ? -7.152  -14.118 5.530   1.00 17.97 ? 30  HIS C CE1 1 
ATOM   1822 N  NE2 . HIS B 1 31  ? -8.207  -14.732 6.042   1.00 15.53 ? 30  HIS C NE2 1 
ATOM   1823 N  N   . HIS B 1 32  ? -5.426  -13.794 11.982  1.00 15.97 ? 31  HIS C N   1 
ATOM   1824 C  CA  . HIS B 1 32  ? -4.746  -13.208 13.151  1.00 15.61 ? 31  HIS C CA  1 
ATOM   1825 C  C   . HIS B 1 32  ? -3.641  -14.173 13.641  1.00 15.52 ? 31  HIS C C   1 
ATOM   1826 O  O   . HIS B 1 32  ? -2.499  -13.740 13.869  1.00 14.96 ? 31  HIS C O   1 
ATOM   1827 C  CB  . HIS B 1 32  ? -5.780  -12.890 14.234  1.00 16.23 ? 31  HIS C CB  1 
ATOM   1828 C  CG  . HIS B 1 32  ? -5.276  -12.064 15.386  1.00 15.26 ? 31  HIS C CG  1 
ATOM   1829 N  ND1 . HIS B 1 32  ? -3.951  -11.692 15.565  1.00 17.60 ? 31  HIS C ND1 1 
ATOM   1830 C  CD2 . HIS B 1 32  ? -5.940  -11.604 16.470  1.00 13.36 ? 31  HIS C CD2 1 
ATOM   1831 C  CE1 . HIS B 1 32  ? -3.853  -10.977 16.674  1.00 14.36 ? 31  HIS C CE1 1 
ATOM   1832 N  NE2 . HIS B 1 32  ? -5.038  -10.949 17.259  1.00 17.36 ? 31  HIS C NE2 1 
ATOM   1833 N  N   . ALA B 1 33  ? -3.957  -15.469 13.730  1.00 15.83 ? 32  ALA C N   1 
ATOM   1834 C  CA  . ALA B 1 33  ? -2.970  -16.472 14.148  1.00 14.98 ? 32  ALA C CA  1 
ATOM   1835 C  C   . ALA B 1 33  ? -1.679  -16.368 13.307  1.00 15.23 ? 32  ALA C C   1 
ATOM   1836 O  O   . ALA B 1 33  ? -0.562  -16.418 13.846  1.00 15.32 ? 32  ALA C O   1 
ATOM   1837 C  CB  . ALA B 1 33  ? -3.573  -17.875 14.032  1.00 14.78 ? 32  ALA C CB  1 
ATOM   1838 N  N   . THR B 1 34  ? -1.845  -16.190 11.994  1.00 14.37 ? 33  THR C N   1 
ATOM   1839 C  CA  . THR B 1 34  ? -0.712  -16.063 11.080  1.00 15.87 ? 33  THR C CA  1 
ATOM   1840 C  C   . THR B 1 34  ? 0.144   -14.836 11.414  1.00 14.70 ? 33  THR C C   1 
ATOM   1841 O  O   . THR B 1 34  ? 1.390   -14.927 11.431  1.00 15.33 ? 33  THR C O   1 
ATOM   1842 C  CB  . THR B 1 34  ? -1.145  -16.136 9.595   1.00 16.17 ? 33  THR C CB  1 
ATOM   1843 O  OG1 . THR B 1 34  ? -1.615  -17.464 9.314   1.00 15.67 ? 33  THR C OG1 1 
ATOM   1844 C  CG2 . THR B 1 34  ? 0.046   -15.826 8.663   1.00 18.12 ? 33  THR C CG2 1 
ATOM   1845 N  N   . TYR B 1 35  ? -0.500  -13.683 11.662  1.00 15.38 ? 34  TYR C N   1 
ATOM   1846 C  CA  . TYR B 1 35  ? 0.228   -12.500 12.077  1.00 14.46 ? 34  TYR C CA  1 
ATOM   1847 C  C   . TYR B 1 35  ? 1.013   -12.784 13.343  1.00 14.80 ? 34  TYR C C   1 
ATOM   1848 O  O   . TYR B 1 35  ? 2.202   -12.437 13.411  1.00 13.84 ? 34  TYR C O   1 
ATOM   1849 C  CB  . TYR B 1 35  ? -0.653  -11.262 12.276  1.00 15.13 ? 34  TYR C CB  1 
ATOM   1850 C  CG  . TYR B 1 35  ? -1.277  -10.778 10.988  1.00 15.51 ? 34  TYR C CG  1 
ATOM   1851 C  CD1 . TYR B 1 35  ? -0.487  -10.518 9.858   1.00 14.14 ? 34  TYR C CD1 1 
ATOM   1852 C  CD2 . TYR B 1 35  ? -2.647  -10.550 10.909  1.00 18.19 ? 34  TYR C CD2 1 
ATOM   1853 C  CE1 . TYR B 1 35  ? -1.061  -10.057 8.660   1.00 16.53 ? 34  TYR C CE1 1 
ATOM   1854 C  CE2 . TYR B 1 35  ? -3.237  -10.084 9.721   1.00 18.23 ? 34  TYR C CE2 1 
ATOM   1855 C  CZ  . TYR B 1 35  ? -2.437  -9.835  8.621   1.00 16.50 ? 34  TYR C CZ  1 
ATOM   1856 O  OH  . TYR B 1 35  ? -3.015  -9.399  7.448   1.00 18.36 ? 34  TYR C OH  1 
ATOM   1857 N  N   . VAL B 1 36  ? 0.366   -13.417 14.323  1.00 14.52 ? 35  VAL C N   1 
ATOM   1858 C  CA  . VAL B 1 36  ? 1.043   -13.731 15.591  1.00 14.62 ? 35  VAL C CA  1 
ATOM   1859 C  C   . VAL B 1 36  ? 2.241   -14.637 15.375  1.00 14.89 ? 35  VAL C C   1 
ATOM   1860 O  O   . VAL B 1 36  ? 3.335   -14.370 15.897  1.00 14.89 ? 35  VAL C O   1 
ATOM   1861 C  CB  . VAL B 1 36  ? 0.068   -14.350 16.656  1.00 14.89 ? 35  VAL C CB  1 
ATOM   1862 C  CG1 . VAL B 1 36  ? 0.844   -14.852 17.897  1.00 14.43 ? 35  VAL C CG1 1 
ATOM   1863 C  CG2 . VAL B 1 36  ? -0.955  -13.342 17.088  1.00 15.60 ? 35  VAL C CG2 1 
ATOM   1864 N  N   . ASN B 1 37  ? 2.066   -15.684 14.571  1.00 14.77 ? 36  ASN C N   1 
ATOM   1865 C  CA  . ASN B 1 37  ? 3.142   -16.663 14.381  1.00 16.42 ? 36  ASN C CA  1 
ATOM   1866 C  C   . ASN B 1 37  ? 4.317   -16.031 13.666  1.00 15.91 ? 36  ASN C C   1 
ATOM   1867 O  O   . ASN B 1 37  ? 5.487   -16.206 14.056  1.00 16.25 ? 36  ASN C O   1 
ATOM   1868 C  CB  . ASN B 1 37  ? 2.644   -17.856 13.574  1.00 16.33 ? 36  ASN C CB  1 
ATOM   1869 C  CG  . ASN B 1 37  ? 1.550   -18.640 14.294  1.00 19.35 ? 36  ASN C CG  1 
ATOM   1870 O  OD1 . ASN B 1 37  ? 1.411   -18.575 15.530  1.00 21.36 ? 36  ASN C OD1 1 
ATOM   1871 N  ND2 . ASN B 1 37  ? 0.779   -19.421 13.521  1.00 22.61 ? 36  ASN C ND2 1 
ATOM   1872 N  N   . ASN B 1 38  ? 3.987   -15.287 12.613  1.00 15.89 ? 37  ASN C N   1 
ATOM   1873 C  CA  . ASN B 1 38  ? 5.000   -14.572 11.860  1.00 16.49 ? 37  ASN C CA  1 
ATOM   1874 C  C   . ASN B 1 38  ? 5.669   -13.495 12.718  1.00 16.49 ? 37  ASN C C   1 
ATOM   1875 O  O   . ASN B 1 38  ? 6.883   -13.308 12.635  1.00 17.52 ? 37  ASN C O   1 
ATOM   1876 C  CB  . ASN B 1 38  ? 4.428   -14.003 10.571  1.00 16.81 ? 37  ASN C CB  1 
ATOM   1877 C  CG  . ASN B 1 38  ? 4.108   -15.083 9.532   1.00 19.12 ? 37  ASN C CG  1 
ATOM   1878 O  OD1 . ASN B 1 38  ? 3.394   -14.810 8.549   1.00 22.99 ? 37  ASN C OD1 1 
ATOM   1879 N  ND2 . ASN B 1 38  ? 4.654   -16.278 9.715   1.00 22.28 ? 37  ASN C ND2 1 
ATOM   1880 N  N   . LEU B 1 39  ? 4.892   -12.822 13.566  1.00 15.73 ? 38  LEU C N   1 
ATOM   1881 C  CA  . LEU B 1 39  ? 5.447   -11.737 14.408  1.00 15.46 ? 38  LEU C CA  1 
ATOM   1882 C  C   . LEU B 1 39  ? 6.551   -12.313 15.321  1.00 15.15 ? 38  LEU C C   1 
ATOM   1883 O  O   . LEU B 1 39  ? 7.638   -11.704 15.486  1.00 15.28 ? 38  LEU C O   1 
ATOM   1884 C  CB  . LEU B 1 39  ? 4.346   -11.147 15.297  1.00 15.23 ? 38  LEU C CB  1 
ATOM   1885 C  CG  . LEU B 1 39  ? 4.759   -10.125 16.356  1.00 15.08 ? 38  LEU C CG  1 
ATOM   1886 C  CD1 . LEU B 1 39  ? 5.603   -8.937  15.763  1.00 16.79 ? 38  LEU C CD1 1 
ATOM   1887 C  CD2 . LEU B 1 39  ? 3.547   -9.636  17.110  1.00 16.17 ? 38  LEU C CD2 1 
ATOM   1888 N  N   . ASN B 1 40  ? 6.264   -13.461 15.924  1.00 15.40 ? 39  ASN C N   1 
ATOM   1889 C  CA  . ASN B 1 40  ? 7.251   -14.082 16.842  1.00 14.60 ? 39  ASN C CA  1 
ATOM   1890 C  C   . ASN B 1 40  ? 8.550   -14.401 16.117  1.00 15.96 ? 39  ASN C C   1 
ATOM   1891 O  O   . ASN B 1 40  ? 9.640   -14.106 16.633  1.00 14.58 ? 39  ASN C O   1 
ATOM   1892 C  CB  . ASN B 1 40  ? 6.674   -15.326 17.531  1.00 15.25 ? 39  ASN C CB  1 
ATOM   1893 C  CG  . ASN B 1 40  ? 5.649   -14.964 18.602  1.00 15.96 ? 39  ASN C CG  1 
ATOM   1894 O  OD1 . ASN B 1 40  ? 5.881   -14.047 19.403  1.00 16.14 ? 39  ASN C OD1 1 
ATOM   1895 N  ND2 . ASN B 1 40  ? 4.518   -15.674 18.626  1.00 14.84 ? 39  ASN C ND2 1 
ATOM   1896 N  N   . GLN B 1 41  ? 8.434   -14.964 14.915  1.00 15.43 ? 40  GLN C N   1 
ATOM   1897 C  CA  . GLN B 1 41  ? 9.619   -15.250 14.096  1.00 17.07 ? 40  GLN C CA  1 
ATOM   1898 C  C   . GLN B 1 41  ? 10.413  -13.992 13.727  1.00 16.88 ? 40  GLN C C   1 
ATOM   1899 O  O   . GLN B 1 41  ? 11.647  -13.941 13.866  1.00 14.53 ? 40  GLN C O   1 
ATOM   1900 C  CB  . GLN B 1 41  ? 9.217   -16.032 12.851  1.00 17.93 ? 40  GLN C CB  1 
ATOM   1901 C  CG  . GLN B 1 41  ? 8.602   -17.397 13.194  1.00 24.80 ? 40  GLN C CG  1 
ATOM   1902 C  CD  . GLN B 1 41  ? 8.742   -18.414 12.071  1.00 32.98 ? 40  GLN C CD  1 
ATOM   1903 O  OE1 . GLN B 1 41  ? 9.714   -18.375 11.303  1.00 37.92 ? 40  GLN C OE1 1 
ATOM   1904 N  NE2 . GLN B 1 41  ? 7.786   -19.351 11.984  1.00 34.03 ? 40  GLN C NE2 1 
ATOM   1905 N  N   . ILE B 1 42  ? 9.706   -12.966 13.299  1.00 16.78 ? 41  ILE C N   1 
ATOM   1906 C  CA  . ILE B 1 42  ? 10.336  -11.721 12.906  1.00 16.89 ? 41  ILE C CA  1 
ATOM   1907 C  C   . ILE B 1 42  ? 11.013  -11.026 14.094  1.00 15.81 ? 41  ILE C C   1 
ATOM   1908 O  O   . ILE B 1 42  ? 12.167  -10.577 13.986  1.00 14.65 ? 41  ILE C O   1 
ATOM   1909 C  CB  . ILE B 1 42  ? 9.332   -10.833 12.166  1.00 17.73 ? 41  ILE C CB  1 
ATOM   1910 C  CG1 . ILE B 1 42  ? 8.934   -11.547 10.859  1.00 17.90 ? 41  ILE C CG1 1 
ATOM   1911 C  CG2 . ILE B 1 42  ? 9.950   -9.453  11.920  1.00 18.53 ? 41  ILE C CG2 1 
ATOM   1912 C  CD1 . ILE B 1 42  ? 7.641   -11.053 10.233  1.00 23.51 ? 41  ILE C CD1 1 
ATOM   1913 N  N   . GLU B 1 43  ? 10.336  -11.003 15.245  1.00 15.71 ? 42  GLU C N   1 
ATOM   1914 C  CA  . GLU B 1 43  ? 10.949  -10.397 16.438  1.00 15.57 ? 42  GLU C CA  1 
ATOM   1915 C  C   . GLU B 1 43  ? 12.237  -11.107 16.805  1.00 14.61 ? 42  GLU C C   1 
ATOM   1916 O  O   . GLU B 1 43  ? 13.210  -10.474 17.200  1.00 13.23 ? 42  GLU C O   1 
ATOM   1917 C  CB  . GLU B 1 43  ? 10.035  -10.487 17.647  1.00 16.58 ? 42  GLU C CB  1 
ATOM   1918 C  CG  . GLU B 1 43  ? 8.937   -9.472  17.651  1.00 20.16 ? 42  GLU C CG  1 
ATOM   1919 C  CD  . GLU B 1 43  ? 8.251   -9.446  18.993  1.00 24.13 ? 42  GLU C CD  1 
ATOM   1920 O  OE1 . GLU B 1 43  ? 7.659   -8.399  19.316  1.00 23.56 ? 42  GLU C OE1 1 
ATOM   1921 O  OE2 . GLU B 1 43  ? 8.321   -10.475 19.711  1.00 21.66 ? 42  GLU C OE2 1 
ATOM   1922 N  N   . GLU B 1 44  ? 12.236  -12.435 16.705  1.00 14.23 ? 43  GLU C N   1 
ATOM   1923 C  CA  . GLU B 1 44  ? 13.456  -13.207 17.005  1.00 14.91 ? 43  GLU C CA  1 
ATOM   1924 C  C   . GLU B 1 44  ? 14.591  -12.812 16.048  1.00 13.60 ? 43  GLU C C   1 
ATOM   1925 O  O   . GLU B 1 44  ? 15.746  -12.622 16.457  1.00 13.33 ? 43  GLU C O   1 
ATOM   1926 C  CB  . GLU B 1 44  ? 13.163  -14.695 16.823  1.00 13.87 ? 43  GLU C CB  1 
ATOM   1927 C  CG  . GLU B 1 44  ? 12.187  -15.283 17.811  1.00 18.74 ? 43  GLU C CG  1 
ATOM   1928 C  CD  . GLU B 1 44  ? 11.757  -16.732 17.464  1.00 20.98 ? 43  GLU C CD  1 
ATOM   1929 O  OE1 . GLU B 1 44  ? 12.426  -17.415 16.631  1.00 26.84 ? 43  GLU C OE1 1 
ATOM   1930 O  OE2 . GLU B 1 44  ? 10.731  -17.190 18.035  1.00 26.31 ? 43  GLU C OE2 1 
ATOM   1931 N  N   . LYS B 1 45  ? 14.267  -12.662 14.770  1.00 13.76 ? 44  LYS C N   1 
ATOM   1932 C  CA  . LYS B 1 45  ? 15.279  -12.323 13.771  1.00 14.27 ? 44  LYS C CA  1 
ATOM   1933 C  C   . LYS B 1 45  ? 15.786  -10.909 13.995  1.00 13.90 ? 44  LYS C C   1 
ATOM   1934 O  O   . LYS B 1 45  ? 16.978  -10.609 13.847  1.00 13.42 ? 44  LYS C O   1 
ATOM   1935 C  CB  . LYS B 1 45  ? 14.721  -12.489 12.371  1.00 15.20 ? 44  LYS C CB  1 
ATOM   1936 C  CG  . LYS B 1 45  ? 14.583  -13.956 11.981  1.00 16.87 ? 44  LYS C CG  1 
ATOM   1937 C  CD  . LYS B 1 45  ? 13.926  -14.093 10.626  1.00 24.89 ? 44  LYS C CD  1 
ATOM   1938 C  CE  . LYS B 1 45  ? 14.164  -15.497 10.073  1.00 30.30 ? 44  LYS C CE  1 
ATOM   1939 N  NZ  . LYS B 1 45  ? 13.116  -15.807 9.043   1.00 34.44 ? 44  LYS C NZ  1 
ATOM   1940 N  N   . LEU B 1 46  ? 14.863  -10.036 14.364  1.00 14.29 ? 45  LEU C N   1 
ATOM   1941 C  CA  . LEU B 1 46  ? 15.190  -8.638  14.605  1.00 14.66 ? 45  LEU C CA  1 
ATOM   1942 C  C   . LEU B 1 46  ? 16.068  -8.549  15.858  1.00 13.51 ? 45  LEU C C   1 
ATOM   1943 O  O   . LEU B 1 46  ? 17.080  -7.837  15.850  1.00 13.23 ? 45  LEU C O   1 
ATOM   1944 C  CB  . LEU B 1 46  ? 13.910  -7.809  14.758  1.00 15.05 ? 45  LEU C CB  1 
ATOM   1945 C  CG  . LEU B 1 46  ? 14.097  -6.307  14.922  1.00 16.05 ? 45  LEU C CG  1 
ATOM   1946 C  CD1 . LEU B 1 46  ? 15.013  -5.684  13.822  1.00 16.41 ? 45  LEU C CD1 1 
ATOM   1947 C  CD2 . LEU B 1 46  ? 12.703  -5.618  14.968  1.00 17.55 ? 45  LEU C CD2 1 
ATOM   1948 N  N   . HIS B 1 47  ? 15.701  -9.287  16.911  1.00 13.13 ? 46  HIS C N   1 
ATOM   1949 C  CA  . HIS B 1 47  ? 16.508  -9.254  18.124  1.00 12.17 ? 46  HIS C CA  1 
ATOM   1950 C  C   . HIS B 1 47  ? 17.933  -9.730  17.816  1.00 12.29 ? 46  HIS C C   1 
ATOM   1951 O  O   . HIS B 1 47  ? 18.914  -9.171  18.327  1.00 12.88 ? 46  HIS C O   1 
ATOM   1952 C  CB  . HIS B 1 47  ? 15.875  -10.096 19.238  1.00 11.88 ? 46  HIS C CB  1 
ATOM   1953 C  CG  . HIS B 1 47  ? 16.497  -9.867  20.575  1.00 13.11 ? 46  HIS C CG  1 
ATOM   1954 N  ND1 . HIS B 1 47  ? 17.558  -10.613 21.043  1.00 13.96 ? 46  HIS C ND1 1 
ATOM   1955 C  CD2 . HIS B 1 47  ? 16.213  -8.968  21.549  1.00 11.87 ? 46  HIS C CD2 1 
ATOM   1956 C  CE1 . HIS B 1 47  ? 17.898  -10.188 22.250  1.00 13.37 ? 46  HIS C CE1 1 
ATOM   1957 N  NE2 . HIS B 1 47  ? 17.086  -9.198  22.583  1.00 12.73 ? 46  HIS C NE2 1 
ATOM   1958 N  N   . GLU B 1 48  ? 18.038  -10.775 16.991  1.00 12.70 ? 47  GLU C N   1 
ATOM   1959 C  CA  . GLU B 1 48  ? 19.338  -11.294 16.576  1.00 13.04 ? 47  GLU C CA  1 
ATOM   1960 C  C   . GLU B 1 48  ? 20.167  -10.228 15.821  1.00 12.39 ? 47  GLU C C   1 
ATOM   1961 O  O   . GLU B 1 48  ? 21.348  -10.054 16.105  1.00 12.75 ? 47  GLU C O   1 
ATOM   1962 C  CB  . GLU B 1 48  ? 19.160  -12.547 15.707  1.00 14.19 ? 47  GLU C CB  1 
ATOM   1963 C  CG  . GLU B 1 48  ? 20.493  -13.059 15.143  1.00 14.33 ? 47  GLU C CG  1 
ATOM   1964 C  CD  . GLU B 1 48  ? 20.411  -14.419 14.443  1.00 18.01 ? 47  GLU C CD  1 
ATOM   1965 O  OE1 . GLU B 1 48  ? 19.779  -15.354 14.959  1.00 20.48 ? 47  GLU C OE1 1 
ATOM   1966 O  OE2 . GLU B 1 48  ? 21.095  -14.587 13.408  1.00 25.81 ? 47  GLU C OE2 1 
ATOM   1967 N  N   . ALA B 1 49  ? 19.549  -9.563  14.848  1.00 11.69 ? 48  ALA C N   1 
ATOM   1968 C  CA  . ALA B 1 49  ? 20.254  -8.558  14.034  1.00 11.84 ? 48  ALA C CA  1 
ATOM   1969 C  C   . ALA B 1 49  ? 20.726  -7.410  14.918  1.00 12.25 ? 48  ALA C C   1 
ATOM   1970 O  O   . ALA B 1 49  ? 21.841  -6.928  14.781  1.00 13.62 ? 48  ALA C O   1 
ATOM   1971 C  CB  . ALA B 1 49  ? 19.384  -8.013  12.923  1.00 11.85 ? 48  ALA C CB  1 
ATOM   1972 N  N   . VAL B 1 50  ? 19.883  -7.003  15.845  1.00 12.21 ? 49  VAL C N   1 
ATOM   1973 C  CA  . VAL B 1 50  ? 20.260  -5.916  16.752  1.00 13.26 ? 49  VAL C CA  1 
ATOM   1974 C  C   . VAL B 1 50  ? 21.425  -6.344  17.648  1.00 13.60 ? 49  VAL C C   1 
ATOM   1975 O  O   . VAL B 1 50  ? 22.421  -5.641  17.769  1.00 13.65 ? 49  VAL C O   1 
ATOM   1976 C  CB  . VAL B 1 50  ? 19.035  -5.403  17.542  1.00 13.03 ? 49  VAL C CB  1 
ATOM   1977 C  CG1 . VAL B 1 50  ? 19.441  -4.386  18.626  1.00 16.31 ? 49  VAL C CG1 1 
ATOM   1978 C  CG2 . VAL B 1 50  ? 17.998  -4.826  16.562  1.00 13.39 ? 49  VAL C CG2 1 
ATOM   1979 N  N   . SER B 1 51  ? 21.323  -7.542  18.223  1.00 12.52 ? 50  SER C N   1 
ATOM   1980 C  CA  . SER B 1 51  ? 22.368  -8.063  19.079  1.00 13.09 ? 50  SER C CA  1 
ATOM   1981 C  C   . SER B 1 51  ? 23.730  -8.182  18.352  1.00 13.76 ? 50  SER C C   1 
ATOM   1982 O  O   . SER B 1 51  ? 24.772  -7.878  18.939  1.00 14.78 ? 50  SER C O   1 
ATOM   1983 C  CB  . SER B 1 51  ? 21.944  -9.397  19.681  1.00 12.42 ? 50  SER C CB  1 
ATOM   1984 O  OG  . SER B 1 51  ? 20.737  -9.238  20.433  1.00 12.63 ? 50  SER C OG  1 
ATOM   1985 N  N   . LYS B 1 52  ? 23.698  -8.612  17.089  1.00 14.00 ? 51  LYS C N   1 
ATOM   1986 C  CA  . LYS B 1 52  ? 24.914  -8.845  16.302  1.00 15.59 ? 51  LYS C CA  1 
ATOM   1987 C  C   . LYS B 1 52  ? 25.465  -7.551  15.724  1.00 15.63 ? 51  LYS C C   1 
ATOM   1988 O  O   . LYS B 1 52  ? 26.583  -7.538  15.187  1.00 15.13 ? 51  LYS C O   1 
ATOM   1989 C  CB  . LYS B 1 52  ? 24.657  -9.823  15.149  1.00 14.88 ? 51  LYS C CB  1 
ATOM   1990 C  CG  . LYS B 1 52  ? 24.356  -11.262 15.520  1.00 16.54 ? 51  LYS C CG  1 
ATOM   1991 C  CD  . LYS B 1 52  ? 24.209  -12.076 14.234  1.00 18.30 ? 51  LYS C CD  1 
ATOM   1992 C  CE  . LYS B 1 52  ? 24.155  -13.572 14.498  1.00 21.42 ? 51  LYS C CE  1 
ATOM   1993 N  NZ  . LYS B 1 52  ? 24.129  -14.341 13.218  1.00 23.68 ? 51  LYS C NZ  1 
ATOM   1994 N  N   . GLY B 1 53  ? 24.682  -6.482  15.821  1.00 15.64 ? 52  GLY C N   1 
ATOM   1995 C  CA  . GLY B 1 53  ? 25.054  -5.179  15.218  1.00 17.17 ? 52  GLY C CA  1 
ATOM   1996 C  C   . GLY B 1 53  ? 24.936  -5.158  13.701  1.00 17.48 ? 52  GLY C C   1 
ATOM   1997 O  O   . GLY B 1 53  ? 25.656  -4.383  13.013  1.00 17.09 ? 52  GLY C O   1 
ATOM   1998 N  N   . ASN B 1 54  ? 24.014  -5.973  13.182  1.00 16.35 ? 53  ASN C N   1 
ATOM   1999 C  CA  . ASN B 1 54  ? 23.759  -6.060  11.748  1.00 15.74 ? 53  ASN C CA  1 
ATOM   2000 C  C   . ASN B 1 54  ? 22.692  -5.044  11.408  1.00 15.15 ? 53  ASN C C   1 
ATOM   2001 O  O   . ASN B 1 54  ? 21.514  -5.370  11.323  1.00 12.62 ? 53  ASN C O   1 
ATOM   2002 C  CB  . ASN B 1 54  ? 23.363  -7.481  11.314  1.00 16.40 ? 53  ASN C CB  1 
ATOM   2003 C  CG  . ASN B 1 54  ? 24.522  -8.505  11.440  1.00 18.52 ? 53  ASN C CG  1 
ATOM   2004 O  OD1 . ASN B 1 54  ? 25.708  -8.147  11.485  1.00 24.00 ? 53  ASN C OD1 1 
ATOM   2005 N  ND2 . ASN B 1 54  ? 24.165  -9.791  11.484  1.00 20.55 ? 53  ASN C ND2 1 
ATOM   2006 N  N   . LEU B 1 55  ? 23.137  -3.798  11.233  1.00 14.55 ? 54  LEU C N   1 
ATOM   2007 C  CA  . LEU B 1 55  ? 22.208  -2.688  11.005  1.00 15.17 ? 54  LEU C CA  1 
ATOM   2008 C  C   . LEU B 1 55  ? 21.394  -2.893  9.735   1.00 14.46 ? 54  LEU C C   1 
ATOM   2009 O  O   . LEU B 1 55  ? 20.157  -2.747  9.736   1.00 13.68 ? 54  LEU C O   1 
ATOM   2010 C  CB  . LEU B 1 55  ? 23.002  -1.387  10.960  1.00 15.64 ? 54  LEU C CB  1 
ATOM   2011 C  CG  . LEU B 1 55  ? 22.318  -0.059  11.182  1.00 19.70 ? 54  LEU C CG  1 
ATOM   2012 C  CD1 . LEU B 1 55  ? 21.474  -0.034  12.458  1.00 23.59 ? 54  LEU C CD1 1 
ATOM   2013 C  CD2 . LEU B 1 55  ? 23.419  1.001   11.171  1.00 20.48 ? 54  LEU C CD2 1 
ATOM   2014 N  N   . LYS B 1 56  ? 22.063  -3.238  8.637   1.00 15.24 ? 55  LYS C N   1 
ATOM   2015 C  CA  . LYS B 1 56  ? 21.336  -3.446  7.381   1.00 16.93 ? 55  LYS C CA  1 
ATOM   2016 C  C   . LYS B 1 56  ? 20.254  -4.524  7.513   1.00 16.53 ? 55  LYS C C   1 
ATOM   2017 O  O   . LYS B 1 56  ? 19.120  -4.329  7.060   1.00 15.51 ? 55  LYS C O   1 
ATOM   2018 C  CB  . LYS B 1 56  ? 22.304  -3.743  6.228   1.00 18.03 ? 55  LYS C CB  1 
ATOM   2019 C  CG  . LYS B 1 56  ? 21.659  -3.727  4.835   1.00 21.27 ? 55  LYS C CG  1 
ATOM   2020 C  CD  . LYS B 1 56  ? 22.700  -4.138  3.761   1.00 22.27 ? 55  LYS C CD  1 
ATOM   2021 C  CE  . LYS B 1 56  ? 22.697  -5.673  3.608   1.00 28.21 ? 55  LYS C CE  1 
ATOM   2022 N  NZ  . LYS B 1 56  ? 23.924  -6.189  2.930   1.00 32.10 ? 55  LYS C NZ  1 
ATOM   2023 N  N   . GLU B 1 57  ? 20.590  -5.630  8.173   1.00 15.64 ? 56  GLU C N   1 
ATOM   2024 C  CA  . GLU B 1 57  ? 19.611  -6.689  8.376   1.00 16.39 ? 56  GLU C CA  1 
ATOM   2025 C  C   . GLU B 1 57  ? 18.458  -6.242  9.250   1.00 15.03 ? 56  GLU C C   1 
ATOM   2026 O  O   . GLU B 1 57  ? 17.321  -6.594  8.960   1.00 15.02 ? 56  GLU C O   1 
ATOM   2027 C  CB  . GLU B 1 57  ? 20.263  -7.909  8.996   1.00 16.95 ? 56  GLU C CB  1 
ATOM   2028 C  CG  . GLU B 1 57  ? 21.197  -8.618  8.019   1.00 23.25 ? 56  GLU C CG  1 
ATOM   2029 C  CD  . GLU B 1 57  ? 21.914  -9.810  8.629   1.00 31.89 ? 56  GLU C CD  1 
ATOM   2030 O  OE1 . GLU B 1 57  ? 21.841  -10.002 9.866   1.00 35.10 ? 56  GLU C OE1 1 
ATOM   2031 O  OE2 . GLU B 1 57  ? 22.598  -10.534 7.864   1.00 35.81 ? 56  GLU C OE2 1 
ATOM   2032 N  N   . ALA B 1 58  ? 18.749  -5.497  10.325  1.00 13.77 ? 57  ALA C N   1 
ATOM   2033 C  CA  . ALA B 1 58  ? 17.687  -4.995  11.231  1.00 13.58 ? 57  ALA C CA  1 
ATOM   2034 C  C   . ALA B 1 58  ? 16.731  -4.079  10.447  1.00 13.71 ? 57  ALA C C   1 
ATOM   2035 O  O   . ALA B 1 58  ? 15.515  -4.131  10.589  1.00 15.38 ? 57  ALA C O   1 
ATOM   2036 C  CB  . ALA B 1 58  ? 18.293  -4.246  12.402  1.00 13.80 ? 57  ALA C CB  1 
ATOM   2037 N  N   . ILE B 1 59  ? 17.310  -3.244  9.600   1.00 12.96 ? 58  ILE C N   1 
ATOM   2038 C  CA  . ILE B 1 59  ? 16.492  -2.352  8.795   1.00 14.01 ? 58  ILE C CA  1 
ATOM   2039 C  C   . ILE B 1 59  ? 15.618  -3.128  7.810   1.00 13.50 ? 58  ILE C C   1 
ATOM   2040 O  O   . ILE B 1 59  ? 14.433  -2.810  7.615   1.00 14.48 ? 58  ILE C O   1 
ATOM   2041 C  CB  . ILE B 1 59  ? 17.367  -1.337  8.055   1.00 13.14 ? 58  ILE C CB  1 
ATOM   2042 C  CG1 . ILE B 1 59  ? 17.960  -0.350  9.074   1.00 13.81 ? 58  ILE C CG1 1 
ATOM   2043 C  CG2 . ILE B 1 59  ? 16.472  -0.567  7.054   1.00 14.04 ? 58  ILE C CG2 1 
ATOM   2044 C  CD1 . ILE B 1 59  ? 19.059  0.563   8.549   1.00 12.99 ? 58  ILE C CD1 1 
ATOM   2045 N  N   . ALA B 1 60  ? 16.199  -4.156  7.197   1.00 15.04 ? 59  ALA C N   1 
ATOM   2046 C  CA  . ALA B 1 60  ? 15.466  -4.976  6.210   1.00 16.20 ? 59  ALA C CA  1 
ATOM   2047 C  C   . ALA B 1 60  ? 14.242  -5.682  6.798   1.00 16.88 ? 59  ALA C C   1 
ATOM   2048 O  O   . ALA B 1 60  ? 13.265  -5.962  6.083   1.00 17.03 ? 59  ALA C O   1 
ATOM   2049 C  CB  . ALA B 1 60  ? 16.384  -6.003  5.581   1.00 17.24 ? 59  ALA C CB  1 
ATOM   2050 N  N   . LEU B 1 61  ? 14.330  -6.004  8.083   1.00 15.49 ? 60  LEU C N   1 
ATOM   2051 C  CA  . LEU B 1 61  ? 13.238  -6.684  8.792   1.00 15.91 ? 60  LEU C CA  1 
ATOM   2052 C  C   . LEU B 1 61  ? 12.097  -5.757  9.200   1.00 16.86 ? 60  LEU C C   1 
ATOM   2053 O  O   . LEU B 1 61  ? 11.030  -6.212  9.633   1.00 16.09 ? 60  LEU C O   1 
ATOM   2054 C  CB  . LEU B 1 61  ? 13.803  -7.372  10.039  1.00 15.94 ? 60  LEU C CB  1 
ATOM   2055 C  CG  . LEU B 1 61  ? 14.734  -8.549  9.766   1.00 15.77 ? 60  LEU C CG  1 
ATOM   2056 C  CD1 . LEU B 1 61  ? 15.520  -8.916  11.009  1.00 14.16 ? 60  LEU C CD1 1 
ATOM   2057 C  CD2 . LEU B 1 61  ? 13.879  -9.775  9.307   1.00 17.40 ? 60  LEU C CD2 1 
ATOM   2058 N  N   . GLN B 1 62  ? 12.294  -4.448  9.068   1.00 16.90 ? 61  GLN C N   1 
ATOM   2059 C  CA  . GLN B 1 62  ? 11.282  -3.531  9.567   1.00 18.46 ? 61  GLN C CA  1 
ATOM   2060 C  C   . GLN B 1 62  ? 9.903   -3.680  8.893   1.00 17.57 ? 61  GLN C C   1 
ATOM   2061 O  O   . GLN B 1 62  ? 8.900   -3.693  9.604   1.00 18.06 ? 61  GLN C O   1 
ATOM   2062 C  CB  . GLN B 1 62  ? 11.765  -2.074  9.504   1.00 18.62 ? 61  GLN C CB  1 
ATOM   2063 C  CG  . GLN B 1 62  ? 12.987  -1.816  10.401  1.00 21.15 ? 61  GLN C CG  1 
ATOM   2064 C  CD  . GLN B 1 62  ? 13.361  -0.339  10.458  1.00 21.77 ? 61  GLN C CD  1 
ATOM   2065 O  OE1 . GLN B 1 62  ? 13.030  0.434   9.563   1.00 23.97 ? 61  GLN C OE1 1 
ATOM   2066 N  NE2 . GLN B 1 62  ? 14.053  0.046   11.514  1.00 25.04 ? 61  GLN C NE2 1 
ATOM   2067 N  N   . PRO B 1 63  ? 9.843   -3.782  7.549   1.00 17.63 ? 62  PRO C N   1 
ATOM   2068 C  CA  . PRO B 1 63  ? 8.490   -3.963  6.961   1.00 18.89 ? 62  PRO C CA  1 
ATOM   2069 C  C   . PRO B 1 63  ? 7.751   -5.167  7.508   1.00 18.15 ? 62  PRO C C   1 
ATOM   2070 O  O   . PRO B 1 63  ? 6.519   -5.097  7.712   1.00 16.20 ? 62  PRO C O   1 
ATOM   2071 C  CB  . PRO B 1 63  ? 8.780   -4.180  5.476   1.00 19.11 ? 62  PRO C CB  1 
ATOM   2072 C  CG  . PRO B 1 63  ? 10.034  -3.426  5.268   1.00 19.98 ? 62  PRO C CG  1 
ATOM   2073 C  CD  . PRO B 1 63  ? 10.856  -3.707  6.486   1.00 18.37 ? 62  PRO C CD  1 
ATOM   2074 N  N   . ALA B 1 64  ? 8.472   -6.274  7.705   1.00 17.79 ? 63  ALA C N   1 
ATOM   2075 C  CA  . ALA B 1 64  ? 7.870   -7.496  8.229   1.00 17.01 ? 63  ALA C CA  1 
ATOM   2076 C  C   . ALA B 1 64  ? 7.394   -7.317  9.674   1.00 17.13 ? 63  ALA C C   1 
ATOM   2077 O  O   . ALA B 1 64  ? 6.292   -7.785  10.042  1.00 16.29 ? 63  ALA C O   1 
ATOM   2078 C  CB  . ALA B 1 64  ? 8.815   -8.684  8.087   1.00 17.12 ? 63  ALA C CB  1 
ATOM   2079 N  N   . LEU B 1 65  ? 8.170   -6.618  10.498  1.00 16.13 ? 64  LEU C N   1 
ATOM   2080 C  CA  . LEU B 1 65  ? 7.722   -6.324  11.855  1.00 17.65 ? 64  LEU C CA  1 
ATOM   2081 C  C   . LEU B 1 65  ? 6.479   -5.417  11.858  1.00 17.59 ? 64  LEU C C   1 
ATOM   2082 O  O   . LEU B 1 65  ? 5.536   -5.649  12.604  1.00 17.10 ? 64  LEU C O   1 
ATOM   2083 C  CB  . LEU B 1 65  ? 8.832   -5.711  12.729  1.00 18.73 ? 64  LEU C CB  1 
ATOM   2084 C  CG  . LEU B 1 65  ? 8.403   -5.627  14.194  1.00 20.22 ? 64  LEU C CG  1 
ATOM   2085 C  CD1 . LEU B 1 65  ? 8.542   -7.052  14.845  1.00 21.30 ? 64  LEU C CD1 1 
ATOM   2086 C  CD2 . LEU B 1 65  ? 9.146   -4.581  14.991  1.00 23.62 ? 64  LEU C CD2 1 
ATOM   2087 N  N   . LYS B 1 66  ? 6.479   -4.372  11.036  1.00 16.82 ? 65  LYS C N   1 
ATOM   2088 C  CA  . LYS B 1 66  ? 5.327   -3.476  10.986  1.00 16.43 ? 65  LYS C CA  1 
ATOM   2089 C  C   . LYS B 1 66  ? 4.099   -4.194  10.500  1.00 15.94 ? 65  LYS C C   1 
ATOM   2090 O  O   . LYS B 1 66  ? 3.025   -4.025  11.075  1.00 15.62 ? 65  LYS C O   1 
ATOM   2091 C  CB  . LYS B 1 66  ? 5.639   -2.265  10.073  1.00 15.81 ? 65  LYS C CB  1 
ATOM   2092 C  CG  . LYS B 1 66  ? 4.487   -1.331  9.986   1.00 18.06 ? 65  LYS C CG  1 
ATOM   2093 C  CD  . LYS B 1 66  ? 4.954   -0.067  9.302   1.00 22.23 ? 65  LYS C CD  1 
ATOM   2094 C  CE  . LYS B 1 66  ? 3.970   1.028   9.485   1.00 30.94 ? 65  LYS C CE  1 
ATOM   2095 N  NZ  . LYS B 1 66  ? 4.391   2.218   8.683   1.00 31.84 ? 65  LYS C NZ  1 
ATOM   2096 N  N   . PHE B 1 67  ? 4.273   -5.070  9.503   1.00 15.54 ? 66  PHE C N   1 
ATOM   2097 C  CA  . PHE B 1 67  ? 3.135   -5.785  8.921   1.00 15.27 ? 66  PHE C CA  1 
ATOM   2098 C  C   . PHE B 1 67  ? 2.544   -6.782  9.914   1.00 15.19 ? 66  PHE C C   1 
ATOM   2099 O  O   . PHE B 1 67  ? 1.351   -6.762  10.187  1.00 15.27 ? 66  PHE C O   1 
ATOM   2100 C  CB  . PHE B 1 67  ? 3.604   -6.524  7.658   1.00 15.03 ? 66  PHE C CB  1 
ATOM   2101 C  CG  . PHE B 1 67  ? 2.509   -7.201  6.910   1.00 14.13 ? 66  PHE C CG  1 
ATOM   2102 C  CD1 . PHE B 1 67  ? 2.525   -8.612  6.745   1.00 14.13 ? 66  PHE C CD1 1 
ATOM   2103 C  CD2 . PHE B 1 67  ? 1.477   -6.455  6.346   1.00 17.56 ? 66  PHE C CD2 1 
ATOM   2104 C  CE1 . PHE B 1 67  ? 1.535   -9.239  6.030   1.00 17.27 ? 66  PHE C CE1 1 
ATOM   2105 C  CE2 . PHE B 1 67  ? 0.449   -7.080  5.639   1.00 14.60 ? 66  PHE C CE2 1 
ATOM   2106 C  CZ  . PHE B 1 67  ? 0.478   -8.486  5.464   1.00 15.47 ? 66  PHE C CZ  1 
ATOM   2107 N  N   . ASN B 1 68  ? 3.394   -7.628  10.490  1.00 14.82 ? 67  ASN C N   1 
ATOM   2108 C  CA  . ASN B 1 68  ? 2.901   -8.653  11.413  1.00 14.67 ? 67  ASN C CA  1 
ATOM   2109 C  C   . ASN B 1 68  ? 2.559   -8.095  12.807  1.00 15.35 ? 67  ASN C C   1 
ATOM   2110 O  O   . ASN B 1 68  ? 1.527   -8.466  13.407  1.00 16.49 ? 67  ASN C O   1 
ATOM   2111 C  CB  . ASN B 1 68  ? 3.888   -9.829  11.449  1.00 15.52 ? 67  ASN C CB  1 
ATOM   2112 C  CG  . ASN B 1 68  ? 3.981   -10.515 10.104  1.00 15.71 ? 67  ASN C CG  1 
ATOM   2113 O  OD1 . ASN B 1 68  ? 4.972   -10.346 9.350   1.00 20.76 ? 67  ASN C OD1 1 
ATOM   2114 N  ND2 . ASN B 1 68  ? 2.936   -11.218 9.753   1.00 12.35 ? 67  ASN C ND2 1 
ATOM   2115 N  N   . GLY B 1 69  ? 3.427   -7.204  13.304  1.00 15.72 ? 68  GLY C N   1 
ATOM   2116 C  CA  . GLY B 1 69  ? 3.213   -6.517  14.577  1.00 15.82 ? 68  GLY C CA  1 
ATOM   2117 C  C   . GLY B 1 69  ? 1.929   -5.699  14.456  1.00 15.64 ? 68  GLY C C   1 
ATOM   2118 O  O   . GLY B 1 69  ? 1.037   -5.792  15.293  1.00 13.98 ? 68  GLY C O   1 
ATOM   2119 N  N   . GLY B 1 70  ? 1.832   -4.922  13.388  1.00 15.11 ? 69  GLY C N   1 
ATOM   2120 C  CA  . GLY B 1 70  ? 0.582   -4.171  13.128  1.00 17.14 ? 69  GLY C CA  1 
ATOM   2121 C  C   . GLY B 1 70  ? -0.631  -5.076  13.008  1.00 16.24 ? 69  GLY C C   1 
ATOM   2122 O  O   . GLY B 1 70  ? -1.669  -4.813  13.618  1.00 15.38 ? 69  GLY C O   1 
ATOM   2123 N  N   . GLY B 1 71  ? -0.495  -6.214  12.295  1.00 16.27 ? 70  GLY C N   1 
ATOM   2124 C  CA  . GLY B 1 71  ? -1.609  -7.159  12.168  1.00 16.63 ? 70  GLY C CA  1 
ATOM   2125 C  C   . GLY B 1 71  ? -2.082  -7.615  13.542  1.00 15.73 ? 70  GLY C C   1 
ATOM   2126 O  O   . GLY B 1 71  ? -3.275  -7.692  13.823  1.00 15.85 ? 70  GLY C O   1 
ATOM   2127 N  N   . HIS B 1 72  ? -1.127  -7.893  14.426  1.00 15.69 ? 71  HIS C N   1 
ATOM   2128 C  CA  . HIS B 1 72  ? -1.465  -8.341  15.762  1.00 15.92 ? 71  HIS C CA  1 
ATOM   2129 C  C   . HIS B 1 72  ? -2.158  -7.261  16.586  1.00 15.61 ? 71  HIS C C   1 
ATOM   2130 O  O   . HIS B 1 72  ? -3.198  -7.516  17.205  1.00 15.16 ? 71  HIS C O   1 
ATOM   2131 C  CB  . HIS B 1 72  ? -0.196  -8.806  16.477  1.00 16.25 ? 71  HIS C CB  1 
ATOM   2132 C  CG  . HIS B 1 72  ? -0.447  -9.353  17.847  1.00 16.49 ? 71  HIS C CG  1 
ATOM   2133 N  ND1 . HIS B 1 72  ? -1.539  -10.146 18.153  1.00 15.18 ? 71  HIS C ND1 1 
ATOM   2134 C  CD2 . HIS B 1 72  ? 0.268   -9.242  18.991  1.00 16.35 ? 71  HIS C CD2 1 
ATOM   2135 C  CE1 . HIS B 1 72  ? -1.481  -10.502 19.423  1.00 14.93 ? 71  HIS C CE1 1 
ATOM   2136 N  NE2 . HIS B 1 72  ? -0.389  -9.982  19.951  1.00 14.95 ? 71  HIS C NE2 1 
ATOM   2137 N  N   . ILE B 1 73  ? -1.585  -6.059  16.576  1.00 15.17 ? 72  ILE C N   1 
ATOM   2138 C  CA  . ILE B 1 73  ? -2.130  -4.934  17.336  1.00 14.31 ? 72  ILE C CA  1 
ATOM   2139 C  C   . ILE B 1 73  ? -3.550  -4.656  16.862  1.00 14.57 ? 72  ILE C C   1 
ATOM   2140 O  O   . ILE B 1 73  ? -4.486  -4.577  17.675  1.00 14.61 ? 72  ILE C O   1 
ATOM   2141 C  CB  . ILE B 1 73  ? -1.250  -3.691  17.104  1.00 14.30 ? 72  ILE C CB  1 
ATOM   2142 C  CG1 . ILE B 1 73  ? 0.110   -3.869  17.833  1.00 15.21 ? 72  ILE C CG1 1 
ATOM   2143 C  CG2 . ILE B 1 73  ? -1.987  -2.383  17.487  1.00 14.76 ? 72  ILE C CG2 1 
ATOM   2144 C  CD1 . ILE B 1 73  ? 1.168   -2.916  17.385  1.00 17.24 ? 72  ILE C CD1 1 
ATOM   2145 N  N   . ASN B 1 74  ? -3.689  -4.510  15.544  1.00 15.39 ? 73  ASN C N   1 
ATOM   2146 C  CA  . ASN B 1 74  ? -4.972  -4.133  14.923  1.00 15.34 ? 73  ASN C CA  1 
ATOM   2147 C  C   . ASN B 1 74  ? -6.083  -5.140  15.191  1.00 16.13 ? 73  ASN C C   1 
ATOM   2148 O  O   . ASN B 1 74  ? -7.180  -4.759  15.623  1.00 15.89 ? 73  ASN C O   1 
ATOM   2149 C  CB  . ASN B 1 74  ? -4.816  -3.942  13.414  1.00 15.96 ? 73  ASN C CB  1 
ATOM   2150 C  CG  . ASN B 1 74  ? -3.795  -2.862  13.058  1.00 14.88 ? 73  ASN C CG  1 
ATOM   2151 O  OD1 . ASN B 1 74  ? -3.454  -1.964  13.869  1.00 16.82 ? 73  ASN C OD1 1 
ATOM   2152 N  ND2 . ASN B 1 74  ? -3.262  -2.963  11.850  1.00 16.76 ? 73  ASN C ND2 1 
ATOM   2153 N  N   . HIS B 1 75  ? -5.810  -6.415  14.930  1.00 15.92 ? 74  HIS C N   1 
ATOM   2154 C  CA  . HIS B 1 75  ? -6.829  -7.415  15.199  1.00 15.52 ? 74  HIS C CA  1 
ATOM   2155 C  C   . HIS B 1 75  ? -7.167  -7.535  16.686  1.00 15.59 ? 74  HIS C C   1 
ATOM   2156 O  O   . HIS B 1 75  ? -8.338  -7.728  17.041  1.00 14.73 ? 74  HIS C O   1 
ATOM   2157 C  CB  . HIS B 1 75  ? -6.454  -8.731  14.548  1.00 15.51 ? 74  HIS C CB  1 
ATOM   2158 C  CG  . HIS B 1 75  ? -6.495  -8.657  13.065  1.00 16.28 ? 74  HIS C CG  1 
ATOM   2159 N  ND1 . HIS B 1 75  ? -5.418  -8.234  12.318  1.00 17.09 ? 74  HIS C ND1 1 
ATOM   2160 C  CD2 . HIS B 1 75  ? -7.480  -8.949  12.181  1.00 15.32 ? 74  HIS C CD2 1 
ATOM   2161 C  CE1 . HIS B 1 75  ? -5.751  -8.227  11.038  1.00 17.30 ? 74  HIS C CE1 1 
ATOM   2162 N  NE2 . HIS B 1 75  ? -7.000  -8.645  10.925  1.00 13.94 ? 74  HIS C NE2 1 
ATOM   2163 N  N   . SER B 1 76  ? -6.155  -7.453  17.558  1.00 14.92 ? 75  SER C N   1 
ATOM   2164 C  CA  . SER B 1 76  ? -6.410  -7.503  18.996  1.00 15.57 ? 75  SER C CA  1 
ATOM   2165 C  C   . SER B 1 76  ? -7.404  -6.413  19.431  1.00 15.51 ? 75  SER C C   1 
ATOM   2166 O  O   . SER B 1 76  ? -8.360  -6.673  20.191  1.00 16.11 ? 75  SER C O   1 
ATOM   2167 C  CB  . SER B 1 76  ? -5.091  -7.463  19.798  1.00 15.34 ? 75  SER C CB  1 
ATOM   2168 O  OG  . SER B 1 76  ? -4.288  -8.602  19.481  1.00 16.13 ? 75  SER C OG  1 
ATOM   2169 N  N   . ILE B 1 77  ? -7.226  -5.204  18.897  1.00 15.29 ? 76  ILE C N   1 
ATOM   2170 C  CA  . ILE B 1 77  ? -8.144  -4.123  19.242  1.00 15.14 ? 76  ILE C CA  1 
ATOM   2171 C  C   . ILE B 1 77  ? -9.519  -4.423  18.627  1.00 14.59 ? 76  ILE C C   1 
ATOM   2172 O  O   . ILE B 1 77  ? -10.562 -4.275  19.268  1.00 15.16 ? 76  ILE C O   1 
ATOM   2173 C  CB  . ILE B 1 77  ? -7.626  -2.780  18.709  1.00 15.41 ? 76  ILE C CB  1 
ATOM   2174 C  CG1 . ILE B 1 77  ? -6.294  -2.434  19.398  1.00 15.04 ? 76  ILE C CG1 1 
ATOM   2175 C  CG2 . ILE B 1 77  ? -8.714  -1.675  18.918  1.00 15.51 ? 76  ILE C CG2 1 
ATOM   2176 C  CD1 . ILE B 1 77  ? -5.549  -1.217  18.734  1.00 15.61 ? 76  ILE C CD1 1 
ATOM   2177 N  N   . PHE B 1 78  ? -9.500  -4.854  17.372  1.00 15.53 ? 77  PHE C N   1 
ATOM   2178 C  CA  . PHE B 1 78  ? -10.743 -5.107  16.618  1.00 14.85 ? 77  PHE C CA  1 
ATOM   2179 C  C   . PHE B 1 78  ? -11.683 -6.078  17.350  1.00 15.30 ? 77  PHE C C   1 
ATOM   2180 O  O   . PHE B 1 78  ? -12.875 -5.827  17.420  1.00 14.88 ? 77  PHE C O   1 
ATOM   2181 C  CB  . PHE B 1 78  ? -10.389 -5.638  15.240  1.00 14.25 ? 77  PHE C CB  1 
ATOM   2182 C  CG  . PHE B 1 78  ? -11.544 -5.669  14.266  1.00 14.35 ? 77  PHE C CG  1 
ATOM   2183 C  CD1 . PHE B 1 78  ? -12.313 -4.533  14.011  1.00 13.97 ? 77  PHE C CD1 1 
ATOM   2184 C  CD2 . PHE B 1 78  ? -11.820 -6.850  13.561  1.00 16.43 ? 77  PHE C CD2 1 
ATOM   2185 C  CE1 . PHE B 1 78  ? -13.351 -4.557  13.065  1.00 14.96 ? 77  PHE C CE1 1 
ATOM   2186 C  CE2 . PHE B 1 78  ? -12.847 -6.887  12.605  1.00 15.93 ? 77  PHE C CE2 1 
ATOM   2187 C  CZ  . PHE B 1 78  ? -13.619 -5.751  12.361  1.00 15.47 ? 77  PHE C CZ  1 
ATOM   2188 N  N   . TRP B 1 79  ? -11.148 -7.186  17.874  1.00 15.04 ? 78  TRP C N   1 
ATOM   2189 C  CA  . TRP B 1 79  ? -12.013 -8.126  18.614  1.00 15.36 ? 78  TRP C CA  1 
ATOM   2190 C  C   . TRP B 1 79  ? -12.727 -7.473  19.802  1.00 15.87 ? 78  TRP C C   1 
ATOM   2191 O  O   . TRP B 1 79  ? -13.924 -7.738  20.055  1.00 17.17 ? 78  TRP C O   1 
ATOM   2192 C  CB  . TRP B 1 79  ? -11.234 -9.368  19.103  1.00 15.69 ? 78  TRP C CB  1 
ATOM   2193 C  CG  . TRP B 1 79  ? -10.365 -10.041 18.075  1.00 15.43 ? 78  TRP C CG  1 
ATOM   2194 C  CD1 . TRP B 1 79  ? -9.128  -10.558 18.279  1.00 16.46 ? 78  TRP C CD1 1 
ATOM   2195 C  CD2 . TRP B 1 79  ? -10.677 -10.268 16.699  1.00 15.36 ? 78  TRP C CD2 1 
ATOM   2196 N  NE1 . TRP B 1 79  ? -8.637  -11.094 17.110  1.00 16.63 ? 78  TRP C NE1 1 
ATOM   2197 C  CE2 . TRP B 1 79  ? -9.574  -10.932 16.125  1.00 17.25 ? 78  TRP C CE2 1 
ATOM   2198 C  CE3 . TRP B 1 79  ? -11.797 -9.984  15.893  1.00 18.22 ? 78  TRP C CE3 1 
ATOM   2199 C  CZ2 . TRP B 1 79  ? -9.542  -11.314 14.786  1.00 16.85 ? 78  TRP C CZ2 1 
ATOM   2200 C  CZ3 . TRP B 1 79  ? -11.773 -10.364 14.552  1.00 17.05 ? 78  TRP C CZ3 1 
ATOM   2201 C  CH2 . TRP B 1 79  ? -10.635 -11.012 14.010  1.00 16.89 ? 78  TRP C CH2 1 
ATOM   2202 N  N   . THR B 1 80  ? -12.001 -6.638  20.537  1.00 15.84 ? 79  THR C N   1 
ATOM   2203 C  CA  . THR B 1 80  ? -12.551 -5.959  21.702  1.00 16.57 ? 79  THR C CA  1 
ATOM   2204 C  C   . THR B 1 80  ? -13.550 -4.863  21.298  1.00 16.50 ? 79  THR C C   1 
ATOM   2205 O  O   . THR B 1 80  ? -14.366 -4.439  22.118  1.00 16.83 ? 79  THR C O   1 
ATOM   2206 C  CB  . THR B 1 80  ? -11.439 -5.320  22.581  1.00 16.42 ? 79  THR C CB  1 
ATOM   2207 O  OG1 . THR B 1 80  ? -10.885 -4.164  21.934  1.00 16.73 ? 79  THR C OG1 1 
ATOM   2208 C  CG2 . THR B 1 80  ? -10.334 -6.364  22.951  1.00 16.52 ? 79  THR C CG2 1 
ATOM   2209 N  N   . ASN B 1 81  ? -13.456 -4.408  20.043  1.00 16.29 ? 80  ASN C N   1 
ATOM   2210 C  CA  . ASN B 1 81  ? -14.312 -3.340  19.490  1.00 15.86 ? 80  ASN C CA  1 
ATOM   2211 C  C   . ASN B 1 81  ? -15.662 -3.848  18.985  1.00 15.62 ? 80  ASN C C   1 
ATOM   2212 O  O   . ASN B 1 81  ? -16.497 -3.047  18.563  1.00 16.14 ? 80  ASN C O   1 
ATOM   2213 C  CB  . ASN B 1 81  ? -13.646 -2.677  18.271  1.00 15.92 ? 80  ASN C CB  1 
ATOM   2214 C  CG  . ASN B 1 81  ? -12.546 -1.658  18.616  1.00 14.84 ? 80  ASN C CG  1 
ATOM   2215 O  OD1 . ASN B 1 81  ? -11.846 -1.200  17.710  1.00 14.23 ? 80  ASN C OD1 1 
ATOM   2216 N  ND2 . ASN B 1 81  ? -12.421 -1.271  19.874  1.00 14.72 ? 80  ASN C ND2 1 
ATOM   2217 N  N   . LEU B 1 82  ? -15.855 -5.170  18.978  1.00 15.78 ? 81  LEU C N   1 
ATOM   2218 C  CA  . LEU B 1 82  ? -17.091 -5.796  18.469  1.00 15.42 ? 81  LEU C CA  1 
ATOM   2219 C  C   . LEU B 1 82  ? -17.920 -6.445  19.584  1.00 15.72 ? 81  LEU C C   1 
ATOM   2220 O  O   . LEU B 1 82  ? -17.377 -7.005  20.530  1.00 15.43 ? 81  LEU C O   1 
ATOM   2221 C  CB  . LEU B 1 82  ? -16.732 -6.843  17.404  1.00 15.68 ? 81  LEU C CB  1 
ATOM   2222 C  CG  . LEU B 1 82  ? -15.943 -6.302  16.189  1.00 15.24 ? 81  LEU C CG  1 
ATOM   2223 C  CD1 . LEU B 1 82  ? -15.540 -7.447  15.277  1.00 17.70 ? 81  LEU C CD1 1 
ATOM   2224 C  CD2 . LEU B 1 82  ? -16.740 -5.248  15.430  1.00 17.38 ? 81  LEU C CD2 1 
ATOM   2225 N  N   . ALA B 1 83  ? -19.239 -6.351  19.475  1.00 15.78 ? 82  ALA C N   1 
ATOM   2226 C  CA  . ALA B 1 83  ? -20.120 -6.983  20.468  1.00 17.17 ? 82  ALA C CA  1 
ATOM   2227 C  C   . ALA B 1 83  ? -21.544 -7.073  19.968  1.00 17.98 ? 82  ALA C C   1 
ATOM   2228 O  O   . ALA B 1 83  ? -22.015 -6.188  19.246  1.00 18.45 ? 82  ALA C O   1 
ATOM   2229 C  CB  . ALA B 1 83  ? -20.070 -6.217  21.789  1.00 17.22 ? 82  ALA C CB  1 
ATOM   2230 N  N   . LYS B 1 84  ? -22.231 -8.139  20.367  1.00 18.85 ? 83  LYS C N   1 
ATOM   2231 C  CA  . LYS B 1 84  ? -23.647 -8.269  20.050  1.00 20.26 ? 83  LYS C CA  1 
ATOM   2232 C  C   . LYS B 1 84  ? -24.413 -7.201  20.861  1.00 20.49 ? 83  LYS C C   1 
ATOM   2233 O  O   . LYS B 1 84  ? -25.280 -6.522  20.320  1.00 21.42 ? 83  LYS C O   1 
ATOM   2234 C  CB  . LYS B 1 84  ? -24.152 -9.702  20.290  1.00 20.16 ? 83  LYS C CB  1 
ATOM   2235 C  CG  . LYS B 1 84  ? -25.629 -9.897  19.886  1.00 22.37 ? 83  LYS C CG  1 
ATOM   2236 C  CD  . LYS B 1 84  ? -25.977 -11.325 19.372  1.00 24.87 ? 83  LYS C CD  1 
ATOM   2237 C  CE  . LYS B 1 84  ? -25.917 -12.444 20.421  1.00 23.72 ? 83  LYS C CE  1 
ATOM   2238 N  NZ  . LYS B 1 84  ? -27.250 -12.743 21.064  1.00 24.66 ? 83  LYS C NZ  1 
ATOM   2239 N  N   . ASP B 1 85  ? -24.037 -7.027  22.133  1.00 21.57 ? 84  ASP C N   1 
ATOM   2240 C  CA  . ASP B 1 85  ? -24.657 -6.047  23.043  1.00 23.29 ? 84  ASP C CA  1 
ATOM   2241 C  C   . ASP B 1 85  ? -23.593 -5.066  23.529  1.00 24.01 ? 84  ASP C C   1 
ATOM   2242 O  O   . ASP B 1 85  ? -23.090 -5.167  24.656  1.00 24.60 ? 84  ASP C O   1 
ATOM   2243 C  CB  . ASP B 1 85  ? -25.338 -6.756  24.232  1.00 23.48 ? 84  ASP C CB  1 
ATOM   2244 C  CG  . ASP B 1 85  ? -25.877 -5.775  25.291  1.00 24.98 ? 84  ASP C CG  1 
ATOM   2245 O  OD1 . ASP B 1 85  ? -25.832 -6.108  26.498  1.00 26.30 ? 84  ASP C OD1 1 
ATOM   2246 O  OD2 . ASP B 1 85  ? -26.335 -4.669  24.927  1.00 28.76 ? 84  ASP C OD2 1 
ATOM   2247 N  N   . GLY B 1 86  ? -23.251 -4.123  22.660  1.00 24.20 ? 85  GLY C N   1 
ATOM   2248 C  CA  . GLY B 1 86  ? -22.207 -3.146  22.935  1.00 25.03 ? 85  GLY C CA  1 
ATOM   2249 C  C   . GLY B 1 86  ? -22.598 -1.985  23.829  1.00 25.21 ? 85  GLY C C   1 
ATOM   2250 O  O   . GLY B 1 86  ? -21.733 -1.351  24.446  1.00 25.17 ? 85  GLY C O   1 
ATOM   2251 N  N   . GLY B 1 87  ? -23.900 -1.706  23.907  1.00 24.88 ? 86  GLY C N   1 
ATOM   2252 C  CA  . GLY B 1 87  ? -24.386 -0.573  24.681  1.00 25.31 ? 86  GLY C CA  1 
ATOM   2253 C  C   . GLY B 1 87  ? -24.300 0.714   23.879  1.00 25.16 ? 86  GLY C C   1 
ATOM   2254 O  O   . GLY B 1 87  ? -24.414 0.704   22.655  1.00 25.73 ? 86  GLY C O   1 
ATOM   2255 N  N   . GLU B 1 88  ? -24.079 1.824   24.573  1.00 24.71 ? 87  GLU C N   1 
ATOM   2256 C  CA  . GLU B 1 88  ? -24.041 3.142   23.942  1.00 24.41 ? 87  GLU C CA  1 
ATOM   2257 C  C   . GLU B 1 88  ? -22.827 3.928   24.419  1.00 22.90 ? 87  GLU C C   1 
ATOM   2258 O  O   . GLU B 1 88  ? -22.277 3.632   25.485  1.00 22.46 ? 87  GLU C O   1 
ATOM   2259 C  CB  . GLU B 1 88  ? -25.313 3.934   24.293  1.00 24.30 ? 87  GLU C CB  1 
ATOM   2260 C  CG  . GLU B 1 88  ? -26.602 3.457   23.633  1.00 24.97 ? 87  GLU C CG  1 
ATOM   2261 C  CD  . GLU B 1 88  ? -27.821 4.252   24.095  1.00 26.94 ? 87  GLU C CD  1 
ATOM   2262 O  OE1 . GLU B 1 88  ? -27.686 5.464   24.401  1.00 31.23 ? 87  GLU C OE1 1 
ATOM   2263 O  OE2 . GLU B 1 88  ? -28.926 3.668   24.154  1.00 28.34 ? 87  GLU C OE2 1 
ATOM   2264 N  N   . PRO B 1 89  ? -22.405 4.942   23.643  1.00 22.13 ? 88  PRO C N   1 
ATOM   2265 C  CA  . PRO B 1 89  ? -21.256 5.704   24.131  1.00 21.77 ? 88  PRO C CA  1 
ATOM   2266 C  C   . PRO B 1 89  ? -21.505 6.261   25.535  1.00 21.13 ? 88  PRO C C   1 
ATOM   2267 O  O   . PRO B 1 89  ? -22.642 6.610   25.874  1.00 20.85 ? 88  PRO C O   1 
ATOM   2268 C  CB  . PRO B 1 89  ? -21.114 6.842   23.108  1.00 21.73 ? 88  PRO C CB  1 
ATOM   2269 C  CG  . PRO B 1 89  ? -21.839 6.365   21.867  1.00 21.52 ? 88  PRO C CG  1 
ATOM   2270 C  CD  . PRO B 1 89  ? -22.909 5.428   22.340  1.00 21.98 ? 88  PRO C CD  1 
ATOM   2271 N  N   . SER B 1 90  ? -20.454 6.293   26.353  1.00 20.92 ? 89  SER C N   1 
ATOM   2272 C  CA  . SER B 1 90  ? -20.499 6.920   27.671  1.00 20.70 ? 89  SER C CA  1 
ATOM   2273 C  C   . SER B 1 90  ? -20.888 8.390   27.482  1.00 20.97 ? 89  SER C C   1 
ATOM   2274 O  O   . SER B 1 90  ? -20.706 8.950   26.391  1.00 20.54 ? 89  SER C O   1 
ATOM   2275 C  CB  . SER B 1 90  ? -19.125 6.847   28.337  1.00 20.79 ? 89  SER C CB  1 
ATOM   2276 O  OG  . SER B 1 90  ? -18.175 7.632   27.620  1.00 20.41 ? 89  SER C OG  1 
ATOM   2277 N  N   . LYS B 1 91  ? -21.403 9.027   28.529  1.00 20.82 ? 90  LYS C N   1 
ATOM   2278 C  CA  . LYS B 1 91  ? -21.803 10.417  28.383  1.00 21.46 ? 90  LYS C CA  1 
ATOM   2279 C  C   . LYS B 1 91  ? -20.628 11.292  27.925  1.00 21.30 ? 90  LYS C C   1 
ATOM   2280 O  O   . LYS B 1 91  ? -20.791 12.131  27.032  1.00 21.72 ? 90  LYS C O   1 
ATOM   2281 C  CB  . LYS B 1 91  ? -22.427 10.974  29.663  1.00 21.27 ? 90  LYS C CB  1 
ATOM   2282 C  CG  . LYS B 1 91  ? -23.268 12.210  29.400  1.00 22.80 ? 90  LYS C CG  1 
ATOM   2283 C  CD  . LYS B 1 91  ? -23.816 12.834  30.684  1.00 24.32 ? 90  LYS C CD  1 
ATOM   2284 C  CE  . LYS B 1 91  ? -22.782 13.702  31.414  1.00 25.79 ? 90  LYS C CE  1 
ATOM   2285 N  NZ  . LYS B 1 91  ? -22.456 14.960  30.669  1.00 26.23 ? 90  LYS C NZ  1 
ATOM   2286 N  N   . GLU B 1 92  ? -19.450 11.096  28.518  1.00 21.40 ? 91  GLU C N   1 
ATOM   2287 C  CA  . GLU B 1 92  ? -18.288 11.907  28.141  1.00 21.66 ? 91  GLU C CA  1 
ATOM   2288 C  C   . GLU B 1 92  ? -17.824 11.670  26.697  1.00 20.74 ? 91  GLU C C   1 
ATOM   2289 O  O   . GLU B 1 92  ? -17.371 12.609  26.043  1.00 20.65 ? 91  GLU C O   1 
ATOM   2290 C  CB  . GLU B 1 92  ? -17.119 11.748  29.123  1.00 21.98 ? 91  GLU C CB  1 
ATOM   2291 C  CG  . GLU B 1 92  ? -16.550 10.332  29.252  1.00 22.94 ? 91  GLU C CG  1 
ATOM   2292 C  CD  . GLU B 1 92  ? -15.130 10.327  29.818  1.00 24.38 ? 91  GLU C CD  1 
ATOM   2293 O  OE1 . GLU B 1 92  ? -14.644 11.416  30.212  1.00 27.94 ? 91  GLU C OE1 1 
ATOM   2294 O  OE2 . GLU B 1 92  ? -14.496 9.243   29.861  1.00 27.03 ? 91  GLU C OE2 1 
ATOM   2295 N  N   . LEU B 1 93  ? -17.942 10.432  26.208  1.00 19.40 ? 92  LEU C N   1 
ATOM   2296 C  CA  . LEU B 1 93  ? -17.565 10.118  24.813  1.00 18.88 ? 92  LEU C CA  1 
ATOM   2297 C  C   . LEU B 1 93  ? -18.616 10.677  23.860  1.00 18.36 ? 92  LEU C C   1 
ATOM   2298 O  O   . LEU B 1 93  ? -18.277 11.268  22.842  1.00 17.92 ? 92  LEU C O   1 
ATOM   2299 C  CB  . LEU B 1 93  ? -17.373 8.616   24.585  1.00 18.55 ? 92  LEU C CB  1 
ATOM   2300 C  CG  . LEU B 1 93  ? -17.059 8.144   23.146  1.00 19.16 ? 92  LEU C CG  1 
ATOM   2301 C  CD1 . LEU B 1 93  ? -15.870 8.867   22.501  1.00 18.13 ? 92  LEU C CD1 1 
ATOM   2302 C  CD2 . LEU B 1 93  ? -16.842 6.654   23.093  1.00 18.31 ? 92  LEU C CD2 1 
ATOM   2303 N  N   . MET B 1 94  ? -19.890 10.510  24.202  1.00 17.86 ? 93  MET C N   1 
ATOM   2304 C  CA  . MET B 1 94  ? -20.942 11.107  23.380  1.00 17.91 ? 93  MET C CA  1 
ATOM   2305 C  C   . MET B 1 94  ? -20.755 12.624  23.302  1.00 17.82 ? 93  MET C C   1 
ATOM   2306 O  O   . MET B 1 94  ? -20.826 13.184  22.216  1.00 18.06 ? 93  MET C O   1 
ATOM   2307 C  CB  . MET B 1 94  ? -22.351 10.745  23.879  1.00 18.26 ? 93  MET C CB  1 
ATOM   2308 C  CG  . MET B 1 94  ? -23.476 11.277  22.966  1.00 19.12 ? 93  MET C CG  1 
ATOM   2309 S  SD  . MET B 1 94  ? -23.403 10.626  21.264  1.00 23.02 ? 93  MET C SD  1 
ATOM   2310 C  CE  . MET B 1 94  ? -24.265 9.065   21.469  1.00 24.09 ? 93  MET C CE  1 
ATOM   2311 N  N   . ASP B 1 95  ? -20.498 13.282  24.439  1.00 18.30 ? 94  ASP C N   1 
ATOM   2312 C  CA  . ASP B 1 95  ? -20.316 14.746  24.468  1.00 18.42 ? 94  ASP C CA  1 
ATOM   2313 C  C   . ASP B 1 95  ? -19.125 15.164  23.594  1.00 17.51 ? 94  ASP C C   1 
ATOM   2314 O  O   . ASP B 1 95  ? -19.183 16.183  22.904  1.00 17.46 ? 94  ASP C O   1 
ATOM   2315 C  CB  . ASP B 1 95  ? -20.090 15.279  25.886  1.00 18.60 ? 94  ASP C CB  1 
ATOM   2316 C  CG  . ASP B 1 95  ? -21.334 15.225  26.759  1.00 20.24 ? 94  ASP C CG  1 
ATOM   2317 O  OD1 . ASP B 1 95  ? -22.472 15.132  26.238  1.00 21.61 ? 94  ASP C OD1 1 
ATOM   2318 O  OD2 . ASP B 1 95  ? -21.156 15.289  27.994  1.00 22.06 ? 94  ASP C OD2 1 
ATOM   2319 N  N   . THR B 1 96  ? -18.051 14.378  23.628  1.00 17.13 ? 95  THR C N   1 
ATOM   2320 C  CA  . THR B 1 96  ? -16.877 14.686  22.832  1.00 16.38 ? 95  THR C CA  1 
ATOM   2321 C  C   . THR B 1 96  ? -17.158 14.432  21.340  1.00 16.37 ? 95  THR C C   1 
ATOM   2322 O  O   . THR B 1 96  ? -16.738 15.222  20.480  1.00 16.18 ? 95  THR C O   1 
ATOM   2323 C  CB  . THR B 1 96  ? -15.615 13.926  23.345  1.00 16.85 ? 95  THR C CB  1 
ATOM   2324 O  OG1 . THR B 1 96  ? -15.438 14.218  24.738  1.00 17.60 ? 95  THR C OG1 1 
ATOM   2325 C  CG2 . THR B 1 96  ? -14.385 14.387  22.612  1.00 15.61 ? 95  THR C CG2 1 
ATOM   2326 N  N   . ILE B 1 97  ? -17.848 13.329  21.030  1.00 16.47 ? 96  ILE C N   1 
ATOM   2327 C  CA  . ILE B 1 97  ? -18.295 13.062  19.654  1.00 16.26 ? 96  ILE C CA  1 
ATOM   2328 C  C   . ILE B 1 97  ? -19.074 14.291  19.125  1.00 16.33 ? 96  ILE C C   1 
ATOM   2329 O  O   . ILE B 1 97  ? -18.798 14.797  18.041  1.00 15.59 ? 96  ILE C O   1 
ATOM   2330 C  CB  . ILE B 1 97  ? -19.118 11.722  19.546  1.00 16.72 ? 96  ILE C CB  1 
ATOM   2331 C  CG1 . ILE B 1 97  ? -18.188 10.495  19.683  1.00 16.67 ? 96  ILE C CG1 1 
ATOM   2332 C  CG2 . ILE B 1 97  ? -19.876 11.642  18.230  1.00 17.36 ? 96  ILE C CG2 1 
ATOM   2333 C  CD1 . ILE B 1 97  ? -18.938 9.110   19.725  1.00 15.93 ? 96  ILE C CD1 1 
ATOM   2334 N  N   . LYS B 1 98  ? -20.037 14.773  19.912  1.00 16.19 ? 97  LYS C N   1 
ATOM   2335 C  CA  . LYS B 1 98  ? -20.804 15.956  19.533  1.00 16.71 ? 97  LYS C CA  1 
ATOM   2336 C  C   . LYS B 1 98  ? -19.896 17.159  19.354  1.00 16.63 ? 97  LYS C C   1 
ATOM   2337 O  O   . LYS B 1 98  ? -20.061 17.916  18.401  1.00 17.26 ? 97  LYS C O   1 
ATOM   2338 C  CB  . LYS B 1 98  ? -21.928 16.260  20.547  1.00 16.42 ? 97  LYS C CB  1 
ATOM   2339 C  CG  . LYS B 1 98  ? -23.082 15.266  20.515  1.00 17.09 ? 97  LYS C CG  1 
ATOM   2340 C  CD  . LYS B 1 98  ? -24.178 15.632  21.530  1.00 18.29 ? 97  LYS C CD  1 
ATOM   2341 C  CE  . LYS B 1 98  ? -25.171 14.487  21.681  1.00 20.45 ? 97  LYS C CE  1 
ATOM   2342 N  NZ  . LYS B 1 98  ? -26.047 14.670  22.880  1.00 20.00 ? 97  LYS C NZ  1 
ATOM   2343 N  N   . ARG B 1 99  ? -18.914 17.321  20.239  1.00 16.28 ? 98  ARG C N   1 
ATOM   2344 C  CA  . ARG B 1 99  ? -18.063 18.501  20.174  1.00 16.55 ? 98  ARG C CA  1 
ATOM   2345 C  C   . ARG B 1 99  ? -17.180 18.490  18.920  1.00 16.68 ? 98  ARG C C   1 
ATOM   2346 O  O   . ARG B 1 99  ? -16.981 19.526  18.275  1.00 16.04 ? 98  ARG C O   1 
ATOM   2347 C  CB  . ARG B 1 99  ? -17.248 18.663  21.471  1.00 17.35 ? 98  ARG C CB  1 
ATOM   2348 C  CG  . ARG B 1 99  ? -16.122 19.702  21.437  1.00 18.36 ? 98  ARG C CG  1 
ATOM   2349 C  CD  . ARG B 1 99  ? -14.770 19.021  21.353  1.00 24.22 ? 98  ARG C CD  1 
ATOM   2350 N  NE  . ARG B 1 99  ? -14.167 18.907  22.673  1.00 26.61 ? 98  ARG C NE  1 
ATOM   2351 C  CZ  . ARG B 1 99  ? -13.095 18.187  22.983  1.00 26.39 ? 98  ARG C CZ  1 
ATOM   2352 N  NH1 . ARG B 1 99  ? -12.472 17.430  22.081  1.00 27.41 ? 98  ARG C NH1 1 
ATOM   2353 N  NH2 . ARG B 1 99  ? -12.670 18.203  24.240  1.00 28.20 ? 98  ARG C NH2 1 
ATOM   2354 N  N   . ASP B 1 100 ? -16.715 17.303  18.548  1.00 16.28 ? 99  ASP C N   1 
ATOM   2355 C  CA  . ASP B 1 100 ? -15.734 17.186  17.471  1.00 17.41 ? 99  ASP C CA  1 
ATOM   2356 C  C   . ASP B 1 100 ? -16.266 16.855  16.074  1.00 18.08 ? 99  ASP C C   1 
ATOM   2357 O  O   . ASP B 1 100 ? -15.580 17.113  15.087  1.00 18.66 ? 99  ASP C O   1 
ATOM   2358 C  CB  . ASP B 1 100 ? -14.634 16.224  17.902  1.00 17.02 ? 99  ASP C CB  1 
ATOM   2359 C  CG  . ASP B 1 100 ? -13.769 16.809  19.002  1.00 17.54 ? 99  ASP C CG  1 
ATOM   2360 O  OD1 . ASP B 1 100 ? -13.806 18.055  19.182  1.00 15.47 ? 99  ASP C OD1 1 
ATOM   2361 O  OD2 . ASP B 1 100 ? -13.068 16.041  19.686  1.00 15.48 ? 99  ASP C OD2 1 
ATOM   2362 N  N   . PHE B 1 101 ? -17.471 16.289  16.004  1.00 17.82 ? 100 PHE C N   1 
ATOM   2363 C  CA  . PHE B 1 101 ? -18.091 15.868  14.742  1.00 18.04 ? 100 PHE C CA  1 
ATOM   2364 C  C   . PHE B 1 101 ? -19.540 16.336  14.565  1.00 18.26 ? 100 PHE C C   1 
ATOM   2365 O  O   . PHE B 1 101 ? -20.144 16.037  13.536  1.00 18.94 ? 100 PHE C O   1 
ATOM   2366 C  CB  . PHE B 1 101 ? -18.063 14.337  14.606  1.00 18.09 ? 100 PHE C CB  1 
ATOM   2367 C  CG  . PHE B 1 101 ? -16.673 13.763  14.554  1.00 18.38 ? 100 PHE C CG  1 
ATOM   2368 C  CD1 . PHE B 1 101 ? -16.047 13.341  15.716  1.00 17.86 ? 100 PHE C CD1 1 
ATOM   2369 C  CD2 . PHE B 1 101 ? -15.973 13.689  13.345  1.00 20.22 ? 100 PHE C CD2 1 
ATOM   2370 C  CE1 . PHE B 1 101 ? -14.739 12.842  15.678  1.00 18.51 ? 100 PHE C CE1 1 
ATOM   2371 C  CE2 . PHE B 1 101 ? -14.670 13.192  13.302  1.00 19.94 ? 100 PHE C CE2 1 
ATOM   2372 C  CZ  . PHE B 1 101 ? -14.060 12.773  14.465  1.00 18.15 ? 100 PHE C CZ  1 
ATOM   2373 N  N   . GLY B 1 102 ? -20.092 17.041  15.556  1.00 18.00 ? 101 GLY C N   1 
ATOM   2374 C  CA  . GLY B 1 102 ? -21.491 17.507  15.498  1.00 18.01 ? 101 GLY C CA  1 
ATOM   2375 C  C   . GLY B 1 102 ? -22.522 16.514  16.025  1.00 18.01 ? 101 GLY C C   1 
ATOM   2376 O  O   . GLY B 1 102 ? -23.461 16.896  16.725  1.00 17.82 ? 101 GLY C O   1 
ATOM   2377 N  N   . SER B 1 103 ? -22.359 15.236  15.674  1.00 17.76 ? 102 SER C N   1 
ATOM   2378 C  CA  . SER B 1 103 ? -23.257 14.168  16.138  1.00 17.92 ? 102 SER C CA  1 
ATOM   2379 C  C   . SER B 1 103 ? -22.609 12.809  15.952  1.00 17.83 ? 102 SER C C   1 
ATOM   2380 O  O   . SER B 1 103 ? -21.534 12.703  15.344  1.00 18.55 ? 102 SER C O   1 
ATOM   2381 C  CB  . SER B 1 103 ? -24.578 14.177  15.354  1.00 17.51 ? 102 SER C CB  1 
ATOM   2382 O  OG  . SER B 1 103 ? -24.336 13.956  13.969  1.00 17.68 ? 102 SER C OG  1 
ATOM   2383 N  N   . LEU B 1 104 ? -23.263 11.767  16.461  1.00 17.84 ? 103 LEU C N   1 
ATOM   2384 C  CA  . LEU B 1 104 ? -22.783 10.402  16.224  1.00 17.93 ? 103 LEU C CA  1 
ATOM   2385 C  C   . LEU B 1 104 ? -23.044 10.032  14.766  1.00 17.98 ? 103 LEU C C   1 
ATOM   2386 O  O   . LEU B 1 104 ? -22.198 9.424   14.120  1.00 17.82 ? 103 LEU C O   1 
ATOM   2387 C  CB  . LEU B 1 104 ? -23.431 9.397   17.183  1.00 17.63 ? 103 LEU C CB  1 
ATOM   2388 C  CG  . LEU B 1 104 ? -23.143 7.904   16.953  1.00 17.20 ? 103 LEU C CG  1 
ATOM   2389 C  CD1 . LEU B 1 104 ? -21.635 7.615   16.835  1.00 17.59 ? 103 LEU C CD1 1 
ATOM   2390 C  CD2 . LEU B 1 104 ? -23.761 7.045   18.037  1.00 17.93 ? 103 LEU C CD2 1 
ATOM   2391 N  N   . ASP B 1 105 ? -24.228 10.387  14.265  1.00 18.46 ? 104 ASP C N   1 
ATOM   2392 C  CA  . ASP B 1 105 ? -24.568 10.174  12.861  1.00 18.93 ? 104 ASP C CA  1 
ATOM   2393 C  C   . ASP B 1 105 ? -23.501 10.754  11.944  1.00 18.69 ? 104 ASP C C   1 
ATOM   2394 O  O   . ASP B 1 105 ? -23.105 10.103  10.985  1.00 17.50 ? 104 ASP C O   1 
ATOM   2395 C  CB  . ASP B 1 105 ? -25.941 10.774  12.507  1.00 19.04 ? 104 ASP C CB  1 
ATOM   2396 C  CG  . ASP B 1 105 ? -27.107 9.886   12.932  1.00 22.06 ? 104 ASP C CG  1 
ATOM   2397 O  OD1 . ASP B 1 105 ? -28.254 10.370  12.875  1.00 26.84 ? 104 ASP C OD1 1 
ATOM   2398 O  OD2 . ASP B 1 105 ? -26.894 8.708   13.314  1.00 25.81 ? 104 ASP C OD2 1 
ATOM   2399 N  N   . ASN B 1 106 ? -23.058 11.984  12.217  1.00 18.73 ? 105 ASN C N   1 
ATOM   2400 C  CA  . ASN B 1 106 ? -21.994 12.594  11.406  1.00 18.77 ? 105 ASN C CA  1 
ATOM   2401 C  C   . ASN B 1 106 ? -20.679 11.796  11.460  1.00 18.50 ? 105 ASN C C   1 
ATOM   2402 O  O   . ASN B 1 106 ? -20.053 11.527  10.424  1.00 17.91 ? 105 ASN C O   1 
ATOM   2403 C  CB  . ASN B 1 106 ? -21.731 14.041  11.848  1.00 19.18 ? 105 ASN C CB  1 
ATOM   2404 C  CG  . ASN B 1 106 ? -22.820 15.023  11.413  1.00 19.56 ? 105 ASN C CG  1 
ATOM   2405 O  OD1 . ASN B 1 106 ? -23.765 14.681  10.690  1.00 21.01 ? 105 ASN C OD1 1 
ATOM   2406 N  ND2 . ASN B 1 106 ? -22.689 16.267  11.871  1.00 19.76 ? 105 ASN C ND2 1 
ATOM   2407 N  N   . LEU B 1 107 ? -20.272 11.414  12.667  1.00 18.08 ? 106 LEU C N   1 
ATOM   2408 C  CA  . LEU B 1 107 ? -19.073 10.626  12.861  1.00 18.20 ? 106 LEU C CA  1 
ATOM   2409 C  C   . LEU B 1 107 ? -19.159 9.310   12.062  1.00 18.32 ? 106 LEU C C   1 
ATOM   2410 O  O   . LEU B 1 107 ? -18.237 8.973   11.317  1.00 18.85 ? 106 LEU C O   1 
ATOM   2411 C  CB  . LEU B 1 107 ? -18.849 10.331  14.350  1.00 18.34 ? 106 LEU C CB  1 
ATOM   2412 C  CG  . LEU B 1 107 ? -17.741 9.299   14.649  1.00 16.66 ? 106 LEU C CG  1 
ATOM   2413 C  CD1 . LEU B 1 107 ? -16.417 9.675   13.989  1.00 15.50 ? 106 LEU C CD1 1 
ATOM   2414 C  CD2 . LEU B 1 107 ? -17.549 9.091   16.115  1.00 18.12 ? 106 LEU C CD2 1 
ATOM   2415 N  N   . GLN B 1 108 ? -20.278 8.594   12.210  1.00 18.54 ? 107 GLN C N   1 
ATOM   2416 C  CA  . GLN B 1 108 ? -20.466 7.329   11.478  1.00 18.80 ? 107 GLN C CA  1 
ATOM   2417 C  C   . GLN B 1 108 ? -20.395 7.527   9.971   1.00 18.56 ? 107 GLN C C   1 
ATOM   2418 O  O   . GLN B 1 108 ? -19.726 6.758   9.287   1.00 19.49 ? 107 GLN C O   1 
ATOM   2419 C  CB  . GLN B 1 108 ? -21.783 6.670   11.859  1.00 18.94 ? 107 GLN C CB  1 
ATOM   2420 C  CG  . GLN B 1 108 ? -21.741 6.072   13.240  1.00 20.74 ? 107 GLN C CG  1 
ATOM   2421 C  CD  . GLN B 1 108 ? -23.102 5.632   13.720  1.00 22.19 ? 107 GLN C CD  1 
ATOM   2422 O  OE1 . GLN B 1 108 ? -24.134 6.176   13.304  1.00 24.71 ? 107 GLN C OE1 1 
ATOM   2423 N  NE2 . GLN B 1 108 ? -23.116 4.658   14.616  1.00 22.80 ? 107 GLN C NE2 1 
ATOM   2424 N  N   . LYS B 1 109 ? -21.056 8.566   9.455   1.00 18.29 ? 108 LYS C N   1 
ATOM   2425 C  CA  . LYS B 1 109 ? -20.977 8.851   8.025   1.00 18.36 ? 108 LYS C CA  1 
ATOM   2426 C  C   . LYS B 1 109 ? -19.546 9.130   7.572   1.00 18.22 ? 108 LYS C C   1 
ATOM   2427 O  O   . LYS B 1 109 ? -19.061 8.510   6.630   1.00 17.65 ? 108 LYS C O   1 
ATOM   2428 C  CB  . LYS B 1 109 ? -21.871 10.027  7.622   1.00 19.15 ? 108 LYS C CB  1 
ATOM   2429 C  CG  . LYS B 1 109 ? -21.839 10.217  6.131   1.00 21.22 ? 108 LYS C CG  1 
ATOM   2430 C  CD  . LYS B 1 109 ? -22.784 11.271  5.627   1.00 25.07 ? 108 LYS C CD  1 
ATOM   2431 C  CE  . LYS B 1 109 ? -22.636 11.367  4.117   1.00 27.47 ? 108 LYS C CE  1 
ATOM   2432 N  NZ  . LYS B 1 109 ? -23.414 12.513  3.565   1.00 30.90 ? 108 LYS C NZ  1 
ATOM   2433 N  N   . ARG B 1 110 ? -18.890 10.076  8.238   1.00 17.60 ? 109 ARG C N   1 
ATOM   2434 C  CA  . ARG B 1 110 ? -17.511 10.462  7.885   1.00 17.68 ? 109 ARG C CA  1 
ATOM   2435 C  C   . ARG B 1 110 ? -16.499 9.305   7.967   1.00 17.58 ? 109 ARG C C   1 
ATOM   2436 O  O   . ARG B 1 110 ? -15.691 9.119   7.051   1.00 18.10 ? 109 ARG C O   1 
ATOM   2437 C  CB  . ARG B 1 110 ? -17.056 11.681  8.701   1.00 18.09 ? 109 ARG C CB  1 
ATOM   2438 C  CG  . ARG B 1 110 ? -17.743 12.979  8.280   1.00 19.73 ? 109 ARG C CG  1 
ATOM   2439 C  CD  . ARG B 1 110 ? -17.444 14.125  9.210   1.00 20.34 ? 109 ARG C CD  1 
ATOM   2440 N  NE  . ARG B 1 110 ? -16.030 14.479  9.169   1.00 24.81 ? 109 ARG C NE  1 
ATOM   2441 C  CZ  . ARG B 1 110 ? -15.474 15.442  9.900   1.00 24.58 ? 109 ARG C CZ  1 
ATOM   2442 N  NH1 . ARG B 1 110 ? -16.198 16.158  10.751  1.00 24.09 ? 109 ARG C NH1 1 
ATOM   2443 N  NH2 . ARG B 1 110 ? -14.177 15.672  9.786   1.00 25.04 ? 109 ARG C NH2 1 
ATOM   2444 N  N   . LEU B 1 111 ? -16.531 8.540   9.054   1.00 17.28 ? 110 LEU C N   1 
ATOM   2445 C  CA  . LEU B 1 111 ? -15.629 7.397   9.182   1.00 16.97 ? 110 LEU C CA  1 
ATOM   2446 C  C   . LEU B 1 111 ? -16.005 6.302   8.165   1.00 16.52 ? 110 LEU C C   1 
ATOM   2447 O  O   . LEU B 1 111 ? -15.146 5.758   7.482   1.00 15.65 ? 110 LEU C O   1 
ATOM   2448 C  CB  . LEU B 1 111 ? -15.628 6.851   10.614  1.00 16.74 ? 110 LEU C CB  1 
ATOM   2449 C  CG  . LEU B 1 111 ? -14.697 5.646   10.835  1.00 17.44 ? 110 LEU C CG  1 
ATOM   2450 C  CD1 . LEU B 1 111 ? -13.272 5.911   10.302  1.00 15.26 ? 110 LEU C CD1 1 
ATOM   2451 C  CD2 . LEU B 1 111 ? -14.693 5.284   12.316  1.00 19.10 ? 110 LEU C CD2 1 
ATOM   2452 N  N   . SER B 1 112 ? -17.305 5.999   8.037   1.00 15.88 ? 111 SER C N   1 
ATOM   2453 C  CA  . SER B 1 112 ? -17.688 5.007   7.034   1.00 16.79 ? 111 SER C CA  1 
ATOM   2454 C  C   . SER B 1 112 ? -17.196 5.380   5.644   1.00 16.71 ? 111 SER C C   1 
ATOM   2455 O  O   . SER B 1 112 ? -16.677 4.517   4.926   1.00 17.47 ? 111 SER C O   1 
ATOM   2456 C  CB  . SER B 1 112 ? -19.198 4.776   7.008   1.00 17.15 ? 111 SER C CB  1 
ATOM   2457 O  OG  . SER B 1 112 ? -19.626 4.243   8.237   1.00 19.01 ? 111 SER C OG  1 
ATOM   2458 N  N   . ASP B 1 113 ? -17.338 6.657   5.276   1.00 17.10 ? 112 ASP C N   1 
ATOM   2459 C  CA  . ASP B 1 113 ? -16.944 7.121   3.941   1.00 17.24 ? 112 ASP C CA  1 
ATOM   2460 C  C   . ASP B 1 113 ? -15.468 6.961   3.680   1.00 16.12 ? 112 ASP C C   1 
ATOM   2461 O  O   . ASP B 1 113 ? -15.084 6.399   2.651   1.00 16.81 ? 112 ASP C O   1 
ATOM   2462 C  CB  . ASP B 1 113 ? -17.349 8.568   3.699   1.00 17.60 ? 112 ASP C CB  1 
ATOM   2463 C  CG  . ASP B 1 113 ? -18.861 8.718   3.409   1.00 19.18 ? 112 ASP C CG  1 
ATOM   2464 O  OD1 . ASP B 1 113 ? -19.560 7.700   3.196   1.00 20.33 ? 112 ASP C OD1 1 
ATOM   2465 O  OD2 . ASP B 1 113 ? -19.340 9.862   3.392   1.00 25.09 ? 112 ASP C OD2 1 
ATOM   2466 N  N   . ILE B 1 114 ? -14.636 7.400   4.619   1.00 15.55 ? 113 ILE C N   1 
ATOM   2467 C  CA  . ILE B 1 114 ? -13.181 7.288   4.386   1.00 15.96 ? 113 ILE C CA  1 
ATOM   2468 C  C   . ILE B 1 114 ? -12.763 5.804   4.399   1.00 15.90 ? 113 ILE C C   1 
ATOM   2469 O  O   . ILE B 1 114 ? -11.875 5.396   3.648   1.00 16.81 ? 113 ILE C O   1 
ATOM   2470 C  CB  . ILE B 1 114 ? -12.310 8.172   5.322   1.00 16.04 ? 113 ILE C CB  1 
ATOM   2471 C  CG1 . ILE B 1 114 ? -12.336 7.712   6.788   1.00 17.09 ? 113 ILE C CG1 1 
ATOM   2472 C  CG2 . ILE B 1 114 ? -12.623 9.699   5.122   1.00 16.80 ? 113 ILE C CG2 1 
ATOM   2473 C  CD1 . ILE B 1 114 ? -11.291 8.434   7.701   1.00 17.29 ? 113 ILE C CD1 1 
ATOM   2474 N  N   . THR B 1 115 ? -13.414 5.003   5.240   1.00 14.82 ? 114 THR C N   1 
ATOM   2475 C  CA  . THR B 1 115 ? -13.107 3.570   5.338   1.00 15.57 ? 114 THR C CA  1 
ATOM   2476 C  C   . THR B 1 115 ? -13.476 2.848   4.025   1.00 15.27 ? 114 THR C C   1 
ATOM   2477 O  O   . THR B 1 115 ? -12.707 2.049   3.485   1.00 15.58 ? 114 THR C O   1 
ATOM   2478 C  CB  . THR B 1 115 ? -13.843 2.938   6.553   1.00 15.14 ? 114 THR C CB  1 
ATOM   2479 O  OG1 . THR B 1 115 ? -13.399 3.595   7.747   1.00 16.86 ? 114 THR C OG1 1 
ATOM   2480 C  CG2 . THR B 1 115 ? -13.495 1.503   6.680   1.00 14.74 ? 114 THR C CG2 1 
ATOM   2481 N  N   . ILE B 1 116 ? -14.654 3.157   3.501   1.00 16.29 ? 115 ILE C N   1 
ATOM   2482 C  CA  . ILE B 1 116 ? -15.080 2.594   2.231   1.00 16.42 ? 115 ILE C CA  1 
ATOM   2483 C  C   . ILE B 1 116 ? -14.113 2.942   1.100   1.00 16.46 ? 115 ILE C C   1 
ATOM   2484 O  O   . ILE B 1 116 ? -13.865 2.126   0.213   1.00 16.64 ? 115 ILE C O   1 
ATOM   2485 C  CB  . ILE B 1 116 ? -16.526 3.018   1.907   1.00 16.73 ? 115 ILE C CB  1 
ATOM   2486 C  CG1 . ILE B 1 116 ? -17.475 2.257   2.838   1.00 14.91 ? 115 ILE C CG1 1 
ATOM   2487 C  CG2 . ILE B 1 116 ? -16.884 2.783   0.428   1.00 17.78 ? 115 ILE C CG2 1 
ATOM   2488 C  CD1 . ILE B 1 116 ? -18.887 2.911   2.912   1.00 16.42 ? 115 ILE C CD1 1 
ATOM   2489 N  N   . ALA B 1 117 ? -13.582 4.162   1.159   1.00 15.63 ? 116 ALA C N   1 
ATOM   2490 C  CA  . ALA B 1 117 ? -12.657 4.711   0.141   1.00 16.43 ? 116 ALA C CA  1 
ATOM   2491 C  C   . ALA B 1 117 ? -11.220 4.165   0.170   1.00 16.50 ? 116 ALA C C   1 
ATOM   2492 O  O   . ALA B 1 117 ? -10.402 4.507   -0.707  1.00 17.27 ? 116 ALA C O   1 
ATOM   2493 C  CB  . ALA B 1 117 ? -12.642 6.207   0.255   1.00 15.67 ? 116 ALA C CB  1 
ATOM   2494 N  N   . VAL B 1 118 ? -10.881 3.346   1.171   1.00 16.53 ? 117 VAL C N   1 
ATOM   2495 C  CA  . VAL B 1 118 ? -9.535  2.787   1.255   1.00 16.81 ? 117 VAL C CA  1 
ATOM   2496 C  C   . VAL B 1 118 ? -9.222  2.014   -0.026  1.00 16.28 ? 117 VAL C C   1 
ATOM   2497 O  O   . VAL B 1 118 ? -10.037 1.196   -0.474  1.00 15.88 ? 117 VAL C O   1 
ATOM   2498 C  CB  . VAL B 1 118 ? -9.400  1.825   2.485   1.00 17.25 ? 117 VAL C CB  1 
ATOM   2499 C  CG1 . VAL B 1 118 ? -8.137  0.988   2.366   1.00 19.51 ? 117 VAL C CG1 1 
ATOM   2500 C  CG2 . VAL B 1 118 ? -9.360  2.694   3.759   1.00 17.21 ? 117 VAL C CG2 1 
ATOM   2501 N  N   . GLN B 1 119 ? -8.087  2.323   -0.631  1.00 14.33 ? 118 GLN C N   1 
ATOM   2502 C  CA  . GLN B 1 119 ? -7.657  1.668   -1.852  1.00 16.17 ? 118 GLN C CA  1 
ATOM   2503 C  C   . GLN B 1 119 ? -6.851  0.454   -1.479  1.00 16.06 ? 118 GLN C C   1 
ATOM   2504 O  O   . GLN B 1 119 ? -5.724  0.570   -0.936  1.00 16.66 ? 118 GLN C O   1 
ATOM   2505 C  CB  . GLN B 1 119 ? -6.827  2.604   -2.738  1.00 16.19 ? 118 GLN C CB  1 
ATOM   2506 C  CG  . GLN B 1 119 ? -7.654  3.776   -3.258  1.00 17.07 ? 118 GLN C CG  1 
ATOM   2507 C  CD  . GLN B 1 119 ? -6.854  4.726   -4.149  1.00 18.41 ? 118 GLN C CD  1 
ATOM   2508 O  OE1 . GLN B 1 119 ? -7.446  5.618   -4.778  1.00 25.47 ? 118 GLN C OE1 1 
ATOM   2509 N  NE2 . GLN B 1 119 ? -5.541  4.489   -4.269  1.00 18.67 ? 118 GLN C NE2 1 
ATOM   2510 N  N   . GLY B 1 120 ? -7.388  -0.706  -1.818  1.00 15.58 ? 119 GLY C N   1 
ATOM   2511 C  CA  . GLY B 1 120 ? -6.737  -1.972  -1.427  1.00 14.65 ? 119 GLY C CA  1 
ATOM   2512 C  C   . GLY B 1 120 ? -7.085  -2.337  -0.007  1.00 14.33 ? 119 GLY C C   1 
ATOM   2513 O  O   . GLY B 1 120 ? -8.209  -2.123  0.459   1.00 14.27 ? 119 GLY C O   1 
ATOM   2514 N  N   . SER B 1 121 ? -6.104  -2.895  0.703   1.00 15.20 ? 120 SER C N   1 
ATOM   2515 C  CA  . SER B 1 121 ? -6.354  -3.387  2.045   1.00 15.08 ? 120 SER C CA  1 
ATOM   2516 C  C   . SER B 1 121 ? -6.012  -2.308  3.066   1.00 15.26 ? 120 SER C C   1 
ATOM   2517 O  O   . SER B 1 121 ? -5.010  -1.620  2.924   1.00 15.44 ? 120 SER C O   1 
ATOM   2518 C  CB  . SER B 1 121 ? -5.454  -4.585  2.350   1.00 14.84 ? 120 SER C CB  1 
ATOM   2519 O  OG  . SER B 1 121 ? -5.559  -5.609  1.377   1.00 14.62 ? 120 SER C OG  1 
ATOM   2520 N  N   . GLY B 1 122 ? -6.791  -2.228  4.111   1.00 15.00 ? 121 GLY C N   1 
ATOM   2521 C  CA  . GLY B 1 122 ? -6.483  -1.270  5.161   1.00 15.32 ? 121 GLY C CA  1 
ATOM   2522 C  C   . GLY B 1 122 ? -7.558  -1.262  6.267   1.00 14.93 ? 121 GLY C C   1 
ATOM   2523 O  O   . GLY B 1 122 ? -8.354  -2.192  6.412   1.00 14.01 ? 121 GLY C O   1 
ATOM   2524 N  N   . TRP B 1 123 ? -7.563  -0.172  7.027   1.00 14.56 ? 122 TRP C N   1 
ATOM   2525 C  CA  . TRP B 1 123 ? -8.373  -0.004  8.186   1.00 14.90 ? 122 TRP C CA  1 
ATOM   2526 C  C   . TRP B 1 123 ? -8.846  1.440   8.296   1.00 14.75 ? 122 TRP C C   1 
ATOM   2527 O  O   . TRP B 1 123 ? -8.184  2.346   7.820   1.00 13.98 ? 122 TRP C O   1 
ATOM   2528 C  CB  . TRP B 1 123 ? -7.565  -0.295  9.452   1.00 14.98 ? 122 TRP C CB  1 
ATOM   2529 C  CG  . TRP B 1 123 ? -7.119  -1.694  9.678   1.00 15.78 ? 122 TRP C CG  1 
ATOM   2530 C  CD1 . TRP B 1 123 ? -6.122  -2.375  9.069   1.00 16.54 ? 122 TRP C CD1 1 
ATOM   2531 C  CD2 . TRP B 1 123 ? -7.720  -2.607  10.632  1.00 16.29 ? 122 TRP C CD2 1 
ATOM   2532 N  NE1 . TRP B 1 123 ? -6.062  -3.669  9.565   1.00 16.99 ? 122 TRP C NE1 1 
ATOM   2533 C  CE2 . TRP B 1 123 ? -7.031  -3.813  10.526  1.00 15.67 ? 122 TRP C CE2 1 
ATOM   2534 C  CE3 . TRP B 1 123 ? -8.793  -2.499  11.564  1.00 13.05 ? 122 TRP C CE3 1 
ATOM   2535 C  CZ2 . TRP B 1 123 ? -7.361  -4.928  11.309  1.00 14.37 ? 122 TRP C CZ2 1 
ATOM   2536 C  CZ3 . TRP B 1 123 ? -9.084  -3.590  12.341  1.00 14.83 ? 122 TRP C CZ3 1 
ATOM   2537 C  CH2 . TRP B 1 123 ? -8.383  -4.799  12.218  1.00 15.75 ? 122 TRP C CH2 1 
ATOM   2538 N  N   . GLY B 1 124 ? -9.982  1.609   8.951   1.00 14.66 ? 123 GLY C N   1 
ATOM   2539 C  CA  . GLY B 1 124 ? -10.571 2.921   9.232   1.00 15.50 ? 123 GLY C CA  1 
ATOM   2540 C  C   . GLY B 1 124 ? -10.514 3.044   10.759  1.00 14.93 ? 123 GLY C C   1 
ATOM   2541 O  O   . GLY B 1 124 ? -10.754 2.063   11.457  1.00 16.00 ? 123 GLY C O   1 
ATOM   2542 N  N   . TRP B 1 125 ? -10.167 4.216   11.291  1.00 15.15 ? 124 TRP C N   1 
ATOM   2543 C  CA  . TRP B 1 125 ? -10.061 4.366   12.729  1.00 15.19 ? 124 TRP C CA  1 
ATOM   2544 C  C   . TRP B 1 125 ? -10.637 5.637   13.300  1.00 15.77 ? 124 TRP C C   1 
ATOM   2545 O  O   . TRP B 1 125 ? -10.547 6.708   12.693  1.00 15.57 ? 124 TRP C O   1 
ATOM   2546 C  CB  . TRP B 1 125 ? -8.586  4.436   13.176  1.00 16.04 ? 124 TRP C CB  1 
ATOM   2547 C  CG  . TRP B 1 125 ? -7.876  3.145   13.109  1.00 15.77 ? 124 TRP C CG  1 
ATOM   2548 C  CD1 . TRP B 1 125 ? -6.997  2.776   12.124  1.00 17.19 ? 124 TRP C CD1 1 
ATOM   2549 C  CD2 . TRP B 1 125 ? -7.944  2.054   14.026  1.00 16.57 ? 124 TRP C CD2 1 
ATOM   2550 N  NE1 . TRP B 1 125 ? -6.542  1.508   12.365  1.00 17.02 ? 124 TRP C NE1 1 
ATOM   2551 C  CE2 . TRP B 1 125 ? -7.102  1.043   13.526  1.00 15.04 ? 124 TRP C CE2 1 
ATOM   2552 C  CE3 . TRP B 1 125 ? -8.641  1.828   15.226  1.00 15.75 ? 124 TRP C CE3 1 
ATOM   2553 C  CZ2 . TRP B 1 125 ? -6.927  -0.197  14.182  1.00 18.74 ? 124 TRP C CZ2 1 
ATOM   2554 C  CZ3 . TRP B 1 125 ? -8.477  0.595   15.850  1.00 18.83 ? 124 TRP C CZ3 1 
ATOM   2555 C  CH2 . TRP B 1 125 ? -7.630  -0.402  15.343  1.00 18.95 ? 124 TRP C CH2 1 
ATOM   2556 N  N   . LEU B 1 126 ? -11.246 5.479   14.477  1.00 14.99 ? 125 LEU C N   1 
ATOM   2557 C  CA  . LEU B 1 126 ? -11.674 6.594   15.297  1.00 14.81 ? 125 LEU C CA  1 
ATOM   2558 C  C   . LEU B 1 126 ? -10.601 6.634   16.316  1.00 14.81 ? 125 LEU C C   1 
ATOM   2559 O  O   . LEU B 1 126 ? -10.358 5.628   16.987  1.00 14.78 ? 125 LEU C O   1 
ATOM   2560 C  CB  . LEU B 1 126 ? -13.037 6.425   15.987  1.00 14.27 ? 125 LEU C CB  1 
ATOM   2561 C  CG  . LEU B 1 126 ? -13.337 7.413   17.123  1.00 15.24 ? 125 LEU C CG  1 
ATOM   2562 C  CD1 . LEU B 1 126 ? -13.450 8.839   16.588  1.00 15.38 ? 125 LEU C CD1 1 
ATOM   2563 C  CD2 . LEU B 1 126 ? -14.600 7.021   17.876  1.00 14.94 ? 125 LEU C CD2 1 
ATOM   2564 N  N   . GLY B 1 127 ? -9.927  7.740   16.509  1.00 14.97 ? 126 GLY C N   1 
ATOM   2565 C  CA  . GLY B 1 127 ? -8.886  7.826   17.510  1.00 15.59 ? 126 GLY C CA  1 
ATOM   2566 C  C   . GLY B 1 127 ? -8.958  9.086   18.348  1.00 16.33 ? 126 GLY C C   1 
ATOM   2567 O  O   . GLY B 1 127 ? -9.719  9.999   18.043  1.00 16.22 ? 126 GLY C O   1 
ATOM   2568 N  N   . TYR B 1 128 ? -8.140  9.113   19.392  1.00 17.14 ? 127 TYR C N   1 
ATOM   2569 C  CA  . TYR B 1 128 ? -8.067  10.288  20.254  1.00 18.15 ? 127 TYR C CA  1 
ATOM   2570 C  C   . TYR B 1 128 ? -6.665  10.865  20.224  1.00 19.35 ? 127 TYR C C   1 
ATOM   2571 O  O   . TYR B 1 128 ? -5.698  10.183  20.553  1.00 18.76 ? 127 TYR C O   1 
ATOM   2572 C  CB  . TYR B 1 128 ? -8.466  9.959   21.685  1.00 18.20 ? 127 TYR C CB  1 
ATOM   2573 C  CG  . TYR B 1 128 ? -8.479  11.179  22.591  1.00 17.80 ? 127 TYR C CG  1 
ATOM   2574 C  CD1 . TYR B 1 128 ? -9.483  12.126  22.477  1.00 18.53 ? 127 TYR C CD1 1 
ATOM   2575 C  CD2 . TYR B 1 128 ? -7.472  11.383  23.544  1.00 18.47 ? 127 TYR C CD2 1 
ATOM   2576 C  CE1 . TYR B 1 128 ? -9.512  13.243  23.290  1.00 17.20 ? 127 TYR C CE1 1 
ATOM   2577 C  CE2 . TYR B 1 128 ? -7.481  12.511  24.372  1.00 18.71 ? 127 TYR C CE2 1 
ATOM   2578 C  CZ  . TYR B 1 128 ? -8.506  13.434  24.232  1.00 19.00 ? 127 TYR C CZ  1 
ATOM   2579 O  OH  . TYR B 1 128 ? -8.521  14.544  25.044  1.00 20.08 ? 127 TYR C OH  1 
ATOM   2580 N  N   . CYS B 1 129 ? -6.571  12.130  19.828  1.00 20.99 ? 128 CYS C N   1 
ATOM   2581 C  CA  . CYS B 1 129 ? -5.293  12.818  19.758  1.00 22.02 ? 128 CYS C CA  1 
ATOM   2582 C  C   . CYS B 1 129 ? -5.078  13.507  21.106  1.00 22.36 ? 128 CYS C C   1 
ATOM   2583 O  O   . CYS B 1 129 ? -5.830  14.410  21.487  1.00 21.94 ? 128 CYS C O   1 
ATOM   2584 C  CB  . CYS B 1 129 ? -5.299  13.836  18.613  1.00 22.12 ? 128 CYS C CB  1 
ATOM   2585 S  SG  . CYS B 1 129 ? -3.717  14.729  18.422  1.00 25.10 ? 128 CYS C SG  1 
ATOM   2586 N  N   . LYS B 1 130 ? -4.060  13.058  21.826  1.00 23.58 ? 129 LYS C N   1 
ATOM   2587 C  CA  . LYS B 1 130 ? -3.791  13.534  23.189  1.00 24.76 ? 129 LYS C CA  1 
ATOM   2588 C  C   . LYS B 1 130 ? -3.263  14.959  23.288  1.00 25.02 ? 129 LYS C C   1 
ATOM   2589 O  O   . LYS B 1 130 ? -3.587  15.667  24.242  1.00 25.52 ? 129 LYS C O   1 
ATOM   2590 C  CB  . LYS B 1 130 ? -2.869  12.551  23.921  1.00 25.13 ? 129 LYS C CB  1 
ATOM   2591 C  CG  . LYS B 1 130 ? -3.528  11.206  24.136  1.00 27.26 ? 129 LYS C CG  1 
ATOM   2592 C  CD  . LYS B 1 130 ? -2.557  10.129  24.569  1.00 31.37 ? 129 LYS C CD  1 
ATOM   2593 C  CE  . LYS B 1 130 ? -2.465  9.990   26.068  1.00 32.93 ? 129 LYS C CE  1 
ATOM   2594 N  NZ  . LYS B 1 130 ? -1.630  8.788   26.382  1.00 34.34 ? 129 LYS C NZ  1 
ATOM   2595 N  N   . LYS B 1 131 ? -2.479  15.371  22.295  1.00 25.15 ? 130 LYS C N   1 
ATOM   2596 C  CA  . LYS B 1 131 ? -1.880  16.706  22.225  1.00 25.30 ? 130 LYS C CA  1 
ATOM   2597 C  C   . LYS B 1 131 ? -2.954  17.785  22.080  1.00 24.51 ? 130 LYS C C   1 
ATOM   2598 O  O   . LYS B 1 131 ? -3.008  18.747  22.861  1.00 25.21 ? 130 LYS C O   1 
ATOM   2599 C  CB  . LYS B 1 131 ? -0.913  16.756  21.032  1.00 25.37 ? 130 LYS C CB  1 
ATOM   2600 C  CG  . LYS B 1 131 ? -0.019  17.994  20.889  1.00 28.11 ? 130 LYS C CG  1 
ATOM   2601 C  CD  . LYS B 1 131 ? 1.097   18.028  21.930  1.00 31.14 ? 130 LYS C CD  1 
ATOM   2602 C  CE  . LYS B 1 131 ? 2.322   18.784  21.429  1.00 32.48 ? 130 LYS C CE  1 
ATOM   2603 N  NZ  . LYS B 1 131 ? 3.069   17.996  20.392  1.00 33.63 ? 130 LYS C NZ  1 
ATOM   2604 N  N   . ASP B 1 132 ? -3.827  17.616  21.091  1.00 23.77 ? 131 ASP C N   1 
ATOM   2605 C  CA  . ASP B 1 132 ? -4.865  18.603  20.837  1.00 22.87 ? 131 ASP C CA  1 
ATOM   2606 C  C   . ASP B 1 132 ? -6.158  18.255  21.556  1.00 22.31 ? 131 ASP C C   1 
ATOM   2607 O  O   . ASP B 1 132 ? -7.122  19.017  21.507  1.00 21.59 ? 131 ASP C O   1 
ATOM   2608 C  CB  . ASP B 1 132 ? -5.050  18.812  19.333  1.00 23.42 ? 131 ASP C CB  1 
ATOM   2609 C  CG  . ASP B 1 132 ? -3.828  19.463  18.693  1.00 24.61 ? 131 ASP C CG  1 
ATOM   2610 O  OD1 . ASP B 1 132 ? -3.243  20.375  19.333  1.00 28.11 ? 131 ASP C OD1 1 
ATOM   2611 O  OD2 . ASP B 1 132 ? -3.454  19.064  17.574  1.00 26.47 ? 131 ASP C OD2 1 
ATOM   2612 N  N   . LYS B 1 133 ? -6.154  17.107  22.241  1.00 20.85 ? 132 LYS C N   1 
ATOM   2613 C  CA  . LYS B 1 133 ? -7.297  16.677  23.057  1.00 20.24 ? 132 LYS C CA  1 
ATOM   2614 C  C   . LYS B 1 133 ? -8.586  16.646  22.239  1.00 19.05 ? 132 LYS C C   1 
ATOM   2615 O  O   . LYS B 1 133 ? -9.624  17.171  22.657  1.00 18.81 ? 132 LYS C O   1 
ATOM   2616 C  CB  . LYS B 1 133 ? -7.462  17.576  24.299  1.00 20.21 ? 132 LYS C CB  1 
ATOM   2617 C  CG  . LYS B 1 133 ? -6.247  17.648  25.211  1.00 21.78 ? 132 LYS C CG  1 
ATOM   2618 C  CD  . LYS B 1 133 ? -6.558  18.449  26.473  1.00 21.72 ? 132 LYS C CD  1 
ATOM   2619 C  CE  . LYS B 1 133 ? -5.457  18.269  27.510  1.00 25.26 ? 132 LYS C CE  1 
ATOM   2620 N  NZ  . LYS B 1 133 ? -5.760  18.965  28.799  1.00 26.51 ? 132 LYS C NZ  1 
ATOM   2621 N  N   . ILE B 1 134 ? -8.509  16.028  21.065  1.00 17.88 ? 133 ILE C N   1 
ATOM   2622 C  CA  . ILE B 1 134 ? -9.658  15.926  20.181  1.00 17.51 ? 133 ILE C CA  1 
ATOM   2623 C  C   . ILE B 1 134 ? -9.756  14.541  19.560  1.00 16.85 ? 133 ILE C C   1 
ATOM   2624 O  O   . ILE B 1 134 ? -8.746  13.834  19.414  1.00 16.41 ? 133 ILE C O   1 
ATOM   2625 C  CB  . ILE B 1 134 ? -9.631  16.976  19.026  1.00 17.58 ? 133 ILE C CB  1 
ATOM   2626 C  CG1 . ILE B 1 134 ? -8.315  16.895  18.247  1.00 19.38 ? 133 ILE C CG1 1 
ATOM   2627 C  CG2 . ILE B 1 134 ? -9.916  18.401  19.554  1.00 18.18 ? 133 ILE C CG2 1 
ATOM   2628 C  CD1 . ILE B 1 134 ? -8.405  17.564  16.894  1.00 25.22 ? 133 ILE C CD1 1 
ATOM   2629 N  N   . LEU B 1 135 ? -10.981 14.165  19.205  1.00 15.62 ? 134 LEU C N   1 
ATOM   2630 C  CA  . LEU B 1 135 ? -11.206 12.940  18.444  1.00 15.44 ? 134 LEU C CA  1 
ATOM   2631 C  C   . LEU B 1 135 ? -10.864 13.224  16.991  1.00 15.88 ? 134 LEU C C   1 
ATOM   2632 O  O   . LEU B 1 135 ? -11.047 14.354  16.498  1.00 16.04 ? 134 LEU C O   1 
ATOM   2633 C  CB  . LEU B 1 135 ? -12.661 12.488  18.563  1.00 14.83 ? 134 LEU C CB  1 
ATOM   2634 C  CG  . LEU B 1 135 ? -13.136 12.059  19.943  1.00 14.02 ? 134 LEU C CG  1 
ATOM   2635 C  CD1 . LEU B 1 135 ? -14.651 11.922  19.901  1.00 16.00 ? 134 LEU C CD1 1 
ATOM   2636 C  CD2 . LEU B 1 135 ? -12.449 10.760  20.378  1.00 15.47 ? 134 LEU C CD2 1 
ATOM   2637 N  N   . LYS B 1 136 ? -10.343 12.201  16.315  1.00 15.79 ? 135 LYS C N   1 
ATOM   2638 C  CA  . LYS B 1 136 ? -10.009 12.297  14.919  1.00 17.06 ? 135 LYS C CA  1 
ATOM   2639 C  C   . LYS B 1 136 ? -10.321 10.977  14.218  1.00 16.23 ? 135 LYS C C   1 
ATOM   2640 O  O   . LYS B 1 136 ? -10.417 9.935   14.859  1.00 16.99 ? 135 LYS C O   1 
ATOM   2641 C  CB  . LYS B 1 136 ? -8.514  12.563  14.747  1.00 16.84 ? 135 LYS C CB  1 
ATOM   2642 C  CG  . LYS B 1 136 ? -8.034  13.932  15.233  1.00 20.01 ? 135 LYS C CG  1 
ATOM   2643 C  CD  . LYS B 1 136 ? -6.527  13.997  14.978  1.00 23.92 ? 135 LYS C CD  1 
ATOM   2644 C  CE  . LYS B 1 136 ? -5.993  15.393  15.210  1.00 28.57 ? 135 LYS C CE  1 
ATOM   2645 N  NZ  . LYS B 1 136 ? -4.507  15.482  14.965  1.00 29.84 ? 135 LYS C NZ  1 
ATOM   2646 N  N   . ILE B 1 137 ? -10.514 11.050  12.905  1.00 16.03 ? 136 ILE C N   1 
ATOM   2647 C  CA  . ILE B 1 137 ? -10.679 9.834   12.113  1.00 15.79 ? 136 ILE C CA  1 
ATOM   2648 C  C   . ILE B 1 137 ? -9.553  9.740   11.100  1.00 15.17 ? 136 ILE C C   1 
ATOM   2649 O  O   . ILE B 1 137 ? -9.016  10.752  10.644  1.00 14.50 ? 136 ILE C O   1 
ATOM   2650 C  CB  . ILE B 1 137 ? -12.050 9.706   11.440  1.00 15.03 ? 136 ILE C CB  1 
ATOM   2651 C  CG1 . ILE B 1 137 ? -12.370 10.961  10.604  1.00 16.24 ? 136 ILE C CG1 1 
ATOM   2652 C  CG2 . ILE B 1 137 ? -13.145 9.556   12.508  1.00 17.42 ? 136 ILE C CG2 1 
ATOM   2653 C  CD1 . ILE B 1 137 ? -13.650 10.814  9.752   1.00 17.19 ? 136 ILE C CD1 1 
ATOM   2654 N  N   . ALA B 1 138 ? -9.189  8.506   10.753  1.00 15.83 ? 137 ALA C N   1 
ATOM   2655 C  CA  . ALA B 1 138 ? -8.065  8.297   9.855   1.00 15.81 ? 137 ALA C CA  1 
ATOM   2656 C  C   . ALA B 1 138 ? -8.182  6.923   9.232   1.00 16.27 ? 137 ALA C C   1 
ATOM   2657 O  O   . ALA B 1 138 ? -8.966  6.109   9.677   1.00 17.00 ? 137 ALA C O   1 
ATOM   2658 C  CB  . ALA B 1 138 ? -6.761  8.368   10.653  1.00 17.38 ? 137 ALA C CB  1 
ATOM   2659 N  N   . THR B 1 139 ? -7.404  6.675   8.193   1.00 15.66 ? 138 THR C N   1 
ATOM   2660 C  CA  . THR B 1 139 ? -7.317  5.320   7.655   1.00 16.27 ? 138 THR C CA  1 
ATOM   2661 C  C   . THR B 1 139 ? -5.848  4.919   7.699   1.00 15.69 ? 138 THR C C   1 
ATOM   2662 O  O   . THR B 1 139 ? -4.945  5.788   7.748   1.00 15.12 ? 138 THR C O   1 
ATOM   2663 C  CB  . THR B 1 139 ? -7.833  5.189   6.203   1.00 17.05 ? 138 THR C CB  1 
ATOM   2664 O  OG1 . THR B 1 139 ? -7.019  6.002   5.323   1.00 17.68 ? 138 THR C OG1 1 
ATOM   2665 C  CG2 . THR B 1 139 ? -9.332  5.585   6.104   1.00 17.80 ? 138 THR C CG2 1 
ATOM   2666 N  N   . CYS B 1 140 ? -5.590  3.618   7.632   1.00 15.83 ? 139 CYS C N   1 
ATOM   2667 C  CA  . CYS B 1 140 ? -4.207  3.105   7.599   1.00 15.85 ? 139 CYS C CA  1 
ATOM   2668 C  C   . CYS B 1 140 ? -4.151  2.050   6.511   1.00 16.33 ? 139 CYS C C   1 
ATOM   2669 O  O   . CYS B 1 140 ? -5.117  1.363   6.287   1.00 15.97 ? 139 CYS C O   1 
ATOM   2670 C  CB  . CYS B 1 140 ? -3.844  2.421   8.927   1.00 18.04 ? 139 CYS C CB  1 
ATOM   2671 S  SG  . CYS B 1 140 ? -3.822  3.566   10.329  1.00 19.81 ? 139 CYS C SG  1 
ATOM   2672 N  N   . ALA B 1 141 ? -3.026  1.980   5.827   1.00 14.98 ? 140 ALA C N   1 
ATOM   2673 C  CA  . ALA B 1 141 ? -2.833  0.969   4.778   1.00 15.71 ? 140 ALA C CA  1 
ATOM   2674 C  C   . ALA B 1 141 ? -2.398  -0.348  5.387   1.00 16.07 ? 140 ALA C C   1 
ATOM   2675 O  O   . ALA B 1 141 ? -1.662  -0.358  6.364   1.00 16.60 ? 140 ALA C O   1 
ATOM   2676 C  CB  . ALA B 1 141 ? -1.789  1.429   3.801   1.00 15.26 ? 140 ALA C CB  1 
ATOM   2677 N  N   . ASN B 1 142 ? -2.785  -1.448  4.733   1.00 16.05 ? 141 ASN C N   1 
ATOM   2678 C  CA  . ASN B 1 142 ? -2.336  -2.799  5.102   1.00 15.59 ? 141 ASN C CA  1 
ATOM   2679 C  C   . ASN B 1 142 ? -2.511  -3.064  6.591   1.00 15.19 ? 141 ASN C C   1 
ATOM   2680 O  O   . ASN B 1 142 ? -3.649  -2.960  7.077   1.00 14.70 ? 141 ASN C O   1 
ATOM   2681 C  CB  . ASN B 1 142 ? -0.910  -3.042  4.518   1.00 15.16 ? 141 ASN C CB  1 
ATOM   2682 C  CG  . ASN B 1 142 ? -0.920  -2.861  3.051   1.00 18.63 ? 141 ASN C CG  1 
ATOM   2683 O  OD1 . ASN B 1 142 ? -1.865  -3.287  2.394   1.00 18.99 ? 141 ASN C OD1 1 
ATOM   2684 N  ND2 . ASN B 1 142 ? 0.095   -2.179  2.504   1.00 22.23 ? 141 ASN C ND2 1 
ATOM   2685 N  N   . GLN B 1 143 ? -1.431  -3.365  7.319   1.00 14.90 ? 142 GLN C N   1 
ATOM   2686 C  CA  . GLN B 1 143 ? -1.536  -3.538  8.767   1.00 14.86 ? 142 GLN C CA  1 
ATOM   2687 C  C   . GLN B 1 143 ? -0.822  -2.415  9.542   1.00 15.92 ? 142 GLN C C   1 
ATOM   2688 O  O   . GLN B 1 143 ? -0.513  -2.566  10.723  1.00 15.32 ? 142 GLN C O   1 
ATOM   2689 C  CB  . GLN B 1 143 ? -1.040  -4.916  9.222   1.00 16.41 ? 142 GLN C CB  1 
ATOM   2690 C  CG  . GLN B 1 143 ? -1.832  -6.081  8.651   1.00 15.96 ? 142 GLN C CG  1 
ATOM   2691 C  CD  . GLN B 1 143 ? -3.312  -6.068  9.070   1.00 14.99 ? 142 GLN C CD  1 
ATOM   2692 O  OE1 . GLN B 1 143 ? -3.742  -5.302  9.953   1.00 17.01 ? 142 GLN C OE1 1 
ATOM   2693 N  NE2 . GLN B 1 143 ? -4.106  -6.916  8.419   1.00 14.68 ? 142 GLN C NE2 1 
ATOM   2694 N  N   . ASP B 1 144 ? -0.602  -1.285  8.879   1.00 15.86 ? 143 ASP C N   1 
ATOM   2695 C  CA  . ASP B 1 144 ? 0.077   -0.149  9.541   1.00 16.71 ? 143 ASP C CA  1 
ATOM   2696 C  C   . ASP B 1 144 ? -0.732  0.206   10.774  1.00 18.18 ? 143 ASP C C   1 
ATOM   2697 O  O   . ASP B 1 144 ? -1.936  0.473   10.643  1.00 17.60 ? 143 ASP C O   1 
ATOM   2698 C  CB  . ASP B 1 144 ? 0.153   1.067   8.621   1.00 16.85 ? 143 ASP C CB  1 
ATOM   2699 C  CG  . ASP B 1 144 ? 1.100   0.873   7.437   1.00 18.10 ? 143 ASP C CG  1 
ATOM   2700 O  OD1 . ASP B 1 144 ? 1.167   1.827   6.605   1.00 18.50 ? 143 ASP C OD1 1 
ATOM   2701 O  OD2 . ASP B 1 144 ? 1.750   -0.181  7.319   1.00 17.36 ? 143 ASP C OD2 1 
ATOM   2702 N  N   . PRO B 1 145 ? -0.102  0.211   11.977  1.00 18.69 ? 144 PRO C N   1 
ATOM   2703 C  CA  . PRO B 1 145 ? -0.893  0.588   13.153  1.00 20.01 ? 144 PRO C CA  1 
ATOM   2704 C  C   . PRO B 1 145 ? -1.206  2.064   13.154  1.00 20.05 ? 144 PRO C C   1 
ATOM   2705 O  O   . PRO B 1 145 ? -0.473  2.870   12.570  1.00 19.67 ? 144 PRO C O   1 
ATOM   2706 C  CB  . PRO B 1 145 ? 0.011   0.253   14.351  1.00 19.98 ? 144 PRO C CB  1 
ATOM   2707 C  CG  . PRO B 1 145 ? 1.286   -0.195  13.815  1.00 20.63 ? 144 PRO C CG  1 
ATOM   2708 C  CD  . PRO B 1 145 ? 1.295   -0.106  12.325  1.00 20.58 ? 144 PRO C CD  1 
ATOM   2709 N  N   . LEU B 1 146 ? -2.322  2.414   13.784  1.00 19.90 ? 145 LEU C N   1 
ATOM   2710 C  CA  . LEU B 1 146 ? -2.697  3.812   13.873  1.00 20.62 ? 145 LEU C CA  1 
ATOM   2711 C  C   . LEU B 1 146 ? -1.620  4.440   14.734  1.00 22.26 ? 145 LEU C C   1 
ATOM   2712 O  O   . LEU B 1 146 ? -1.321  3.931   15.804  1.00 23.52 ? 145 LEU C O   1 
ATOM   2713 C  CB  . LEU B 1 146 ? -4.066  3.942   14.547  1.00 19.98 ? 145 LEU C CB  1 
ATOM   2714 C  CG  . LEU B 1 146 ? -4.583  5.373   14.685  1.00 17.82 ? 145 LEU C CG  1 
ATOM   2715 C  CD1 . LEU B 1 146 ? -4.861  5.988   13.310  1.00 16.77 ? 145 LEU C CD1 1 
ATOM   2716 C  CD2 . LEU B 1 146 ? -5.841  5.383   15.549  1.00 16.78 ? 145 LEU C CD2 1 
ATOM   2717 N  N   . GLU B 1 147 ? -1.019  5.516   14.252  1.00 24.33 ? 146 GLU C N   1 
ATOM   2718 C  CA  . GLU B 1 147 ? 0.052   6.167   15.008  1.00 26.18 ? 146 GLU C CA  1 
ATOM   2719 C  C   . GLU B 1 147 ? -0.280  7.624   15.200  1.00 25.94 ? 146 GLU C C   1 
ATOM   2720 O  O   . GLU B 1 147 ? -1.018  8.221   14.409  1.00 25.90 ? 146 GLU C O   1 
ATOM   2721 C  CB  . GLU B 1 147 ? 1.415   6.046   14.302  1.00 26.79 ? 146 GLU C CB  1 
ATOM   2722 C  CG  . GLU B 1 147 ? 2.016   4.658   14.362  1.00 28.21 ? 146 GLU C CG  1 
ATOM   2723 C  CD  . GLU B 1 147 ? 3.355   4.563   13.633  1.00 28.96 ? 146 GLU C CD  1 
ATOM   2724 O  OE1 . GLU B 1 147 ? 3.891   5.625   13.234  1.00 31.47 ? 146 GLU C OE1 1 
ATOM   2725 O  OE2 . GLU B 1 147 ? 3.875   3.439   13.470  1.00 27.40 ? 146 GLU C OE2 1 
ATOM   2726 N  N   . GLY B 1 148 ? 0.237   8.195   16.281  1.00 26.16 ? 147 GLY C N   1 
ATOM   2727 C  CA  . GLY B 1 148 ? 0.044   9.615   16.508  1.00 25.73 ? 147 GLY C CA  1 
ATOM   2728 C  C   . GLY B 1 148 ? -1.229  9.925   17.268  1.00 25.48 ? 147 GLY C C   1 
ATOM   2729 O  O   . GLY B 1 148 ? -1.427  11.059  17.683  1.00 25.23 ? 147 GLY C O   1 
ATOM   2730 N  N   . MET B 1 149 ? -2.084  8.919   17.423  1.00 24.51 ? 148 MET C N   1 
ATOM   2731 C  CA  . MET B 1 149 ? -3.315  9.040   18.211  1.00 24.68 ? 148 MET C CA  1 
ATOM   2732 C  C   . MET B 1 149 ? -3.667  7.668   18.796  1.00 22.75 ? 148 MET C C   1 
ATOM   2733 O  O   . MET B 1 149 ? -3.182  6.624   18.315  1.00 21.49 ? 148 MET C O   1 
ATOM   2734 C  CB  . MET B 1 149 ? -4.470  9.645   17.390  1.00 23.73 ? 148 MET C CB  1 
ATOM   2735 C  CG  . MET B 1 149 ? -5.147  8.716   16.394  1.00 26.15 ? 148 MET C CG  1 
ATOM   2736 S  SD  . MET B 1 149 ? -6.378  9.571   15.380  1.00 30.91 ? 148 MET C SD  1 
ATOM   2737 C  CE  . MET B 1 149 ? -5.318  10.192  14.062  1.00 30.22 ? 148 MET C CE  1 
ATOM   2738 N  N   . VAL B 1 150 ? -4.507  7.676   19.829  1.00 21.25 ? 149 VAL C N   1 
ATOM   2739 C  CA  . VAL B 1 150 ? -4.881  6.451   20.523  1.00 20.04 ? 149 VAL C CA  1 
ATOM   2740 C  C   . VAL B 1 150 ? -6.071  5.832   19.801  1.00 19.82 ? 149 VAL C C   1 
ATOM   2741 O  O   . VAL B 1 150 ? -7.075  6.512   19.594  1.00 17.94 ? 149 VAL C O   1 
ATOM   2742 C  CB  . VAL B 1 150 ? -5.261  6.724   22.010  1.00 20.40 ? 149 VAL C CB  1 
ATOM   2743 C  CG1 . VAL B 1 150 ? -5.696  5.435   22.706  1.00 18.72 ? 149 VAL C CG1 1 
ATOM   2744 C  CG2 . VAL B 1 150 ? -4.083  7.367   22.772  1.00 20.39 ? 149 VAL C CG2 1 
ATOM   2745 N  N   . PRO B 1 151 ? -5.951  4.544   19.395  1.00 19.41 ? 150 PRO C N   1 
ATOM   2746 C  CA  . PRO B 1 151 ? -7.071  3.930   18.689  1.00 19.17 ? 150 PRO C CA  1 
ATOM   2747 C  C   . PRO B 1 151 ? -8.263  3.689   19.609  1.00 18.44 ? 150 PRO C C   1 
ATOM   2748 O  O   . PRO B 1 151 ? -8.106  3.192   20.733  1.00 19.01 ? 150 PRO C O   1 
ATOM   2749 C  CB  . PRO B 1 151 ? -6.496  2.601   18.171  1.00 19.60 ? 150 PRO C CB  1 
ATOM   2750 C  CG  . PRO B 1 151 ? -5.357  2.267   19.124  1.00 19.11 ? 150 PRO C CG  1 
ATOM   2751 C  CD  . PRO B 1 151 ? -4.790  3.634   19.509  1.00 20.21 ? 150 PRO C CD  1 
ATOM   2752 N  N   . LEU B 1 152 ? -9.441  4.043   19.122  1.00 17.18 ? 151 LEU C N   1 
ATOM   2753 C  CA  . LEU B 1 152 ? -10.670 3.839   19.882  1.00 16.46 ? 151 LEU C CA  1 
ATOM   2754 C  C   . LEU B 1 152 ? -11.571 2.801   19.253  1.00 16.26 ? 151 LEU C C   1 
ATOM   2755 O  O   . LEU B 1 152 ? -12.001 1.882   19.934  1.00 17.56 ? 151 LEU C O   1 
ATOM   2756 C  CB  . LEU B 1 152 ? -11.420 5.147   20.057  1.00 16.11 ? 151 LEU C CB  1 
ATOM   2757 C  CG  . LEU B 1 152 ? -10.664 6.260   20.755  1.00 17.31 ? 151 LEU C CG  1 
ATOM   2758 C  CD1 . LEU B 1 152 ? -11.628 7.414   20.879  1.00 16.28 ? 151 LEU C CD1 1 
ATOM   2759 C  CD2 . LEU B 1 152 ? -10.129 5.826   22.109  1.00 16.31 ? 151 LEU C CD2 1 
ATOM   2760 N  N   . PHE B 1 153 ? -11.864 2.967   17.963  1.00 16.23 ? 152 PHE C N   1 
ATOM   2761 C  CA  . PHE B 1 153 ? -12.677 2.021   17.200  1.00 15.99 ? 152 PHE C CA  1 
ATOM   2762 C  C   . PHE B 1 153 ? -12.069 1.866   15.806  1.00 16.43 ? 152 PHE C C   1 
ATOM   2763 O  O   . PHE B 1 153 ? -11.828 2.851   15.131  1.00 16.86 ? 152 PHE C O   1 
ATOM   2764 C  CB  . PHE B 1 153 ? -14.130 2.511   17.113  1.00 16.33 ? 152 PHE C CB  1 
ATOM   2765 C  CG  . PHE B 1 153 ? -15.046 1.605   16.310  1.00 15.47 ? 152 PHE C CG  1 
ATOM   2766 C  CD1 . PHE B 1 153 ? -15.278 0.279   16.694  1.00 17.83 ? 152 PHE C CD1 1 
ATOM   2767 C  CD2 . PHE B 1 153 ? -15.719 2.096   15.191  1.00 18.43 ? 152 PHE C CD2 1 
ATOM   2768 C  CE1 . PHE B 1 153 ? -16.142 -0.542  15.942  1.00 16.64 ? 152 PHE C CE1 1 
ATOM   2769 C  CE2 . PHE B 1 153 ? -16.568 1.277   14.432  1.00 16.85 ? 152 PHE C CE2 1 
ATOM   2770 C  CZ  . PHE B 1 153 ? -16.762 -0.037  14.797  1.00 16.54 ? 152 PHE C CZ  1 
ATOM   2771 N  N   . GLY B 1 154 ? -11.871 0.620   15.394  1.00 16.20 ? 153 GLY C N   1 
ATOM   2772 C  CA  . GLY B 1 154 ? -11.301 0.295   14.089  1.00 15.78 ? 153 GLY C CA  1 
ATOM   2773 C  C   . GLY B 1 154 ? -12.272 -0.552  13.277  1.00 15.43 ? 153 GLY C C   1 
ATOM   2774 O  O   . GLY B 1 154 ? -13.003 -1.402  13.818  1.00 15.79 ? 153 GLY C O   1 
ATOM   2775 N  N   . ILE B 1 155 ? -12.245 -0.308  11.974  1.00 15.20 ? 154 ILE C N   1 
ATOM   2776 C  CA  . ILE B 1 155 ? -13.007 -1.033  10.988  1.00 15.09 ? 154 ILE C CA  1 
ATOM   2777 C  C   . ILE B 1 155 ? -12.042 -1.644  9.967   1.00 14.90 ? 154 ILE C C   1 
ATOM   2778 O  O   . ILE B 1 155 ? -11.396 -0.949  9.201   1.00 14.79 ? 154 ILE C O   1 
ATOM   2779 C  CB  . ILE B 1 155 ? -14.050 -0.164  10.253  1.00 14.29 ? 154 ILE C CB  1 
ATOM   2780 C  CG1 . ILE B 1 155 ? -15.027 0.518   11.240  1.00 13.93 ? 154 ILE C CG1 1 
ATOM   2781 C  CG2 . ILE B 1 155 ? -14.792 -1.045  9.225   1.00 13.99 ? 154 ILE C CG2 1 
ATOM   2782 C  CD1 . ILE B 1 155 ? -15.936 1.629   10.599  1.00 15.72 ? 154 ILE C CD1 1 
ATOM   2783 N  N   . ASP B 1 156 ? -11.925 -2.938  9.977   1.00 15.63 ? 155 ASP C N   1 
ATOM   2784 C  CA  . ASP B 1 156 ? -11.101 -3.687  9.070   1.00 14.61 ? 155 ASP C CA  1 
ATOM   2785 C  C   . ASP B 1 156 ? -11.735 -3.796  7.687   1.00 15.29 ? 155 ASP C C   1 
ATOM   2786 O  O   . ASP B 1 156 ? -12.800 -4.383  7.536   1.00 15.67 ? 155 ASP C O   1 
ATOM   2787 C  CB  . ASP B 1 156 ? -10.830 -5.081  9.682   1.00 14.48 ? 155 ASP C CB  1 
ATOM   2788 C  CG  . ASP B 1 156 ? -9.814  -5.920  8.924   1.00 15.16 ? 155 ASP C CG  1 
ATOM   2789 O  OD1 . ASP B 1 156 ? -9.635  -7.108  9.261   1.00 16.01 ? 155 ASP C OD1 1 
ATOM   2790 O  OD2 . ASP B 1 156 ? -9.182  -5.389  7.977   1.00 13.31 ? 155 ASP C OD2 1 
ATOM   2791 N  N   . VAL B 1 157 ? -11.065 -3.222  6.661   1.00 15.32 ? 156 VAL C N   1 
ATOM   2792 C  CA  . VAL B 1 157 ? -11.628 -3.359  5.286   1.00 15.32 ? 156 VAL C CA  1 
ATOM   2793 C  C   . VAL B 1 157 ? -10.792 -4.227  4.340   1.00 15.04 ? 156 VAL C C   1 
ATOM   2794 O  O   . VAL B 1 157 ? -10.928 -4.131  3.130   1.00 14.94 ? 156 VAL C O   1 
ATOM   2795 C  CB  . VAL B 1 157 ? -12.028 -2.008  4.651   1.00 15.33 ? 156 VAL C CB  1 
ATOM   2796 C  CG1 . VAL B 1 157 ? -13.422 -1.599  5.095   1.00 16.61 ? 156 VAL C CG1 1 
ATOM   2797 C  CG2 . VAL B 1 157 ? -11.006 -0.933  5.004   1.00 15.10 ? 156 VAL C CG2 1 
ATOM   2798 N  N   . TRP B 1 158 ? -9.923  -5.053  4.917   1.00 14.34 ? 157 TRP C N   1 
ATOM   2799 C  CA  . TRP B 1 158 ? -9.277  -6.055  4.132   1.00 13.61 ? 157 TRP C CA  1 
ATOM   2800 C  C   . TRP B 1 158 ? -10.408 -6.873  3.579   1.00 14.32 ? 157 TRP C C   1 
ATOM   2801 O  O   . TRP B 1 158 ? -11.430 -7.042  4.250   1.00 13.16 ? 157 TRP C O   1 
ATOM   2802 C  CB  . TRP B 1 158 ? -8.386  -6.942  4.951   1.00 13.56 ? 157 TRP C CB  1 
ATOM   2803 C  CG  . TRP B 1 158 ? -7.052  -6.354  5.235   1.00 12.92 ? 157 TRP C CG  1 
ATOM   2804 C  CD1 . TRP B 1 158 ? -6.756  -5.184  5.859   1.00 14.90 ? 157 TRP C CD1 1 
ATOM   2805 C  CD2 . TRP B 1 158 ? -5.798  -6.965  4.899   1.00 14.12 ? 157 TRP C CD2 1 
ATOM   2806 N  NE1 . TRP B 1 158 ? -5.383  -5.002  5.927   1.00 14.60 ? 157 TRP C NE1 1 
ATOM   2807 C  CE2 . TRP B 1 158 ? -4.765  -6.084  5.332   1.00 14.06 ? 157 TRP C CE2 1 
ATOM   2808 C  CE3 . TRP B 1 158 ? -5.417  -8.133  4.248   1.00 14.73 ? 157 TRP C CE3 1 
ATOM   2809 C  CZ2 . TRP B 1 158 ? -3.416  -6.379  5.165   1.00 14.68 ? 157 TRP C CZ2 1 
ATOM   2810 C  CZ3 . TRP B 1 158 ? -4.054  -8.392  4.073   1.00 14.71 ? 157 TRP C CZ3 1 
ATOM   2811 C  CH2 . TRP B 1 158 ? -3.055  -7.547  4.516   1.00 15.71 ? 157 TRP C CH2 1 
ATOM   2812 N  N   . GLU B 1 159 ? -10.291 -7.354  2.335   1.00 13.81 ? 158 GLU C N   1 
ATOM   2813 C  CA  . GLU B 1 159 ? -11.405 -8.113  1.763   1.00 14.70 ? 158 GLU C CA  1 
ATOM   2814 C  C   . GLU B 1 159 ? -11.752 -9.364  2.594   1.00 13.58 ? 158 GLU C C   1 
ATOM   2815 O  O   . GLU B 1 159 ? -12.909 -9.788  2.603   1.00 14.00 ? 158 GLU C O   1 
ATOM   2816 C  CB  . GLU B 1 159 ? -11.121 -8.438  0.283   1.00 14.19 ? 158 GLU C CB  1 
ATOM   2817 C  CG  . GLU B 1 159 ? -11.146 -7.164  -0.548  1.00 13.86 ? 158 GLU C CG  1 
ATOM   2818 C  CD  . GLU B 1 159 ? -10.811 -7.356  -2.018  1.00 14.24 ? 158 GLU C CD  1 
ATOM   2819 O  OE1 . GLU B 1 159 ? -9.799  -8.017  -2.306  1.00 12.13 ? 158 GLU C OE1 1 
ATOM   2820 O  OE2 . GLU B 1 159 ? -11.550 -6.836  -2.867  1.00 14.66 ? 158 GLU C OE2 1 
ATOM   2821 N  N   . HIS B 1 160 ? -10.768 -9.949  3.311   1.00 14.17 ? 159 HIS C N   1 
ATOM   2822 C  CA  . HIS B 1 160 ? -11.047 -11.139 4.132   1.00 14.79 ? 159 HIS C CA  1 
ATOM   2823 C  C   . HIS B 1 160 ? -11.969 -10.785 5.307   1.00 15.00 ? 159 HIS C C   1 
ATOM   2824 O  O   . HIS B 1 160 ? -12.564 -11.684 5.913   1.00 15.92 ? 159 HIS C O   1 
ATOM   2825 C  CB  . HIS B 1 160 ? -9.765  -11.812 4.617   1.00 14.47 ? 159 HIS C CB  1 
ATOM   2826 C  CG  . HIS B 1 160 ? -8.979  -10.982 5.659   1.00 14.15 ? 159 HIS C CG  1 
ATOM   2827 N  ND1 . HIS B 1 160 ? -7.635  -10.679 5.480   1.00 15.91 ? 159 HIS C ND1 1 
ATOM   2828 C  CD2 . HIS B 1 160 ? -9.318  -10.427 6.850   1.00 12.59 ? 159 HIS C CD2 1 
ATOM   2829 C  CE1 . HIS B 1 160 ? -7.191  -9.981  6.497   1.00 14.71 ? 159 HIS C CE1 1 
ATOM   2830 N  NE2 . HIS B 1 160 ? -8.192  -9.826  7.354   1.00 11.99 ? 159 HIS C NE2 1 
ATOM   2831 N  N   . ALA B 1 161 ? -12.113 -9.493  5.640   1.00 14.35 ? 160 ALA C N   1 
ATOM   2832 C  CA  . ALA B 1 161 ? -12.970 -9.144  6.749   1.00 14.63 ? 160 ALA C CA  1 
ATOM   2833 C  C   . ALA B 1 161 ? -14.451 -9.240  6.404   1.00 14.66 ? 160 ALA C C   1 
ATOM   2834 O  O   . ALA B 1 161 ? -15.288 -9.245  7.298   1.00 15.03 ? 160 ALA C O   1 
ATOM   2835 C  CB  . ALA B 1 161 ? -12.630 -7.739  7.229   1.00 15.06 ? 160 ALA C CB  1 
ATOM   2836 N  N   . TYR B 1 162 ? -14.752 -9.301  5.108   1.00 14.42 ? 161 TYR C N   1 
ATOM   2837 C  CA  . TYR B 1 162 ? -16.162 -9.269  4.707   1.00 13.70 ? 161 TYR C CA  1 
ATOM   2838 C  C   . TYR B 1 162 ? -16.529 -10.064 3.438   1.00 13.38 ? 161 TYR C C   1 
ATOM   2839 O  O   . TYR B 1 162 ? -17.707 -10.346 3.216   1.00 13.14 ? 161 TYR C O   1 
ATOM   2840 C  CB  . TYR B 1 162 ? -16.582 -7.800  4.450   1.00 13.57 ? 161 TYR C CB  1 
ATOM   2841 C  CG  . TYR B 1 162 ? -15.809 -7.039  3.353   1.00 14.59 ? 161 TYR C CG  1 
ATOM   2842 C  CD1 . TYR B 1 162 ? -14.681 -6.254  3.636   1.00 15.43 ? 161 TYR C CD1 1 
ATOM   2843 C  CD2 . TYR B 1 162 ? -16.208 -7.076  2.013   1.00 15.30 ? 161 TYR C CD2 1 
ATOM   2844 C  CE1 . TYR B 1 162 ? -13.997 -5.544  2.656   1.00 14.92 ? 161 TYR C CE1 1 
ATOM   2845 C  CE2 . TYR B 1 162 ? -15.533 -6.366  1.031   1.00 14.31 ? 161 TYR C CE2 1 
ATOM   2846 C  CZ  . TYR B 1 162 ? -14.436 -5.599  1.341   1.00 13.02 ? 161 TYR C CZ  1 
ATOM   2847 O  OH  . TYR B 1 162 ? -13.777 -4.887  0.358   1.00 14.39 ? 161 TYR C OH  1 
ATOM   2848 N  N   . TYR B 1 163 ? -15.548 -10.413 2.591   1.00 13.32 ? 162 TYR C N   1 
ATOM   2849 C  CA  . TYR B 1 163 ? -15.867 -10.989 1.285   1.00 13.23 ? 162 TYR C CA  1 
ATOM   2850 C  C   . TYR B 1 163 ? -16.788 -12.199 1.247   1.00 13.50 ? 162 TYR C C   1 
ATOM   2851 O  O   . TYR B 1 163 ? -17.668 -12.264 0.401   1.00 13.41 ? 162 TYR C O   1 
ATOM   2852 C  CB  . TYR B 1 163 ? -14.597 -11.272 0.482   1.00 12.36 ? 162 TYR C CB  1 
ATOM   2853 C  CG  . TYR B 1 163 ? -14.869 -11.088 -1.022  1.00 11.96 ? 162 TYR C CG  1 
ATOM   2854 C  CD1 . TYR B 1 163 ? -14.785 -9.831  -1.604  1.00 9.59  ? 162 TYR C CD1 1 
ATOM   2855 C  CD2 . TYR B 1 163 ? -15.242 -12.147 -1.832  1.00 10.56 ? 162 TYR C CD2 1 
ATOM   2856 C  CE1 . TYR B 1 163 ? -15.038 -9.621  -2.959  1.00 11.86 ? 162 TYR C CE1 1 
ATOM   2857 C  CE2 . TYR B 1 163 ? -15.498 -11.960 -3.170  1.00 11.89 ? 162 TYR C CE2 1 
ATOM   2858 C  CZ  . TYR B 1 163 ? -15.407 -10.691 -3.748  1.00 12.27 ? 162 TYR C CZ  1 
ATOM   2859 O  OH  . TYR B 1 163 ? -15.647 -10.499 -5.097  1.00 11.36 ? 162 TYR C OH  1 
ATOM   2860 N  N   . LEU B 1 164 ? -16.608 -13.153 2.161   1.00 14.63 ? 163 LEU C N   1 
ATOM   2861 C  CA  . LEU B 1 164 ? -17.422 -14.356 2.103   1.00 15.30 ? 163 LEU C CA  1 
ATOM   2862 C  C   . LEU B 1 164 ? -18.913 -14.062 2.241   1.00 15.57 ? 163 LEU C C   1 
ATOM   2863 O  O   . LEU B 1 164 ? -19.738 -14.762 1.654   1.00 15.41 ? 163 LEU C O   1 
ATOM   2864 C  CB  . LEU B 1 164 ? -17.005 -15.358 3.180   1.00 15.88 ? 163 LEU C CB  1 
ATOM   2865 C  CG  . LEU B 1 164 ? -15.641 -16.004 2.988   1.00 16.70 ? 163 LEU C CG  1 
ATOM   2866 C  CD1 . LEU B 1 164 ? -15.259 -16.799 4.228   1.00 18.38 ? 163 LEU C CD1 1 
ATOM   2867 C  CD2 . LEU B 1 164 ? -15.643 -16.884 1.758   1.00 18.10 ? 163 LEU C CD2 1 
ATOM   2868 N  N   . GLN B 1 165 ? -19.231 -13.032 3.024   1.00 15.58 ? 164 GLN C N   1 
ATOM   2869 C  CA  . GLN B 1 165 ? -20.618 -12.647 3.275   1.00 15.88 ? 164 GLN C CA  1 
ATOM   2870 C  C   . GLN B 1 165 ? -21.125 -11.573 2.300   1.00 15.54 ? 164 GLN C C   1 
ATOM   2871 O  O   . GLN B 1 165 ? -22.154 -11.731 1.648   1.00 15.34 ? 164 GLN C O   1 
ATOM   2872 C  CB  . GLN B 1 165 ? -20.798 -12.147 4.715   1.00 15.51 ? 164 GLN C CB  1 
ATOM   2873 C  CG  . GLN B 1 165 ? -22.122 -11.402 4.972   1.00 15.72 ? 164 GLN C CG  1 
ATOM   2874 C  CD  . GLN B 1 165 ? -22.594 -11.387 6.416   1.00 16.52 ? 164 GLN C CD  1 
ATOM   2875 O  OE1 . GLN B 1 165 ? -23.598 -10.764 6.745   1.00 20.62 ? 164 GLN C OE1 1 
ATOM   2876 N  NE2 . GLN B 1 165 ? -22.001 -11.994 7.443   1.00 16.77 ? 164 GLN C NE2 1 
ATOM   2877 N  N   . TYR B 1 166 ? -20.360 -10.487 2.199   1.00 15.02 ? 165 TYR C N   1 
ATOM   2878 C  CA  . TYR B 1 166 ? -20.746 -9.312  1.432   1.00 14.57 ? 165 TYR C CA  1 
ATOM   2879 C  C   . TYR B 1 166 ? -20.262 -9.272  -0.009  1.00 14.86 ? 165 TYR C C   1 
ATOM   2880 O  O   . TYR B 1 166 ? -20.727 -8.428  -0.786  1.00 14.63 ? 165 TYR C O   1 
ATOM   2881 C  CB  . TYR B 1 166 ? -20.313 -8.032  2.174   1.00 15.34 ? 165 TYR C CB  1 
ATOM   2882 C  CG  . TYR B 1 166 ? -20.976 -7.869  3.531   1.00 16.29 ? 165 TYR C CG  1 
ATOM   2883 C  CD1 . TYR B 1 166 ? -20.433 -8.459  4.683   1.00 16.37 ? 165 TYR C CD1 1 
ATOM   2884 C  CD2 . TYR B 1 166 ? -22.158 -7.140  3.655   1.00 16.98 ? 165 TYR C CD2 1 
ATOM   2885 C  CE1 . TYR B 1 166 ? -21.054 -8.311  5.923   1.00 17.80 ? 165 TYR C CE1 1 
ATOM   2886 C  CE2 . TYR B 1 166 ? -22.779 -6.980  4.873   1.00 17.60 ? 165 TYR C CE2 1 
ATOM   2887 C  CZ  . TYR B 1 166 ? -22.238 -7.564  6.007   1.00 16.23 ? 165 TYR C CZ  1 
ATOM   2888 O  OH  . TYR B 1 166 ? -22.917 -7.385  7.203   1.00 18.13 ? 165 TYR C OH  1 
ATOM   2889 N  N   . LYS B 1 167 ? -19.358 -10.188 -0.374  1.00 14.27 ? 166 LYS C N   1 
ATOM   2890 C  CA  . LYS B 1 167 ? -18.695 -10.154 -1.686  1.00 15.01 ? 166 LYS C CA  1 
ATOM   2891 C  C   . LYS B 1 167 ? -18.108 -8.750  -1.926  1.00 13.79 ? 166 LYS C C   1 
ATOM   2892 O  O   . LYS B 1 167 ? -17.507 -8.157  -1.023  1.00 13.65 ? 166 LYS C O   1 
ATOM   2893 C  CB  . LYS B 1 167 ? -19.612 -10.628 -2.838  1.00 14.71 ? 166 LYS C CB  1 
ATOM   2894 C  CG  . LYS B 1 167 ? -19.850 -12.167 -2.878  1.00 19.93 ? 166 LYS C CG  1 
ATOM   2895 C  CD  . LYS B 1 167 ? -20.388 -12.680 -1.571  1.00 22.08 ? 166 LYS C CD  1 
ATOM   2896 C  CE  . LYS B 1 167 ? -20.839 -14.140 -1.641  1.00 20.31 ? 166 LYS C CE  1 
ATOM   2897 N  NZ  . LYS B 1 167 ? -21.677 -14.362 -0.449  1.00 24.32 ? 166 LYS C NZ  1 
ATOM   2898 N  N   . ASN B 1 168 ? -18.325 -8.205  -3.117  1.00 14.01 ? 167 ASN C N   1 
ATOM   2899 C  CA  . ASN B 1 168 ? -17.761 -6.909  -3.489  1.00 13.58 ? 167 ASN C CA  1 
ATOM   2900 C  C   . ASN B 1 168 ? -18.394 -5.722  -2.761  1.00 14.03 ? 167 ASN C C   1 
ATOM   2901 O  O   . ASN B 1 168 ? -17.876 -4.621  -2.798  1.00 13.52 ? 167 ASN C O   1 
ATOM   2902 C  CB  . ASN B 1 168 ? -17.902 -6.720  -4.993  1.00 14.05 ? 167 ASN C CB  1 
ATOM   2903 C  CG  . ASN B 1 168 ? -19.352 -6.868  -5.452  1.00 14.80 ? 167 ASN C CG  1 
ATOM   2904 O  OD1 . ASN B 1 168 ? -19.982 -7.929  -5.316  1.00 13.92 ? 167 ASN C OD1 1 
ATOM   2905 N  ND2 . ASN B 1 168 ? -19.899 -5.784  -5.976  1.00 19.03 ? 167 ASN C ND2 1 
ATOM   2906 N  N   . VAL B 1 169 ? -19.560 -5.933  -2.146  1.00 13.76 ? 168 VAL C N   1 
ATOM   2907 C  CA  . VAL B 1 169 ? -20.300 -4.811  -1.552  1.00 13.60 ? 168 VAL C CA  1 
ATOM   2908 C  C   . VAL B 1 169 ? -19.764 -4.342  -0.193  1.00 13.24 ? 168 VAL C C   1 
ATOM   2909 O  O   . VAL B 1 169 ? -20.448 -4.447  0.847   1.00 12.99 ? 168 VAL C O   1 
ATOM   2910 C  CB  . VAL B 1 169 ? -21.826 -5.127  -1.465  1.00 12.64 ? 168 VAL C CB  1 
ATOM   2911 C  CG1 . VAL B 1 169 ? -22.597 -3.826  -1.361  1.00 13.60 ? 168 VAL C CG1 1 
ATOM   2912 C  CG2 . VAL B 1 169 ? -22.248 -5.877  -2.684  1.00 13.59 ? 168 VAL C CG2 1 
ATOM   2913 N  N   . ARG B 1 170 ? -18.514 -3.870  -0.212  1.00 13.78 ? 169 ARG C N   1 
ATOM   2914 C  CA  . ARG B 1 170 ? -17.861 -3.308  0.968   1.00 14.12 ? 169 ARG C CA  1 
ATOM   2915 C  C   . ARG B 1 170 ? -18.735 -2.271  1.728   1.00 14.80 ? 169 ARG C C   1 
ATOM   2916 O  O   . ARG B 1 170 ? -18.782 -2.301  2.960   1.00 14.51 ? 169 ARG C O   1 
ATOM   2917 C  CB  . ARG B 1 170 ? -16.478 -2.740  0.596   1.00 14.40 ? 169 ARG C CB  1 
ATOM   2918 C  CG  . ARG B 1 170 ? -15.690 -2.212  1.781   1.00 15.94 ? 169 ARG C CG  1 
ATOM   2919 C  CD  . ARG B 1 170 ? -14.570 -1.265  1.347   1.00 16.32 ? 169 ARG C CD  1 
ATOM   2920 N  NE  . ARG B 1 170 ? -13.391 -2.029  1.010   1.00 16.93 ? 169 ARG C NE  1 
ATOM   2921 C  CZ  . ARG B 1 170 ? -12.239 -1.478  0.673   1.00 20.08 ? 169 ARG C CZ  1 
ATOM   2922 N  NH1 . ARG B 1 170 ? -12.140 -0.153  0.588   1.00 19.78 ? 169 ARG C NH1 1 
ATOM   2923 N  NH2 . ARG B 1 170 ? -11.221 -2.265  0.404   1.00 20.74 ? 169 ARG C NH2 1 
ATOM   2924 N  N   . PRO B 1 171 ? -19.428 -1.359  1.001   1.00 14.77 ? 170 PRO C N   1 
ATOM   2925 C  CA  . PRO B 1 171 ? -20.218 -0.371  1.748   1.00 14.85 ? 170 PRO C CA  1 
ATOM   2926 C  C   . PRO B 1 171 ? -21.277 -0.984  2.685   1.00 15.07 ? 170 PRO C C   1 
ATOM   2927 O  O   . PRO B 1 171 ? -21.516 -0.435  3.759   1.00 13.87 ? 170 PRO C O   1 
ATOM   2928 C  CB  . PRO B 1 171 ? -20.862 0.481   0.641   1.00 14.74 ? 170 PRO C CB  1 
ATOM   2929 C  CG  . PRO B 1 171 ? -19.872 0.368   -0.507  1.00 15.23 ? 170 PRO C CG  1 
ATOM   2930 C  CD  . PRO B 1 171 ? -19.492 -1.101  -0.450  1.00 15.37 ? 170 PRO C CD  1 
ATOM   2931 N  N   . ASP B 1 172 ? -21.869 -2.122  2.303   1.00 14.43 ? 171 ASP C N   1 
ATOM   2932 C  CA  . ASP B 1 172 ? -22.906 -2.766  3.138   1.00 16.10 ? 171 ASP C CA  1 
ATOM   2933 C  C   . ASP B 1 172 ? -22.302 -3.252  4.453   1.00 15.15 ? 171 ASP C C   1 
ATOM   2934 O  O   . ASP B 1 172 ? -22.919 -3.098  5.504   1.00 15.72 ? 171 ASP C O   1 
ATOM   2935 C  CB  . ASP B 1 172 ? -23.612 -3.925  2.412   1.00 15.50 ? 171 ASP C CB  1 
ATOM   2936 C  CG  . ASP B 1 172 ? -24.662 -3.455  1.411   1.00 18.20 ? 171 ASP C CG  1 
ATOM   2937 O  OD1 . ASP B 1 172 ? -24.819 -2.227  1.209   1.00 19.46 ? 171 ASP C OD1 1 
ATOM   2938 O  OD2 . ASP B 1 172 ? -25.318 -4.338  0.821   1.00 16.79 ? 171 ASP C OD2 1 
ATOM   2939 N  N   . TYR B 1 173 ? -21.103 -3.836  4.381   1.00 15.43 ? 172 TYR C N   1 
ATOM   2940 C  CA  . TYR B 1 173 ? -20.380 -4.277  5.565   1.00 14.73 ? 172 TYR C CA  1 
ATOM   2941 C  C   . TYR B 1 173 ? -20.013 -3.083  6.458   1.00 15.75 ? 172 TYR C C   1 
ATOM   2942 O  O   . TYR B 1 173 ? -20.279 -3.116  7.663   1.00 16.19 ? 172 TYR C O   1 
ATOM   2943 C  CB  . TYR B 1 173 ? -19.107 -5.016  5.127   1.00 15.60 ? 172 TYR C CB  1 
ATOM   2944 C  CG  . TYR B 1 173 ? -18.029 -5.105  6.173   1.00 14.57 ? 172 TYR C CG  1 
ATOM   2945 C  CD1 . TYR B 1 173 ? -16.855 -4.372  6.039   1.00 15.29 ? 172 TYR C CD1 1 
ATOM   2946 C  CD2 . TYR B 1 173 ? -18.155 -5.979  7.259   1.00 14.74 ? 172 TYR C CD2 1 
ATOM   2947 C  CE1 . TYR B 1 173 ? -15.828 -4.453  6.985   1.00 15.82 ? 172 TYR C CE1 1 
ATOM   2948 C  CE2 . TYR B 1 173 ? -17.138 -6.090  8.212   1.00 14.67 ? 172 TYR C CE2 1 
ATOM   2949 C  CZ  . TYR B 1 173 ? -15.968 -5.337  8.061   1.00 15.87 ? 172 TYR C CZ  1 
ATOM   2950 O  OH  . TYR B 1 173 ? -14.947 -5.431  8.986   1.00 17.00 ? 172 TYR C OH  1 
ATOM   2951 N  N   . VAL B 1 174 ? -19.451 -2.023  5.862   1.00 15.30 ? 173 VAL C N   1 
ATOM   2952 C  CA  . VAL B 1 174 ? -18.992 -0.865  6.660   1.00 15.85 ? 173 VAL C CA  1 
ATOM   2953 C  C   . VAL B 1 174 ? -20.165 -0.201  7.391   1.00 16.79 ? 173 VAL C C   1 
ATOM   2954 O  O   . VAL B 1 174 ? -20.079 0.099   8.572   1.00 17.85 ? 173 VAL C O   1 
ATOM   2955 C  CB  . VAL B 1 174 ? -18.153 0.121   5.836   1.00 16.17 ? 173 VAL C CB  1 
ATOM   2956 C  CG1 . VAL B 1 174 ? -17.773 1.345   6.672   1.00 16.37 ? 173 VAL C CG1 1 
ATOM   2957 C  CG2 . VAL B 1 174 ? -16.871 -0.591  5.333   1.00 14.36 ? 173 VAL C CG2 1 
ATOM   2958 N  N   . HIS B 1 175 ? -21.268 0.003   6.688   1.00 15.62 ? 174 HIS C N   1 
ATOM   2959 C  CA  . HIS B 1 175 ? -22.445 0.571   7.320   1.00 17.15 ? 174 HIS C CA  1 
ATOM   2960 C  C   . HIS B 1 175 ? -23.003 -0.353  8.391   1.00 16.57 ? 174 HIS C C   1 
ATOM   2961 O  O   . HIS B 1 175 ? -23.443 0.109   9.451   1.00 17.62 ? 174 HIS C O   1 
ATOM   2962 C  CB  . HIS B 1 175 ? -23.472 0.917   6.256   1.00 17.40 ? 174 HIS C CB  1 
ATOM   2963 C  CG  . HIS B 1 175 ? -23.024 2.029   5.355   1.00 19.02 ? 174 HIS C CG  1 
ATOM   2964 N  ND1 . HIS B 1 175 ? -23.087 1.950   3.979   1.00 21.23 ? 174 HIS C ND1 1 
ATOM   2965 C  CD2 . HIS B 1 175 ? -22.464 3.230   5.636   1.00 20.61 ? 174 HIS C CD2 1 
ATOM   2966 C  CE1 . HIS B 1 175 ? -22.636 3.075   3.456   1.00 20.47 ? 174 HIS C CE1 1 
ATOM   2967 N  NE2 . HIS B 1 175 ? -22.234 3.861   4.439   1.00 21.18 ? 174 HIS C NE2 1 
ATOM   2968 N  N   . ALA B 1 176 ? -22.964 -1.655  8.137   1.00 15.27 ? 175 ALA C N   1 
ATOM   2969 C  CA  . ALA B 1 176 ? -23.572 -2.605  9.067   1.00 16.00 ? 175 ALA C CA  1 
ATOM   2970 C  C   . ALA B 1 176 ? -22.764 -2.799  10.347  1.00 15.50 ? 175 ALA C C   1 
ATOM   2971 O  O   . ALA B 1 176 ? -23.355 -3.091  11.393  1.00 16.39 ? 175 ALA C O   1 
ATOM   2972 C  CB  . ALA B 1 176 ? -23.842 -3.966  8.389   1.00 16.07 ? 175 ALA C CB  1 
ATOM   2973 N  N   . ILE B 1 177 ? -21.440 -2.623  10.273  1.00 14.96 ? 176 ILE C N   1 
ATOM   2974 C  CA  . ILE B 1 177 ? -20.574 -2.876  11.428  1.00 15.12 ? 176 ILE C CA  1 
ATOM   2975 C  C   . ILE B 1 177 ? -20.901 -1.999  12.639  1.00 14.92 ? 176 ILE C C   1 
ATOM   2976 O  O   . ILE B 1 177 ? -20.710 -2.406  13.788  1.00 13.76 ? 176 ILE C O   1 
ATOM   2977 C  CB  . ILE B 1 177 ? -19.057 -2.787  11.072  1.00 13.62 ? 176 ILE C CB  1 
ATOM   2978 C  CG1 . ILE B 1 177 ? -18.288 -3.744  11.983  1.00 15.37 ? 176 ILE C CG1 1 
ATOM   2979 C  CG2 . ILE B 1 177 ? -18.550 -1.309  11.095  1.00 15.56 ? 176 ILE C CG2 1 
ATOM   2980 C  CD1 . ILE B 1 177 ? -16.816 -3.962  11.598  1.00 15.74 ? 176 ILE C CD1 1 
ATOM   2981 N  N   . TRP B 1 178 ? -21.406 -0.797  12.376  1.00 15.02 ? 177 TRP C N   1 
ATOM   2982 C  CA  . TRP B 1 178 ? -21.880 0.069   13.449  1.00 16.07 ? 177 TRP C CA  1 
ATOM   2983 C  C   . TRP B 1 178 ? -22.909 -0.585  14.406  1.00 16.51 ? 177 TRP C C   1 
ATOM   2984 O  O   . TRP B 1 178 ? -22.990 -0.229  15.579  1.00 16.51 ? 177 TRP C O   1 
ATOM   2985 C  CB  . TRP B 1 178 ? -22.395 1.379   12.851  1.00 16.56 ? 177 TRP C CB  1 
ATOM   2986 C  CG  . TRP B 1 178 ? -21.271 2.146   12.245  1.00 17.93 ? 177 TRP C CG  1 
ATOM   2987 C  CD1 . TRP B 1 178 ? -20.928 2.226   10.914  1.00 18.32 ? 177 TRP C CD1 1 
ATOM   2988 C  CD2 . TRP B 1 178 ? -20.283 2.885   12.962  1.00 17.57 ? 177 TRP C CD2 1 
ATOM   2989 N  NE1 . TRP B 1 178 ? -19.800 3.019   10.763  1.00 17.12 ? 177 TRP C NE1 1 
ATOM   2990 C  CE2 . TRP B 1 178 ? -19.386 3.435   12.003  1.00 17.62 ? 177 TRP C CE2 1 
ATOM   2991 C  CE3 . TRP B 1 178 ? -20.083 3.170   14.322  1.00 18.32 ? 177 TRP C CE3 1 
ATOM   2992 C  CZ2 . TRP B 1 178 ? -18.300 4.231   12.368  1.00 16.94 ? 177 TRP C CZ2 1 
ATOM   2993 C  CZ3 . TRP B 1 178 ? -18.996 3.982   14.680  1.00 18.86 ? 177 TRP C CZ3 1 
ATOM   2994 C  CH2 . TRP B 1 178 ? -18.123 4.492   13.703  1.00 18.42 ? 177 TRP C CH2 1 
ATOM   2995 N  N   . LYS B 1 179 ? -23.645 -1.578  13.910  1.00 16.18 ? 178 LYS C N   1 
ATOM   2996 C  CA  . LYS B 1 179 ? -24.654 -2.288  14.708  1.00 17.66 ? 178 LYS C CA  1 
ATOM   2997 C  C   . LYS B 1 179 ? -24.033 -3.200  15.756  1.00 17.12 ? 178 LYS C C   1 
ATOM   2998 O  O   . LYS B 1 179 ? -24.721 -3.657  16.681  1.00 17.26 ? 178 LYS C O   1 
ATOM   2999 C  CB  . LYS B 1 179 ? -25.579 -3.099  13.800  1.00 17.98 ? 178 LYS C CB  1 
ATOM   3000 C  CG  . LYS B 1 179 ? -26.273 -2.287  12.732  1.00 21.01 ? 178 LYS C CG  1 
ATOM   3001 C  CD  . LYS B 1 179 ? -27.161 -3.176  11.865  1.00 24.55 ? 178 LYS C CD  1 
ATOM   3002 C  CE  . LYS B 1 179 ? -27.705 -2.372  10.677  1.00 28.64 ? 178 LYS C CE  1 
ATOM   3003 N  NZ  . LYS B 1 179 ? -28.568 -3.219  9.795   1.00 31.69 ? 178 LYS C NZ  1 
ATOM   3004 N  N   . ILE B 1 180 ? -22.741 -3.481  15.592  1.00 17.03 ? 179 ILE C N   1 
ATOM   3005 C  CA  . ILE B 1 180 ? -21.997 -4.345  16.514  1.00 17.56 ? 179 ILE C CA  1 
ATOM   3006 C  C   . ILE B 1 180 ? -20.765 -3.660  17.134  1.00 17.19 ? 179 ILE C C   1 
ATOM   3007 O  O   . ILE B 1 180 ? -19.904 -4.316  17.751  1.00 16.87 ? 179 ILE C O   1 
ATOM   3008 C  CB  . ILE B 1 180 ? -21.608 -5.714  15.875  1.00 17.44 ? 179 ILE C CB  1 
ATOM   3009 C  CG1 . ILE B 1 180 ? -20.804 -5.509  14.577  1.00 18.02 ? 179 ILE C CG1 1 
ATOM   3010 C  CG2 . ILE B 1 180 ? -22.858 -6.563  15.645  1.00 18.08 ? 179 ILE C CG2 1 
ATOM   3011 C  CD1 . ILE B 1 180 ? -20.073 -6.756  14.089  1.00 17.39 ? 179 ILE C CD1 1 
ATOM   3012 N  N   . ALA B 1 181 ? -20.683 -2.335  16.981  1.00 17.12 ? 180 ALA C N   1 
ATOM   3013 C  CA  . ALA B 1 181 ? -19.638 -1.570  17.644  1.00 16.21 ? 180 ALA C CA  1 
ATOM   3014 C  C   . ALA B 1 181 ? -19.795 -1.699  19.159  1.00 16.26 ? 180 ALA C C   1 
ATOM   3015 O  O   . ALA B 1 181 ? -20.893 -1.471  19.717  1.00 15.75 ? 180 ALA C O   1 
ATOM   3016 C  CB  . ALA B 1 181 ? -19.674 -0.113  17.221  1.00 16.05 ? 180 ALA C CB  1 
ATOM   3017 N  N   . ASN B 1 182 ? -18.722 -2.134  19.816  1.00 16.33 ? 181 ASN C N   1 
ATOM   3018 C  CA  . ASN B 1 182 ? -18.736 -2.321  21.268  1.00 16.56 ? 181 ASN C CA  1 
ATOM   3019 C  C   . ASN B 1 182 ? -18.456 -0.992  21.977  1.00 16.85 ? 181 ASN C C   1 
ATOM   3020 O  O   . ASN B 1 182 ? -17.309 -0.721  22.374  1.00 16.75 ? 181 ASN C O   1 
ATOM   3021 C  CB  . ASN B 1 182 ? -17.713 -3.388  21.703  1.00 16.99 ? 181 ASN C CB  1 
ATOM   3022 C  CG  . ASN B 1 182 ? -17.833 -3.735  23.182  1.00 16.36 ? 181 ASN C CG  1 
ATOM   3023 O  OD1 . ASN B 1 182 ? -18.694 -3.205  23.899  1.00 17.50 ? 181 ASN C OD1 1 
ATOM   3024 N  ND2 . ASN B 1 182 ? -16.979 -4.628  23.644  1.00 16.47 ? 181 ASN C ND2 1 
ATOM   3025 N  N   . TRP B 1 183 ? -19.497 -0.173  22.125  1.00 16.51 ? 182 TRP C N   1 
ATOM   3026 C  CA  . TRP B 1 183 ? -19.371 1.135   22.770  1.00 16.79 ? 182 TRP C CA  1 
ATOM   3027 C  C   . TRP B 1 183 ? -18.859 1.085   24.210  1.00 16.70 ? 182 TRP C C   1 
ATOM   3028 O  O   . TRP B 1 183 ? -18.244 2.046   24.675  1.00 16.44 ? 182 TRP C O   1 
ATOM   3029 C  CB  . TRP B 1 183 ? -20.659 1.951   22.652  1.00 17.32 ? 182 TRP C CB  1 
ATOM   3030 C  CG  . TRP B 1 183 ? -20.912 2.411   21.262  1.00 16.90 ? 182 TRP C CG  1 
ATOM   3031 C  CD1 . TRP B 1 183 ? -21.864 1.946   20.416  1.00 15.62 ? 182 TRP C CD1 1 
ATOM   3032 C  CD2 . TRP B 1 183 ? -20.178 3.409   20.539  1.00 17.11 ? 182 TRP C CD2 1 
ATOM   3033 N  NE1 . TRP B 1 183 ? -21.784 2.596   19.213  1.00 16.92 ? 182 TRP C NE1 1 
ATOM   3034 C  CE2 . TRP B 1 183 ? -20.766 3.509   19.260  1.00 17.15 ? 182 TRP C CE2 1 
ATOM   3035 C  CE3 . TRP B 1 183 ? -19.085 4.235   20.851  1.00 18.14 ? 182 TRP C CE3 1 
ATOM   3036 C  CZ2 . TRP B 1 183 ? -20.298 4.398   18.280  1.00 16.24 ? 182 TRP C CZ2 1 
ATOM   3037 C  CZ3 . TRP B 1 183 ? -18.620 5.126   19.876  1.00 16.41 ? 182 TRP C CZ3 1 
ATOM   3038 C  CH2 . TRP B 1 183 ? -19.233 5.201   18.609  1.00 16.90 ? 182 TRP C CH2 1 
ATOM   3039 N  N   . LYS B 1 184 ? -19.104 -0.027  24.912  1.00 16.85 ? 183 LYS C N   1 
ATOM   3040 C  CA  . LYS B 1 184 ? -18.538 -0.201  26.246  1.00 17.18 ? 183 LYS C CA  1 
ATOM   3041 C  C   . LYS B 1 184 ? -17.005 -0.156  26.157  1.00 16.92 ? 183 LYS C C   1 
ATOM   3042 O  O   . LYS B 1 184 ? -16.343 0.579   26.893  1.00 17.50 ? 183 LYS C O   1 
ATOM   3043 C  CB  . LYS B 1 184 ? -18.998 -1.519  26.886  1.00 17.29 ? 183 LYS C CB  1 
ATOM   3044 C  CG  . LYS B 1 184 ? -18.519 -1.662  28.317  1.00 19.25 ? 183 LYS C CG  1 
ATOM   3045 C  CD  . LYS B 1 184 ? -19.123 -2.864  29.017  1.00 23.07 ? 183 LYS C CD  1 
ATOM   3046 C  CE  . LYS B 1 184 ? -18.433 -3.107  30.359  1.00 24.69 ? 183 LYS C CE  1 
ATOM   3047 N  NZ  . LYS B 1 184 ? -17.017 -3.529  30.189  1.00 26.13 ? 183 LYS C NZ  1 
ATOM   3048 N  N   . ASN B 1 185 ? -16.449 -0.927  25.232  1.00 16.59 ? 184 ASN C N   1 
ATOM   3049 C  CA  . ASN B 1 185 ? -15.005 -0.966  25.040  1.00 16.46 ? 184 ASN C CA  1 
ATOM   3050 C  C   . ASN B 1 185 ? -14.446 0.351   24.504  1.00 16.36 ? 184 ASN C C   1 
ATOM   3051 O  O   . ASN B 1 185 ? -13.417 0.843   24.982  1.00 16.66 ? 184 ASN C O   1 
ATOM   3052 C  CB  . ASN B 1 185 ? -14.623 -2.074  24.075  1.00 17.21 ? 184 ASN C CB  1 
ATOM   3053 C  CG  . ASN B 1 185 ? -13.133 -2.098  23.801  1.00 17.89 ? 184 ASN C CG  1 
ATOM   3054 O  OD1 . ASN B 1 185 ? -12.684 -1.683  22.730  1.00 19.62 ? 184 ASN C OD1 1 
ATOM   3055 N  ND2 . ASN B 1 185 ? -12.349 -2.526  24.796  1.00 18.06 ? 184 ASN C ND2 1 
ATOM   3056 N  N   . ILE B 1 186 ? -15.123 0.902   23.502  1.00 16.28 ? 185 ILE C N   1 
ATOM   3057 C  CA  . ILE B 1 186 ? -14.695 2.160   22.881  1.00 16.41 ? 185 ILE C CA  1 
ATOM   3058 C  C   . ILE B 1 186 ? -14.665 3.273   23.933  1.00 16.39 ? 185 ILE C C   1 
ATOM   3059 O  O   . ILE B 1 186 ? -13.718 4.077   23.956  1.00 17.19 ? 185 ILE C O   1 
ATOM   3060 C  CB  . ILE B 1 186 ? -15.586 2.525   21.679  1.00 16.84 ? 185 ILE C CB  1 
ATOM   3061 C  CG1 . ILE B 1 186 ? -15.538 1.424   20.616  1.00 16.38 ? 185 ILE C CG1 1 
ATOM   3062 C  CG2 . ILE B 1 186 ? -15.181 3.889   21.084  1.00 16.43 ? 185 ILE C CG2 1 
ATOM   3063 C  CD1 . ILE B 1 186 ? -16.721 1.432   19.655  1.00 17.70 ? 185 ILE C CD1 1 
ATOM   3064 N  N   . SER B 1 187 ? -15.675 3.284   24.812  1.00 16.38 ? 186 SER C N   1 
ATOM   3065 C  CA  . SER B 1 187 ? -15.775 4.274   25.892  1.00 16.88 ? 186 SER C CA  1 
ATOM   3066 C  C   . SER B 1 187 ? -14.667 4.102   26.917  1.00 17.15 ? 186 SER C C   1 
ATOM   3067 O  O   . SER B 1 187 ? -14.101 5.092   27.398  1.00 17.35 ? 186 SER C O   1 
ATOM   3068 C  CB  . SER B 1 187 ? -17.158 4.263   26.567  1.00 16.39 ? 186 SER C CB  1 
ATOM   3069 O  OG  . SER B 1 187 ? -18.153 4.574   25.614  1.00 17.40 ? 186 SER C OG  1 
ATOM   3070 N  N   . GLU B 1 188 ? -14.334 2.849   27.227  1.00 17.41 ? 187 GLU C N   1 
ATOM   3071 C  CA  . GLU B 1 188 ? -13.236 2.560   28.139  1.00 17.57 ? 187 GLU C CA  1 
ATOM   3072 C  C   . GLU B 1 188 ? -11.907 3.043   27.554  1.00 16.92 ? 187 GLU C C   1 
ATOM   3073 O  O   . GLU B 1 188 ? -11.114 3.660   28.258  1.00 16.38 ? 187 GLU C O   1 
ATOM   3074 C  CB  . GLU B 1 188 ? -13.147 1.067   28.439  1.00 17.48 ? 187 GLU C CB  1 
ATOM   3075 C  CG  . GLU B 1 188 ? -14.136 0.599   29.481  1.00 19.10 ? 187 GLU C CG  1 
ATOM   3076 C  CD  . GLU B 1 188 ? -14.316 -0.909  29.474  1.00 21.09 ? 187 GLU C CD  1 
ATOM   3077 O  OE1 . GLU B 1 188 ? -13.545 -1.598  28.778  1.00 22.57 ? 187 GLU C OE1 1 
ATOM   3078 O  OE2 . GLU B 1 188 ? -15.239 -1.399  30.165  1.00 22.16 ? 187 GLU C OE2 1 
ATOM   3079 N  N   . ARG B 1 189 ? -11.688 2.752   26.271  1.00 17.49 ? 188 ARG C N   1 
ATOM   3080 C  CA  . ARG B 1 189 ? -10.490 3.195   25.543  1.00 17.94 ? 188 ARG C CA  1 
ATOM   3081 C  C   . ARG B 1 189 ? -10.382 4.719   25.554  1.00 18.81 ? 188 ARG C C   1 
ATOM   3082 O  O   . ARG B 1 189 ? -9.293  5.270   25.730  1.00 19.59 ? 188 ARG C O   1 
ATOM   3083 C  CB  . ARG B 1 189 ? -10.505 2.654   24.108  1.00 17.90 ? 188 ARG C CB  1 
ATOM   3084 C  CG  . ARG B 1 189 ? -10.151 1.177   24.038  1.00 16.96 ? 188 ARG C CG  1 
ATOM   3085 C  CD  . ARG B 1 189 ? -10.069 0.645   22.611  1.00 18.64 ? 188 ARG C CD  1 
ATOM   3086 N  NE  . ARG B 1 189 ? -9.837  -0.807  22.617  1.00 17.65 ? 188 ARG C NE  1 
ATOM   3087 C  CZ  . ARG B 1 189 ? -8.643  -1.398  22.747  1.00 19.02 ? 188 ARG C CZ  1 
ATOM   3088 N  NH1 . ARG B 1 189 ? -7.526  -0.680  22.875  1.00 17.64 ? 188 ARG C NH1 1 
ATOM   3089 N  NH2 . ARG B 1 189 ? -8.557  -2.731  22.759  1.00 17.81 ? 188 ARG C NH2 1 
ATOM   3090 N  N   . PHE B 1 190 ? -11.521 5.386   25.380  1.00 18.84 ? 189 PHE C N   1 
ATOM   3091 C  CA  . PHE B 1 190 ? -11.586 6.853   25.413  1.00 19.54 ? 189 PHE C CA  1 
ATOM   3092 C  C   . PHE B 1 190 ? -11.185 7.385   26.793  1.00 20.14 ? 189 PHE C C   1 
ATOM   3093 O  O   . PHE B 1 190 ? -10.286 8.223   26.898  1.00 20.48 ? 189 PHE C O   1 
ATOM   3094 C  CB  . PHE B 1 190 ? -12.987 7.317   25.017  1.00 18.11 ? 189 PHE C CB  1 
ATOM   3095 C  CG  . PHE B 1 190 ? -13.196 8.809   25.082  1.00 18.14 ? 189 PHE C CG  1 
ATOM   3096 C  CD1 . PHE B 1 190 ? -12.590 9.658   24.155  1.00 14.37 ? 189 PHE C CD1 1 
ATOM   3097 C  CD2 . PHE B 1 190 ? -14.047 9.358   26.043  1.00 15.57 ? 189 PHE C CD2 1 
ATOM   3098 C  CE1 . PHE B 1 190 ? -12.819 11.045  24.192  1.00 17.40 ? 189 PHE C CE1 1 
ATOM   3099 C  CE2 . PHE B 1 190 ? -14.274 10.745  26.093  1.00 16.58 ? 189 PHE C CE2 1 
ATOM   3100 C  CZ  . PHE B 1 190 ? -13.655 11.580  25.158  1.00 15.09 ? 189 PHE C CZ  1 
ATOM   3101 N  N   . ALA B 1 191 ? -11.813 6.863   27.845  1.00 20.64 ? 190 ALA C N   1 
ATOM   3102 C  CA  . ALA B 1 191 ? -11.459 7.237   29.218  1.00 21.84 ? 190 ALA C CA  1 
ATOM   3103 C  C   . ALA B 1 191 ? -9.962  7.031   29.480  1.00 22.68 ? 190 ALA C C   1 
ATOM   3104 O  O   . ALA B 1 191 ? -9.315  7.889   30.072  1.00 22.97 ? 190 ALA C O   1 
ATOM   3105 C  CB  . ALA B 1 191 ? -12.292 6.462   30.218  1.00 21.96 ? 190 ALA C CB  1 
ATOM   3106 N  N   . ASN B 1 192 ? -9.423  5.905   29.012  1.00 23.65 ? 191 ASN C N   1 
ATOM   3107 C  CA  . ASN B 1 192 ? -8.001  5.584   29.146  1.00 24.91 ? 191 ASN C CA  1 
ATOM   3108 C  C   . ASN B 1 192 ? -7.090  6.573   28.403  1.00 25.13 ? 191 ASN C C   1 
ATOM   3109 O  O   . ASN B 1 192 ? -6.041  6.965   28.911  1.00 25.31 ? 191 ASN C O   1 
ATOM   3110 C  CB  . ASN B 1 192 ? -7.727  4.148   28.670  1.00 25.01 ? 191 ASN C CB  1 
ATOM   3111 C  CG  . ASN B 1 192 ? -8.357  3.081   29.581  1.00 26.51 ? 191 ASN C CG  1 
ATOM   3112 O  OD1 . ASN B 1 192 ? -8.698  3.345   30.736  1.00 28.44 ? 191 ASN C OD1 1 
ATOM   3113 N  ND2 . ASN B 1 192 ? -8.501  1.864   29.055  1.00 27.17 ? 191 ASN C ND2 1 
ATOM   3114 N  N   . ALA B 1 193 ? -7.515  6.978   27.210  1.00 25.98 ? 192 ALA C N   1 
ATOM   3115 C  CA  . ALA B 1 193 ? -6.766  7.925   26.367  1.00 26.99 ? 192 ALA C CA  1 
ATOM   3116 C  C   . ALA B 1 193 ? -6.724  9.356   26.926  1.00 28.20 ? 192 ALA C C   1 
ATOM   3117 O  O   . ALA B 1 193 ? -5.834  10.138  26.579  1.00 28.47 ? 192 ALA C O   1 
ATOM   3118 C  CB  . ALA B 1 193 ? -7.337  7.925   24.954  1.00 26.73 ? 192 ALA C CB  1 
ATOM   3119 N  N   . ARG B 1 194 ? -7.686  9.694   27.781  1.00 29.23 ? 193 ARG C N   1 
ATOM   3120 C  CA  . ARG B 1 194 ? -7.749  11.026  28.390  1.00 31.03 ? 193 ARG C CA  1 
ATOM   3121 C  C   . ARG B 1 194 ? -7.123  11.084  29.788  1.00 31.88 ? 193 ARG C C   1 
ATOM   3122 O  O   . ARG B 1 194 ? -7.294  12.067  30.509  1.00 32.57 ? 193 ARG C O   1 
ATOM   3123 C  CB  . ARG B 1 194 ? -9.192  11.539  28.416  1.00 30.82 ? 193 ARG C CB  1 
ATOM   3124 C  CG  . ARG B 1 194 ? -9.797  11.634  27.037  1.00 31.87 ? 193 ARG C CG  1 
ATOM   3125 C  CD  . ARG B 1 194 ? -11.206 12.115  27.099  1.00 35.25 ? 193 ARG C CD  1 
ATOM   3126 N  NE  . ARG B 1 194 ? -11.307 13.564  27.200  1.00 37.03 ? 193 ARG C NE  1 
ATOM   3127 C  CZ  . ARG B 1 194 ? -12.386 14.208  27.636  1.00 37.58 ? 193 ARG C CZ  1 
ATOM   3128 N  NH1 . ARG B 1 194 ? -13.457 13.535  28.052  1.00 38.39 ? 193 ARG C NH1 1 
ATOM   3129 N  NH2 . ARG B 1 194 ? -12.384 15.533  27.684  1.00 37.76 ? 193 ARG C NH2 1 
ATOM   3130 N  N   . GLN B 1 195 ? -6.386  10.034  30.150  1.00 33.27 ? 194 GLN C N   1 
ATOM   3131 C  CA  . GLN B 1 195 ? -5.716  9.954   31.448  1.00 34.18 ? 194 GLN C CA  1 
ATOM   3132 C  C   . GLN B 1 195 ? -4.343  10.615  31.383  1.00 34.38 ? 194 GLN C C   1 
ATOM   3133 O  O   . GLN B 1 195 ? -3.815  11.070  32.401  1.00 34.55 ? 194 GLN C O   1 
ATOM   3134 C  CB  . GLN B 1 195 ? -5.575  8.495   31.897  1.00 34.28 ? 194 GLN C CB  1 
ATOM   3135 C  CG  . GLN B 1 195 ? -6.897  7.796   32.238  1.00 35.09 ? 194 GLN C CG  1 
ATOM   3136 C  CD  . GLN B 1 195 ? -6.752  6.280   32.384  1.00 35.15 ? 194 GLN C CD  1 
ATOM   3137 O  OE1 . GLN B 1 195 ? -5.689  5.714   32.111  1.00 37.98 ? 194 GLN C OE1 1 
ATOM   3138 N  NE2 . GLN B 1 195 ? -7.829  5.616   32.809  1.00 35.22 ? 194 GLN C NE2 1 
HETATM 3139 MN MN  . MN  C 2 .   ? 25.229  12.838  2.561   1.00 13.65 ? 195 MN  A MN  1 
HETATM 3140 C  C1  . MLI D 3 .   ? 19.795  21.351  -12.794 1.00 24.25 ? 196 MLI A C1  1 
HETATM 3141 C  C2  . MLI D 3 .   ? 18.703  21.026  -13.835 1.00 27.76 ? 196 MLI A C2  1 
HETATM 3142 C  C3  . MLI D 3 .   ? 20.464  22.666  -13.192 1.00 25.73 ? 196 MLI A C3  1 
HETATM 3143 O  O6  . MLI D 3 .   ? 17.795  20.240  -13.486 1.00 28.56 ? 196 MLI A O6  1 
HETATM 3144 O  O7  . MLI D 3 .   ? 18.770  21.577  -14.959 1.00 28.97 ? 196 MLI A O7  1 
HETATM 3145 O  O8  . MLI D 3 .   ? 21.498  22.574  -13.898 1.00 24.75 ? 196 MLI A O8  1 
HETATM 3146 O  O9  . MLI D 3 .   ? 19.932  23.723  -12.780 1.00 22.63 ? 196 MLI A O9  1 
HETATM 3147 MN MN  . MN  E 2 .   ? -8.231  -8.626  9.111   1.00 16.13 ? 195 MN  C MN  1 
HETATM 3148 O  O   . HOH F 4 .   ? 23.138  12.081  2.193   1.00 9.89  ? 197 HOH A O   1 
HETATM 3149 O  O   . HOH F 4 .   ? 19.187  21.497  -8.494  1.00 15.32 ? 198 HOH A O   1 
HETATM 3150 O  O   . HOH F 4 .   ? 13.861  13.867  -0.037  0.50 11.03 ? 199 HOH A O   1 
HETATM 3151 O  O   . HOH F 4 .   ? 27.428  26.152  -13.202 1.00 17.02 ? 200 HOH A O   1 
HETATM 3152 O  O   . HOH F 4 .   ? 13.638  8.933   -4.473  1.00 17.52 ? 201 HOH A O   1 
HETATM 3153 O  O   . HOH F 4 .   ? 20.167  14.259  10.189  1.00 18.57 ? 202 HOH A O   1 
HETATM 3154 O  O   . HOH F 4 .   ? 10.757  11.726  1.136   1.00 21.00 ? 203 HOH A O   1 
HETATM 3155 O  O   . HOH F 4 .   ? 25.126  21.475  -16.395 1.00 20.53 ? 204 HOH A O   1 
HETATM 3156 O  O   . HOH F 4 .   ? 24.163  28.478  -10.505 1.00 23.41 ? 205 HOH A O   1 
HETATM 3157 O  O   . HOH F 4 .   ? 24.696  24.078  -16.664 1.00 25.39 ? 206 HOH A O   1 
HETATM 3158 O  O   . HOH F 4 .   ? 26.559  17.898  -16.308 1.00 20.22 ? 207 HOH A O   1 
HETATM 3159 O  O   . HOH F 4 .   ? 11.772  -2.347  14.537  1.00 31.78 ? 208 HOH A O   1 
HETATM 3160 O  O   . HOH F 4 .   ? 33.778  2.649   7.670   1.00 30.08 ? 209 HOH A O   1 
HETATM 3161 O  O   . HOH F 4 .   ? 10.508  9.874   -6.929  1.00 31.03 ? 210 HOH A O   1 
HETATM 3162 O  O   . HOH F 4 .   ? 8.531   13.314  -5.240  1.00 23.85 ? 211 HOH A O   1 
HETATM 3163 O  O   . HOH F 4 .   ? 33.530  25.785  -3.958  1.00 32.02 ? 212 HOH A O   1 
HETATM 3164 O  O   . HOH F 4 .   ? 12.686  7.108   2.583   1.00 26.02 ? 213 HOH A O   1 
HETATM 3165 O  O   . HOH F 4 .   ? 15.871  8.059   -10.946 1.00 22.50 ? 214 HOH A O   1 
HETATM 3166 O  O   . HOH F 4 .   ? 27.305  21.401  0.077   1.00 14.99 ? 215 HOH A O   1 
HETATM 3167 O  O   . HOH F 4 .   ? 23.431  1.514   0.900   1.00 17.79 ? 216 HOH A O   1 
HETATM 3168 O  O   . HOH F 4 .   ? 22.902  14.516  9.064   1.00 15.48 ? 217 HOH A O   1 
HETATM 3169 O  O   . HOH F 4 .   ? 31.224  14.485  0.197   1.00 19.53 ? 218 HOH A O   1 
HETATM 3170 O  O   . HOH F 4 .   ? 21.099  4.680   -0.205  1.00 15.27 ? 219 HOH A O   1 
HETATM 3171 O  O   . HOH F 4 .   ? 38.354  17.458  -1.058  1.00 20.04 ? 220 HOH A O   1 
HETATM 3172 O  O   . HOH F 4 .   ? 13.210  9.801   -7.232  1.00 16.56 ? 221 HOH A O   1 
HETATM 3173 O  O   . HOH F 4 .   ? 20.213  21.013  -5.978  1.00 15.89 ? 222 HOH A O   1 
HETATM 3174 O  O   . HOH F 4 .   ? 19.634  14.449  7.396   1.00 14.09 ? 223 HOH A O   1 
HETATM 3175 O  O   . HOH F 4 .   ? 19.012  17.043  0.145   1.00 11.78 ? 224 HOH A O   1 
HETATM 3176 O  O   . HOH F 4 .   ? 19.041  2.774   -17.259 1.00 28.01 ? 225 HOH A O   1 
HETATM 3177 O  O   . HOH F 4 .   ? 36.610  21.276  -5.011  1.00 32.36 ? 226 HOH A O   1 
HETATM 3178 O  O   . HOH F 4 .   ? 26.880  22.744  13.636  1.00 21.73 ? 227 HOH A O   1 
HETATM 3179 O  O   . HOH F 4 .   ? 30.438  -2.232  3.607   1.00 34.42 ? 228 HOH A O   1 
HETATM 3180 O  O   . HOH F 4 .   ? 22.400  17.025  9.854   1.00 16.41 ? 229 HOH A O   1 
HETATM 3181 O  O   . HOH F 4 .   ? 32.540  24.464  -1.687  1.00 25.94 ? 230 HOH A O   1 
HETATM 3182 O  O   . HOH F 4 .   ? 30.014  -3.933  -0.527  1.00 23.03 ? 231 HOH A O   1 
HETATM 3183 O  O   . HOH F 4 .   ? 15.581  7.153   4.826   1.00 14.52 ? 232 HOH A O   1 
HETATM 3184 O  O   . HOH F 4 .   ? 16.177  2.062   -8.459  1.00 23.49 ? 233 HOH A O   1 
HETATM 3185 O  O   . HOH F 4 .   ? 23.567  -1.167  1.865   1.00 20.89 ? 234 HOH A O   1 
HETATM 3186 O  O   . HOH F 4 .   ? 33.278  -5.683  0.647   1.00 36.56 ? 235 HOH A O   1 
HETATM 3187 O  O   . HOH F 4 .   ? 24.574  11.220  -18.143 1.00 32.51 ? 236 HOH A O   1 
HETATM 3188 O  O   . HOH F 4 .   ? 28.261  20.328  2.582   1.00 16.77 ? 237 HOH A O   1 
HETATM 3189 O  O   . HOH F 4 .   ? 33.896  4.789   6.214   1.00 20.26 ? 238 HOH A O   1 
HETATM 3190 O  O   . HOH F 4 .   ? 13.928  11.019  -2.790  1.00 17.86 ? 239 HOH A O   1 
HETATM 3191 O  O   . HOH F 4 .   ? 29.641  14.665  -2.029  1.00 17.25 ? 240 HOH A O   1 
HETATM 3192 O  O   . HOH F 4 .   ? 14.476  4.026   -1.284  1.00 19.72 ? 241 HOH A O   1 
HETATM 3193 O  O   . HOH F 4 .   ? 20.227  -2.299  -13.482 1.00 30.39 ? 242 HOH A O   1 
HETATM 3194 O  O   . HOH F 4 .   ? 18.521  12.281  -15.635 1.00 20.60 ? 243 HOH A O   1 
HETATM 3195 O  O   . HOH F 4 .   ? -2.453  1.329   17.255  1.00 23.51 ? 244 HOH A O   1 
HETATM 3196 O  O   . HOH F 4 .   ? 37.936  5.380   11.926  1.00 34.10 ? 245 HOH A O   1 
HETATM 3197 O  O   . HOH F 4 .   ? 33.799  13.476  -15.433 1.00 23.64 ? 246 HOH A O   1 
HETATM 3198 O  O   . HOH F 4 .   ? 28.600  0.820   5.737   1.00 25.46 ? 247 HOH A O   1 
HETATM 3199 O  O   . HOH F 4 .   ? 21.758  -9.851  -3.996  1.00 35.31 ? 248 HOH A O   1 
HETATM 3200 O  O   . HOH F 4 .   ? 15.363  17.117  -6.755  1.00 12.66 ? 249 HOH A O   1 
HETATM 3201 O  O   . HOH F 4 .   ? 38.886  11.798  8.853   1.00 34.79 ? 250 HOH A O   1 
HETATM 3202 O  O   . HOH F 4 .   ? 19.550  15.865  15.086  1.00 31.61 ? 251 HOH A O   1 
HETATM 3203 O  O   . HOH F 4 .   ? 23.929  2.282   19.962  1.00 33.85 ? 252 HOH A O   1 
HETATM 3204 O  O   . HOH F 4 .   ? 36.576  24.449  0.471   1.00 27.19 ? 253 HOH A O   1 
HETATM 3205 O  O   . HOH F 4 .   ? 15.565  16.030  -9.460  1.00 17.61 ? 254 HOH A O   1 
HETATM 3206 O  O   . HOH F 4 .   ? 32.307  15.192  14.194  1.00 27.69 ? 255 HOH A O   1 
HETATM 3207 O  O   . HOH F 4 .   ? 21.441  16.404  6.297   1.00 19.65 ? 256 HOH A O   1 
HETATM 3208 O  O   . HOH F 4 .   ? 32.503  3.124   12.144  1.00 29.17 ? 257 HOH A O   1 
HETATM 3209 O  O   . HOH F 4 .   ? 19.593  5.442   -17.076 1.00 23.22 ? 258 HOH A O   1 
HETATM 3210 O  O   . HOH F 4 .   ? 3.306   2.289   15.913  1.00 36.16 ? 259 HOH A O   1 
HETATM 3211 O  O   . HOH F 4 .   ? 39.821  6.274   -0.470  1.00 30.11 ? 260 HOH A O   1 
HETATM 3212 O  O   . HOH F 4 .   ? 38.154  18.391  -12.342 1.00 28.69 ? 261 HOH A O   1 
HETATM 3213 O  O   . HOH F 4 .   ? 26.974  16.934  14.252  1.00 24.88 ? 262 HOH A O   1 
HETATM 3214 O  O   . HOH F 4 .   ? 27.729  25.143  -10.584 1.00 23.22 ? 263 HOH A O   1 
HETATM 3215 O  O   . HOH F 4 .   ? 20.599  13.190  -17.136 1.00 30.56 ? 264 HOH A O   1 
HETATM 3216 O  O   . HOH F 4 .   ? 18.753  16.611  -3.503  1.00 24.62 ? 265 HOH A O   1 
HETATM 3217 O  O   . HOH F 4 .   ? 8.418   1.188   9.346   1.00 31.70 ? 266 HOH A O   1 
HETATM 3218 O  O   . HOH F 4 .   ? 32.493  21.163  9.917   1.00 37.34 ? 267 HOH A O   1 
HETATM 3219 O  O   . HOH F 4 .   ? 10.809  6.800   14.016  1.00 23.31 ? 268 HOH A O   1 
HETATM 3220 O  O   . HOH F 4 .   ? 12.747  6.434   7.466   1.00 28.56 ? 269 HOH A O   1 
HETATM 3221 O  O   . HOH F 4 .   ? 19.029  12.540  11.966  1.00 25.21 ? 270 HOH A O   1 
HETATM 3222 O  O   . HOH F 4 .   ? 29.780  26.256  -9.426  1.00 27.01 ? 271 HOH A O   1 
HETATM 3223 O  O   . HOH F 4 .   ? 29.465  11.030  15.698  1.00 33.34 ? 272 HOH A O   1 
HETATM 3224 O  O   . HOH F 4 .   ? 42.951  18.638  3.686   1.00 33.92 ? 273 HOH A O   1 
HETATM 3225 O  O   . HOH F 4 .   ? 24.427  17.887  11.308  1.00 20.91 ? 274 HOH A O   1 
HETATM 3226 O  O   . HOH F 4 .   ? 31.508  2.800   9.632   1.00 26.39 ? 275 HOH A O   1 
HETATM 3227 O  O   . HOH F 4 .   ? 31.725  8.921   16.742  1.00 33.10 ? 276 HOH A O   1 
HETATM 3228 O  O   . HOH F 4 .   ? 38.754  3.507   0.338   1.00 28.87 ? 277 HOH A O   1 
HETATM 3229 O  O   . HOH F 4 .   ? 33.483  22.723  8.001   1.00 34.35 ? 278 HOH A O   1 
HETATM 3230 O  O   . HOH F 4 .   ? 30.910  11.201  -16.323 1.00 24.60 ? 279 HOH A O   1 
HETATM 3231 O  O   . HOH F 4 .   ? 17.230  -0.772  -2.150  1.00 32.50 ? 280 HOH A O   1 
HETATM 3232 O  O   . HOH F 4 .   ? 29.865  28.254  -1.593  1.00 36.80 ? 281 HOH A O   1 
HETATM 3233 O  O   . HOH F 4 .   ? 36.427  5.594   5.743   1.00 21.97 ? 282 HOH A O   1 
HETATM 3234 O  O   . HOH F 4 .   ? 14.908  6.305   -5.320  1.00 23.61 ? 283 HOH A O   1 
HETATM 3235 O  O   . HOH F 4 .   ? 17.604  18.569  -5.976  1.00 19.83 ? 284 HOH A O   1 
HETATM 3236 O  O   . HOH F 4 .   ? 44.430  10.922  -0.611  1.00 29.66 ? 285 HOH A O   1 
HETATM 3237 O  O   . HOH F 4 .   ? 20.420  6.591   -19.503 1.00 29.07 ? 286 HOH A O   1 
HETATM 3238 O  O   . HOH F 4 .   ? 21.500  -5.081  -14.811 1.00 41.35 ? 287 HOH A O   1 
HETATM 3239 O  O   . HOH F 4 .   ? 32.042  26.823  -5.896  1.00 43.97 ? 288 HOH A O   1 
HETATM 3240 O  O   . HOH F 4 .   ? 40.521  13.146  6.798   1.00 42.06 ? 289 HOH A O   1 
HETATM 3241 O  O   . HOH F 4 .   ? 35.202  6.445   -13.311 1.00 28.87 ? 290 HOH A O   1 
HETATM 3242 O  O   . HOH F 4 .   ? 16.617  0.712   -4.363  1.00 33.10 ? 291 HOH A O   1 
HETATM 3243 O  O   . HOH F 4 .   ? 24.239  9.517   20.944  1.00 44.08 ? 292 HOH A O   1 
HETATM 3244 O  O   . HOH F 4 .   ? 26.196  -14.642 -6.321  1.00 41.24 ? 293 HOH A O   1 
HETATM 3245 O  O   . HOH F 4 .   ? 29.193  16.982  15.189  1.00 29.44 ? 294 HOH A O   1 
HETATM 3246 O  O   . HOH F 4 .   ? 35.640  -1.640  1.647   1.00 31.29 ? 295 HOH A O   1 
HETATM 3247 O  O   . HOH F 4 .   ? 39.213  -0.269  -0.257  1.00 31.73 ? 296 HOH A O   1 
HETATM 3248 O  O   . HOH F 4 .   ? 10.674  2.531   8.722   1.00 26.90 ? 297 HOH A O   1 
HETATM 3249 O  O   . HOH F 4 .   ? 42.653  9.554   -1.908  1.00 30.67 ? 298 HOH A O   1 
HETATM 3250 O  O   . HOH F 4 .   ? 13.647  -2.201  0.091   1.00 50.66 ? 299 HOH A O   1 
HETATM 3251 O  O   . HOH F 4 .   ? 42.492  3.658   -4.284  1.00 42.16 ? 300 HOH A O   1 
HETATM 3252 O  O   . HOH F 4 .   ? 16.290  11.076  13.389  1.00 35.19 ? 301 HOH A O   1 
HETATM 3253 O  O   . HOH F 4 .   ? 18.935  18.798  -8.235  1.00 28.09 ? 302 HOH A O   1 
HETATM 3254 O  O   . HOH F 4 .   ? 33.056  26.120  0.317   1.00 35.93 ? 303 HOH A O   1 
HETATM 3255 O  O   . HOH F 4 .   ? 37.211  -7.069  -8.699  1.00 31.88 ? 304 HOH A O   1 
HETATM 3256 O  O   . HOH F 4 .   ? 31.266  -6.315  -1.033  1.00 23.92 ? 305 HOH A O   1 
HETATM 3257 O  O   . HOH F 4 .   ? 22.554  20.891  -15.639 1.00 21.66 ? 306 HOH A O   1 
HETATM 3258 O  O   . HOH F 4 .   ? 20.026  16.750  11.054  1.00 17.49 ? 307 HOH A O   1 
HETATM 3259 O  O   . HOH F 4 .   ? 22.454  24.700  -15.263 1.00 21.82 ? 308 HOH A O   1 
HETATM 3260 O  O   . HOH F 4 .   ? 16.132  0.197   2.242   1.00 23.38 ? 309 HOH A O   1 
HETATM 3261 O  O   . HOH F 4 .   ? 11.331  8.889   12.506  1.00 35.02 ? 310 HOH A O   1 
HETATM 3262 O  O   . HOH F 4 .   ? 14.803  7.819   -13.440 1.00 31.59 ? 311 HOH A O   1 
HETATM 3263 O  O   . HOH F 4 .   ? 38.885  2.652   2.945   1.00 34.53 ? 312 HOH A O   1 
HETATM 3264 O  O   . HOH F 4 .   ? 18.033  -1.165  16.853  1.00 26.00 ? 313 HOH A O   1 
HETATM 3265 O  O   . HOH F 4 .   ? 21.452  15.834  -16.855 1.00 31.48 ? 314 HOH A O   1 
HETATM 3266 O  O   . HOH F 4 .   ? 14.412  7.935   -8.594  1.00 29.61 ? 315 HOH A O   1 
HETATM 3267 O  O   . HOH F 4 .   ? 34.889  14.701  13.719  1.00 32.54 ? 316 HOH A O   1 
HETATM 3268 O  O   . HOH F 4 .   ? 36.114  10.209  12.625  1.00 33.43 ? 317 HOH A O   1 
HETATM 3269 O  O   . HOH F 4 .   ? 31.453  13.022  16.043  1.00 33.02 ? 318 HOH A O   1 
HETATM 3270 O  O   . HOH F 4 .   ? 11.311  7.550   -4.079  1.00 30.35 ? 319 HOH A O   1 
HETATM 3271 O  O   . HOH F 4 .   ? 18.027  -2.201  -9.935  1.00 38.93 ? 320 HOH A O   1 
HETATM 3272 O  O   . HOH F 4 .   ? -2.386  0.465   19.962  1.00 34.45 ? 321 HOH A O   1 
HETATM 3273 O  O   . HOH F 4 .   ? 35.964  -12.232 -7.590  1.00 47.47 ? 322 HOH A O   1 
HETATM 3274 O  O   . HOH F 4 .   ? 16.685  14.183  -14.817 1.00 27.92 ? 323 HOH A O   1 
HETATM 3275 O  O   . HOH F 4 .   ? 25.753  19.424  14.728  1.00 28.32 ? 324 HOH A O   1 
HETATM 3276 O  O   . HOH F 4 .   ? 42.597  -6.450  -12.730 1.00 42.17 ? 325 HOH A O   1 
HETATM 3277 O  O   . HOH F 4 .   ? 28.610  -4.353  1.877   1.00 39.16 ? 326 HOH A O   1 
HETATM 3278 O  O   . HOH F 4 .   ? 25.701  -2.537  3.208   1.00 31.44 ? 327 HOH A O   1 
HETATM 3279 O  O   . HOH F 4 .   ? 25.761  5.370   -23.576 1.00 35.12 ? 328 HOH A O   1 
HETATM 3280 O  O   . HOH F 4 .   ? 12.564  10.354  -10.792 1.00 32.28 ? 329 HOH A O   1 
HETATM 3281 O  O   . HOH F 4 .   ? 16.839  16.205  -12.109 1.00 36.38 ? 330 HOH A O   1 
HETATM 3282 O  O   . HOH F 4 .   ? 22.520  -4.568  0.454   1.00 36.82 ? 331 HOH A O   1 
HETATM 3283 O  O   . HOH F 4 .   ? 29.873  8.169   -19.852 1.00 38.90 ? 332 HOH A O   1 
HETATM 3284 O  O   . HOH F 4 .   ? 15.717  5.295   -10.337 1.00 33.53 ? 333 HOH A O   1 
HETATM 3285 O  O   . HOH F 4 .   ? 26.075  -0.581  18.164  1.00 47.87 ? 334 HOH A O   1 
HETATM 3286 O  O   . HOH F 4 .   ? 30.879  28.881  3.127   1.00 32.81 ? 335 HOH A O   1 
HETATM 3287 O  O   . HOH F 4 .   ? 33.501  2.768   -22.112 1.00 34.87 ? 336 HOH A O   1 
HETATM 3288 O  O   . HOH F 4 .   ? 42.140  7.071   -0.742  1.00 43.35 ? 337 HOH A O   1 
HETATM 3289 O  O   . HOH F 4 .   ? 23.460  16.444  15.695  1.00 32.72 ? 338 HOH A O   1 
HETATM 3290 O  O   . HOH F 4 .   ? 34.556  5.941   -19.025 1.00 43.76 ? 339 HOH A O   1 
HETATM 3291 O  O   . HOH F 4 .   ? 35.286  7.987   15.721  1.00 35.45 ? 340 HOH A O   1 
HETATM 3292 O  O   . HOH F 4 .   ? 27.702  10.103  -19.042 1.00 43.34 ? 341 HOH A O   1 
HETATM 3293 O  O   . HOH F 4 .   ? 29.781  7.608   18.875  1.00 34.44 ? 342 HOH A O   1 
HETATM 3294 O  O   . HOH F 4 .   ? 17.711  17.545  -10.091 1.00 34.46 ? 343 HOH A O   1 
HETATM 3295 O  O   . HOH F 4 .   ? 39.545  -2.187  -16.498 1.00 40.52 ? 344 HOH A O   1 
HETATM 3296 O  O   . HOH F 4 .   ? 35.986  5.437   14.471  1.00 45.57 ? 345 HOH A O   1 
HETATM 3297 O  O   . HOH F 4 .   ? 17.369  1.568   26.093  1.00 35.20 ? 346 HOH A O   1 
HETATM 3298 O  O   . HOH F 4 .   ? 13.369  13.631  -11.965 1.00 34.36 ? 347 HOH A O   1 
HETATM 3299 O  O   . HOH F 4 .   ? 23.788  4.509   -21.998 1.00 42.16 ? 348 HOH A O   1 
HETATM 3300 O  O   . HOH F 4 .   ? 27.850  -2.848  16.898  1.00 41.90 ? 349 HOH A O   1 
HETATM 3301 O  O   . HOH F 4 .   ? 44.187  8.416   -3.679  1.00 29.06 ? 350 HOH A O   1 
HETATM 3302 O  O   . HOH F 4 .   ? 30.141  19.255  16.002  1.00 35.64 ? 351 HOH A O   1 
HETATM 3303 O  O   . HOH F 4 .   ? 15.931  0.487   -0.096  1.00 48.06 ? 352 HOH A O   1 
HETATM 3304 O  O   . HOH F 4 .   ? 27.366  8.851   19.085  1.00 38.83 ? 353 HOH A O   1 
HETATM 3305 O  O   . HOH F 4 .   ? 38.049  7.325   -10.801 1.00 34.93 ? 354 HOH A O   1 
HETATM 3306 O  O   . HOH F 4 .   ? 13.955  16.273  -11.749 1.00 35.14 ? 355 HOH A O   1 
HETATM 3307 O  O   . HOH F 4 .   ? 41.834  0.326   -9.210  1.00 50.64 ? 356 HOH A O   1 
HETATM 3308 O  O   . HOH F 4 .   ? 6.691   6.766   13.379  1.00 42.63 ? 357 HOH A O   1 
HETATM 3309 O  O   . HOH F 4 .   ? 34.187  11.413  16.146  1.00 53.16 ? 358 HOH A O   1 
HETATM 3310 O  O   . HOH F 4 .   ? 33.189  3.515   -24.720 1.00 51.23 ? 359 HOH A O   1 
HETATM 3311 O  O   . HOH F 4 .   ? 18.683  10.031  -20.367 1.00 49.69 ? 360 HOH A O   1 
HETATM 3312 O  O   . HOH F 4 .   ? 41.128  -3.982  -6.026  1.00 46.44 ? 361 HOH A O   1 
HETATM 3313 O  O   . HOH F 4 .   ? 37.574  -3.872  0.338   1.00 47.04 ? 362 HOH A O   1 
HETATM 3314 O  O   . HOH F 4 .   ? 28.522  9.910   -16.254 1.00 32.28 ? 363 HOH A O   1 
HETATM 3315 O  O   . HOH F 4 .   ? 41.839  -3.245  -8.589  1.00 43.90 ? 364 HOH A O   1 
HETATM 3316 O  O   . HOH F 4 .   ? 37.446  25.328  3.269   1.00 35.63 ? 365 HOH A O   1 
HETATM 3317 O  O   . HOH F 4 .   ? 21.870  14.750  17.367  1.00 33.50 ? 366 HOH A O   1 
HETATM 3318 O  O   . HOH F 4 .   ? 38.787  -2.543  -21.014 1.00 51.29 ? 367 HOH A O   1 
HETATM 3319 O  O   . HOH F 4 .   ? 13.956  13.223  -15.101 1.00 45.38 ? 368 HOH A O   1 
HETATM 3320 O  O   . HOH F 4 .   ? 47.225  13.485  6.854   1.00 47.66 ? 369 HOH A O   1 
HETATM 3321 O  O   . HOH F 4 .   ? 38.304  -8.070  -2.222  1.00 34.79 ? 370 HOH A O   1 
HETATM 3322 O  O   . HOH F 4 .   ? 27.070  -10.672 -14.512 1.00 32.39 ? 371 HOH A O   1 
HETATM 3323 O  O   . HOH F 4 .   ? 17.378  0.796   -12.049 1.00 37.45 ? 372 HOH A O   1 
HETATM 3324 O  O   . HOH F 4 .   ? 41.504  -2.749  1.342   1.00 52.36 ? 373 HOH A O   1 
HETATM 3325 O  O   . HOH F 4 .   ? 43.685  18.451  -3.262  1.00 52.15 ? 374 HOH A O   1 
HETATM 3326 O  O   . HOH F 4 .   ? 42.003  10.166  9.066   1.00 49.30 ? 375 HOH A O   1 
HETATM 3327 O  O   . HOH F 4 .   ? 11.932  -1.905  2.120   1.00 41.76 ? 376 HOH A O   1 
HETATM 3328 O  O   . HOH F 4 .   ? 16.726  10.919  -16.953 1.00 39.18 ? 377 HOH A O   1 
HETATM 3329 O  O   . HOH F 4 .   ? 18.660  17.651  -13.619 1.00 34.01 ? 378 HOH A O   1 
HETATM 3330 O  O   . HOH F 4 .   ? 16.229  2.953   -11.217 1.00 47.09 ? 379 HOH A O   1 
HETATM 3331 O  O   . HOH F 4 .   ? 46.622  9.860   -3.234  1.00 48.28 ? 380 HOH A O   1 
HETATM 3332 O  O   . HOH F 4 .   ? 10.284  11.437  -4.673  1.00 37.03 ? 381 HOH A O   1 
HETATM 3333 O  O   . HOH F 4 .   ? 13.363  1.092   1.515   1.00 39.80 ? 382 HOH A O   1 
HETATM 3334 O  O   . HOH F 4 .   ? 19.547  17.330  -15.915 1.00 32.89 ? 383 HOH A O   1 
HETATM 3335 O  O   . HOH F 4 .   ? 17.586  10.341  17.952  1.00 43.96 ? 384 HOH A O   1 
HETATM 3336 O  O   . HOH F 4 .   ? 16.625  8.587   -15.393 1.00 43.98 ? 385 HOH A O   1 
HETATM 3337 O  O   . HOH F 4 .   ? 14.634  1.509   -1.959  1.00 33.86 ? 386 HOH A O   1 
HETATM 3338 O  O   . HOH F 4 .   ? 17.049  6.728   -17.269 1.00 30.98 ? 387 HOH A O   1 
HETATM 3339 O  O   . HOH F 4 .   ? 9.578   -0.095  3.727   1.00 52.19 ? 388 HOH A O   1 
HETATM 3340 O  O   . HOH F 4 .   ? 18.293  -0.824  -14.530 1.00 38.71 ? 389 HOH A O   1 
HETATM 3341 O  O   . HOH F 4 .   ? 16.783  -1.129  -17.246 1.00 40.74 ? 390 HOH A O   1 
HETATM 3342 O  O   . HOH F 4 .   ? 40.990  2.072   -1.258  1.00 41.33 ? 391 HOH A O   1 
HETATM 3343 O  O   . HOH F 4 .   ? 28.060  -14.289 -7.760  1.00 40.29 ? 392 HOH A O   1 
HETATM 3344 O  O   . HOH F 4 .   ? 29.528  -12.998 -1.112  1.00 45.08 ? 393 HOH A O   1 
HETATM 3345 O  O   . HOH F 4 .   ? 30.079  -8.495  -0.129  1.00 39.10 ? 394 HOH A O   1 
HETATM 3346 O  O   . HOH F 4 .   ? 38.099  3.605   5.433   1.00 29.38 ? 395 HOH A O   1 
HETATM 3347 O  O   . HOH F 4 .   ? 12.588  5.997   -8.518  1.00 33.02 ? 396 HOH A O   1 
HETATM 3348 O  O   . HOH G 4 .   ? -6.950  -7.029  8.154   1.00 11.83 ? 196 HOH C O   1 
HETATM 3349 O  O   . HOH G 4 .   ? -3.292  -3.285  -0.011  0.50 12.46 ? 197 HOH C O   1 
HETATM 3350 O  O   . HOH G 4 .   ? -10.131 -1.206  -2.821  1.00 14.07 ? 198 HOH C O   1 
HETATM 3351 O  O   . HOH G 4 .   ? -0.396  -12.779 6.655   1.00 19.39 ? 199 HOH C O   1 
HETATM 3352 O  O   . HOH G 4 .   ? 13.088  -15.636 20.998  1.00 20.32 ? 200 HOH C O   1 
HETATM 3353 O  O   . HOH G 4 .   ? -4.531  2.983   2.058   1.00 21.73 ? 201 HOH C O   1 
HETATM 3354 O  O   . HOH G 4 .   ? -3.203  -15.287 6.276   1.00 21.43 ? 202 HOH C O   1 
HETATM 3355 O  O   . HOH G 4 .   ? 0.438   -1.599  -0.361  1.00 23.15 ? 203 HOH C O   1 
HETATM 3356 O  O   . HOH G 4 .   ? -7.145  14.691  27.098  1.00 43.19 ? 204 HOH C O   1 
HETATM 3357 O  O   . HOH G 4 .   ? -22.423 -8.892  -5.516  1.00 28.29 ? 205 HOH C O   1 
HETATM 3358 O  O   . HOH G 4 .   ? 12.520  -11.845 20.500  1.00 21.72 ? 206 HOH C O   1 
HETATM 3359 O  O   . HOH G 4 .   ? -2.944  -20.191 16.558  1.00 26.31 ? 207 HOH C O   1 
HETATM 3360 O  O   . HOH G 4 .   ? 9.734   -17.302 23.193  1.00 26.33 ? 208 HOH C O   1 
HETATM 3361 O  O   . HOH G 4 .   ? 11.853  -9.794  6.289   1.00 25.53 ? 209 HOH C O   1 
HETATM 3362 O  O   . HOH G 4 .   ? -3.347  2.759   -4.674  1.00 29.13 ? 210 HOH C O   1 
HETATM 3363 O  O   . HOH G 4 .   ? 21.491  -7.459  22.359  1.00 23.31 ? 211 HOH C O   1 
HETATM 3364 O  O   . HOH G 4 .   ? -22.556 -15.484 4.508   1.00 29.60 ? 212 HOH C O   1 
HETATM 3365 O  O   . HOH G 4 .   ? 8.834   -0.652  7.682   1.00 30.14 ? 213 HOH C O   1 
HETATM 3366 O  O   . HOH G 4 .   ? -0.765  -17.962 19.707  1.00 25.42 ? 214 HOH C O   1 
HETATM 3367 O  O   . HOH G 4 .   ? -10.672 -21.380 10.562  1.00 35.00 ? 215 HOH C O   1 
HETATM 3368 O  O   . HOH G 4 .   ? -11.246 5.115   -3.238  1.00 30.56 ? 216 HOH C O   1 
HETATM 3369 O  O   . HOH G 4 .   ? -16.546 -21.719 10.377  1.00 41.09 ? 217 HOH C O   1 
HETATM 3370 O  O   . HOH G 4 .   ? -14.616 11.601  2.907   1.00 31.59 ? 218 HOH C O   1 
HETATM 3371 O  O   . HOH G 4 .   ? 1.106   -9.566  22.532  1.00 29.15 ? 219 HOH C O   1 
HETATM 3372 O  O   . HOH G 4 .   ? 22.621  -13.120 11.374  1.00 42.52 ? 220 HOH C O   1 
HETATM 3373 O  O   . HOH G 4 .   ? 16.569  -13.654 18.768  1.00 14.30 ? 221 HOH C O   1 
HETATM 3374 O  O   . HOH G 4 .   ? 1.365   -2.920  7.017   1.00 13.97 ? 222 HOH C O   1 
HETATM 3375 O  O   . HOH G 4 .   ? -6.377  4.334   0.492   1.00 16.92 ? 223 HOH C O   1 
HETATM 3376 O  O   . HOH G 4 .   ? -7.352  -7.607  -1.415  1.00 16.37 ? 224 HOH C O   1 
HETATM 3377 O  O   . HOH G 4 .   ? -14.321 -13.134 3.935   1.00 21.27 ? 225 HOH C O   1 
HETATM 3378 O  O   . HOH G 4 .   ? 10.929  -7.226  6.256   1.00 17.77 ? 226 HOH C O   1 
HETATM 3379 O  O   . HOH G 4 .   ? -14.207 -10.218 11.562  1.00 20.54 ? 227 HOH C O   1 
HETATM 3380 O  O   . HOH G 4 .   ? -4.554  -0.032  11.057  1.00 16.82 ? 228 HOH C O   1 
HETATM 3381 O  O   . HOH G 4 .   ? -9.926  6.985   2.445   1.00 19.55 ? 229 HOH C O   1 
HETATM 3382 O  O   . HOH G 4 .   ? -16.383 6.534   0.284   1.00 23.59 ? 230 HOH C O   1 
HETATM 3383 O  O   . HOH G 4 .   ? -20.652 -14.171 14.036  1.00 22.56 ? 231 HOH C O   1 
HETATM 3384 O  O   . HOH G 4 .   ? -4.178  0.361   1.243   1.00 19.43 ? 232 HOH C O   1 
HETATM 3385 O  O   . HOH G 4 .   ? -14.099 -5.979  -2.138  1.00 18.26 ? 233 HOH C O   1 
HETATM 3386 O  O   . HOH G 4 .   ? -22.737 -4.529  -6.319  1.00 35.67 ? 234 HOH C O   1 
HETATM 3387 O  O   . HOH G 4 .   ? -14.807 -8.303  9.776   1.00 20.90 ? 235 HOH C O   1 
HETATM 3388 O  O   . HOH G 4 .   ? -2.812  -13.259 7.997   1.00 18.92 ? 236 HOH C O   1 
HETATM 3389 O  O   . HOH G 4 .   ? -15.421 -4.336  -3.723  1.00 18.05 ? 237 HOH C O   1 
HETATM 3390 O  O   . HOH G 4 .   ? -20.849 -18.662 8.019   1.00 32.03 ? 238 HOH C O   1 
HETATM 3391 O  O   . HOH G 4 .   ? -4.010  0.351   15.160  1.00 18.66 ? 239 HOH C O   1 
HETATM 3392 O  O   . HOH G 4 .   ? -25.466 -2.448  5.626   1.00 25.04 ? 240 HOH C O   1 
HETATM 3393 O  O   . HOH G 4 .   ? -14.301 13.577  6.951   1.00 28.83 ? 241 HOH C O   1 
HETATM 3394 O  O   . HOH G 4 .   ? -19.895 -15.772 5.055   1.00 32.41 ? 242 HOH C O   1 
HETATM 3395 O  O   . HOH G 4 .   ? -4.629  -12.019 5.016   1.00 20.64 ? 243 HOH C O   1 
HETATM 3396 O  O   . HOH G 4 .   ? -7.163  3.652   25.301  1.00 27.18 ? 244 HOH C O   1 
HETATM 3397 O  O   . HOH G 4 .   ? -10.089 -10.544 22.370  1.00 25.55 ? 245 HOH C O   1 
HETATM 3398 O  O   . HOH G 4 .   ? -8.188  -9.166  21.444  1.00 19.86 ? 246 HOH C O   1 
HETATM 3399 O  O   . HOH G 4 .   ? -6.027  9.095   7.263   1.00 20.98 ? 247 HOH C O   1 
HETATM 3400 O  O   . HOH G 4 .   ? -0.973  3.618   6.590   1.00 18.47 ? 248 HOH C O   1 
HETATM 3401 O  O   . HOH G 4 .   ? 18.556  -11.712 11.962  1.00 23.78 ? 249 HOH C O   1 
HETATM 3402 O  O   . HOH G 4 .   ? 24.920  -3.507  8.344   0.50 12.42 ? 250 HOH C O   1 
HETATM 3403 O  O   . HOH G 4 .   ? 26.043  -3.099  10.357  0.50 17.64 ? 251 HOH C O   1 
HETATM 3404 O  O   . HOH G 4 .   ? -6.802  2.237   22.865  1.00 22.71 ? 252 HOH C O   1 
HETATM 3405 O  O   . HOH G 4 .   ? 17.328  -9.074  7.467   1.00 31.40 ? 253 HOH C O   1 
HETATM 3406 O  O   . HOH G 4 .   ? -11.484 -3.594  -2.114  1.00 22.85 ? 254 HOH C O   1 
HETATM 3407 O  O   . HOH G 4 .   ? -25.592 -6.721  7.240   1.00 32.08 ? 255 HOH C O   1 
HETATM 3408 O  O   . HOH G 4 .   ? -12.887 -14.463 6.165   1.00 19.96 ? 256 HOH C O   1 
HETATM 3409 O  O   . HOH G 4 .   ? -2.017  -10.883 5.514   1.00 15.69 ? 257 HOH C O   1 
HETATM 3410 O  O   . HOH G 4 .   ? -11.653 1.157   -2.774  1.00 20.37 ? 258 HOH C O   1 
HETATM 3411 O  O   . HOH G 4 .   ? -25.371 -9.852  4.399   1.00 34.54 ? 259 HOH C O   1 
HETATM 3412 O  O   . HOH G 4 .   ? -2.140  11.541  20.438  1.00 30.49 ? 260 HOH C O   1 
HETATM 3413 O  O   . HOH G 4 .   ? -2.542  -11.825 23.027  1.00 33.87 ? 261 HOH C O   1 
HETATM 3414 O  O   . HOH G 4 .   ? 5.179   -3.196  6.374   1.00 24.83 ? 262 HOH C O   1 
HETATM 3415 O  O   . HOH G 4 .   ? 3.246   -18.149 17.554  1.00 29.87 ? 263 HOH C O   1 
HETATM 3416 O  O   . HOH G 4 .   ? -23.388 -8.551  -0.906  1.00 27.32 ? 264 HOH C O   1 
HETATM 3417 O  O   . HOH G 4 .   ? -15.444 11.513  5.514   1.00 28.15 ? 265 HOH C O   1 
HETATM 3418 O  O   . HOH G 4 .   ? -7.170  1.353   26.821  1.00 34.49 ? 266 HOH C O   1 
HETATM 3419 O  O   . HOH G 4 .   ? -22.514 -8.809  23.617  1.00 35.47 ? 267 HOH C O   1 
HETATM 3420 O  O   . HOH G 4 .   ? -3.449  -9.385  22.065  1.00 25.69 ? 268 HOH C O   1 
HETATM 3421 O  O   . HOH G 4 .   ? -2.953  6.981   9.440   1.00 34.49 ? 269 HOH C O   1 
HETATM 3422 O  O   . HOH G 4 .   ? -1.119  -17.954 16.778  1.00 25.93 ? 270 HOH C O   1 
HETATM 3423 O  O   . HOH G 4 .   ? 2.194   -12.524 7.506   1.00 20.93 ? 271 HOH C O   1 
HETATM 3424 O  O   . HOH G 4 .   ? 2.933   -16.798 6.418   1.00 40.99 ? 272 HOH C O   1 
HETATM 3425 O  O   . HOH G 4 .   ? -14.453 -17.546 20.630  1.00 42.84 ? 273 HOH C O   1 
HETATM 3426 O  O   . HOH G 4 .   ? -6.781  -15.115 25.386  1.00 35.52 ? 274 HOH C O   1 
HETATM 3427 O  O   . HOH G 4 .   ? -23.858 -13.361 8.643   1.00 31.68 ? 275 HOH C O   1 
HETATM 3428 O  O   . HOH G 4 .   ? 6.290   -18.457 15.304  1.00 32.14 ? 276 HOH C O   1 
HETATM 3429 O  O   . HOH G 4 .   ? -6.822  -17.638 21.209  1.00 28.41 ? 277 HOH C O   1 
HETATM 3430 O  O   . HOH G 4 .   ? -19.012 6.240   0.664   1.00 30.21 ? 278 HOH C O   1 
HETATM 3431 O  O   . HOH G 4 .   ? -16.306 -5.238  26.329  1.00 35.51 ? 279 HOH C O   1 
HETATM 3432 O  O   . HOH G 4 .   ? 15.594  -15.693 15.202  1.00 32.51 ? 280 HOH C O   1 
HETATM 3433 O  O   . HOH G 4 .   ? 17.615  -7.470  24.622  1.00 27.44 ? 281 HOH C O   1 
HETATM 3434 O  O   . HOH G 4 .   ? 13.100  -5.471  3.445   1.00 26.36 ? 282 HOH C O   1 
HETATM 3435 O  O   . HOH G 4 .   ? -8.398  -12.636 25.548  1.00 40.40 ? 283 HOH C O   1 
HETATM 3436 O  O   . HOH G 4 .   ? -10.169 9.611   31.832  1.00 43.83 ? 284 HOH C O   1 
HETATM 3437 O  O   . HOH G 4 .   ? -18.155 12.011  4.482   1.00 27.48 ? 285 HOH C O   1 
HETATM 3438 O  O   . HOH G 4 .   ? -15.561 7.236   28.542  1.00 36.68 ? 286 HOH C O   1 
HETATM 3439 O  O   . HOH G 4 .   ? -13.966 -2.501  -2.075  1.00 27.09 ? 287 HOH C O   1 
HETATM 3440 O  O   . HOH G 4 .   ? -3.524  -4.258  20.599  1.00 32.42 ? 288 HOH C O   1 
HETATM 3441 O  O   . HOH G 4 .   ? 18.506  -2.832  4.789   1.00 29.79 ? 289 HOH C O   1 
HETATM 3442 O  O   . HOH G 4 .   ? -4.699  4.693   4.562   1.00 24.67 ? 290 HOH C O   1 
HETATM 3443 O  O   . HOH G 4 .   ? -22.953 2.382   16.569  1.00 29.74 ? 291 HOH C O   1 
HETATM 3444 O  O   . HOH G 4 .   ? -25.866 -5.776  17.779  1.00 35.24 ? 292 HOH C O   1 
HETATM 3445 O  O   . HOH G 4 .   ? -13.810 -3.500  27.140  1.00 33.24 ? 293 HOH C O   1 
HETATM 3446 O  O   . HOH G 4 .   ? 14.501  -2.333  12.981  1.00 37.58 ? 294 HOH C O   1 
HETATM 3447 O  O   . HOH G 4 .   ? -9.646  -2.755  25.817  1.00 32.39 ? 295 HOH C O   1 
HETATM 3448 O  O   . HOH G 4 .   ? -3.652  -21.146 12.153  1.00 34.60 ? 296 HOH C O   1 
HETATM 3449 O  O   . HOH G 4 .   ? -22.331 4.643   8.430   1.00 31.81 ? 297 HOH C O   1 
HETATM 3450 O  O   . HOH G 4 .   ? 1.933   2.931   11.329  1.00 23.86 ? 298 HOH C O   1 
HETATM 3451 O  O   . HOH G 4 .   ? 13.416  -1.623  5.192   1.00 31.05 ? 299 HOH C O   1 
HETATM 3452 O  O   . HOH G 4 .   ? 6.228   3.456   11.911  1.00 33.49 ? 300 HOH C O   1 
HETATM 3453 O  O   . HOH G 4 .   ? -9.753  -4.390  0.716   1.00 26.82 ? 301 HOH C O   1 
HETATM 3454 O  O   . HOH G 4 .   ? 11.230  0.395   7.374   1.00 30.21 ? 302 HOH C O   1 
HETATM 3455 O  O   . HOH G 4 .   ? -1.224  6.143   11.575  1.00 35.77 ? 303 HOH C O   1 
HETATM 3456 O  O   . HOH G 4 .   ? 21.227  -11.083 11.720  1.00 33.62 ? 304 HOH C O   1 
HETATM 3457 O  O   . HOH G 4 .   ? -5.342  -20.693 15.282  1.00 27.87 ? 305 HOH C O   1 
HETATM 3458 O  O   . HOH G 4 .   ? -26.670 -17.912 13.543  1.00 42.61 ? 306 HOH C O   1 
HETATM 3459 O  O   . HOH G 4 .   ? 22.628  -16.520 16.063  1.00 32.75 ? 307 HOH C O   1 
HETATM 3460 O  O   . HOH G 4 .   ? -10.426 13.808  11.933  1.00 26.66 ? 308 HOH C O   1 
HETATM 3461 O  O   . HOH G 4 .   ? 1.853   -17.908 20.100  1.00 30.69 ? 309 HOH C O   1 
HETATM 3462 O  O   . HOH G 4 .   ? -9.077  11.765  8.086   1.00 42.19 ? 310 HOH C O   1 
HETATM 3463 O  O   . HOH G 4 .   ? 0.772   -19.541 10.745  1.00 34.66 ? 311 HOH C O   1 
HETATM 3464 O  O   . HOH G 4 .   ? 5.618   -11.564 6.907   1.00 32.48 ? 312 HOH C O   1 
HETATM 3465 O  O   . HOH G 4 .   ? 1.746   -0.426  4.375   1.00 27.29 ? 313 HOH C O   1 
HETATM 3466 O  O   . HOH G 4 .   ? 8.977   -6.180  19.705  1.00 26.04 ? 314 HOH C O   1 
HETATM 3467 O  O   . HOH G 4 .   ? -18.921 16.545  10.994  1.00 38.26 ? 315 HOH C O   1 
HETATM 3468 O  O   . HOH G 4 .   ? 6.789   -0.855  5.634   1.00 39.47 ? 316 HOH C O   1 
HETATM 3469 O  O   . HOH G 4 .   ? 25.334  -6.261  0.921   1.00 41.24 ? 317 HOH C O   1 
HETATM 3470 O  O   . HOH G 4 .   ? 8.198   -18.558 16.970  1.00 40.32 ? 318 HOH C O   1 
HETATM 3471 O  O   . HOH G 4 .   ? -0.421  -14.968 5.124   1.00 24.80 ? 319 HOH C O   1 
HETATM 3472 O  O   . HOH G 4 .   ? -4.972  4.932   26.243  1.00 37.26 ? 320 HOH C O   1 
HETATM 3473 O  O   . HOH G 4 .   ? 14.555  -3.896  17.646  1.00 22.72 ? 321 HOH C O   1 
HETATM 3474 O  O   . HOH G 4 .   ? 2.614   4.089   8.933   1.00 37.31 ? 322 HOH C O   1 
HETATM 3475 O  O   . HOH G 4 .   ? -25.020 12.205  18.649  1.00 33.57 ? 323 HOH C O   1 
HETATM 3476 O  O   . HOH G 4 .   ? -23.533 18.888  18.537  1.00 43.70 ? 324 HOH C O   1 
HETATM 3477 O  O   . HOH G 4 .   ? -21.422 -12.616 22.961  1.00 27.74 ? 325 HOH C O   1 
HETATM 3478 O  O   . HOH G 4 .   ? 12.997  -16.574 13.908  1.00 24.69 ? 326 HOH C O   1 
HETATM 3479 O  O   . HOH G 4 .   ? -11.798 -17.242 20.891  1.00 27.94 ? 327 HOH C O   1 
HETATM 3480 O  O   . HOH G 4 .   ? -5.932  -8.953  23.382  1.00 28.74 ? 328 HOH C O   1 
HETATM 3481 O  O   . HOH G 4 .   ? -13.759 9.424   1.439   1.00 37.52 ? 329 HOH C O   1 
HETATM 3482 O  O   . HOH G 4 .   ? 14.876  -9.532  5.877   1.00 35.83 ? 330 HOH C O   1 
HETATM 3483 O  O   . HOH G 4 .   ? -14.180 -0.069  -2.409  1.00 27.57 ? 331 HOH C O   1 
HETATM 3484 O  O   . HOH G 4 .   ? -24.561 -7.044  -5.597  1.00 35.87 ? 332 HOH C O   1 
HETATM 3485 O  O   . HOH G 4 .   ? 10.257  -15.259 19.808  1.00 35.01 ? 333 HOH C O   1 
HETATM 3486 O  O   . HOH G 4 .   ? -9.945  20.199  22.906  1.00 42.67 ? 334 HOH C O   1 
HETATM 3487 O  O   . HOH G 4 .   ? -8.472  8.510   4.372   1.00 33.82 ? 335 HOH C O   1 
HETATM 3488 O  O   . HOH G 4 .   ? -28.614 -6.423  11.019  1.00 36.16 ? 336 HOH C O   1 
HETATM 3489 O  O   . HOH G 4 .   ? 8.793   -15.902 26.002  1.00 37.34 ? 337 HOH C O   1 
HETATM 3490 O  O   . HOH G 4 .   ? -26.482 -9.403  7.118   1.00 50.28 ? 338 HOH C O   1 
HETATM 3491 O  O   . HOH G 4 .   ? -16.657 -8.006  22.959  1.00 43.63 ? 339 HOH C O   1 
HETATM 3492 O  O   . HOH G 4 .   ? -5.862  -4.313  22.553  1.00 39.24 ? 340 HOH C O   1 
HETATM 3493 O  O   . HOH G 4 .   ? -19.890 -19.824 18.021  1.00 34.72 ? 341 HOH C O   1 
HETATM 3494 O  O   . HOH G 4 .   ? -4.514  7.734   5.646   1.00 34.91 ? 342 HOH C O   1 
HETATM 3495 O  O   . HOH G 4 .   ? -24.246 0.386   1.972   1.00 40.60 ? 343 HOH C O   1 
HETATM 3496 O  O   . HOH G 4 .   ? -19.409 -18.495 4.293   1.00 34.58 ? 344 HOH C O   1 
HETATM 3497 O  O   . HOH G 4 .   ? -16.898 0.412   31.396  1.00 40.65 ? 345 HOH C O   1 
HETATM 3498 O  O   . HOH G 4 .   ? -24.262 6.295   28.218  1.00 39.62 ? 346 HOH C O   1 
HETATM 3499 O  O   . HOH G 4 .   ? -27.086 -14.909 10.378  1.00 40.85 ? 347 HOH C O   1 
HETATM 3500 O  O   . HOH G 4 .   ? -20.583 -17.949 -2.210  1.00 40.63 ? 348 HOH C O   1 
HETATM 3501 O  O   . HOH G 4 .   ? 2.753   -3.566  2.011   1.00 32.71 ? 349 HOH C O   1 
HETATM 3502 O  O   . HOH G 4 .   ? -6.765  12.248  10.767  1.00 38.28 ? 350 HOH C O   1 
HETATM 3503 O  O   . HOH G 4 .   ? -20.174 -4.593  25.596  1.00 40.70 ? 351 HOH C O   1 
HETATM 3504 O  O   . HOH G 4 .   ? -15.208 21.552  17.437  1.00 39.79 ? 352 HOH C O   1 
HETATM 3505 O  O   . HOH G 4 .   ? -21.373 13.890  8.038   1.00 39.74 ? 353 HOH C O   1 
HETATM 3506 O  O   . HOH G 4 .   ? -20.284 16.473  9.022   1.00 45.90 ? 354 HOH C O   1 
HETATM 3507 O  O   . HOH G 4 .   ? -2.962  -19.658 10.548  1.00 37.15 ? 355 HOH C O   1 
HETATM 3508 O  O   . HOH G 4 .   ? -8.754  6.769   -1.102  1.00 38.15 ? 356 HOH C O   1 
HETATM 3509 O  O   . HOH G 4 .   ? -16.869 -20.156 19.271  1.00 43.69 ? 357 HOH C O   1 
HETATM 3510 O  O   . HOH G 4 .   ? -23.335 -0.623  18.625  1.00 31.22 ? 358 HOH C O   1 
HETATM 3511 O  O   . HOH G 4 .   ? -24.205 3.029   9.602   1.00 42.46 ? 359 HOH C O   1 
HETATM 3512 O  O   . HOH G 4 .   ? -26.419 11.330  15.877  1.00 36.32 ? 360 HOH C O   1 
HETATM 3513 O  O   . HOH G 4 .   ? -24.732 -6.977  0.420   1.00 45.63 ? 361 HOH C O   1 
HETATM 3514 O  O   . HOH G 4 .   ? -14.175 17.661  27.059  1.00 51.00 ? 362 HOH C O   1 
HETATM 3515 O  O   . HOH G 4 .   ? -19.595 -17.367 0.974   1.00 36.73 ? 363 HOH C O   1 
HETATM 3516 O  O   . HOH G 4 .   ? -20.771 -10.150 21.885  1.00 37.16 ? 364 HOH C O   1 
HETATM 3517 O  O   . HOH G 4 .   ? 8.701   -13.095 20.109  1.00 30.29 ? 365 HOH C O   1 
HETATM 3518 O  O   . HOH G 4 .   ? -4.982  -1.903  23.227  1.00 44.31 ? 366 HOH C O   1 
HETATM 3519 O  O   . HOH G 4 .   ? -11.163 -2.064  28.153  1.00 44.90 ? 367 HOH C O   1 
HETATM 3520 O  O   . HOH G 4 .   ? -15.162 -24.444 15.892  1.00 38.69 ? 368 HOH C O   1 
HETATM 3521 O  O   . HOH G 4 .   ? -16.972 -16.884 24.148  1.00 46.91 ? 369 HOH C O   1 
HETATM 3522 O  O   . HOH G 4 .   ? 3.084   -18.744 9.430   1.00 35.31 ? 370 HOH C O   1 
HETATM 3523 O  O   . HOH G 4 .   ? 13.406  -8.922  23.606  1.00 34.56 ? 371 HOH C O   1 
HETATM 3524 O  O   . HOH G 4 .   ? -27.457 12.270  22.643  1.00 54.50 ? 372 HOH C O   1 
HETATM 3525 O  O   . HOH G 4 .   ? -26.988 -2.225  17.747  1.00 34.03 ? 373 HOH C O   1 
HETATM 3526 O  O   . HOH G 4 .   ? -7.436  6.117   2.383   1.00 29.21 ? 374 HOH C O   1 
HETATM 3527 O  O   . HOH G 4 .   ? 21.618  -3.620  14.411  1.00 26.64 ? 375 HOH C O   1 
HETATM 3528 O  O   . HOH G 4 .   ? -19.369 9.887   30.983  1.00 49.93 ? 376 HOH C O   1 
HETATM 3529 O  O   . HOH G 4 .   ? -1.560  5.450   4.656   1.00 37.94 ? 377 HOH C O   1 
HETATM 3530 O  O   . HOH G 4 .   ? -25.102 -9.391  1.928   1.00 51.02 ? 378 HOH C O   1 
HETATM 3531 O  O   . HOH G 4 .   ? -1.552  -21.007 14.512  1.00 41.70 ? 379 HOH C O   1 
HETATM 3532 O  O   . HOH G 4 .   ? -26.969 -5.183  8.891   1.00 40.59 ? 380 HOH C O   1 
HETATM 3533 O  O   . HOH G 4 .   ? 19.168  -5.700  3.410   1.00 35.89 ? 381 HOH C O   1 
HETATM 3534 O  O   . HOH G 4 .   ? -4.057  22.517  21.273  1.00 41.00 ? 382 HOH C O   1 
HETATM 3535 O  O   . HOH G 4 .   ? 6.615   3.298   9.485   1.00 34.54 ? 383 HOH C O   1 
HETATM 3536 O  O   . HOH G 4 .   ? -14.022 -22.073 6.887   1.00 40.87 ? 384 HOH C O   1 
HETATM 3537 O  O   . HOH G 4 .   ? -13.466 21.256  25.546  1.00 42.90 ? 385 HOH C O   1 
HETATM 3538 O  O   . HOH G 4 .   ? -6.806  23.587  21.078  1.00 46.05 ? 386 HOH C O   1 
HETATM 3539 O  O   . HOH G 4 .   ? -21.906 7.207   30.790  1.00 56.93 ? 387 HOH C O   1 
HETATM 3540 O  O   . HOH G 4 .   ? -2.232  4.375   1.420   1.00 28.05 ? 388 HOH C O   1 
HETATM 3541 O  O   . HOH G 4 .   ? -5.634  8.019   2.227   1.00 46.99 ? 389 HOH C O   1 
HETATM 3542 O  O   . HOH G 4 .   ? 20.721  -7.492  4.873   1.00 38.64 ? 390 HOH C O   1 
HETATM 3543 O  O   . HOH G 4 .   ? 5.204   -4.313  1.271   1.00 33.35 ? 391 HOH C O   1 
HETATM 3544 O  O   . HOH G 4 .   ? -28.685 -14.239 12.333  1.00 40.23 ? 392 HOH C O   1 
HETATM 3545 O  O   . HOH G 4 .   ? -29.122 13.789  24.244  1.00 52.56 ? 393 HOH C O   1 
HETATM 3546 O  O   . HOH G 4 .   ? 18.636  -8.718  4.830   1.00 38.80 ? 394 HOH C O   1 
HETATM 3547 O  O   . HOH G 4 .   ? -28.170 -15.484 14.712  1.00 52.74 ? 395 HOH C O   1 
HETATM 3548 O  O   . HOH G 4 .   ? -8.399  -7.754  26.073  1.00 41.34 ? 396 HOH C O   1 
HETATM 3549 O  O   . HOH G 4 .   ? -7.247  21.605  23.425  1.00 48.91 ? 397 HOH C O   1 
HETATM 3550 O  O   . HOH G 4 .   ? 7.355   -3.328  -0.992  1.00 47.65 ? 398 HOH C O   1 
HETATM 3551 O  O   . HOH G 4 .   ? -10.712 -9.278  25.063  1.00 38.04 ? 399 HOH C O   1 
HETATM 3552 O  O   . HOH G 4 .   ? -12.445 -7.753  25.598  1.00 36.61 ? 400 HOH C O   1 
HETATM 3553 O  O   . HOH G 4 .   ? 6.453   -1.830  3.254   1.00 50.21 ? 401 HOH C O   1 
HETATM 3554 O  O   . HOH G 4 .   ? -6.501  -10.429 25.537  1.00 38.35 ? 402 HOH C O   1 
HETATM 3555 O  O   . HOH G 4 .   ? -26.323 -12.692 7.065   1.00 36.75 ? 403 HOH C O   1 
HETATM 3556 O  O   . HOH G 4 .   ? -2.786  -20.604 8.315   1.00 43.19 ? 404 HOH C O   1 
HETATM 3557 O  O   . HOH G 4 .   ? -3.614  -17.765 7.044   0.50 19.04 ? 405 HOH C O   1 
HETATM 3558 O  O   . HOH G 4 .   ? 12.884  -7.903  18.755  1.00 27.93 ? 406 HOH C O   1 
HETATM 3559 O  O   . HOH G 4 .   ? 10.924  -6.139  17.925  1.00 26.69 ? 407 HOH C O   1 
HETATM 3560 O  O   . HOH G 4 .   ? 23.366  -6.277  8.446   1.00 27.91 ? 408 HOH C O   1 
HETATM 3561 O  O   . HOH G 4 .   ? 8.869   -7.546  4.627   1.00 30.33 ? 409 HOH C O   1 
HETATM 3562 O  O   . HOH G 4 .   ? -24.813 2.165   27.242  1.00 42.16 ? 410 HOH C O   1 
HETATM 3563 O  O   . HOH G 4 .   ? -15.620 5.393   -2.043  1.00 41.57 ? 411 HOH C O   1 
HETATM 3564 O  O   . HOH G 4 .   ? -20.421 4.124   -0.567  1.00 40.68 ? 412 HOH C O   1 
HETATM 3565 O  O   . HOH G 4 .   ? -18.703 -9.153  24.021  1.00 48.65 ? 413 HOH C O   1 
HETATM 3566 O  O   . HOH G 4 .   ? 15.025  -6.498  18.679  1.00 27.21 ? 414 HOH C O   1 
HETATM 3567 O  O   . HOH G 4 .   ? 12.359  -9.312  20.952  1.00 28.34 ? 415 HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   0   ?   ?   ?   A . n 
A 1 2   LYS 2   1   1   LYS LYS A . n 
A 1 3   HIS 3   2   2   HIS HIS A . n 
A 1 4   THR 4   3   3   THR THR A . n 
A 1 5   LEU 5   4   4   LEU LEU A . n 
A 1 6   PRO 6   5   5   PRO PRO A . n 
A 1 7   ASP 7   6   6   ASP ASP A . n 
A 1 8   LEU 8   7   7   LEU LEU A . n 
A 1 9   PRO 9   8   8   PRO PRO A . n 
A 1 10  PHE 10  9   9   PHE PHE A . n 
A 1 11  ASP 11  10  10  ASP ASP A . n 
A 1 12  TYR 12  11  11  TYR TYR A . n 
A 1 13  ALA 13  12  12  ALA ALA A . n 
A 1 14  ASP 14  13  13  ASP ASP A . n 
A 1 15  LEU 15  14  14  LEU LEU A . n 
A 1 16  GLU 16  15  15  GLU GLU A . n 
A 1 17  PRO 17  16  16  PRO PRO A . n 
A 1 18  VAL 18  17  17  VAL VAL A . n 
A 1 19  ILE 19  18  18  ILE ILE A . n 
A 1 20  SER 20  19  19  SER SER A . n 
A 1 21  HIS 21  20  20  HIS HIS A . n 
A 1 22  GLU 22  21  21  GLU GLU A . n 
A 1 23  ILE 23  22  22  ILE ILE A . n 
A 1 24  MET 24  23  23  MET MET A . n 
A 1 25  GLN 25  24  24  GLN GLN A . n 
A 1 26  LEU 26  25  25  LEU LEU A . n 
A 1 27  HIS 27  26  26  HIS HIS A . n 
A 1 28  HIS 28  27  27  HIS HIS A . n 
A 1 29  GLN 29  28  28  GLN GLN A . n 
A 1 30  LYS 30  29  29  LYS LYS A . n 
A 1 31  HIS 31  30  30  HIS HIS A . n 
A 1 32  HIS 32  31  31  HIS HIS A . n 
A 1 33  ALA 33  32  32  ALA ALA A . n 
A 1 34  THR 34  33  33  THR THR A . n 
A 1 35  TYR 35  34  34  TYR TYR A . n 
A 1 36  VAL 36  35  35  VAL VAL A . n 
A 1 37  ASN 37  36  36  ASN ASN A . n 
A 1 38  ASN 38  37  37  ASN ASN A . n 
A 1 39  LEU 39  38  38  LEU LEU A . n 
A 1 40  ASN 40  39  39  ASN ASN A . n 
A 1 41  GLN 41  40  40  GLN GLN A . n 
A 1 42  ILE 42  41  41  ILE ILE A . n 
A 1 43  GLU 43  42  42  GLU GLU A . n 
A 1 44  GLU 44  43  43  GLU GLU A . n 
A 1 45  LYS 45  44  44  LYS LYS A . n 
A 1 46  LEU 46  45  45  LEU LEU A . n 
A 1 47  HIS 47  46  46  HIS HIS A . n 
A 1 48  GLU 48  47  47  GLU GLU A . n 
A 1 49  ALA 49  48  48  ALA ALA A . n 
A 1 50  VAL 50  49  49  VAL VAL A . n 
A 1 51  SER 51  50  50  SER SER A . n 
A 1 52  LYS 52  51  51  LYS LYS A . n 
A 1 53  GLY 53  52  52  GLY GLY A . n 
A 1 54  ASN 54  53  53  ASN ASN A . n 
A 1 55  LEU 55  54  54  LEU LEU A . n 
A 1 56  LYS 56  55  55  LYS LYS A . n 
A 1 57  GLU 57  56  56  GLU GLU A . n 
A 1 58  ALA 58  57  57  ALA ALA A . n 
A 1 59  ILE 59  58  58  ILE ILE A . n 
A 1 60  ALA 60  59  59  ALA ALA A . n 
A 1 61  LEU 61  60  60  LEU LEU A . n 
A 1 62  GLN 62  61  61  GLN GLN A . n 
A 1 63  PRO 63  62  62  PRO PRO A . n 
A 1 64  ALA 64  63  63  ALA ALA A . n 
A 1 65  LEU 65  64  64  LEU LEU A . n 
A 1 66  LYS 66  65  65  LYS LYS A . n 
A 1 67  PHE 67  66  66  PHE PHE A . n 
A 1 68  ASN 68  67  67  ASN ASN A . n 
A 1 69  GLY 69  68  68  GLY GLY A . n 
A 1 70  GLY 70  69  69  GLY GLY A . n 
A 1 71  GLY 71  70  70  GLY GLY A . n 
A 1 72  HIS 72  71  71  HIS HIS A . n 
A 1 73  ILE 73  72  72  ILE ILE A . n 
A 1 74  ASN 74  73  73  ASN ASN A . n 
A 1 75  HIS 75  74  74  HIS HIS A . n 
A 1 76  SER 76  75  75  SER SER A . n 
A 1 77  ILE 77  76  76  ILE ILE A . n 
A 1 78  PHE 78  77  77  PHE PHE A . n 
A 1 79  TRP 79  78  78  TRP TRP A . n 
A 1 80  THR 80  79  79  THR THR A . n 
A 1 81  ASN 81  80  80  ASN ASN A . n 
A 1 82  LEU 82  81  81  LEU LEU A . n 
A 1 83  ALA 83  82  82  ALA ALA A . n 
A 1 84  LYS 84  83  83  LYS LYS A . n 
A 1 85  ASP 85  84  84  ASP ASP A . n 
A 1 86  GLY 86  85  85  GLY GLY A . n 
A 1 87  GLY 87  86  86  GLY GLY A . n 
A 1 88  GLU 88  87  87  GLU GLU A . n 
A 1 89  PRO 89  88  88  PRO PRO A . n 
A 1 90  SER 90  89  89  SER SER A . n 
A 1 91  LYS 91  90  90  LYS LYS A . n 
A 1 92  GLU 92  91  91  GLU GLU A . n 
A 1 93  LEU 93  92  92  LEU LEU A . n 
A 1 94  MET 94  93  93  MET MET A . n 
A 1 95  ASP 95  94  94  ASP ASP A . n 
A 1 96  THR 96  95  95  THR THR A . n 
A 1 97  ILE 97  96  96  ILE ILE A . n 
A 1 98  LYS 98  97  97  LYS LYS A . n 
A 1 99  ARG 99  98  98  ARG ARG A . n 
A 1 100 ASP 100 99  99  ASP ASP A . n 
A 1 101 PHE 101 100 100 PHE PHE A . n 
A 1 102 GLY 102 101 101 GLY GLY A . n 
A 1 103 SER 103 102 102 SER SER A . n 
A 1 104 LEU 104 103 103 LEU LEU A . n 
A 1 105 ASP 105 104 104 ASP ASP A . n 
A 1 106 ASN 106 105 105 ASN ASN A . n 
A 1 107 LEU 107 106 106 LEU LEU A . n 
A 1 108 GLN 108 107 107 GLN GLN A . n 
A 1 109 LYS 109 108 108 LYS LYS A . n 
A 1 110 ARG 110 109 109 ARG ARG A . n 
A 1 111 LEU 111 110 110 LEU LEU A . n 
A 1 112 SER 112 111 111 SER SER A . n 
A 1 113 ASP 113 112 112 ASP ASP A . n 
A 1 114 ILE 114 113 113 ILE ILE A . n 
A 1 115 THR 115 114 114 THR THR A . n 
A 1 116 ILE 116 115 115 ILE ILE A . n 
A 1 117 ALA 117 116 116 ALA ALA A . n 
A 1 118 VAL 118 117 117 VAL VAL A . n 
A 1 119 GLN 119 118 118 GLN GLN A . n 
A 1 120 GLY 120 119 119 GLY GLY A . n 
A 1 121 SER 121 120 120 SER SER A . n 
A 1 122 GLY 122 121 121 GLY GLY A . n 
A 1 123 TRP 123 122 122 TRP TRP A . n 
A 1 124 GLY 124 123 123 GLY GLY A . n 
A 1 125 TRP 125 124 124 TRP TRP A . n 
A 1 126 LEU 126 125 125 LEU LEU A . n 
A 1 127 GLY 127 126 126 GLY GLY A . n 
A 1 128 TYR 128 127 127 TYR TYR A . n 
A 1 129 CYS 129 128 128 CYS CYS A . n 
A 1 130 LYS 130 129 129 LYS LYS A . n 
A 1 131 LYS 131 130 130 LYS LYS A . n 
A 1 132 ASP 132 131 131 ASP ASP A . n 
A 1 133 LYS 133 132 132 LYS LYS A . n 
A 1 134 ILE 134 133 133 ILE ILE A . n 
A 1 135 LEU 135 134 134 LEU LEU A . n 
A 1 136 LYS 136 135 135 LYS LYS A . n 
A 1 137 ILE 137 136 136 ILE ILE A . n 
A 1 138 ALA 138 137 137 ALA ALA A . n 
A 1 139 THR 139 138 138 THR THR A . n 
A 1 140 CYS 140 139 139 CYS CYS A . n 
A 1 141 ALA 141 140 140 ALA ALA A . n 
A 1 142 ASN 142 141 141 ASN ASN A . n 
A 1 143 GLN 143 142 142 GLN GLN A . n 
A 1 144 ASP 144 143 143 ASP ASP A . n 
A 1 145 PRO 145 144 144 PRO PRO A . n 
A 1 146 LEU 146 145 145 LEU LEU A . n 
A 1 147 GLU 147 146 146 GLU GLU A . n 
A 1 148 GLY 148 147 147 GLY GLY A . n 
A 1 149 MET 149 148 148 MET MET A . n 
A 1 150 VAL 150 149 149 VAL VAL A . n 
A 1 151 PRO 151 150 150 PRO PRO A . n 
A 1 152 LEU 152 151 151 LEU LEU A . n 
A 1 153 PHE 153 152 152 PHE PHE A . n 
A 1 154 GLY 154 153 153 GLY GLY A . n 
A 1 155 ILE 155 154 154 ILE ILE A . n 
A 1 156 ASP 156 155 155 ASP ASP A . n 
A 1 157 VAL 157 156 156 VAL VAL A . n 
A 1 158 TRP 158 157 157 TRP TRP A . n 
A 1 159 GLU 159 158 158 GLU GLU A . n 
A 1 160 HIS 160 159 159 HIS HIS A . n 
A 1 161 ALA 161 160 160 ALA ALA A . n 
A 1 162 TYR 162 161 161 TYR TYR A . n 
A 1 163 TYR 163 162 162 TYR TYR A . n 
A 1 164 LEU 164 163 163 LEU LEU A . n 
A 1 165 GLN 165 164 164 GLN GLN A . n 
A 1 166 TYR 166 165 165 TYR TYR A . n 
A 1 167 LYS 167 166 166 LYS LYS A . n 
A 1 168 ASN 168 167 167 ASN ASN A . n 
A 1 169 VAL 169 168 168 VAL VAL A . n 
A 1 170 ARG 170 169 169 ARG ARG A . n 
A 1 171 PRO 171 170 170 PRO PRO A . n 
A 1 172 ASP 172 171 171 ASP ASP A . n 
A 1 173 TYR 173 172 172 TYR TYR A . n 
A 1 174 VAL 174 173 173 VAL VAL A . n 
A 1 175 HIS 175 174 174 HIS HIS A . n 
A 1 176 ALA 176 175 175 ALA ALA A . n 
A 1 177 ILE 177 176 176 ILE ILE A . n 
A 1 178 TRP 178 177 177 TRP TRP A . n 
A 1 179 LYS 179 178 178 LYS LYS A . n 
A 1 180 ILE 180 179 179 ILE ILE A . n 
A 1 181 ALA 181 180 180 ALA ALA A . n 
A 1 182 ASN 182 181 181 ASN ASN A . n 
A 1 183 TRP 183 182 182 TRP TRP A . n 
A 1 184 LYS 184 183 183 LYS LYS A . n 
A 1 185 ASN 185 184 184 ASN ASN A . n 
A 1 186 ILE 186 185 185 ILE ILE A . n 
A 1 187 SER 187 186 186 SER SER A . n 
A 1 188 GLU 188 187 187 GLU GLU A . n 
A 1 189 ARG 189 188 188 ARG ARG A . n 
A 1 190 PHE 190 189 189 PHE PHE A . n 
A 1 191 ALA 191 190 190 ALA ALA A . n 
A 1 192 ASN 192 191 191 ASN ASN A . n 
A 1 193 ALA 193 192 192 ALA ALA A . n 
A 1 194 ARG 194 193 193 ARG ARG A . n 
A 1 195 GLN 195 194 194 GLN GLN A . n 
B 1 1   MET 1   0   0   MET MET C . n 
B 1 2   LYS 2   1   1   LYS LYS C . n 
B 1 3   HIS 3   2   2   HIS HIS C . n 
B 1 4   THR 4   3   3   THR THR C . n 
B 1 5   LEU 5   4   4   LEU LEU C . n 
B 1 6   PRO 6   5   5   PRO PRO C . n 
B 1 7   ASP 7   6   6   ASP ASP C . n 
B 1 8   LEU 8   7   7   LEU LEU C . n 
B 1 9   PRO 9   8   8   PRO PRO C . n 
B 1 10  PHE 10  9   9   PHE PHE C . n 
B 1 11  ASP 11  10  10  ASP ASP C . n 
B 1 12  TYR 12  11  11  TYR TYR C . n 
B 1 13  ALA 13  12  12  ALA ALA C . n 
B 1 14  ASP 14  13  13  ASP ASP C . n 
B 1 15  LEU 15  14  14  LEU LEU C . n 
B 1 16  GLU 16  15  15  GLU GLU C . n 
B 1 17  PRO 17  16  16  PRO PRO C . n 
B 1 18  VAL 18  17  17  VAL VAL C . n 
B 1 19  ILE 19  18  18  ILE ILE C . n 
B 1 20  SER 20  19  19  SER SER C . n 
B 1 21  HIS 21  20  20  HIS HIS C . n 
B 1 22  GLU 22  21  21  GLU GLU C . n 
B 1 23  ILE 23  22  22  ILE ILE C . n 
B 1 24  MET 24  23  23  MET MET C . n 
B 1 25  GLN 25  24  24  GLN GLN C . n 
B 1 26  LEU 26  25  25  LEU LEU C . n 
B 1 27  HIS 27  26  26  HIS HIS C . n 
B 1 28  HIS 28  27  27  HIS HIS C . n 
B 1 29  GLN 29  28  28  GLN GLN C . n 
B 1 30  LYS 30  29  29  LYS LYS C . n 
B 1 31  HIS 31  30  30  HIS HIS C . n 
B 1 32  HIS 32  31  31  HIS HIS C . n 
B 1 33  ALA 33  32  32  ALA ALA C . n 
B 1 34  THR 34  33  33  THR THR C . n 
B 1 35  TYR 35  34  34  TYR TYR C . n 
B 1 36  VAL 36  35  35  VAL VAL C . n 
B 1 37  ASN 37  36  36  ASN ASN C . n 
B 1 38  ASN 38  37  37  ASN ASN C . n 
B 1 39  LEU 39  38  38  LEU LEU C . n 
B 1 40  ASN 40  39  39  ASN ASN C . n 
B 1 41  GLN 41  40  40  GLN GLN C . n 
B 1 42  ILE 42  41  41  ILE ILE C . n 
B 1 43  GLU 43  42  42  GLU GLU C . n 
B 1 44  GLU 44  43  43  GLU GLU C . n 
B 1 45  LYS 45  44  44  LYS LYS C . n 
B 1 46  LEU 46  45  45  LEU LEU C . n 
B 1 47  HIS 47  46  46  HIS HIS C . n 
B 1 48  GLU 48  47  47  GLU GLU C . n 
B 1 49  ALA 49  48  48  ALA ALA C . n 
B 1 50  VAL 50  49  49  VAL VAL C . n 
B 1 51  SER 51  50  50  SER SER C . n 
B 1 52  LYS 52  51  51  LYS LYS C . n 
B 1 53  GLY 53  52  52  GLY GLY C . n 
B 1 54  ASN 54  53  53  ASN ASN C . n 
B 1 55  LEU 55  54  54  LEU LEU C . n 
B 1 56  LYS 56  55  55  LYS LYS C . n 
B 1 57  GLU 57  56  56  GLU GLU C . n 
B 1 58  ALA 58  57  57  ALA ALA C . n 
B 1 59  ILE 59  58  58  ILE ILE C . n 
B 1 60  ALA 60  59  59  ALA ALA C . n 
B 1 61  LEU 61  60  60  LEU LEU C . n 
B 1 62  GLN 62  61  61  GLN GLN C . n 
B 1 63  PRO 63  62  62  PRO PRO C . n 
B 1 64  ALA 64  63  63  ALA ALA C . n 
B 1 65  LEU 65  64  64  LEU LEU C . n 
B 1 66  LYS 66  65  65  LYS LYS C . n 
B 1 67  PHE 67  66  66  PHE PHE C . n 
B 1 68  ASN 68  67  67  ASN ASN C . n 
B 1 69  GLY 69  68  68  GLY GLY C . n 
B 1 70  GLY 70  69  69  GLY GLY C . n 
B 1 71  GLY 71  70  70  GLY GLY C . n 
B 1 72  HIS 72  71  71  HIS HIS C . n 
B 1 73  ILE 73  72  72  ILE ILE C . n 
B 1 74  ASN 74  73  73  ASN ASN C . n 
B 1 75  HIS 75  74  74  HIS HIS C . n 
B 1 76  SER 76  75  75  SER SER C . n 
B 1 77  ILE 77  76  76  ILE ILE C . n 
B 1 78  PHE 78  77  77  PHE PHE C . n 
B 1 79  TRP 79  78  78  TRP TRP C . n 
B 1 80  THR 80  79  79  THR THR C . n 
B 1 81  ASN 81  80  80  ASN ASN C . n 
B 1 82  LEU 82  81  81  LEU LEU C . n 
B 1 83  ALA 83  82  82  ALA ALA C . n 
B 1 84  LYS 84  83  83  LYS LYS C . n 
B 1 85  ASP 85  84  84  ASP ASP C . n 
B 1 86  GLY 86  85  85  GLY GLY C . n 
B 1 87  GLY 87  86  86  GLY GLY C . n 
B 1 88  GLU 88  87  87  GLU GLU C . n 
B 1 89  PRO 89  88  88  PRO PRO C . n 
B 1 90  SER 90  89  89  SER SER C . n 
B 1 91  LYS 91  90  90  LYS LYS C . n 
B 1 92  GLU 92  91  91  GLU GLU C . n 
B 1 93  LEU 93  92  92  LEU LEU C . n 
B 1 94  MET 94  93  93  MET MET C . n 
B 1 95  ASP 95  94  94  ASP ASP C . n 
B 1 96  THR 96  95  95  THR THR C . n 
B 1 97  ILE 97  96  96  ILE ILE C . n 
B 1 98  LYS 98  97  97  LYS LYS C . n 
B 1 99  ARG 99  98  98  ARG ARG C . n 
B 1 100 ASP 100 99  99  ASP ASP C . n 
B 1 101 PHE 101 100 100 PHE PHE C . n 
B 1 102 GLY 102 101 101 GLY GLY C . n 
B 1 103 SER 103 102 102 SER SER C . n 
B 1 104 LEU 104 103 103 LEU LEU C . n 
B 1 105 ASP 105 104 104 ASP ASP C . n 
B 1 106 ASN 106 105 105 ASN ASN C . n 
B 1 107 LEU 107 106 106 LEU LEU C . n 
B 1 108 GLN 108 107 107 GLN GLN C . n 
B 1 109 LYS 109 108 108 LYS LYS C . n 
B 1 110 ARG 110 109 109 ARG ARG C . n 
B 1 111 LEU 111 110 110 LEU LEU C . n 
B 1 112 SER 112 111 111 SER SER C . n 
B 1 113 ASP 113 112 112 ASP ASP C . n 
B 1 114 ILE 114 113 113 ILE ILE C . n 
B 1 115 THR 115 114 114 THR THR C . n 
B 1 116 ILE 116 115 115 ILE ILE C . n 
B 1 117 ALA 117 116 116 ALA ALA C . n 
B 1 118 VAL 118 117 117 VAL VAL C . n 
B 1 119 GLN 119 118 118 GLN GLN C . n 
B 1 120 GLY 120 119 119 GLY GLY C . n 
B 1 121 SER 121 120 120 SER SER C . n 
B 1 122 GLY 122 121 121 GLY GLY C . n 
B 1 123 TRP 123 122 122 TRP TRP C . n 
B 1 124 GLY 124 123 123 GLY GLY C . n 
B 1 125 TRP 125 124 124 TRP TRP C . n 
B 1 126 LEU 126 125 125 LEU LEU C . n 
B 1 127 GLY 127 126 126 GLY GLY C . n 
B 1 128 TYR 128 127 127 TYR TYR C . n 
B 1 129 CYS 129 128 128 CYS CYS C . n 
B 1 130 LYS 130 129 129 LYS LYS C . n 
B 1 131 LYS 131 130 130 LYS LYS C . n 
B 1 132 ASP 132 131 131 ASP ASP C . n 
B 1 133 LYS 133 132 132 LYS LYS C . n 
B 1 134 ILE 134 133 133 ILE ILE C . n 
B 1 135 LEU 135 134 134 LEU LEU C . n 
B 1 136 LYS 136 135 135 LYS LYS C . n 
B 1 137 ILE 137 136 136 ILE ILE C . n 
B 1 138 ALA 138 137 137 ALA ALA C . n 
B 1 139 THR 139 138 138 THR THR C . n 
B 1 140 CYS 140 139 139 CYS CYS C . n 
B 1 141 ALA 141 140 140 ALA ALA C . n 
B 1 142 ASN 142 141 141 ASN ASN C . n 
B 1 143 GLN 143 142 142 GLN GLN C . n 
B 1 144 ASP 144 143 143 ASP ASP C . n 
B 1 145 PRO 145 144 144 PRO PRO C . n 
B 1 146 LEU 146 145 145 LEU LEU C . n 
B 1 147 GLU 147 146 146 GLU GLU C . n 
B 1 148 GLY 148 147 147 GLY GLY C . n 
B 1 149 MET 149 148 148 MET MET C . n 
B 1 150 VAL 150 149 149 VAL VAL C . n 
B 1 151 PRO 151 150 150 PRO PRO C . n 
B 1 152 LEU 152 151 151 LEU LEU C . n 
B 1 153 PHE 153 152 152 PHE PHE C . n 
B 1 154 GLY 154 153 153 GLY GLY C . n 
B 1 155 ILE 155 154 154 ILE ILE C . n 
B 1 156 ASP 156 155 155 ASP ASP C . n 
B 1 157 VAL 157 156 156 VAL VAL C . n 
B 1 158 TRP 158 157 157 TRP TRP C . n 
B 1 159 GLU 159 158 158 GLU GLU C . n 
B 1 160 HIS 160 159 159 HIS HIS C . n 
B 1 161 ALA 161 160 160 ALA ALA C . n 
B 1 162 TYR 162 161 161 TYR TYR C . n 
B 1 163 TYR 163 162 162 TYR TYR C . n 
B 1 164 LEU 164 163 163 LEU LEU C . n 
B 1 165 GLN 165 164 164 GLN GLN C . n 
B 1 166 TYR 166 165 165 TYR TYR C . n 
B 1 167 LYS 167 166 166 LYS LYS C . n 
B 1 168 ASN 168 167 167 ASN ASN C . n 
B 1 169 VAL 169 168 168 VAL VAL C . n 
B 1 170 ARG 170 169 169 ARG ARG C . n 
B 1 171 PRO 171 170 170 PRO PRO C . n 
B 1 172 ASP 172 171 171 ASP ASP C . n 
B 1 173 TYR 173 172 172 TYR TYR C . n 
B 1 174 VAL 174 173 173 VAL VAL C . n 
B 1 175 HIS 175 174 174 HIS HIS C . n 
B 1 176 ALA 176 175 175 ALA ALA C . n 
B 1 177 ILE 177 176 176 ILE ILE C . n 
B 1 178 TRP 178 177 177 TRP TRP C . n 
B 1 179 LYS 179 178 178 LYS LYS C . n 
B 1 180 ILE 180 179 179 ILE ILE C . n 
B 1 181 ALA 181 180 180 ALA ALA C . n 
B 1 182 ASN 182 181 181 ASN ASN C . n 
B 1 183 TRP 183 182 182 TRP TRP C . n 
B 1 184 LYS 184 183 183 LYS LYS C . n 
B 1 185 ASN 185 184 184 ASN ASN C . n 
B 1 186 ILE 186 185 185 ILE ILE C . n 
B 1 187 SER 187 186 186 SER SER C . n 
B 1 188 GLU 188 187 187 GLU GLU C . n 
B 1 189 ARG 189 188 188 ARG ARG C . n 
B 1 190 PHE 190 189 189 PHE PHE C . n 
B 1 191 ALA 191 190 190 ALA ALA C . n 
B 1 192 ASN 192 191 191 ASN ASN C . n 
B 1 193 ALA 193 192 192 ALA ALA C . n 
B 1 194 ARG 194 193 193 ARG ARG C . n 
B 1 195 GLN 195 194 194 GLN GLN C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 MN  1   195 2   MN  MN  A . 
D 3 MLI 1   196 1   MLI MLI A . 
E 2 MN  1   195 1   MN  MN  C . 
F 4 HOH 1   197 2   HOH HOH A . 
F 4 HOH 2   198 3   HOH HOH A . 
F 4 HOH 3   199 5   HOH HOH A . 
F 4 HOH 4   200 7   HOH HOH A . 
F 4 HOH 5   201 8   HOH HOH A . 
F 4 HOH 6   202 9   HOH HOH A . 
F 4 HOH 7   203 12  HOH HOH A . 
F 4 HOH 8   204 14  HOH HOH A . 
F 4 HOH 9   205 16  HOH HOH A . 
F 4 HOH 10  206 17  HOH HOH A . 
F 4 HOH 11  207 21  HOH HOH A . 
F 4 HOH 12  208 24  HOH HOH A . 
F 4 HOH 13  209 26  HOH HOH A . 
F 4 HOH 14  210 30  HOH HOH A . 
F 4 HOH 15  211 31  HOH HOH A . 
F 4 HOH 16  212 35  HOH HOH A . 
F 4 HOH 17  213 38  HOH HOH A . 
F 4 HOH 18  214 42  HOH HOH A . 
F 4 HOH 19  215 45  HOH HOH A . 
F 4 HOH 20  216 46  HOH HOH A . 
F 4 HOH 21  217 48  HOH HOH A . 
F 4 HOH 22  218 49  HOH HOH A . 
F 4 HOH 23  219 57  HOH HOH A . 
F 4 HOH 24  220 62  HOH HOH A . 
F 4 HOH 25  221 63  HOH HOH A . 
F 4 HOH 26  222 64  HOH HOH A . 
F 4 HOH 27  223 67  HOH HOH A . 
F 4 HOH 28  224 68  HOH HOH A . 
F 4 HOH 29  225 70  HOH HOH A . 
F 4 HOH 30  226 72  HOH HOH A . 
F 4 HOH 31  227 74  HOH HOH A . 
F 4 HOH 32  228 75  HOH HOH A . 
F 4 HOH 33  229 78  HOH HOH A . 
F 4 HOH 34  230 79  HOH HOH A . 
F 4 HOH 35  231 81  HOH HOH A . 
F 4 HOH 36  232 82  HOH HOH A . 
F 4 HOH 37  233 86  HOH HOH A . 
F 4 HOH 38  234 88  HOH HOH A . 
F 4 HOH 39  235 89  HOH HOH A . 
F 4 HOH 40  236 90  HOH HOH A . 
F 4 HOH 41  237 92  HOH HOH A . 
F 4 HOH 42  238 93  HOH HOH A . 
F 4 HOH 43  239 95  HOH HOH A . 
F 4 HOH 44  240 101 HOH HOH A . 
F 4 HOH 45  241 102 HOH HOH A . 
F 4 HOH 46  242 103 HOH HOH A . 
F 4 HOH 47  243 104 HOH HOH A . 
F 4 HOH 48  244 105 HOH HOH A . 
F 4 HOH 49  245 107 HOH HOH A . 
F 4 HOH 50  246 108 HOH HOH A . 
F 4 HOH 51  247 109 HOH HOH A . 
F 4 HOH 52  248 110 HOH HOH A . 
F 4 HOH 53  249 111 HOH HOH A . 
F 4 HOH 54  250 113 HOH HOH A . 
F 4 HOH 55  251 114 HOH HOH A . 
F 4 HOH 56  252 117 HOH HOH A . 
F 4 HOH 57  253 119 HOH HOH A . 
F 4 HOH 58  254 120 HOH HOH A . 
F 4 HOH 59  255 122 HOH HOH A . 
F 4 HOH 60  256 124 HOH HOH A . 
F 4 HOH 61  257 126 HOH HOH A . 
F 4 HOH 62  258 127 HOH HOH A . 
F 4 HOH 63  259 131 HOH HOH A . 
F 4 HOH 64  260 132 HOH HOH A . 
F 4 HOH 65  261 135 HOH HOH A . 
F 4 HOH 66  262 139 HOH HOH A . 
F 4 HOH 67  263 140 HOH HOH A . 
F 4 HOH 68  264 145 HOH HOH A . 
F 4 HOH 69  265 148 HOH HOH A . 
F 4 HOH 70  266 150 HOH HOH A . 
F 4 HOH 71  267 151 HOH HOH A . 
F 4 HOH 72  268 152 HOH HOH A . 
F 4 HOH 73  269 158 HOH HOH A . 
F 4 HOH 74  270 160 HOH HOH A . 
F 4 HOH 75  271 161 HOH HOH A . 
F 4 HOH 76  272 162 HOH HOH A . 
F 4 HOH 77  273 163 HOH HOH A . 
F 4 HOH 78  274 166 HOH HOH A . 
F 4 HOH 79  275 168 HOH HOH A . 
F 4 HOH 80  276 171 HOH HOH A . 
F 4 HOH 81  277 172 HOH HOH A . 
F 4 HOH 82  278 173 HOH HOH A . 
F 4 HOH 83  279 176 HOH HOH A . 
F 4 HOH 84  280 177 HOH HOH A . 
F 4 HOH 85  281 179 HOH HOH A . 
F 4 HOH 86  282 183 HOH HOH A . 
F 4 HOH 87  283 184 HOH HOH A . 
F 4 HOH 88  284 189 HOH HOH A . 
F 4 HOH 89  285 191 HOH HOH A . 
F 4 HOH 90  286 192 HOH HOH A . 
F 4 HOH 91  287 194 HOH HOH A . 
F 4 HOH 92  288 198 HOH HOH A . 
F 4 HOH 93  289 199 HOH HOH A . 
F 4 HOH 94  290 200 HOH HOH A . 
F 4 HOH 95  291 202 HOH HOH A . 
F 4 HOH 96  292 203 HOH HOH A . 
F 4 HOH 97  293 206 HOH HOH A . 
F 4 HOH 98  294 210 HOH HOH A . 
F 4 HOH 99  295 212 HOH HOH A . 
F 4 HOH 100 296 215 HOH HOH A . 
F 4 HOH 101 297 216 HOH HOH A . 
F 4 HOH 102 298 219 HOH HOH A . 
F 4 HOH 103 299 224 HOH HOH A . 
F 4 HOH 104 300 225 HOH HOH A . 
F 4 HOH 105 301 227 HOH HOH A . 
F 4 HOH 106 302 228 HOH HOH A . 
F 4 HOH 107 303 230 HOH HOH A . 
F 4 HOH 108 304 231 HOH HOH A . 
F 4 HOH 109 305 232 HOH HOH A . 
F 4 HOH 110 306 233 HOH HOH A . 
F 4 HOH 111 307 234 HOH HOH A . 
F 4 HOH 112 308 236 HOH HOH A . 
F 4 HOH 113 309 239 HOH HOH A . 
F 4 HOH 114 310 240 HOH HOH A . 
F 4 HOH 115 311 243 HOH HOH A . 
F 4 HOH 116 312 245 HOH HOH A . 
F 4 HOH 117 313 246 HOH HOH A . 
F 4 HOH 118 314 248 HOH HOH A . 
F 4 HOH 119 315 249 HOH HOH A . 
F 4 HOH 120 316 251 HOH HOH A . 
F 4 HOH 121 317 253 HOH HOH A . 
F 4 HOH 122 318 255 HOH HOH A . 
F 4 HOH 123 319 256 HOH HOH A . 
F 4 HOH 124 320 257 HOH HOH A . 
F 4 HOH 125 321 259 HOH HOH A . 
F 4 HOH 126 322 260 HOH HOH A . 
F 4 HOH 127 323 262 HOH HOH A . 
F 4 HOH 128 324 264 HOH HOH A . 
F 4 HOH 129 325 265 HOH HOH A . 
F 4 HOH 130 326 266 HOH HOH A . 
F 4 HOH 131 327 267 HOH HOH A . 
F 4 HOH 132 328 268 HOH HOH A . 
F 4 HOH 133 329 273 HOH HOH A . 
F 4 HOH 134 330 276 HOH HOH A . 
F 4 HOH 135 331 277 HOH HOH A . 
F 4 HOH 136 332 278 HOH HOH A . 
F 4 HOH 137 333 279 HOH HOH A . 
F 4 HOH 138 334 286 HOH HOH A . 
F 4 HOH 139 335 287 HOH HOH A . 
F 4 HOH 140 336 290 HOH HOH A . 
F 4 HOH 141 337 292 HOH HOH A . 
F 4 HOH 142 338 293 HOH HOH A . 
F 4 HOH 143 339 296 HOH HOH A . 
F 4 HOH 144 340 300 HOH HOH A . 
F 4 HOH 145 341 301 HOH HOH A . 
F 4 HOH 146 342 303 HOH HOH A . 
F 4 HOH 147 343 307 HOH HOH A . 
F 4 HOH 148 344 308 HOH HOH A . 
F 4 HOH 149 345 309 HOH HOH A . 
F 4 HOH 150 346 312 HOH HOH A . 
F 4 HOH 151 347 314 HOH HOH A . 
F 4 HOH 152 348 315 HOH HOH A . 
F 4 HOH 153 349 317 HOH HOH A . 
F 4 HOH 154 350 318 HOH HOH A . 
F 4 HOH 155 351 319 HOH HOH A . 
F 4 HOH 156 352 320 HOH HOH A . 
F 4 HOH 157 353 322 HOH HOH A . 
F 4 HOH 158 354 323 HOH HOH A . 
F 4 HOH 159 355 329 HOH HOH A . 
F 4 HOH 160 356 330 HOH HOH A . 
F 4 HOH 161 357 331 HOH HOH A . 
F 4 HOH 162 358 334 HOH HOH A . 
F 4 HOH 163 359 335 HOH HOH A . 
F 4 HOH 164 360 336 HOH HOH A . 
F 4 HOH 165 361 338 HOH HOH A . 
F 4 HOH 166 362 339 HOH HOH A . 
F 4 HOH 167 363 341 HOH HOH A . 
F 4 HOH 168 364 343 HOH HOH A . 
F 4 HOH 169 365 347 HOH HOH A . 
F 4 HOH 170 366 349 HOH HOH A . 
F 4 HOH 171 367 351 HOH HOH A . 
F 4 HOH 172 368 354 HOH HOH A . 
F 4 HOH 173 369 357 HOH HOH A . 
F 4 HOH 174 370 359 HOH HOH A . 
F 4 HOH 175 371 360 HOH HOH A . 
F 4 HOH 176 372 361 HOH HOH A . 
F 4 HOH 177 373 366 HOH HOH A . 
F 4 HOH 178 374 367 HOH HOH A . 
F 4 HOH 179 375 368 HOH HOH A . 
F 4 HOH 180 376 371 HOH HOH A . 
F 4 HOH 181 377 374 HOH HOH A . 
F 4 HOH 182 378 376 HOH HOH A . 
F 4 HOH 183 379 377 HOH HOH A . 
F 4 HOH 184 380 379 HOH HOH A . 
F 4 HOH 185 381 381 HOH HOH A . 
F 4 HOH 186 382 382 HOH HOH A . 
F 4 HOH 187 383 383 HOH HOH A . 
F 4 HOH 188 384 385 HOH HOH A . 
F 4 HOH 189 385 386 HOH HOH A . 
F 4 HOH 190 386 387 HOH HOH A . 
F 4 HOH 191 387 389 HOH HOH A . 
F 4 HOH 192 388 391 HOH HOH A . 
F 4 HOH 193 389 393 HOH HOH A . 
F 4 HOH 194 390 395 HOH HOH A . 
F 4 HOH 195 391 398 HOH HOH A . 
F 4 HOH 196 392 403 HOH HOH A . 
F 4 HOH 197 393 404 HOH HOH A . 
F 4 HOH 198 394 405 HOH HOH A . 
F 4 HOH 199 395 406 HOH HOH A . 
F 4 HOH 200 396 416 HOH HOH A . 
G 4 HOH 1   196 1   HOH HOH C . 
G 4 HOH 2   197 4   HOH HOH C . 
G 4 HOH 3   198 6   HOH HOH C . 
G 4 HOH 4   199 10  HOH HOH C . 
G 4 HOH 5   200 11  HOH HOH C . 
G 4 HOH 6   201 13  HOH HOH C . 
G 4 HOH 7   202 15  HOH HOH C . 
G 4 HOH 8   203 18  HOH HOH C . 
G 4 HOH 9   204 19  HOH HOH C . 
G 4 HOH 10  205 20  HOH HOH C . 
G 4 HOH 11  206 22  HOH HOH C . 
G 4 HOH 12  207 23  HOH HOH C . 
G 4 HOH 13  208 25  HOH HOH C . 
G 4 HOH 14  209 27  HOH HOH C . 
G 4 HOH 15  210 28  HOH HOH C . 
G 4 HOH 16  211 29  HOH HOH C . 
G 4 HOH 17  212 32  HOH HOH C . 
G 4 HOH 18  213 33  HOH HOH C . 
G 4 HOH 19  214 34  HOH HOH C . 
G 4 HOH 20  215 36  HOH HOH C . 
G 4 HOH 21  216 37  HOH HOH C . 
G 4 HOH 22  217 39  HOH HOH C . 
G 4 HOH 23  218 40  HOH HOH C . 
G 4 HOH 24  219 41  HOH HOH C . 
G 4 HOH 25  220 43  HOH HOH C . 
G 4 HOH 26  221 44  HOH HOH C . 
G 4 HOH 27  222 47  HOH HOH C . 
G 4 HOH 28  223 50  HOH HOH C . 
G 4 HOH 29  224 51  HOH HOH C . 
G 4 HOH 30  225 52  HOH HOH C . 
G 4 HOH 31  226 53  HOH HOH C . 
G 4 HOH 32  227 54  HOH HOH C . 
G 4 HOH 33  228 55  HOH HOH C . 
G 4 HOH 34  229 56  HOH HOH C . 
G 4 HOH 35  230 58  HOH HOH C . 
G 4 HOH 36  231 59  HOH HOH C . 
G 4 HOH 37  232 60  HOH HOH C . 
G 4 HOH 38  233 61  HOH HOH C . 
G 4 HOH 39  234 65  HOH HOH C . 
G 4 HOH 40  235 66  HOH HOH C . 
G 4 HOH 41  236 69  HOH HOH C . 
G 4 HOH 42  237 71  HOH HOH C . 
G 4 HOH 43  238 73  HOH HOH C . 
G 4 HOH 44  239 76  HOH HOH C . 
G 4 HOH 45  240 77  HOH HOH C . 
G 4 HOH 46  241 80  HOH HOH C . 
G 4 HOH 47  242 83  HOH HOH C . 
G 4 HOH 48  243 84  HOH HOH C . 
G 4 HOH 49  244 85  HOH HOH C . 
G 4 HOH 50  245 87  HOH HOH C . 
G 4 HOH 51  246 91  HOH HOH C . 
G 4 HOH 52  247 94  HOH HOH C . 
G 4 HOH 53  248 96  HOH HOH C . 
G 4 HOH 54  249 97  HOH HOH C . 
G 4 HOH 55  250 98  HOH HOH C . 
G 4 HOH 56  251 99  HOH HOH C . 
G 4 HOH 57  252 100 HOH HOH C . 
G 4 HOH 58  253 106 HOH HOH C . 
G 4 HOH 59  254 112 HOH HOH C . 
G 4 HOH 60  255 115 HOH HOH C . 
G 4 HOH 61  256 116 HOH HOH C . 
G 4 HOH 62  257 118 HOH HOH C . 
G 4 HOH 63  258 121 HOH HOH C . 
G 4 HOH 64  259 123 HOH HOH C . 
G 4 HOH 65  260 125 HOH HOH C . 
G 4 HOH 66  261 128 HOH HOH C . 
G 4 HOH 67  262 129 HOH HOH C . 
G 4 HOH 68  263 130 HOH HOH C . 
G 4 HOH 69  264 133 HOH HOH C . 
G 4 HOH 70  265 134 HOH HOH C . 
G 4 HOH 71  266 136 HOH HOH C . 
G 4 HOH 72  267 137 HOH HOH C . 
G 4 HOH 73  268 138 HOH HOH C . 
G 4 HOH 74  269 141 HOH HOH C . 
G 4 HOH 75  270 142 HOH HOH C . 
G 4 HOH 76  271 143 HOH HOH C . 
G 4 HOH 77  272 144 HOH HOH C . 
G 4 HOH 78  273 146 HOH HOH C . 
G 4 HOH 79  274 147 HOH HOH C . 
G 4 HOH 80  275 149 HOH HOH C . 
G 4 HOH 81  276 153 HOH HOH C . 
G 4 HOH 82  277 154 HOH HOH C . 
G 4 HOH 83  278 155 HOH HOH C . 
G 4 HOH 84  279 156 HOH HOH C . 
G 4 HOH 85  280 157 HOH HOH C . 
G 4 HOH 86  281 159 HOH HOH C . 
G 4 HOH 87  282 164 HOH HOH C . 
G 4 HOH 88  283 165 HOH HOH C . 
G 4 HOH 89  284 167 HOH HOH C . 
G 4 HOH 90  285 169 HOH HOH C . 
G 4 HOH 91  286 170 HOH HOH C . 
G 4 HOH 92  287 174 HOH HOH C . 
G 4 HOH 93  288 175 HOH HOH C . 
G 4 HOH 94  289 178 HOH HOH C . 
G 4 HOH 95  290 180 HOH HOH C . 
G 4 HOH 96  291 181 HOH HOH C . 
G 4 HOH 97  292 182 HOH HOH C . 
G 4 HOH 98  293 185 HOH HOH C . 
G 4 HOH 99  294 186 HOH HOH C . 
G 4 HOH 100 295 187 HOH HOH C . 
G 4 HOH 101 296 188 HOH HOH C . 
G 4 HOH 102 297 190 HOH HOH C . 
G 4 HOH 103 298 193 HOH HOH C . 
G 4 HOH 104 299 195 HOH HOH C . 
G 4 HOH 105 300 196 HOH HOH C . 
G 4 HOH 106 301 197 HOH HOH C . 
G 4 HOH 107 302 201 HOH HOH C . 
G 4 HOH 108 303 204 HOH HOH C . 
G 4 HOH 109 304 205 HOH HOH C . 
G 4 HOH 110 305 207 HOH HOH C . 
G 4 HOH 111 306 208 HOH HOH C . 
G 4 HOH 112 307 209 HOH HOH C . 
G 4 HOH 113 308 211 HOH HOH C . 
G 4 HOH 114 309 213 HOH HOH C . 
G 4 HOH 115 310 214 HOH HOH C . 
G 4 HOH 116 311 217 HOH HOH C . 
G 4 HOH 117 312 218 HOH HOH C . 
G 4 HOH 118 313 220 HOH HOH C . 
G 4 HOH 119 314 221 HOH HOH C . 
G 4 HOH 120 315 222 HOH HOH C . 
G 4 HOH 121 316 223 HOH HOH C . 
G 4 HOH 122 317 226 HOH HOH C . 
G 4 HOH 123 318 229 HOH HOH C . 
G 4 HOH 124 319 235 HOH HOH C . 
G 4 HOH 125 320 237 HOH HOH C . 
G 4 HOH 126 321 238 HOH HOH C . 
G 4 HOH 127 322 241 HOH HOH C . 
G 4 HOH 128 323 242 HOH HOH C . 
G 4 HOH 129 324 244 HOH HOH C . 
G 4 HOH 130 325 247 HOH HOH C . 
G 4 HOH 131 326 250 HOH HOH C . 
G 4 HOH 132 327 252 HOH HOH C . 
G 4 HOH 133 328 254 HOH HOH C . 
G 4 HOH 134 329 258 HOH HOH C . 
G 4 HOH 135 330 261 HOH HOH C . 
G 4 HOH 136 331 263 HOH HOH C . 
G 4 HOH 137 332 269 HOH HOH C . 
G 4 HOH 138 333 270 HOH HOH C . 
G 4 HOH 139 334 271 HOH HOH C . 
G 4 HOH 140 335 272 HOH HOH C . 
G 4 HOH 141 336 274 HOH HOH C . 
G 4 HOH 142 337 275 HOH HOH C . 
G 4 HOH 143 338 280 HOH HOH C . 
G 4 HOH 144 339 281 HOH HOH C . 
G 4 HOH 145 340 282 HOH HOH C . 
G 4 HOH 146 341 283 HOH HOH C . 
G 4 HOH 147 342 284 HOH HOH C . 
G 4 HOH 148 343 285 HOH HOH C . 
G 4 HOH 149 344 288 HOH HOH C . 
G 4 HOH 150 345 289 HOH HOH C . 
G 4 HOH 151 346 291 HOH HOH C . 
G 4 HOH 152 347 294 HOH HOH C . 
G 4 HOH 153 348 295 HOH HOH C . 
G 4 HOH 154 349 297 HOH HOH C . 
G 4 HOH 155 350 298 HOH HOH C . 
G 4 HOH 156 351 299 HOH HOH C . 
G 4 HOH 157 352 302 HOH HOH C . 
G 4 HOH 158 353 304 HOH HOH C . 
G 4 HOH 159 354 305 HOH HOH C . 
G 4 HOH 160 355 306 HOH HOH C . 
G 4 HOH 161 356 310 HOH HOH C . 
G 4 HOH 162 357 311 HOH HOH C . 
G 4 HOH 163 358 313 HOH HOH C . 
G 4 HOH 164 359 316 HOH HOH C . 
G 4 HOH 165 360 321 HOH HOH C . 
G 4 HOH 166 361 324 HOH HOH C . 
G 4 HOH 167 362 325 HOH HOH C . 
G 4 HOH 168 363 326 HOH HOH C . 
G 4 HOH 169 364 327 HOH HOH C . 
G 4 HOH 170 365 328 HOH HOH C . 
G 4 HOH 171 366 332 HOH HOH C . 
G 4 HOH 172 367 333 HOH HOH C . 
G 4 HOH 173 368 337 HOH HOH C . 
G 4 HOH 174 369 340 HOH HOH C . 
G 4 HOH 175 370 342 HOH HOH C . 
G 4 HOH 176 371 344 HOH HOH C . 
G 4 HOH 177 372 345 HOH HOH C . 
G 4 HOH 178 373 346 HOH HOH C . 
G 4 HOH 179 374 348 HOH HOH C . 
G 4 HOH 180 375 350 HOH HOH C . 
G 4 HOH 181 376 352 HOH HOH C . 
G 4 HOH 182 377 353 HOH HOH C . 
G 4 HOH 183 378 355 HOH HOH C . 
G 4 HOH 184 379 356 HOH HOH C . 
G 4 HOH 185 380 358 HOH HOH C . 
G 4 HOH 186 381 362 HOH HOH C . 
G 4 HOH 187 382 363 HOH HOH C . 
G 4 HOH 188 383 364 HOH HOH C . 
G 4 HOH 189 384 365 HOH HOH C . 
G 4 HOH 190 385 369 HOH HOH C . 
G 4 HOH 191 386 370 HOH HOH C . 
G 4 HOH 192 387 372 HOH HOH C . 
G 4 HOH 193 388 373 HOH HOH C . 
G 4 HOH 194 389 375 HOH HOH C . 
G 4 HOH 195 390 378 HOH HOH C . 
G 4 HOH 196 391 380 HOH HOH C . 
G 4 HOH 197 392 384 HOH HOH C . 
G 4 HOH 198 393 388 HOH HOH C . 
G 4 HOH 199 394 390 HOH HOH C . 
G 4 HOH 200 395 392 HOH HOH C . 
G 4 HOH 201 396 394 HOH HOH C . 
G 4 HOH 202 397 396 HOH HOH C . 
G 4 HOH 203 398 397 HOH HOH C . 
G 4 HOH 204 399 399 HOH HOH C . 
G 4 HOH 205 400 400 HOH HOH C . 
G 4 HOH 206 401 401 HOH HOH C . 
G 4 HOH 207 402 402 HOH HOH C . 
G 4 HOH 208 403 407 HOH HOH C . 
G 4 HOH 209 404 408 HOH HOH C . 
G 4 HOH 210 405 409 HOH HOH C . 
G 4 HOH 211 406 410 HOH HOH C . 
G 4 HOH 212 407 411 HOH HOH C . 
G 4 HOH 213 408 412 HOH HOH C . 
G 4 HOH 214 409 413 HOH HOH C . 
G 4 HOH 215 410 414 HOH HOH C . 
G 4 HOH 216 411 415 HOH HOH C . 
G 4 HOH 217 412 417 HOH HOH C . 
G 4 HOH 218 413 418 HOH HOH C . 
G 4 HOH 219 414 419 HOH HOH C . 
G 4 HOH 220 415 420 HOH HOH C . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 7930  ? 
1 MORE         -39.2 ? 
1 'SSA (A^2)'  33160 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z  1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 199 ? F HOH . 
2 1 C HOH 197 ? G HOH . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A ASP 156 ? A ASP 155 ? 1_555 MN ? C MN . ? A MN 195 ? 1_555 NE2 ? A HIS 27  ? A HIS 26  ? 1_555 82.8  ? 
2  OD1 ? A ASP 156 ? A ASP 155 ? 1_555 MN ? C MN . ? A MN 195 ? 1_555 NE2 ? A HIS 75  ? A HIS 74  ? 1_555 112.7 ? 
3  NE2 ? A HIS 27  ? A HIS 26  ? 1_555 MN ? C MN . ? A MN 195 ? 1_555 NE2 ? A HIS 75  ? A HIS 74  ? 1_555 97.6  ? 
4  OD1 ? A ASP 156 ? A ASP 155 ? 1_555 MN ? C MN . ? A MN 195 ? 1_555 NE2 ? A HIS 160 ? A HIS 159 ? 1_555 122.7 ? 
5  NE2 ? A HIS 27  ? A HIS 26  ? 1_555 MN ? C MN . ? A MN 195 ? 1_555 NE2 ? A HIS 160 ? A HIS 159 ? 1_555 90.7  ? 
6  NE2 ? A HIS 75  ? A HIS 74  ? 1_555 MN ? C MN . ? A MN 195 ? 1_555 NE2 ? A HIS 160 ? A HIS 159 ? 1_555 124.6 ? 
7  OD1 ? A ASP 156 ? A ASP 155 ? 1_555 MN ? C MN . ? A MN 195 ? 1_555 O   ? F HOH .   ? A HOH 197 ? 1_555 89.7  ? 
8  NE2 ? A HIS 27  ? A HIS 26  ? 1_555 MN ? C MN . ? A MN 195 ? 1_555 O   ? F HOH .   ? A HOH 197 ? 1_555 171.0 ? 
9  NE2 ? A HIS 75  ? A HIS 74  ? 1_555 MN ? C MN . ? A MN 195 ? 1_555 O   ? F HOH .   ? A HOH 197 ? 1_555 89.8  ? 
10 NE2 ? A HIS 160 ? A HIS 159 ? 1_555 MN ? C MN . ? A MN 195 ? 1_555 O   ? F HOH .   ? A HOH 197 ? 1_555 89.2  ? 
11 OD1 ? B ASP 156 ? C ASP 155 ? 1_555 MN ? E MN . ? C MN 195 ? 1_555 NE2 ? B HIS 27  ? C HIS 26  ? 1_555 85.0  ? 
12 OD1 ? B ASP 156 ? C ASP 155 ? 1_555 MN ? E MN . ? C MN 195 ? 1_555 NE2 ? B HIS 75  ? C HIS 74  ? 1_555 109.1 ? 
13 NE2 ? B HIS 27  ? C HIS 26  ? 1_555 MN ? E MN . ? C MN 195 ? 1_555 NE2 ? B HIS 75  ? C HIS 74  ? 1_555 95.4  ? 
14 OD1 ? B ASP 156 ? C ASP 155 ? 1_555 MN ? E MN . ? C MN 195 ? 1_555 NE2 ? B HIS 160 ? C HIS 159 ? 1_555 119.0 ? 
15 NE2 ? B HIS 27  ? C HIS 26  ? 1_555 MN ? E MN . ? C MN 195 ? 1_555 NE2 ? B HIS 160 ? C HIS 159 ? 1_555 89.3  ? 
16 NE2 ? B HIS 75  ? C HIS 74  ? 1_555 MN ? E MN . ? C MN 195 ? 1_555 NE2 ? B HIS 160 ? C HIS 159 ? 1_555 131.9 ? 
17 OD1 ? B ASP 156 ? C ASP 155 ? 1_555 MN ? E MN . ? C MN 195 ? 1_555 O   ? G HOH .   ? C HOH 196 ? 1_555 84.1  ? 
18 NE2 ? B HIS 27  ? C HIS 26  ? 1_555 MN ? E MN . ? C MN 195 ? 1_555 O   ? G HOH .   ? C HOH 196 ? 1_555 168.3 ? 
19 NE2 ? B HIS 75  ? C HIS 74  ? 1_555 MN ? E MN . ? C MN 195 ? 1_555 O   ? G HOH .   ? C HOH 196 ? 1_555 92.2  ? 
20 NE2 ? B HIS 160 ? C HIS 159 ? 1_555 MN ? E MN . ? C MN 195 ? 1_555 O   ? G HOH .   ? C HOH 196 ? 1_555 92.2  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-06-09 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 26.7870 5.9450  -0.8920 -0.0266 -0.0706 0.1460 0.0261 0.0351 0.0249 1.3733 1.7851 1.4371 0.1860  0.0404 -0.7409 0.0009 
-0.0416 -0.1054 -0.1452 -0.1550 -0.3853 0.2663  0.1384  0.1541  'X-RAY DIFFRACTION' 
2 ? refined -8.7530 -2.5360 14.1280 -0.0634 -0.0166 0.1348 0.0006 0.0675 0.0609 1.3820 1.2766 0.8784 -0.1126 0.1410 -0.3000 0.0228 
-0.2551 -0.0911 0.1849  0.0616  0.3050  -0.0412 -0.1624 -0.0844 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 1 A 2 A 194 A 195 ? 'X-RAY DIFFRACTION' ? 
2 2 C 0 B 1 C 194 B 195 ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement        5.2.0005 ? 1 
ADSC   'data collection' Quantum  ? 2 
MOSFLM 'data reduction'  .        ? 3 
SCALA  'data scaling'    .        ? 4 
PHASER phasing           .        ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN A 141 ? ? 53.13   -120.17 
2 1 TYR A 161 ? ? -145.45 -12.47  
3 1 LYS A 166 ? ? 51.12   -130.39 
4 1 ASN C 141 ? ? 49.73   -120.41 
5 1 TYR C 161 ? ? -147.81 -18.03  
6 1 LYS C 166 ? ? 51.17   -134.16 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A LYS 1  ? CG ? A LYS 2  CG 
2 1 Y 1 A LYS 1  ? CD ? A LYS 2  CD 
3 1 Y 1 A LYS 1  ? CE ? A LYS 2  CE 
4 1 Y 1 A LYS 1  ? NZ ? A LYS 2  NZ 
5 1 Y 1 A LYS 90 ? CG ? A LYS 91 CG 
6 1 Y 1 A LYS 90 ? CD ? A LYS 91 CD 
7 1 Y 1 A LYS 90 ? CE ? A LYS 91 CE 
8 1 Y 1 A LYS 90 ? NZ ? A LYS 91 NZ 
# 
_pdbx_unobs_or_zero_occ_residues.id               1 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_residues.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id     A 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id     MET 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id      0 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_residues.label_asym_id    A 
_pdbx_unobs_or_zero_occ_residues.label_comp_id    MET 
_pdbx_unobs_or_zero_occ_residues.label_seq_id     1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MANGANESE (II) ION' MN  
3 'MALONATE ION'       MLI 
4 water                HOH 
#