data_3DC6
# 
_entry.id   3DC6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3DC6         
RCSB  RCSB047854   
WWPDB D_1000047854 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3DC5 
_pdbx_database_related.details        'Homologous protein' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3DC6 
_pdbx_database_status.recvd_initial_deposition_date   2008-06-03 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Trinh, C.H.'      1 
'Hunter, T.'       2 
'Stewart, E.E.'    3 
'Phillips, S.E.V.' 4 
'Hunter, G.J.'     5 
# 
_citation.id                        primary 
_citation.title                     
'Purification, crystallization and X-ray structures of the two manganese superoxide dismutases from Caenorhabditis elegans' 
_citation.journal_abbrev            'Acta Crystallogr.,Sect.F' 
_citation.journal_volume            64 
_citation.page_first                1110 
_citation.page_last                 1114 
_citation.year                      2008 
_citation.journal_id_ASTM           ? 
_citation.country                   DK 
_citation.journal_id_ISSN           1744-3091 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19052361 
_citation.pdbx_database_id_DOI      10.1107/S1744309108037056 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Trinh, C.H.'    1 
primary 'Hunter, T.'     2 
primary 'Stewart, E.E.'  3 
primary 'Phillips, S.E.' 4 
primary 'Hunter, G.J.'   5 
# 
_cell.entry_id           3DC6 
_cell.length_a           80.980 
_cell.length_b           80.980 
_cell.length_c           137.444 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3DC6 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Superoxide dismutase [Mn] 1' 22143.039 2   1.15.1.1 ? ? ? 
2 non-polymer syn 'MANGANESE (II) ION'          54.938    2   ?        ? ? ? 
3 non-polymer syn 'SULFATE ION'                 96.063    3   ?        ? ? ? 
4 water       nat water                         18.015    448 ?        ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MKHSLPDLPYDYADLEPVISHEIMQLHHQKHHATYVNNLNQIEEKLHEAVSKGNVKEAIALQPALKFNGGGHINHSIFWT
NLAKDGGEPSAELLTAIKSDFGSLDNLQKQLSASTVAVQGSGWGWLGYCPKGKILKVATCANQDPLEATTGLVPLFGIDV
WEHAYYLQYKNVRPDYVNAIWKIANWKNVSERFAKAQQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MKHSLPDLPYDYADLEPVISHEIMQLHHQKHHATYVNNLNQIEEKLHEAVSKGNVKEAIALQPALKFNGGGHINHSIFWT
NLAKDGGEPSAELLTAIKSDFGSLDNLQKQLSASTVAVQGSGWGWLGYCPKGKILKVATCANQDPLEATTGLVPLFGIDV
WEHAYYLQYKNVRPDYVNAIWKIANWKNVSERFAKAQQ
;
_entity_poly.pdbx_strand_id                 A,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   HIS n 
1 4   SER n 
1 5   LEU n 
1 6   PRO n 
1 7   ASP n 
1 8   LEU n 
1 9   PRO n 
1 10  TYR n 
1 11  ASP n 
1 12  TYR n 
1 13  ALA n 
1 14  ASP n 
1 15  LEU n 
1 16  GLU n 
1 17  PRO n 
1 18  VAL n 
1 19  ILE n 
1 20  SER n 
1 21  HIS n 
1 22  GLU n 
1 23  ILE n 
1 24  MET n 
1 25  GLN n 
1 26  LEU n 
1 27  HIS n 
1 28  HIS n 
1 29  GLN n 
1 30  LYS n 
1 31  HIS n 
1 32  HIS n 
1 33  ALA n 
1 34  THR n 
1 35  TYR n 
1 36  VAL n 
1 37  ASN n 
1 38  ASN n 
1 39  LEU n 
1 40  ASN n 
1 41  GLN n 
1 42  ILE n 
1 43  GLU n 
1 44  GLU n 
1 45  LYS n 
1 46  LEU n 
1 47  HIS n 
1 48  GLU n 
1 49  ALA n 
1 50  VAL n 
1 51  SER n 
1 52  LYS n 
1 53  GLY n 
1 54  ASN n 
1 55  VAL n 
1 56  LYS n 
1 57  GLU n 
1 58  ALA n 
1 59  ILE n 
1 60  ALA n 
1 61  LEU n 
1 62  GLN n 
1 63  PRO n 
1 64  ALA n 
1 65  LEU n 
1 66  LYS n 
1 67  PHE n 
1 68  ASN n 
1 69  GLY n 
1 70  GLY n 
1 71  GLY n 
1 72  HIS n 
1 73  ILE n 
1 74  ASN n 
1 75  HIS n 
1 76  SER n 
1 77  ILE n 
1 78  PHE n 
1 79  TRP n 
1 80  THR n 
1 81  ASN n 
1 82  LEU n 
1 83  ALA n 
1 84  LYS n 
1 85  ASP n 
1 86  GLY n 
1 87  GLY n 
1 88  GLU n 
1 89  PRO n 
1 90  SER n 
1 91  ALA n 
1 92  GLU n 
1 93  LEU n 
1 94  LEU n 
1 95  THR n 
1 96  ALA n 
1 97  ILE n 
1 98  LYS n 
1 99  SER n 
1 100 ASP n 
1 101 PHE n 
1 102 GLY n 
1 103 SER n 
1 104 LEU n 
1 105 ASP n 
1 106 ASN n 
1 107 LEU n 
1 108 GLN n 
1 109 LYS n 
1 110 GLN n 
1 111 LEU n 
1 112 SER n 
1 113 ALA n 
1 114 SER n 
1 115 THR n 
1 116 VAL n 
1 117 ALA n 
1 118 VAL n 
1 119 GLN n 
1 120 GLY n 
1 121 SER n 
1 122 GLY n 
1 123 TRP n 
1 124 GLY n 
1 125 TRP n 
1 126 LEU n 
1 127 GLY n 
1 128 TYR n 
1 129 CYS n 
1 130 PRO n 
1 131 LYS n 
1 132 GLY n 
1 133 LYS n 
1 134 ILE n 
1 135 LEU n 
1 136 LYS n 
1 137 VAL n 
1 138 ALA n 
1 139 THR n 
1 140 CYS n 
1 141 ALA n 
1 142 ASN n 
1 143 GLN n 
1 144 ASP n 
1 145 PRO n 
1 146 LEU n 
1 147 GLU n 
1 148 ALA n 
1 149 THR n 
1 150 THR n 
1 151 GLY n 
1 152 LEU n 
1 153 VAL n 
1 154 PRO n 
1 155 LEU n 
1 156 PHE n 
1 157 GLY n 
1 158 ILE n 
1 159 ASP n 
1 160 VAL n 
1 161 TRP n 
1 162 GLU n 
1 163 HIS n 
1 164 ALA n 
1 165 TYR n 
1 166 TYR n 
1 167 LEU n 
1 168 GLN n 
1 169 TYR n 
1 170 LYS n 
1 171 ASN n 
1 172 VAL n 
1 173 ARG n 
1 174 PRO n 
1 175 ASP n 
1 176 TYR n 
1 177 VAL n 
1 178 ASN n 
1 179 ALA n 
1 180 ILE n 
1 181 TRP n 
1 182 LYS n 
1 183 ILE n 
1 184 ALA n 
1 185 ASN n 
1 186 TRP n 
1 187 LYS n 
1 188 ASN n 
1 189 VAL n 
1 190 SER n 
1 191 GLU n 
1 192 ARG n 
1 193 PHE n 
1 194 ALA n 
1 195 LYS n 
1 196 ALA n 
1 197 GLN n 
1 198 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               nematode 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'sod-2, sdm-1, F10D11.1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Caenorhabditis elegans' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     6239 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               OX326A 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pTrc-99A 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SODM1_CAEEL 
_struct_ref.pdbx_db_accession          P31161 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;KHSLPDLPYDYADLEPVISHEIMQLHHQKHHATYVNNLNQIEEKLHEAVSKGNVKEAIALQPALKFNGGGHINHSIFWTN
LAKDGGEPSAELLTAIKSDFGSLDNLQKQLSASTVAVQGSGWGWLGYCPKGKILKVATCANQDPLEATTGLVPLFGIDVW
EHAYYLQYKNVRPDYVNAIWKIANWKNVSERFAKAQQ
;
_struct_ref.pdbx_align_begin           25 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3DC6 A 2 ? 198 ? P31161 25 ? 221 ? 1 197 
2 1 3DC6 C 2 ? 198 ? P31161 25 ? 221 ? 1 197 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3DC6 MET A 1 ? UNP P31161 ? ? 'INITIATING METHIONINE' 0 1 
2 3DC6 MET C 1 ? UNP P31161 ? ? 'INITIATING METHIONINE' 0 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE              ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE             ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE           ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'      ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE             ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE            ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'      ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE              ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE            ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE           ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE              ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE               ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE           ? 'C5 H11 N O2 S'  149.211 
MN  non-polymer         . 'MANGANESE (II) ION' ? 'Mn 2'           54.938  
PHE 'L-peptide linking' y PHENYLALANINE        ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE              ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE               ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'        ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE            ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN           ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE             ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE               ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3DC6 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.54 
_exptl_crystal.density_percent_sol   51.65 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              9.2 
_exptl_crystal_grow.pdbx_details    '3M ammonium sulphate, 0.1M bicine, pH9.2, VAPOR DIFFUSION, SITTING DROP, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2007-05-25 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si (111) double crystal' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.060 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I03' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I03 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.060 
# 
_reflns.entry_id                     3DC6 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            1.80 
_reflns.d_resolution_low             69.84 
_reflns.number_all                   42770 
_reflns.number_obs                   41573 
_reflns.percent_possible_obs         97.2 
_reflns.pdbx_Rmerge_I_obs            0.056 
_reflns.pdbx_Rsym_value              0.056 
_reflns.pdbx_netI_over_sigmaI        8.7 
_reflns.B_iso_Wilson_estimate        17.2 
_reflns.pdbx_redundancy              4.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.80 
_reflns_shell.d_res_low              1.90 
_reflns_shell.percent_possible_all   98.9 
_reflns_shell.Rmerge_I_obs           0.144 
_reflns_shell.pdbx_Rsym_value        0.144 
_reflns_shell.meanI_over_sigI_obs    8.5 
_reflns_shell.pdbx_redundancy        4.2 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      6162 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3DC6 
_refine.ls_number_reflns_obs                     41573 
_refine.ls_number_reflns_all                     42770 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             43.99 
_refine.ls_d_res_high                            1.80 
_refine.ls_percent_reflns_obs                    96.35 
_refine.ls_R_factor_obs                          0.17079 
_refine.ls_R_factor_all                          0.17079 
_refine.ls_R_factor_R_work                       0.1692 
_refine.ls_R_factor_R_free                       0.20121 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  2105 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.955 
_refine.correlation_coeff_Fo_to_Fc_free          0.934 
_refine.B_iso_mean                               15.646 
_refine.aniso_B[1][1]                            -0.31 
_refine.aniso_B[2][2]                            -0.31 
_refine.aniso_B[3][3]                            0.61 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'C. Elegans MnSOD3' 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             Isotropic 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.120 
_refine.pdbx_overall_ESU_R_Free                  0.113 
_refine.overall_SU_ML                            0.067 
_refine.overall_SU_B                             3.773 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3105 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         17 
_refine_hist.number_atoms_solvent             448 
_refine_hist.number_atoms_total               3570 
_refine_hist.d_res_high                       1.80 
_refine_hist.d_res_low                        43.99 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.009  0.021  ? 3276 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.109  1.931  ? 4471 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   5.054  5.000  ? 410  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   33.408 25.686 ? 153  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   11.573 15.000 ? 534  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   4.469  15.000 ? 4    'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.078  0.200  ? 480  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.004  0.020  ? 2522 'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.194  0.200  ? 1697 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.304  0.200  ? 2260 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.150  0.200  ? 376  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.138  0.200  ? 59   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.200  0.200  ? 44   'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.605  1.500  ? 2075 'X-RAY DIFFRACTION' ? 
r_mcangle_it             0.837  2.000  ? 3224 'X-RAY DIFFRACTION' ? 
r_scbond_it              1.472  3.000  ? 1414 'X-RAY DIFFRACTION' ? 
r_scangle_it             2.317  4.500  ? 1244 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.800 
_refine_ls_shell.d_res_low                        1.847 
_refine_ls_shell.number_reflns_R_work             2935 
_refine_ls_shell.R_factor_R_work                  0.185 
_refine_ls_shell.percent_reflns_obs               98.63 
_refine_ls_shell.R_factor_R_free                  0.208 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             159 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                3094 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3DC6 
_struct.title                     'Crystal Structure of a manganese superoxide dismutases from Caenorhabditis elegans' 
_struct.pdbx_descriptor           'Manganese superoxide dismutase (E.C.1.15.11)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3DC6 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            
'alpha hairpin N domain, alpha/beta C domain, OXIDOREDUCTASE, Manganese, Metal-binding, Mitochondrion, Transit peptide' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 20  ? LYS A 30  ? SER A 19  LYS A 29  1 ? 11 
HELX_P HELX_P2  2  LYS A 30  ? LYS A 52  ? LYS A 29  LYS A 51  1 ? 23 
HELX_P HELX_P3  3  ASN A 54  ? LEU A 61  ? ASN A 53  LEU A 60  1 ? 8  
HELX_P HELX_P4  4  LEU A 61  ? ASN A 81  ? LEU A 60  ASN A 80  1 ? 21 
HELX_P HELX_P5  5  SER A 90  ? GLY A 102 ? SER A 89  GLY A 101 1 ? 13 
HELX_P HELX_P6  6  SER A 103 ? ALA A 117 ? SER A 102 ALA A 116 1 ? 15 
HELX_P HELX_P7  7  PRO A 145 ? GLY A 151 ? PRO A 144 GLY A 150 1 ? 7  
HELX_P HELX_P8  8  TRP A 161 ? ALA A 164 ? TRP A 160 ALA A 163 5 ? 4  
HELX_P HELX_P9  9  TYR A 165 ? LYS A 170 ? TYR A 164 LYS A 169 1 ? 6  
HELX_P HELX_P10 10 VAL A 172 ? ILE A 180 ? VAL A 171 ILE A 179 1 ? 9  
HELX_P HELX_P11 11 TRP A 181 ? ALA A 184 ? TRP A 180 ALA A 183 5 ? 4  
HELX_P HELX_P12 12 ASN A 185 ? GLN A 197 ? ASN A 184 GLN A 196 1 ? 13 
HELX_P HELX_P13 13 SER B 20  ? LYS B 30  ? SER C 19  LYS C 29  1 ? 11 
HELX_P HELX_P14 14 LYS B 30  ? GLY B 53  ? LYS C 29  GLY C 52  1 ? 24 
HELX_P HELX_P15 15 ASN B 54  ? LEU B 61  ? ASN C 53  LEU C 60  1 ? 8  
HELX_P HELX_P16 16 LEU B 61  ? ASN B 81  ? LEU C 60  ASN C 80  1 ? 21 
HELX_P HELX_P17 17 SER B 90  ? GLY B 102 ? SER C 89  GLY C 101 1 ? 13 
HELX_P HELX_P18 18 SER B 103 ? ALA B 117 ? SER C 102 ALA C 116 1 ? 15 
HELX_P HELX_P19 19 PRO B 145 ? GLY B 151 ? PRO C 144 GLY C 150 1 ? 7  
HELX_P HELX_P20 20 TRP B 161 ? ALA B 164 ? TRP C 160 ALA C 163 5 ? 4  
HELX_P HELX_P21 21 TYR B 165 ? LYS B 170 ? TYR C 164 LYS C 169 1 ? 6  
HELX_P HELX_P22 22 VAL B 172 ? ILE B 180 ? VAL C 171 ILE C 179 1 ? 9  
HELX_P HELX_P23 23 TRP B 181 ? ALA B 184 ? TRP C 180 ALA C 183 5 ? 4  
HELX_P HELX_P24 24 ASN B 185 ? GLN B 197 ? ASN C 184 GLN C 196 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 159 OD1 ? ? ? 1_555 C MN  . MN ? ? A ASP 158 A MN  198 1_555 ? ? ? ? ? ? ? 2.008 ? 
metalc2  metalc ? ? B ASP 159 OD1 ? ? ? 1_555 F MN  . MN ? ? C ASP 158 C MN  198 1_555 ? ? ? ? ? ? ? 1.986 ? 
metalc3  metalc ? ? A HIS 27  NE2 ? ? ? 1_555 C MN  . MN ? ? A HIS 26  A MN  198 1_555 ? ? ? ? ? ? ? 2.149 ? 
metalc4  metalc ? ? B HIS 27  NE2 ? ? ? 1_555 F MN  . MN ? ? C HIS 26  C MN  198 1_555 ? ? ? ? ? ? ? 2.222 ? 
metalc5  metalc ? ? A HIS 75  NE2 ? ? ? 1_555 C MN  . MN ? ? A HIS 74  A MN  198 1_555 ? ? ? ? ? ? ? 2.158 ? 
metalc6  metalc ? ? B HIS 75  NE2 ? ? ? 1_555 F MN  . MN ? ? C HIS 74  C MN  198 1_555 ? ? ? ? ? ? ? 2.152 ? 
metalc7  metalc ? ? A HIS 163 NE2 ? ? ? 1_555 C MN  . MN ? ? A HIS 162 A MN  198 1_555 ? ? ? ? ? ? ? 2.194 ? 
metalc8  metalc ? ? B HIS 163 NE2 ? ? ? 1_555 F MN  . MN ? ? C HIS 162 C MN  198 1_555 ? ? ? ? ? ? ? 2.168 ? 
metalc9  metalc ? ? C MN  .   MN  ? ? ? 1_555 H HOH . O  ? ? A MN  198 A HOH 202 1_555 ? ? ? ? ? ? ? 1.950 ? 
metalc10 metalc ? ? F MN  .   MN  ? ? ? 1_555 I HOH . O  ? ? C MN  198 C HOH 220 1_555 ? ? ? ? ? ? ? 2.097 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 16 A . ? GLU 15 A PRO 17 A ? PRO 16 A 1 4.26 
2 GLU 16 B . ? GLU 15 C PRO 17 B ? PRO 16 C 1 9.14 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 134 ? ALA A 141 ? ILE A 133 ALA A 140 
A 2 GLY A 122 ? CYS A 129 ? GLY A 121 CYS A 128 
A 3 VAL A 153 ? ASP A 159 ? VAL A 152 ASP A 158 
B 1 ILE B 134 ? ALA B 141 ? ILE C 133 ALA C 140 
B 2 GLY B 122 ? CYS B 129 ? GLY C 121 CYS C 128 
B 3 VAL B 153 ? ASP B 159 ? VAL C 152 ASP C 158 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LYS A 136 ? O LYS A 135 N GLY A 127 ? N GLY A 126 
A 2 3 N TYR A 128 ? N TYR A 127 O VAL A 153 ? O VAL A 152 
B 1 2 O ALA B 138 ? O ALA C 137 N TRP B 125 ? N TRP C 124 
B 2 3 N TYR B 128 ? N TYR C 127 O VAL B 153 ? O VAL C 152 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MN A 198'  
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 A 199' 
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 A 200' 
AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MN C 198'  
AC5 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SO4 C 199' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 HIS A 27  ? HIS A 26  . ? 1_555 ? 
2  AC1 5 HIS A 75  ? HIS A 74  . ? 1_555 ? 
3  AC1 5 ASP A 159 ? ASP A 158 . ? 1_555 ? 
4  AC1 5 HIS A 163 ? HIS A 162 . ? 1_555 ? 
5  AC1 5 HOH H .   ? HOH A 202 . ? 1_555 ? 
6  AC2 6 TYR A 12  ? TYR A 11  . ? 1_555 ? 
7  AC2 6 GLN A 25  ? GLN A 24  . ? 1_555 ? 
8  AC2 6 GLN A 29  ? GLN A 28  . ? 1_555 ? 
9  AC2 6 HOH H .   ? HOH A 323 . ? 1_555 ? 
10 AC2 6 LYS B 2   ? LYS C 1   . ? 5_555 ? 
11 AC2 6 SER B 4   ? SER C 3   . ? 5_555 ? 
12 AC3 5 HIS A 3   ? HIS A 2   . ? 1_555 ? 
13 AC3 5 SER A 4   ? SER A 3   . ? 1_555 ? 
14 AC3 5 HIS A 72  ? HIS A 71  . ? 1_555 ? 
15 AC3 5 HOH H .   ? HOH A 288 . ? 1_555 ? 
16 AC3 5 HOH H .   ? HOH A 419 . ? 1_555 ? 
17 AC4 5 HIS B 27  ? HIS C 26  . ? 1_555 ? 
18 AC4 5 HIS B 75  ? HIS C 74  . ? 1_555 ? 
19 AC4 5 ASP B 159 ? ASP C 158 . ? 1_555 ? 
20 AC4 5 HIS B 163 ? HIS C 162 . ? 1_555 ? 
21 AC4 5 HOH I .   ? HOH C 220 . ? 1_555 ? 
22 AC5 7 HIS B 3   ? HIS C 2   . ? 1_555 ? 
23 AC5 7 SER B 4   ? SER C 3   . ? 1_555 ? 
24 AC5 7 HIS B 72  ? HIS C 71  . ? 1_555 ? 
25 AC5 7 HOH I .   ? HOH C 262 . ? 1_555 ? 
26 AC5 7 HOH I .   ? HOH C 318 . ? 1_555 ? 
27 AC5 7 HOH I .   ? HOH C 321 . ? 1_555 ? 
28 AC5 7 HOH I .   ? HOH C 334 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3DC6 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3DC6 
_atom_sites.fract_transf_matrix[1][1]   0.012349 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012349 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007276 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . LYS A 1 2   ? 29.783  -0.929  19.433  1.00 18.05 ? 1   LYS A N   1 
ATOM   2    C  CA  . LYS A 1 2   ? 28.850  0.176   19.044  1.00 16.55 ? 1   LYS A CA  1 
ATOM   3    C  C   . LYS A 1 2   ? 29.213  0.754   17.666  1.00 14.97 ? 1   LYS A C   1 
ATOM   4    O  O   . LYS A 1 2   ? 30.393  0.845   17.318  1.00 14.82 ? 1   LYS A O   1 
ATOM   5    C  CB  . LYS A 1 2   ? 28.900  1.277   20.105  1.00 18.11 ? 1   LYS A CB  1 
ATOM   6    C  CG  . LYS A 1 2   ? 27.766  2.298   20.057  1.00 20.58 ? 1   LYS A CG  1 
ATOM   7    C  CD  . LYS A 1 2   ? 26.454  1.809   20.701  1.00 23.89 ? 1   LYS A CD  1 
ATOM   8    C  CE  . LYS A 1 2   ? 25.722  0.762   19.857  1.00 26.54 ? 1   LYS A CE  1 
ATOM   9    N  NZ  . LYS A 1 2   ? 24.269  0.730   20.154  1.00 28.22 ? 1   LYS A NZ  1 
ATOM   10   N  N   . HIS A 1 3   ? 28.206  1.150   16.889  1.00 12.68 ? 2   HIS A N   1 
ATOM   11   C  CA  . HIS A 1 3   ? 28.460  1.760   15.576  1.00 11.39 ? 2   HIS A CA  1 
ATOM   12   C  C   . HIS A 1 3   ? 29.288  3.035   15.743  1.00 10.41 ? 2   HIS A C   1 
ATOM   13   O  O   . HIS A 1 3   ? 29.122  3.769   16.720  1.00 10.05 ? 2   HIS A O   1 
ATOM   14   C  CB  . HIS A 1 3   ? 27.139  2.018   14.850  1.00 10.79 ? 2   HIS A CB  1 
ATOM   15   C  CG  . HIS A 1 3   ? 26.274  0.796   14.758  1.00 10.56 ? 2   HIS A CG  1 
ATOM   16   N  ND1 . HIS A 1 3   ? 26.638  -0.319  14.032  1.00 9.37  ? 2   HIS A ND1 1 
ATOM   17   C  CD2 . HIS A 1 3   ? 25.092  0.493   15.349  1.00 10.37 ? 2   HIS A CD2 1 
ATOM   18   C  CE1 . HIS A 1 3   ? 25.699  -1.243  14.150  1.00 10.63 ? 2   HIS A CE1 1 
ATOM   19   N  NE2 . HIS A 1 3   ? 24.749  -0.776  14.943  1.00 9.43  ? 2   HIS A NE2 1 
ATOM   20   N  N   . SER A 1 4   ? 30.206  3.266   14.812  1.00 10.63 ? 3   SER A N   1 
ATOM   21   C  CA  . SER A 1 4   ? 31.108  4.403   14.905  1.00 10.10 ? 3   SER A CA  1 
ATOM   22   C  C   . SER A 1 4   ? 31.274  5.037   13.532  1.00 9.86  ? 3   SER A C   1 
ATOM   23   O  O   . SER A 1 4   ? 31.109  4.378   12.500  1.00 9.21  ? 3   SER A O   1 
ATOM   24   C  CB  . SER A 1 4   ? 32.478  3.973   15.438  1.00 10.83 ? 3   SER A CB  1 
ATOM   25   O  OG  . SER A 1 4   ? 33.071  3.073   14.521  1.00 13.09 ? 3   SER A OG  1 
ATOM   26   N  N   . LEU A 1 5   ? 31.628  6.314   13.537  1.00 8.86  ? 4   LEU A N   1 
ATOM   27   C  CA  . LEU A 1 5   ? 31.906  7.026   12.297  1.00 8.56  ? 4   LEU A CA  1 
ATOM   28   C  C   . LEU A 1 5   ? 33.262  6.564   11.753  1.00 8.36  ? 4   LEU A C   1 
ATOM   29   O  O   . LEU A 1 5   ? 34.287  6.755   12.419  1.00 8.16  ? 4   LEU A O   1 
ATOM   30   C  CB  . LEU A 1 5   ? 31.953  8.536   12.592  1.00 8.47  ? 4   LEU A CB  1 
ATOM   31   C  CG  . LEU A 1 5   ? 32.262  9.428   11.398  1.00 9.36  ? 4   LEU A CG  1 
ATOM   32   C  CD1 . LEU A 1 5   ? 31.082  9.466   10.441  1.00 10.05 ? 4   LEU A CD1 1 
ATOM   33   C  CD2 . LEU A 1 5   ? 32.599  10.821  11.870  1.00 10.41 ? 4   LEU A CD2 1 
ATOM   34   N  N   . PRO A 1 6   ? 33.291  5.968   10.543  1.00 8.78  ? 5   PRO A N   1 
ATOM   35   C  CA  . PRO A 1 6   ? 34.579  5.521   10.006  1.00 9.30  ? 5   PRO A CA  1 
ATOM   36   C  C   . PRO A 1 6   ? 35.440  6.698   9.577   1.00 9.69  ? 5   PRO A C   1 
ATOM   37   O  O   . PRO A 1 6   ? 34.902  7.686   9.084   1.00 10.20 ? 5   PRO A O   1 
ATOM   38   C  CB  . PRO A 1 6   ? 34.175  4.698   8.773   1.00 9.09  ? 5   PRO A CB  1 
ATOM   39   C  CG  . PRO A 1 6   ? 32.868  5.294   8.328   1.00 9.51  ? 5   PRO A CG  1 
ATOM   40   C  CD  . PRO A 1 6   ? 32.173  5.704   9.612   1.00 8.77  ? 5   PRO A CD  1 
ATOM   41   N  N   . ASP A 1 7   ? 36.740  6.551   9.683   1.00 9.91  ? 6   ASP A N   1 
ATOM   42   C  CA  . ASP A 1 7   ? 37.631  7.580   9.125   1.00 10.36 ? 6   ASP A CA  1 
ATOM   43   C  C   . ASP A 1 7   ? 37.525  7.464   7.615   1.00 10.30 ? 6   ASP A C   1 
ATOM   44   O  O   . ASP A 1 7   ? 37.303  6.377   7.071   1.00 9.59  ? 6   ASP A O   1 
ATOM   45   C  CB  . ASP A 1 7   ? 39.090  7.365   9.526   1.00 11.12 ? 6   ASP A CB  1 
ATOM   46   C  CG  . ASP A 1 7   ? 39.341  7.593   11.003  1.00 12.71 ? 6   ASP A CG  1 
ATOM   47   O  OD1 . ASP A 1 7   ? 40.383  7.105   11.474  1.00 15.31 ? 6   ASP A OD1 1 
ATOM   48   O  OD2 . ASP A 1 7   ? 38.520  8.258   11.680  1.00 14.36 ? 6   ASP A OD2 1 
ATOM   49   N  N   . LEU A 1 8   ? 37.681  8.601   6.934   1.00 10.42 ? 7   LEU A N   1 
ATOM   50   C  CA  . LEU A 1 8   ? 37.727  8.597   5.480   1.00 10.42 ? 7   LEU A CA  1 
ATOM   51   C  C   . LEU A 1 8   ? 39.042  7.966   5.046   1.00 10.53 ? 7   LEU A C   1 
ATOM   52   O  O   . LEU A 1 8   ? 40.027  7.994   5.794   1.00 9.94  ? 7   LEU A O   1 
ATOM   53   C  CB  . LEU A 1 8   ? 37.626  10.026  4.926   1.00 10.39 ? 7   LEU A CB  1 
ATOM   54   C  CG  . LEU A 1 8   ? 36.353  10.829  5.202   1.00 9.67  ? 7   LEU A CG  1 
ATOM   55   C  CD1 . LEU A 1 8   ? 36.458  12.178  4.506   1.00 10.93 ? 7   LEU A CD1 1 
ATOM   56   C  CD2 . LEU A 1 8   ? 35.136  10.085  4.694   1.00 11.24 ? 7   LEU A CD2 1 
ATOM   57   N  N   . PRO A 1 9   ? 39.066  7.378   3.836   1.00 10.89 ? 8   PRO A N   1 
ATOM   58   C  CA  . PRO A 1 9   ? 40.330  6.839   3.310   1.00 11.05 ? 8   PRO A CA  1 
ATOM   59   C  C   . PRO A 1 9   ? 41.287  7.896   2.739   1.00 11.34 ? 8   PRO A C   1 
ATOM   60   O  O   . PRO A 1 9   ? 42.353  7.539   2.224   1.00 12.37 ? 8   PRO A O   1 
ATOM   61   C  CB  . PRO A 1 9   ? 39.878  5.905   2.181   1.00 10.94 ? 8   PRO A CB  1 
ATOM   62   C  CG  . PRO A 1 9   ? 38.407  5.956   2.132   1.00 11.26 ? 8   PRO A CG  1 
ATOM   63   C  CD  . PRO A 1 9   ? 37.946  7.155   2.912   1.00 10.74 ? 8   PRO A CD  1 
ATOM   64   N  N   . TYR A 1 10  ? 40.903  9.169   2.805   1.00 10.53 ? 9   TYR A N   1 
ATOM   65   C  CA  . TYR A 1 10  ? 41.680  10.278  2.225   1.00 10.24 ? 9   TYR A CA  1 
ATOM   66   C  C   . TYR A 1 10  ? 41.435  11.509  3.078   1.00 10.20 ? 9   TYR A C   1 
ATOM   67   O  O   . TYR A 1 10  ? 40.551  11.496  3.962   1.00 10.42 ? 9   TYR A O   1 
ATOM   68   C  CB  . TYR A 1 10  ? 41.257  10.532  0.759   1.00 9.55  ? 9   TYR A CB  1 
ATOM   69   C  CG  . TYR A 1 10  ? 39.780  10.248  0.565   1.00 9.68  ? 9   TYR A CG  1 
ATOM   70   C  CD1 . TYR A 1 10  ? 39.352  9.076   -0.058  1.00 10.62 ? 9   TYR A CD1 1 
ATOM   71   C  CD2 . TYR A 1 10  ? 38.818  11.104  1.093   1.00 9.55  ? 9   TYR A CD2 1 
ATOM   72   C  CE1 . TYR A 1 10  ? 37.988  8.793   -0.208  1.00 9.28  ? 9   TYR A CE1 1 
ATOM   73   C  CE2 . TYR A 1 10  ? 37.443  10.819  0.979   1.00 8.52  ? 9   TYR A CE2 1 
ATOM   74   C  CZ  . TYR A 1 10  ? 37.042  9.671   0.320   1.00 9.70  ? 9   TYR A CZ  1 
ATOM   75   O  OH  . TYR A 1 10  ? 35.695  9.387   0.228   1.00 8.63  ? 9   TYR A OH  1 
ATOM   76   N  N   . ASP A 1 11  ? 42.218  12.560  2.827   1.00 10.29 ? 10  ASP A N   1 
ATOM   77   C  CA  . ASP A 1 11  ? 42.014  13.857  3.471   1.00 10.54 ? 10  ASP A CA  1 
ATOM   78   C  C   . ASP A 1 11  ? 40.772  14.546  2.886   1.00 9.55  ? 10  ASP A C   1 
ATOM   79   O  O   . ASP A 1 11  ? 40.331  14.217  1.782   1.00 9.01  ? 10  ASP A O   1 
ATOM   80   C  CB  . ASP A 1 11  ? 43.257  14.738  3.293   1.00 10.40 ? 10  ASP A CB  1 
ATOM   81   C  CG  . ASP A 1 11  ? 44.448  14.242  4.096   1.00 13.63 ? 10  ASP A CG  1 
ATOM   82   O  OD1 . ASP A 1 11  ? 44.249  13.579  5.138   1.00 14.09 ? 10  ASP A OD1 1 
ATOM   83   O  OD2 . ASP A 1 11  ? 45.592  14.529  3.690   1.00 17.78 ? 10  ASP A OD2 1 
ATOM   84   N  N   . TYR A 1 12  ? 40.201  15.488  3.630   1.00 8.79  ? 11  TYR A N   1 
ATOM   85   C  CA  . TYR A 1 12  ? 38.940  16.108  3.227   1.00 8.40  ? 11  TYR A CA  1 
ATOM   86   C  C   . TYR A 1 12  ? 39.016  16.869  1.916   1.00 8.42  ? 11  TYR A C   1 
ATOM   87   O  O   . TYR A 1 12  ? 38.017  16.989  1.240   1.00 7.77  ? 11  TYR A O   1 
ATOM   88   C  CB  . TYR A 1 12  ? 38.409  17.037  4.323   1.00 9.32  ? 11  TYR A CB  1 
ATOM   89   C  CG  . TYR A 1 12  ? 37.893  16.294  5.546   1.00 8.69  ? 11  TYR A CG  1 
ATOM   90   C  CD1 . TYR A 1 12  ? 36.748  15.513  5.476   1.00 8.90  ? 11  TYR A CD1 1 
ATOM   91   C  CD2 . TYR A 1 12  ? 38.556  16.387  6.769   1.00 11.70 ? 11  TYR A CD2 1 
ATOM   92   C  CE1 . TYR A 1 12  ? 36.258  14.825  6.600   1.00 8.63  ? 11  TYR A CE1 1 
ATOM   93   C  CE2 . TYR A 1 12  ? 38.086  15.706  7.898   1.00 11.34 ? 11  TYR A CE2 1 
ATOM   94   C  CZ  . TYR A 1 12  ? 36.940  14.935  7.807   1.00 10.53 ? 11  TYR A CZ  1 
ATOM   95   O  OH  . TYR A 1 12  ? 36.478  14.264  8.917   1.00 10.49 ? 11  TYR A OH  1 
ATOM   96   N  N   . ALA A 1 13  ? 40.193  17.406  1.577   1.00 8.16  ? 12  ALA A N   1 
ATOM   97   C  CA  . ALA A 1 13  ? 40.344  18.153  0.330   1.00 8.38  ? 12  ALA A CA  1 
ATOM   98   C  C   . ALA A 1 13  ? 40.837  17.298  -0.847  1.00 8.14  ? 12  ALA A C   1 
ATOM   99   O  O   . ALA A 1 13  ? 41.053  17.829  -1.950  1.00 8.68  ? 12  ALA A O   1 
ATOM   100  C  CB  . ALA A 1 13  ? 41.261  19.346  0.545   1.00 8.56  ? 12  ALA A CB  1 
ATOM   101  N  N   . ASP A 1 14  ? 40.991  15.988  -0.632  1.00 8.16  ? 13  ASP A N   1 
ATOM   102  C  CA  . ASP A 1 14  ? 41.632  15.117  -1.640  1.00 8.01  ? 13  ASP A CA  1 
ATOM   103  C  C   . ASP A 1 14  ? 40.790  14.853  -2.883  1.00 7.69  ? 13  ASP A C   1 
ATOM   104  O  O   . ASP A 1 14  ? 41.316  14.366  -3.900  1.00 7.76  ? 13  ASP A O   1 
ATOM   105  C  CB  . ASP A 1 14  ? 42.075  13.774  -1.030  1.00 8.03  ? 13  ASP A CB  1 
ATOM   106  C  CG  . ASP A 1 14  ? 43.390  13.873  -0.265  1.00 9.48  ? 13  ASP A CG  1 
ATOM   107  O  OD1 . ASP A 1 14  ? 44.046  14.940  -0.297  1.00 9.87  ? 13  ASP A OD1 1 
ATOM   108  O  OD2 . ASP A 1 14  ? 43.760  12.866  0.382   1.00 10.17 ? 13  ASP A OD2 1 
ATOM   109  N  N   . LEU A 1 15  ? 39.502  15.172  -2.812  1.00 6.95  ? 14  LEU A N   1 
ATOM   110  C  CA  . LEU A 1 15  ? 38.605  14.958  -3.959  1.00 6.55  ? 14  LEU A CA  1 
ATOM   111  C  C   . LEU A 1 15  ? 38.315  16.236  -4.757  1.00 6.98  ? 14  LEU A C   1 
ATOM   112  O  O   . LEU A 1 15  ? 37.547  16.218  -5.725  1.00 6.51  ? 14  LEU A O   1 
ATOM   113  C  CB  . LEU A 1 15  ? 37.306  14.282  -3.503  1.00 7.00  ? 14  LEU A CB  1 
ATOM   114  C  CG  . LEU A 1 15  ? 37.505  12.970  -2.712  1.00 6.15  ? 14  LEU A CG  1 
ATOM   115  C  CD1 . LEU A 1 15  ? 36.153  12.378  -2.371  1.00 6.87  ? 14  LEU A CD1 1 
ATOM   116  C  CD2 . LEU A 1 15  ? 38.379  11.923  -3.433  1.00 8.49  ? 14  LEU A CD2 1 
ATOM   117  N  N   . GLU A 1 16  ? 38.946  17.341  -4.365  1.00 7.15  ? 15  GLU A N   1 
ATOM   118  C  CA  . GLU A 1 16  ? 38.823  18.585  -5.112  1.00 7.87  ? 15  GLU A CA  1 
ATOM   119  C  C   . GLU A 1 16  ? 39.475  18.393  -6.492  1.00 7.97  ? 15  GLU A C   1 
ATOM   120  O  O   . GLU A 1 16  ? 40.457  17.655  -6.615  1.00 8.11  ? 15  GLU A O   1 
ATOM   121  C  CB  . GLU A 1 16  ? 39.460  19.743  -4.333  1.00 7.80  ? 15  GLU A CB  1 
ATOM   122  C  CG  . GLU A 1 16  ? 38.740  20.047  -2.994  1.00 8.00  ? 15  GLU A CG  1 
ATOM   123  C  CD  . GLU A 1 16  ? 39.269  21.273  -2.277  1.00 9.38  ? 15  GLU A CD  1 
ATOM   124  O  OE1 . GLU A 1 16  ? 40.435  21.670  -2.510  1.00 8.81  ? 15  GLU A OE1 1 
ATOM   125  O  OE2 . GLU A 1 16  ? 38.506  21.845  -1.466  1.00 9.45  ? 15  GLU A OE2 1 
ATOM   126  N  N   . PRO A 1 17  ? 38.944  19.054  -7.530  1.00 8.23  ? 16  PRO A N   1 
ATOM   127  C  CA  . PRO A 1 17  ? 37.851  20.020  -7.498  1.00 8.16  ? 16  PRO A CA  1 
ATOM   128  C  C   . PRO A 1 17  ? 36.467  19.413  -7.743  1.00 7.49  ? 16  PRO A C   1 
ATOM   129  O  O   . PRO A 1 17  ? 35.540  20.154  -8.061  1.00 7.75  ? 16  PRO A O   1 
ATOM   130  C  CB  . PRO A 1 17  ? 38.212  20.955  -8.656  1.00 8.42  ? 16  PRO A CB  1 
ATOM   131  C  CG  . PRO A 1 17  ? 38.785  19.992  -9.692  1.00 8.70  ? 16  PRO A CG  1 
ATOM   132  C  CD  . PRO A 1 17  ? 39.491  18.897  -8.895  1.00 8.93  ? 16  PRO A CD  1 
ATOM   133  N  N   . VAL A 1 18  ? 36.331  18.090  -7.624  1.00 7.04  ? 17  VAL A N   1 
ATOM   134  C  CA  . VAL A 1 18  ? 35.026  17.441  -7.876  1.00 6.75  ? 17  VAL A CA  1 
ATOM   135  C  C   . VAL A 1 18  ? 34.089  17.616  -6.676  1.00 6.81  ? 17  VAL A C   1 
ATOM   136  O  O   . VAL A 1 18  ? 32.899  17.895  -6.846  1.00 6.43  ? 17  VAL A O   1 
ATOM   137  C  CB  . VAL A 1 18  ? 35.167  15.955  -8.289  1.00 7.23  ? 17  VAL A CB  1 
ATOM   138  C  CG1 . VAL A 1 18  ? 33.770  15.305  -8.454  1.00 7.62  ? 17  VAL A CG1 1 
ATOM   139  C  CG2 . VAL A 1 18  ? 35.951  15.869  -9.598  1.00 7.36  ? 17  VAL A CG2 1 
ATOM   140  N  N   . ILE A 1 19  ? 34.629  17.436  -5.472  1.00 6.87  ? 18  ILE A N   1 
ATOM   141  C  CA  . ILE A 1 19  ? 33.852  17.682  -4.249  1.00 6.80  ? 18  ILE A CA  1 
ATOM   142  C  C   . ILE A 1 19  ? 34.760  18.458  -3.316  1.00 6.51  ? 18  ILE A C   1 
ATOM   143  O  O   . ILE A 1 19  ? 35.888  18.037  -3.054  1.00 7.33  ? 18  ILE A O   1 
ATOM   144  C  CB  . ILE A 1 19  ? 33.354  16.379  -3.545  1.00 6.09  ? 18  ILE A CB  1 
ATOM   145  C  CG1 . ILE A 1 19  ? 32.623  15.426  -4.520  1.00 7.22  ? 18  ILE A CG1 1 
ATOM   146  C  CG2 . ILE A 1 19  ? 32.434  16.750  -2.362  1.00 6.26  ? 18  ILE A CG2 1 
ATOM   147  C  CD1 . ILE A 1 19  ? 32.320  14.021  -3.893  1.00 6.68  ? 18  ILE A CD1 1 
ATOM   148  N  N   . SER A 1 20  ? 34.261  19.587  -2.816  1.00 7.58  ? 19  SER A N   1 
ATOM   149  C  CA  . SER A 1 20  ? 35.061  20.510  -2.013  1.00 7.28  ? 19  SER A CA  1 
ATOM   150  C  C   . SER A 1 20  ? 35.378  19.976  -0.619  1.00 7.67  ? 19  SER A C   1 
ATOM   151  O  O   . SER A 1 20  ? 34.659  19.121  -0.070  1.00 7.33  ? 19  SER A O   1 
ATOM   152  C  CB  . SER A 1 20  ? 34.347  21.857  -1.878  1.00 8.25  ? 19  SER A CB  1 
ATOM   153  O  OG  . SER A 1 20  ? 33.157  21.730  -1.097  1.00 7.09  ? 19  SER A OG  1 
ATOM   154  N  N   . HIS A 1 21  ? 36.448  20.517  -0.045  1.00 7.15  ? 20  HIS A N   1 
ATOM   155  C  CA  . HIS A 1 21  ? 36.793  20.280  1.344   1.00 7.00  ? 20  HIS A CA  1 
ATOM   156  C  C   . HIS A 1 21  ? 35.592  20.500  2.282   1.00 6.71  ? 20  HIS A C   1 
ATOM   157  O  O   . HIS A 1 21  ? 35.304  19.649  3.127   1.00 5.74  ? 20  HIS A O   1 
ATOM   158  C  CB  . HIS A 1 21  ? 37.948  21.201  1.743   1.00 7.77  ? 20  HIS A CB  1 
ATOM   159  C  CG  . HIS A 1 21  ? 38.339  21.076  3.187   1.00 9.62  ? 20  HIS A CG  1 
ATOM   160  N  ND1 . HIS A 1 21  ? 37.669  21.730  4.199   1.00 12.21 ? 20  HIS A ND1 1 
ATOM   161  C  CD2 . HIS A 1 21  ? 39.326  20.368  3.785   1.00 11.53 ? 20  HIS A CD2 1 
ATOM   162  C  CE1 . HIS A 1 21  ? 38.233  21.438  5.357   1.00 10.65 ? 20  HIS A CE1 1 
ATOM   163  N  NE2 . HIS A 1 21  ? 39.237  20.609  5.135   1.00 11.09 ? 20  HIS A NE2 1 
ATOM   164  N  N   . GLU A 1 22  ? 34.901  21.639  2.127   1.00 6.28  ? 21  GLU A N   1 
ATOM   165  C  CA  . GLU A 1 22  ? 33.791  21.940  3.040   1.00 6.89  ? 21  GLU A CA  1 
ATOM   166  C  C   . GLU A 1 22  ? 32.700  20.895  2.950   1.00 6.00  ? 21  GLU A C   1 
ATOM   167  O  O   . GLU A 1 22  ? 32.178  20.467  3.968   1.00 6.23  ? 21  GLU A O   1 
ATOM   168  C  CB  . GLU A 1 22  ? 33.190  23.341  2.823   1.00 7.28  ? 21  GLU A CB  1 
ATOM   169  C  CG  . GLU A 1 22  ? 32.198  23.607  3.950   1.00 8.22  ? 21  GLU A CG  1 
ATOM   170  C  CD  . GLU A 1 22  ? 31.562  24.972  3.969   1.00 11.81 ? 21  GLU A CD  1 
ATOM   171  O  OE1 . GLU A 1 22  ? 31.602  25.677  2.947   1.00 10.66 ? 21  GLU A OE1 1 
ATOM   172  O  OE2 . GLU A 1 22  ? 30.997  25.316  5.036   1.00 12.29 ? 21  GLU A OE2 1 
ATOM   173  N  N   . ILE A 1 23  ? 32.347  20.491  1.734   1.00 6.25  ? 22  ILE A N   1 
ATOM   174  C  CA  . ILE A 1 23  ? 31.332  19.447  1.560   1.00 6.28  ? 22  ILE A CA  1 
ATOM   175  C  C   . ILE A 1 23  ? 31.801  18.161  2.256   1.00 6.00  ? 22  ILE A C   1 
ATOM   176  O  O   . ILE A 1 23  ? 31.057  17.574  3.043   1.00 5.85  ? 22  ILE A O   1 
ATOM   177  C  CB  . ILE A 1 23  ? 30.997  19.164  0.087   1.00 6.82  ? 22  ILE A CB  1 
ATOM   178  C  CG1 . ILE A 1 23  ? 30.218  20.353  -0.532  1.00 6.35  ? 22  ILE A CG1 1 
ATOM   179  C  CG2 . ILE A 1 23  ? 30.142  17.873  0.011   1.00 8.64  ? 22  ILE A CG2 1 
ATOM   180  C  CD1 . ILE A 1 23  ? 29.973  20.233  -2.068  1.00 7.72  ? 22  ILE A CD1 1 
ATOM   181  N  N   . MET A 1 24  ? 33.026  17.724  1.965   1.00 5.97  ? 23  MET A N   1 
ATOM   182  C  CA  . MET A 1 24  ? 33.507  16.470  2.556   1.00 5.90  ? 23  MET A CA  1 
ATOM   183  C  C   . MET A 1 24  ? 33.476  16.534  4.079   1.00 6.29  ? 23  MET A C   1 
ATOM   184  O  O   . MET A 1 24  ? 33.048  15.585  4.737   1.00 6.89  ? 23  MET A O   1 
ATOM   185  C  CB  . MET A 1 24  ? 34.898  16.100  2.055   1.00 5.47  ? 23  MET A CB  1 
ATOM   186  C  CG  . MET A 1 24  ? 34.946  15.817  0.541   1.00 5.33  ? 23  MET A CG  1 
ATOM   187  S  SD  . MET A 1 24  ? 33.837  14.503  -0.006  1.00 7.81  ? 23  MET A SD  1 
ATOM   188  C  CE  . MET A 1 24  ? 34.402  13.130  0.989   1.00 8.04  ? 23  MET A CE  1 
ATOM   189  N  N   . GLN A 1 25  ? 33.912  17.665  4.623   1.00 5.97  ? 24  GLN A N   1 
ATOM   190  C  CA  . GLN A 1 25  ? 34.005  17.833  6.071   1.00 6.69  ? 24  GLN A CA  1 
ATOM   191  C  C   . GLN A 1 25  ? 32.627  17.795  6.721   1.00 6.20  ? 24  GLN A C   1 
ATOM   192  O  O   . GLN A 1 25  ? 32.422  17.071  7.692   1.00 6.67  ? 24  GLN A O   1 
ATOM   193  C  CB  . GLN A 1 25  ? 34.708  19.150  6.392   1.00 5.90  ? 24  GLN A CB  1 
ATOM   194  C  CG  . GLN A 1 25  ? 35.115  19.308  7.856   1.00 8.82  ? 24  GLN A CG  1 
ATOM   195  C  CD  . GLN A 1 25  ? 35.847  20.612  8.079   1.00 10.96 ? 24  GLN A CD  1 
ATOM   196  O  OE1 . GLN A 1 25  ? 35.327  21.673  7.744   1.00 12.40 ? 24  GLN A OE1 1 
ATOM   197  N  NE2 . GLN A 1 25  ? 37.068  20.543  8.623   1.00 13.10 ? 24  GLN A NE2 1 
ATOM   198  N  N   . LEU A 1 26  ? 31.682  18.565  6.178   1.00 6.48  ? 25  LEU A N   1 
ATOM   199  C  CA  . LEU A 1 26  ? 30.308  18.561  6.692   1.00 5.87  ? 25  LEU A CA  1 
ATOM   200  C  C   . LEU A 1 26  ? 29.653  17.209  6.503   1.00 6.14  ? 25  LEU A C   1 
ATOM   201  O  O   . LEU A 1 26  ? 28.995  16.688  7.402   1.00 6.29  ? 25  LEU A O   1 
ATOM   202  C  CB  . LEU A 1 26  ? 29.462  19.619  5.963   1.00 6.27  ? 25  LEU A CB  1 
ATOM   203  C  CG  . LEU A 1 26  ? 29.767  21.064  6.344   1.00 6.06  ? 25  LEU A CG  1 
ATOM   204  C  CD1 . LEU A 1 26  ? 29.123  21.976  5.298   1.00 6.09  ? 25  LEU A CD1 1 
ATOM   205  C  CD2 . LEU A 1 26  ? 29.288  21.407  7.768   1.00 7.62  ? 25  LEU A CD2 1 
ATOM   206  N  N   . HIS A 1 27  ? 29.820  16.652  5.310   1.00 6.12  ? 26  HIS A N   1 
ATOM   207  C  CA  . HIS A 1 27  ? 29.152  15.422  4.953   1.00 7.15  ? 26  HIS A CA  1 
ATOM   208  C  C   . HIS A 1 27  ? 29.580  14.294  5.890   1.00 7.57  ? 26  HIS A C   1 
ATOM   209  O  O   . HIS A 1 27  ? 28.749  13.496  6.328   1.00 8.23  ? 26  HIS A O   1 
ATOM   210  C  CB  . HIS A 1 27  ? 29.451  15.095  3.494   1.00 6.96  ? 26  HIS A CB  1 
ATOM   211  C  CG  . HIS A 1 27  ? 28.425  14.228  2.843   1.00 7.66  ? 26  HIS A CG  1 
ATOM   212  N  ND1 . HIS A 1 27  ? 28.575  13.773  1.549   1.00 6.91  ? 26  HIS A ND1 1 
ATOM   213  C  CD2 . HIS A 1 27  ? 27.234  13.753  3.282   1.00 5.79  ? 26  HIS A CD2 1 
ATOM   214  C  CE1 . HIS A 1 27  ? 27.520  13.045  1.220   1.00 5.58  ? 26  HIS A CE1 1 
ATOM   215  N  NE2 . HIS A 1 27  ? 26.694  13.010  2.257   1.00 6.55  ? 26  HIS A NE2 1 
ATOM   216  N  N   . HIS A 1 28  ? 30.860  14.283  6.250   1.00 7.51  ? 27  HIS A N   1 
ATOM   217  C  CA  . HIS A 1 28  ? 31.420  13.276  7.137   1.00 7.42  ? 27  HIS A CA  1 
ATOM   218  C  C   . HIS A 1 28  ? 31.167  13.599  8.621   1.00 7.83  ? 27  HIS A C   1 
ATOM   219  O  O   . HIS A 1 28  ? 30.520  12.809  9.319   1.00 7.14  ? 27  HIS A O   1 
ATOM   220  C  CB  . HIS A 1 28  ? 32.921  13.125  6.847   1.00 8.22  ? 27  HIS A CB  1 
ATOM   221  C  CG  . HIS A 1 28  ? 33.607  12.082  7.681   1.00 8.96  ? 27  HIS A CG  1 
ATOM   222  N  ND1 . HIS A 1 28  ? 34.608  12.389  8.573   1.00 8.92  ? 27  HIS A ND1 1 
ATOM   223  C  CD2 . HIS A 1 28  ? 33.447  10.737  7.738   1.00 8.68  ? 27  HIS A CD2 1 
ATOM   224  C  CE1 . HIS A 1 28  ? 35.042  11.279  9.147   1.00 9.57  ? 27  HIS A CE1 1 
ATOM   225  N  NE2 . HIS A 1 28  ? 34.348  10.262  8.662   1.00 8.53  ? 27  HIS A NE2 1 
ATOM   226  N  N   . GLN A 1 29  ? 31.651  14.756  9.085   1.00 6.75  ? 28  GLN A N   1 
ATOM   227  C  CA  . GLN A 1 29  ? 31.662  15.108  10.506  1.00 7.87  ? 28  GLN A CA  1 
ATOM   228  C  C   . GLN A 1 29  ? 30.265  15.497  11.053  1.00 7.65  ? 28  GLN A C   1 
ATOM   229  O  O   . GLN A 1 29  ? 30.031  15.354  12.257  1.00 8.14  ? 28  GLN A O   1 
ATOM   230  C  CB  . GLN A 1 29  ? 32.647  16.215  10.800  1.00 8.11  ? 28  GLN A CB  1 
ATOM   231  C  CG  . GLN A 1 29  ? 34.053  15.805  10.427  1.00 10.39 ? 28  GLN A CG  1 
ATOM   232  C  CD  . GLN A 1 29  ? 35.105  16.803  10.836  1.00 13.93 ? 28  GLN A CD  1 
ATOM   233  O  OE1 . GLN A 1 29  ? 36.304  16.562  10.639  1.00 18.26 ? 28  GLN A OE1 1 
ATOM   234  N  NE2 . GLN A 1 29  ? 34.681  17.928  11.399  1.00 15.14 ? 28  GLN A NE2 1 
ATOM   235  N  N   . LYS A 1 30  ? 29.386  16.005  10.185  1.00 7.74  ? 29  LYS A N   1 
ATOM   236  C  CA  . LYS A 1 30  ? 28.066  16.349  10.612  1.00 7.64  ? 29  LYS A CA  1 
ATOM   237  C  C   . LYS A 1 30  ? 26.949  15.385  10.173  1.00 7.69  ? 29  LYS A C   1 
ATOM   238  O  O   . LYS A 1 30  ? 26.222  14.843  11.012  1.00 8.28  ? 29  LYS A O   1 
ATOM   239  C  CB  . LYS A 1 30  ? 27.694  17.779  10.149  1.00 7.19  ? 29  LYS A CB  1 
ATOM   240  C  CG  . LYS A 1 30  ? 28.583  18.876  10.817  1.00 6.86  ? 29  LYS A CG  1 
ATOM   241  C  CD  . LYS A 1 30  ? 28.433  18.854  12.358  1.00 7.29  ? 29  LYS A CD  1 
ATOM   242  C  CE  . LYS A 1 30  ? 29.084  20.086  12.975  1.00 7.94  ? 29  LYS A CE  1 
ATOM   243  N  NZ  . LYS A 1 30  ? 28.832  20.157  14.475  1.00 8.92  ? 29  LYS A NZ  1 
ATOM   244  N  N   . HIS A 1 31  ? 26.825  15.156  8.866   1.00 7.38  ? 30  HIS A N   1 
ATOM   245  C  CA  . HIS A 1 31  ? 25.708  14.341  8.378   1.00 7.73  ? 30  HIS A CA  1 
ATOM   246  C  C   . HIS A 1 31  ? 25.891  12.876  8.757   1.00 7.71  ? 30  HIS A C   1 
ATOM   247  O  O   . HIS A 1 31  ? 25.034  12.283  9.432   1.00 7.61  ? 30  HIS A O   1 
ATOM   248  C  CB  . HIS A 1 31  ? 25.515  14.497  6.870   1.00 7.13  ? 30  HIS A CB  1 
ATOM   249  C  CG  . HIS A 1 31  ? 25.081  15.875  6.471   1.00 8.13  ? 30  HIS A CG  1 
ATOM   250  N  ND1 . HIS A 1 31  ? 23.753  16.236  6.356   1.00 9.16  ? 30  HIS A ND1 1 
ATOM   251  C  CD2 . HIS A 1 31  ? 25.799  16.991  6.200   1.00 7.58  ? 30  HIS A CD2 1 
ATOM   252  C  CE1 . HIS A 1 31  ? 23.676  17.510  6.002   1.00 8.53  ? 30  HIS A CE1 1 
ATOM   253  N  NE2 . HIS A 1 31  ? 24.904  17.987  5.889   1.00 8.71  ? 30  HIS A NE2 1 
ATOM   254  N  N   . HIS A 1 32  ? 27.015  12.289  8.360   1.00 7.67  ? 31  HIS A N   1 
ATOM   255  C  CA  . HIS A 1 32  ? 27.222  10.881  8.691   1.00 7.65  ? 31  HIS A CA  1 
ATOM   256  C  C   . HIS A 1 32  ? 27.283  10.676  10.212  1.00 8.32  ? 31  HIS A C   1 
ATOM   257  O  O   . HIS A 1 32  ? 26.625  9.777   10.745  1.00 8.13  ? 31  HIS A O   1 
ATOM   258  C  CB  . HIS A 1 32  ? 28.465  10.336  7.983   1.00 7.90  ? 31  HIS A CB  1 
ATOM   259  C  CG  . HIS A 1 32  ? 28.605  8.846   8.093   1.00 8.63  ? 31  HIS A CG  1 
ATOM   260  N  ND1 . HIS A 1 32  ? 29.624  8.151   7.486   1.00 8.43  ? 31  HIS A ND1 1 
ATOM   261  C  CD2 . HIS A 1 32  ? 27.846  7.922   8.732   1.00 7.64  ? 31  HIS A CD2 1 
ATOM   262  C  CE1 . HIS A 1 32  ? 29.501  6.864   7.760   1.00 9.24  ? 31  HIS A CE1 1 
ATOM   263  N  NE2 . HIS A 1 32  ? 28.437  6.700   8.526   1.00 7.00  ? 31  HIS A NE2 1 
ATOM   264  N  N   . ALA A 1 33  ? 28.014  11.541  10.912  1.00 7.55  ? 32  ALA A N   1 
ATOM   265  C  CA  . ALA A 1 33  ? 28.109  11.458  12.381  1.00 8.15  ? 32  ALA A CA  1 
ATOM   266  C  C   . ALA A 1 33  ? 26.725  11.466  13.026  1.00 8.01  ? 32  ALA A C   1 
ATOM   267  O  O   . ALA A 1 33  ? 26.466  10.708  13.952  1.00 8.78  ? 32  ALA A O   1 
ATOM   268  C  CB  . ALA A 1 33  ? 28.948  12.606  12.933  1.00 7.82  ? 32  ALA A CB  1 
ATOM   269  N  N   . THR A 1 34  ? 25.837  12.311  12.523  1.00 7.98  ? 33  THR A N   1 
ATOM   270  C  CA  . THR A 1 34  ? 24.471  12.381  13.061  1.00 8.45  ? 33  THR A CA  1 
ATOM   271  C  C   . THR A 1 34  ? 23.715  11.068  12.866  1.00 8.39  ? 33  THR A C   1 
ATOM   272  O  O   . THR A 1 34  ? 23.049  10.591  13.791  1.00 8.43  ? 33  THR A O   1 
ATOM   273  C  CB  . THR A 1 34  ? 23.703  13.596  12.488  1.00 8.90  ? 33  THR A CB  1 
ATOM   274  O  OG1 . THR A 1 34  ? 24.296  14.789  13.022  1.00 9.29  ? 33  THR A OG1 1 
ATOM   275  C  CG2 . THR A 1 34  ? 22.221  13.558  12.855  1.00 9.83  ? 33  THR A CG2 1 
ATOM   276  N  N   . TYR A 1 35  ? 23.796  10.496  11.668  1.00 8.23  ? 34  TYR A N   1 
ATOM   277  C  CA  . TYR A 1 35  ? 23.175  9.189   11.426  1.00 7.81  ? 34  TYR A CA  1 
ATOM   278  C  C   . TYR A 1 35  ? 23.717  8.144   12.413  1.00 8.12  ? 34  TYR A C   1 
ATOM   279  O  O   . TYR A 1 35  ? 22.944  7.392   12.986  1.00 7.10  ? 34  TYR A O   1 
ATOM   280  C  CB  . TYR A 1 35  ? 23.377  8.729   9.982   1.00 8.55  ? 34  TYR A CB  1 
ATOM   281  C  CG  . TYR A 1 35  ? 22.665  9.589   8.950   1.00 8.27  ? 34  TYR A CG  1 
ATOM   282  C  CD1 . TYR A 1 35  ? 21.315  9.932   9.093   1.00 8.82  ? 34  TYR A CD1 1 
ATOM   283  C  CD2 . TYR A 1 35  ? 23.337  10.037  7.829   1.00 9.72  ? 34  TYR A CD2 1 
ATOM   284  C  CE1 . TYR A 1 35  ? 20.657  10.717  8.129   1.00 9.86  ? 34  TYR A CE1 1 
ATOM   285  C  CE2 . TYR A 1 35  ? 22.704  10.835  6.877   1.00 9.17  ? 34  TYR A CE2 1 
ATOM   286  C  CZ  . TYR A 1 35  ? 21.379  11.159  7.025   1.00 10.45 ? 34  TYR A CZ  1 
ATOM   287  O  OH  . TYR A 1 35  ? 20.784  11.947  6.065   1.00 9.88  ? 34  TYR A OH  1 
ATOM   288  N  N   . VAL A 1 36  ? 25.032  8.102   12.597  1.00 7.85  ? 35  VAL A N   1 
ATOM   289  C  CA  . VAL A 1 36  ? 25.655  7.125   13.520  1.00 8.78  ? 35  VAL A CA  1 
ATOM   290  C  C   . VAL A 1 36  ? 25.167  7.318   14.949  1.00 8.77  ? 35  VAL A C   1 
ATOM   291  O  O   . VAL A 1 36  ? 24.796  6.348   15.640  1.00 8.18  ? 35  VAL A O   1 
ATOM   292  C  CB  . VAL A 1 36  ? 27.208  7.236   13.497  1.00 9.07  ? 35  VAL A CB  1 
ATOM   293  C  CG1 . VAL A 1 36  ? 27.864  6.390   14.626  1.00 10.67 ? 35  VAL A CG1 1 
ATOM   294  C  CG2 . VAL A 1 36  ? 27.716  6.787   12.164  1.00 10.19 ? 35  VAL A CG2 1 
ATOM   295  N  N   . ASN A 1 37  ? 25.177  8.569   15.401  1.00 9.20  ? 36  ASN A N   1 
ATOM   296  C  CA  . ASN A 1 37  ? 24.771  8.864   16.775  1.00 9.41  ? 36  ASN A CA  1 
ATOM   297  C  C   . ASN A 1 37  ? 23.324  8.463   16.982  1.00 9.52  ? 36  ASN A C   1 
ATOM   298  O  O   . ASN A 1 37  ? 23.002  7.783   17.956  1.00 9.08  ? 36  ASN A O   1 
ATOM   299  C  CB  . ASN A 1 37  ? 24.970  10.338  17.101  1.00 9.51  ? 36  ASN A CB  1 
ATOM   300  C  CG  . ASN A 1 37  ? 26.434  10.751  17.050  1.00 12.14 ? 36  ASN A CG  1 
ATOM   301  O  OD1 . ASN A 1 37  ? 27.346  9.923   17.152  1.00 14.01 ? 36  ASN A OD1 1 
ATOM   302  N  ND2 . ASN A 1 37  ? 26.662  12.041  16.896  1.00 13.76 ? 36  ASN A ND2 1 
ATOM   303  N  N   . ASN A 1 38  ? 22.466  8.840   16.034  1.00 9.62  ? 37  ASN A N   1 
ATOM   304  C  CA  . ASN A 1 38  ? 21.050  8.499   16.135  1.00 9.88  ? 37  ASN A CA  1 
ATOM   305  C  C   . ASN A 1 38  ? 20.841  7.006   16.015  1.00 9.44  ? 37  ASN A C   1 
ATOM   306  O  O   . ASN A 1 38  ? 20.057  6.436   16.769  1.00 9.85  ? 37  ASN A O   1 
ATOM   307  C  CB  . ASN A 1 38  ? 20.198  9.220   15.093  1.00 9.83  ? 37  ASN A CB  1 
ATOM   308  C  CG  . ASN A 1 38  ? 20.132  10.730  15.309  1.00 12.37 ? 37  ASN A CG  1 
ATOM   309  O  OD1 . ASN A 1 38  ? 19.826  11.480  14.375  1.00 15.55 ? 37  ASN A OD1 1 
ATOM   310  N  ND2 . ASN A 1 38  ? 20.385  11.178  16.527  1.00 10.40 ? 37  ASN A ND2 1 
ATOM   311  N  N   . LEU A 1 39  ? 21.552  6.373   15.084  1.00 9.38  ? 38  LEU A N   1 
ATOM   312  C  CA  . LEU A 1 39  ? 21.497  4.911   14.967  1.00 9.39  ? 38  LEU A CA  1 
ATOM   313  C  C   . LEU A 1 39  ? 21.772  4.195   16.296  1.00 9.61  ? 38  LEU A C   1 
ATOM   314  O  O   . LEU A 1 39  ? 21.065  3.249   16.656  1.00 9.58  ? 38  LEU A O   1 
ATOM   315  C  CB  . LEU A 1 39  ? 22.488  4.410   13.920  1.00 9.07  ? 38  LEU A CB  1 
ATOM   316  C  CG  . LEU A 1 39  ? 22.696  2.885   13.837  1.00 9.80  ? 38  LEU A CG  1 
ATOM   317  C  CD1 . LEU A 1 39  ? 21.388  2.129   13.548  1.00 9.97  ? 38  LEU A CD1 1 
ATOM   318  C  CD2 . LEU A 1 39  ? 23.760  2.539   12.799  1.00 9.61  ? 38  LEU A CD2 1 
ATOM   319  N  N   . ASN A 1 40  ? 22.811  4.616   17.008  1.00 9.29  ? 39  ASN A N   1 
ATOM   320  C  CA  . ASN A 1 40  ? 23.130  3.969   18.276  1.00 9.57  ? 39  ASN A CA  1 
ATOM   321  C  C   . ASN A 1 40  ? 21.987  4.094   19.285  1.00 9.81  ? 39  ASN A C   1 
ATOM   322  O  O   . ASN A 1 40  ? 21.643  3.121   19.972  1.00 9.63  ? 39  ASN A O   1 
ATOM   323  C  CB  . ASN A 1 40  ? 24.443  4.492   18.857  1.00 10.08 ? 39  ASN A CB  1 
ATOM   324  C  CG  . ASN A 1 40  ? 25.645  3.923   18.146  1.00 11.16 ? 39  ASN A CG  1 
ATOM   325  O  OD1 . ASN A 1 40  ? 25.650  2.748   17.739  1.00 11.80 ? 39  ASN A OD1 1 
ATOM   326  N  ND2 . ASN A 1 40  ? 26.683  4.743   17.998  1.00 11.57 ? 39  ASN A ND2 1 
ATOM   327  N  N   . GLN A 1 41  ? 21.400  5.285   19.352  1.00 9.94  ? 40  GLN A N   1 
ATOM   328  C  CA  . GLN A 1 41  ? 20.253  5.558   20.243  1.00 11.15 ? 40  GLN A CA  1 
ATOM   329  C  C   . GLN A 1 41  ? 19.050  4.696   19.885  1.00 9.71  ? 40  GLN A C   1 
ATOM   330  O  O   . GLN A 1 41  ? 18.411  4.097   20.764  1.00 8.47  ? 40  GLN A O   1 
ATOM   331  C  CB  . GLN A 1 41  ? 19.857  7.047   20.177  1.00 11.57 ? 40  GLN A CB  1 
ATOM   332  C  CG  . GLN A 1 41  ? 20.910  7.968   20.779  1.00 15.40 ? 40  GLN A CG  1 
ATOM   333  C  CD  . GLN A 1 41  ? 20.628  9.462   20.604  1.00 16.99 ? 40  GLN A CD  1 
ATOM   334  O  OE1 . GLN A 1 41  ? 19.913  9.898   19.681  1.00 24.67 ? 40  GLN A OE1 1 
ATOM   335  N  NE2 . GLN A 1 41  ? 21.212  10.261  21.498  1.00 23.65 ? 40  GLN A NE2 1 
ATOM   336  N  N   A ILE A 1 42  ? 18.746  4.630   18.590  0.50 8.83  ? 41  ILE A N   1 
ATOM   337  N  N   B ILE A 1 42  ? 18.749  4.644   18.591  0.50 8.81  ? 41  ILE A N   1 
ATOM   338  C  CA  A ILE A 1 42  ? 17.579  3.898   18.107  0.50 8.74  ? 41  ILE A CA  1 
ATOM   339  C  CA  B ILE A 1 42  ? 17.605  3.900   18.083  0.50 8.76  ? 41  ILE A CA  1 
ATOM   340  C  C   A ILE A 1 42  ? 17.785  2.381   18.205  0.50 8.54  ? 41  ILE A C   1 
ATOM   341  C  C   B ILE A 1 42  ? 17.814  2.400   18.279  0.50 8.51  ? 41  ILE A C   1 
ATOM   342  O  O   A ILE A 1 42  ? 16.858  1.651   18.543  0.50 8.41  ? 41  ILE A O   1 
ATOM   343  O  O   B ILE A 1 42  ? 16.927  1.703   18.766  0.50 8.31  ? 41  ILE A O   1 
ATOM   344  C  CB  A ILE A 1 42  ? 17.212  4.305   16.663  0.50 8.79  ? 41  ILE A CB  1 
ATOM   345  C  CB  B ILE A 1 42  ? 17.369  4.214   16.600  0.50 8.70  ? 41  ILE A CB  1 
ATOM   346  C  CG1 A ILE A 1 42  ? 16.853  5.805   16.593  0.50 8.08  ? 41  ILE A CG1 1 
ATOM   347  C  CG1 B ILE A 1 42  ? 16.920  5.676   16.446  0.50 8.54  ? 41  ILE A CG1 1 
ATOM   348  C  CG2 A ILE A 1 42  ? 16.069  3.423   16.108  0.50 8.80  ? 41  ILE A CG2 1 
ATOM   349  C  CG2 B ILE A 1 42  ? 16.338  3.249   15.989  0.50 8.83  ? 41  ILE A CG2 1 
ATOM   350  C  CD1 A ILE A 1 42  ? 15.447  6.157   17.065  0.50 6.97  ? 41  ILE A CD1 1 
ATOM   351  C  CD1 B ILE A 1 42  ? 17.312  6.289   15.130  0.50 7.42  ? 41  ILE A CD1 1 
ATOM   352  N  N   . GLU A 1 43  ? 18.994  1.915   17.915  1.00 8.52  ? 42  GLU A N   1 
ATOM   353  C  CA  . GLU A 1 43  ? 19.304  0.486   18.062  1.00 8.84  ? 42  GLU A CA  1 
ATOM   354  C  C   . GLU A 1 43  ? 19.156  0.041   19.512  1.00 8.85  ? 42  GLU A C   1 
ATOM   355  O  O   . GLU A 1 43  ? 18.605  -1.022  19.773  1.00 7.57  ? 42  GLU A O   1 
ATOM   356  C  CB  . GLU A 1 43  ? 20.687  0.137   17.519  1.00 9.26  ? 42  GLU A CB  1 
ATOM   357  C  CG  . GLU A 1 43  ? 20.915  -1.379  17.433  1.00 10.55 ? 42  GLU A CG  1 
ATOM   358  C  CD  . GLU A 1 43  ? 22.294  -1.712  16.893  1.00 10.50 ? 42  GLU A CD  1 
ATOM   359  O  OE1 . GLU A 1 43  ? 22.430  -1.776  15.668  1.00 11.38 ? 42  GLU A OE1 1 
ATOM   360  O  OE2 . GLU A 1 43  ? 23.226  -1.902  17.691  1.00 11.66 ? 42  GLU A OE2 1 
ATOM   361  N  N   . GLU A 1 44  ? 19.609  0.872   20.451  1.00 8.78  ? 43  GLU A N   1 
ATOM   362  C  CA  . GLU A 1 44  ? 19.412  0.578   21.870  1.00 9.62  ? 43  GLU A CA  1 
ATOM   363  C  C   . GLU A 1 44  ? 17.934  0.476   22.246  1.00 8.20  ? 43  GLU A C   1 
ATOM   364  O  O   . GLU A 1 44  ? 17.545  -0.411  22.975  1.00 7.94  ? 43  GLU A O   1 
ATOM   365  C  CB  . GLU A 1 44  ? 20.093  1.629   22.739  1.00 10.05 ? 43  GLU A CB  1 
ATOM   366  C  CG  . GLU A 1 44  ? 21.617  1.515   22.785  1.00 12.56 ? 43  GLU A CG  1 
ATOM   367  C  CD  . GLU A 1 44  ? 22.245  2.376   23.893  1.00 13.69 ? 43  GLU A CD  1 
ATOM   368  O  OE1 . GLU A 1 44  ? 21.525  2.794   24.828  1.00 19.17 ? 43  GLU A OE1 1 
ATOM   369  O  OE2 . GLU A 1 44  ? 23.473  2.608   23.831  1.00 18.54 ? 43  GLU A OE2 1 
ATOM   370  N  N   . LYS A 1 45  ? 17.117  1.405   21.758  1.00 7.40  ? 44  LYS A N   1 
ATOM   371  C  CA  . LYS A 1 45  ? 15.683  1.396   22.059  1.00 7.25  ? 44  LYS A CA  1 
ATOM   372  C  C   . LYS A 1 45  ? 15.007  0.171   21.448  1.00 7.22  ? 44  LYS A C   1 
ATOM   373  O  O   . LYS A 1 45  ? 14.109  -0.439  22.050  1.00 6.43  ? 44  LYS A O   1 
ATOM   374  C  CB  . LYS A 1 45  ? 15.046  2.670   21.524  1.00 8.70  ? 44  LYS A CB  1 
ATOM   375  C  CG  . LYS A 1 45  ? 15.399  3.892   22.365  1.00 11.35 ? 44  LYS A CG  1 
ATOM   376  C  CD  . LYS A 1 45  ? 14.875  5.145   21.692  1.00 15.66 ? 44  LYS A CD  1 
ATOM   377  C  CE  . LYS A 1 45  ? 15.171  6.376   22.529  1.00 21.12 ? 44  LYS A CE  1 
ATOM   378  N  NZ  . LYS A 1 45  ? 14.899  7.620   21.737  1.00 24.36 ? 44  LYS A NZ  1 
ATOM   379  N  N   . LEU A 1 46  ? 15.450  -0.176  20.245  1.00 6.31  ? 45  LEU A N   1 
ATOM   380  C  CA  . LEU A 1 46  ? 14.890  -1.324  19.523  1.00 6.41  ? 45  LEU A CA  1 
ATOM   381  C  C   . LEU A 1 46  ? 15.259  -2.626  20.223  1.00 6.40  ? 45  LEU A C   1 
ATOM   382  O  O   . LEU A 1 46  ? 14.426  -3.536  20.360  1.00 6.71  ? 45  LEU A O   1 
ATOM   383  C  CB  . LEU A 1 46  ? 15.376  -1.323  18.072  1.00 6.00  ? 45  LEU A CB  1 
ATOM   384  C  CG  . LEU A 1 46  ? 14.760  -2.409  17.177  1.00 6.90  ? 45  LEU A CG  1 
ATOM   385  C  CD1 . LEU A 1 46  ? 13.230  -2.285  17.086  1.00 7.38  ? 45  LEU A CD1 1 
ATOM   386  C  CD2 . LEU A 1 46  ? 15.377  -2.325  15.777  1.00 6.30  ? 45  LEU A CD2 1 
ATOM   387  N  N   . HIS A 1 47  ? 16.506  -2.721  20.680  1.00 6.21  ? 46  HIS A N   1 
ATOM   388  C  CA  . HIS A 1 47  ? 16.942  -3.909  21.418  1.00 6.33  ? 46  HIS A CA  1 
ATOM   389  C  C   . HIS A 1 47  ? 16.025  -4.129  22.616  1.00 6.25  ? 46  HIS A C   1 
ATOM   390  O  O   . HIS A 1 47  ? 15.525  -5.232  22.827  1.00 5.21  ? 46  HIS A O   1 
ATOM   391  C  CB  . HIS A 1 47  ? 18.404  -3.746  21.870  1.00 6.87  ? 46  HIS A CB  1 
ATOM   392  C  CG  . HIS A 1 47  ? 19.057  -5.022  22.301  1.00 8.34  ? 46  HIS A CG  1 
ATOM   393  N  ND1 . HIS A 1 47  ? 20.394  -5.092  22.627  1.00 7.42  ? 46  HIS A ND1 1 
ATOM   394  C  CD2 . HIS A 1 47  ? 18.570  -6.280  22.433  1.00 11.26 ? 46  HIS A CD2 1 
ATOM   395  C  CE1 . HIS A 1 47  ? 20.696  -6.331  22.976  1.00 10.62 ? 46  HIS A CE1 1 
ATOM   396  N  NE2 . HIS A 1 47  ? 19.609  -7.075  22.856  1.00 13.20 ? 46  HIS A NE2 1 
ATOM   397  N  N   . GLU A 1 48  ? 15.778  -3.059  23.368  1.00 6.45  ? 47  GLU A N   1 
ATOM   398  C  CA  . GLU A 1 48  ? 14.906  -3.127  24.548  1.00 7.64  ? 47  GLU A CA  1 
ATOM   399  C  C   . GLU A 1 48  ? 13.473  -3.535  24.172  1.00 7.71  ? 47  GLU A C   1 
ATOM   400  O  O   . GLU A 1 48  ? 12.875  -4.411  24.821  1.00 7.03  ? 47  GLU A O   1 
ATOM   401  C  CB  . GLU A 1 48  ? 14.883  -1.775  25.251  1.00 8.20  ? 47  GLU A CB  1 
ATOM   402  C  CG  . GLU A 1 48  ? 14.104  -1.791  26.559  1.00 11.28 ? 47  GLU A CG  1 
ATOM   403  C  CD  . GLU A 1 48  ? 14.170  -0.464  27.287  1.00 17.11 ? 47  GLU A CD  1 
ATOM   404  O  OE1 . GLU A 1 48  ? 14.872  0.470   26.815  1.00 19.44 ? 47  GLU A OE1 1 
ATOM   405  O  OE2 . GLU A 1 48  ? 13.538  -0.371  28.361  1.00 21.34 ? 47  GLU A OE2 1 
ATOM   406  N  N   . ALA A 1 49  ? 12.928  -2.885  23.138  1.00 7.53  ? 48  ALA A N   1 
ATOM   407  C  CA  . ALA A 1 49  ? 11.559  -3.140  22.710  1.00 7.13  ? 48  ALA A CA  1 
ATOM   408  C  C   . ALA A 1 49  ? 11.409  -4.586  22.293  1.00 6.85  ? 48  ALA A C   1 
ATOM   409  O  O   . ALA A 1 49  ? 10.501  -5.269  22.745  1.00 7.58  ? 48  ALA A O   1 
ATOM   410  C  CB  . ALA A 1 49  ? 11.157  -2.216  21.570  1.00 7.11  ? 48  ALA A CB  1 
ATOM   411  N  N   . VAL A 1 50  ? 12.307  -5.063  21.432  1.00 7.01  ? 49  VAL A N   1 
ATOM   412  C  CA  . VAL A 1 50  ? 12.209  -6.449  20.949  1.00 6.43  ? 49  VAL A CA  1 
ATOM   413  C  C   . VAL A 1 50  ? 12.435  -7.459  22.085  1.00 6.62  ? 49  VAL A C   1 
ATOM   414  O  O   . VAL A 1 50  ? 11.759  -8.494  22.168  1.00 5.76  ? 49  VAL A O   1 
ATOM   415  C  CB  . VAL A 1 50  ? 13.172  -6.704  19.747  1.00 6.14  ? 49  VAL A CB  1 
ATOM   416  C  CG1 . VAL A 1 50  ? 13.034  -8.144  19.283  1.00 7.19  ? 49  VAL A CG1 1 
ATOM   417  C  CG2 . VAL A 1 50  ? 12.854  -5.734  18.588  1.00 6.97  ? 49  VAL A CG2 1 
ATOM   418  N  N   . SER A 1 51  ? 13.364  -7.139  22.984  1.00 6.72  ? 50  SER A N   1 
ATOM   419  C  CA  . SER A 1 51  ? 13.651  -8.008  24.124  1.00 7.78  ? 50  SER A CA  1 
ATOM   420  C  C   . SER A 1 51  ? 12.392  -8.287  24.925  1.00 7.89  ? 50  SER A C   1 
ATOM   421  O  O   . SER A 1 51  ? 12.167  -9.414  25.382  1.00 8.18  ? 50  SER A O   1 
ATOM   422  C  CB  . SER A 1 51  ? 14.664  -7.350  25.054  1.00 8.08  ? 50  SER A CB  1 
ATOM   423  O  OG  . SER A 1 51  ? 15.059  -8.276  26.025  1.00 11.01 ? 50  SER A OG  1 
ATOM   424  N  N   . LYS A 1 52  ? 11.577  -7.252  25.090  1.00 7.60  ? 51  LYS A N   1 
ATOM   425  C  CA  . LYS A 1 52  ? 10.397  -7.316  25.935  1.00 8.15  ? 51  LYS A CA  1 
ATOM   426  C  C   . LYS A 1 52  ? 9.127   -7.658  25.155  1.00 8.13  ? 51  LYS A C   1 
ATOM   427  O  O   . LYS A 1 52  ? 8.020   -7.694  25.725  1.00 7.66  ? 51  LYS A O   1 
ATOM   428  C  CB  . LYS A 1 52  ? 10.266  -5.992  26.662  1.00 8.92  ? 51  LYS A CB  1 
ATOM   429  C  CG  . LYS A 1 52  ? 11.429  -5.777  27.627  1.00 11.82 ? 51  LYS A CG  1 
ATOM   430  C  CD  . LYS A 1 52  ? 11.584  -4.321  28.023  1.00 15.75 ? 51  LYS A CD  1 
ATOM   431  C  CE  . LYS A 1 52  ? 12.392  -4.200  29.333  1.00 18.70 ? 51  LYS A CE  1 
ATOM   432  N  NZ  . LYS A 1 52  ? 12.691  -2.755  29.600  1.00 22.10 ? 51  LYS A NZ  1 
ATOM   433  N  N   . GLY A 1 53  ? 9.298   -7.947  23.866  1.00 7.44  ? 52  GLY A N   1 
ATOM   434  C  CA  . GLY A 1 53  ? 8.170   -8.282  23.006  1.00 7.83  ? 52  GLY A CA  1 
ATOM   435  C  C   . GLY A 1 53  ? 7.196   -7.128  22.826  1.00 7.70  ? 52  GLY A C   1 
ATOM   436  O  O   . GLY A 1 53  ? 5.977   -7.343  22.643  1.00 8.41  ? 52  GLY A O   1 
ATOM   437  N  N   . ASN A 1 54  ? 7.717   -5.911  22.900  1.00 6.79  ? 53  ASN A N   1 
ATOM   438  C  CA  A ASN A 1 54  ? 6.904   -4.720  22.676  0.50 6.92  ? 53  ASN A CA  1 
ATOM   439  C  CA  B ASN A 1 54  ? 6.908   -4.718  22.681  0.50 7.20  ? 53  ASN A CA  1 
ATOM   440  C  C   . ASN A 1 54  ? 6.831   -4.444  21.174  1.00 6.67  ? 53  ASN A C   1 
ATOM   441  O  O   . ASN A 1 54  ? 7.618   -3.661  20.616  1.00 5.75  ? 53  ASN A O   1 
ATOM   442  C  CB  A ASN A 1 54  ? 7.458   -3.508  23.449  0.50 7.21  ? 53  ASN A CB  1 
ATOM   443  C  CB  B ASN A 1 54  ? 7.476   -3.513  23.462  0.50 7.76  ? 53  ASN A CB  1 
ATOM   444  C  CG  A ASN A 1 54  ? 6.485   -2.340  23.485  0.50 7.17  ? 53  ASN A CG  1 
ATOM   445  C  CG  B ASN A 1 54  ? 7.533   -3.754  24.970  0.50 8.85  ? 53  ASN A CG  1 
ATOM   446  O  OD1 A ASN A 1 54  ? 5.657   -2.164  22.583  0.50 4.86  ? 53  ASN A OD1 1 
ATOM   447  O  OD1 B ASN A 1 54  ? 6.709   -4.480  25.538  0.50 10.95 ? 53  ASN A OD1 1 
ATOM   448  N  ND2 A ASN A 1 54  ? 6.572   -1.533  24.545  0.50 9.59  ? 53  ASN A ND2 1 
ATOM   449  N  ND2 B ASN A 1 54  ? 8.504   -3.119  25.632  0.50 10.50 ? 53  ASN A ND2 1 
ATOM   450  N  N   . VAL A 1 55  ? 5.895   -5.123  20.515  1.00 6.70  ? 54  VAL A N   1 
ATOM   451  C  CA  . VAL A 1 55  ? 5.756   -5.049  19.054  1.00 7.21  ? 54  VAL A CA  1 
ATOM   452  C  C   . VAL A 1 55  ? 5.388   -3.643  18.594  1.00 7.38  ? 54  VAL A C   1 
ATOM   453  O  O   . VAL A 1 55  ? 5.903   -3.167  17.579  1.00 6.26  ? 54  VAL A O   1 
ATOM   454  C  CB  . VAL A 1 55  ? 4.734   -6.089  18.535  1.00 7.61  ? 54  VAL A CB  1 
ATOM   455  C  CG1 . VAL A 1 55  ? 4.505   -5.947  17.021  1.00 7.67  ? 54  VAL A CG1 1 
ATOM   456  C  CG2 . VAL A 1 55  ? 5.227   -7.497  18.849  1.00 8.37  ? 54  VAL A CG2 1 
ATOM   457  N  N   . LYS A 1 56  ? 4.497   -2.984  19.343  1.00 7.16  ? 55  LYS A N   1 
ATOM   458  C  CA  . LYS A 1 56  ? 4.156   -1.583  19.037  1.00 7.28  ? 55  LYS A CA  1 
ATOM   459  C  C   . LYS A 1 56  ? 5.398   -0.695  18.953  1.00 6.94  ? 55  LYS A C   1 
ATOM   460  O  O   . LYS A 1 56  ? 5.605   0.003   17.957  1.00 4.60  ? 55  LYS A O   1 
ATOM   461  C  CB  . LYS A 1 56  ? 3.164   -1.016  20.071  1.00 7.49  ? 55  LYS A CB  1 
ATOM   462  C  CG  . LYS A 1 56  ? 2.824   0.470   19.816  1.00 9.60  ? 55  LYS A CG  1 
ATOM   463  C  CD  . LYS A 1 56  ? 1.947   1.056   20.932  1.00 10.45 ? 55  LYS A CD  1 
ATOM   464  C  CE  . LYS A 1 56  ? 2.744   1.274   22.218  1.00 15.04 ? 55  LYS A CE  1 
ATOM   465  N  NZ  . LYS A 1 56  ? 1.883   1.847   23.291  1.00 16.43 ? 55  LYS A NZ  1 
ATOM   466  N  N   A GLU A 1 57  ? 6.219   -0.720  20.003  0.50 7.09  ? 56  GLU A N   1 
ATOM   467  N  N   B GLU A 1 57  ? 6.224   -0.718  19.999  0.50 6.77  ? 56  GLU A N   1 
ATOM   468  C  CA  A GLU A 1 57  ? 7.418   0.120   20.049  0.50 7.98  ? 56  GLU A CA  1 
ATOM   469  C  CA  B GLU A 1 57  ? 7.415   0.137   20.034  0.50 7.12  ? 56  GLU A CA  1 
ATOM   470  C  C   A GLU A 1 57  ? 8.395   -0.272  18.952  0.50 7.34  ? 56  GLU A C   1 
ATOM   471  C  C   B GLU A 1 57  ? 8.426   -0.273  18.973  0.50 6.98  ? 56  GLU A C   1 
ATOM   472  O  O   A GLU A 1 57  ? 8.987   0.594   18.300  0.50 7.02  ? 56  GLU A O   1 
ATOM   473  O  O   B GLU A 1 57  ? 9.073   0.585   18.364  0.50 6.62  ? 56  GLU A O   1 
ATOM   474  C  CB  A GLU A 1 57  ? 8.107   0.033   21.420  0.50 8.15  ? 56  GLU A CB  1 
ATOM   475  C  CB  B GLU A 1 57  ? 8.066   0.141   21.428  0.50 7.66  ? 56  GLU A CB  1 
ATOM   476  C  CG  A GLU A 1 57  ? 7.314   0.625   22.583  0.50 10.33 ? 56  GLU A CG  1 
ATOM   477  C  CG  B GLU A 1 57  ? 7.296   0.938   22.486  0.50 9.98  ? 56  GLU A CG  1 
ATOM   478  C  CD  A GLU A 1 57  ? 8.088   0.593   23.892  0.50 10.86 ? 56  GLU A CD  1 
ATOM   479  C  CD  B GLU A 1 57  ? 6.250   0.119   23.225  0.50 11.91 ? 56  GLU A CD  1 
ATOM   480  O  OE1 A GLU A 1 57  ? 9.016   -0.244  24.023  0.50 14.80 ? 56  GLU A OE1 1 
ATOM   481  O  OE1 B GLU A 1 57  ? 5.935   -1.014  22.788  0.50 11.97 ? 56  GLU A OE1 1 
ATOM   482  O  OE2 A GLU A 1 57  ? 7.758   1.390   24.804  0.50 14.76 ? 56  GLU A OE2 1 
ATOM   483  O  OE2 B GLU A 1 57  ? 5.740   0.616   24.262  0.50 14.03 ? 56  GLU A OE2 1 
ATOM   484  N  N   . ALA A 1 58  ? 8.550   -1.578  18.740  1.00 6.69  ? 57  ALA A N   1 
ATOM   485  C  CA  . ALA A 1 58  ? 9.461   -2.092  17.701  1.00 6.81  ? 57  ALA A CA  1 
ATOM   486  C  C   . ALA A 1 58  ? 9.045   -1.559  16.319  1.00 6.48  ? 57  ALA A C   1 
ATOM   487  O  O   . ALA A 1 58  ? 9.882   -1.089  15.542  1.00 7.39  ? 57  ALA A O   1 
ATOM   488  C  CB  . ALA A 1 58  ? 9.481   -3.644  17.737  1.00 6.55  ? 57  ALA A CB  1 
ATOM   489  N  N   . ILE A 1 59  ? 7.743   -1.578  16.036  1.00 5.56  ? 58  ILE A N   1 
ATOM   490  C  CA  . ILE A 1 59  ? 7.239   -1.069  14.755  1.00 5.10  ? 58  ILE A CA  1 
ATOM   491  C  C   . ILE A 1 59  ? 7.422   0.450   14.666  1.00 5.90  ? 58  ILE A C   1 
ATOM   492  O  O   . ILE A 1 59  ? 7.829   0.989   13.624  1.00 5.84  ? 58  ILE A O   1 
ATOM   493  C  CB  . ILE A 1 59  ? 5.780   -1.509  14.492  1.00 5.48  ? 58  ILE A CB  1 
ATOM   494  C  CG1 . ILE A 1 59  ? 5.727   -3.032  14.284  1.00 5.22  ? 58  ILE A CG1 1 
ATOM   495  C  CG2 . ILE A 1 59  ? 5.190   -0.771  13.244  1.00 5.92  ? 58  ILE A CG2 1 
ATOM   496  C  CD1 . ILE A 1 59  ? 4.309   -3.629  14.315  1.00 3.60  ? 58  ILE A CD1 1 
ATOM   497  N  N   . ALA A 1 60  ? 7.160   1.137   15.775  1.00 5.99  ? 59  ALA A N   1 
ATOM   498  C  CA  . ALA A 1 60  ? 7.266   2.598   15.803  1.00 6.88  ? 59  ALA A CA  1 
ATOM   499  C  C   . ALA A 1 60  ? 8.668   3.117   15.513  1.00 6.28  ? 59  ALA A C   1 
ATOM   500  O  O   . ALA A 1 60  ? 8.834   4.222   14.990  1.00 6.70  ? 59  ALA A O   1 
ATOM   501  C  CB  . ALA A 1 60  ? 6.779   3.122   17.145  1.00 6.57  ? 59  ALA A CB  1 
ATOM   502  N  N   . LEU A 1 61  ? 9.672   2.321   15.867  1.00 6.58  ? 60  LEU A N   1 
ATOM   503  C  CA  . LEU A 1 61  ? 11.080  2.674   15.675  1.00 6.65  ? 60  LEU A CA  1 
ATOM   504  C  C   . LEU A 1 61  ? 11.574  2.421   14.244  1.00 7.88  ? 60  LEU A C   1 
ATOM   505  O  O   . LEU A 1 61  ? 12.695  2.800   13.892  1.00 8.26  ? 60  LEU A O   1 
ATOM   506  C  CB  . LEU A 1 61  ? 11.947  1.863   16.661  1.00 6.27  ? 60  LEU A CB  1 
ATOM   507  C  CG  . LEU A 1 61  ? 11.826  2.258   18.138  1.00 6.82  ? 60  LEU A CG  1 
ATOM   508  C  CD1 . LEU A 1 61  ? 12.468  1.198   19.059  1.00 8.22  ? 60  LEU A CD1 1 
ATOM   509  C  CD2 . LEU A 1 61  ? 12.447  3.623   18.377  1.00 9.70  ? 60  LEU A CD2 1 
ATOM   510  N  N   . GLN A 1 62  ? 10.752  1.764   13.433  1.00 8.03  ? 61  GLN A N   1 
ATOM   511  C  CA  . GLN A 1 62  ? 11.209  1.329   12.106  1.00 8.65  ? 61  GLN A CA  1 
ATOM   512  C  C   . GLN A 1 62  ? 11.649  2.461   11.163  1.00 8.98  ? 61  GLN A C   1 
ATOM   513  O  O   . GLN A 1 62  ? 12.731  2.366   10.579  1.00 9.27  ? 61  GLN A O   1 
ATOM   514  C  CB  . GLN A 1 62  ? 10.184  0.406   11.449  1.00 8.64  ? 61  GLN A CB  1 
ATOM   515  C  CG  . GLN A 1 62  ? 10.095  -0.923  12.176  1.00 9.16  ? 61  GLN A CG  1 
ATOM   516  C  CD  . GLN A 1 62  ? 9.219   -1.911  11.449  1.00 11.23 ? 61  GLN A CD  1 
ATOM   517  O  OE1 . GLN A 1 62  ? 8.473   -1.547  10.521  1.00 11.99 ? 61  GLN A OE1 1 
ATOM   518  N  NE2 . GLN A 1 62  ? 9.292   -3.155  11.864  1.00 11.81 ? 61  GLN A NE2 1 
ATOM   519  N  N   . PRO A 1 63  ? 10.842  3.533   11.014  1.00 9.49  ? 62  PRO A N   1 
ATOM   520  C  CA  . PRO A 1 63  ? 11.320  4.648   10.163  1.00 9.95  ? 62  PRO A CA  1 
ATOM   521  C  C   . PRO A 1 63  ? 12.668  5.217   10.609  1.00 9.87  ? 62  PRO A C   1 
ATOM   522  O  O   . PRO A 1 63  ? 13.547  5.441   9.768   1.00 9.44  ? 62  PRO A O   1 
ATOM   523  C  CB  . PRO A 1 63  ? 10.213  5.699   10.322  1.00 10.35 ? 62  PRO A CB  1 
ATOM   524  C  CG  . PRO A 1 63  ? 8.995   4.884   10.561  1.00 10.73 ? 62  PRO A CG  1 
ATOM   525  C  CD  . PRO A 1 63  ? 9.480   3.814   11.520  1.00 9.91  ? 62  PRO A CD  1 
ATOM   526  N  N   . ALA A 1 64  ? 12.836  5.409   11.922  1.00 8.95  ? 63  ALA A N   1 
ATOM   527  C  CA  . ALA A 1 64  ? 14.074  5.962   12.465  1.00 7.90  ? 63  ALA A CA  1 
ATOM   528  C  C   . ALA A 1 64  ? 15.262  5.015   12.259  1.00 7.89  ? 63  ALA A C   1 
ATOM   529  O  O   . ALA A 1 64  ? 16.352  5.469   11.917  1.00 7.18  ? 63  ALA A O   1 
ATOM   530  C  CB  . ALA A 1 64  ? 13.904  6.303   13.909  1.00 8.87  ? 63  ALA A CB  1 
ATOM   531  N  N   . LEU A 1 65  ? 15.054  3.706   12.442  1.00 7.53  ? 64  LEU A N   1 
ATOM   532  C  CA  . LEU A 1 65  ? 16.141  2.755   12.203  1.00 8.11  ? 64  LEU A CA  1 
ATOM   533  C  C   . LEU A 1 65  ? 16.515  2.716   10.713  1.00 8.29  ? 64  LEU A C   1 
ATOM   534  O  O   . LEU A 1 65  ? 17.704  2.724   10.369  1.00 9.25  ? 64  LEU A O   1 
ATOM   535  C  CB  . LEU A 1 65  ? 15.829  1.350   12.743  1.00 8.57  ? 64  LEU A CB  1 
ATOM   536  C  CG  . LEU A 1 65  ? 17.053  0.424   12.625  1.00 9.28  ? 64  LEU A CG  1 
ATOM   537  C  CD1 . LEU A 1 65  ? 18.006  0.684   13.784  1.00 11.48 ? 64  LEU A CD1 1 
ATOM   538  C  CD2 . LEU A 1 65  ? 16.670  -1.036  12.543  1.00 10.60 ? 64  LEU A CD2 1 
ATOM   539  N  N   . LYS A 1 66  ? 15.519  2.665   9.825   1.00 7.97  ? 65  LYS A N   1 
ATOM   540  C  CA  . LYS A 1 66  ? 15.846  2.598   8.396   1.00 7.93  ? 65  LYS A CA  1 
ATOM   541  C  C   . LYS A 1 66  ? 16.597  3.857   7.951   1.00 8.36  ? 65  LYS A C   1 
ATOM   542  O  O   . LYS A 1 66  ? 17.547  3.792   7.160   1.00 8.24  ? 65  LYS A O   1 
ATOM   543  C  CB  . LYS A 1 66  ? 14.578  2.392   7.554   1.00 8.59  ? 65  LYS A CB  1 
ATOM   544  C  CG  . LYS A 1 66  ? 14.845  2.439   6.052   1.00 8.78  ? 65  LYS A CG  1 
ATOM   545  C  CD  . LYS A 1 66  ? 13.726  1.813   5.258   1.00 10.94 ? 65  LYS A CD  1 
ATOM   546  C  CE  . LYS A 1 66  ? 12.380  2.489   5.494   1.00 13.82 ? 65  LYS A CE  1 
ATOM   547  N  NZ  . LYS A 1 66  ? 12.340  3.924   5.106   1.00 17.42 ? 65  LYS A NZ  1 
ATOM   548  N  N   . PHE A 1 67  ? 16.158  5.005   8.457   1.00 8.16  ? 66  PHE A N   1 
ATOM   549  C  CA  . PHE A 1 67  ? 16.713  6.292   8.042   1.00 8.33  ? 66  PHE A CA  1 
ATOM   550  C  C   . PHE A 1 67  ? 18.143  6.464   8.555   1.00 8.48  ? 66  PHE A C   1 
ATOM   551  O  O   . PHE A 1 67  ? 19.059  6.822   7.797   1.00 7.88  ? 66  PHE A O   1 
ATOM   552  C  CB  . PHE A 1 67  ? 15.805  7.401   8.596   1.00 8.45  ? 66  PHE A CB  1 
ATOM   553  C  CG  . PHE A 1 67  ? 16.193  8.791   8.163   1.00 8.20  ? 66  PHE A CG  1 
ATOM   554  C  CD1 . PHE A 1 67  ? 16.610  9.732   9.104   1.00 10.55 ? 66  PHE A CD1 1 
ATOM   555  C  CD2 . PHE A 1 67  ? 16.120  9.154   6.818   1.00 10.15 ? 66  PHE A CD2 1 
ATOM   556  C  CE1 . PHE A 1 67  ? 16.932  11.037  8.701   1.00 10.69 ? 66  PHE A CE1 1 
ATOM   557  C  CE2 . PHE A 1 67  ? 16.445  10.444  6.409   1.00 9.98  ? 66  PHE A CE2 1 
ATOM   558  C  CZ  . PHE A 1 67  ? 16.860  11.375  7.358   1.00 10.30 ? 66  PHE A CZ  1 
ATOM   559  N  N   . ASN A 1 68  ? 18.326  6.232   9.853   1.00 8.81  ? 67  ASN A N   1 
ATOM   560  C  CA  . ASN A 1 68  ? 19.644  6.421   10.460  1.00 8.78  ? 67  ASN A CA  1 
ATOM   561  C  C   . ASN A 1 68  ? 20.587  5.268   10.206  1.00 8.79  ? 67  ASN A C   1 
ATOM   562  O  O   . ASN A 1 68  ? 21.761  5.486   9.908   1.00 8.70  ? 67  ASN A O   1 
ATOM   563  C  CB  . ASN A 1 68  ? 19.517  6.749   11.942  1.00 9.08  ? 67  ASN A CB  1 
ATOM   564  C  CG  . ASN A 1 68  ? 18.863  8.092   12.163  1.00 10.12 ? 67  ASN A CG  1 
ATOM   565  O  OD1 . ASN A 1 68  ? 19.475  9.136   11.932  1.00 9.49  ? 67  ASN A OD1 1 
ATOM   566  N  ND2 . ASN A 1 68  ? 17.607  8.075   12.570  1.00 10.99 ? 67  ASN A ND2 1 
ATOM   567  N  N   . GLY A 1 69  ? 20.077  4.040   10.317  1.00 8.44  ? 68  GLY A N   1 
ATOM   568  C  CA  . GLY A 1 69  ? 20.860  2.861   9.979   1.00 8.26  ? 68  GLY A CA  1 
ATOM   569  C  C   . GLY A 1 69  ? 21.233  2.896   8.508   1.00 8.31  ? 68  GLY A C   1 
ATOM   570  O  O   . GLY A 1 69  ? 22.380  2.640   8.140   1.00 7.00  ? 68  GLY A O   1 
ATOM   571  N  N   . GLY A 1 70  ? 20.260  3.236   7.671   1.00 8.60  ? 69  GLY A N   1 
ATOM   572  C  CA  . GLY A 1 70  ? 20.517  3.369   6.230   1.00 8.15  ? 69  GLY A CA  1 
ATOM   573  C  C   . GLY A 1 70  ? 21.547  4.459   5.974   1.00 8.04  ? 69  GLY A C   1 
ATOM   574  O  O   . GLY A 1 70  ? 22.445  4.274   5.158   1.00 7.32  ? 69  GLY A O   1 
ATOM   575  N  N   . GLY A 1 71  ? 21.409  5.602   6.657   1.00 7.99  ? 70  GLY A N   1 
ATOM   576  C  CA  . GLY A 1 71  ? 22.371  6.695   6.473   1.00 7.56  ? 70  GLY A CA  1 
ATOM   577  C  C   . GLY A 1 71  ? 23.784  6.208   6.764   1.00 8.24  ? 70  GLY A C   1 
ATOM   578  O  O   . GLY A 1 71  ? 24.722  6.478   6.005   1.00 7.45  ? 70  GLY A O   1 
ATOM   579  N  N   . HIS A 1 72  ? 23.930  5.467   7.865   1.00 8.29  ? 71  HIS A N   1 
ATOM   580  C  CA  . HIS A 1 72  ? 25.224  4.901   8.225   1.00 8.69  ? 71  HIS A CA  1 
ATOM   581  C  C   . HIS A 1 72  ? 25.758  3.952   7.142   1.00 8.62  ? 71  HIS A C   1 
ATOM   582  O  O   . HIS A 1 72  ? 26.898  4.086   6.717   1.00 9.04  ? 71  HIS A O   1 
ATOM   583  C  CB  . HIS A 1 72  ? 25.133  4.183   9.577   1.00 8.44  ? 71  HIS A CB  1 
ATOM   584  C  CG  . HIS A 1 72  ? 26.434  3.605   10.055  1.00 9.64  ? 71  HIS A CG  1 
ATOM   585  N  ND1 . HIS A 1 72  ? 27.638  4.271   9.950   1.00 9.92  ? 71  HIS A ND1 1 
ATOM   586  C  CD2 . HIS A 1 72  ? 26.709  2.431   10.675  1.00 10.89 ? 71  HIS A CD2 1 
ATOM   587  C  CE1 . HIS A 1 72  ? 28.600  3.531   10.475  1.00 8.99  ? 71  HIS A CE1 1 
ATOM   588  N  NE2 . HIS A 1 72  ? 28.064  2.406   10.918  1.00 10.69 ? 71  HIS A NE2 1 
ATOM   589  N  N   . ILE A 1 73  ? 24.937  3.000   6.707   1.00 8.28  ? 72  ILE A N   1 
ATOM   590  C  CA  . ILE A 1 73  ? 25.348  2.031   5.671   1.00 8.14  ? 72  ILE A CA  1 
ATOM   591  C  C   . ILE A 1 73  ? 25.769  2.743   4.382   1.00 8.41  ? 72  ILE A C   1 
ATOM   592  O  O   . ILE A 1 73  ? 26.849  2.480   3.823   1.00 8.02  ? 72  ILE A O   1 
ATOM   593  C  CB  . ILE A 1 73  ? 24.197  1.036   5.365   1.00 8.29  ? 72  ILE A CB  1 
ATOM   594  C  CG1 . ILE A 1 73  ? 23.964  0.113   6.569   1.00 9.18  ? 72  ILE A CG1 1 
ATOM   595  C  CG2 . ILE A 1 73  ? 24.490  0.172   4.119   1.00 8.17  ? 72  ILE A CG2 1 
ATOM   596  C  CD1 . ILE A 1 73  ? 22.612  -0.635  6.506   1.00 8.81  ? 72  ILE A CD1 1 
ATOM   597  N  N   . ASN A 1 74  ? 24.896  3.643   3.934   1.00 7.74  ? 73  ASN A N   1 
ATOM   598  C  CA  . ASN A 1 74  ? 25.054  4.315   2.636   1.00 7.96  ? 73  ASN A CA  1 
ATOM   599  C  C   . ASN A 1 74  ? 26.325  5.148   2.621   1.00 8.02  ? 73  ASN A C   1 
ATOM   600  O  O   . ASN A 1 74  ? 27.140  5.025   1.686   1.00 7.79  ? 73  ASN A O   1 
ATOM   601  C  CB  . ASN A 1 74  ? 23.867  5.231   2.366   1.00 7.41  ? 73  ASN A CB  1 
ATOM   602  C  CG  . ASN A 1 74  ? 22.559  4.497   2.209   1.00 8.69  ? 73  ASN A CG  1 
ATOM   603  O  OD1 . ASN A 1 74  ? 21.496  5.120   2.311   1.00 11.59 ? 73  ASN A OD1 1 
ATOM   604  N  ND2 . ASN A 1 74  ? 22.610  3.195   1.948   1.00 5.48  ? 73  ASN A ND2 1 
ATOM   605  N  N   . HIS A 1 75  ? 26.521  5.970   3.654   1.00 7.85  ? 74  HIS A N   1 
ATOM   606  C  CA  . HIS A 1 75  ? 27.714  6.827   3.676   1.00 8.32  ? 74  HIS A CA  1 
ATOM   607  C  C   . HIS A 1 75  ? 28.996  6.039   3.890   1.00 8.77  ? 74  HIS A C   1 
ATOM   608  O  O   . HIS A 1 75  ? 30.022  6.369   3.293   1.00 9.39  ? 74  HIS A O   1 
ATOM   609  C  CB  . HIS A 1 75  ? 27.578  7.969   4.684   1.00 8.43  ? 74  HIS A CB  1 
ATOM   610  C  CG  . HIS A 1 75  ? 26.523  8.954   4.305   1.00 9.44  ? 74  HIS A CG  1 
ATOM   611  N  ND1 . HIS A 1 75  ? 25.197  8.761   4.614   1.00 9.56  ? 74  HIS A ND1 1 
ATOM   612  C  CD2 . HIS A 1 75  ? 26.589  10.110  3.601   1.00 8.66  ? 74  HIS A CD2 1 
ATOM   613  C  CE1 . HIS A 1 75  ? 24.484  9.765   4.123   1.00 9.00  ? 74  HIS A CE1 1 
ATOM   614  N  NE2 . HIS A 1 75  ? 25.311  10.608  3.529   1.00 8.94  ? 74  HIS A NE2 1 
ATOM   615  N  N   . SER A 1 76  ? 28.935  4.988   4.710   1.00 8.28  ? 75  SER A N   1 
ATOM   616  C  CA  . SER A 1 76  ? 30.111  4.136   4.908   1.00 8.25  ? 75  SER A CA  1 
ATOM   617  C  C   . SER A 1 76  ? 30.594  3.577   3.571   1.00 8.29  ? 75  SER A C   1 
ATOM   618  O  O   . SER A 1 76  ? 31.786  3.586   3.272   1.00 8.54  ? 75  SER A O   1 
ATOM   619  C  CB  . SER A 1 76  ? 29.820  3.013   5.911   1.00 8.43  ? 75  SER A CB  1 
ATOM   620  O  OG  . SER A 1 76  ? 29.627  3.566   7.215   1.00 7.99  ? 75  SER A OG  1 
ATOM   621  N  N   . ILE A 1 77  ? 29.664  3.109   2.751   1.00 8.13  ? 76  ILE A N   1 
ATOM   622  C  CA  . ILE A 1 77  ? 30.029  2.591   1.436   1.00 8.24  ? 76  ILE A CA  1 
ATOM   623  C  C   . ILE A 1 77  ? 30.549  3.736   0.563   1.00 8.04  ? 76  ILE A C   1 
ATOM   624  O  O   . ILE A 1 77  ? 31.600  3.629   -0.091  1.00 7.75  ? 76  ILE A O   1 
ATOM   625  C  CB  . ILE A 1 77  ? 28.827  1.883   0.768   1.00 8.37  ? 76  ILE A CB  1 
ATOM   626  C  CG1 . ILE A 1 77  ? 28.437  0.619   1.560   1.00 8.87  ? 76  ILE A CG1 1 
ATOM   627  C  CG2 . ILE A 1 77  ? 29.134  1.537   -0.714  1.00 8.46  ? 76  ILE A CG2 1 
ATOM   628  C  CD1 . ILE A 1 77  ? 27.013  0.098   1.217   1.00 9.91  ? 76  ILE A CD1 1 
ATOM   629  N  N   . PHE A 1 78  ? 29.813  4.841   0.581   1.00 8.16  ? 77  PHE A N   1 
ATOM   630  C  CA  . PHE A 1 78  ? 30.104  5.980   -0.290  1.00 7.99  ? 77  PHE A CA  1 
ATOM   631  C  C   . PHE A 1 78  ? 31.551  6.458   -0.163  1.00 8.29  ? 77  PHE A C   1 
ATOM   632  O  O   . PHE A 1 78  ? 32.227  6.672   -1.190  1.00 8.21  ? 77  PHE A O   1 
ATOM   633  C  CB  . PHE A 1 78  ? 29.124  7.115   0.028   1.00 8.08  ? 77  PHE A CB  1 
ATOM   634  C  CG  . PHE A 1 78  ? 29.186  8.279   -0.936  1.00 8.13  ? 77  PHE A CG  1 
ATOM   635  C  CD1 . PHE A 1 78  ? 28.987  8.085   -2.302  1.00 7.91  ? 77  PHE A CD1 1 
ATOM   636  C  CD2 . PHE A 1 78  ? 29.374  9.585   -0.458  1.00 8.18  ? 77  PHE A CD2 1 
ATOM   637  C  CE1 . PHE A 1 78  ? 29.011  9.175   -3.204  1.00 9.25  ? 77  PHE A CE1 1 
ATOM   638  C  CE2 . PHE A 1 78  ? 29.381  10.690  -1.349  1.00 8.29  ? 77  PHE A CE2 1 
ATOM   639  C  CZ  . PHE A 1 78  ? 29.206  10.472  -2.720  1.00 6.66  ? 77  PHE A CZ  1 
ATOM   640  N  N   . TRP A 1 79  ? 32.054  6.614   1.071   1.00 7.82  ? 78  TRP A N   1 
ATOM   641  C  CA  . TRP A 1 79  ? 33.425  7.105   1.233   1.00 7.85  ? 78  TRP A CA  1 
ATOM   642  C  C   . TRP A 1 79  ? 34.421  6.201   0.519   1.00 7.55  ? 78  TRP A C   1 
ATOM   643  O  O   . TRP A 1 79  ? 35.390  6.688   -0.064  1.00 7.84  ? 78  TRP A O   1 
ATOM   644  C  CB  . TRP A 1 79  ? 33.845  7.231   2.700   1.00 8.38  ? 78  TRP A CB  1 
ATOM   645  C  CG  . TRP A 1 79  ? 32.859  7.960   3.596   1.00 7.93  ? 78  TRP A CG  1 
ATOM   646  C  CD1 . TRP A 1 79  ? 32.426  7.552   4.817   1.00 9.03  ? 78  TRP A CD1 1 
ATOM   647  C  CD2 . TRP A 1 79  ? 32.162  9.187   3.309   1.00 8.52  ? 78  TRP A CD2 1 
ATOM   648  N  NE1 . TRP A 1 79  ? 31.520  8.450   5.330   1.00 7.77  ? 78  TRP A NE1 1 
ATOM   649  C  CE2 . TRP A 1 79  ? 31.342  9.469   4.431   1.00 8.49  ? 78  TRP A CE2 1 
ATOM   650  C  CE3 . TRP A 1 79  ? 32.170  10.086  2.229   1.00 8.67  ? 78  TRP A CE3 1 
ATOM   651  C  CZ2 . TRP A 1 79  ? 30.522  10.603  4.504   1.00 8.44  ? 78  TRP A CZ2 1 
ATOM   652  C  CZ3 . TRP A 1 79  ? 31.352  11.234  2.302   1.00 8.63  ? 78  TRP A CZ3 1 
ATOM   653  C  CH2 . TRP A 1 79  ? 30.538  11.473  3.437   1.00 9.16  ? 78  TRP A CH2 1 
ATOM   654  N  N   . THR A 1 80  ? 34.196  4.891   0.586   1.00 7.46  ? 79  THR A N   1 
ATOM   655  C  CA  . THR A 1 80  ? 35.136  3.927   -0.008  1.00 7.60  ? 79  THR A CA  1 
ATOM   656  C  C   . THR A 1 80  ? 34.997  3.882   -1.533  1.00 7.77  ? 79  THR A C   1 
ATOM   657  O  O   . THR A 1 80  ? 35.910  3.440   -2.228  1.00 7.55  ? 79  THR A O   1 
ATOM   658  C  CB  . THR A 1 80  ? 34.953  2.507   0.570   1.00 7.36  ? 79  THR A CB  1 
ATOM   659  O  OG1 . THR A 1 80  ? 33.744  1.926   0.062   1.00 7.96  ? 79  THR A OG1 1 
ATOM   660  C  CG2 . THR A 1 80  ? 34.925  2.534   2.122   1.00 8.17  ? 79  THR A CG2 1 
ATOM   661  N  N   . ASN A 1 81  ? 33.857  4.353   -2.041  1.00 7.49  ? 80  ASN A N   1 
ATOM   662  C  CA  . ASN A 1 81  ? 33.591  4.396   -3.480  1.00 8.03  ? 80  ASN A CA  1 
ATOM   663  C  C   . ASN A 1 81  ? 34.303  5.543   -4.222  1.00 7.59  ? 80  ASN A C   1 
ATOM   664  O  O   . ASN A 1 81  ? 34.203  5.633   -5.441  1.00 8.38  ? 80  ASN A O   1 
ATOM   665  C  CB  . ASN A 1 81  ? 32.101  4.585   -3.749  1.00 8.01  ? 80  ASN A CB  1 
ATOM   666  C  CG  . ASN A 1 81  ? 31.267  3.327   -3.557  1.00 9.30  ? 80  ASN A CG  1 
ATOM   667  O  OD1 . ASN A 1 81  ? 30.048  3.425   -3.574  1.00 9.42  ? 80  ASN A OD1 1 
ATOM   668  N  ND2 . ASN A 1 81  ? 31.900  2.148   -3.397  1.00 8.56  ? 80  ASN A ND2 1 
ATOM   669  N  N   . LEU A 1 82  ? 34.972  6.432   -3.489  1.00 7.77  ? 81  LEU A N   1 
ATOM   670  C  CA  . LEU A 1 82  ? 35.619  7.607   -4.083  1.00 7.52  ? 81  LEU A CA  1 
ATOM   671  C  C   . LEU A 1 82  ? 37.125  7.574   -3.851  1.00 8.20  ? 81  LEU A C   1 
ATOM   672  O  O   . LEU A 1 82  ? 37.586  7.017   -2.853  1.00 8.05  ? 81  LEU A O   1 
ATOM   673  C  CB  . LEU A 1 82  ? 35.039  8.889   -3.475  1.00 7.65  ? 81  LEU A CB  1 
ATOM   674  C  CG  . LEU A 1 82  ? 33.510  9.011   -3.459  1.00 8.21  ? 81  LEU A CG  1 
ATOM   675  C  CD1 . LEU A 1 82  ? 33.064  10.222  -2.636  1.00 8.28  ? 81  LEU A CD1 1 
ATOM   676  C  CD2 . LEU A 1 82  ? 32.937  9.079   -4.885  1.00 8.26  ? 81  LEU A CD2 1 
ATOM   677  N  N   . ALA A 1 83  ? 37.889  8.165   -4.770  1.00 8.75  ? 82  ALA A N   1 
ATOM   678  C  CA  . ALA A 1 83  ? 39.332  8.287   -4.597  1.00 10.05 ? 82  ALA A CA  1 
ATOM   679  C  C   . ALA A 1 83  ? 39.864  9.363   -5.528  1.00 10.84 ? 82  ALA A C   1 
ATOM   680  O  O   . ALA A 1 83  ? 39.285  9.610   -6.585  1.00 10.34 ? 82  ALA A O   1 
ATOM   681  C  CB  . ALA A 1 83  ? 40.023  6.960   -4.881  1.00 9.97  ? 82  ALA A CB  1 
ATOM   682  N  N   . LYS A 1 84  ? 40.961  9.997   -5.122  1.00 12.43 ? 83  LYS A N   1 
ATOM   683  C  CA  . LYS A 1 84  ? 41.667  10.958  -5.974  1.00 13.71 ? 83  LYS A CA  1 
ATOM   684  C  C   . LYS A 1 84  ? 42.077  10.281  -7.290  1.00 14.88 ? 83  LYS A C   1 
ATOM   685  O  O   . LYS A 1 84  ? 41.848  10.814  -8.384  1.00 14.48 ? 83  LYS A O   1 
ATOM   686  C  CB  . LYS A 1 84  ? 42.893  11.497  -5.228  1.00 14.06 ? 83  LYS A CB  1 
ATOM   687  C  CG  . LYS A 1 84  ? 43.630  12.604  -5.933  1.00 14.88 ? 83  LYS A CG  1 
ATOM   688  C  CD  . LYS A 1 84  ? 44.803  13.091  -5.096  1.00 17.15 ? 83  LYS A CD  1 
ATOM   689  C  CE  . LYS A 1 84  ? 45.439  14.318  -5.724  1.00 19.29 ? 83  LYS A CE  1 
ATOM   690  N  NZ  . LYS A 1 84  ? 46.670  14.742  -5.012  1.00 21.94 ? 83  LYS A NZ  1 
ATOM   691  N  N   . ASP A 1 85  ? 42.692  9.112   -7.167  1.00 15.90 ? 84  ASP A N   1 
ATOM   692  C  CA  A ASP A 1 85  ? 43.045  8.297   -8.327  0.50 16.94 ? 84  ASP A CA  1 
ATOM   693  C  CA  B ASP A 1 85  ? 43.065  8.302   -8.317  0.50 16.90 ? 84  ASP A CA  1 
ATOM   694  C  C   . ASP A 1 85  ? 42.464  6.908   -8.135  1.00 17.51 ? 84  ASP A C   1 
ATOM   695  O  O   . ASP A 1 85  ? 43.047  6.056   -7.462  1.00 18.18 ? 84  ASP A O   1 
ATOM   696  C  CB  A ASP A 1 85  ? 44.563  8.227   -8.521  0.50 17.11 ? 84  ASP A CB  1 
ATOM   697  C  CB  B ASP A 1 85  ? 44.593  8.236   -8.445  0.50 17.01 ? 84  ASP A CB  1 
ATOM   698  C  CG  A ASP A 1 85  ? 44.974  7.257   -9.629  0.50 17.41 ? 84  ASP A CG  1 
ATOM   699  C  CG  B ASP A 1 85  ? 45.242  9.617   -8.495  0.50 17.12 ? 84  ASP A CG  1 
ATOM   700  O  OD1 A ASP A 1 85  ? 46.119  6.771   -9.579  0.50 18.70 ? 84  ASP A OD1 1 
ATOM   701  O  OD1 B ASP A 1 85  ? 44.924  10.410  -9.411  0.50 17.41 ? 84  ASP A OD1 1 
ATOM   702  O  OD2 A ASP A 1 85  ? 44.163  6.974   -10.543 0.50 17.54 ? 84  ASP A OD2 1 
ATOM   703  O  OD2 B ASP A 1 85  ? 46.081  9.910   -7.617  0.50 18.22 ? 84  ASP A OD2 1 
ATOM   704  N  N   . GLY A 1 86  ? 41.298  6.691   -8.726  1.00 18.51 ? 85  GLY A N   1 
ATOM   705  C  CA  . GLY A 1 86  ? 40.552  5.466   -8.486  1.00 19.35 ? 85  GLY A CA  1 
ATOM   706  C  C   . GLY A 1 86  ? 40.787  4.351   -9.481  1.00 19.87 ? 85  GLY A C   1 
ATOM   707  O  O   . GLY A 1 86  ? 40.118  3.323   -9.417  1.00 20.24 ? 85  GLY A O   1 
ATOM   708  N  N   . GLY A 1 87  ? 41.739  4.545   -10.394 1.00 19.83 ? 86  GLY A N   1 
ATOM   709  C  CA  . GLY A 1 87  ? 42.091  3.511   -11.367 1.00 19.78 ? 86  GLY A CA  1 
ATOM   710  C  C   . GLY A 1 87  ? 40.972  3.170   -12.331 1.00 19.61 ? 86  GLY A C   1 
ATOM   711  O  O   . GLY A 1 87  ? 40.126  4.002   -12.655 1.00 20.22 ? 86  GLY A O   1 
ATOM   712  N  N   . GLU A 1 88  ? 40.965  1.926   -12.782 1.00 19.28 ? 87  GLU A N   1 
ATOM   713  C  CA  . GLU A 1 88  ? 40.009  1.470   -13.774 1.00 19.02 ? 87  GLU A CA  1 
ATOM   714  C  C   . GLU A 1 88  ? 39.352  0.202   -13.267 1.00 17.65 ? 87  GLU A C   1 
ATOM   715  O  O   . GLU A 1 88  ? 39.892  -0.439  -12.374 1.00 17.36 ? 87  GLU A O   1 
ATOM   716  C  CB  . GLU A 1 88  ? 40.739  1.189   -15.087 1.00 19.56 ? 87  GLU A CB  1 
ATOM   717  C  CG  . GLU A 1 88  ? 40.924  2.430   -15.940 1.00 22.61 ? 87  GLU A CG  1 
ATOM   718  C  CD  . GLU A 1 88  ? 42.141  2.358   -16.843 1.00 26.30 ? 87  GLU A CD  1 
ATOM   719  O  OE1 . GLU A 1 88  ? 42.620  1.236   -17.145 1.00 28.42 ? 87  GLU A OE1 1 
ATOM   720  O  OE2 . GLU A 1 88  ? 42.624  3.438   -17.251 1.00 28.26 ? 87  GLU A OE2 1 
ATOM   721  N  N   . PRO A 1 89  ? 38.185  -0.167  -13.832 1.00 16.82 ? 88  PRO A N   1 
ATOM   722  C  CA  . PRO A 1 89  ? 37.564  -1.429  -13.434 1.00 16.16 ? 88  PRO A CA  1 
ATOM   723  C  C   . PRO A 1 89  ? 38.481  -2.621  -13.688 1.00 15.28 ? 88  PRO A C   1 
ATOM   724  O  O   . PRO A 1 89  ? 39.257  -2.621  -14.663 1.00 14.48 ? 88  PRO A O   1 
ATOM   725  C  CB  . PRO A 1 89  ? 36.342  -1.536  -14.355 1.00 16.29 ? 88  PRO A CB  1 
ATOM   726  C  CG  . PRO A 1 89  ? 36.090  -0.160  -14.852 1.00 17.21 ? 88  PRO A CG  1 
ATOM   727  C  CD  . PRO A 1 89  ? 37.398  0.543   -14.856 1.00 16.89 ? 88  PRO A CD  1 
ATOM   728  N  N   . SER A 1 90  ? 38.395  -3.629  -12.819 1.00 14.09 ? 89  SER A N   1 
ATOM   729  C  CA  . SER A 1 90  ? 39.091  -4.889  -13.041 1.00 13.40 ? 89  SER A CA  1 
ATOM   730  C  C   . SER A 1 90  ? 38.623  -5.494  -14.362 1.00 12.97 ? 89  SER A C   1 
ATOM   731  O  O   . SER A 1 90  ? 37.570  -5.116  -14.891 1.00 12.36 ? 89  SER A O   1 
ATOM   732  C  CB  . SER A 1 90  ? 38.811  -5.867  -11.905 1.00 13.39 ? 89  SER A CB  1 
ATOM   733  O  OG  . SER A 1 90  ? 37.437  -6.230  -11.884 1.00 12.91 ? 89  SER A OG  1 
ATOM   734  N  N   . ALA A 1 91  ? 39.416  -6.424  -14.888 1.00 12.85 ? 90  ALA A N   1 
ATOM   735  C  CA  . ALA A 1 91  ? 39.050  -7.170  -16.085 1.00 12.68 ? 90  ALA A CA  1 
ATOM   736  C  C   . ALA A 1 91  ? 37.661  -7.787  -15.928 1.00 12.37 ? 90  ALA A C   1 
ATOM   737  O  O   . ALA A 1 91  ? 36.814  -7.628  -16.807 1.00 12.78 ? 90  ALA A O   1 
ATOM   738  C  CB  . ALA A 1 91  ? 40.091  -8.252  -16.372 1.00 12.41 ? 90  ALA A CB  1 
ATOM   739  N  N   . GLU A 1 92  ? 37.439  -8.463  -14.796 1.00 12.17 ? 91  GLU A N   1 
ATOM   740  C  CA  . GLU A 1 92  ? 36.170  -9.144  -14.477 1.00 12.07 ? 91  GLU A CA  1 
ATOM   741  C  C   . GLU A 1 92  ? 34.978  -8.190  -14.456 1.00 11.42 ? 91  GLU A C   1 
ATOM   742  O  O   . GLU A 1 92  ? 33.915  -8.482  -15.020 1.00 10.62 ? 91  GLU A O   1 
ATOM   743  C  CB  . GLU A 1 92  ? 36.268  -9.862  -13.118 1.00 12.72 ? 91  GLU A CB  1 
ATOM   744  C  CG  . GLU A 1 92  ? 37.201  -11.090 -13.110 1.00 15.06 ? 91  GLU A CG  1 
ATOM   745  C  CD  . GLU A 1 92  ? 38.693  -10.737 -13.150 1.00 19.50 ? 91  GLU A CD  1 
ATOM   746  O  OE1 . GLU A 1 92  ? 39.059  -9.551  -12.961 1.00 21.40 ? 91  GLU A OE1 1 
ATOM   747  O  OE2 . GLU A 1 92  ? 39.510  -11.658 -13.380 1.00 21.29 ? 91  GLU A OE2 1 
ATOM   748  N  N   . LEU A 1 93  ? 35.159  -7.052  -13.791 1.00 10.42 ? 92  LEU A N   1 
ATOM   749  C  CA  . LEU A 1 93  ? 34.098  -6.070  -13.693 1.00 10.43 ? 92  LEU A CA  1 
ATOM   750  C  C   . LEU A 1 93  ? 33.793  -5.461  -15.059 1.00 10.81 ? 92  LEU A C   1 
ATOM   751  O  O   . LEU A 1 93  ? 32.623  -5.300  -15.418 1.00 10.92 ? 92  LEU A O   1 
ATOM   752  C  CB  . LEU A 1 93  ? 34.427  -4.993  -12.646 1.00 9.81  ? 92  LEU A CB  1 
ATOM   753  C  CG  . LEU A 1 93  ? 33.417  -3.844  -12.531 1.00 10.07 ? 92  LEU A CG  1 
ATOM   754  C  CD1 . LEU A 1 93  ? 32.018  -4.362  -12.164 1.00 10.74 ? 92  LEU A CD1 1 
ATOM   755  C  CD2 . LEU A 1 93  ? 33.879  -2.798  -11.532 1.00 9.86  ? 92  LEU A CD2 1 
ATOM   756  N  N   . LEU A 1 94  ? 34.834  -5.151  -15.826 1.00 11.36 ? 93  LEU A N   1 
ATOM   757  C  CA  . LEU A 1 94  ? 34.618  -4.579  -17.157 1.00 12.19 ? 93  LEU A CA  1 
ATOM   758  C  C   . LEU A 1 94  ? 33.866  -5.569  -18.059 1.00 11.60 ? 93  LEU A C   1 
ATOM   759  O  O   . LEU A 1 94  ? 32.982  -5.169  -18.803 1.00 12.06 ? 93  LEU A O   1 
ATOM   760  C  CB  . LEU A 1 94  ? 35.932  -4.121  -17.808 1.00 12.62 ? 93  LEU A CB  1 
ATOM   761  C  CG  . LEU A 1 94  ? 35.775  -3.399  -19.158 1.00 13.11 ? 93  LEU A CG  1 
ATOM   762  C  CD1 . LEU A 1 94  ? 34.976  -2.098  -18.997 1.00 14.29 ? 93  LEU A CD1 1 
ATOM   763  C  CD2 . LEU A 1 94  ? 37.123  -3.133  -19.812 1.00 13.46 ? 93  LEU A CD2 1 
ATOM   764  N  N   . THR A 1 95  ? 34.209  -6.855  -17.976 1.00 11.73 ? 94  THR A N   1 
ATOM   765  C  CA  . THR A 1 95  ? 33.487  -7.889  -18.722 1.00 11.75 ? 94  THR A CA  1 
ATOM   766  C  C   . THR A 1 95  ? 31.987  -7.875  -18.388 1.00 11.61 ? 94  THR A C   1 
ATOM   767  O  O   . THR A 1 95  ? 31.148  -7.928  -19.300 1.00 11.63 ? 94  THR A O   1 
ATOM   768  C  CB  . THR A 1 95  ? 34.135  -9.289  -18.528 1.00 11.89 ? 94  THR A CB  1 
ATOM   769  O  OG1 . THR A 1 95  ? 35.469  -9.238  -19.041 1.00 11.98 ? 94  THR A OG1 1 
ATOM   770  C  CG2 . THR A 1 95  ? 33.367  -10.386 -19.282 1.00 12.27 ? 94  THR A CG2 1 
ATOM   771  N  N   . ALA A 1 96  ? 31.668  -7.796  -17.095 1.00 11.23 ? 95  ALA A N   1 
ATOM   772  C  CA  . ALA A 1 96  ? 30.284  -7.746  -16.607 1.00 11.41 ? 95  ALA A CA  1 
ATOM   773  C  C   . ALA A 1 96  ? 29.565  -6.462  -17.031 1.00 11.52 ? 95  ALA A C   1 
ATOM   774  O  O   . ALA A 1 96  ? 28.385  -6.496  -17.413 1.00 11.24 ? 95  ALA A O   1 
ATOM   775  C  CB  . ALA A 1 96  ? 30.242  -7.901  -15.086 1.00 11.18 ? 95  ALA A CB  1 
ATOM   776  N  N   . ILE A 1 97  ? 30.288  -5.342  -16.986 1.00 11.76 ? 96  ILE A N   1 
ATOM   777  C  CA  . ILE A 1 97  ? 29.746  -4.052  -17.424 1.00 11.90 ? 96  ILE A CA  1 
ATOM   778  C  C   . ILE A 1 97  ? 29.391  -4.097  -18.914 1.00 12.48 ? 96  ILE A C   1 
ATOM   779  O  O   . ILE A 1 97  ? 28.287  -3.712  -19.317 1.00 12.30 ? 96  ILE A O   1 
ATOM   780  C  CB  . ILE A 1 97  ? 30.721  -2.886  -17.124 1.00 12.15 ? 96  ILE A CB  1 
ATOM   781  C  CG1 . ILE A 1 97  ? 30.799  -2.638  -15.615 1.00 11.73 ? 96  ILE A CG1 1 
ATOM   782  C  CG2 . ILE A 1 97  ? 30.279  -1.602  -17.853 1.00 12.55 ? 96  ILE A CG2 1 
ATOM   783  C  CD1 . ILE A 1 97  ? 31.848  -1.617  -15.193 1.00 11.53 ? 96  ILE A CD1 1 
ATOM   784  N  N   . LYS A 1 98  ? 30.324  -4.588  -19.724 1.00 13.10 ? 97  LYS A N   1 
ATOM   785  C  CA  . LYS A 1 98  ? 30.086  -4.715  -21.157 1.00 13.52 ? 97  LYS A CA  1 
ATOM   786  C  C   . LYS A 1 98  ? 28.936  -5.661  -21.451 1.00 13.50 ? 97  LYS A C   1 
ATOM   787  O  O   . LYS A 1 98  ? 28.127  -5.397  -22.336 1.00 13.80 ? 97  LYS A O   1 
ATOM   788  C  CB  . LYS A 1 98  ? 31.354  -5.146  -21.890 1.00 13.92 ? 97  LYS A CB  1 
ATOM   789  C  CG  . LYS A 1 98  ? 32.431  -4.070  -21.899 1.00 15.35 ? 97  LYS A CG  1 
ATOM   790  C  CD  . LYS A 1 98  ? 33.647  -4.541  -22.680 1.00 17.18 ? 97  LYS A CD  1 
ATOM   791  C  CE  . LYS A 1 98  ? 34.691  -3.447  -22.786 1.00 17.32 ? 97  LYS A CE  1 
ATOM   792  N  NZ  . LYS A 1 98  ? 35.932  -3.999  -23.397 1.00 19.27 ? 97  LYS A NZ  1 
ATOM   793  N  N   . SER A 1 99  ? 28.855  -6.755  -20.700 1.00 13.68 ? 98  SER A N   1 
ATOM   794  C  CA  . SER A 1 99  ? 27.795  -7.737  -20.890 1.00 14.20 ? 98  SER A CA  1 
ATOM   795  C  C   . SER A 1 99  ? 26.420  -7.153  -20.570 1.00 13.82 ? 98  SER A C   1 
ATOM   796  O  O   . SER A 1 99  ? 25.465  -7.340  -21.333 1.00 13.23 ? 98  SER A O   1 
ATOM   797  C  CB  . SER A 1 99  ? 28.053  -8.980  -20.038 1.00 14.53 ? 98  SER A CB  1 
ATOM   798  O  OG  . SER A 1 99  ? 27.227  -10.049 -20.457 1.00 17.64 ? 98  SER A OG  1 
ATOM   799  N  N   . ASP A 1 100 ? 26.332  -6.427  -19.456 1.00 13.43 ? 99  ASP A N   1 
ATOM   800  C  CA  . ASP A 1 100 ? 25.056  -5.911  -18.979 1.00 13.64 ? 99  ASP A CA  1 
ATOM   801  C  C   . ASP A 1 100 ? 24.680  -4.534  -19.515 1.00 13.82 ? 99  ASP A C   1 
ATOM   802  O  O   . ASP A 1 100 ? 23.495  -4.229  -19.617 1.00 14.24 ? 99  ASP A O   1 
ATOM   803  C  CB  . ASP A 1 100 ? 24.997  -5.954  -17.442 1.00 13.63 ? 99  ASP A CB  1 
ATOM   804  C  CG  . ASP A 1 100 ? 25.046  -7.374  -16.909 1.00 14.53 ? 99  ASP A CG  1 
ATOM   805  O  OD1 . ASP A 1 100 ? 24.566  -8.290  -17.629 1.00 14.70 ? 99  ASP A OD1 1 
ATOM   806  O  OD2 . ASP A 1 100 ? 25.580  -7.586  -15.792 1.00 13.21 ? 99  ASP A OD2 1 
ATOM   807  N  N   . PHE A 1 101 ? 25.669  -3.719  -19.890 1.00 13.67 ? 100 PHE A N   1 
ATOM   808  C  CA  . PHE A 1 101 ? 25.398  -2.340  -20.324 1.00 13.41 ? 100 PHE A CA  1 
ATOM   809  C  C   . PHE A 1 101 ? 25.993  -1.990  -21.676 1.00 13.53 ? 100 PHE A C   1 
ATOM   810  O  O   . PHE A 1 101 ? 25.788  -0.884  -22.171 1.00 13.82 ? 100 PHE A O   1 
ATOM   811  C  CB  . PHE A 1 101 ? 25.882  -1.335  -19.272 1.00 13.64 ? 100 PHE A CB  1 
ATOM   812  C  CG  . PHE A 1 101 ? 25.191  -1.479  -17.957 1.00 13.49 ? 100 PHE A CG  1 
ATOM   813  C  CD1 . PHE A 1 101 ? 25.767  -2.230  -16.942 1.00 13.59 ? 100 PHE A CD1 1 
ATOM   814  C  CD2 . PHE A 1 101 ? 23.941  -0.903  -17.748 1.00 13.88 ? 100 PHE A CD2 1 
ATOM   815  C  CE1 . PHE A 1 101 ? 25.122  -2.386  -15.717 1.00 14.71 ? 100 PHE A CE1 1 
ATOM   816  C  CE2 . PHE A 1 101 ? 23.284  -1.051  -16.515 1.00 14.95 ? 100 PHE A CE2 1 
ATOM   817  C  CZ  . PHE A 1 101 ? 23.871  -1.796  -15.510 1.00 14.49 ? 100 PHE A CZ  1 
ATOM   818  N  N   . GLY A 1 102 ? 26.726  -2.927  -22.274 1.00 13.24 ? 101 GLY A N   1 
ATOM   819  C  CA  . GLY A 1 102 ? 27.327  -2.701  -23.587 1.00 13.23 ? 101 GLY A CA  1 
ATOM   820  C  C   . GLY A 1 102 ? 28.708  -2.077  -23.505 1.00 13.11 ? 101 GLY A C   1 
ATOM   821  O  O   . GLY A 1 102 ? 29.625  -2.496  -24.218 1.00 12.88 ? 101 GLY A O   1 
ATOM   822  N  N   . SER A 1 103 ? 28.848  -1.069  -22.644 1.00 12.33 ? 102 SER A N   1 
ATOM   823  C  CA  . SER A 1 103 ? 30.096  -0.321  -22.480 1.00 12.36 ? 102 SER A CA  1 
ATOM   824  C  C   . SER A 1 103 ? 30.085  0.410   -21.142 1.00 12.07 ? 102 SER A C   1 
ATOM   825  O  O   . SER A 1 103 ? 29.014  0.608   -20.552 1.00 12.03 ? 102 SER A O   1 
ATOM   826  C  CB  . SER A 1 103 ? 30.263  0.707   -23.607 1.00 12.28 ? 102 SER A CB  1 
ATOM   827  O  OG  . SER A 1 103 ? 29.324  1.777   -23.478 1.00 12.64 ? 102 SER A OG  1 
ATOM   828  N  N   . LEU A 1 104 ? 31.270  0.801   -20.675 1.00 11.81 ? 103 LEU A N   1 
ATOM   829  C  CA  . LEU A 1 104 ? 31.391  1.628   -19.473 1.00 12.37 ? 103 LEU A CA  1 
ATOM   830  C  C   . LEU A 1 104 ? 30.699  2.970   -19.686 1.00 12.52 ? 103 LEU A C   1 
ATOM   831  O  O   . LEU A 1 104 ? 30.029  3.470   -18.783 1.00 12.04 ? 103 LEU A O   1 
ATOM   832  C  CB  . LEU A 1 104 ? 32.860  1.823   -19.078 1.00 12.29 ? 103 LEU A CB  1 
ATOM   833  C  CG  . LEU A 1 104 ? 33.139  2.706   -17.848 1.00 13.28 ? 103 LEU A CG  1 
ATOM   834  C  CD1 . LEU A 1 104 ? 32.490  2.140   -16.577 1.00 13.86 ? 103 LEU A CD1 1 
ATOM   835  C  CD2 . LEU A 1 104 ? 34.639  2.899   -17.650 1.00 13.08 ? 103 LEU A CD2 1 
ATOM   836  N  N   . ASP A 1 105 ? 30.843  3.550   -20.880 1.00 12.54 ? 104 ASP A N   1 
ATOM   837  C  CA  A ASP A 1 105 ? 30.169  4.812   -21.188 0.50 12.89 ? 104 ASP A CA  1 
ATOM   838  C  CA  B ASP A 1 105 ? 30.172  4.816   -21.183 0.50 13.02 ? 104 ASP A CA  1 
ATOM   839  C  C   . ASP A 1 105 ? 28.649  4.695   -21.037 1.00 12.99 ? 104 ASP A C   1 
ATOM   840  O  O   . ASP A 1 105 ? 28.010  5.566   -20.431 1.00 12.88 ? 104 ASP A O   1 
ATOM   841  C  CB  A ASP A 1 105 ? 30.539  5.307   -22.586 0.50 13.19 ? 104 ASP A CB  1 
ATOM   842  C  CB  B ASP A 1 105 ? 30.568  5.342   -22.569 0.50 13.47 ? 104 ASP A CB  1 
ATOM   843  C  CG  A ASP A 1 105 ? 29.971  6.681   -22.885 0.50 13.50 ? 104 ASP A CG  1 
ATOM   844  C  CG  B ASP A 1 105 ? 31.941  6.023   -22.581 0.50 14.22 ? 104 ASP A CG  1 
ATOM   845  O  OD1 A ASP A 1 105 ? 30.271  7.634   -22.136 0.50 13.66 ? 104 ASP A OD1 1 
ATOM   846  O  OD1 B ASP A 1 105 ? 32.434  6.459   -21.516 0.50 16.05 ? 104 ASP A OD1 1 
ATOM   847  O  OD2 A ASP A 1 105 ? 29.221  6.799   -23.874 0.50 15.41 ? 104 ASP A OD2 1 
ATOM   848  O  OD2 B ASP A 1 105 ? 32.528  6.137   -23.677 0.50 16.75 ? 104 ASP A OD2 1 
ATOM   849  N  N   . ASN A 1 106 ? 28.073  3.615   -21.575 1.00 12.48 ? 105 ASN A N   1 
ATOM   850  C  CA  . ASN A 1 106 ? 26.641  3.336   -21.433 1.00 12.60 ? 105 ASN A CA  1 
ATOM   851  C  C   . ASN A 1 106 ? 26.192  3.185   -19.970 1.00 12.30 ? 105 ASN A C   1 
ATOM   852  O  O   . ASN A 1 106 ? 25.154  3.721   -19.578 1.00 11.79 ? 105 ASN A O   1 
ATOM   853  C  CB  . ASN A 1 106 ? 26.245  2.068   -22.189 1.00 12.82 ? 105 ASN A CB  1 
ATOM   854  C  CG  . ASN A 1 106 ? 26.261  2.241   -23.691 1.00 15.17 ? 105 ASN A CG  1 
ATOM   855  O  OD1 . ASN A 1 106 ? 26.535  3.324   -24.200 1.00 17.69 ? 105 ASN A OD1 1 
ATOM   856  N  ND2 . ASN A 1 106 ? 25.964  1.154   -24.418 1.00 16.92 ? 105 ASN A ND2 1 
ATOM   857  N  N   . LEU A 1 107 ? 26.966  2.446   -19.178 1.00 11.80 ? 106 LEU A N   1 
ATOM   858  C  CA  . LEU A 1 107 ? 26.676  2.314   -17.749 1.00 11.93 ? 106 LEU A CA  1 
ATOM   859  C  C   . LEU A 1 107 ? 26.657  3.700   -17.084 1.00 12.05 ? 106 LEU A C   1 
ATOM   860  O  O   . LEU A 1 107 ? 25.699  4.049   -16.373 1.00 11.60 ? 106 LEU A O   1 
ATOM   861  C  CB  . LEU A 1 107 ? 27.721  1.428   -17.066 1.00 12.00 ? 106 LEU A CB  1 
ATOM   862  C  CG  . LEU A 1 107 ? 27.672  1.431   -15.536 1.00 12.77 ? 106 LEU A CG  1 
ATOM   863  C  CD1 . LEU A 1 107 ? 26.284  1.028   -15.047 1.00 13.21 ? 106 LEU A CD1 1 
ATOM   864  C  CD2 . LEU A 1 107 ? 28.725  0.480   -15.019 1.00 15.18 ? 106 LEU A CD2 1 
ATOM   865  N  N   . GLN A 1 108 ? 27.709  4.483   -17.326 1.00 11.66 ? 107 GLN A N   1 
ATOM   866  C  CA  . GLN A 1 108 ? 27.797  5.828   -16.744 1.00 12.32 ? 107 GLN A CA  1 
ATOM   867  C  C   . GLN A 1 108 ? 26.576  6.671   -17.103 1.00 11.39 ? 107 GLN A C   1 
ATOM   868  O  O   . GLN A 1 108 ? 25.978  7.294   -16.227 1.00 10.60 ? 107 GLN A O   1 
ATOM   869  C  CB  . GLN A 1 108 ? 29.111  6.529   -17.132 1.00 12.53 ? 107 GLN A CB  1 
ATOM   870  C  CG  . GLN A 1 108 ? 30.321  5.876   -16.465 1.00 14.36 ? 107 GLN A CG  1 
ATOM   871  C  CD  . GLN A 1 108 ? 31.619  6.647   -16.654 1.00 15.75 ? 107 GLN A CD  1 
ATOM   872  O  OE1 . GLN A 1 108 ? 31.669  7.672   -17.348 1.00 22.98 ? 107 GLN A OE1 1 
ATOM   873  N  NE2 . GLN A 1 108 ? 32.674  6.164   -16.021 1.00 16.99 ? 107 GLN A NE2 1 
ATOM   874  N  N   A LYS A 1 109 ? 26.201  6.643   -18.382 0.50 11.05 ? 108 LYS A N   1 
ATOM   875  N  N   B LYS A 1 109 ? 26.195  6.690   -18.377 0.50 11.00 ? 108 LYS A N   1 
ATOM   876  C  CA  A LYS A 1 109 ? 25.037  7.374   -18.889 0.50 11.23 ? 108 LYS A CA  1 
ATOM   877  C  CA  B LYS A 1 109 ? 25.056  7.509   -18.808 0.50 11.01 ? 108 LYS A CA  1 
ATOM   878  C  C   A LYS A 1 109 ? 23.752  6.931   -18.192 0.50 10.74 ? 108 LYS A C   1 
ATOM   879  C  C   B LYS A 1 109 ? 23.752  7.052   -18.164 0.50 10.47 ? 108 LYS A C   1 
ATOM   880  O  O   A LYS A 1 109 ? 22.975  7.764   -17.730 0.50 10.48 ? 108 LYS A O   1 
ATOM   881  O  O   B LYS A 1 109 ? 22.942  7.871   -17.737 0.50 10.15 ? 108 LYS A O   1 
ATOM   882  C  CB  A LYS A 1 109 ? 24.911  7.186   -20.409 0.50 11.07 ? 108 LYS A CB  1 
ATOM   883  C  CB  B LYS A 1 109 ? 24.925  7.508   -20.334 0.50 11.18 ? 108 LYS A CB  1 
ATOM   884  C  CG  A LYS A 1 109 ? 23.753  7.942   -21.051 0.50 11.40 ? 108 LYS A CG  1 
ATOM   885  C  CG  B LYS A 1 109 ? 25.720  8.599   -21.030 0.50 13.00 ? 108 LYS A CG  1 
ATOM   886  C  CD  A LYS A 1 109 ? 23.676  7.694   -22.555 0.50 12.38 ? 108 LYS A CD  1 
ATOM   887  C  CD  B LYS A 1 109 ? 27.187  8.249   -21.147 0.50 15.92 ? 108 LYS A CD  1 
ATOM   888  C  CE  A LYS A 1 109 ? 22.660  8.628   -23.205 0.50 13.86 ? 108 LYS A CE  1 
ATOM   889  C  CE  B LYS A 1 109 ? 27.992  9.424   -21.640 0.50 17.31 ? 108 LYS A CE  1 
ATOM   890  N  NZ  A LYS A 1 109 ? 22.444  8.320   -24.651 0.50 14.95 ? 108 LYS A NZ  1 
ATOM   891  N  NZ  B LYS A 1 109 ? 29.438  9.161   -21.450 0.50 19.43 ? 108 LYS A NZ  1 
ATOM   892  N  N   A GLN A 1 110 ? 23.540  5.621   -18.105 0.50 10.66 ? 109 GLN A N   1 
ATOM   893  N  N   B GLN A 1 110 ? 23.573  5.739   -18.071 0.50 10.20 ? 109 GLN A N   1 
ATOM   894  C  CA  A GLN A 1 110 ? 22.298  5.098   -17.539 0.50 10.38 ? 109 GLN A CA  1 
ATOM   895  C  CA  B GLN A 1 110 ? 22.335  5.165   -17.550 0.50 9.69  ? 109 GLN A CA  1 
ATOM   896  C  C   A GLN A 1 110 ? 22.205  5.403   -16.055 0.50 9.66  ? 109 GLN A C   1 
ATOM   897  C  C   B GLN A 1 110 ? 22.202  5.385   -16.056 0.50 9.31  ? 109 GLN A C   1 
ATOM   898  O  O   A GLN A 1 110 ? 21.169  5.882   -15.583 0.50 9.41  ? 109 GLN A O   1 
ATOM   899  O  O   B GLN A 1 110 ? 21.134  5.778   -15.575 0.50 9.05  ? 109 GLN A O   1 
ATOM   900  C  CB  A GLN A 1 110 ? 22.150  3.590   -17.772 0.50 10.56 ? 109 GLN A CB  1 
ATOM   901  C  CB  B GLN A 1 110 ? 22.262  3.670   -17.857 0.50 10.02 ? 109 GLN A CB  1 
ATOM   902  C  CG  A GLN A 1 110 ? 20.749  3.069   -17.428 0.50 11.51 ? 109 GLN A CG  1 
ATOM   903  C  CG  B GLN A 1 110 ? 21.951  3.353   -19.310 0.50 10.14 ? 109 GLN A CG  1 
ATOM   904  C  CD  A GLN A 1 110 ? 20.580  1.567   -17.601 0.50 11.58 ? 109 GLN A CD  1 
ATOM   905  C  CD  B GLN A 1 110 ? 22.014  1.870   -19.610 0.50 12.30 ? 109 GLN A CD  1 
ATOM   906  O  OE1 A GLN A 1 110 ? 20.115  0.873   -16.690 0.50 12.91 ? 109 GLN A OE1 1 
ATOM   907  O  OE1 B GLN A 1 110 ? 21.671  1.041   -18.770 0.50 13.39 ? 109 GLN A OE1 1 
ATOM   908  N  NE2 A GLN A 1 110 ? 20.945  1.058   -18.774 0.50 13.36 ? 109 GLN A NE2 1 
ATOM   909  N  NE2 B GLN A 1 110 ? 22.452  1.528   -20.822 0.50 11.21 ? 109 GLN A NE2 1 
ATOM   910  N  N   . LEU A 1 111 ? 23.278  5.118   -15.317 1.00 8.75  ? 110 LEU A N   1 
ATOM   911  C  CA  . LEU A 1 111 ? 23.269  5.379   -13.872 1.00 7.75  ? 110 LEU A CA  1 
ATOM   912  C  C   . LEU A 1 111 ? 23.134  6.884   -13.602 1.00 7.82  ? 110 LEU A C   1 
ATOM   913  O  O   . LEU A 1 111 ? 22.365  7.300   -12.728 1.00 7.68  ? 110 LEU A O   1 
ATOM   914  C  CB  . LEU A 1 111 ? 24.508  4.791   -13.179 1.00 7.59  ? 110 LEU A CB  1 
ATOM   915  C  CG  . LEU A 1 111 ? 24.584  5.062   -11.663 1.00 8.01  ? 110 LEU A CG  1 
ATOM   916  C  CD1 . LEU A 1 111 ? 23.359  4.548   -10.894 1.00 7.62  ? 110 LEU A CD1 1 
ATOM   917  C  CD2 . LEU A 1 111 ? 25.830  4.454   -11.062 1.00 7.00  ? 110 LEU A CD2 1 
ATOM   918  N  N   . SER A 1 112 ? 23.843  7.710   -14.378 1.00 7.05  ? 111 SER A N   1 
ATOM   919  C  CA  . SER A 1 112 ? 23.741  9.163   -14.187 1.00 8.28  ? 111 SER A CA  1 
ATOM   920  C  C   . SER A 1 112 ? 22.306  9.680   -14.403 1.00 8.68  ? 111 SER A C   1 
ATOM   921  O  O   . SER A 1 112 ? 21.783  10.463  -13.593 1.00 8.19  ? 111 SER A O   1 
ATOM   922  C  CB  . SER A 1 112 ? 24.716  9.897   -15.112 1.00 8.24  ? 111 SER A CB  1 
ATOM   923  O  OG  . SER A 1 112 ? 26.047  9.620   -14.711 1.00 8.85  ? 111 SER A OG  1 
ATOM   924  N  N   . ALA A 1 113 ? 21.676  9.212   -15.477 1.00 8.88  ? 112 ALA A N   1 
ATOM   925  C  CA  . ALA A 1 113 ? 20.306  9.618   -15.797 1.00 8.92  ? 112 ALA A CA  1 
ATOM   926  C  C   . ALA A 1 113 ? 19.340  9.187   -14.695 1.00 8.97  ? 112 ALA A C   1 
ATOM   927  O  O   . ALA A 1 113 ? 18.508  9.988   -14.249 1.00 8.96  ? 112 ALA A O   1 
ATOM   928  C  CB  . ALA A 1 113 ? 19.870  9.044   -17.130 1.00 8.57  ? 112 ALA A CB  1 
ATOM   929  N  N   . SER A 1 114 ? 19.449  7.936   -14.243 1.00 8.65  ? 113 SER A N   1 
ATOM   930  C  CA  . SER A 1 114 ? 18.523  7.468   -13.192 1.00 8.68  ? 113 SER A CA  1 
ATOM   931  C  C   . SER A 1 114 ? 18.712  8.256   -11.890 1.00 8.35  ? 113 SER A C   1 
ATOM   932  O  O   . SER A 1 114 ? 17.743  8.572   -11.176 1.00 8.07  ? 113 SER A O   1 
ATOM   933  C  CB  . SER A 1 114 ? 18.662  5.963   -12.926 1.00 8.84  ? 113 SER A CB  1 
ATOM   934  O  OG  . SER A 1 114 ? 18.357  5.195   -14.081 1.00 10.34 ? 113 SER A OG  1 
ATOM   935  N  N   . THR A 1 115 ? 19.966  8.558   -11.581 1.00 7.71  ? 114 THR A N   1 
ATOM   936  C  CA  . THR A 1 115 ? 20.318  9.248   -10.336 1.00 7.46  ? 114 THR A CA  1 
ATOM   937  C  C   . THR A 1 115 ? 19.829  10.701  -10.385 1.00 7.41  ? 114 THR A C   1 
ATOM   938  O  O   . THR A 1 115 ? 19.208  11.203  -9.446  1.00 6.34  ? 114 THR A O   1 
ATOM   939  C  CB  . THR A 1 115 ? 21.843  9.199   -10.112 1.00 7.64  ? 114 THR A CB  1 
ATOM   940  O  OG1 . THR A 1 115 ? 22.254  7.833   -10.008 1.00 7.23  ? 114 THR A OG1 1 
ATOM   941  C  CG2 . THR A 1 115 ? 22.239  9.926   -8.847  1.00 7.49  ? 114 THR A CG2 1 
ATOM   942  N  N   . VAL A 1 116 ? 20.083  11.362  -11.497 1.00 7.45  ? 115 VAL A N   1 
ATOM   943  C  CA  . VAL A 1 116 ? 19.598  12.738  -11.653 1.00 8.86  ? 115 VAL A CA  1 
ATOM   944  C  C   . VAL A 1 116 ? 18.068  12.828  -11.495 1.00 8.88  ? 115 VAL A C   1 
ATOM   945  O  O   . VAL A 1 116 ? 17.549  13.821  -10.956 1.00 10.12 ? 115 VAL A O   1 
ATOM   946  C  CB  . VAL A 1 116 ? 20.069  13.339  -12.976 1.00 9.03  ? 115 VAL A CB  1 
ATOM   947  C  CG1 . VAL A 1 116 ? 19.248  14.576  -13.345 1.00 11.22 ? 115 VAL A CG1 1 
ATOM   948  C  CG2 . VAL A 1 116 ? 21.574  13.687  -12.876 1.00 8.88  ? 115 VAL A CG2 1 
ATOM   949  N  N   . ALA A 1 117 ? 17.367  11.790  -11.950 1.00 8.27  ? 116 ALA A N   1 
ATOM   950  C  CA  . ALA A 1 117 ? 15.902  11.770  -11.963 1.00 8.09  ? 116 ALA A CA  1 
ATOM   951  C  C   . ALA A 1 117 ? 15.269  11.532  -10.602 1.00 8.06  ? 116 ALA A C   1 
ATOM   952  O  O   . ALA A 1 117 ? 14.048  11.603  -10.482 1.00 7.18  ? 116 ALA A O   1 
ATOM   953  C  CB  . ALA A 1 117 ? 15.391  10.738  -12.965 1.00 8.72  ? 116 ALA A CB  1 
ATOM   954  N  N   . VAL A 1 118 ? 16.078  11.227  -9.587  1.00 7.77  ? 117 VAL A N   1 
ATOM   955  C  CA  . VAL A 1 118 ? 15.571  11.029  -8.204  1.00 7.36  ? 117 VAL A CA  1 
ATOM   956  C  C   . VAL A 1 118 ? 14.804  12.286  -7.775  1.00 7.56  ? 117 VAL A C   1 
ATOM   957  O  O   . VAL A 1 118 ? 15.323  13.409  -7.856  1.00 7.77  ? 117 VAL A O   1 
ATOM   958  C  CB  . VAL A 1 118 ? 16.722  10.690  -7.198  1.00 7.05  ? 117 VAL A CB  1 
ATOM   959  C  CG1 . VAL A 1 118 ? 16.253  10.766  -5.747  1.00 8.49  ? 117 VAL A CG1 1 
ATOM   960  C  CG2 . VAL A 1 118 ? 17.292  9.299   -7.499  1.00 8.66  ? 117 VAL A CG2 1 
ATOM   961  N  N   . GLN A 1 119 ? 13.559  12.097  -7.346  1.00 7.34  ? 118 GLN A N   1 
ATOM   962  C  CA  . GLN A 1 119 ? 12.741  13.218  -6.865  1.00 8.41  ? 118 GLN A CA  1 
ATOM   963  C  C   . GLN A 1 119 ? 12.963  13.381  -5.369  1.00 8.73  ? 118 GLN A C   1 
ATOM   964  O  O   . GLN A 1 119 ? 12.614  12.489  -4.578  1.00 9.52  ? 118 GLN A O   1 
ATOM   965  C  CB  . GLN A 1 119 ? 11.260  12.984  -7.165  1.00 8.41  ? 118 GLN A CB  1 
ATOM   966  C  CG  . GLN A 1 119 ? 10.955  12.974  -8.653  1.00 10.62 ? 118 GLN A CG  1 
ATOM   967  C  CD  . GLN A 1 119 ? 9.480   12.747  -8.933  1.00 14.00 ? 118 GLN A CD  1 
ATOM   968  O  OE1 . GLN A 1 119 ? 9.027   12.936  -10.065 1.00 17.69 ? 118 GLN A OE1 1 
ATOM   969  N  NE2 . GLN A 1 119 ? 8.729   12.379  -7.909  1.00 13.84 ? 118 GLN A NE2 1 
ATOM   970  N  N   . GLY A 1 120 ? 13.554  14.515  -4.986  1.00 7.86  ? 119 GLY A N   1 
ATOM   971  C  CA  . GLY A 1 120 ? 13.874  14.750  -3.590  1.00 7.67  ? 119 GLY A CA  1 
ATOM   972  C  C   . GLY A 1 120 ? 15.225  14.156  -3.244  1.00 7.26  ? 119 GLY A C   1 
ATOM   973  O  O   . GLY A 1 120 ? 16.149  14.150  -4.071  1.00 7.35  ? 119 GLY A O   1 
ATOM   974  N  N   . SER A 1 121 ? 15.339  13.659  -2.015  1.00 6.82  ? 120 SER A N   1 
ATOM   975  C  CA  . SER A 1 121 ? 16.622  13.149  -1.523  1.00 6.66  ? 120 SER A CA  1 
ATOM   976  C  C   . SER A 1 121 ? 16.756  11.657  -1.826  1.00 7.13  ? 120 SER A C   1 
ATOM   977  O  O   . SER A 1 121 ? 15.789  10.898  -1.735  1.00 7.28  ? 120 SER A O   1 
ATOM   978  C  CB  . SER A 1 121 ? 16.749  13.343  -0.002  1.00 6.37  ? 120 SER A CB  1 
ATOM   979  O  OG  . SER A 1 121 ? 16.503  14.680  0.386   1.00 7.84  ? 120 SER A OG  1 
ATOM   980  N  N   . GLY A 1 122 ? 17.966  11.236  -2.177  1.00 6.90  ? 121 GLY A N   1 
ATOM   981  C  CA  . GLY A 1 122 ? 18.186  9.830   -2.412  1.00 7.37  ? 121 GLY A CA  1 
ATOM   982  C  C   . GLY A 1 122 ? 19.534  9.510   -2.992  1.00 7.31  ? 121 GLY A C   1 
ATOM   983  O  O   . GLY A 1 122 ? 20.444  10.338  -2.996  1.00 7.59  ? 121 GLY A O   1 
ATOM   984  N  N   . TRP A 1 123 ? 19.611  8.284   -3.444  1.00 6.98  ? 122 TRP A N   1 
ATOM   985  C  CA  . TRP A 1 123 ? 20.834  7.711   -3.947  1.00 6.60  ? 122 TRP A CA  1 
ATOM   986  C  C   . TRP A 1 123 ? 20.690  6.968   -5.267  1.00 6.36  ? 122 TRP A C   1 
ATOM   987  O  O   . TRP A 1 123 ? 19.645  6.413   -5.581  1.00 7.03  ? 122 TRP A O   1 
ATOM   988  C  CB  . TRP A 1 123 ? 21.355  6.639   -2.957  1.00 6.10  ? 122 TRP A CB  1 
ATOM   989  C  CG  . TRP A 1 123 ? 21.830  7.202   -1.665  1.00 6.76  ? 122 TRP A CG  1 
ATOM   990  C  CD1 . TRP A 1 123 ? 21.066  7.676   -0.629  1.00 7.80  ? 122 TRP A CD1 1 
ATOM   991  C  CD2 . TRP A 1 123 ? 23.194  7.349   -1.267  1.00 7.96  ? 122 TRP A CD2 1 
ATOM   992  N  NE1 . TRP A 1 123 ? 21.891  8.127   0.392   1.00 7.38  ? 122 TRP A NE1 1 
ATOM   993  C  CE2 . TRP A 1 123 ? 23.200  7.929   0.021   1.00 6.33  ? 122 TRP A CE2 1 
ATOM   994  C  CE3 . TRP A 1 123 ? 24.415  7.046   -1.850  1.00 7.89  ? 122 TRP A CE3 1 
ATOM   995  C  CZ2 . TRP A 1 123 ? 24.388  8.206   0.718   1.00 6.86  ? 122 TRP A CZ2 1 
ATOM   996  C  CZ3 . TRP A 1 123 ? 25.606  7.307   -1.178  1.00 7.99  ? 122 TRP A CZ3 1 
ATOM   997  C  CH2 . TRP A 1 123 ? 25.577  7.880   0.109   1.00 7.84  ? 122 TRP A CH2 1 
ATOM   998  N  N   . GLY A 1 124 ? 21.771  6.942   -6.025  1.00 6.10  ? 123 GLY A N   1 
ATOM   999  C  CA  . GLY A 1 124 ? 21.838  6.190   -7.253  1.00 6.89  ? 123 GLY A CA  1 
ATOM   1000 C  C   . GLY A 1 124 ? 22.821  5.055   -7.013  1.00 7.32  ? 123 GLY A C   1 
ATOM   1001 O  O   . GLY A 1 124 ? 23.853  5.306   -6.412  1.00 7.93  ? 123 GLY A O   1 
ATOM   1002 N  N   . TRP A 1 125 ? 22.555  3.853   -7.488  1.00 8.04  ? 124 TRP A N   1 
ATOM   1003 C  CA  . TRP A 1 125 ? 23.481  2.760   -7.238  1.00 7.99  ? 124 TRP A CA  1 
ATOM   1004 C  C   . TRP A 1 125 ? 23.710  1.853   -8.420  1.00 8.04  ? 124 TRP A C   1 
ATOM   1005 O  O   . TRP A 1 125 ? 22.797  1.572   -9.191  1.00 8.22  ? 124 TRP A O   1 
ATOM   1006 C  CB  . TRP A 1 125 ? 22.953  1.774   -6.162  1.00 7.32  ? 124 TRP A CB  1 
ATOM   1007 C  CG  . TRP A 1 125 ? 22.899  2.361   -4.803  1.00 7.75  ? 124 TRP A CG  1 
ATOM   1008 C  CD1 . TRP A 1 125 ? 21.800  2.858   -4.179  1.00 8.78  ? 124 TRP A CD1 1 
ATOM   1009 C  CD2 . TRP A 1 125 ? 23.988  2.460   -3.886  1.00 7.94  ? 124 TRP A CD2 1 
ATOM   1010 N  NE1 . TRP A 1 125 ? 22.141  3.299   -2.916  1.00 7.91  ? 124 TRP A NE1 1 
ATOM   1011 C  CE2 . TRP A 1 125 ? 23.479  3.082   -2.716  1.00 8.73  ? 124 TRP A CE2 1 
ATOM   1012 C  CE3 . TRP A 1 125 ? 25.348  2.110   -3.901  1.00 8.46  ? 124 TRP A CE3 1 
ATOM   1013 C  CZ2 . TRP A 1 125 ? 24.289  3.361   -1.600  1.00 7.90  ? 124 TRP A CZ2 1 
ATOM   1014 C  CZ3 . TRP A 1 125 ? 26.155  2.400   -2.814  1.00 8.90  ? 124 TRP A CZ3 1 
ATOM   1015 C  CH2 . TRP A 1 125 ? 25.618  3.023   -1.678  1.00 8.29  ? 124 TRP A CH2 1 
ATOM   1016 N  N   . LEU A 1 126 ? 24.942  1.412   -8.515  1.00 7.28  ? 125 LEU A N   1 
ATOM   1017 C  CA  . LEU A 1 126 ? 25.317  0.380   -9.436  1.00 8.15  ? 125 LEU A CA  1 
ATOM   1018 C  C   . LEU A 1 126 ? 25.269  -0.843  -8.544  1.00 8.38  ? 125 LEU A C   1 
ATOM   1019 O  O   . LEU A 1 126 ? 26.014  -0.846  -7.561  1.00 9.03  ? 125 LEU A O   1 
ATOM   1020 C  CB  . LEU A 1 126 ? 26.716  0.468   -10.059 1.00 8.04  ? 125 LEU A CB  1 
ATOM   1021 C  CG  . LEU A 1 126 ? 27.230  -0.834  -10.718 1.00 9.01  ? 125 LEU A CG  1 
ATOM   1022 C  CD1 . LEU A 1 126 ? 26.360  -1.205  -11.919 1.00 8.44  ? 125 LEU A CD1 1 
ATOM   1023 C  CD2 . LEU A 1 126 ? 28.692  -0.677  -11.139 1.00 9.55  ? 125 LEU A CD2 1 
ATOM   1024 N  N   . GLY A 1 127 ? 24.468  -1.832  -8.710  1.00 8.41  ? 126 GLY A N   1 
ATOM   1025 C  CA  . GLY A 1 127 ? 24.429  -2.949  -7.809  1.00 8.71  ? 126 GLY A CA  1 
ATOM   1026 C  C   . GLY A 1 127 ? 24.529  -4.304  -8.520  1.00 9.32  ? 126 GLY A C   1 
ATOM   1027 O  O   . GLY A 1 127 ? 24.405  -4.375  -9.752  1.00 9.76  ? 126 GLY A O   1 
ATOM   1028 N  N   . TYR A 1 128 ? 24.743  -5.349  -7.731  1.00 9.93  ? 127 TYR A N   1 
ATOM   1029 C  CA  . TYR A 1 128 ? 24.842  -6.706  -8.260  1.00 11.15 ? 127 TYR A CA  1 
ATOM   1030 C  C   . TYR A 1 128 ? 23.675  -7.512  -7.721  1.00 12.05 ? 127 TYR A C   1 
ATOM   1031 O  O   . TYR A 1 128 ? 23.431  -7.525  -6.504  1.00 11.13 ? 127 TYR A O   1 
ATOM   1032 C  CB  . TYR A 1 128 ? 26.171  -7.341  -7.844  1.00 11.19 ? 127 TYR A CB  1 
ATOM   1033 C  CG  . TYR A 1 128 ? 26.335  -8.775  -8.284  1.00 12.00 ? 127 TYR A CG  1 
ATOM   1034 C  CD1 . TYR A 1 128 ? 26.661  -9.071  -9.606  1.00 10.85 ? 127 TYR A CD1 1 
ATOM   1035 C  CD2 . TYR A 1 128 ? 26.170  -9.831  -7.382  1.00 11.74 ? 127 TYR A CD2 1 
ATOM   1036 C  CE1 . TYR A 1 128 ? 26.817  -10.380 -10.032 1.00 12.74 ? 127 TYR A CE1 1 
ATOM   1037 C  CE2 . TYR A 1 128 ? 26.335  -11.164 -7.805  1.00 13.84 ? 127 TYR A CE2 1 
ATOM   1038 C  CZ  . TYR A 1 128 ? 26.660  -11.413 -9.131  1.00 12.78 ? 127 TYR A CZ  1 
ATOM   1039 O  OH  . TYR A 1 128 ? 26.832  -12.692 -9.592  1.00 14.57 ? 127 TYR A OH  1 
ATOM   1040 N  N   . CYS A 1 129 ? 22.935  -8.147  -8.627  1.00 14.20 ? 128 CYS A N   1 
ATOM   1041 C  CA  . CYS A 1 129 ? 21.833  -9.016  -8.232  1.00 15.21 ? 128 CYS A CA  1 
ATOM   1042 C  C   . CYS A 1 129 ? 22.342  -10.445 -8.093  1.00 15.91 ? 128 CYS A C   1 
ATOM   1043 O  O   . CYS A 1 129 ? 22.719  -11.060 -9.091  1.00 15.15 ? 128 CYS A O   1 
ATOM   1044 C  CB  . CYS A 1 129 ? 20.692  -8.939  -9.248  1.00 15.55 ? 128 CYS A CB  1 
ATOM   1045 S  SG  . CYS A 1 129 ? 19.314  -10.063 -8.881  1.00 18.91 ? 128 CYS A SG  1 
ATOM   1046 N  N   . PRO A 1 130 ? 22.377  -10.971 -6.850  1.00 16.53 ? 129 PRO A N   1 
ATOM   1047 C  CA  . PRO A 1 130 ? 22.895  -12.322 -6.636  1.00 17.19 ? 129 PRO A CA  1 
ATOM   1048 C  C   . PRO A 1 130 ? 22.030  -13.403 -7.288  1.00 17.20 ? 129 PRO A C   1 
ATOM   1049 O  O   . PRO A 1 130 ? 22.548  -14.470 -7.637  1.00 18.04 ? 129 PRO A O   1 
ATOM   1050 C  CB  . PRO A 1 130 ? 22.884  -12.470 -5.108  1.00 17.05 ? 129 PRO A CB  1 
ATOM   1051 C  CG  . PRO A 1 130 ? 21.921  -11.463 -4.620  1.00 17.91 ? 129 PRO A CG  1 
ATOM   1052 C  CD  . PRO A 1 130 ? 21.964  -10.329 -5.587  1.00 16.79 ? 129 PRO A CD  1 
ATOM   1053 N  N   . LYS A 1 131 ? 20.739  -13.113 -7.465  1.00 17.23 ? 130 LYS A N   1 
ATOM   1054 C  CA  . LYS A 1 131 ? 19.804  -14.044 -8.106  1.00 17.71 ? 130 LYS A CA  1 
ATOM   1055 C  C   . LYS A 1 131 ? 20.008  -14.125 -9.621  1.00 17.55 ? 130 LYS A C   1 
ATOM   1056 O  O   . LYS A 1 131 ? 20.197  -15.214 -10.163 1.00 17.91 ? 130 LYS A O   1 
ATOM   1057 C  CB  . LYS A 1 131 ? 18.359  -13.680 -7.761  1.00 17.91 ? 130 LYS A CB  1 
ATOM   1058 N  N   . GLY A 1 132 ? 19.979  -12.980 -10.305 1.00 17.24 ? 131 GLY A N   1 
ATOM   1059 C  CA  . GLY A 1 132 ? 20.202  -12.952 -11.750 1.00 16.98 ? 131 GLY A CA  1 
ATOM   1060 C  C   . GLY A 1 132 ? 21.665  -13.042 -12.159 1.00 16.73 ? 131 GLY A C   1 
ATOM   1061 O  O   . GLY A 1 132 ? 21.977  -13.301 -13.328 1.00 16.66 ? 131 GLY A O   1 
ATOM   1062 N  N   . LYS A 1 133 ? 22.566  -12.797 -11.197 1.00 16.24 ? 132 LYS A N   1 
ATOM   1063 C  CA  . LYS A 1 133 ? 24.011  -12.771 -11.453 1.00 15.68 ? 132 LYS A CA  1 
ATOM   1064 C  C   . LYS A 1 133 ? 24.323  -11.709 -12.497 1.00 14.86 ? 132 LYS A C   1 
ATOM   1065 O  O   . LYS A 1 133 ? 25.183  -11.914 -13.354 1.00 14.30 ? 132 LYS A O   1 
ATOM   1066 C  CB  . LYS A 1 133 ? 24.535  -14.143 -11.866 1.00 16.33 ? 132 LYS A CB  1 
ATOM   1067 C  CG  . LYS A 1 133 ? 24.738  -15.117 -10.727 1.00 18.36 ? 132 LYS A CG  1 
ATOM   1068 C  CD  . LYS A 1 133 ? 24.278  -16.509 -11.092 1.00 22.57 ? 132 LYS A CD  1 
ATOM   1069 C  CE  . LYS A 1 133 ? 22.782  -16.683 -10.860 1.00 24.37 ? 132 LYS A CE  1 
ATOM   1070 N  NZ  . LYS A 1 133 ? 22.220  -17.800 -11.660 1.00 22.81 ? 132 LYS A NZ  1 
ATOM   1071 N  N   . ILE A 1 134 ? 23.628  -10.578 -12.400 1.00 14.04 ? 133 ILE A N   1 
ATOM   1072 C  CA  . ILE A 1 134 ? 23.869  -9.465  -13.304 1.00 14.03 ? 133 ILE A CA  1 
ATOM   1073 C  C   . ILE A 1 134 ? 23.942  -8.131  -12.569 1.00 12.28 ? 133 ILE A C   1 
ATOM   1074 O  O   . ILE A 1 134 ? 23.460  -7.990  -11.437 1.00 11.67 ? 133 ILE A O   1 
ATOM   1075 C  CB  . ILE A 1 134 ? 22.809  -9.377  -14.446 1.00 14.03 ? 133 ILE A CB  1 
ATOM   1076 C  CG1 . ILE A 1 134 ? 21.411  -9.139  -13.882 1.00 15.35 ? 133 ILE A CG1 1 
ATOM   1077 C  CG2 . ILE A 1 134 ? 22.819  -10.650 -15.298 1.00 15.43 ? 133 ILE A CG2 1 
ATOM   1078 C  CD1 . ILE A 1 134 ? 20.371  -8.852  -14.946 1.00 15.68 ? 133 ILE A CD1 1 
ATOM   1079 N  N   . LEU A 1 135 ? 24.547  -7.161  -13.244 1.00 11.36 ? 134 LEU A N   1 
ATOM   1080 C  CA  . LEU A 1 135 ? 24.643  -5.798  -12.736 1.00 10.95 ? 134 LEU A CA  1 
ATOM   1081 C  C   . LEU A 1 135 ? 23.370  -5.052  -13.065 1.00 11.27 ? 134 LEU A C   1 
ATOM   1082 O  O   . LEU A 1 135 ? 22.735  -5.283  -14.096 1.00 11.13 ? 134 LEU A O   1 
ATOM   1083 C  CB  . LEU A 1 135 ? 25.829  -5.073  -13.373 1.00 11.05 ? 134 LEU A CB  1 
ATOM   1084 C  CG  . LEU A 1 135 ? 27.220  -5.661  -13.138 1.00 10.91 ? 134 LEU A CG  1 
ATOM   1085 C  CD1 . LEU A 1 135 ? 28.259  -4.948  -13.986 1.00 11.15 ? 134 LEU A CD1 1 
ATOM   1086 C  CD2 . LEU A 1 135 ? 27.577  -5.599  -11.654 1.00 10.77 ? 134 LEU A CD2 1 
ATOM   1087 N  N   . LYS A 1 136 ? 22.977  -4.152  -12.164 1.00 10.96 ? 135 LYS A N   1 
ATOM   1088 C  CA  . LYS A 1 136 ? 21.778  -3.387  -12.304 1.00 11.82 ? 135 LYS A CA  1 
ATOM   1089 C  C   . LYS A 1 136 ? 21.922  -1.968  -11.767 1.00 10.65 ? 135 LYS A C   1 
ATOM   1090 O  O   . LYS A 1 136 ? 22.678  -1.737  -10.817 1.00 10.83 ? 135 LYS A O   1 
ATOM   1091 C  CB  . LYS A 1 136 ? 20.631  -4.015  -11.499 1.00 11.55 ? 135 LYS A CB  1 
ATOM   1092 C  CG  . LYS A 1 136 ? 20.149  -5.378  -11.975 1.00 13.49 ? 135 LYS A CG  1 
ATOM   1093 C  CD  . LYS A 1 136 ? 18.864  -5.805  -11.297 1.00 14.78 ? 135 LYS A CD  1 
ATOM   1094 C  CE  . LYS A 1 136 ? 18.280  -7.045  -11.947 1.00 19.61 ? 135 LYS A CE  1 
ATOM   1095 N  NZ  . LYS A 1 136 ? 17.257  -7.692  -11.084 1.00 22.48 ? 135 LYS A NZ  1 
ATOM   1096 N  N   . VAL A 1 137 ? 21.184  -1.032  -12.354 1.00 9.49  ? 136 VAL A N   1 
ATOM   1097 C  CA  . VAL A 1 137 ? 21.129  0.328   -11.886 1.00 8.89  ? 136 VAL A CA  1 
ATOM   1098 C  C   . VAL A 1 137 ? 19.870  0.390   -11.032 1.00 9.10  ? 136 VAL A C   1 
ATOM   1099 O  O   . VAL A 1 137 ? 18.820  -0.100  -11.442 1.00 9.10  ? 136 VAL A O   1 
ATOM   1100 C  CB  . VAL A 1 137 ? 21.048  1.354   -13.051 1.00 8.89  ? 136 VAL A CB  1 
ATOM   1101 C  CG1 . VAL A 1 137 ? 20.594  2.725   -12.546 1.00 8.92  ? 136 VAL A CG1 1 
ATOM   1102 C  CG2 . VAL A 1 137 ? 22.388  1.469   -13.758 1.00 10.27 ? 136 VAL A CG2 1 
ATOM   1103 N  N   . ALA A 1 138 ? 19.972  0.986   -9.844  1.00 8.52  ? 137 ALA A N   1 
ATOM   1104 C  CA  . ALA A 1 138 ? 18.809  1.157   -8.973  1.00 8.82  ? 137 ALA A CA  1 
ATOM   1105 C  C   . ALA A 1 138 ? 18.889  2.498   -8.236  1.00 8.48  ? 137 ALA A C   1 
ATOM   1106 O  O   . ALA A 1 138 ? 19.978  3.047   -8.052  1.00 9.85  ? 137 ALA A O   1 
ATOM   1107 C  CB  . ALA A 1 138 ? 18.720  0.013   -7.969  1.00 8.64  ? 137 ALA A CB  1 
ATOM   1108 N  N   . THR A 1 139 ? 17.749  3.039   -7.829  1.00 8.06  ? 138 THR A N   1 
ATOM   1109 C  CA  . THR A 1 139 ? 17.784  4.230   -6.997  1.00 8.26  ? 138 THR A CA  1 
ATOM   1110 C  C   . THR A 1 139 ? 17.020  3.951   -5.720  1.00 7.60  ? 138 THR A C   1 
ATOM   1111 O  O   . THR A 1 139 ? 16.102  3.120   -5.702  1.00 8.26  ? 138 THR A O   1 
ATOM   1112 C  CB  . THR A 1 139 ? 17.206  5.468   -7.678  1.00 8.71  ? 138 THR A CB  1 
ATOM   1113 O  OG1 . THR A 1 139 ? 15.819  5.259   -7.970  1.00 9.87  ? 138 THR A OG1 1 
ATOM   1114 C  CG2 . THR A 1 139 ? 17.956  5.758   -8.968  1.00 9.00  ? 138 THR A CG2 1 
ATOM   1115 N  N   . CYS A 1 140 ? 17.401  4.656   -4.664  1.00 7.39  ? 139 CYS A N   1 
ATOM   1116 C  CA  . CYS A 1 140 ? 16.791  4.523   -3.351  1.00 7.57  ? 139 CYS A CA  1 
ATOM   1117 C  C   . CYS A 1 140 ? 16.343  5.884   -2.851  1.00 8.01  ? 139 CYS A C   1 
ATOM   1118 O  O   . CYS A 1 140 ? 17.031  6.885   -3.083  1.00 7.48  ? 139 CYS A O   1 
ATOM   1119 C  CB  . CYS A 1 140 ? 17.796  3.940   -2.364  1.00 8.23  ? 139 CYS A CB  1 
ATOM   1120 S  SG  . CYS A 1 140 ? 18.275  2.256   -2.798  1.00 10.25 ? 139 CYS A SG  1 
ATOM   1121 N  N   . ALA A 1 141 ? 15.197  5.912   -2.167  1.00 7.81  ? 140 ALA A N   1 
ATOM   1122 C  CA  . ALA A 1 141 ? 14.700  7.152   -1.579  1.00 7.63  ? 140 ALA A CA  1 
ATOM   1123 C  C   . ALA A 1 141 ? 15.373  7.435   -0.243  1.00 7.56  ? 140 ALA A C   1 
ATOM   1124 O  O   . ALA A 1 141 ? 15.639  6.513   0.533   1.00 7.17  ? 140 ALA A O   1 
ATOM   1125 C  CB  . ALA A 1 141 ? 13.182  7.084   -1.386  1.00 8.36  ? 140 ALA A CB  1 
ATOM   1126 N  N   . ASN A 1 142 ? 15.602  8.721   0.032   1.00 7.64  ? 141 ASN A N   1 
ATOM   1127 C  CA  . ASN A 1 142 ? 16.101  9.155   1.346   1.00 7.69  ? 141 ASN A CA  1 
ATOM   1128 C  C   . ASN A 1 142 ? 17.361  8.361   1.726   1.00 7.79  ? 141 ASN A C   1 
ATOM   1129 O  O   . ASN A 1 142 ? 18.314  8.363   0.945   1.00 7.31  ? 141 ASN A O   1 
ATOM   1130 C  CB  . ASN A 1 142 ? 14.966  9.095   2.363   1.00 7.88  ? 141 ASN A CB  1 
ATOM   1131 C  CG  . ASN A 1 142 ? 13.827  10.009  1.970   1.00 9.95  ? 141 ASN A CG  1 
ATOM   1132 O  OD1 . ASN A 1 142 ? 14.048  11.106  1.449   1.00 8.60  ? 141 ASN A OD1 1 
ATOM   1133 N  ND2 . ASN A 1 142 ? 12.603  9.527   2.137   1.00 14.14 ? 141 ASN A ND2 1 
ATOM   1134 N  N   . GLN A 1 143 ? 17.385  7.712   2.888   1.00 7.11  ? 142 GLN A N   1 
ATOM   1135 C  CA  . GLN A 1 143 ? 18.517  6.858   3.251   1.00 7.77  ? 142 GLN A CA  1 
ATOM   1136 C  C   . GLN A 1 143 ? 18.218  5.375   3.161   1.00 8.09  ? 142 GLN A C   1 
ATOM   1137 O  O   . GLN A 1 143 ? 18.959  4.583   3.729   1.00 8.93  ? 142 GLN A O   1 
ATOM   1138 C  CB  . GLN A 1 143 ? 18.995  7.180   4.684   1.00 8.59  ? 142 GLN A CB  1 
ATOM   1139 C  CG  . GLN A 1 143 ? 19.594  8.590   4.858   1.00 7.67  ? 142 GLN A CG  1 
ATOM   1140 C  CD  . GLN A 1 143 ? 20.750  8.926   3.909   1.00 7.63  ? 142 GLN A CD  1 
ATOM   1141 O  OE1 . GLN A 1 143 ? 21.366  8.053   3.278   1.00 8.42  ? 142 GLN A OE1 1 
ATOM   1142 N  NE2 . GLN A 1 143 ? 21.076  10.201  3.853   1.00 7.50  ? 142 GLN A NE2 1 
ATOM   1143 N  N   . ASP A 1 144 ? 17.141  5.004   2.464   1.00 7.67  ? 143 ASP A N   1 
ATOM   1144 C  CA  . ASP A 1 144 ? 16.807  3.590   2.277   1.00 8.40  ? 143 ASP A CA  1 
ATOM   1145 C  C   . ASP A 1 144 ? 18.051  2.885   1.735   1.00 7.89  ? 143 ASP A C   1 
ATOM   1146 O  O   . ASP A 1 144 ? 18.545  3.258   0.669   1.00 7.14  ? 143 ASP A O   1 
ATOM   1147 C  CB  . ASP A 1 144 ? 15.654  3.422   1.282   1.00 7.87  ? 143 ASP A CB  1 
ATOM   1148 C  CG  . ASP A 1 144 ? 14.330  3.952   1.799   1.00 9.56  ? 143 ASP A CG  1 
ATOM   1149 O  OD1 . ASP A 1 144 ? 13.345  3.890   1.017   1.00 10.59 ? 143 ASP A OD1 1 
ATOM   1150 O  OD2 . ASP A 1 144 ? 14.248  4.431   2.954   1.00 8.68  ? 143 ASP A OD2 1 
ATOM   1151 N  N   . PRO A 1 145 ? 18.598  1.908   2.490   1.00 7.95  ? 144 PRO A N   1 
ATOM   1152 C  CA  . PRO A 1 145 ? 19.826  1.263   2.024   1.00 7.87  ? 144 PRO A CA  1 
ATOM   1153 C  C   . PRO A 1 145 ? 19.530  0.197   0.970   1.00 7.80  ? 144 PRO A C   1 
ATOM   1154 O  O   . PRO A 1 145 ? 18.502  -0.488  1.049   1.00 8.64  ? 144 PRO A O   1 
ATOM   1155 C  CB  . PRO A 1 145 ? 20.411  0.655   3.311   1.00 7.84  ? 144 PRO A CB  1 
ATOM   1156 C  CG  . PRO A 1 145 ? 19.206  0.334   4.147   1.00 8.42  ? 144 PRO A CG  1 
ATOM   1157 C  CD  . PRO A 1 145 ? 18.169  1.411   3.821   1.00 7.91  ? 144 PRO A CD  1 
ATOM   1158 N  N   . LEU A 1 146 ? 20.419  0.063   -0.006  1.00 7.47  ? 145 LEU A N   1 
ATOM   1159 C  CA  . LEU A 1 146 ? 20.130  -0.738  -1.184  1.00 7.88  ? 145 LEU A CA  1 
ATOM   1160 C  C   . LEU A 1 146 ? 19.884  -2.216  -0.860  1.00 7.89  ? 145 LEU A C   1 
ATOM   1161 O  O   . LEU A 1 146 ? 18.851  -2.770  -1.250  1.00 7.69  ? 145 LEU A O   1 
ATOM   1162 C  CB  . LEU A 1 146 ? 21.245  -0.601  -2.233  1.00 7.86  ? 145 LEU A CB  1 
ATOM   1163 C  CG  . LEU A 1 146 ? 20.995  -1.384  -3.527  1.00 8.46  ? 145 LEU A CG  1 
ATOM   1164 C  CD1 . LEU A 1 146 ? 19.924  -0.684  -4.375  1.00 8.73  ? 145 LEU A CD1 1 
ATOM   1165 C  CD2 . LEU A 1 146 ? 22.314  -1.518  -4.285  1.00 10.02 ? 145 LEU A CD2 1 
ATOM   1166 N  N   . GLU A 1 147 ? 20.819  -2.840  -0.142  1.00 7.35  ? 146 GLU A N   1 
ATOM   1167 C  CA  . GLU A 1 147 ? 20.750  -4.289  0.025   1.00 8.07  ? 146 GLU A CA  1 
ATOM   1168 C  C   . GLU A 1 147 ? 19.573  -4.709  0.908   1.00 7.92  ? 146 GLU A C   1 
ATOM   1169 O  O   . GLU A 1 147 ? 18.828  -5.636  0.570   1.00 8.41  ? 146 GLU A O   1 
ATOM   1170 C  CB  . GLU A 1 147 ? 22.069  -4.852  0.538   1.00 8.15  ? 146 GLU A CB  1 
ATOM   1171 C  CG  . GLU A 1 147 ? 22.177  -6.347  0.311   1.00 9.15  ? 146 GLU A CG  1 
ATOM   1172 C  CD  . GLU A 1 147 ? 23.514  -6.916  0.699   1.00 11.84 ? 146 GLU A CD  1 
ATOM   1173 O  OE1 . GLU A 1 147 ? 24.490  -6.159  0.862   1.00 11.89 ? 146 GLU A OE1 1 
ATOM   1174 O  OE2 . GLU A 1 147 ? 23.579  -8.148  0.818   1.00 13.45 ? 146 GLU A OE2 1 
ATOM   1175 N  N   . ALA A 1 148 ? 19.402  -4.017  2.024   1.00 8.68  ? 147 ALA A N   1 
ATOM   1176 C  CA  . ALA A 1 148 ? 18.341  -4.365  2.965   1.00 9.12  ? 147 ALA A CA  1 
ATOM   1177 C  C   . ALA A 1 148 ? 16.989  -4.246  2.282   1.00 9.65  ? 147 ALA A C   1 
ATOM   1178 O  O   . ALA A 1 148 ? 16.129  -5.083  2.494   1.00 10.10 ? 147 ALA A O   1 
ATOM   1179 C  CB  . ALA A 1 148 ? 18.395  -3.491  4.198   1.00 8.66  ? 147 ALA A CB  1 
ATOM   1180 N  N   . THR A 1 149 ? 16.825  -3.232  1.433   1.00 9.86  ? 148 THR A N   1 
ATOM   1181 C  CA  . THR A 1 149 ? 15.510  -2.939  0.842   1.00 10.60 ? 148 THR A CA  1 
ATOM   1182 C  C   . THR A 1 149 ? 15.226  -3.572  -0.529  1.00 11.79 ? 148 THR A C   1 
ATOM   1183 O  O   . THR A 1 149 ? 14.051  -3.665  -0.926  1.00 12.97 ? 148 THR A O   1 
ATOM   1184 C  CB  . THR A 1 149 ? 15.218  -1.417  0.754   1.00 11.11 ? 148 THR A CB  1 
ATOM   1185 O  OG1 . THR A 1 149 ? 16.151  -0.780  -0.138  1.00 9.87  ? 148 THR A OG1 1 
ATOM   1186 C  CG2 . THR A 1 149 ? 15.273  -0.767  2.159   1.00 9.82  ? 148 THR A CG2 1 
ATOM   1187 N  N   . THR A 1 150 ? 16.266  -3.976  -1.253  1.00 11.21 ? 149 THR A N   1 
ATOM   1188 C  CA  . THR A 1 150 ? 16.091  -4.540  -2.614  1.00 11.08 ? 149 THR A CA  1 
ATOM   1189 C  C   . THR A 1 150 ? 16.763  -5.886  -2.838  1.00 10.94 ? 149 THR A C   1 
ATOM   1190 O  O   . THR A 1 150 ? 16.455  -6.570  -3.822  1.00 10.99 ? 149 THR A O   1 
ATOM   1191 C  CB  . THR A 1 150 ? 16.647  -3.602  -3.711  1.00 11.03 ? 149 THR A CB  1 
ATOM   1192 O  OG1 . THR A 1 150 ? 18.083  -3.616  -3.669  1.00 11.27 ? 149 THR A OG1 1 
ATOM   1193 C  CG2 . THR A 1 150 ? 16.137  -2.172  -3.548  1.00 12.04 ? 149 THR A CG2 1 
ATOM   1194 N  N   . GLY A 1 151 ? 17.704  -6.251  -1.965  1.00 10.39 ? 150 GLY A N   1 
ATOM   1195 C  CA  . GLY A 1 151 ? 18.504  -7.463  -2.164  1.00 10.24 ? 150 GLY A CA  1 
ATOM   1196 C  C   . GLY A 1 151 ? 19.720  -7.257  -3.059  1.00 10.18 ? 150 GLY A C   1 
ATOM   1197 O  O   . GLY A 1 151 ? 20.588  -8.130  -3.162  1.00 9.90  ? 150 GLY A O   1 
ATOM   1198 N  N   . LEU A 1 152 ? 19.789  -6.110  -3.729  1.00 9.75  ? 151 LEU A N   1 
ATOM   1199 C  CA  . LEU A 1 152 ? 20.915  -5.838  -4.619  1.00 10.28 ? 151 LEU A CA  1 
ATOM   1200 C  C   . LEU A 1 152 ? 22.120  -5.462  -3.785  1.00 9.88  ? 151 LEU A C   1 
ATOM   1201 O  O   . LEU A 1 152 ? 22.001  -4.691  -2.821  1.00 10.04 ? 151 LEU A O   1 
ATOM   1202 C  CB  . LEU A 1 152 ? 20.589  -4.697  -5.578  1.00 10.91 ? 151 LEU A CB  1 
ATOM   1203 C  CG  . LEU A 1 152 ? 19.571  -4.926  -6.693  1.00 11.36 ? 151 LEU A CG  1 
ATOM   1204 C  CD1 . LEU A 1 152 ? 19.441  -3.662  -7.507  1.00 12.62 ? 151 LEU A CD1 1 
ATOM   1205 C  CD2 . LEU A 1 152 ? 19.987  -6.068  -7.602  1.00 14.05 ? 151 LEU A CD2 1 
ATOM   1206 N  N   . VAL A 1 153 ? 23.269  -6.019  -4.139  1.00 9.07  ? 152 VAL A N   1 
ATOM   1207 C  CA  . VAL A 1 153 ? 24.504  -5.723  -3.410  1.00 9.18  ? 152 VAL A CA  1 
ATOM   1208 C  C   . VAL A 1 153 ? 25.118  -4.452  -3.981  1.00 8.64  ? 152 VAL A C   1 
ATOM   1209 O  O   . VAL A 1 153 ? 25.405  -4.395  -5.191  1.00 8.83  ? 152 VAL A O   1 
ATOM   1210 C  CB  . VAL A 1 153 ? 25.509  -6.891  -3.502  1.00 9.07  ? 152 VAL A CB  1 
ATOM   1211 C  CG1 . VAL A 1 153 ? 26.765  -6.556  -2.698  1.00 9.80  ? 152 VAL A CG1 1 
ATOM   1212 C  CG2 . VAL A 1 153 ? 24.867  -8.188  -2.986  1.00 9.35  ? 152 VAL A CG2 1 
ATOM   1213 N  N   . PRO A 1 154 ? 25.334  -3.426  -3.129  1.00 8.53  ? 153 PRO A N   1 
ATOM   1214 C  CA  . PRO A 1 154 ? 25.838  -2.155  -3.678  1.00 8.23  ? 153 PRO A CA  1 
ATOM   1215 C  C   . PRO A 1 154 ? 27.294  -2.253  -4.110  1.00 7.92  ? 153 PRO A C   1 
ATOM   1216 O  O   . PRO A 1 154 ? 28.117  -2.812  -3.393  1.00 7.34  ? 153 PRO A O   1 
ATOM   1217 C  CB  . PRO A 1 154 ? 25.678  -1.168  -2.516  1.00 8.47  ? 153 PRO A CB  1 
ATOM   1218 C  CG  . PRO A 1 154 ? 25.714  -2.015  -1.273  1.00 7.89  ? 153 PRO A CG  1 
ATOM   1219 C  CD  . PRO A 1 154 ? 25.159  -3.380  -1.661  1.00 8.40  ? 153 PRO A CD  1 
ATOM   1220 N  N   . LEU A 1 155 ? 27.583  -1.708  -5.289  1.00 7.22  ? 154 LEU A N   1 
ATOM   1221 C  CA  . LEU A 1 155 ? 28.941  -1.647  -5.803  1.00 7.47  ? 154 LEU A CA  1 
ATOM   1222 C  C   . LEU A 1 155 ? 29.469  -0.225  -5.913  1.00 7.33  ? 154 LEU A C   1 
ATOM   1223 O  O   . LEU A 1 155 ? 30.624  0.030   -5.566  1.00 7.74  ? 154 LEU A O   1 
ATOM   1224 C  CB  . LEU A 1 155 ? 29.023  -2.327  -7.164  1.00 7.34  ? 154 LEU A CB  1 
ATOM   1225 C  CG  . LEU A 1 155 ? 28.505  -3.752  -7.252  1.00 7.78  ? 154 LEU A CG  1 
ATOM   1226 C  CD1 . LEU A 1 155 ? 28.727  -4.216  -8.693  1.00 6.86  ? 154 LEU A CD1 1 
ATOM   1227 C  CD2 . LEU A 1 155 ? 29.171  -4.695  -6.227  1.00 5.98  ? 154 LEU A CD2 1 
ATOM   1228 N  N   . PHE A 1 156 ? 28.641  0.687   -6.430  1.00 7.52  ? 155 PHE A N   1 
ATOM   1229 C  CA  . PHE A 1 156 ? 29.018  2.097   -6.542  1.00 7.38  ? 155 PHE A CA  1 
ATOM   1230 C  C   . PHE A 1 156 ? 27.792  2.963   -6.321  1.00 7.41  ? 155 PHE A C   1 
ATOM   1231 O  O   . PHE A 1 156 ? 26.775  2.771   -6.985  1.00 7.55  ? 155 PHE A O   1 
ATOM   1232 C  CB  . PHE A 1 156 ? 29.615  2.402   -7.923  1.00 7.78  ? 155 PHE A CB  1 
ATOM   1233 C  CG  . PHE A 1 156 ? 30.039  3.829   -8.085  1.00 7.66  ? 155 PHE A CG  1 
ATOM   1234 C  CD1 . PHE A 1 156 ? 31.141  4.321   -7.381  1.00 8.38  ? 155 PHE A CD1 1 
ATOM   1235 C  CD2 . PHE A 1 156 ? 29.331  4.691   -8.928  1.00 9.83  ? 155 PHE A CD2 1 
ATOM   1236 C  CE1 . PHE A 1 156 ? 31.533  5.662   -7.504  1.00 8.32  ? 155 PHE A CE1 1 
ATOM   1237 C  CE2 . PHE A 1 156 ? 29.715  6.030   -9.057  1.00 8.69  ? 155 PHE A CE2 1 
ATOM   1238 C  CZ  . PHE A 1 156 ? 30.816  6.512   -8.353  1.00 9.09  ? 155 PHE A CZ  1 
ATOM   1239 N  N   . GLY A 1 157 ? 27.885  3.904   -5.385  1.00 7.45  ? 156 GLY A N   1 
ATOM   1240 C  CA  . GLY A 1 157 ? 26.747  4.774   -5.057  1.00 7.64  ? 156 GLY A CA  1 
ATOM   1241 C  C   . GLY A 1 157 ? 27.026  6.232   -5.349  1.00 8.04  ? 156 GLY A C   1 
ATOM   1242 O  O   . GLY A 1 157 ? 28.177  6.670   -5.266  1.00 7.98  ? 156 GLY A O   1 
ATOM   1243 N  N   . ILE A 1 158 ? 25.978  6.967   -5.697  1.00 7.46  ? 157 ILE A N   1 
ATOM   1244 C  CA  . ILE A 1 158 ? 26.054  8.415   -5.938  1.00 7.19  ? 157 ILE A CA  1 
ATOM   1245 C  C   . ILE A 1 158 ? 24.981  9.049   -5.057  1.00 7.27  ? 157 ILE A C   1 
ATOM   1246 O  O   . ILE A 1 158 ? 23.792  8.901   -5.312  1.00 7.03  ? 157 ILE A O   1 
ATOM   1247 C  CB  . ILE A 1 158 ? 25.823  8.826   -7.417  1.00 7.73  ? 157 ILE A CB  1 
ATOM   1248 C  CG1 . ILE A 1 158 ? 26.781  8.084   -8.356  1.00 8.00  ? 157 ILE A CG1 1 
ATOM   1249 C  CG2 . ILE A 1 158 ? 25.993  10.331  -7.589  1.00 7.62  ? 157 ILE A CG2 1 
ATOM   1250 C  CD1 . ILE A 1 158 ? 26.701  8.536   -9.799  1.00 7.35  ? 157 ILE A CD1 1 
ATOM   1251 N  N   . ASP A 1 159 ? 25.426  9.765   -4.033  1.00 6.84  ? 158 ASP A N   1 
ATOM   1252 C  CA  . ASP A 1 159 ? 24.566  10.459  -3.142  1.00 7.44  ? 158 ASP A CA  1 
ATOM   1253 C  C   . ASP A 1 159 ? 24.022  11.728  -3.797  1.00 7.59  ? 158 ASP A C   1 
ATOM   1254 O  O   . ASP A 1 159 ? 24.785  12.636  -4.140  1.00 8.00  ? 158 ASP A O   1 
ATOM   1255 C  CB  . ASP A 1 159 ? 25.343  10.807  -1.864  1.00 7.63  ? 158 ASP A CB  1 
ATOM   1256 C  CG  . ASP A 1 159 ? 24.516  11.425  -0.750  1.00 8.24  ? 158 ASP A CG  1 
ATOM   1257 O  OD1 . ASP A 1 159 ? 25.114  11.829  0.263   1.00 8.11  ? 158 ASP A OD1 1 
ATOM   1258 O  OD2 . ASP A 1 159 ? 23.277  11.487  -0.884  1.00 8.21  ? 158 ASP A OD2 1 
ATOM   1259 N  N   . VAL A 1 160 ? 22.672  11.827  -3.936  1.00 7.19  ? 159 VAL A N   1 
ATOM   1260 C  CA  . VAL A 1 160 ? 22.157  13.079  -4.531  1.00 7.31  ? 159 VAL A CA  1 
ATOM   1261 C  C   . VAL A 1 160 ? 21.278  13.872  -3.567  1.00 6.97  ? 159 VAL A C   1 
ATOM   1262 O  O   . VAL A 1 160 ? 20.383  14.607  -3.991  1.00 7.33  ? 159 VAL A O   1 
ATOM   1263 C  CB  . VAL A 1 160 ? 21.527  12.872  -5.919  1.00 7.86  ? 159 VAL A CB  1 
ATOM   1264 C  CG1 . VAL A 1 160 ? 22.611  12.562  -6.945  1.00 7.17  ? 159 VAL A CG1 1 
ATOM   1265 C  CG2 . VAL A 1 160 ? 20.490  11.765  -5.880  1.00 7.60  ? 159 VAL A CG2 1 
ATOM   1266 N  N   . TRP A 1 161 ? 21.540  13.680  -2.302  1.00 6.43  ? 160 TRP A N   1 
ATOM   1267 C  CA  . TRP A 1 161 ? 20.918  14.500  -1.335  1.00 6.44  ? 160 TRP A CA  1 
ATOM   1268 C  C   . TRP A 1 161 ? 21.504  15.818  -1.652  1.00 6.12  ? 160 TRP A C   1 
ATOM   1269 O  O   . TRP A 1 161 ? 22.655  15.861  -2.054  1.00 5.98  ? 160 TRP A O   1 
ATOM   1270 C  CB  . TRP A 1 161 ? 21.244  14.130  0.099   1.00 6.41  ? 160 TRP A CB  1 
ATOM   1271 C  CG  . TRP A 1 161 ? 20.400  13.051  0.712   1.00 6.77  ? 160 TRP A CG  1 
ATOM   1272 C  CD1 . TRP A 1 161 ? 20.215  11.773  0.273   1.00 6.06  ? 160 TRP A CD1 1 
ATOM   1273 C  CD2 . TRP A 1 161 ? 19.644  13.188  1.913   1.00 6.77  ? 160 TRP A CD2 1 
ATOM   1274 N  NE1 . TRP A 1 161 ? 19.369  11.108  1.130   1.00 7.46  ? 160 TRP A NE1 1 
ATOM   1275 C  CE2 . TRP A 1 161 ? 18.984  11.954  2.165   1.00 7.76  ? 160 TRP A CE2 1 
ATOM   1276 C  CE3 . TRP A 1 161 ? 19.430  14.250  2.808   1.00 5.47  ? 160 TRP A CE3 1 
ATOM   1277 C  CZ2 . TRP A 1 161 ? 18.147  11.732  3.246   1.00 7.39  ? 160 TRP A CZ2 1 
ATOM   1278 C  CZ3 . TRP A 1 161 ? 18.588  14.020  3.902   1.00 5.60  ? 160 TRP A CZ3 1 
ATOM   1279 C  CH2 . TRP A 1 161 ? 17.959  12.790  4.116   1.00 6.56  ? 160 TRP A CH2 1 
ATOM   1280 N  N   . GLU A 1 162 ? 20.816  16.921  -1.523  1.00 6.03  ? 161 GLU A N   1 
ATOM   1281 C  CA  . GLU A 1 162 ? 21.390  18.215  -1.898  1.00 6.53  ? 161 GLU A CA  1 
ATOM   1282 C  C   . GLU A 1 162 ? 22.657  18.525  -1.075  1.00 6.59  ? 161 GLU A C   1 
ATOM   1283 O  O   . GLU A 1 162 ? 23.573  19.187  -1.576  1.00 6.68  ? 161 GLU A O   1 
ATOM   1284 C  CB  . GLU A 1 162 ? 20.314  19.297  -1.795  1.00 6.48  ? 161 GLU A CB  1 
ATOM   1285 C  CG  . GLU A 1 162 ? 19.270  19.183  -2.898  1.00 7.27  ? 161 GLU A CG  1 
ATOM   1286 C  CD  . GLU A 1 162 ? 18.164  20.200  -2.812  1.00 6.99  ? 161 GLU A CD  1 
ATOM   1287 O  OE1 . GLU A 1 162 ? 17.621  20.405  -1.709  1.00 6.39  ? 161 GLU A OE1 1 
ATOM   1288 O  OE2 . GLU A 1 162 ? 17.842  20.810  -3.838  1.00 7.55  ? 161 GLU A OE2 1 
ATOM   1289 N  N   . HIS A 1 163 ? 22.749  18.014  0.149   1.00 6.48  ? 162 HIS A N   1 
ATOM   1290 C  CA  . HIS A 1 163 ? 23.947  18.295  0.966   1.00 6.20  ? 162 HIS A CA  1 
ATOM   1291 C  C   . HIS A 1 163 ? 25.210  17.673  0.326   1.00 6.64  ? 162 HIS A C   1 
ATOM   1292 O  O   . HIS A 1 163 ? 26.331  18.079  0.631   1.00 6.88  ? 162 HIS A O   1 
ATOM   1293 C  CB  . HIS A 1 163 ? 23.766  17.865  2.405   1.00 6.72  ? 162 HIS A CB  1 
ATOM   1294 C  CG  . HIS A 1 163 ? 23.651  16.347  2.611   1.00 6.92  ? 162 HIS A CG  1 
ATOM   1295 N  ND1 . HIS A 1 163 ? 22.560  15.776  3.230   1.00 6.65  ? 162 HIS A ND1 1 
ATOM   1296 C  CD2 . HIS A 1 163 ? 24.475  15.322  2.280   1.00 7.36  ? 162 HIS A CD2 1 
ATOM   1297 C  CE1 . HIS A 1 163 ? 22.703  14.459  3.254   1.00 7.14  ? 162 HIS A CE1 1 
ATOM   1298 N  NE2 . HIS A 1 163 ? 23.862  14.156  2.691   1.00 7.47  ? 162 HIS A NE2 1 
ATOM   1299 N  N   . ALA A 1 164 ? 25.037  16.685  -0.557  1.00 6.30  ? 163 ALA A N   1 
ATOM   1300 C  CA  . ALA A 1 164 ? 26.187  16.043  -1.215  1.00 6.41  ? 163 ALA A CA  1 
ATOM   1301 C  C   . ALA A 1 164 ? 26.853  16.954  -2.260  1.00 7.00  ? 163 ALA A C   1 
ATOM   1302 O  O   . ALA A 1 164 ? 28.010  16.722  -2.626  1.00 6.87  ? 163 ALA A O   1 
ATOM   1303 C  CB  . ALA A 1 164 ? 25.765  14.738  -1.863  1.00 7.32  ? 163 ALA A CB  1 
ATOM   1304 N  N   . TYR A 1 165 ? 26.164  18.006  -2.717  1.00 6.49  ? 164 TYR A N   1 
ATOM   1305 C  CA  . TYR A 1 165 ? 26.723  18.815  -3.805  1.00 6.12  ? 164 TYR A CA  1 
ATOM   1306 C  C   . TYR A 1 165 ? 26.336  20.281  -3.788  1.00 6.64  ? 164 TYR A C   1 
ATOM   1307 O  O   . TYR A 1 165 ? 26.941  21.087  -4.515  1.00 6.25  ? 164 TYR A O   1 
ATOM   1308 C  CB  . TYR A 1 165 ? 26.209  18.276  -5.151  1.00 7.16  ? 164 TYR A CB  1 
ATOM   1309 C  CG  . TYR A 1 165 ? 24.668  18.251  -5.340  1.00 6.91  ? 164 TYR A CG  1 
ATOM   1310 C  CD1 . TYR A 1 165 ? 23.937  17.091  -5.081  1.00 7.88  ? 164 TYR A CD1 1 
ATOM   1311 C  CD2 . TYR A 1 165 ? 23.957  19.341  -5.829  1.00 8.21  ? 164 TYR A CD2 1 
ATOM   1312 C  CE1 . TYR A 1 165 ? 22.577  17.044  -5.276  1.00 8.44  ? 164 TYR A CE1 1 
ATOM   1313 C  CE2 . TYR A 1 165 ? 22.595  19.318  -6.019  1.00 6.75  ? 164 TYR A CE2 1 
ATOM   1314 C  CZ  . TYR A 1 165 ? 21.888  18.166  -5.740  1.00 8.26  ? 164 TYR A CZ  1 
ATOM   1315 O  OH  . TYR A 1 165 ? 20.522  18.111  -5.913  1.00 7.69  ? 164 TYR A OH  1 
ATOM   1316 N  N   . TYR A 1 166 ? 25.358  20.694  -2.987  1.00 5.93  ? 165 TYR A N   1 
ATOM   1317 C  CA  . TYR A 1 166 ? 24.850  22.061  -3.116  1.00 5.96  ? 165 TYR A CA  1 
ATOM   1318 C  C   . TYR A 1 166 ? 25.845  23.229  -2.915  1.00 5.30  ? 165 TYR A C   1 
ATOM   1319 O  O   . TYR A 1 166 ? 25.799  24.223  -3.657  1.00 5.74  ? 165 TYR A O   1 
ATOM   1320 C  CB  . TYR A 1 166 ? 23.650  22.265  -2.171  1.00 6.05  ? 165 TYR A CB  1 
ATOM   1321 C  CG  . TYR A 1 166 ? 22.670  23.252  -2.801  1.00 6.21  ? 165 TYR A CG  1 
ATOM   1322 C  CD1 . TYR A 1 166 ? 21.666  22.821  -3.702  1.00 5.52  ? 165 TYR A CD1 1 
ATOM   1323 C  CD2 . TYR A 1 166 ? 22.754  24.621  -2.544  1.00 5.78  ? 165 TYR A CD2 1 
ATOM   1324 C  CE1 . TYR A 1 166 ? 20.817  23.741  -4.301  1.00 5.53  ? 165 TYR A CE1 1 
ATOM   1325 C  CE2 . TYR A 1 166 ? 21.922  25.546  -3.174  1.00 6.28  ? 165 TYR A CE2 1 
ATOM   1326 C  CZ  . TYR A 1 166 ? 20.955  25.094  -4.048  1.00 5.92  ? 165 TYR A CZ  1 
ATOM   1327 O  OH  . TYR A 1 166 ? 20.124  25.987  -4.670  1.00 5.90  ? 165 TYR A OH  1 
ATOM   1328 N  N   . LEU A 1 167 ? 26.731  23.121  -1.931  1.00 5.53  ? 166 LEU A N   1 
ATOM   1329 C  CA  . LEU A 1 167 ? 27.653  24.223  -1.651  1.00 5.48  ? 166 LEU A CA  1 
ATOM   1330 C  C   . LEU A 1 167 ? 28.489  24.581  -2.875  1.00 5.56  ? 166 LEU A C   1 
ATOM   1331 O  O   . LEU A 1 167 ? 28.840  25.747  -3.083  1.00 5.38  ? 166 LEU A O   1 
ATOM   1332 C  CB  . LEU A 1 167 ? 28.553  23.886  -0.486  1.00 5.87  ? 166 LEU A CB  1 
ATOM   1333 C  CG  . LEU A 1 167 ? 27.924  23.886  0.899   1.00 5.89  ? 166 LEU A CG  1 
ATOM   1334 C  CD1 . LEU A 1 167 ? 28.950  23.444  1.939   1.00 7.51  ? 166 LEU A CD1 1 
ATOM   1335 C  CD2 . LEU A 1 167 ? 27.377  25.262  1.259   1.00 9.82  ? 166 LEU A CD2 1 
ATOM   1336 N  N   . GLN A 1 168 ? 28.799  23.560  -3.671  1.00 5.78  ? 167 GLN A N   1 
ATOM   1337 C  CA  . GLN A 1 168 ? 29.655  23.706  -4.854  1.00 6.17  ? 167 GLN A CA  1 
ATOM   1338 C  C   . GLN A 1 168 ? 28.880  23.867  -6.158  1.00 5.51  ? 167 GLN A C   1 
ATOM   1339 O  O   . GLN A 1 168 ? 29.200  24.747  -6.971  1.00 6.43  ? 167 GLN A O   1 
ATOM   1340 C  CB  . GLN A 1 168 ? 30.591  22.500  -4.967  1.00 6.45  ? 167 GLN A CB  1 
ATOM   1341 C  CG  . GLN A 1 168 ? 31.537  22.640  -6.175  1.00 7.66  ? 167 GLN A CG  1 
ATOM   1342 C  CD  . GLN A 1 168 ? 32.594  21.580  -6.278  1.00 9.83  ? 167 GLN A CD  1 
ATOM   1343 O  OE1 . GLN A 1 168 ? 33.039  21.262  -7.385  1.00 12.77 ? 167 GLN A OE1 1 
ATOM   1344 N  NE2 . GLN A 1 168 ? 33.032  21.044  -5.143  1.00 6.97  ? 167 GLN A NE2 1 
ATOM   1345 N  N   . TYR A 1 169 ? 27.895  22.993  -6.364  1.00 5.14  ? 168 TYR A N   1 
ATOM   1346 C  CA  . TYR A 1 169 ? 27.182  22.865  -7.662  1.00 5.69  ? 168 TYR A CA  1 
ATOM   1347 C  C   . TYR A 1 169 ? 25.846  23.583  -7.657  1.00 6.29  ? 168 TYR A C   1 
ATOM   1348 O  O   . TYR A 1 169 ? 25.207  23.758  -8.721  1.00 6.28  ? 168 TYR A O   1 
ATOM   1349 C  CB  . TYR A 1 169 ? 26.944  21.393  -7.985  1.00 5.99  ? 168 TYR A CB  1 
ATOM   1350 C  CG  . TYR A 1 169 ? 28.219  20.637  -8.280  1.00 5.71  ? 168 TYR A CG  1 
ATOM   1351 C  CD1 . TYR A 1 169 ? 28.994  20.100  -7.242  1.00 6.53  ? 168 TYR A CD1 1 
ATOM   1352 C  CD2 . TYR A 1 169 ? 28.657  20.467  -9.607  1.00 6.90  ? 168 TYR A CD2 1 
ATOM   1353 C  CE1 . TYR A 1 169 ? 30.187  19.411  -7.518  1.00 6.26  ? 168 TYR A CE1 1 
ATOM   1354 C  CE2 . TYR A 1 169 ? 29.833  19.782  -9.891  1.00 7.32  ? 168 TYR A CE2 1 
ATOM   1355 C  CZ  . TYR A 1 169 ? 30.585  19.259  -8.853  1.00 6.48  ? 168 TYR A CZ  1 
ATOM   1356 O  OH  . TYR A 1 169 ? 31.731  18.582  -9.149  1.00 6.24  ? 168 TYR A OH  1 
ATOM   1357 N  N   . LYS A 1 170 ? 25.423  23.979  -6.455  1.00 7.18  ? 169 LYS A N   1 
ATOM   1358 C  CA  . LYS A 1 170 ? 24.122  24.631  -6.239  1.00 7.72  ? 169 LYS A CA  1 
ATOM   1359 C  C   . LYS A 1 170 ? 23.051  23.723  -6.850  1.00 7.82  ? 169 LYS A C   1 
ATOM   1360 O  O   . LYS A 1 170 ? 23.091  22.515  -6.618  1.00 7.61  ? 169 LYS A O   1 
ATOM   1361 C  CB  . LYS A 1 170 ? 24.125  26.084  -6.763  1.00 8.62  ? 169 LYS A CB  1 
ATOM   1362 C  CG  . LYS A 1 170 ? 24.893  27.069  -5.791  1.00 10.82 ? 169 LYS A CG  1 
ATOM   1363 C  CD  . LYS A 1 170 ? 26.358  26.780  -5.704  1.00 14.78 ? 169 LYS A CD  1 
ATOM   1364 C  CE  . LYS A 1 170 ? 27.135  27.809  -4.884  1.00 11.36 ? 169 LYS A CE  1 
ATOM   1365 N  NZ  . LYS A 1 170 ? 27.316  29.045  -5.661  1.00 11.55 ? 169 LYS A NZ  1 
ATOM   1366 N  N   . ASN A 1 171 ? 22.124  24.280  -7.629  1.00 7.53  ? 170 ASN A N   1 
ATOM   1367 C  CA  . ASN A 1 171 ? 21.021  23.487  -8.181  1.00 8.17  ? 170 ASN A CA  1 
ATOM   1368 C  C   . ASN A 1 171 ? 21.443  22.496  -9.267  1.00 7.52  ? 170 ASN A C   1 
ATOM   1369 O  O   . ASN A 1 171 ? 20.640  21.631  -9.663  1.00 8.03  ? 170 ASN A O   1 
ATOM   1370 C  CB  . ASN A 1 171 ? 19.968  24.426  -8.790  1.00 7.22  ? 170 ASN A CB  1 
ATOM   1371 C  CG  . ASN A 1 171 ? 20.563  25.330  -9.834  1.00 8.16  ? 170 ASN A CG  1 
ATOM   1372 O  OD1 . ASN A 1 171 ? 21.366  26.202  -9.513  1.00 7.65  ? 170 ASN A OD1 1 
ATOM   1373 N  ND2 . ASN A 1 171 ? 20.206  25.104  -11.113 1.00 7.07  ? 170 ASN A ND2 1 
ATOM   1374 N  N   . VAL A 1 172 ? 22.680  22.615  -9.761  1.00 6.39  ? 171 VAL A N   1 
ATOM   1375 C  CA  . VAL A 1 172 ? 23.047  21.843  -10.947 1.00 6.87  ? 171 VAL A CA  1 
ATOM   1376 C  C   . VAL A 1 172 ? 23.513  20.416  -10.580 1.00 6.94  ? 171 VAL A C   1 
ATOM   1377 O  O   . VAL A 1 172 ? 24.684  20.037  -10.762 1.00 6.99  ? 171 VAL A O   1 
ATOM   1378 C  CB  . VAL A 1 172 ? 24.046  22.589  -11.851 1.00 6.36  ? 171 VAL A CB  1 
ATOM   1379 C  CG1 . VAL A 1 172 ? 24.078  21.907  -13.204 1.00 5.51  ? 171 VAL A CG1 1 
ATOM   1380 C  CG2 . VAL A 1 172 ? 23.648  24.064  -11.989 1.00 7.78  ? 171 VAL A CG2 1 
ATOM   1381 N  N   . ARG A 1 173 ? 22.575  19.637  -10.039 1.00 5.83  ? 172 ARG A N   1 
ATOM   1382 C  CA  . ARG A 1 173 ? 22.828  18.229  -9.730  1.00 5.68  ? 172 ARG A CA  1 
ATOM   1383 C  C   . ARG A 1 173 ? 23.482  17.428  -10.889 1.00 6.37  ? 172 ARG A C   1 
ATOM   1384 O  O   . ARG A 1 173 ? 24.437  16.679  -10.639 1.00 7.53  ? 172 ARG A O   1 
ATOM   1385 C  CB  . ARG A 1 173 ? 21.539  17.545  -9.238  1.00 6.21  ? 172 ARG A CB  1 
ATOM   1386 C  CG  . ARG A 1 173 ? 21.729  16.077  -8.892  1.00 6.29  ? 172 ARG A CG  1 
ATOM   1387 C  CD  . ARG A 1 173 ? 20.385  15.376  -8.838  1.00 9.42  ? 172 ARG A CD  1 
ATOM   1388 N  NE  . ARG A 1 173 ? 19.717  15.646  -7.572  1.00 9.50  ? 172 ARG A NE  1 
ATOM   1389 C  CZ  . ARG A 1 173 ? 18.532  15.130  -7.256  1.00 11.82 ? 172 ARG A CZ  1 
ATOM   1390 N  NH1 . ARG A 1 173 ? 17.888  14.365  -8.132  1.00 10.96 ? 172 ARG A NH1 1 
ATOM   1391 N  NH2 . ARG A 1 173 ? 18.000  15.385  -6.071  1.00 13.15 ? 172 ARG A NH2 1 
ATOM   1392 N  N   . PRO A 1 174 ? 23.011  17.602  -12.149 1.00 7.25  ? 173 PRO A N   1 
ATOM   1393 C  CA  . PRO A 1 174 ? 23.603  16.829  -13.257 1.00 6.73  ? 173 PRO A CA  1 
ATOM   1394 C  C   . PRO A 1 174 ? 25.112  17.007  -13.415 1.00 6.84  ? 173 PRO A C   1 
ATOM   1395 O  O   . PRO A 1 174 ? 25.813  16.039  -13.749 1.00 6.60  ? 173 PRO A O   1 
ATOM   1396 C  CB  . PRO A 1 174 ? 22.852  17.349  -14.488 1.00 7.80  ? 173 PRO A CB  1 
ATOM   1397 C  CG  . PRO A 1 174 ? 21.539  17.765  -13.944 1.00 8.03  ? 173 PRO A CG  1 
ATOM   1398 C  CD  . PRO A 1 174 ? 21.912  18.452  -12.641 1.00 7.34  ? 173 PRO A CD  1 
ATOM   1399 N  N   . ASP A 1 175 ? 25.621  18.214  -13.153 1.00 6.13  ? 174 ASP A N   1 
ATOM   1400 C  CA  . ASP A 1 175 ? 27.056  18.438  -13.291 1.00 6.22  ? 174 ASP A CA  1 
ATOM   1401 C  C   . ASP A 1 175 ? 27.815  17.657  -12.211 1.00 6.09  ? 174 ASP A C   1 
ATOM   1402 O  O   . ASP A 1 175 ? 28.880  17.115  -12.470 1.00 6.18  ? 174 ASP A O   1 
ATOM   1403 C  CB  . ASP A 1 175 ? 27.385  19.928  -13.206 1.00 6.19  ? 174 ASP A CB  1 
ATOM   1404 C  CG  . ASP A 1 175 ? 27.015  20.689  -14.465 1.00 6.95  ? 174 ASP A CG  1 
ATOM   1405 O  OD1 . ASP A 1 175 ? 26.437  20.114  -15.424 1.00 7.76  ? 174 ASP A OD1 1 
ATOM   1406 O  OD2 . ASP A 1 175 ? 27.312  21.887  -14.505 1.00 6.35  ? 174 ASP A OD2 1 
ATOM   1407 N  N   . TYR A 1 176 ? 27.274  17.619  -10.998 1.00 5.83  ? 175 TYR A N   1 
ATOM   1408 C  CA  . TYR A 1 176 ? 27.892  16.827  -9.926  1.00 5.56  ? 175 TYR A CA  1 
ATOM   1409 C  C   . TYR A 1 176 ? 27.867  15.338  -10.267 1.00 5.99  ? 175 TYR A C   1 
ATOM   1410 O  O   . TYR A 1 176 ? 28.872  14.632  -10.115 1.00 5.53  ? 175 TYR A O   1 
ATOM   1411 C  CB  . TYR A 1 176 ? 27.154  17.083  -8.616  1.00 5.63  ? 175 TYR A CB  1 
ATOM   1412 C  CG  . TYR A 1 176 ? 27.296  16.007  -7.561  1.00 6.22  ? 175 TYR A CG  1 
ATOM   1413 C  CD1 . TYR A 1 176 ? 26.208  15.185  -7.255  1.00 7.31  ? 175 TYR A CD1 1 
ATOM   1414 C  CD2 . TYR A 1 176 ? 28.484  15.835  -6.842  1.00 6.23  ? 175 TYR A CD2 1 
ATOM   1415 C  CE1 . TYR A 1 176 ? 26.296  14.207  -6.287  1.00 6.54  ? 175 TYR A CE1 1 
ATOM   1416 C  CE2 . TYR A 1 176 ? 28.575  14.840  -5.828  1.00 6.75  ? 175 TYR A CE2 1 
ATOM   1417 C  CZ  . TYR A 1 176 ? 27.458  14.036  -5.578  1.00 5.63  ? 175 TYR A CZ  1 
ATOM   1418 O  OH  . TYR A 1 176 ? 27.472  13.053  -4.612  1.00 7.12  ? 175 TYR A OH  1 
ATOM   1419 N  N   . VAL A 1 177 ? 26.707  14.857  -10.714 1.00 5.85  ? 176 VAL A N   1 
ATOM   1420 C  CA  . VAL A 1 177 ? 26.593  13.447  -11.102 1.00 6.84  ? 176 VAL A CA  1 
ATOM   1421 C  C   . VAL A 1 177 ? 27.576  13.070  -12.237 1.00 7.10  ? 176 VAL A C   1 
ATOM   1422 O  O   . VAL A 1 177 ? 28.179  11.991  -12.216 1.00 7.43  ? 176 VAL A O   1 
ATOM   1423 C  CB  . VAL A 1 177 ? 25.124  13.075  -11.434 1.00 6.39  ? 176 VAL A CB  1 
ATOM   1424 C  CG1 . VAL A 1 177 ? 25.024  11.610  -11.925 1.00 7.18  ? 176 VAL A CG1 1 
ATOM   1425 C  CG2 . VAL A 1 177 ? 24.242  13.258  -10.184 1.00 6.56  ? 176 VAL A CG2 1 
ATOM   1426 N  N   . ASN A 1 178 ? 27.753  13.956  -13.207 1.00 7.45  ? 177 ASN A N   1 
ATOM   1427 C  CA  . ASN A 1 178 ? 28.723  13.687  -14.273 1.00 7.30  ? 177 ASN A CA  1 
ATOM   1428 C  C   . ASN A 1 178 ? 30.163  13.715  -13.757 1.00 7.15  ? 177 ASN A C   1 
ATOM   1429 O  O   . ASN A 1 178 ? 30.987  12.883  -14.141 1.00 7.10  ? 177 ASN A O   1 
ATOM   1430 C  CB  . ASN A 1 178 ? 28.542  14.658  -15.437 1.00 7.89  ? 177 ASN A CB  1 
ATOM   1431 C  CG  . ASN A 1 178 ? 27.256  14.397  -16.211 1.00 8.44  ? 177 ASN A CG  1 
ATOM   1432 O  OD1 . ASN A 1 178 ? 26.755  13.265  -16.233 1.00 10.70 ? 177 ASN A OD1 1 
ATOM   1433 N  ND2 . ASN A 1 178 ? 26.725  15.429  -16.859 1.00 8.46  ? 177 ASN A ND2 1 
ATOM   1434 N  N   . ALA A 1 179 ? 30.446  14.658  -12.869 1.00 6.46  ? 178 ALA A N   1 
ATOM   1435 C  CA  . ALA A 1 179 ? 31.819  14.861  -12.418 1.00 6.71  ? 178 ALA A CA  1 
ATOM   1436 C  C   . ALA A 1 179 ? 32.267  13.769  -11.481 1.00 6.76  ? 178 ALA A C   1 
ATOM   1437 O  O   . ALA A 1 179 ? 33.451  13.487  -11.399 1.00 6.56  ? 178 ALA A O   1 
ATOM   1438 C  CB  . ALA A 1 179 ? 31.973  16.210  -11.763 1.00 6.60  ? 178 ALA A CB  1 
ATOM   1439 N  N   . ILE A 1 180 ? 31.324  13.148  -10.773 1.00 6.17  ? 179 ILE A N   1 
ATOM   1440 C  CA  . ILE A 1 180 ? 31.718  12.163  -9.758  1.00 6.98  ? 179 ILE A CA  1 
ATOM   1441 C  C   . ILE A 1 180 ? 32.434  10.959  -10.389 1.00 6.86  ? 179 ILE A C   1 
ATOM   1442 O  O   . ILE A 1 180 ? 33.203  10.267  -9.730  1.00 7.56  ? 179 ILE A O   1 
ATOM   1443 C  CB  . ILE A 1 180 ? 30.533  11.737  -8.855  1.00 6.79  ? 179 ILE A CB  1 
ATOM   1444 C  CG1 . ILE A 1 180 ? 31.061  11.209  -7.509  1.00 6.93  ? 179 ILE A CG1 1 
ATOM   1445 C  CG2 . ILE A 1 180 ? 29.610  10.718  -9.553  1.00 8.69  ? 179 ILE A CG2 1 
ATOM   1446 C  CD1 . ILE A 1 180 ? 29.980  11.043  -6.445  1.00 7.48  ? 179 ILE A CD1 1 
ATOM   1447 N  N   . TRP A 1 181 ? 32.175  10.715  -11.670 1.00 7.21  ? 180 TRP A N   1 
ATOM   1448 C  CA  . TRP A 1 181 ? 32.864  9.632   -12.372 1.00 8.43  ? 180 TRP A CA  1 
ATOM   1449 C  C   . TRP A 1 181 ? 34.380  9.809   -12.405 1.00 8.59  ? 180 TRP A C   1 
ATOM   1450 O  O   . TRP A 1 181 ? 35.123  8.813   -12.466 1.00 9.30  ? 180 TRP A O   1 
ATOM   1451 C  CB  . TRP A 1 181 ? 32.276  9.455   -13.763 1.00 8.74  ? 180 TRP A CB  1 
ATOM   1452 C  CG  . TRP A 1 181 ? 30.861  8.969   -13.651 1.00 9.45  ? 180 TRP A CG  1 
ATOM   1453 C  CD1 . TRP A 1 181 ? 29.724  9.715   -13.788 1.00 9.95  ? 180 TRP A CD1 1 
ATOM   1454 C  CD2 . TRP A 1 181 ? 30.438  7.647   -13.291 1.00 9.07  ? 180 TRP A CD2 1 
ATOM   1455 N  NE1 . TRP A 1 181 ? 28.613  8.924   -13.582 1.00 10.26 ? 180 TRP A NE1 1 
ATOM   1456 C  CE2 . TRP A 1 181 ? 29.024  7.650   -13.275 1.00 9.93  ? 180 TRP A CE2 1 
ATOM   1457 C  CE3 . TRP A 1 181 ? 31.119  6.453   -12.994 1.00 11.17 ? 180 TRP A CE3 1 
ATOM   1458 C  CZ2 . TRP A 1 181 ? 28.268  6.498   -12.975 1.00 8.91  ? 180 TRP A CZ2 1 
ATOM   1459 C  CZ3 . TRP A 1 181 ? 30.368  5.303   -12.697 1.00 10.01 ? 180 TRP A CZ3 1 
ATOM   1460 C  CH2 . TRP A 1 181 ? 28.956  5.341   -12.697 1.00 9.83  ? 180 TRP A CH2 1 
ATOM   1461 N  N   . LYS A 1 182 ? 34.837  11.061  -12.357 1.00 7.87  ? 181 LYS A N   1 
ATOM   1462 C  CA  . LYS A 1 182 ? 36.281  11.364  -12.326 1.00 7.84  ? 181 LYS A CA  1 
ATOM   1463 C  C   . LYS A 1 182 ? 36.949  10.830  -11.061 1.00 7.90  ? 181 LYS A C   1 
ATOM   1464 O  O   . LYS A 1 182 ? 38.165  10.578  -11.057 1.00 8.03  ? 181 LYS A O   1 
ATOM   1465 C  CB  . LYS A 1 182 ? 36.541  12.879  -12.393 1.00 7.82  ? 181 LYS A CB  1 
ATOM   1466 C  CG  . LYS A 1 182 ? 36.045  13.526  -13.675 1.00 8.60  ? 181 LYS A CG  1 
ATOM   1467 C  CD  . LYS A 1 182 ? 36.533  14.958  -13.774 1.00 10.70 ? 181 LYS A CD  1 
ATOM   1468 C  CE  . LYS A 1 182 ? 35.775  15.703  -14.867 1.00 9.51  ? 181 LYS A CE  1 
ATOM   1469 N  NZ  . LYS A 1 182 ? 36.275  17.113  -14.978 1.00 8.97  ? 181 LYS A NZ  1 
ATOM   1470 N  N   . ILE A 1 183 ? 36.174  10.693  -9.985  1.00 7.72  ? 182 ILE A N   1 
ATOM   1471 C  CA  . ILE A 1 183 ? 36.719  10.232  -8.702  1.00 7.94  ? 182 ILE A CA  1 
ATOM   1472 C  C   . ILE A 1 183 ? 36.139  8.888   -8.246  1.00 8.05  ? 182 ILE A C   1 
ATOM   1473 O  O   . ILE A 1 183 ? 36.305  8.508   -7.085  1.00 7.78  ? 182 ILE A O   1 
ATOM   1474 C  CB  . ILE A 1 183 ? 36.555  11.297  -7.584  1.00 7.78  ? 182 ILE A CB  1 
ATOM   1475 C  CG1 . ILE A 1 183 ? 35.081  11.755  -7.456  1.00 8.37  ? 182 ILE A CG1 1 
ATOM   1476 C  CG2 . ILE A 1 183 ? 37.530  12.477  -7.826  1.00 8.54  ? 182 ILE A CG2 1 
ATOM   1477 C  CD1 . ILE A 1 183 ? 34.792  12.554  -6.169  1.00 8.02  ? 182 ILE A CD1 1 
ATOM   1478 N  N   . ALA A 1 184 ? 35.459  8.183   -9.157  1.00 8.63  ? 183 ALA A N   1 
ATOM   1479 C  CA  . ALA A 1 184 ? 34.957  6.838   -8.875  1.00 8.57  ? 183 ALA A CA  1 
ATOM   1480 C  C   . ALA A 1 184 ? 36.153  5.936   -8.562  1.00 8.79  ? 183 ALA A C   1 
ATOM   1481 O  O   . ALA A 1 184 ? 37.108  5.848   -9.361  1.00 8.73  ? 183 ALA A O   1 
ATOM   1482 C  CB  . ALA A 1 184 ? 34.151  6.287   -10.072 1.00 8.66  ? 183 ALA A CB  1 
ATOM   1483 N  N   . ASN A 1 185 ? 36.105  5.282   -7.402  1.00 8.71  ? 184 ASN A N   1 
ATOM   1484 C  CA  . ASN A 1 185 ? 37.190  4.389   -6.986  1.00 9.23  ? 184 ASN A CA  1 
ATOM   1485 C  C   . ASN A 1 185 ? 36.936  2.999   -7.524  1.00 9.44  ? 184 ASN A C   1 
ATOM   1486 O  O   . ASN A 1 185 ? 36.368  2.143   -6.835  1.00 9.56  ? 184 ASN A O   1 
ATOM   1487 C  CB  . ASN A 1 185 ? 37.361  4.379   -5.458  1.00 9.06  ? 184 ASN A CB  1 
ATOM   1488 C  CG  . ASN A 1 185 ? 38.524  3.508   -4.997  1.00 9.73  ? 184 ASN A CG  1 
ATOM   1489 O  OD1 . ASN A 1 185 ? 39.205  2.903   -5.814  1.00 10.04 ? 184 ASN A OD1 1 
ATOM   1490 N  ND2 . ASN A 1 185 ? 38.749  3.441   -3.676  1.00 9.39  ? 184 ASN A ND2 1 
ATOM   1491 N  N   . TRP A 1 186 ? 37.391  2.766   -8.756  1.00 9.67  ? 185 TRP A N   1 
ATOM   1492 C  CA  . TRP A 1 186 ? 37.125  1.503   -9.412  1.00 10.05 ? 185 TRP A CA  1 
ATOM   1493 C  C   . TRP A 1 186 ? 37.795  0.339   -8.701  1.00 10.28 ? 185 TRP A C   1 
ATOM   1494 O  O   . TRP A 1 186 ? 37.315  -0.785  -8.792  1.00 10.58 ? 185 TRP A O   1 
ATOM   1495 C  CB  . TRP A 1 186 ? 37.495  1.552   -10.900 1.00 10.04 ? 185 TRP A CB  1 
ATOM   1496 C  CG  . TRP A 1 186 ? 36.526  2.394   -11.672 1.00 10.78 ? 185 TRP A CG  1 
ATOM   1497 C  CD1 . TRP A 1 186 ? 36.748  3.637   -12.188 1.00 10.44 ? 185 TRP A CD1 1 
ATOM   1498 C  CD2 . TRP A 1 186 ? 35.163  2.067   -11.975 1.00 10.16 ? 185 TRP A CD2 1 
ATOM   1499 N  NE1 . TRP A 1 186 ? 35.606  4.111   -12.799 1.00 10.50 ? 185 TRP A NE1 1 
ATOM   1500 C  CE2 . TRP A 1 186 ? 34.625  3.156   -12.696 1.00 10.29 ? 185 TRP A CE2 1 
ATOM   1501 C  CE3 . TRP A 1 186 ? 34.347  0.945   -11.723 1.00 10.82 ? 185 TRP A CE3 1 
ATOM   1502 C  CZ2 . TRP A 1 186 ? 33.309  3.165   -13.167 1.00 10.23 ? 185 TRP A CZ2 1 
ATOM   1503 C  CZ3 . TRP A 1 186 ? 33.042  0.948   -12.191 1.00 10.05 ? 185 TRP A CZ3 1 
ATOM   1504 C  CH2 . TRP A 1 186 ? 32.531  2.064   -12.903 1.00 10.19 ? 185 TRP A CH2 1 
ATOM   1505 N  N   . LYS A 1 187 ? 38.890  0.602   -7.986  1.00 10.07 ? 186 LYS A N   1 
ATOM   1506 C  CA  . LYS A 1 187 ? 39.523  -0.448  -7.195  1.00 10.34 ? 186 LYS A CA  1 
ATOM   1507 C  C   . LYS A 1 187 ? 38.526  -1.003  -6.176  1.00 9.27  ? 186 LYS A C   1 
ATOM   1508 O  O   . LYS A 1 187 ? 38.369  -2.216  -6.040  1.00 8.98  ? 186 LYS A O   1 
ATOM   1509 C  CB  . LYS A 1 187 ? 40.772  0.074   -6.490  1.00 11.00 ? 186 LYS A CB  1 
ATOM   1510 C  CG  . LYS A 1 187 ? 41.548  -1.010  -5.758  1.00 13.60 ? 186 LYS A CG  1 
ATOM   1511 C  CD  . LYS A 1 187 ? 42.714  -0.410  -5.005  1.00 17.82 ? 186 LYS A CD  1 
ATOM   1512 C  CE  . LYS A 1 187 ? 43.334  -1.417  -4.066  1.00 19.08 ? 186 LYS A CE  1 
ATOM   1513 N  NZ  . LYS A 1 187 ? 44.355  -0.738  -3.218  1.00 22.67 ? 186 LYS A NZ  1 
ATOM   1514 N  N   . ASN A 1 188 ? 37.853  -0.103  -5.467  1.00 8.10  ? 187 ASN A N   1 
ATOM   1515 C  CA  . ASN A 1 188 ? 36.853  -0.503  -4.495  1.00 8.29  ? 187 ASN A CA  1 
ATOM   1516 C  C   . ASN A 1 188 ? 35.614  -1.141  -5.130  1.00 7.86  ? 187 ASN A C   1 
ATOM   1517 O  O   . ASN A 1 188 ? 35.120  -2.142  -4.643  1.00 7.47  ? 187 ASN A O   1 
ATOM   1518 C  CB  . ASN A 1 188 ? 36.445  0.693   -3.660  1.00 8.13  ? 187 ASN A CB  1 
ATOM   1519 C  CG  . ASN A 1 188 ? 35.431  0.333   -2.611  1.00 8.63  ? 187 ASN A CG  1 
ATOM   1520 O  OD1 . ASN A 1 188 ? 34.226  0.550   -2.794  1.00 6.58  ? 187 ASN A OD1 1 
ATOM   1521 N  ND2 . ASN A 1 188 ? 35.905  -0.239  -1.506  1.00 7.95  ? 187 ASN A ND2 1 
ATOM   1522 N  N   . VAL A 1 189 ? 35.102  -0.542  -6.201  1.00 8.27  ? 188 VAL A N   1 
ATOM   1523 C  CA  . VAL A 1 189 ? 33.943  -1.109  -6.900  1.00 8.31  ? 188 VAL A CA  1 
ATOM   1524 C  C   . VAL A 1 189 ? 34.263  -2.544  -7.362  1.00 8.51  ? 188 VAL A C   1 
ATOM   1525 O  O   . VAL A 1 189 ? 33.451  -3.466  -7.194  1.00 8.57  ? 188 VAL A O   1 
ATOM   1526 C  CB  . VAL A 1 189 ? 33.483  -0.191  -8.081  1.00 8.69  ? 188 VAL A CB  1 
ATOM   1527 C  CG1 . VAL A 1 189 ? 32.217  -0.749  -8.757  1.00 7.67  ? 188 VAL A CG1 1 
ATOM   1528 C  CG2 . VAL A 1 189 ? 33.211  1.212   -7.579  1.00 7.68  ? 188 VAL A CG2 1 
ATOM   1529 N  N   . SER A 1 190 ? 35.468  -2.726  -7.900  1.00 8.72  ? 189 SER A N   1 
ATOM   1530 C  CA  . SER A 1 190 ? 35.930  -4.039  -8.344  1.00 8.89  ? 189 SER A CA  1 
ATOM   1531 C  C   . SER A 1 190 ? 36.024  -5.033  -7.198  1.00 9.26  ? 189 SER A C   1 
ATOM   1532 O  O   . SER A 1 190 ? 35.614  -6.184  -7.344  1.00 9.90  ? 189 SER A O   1 
ATOM   1533 C  CB  . SER A 1 190 ? 37.274  -3.909  -9.043  1.00 8.78  ? 189 SER A CB  1 
ATOM   1534 O  OG  . SER A 1 190 ? 37.131  -3.133  -10.215 1.00 7.97  ? 189 SER A OG  1 
ATOM   1535 N  N   . GLU A 1 191 ? 36.557  -4.587  -6.060  1.00 9.69  ? 190 GLU A N   1 
ATOM   1536 C  CA  . GLU A 1 191 ? 36.623  -5.429  -4.861  1.00 10.20 ? 190 GLU A CA  1 
ATOM   1537 C  C   . GLU A 1 191 ? 35.228  -5.839  -4.376  1.00 9.93  ? 190 GLU A C   1 
ATOM   1538 O  O   . GLU A 1 191 ? 35.011  -6.998  -3.982  1.00 9.81  ? 190 GLU A O   1 
ATOM   1539 C  CB  . GLU A 1 191 ? 37.366  -4.715  -3.732  1.00 10.15 ? 190 GLU A CB  1 
ATOM   1540 C  CG  . GLU A 1 191 ? 38.874  -4.637  -3.939  1.00 12.71 ? 190 GLU A CG  1 
ATOM   1541 C  CD  . GLU A 1 191 ? 39.547  -3.683  -2.968  1.00 15.13 ? 190 GLU A CD  1 
ATOM   1542 O  OE1 . GLU A 1 191 ? 38.852  -3.140  -2.082  1.00 15.23 ? 190 GLU A OE1 1 
ATOM   1543 O  OE2 . GLU A 1 191 ? 40.773  -3.482  -3.097  1.00 17.46 ? 190 GLU A OE2 1 
ATOM   1544 N  N   . ARG A 1 192 ? 34.294  -4.886  -4.403  1.00 9.97  ? 191 ARG A N   1 
ATOM   1545 C  CA  . ARG A 1 192 ? 32.909  -5.138  -3.996  1.00 10.24 ? 191 ARG A CA  1 
ATOM   1546 C  C   . ARG A 1 192 ? 32.225  -6.117  -4.944  1.00 10.49 ? 191 ARG A C   1 
ATOM   1547 O  O   . ARG A 1 192 ? 31.457  -6.989  -4.505  1.00 10.84 ? 191 ARG A O   1 
ATOM   1548 C  CB  . ARG A 1 192 ? 32.113  -3.826  -3.913  1.00 9.50  ? 191 ARG A CB  1 
ATOM   1549 C  CG  . ARG A 1 192 ? 32.591  -2.886  -2.800  1.00 9.87  ? 191 ARG A CG  1 
ATOM   1550 C  CD  . ARG A 1 192 ? 31.703  -1.655  -2.666  1.00 9.94  ? 191 ARG A CD  1 
ATOM   1551 N  NE  . ARG A 1 192 ? 32.115  -0.877  -1.495  1.00 8.97  ? 191 ARG A NE  1 
ATOM   1552 C  CZ  . ARG A 1 192 ? 31.742  -1.138  -0.244  1.00 10.52 ? 191 ARG A CZ  1 
ATOM   1553 N  NH1 . ARG A 1 192 ? 30.901  -2.134  0.020   1.00 8.90  ? 191 ARG A NH1 1 
ATOM   1554 N  NH2 . ARG A 1 192 ? 32.193  -0.374  0.747   1.00 8.79  ? 191 ARG A NH2 1 
ATOM   1555 N  N   . PHE A 1 193 ? 32.513  -5.980  -6.238  1.00 10.38 ? 192 PHE A N   1 
ATOM   1556 C  CA  . PHE A 1 193 ? 32.009  -6.912  -7.247  1.00 10.99 ? 192 PHE A CA  1 
ATOM   1557 C  C   . PHE A 1 193 ? 32.525  -8.329  -6.991  1.00 11.67 ? 192 PHE A C   1 
ATOM   1558 O  O   . PHE A 1 193 ? 31.755  -9.295  -7.046  1.00 12.31 ? 192 PHE A O   1 
ATOM   1559 C  CB  . PHE A 1 193 ? 32.376  -6.443  -8.660  1.00 10.32 ? 192 PHE A CB  1 
ATOM   1560 C  CG  . PHE A 1 193 ? 31.933  -7.388  -9.755  1.00 10.69 ? 192 PHE A CG  1 
ATOM   1561 C  CD1 . PHE A 1 193 ? 30.575  -7.595  -10.022 1.00 9.88  ? 192 PHE A CD1 1 
ATOM   1562 C  CD2 . PHE A 1 193 ? 32.871  -8.077  -10.509 1.00 10.83 ? 192 PHE A CD2 1 
ATOM   1563 C  CE1 . PHE A 1 193 ? 30.168  -8.460  -11.032 1.00 9.94  ? 192 PHE A CE1 1 
ATOM   1564 C  CE2 . PHE A 1 193 ? 32.470  -8.962  -11.526 1.00 11.79 ? 192 PHE A CE2 1 
ATOM   1565 C  CZ  . PHE A 1 193 ? 31.118  -9.146  -11.787 1.00 10.34 ? 192 PHE A CZ  1 
ATOM   1566 N  N   . ALA A 1 194 ? 33.816  -8.452  -6.692  1.00 12.77 ? 193 ALA A N   1 
ATOM   1567 C  CA  . ALA A 1 194 ? 34.413  -9.764  -6.427  1.00 14.03 ? 193 ALA A CA  1 
ATOM   1568 C  C   . ALA A 1 194 ? 33.763  -10.409 -5.204  1.00 15.22 ? 193 ALA A C   1 
ATOM   1569 O  O   . ALA A 1 194 ? 33.434  -11.599 -5.215  1.00 14.60 ? 193 ALA A O   1 
ATOM   1570 C  CB  . ALA A 1 194 ? 35.910  -9.643  -6.236  1.00 13.68 ? 193 ALA A CB  1 
ATOM   1571 N  N   . LYS A 1 195 ? 33.573  -9.608  -4.160  1.00 16.50 ? 194 LYS A N   1 
ATOM   1572 C  CA  . LYS A 1 195 ? 32.968  -10.077 -2.921  1.00 18.68 ? 194 LYS A CA  1 
ATOM   1573 C  C   . LYS A 1 195 ? 31.497  -10.448 -3.116  1.00 19.73 ? 194 LYS A C   1 
ATOM   1574 O  O   . LYS A 1 195 ? 31.030  -11.437 -2.545  1.00 20.38 ? 194 LYS A O   1 
ATOM   1575 C  CB  . LYS A 1 195 ? 33.139  -9.031  -1.813  1.00 18.65 ? 194 LYS A CB  1 
ATOM   1576 C  CG  . LYS A 1 195 ? 32.729  -9.498  -0.423  1.00 21.59 ? 194 LYS A CG  1 
ATOM   1577 C  CD  . LYS A 1 195 ? 33.757  -10.455 0.186   1.00 25.71 ? 194 LYS A CD  1 
ATOM   1578 C  CE  . LYS A 1 195 ? 33.213  -11.133 1.445   1.00 28.21 ? 194 LYS A CE  1 
ATOM   1579 N  NZ  . LYS A 1 195 ? 32.815  -12.559 1.204   1.00 30.03 ? 194 LYS A NZ  1 
ATOM   1580 N  N   . ALA A 1 196 ? 30.784  -9.679  -3.938  1.00 20.73 ? 195 ALA A N   1 
ATOM   1581 C  CA  . ALA A 1 196 ? 29.375  -9.949  -4.250  1.00 22.15 ? 195 ALA A CA  1 
ATOM   1582 C  C   . ALA A 1 196 ? 29.169  -11.299 -4.960  1.00 23.48 ? 195 ALA A C   1 
ATOM   1583 O  O   . ALA A 1 196 ? 28.080  -11.874 -4.904  1.00 24.01 ? 195 ALA A O   1 
ATOM   1584 C  CB  . ALA A 1 196 ? 28.781  -8.809  -5.086  1.00 21.72 ? 195 ALA A CB  1 
ATOM   1585 N  N   . GLN A 1 197 ? 30.215  -11.792 -5.617  1.00 24.98 ? 196 GLN A N   1 
ATOM   1586 C  CA  . GLN A 1 197 ? 30.135  -13.035 -6.392  1.00 26.46 ? 196 GLN A CA  1 
ATOM   1587 C  C   . GLN A 1 197 ? 30.449  -14.270 -5.546  1.00 27.65 ? 196 GLN A C   1 
ATOM   1588 O  O   . GLN A 1 197 ? 30.288  -15.407 -6.009  1.00 27.99 ? 196 GLN A O   1 
ATOM   1589 C  CB  . GLN A 1 197 ? 31.055  -12.970 -7.614  1.00 26.69 ? 196 GLN A CB  1 
ATOM   1590 C  CG  . GLN A 1 197 ? 30.643  -11.934 -8.661  1.00 26.87 ? 196 GLN A CG  1 
ATOM   1591 C  CD  . GLN A 1 197 ? 31.161  -12.259 -10.051 1.00 28.64 ? 196 GLN A CD  1 
ATOM   1592 O  OE1 . GLN A 1 197 ? 32.368  -12.266 -10.297 1.00 29.93 ? 196 GLN A OE1 1 
ATOM   1593 N  NE2 . GLN A 1 197 ? 30.242  -12.520 -10.974 1.00 28.91 ? 196 GLN A NE2 1 
ATOM   1594 N  N   . GLN A 1 198 ? 30.886  -14.044 -4.306  1.00 28.60 ? 197 GLN A N   1 
ATOM   1595 C  CA  . GLN A 1 198 ? 31.227  -15.136 -3.389  1.00 29.62 ? 197 GLN A CA  1 
ATOM   1596 C  C   . GLN A 1 198 ? 29.990  -15.725 -2.718  1.00 29.66 ? 197 GLN A C   1 
ATOM   1597 O  O   . GLN A 1 198 ? 28.967  -15.053 -2.576  1.00 30.03 ? 197 GLN A O   1 
ATOM   1598 C  CB  . GLN A 1 198 ? 32.225  -14.658 -2.333  1.00 29.85 ? 197 GLN A CB  1 
ATOM   1599 C  CG  . GLN A 1 198 ? 33.627  -14.424 -2.878  1.00 31.39 ? 197 GLN A CG  1 
ATOM   1600 C  CD  . GLN A 1 198 ? 34.674  -14.294 -1.783  1.00 33.65 ? 197 GLN A CD  1 
ATOM   1601 O  OE1 . GLN A 1 198 ? 34.453  -13.628 -0.768  1.00 34.71 ? 197 GLN A OE1 1 
ATOM   1602 N  NE2 . GLN A 1 198 ? 35.827  -14.931 -1.988  1.00 34.50 ? 197 GLN A NE2 1 
ATOM   1603 N  N   . MET B 1 1   ? 9.004   -16.107 26.827  1.00 24.34 ? 0   MET C N   1 
ATOM   1604 C  CA  . MET B 1 1   ? 7.877   -15.208 26.445  1.00 25.94 ? 0   MET C CA  1 
ATOM   1605 C  C   . MET B 1 1   ? 7.604   -15.327 24.953  1.00 23.64 ? 0   MET C C   1 
ATOM   1606 O  O   . MET B 1 1   ? 8.533   -15.335 24.143  1.00 23.90 ? 0   MET C O   1 
ATOM   1607 C  CB  . MET B 1 1   ? 8.233   -13.766 26.806  1.00 25.84 ? 0   MET C CB  1 
ATOM   1608 C  CG  . MET B 1 1   ? 7.163   -12.735 26.530  1.00 28.65 ? 0   MET C CG  1 
ATOM   1609 S  SD  . MET B 1 1   ? 7.856   -11.063 26.668  1.00 32.45 ? 0   MET C SD  1 
ATOM   1610 C  CE  . MET B 1 1   ? 9.261   -11.109 25.545  1.00 30.35 ? 0   MET C CE  1 
ATOM   1611 N  N   . LYS B 1 2   ? 6.331   -15.423 24.589  1.00 21.67 ? 1   LYS C N   1 
ATOM   1612 C  CA  . LYS B 1 2   ? 5.961   -15.447 23.181  1.00 19.73 ? 1   LYS C CA  1 
ATOM   1613 C  C   . LYS B 1 2   ? 4.558   -14.897 22.993  1.00 18.58 ? 1   LYS C C   1 
ATOM   1614 O  O   . LYS B 1 2   ? 3.749   -14.900 23.916  1.00 17.63 ? 1   LYS C O   1 
ATOM   1615 C  CB  . LYS B 1 2   ? 6.036   -16.866 22.620  1.00 20.22 ? 1   LYS C CB  1 
ATOM   1616 C  CG  . LYS B 1 2   ? 4.930   -17.768 23.104  1.00 20.61 ? 1   LYS C CG  1 
ATOM   1617 C  CD  . LYS B 1 2   ? 5.112   -19.219 22.678  1.00 23.51 ? 1   LYS C CD  1 
ATOM   1618 C  CE  . LYS B 1 2   ? 4.811   -19.429 21.204  1.00 23.52 ? 1   LYS C CE  1 
ATOM   1619 N  NZ  . LYS B 1 2   ? 4.479   -20.875 20.986  1.00 25.34 ? 1   LYS C NZ  1 
ATOM   1620 N  N   . HIS B 1 3   ? 4.281   -14.448 21.779  1.00 16.68 ? 2   HIS C N   1 
ATOM   1621 C  CA  . HIS B 1 3   ? 2.951   -13.973 21.436  1.00 16.16 ? 2   HIS C CA  1 
ATOM   1622 C  C   . HIS B 1 3   ? 2.069   -15.174 21.189  1.00 15.77 ? 2   HIS C C   1 
ATOM   1623 O  O   . HIS B 1 3   ? 2.521   -16.185 20.649  1.00 15.48 ? 2   HIS C O   1 
ATOM   1624 C  CB  . HIS B 1 3   ? 3.041   -13.084 20.204  1.00 16.03 ? 2   HIS C CB  1 
ATOM   1625 C  CG  . HIS B 1 3   ? 3.979   -11.939 20.396  1.00 16.90 ? 2   HIS C CG  1 
ATOM   1626 N  ND1 . HIS B 1 3   ? 3.655   -10.847 21.173  1.00 18.21 ? 2   HIS C ND1 1 
ATOM   1627 C  CD2 . HIS B 1 3   ? 5.257   -11.752 19.993  1.00 18.35 ? 2   HIS C CD2 1 
ATOM   1628 C  CE1 . HIS B 1 3   ? 4.680   -10.012 21.199  1.00 19.13 ? 2   HIS C CE1 1 
ATOM   1629 N  NE2 . HIS B 1 3   ? 5.667   -10.539 20.495  1.00 19.15 ? 2   HIS C NE2 1 
ATOM   1630 N  N   A SER B 1 4   ? 0.811   -15.076 21.600  0.50 15.73 ? 3   SER C N   1 
ATOM   1631 N  N   B SER B 1 4   ? 0.812   -15.064 21.607  0.50 15.55 ? 3   SER C N   1 
ATOM   1632 C  CA  A SER B 1 4   ? -0.133  -16.167 21.396  0.50 15.53 ? 3   SER C CA  1 
ATOM   1633 C  CA  B SER B 1 4   ? -0.158  -16.138 21.432  0.50 15.15 ? 3   SER C CA  1 
ATOM   1634 C  C   A SER B 1 4   ? -1.454  -15.661 20.836  0.50 15.33 ? 3   SER C C   1 
ATOM   1635 C  C   B SER B 1 4   ? -1.416  -15.627 20.740  0.50 15.13 ? 3   SER C C   1 
ATOM   1636 O  O   A SER B 1 4   ? -1.811  -14.491 21.011  0.50 15.22 ? 3   SER C O   1 
ATOM   1637 O  O   B SER B 1 4   ? -1.697  -14.424 20.738  0.50 14.97 ? 3   SER C O   1 
ATOM   1638 C  CB  A SER B 1 4   ? -0.350  -16.947 22.696  0.50 15.64 ? 3   SER C CB  1 
ATOM   1639 C  CB  B SER B 1 4   ? -0.519  -16.764 22.784  0.50 15.20 ? 3   SER C CB  1 
ATOM   1640 O  OG  A SER B 1 4   ? 0.819   -17.670 23.050  0.50 16.20 ? 3   SER C OG  1 
ATOM   1641 O  OG  B SER B 1 4   ? -1.308  -15.881 23.565  0.50 14.32 ? 3   SER C OG  1 
ATOM   1642 N  N   . LEU B 1 5   ? -2.168  -16.549 20.148  1.00 15.14 ? 4   LEU C N   1 
ATOM   1643 C  CA  . LEU B 1 5   ? -3.469  -16.220 19.575  1.00 14.90 ? 4   LEU C CA  1 
ATOM   1644 C  C   . LEU B 1 5   ? -4.468  -16.095 20.729  1.00 15.10 ? 4   LEU C C   1 
ATOM   1645 O  O   . LEU B 1 5   ? -4.690  -17.063 21.456  1.00 14.56 ? 4   LEU C O   1 
ATOM   1646 C  CB  . LEU B 1 5   ? -3.915  -17.309 18.593  1.00 14.60 ? 4   LEU C CB  1 
ATOM   1647 C  CG  . LEU B 1 5   ? -5.262  -17.130 17.883  1.00 14.78 ? 4   LEU C CG  1 
ATOM   1648 C  CD1 . LEU B 1 5   ? -5.241  -15.946 16.926  1.00 13.83 ? 4   LEU C CD1 1 
ATOM   1649 C  CD2 . LEU B 1 5   ? -5.656  -18.397 17.141  1.00 15.45 ? 4   LEU C CD2 1 
ATOM   1650 N  N   . PRO B 1 6   ? -5.027  -14.903 20.923  1.00 15.15 ? 5   PRO C N   1 
ATOM   1651 C  CA  . PRO B 1 6   ? -5.971  -14.765 22.032  1.00 15.39 ? 5   PRO C CA  1 
ATOM   1652 C  C   . PRO B 1 6   ? -7.285  -15.486 21.742  1.00 16.25 ? 5   PRO C C   1 
ATOM   1653 O  O   . PRO B 1 6   ? -7.705  -15.519 20.585  1.00 16.20 ? 5   PRO C O   1 
ATOM   1654 C  CB  . PRO B 1 6   ? -6.245  -13.260 22.074  1.00 15.56 ? 5   PRO C CB  1 
ATOM   1655 C  CG  . PRO B 1 6   ? -5.991  -12.784 20.665  1.00 14.81 ? 5   PRO C CG  1 
ATOM   1656 C  CD  . PRO B 1 6   ? -4.863  -13.647 20.164  1.00 14.93 ? 5   PRO C CD  1 
ATOM   1657 N  N   . ASP B 1 7   ? -7.932  -16.044 22.774  1.00 16.37 ? 6   ASP C N   1 
ATOM   1658 C  CA  . ASP B 1 7   ? -9.235  -16.624 22.612  1.00 17.33 ? 6   ASP C CA  1 
ATOM   1659 C  C   . ASP B 1 7   ? -10.166 -15.447 22.309  1.00 17.55 ? 6   ASP C C   1 
ATOM   1660 O  O   . ASP B 1 7   ? -9.969  -14.344 22.824  1.00 17.74 ? 6   ASP C O   1 
ATOM   1661 C  CB  . ASP B 1 7   ? -9.703  -17.336 23.881  1.00 17.35 ? 6   ASP C CB  1 
ATOM   1662 C  CG  . ASP B 1 7   ? -8.897  -18.596 24.196  1.00 17.99 ? 6   ASP C CG  1 
ATOM   1663 O  OD1 . ASP B 1 7   ? -8.980  -19.062 25.353  1.00 19.45 ? 6   ASP C OD1 1 
ATOM   1664 O  OD2 . ASP B 1 7   ? -8.192  -19.124 23.306  1.00 18.30 ? 6   ASP C OD2 1 
ATOM   1665 N  N   . LEU B 1 8   ? -11.162 -15.677 21.459  1.00 17.99 ? 7   LEU C N   1 
ATOM   1666 C  CA  . LEU B 1 8   ? -12.240 -14.707 21.258  1.00 18.53 ? 7   LEU C CA  1 
ATOM   1667 C  C   . LEU B 1 8   ? -13.044 -14.559 22.557  1.00 18.53 ? 7   LEU C C   1 
ATOM   1668 O  O   . LEU B 1 8   ? -13.130 -15.513 23.345  1.00 18.88 ? 7   LEU C O   1 
ATOM   1669 C  CB  . LEU B 1 8   ? -13.163 -15.147 20.117  1.00 18.26 ? 7   LEU C CB  1 
ATOM   1670 C  CG  . LEU B 1 8   ? -12.598 -15.315 18.706  1.00 18.33 ? 7   LEU C CG  1 
ATOM   1671 C  CD1 . LEU B 1 8   ? -13.728 -15.646 17.759  1.00 18.62 ? 7   LEU C CD1 1 
ATOM   1672 C  CD2 . LEU B 1 8   ? -11.892 -14.057 18.249  1.00 17.30 ? 7   LEU C CD2 1 
ATOM   1673 N  N   . PRO B 1 9   ? -13.619 -13.362 22.807  1.00 18.82 ? 8   PRO C N   1 
ATOM   1674 C  CA  . PRO B 1 9   ? -14.461 -13.176 24.003  1.00 18.76 ? 8   PRO C CA  1 
ATOM   1675 C  C   . PRO B 1 9   ? -15.848 -13.821 23.895  1.00 18.85 ? 8   PRO C C   1 
ATOM   1676 O  O   . PRO B 1 9   ? -16.679 -13.662 24.797  1.00 19.03 ? 8   PRO C O   1 
ATOM   1677 C  CB  . PRO B 1 9   ? -14.608 -11.648 24.105  1.00 18.97 ? 8   PRO C CB  1 
ATOM   1678 C  CG  . PRO B 1 9   ? -13.698 -11.062 23.073  1.00 18.59 ? 8   PRO C CG  1 
ATOM   1679 C  CD  . PRO B 1 9   ? -13.493 -12.113 22.036  1.00 18.97 ? 8   PRO C CD  1 
ATOM   1680 N  N   . TYR B 1 10  ? -16.083 -14.543 22.802  1.00 18.68 ? 9   TYR C N   1 
ATOM   1681 C  CA  . TYR B 1 10  ? -17.381 -15.139 22.485  1.00 18.69 ? 9   TYR C CA  1 
ATOM   1682 C  C   . TYR B 1 10  ? -17.148 -16.355 21.596  1.00 18.80 ? 9   TYR C C   1 
ATOM   1683 O  O   . TYR B 1 10  ? -16.025 -16.578 21.117  1.00 18.78 ? 9   TYR C O   1 
ATOM   1684 C  CB  . TYR B 1 10  ? -18.264 -14.118 21.748  1.00 18.29 ? 9   TYR C CB  1 
ATOM   1685 C  CG  . TYR B 1 10  ? -17.464 -13.211 20.849  1.00 17.72 ? 9   TYR C CG  1 
ATOM   1686 C  CD1 . TYR B 1 10  ? -17.144 -11.915 21.247  1.00 17.27 ? 9   TYR C CD1 1 
ATOM   1687 C  CD2 . TYR B 1 10  ? -16.988 -13.661 19.615  1.00 17.57 ? 9   TYR C CD2 1 
ATOM   1688 C  CE1 . TYR B 1 10  ? -16.388 -11.083 20.434  1.00 17.37 ? 9   TYR C CE1 1 
ATOM   1689 C  CE2 . TYR B 1 10  ? -16.224 -12.842 18.797  1.00 17.89 ? 9   TYR C CE2 1 
ATOM   1690 C  CZ  . TYR B 1 10  ? -15.931 -11.555 19.212  1.00 17.94 ? 9   TYR C CZ  1 
ATOM   1691 O  OH  . TYR B 1 10  ? -15.171 -10.741 18.414  1.00 16.44 ? 9   TYR C OH  1 
ATOM   1692 N  N   . ASP B 1 11  ? -18.209 -17.131 21.376  1.00 18.51 ? 10  ASP C N   1 
ATOM   1693 C  CA  . ASP B 1 11  ? -18.175 -18.263 20.451  1.00 18.59 ? 10  ASP C CA  1 
ATOM   1694 C  C   . ASP B 1 11  ? -18.180 -17.781 19.002  1.00 18.27 ? 10  ASP C C   1 
ATOM   1695 O  O   . ASP B 1 11  ? -18.527 -16.632 18.730  1.00 18.28 ? 10  ASP C O   1 
ATOM   1696 C  CB  . ASP B 1 11  ? -19.367 -19.184 20.698  1.00 18.81 ? 10  ASP C CB  1 
ATOM   1697 C  CG  . ASP B 1 11  ? -19.385 -19.747 22.103  1.00 19.62 ? 10  ASP C CG  1 
ATOM   1698 O  OD1 . ASP B 1 11  ? -18.416 -19.512 22.860  1.00 21.07 ? 10  ASP C OD1 1 
ATOM   1699 O  OD2 . ASP B 1 11  ? -20.369 -20.426 22.447  1.00 20.97 ? 10  ASP C OD2 1 
ATOM   1700 N  N   . TYR B 1 12  ? -17.814 -18.671 18.081  1.00 18.13 ? 11  TYR C N   1 
ATOM   1701 C  CA  . TYR B 1 12  ? -17.618 -18.308 16.672  1.00 18.11 ? 11  TYR C CA  1 
ATOM   1702 C  C   . TYR B 1 12  ? -18.876 -17.847 15.955  1.00 17.85 ? 11  TYR C C   1 
ATOM   1703 O  O   . TYR B 1 12  ? -18.806 -17.020 15.050  1.00 17.31 ? 11  TYR C O   1 
ATOM   1704 C  CB  . TYR B 1 12  ? -16.978 -19.456 15.894  1.00 18.57 ? 11  TYR C CB  1 
ATOM   1705 C  CG  . TYR B 1 12  ? -15.508 -19.603 16.171  1.00 18.79 ? 11  TYR C CG  1 
ATOM   1706 C  CD1 . TYR B 1 12  ? -14.614 -18.589 15.827  1.00 19.59 ? 11  TYR C CD1 1 
ATOM   1707 C  CD2 . TYR B 1 12  ? -15.008 -20.748 16.783  1.00 19.91 ? 11  TYR C CD2 1 
ATOM   1708 C  CE1 . TYR B 1 12  ? -13.263 -18.709 16.081  1.00 19.55 ? 11  TYR C CE1 1 
ATOM   1709 C  CE2 . TYR B 1 12  ? -13.653 -20.878 17.043  1.00 19.93 ? 11  TYR C CE2 1 
ATOM   1710 C  CZ  . TYR B 1 12  ? -12.788 -19.850 16.680  1.00 19.80 ? 11  TYR C CZ  1 
ATOM   1711 O  OH  . TYR B 1 12  ? -11.446 -19.952 16.929  1.00 19.74 ? 11  TYR C OH  1 
ATOM   1712 N  N   . ALA B 1 13  ? -20.020 -18.395 16.357  1.00 17.44 ? 12  ALA C N   1 
ATOM   1713 C  CA  . ALA B 1 13  ? -21.282 -18.051 15.724  1.00 17.34 ? 12  ALA C CA  1 
ATOM   1714 C  C   . ALA B 1 13  ? -22.029 -16.942 16.465  1.00 17.34 ? 12  ALA C C   1 
ATOM   1715 O  O   . ALA B 1 13  ? -23.163 -16.614 16.108  1.00 17.48 ? 12  ALA C O   1 
ATOM   1716 C  CB  . ALA B 1 13  ? -22.156 -19.290 15.587  1.00 17.36 ? 12  ALA C CB  1 
ATOM   1717 N  N   . ASP B 1 14  ? -21.398 -16.362 17.488  1.00 16.91 ? 13  ASP C N   1 
ATOM   1718 C  CA  . ASP B 1 14  ? -22.058 -15.343 18.316  1.00 16.74 ? 13  ASP C CA  1 
ATOM   1719 C  C   . ASP B 1 14  ? -22.317 -14.005 17.622  1.00 16.75 ? 13  ASP C C   1 
ATOM   1720 O  O   . ASP B 1 14  ? -23.165 -13.227 18.072  1.00 16.68 ? 13  ASP C O   1 
ATOM   1721 C  CB  . ASP B 1 14  ? -21.306 -15.124 19.631  1.00 16.54 ? 13  ASP C CB  1 
ATOM   1722 C  CG  . ASP B 1 14  ? -21.584 -16.209 20.647  1.00 15.92 ? 13  ASP C CG  1 
ATOM   1723 O  OD1 . ASP B 1 14  ? -22.455 -17.075 20.378  1.00 15.32 ? 13  ASP C OD1 1 
ATOM   1724 O  OD2 . ASP B 1 14  ? -20.926 -16.201 21.720  1.00 15.91 ? 13  ASP C OD2 1 
ATOM   1725 N  N   . LEU B 1 15  ? -21.602 -13.737 16.532  1.00 16.94 ? 14  LEU C N   1 
ATOM   1726 C  CA  . LEU B 1 15  ? -21.765 -12.473 15.820  1.00 16.71 ? 14  LEU C CA  1 
ATOM   1727 C  C   . LEU B 1 15  ? -22.699 -12.575 14.610  1.00 17.01 ? 14  LEU C C   1 
ATOM   1728 O  O   . LEU B 1 15  ? -23.001 -11.565 13.966  1.00 16.57 ? 14  LEU C O   1 
ATOM   1729 C  CB  . LEU B 1 15  ? -20.404 -11.875 15.433  1.00 16.82 ? 14  LEU C CB  1 
ATOM   1730 C  CG  . LEU B 1 15  ? -19.405 -11.678 16.582  1.00 16.42 ? 14  LEU C CG  1 
ATOM   1731 C  CD1 . LEU B 1 15  ? -18.106 -11.083 16.056  1.00 15.99 ? 14  LEU C CD1 1 
ATOM   1732 C  CD2 . LEU B 1 15  ? -19.975 -10.804 17.699  1.00 15.83 ? 14  LEU C CD2 1 
ATOM   1733 N  N   . GLU B 1 16  ? -23.149 -13.791 14.305  1.00 17.05 ? 15  GLU C N   1 
ATOM   1734 C  CA  . GLU B 1 16  ? -24.232 -13.984 13.332  1.00 17.72 ? 15  GLU C CA  1 
ATOM   1735 C  C   . GLU B 1 16  ? -25.475 -13.281 13.881  1.00 17.52 ? 15  GLU C C   1 
ATOM   1736 O  O   . GLU B 1 16  ? -25.718 -13.335 15.088  1.00 17.37 ? 15  GLU C O   1 
ATOM   1737 C  CB  . GLU B 1 16  ? -24.513 -15.473 13.110  1.00 17.53 ? 15  GLU C CB  1 
ATOM   1738 C  CG  . GLU B 1 16  ? -23.318 -16.272 12.605  1.00 18.30 ? 15  GLU C CG  1 
ATOM   1739 C  CD  . GLU B 1 16  ? -23.689 -17.651 12.085  1.00 18.75 ? 15  GLU C CD  1 
ATOM   1740 O  OE1 . GLU B 1 16  ? -24.598 -18.302 12.657  1.00 20.42 ? 15  GLU C OE1 1 
ATOM   1741 O  OE2 . GLU B 1 16  ? -23.066 -18.091 11.097  1.00 19.80 ? 15  GLU C OE2 1 
ATOM   1742 N  N   . PRO B 1 17  ? -26.273 -12.633 13.009  1.00 17.64 ? 16  PRO C N   1 
ATOM   1743 C  CA  . PRO B 1 17  ? -26.214 -12.655 11.549  1.00 17.81 ? 16  PRO C CA  1 
ATOM   1744 C  C   . PRO B 1 17  ? -25.276 -11.625 10.919  1.00 17.82 ? 16  PRO C C   1 
ATOM   1745 O  O   . PRO B 1 17  ? -25.215 -11.544 9.692   1.00 18.13 ? 16  PRO C O   1 
ATOM   1746 C  CB  . PRO B 1 17  ? -27.658 -12.329 11.157  1.00 17.70 ? 16  PRO C CB  1 
ATOM   1747 C  CG  . PRO B 1 17  ? -28.091 -11.364 12.208  1.00 17.69 ? 16  PRO C CG  1 
ATOM   1748 C  CD  . PRO B 1 17  ? -27.370 -11.765 13.484  1.00 17.65 ? 16  PRO C CD  1 
ATOM   1749 N  N   . VAL B 1 18  ? -24.559 -10.849 11.734  1.00 17.91 ? 17  VAL C N   1 
ATOM   1750 C  CA  . VAL B 1 18  ? -23.751 -9.728  11.215  1.00 18.00 ? 17  VAL C CA  1 
ATOM   1751 C  C   . VAL B 1 18  ? -22.415 -10.197 10.629  1.00 18.05 ? 17  VAL C C   1 
ATOM   1752 O  O   . VAL B 1 18  ? -21.959 -9.680  9.602   1.00 17.95 ? 17  VAL C O   1 
ATOM   1753 C  CB  . VAL B 1 18  ? -23.539 -8.610  12.281  1.00 18.00 ? 17  VAL C CB  1 
ATOM   1754 C  CG1 . VAL B 1 18  ? -22.644 -7.490  11.740  1.00 18.23 ? 17  VAL C CG1 1 
ATOM   1755 C  CG2 . VAL B 1 18  ? -24.876 -8.037  12.730  1.00 18.66 ? 17  VAL C CG2 1 
ATOM   1756 N  N   . ILE B 1 19  ? -21.785 -11.163 11.298  1.00 17.65 ? 18  ILE C N   1 
ATOM   1757 C  CA  . ILE B 1 19  ? -20.598 -11.824 10.759  1.00 17.42 ? 18  ILE C CA  1 
ATOM   1758 C  C   . ILE B 1 19  ? -20.775 -13.329 10.932  1.00 17.27 ? 18  ILE C C   1 
ATOM   1759 O  O   . ILE B 1 19  ? -20.988 -13.815 12.053  1.00 17.42 ? 18  ILE C O   1 
ATOM   1760 C  CB  . ILE B 1 19  ? -19.272 -11.356 11.437  1.00 17.25 ? 18  ILE C CB  1 
ATOM   1761 C  CG1 . ILE B 1 19  ? -19.150 -9.825  11.426  1.00 17.03 ? 18  ILE C CG1 1 
ATOM   1762 C  CG2 . ILE B 1 19  ? -18.075 -11.981 10.735  1.00 17.65 ? 18  ILE C CG2 1 
ATOM   1763 C  CD1 . ILE B 1 19  ? -17.905 -9.279  12.139  1.00 17.11 ? 18  ILE C CD1 1 
ATOM   1764 N  N   . SER B 1 20  ? -20.674 -14.064 9.829   1.00 17.00 ? 19  SER C N   1 
ATOM   1765 C  CA  . SER B 1 20  ? -20.911 -15.505 9.847   1.00 17.26 ? 19  SER C CA  1 
ATOM   1766 C  C   . SER B 1 20  ? -19.848 -16.239 10.650  1.00 17.39 ? 19  SER C C   1 
ATOM   1767 O  O   . SER B 1 20  ? -18.720 -15.753 10.802  1.00 17.22 ? 19  SER C O   1 
ATOM   1768 C  CB  . SER B 1 20  ? -20.957 -16.065 8.430   1.00 17.43 ? 19  SER C CB  1 
ATOM   1769 O  OG  . SER B 1 20  ? -19.659 -16.092 7.864   1.00 16.89 ? 19  SER C OG  1 
ATOM   1770 N  N   . HIS B 1 21  ? -20.219 -17.414 11.151  1.00 17.46 ? 20  HIS C N   1 
ATOM   1771 C  CA  . HIS B 1 21  ? -19.309 -18.260 11.903  1.00 17.57 ? 20  HIS C CA  1 
ATOM   1772 C  C   . HIS B 1 21  ? -18.137 -18.741 11.044  1.00 17.66 ? 20  HIS C C   1 
ATOM   1773 O  O   . HIS B 1 21  ? -17.033 -18.915 11.559  1.00 17.35 ? 20  HIS C O   1 
ATOM   1774 C  CB  . HIS B 1 21  ? -20.055 -19.443 12.549  1.00 18.14 ? 20  HIS C CB  1 
ATOM   1775 C  CG  . HIS B 1 21  ? -20.492 -20.498 11.580  1.00 18.83 ? 20  HIS C CG  1 
ATOM   1776 N  ND1 . HIS B 1 21  ? -21.688 -20.434 10.897  1.00 20.16 ? 20  HIS C ND1 1 
ATOM   1777 C  CD2 . HIS B 1 21  ? -19.897 -21.650 11.190  1.00 19.70 ? 20  HIS C CD2 1 
ATOM   1778 C  CE1 . HIS B 1 21  ? -21.807 -21.499 10.123  1.00 21.03 ? 20  HIS C CE1 1 
ATOM   1779 N  NE2 . HIS B 1 21  ? -20.732 -22.251 10.280  1.00 20.44 ? 20  HIS C NE2 1 
ATOM   1780 N  N   . GLU B 1 22  ? -18.361 -18.943 9.743   1.00 17.42 ? 21  GLU C N   1 
ATOM   1781 C  CA  . GLU B 1 22  ? -17.256 -19.353 8.876   1.00 17.82 ? 21  GLU C CA  1 
ATOM   1782 C  C   . GLU B 1 22  ? -16.226 -18.224 8.725   1.00 17.18 ? 21  GLU C C   1 
ATOM   1783 O  O   . GLU B 1 22  ? -15.015 -18.470 8.766   1.00 16.63 ? 21  GLU C O   1 
ATOM   1784 C  CB  . GLU B 1 22  ? -17.725 -19.870 7.508   1.00 18.00 ? 21  GLU C CB  1 
ATOM   1785 C  CG  . GLU B 1 22  ? -16.528 -20.213 6.599   1.00 19.79 ? 21  GLU C CG  1 
ATOM   1786 C  CD  . GLU B 1 22  ? -16.885 -20.816 5.252   1.00 19.46 ? 21  GLU C CD  1 
ATOM   1787 O  OE1 . GLU B 1 22  ? -18.003 -20.595 4.738   1.00 21.41 ? 21  GLU C OE1 1 
ATOM   1788 O  OE2 . GLU B 1 22  ? -16.000 -21.502 4.694   1.00 22.80 ? 21  GLU C OE2 1 
ATOM   1789 N  N   . ILE B 1 23  ? -16.699 -16.990 8.558   1.00 16.73 ? 22  ILE C N   1 
ATOM   1790 C  CA  . ILE B 1 23  ? -15.774 -15.847 8.548   1.00 16.10 ? 22  ILE C CA  1 
ATOM   1791 C  C   . ILE B 1 23  ? -14.997 -15.795 9.875   1.00 16.43 ? 22  ILE C C   1 
ATOM   1792 O  O   . ILE B 1 23  ? -13.768 -15.774 9.872   1.00 15.32 ? 22  ILE C O   1 
ATOM   1793 C  CB  . ILE B 1 23  ? -16.488 -14.510 8.261   1.00 16.41 ? 22  ILE C CB  1 
ATOM   1794 C  CG1 . ILE B 1 23  ? -16.973 -14.475 6.805   1.00 15.98 ? 22  ILE C CG1 1 
ATOM   1795 C  CG2 . ILE B 1 23  ? -15.555 -13.334 8.537   1.00 15.74 ? 22  ILE C CG2 1 
ATOM   1796 C  CD1 . ILE B 1 23  ? -17.875 -13.298 6.470   1.00 15.91 ? 22  ILE C CD1 1 
ATOM   1797 N  N   . MET B 1 24  ? -15.712 -15.825 10.999  1.00 16.20 ? 23  MET C N   1 
ATOM   1798 C  CA  . MET B 1 24  ? -15.057 -15.734 12.308  1.00 17.16 ? 23  MET C CA  1 
ATOM   1799 C  C   . MET B 1 24  ? -13.992 -16.803 12.529  1.00 17.12 ? 23  MET C C   1 
ATOM   1800 O  O   . MET B 1 24  ? -12.909 -16.497 13.022  1.00 17.07 ? 23  MET C O   1 
ATOM   1801 C  CB  . MET B 1 24  ? -16.079 -15.760 13.446  1.00 16.69 ? 23  MET C CB  1 
ATOM   1802 C  CG  . MET B 1 24  ? -17.004 -14.545 13.472  1.00 17.80 ? 23  MET C CG  1 
ATOM   1803 S  SD  . MET B 1 24  ? -16.167 -12.953 13.604  1.00 18.13 ? 23  MET C SD  1 
ATOM   1804 C  CE  . MET B 1 24  ? -15.243 -13.156 15.131  1.00 17.67 ? 23  MET C CE  1 
ATOM   1805 N  N   . GLN B 1 25  ? -14.299 -18.046 12.160  1.00 17.42 ? 24  GLN C N   1 
ATOM   1806 C  CA  . GLN B 1 25  ? -13.370 -19.157 12.377  1.00 18.13 ? 24  GLN C CA  1 
ATOM   1807 C  C   . GLN B 1 25  ? -12.133 -19.026 11.501  1.00 17.16 ? 24  GLN C C   1 
ATOM   1808 O  O   . GLN B 1 25  ? -11.014 -19.154 11.985  1.00 17.52 ? 24  GLN C O   1 
ATOM   1809 C  CB  . GLN B 1 25  ? -14.039 -20.512 12.140  1.00 17.80 ? 24  GLN C CB  1 
ATOM   1810 C  CG  . GLN B 1 25  ? -13.132 -21.693 12.504  1.00 19.62 ? 24  GLN C CG  1 
ATOM   1811 C  CD  . GLN B 1 25  ? -13.874 -23.016 12.640  1.00 20.19 ? 24  GLN C CD  1 
ATOM   1812 O  OE1 . GLN B 1 25  ? -15.107 -23.066 12.625  1.00 23.49 ? 24  GLN C OE1 1 
ATOM   1813 N  NE2 . GLN B 1 25  ? -13.116 -24.101 12.798  1.00 23.68 ? 24  GLN C NE2 1 
ATOM   1814 N  N   . LEU B 1 26  ? -12.342 -18.780 10.211  1.00 16.61 ? 25  LEU C N   1 
ATOM   1815 C  CA  . LEU B 1 26  ? -11.233 -18.545 9.295   1.00 15.39 ? 25  LEU C CA  1 
ATOM   1816 C  C   . LEU B 1 26  ? -10.418 -17.355 9.766   1.00 15.23 ? 25  LEU C C   1 
ATOM   1817 O  O   . LEU B 1 26  ? -9.202  -17.444 9.860   1.00 14.52 ? 25  LEU C O   1 
ATOM   1818 C  CB  . LEU B 1 26  ? -11.734 -18.308 7.859   1.00 15.58 ? 25  LEU C CB  1 
ATOM   1819 C  CG  . LEU B 1 26  ? -12.273 -19.517 7.087   1.00 16.22 ? 25  LEU C CG  1 
ATOM   1820 C  CD1 . LEU B 1 26  ? -12.991 -19.045 5.830   1.00 16.78 ? 25  LEU C CD1 1 
ATOM   1821 C  CD2 . LEU B 1 26  ? -11.170 -20.504 6.726   1.00 17.03 ? 25  LEU C CD2 1 
ATOM   1822 N  N   . HIS B 1 27  ? -11.102 -16.248 10.057  1.00 14.92 ? 26  HIS C N   1 
ATOM   1823 C  CA  . HIS B 1 27  ? -10.453 -14.990 10.419  1.00 14.93 ? 26  HIS C CA  1 
ATOM   1824 C  C   . HIS B 1 27  ? -9.583  -15.180 11.652  1.00 15.15 ? 26  HIS C C   1 
ATOM   1825 O  O   . HIS B 1 27  ? -8.460  -14.679 11.713  1.00 14.96 ? 26  HIS C O   1 
ATOM   1826 C  CB  . HIS B 1 27  ? -11.506 -13.939 10.727  1.00 15.02 ? 26  HIS C CB  1 
ATOM   1827 C  CG  . HIS B 1 27  ? -11.042 -12.534 10.511  1.00 13.05 ? 26  HIS C CG  1 
ATOM   1828 N  ND1 . HIS B 1 27  ? -11.892 -11.458 10.628  1.00 11.32 ? 26  HIS C ND1 1 
ATOM   1829 C  CD2 . HIS B 1 27  ? -9.830  -12.026 10.167  1.00 12.70 ? 26  HIS C CD2 1 
ATOM   1830 C  CE1 . HIS B 1 27  ? -11.225 -10.345 10.370  1.00 13.03 ? 26  HIS C CE1 1 
ATOM   1831 N  NE2 . HIS B 1 27  ? -9.973  -10.663 10.100  1.00 10.91 ? 26  HIS C NE2 1 
ATOM   1832 N  N   . HIS B 1 28  ? -10.108 -15.915 12.628  1.00 15.23 ? 27  HIS C N   1 
ATOM   1833 C  CA  . HIS B 1 28  ? -9.395  -16.128 13.884  1.00 15.61 ? 27  HIS C CA  1 
ATOM   1834 C  C   . HIS B 1 28  ? -8.342  -17.239 13.795  1.00 16.01 ? 27  HIS C C   1 
ATOM   1835 O  O   . HIS B 1 28  ? -7.165  -17.008 14.100  1.00 16.05 ? 27  HIS C O   1 
ATOM   1836 C  CB  . HIS B 1 28  ? -10.395 -16.384 15.019  1.00 15.55 ? 27  HIS C CB  1 
ATOM   1837 C  CG  . HIS B 1 28  ? -9.754  -16.648 16.343  1.00 16.00 ? 27  HIS C CG  1 
ATOM   1838 N  ND1 . HIS B 1 28  ? -9.752  -17.894 16.928  1.00 17.66 ? 27  HIS C ND1 1 
ATOM   1839 C  CD2 . HIS B 1 28  ? -9.083  -15.833 17.190  1.00 16.59 ? 27  HIS C CD2 1 
ATOM   1840 C  CE1 . HIS B 1 28  ? -9.120  -17.834 18.088  1.00 17.61 ? 27  HIS C CE1 1 
ATOM   1841 N  NE2 . HIS B 1 28  ? -8.701  -16.594 18.269  1.00 16.23 ? 27  HIS C NE2 1 
ATOM   1842 N  N   . GLN B 1 29  ? -8.761  -18.420 13.340  1.00 16.37 ? 28  GLN C N   1 
ATOM   1843 C  CA  . GLN B 1 29  ? -7.930  -19.633 13.388  1.00 17.26 ? 28  GLN C CA  1 
ATOM   1844 C  C   . GLN B 1 29  ? -6.885  -19.694 12.279  1.00 16.70 ? 28  GLN C C   1 
ATOM   1845 O  O   . GLN B 1 29  ? -5.832  -20.318 12.465  1.00 16.42 ? 28  GLN C O   1 
ATOM   1846 C  CB  . GLN B 1 29  ? -8.804  -20.896 13.392  1.00 16.98 ? 28  GLN C CB  1 
ATOM   1847 C  CG  . GLN B 1 29  ? -9.691  -21.071 14.614  1.00 19.09 ? 28  GLN C CG  1 
ATOM   1848 C  CD  . GLN B 1 29  ? -10.266 -22.473 14.717  1.00 20.00 ? 28  GLN C CD  1 
ATOM   1849 O  OE1 . GLN B 1 29  ? -9.643  -23.445 14.280  1.00 25.18 ? 28  GLN C OE1 1 
ATOM   1850 N  NE2 . GLN B 1 29  ? -11.449 -22.594 15.324  1.00 22.94 ? 28  GLN C NE2 1 
ATOM   1851 N  N   . LYS B 1 30  ? -7.187  -19.072 11.131  1.00 15.80 ? 29  LYS C N   1 
ATOM   1852 C  CA  . LYS B 1 30  ? -6.280  -19.078 9.980   1.00 15.87 ? 29  LYS C CA  1 
ATOM   1853 C  C   . LYS B 1 30  ? -5.526  -17.761 9.778   1.00 15.88 ? 29  LYS C C   1 
ATOM   1854 O  O   . LYS B 1 30  ? -4.286  -17.732 9.774   1.00 15.57 ? 29  LYS C O   1 
ATOM   1855 C  CB  . LYS B 1 30  ? -7.029  -19.413 8.676   1.00 15.87 ? 29  LYS C CB  1 
ATOM   1856 C  CG  . LYS B 1 30  ? -7.725  -20.782 8.679   1.00 15.47 ? 29  LYS C CG  1 
ATOM   1857 C  CD  . LYS B 1 30  ? -6.718  -21.920 8.741   1.00 16.90 ? 29  LYS C CD  1 
ATOM   1858 C  CE  . LYS B 1 30  ? -7.396  -23.278 8.555   1.00 19.03 ? 29  LYS C CE  1 
ATOM   1859 N  NZ  . LYS B 1 30  ? -6.394  -24.381 8.628   1.00 20.39 ? 29  LYS C NZ  1 
ATOM   1860 N  N   . HIS B 1 31  ? -6.273  -16.671 9.628   1.00 15.78 ? 30  HIS C N   1 
ATOM   1861 C  CA  . HIS B 1 31  ? -5.661  -15.375 9.375   1.00 15.44 ? 30  HIS C CA  1 
ATOM   1862 C  C   . HIS B 1 31  ? -4.887  -14.833 10.578  1.00 15.33 ? 30  HIS C C   1 
ATOM   1863 O  O   . HIS B 1 31  ? -3.690  -14.535 10.459  1.00 15.41 ? 30  HIS C O   1 
ATOM   1864 C  CB  . HIS B 1 31  ? -6.704  -14.360 8.892   1.00 15.24 ? 30  HIS C CB  1 
ATOM   1865 C  CG  . HIS B 1 31  ? -7.289  -14.687 7.555   1.00 15.60 ? 30  HIS C CG  1 
ATOM   1866 N  ND1 . HIS B 1 31  ? -6.702  -14.291 6.371   1.00 16.91 ? 30  HIS C ND1 1 
ATOM   1867 C  CD2 . HIS B 1 31  ? -8.404  -15.374 7.212   1.00 17.54 ? 30  HIS C CD2 1 
ATOM   1868 C  CE1 . HIS B 1 31  ? -7.434  -14.719 5.355   1.00 17.27 ? 30  HIS C CE1 1 
ATOM   1869 N  NE2 . HIS B 1 31  ? -8.475  -15.376 5.838   1.00 17.00 ? 30  HIS C NE2 1 
ATOM   1870 N  N   . HIS B 1 32  ? -5.546  -14.706 11.729  1.00 14.76 ? 31  HIS C N   1 
ATOM   1871 C  CA  . HIS B 1 32  ? -4.860  -14.137 12.898  1.00 15.01 ? 31  HIS C CA  1 
ATOM   1872 C  C   . HIS B 1 32  ? -3.745  -15.086 13.370  1.00 15.05 ? 31  HIS C C   1 
ATOM   1873 O  O   . HIS B 1 32  ? -2.628  -14.646 13.623  1.00 15.46 ? 31  HIS C O   1 
ATOM   1874 C  CB  . HIS B 1 32  ? -5.846  -13.798 14.024  1.00 15.09 ? 31  HIS C CB  1 
ATOM   1875 C  CG  . HIS B 1 32  ? -5.230  -13.059 15.182  1.00 15.00 ? 31  HIS C CG  1 
ATOM   1876 N  ND1 . HIS B 1 32  ? -5.966  -12.652 16.276  1.00 14.37 ? 31  HIS C ND1 1 
ATOM   1877 C  CD2 . HIS B 1 32  ? -3.960  -12.645 15.411  1.00 14.23 ? 31  HIS C CD2 1 
ATOM   1878 C  CE1 . HIS B 1 32  ? -5.175  -12.022 17.127  1.00 12.33 ? 31  HIS C CE1 1 
ATOM   1879 N  NE2 . HIS B 1 32  ? -3.951  -12.013 16.631  1.00 13.96 ? 31  HIS C NE2 1 
ATOM   1880 N  N   . ALA B 1 33  ? -4.027  -16.384 13.418  1.00 15.17 ? 32  ALA C N   1 
ATOM   1881 C  CA  . ALA B 1 33  ? -3.008  -17.384 13.811  1.00 15.34 ? 32  ALA C CA  1 
ATOM   1882 C  C   . ALA B 1 33  ? -1.749  -17.285 12.937  1.00 15.60 ? 32  ALA C C   1 
ATOM   1883 O  O   . ALA B 1 33  ? -0.621  -17.357 13.437  1.00 15.65 ? 32  ALA C O   1 
ATOM   1884 C  CB  . ALA B 1 33  ? -3.583  -18.773 13.739  1.00 15.56 ? 32  ALA C CB  1 
ATOM   1885 N  N   . THR B 1 34  ? -1.946  -17.099 11.631  1.00 15.04 ? 33  THR C N   1 
ATOM   1886 C  CA  . THR B 1 34  ? -0.817  -16.944 10.727  1.00 15.45 ? 33  THR C CA  1 
ATOM   1887 C  C   . THR B 1 34  ? 0.039   -15.732 11.100  1.00 15.17 ? 33  THR C C   1 
ATOM   1888 O  O   . THR B 1 34  ? 1.270   -15.829 11.132  1.00 15.04 ? 33  THR C O   1 
ATOM   1889 C  CB  . THR B 1 34  ? -1.271  -16.918 9.250   1.00 15.10 ? 33  THR C CB  1 
ATOM   1890 O  OG1 . THR B 1 34  ? -1.751  -18.225 8.898   1.00 16.88 ? 33  THR C OG1 1 
ATOM   1891 C  CG2 . THR B 1 34  ? -0.117  -16.522 8.327   1.00 16.70 ? 33  THR C CG2 1 
ATOM   1892 N  N   . TYR B 1 35  ? -0.603  -14.601 11.400  1.00 15.33 ? 34  TYR C N   1 
ATOM   1893 C  CA  . TYR B 1 35  ? 0.129   -13.399 11.796  1.00 15.76 ? 34  TYR C CA  1 
ATOM   1894 C  C   . TYR B 1 35  ? 0.931   -13.650 13.072  1.00 15.69 ? 34  TYR C C   1 
ATOM   1895 O  O   . TYR B 1 35  ? 2.091   -13.268 13.154  1.00 15.65 ? 34  TYR C O   1 
ATOM   1896 C  CB  . TYR B 1 35  ? -0.803  -12.187 11.979  1.00 15.78 ? 34  TYR C CB  1 
ATOM   1897 C  CG  . TYR B 1 35  ? -1.449  -11.690 10.695  1.00 15.71 ? 34  TYR C CG  1 
ATOM   1898 C  CD1 . TYR B 1 35  ? -0.692  -11.449 9.547   1.00 17.03 ? 34  TYR C CD1 1 
ATOM   1899 C  CD2 . TYR B 1 35  ? -2.824  -11.442 10.637  1.00 16.51 ? 34  TYR C CD2 1 
ATOM   1900 C  CE1 . TYR B 1 35  ? -1.292  -10.983 8.363   1.00 16.82 ? 34  TYR C CE1 1 
ATOM   1901 C  CE2 . TYR B 1 35  ? -3.427  -10.986 9.462   1.00 14.94 ? 34  TYR C CE2 1 
ATOM   1902 C  CZ  . TYR B 1 35  ? -2.662  -10.767 8.338   1.00 16.80 ? 34  TYR C CZ  1 
ATOM   1903 O  OH  . TYR B 1 35  ? -3.268  -10.298 7.186   1.00 17.81 ? 34  TYR C OH  1 
ATOM   1904 N  N   . VAL B 1 36  ? 0.303   -14.289 14.056  1.00 15.50 ? 35  VAL C N   1 
ATOM   1905 C  CA  . VAL B 1 36  ? 0.969   -14.587 15.340  1.00 15.80 ? 35  VAL C CA  1 
ATOM   1906 C  C   . VAL B 1 36  ? 2.174   -15.501 15.149  1.00 15.55 ? 35  VAL C C   1 
ATOM   1907 O  O   . VAL B 1 36  ? 3.255   -15.244 15.687  1.00 15.34 ? 35  VAL C O   1 
ATOM   1908 C  CB  . VAL B 1 36  ? 0.009   -15.247 16.345  1.00 15.95 ? 35  VAL C CB  1 
ATOM   1909 C  CG1 . VAL B 1 36  ? 0.765   -15.745 17.579  1.00 17.60 ? 35  VAL C CG1 1 
ATOM   1910 C  CG2 . VAL B 1 36  ? -1.064  -14.274 16.752  1.00 17.70 ? 35  VAL C CG2 1 
ATOM   1911 N  N   . ASN B 1 37  ? 1.977   -16.565 14.381  1.00 15.41 ? 36  ASN C N   1 
ATOM   1912 C  CA  . ASN B 1 37  ? 3.011   -17.573 14.164  1.00 15.90 ? 36  ASN C CA  1 
ATOM   1913 C  C   . ASN B 1 37  ? 4.209   -16.951 13.473  1.00 16.07 ? 36  ASN C C   1 
ATOM   1914 O  O   . ASN B 1 37  ? 5.357   -17.157 13.901  1.00 15.86 ? 36  ASN C O   1 
ATOM   1915 C  CB  . ASN B 1 37  ? 2.459   -18.755 13.348  1.00 16.20 ? 36  ASN C CB  1 
ATOM   1916 C  CG  . ASN B 1 37  ? 1.391   -19.551 14.100  1.00 18.47 ? 36  ASN C CG  1 
ATOM   1917 O  OD1 . ASN B 1 37  ? 1.314   -19.518 15.334  1.00 19.60 ? 36  ASN C OD1 1 
ATOM   1918 N  ND2 . ASN B 1 37  ? 0.567   -20.290 13.350  1.00 19.40 ? 36  ASN C ND2 1 
ATOM   1919 N  N   . ASN B 1 38  ? 3.937   -16.159 12.433  1.00 15.63 ? 37  ASN C N   1 
ATOM   1920 C  CA  . ASN B 1 38  ? 4.988   -15.427 11.726  1.00 16.55 ? 37  ASN C CA  1 
ATOM   1921 C  C   . ASN B 1 38  ? 5.652   -14.388 12.619  1.00 16.66 ? 37  ASN C C   1 
ATOM   1922 O  O   . ASN B 1 38  ? 6.878   -14.237 12.615  1.00 17.10 ? 37  ASN C O   1 
ATOM   1923 C  CB  . ASN B 1 38  ? 4.439   -14.741 10.467  1.00 16.54 ? 37  ASN C CB  1 
ATOM   1924 C  CG  . ASN B 1 38  ? 4.057   -15.718 9.363   1.00 18.86 ? 37  ASN C CG  1 
ATOM   1925 O  OD1 . ASN B 1 38  ? 3.271   -15.376 8.470   1.00 23.65 ? 37  ASN C OD1 1 
ATOM   1926 N  ND2 . ASN B 1 38  ? 4.604   -16.919 9.401   1.00 19.01 ? 37  ASN C ND2 1 
ATOM   1927 N  N   . LEU B 1 39  ? 4.842   -13.671 13.390  1.00 15.90 ? 38  LEU C N   1 
ATOM   1928 C  CA  . LEU B 1 39  ? 5.366   -12.684 14.322  1.00 15.69 ? 38  LEU C CA  1 
ATOM   1929 C  C   . LEU B 1 39  ? 6.433   -13.271 15.250  1.00 15.54 ? 38  LEU C C   1 
ATOM   1930 O  O   . LEU B 1 39  ? 7.493   -12.666 15.447  1.00 15.40 ? 38  LEU C O   1 
ATOM   1931 C  CB  . LEU B 1 39  ? 4.239   -12.084 15.166  1.00 15.46 ? 38  LEU C CB  1 
ATOM   1932 C  CG  . LEU B 1 39  ? 4.661   -11.154 16.306  1.00 14.88 ? 38  LEU C CG  1 
ATOM   1933 C  CD1 . LEU B 1 39  ? 5.497   -9.955  15.817  1.00 14.72 ? 38  LEU C CD1 1 
ATOM   1934 C  CD2 . LEU B 1 39  ? 3.438   -10.686 17.069  1.00 15.83 ? 38  LEU C CD2 1 
ATOM   1935 N  N   . ASN B 1 40  ? 6.129   -14.413 15.853  1.00 15.11 ? 39  ASN C N   1 
ATOM   1936 C  CA  . ASN B 1 40  ? 7.083   -15.047 16.757  1.00 15.73 ? 39  ASN C CA  1 
ATOM   1937 C  C   . ASN B 1 40  ? 8.409   -15.330 16.048  1.00 16.24 ? 39  ASN C C   1 
ATOM   1938 O  O   . ASN B 1 40  ? 9.476   -15.016 16.578  1.00 16.08 ? 39  ASN C O   1 
ATOM   1939 C  CB  . ASN B 1 40  ? 6.476   -16.296 17.386  1.00 15.69 ? 39  ASN C CB  1 
ATOM   1940 C  CG  . ASN B 1 40  ? 5.517   -15.959 18.501  1.00 15.09 ? 39  ASN C CG  1 
ATOM   1941 O  OD1 . ASN B 1 40  ? 5.774   -15.060 19.298  1.00 15.04 ? 39  ASN C OD1 1 
ATOM   1942 N  ND2 . ASN B 1 40  ? 4.409   -16.686 18.575  1.00 15.69 ? 39  ASN C ND2 1 
ATOM   1943 N  N   . GLN B 1 41  ? 8.336   -15.858 14.830  1.00 16.22 ? 40  GLN C N   1 
ATOM   1944 C  CA  . GLN B 1 41  ? 9.550   -16.193 14.088  1.00 17.38 ? 40  GLN C CA  1 
ATOM   1945 C  C   . GLN B 1 41  ? 10.306  -14.925 13.696  1.00 16.14 ? 40  GLN C C   1 
ATOM   1946 O  O   . GLN B 1 41  ? 11.531  -14.866 13.810  1.00 15.59 ? 40  GLN C O   1 
ATOM   1947 C  CB  . GLN B 1 41  ? 9.222   -17.040 12.852  1.00 17.19 ? 40  GLN C CB  1 
ATOM   1948 C  CG  . GLN B 1 41  ? 8.624   -18.402 13.194  1.00 20.90 ? 40  GLN C CG  1 
ATOM   1949 C  CD  . GLN B 1 41  ? 8.060   -19.134 11.985  1.00 21.56 ? 40  GLN C CD  1 
ATOM   1950 O  OE1 . GLN B 1 41  ? 7.823   -18.535 10.929  1.00 26.92 ? 40  GLN C OE1 1 
ATOM   1951 N  NE2 . GLN B 1 41  ? 7.821   -20.434 12.143  1.00 27.14 ? 40  GLN C NE2 1 
ATOM   1952 N  N   . ILE B 1 42  ? 9.581   -13.905 13.258  1.00 15.62 ? 41  ILE C N   1 
ATOM   1953 C  CA  . ILE B 1 42  ? 10.217  -12.659 12.812  1.00 15.64 ? 41  ILE C CA  1 
ATOM   1954 C  C   . ILE B 1 42  ? 10.860  -11.906 13.985  1.00 15.97 ? 41  ILE C C   1 
ATOM   1955 O  O   . ILE B 1 42  ? 11.966  -11.378 13.871  1.00 15.82 ? 41  ILE C O   1 
ATOM   1956 C  CB  . ILE B 1 42  ? 9.202   -11.765 12.068  1.00 15.48 ? 41  ILE C CB  1 
ATOM   1957 C  CG1 . ILE B 1 42  ? 8.737   -12.464 10.782  1.00 15.89 ? 41  ILE C CG1 1 
ATOM   1958 C  CG2 . ILE B 1 42  ? 9.836   -10.403 11.730  1.00 16.08 ? 41  ILE C CG2 1 
ATOM   1959 C  CD1 . ILE B 1 42  ? 7.337   -11.946 10.312  1.00 18.96 ? 41  ILE C CD1 1 
ATOM   1960 N  N   . GLU B 1 43  ? 10.153  -11.851 15.109  1.00 15.94 ? 42  GLU C N   1 
ATOM   1961 C  CA  . GLU B 1 43  ? 10.681  -11.208 16.309  1.00 16.45 ? 42  GLU C CA  1 
ATOM   1962 C  C   . GLU B 1 43  ? 11.996  -11.858 16.768  1.00 16.39 ? 42  GLU C C   1 
ATOM   1963 O  O   . GLU B 1 43  ? 12.925  -11.156 17.173  1.00 15.93 ? 42  GLU C O   1 
ATOM   1964 C  CB  . GLU B 1 43  ? 9.636   -11.272 17.413  1.00 17.38 ? 42  GLU C CB  1 
ATOM   1965 C  CG  . GLU B 1 43  ? 9.852   -10.265 18.537  1.00 17.52 ? 42  GLU C CG  1 
ATOM   1966 C  CD  . GLU B 1 43  ? 8.746   -10.386 19.561  1.00 20.06 ? 42  GLU C CD  1 
ATOM   1967 O  OE1 . GLU B 1 43  ? 8.036   -9.390  19.785  1.00 20.39 ? 42  GLU C OE1 1 
ATOM   1968 O  OE2 . GLU B 1 43  ? 8.551   -11.502 20.080  1.00 20.00 ? 42  GLU C OE2 1 
ATOM   1969 N  N   . GLU B 1 44  ? 12.065  -13.189 16.690  1.00 16.09 ? 43  GLU C N   1 
ATOM   1970 C  CA  . GLU B 1 44  ? 13.289  -13.928 17.032  1.00 15.97 ? 43  GLU C CA  1 
ATOM   1971 C  C   . GLU B 1 44  ? 14.407  -13.515 16.087  1.00 15.30 ? 43  GLU C C   1 
ATOM   1972 O  O   . GLU B 1 44  ? 15.522  -13.225 16.529  1.00 15.00 ? 43  GLU C O   1 
ATOM   1973 C  CB  . GLU B 1 44  ? 13.064  -15.431 16.909  1.00 16.23 ? 43  GLU C CB  1 
ATOM   1974 C  CG  . GLU B 1 44  ? 12.253  -15.981 18.056  1.00 18.56 ? 43  GLU C CG  1 
ATOM   1975 C  CD  . GLU B 1 44  ? 11.841  -17.432 17.885  1.00 23.56 ? 43  GLU C CD  1 
ATOM   1976 O  OE1 . GLU B 1 44  ? 12.226  -18.100 16.884  1.00 22.56 ? 43  GLU C OE1 1 
ATOM   1977 O  OE2 . GLU B 1 44  ? 11.126  -17.907 18.789  1.00 25.40 ? 43  GLU C OE2 1 
ATOM   1978 N  N   . LYS B 1 45  ? 14.106  -13.478 14.788  1.00 14.68 ? 44  LYS C N   1 
ATOM   1979 C  CA  . LYS B 1 45  ? 15.140  -13.091 13.810  1.00 14.99 ? 44  LYS C CA  1 
ATOM   1980 C  C   . LYS B 1 45  ? 15.586  -11.652 14.003  1.00 14.58 ? 44  LYS C C   1 
ATOM   1981 O  O   . LYS B 1 45  ? 16.765  -11.327 13.840  1.00 15.08 ? 44  LYS C O   1 
ATOM   1982 C  CB  . LYS B 1 45  ? 14.654  -13.313 12.369  1.00 14.52 ? 44  LYS C CB  1 
ATOM   1983 C  CG  . LYS B 1 45  ? 14.404  -14.788 12.060  1.00 17.02 ? 44  LYS C CG  1 
ATOM   1984 C  CD  . LYS B 1 45  ? 15.711  -15.576 11.987  1.00 22.13 ? 44  LYS C CD  1 
ATOM   1985 C  CE  . LYS B 1 45  ? 15.498  -16.936 11.331  1.00 25.77 ? 44  LYS C CE  1 
ATOM   1986 N  NZ  . LYS B 1 45  ? 16.774  -17.699 11.232  1.00 30.08 ? 44  LYS C NZ  1 
ATOM   1987 N  N   . LEU B 1 46  ? 14.637  -10.789 14.356  1.00 14.39 ? 45  LEU C N   1 
ATOM   1988 C  CA  . LEU B 1 46  ? 14.939  -9.392  14.616  1.00 13.99 ? 45  LEU C CA  1 
ATOM   1989 C  C   . LEU B 1 46  ? 15.791  -9.249  15.864  1.00 13.68 ? 45  LEU C C   1 
ATOM   1990 O  O   . LEU B 1 46  ? 16.752  -8.489  15.873  1.00 13.63 ? 45  LEU C O   1 
ATOM   1991 C  CB  . LEU B 1 46  ? 13.649  -8.564  14.772  1.00 14.48 ? 45  LEU C CB  1 
ATOM   1992 C  CG  . LEU B 1 46  ? 13.874  -7.049  14.933  1.00 15.00 ? 45  LEU C CG  1 
ATOM   1993 C  CD1 . LEU B 1 46  ? 14.798  -6.502  13.809  1.00 15.22 ? 45  LEU C CD1 1 
ATOM   1994 C  CD2 . LEU B 1 46  ? 12.551  -6.330  14.923  1.00 16.01 ? 45  LEU C CD2 1 
ATOM   1995 N  N   . HIS B 1 47  ? 15.449  -9.973  16.927  1.00 12.92 ? 46  HIS C N   1 
ATOM   1996 C  CA  . HIS B 1 47  ? 16.259  -9.888  18.153  1.00 12.78 ? 46  HIS C CA  1 
ATOM   1997 C  C   . HIS B 1 47  ? 17.685  -10.359 17.864  1.00 12.90 ? 46  HIS C C   1 
ATOM   1998 O  O   . HIS B 1 47  ? 18.653  -9.803  18.386  1.00 12.35 ? 46  HIS C O   1 
ATOM   1999 C  CB  . HIS B 1 47  ? 15.642  -10.714 19.290  1.00 12.71 ? 46  HIS C CB  1 
ATOM   2000 C  CG  . HIS B 1 47  ? 16.239  -10.420 20.630  1.00 13.41 ? 46  HIS C CG  1 
ATOM   2001 N  ND1 . HIS B 1 47  ? 17.232  -11.193 21.187  1.00 13.28 ? 46  HIS C ND1 1 
ATOM   2002 C  CD2 . HIS B 1 47  ? 15.986  -9.430  21.518  1.00 15.08 ? 46  HIS C CD2 1 
ATOM   2003 C  CE1 . HIS B 1 47  ? 17.564  -10.696 22.369  1.00 14.40 ? 46  HIS C CE1 1 
ATOM   2004 N  NE2 . HIS B 1 47  ? 16.830  -9.620  22.590  1.00 13.20 ? 46  HIS C NE2 1 
ATOM   2005 N  N   . GLU B 1 48  ? 17.796  -11.373 17.010  1.00 12.44 ? 47  GLU C N   1 
ATOM   2006 C  CA  . GLU B 1 48  ? 19.107  -11.909 16.608  1.00 13.96 ? 47  GLU C CA  1 
ATOM   2007 C  C   . GLU B 1 48  ? 19.910  -10.824 15.893  1.00 12.86 ? 47  GLU C C   1 
ATOM   2008 O  O   . GLU B 1 48  ? 21.083  -10.578 16.229  1.00 13.30 ? 47  GLU C O   1 
ATOM   2009 C  CB  . GLU B 1 48  ? 18.935  -13.132 15.709  1.00 13.49 ? 47  GLU C CB  1 
ATOM   2010 C  CG  . GLU B 1 48  ? 20.246  -13.702 15.165  1.00 14.29 ? 47  GLU C CG  1 
ATOM   2011 C  CD  . GLU B 1 48  ? 20.037  -14.929 14.281  1.00 17.91 ? 47  GLU C CD  1 
ATOM   2012 O  OE1 . GLU B 1 48  ? 19.001  -15.025 13.599  1.00 23.09 ? 47  GLU C OE1 1 
ATOM   2013 O  OE2 . GLU B 1 48  ? 20.932  -15.781 14.240  1.00 22.89 ? 47  GLU C OE2 1 
ATOM   2014 N  N   . ALA B 1 49  ? 19.273  -10.173 14.922  1.00 12.38 ? 48  ALA C N   1 
ATOM   2015 C  CA  . ALA B 1 49  ? 19.951  -9.137  14.126  1.00 11.83 ? 48  ALA C CA  1 
ATOM   2016 C  C   . ALA B 1 49  ? 20.371  -7.978  15.009  1.00 11.83 ? 48  ALA C C   1 
ATOM   2017 O  O   . ALA B 1 49  ? 21.510  -7.499  14.946  1.00 11.77 ? 48  ALA C O   1 
ATOM   2018 C  CB  . ALA B 1 49  ? 19.035  -8.653  13.015  1.00 12.02 ? 48  ALA C CB  1 
ATOM   2019 N  N   . VAL B 1 50  ? 19.438  -7.508  15.834  1.00 11.70 ? 49  VAL C N   1 
ATOM   2020 C  CA  . VAL B 1 50  ? 19.721  -6.381  16.718  1.00 11.80 ? 49  VAL C CA  1 
ATOM   2021 C  C   . VAL B 1 50  ? 20.825  -6.701  17.725  1.00 11.74 ? 49  VAL C C   1 
ATOM   2022 O  O   . VAL B 1 50  ? 21.741  -5.900  17.947  1.00 11.27 ? 49  VAL C O   1 
ATOM   2023 C  CB  . VAL B 1 50  ? 18.426  -5.843  17.397  1.00 11.66 ? 49  VAL C CB  1 
ATOM   2024 C  CG1 . VAL B 1 50  ? 18.762  -4.751  18.462  1.00 12.51 ? 49  VAL C CG1 1 
ATOM   2025 C  CG2 . VAL B 1 50  ? 17.468  -5.297  16.327  1.00 12.83 ? 49  VAL C CG2 1 
ATOM   2026 N  N   . SER B 1 51  ? 20.769  -7.894  18.315  1.00 11.89 ? 50  SER C N   1 
ATOM   2027 C  CA  . SER B 1 51  ? 21.810  -8.301  19.247  1.00 12.11 ? 50  SER C CA  1 
ATOM   2028 C  C   . SER B 1 51  ? 23.192  -8.315  18.580  1.00 12.01 ? 50  SER C C   1 
ATOM   2029 O  O   . SER B 1 51  ? 24.173  -7.973  19.204  1.00 11.90 ? 50  SER C O   1 
ATOM   2030 C  CB  . SER B 1 51  ? 21.483  -9.680  19.840  1.00 11.95 ? 50  SER C CB  1 
ATOM   2031 O  OG  . SER B 1 51  ? 20.284  -9.612  20.606  1.00 11.81 ? 50  SER C OG  1 
ATOM   2032 N  N   . LYS B 1 52  ? 23.253  -8.700  17.308  1.00 11.83 ? 51  LYS C N   1 
ATOM   2033 C  CA  . LYS B 1 52  ? 24.517  -8.694  16.550  1.00 12.59 ? 51  LYS C CA  1 
ATOM   2034 C  C   . LYS B 1 52  ? 24.975  -7.293  16.124  1.00 12.43 ? 51  LYS C C   1 
ATOM   2035 O  O   . LYS B 1 52  ? 26.141  -7.099  15.756  1.00 13.60 ? 51  LYS C O   1 
ATOM   2036 C  CB  . LYS B 1 52  ? 24.352  -9.521  15.273  1.00 12.84 ? 51  LYS C CB  1 
ATOM   2037 C  CG  . LYS B 1 52  ? 24.406  -11.027 15.495  1.00 14.56 ? 51  LYS C CG  1 
ATOM   2038 C  CD  . LYS B 1 52  ? 24.087  -11.760 14.174  1.00 15.30 ? 51  LYS C CD  1 
ATOM   2039 C  CE  . LYS B 1 52  ? 24.085  -13.269 14.333  1.00 19.82 ? 51  LYS C CE  1 
ATOM   2040 N  NZ  . LYS B 1 52  ? 23.695  -13.904 13.036  1.00 21.65 ? 51  LYS C NZ  1 
ATOM   2041 N  N   . GLY B 1 53  ? 24.060  -6.333  16.150  1.00 11.57 ? 52  GLY C N   1 
ATOM   2042 C  CA  . GLY B 1 53  ? 24.324  -5.009  15.574  1.00 10.94 ? 52  GLY C CA  1 
ATOM   2043 C  C   . GLY B 1 53  ? 24.256  -5.043  14.048  1.00 11.01 ? 52  GLY C C   1 
ATOM   2044 O  O   . GLY B 1 53  ? 24.858  -4.201  13.370  1.00 11.04 ? 52  GLY C O   1 
ATOM   2045 N  N   . ASN B 1 54  ? 23.535  -6.021  13.505  1.00 10.77 ? 53  ASN C N   1 
ATOM   2046 C  CA  . ASN B 1 54  ? 23.427  -6.155  12.053  1.00 11.51 ? 53  ASN C CA  1 
ATOM   2047 C  C   . ASN B 1 54  ? 22.285  -5.295  11.556  1.00 11.88 ? 53  ASN C C   1 
ATOM   2048 O  O   . ASN B 1 54  ? 21.126  -5.704  11.534  1.00 11.54 ? 53  ASN C O   1 
ATOM   2049 C  CB  . ASN B 1 54  ? 23.247  -7.624  11.653  1.00 13.13 ? 53  ASN C CB  1 
ATOM   2050 C  CG  . ASN B 1 54  ? 23.525  -7.866  10.183  1.00 15.79 ? 53  ASN C CG  1 
ATOM   2051 O  OD1 . ASN B 1 54  ? 24.263  -8.798  9.825   1.00 21.03 ? 53  ASN C OD1 1 
ATOM   2052 N  ND2 . ASN B 1 54  ? 22.971  -7.027  9.327   1.00 12.18 ? 53  ASN C ND2 1 
ATOM   2053 N  N   . VAL B 1 55  ? 22.642  -4.081  11.149  1.00 11.19 ? 54  VAL C N   1 
ATOM   2054 C  CA  . VAL B 1 55  ? 21.645  -3.073  10.800  1.00 11.53 ? 54  VAL C CA  1 
ATOM   2055 C  C   . VAL B 1 55  ? 20.920  -3.445  9.526   1.00 11.61 ? 54  VAL C C   1 
ATOM   2056 O  O   . VAL B 1 55  ? 19.705  -3.297  9.442   1.00 11.45 ? 54  VAL C O   1 
ATOM   2057 C  CB  . VAL B 1 55  ? 22.327  -1.711  10.644  1.00 11.56 ? 54  VAL C CB  1 
ATOM   2058 C  CG1 . VAL B 1 55  ? 21.346  -0.657  10.134  1.00 11.88 ? 54  VAL C CG1 1 
ATOM   2059 C  CG2 . VAL B 1 55  ? 22.949  -1.317  11.994  1.00 12.63 ? 54  VAL C CG2 1 
ATOM   2060 N  N   . LYS B 1 56  ? 21.678  -3.909  8.528   1.00 11.12 ? 55  LYS C N   1 
ATOM   2061 C  CA  . LYS B 1 56  ? 21.073  -4.384  7.282   1.00 12.05 ? 55  LYS C CA  1 
ATOM   2062 C  C   . LYS B 1 56  ? 19.948  -5.393  7.557   1.00 12.34 ? 55  LYS C C   1 
ATOM   2063 O  O   . LYS B 1 56  ? 18.840  -5.251  7.037   1.00 11.25 ? 55  LYS C O   1 
ATOM   2064 C  CB  . LYS B 1 56  ? 22.137  -5.035  6.378   1.00 11.82 ? 55  LYS C CB  1 
ATOM   2065 C  CG  . LYS B 1 56  ? 21.553  -5.656  5.099   1.00 12.08 ? 55  LYS C CG  1 
ATOM   2066 C  CD  . LYS B 1 56  ? 22.619  -6.391  4.262   1.00 14.76 ? 55  LYS C CD  1 
ATOM   2067 C  CE  . LYS B 1 56  ? 23.047  -7.713  4.882   1.00 19.41 ? 55  LYS C CE  1 
ATOM   2068 N  NZ  . LYS B 1 56  ? 24.089  -8.375  4.015   1.00 20.53 ? 55  LYS C NZ  1 
ATOM   2069 N  N   . GLU B 1 57  ? 20.251  -6.426  8.339   1.00 12.35 ? 56  GLU C N   1 
ATOM   2070 C  CA  . GLU B 1 57  ? 19.261  -7.490  8.586   1.00 13.83 ? 56  GLU C CA  1 
ATOM   2071 C  C   . GLU B 1 57  ? 18.052  -6.977  9.365   1.00 13.36 ? 56  GLU C C   1 
ATOM   2072 O  O   . GLU B 1 57  ? 16.907  -7.369  9.090   1.00 13.78 ? 56  GLU C O   1 
ATOM   2073 C  CB  . GLU B 1 57  ? 19.914  -8.666  9.313   1.00 13.94 ? 56  GLU C CB  1 
ATOM   2074 C  CG  . GLU B 1 57  ? 20.906  -9.456  8.454   1.00 15.29 ? 56  GLU C CG  1 
ATOM   2075 C  CD  . GLU B 1 57  ? 21.589  -10.567 9.224   1.00 18.70 ? 56  GLU C CD  1 
ATOM   2076 O  OE1 . GLU B 1 57  ? 21.782  -10.423 10.457  1.00 25.31 ? 56  GLU C OE1 1 
ATOM   2077 O  OE2 . GLU B 1 57  ? 21.958  -11.594 8.595   1.00 25.39 ? 56  GLU C OE2 1 
ATOM   2078 N  N   . ALA B 1 58  ? 18.299  -6.082  10.323  1.00 12.59 ? 57  ALA C N   1 
ATOM   2079 C  CA  . ALA B 1 58  ? 17.221  -5.494  11.116  1.00 13.44 ? 57  ALA C CA  1 
ATOM   2080 C  C   . ALA B 1 58  ? 16.273  -4.663  10.228  1.00 13.75 ? 57  ALA C C   1 
ATOM   2081 O  O   . ALA B 1 58  ? 15.045  -4.747  10.373  1.00 14.51 ? 57  ALA C O   1 
ATOM   2082 C  CB  . ALA B 1 58  ? 17.794  -4.652  12.267  1.00 13.25 ? 57  ALA C CB  1 
ATOM   2083 N  N   . ILE B 1 59  ? 16.840  -3.884  9.304   1.00 13.44 ? 58  ILE C N   1 
ATOM   2084 C  CA  . ILE B 1 59  ? 16.029  -3.115  8.351   1.00 13.21 ? 58  ILE C CA  1 
ATOM   2085 C  C   . ILE B 1 59  ? 15.264  -4.037  7.399   1.00 13.93 ? 58  ILE C C   1 
ATOM   2086 O  O   . ILE B 1 59  ? 14.081  -3.794  7.090   1.00 13.78 ? 58  ILE C O   1 
ATOM   2087 C  CB  . ILE B 1 59  ? 16.893  -2.095  7.557   1.00 12.89 ? 58  ILE C CB  1 
ATOM   2088 C  CG1 . ILE B 1 59  ? 17.483  -1.059  8.539   1.00 12.70 ? 58  ILE C CG1 1 
ATOM   2089 C  CG2 . ILE B 1 59  ? 16.063  -1.405  6.448   1.00 13.29 ? 58  ILE C CG2 1 
ATOM   2090 C  CD1 . ILE B 1 59  ? 18.520  -0.121  7.914   1.00 11.84 ? 58  ILE C CD1 1 
ATOM   2091 N  N   . ALA B 1 60  ? 15.940  -5.081  6.923   1.00 13.80 ? 59  ALA C N   1 
ATOM   2092 C  CA  . ALA B 1 60  ? 15.336  -6.013  5.981   1.00 14.46 ? 59  ALA C CA  1 
ATOM   2093 C  C   . ALA B 1 60  ? 14.072  -6.663  6.543   1.00 14.97 ? 59  ALA C C   1 
ATOM   2094 O  O   . ALA B 1 60  ? 13.140  -6.942  5.799   1.00 15.75 ? 59  ALA C O   1 
ATOM   2095 C  CB  . ALA B 1 60  ? 16.338  -7.077  5.568   1.00 14.30 ? 59  ALA C CB  1 
ATOM   2096 N  N   . LEU B 1 61  ? 14.053  -6.874  7.855   1.00 14.82 ? 60  LEU C N   1 
ATOM   2097 C  CA  . LEU B 1 61  ? 12.939  -7.536  8.538   1.00 15.23 ? 60  LEU C CA  1 
ATOM   2098 C  C   . LEU B 1 61  ? 11.739  -6.622  8.840   1.00 16.02 ? 60  LEU C C   1 
ATOM   2099 O  O   . LEU B 1 61  ? 10.673  -7.098  9.256   1.00 16.25 ? 60  LEU C O   1 
ATOM   2100 C  CB  . LEU B 1 61  ? 13.456  -8.161  9.838   1.00 14.84 ? 60  LEU C CB  1 
ATOM   2101 C  CG  . LEU B 1 61  ? 14.334  -9.404  9.680   1.00 13.58 ? 60  LEU C CG  1 
ATOM   2102 C  CD1 . LEU B 1 61  ? 15.074  -9.691  11.005  1.00 14.51 ? 60  LEU C CD1 1 
ATOM   2103 C  CD2 . LEU B 1 61  ? 13.496  -10.614 9.255   1.00 17.62 ? 60  LEU C CD2 1 
ATOM   2104 N  N   . GLN B 1 62  ? 11.900  -5.325  8.607   1.00 16.07 ? 61  GLN C N   1 
ATOM   2105 C  CA  . GLN B 1 62  ? 10.873  -4.363  8.989   1.00 16.57 ? 61  GLN C CA  1 
ATOM   2106 C  C   . GLN B 1 62  ? 9.501   -4.577  8.325   1.00 17.16 ? 61  GLN C C   1 
ATOM   2107 O  O   . GLN B 1 62  ? 8.486   -4.553  9.024   1.00 17.53 ? 61  GLN C O   1 
ATOM   2108 C  CB  . GLN B 1 62  ? 11.379  -2.940  8.811   1.00 17.42 ? 61  GLN C CB  1 
ATOM   2109 C  CG  . GLN B 1 62  ? 12.519  -2.632  9.782   1.00 15.83 ? 61  GLN C CG  1 
ATOM   2110 C  CD  . GLN B 1 62  ? 12.914  -1.163  9.756   1.00 18.76 ? 61  GLN C CD  1 
ATOM   2111 O  OE1 . GLN B 1 62  ? 12.584  -0.417  8.817   1.00 21.24 ? 61  GLN C OE1 1 
ATOM   2112 N  NE2 . GLN B 1 62  ? 13.600  -0.741  10.795  1.00 18.54 ? 61  GLN C NE2 1 
ATOM   2113 N  N   . PRO B 1 63  ? 9.453   -4.734  6.995   1.00 17.50 ? 62  PRO C N   1 
ATOM   2114 C  CA  . PRO B 1 63  ? 8.117   -5.002  6.419   1.00 18.06 ? 62  PRO C CA  1 
ATOM   2115 C  C   . PRO B 1 63  ? 7.411   -6.219  7.023   1.00 18.16 ? 62  PRO C C   1 
ATOM   2116 O  O   . PRO B 1 63  ? 6.210   -6.153  7.285   1.00 17.74 ? 62  PRO C O   1 
ATOM   2117 C  CB  . PRO B 1 63  ? 8.404   -5.198  4.923   1.00 18.09 ? 62  PRO C CB  1 
ATOM   2118 C  CG  . PRO B 1 63  ? 9.678   -4.430  4.690   1.00 18.80 ? 62  PRO C CG  1 
ATOM   2119 C  CD  . PRO B 1 63  ? 10.491  -4.638  5.945   1.00 17.61 ? 62  PRO C CD  1 
ATOM   2120 N  N   . ALA B 1 64  ? 8.152   -7.301  7.270   1.00 17.28 ? 63  ALA C N   1 
ATOM   2121 C  CA  . ALA B 1 64  ? 7.556   -8.533  7.792   1.00 17.46 ? 63  ALA C CA  1 
ATOM   2122 C  C   . ALA B 1 64  ? 7.088   -8.330  9.249   1.00 17.07 ? 63  ALA C C   1 
ATOM   2123 O  O   . ALA B 1 64  ? 6.007   -8.782  9.632   1.00 17.50 ? 63  ALA C O   1 
ATOM   2124 C  CB  . ALA B 1 64  ? 8.548   -9.692  7.681   1.00 17.59 ? 63  ALA C CB  1 
ATOM   2125 N  N   . LEU B 1 65  ? 7.877   -7.623  10.049  1.00 16.73 ? 64  LEU C N   1 
ATOM   2126 C  CA  . LEU B 1 65  ? 7.444   -7.320  11.422  1.00 15.99 ? 64  LEU C CA  1 
ATOM   2127 C  C   . LEU B 1 65  ? 6.219   -6.413  11.438  1.00 16.38 ? 64  LEU C C   1 
ATOM   2128 O  O   . LEU B 1 65  ? 5.273   -6.655  12.191  1.00 16.48 ? 64  LEU C O   1 
ATOM   2129 C  CB  . LEU B 1 65  ? 8.552   -6.687  12.260  1.00 16.68 ? 64  LEU C CB  1 
ATOM   2130 C  CG  . LEU B 1 65  ? 8.167   -6.563  13.749  1.00 18.02 ? 64  LEU C CG  1 
ATOM   2131 C  CD1 . LEU B 1 65  ? 8.294   -7.925  14.428  1.00 19.67 ? 64  LEU C CD1 1 
ATOM   2132 C  CD2 . LEU B 1 65  ? 9.001   -5.540  14.477  1.00 18.49 ? 64  LEU C CD2 1 
ATOM   2133 N  N   A LYS B 1 66  ? 6.236   -5.373  10.607  0.50 16.18 ? 65  LYS C N   1 
ATOM   2134 N  N   B LYS B 1 66  ? 6.217   -5.367  10.614  0.50 16.19 ? 65  LYS C N   1 
ATOM   2135 C  CA  A LYS B 1 66  ? 5.108   -4.453  10.564  0.50 16.44 ? 65  LYS C CA  1 
ATOM   2136 C  CA  B LYS B 1 66  ? 5.072   -4.459  10.629  0.50 16.37 ? 65  LYS C CA  1 
ATOM   2137 C  C   A LYS B 1 66  ? 3.834   -5.208  10.204  0.50 16.17 ? 65  LYS C C   1 
ATOM   2138 C  C   B LYS B 1 66  ? 3.799   -5.179  10.179  0.50 16.17 ? 65  LYS C C   1 
ATOM   2139 O  O   A LYS B 1 66  ? 2.810   -5.044  10.864  0.50 16.17 ? 65  LYS C O   1 
ATOM   2140 O  O   B LYS B 1 66  ? 2.733   -4.960  10.754  0.50 16.13 ? 65  LYS C O   1 
ATOM   2141 C  CB  A LYS B 1 66  ? 5.348   -3.335  9.557   0.50 16.74 ? 65  LYS C CB  1 
ATOM   2142 C  CB  B LYS B 1 66  ? 5.315   -3.216  9.777   0.50 16.82 ? 65  LYS C CB  1 
ATOM   2143 C  CG  A LYS B 1 66  ? 4.147   -2.381  9.432   0.50 16.82 ? 65  LYS C CG  1 
ATOM   2144 C  CG  B LYS B 1 66  ? 4.125   -2.237  9.799   0.50 16.31 ? 65  LYS C CG  1 
ATOM   2145 C  CD  A LYS B 1 66  ? 4.555   -0.983  8.992   0.50 18.65 ? 65  LYS C CD  1 
ATOM   2146 C  CD  B LYS B 1 66  ? 4.493   -0.843  9.300   0.50 17.73 ? 65  LYS C CD  1 
ATOM   2147 C  CE  A LYS B 1 66  ? 5.138   -0.962  7.591   0.50 19.80 ? 65  LYS C CE  1 
ATOM   2148 C  CE  B LYS B 1 66  ? 4.678   -0.790  7.789   0.50 17.84 ? 65  LYS C CE  1 
ATOM   2149 N  NZ  A LYS B 1 66  ? 4.181   -1.411  6.555   0.50 19.92 ? 65  LYS C NZ  1 
ATOM   2150 N  NZ  B LYS B 1 66  ? 5.138   0.571   7.391   0.50 16.99 ? 65  LYS C NZ  1 
ATOM   2151 N  N   . PHE B 1 67  ? 3.920   -6.029  9.159   1.00 15.83 ? 66  PHE C N   1 
ATOM   2152 C  CA  . PHE B 1 67  ? 2.764   -6.761  8.617   1.00 15.69 ? 66  PHE C CA  1 
ATOM   2153 C  C   . PHE B 1 67  ? 2.188   -7.793  9.595   1.00 16.05 ? 66  PHE C C   1 
ATOM   2154 O  O   . PHE B 1 67  ? 0.986   -7.806  9.874   1.00 15.27 ? 66  PHE C O   1 
ATOM   2155 C  CB  . PHE B 1 67  ? 3.188   -7.440  7.320   1.00 15.73 ? 66  PHE C CB  1 
ATOM   2156 C  CG  . PHE B 1 67  ? 2.062   -8.091  6.567   1.00 15.98 ? 66  PHE C CG  1 
ATOM   2157 C  CD1 . PHE B 1 67  ? 2.095   -9.459  6.319   1.00 16.73 ? 66  PHE C CD1 1 
ATOM   2158 C  CD2 . PHE B 1 67  ? 0.990   -7.321  6.075   1.00 15.95 ? 66  PHE C CD2 1 
ATOM   2159 C  CE1 . PHE B 1 67  ? 1.069   -10.077 5.601   1.00 16.91 ? 66  PHE C CE1 1 
ATOM   2160 C  CE2 . PHE B 1 67  ? -0.056  -7.930  5.350   1.00 18.07 ? 66  PHE C CE2 1 
ATOM   2161 C  CZ  . PHE B 1 67  ? -0.013  -9.302  5.110   1.00 17.03 ? 66  PHE C CZ  1 
ATOM   2162 N  N   . ASN B 1 68  ? 3.056   -8.660  10.120  1.00 16.26 ? 67  ASN C N   1 
ATOM   2163 C  CA  . ASN B 1 68  ? 2.620   -9.710  11.026  1.00 16.05 ? 67  ASN C CA  1 
ATOM   2164 C  C   . ASN B 1 68  ? 2.363   -9.201  12.431  1.00 15.78 ? 67  ASN C C   1 
ATOM   2165 O  O   . ASN B 1 68  ? 1.380   -9.589  13.058  1.00 16.35 ? 67  ASN C O   1 
ATOM   2166 C  CB  . ASN B 1 68  ? 3.628   -10.867 11.007  1.00 16.70 ? 67  ASN C CB  1 
ATOM   2167 C  CG  . ASN B 1 68  ? 3.693   -11.527 9.658   1.00 17.06 ? 67  ASN C CG  1 
ATOM   2168 O  OD1 . ASN B 1 68  ? 4.605   -11.266 8.844   1.00 21.39 ? 67  ASN C OD1 1 
ATOM   2169 N  ND2 . ASN B 1 68  ? 2.691   -12.326 9.369   1.00 14.38 ? 67  ASN C ND2 1 
ATOM   2170 N  N   . GLY B 1 69  ? 3.239   -8.319  12.917  1.00 15.84 ? 68  GLY C N   1 
ATOM   2171 C  CA  . GLY B 1 69  ? 3.061   -7.713  14.233  1.00 15.58 ? 68  GLY C CA  1 
ATOM   2172 C  C   . GLY B 1 69  ? 1.817   -6.840  14.218  1.00 15.77 ? 68  GLY C C   1 
ATOM   2173 O  O   . GLY B 1 69  ? 1.013   -6.893  15.144  1.00 15.31 ? 68  GLY C O   1 
ATOM   2174 N  N   . GLY B 1 70  ? 1.675   -6.048  13.155  1.00 14.63 ? 69  GLY C N   1 
ATOM   2175 C  CA  . GLY B 1 70  ? 0.481   -5.216  12.949  1.00 15.01 ? 69  GLY C CA  1 
ATOM   2176 C  C   . GLY B 1 70  ? -0.756  -6.090  12.873  1.00 14.82 ? 69  GLY C C   1 
ATOM   2177 O  O   . GLY B 1 70  ? -1.758  -5.796  13.506  1.00 14.87 ? 69  GLY C O   1 
ATOM   2178 N  N   . GLY B 1 71  ? -0.674  -7.175  12.105  1.00 14.15 ? 70  GLY C N   1 
ATOM   2179 C  CA  . GLY B 1 71  ? -1.794  -8.119  11.989  1.00 14.20 ? 70  GLY C CA  1 
ATOM   2180 C  C   . GLY B 1 71  ? -2.230  -8.615  13.356  1.00 13.90 ? 70  GLY C C   1 
ATOM   2181 O  O   . GLY B 1 71  ? -3.428  -8.672  13.676  1.00 13.50 ? 70  GLY C O   1 
ATOM   2182 N  N   . HIS B 1 72  ? -1.252  -8.975  14.179  1.00 14.07 ? 71  HIS C N   1 
ATOM   2183 C  CA  . HIS B 1 72  ? -1.557  -9.440  15.521  1.00 14.09 ? 71  HIS C CA  1 
ATOM   2184 C  C   . HIS B 1 72  ? -2.201  -8.339  16.373  1.00 14.10 ? 71  HIS C C   1 
ATOM   2185 O  O   . HIS B 1 72  ? -3.230  -8.574  17.016  1.00 13.95 ? 71  HIS C O   1 
ATOM   2186 C  CB  . HIS B 1 72  ? -0.289  -10.006 16.181  1.00 13.66 ? 71  HIS C CB  1 
ATOM   2187 C  CG  . HIS B 1 72  ? -0.478  -10.444 17.602  1.00 14.37 ? 71  HIS C CG  1 
ATOM   2188 N  ND1 . HIS B 1 72  ? -1.516  -11.252 18.012  1.00 14.44 ? 71  HIS C ND1 1 
ATOM   2189 C  CD2 . HIS B 1 72  ? 0.249   -10.176 18.710  1.00 14.26 ? 71  HIS C CD2 1 
ATOM   2190 C  CE1 . HIS B 1 72  ? -1.410  -11.479 19.312  1.00 14.48 ? 71  HIS C CE1 1 
ATOM   2191 N  NE2 . HIS B 1 72  ? -0.348  -10.833 19.760  1.00 13.62 ? 71  HIS C NE2 1 
ATOM   2192 N  N   . ILE B 1 73  ? -1.629  -7.134  16.342  1.00 13.83 ? 72  ILE C N   1 
ATOM   2193 C  CA  . ILE B 1 73  ? -2.160  -6.006  17.145  1.00 13.68 ? 72  ILE C CA  1 
ATOM   2194 C  C   . ILE B 1 73  ? -3.599  -5.690  16.736  1.00 13.85 ? 72  ILE C C   1 
ATOM   2195 O  O   . ILE B 1 73  ? -4.501  -5.587  17.575  1.00 13.56 ? 72  ILE C O   1 
ATOM   2196 C  CB  . ILE B 1 73  ? -1.268  -4.747  16.999  1.00 14.28 ? 72  ILE C CB  1 
ATOM   2197 C  CG1 . ILE B 1 73  ? 0.077   -4.966  17.719  1.00 12.99 ? 72  ILE C CG1 1 
ATOM   2198 C  CG2 . ILE B 1 73  ? -1.985  -3.470  17.566  1.00 14.43 ? 72  ILE C CG2 1 
ATOM   2199 C  CD1 . ILE B 1 73  ? 1.166   -3.965  17.285  1.00 14.52 ? 72  ILE C CD1 1 
ATOM   2200 N  N   . ASN B 1 74  ? -3.794  -5.556  15.429  1.00 13.83 ? 73  ASN C N   1 
ATOM   2201 C  CA  . ASN B 1 74  ? -5.079  -5.149  14.880  1.00 14.29 ? 73  ASN C CA  1 
ATOM   2202 C  C   . ASN B 1 74  ? -6.182  -6.140  15.181  1.00 14.43 ? 73  ASN C C   1 
ATOM   2203 O  O   . ASN B 1 74  ? -7.253  -5.746  15.643  1.00 15.10 ? 73  ASN C O   1 
ATOM   2204 C  CB  . ASN B 1 74  ? -4.966  -4.958  13.378  1.00 13.62 ? 73  ASN C CB  1 
ATOM   2205 C  CG  . ASN B 1 74  ? -3.974  -3.893  13.003  1.00 15.03 ? 73  ASN C CG  1 
ATOM   2206 O  OD1 . ASN B 1 74  ? -3.610  -3.042  13.820  1.00 16.65 ? 73  ASN C OD1 1 
ATOM   2207 N  ND2 . ASN B 1 74  ? -3.518  -3.939  11.767  1.00 15.22 ? 73  ASN C ND2 1 
ATOM   2208 N  N   . HIS B 1 75  ? -5.933  -7.425  14.927  1.00 14.23 ? 74  HIS C N   1 
ATOM   2209 C  CA  . HIS B 1 75  ? -6.978  -8.437  15.174  1.00 14.14 ? 74  HIS C CA  1 
ATOM   2210 C  C   . HIS B 1 75  ? -7.271  -8.648  16.653  1.00 14.33 ? 74  HIS C C   1 
ATOM   2211 O  O   . HIS B 1 75  ? -8.437  -8.804  17.039  1.00 14.53 ? 74  HIS C O   1 
ATOM   2212 C  CB  . HIS B 1 75  ? -6.654  -9.749  14.468  1.00 13.85 ? 74  HIS C CB  1 
ATOM   2213 C  CG  . HIS B 1 75  ? -6.690  -9.643  12.978  1.00 12.82 ? 74  HIS C CG  1 
ATOM   2214 N  ND1 . HIS B 1 75  ? -5.618  -9.199  12.236  1.00 11.60 ? 74  HIS C ND1 1 
ATOM   2215 C  CD2 . HIS B 1 75  ? -7.684  -9.894  12.089  1.00 13.15 ? 74  HIS C CD2 1 
ATOM   2216 C  CE1 . HIS B 1 75  ? -5.946  -9.186  10.953  1.00 12.91 ? 74  HIS C CE1 1 
ATOM   2217 N  NE2 . HIS B 1 75  ? -7.187  -9.621  10.839  1.00 10.32 ? 74  HIS C NE2 1 
ATOM   2218 N  N   . SER B 1 76  ? -6.224  -8.626  17.479  1.00 14.59 ? 75  SER C N   1 
ATOM   2219 C  CA  . SER B 1 76  ? -6.391  -8.659  18.937  1.00 14.47 ? 75  SER C CA  1 
ATOM   2220 C  C   . SER B 1 76  ? -7.365  -7.567  19.400  1.00 14.67 ? 75  SER C C   1 
ATOM   2221 O  O   . SER B 1 76  ? -8.301  -7.842  20.143  1.00 13.55 ? 75  SER C O   1 
ATOM   2222 C  CB  . SER B 1 76  ? -5.045  -8.500  19.646  1.00 14.63 ? 75  SER C CB  1 
ATOM   2223 O  OG  . SER B 1 76  ? -4.233  -9.652  19.477  1.00 14.43 ? 75  SER C OG  1 
ATOM   2224 N  N   . ILE B 1 77  ? -7.150  -6.335  18.940  1.00 14.46 ? 76  ILE C N   1 
ATOM   2225 C  CA  . ILE B 1 77  ? -8.049  -5.223  19.289  1.00 14.60 ? 76  ILE C CA  1 
ATOM   2226 C  C   . ILE B 1 77  ? -9.443  -5.445  18.718  1.00 14.68 ? 76  ILE C C   1 
ATOM   2227 O  O   . ILE B 1 77  ? -10.451 -5.269  19.419  1.00 14.66 ? 76  ILE C O   1 
ATOM   2228 C  CB  . ILE B 1 77  ? -7.485  -3.869  18.802  1.00 14.61 ? 76  ILE C CB  1 
ATOM   2229 C  CG1 . ILE B 1 77  ? -6.236  -3.506  19.614  1.00 14.55 ? 76  ILE C CG1 1 
ATOM   2230 C  CG2 . ILE B 1 77  ? -8.552  -2.762  18.877  1.00 14.78 ? 76  ILE C CG2 1 
ATOM   2231 C  CD1 . ILE B 1 77  ? -5.342  -2.475  18.952  1.00 16.47 ? 76  ILE C CD1 1 
ATOM   2232 N  N   . PHE B 1 78  ? -9.487  -5.841  17.447  1.00 14.84 ? 77  PHE C N   1 
ATOM   2233 C  CA  . PHE B 1 78  ? -10.747 -6.069  16.737  1.00 14.50 ? 77  PHE C CA  1 
ATOM   2234 C  C   . PHE B 1 78  ? -11.690 -7.034  17.465  1.00 14.51 ? 77  PHE C C   1 
ATOM   2235 O  O   . PHE B 1 78  ? -12.883 -6.744  17.585  1.00 14.70 ? 77  PHE C O   1 
ATOM   2236 C  CB  . PHE B 1 78  ? -10.466 -6.557  15.313  1.00 14.45 ? 77  PHE C CB  1 
ATOM   2237 C  CG  . PHE B 1 78  ? -11.664 -6.531  14.402  1.00 13.84 ? 77  PHE C CG  1 
ATOM   2238 C  CD1 . PHE B 1 78  ? -12.401 -5.357  14.212  1.00 14.06 ? 77  PHE C CD1 1 
ATOM   2239 C  CD2 . PHE B 1 78  ? -12.033 -7.673  13.697  1.00 14.02 ? 77  PHE C CD2 1 
ATOM   2240 C  CE1 . PHE B 1 78  ? -13.504 -5.325  13.342  1.00 12.16 ? 77  PHE C CE1 1 
ATOM   2241 C  CE2 . PHE B 1 78  ? -13.124 -7.655  12.823  1.00 12.20 ? 77  PHE C CE2 1 
ATOM   2242 C  CZ  . PHE B 1 78  ? -13.864 -6.479  12.652  1.00 13.04 ? 77  PHE C CZ  1 
ATOM   2243 N  N   . TRP B 1 79  ? -11.177 -8.168  17.957  1.00 14.07 ? 78  TRP C N   1 
ATOM   2244 C  CA  . TRP B 1 79  ? -12.065 -9.141  18.625  1.00 14.32 ? 78  TRP C CA  1 
ATOM   2245 C  C   . TRP B 1 79  ? -12.760 -8.536  19.840  1.00 14.22 ? 78  TRP C C   1 
ATOM   2246 O  O   . TRP B 1 79  ? -13.922 -8.830  20.103  1.00 14.23 ? 78  TRP C O   1 
ATOM   2247 C  CB  . TRP B 1 79  ? -11.340 -10.432 19.040  1.00 14.27 ? 78  TRP C CB  1 
ATOM   2248 C  CG  . TRP B 1 79  ? -10.460 -11.048 17.985  1.00 14.36 ? 78  TRP C CG  1 
ATOM   2249 C  CD1 . TRP B 1 79  ? -9.190  -11.497 18.162  1.00 14.10 ? 78  TRP C CD1 1 
ATOM   2250 C  CD2 . TRP B 1 79  ? -10.789 -11.303 16.607  1.00 13.69 ? 78  TRP C CD2 1 
ATOM   2251 N  NE1 . TRP B 1 79  ? -8.694  -12.001 16.986  1.00 14.65 ? 78  TRP C NE1 1 
ATOM   2252 C  CE2 . TRP B 1 79  ? -9.653  -11.895 16.014  1.00 14.12 ? 78  TRP C CE2 1 
ATOM   2253 C  CE3 . TRP B 1 79  ? -11.930 -11.089 15.819  1.00 13.68 ? 78  TRP C CE3 1 
ATOM   2254 C  CZ2 . TRP B 1 79  ? -9.618  -12.279 14.677  1.00 13.44 ? 78  TRP C CZ2 1 
ATOM   2255 C  CZ3 . TRP B 1 79  ? -11.895 -11.471 14.487  1.00 14.60 ? 78  TRP C CZ3 1 
ATOM   2256 C  CH2 . TRP B 1 79  ? -10.742 -12.052 13.926  1.00 14.47 ? 78  TRP C CH2 1 
ATOM   2257 N  N   . THR B 1 80  ? -12.039 -7.685  20.567  1.00 14.48 ? 79  THR C N   1 
ATOM   2258 C  CA  . THR B 1 80  ? -12.560 -7.074  21.785  1.00 14.85 ? 79  THR C CA  1 
ATOM   2259 C  C   . THR B 1 80  ? -13.519 -5.933  21.458  1.00 15.13 ? 79  THR C C   1 
ATOM   2260 O  O   . THR B 1 80  ? -14.371 -5.582  22.274  1.00 14.96 ? 79  THR C O   1 
ATOM   2261 C  CB  . THR B 1 80  ? -11.433 -6.546  22.700  1.00 14.86 ? 79  THR C CB  1 
ATOM   2262 O  OG1 . THR B 1 80  ? -10.823 -5.396  22.105  1.00 14.43 ? 79  THR C OG1 1 
ATOM   2263 C  CG2 . THR B 1 80  ? -10.384 -7.629  22.967  1.00 14.50 ? 79  THR C CG2 1 
ATOM   2264 N  N   . ASN B 1 81  ? -13.367 -5.377  20.254  1.00 15.05 ? 80  ASN C N   1 
ATOM   2265 C  CA  . ASN B 1 81  ? -14.185 -4.273  19.755  1.00 15.36 ? 80  ASN C CA  1 
ATOM   2266 C  C   . ASN B 1 81  ? -15.610 -4.690  19.369  1.00 15.68 ? 80  ASN C C   1 
ATOM   2267 O  O   . ASN B 1 81  ? -16.450 -3.833  19.066  1.00 15.48 ? 80  ASN C O   1 
ATOM   2268 C  CB  . ASN B 1 81  ? -13.518 -3.624  18.531  1.00 15.18 ? 80  ASN C CB  1 
ATOM   2269 C  CG  . ASN B 1 81  ? -12.405 -2.638  18.890  1.00 15.90 ? 80  ASN C CG  1 
ATOM   2270 O  OD1 . ASN B 1 81  ? -11.733 -2.114  17.998  1.00 15.30 ? 80  ASN C OD1 1 
ATOM   2271 N  ND2 . ASN B 1 81  ? -12.209 -2.376  20.174  1.00 15.25 ? 80  ASN C ND2 1 
ATOM   2272 N  N   . LEU B 1 82  ? -15.873 -5.998  19.380  1.00 15.76 ? 81  LEU C N   1 
ATOM   2273 C  CA  . LEU B 1 82  ? -17.170 -6.540  18.963  1.00 15.90 ? 81  LEU C CA  1 
ATOM   2274 C  C   . LEU B 1 82  ? -17.889 -7.278  20.095  1.00 16.06 ? 81  LEU C C   1 
ATOM   2275 O  O   . LEU B 1 82  ? -17.252 -7.837  21.000  1.00 16.40 ? 81  LEU C O   1 
ATOM   2276 C  CB  . LEU B 1 82  ? -17.004 -7.477  17.764  1.00 16.00 ? 81  LEU C CB  1 
ATOM   2277 C  CG  . LEU B 1 82  ? -16.231 -6.914  16.560  1.00 14.86 ? 81  LEU C CG  1 
ATOM   2278 C  CD1 . LEU B 1 82  ? -15.825 -8.025  15.592  1.00 15.41 ? 81  LEU C CD1 1 
ATOM   2279 C  CD2 . LEU B 1 82  ? -17.030 -5.827  15.846  1.00 14.48 ? 81  LEU C CD2 1 
ATOM   2280 N  N   . ALA B 1 83  ? -19.215 -7.279  20.024  1.00 16.23 ? 82  ALA C N   1 
ATOM   2281 C  CA  . ALA B 1 83  ? -20.067 -7.944  21.019  1.00 16.67 ? 82  ALA C CA  1 
ATOM   2282 C  C   . ALA B 1 83  ? -21.503 -8.033  20.520  1.00 17.23 ? 82  ALA C C   1 
ATOM   2283 O  O   . ALA B 1 83  ? -21.993 -7.121  19.853  1.00 17.06 ? 82  ALA C O   1 
ATOM   2284 C  CB  . ALA B 1 83  ? -20.022 -7.198  22.339  1.00 16.58 ? 82  ALA C CB  1 
ATOM   2285 N  N   . LYS B 1 84  ? -22.173 -9.136  20.849  1.00 17.84 ? 83  LYS C N   1 
ATOM   2286 C  CA  . LYS B 1 84  ? -23.610 -9.268  20.612  1.00 18.49 ? 83  LYS C CA  1 
ATOM   2287 C  C   . LYS B 1 84  ? -24.362 -8.255  21.472  1.00 18.73 ? 83  LYS C C   1 
ATOM   2288 O  O   . LYS B 1 84  ? -25.368 -7.698  21.046  1.00 18.87 ? 83  LYS C O   1 
ATOM   2289 C  CB  . LYS B 1 84  ? -24.075 -10.680 20.926  1.00 18.50 ? 83  LYS C CB  1 
ATOM   2290 N  N   . ASP B 1 85  ? -23.851 -8.014  22.677  1.00 18.90 ? 84  ASP C N   1 
ATOM   2291 C  CA  . ASP B 1 85  ? -24.442 -7.049  23.597  1.00 19.62 ? 84  ASP C CA  1 
ATOM   2292 C  C   . ASP B 1 85  ? -23.430 -5.976  23.976  1.00 19.81 ? 84  ASP C C   1 
ATOM   2293 O  O   . ASP B 1 85  ? -22.903 -5.964  25.094  1.00 20.57 ? 84  ASP C O   1 
ATOM   2294 C  CB  . ASP B 1 85  ? -24.970 -7.756  24.839  1.00 19.65 ? 84  ASP C CB  1 
ATOM   2295 N  N   . GLY B 1 86  ? -23.173 -5.073  23.037  1.00 19.92 ? 85  GLY C N   1 
ATOM   2296 C  CA  . GLY B 1 86  ? -22.156 -4.039  23.192  1.00 19.85 ? 85  GLY C CA  1 
ATOM   2297 C  C   . GLY B 1 86  ? -22.412 -3.022  24.288  1.00 19.65 ? 85  GLY C C   1 
ATOM   2298 O  O   . GLY B 1 86  ? -21.472 -2.576  24.957  1.00 20.00 ? 85  GLY C O   1 
ATOM   2299 N  N   . GLY B 1 87  ? -23.682 -2.666  24.486  1.00 19.25 ? 86  GLY C N   1 
ATOM   2300 C  CA  . GLY B 1 87  ? -24.032 -1.583  25.394  1.00 18.56 ? 86  GLY C CA  1 
ATOM   2301 C  C   . GLY B 1 87  ? -23.983 -0.228  24.696  1.00 18.29 ? 86  GLY C C   1 
ATOM   2302 O  O   . GLY B 1 87  ? -24.319 -0.098  23.506  1.00 18.12 ? 86  GLY C O   1 
ATOM   2303 N  N   . GLU B 1 88  ? -23.555 0.789   25.473  1.00 18.04 ? 87  GLU C N   1 
ATOM   2304 C  CA  . GLU B 1 88  ? -23.540 2.169   24.992  1.00 17.67 ? 87  GLU C CA  1 
ATOM   2305 C  C   . GLU B 1 88  ? -22.275 2.901   25.454  1.00 17.33 ? 87  GLU C C   1 
ATOM   2306 O  O   . GLU B 1 88  ? -21.666 2.512   26.460  1.00 16.97 ? 87  GLU C O   1 
ATOM   2307 C  CB  . GLU B 1 88  ? -24.791 2.904   25.472  1.00 17.83 ? 87  GLU C CB  1 
ATOM   2308 N  N   . PRO B 1 89  ? -21.870 3.957   24.717  1.00 16.96 ? 88  PRO C N   1 
ATOM   2309 C  CA  . PRO B 1 89  ? -20.701 4.751   25.112  1.00 16.95 ? 88  PRO C CA  1 
ATOM   2310 C  C   . PRO B 1 89  ? -20.814 5.349   26.517  1.00 16.88 ? 88  PRO C C   1 
ATOM   2311 O  O   . PRO B 1 89  ? -21.913 5.706   26.959  1.00 16.53 ? 88  PRO C O   1 
ATOM   2312 C  CB  . PRO B 1 89  ? -20.660 5.868   24.065  1.00 16.86 ? 88  PRO C CB  1 
ATOM   2313 C  CG  . PRO B 1 89  ? -21.394 5.319   22.890  1.00 17.13 ? 88  PRO C CG  1 
ATOM   2314 C  CD  . PRO B 1 89  ? -22.465 4.445   23.458  1.00 16.95 ? 88  PRO C CD  1 
ATOM   2315 N  N   . SER B 1 90  ? -19.676 5.440   27.205  1.00 16.80 ? 89  SER C N   1 
ATOM   2316 C  CA  . SER B 1 90  ? -19.600 6.064   28.525  1.00 16.69 ? 89  SER C CA  1 
ATOM   2317 C  C   . SER B 1 90  ? -19.834 7.570   28.437  1.00 16.59 ? 89  SER C C   1 
ATOM   2318 O  O   . SER B 1 90  ? -19.634 8.173   27.375  1.00 16.74 ? 89  SER C O   1 
ATOM   2319 C  CB  . SER B 1 90  ? -18.238 5.791   29.166  1.00 16.59 ? 89  SER C CB  1 
ATOM   2320 O  OG  . SER B 1 90  ? -17.185 6.299   28.364  1.00 17.19 ? 89  SER C OG  1 
ATOM   2321 N  N   . ALA B 1 91  ? -20.252 8.165   29.555  1.00 16.47 ? 90  ALA C N   1 
ATOM   2322 C  CA  . ALA B 1 91  ? -20.516 9.605   29.630  1.00 16.20 ? 90  ALA C CA  1 
ATOM   2323 C  C   . ALA B 1 91  ? -19.311 10.429  29.170  1.00 16.13 ? 90  ALA C C   1 
ATOM   2324 O  O   . ALA B 1 91  ? -19.463 11.364  28.377  1.00 16.33 ? 90  ALA C O   1 
ATOM   2325 C  CB  . ALA B 1 91  ? -20.936 10.002  31.047  1.00 16.36 ? 90  ALA C CB  1 
ATOM   2326 N  N   . GLU B 1 92  ? -18.119 10.065  29.654  1.00 15.63 ? 91  GLU C N   1 
ATOM   2327 C  CA  . GLU B 1 92  ? -16.884 10.743  29.259  1.00 15.23 ? 91  GLU C CA  1 
ATOM   2328 C  C   . GLU B 1 92  ? -16.669 10.688  27.742  1.00 14.71 ? 91  GLU C C   1 
ATOM   2329 O  O   . GLU B 1 92  ? -16.406 11.720  27.114  1.00 14.51 ? 91  GLU C O   1 
ATOM   2330 C  CB  . GLU B 1 92  ? -15.665 10.189  30.014  1.00 15.38 ? 91  GLU C CB  1 
ATOM   2331 C  CG  . GLU B 1 92  ? -15.599 8.661   30.106  1.00 16.64 ? 91  GLU C CG  1 
ATOM   2332 C  CD  . GLU B 1 92  ? -14.183 8.114   30.027  1.00 18.56 ? 91  GLU C CD  1 
ATOM   2333 O  OE1 . GLU B 1 92  ? -13.270 8.697   30.659  1.00 19.43 ? 91  GLU C OE1 1 
ATOM   2334 O  OE2 . GLU B 1 92  ? -13.982 7.085   29.333  1.00 19.21 ? 91  GLU C OE2 1 
ATOM   2335 N  N   . LEU B 1 93  ? -16.823 9.490   27.172  1.00 14.24 ? 92  LEU C N   1 
ATOM   2336 C  CA  . LEU B 1 93  ? -16.594 9.248   25.738  1.00 14.00 ? 92  LEU C CA  1 
ATOM   2337 C  C   . LEU B 1 93  ? -17.562 10.029  24.846  1.00 13.84 ? 92  LEU C C   1 
ATOM   2338 O  O   . LEU B 1 93  ? -17.142 10.602  23.833  1.00 13.79 ? 92  LEU C O   1 
ATOM   2339 C  CB  . LEU B 1 93  ? -16.661 7.745   25.409  1.00 13.92 ? 92  LEU C CB  1 
ATOM   2340 C  CG  . LEU B 1 93  ? -16.510 7.301   23.940  1.00 14.05 ? 92  LEU C CG  1 
ATOM   2341 C  CD1 . LEU B 1 93  ? -15.143 7.669   23.378  1.00 14.74 ? 92  LEU C CD1 1 
ATOM   2342 C  CD2 . LEU B 1 93  ? -16.777 5.811   23.775  1.00 13.97 ? 92  LEU C CD2 1 
ATOM   2343 N  N   . LEU B 1 94  ? -18.842 10.043  25.224  1.00 13.37 ? 93  LEU C N   1 
ATOM   2344 C  CA  . LEU B 1 94  ? -19.879 10.719  24.439  1.00 13.24 ? 93  LEU C CA  1 
ATOM   2345 C  C   . LEU B 1 94  ? -19.685 12.235  24.406  1.00 13.21 ? 93  LEU C C   1 
ATOM   2346 O  O   . LEU B 1 94  ? -19.895 12.860  23.364  1.00 12.71 ? 93  LEU C O   1 
ATOM   2347 C  CB  . LEU B 1 94  ? -21.291 10.375  24.951  1.00 13.13 ? 93  LEU C CB  1 
ATOM   2348 C  CG  . LEU B 1 94  ? -22.451 10.783  24.025  1.00 13.46 ? 93  LEU C CG  1 
ATOM   2349 C  CD1 . LEU B 1 94  ? -22.337 10.099  22.656  1.00 13.11 ? 93  LEU C CD1 1 
ATOM   2350 C  CD2 . LEU B 1 94  ? -23.808 10.497  24.655  1.00 12.99 ? 93  LEU C CD2 1 
ATOM   2351 N  N   . THR B 1 95  ? -19.302 12.813  25.550  1.00 13.17 ? 94  THR C N   1 
ATOM   2352 C  CA  . THR B 1 95  ? -18.919 14.225  25.632  1.00 13.33 ? 94  THR C CA  1 
ATOM   2353 C  C   . THR B 1 95  ? -17.852 14.556  24.579  1.00 13.55 ? 94  THR C C   1 
ATOM   2354 O  O   . THR B 1 95  ? -17.999 15.520  23.819  1.00 13.26 ? 94  THR C O   1 
ATOM   2355 C  CB  . THR B 1 95  ? -18.422 14.608  27.047  1.00 13.34 ? 94  THR C CB  1 
ATOM   2356 O  OG1 . THR B 1 95  ? -19.497 14.476  27.999  1.00 13.44 ? 94  THR C OG1 1 
ATOM   2357 C  CG2 . THR B 1 95  ? -17.900 16.047  27.077  1.00 13.13 ? 94  THR C CG2 1 
ATOM   2358 N  N   . ALA B 1 96  ? -16.796 13.741  24.536  1.00 13.74 ? 95  ALA C N   1 
ATOM   2359 C  CA  . ALA B 1 96  ? -15.731 13.888  23.545  1.00 14.35 ? 95  ALA C CA  1 
ATOM   2360 C  C   . ALA B 1 96  ? -16.227 13.640  22.122  1.00 14.61 ? 95  ALA C C   1 
ATOM   2361 O  O   . ALA B 1 96  ? -15.833 14.354  21.195  1.00 15.00 ? 95  ALA C O   1 
ATOM   2362 C  CB  . ALA B 1 96  ? -14.564 12.970  23.872  1.00 14.04 ? 95  ALA C CB  1 
ATOM   2363 N  N   . ILE B 1 97  ? -17.090 12.637  21.954  1.00 14.93 ? 96  ILE C N   1 
ATOM   2364 C  CA  . ILE B 1 97  ? -17.655 12.313  20.640  1.00 15.48 ? 96  ILE C CA  1 
ATOM   2365 C  C   . ILE B 1 97  ? -18.446 13.505  20.102  1.00 15.76 ? 96  ILE C C   1 
ATOM   2366 O  O   . ILE B 1 97  ? -18.268 13.915  18.951  1.00 15.91 ? 96  ILE C O   1 
ATOM   2367 C  CB  . ILE B 1 97  ? -18.519 11.016  20.670  1.00 15.57 ? 96  ILE C CB  1 
ATOM   2368 C  CG1 . ILE B 1 97  ? -17.614 9.774   20.746  1.00 15.65 ? 96  ILE C CG1 1 
ATOM   2369 C  CG2 . ILE B 1 97  ? -19.412 10.924  19.430  1.00 15.14 ? 96  ILE C CG2 1 
ATOM   2370 C  CD1 . ILE B 1 97  ? -18.358 8.449   20.907  1.00 15.46 ? 96  ILE C CD1 1 
ATOM   2371 N  N   . LYS B 1 98  ? -19.302 14.068  20.953  1.00 16.05 ? 97  LYS C N   1 
ATOM   2372 C  CA  . LYS B 1 98  ? -20.077 15.253  20.606  1.00 16.35 ? 97  LYS C CA  1 
ATOM   2373 C  C   . LYS B 1 98  ? -19.174 16.452  20.314  1.00 16.75 ? 97  LYS C C   1 
ATOM   2374 O  O   . LYS B 1 98  ? -19.441 17.224  19.394  1.00 16.87 ? 97  LYS C O   1 
ATOM   2375 C  CB  . LYS B 1 98  ? -21.075 15.577  21.722  1.00 16.34 ? 97  LYS C CB  1 
ATOM   2376 C  CG  . LYS B 1 98  ? -22.236 14.592  21.811  1.00 16.32 ? 97  LYS C CG  1 
ATOM   2377 C  CD  . LYS B 1 98  ? -23.130 14.940  23.056  1.00 16.68 ? 97  LYS C CD  1 
ATOM   2378 C  CE  . LYS B 1 98  ? -24.337 13.926  23.007  1.00 16.61 ? 97  LYS C CE  1 
ATOM   2379 N  NZ  . LYS B 1 98  ? -25.245 14.217  24.188  1.00 17.02 ? 97  LYS C NZ  1 
ATOM   2380 N  N   . SER B 1 99  ? -18.098 16.587  21.088  1.00 17.33 ? 98  SER C N   1 
ATOM   2381 C  CA  . SER B 1 99  ? -17.144 17.686  20.928  1.00 18.13 ? 98  SER C CA  1 
ATOM   2382 C  C   . SER B 1 99  ? -16.419 17.668  19.582  1.00 18.48 ? 98  SER C C   1 
ATOM   2383 O  O   . SER B 1 99  ? -16.255 18.712  18.942  1.00 18.58 ? 98  SER C O   1 
ATOM   2384 C  CB  . SER B 1 99  ? -16.111 17.656  22.056  1.00 18.33 ? 98  SER C CB  1 
ATOM   2385 O  OG  . SER B 1 99  ? -15.213 18.747  21.948  1.00 19.51 ? 98  SER C OG  1 
ATOM   2386 N  N   . ASP B 1 100 ? -15.997 16.479  19.161  1.00 18.67 ? 99  ASP C N   1 
ATOM   2387 C  CA  . ASP B 1 100 ? -15.142 16.319  17.980  1.00 19.33 ? 99  ASP C CA  1 
ATOM   2388 C  C   . ASP B 1 100 ? -15.904 15.962  16.707  1.00 19.56 ? 99  ASP C C   1 
ATOM   2389 O  O   . ASP B 1 100 ? -15.394 16.159  15.601  1.00 20.01 ? 99  ASP C O   1 
ATOM   2390 C  CB  . ASP B 1 100 ? -14.058 15.275  18.261  1.00 19.12 ? 99  ASP C CB  1 
ATOM   2391 C  CG  . ASP B 1 100 ? -13.164 15.666  19.420  1.00 19.66 ? 99  ASP C CG  1 
ATOM   2392 O  OD1 . ASP B 1 100 ? -12.848 16.870  19.555  1.00 20.81 ? 99  ASP C OD1 1 
ATOM   2393 O  OD2 . ASP B 1 100 ? -12.779 14.777  20.206  1.00 20.09 ? 99  ASP C OD2 1 
ATOM   2394 N  N   . PHE B 1 101 ? -17.116 15.435  16.867  1.00 19.85 ? 100 PHE C N   1 
ATOM   2395 C  CA  . PHE B 1 101 ? -17.922 14.994  15.732  1.00 20.24 ? 100 PHE C CA  1 
ATOM   2396 C  C   . PHE B 1 101 ? -19.322 15.606  15.683  1.00 20.65 ? 100 PHE C C   1 
ATOM   2397 O  O   . PHE B 1 101 ? -19.998 15.513  14.661  1.00 20.66 ? 100 PHE C O   1 
ATOM   2398 C  CB  . PHE B 1 101 ? -18.004 13.467  15.700  1.00 20.34 ? 100 PHE C CB  1 
ATOM   2399 C  CG  . PHE B 1 101 ? -16.685 12.802  15.416  1.00 20.20 ? 100 PHE C CG  1 
ATOM   2400 C  CD1 . PHE B 1 101 ? -15.853 12.405  16.458  1.00 20.24 ? 100 PHE C CD1 1 
ATOM   2401 C  CD2 . PHE B 1 101 ? -16.266 12.591  14.104  1.00 20.24 ? 100 PHE C CD2 1 
ATOM   2402 C  CE1 . PHE B 1 101 ? -14.627 11.800  16.200  1.00 20.86 ? 100 PHE C CE1 1 
ATOM   2403 C  CE2 . PHE B 1 101 ? -15.042 11.987  13.835  1.00 20.72 ? 100 PHE C CE2 1 
ATOM   2404 C  CZ  . PHE B 1 101 ? -14.221 11.590  14.889  1.00 21.09 ? 100 PHE C CZ  1 
ATOM   2405 N  N   . GLY B 1 102 ? -19.751 16.225  16.782  1.00 20.96 ? 101 GLY C N   1 
ATOM   2406 C  CA  . GLY B 1 102 ? -21.087 16.812  16.870  1.00 21.55 ? 101 GLY C CA  1 
ATOM   2407 C  C   . GLY B 1 102 ? -22.116 15.865  17.462  1.00 21.90 ? 101 GLY C C   1 
ATOM   2408 O  O   . GLY B 1 102 ? -22.982 16.284  18.237  1.00 21.95 ? 101 GLY C O   1 
ATOM   2409 N  N   . SER B 1 103 ? -22.013 14.589  17.089  1.00 22.17 ? 102 SER C N   1 
ATOM   2410 C  CA  . SER B 1 103 ? -22.948 13.546  17.509  1.00 22.42 ? 102 SER C CA  1 
ATOM   2411 C  C   . SER B 1 103 ? -22.351 12.170  17.225  1.00 22.68 ? 102 SER C C   1 
ATOM   2412 O  O   . SER B 1 103 ? -21.370 12.059  16.488  1.00 22.72 ? 102 SER C O   1 
ATOM   2413 C  CB  . SER B 1 103 ? -24.265 13.681  16.746  1.00 22.53 ? 102 SER C CB  1 
ATOM   2414 O  OG  . SER B 1 103 ? -24.053 13.530  15.350  1.00 21.81 ? 102 SER C OG  1 
ATOM   2415 N  N   . LEU B 1 104 ? -22.953 11.127  17.797  1.00 22.89 ? 103 LEU C N   1 
ATOM   2416 C  CA  . LEU B 1 104 ? -22.572 9.746   17.485  1.00 23.09 ? 103 LEU C CA  1 
ATOM   2417 C  C   . LEU B 1 104 ? -22.884 9.402   16.030  1.00 23.21 ? 103 LEU C C   1 
ATOM   2418 O  O   . LEU B 1 104 ? -22.108 8.702   15.369  1.00 23.13 ? 103 LEU C O   1 
ATOM   2419 C  CB  . LEU B 1 104 ? -23.279 8.756   18.419  1.00 23.17 ? 103 LEU C CB  1 
ATOM   2420 C  CG  . LEU B 1 104 ? -23.000 7.262   18.203  1.00 23.22 ? 103 LEU C CG  1 
ATOM   2421 C  CD1 . LEU B 1 104 ? -21.593 6.892   18.651  1.00 23.14 ? 103 LEU C CD1 1 
ATOM   2422 C  CD2 . LEU B 1 104 ? -24.034 6.406   18.919  1.00 23.10 ? 103 LEU C CD2 1 
ATOM   2423 N  N   . ASP B 1 105 ? -24.021 9.895   15.543  1.00 23.28 ? 104 ASP C N   1 
ATOM   2424 C  CA  . ASP B 1 105 ? -24.439 9.666   14.165  1.00 23.60 ? 104 ASP C CA  1 
ATOM   2425 C  C   . ASP B 1 105 ? -23.442 10.213  13.158  1.00 23.48 ? 104 ASP C C   1 
ATOM   2426 O  O   . ASP B 1 105 ? -23.165 9.563   12.150  1.00 23.88 ? 104 ASP C O   1 
ATOM   2427 C  CB  . ASP B 1 105 ? -25.831 10.250  13.905  1.00 23.90 ? 104 ASP C CB  1 
ATOM   2428 C  CG  . ASP B 1 105 ? -26.935 9.223   14.078  1.00 25.07 ? 104 ASP C CG  1 
ATOM   2429 O  OD1 . ASP B 1 105 ? -28.117 9.627   14.145  1.00 26.50 ? 104 ASP C OD1 1 
ATOM   2430 O  OD2 . ASP B 1 105 ? -26.623 8.011   14.137  1.00 26.81 ? 104 ASP C OD2 1 
ATOM   2431 N  N   . ASN B 1 106 ? -22.911 11.405  13.432  1.00 23.20 ? 105 ASN C N   1 
ATOM   2432 C  CA  . ASN B 1 106 ? -21.879 12.004  12.586  1.00 22.97 ? 105 ASN C CA  1 
ATOM   2433 C  C   . ASN B 1 106 ? -20.587 11.195  12.612  1.00 22.44 ? 105 ASN C C   1 
ATOM   2434 O  O   . ASN B 1 106 ? -19.933 11.027  11.582  1.00 22.16 ? 105 ASN C O   1 
ATOM   2435 C  CB  . ASN B 1 106 ? -21.587 13.442  13.008  1.00 23.21 ? 105 ASN C CB  1 
ATOM   2436 C  CG  . ASN B 1 106 ? -22.661 14.421  12.569  1.00 24.25 ? 105 ASN C CG  1 
ATOM   2437 O  OD1 . ASN B 1 106 ? -23.606 14.068  11.853  1.00 25.48 ? 105 ASN C OD1 1 
ATOM   2438 N  ND2 . ASN B 1 106 ? -22.521 15.669  13.005  1.00 25.54 ? 105 ASN C ND2 1 
ATOM   2439 N  N   . LEU B 1 107 ? -20.222 10.703  13.794  1.00 21.93 ? 106 LEU C N   1 
ATOM   2440 C  CA  . LEU B 1 107 ? -19.033 9.862   13.939  1.00 21.43 ? 106 LEU C CA  1 
ATOM   2441 C  C   . LEU B 1 107 ? -19.176 8.587   13.111  1.00 21.20 ? 106 LEU C C   1 
ATOM   2442 O  O   . LEU B 1 107 ? -18.273 8.236   12.345  1.00 20.58 ? 106 LEU C O   1 
ATOM   2443 C  CB  . LEU B 1 107 ? -18.766 9.525   15.415  1.00 21.39 ? 106 LEU C CB  1 
ATOM   2444 C  CG  . LEU B 1 107 ? -17.557 8.647   15.773  1.00 22.15 ? 106 LEU C CG  1 
ATOM   2445 C  CD1 . LEU B 1 107 ? -17.169 8.824   17.239  1.00 22.58 ? 106 LEU C CD1 1 
ATOM   2446 C  CD2 . LEU B 1 107 ? -17.799 7.170   15.479  1.00 23.40 ? 106 LEU C CD2 1 
ATOM   2447 N  N   . GLN B 1 108 ? -20.308 7.900   13.268  1.00 20.81 ? 107 GLN C N   1 
ATOM   2448 C  CA  . GLN B 1 108 ? -20.539 6.636   12.568  1.00 21.03 ? 107 GLN C CA  1 
ATOM   2449 C  C   . GLN B 1 108 ? -20.536 6.840   11.053  1.00 20.73 ? 107 GLN C C   1 
ATOM   2450 O  O   . GLN B 1 108 ? -19.907 6.071   10.325  1.00 21.01 ? 107 GLN C O   1 
ATOM   2451 C  CB  . GLN B 1 108 ? -21.826 5.959   13.048  1.00 20.92 ? 107 GLN C CB  1 
ATOM   2452 C  CG  . GLN B 1 108 ? -21.729 5.392   14.476  1.00 21.28 ? 107 GLN C CG  1 
ATOM   2453 C  CD  . GLN B 1 108 ? -22.968 4.618   14.907  1.00 21.78 ? 107 GLN C CD  1 
ATOM   2454 O  OE1 . GLN B 1 108 ? -23.820 4.267   14.089  1.00 23.58 ? 107 GLN C OE1 1 
ATOM   2455 N  NE2 . GLN B 1 108 ? -23.074 4.356   16.201  1.00 22.27 ? 107 GLN C NE2 1 
ATOM   2456 N  N   . LYS B 1 109 ? -21.204 7.897   10.598  1.00 20.37 ? 108 LYS C N   1 
ATOM   2457 C  CA  . LYS B 1 109 ? -21.218 8.275   9.180   1.00 19.94 ? 108 LYS C CA  1 
ATOM   2458 C  C   . LYS B 1 109 ? -19.803 8.506   8.634   1.00 19.42 ? 108 LYS C C   1 
ATOM   2459 O  O   . LYS B 1 109 ? -19.452 7.994   7.571   1.00 18.86 ? 108 LYS C O   1 
ATOM   2460 C  CB  . LYS B 1 109 ? -22.099 9.520   8.970   1.00 20.16 ? 108 LYS C CB  1 
ATOM   2461 C  CG  . LYS B 1 109 ? -22.073 10.105  7.561   1.00 20.54 ? 108 LYS C CG  1 
ATOM   2462 C  CD  . LYS B 1 109 ? -22.872 11.399  7.485   1.00 20.57 ? 108 LYS C CD  1 
ATOM   2463 C  CE  . LYS B 1 109 ? -22.917 11.949  6.063   1.00 21.95 ? 108 LYS C CE  1 
ATOM   2464 N  NZ  . LYS B 1 109 ? -23.796 13.154  5.971   1.00 22.37 ? 108 LYS C NZ  1 
ATOM   2465 N  N   . GLN B 1 110 ? -18.995 9.264   9.372   1.00 18.84 ? 109 GLN C N   1 
ATOM   2466 C  CA  . GLN B 1 110 ? -17.653 9.624   8.919   1.00 18.46 ? 109 GLN C CA  1 
ATOM   2467 C  C   . GLN B 1 110 ? -16.693 8.442   8.966   1.00 18.00 ? 109 GLN C C   1 
ATOM   2468 O  O   . GLN B 1 110 ? -15.924 8.233   8.024   1.00 17.94 ? 109 GLN C O   1 
ATOM   2469 C  CB  . GLN B 1 110 ? -17.100 10.802  9.720   1.00 18.64 ? 109 GLN C CB  1 
ATOM   2470 C  CG  . GLN B 1 110 ? -17.869 12.101  9.475   1.00 20.31 ? 109 GLN C CG  1 
ATOM   2471 C  CD  . GLN B 1 110 ? -17.402 13.233  10.360  1.00 22.15 ? 109 GLN C CD  1 
ATOM   2472 O  OE1 . GLN B 1 110 ? -16.245 13.275  10.778  1.00 23.37 ? 109 GLN C OE1 1 
ATOM   2473 N  NE2 . GLN B 1 110 ? -18.302 14.163  10.651  1.00 23.17 ? 109 GLN C NE2 1 
ATOM   2474 N  N   . LEU B 1 111 ? -16.731 7.668   10.052  1.00 16.80 ? 110 LEU C N   1 
ATOM   2475 C  CA  . LEU B 1 111 ? -15.897 6.465   10.113  1.00 16.62 ? 110 LEU C CA  1 
ATOM   2476 C  C   . LEU B 1 111 ? -16.304 5.468   9.022   1.00 16.06 ? 110 LEU C C   1 
ATOM   2477 O  O   . LEU B 1 111 ? -15.439 4.920   8.333   1.00 16.58 ? 110 LEU C O   1 
ATOM   2478 C  CB  . LEU B 1 111 ? -15.895 5.827   11.513  1.00 16.47 ? 110 LEU C CB  1 
ATOM   2479 C  CG  . LEU B 1 111 ? -14.964 4.619   11.728  1.00 16.39 ? 110 LEU C CG  1 
ATOM   2480 C  CD1 . LEU B 1 111 ? -13.554 4.853   11.200  1.00 15.29 ? 110 LEU C CD1 1 
ATOM   2481 C  CD2 . LEU B 1 111 ? -14.912 4.215   13.208  1.00 16.38 ? 110 LEU C CD2 1 
ATOM   2482 N  N   . SER B 1 112 ? -17.609 5.272   8.836   1.00 15.87 ? 111 SER C N   1 
ATOM   2483 C  CA  . SER B 1 112 ? -18.103 4.373   7.788   1.00 15.62 ? 111 SER C CA  1 
ATOM   2484 C  C   . SER B 1 112 ? -17.609 4.796   6.390   1.00 16.06 ? 111 SER C C   1 
ATOM   2485 O  O   . SER B 1 112 ? -17.079 3.966   5.640   1.00 15.81 ? 111 SER C O   1 
ATOM   2486 C  CB  . SER B 1 112 ? -19.631 4.257   7.817   1.00 16.19 ? 111 SER C CB  1 
ATOM   2487 O  OG  . SER B 1 112 ? -20.078 3.657   9.025   1.00 15.37 ? 111 SER C OG  1 
ATOM   2488 N  N   . ALA B 1 113 ? -17.757 6.081   6.067   1.00 15.74 ? 112 ALA C N   1 
ATOM   2489 C  CA  . ALA B 1 113 ? -17.327 6.615   4.767   1.00 15.94 ? 112 ALA C CA  1 
ATOM   2490 C  C   . ALA B 1 113 ? -15.829 6.413   4.531   1.00 16.04 ? 112 ALA C C   1 
ATOM   2491 O  O   . ALA B 1 113 ? -15.420 5.939   3.463   1.00 15.81 ? 112 ALA C O   1 
ATOM   2492 C  CB  . ALA B 1 113 ? -17.681 8.087   4.649   1.00 15.88 ? 112 ALA C CB  1 
ATOM   2493 N  N   . SER B 1 114 ? -15.016 6.782   5.521   1.00 16.01 ? 113 SER C N   1 
ATOM   2494 C  CA  . SER B 1 114 ? -13.574 6.641   5.396   1.00 16.19 ? 113 SER C CA  1 
ATOM   2495 C  C   . SER B 1 114 ? -13.184 5.176   5.240   1.00 15.90 ? 113 SER C C   1 
ATOM   2496 O  O   . SER B 1 114 ? -12.317 4.845   4.428   1.00 15.95 ? 113 SER C O   1 
ATOM   2497 C  CB  . SER B 1 114 ? -12.856 7.296   6.584   1.00 16.51 ? 113 SER C CB  1 
ATOM   2498 O  OG  . SER B 1 114 ? -13.113 8.700   6.581   1.00 17.69 ? 113 SER C OG  1 
ATOM   2499 N  N   . THR B 1 115 ? -13.854 4.301   5.988   1.00 15.17 ? 114 THR C N   1 
ATOM   2500 C  CA  . THR B 1 115 ? -13.521 2.872   5.986   1.00 15.24 ? 114 THR C CA  1 
ATOM   2501 C  C   . THR B 1 115 ? -13.855 2.235   4.636   1.00 14.90 ? 114 THR C C   1 
ATOM   2502 O  O   . THR B 1 115 ? -13.027 1.538   4.032   1.00 14.11 ? 114 THR C O   1 
ATOM   2503 C  CB  . THR B 1 115 ? -14.212 2.137   7.153   1.00 15.17 ? 114 THR C CB  1 
ATOM   2504 O  OG1 . THR B 1 115 ? -13.760 2.704   8.388   1.00 15.57 ? 114 THR C OG1 1 
ATOM   2505 C  CG2 . THR B 1 115 ? -13.871 0.663   7.155   1.00 15.93 ? 114 THR C CG2 1 
ATOM   2506 N  N   . VAL B 1 116 ? -15.059 2.507   4.149   1.00 14.44 ? 115 VAL C N   1 
ATOM   2507 C  CA  . VAL B 1 116 ? -15.473 2.030   2.831   1.00 14.24 ? 115 VAL C CA  1 
ATOM   2508 C  C   . VAL B 1 116 ? -14.537 2.520   1.715   1.00 14.05 ? 115 VAL C C   1 
ATOM   2509 O  O   . VAL B 1 116 ? -14.305 1.805   0.747   1.00 14.41 ? 115 VAL C O   1 
ATOM   2510 C  CB  . VAL B 1 116 ? -16.931 2.441   2.531   1.00 13.82 ? 115 VAL C CB  1 
ATOM   2511 C  CG1 . VAL B 1 116 ? -17.296 2.170   1.076   1.00 14.28 ? 115 VAL C CG1 1 
ATOM   2512 C  CG2 . VAL B 1 116 ? -17.893 1.722   3.491   1.00 14.28 ? 115 VAL C CG2 1 
ATOM   2513 N  N   . ALA B 1 117 ? -14.000 3.731   1.865   1.00 14.40 ? 116 ALA C N   1 
ATOM   2514 C  CA  . ALA B 1 117 ? -13.127 4.342   0.849   1.00 13.99 ? 116 ALA C CA  1 
ATOM   2515 C  C   . ALA B 1 117 ? -11.690 3.793   0.825   1.00 14.25 ? 116 ALA C C   1 
ATOM   2516 O  O   . ALA B 1 117 ? -10.896 4.173   -0.033  1.00 13.30 ? 116 ALA C O   1 
ATOM   2517 C  CB  . ALA B 1 117 ? -13.109 5.857   1.013   1.00 14.43 ? 116 ALA C CB  1 
ATOM   2518 N  N   . VAL B 1 118 ? -11.346 2.917   1.767   1.00 13.73 ? 117 VAL C N   1 
ATOM   2519 C  CA  . VAL B 1 118 ? -10.019 2.287   1.763   1.00 14.52 ? 117 VAL C CA  1 
ATOM   2520 C  C   . VAL B 1 118 ? -9.786  1.560   0.426   1.00 14.78 ? 117 VAL C C   1 
ATOM   2521 O  O   . VAL B 1 118 ? -10.621 0.753   -0.013  1.00 15.26 ? 117 VAL C O   1 
ATOM   2522 C  CB  . VAL B 1 118 ? -9.808  1.331   2.976   1.00 14.31 ? 117 VAL C CB  1 
ATOM   2523 C  CG1 . VAL B 1 118 ? -8.535  0.455   2.801   1.00 14.59 ? 117 VAL C CG1 1 
ATOM   2524 C  CG2 . VAL B 1 118 ? -9.713  2.129   4.279   1.00 14.73 ? 117 VAL C CG2 1 
ATOM   2525 N  N   . GLN B 1 119 ? -8.676  1.889   -0.234  1.00 15.14 ? 118 GLN C N   1 
ATOM   2526 C  CA  . GLN B 1 119 ? -8.305  1.230   -1.485  1.00 14.94 ? 118 GLN C CA  1 
ATOM   2527 C  C   . GLN B 1 119 ? -7.470  -0.009  -1.172  1.00 15.49 ? 118 GLN C C   1 
ATOM   2528 O  O   . GLN B 1 119 ? -6.355  0.096   -0.632  1.00 15.70 ? 118 GLN C O   1 
ATOM   2529 C  CB  . GLN B 1 119 ? -7.506  2.167   -2.389  1.00 15.26 ? 118 GLN C CB  1 
ATOM   2530 C  CG  . GLN B 1 119 ? -8.292  3.325   -2.948  1.00 15.29 ? 118 GLN C CG  1 
ATOM   2531 C  CD  . GLN B 1 119 ? -7.446  4.197   -3.880  1.00 15.83 ? 118 GLN C CD  1 
ATOM   2532 O  OE1 . GLN B 1 119 ? -7.976  5.068   -4.570  1.00 19.23 ? 118 GLN C OE1 1 
ATOM   2533 N  NE2 . GLN B 1 119 ? -6.134  3.926   -3.932  1.00 16.87 ? 118 GLN C NE2 1 
ATOM   2534 N  N   . GLY B 1 120 ? -8.003  -1.177  -1.533  1.00 14.75 ? 119 GLY C N   1 
ATOM   2535 C  CA  . GLY B 1 120 ? -7.318  -2.421  -1.247  1.00 13.85 ? 119 GLY C CA  1 
ATOM   2536 C  C   . GLY B 1 120 ? -7.620  -2.876  0.167   1.00 13.34 ? 119 GLY C C   1 
ATOM   2537 O  O   . GLY B 1 120 ? -8.739  -2.697  0.675   1.00 12.95 ? 119 GLY C O   1 
ATOM   2538 N  N   . SER B 1 121 ? -6.625  -3.507  0.803   1.00 13.53 ? 120 SER C N   1 
ATOM   2539 C  CA  . SER B 1 121 ? -6.811  -4.045  2.139   1.00 13.14 ? 120 SER C CA  1 
ATOM   2540 C  C   . SER B 1 121 ? -6.449  -3.023  3.198   1.00 13.68 ? 120 SER C C   1 
ATOM   2541 O  O   . SER B 1 121 ? -5.504  -2.239  3.025   1.00 13.85 ? 120 SER C O   1 
ATOM   2542 C  CB  . SER B 1 121 ? -5.973  -5.299  2.342   1.00 13.73 ? 120 SER C CB  1 
ATOM   2543 O  OG  . SER B 1 121 ? -6.049  -6.162  1.213   1.00 14.90 ? 120 SER C OG  1 
ATOM   2544 N  N   . GLY B 1 122 ? -7.199  -3.026  4.295   1.00 14.02 ? 121 GLY C N   1 
ATOM   2545 C  CA  . GLY B 1 122 ? -6.927  -2.036  5.298   1.00 13.92 ? 121 GLY C CA  1 
ATOM   2546 C  C   . GLY B 1 122 ? -7.932  -2.024  6.449   1.00 14.14 ? 121 GLY C C   1 
ATOM   2547 O  O   . GLY B 1 122 ? -8.750  -2.931  6.589   1.00 14.23 ? 121 GLY C O   1 
ATOM   2548 N  N   . TRP B 1 123 ? -7.826  -0.972  7.258   1.00 14.52 ? 122 TRP C N   1 
ATOM   2549 C  CA  . TRP B 1 123 ? -8.631  -0.802  8.440   1.00 14.58 ? 122 TRP C CA  1 
ATOM   2550 C  C   . TRP B 1 123 ? -9.068  0.637   8.603   1.00 14.91 ? 122 TRP C C   1 
ATOM   2551 O  O   . TRP B 1 123 ? -8.366  1.556   8.208   1.00 15.03 ? 122 TRP C O   1 
ATOM   2552 C  CB  . TRP B 1 123 ? -7.797  -1.095  9.700   1.00 14.29 ? 122 TRP C CB  1 
ATOM   2553 C  CG  . TRP B 1 123 ? -7.395  -2.522  9.868   1.00 14.26 ? 122 TRP C CG  1 
ATOM   2554 C  CD1 . TRP B 1 123 ? -6.428  -3.203  9.191   1.00 14.45 ? 122 TRP C CD1 1 
ATOM   2555 C  CD2 . TRP B 1 123 ? -7.964  -3.442  10.797  1.00 15.59 ? 122 TRP C CD2 1 
ATOM   2556 N  NE1 . TRP B 1 123 ? -6.371  -4.506  9.631   1.00 13.49 ? 122 TRP C NE1 1 
ATOM   2557 C  CE2 . TRP B 1 123 ? -7.302  -4.677  10.619  1.00 14.29 ? 122 TRP C CE2 1 
ATOM   2558 C  CE3 . TRP B 1 123 ? -8.983  -3.348  11.760  1.00 14.96 ? 122 TRP C CE3 1 
ATOM   2559 C  CZ2 . TRP B 1 123 ? -7.626  -5.812  11.360  1.00 14.75 ? 122 TRP C CZ2 1 
ATOM   2560 C  CZ3 . TRP B 1 123 ? -9.291  -4.474  12.507  1.00 15.01 ? 122 TRP C CZ3 1 
ATOM   2561 C  CH2 . TRP B 1 123 ? -8.609  -5.690  12.307  1.00 14.38 ? 122 TRP C CH2 1 
ATOM   2562 N  N   . GLY B 1 124 ? -10.245 0.828   9.228   1.00 15.43 ? 123 GLY C N   1 
ATOM   2563 C  CA  . GLY B 1 124 ? -10.762 2.121   9.572   1.00 15.95 ? 123 GLY C CA  1 
ATOM   2564 C  C   . GLY B 1 124 ? -10.737 2.200   11.089  1.00 15.86 ? 123 GLY C C   1 
ATOM   2565 O  O   . GLY B 1 124 ? -11.129 1.254   11.765  1.00 16.54 ? 123 GLY C O   1 
ATOM   2566 N  N   . TRP B 1 125 ? -10.333 3.323   11.661  1.00 16.01 ? 124 TRP C N   1 
ATOM   2567 C  CA  . TRP B 1 125 ? -10.262 3.431   13.085  1.00 15.86 ? 124 TRP C CA  1 
ATOM   2568 C  C   . TRP B 1 125 ? -10.793 4.724   13.667  1.00 15.99 ? 124 TRP C C   1 
ATOM   2569 O  O   . TRP B 1 125 ? -10.724 5.794   13.073  1.00 16.29 ? 124 TRP C O   1 
ATOM   2570 C  CB  . TRP B 1 125 ? -8.793  3.440   13.557  1.00 15.53 ? 124 TRP C CB  1 
ATOM   2571 C  CG  . TRP B 1 125 ? -8.064  2.155   13.379  1.00 15.82 ? 124 TRP C CG  1 
ATOM   2572 C  CD1 . TRP B 1 125 ? -7.193  1.799   12.385  1.00 15.73 ? 124 TRP C CD1 1 
ATOM   2573 C  CD2 . TRP B 1 125 ? -8.128  1.019   14.239  1.00 15.30 ? 124 TRP C CD2 1 
ATOM   2574 N  NE1 . TRP B 1 125 ? -6.741  0.508   12.544  1.00 14.81 ? 124 TRP C NE1 1 
ATOM   2575 C  CE2 . TRP B 1 125 ? -7.319  0.002   13.681  1.00 15.75 ? 124 TRP C CE2 1 
ATOM   2576 C  CE3 . TRP B 1 125 ? -8.831  0.757   15.429  1.00 16.02 ? 124 TRP C CE3 1 
ATOM   2577 C  CZ2 . TRP B 1 125 ? -7.182  -1.256  14.276  1.00 15.98 ? 124 TRP C CZ2 1 
ATOM   2578 C  CZ3 . TRP B 1 125 ? -8.691  -0.500  16.027  1.00 15.83 ? 124 TRP C CZ3 1 
ATOM   2579 C  CH2 . TRP B 1 125 ? -7.873  -1.490  15.443  1.00 16.42 ? 124 TRP C CH2 1 
ATOM   2580 N  N   . LEU B 1 126 ? -11.343 4.586   14.871  1.00 16.14 ? 125 LEU C N   1 
ATOM   2581 C  CA  . LEU B 1 126 ? -11.731 5.696   15.703  1.00 16.51 ? 125 LEU C CA  1 
ATOM   2582 C  C   . LEU B 1 126 ? -10.559 5.805   16.603  1.00 17.17 ? 125 LEU C C   1 
ATOM   2583 O  O   . LEU B 1 126 ? -10.253 4.820   17.232  1.00 17.02 ? 125 LEU C O   1 
ATOM   2584 C  CB  . LEU B 1 126 ? -13.006 5.518   16.539  1.00 16.48 ? 125 LEU C CB  1 
ATOM   2585 C  CG  . LEU B 1 126 ? -13.225 6.544   17.687  1.00 16.17 ? 125 LEU C CG  1 
ATOM   2586 C  CD1 . LEU B 1 126 ? -13.401 7.949   17.117  1.00 15.84 ? 125 LEU C CD1 1 
ATOM   2587 C  CD2 . LEU B 1 126 ? -14.413 6.155   18.535  1.00 16.27 ? 125 LEU C CD2 1 
ATOM   2588 N  N   . GLY B 1 127 ? -9.817  6.849   16.695  1.00 18.27 ? 126 GLY C N   1 
ATOM   2589 C  CA  . GLY B 1 127 ? -8.614  6.928   17.508  1.00 19.58 ? 126 GLY C CA  1 
ATOM   2590 C  C   . GLY B 1 127 ? -8.568  8.166   18.394  1.00 20.45 ? 126 GLY C C   1 
ATOM   2591 O  O   . GLY B 1 127 ? -9.281  9.126   18.159  1.00 20.45 ? 126 GLY C O   1 
ATOM   2592 N  N   . TYR B 1 128 ? -7.722  8.113   19.415  1.00 21.81 ? 127 TYR C N   1 
ATOM   2593 C  CA  . TYR B 1 128 ? -7.553  9.245   20.315  1.00 23.14 ? 127 TYR C CA  1 
ATOM   2594 C  C   . TYR B 1 128 ? -6.149  9.808   20.172  1.00 24.19 ? 127 TYR C C   1 
ATOM   2595 O  O   . TYR B 1 128 ? -5.157  9.081   20.332  1.00 24.36 ? 127 TYR C O   1 
ATOM   2596 C  CB  . TYR B 1 128 ? -7.821  8.836   21.766  1.00 23.22 ? 127 TYR C CB  1 
ATOM   2597 C  CG  . TYR B 1 128 ? -7.627  9.958   22.761  1.00 23.95 ? 127 TYR C CG  1 
ATOM   2598 C  CD1 . TYR B 1 128 ? -8.526  11.021  22.824  1.00 24.12 ? 127 TYR C CD1 1 
ATOM   2599 C  CD2 . TYR B 1 128 ? -6.539  9.959   23.639  1.00 24.48 ? 127 TYR C CD2 1 
ATOM   2600 C  CE1 . TYR B 1 128 ? -8.355  12.064  23.742  1.00 24.77 ? 127 TYR C CE1 1 
ATOM   2601 C  CE2 . TYR B 1 128 ? -6.355  10.997  24.562  1.00 24.33 ? 127 TYR C CE2 1 
ATOM   2602 C  CZ  . TYR B 1 128 ? -7.266  12.043  24.607  1.00 24.46 ? 127 TYR C CZ  1 
ATOM   2603 O  OH  . TYR B 1 128 ? -7.097  13.070  25.517  1.00 23.90 ? 127 TYR C OH  1 
ATOM   2604 N  N   . CYS B 1 129 ? -6.070  11.095  19.849  1.00 25.57 ? 128 CYS C N   1 
ATOM   2605 C  CA  . CYS B 1 129 ? -4.795  11.797  19.809  1.00 26.36 ? 128 CYS C CA  1 
ATOM   2606 C  C   . CYS B 1 129 ? -4.430  12.250  21.220  1.00 27.07 ? 128 CYS C C   1 
ATOM   2607 O  O   . CYS B 1 129 ? -5.101  13.123  21.773  1.00 26.75 ? 128 CYS C O   1 
ATOM   2608 C  CB  . CYS B 1 129 ? -4.863  13.001  18.868  1.00 26.30 ? 128 CYS C CB  1 
ATOM   2609 S  SG  . CYS B 1 129 ? -3.261  13.813  18.636  1.00 27.43 ? 128 CYS C SG  1 
ATOM   2610 N  N   . PRO B 1 130 ? -3.367  11.662  21.808  1.00 27.76 ? 129 PRO C N   1 
ATOM   2611 C  CA  . PRO B 1 130 ? -3.017  12.034  23.185  1.00 28.59 ? 129 PRO C CA  1 
ATOM   2612 C  C   . PRO B 1 130 ? -2.499  13.470  23.308  1.00 29.03 ? 129 PRO C C   1 
ATOM   2613 O  O   . PRO B 1 130 ? -2.749  14.127  24.318  1.00 29.45 ? 129 PRO C O   1 
ATOM   2614 C  CB  . PRO B 1 130 ? -1.925  11.022  23.559  1.00 28.46 ? 129 PRO C CB  1 
ATOM   2615 C  CG  . PRO B 1 130 ? -1.335  10.597  22.270  1.00 28.35 ? 129 PRO C CG  1 
ATOM   2616 C  CD  . PRO B 1 130 ? -2.446  10.647  21.257  1.00 28.10 ? 129 PRO C CD  1 
ATOM   2617 N  N   . LYS B 1 131 ? -1.804  13.948  22.277  1.00 29.62 ? 130 LYS C N   1 
ATOM   2618 C  CA  . LYS B 1 131 ? -1.194  15.277  22.289  1.00 29.96 ? 130 LYS C CA  1 
ATOM   2619 C  C   . LYS B 1 131 ? -2.235  16.370  22.064  1.00 29.59 ? 130 LYS C C   1 
ATOM   2620 O  O   . LYS B 1 131 ? -2.278  17.360  22.800  1.00 29.64 ? 130 LYS C O   1 
ATOM   2621 C  CB  . LYS B 1 131 ? -0.095  15.367  21.223  1.00 30.44 ? 130 LYS C CB  1 
ATOM   2622 C  CG  . LYS B 1 131 ? 1.084   16.259  21.620  1.00 31.71 ? 130 LYS C CG  1 
ATOM   2623 C  CD  . LYS B 1 131 ? 2.178   15.465  22.345  1.00 33.02 ? 130 LYS C CD  1 
ATOM   2624 C  CE  . LYS B 1 131 ? 2.966   14.586  21.380  1.00 33.92 ? 130 LYS C CE  1 
ATOM   2625 N  NZ  . LYS B 1 131 ? 4.028   13.784  22.052  1.00 34.81 ? 130 LYS C NZ  1 
ATOM   2626 N  N   . GLY B 1 132 ? -3.072  16.179  21.048  1.00 29.14 ? 131 GLY C N   1 
ATOM   2627 C  CA  . GLY B 1 132 ? -4.139  17.121  20.725  1.00 28.62 ? 131 GLY C CA  1 
ATOM   2628 C  C   . GLY B 1 132 ? -5.360  17.001  21.618  1.00 28.15 ? 131 GLY C C   1 
ATOM   2629 O  O   . GLY B 1 132 ? -6.220  17.888  21.615  1.00 28.28 ? 131 GLY C O   1 
ATOM   2630 N  N   . LYS B 1 133 ? -5.430  15.907  22.383  1.00 27.51 ? 132 LYS C N   1 
ATOM   2631 C  CA  . LYS B 1 133 ? -6.584  15.595  23.244  1.00 26.91 ? 132 LYS C CA  1 
ATOM   2632 C  C   . LYS B 1 133 ? -7.904  15.608  22.456  1.00 26.26 ? 132 LYS C C   1 
ATOM   2633 O  O   . LYS B 1 133 ? -8.921  16.116  22.927  1.00 25.94 ? 132 LYS C O   1 
ATOM   2634 C  CB  . LYS B 1 133 ? -6.639  16.527  24.466  1.00 27.00 ? 132 LYS C CB  1 
ATOM   2635 C  CG  . LYS B 1 133 ? -5.591  16.216  25.540  1.00 26.99 ? 132 LYS C CG  1 
ATOM   2636 C  CD  . LYS B 1 133 ? -5.422  17.363  26.541  1.00 27.41 ? 132 LYS C CD  1 
ATOM   2637 C  CE  . LYS B 1 133 ? -4.534  18.470  25.977  1.00 27.94 ? 132 LYS C CE  1 
ATOM   2638 N  NZ  . LYS B 1 133 ? -4.079  19.423  27.022  1.00 28.63 ? 132 LYS C NZ  1 
ATOM   2639 N  N   . ILE B 1 134 ? -7.833  15.053  21.229  1.00 25.29 ? 133 ILE C N   1 
ATOM   2640 C  CA  . ILE B 1 134 ? -8.974  15.057  20.306  1.00 24.83 ? 133 ILE C CA  1 
ATOM   2641 C  C   . ILE B 1 134 ? -9.243  13.663  19.690  1.00 23.89 ? 133 ILE C C   1 
ATOM   2642 O  O   . ILE B 1 134 ? -8.314  12.861  19.536  1.00 23.67 ? 133 ILE C O   1 
ATOM   2643 C  CB  . ILE B 1 134 ? -8.693  16.096  19.164  1.00 24.97 ? 133 ILE C CB  1 
ATOM   2644 C  CG1 . ILE B 1 134 ? -9.818  16.112  18.121  1.00 25.54 ? 133 ILE C CG1 1 
ATOM   2645 C  CG2 . ILE B 1 134 ? -7.364  15.801  18.490  1.00 25.18 ? 133 ILE C CG2 1 
ATOM   2646 C  CD1 . ILE B 1 134 ? -9.783  17.324  17.219  1.00 25.56 ? 133 ILE C CD1 1 
ATOM   2647 N  N   . LEU B 1 135 ? -10.508 13.411  19.344  1.00 22.82 ? 134 LEU C N   1 
ATOM   2648 C  CA  . LEU B 1 135 ? -10.879 12.136  18.716  1.00 21.83 ? 134 LEU C CA  1 
ATOM   2649 C  C   . LEU B 1 135 ? -10.745 12.262  17.200  1.00 21.36 ? 134 LEU C C   1 
ATOM   2650 O  O   . LEU B 1 135 ? -11.182 13.252  16.609  1.00 21.16 ? 134 LEU C O   1 
ATOM   2651 C  CB  . LEU B 1 135 ? -12.307 11.720  19.072  1.00 21.62 ? 134 LEU C CB  1 
ATOM   2652 C  CG  . LEU B 1 135 ? -12.579 11.217  20.490  1.00 20.68 ? 134 LEU C CG  1 
ATOM   2653 C  CD1 . LEU B 1 135 ? -14.027 10.806  20.645  1.00 19.73 ? 134 LEU C CD1 1 
ATOM   2654 C  CD2 . LEU B 1 135 ? -11.656 10.048  20.839  1.00 19.36 ? 134 LEU C CD2 1 
ATOM   2655 N  N   . LYS B 1 136 ? -10.153 11.249  16.572  1.00 20.72 ? 135 LYS C N   1 
ATOM   2656 C  CA  . LYS B 1 136 ? -9.929  11.287  15.138  1.00 20.66 ? 135 LYS C CA  1 
ATOM   2657 C  C   . LYS B 1 136 ? -10.323 10.017  14.428  1.00 20.08 ? 135 LYS C C   1 
ATOM   2658 O  O   . LYS B 1 136 ? -10.226 8.923   14.986  1.00 20.00 ? 135 LYS C O   1 
ATOM   2659 C  CB  . LYS B 1 136 ? -8.431  11.533  14.842  1.00 21.00 ? 135 LYS C CB  1 
ATOM   2660 C  CG  . LYS B 1 136 ? -7.918  12.909  15.250  1.00 23.07 ? 135 LYS C CG  1 
ATOM   2661 C  CD  . LYS B 1 136 ? -6.424  13.051  15.009  1.00 25.65 ? 135 LYS C CD  1 
ATOM   2662 C  CE  . LYS B 1 136 ? -5.999  14.502  15.114  1.00 27.82 ? 135 LYS C CE  1 
ATOM   2663 N  NZ  . LYS B 1 136 ? -4.523  14.623  15.260  1.00 30.23 ? 135 LYS C NZ  1 
ATOM   2664 N  N   . VAL B 1 137 ? -10.755 10.181  13.160  1.00 19.33 ? 136 VAL C N   1 
ATOM   2665 C  CA  . VAL B 1 137 ? -11.027 9.059   12.282  1.00 18.23 ? 136 VAL C CA  1 
ATOM   2666 C  C   . VAL B 1 137 ? -9.800  8.933   11.407  1.00 17.61 ? 136 VAL C C   1 
ATOM   2667 O  O   . VAL B 1 137 ? -9.312  9.899   10.832  1.00 16.87 ? 136 VAL C O   1 
ATOM   2668 C  CB  . VAL B 1 137 ? -12.282 9.276   11.382  1.00 18.39 ? 136 VAL C CB  1 
ATOM   2669 C  CG1 . VAL B 1 137 ? -12.259 8.320   10.212  1.00 18.32 ? 136 VAL C CG1 1 
ATOM   2670 C  CG2 . VAL B 1 137 ? -13.552 9.099   12.202  1.00 18.46 ? 136 VAL C CG2 1 
ATOM   2671 N  N   . ALA B 1 138 ? -9.288  7.716   11.295  1.00 16.90 ? 137 ALA C N   1 
ATOM   2672 C  CA  . ALA B 1 138 ? -8.097  7.443   10.487  1.00 16.54 ? 137 ALA C CA  1 
ATOM   2673 C  C   . ALA B 1 138 ? -8.266  6.095   9.792   1.00 16.56 ? 137 ALA C C   1 
ATOM   2674 O  O   . ALA B 1 138 ? -9.059  5.255   10.213  1.00 17.21 ? 137 ALA C O   1 
ATOM   2675 C  CB  . ALA B 1 138 ? -6.837  7.438   11.332  1.00 16.72 ? 137 ALA C CB  1 
ATOM   2676 N  N   . THR B 1 139 ? -7.531  5.902   8.710   1.00 16.07 ? 138 THR C N   1 
ATOM   2677 C  CA  . THR B 1 139 ? -7.468  4.593   8.080   1.00 15.91 ? 138 THR C CA  1 
ATOM   2678 C  C   . THR B 1 139 ? -6.015  4.158   7.997   1.00 15.94 ? 138 THR C C   1 
ATOM   2679 O  O   . THR B 1 139 ? -5.108  5.004   7.994   1.00 16.03 ? 138 THR C O   1 
ATOM   2680 C  CB  . THR B 1 139 ? -8.102  4.579   6.682   1.00 16.17 ? 138 THR C CB  1 
ATOM   2681 O  OG1 . THR B 1 139 ? -7.362  5.438   5.805   1.00 17.74 ? 138 THR C OG1 1 
ATOM   2682 C  CG2 . THR B 1 139 ? -9.564  5.024   6.755   1.00 15.01 ? 138 THR C CG2 1 
ATOM   2683 N  N   . CYS B 1 140 ? -5.811  2.842   7.955   1.00 15.36 ? 139 CYS C N   1 
ATOM   2684 C  CA  . CYS B 1 140 ? -4.479  2.235   7.870   1.00 15.65 ? 139 CYS C CA  1 
ATOM   2685 C  C   . CYS B 1 140 ? -4.471  1.229   6.728   1.00 15.54 ? 139 CYS C C   1 
ATOM   2686 O  O   . CYS B 1 140 ? -5.463  0.532   6.501   1.00 15.71 ? 139 CYS C O   1 
ATOM   2687 C  CB  . CYS B 1 140 ? -4.116  1.511   9.159   1.00 15.93 ? 139 CYS C CB  1 
ATOM   2688 S  SG  . CYS B 1 140 ? -3.979  2.573   10.593  1.00 17.86 ? 139 CYS C SG  1 
ATOM   2689 N  N   . ALA B 1 141 ? -3.352  1.160   6.022   1.00 15.12 ? 140 ALA C N   1 
ATOM   2690 C  CA  . ALA B 1 141 ? -3.208  0.240   4.907   1.00 14.84 ? 140 ALA C CA  1 
ATOM   2691 C  C   . ALA B 1 141 ? -2.739  -1.112  5.397   1.00 14.75 ? 140 ALA C C   1 
ATOM   2692 O  O   . ALA B 1 141 ? -1.933  -1.199  6.330   1.00 14.03 ? 140 ALA C O   1 
ATOM   2693 C  CB  . ALA B 1 141 ? -2.226  0.784   3.899   1.00 15.65 ? 140 ALA C CB  1 
ATOM   2694 N  N   . ASN B 1 142 ? -3.241  -2.160  4.747   1.00 14.27 ? 141 ASN C N   1 
ATOM   2695 C  CA  . ASN B 1 142 ? -2.810  -3.528  5.024   1.00 15.12 ? 141 ASN C CA  1 
ATOM   2696 C  C   . ASN B 1 142 ? -2.892  -3.791  6.521   1.00 14.78 ? 141 ASN C C   1 
ATOM   2697 O  O   . ASN B 1 142 ? -3.984  -3.645  7.093   1.00 14.02 ? 141 ASN C O   1 
ATOM   2698 C  CB  . ASN B 1 142 ? -1.421  -3.760  4.411   1.00 15.42 ? 141 ASN C CB  1 
ATOM   2699 C  CG  . ASN B 1 142 ? -1.441  -3.555  2.911   1.00 18.63 ? 141 ASN C CG  1 
ATOM   2700 O  OD1 . ASN B 1 142 ? -2.427  -3.891  2.248   1.00 18.00 ? 141 ASN C OD1 1 
ATOM   2701 N  ND2 . ASN B 1 142 ? -0.394  -2.939  2.374   1.00 23.99 ? 141 ASN C ND2 1 
ATOM   2702 N  N   . GLN B 1 143 ? -1.807  -4.221  7.164   1.00 14.42 ? 142 GLN C N   1 
ATOM   2703 C  CA  . GLN B 1 143 ? -1.867  -4.408  8.621   1.00 13.55 ? 142 GLN C CA  1 
ATOM   2704 C  C   . GLN B 1 143 ? -1.121  -3.356  9.420   1.00 13.93 ? 142 GLN C C   1 
ATOM   2705 O  O   . GLN B 1 143 ? -0.837  -3.568  10.592  1.00 14.78 ? 142 GLN C O   1 
ATOM   2706 C  CB  . GLN B 1 143 ? -1.366  -5.807  9.053   1.00 14.89 ? 142 GLN C CB  1 
ATOM   2707 C  CG  . GLN B 1 143 ? -2.137  -7.002  8.489   1.00 13.53 ? 142 GLN C CG  1 
ATOM   2708 C  CD  . GLN B 1 143 ? -3.603  -7.026  8.877   1.00 14.48 ? 142 GLN C CD  1 
ATOM   2709 O  OE1 . GLN B 1 143 ? -4.036  -6.317  9.791   1.00 14.76 ? 142 GLN C OE1 1 
ATOM   2710 N  NE2 . GLN B 1 143 ? -4.372  -7.891  8.208   1.00 12.25 ? 142 GLN C NE2 1 
ATOM   2711 N  N   . ASP B 1 144 ? -0.823  -2.220  8.802   1.00 14.42 ? 143 ASP C N   1 
ATOM   2712 C  CA  . ASP B 1 144 ? -0.157  -1.144  9.523   1.00 15.28 ? 143 ASP C CA  1 
ATOM   2713 C  C   . ASP B 1 144 ? -0.954  -0.849  10.788  1.00 15.11 ? 143 ASP C C   1 
ATOM   2714 O  O   . ASP B 1 144 ? -2.137  -0.500  10.705  1.00 15.33 ? 143 ASP C O   1 
ATOM   2715 C  CB  . ASP B 1 144 ? -0.080  0.108   8.659   1.00 14.63 ? 143 ASP C CB  1 
ATOM   2716 C  CG  . ASP B 1 144 ? 0.761   -0.069  7.420   1.00 16.88 ? 143 ASP C CG  1 
ATOM   2717 O  OD1 . ASP B 1 144 ? 0.760   0.889   6.607   1.00 17.59 ? 143 ASP C OD1 1 
ATOM   2718 O  OD2 . ASP B 1 144 ? 1.412   -1.120  7.238   1.00 16.01 ? 143 ASP C OD2 1 
ATOM   2719 N  N   . PRO B 1 145 ? -0.334  -1.013  11.974  1.00 15.30 ? 144 PRO C N   1 
ATOM   2720 C  CA  . PRO B 1 145 ? -1.103  -0.762  13.198  1.00 14.79 ? 144 PRO C CA  1 
ATOM   2721 C  C   . PRO B 1 145 ? -1.224  0.714   13.551  1.00 15.18 ? 144 PRO C C   1 
ATOM   2722 O  O   . PRO B 1 145 ? -0.279  1.492   13.364  1.00 15.66 ? 144 PRO C O   1 
ATOM   2723 C  CB  . PRO B 1 145 ? -0.304  -1.523  14.271  1.00 15.04 ? 144 PRO C CB  1 
ATOM   2724 C  CG  . PRO B 1 145 ? 1.111   -1.475  13.780  1.00 15.11 ? 144 PRO C CG  1 
ATOM   2725 C  CD  . PRO B 1 145 ? 1.044   -1.477  12.262  1.00 14.71 ? 144 PRO C CD  1 
ATOM   2726 N  N   . LEU B 1 146 ? -2.380  1.093   14.073  1.00 15.27 ? 145 LEU C N   1 
ATOM   2727 C  CA  . LEU B 1 146 ? -2.664  2.518   14.294  1.00 15.27 ? 145 LEU C CA  1 
ATOM   2728 C  C   . LEU B 1 146 ? -1.660  3.287   15.140  1.00 15.68 ? 145 LEU C C   1 
ATOM   2729 O  O   . LEU B 1 146 ? -1.124  4.298   14.684  1.00 15.94 ? 145 LEU C O   1 
ATOM   2730 C  CB  . LEU B 1 146 ? -4.067  2.733   14.849  1.00 15.61 ? 145 LEU C CB  1 
ATOM   2731 C  CG  . LEU B 1 146 ? -4.520  4.200   14.934  1.00 15.02 ? 145 LEU C CG  1 
ATOM   2732 C  CD1 . LEU B 1 146 ? -4.671  4.860   13.558  1.00 16.68 ? 145 LEU C CD1 1 
ATOM   2733 C  CD2 . LEU B 1 146 ? -5.814  4.244   15.679  1.00 16.65 ? 145 LEU C CD2 1 
ATOM   2734 N  N   . GLU B 1 147 ? -1.433  2.813   16.343  1.00 15.95 ? 146 GLU C N   1 
ATOM   2735 C  CA  . GLU B 1 147 ? -0.658  3.568   17.324  1.00 16.95 ? 146 GLU C CA  1 
ATOM   2736 C  C   . GLU B 1 147 ? 0.799   3.665   16.931  1.00 16.99 ? 146 GLU C C   1 
ATOM   2737 O  O   . GLU B 1 147 ? 1.384   4.750   16.987  1.00 17.00 ? 146 GLU C O   1 
ATOM   2738 C  CB  . GLU B 1 147 ? -0.791  2.969   18.727  1.00 16.82 ? 146 GLU C CB  1 
ATOM   2739 C  CG  . GLU B 1 147 ? -0.419  3.955   19.835  1.00 16.85 ? 146 GLU C CG  1 
ATOM   2740 C  CD  . GLU B 1 147 ? -0.713  3.430   21.222  1.00 18.65 ? 146 GLU C CD  1 
ATOM   2741 O  OE1 . GLU B 1 147 ? -1.605  2.568   21.367  1.00 20.53 ? 146 GLU C OE1 1 
ATOM   2742 O  OE2 . GLU B 1 147 ? -0.054  3.902   22.178  1.00 19.84 ? 146 GLU C OE2 1 
ATOM   2743 N  N   . ALA B 1 148 ? 1.373   2.536   16.525  1.00 17.00 ? 147 ALA C N   1 
ATOM   2744 C  CA  . ALA B 1 148 ? 2.779   2.492   16.161  1.00 18.09 ? 147 ALA C CA  1 
ATOM   2745 C  C   . ALA B 1 148 ? 3.060   3.414   14.977  1.00 19.21 ? 147 ALA C C   1 
ATOM   2746 O  O   . ALA B 1 148 ? 4.103   4.073   14.942  1.00 19.74 ? 147 ALA C O   1 
ATOM   2747 C  CB  . ALA B 1 148 ? 3.222   1.056   15.873  1.00 17.76 ? 147 ALA C CB  1 
ATOM   2748 N  N   . THR B 1 149 ? 2.108   3.508   14.045  1.00 19.35 ? 148 THR C N   1 
ATOM   2749 C  CA  . THR B 1 149 ? 2.367   4.231   12.799  1.00 19.74 ? 148 THR C CA  1 
ATOM   2750 C  C   . THR B 1 149 ? 1.878   5.674   12.775  1.00 20.36 ? 148 THR C C   1 
ATOM   2751 O  O   . THR B 1 149 ? 2.324   6.448   11.924  1.00 21.38 ? 148 THR C O   1 
ATOM   2752 C  CB  . THR B 1 149 ? 1.848   3.487   11.541  1.00 20.11 ? 148 THR C CB  1 
ATOM   2753 O  OG1 . THR B 1 149 ? 0.420   3.412   11.569  1.00 19.65 ? 148 THR C OG1 1 
ATOM   2754 C  CG2 . THR B 1 149 ? 2.448   2.089   11.445  1.00 19.80 ? 148 THR C CG2 1 
ATOM   2755 N  N   . THR B 1 150 ? 0.980   6.045   13.693  1.00 19.66 ? 149 THR C N   1 
ATOM   2756 C  CA  . THR B 1 150 ? 0.403   7.400   13.689  1.00 20.08 ? 149 THR C CA  1 
ATOM   2757 C  C   . THR B 1 150 ? 0.449   8.110   15.041  1.00 19.67 ? 149 THR C C   1 
ATOM   2758 O  O   . THR B 1 150 ? 0.266   9.340   15.115  1.00 19.38 ? 149 THR C O   1 
ATOM   2759 C  CB  . THR B 1 150 ? -1.070  7.410   13.217  1.00 19.77 ? 149 THR C CB  1 
ATOM   2760 O  OG1 . THR B 1 150 ? -1.904  6.850   14.239  1.00 19.98 ? 149 THR C OG1 1 
ATOM   2761 C  CG2 . THR B 1 150 ? -1.243  6.641   11.913  1.00 21.57 ? 149 THR C CG2 1 
ATOM   2762 N  N   . GLY B 1 151 ? 0.653   7.343   16.107  1.00 19.51 ? 150 GLY C N   1 
ATOM   2763 C  CA  . GLY B 1 151 ? 0.581   7.886   17.469  1.00 19.82 ? 150 GLY C CA  1 
ATOM   2764 C  C   . GLY B 1 151 ? -0.829  7.900   18.038  1.00 20.00 ? 150 GLY C C   1 
ATOM   2765 O  O   . GLY B 1 151 ? -1.010  8.115   19.243  1.00 19.97 ? 150 GLY C O   1 
ATOM   2766 N  N   . LEU B 1 152 ? -1.832  7.676   17.185  1.00 19.91 ? 151 LEU C N   1 
ATOM   2767 C  CA  . LEU B 1 152 ? -3.230  7.616   17.632  1.00 19.82 ? 151 LEU C CA  1 
ATOM   2768 C  C   . LEU B 1 152 ? -3.499  6.322   18.376  1.00 19.92 ? 151 LEU C C   1 
ATOM   2769 O  O   . LEU B 1 152 ? -3.157  5.241   17.888  1.00 19.81 ? 151 LEU C O   1 
ATOM   2770 C  CB  . LEU B 1 152 ? -4.212  7.725   16.451  1.00 19.66 ? 151 LEU C CB  1 
ATOM   2771 C  CG  . LEU B 1 152 ? -4.401  9.044   15.709  1.00 20.00 ? 151 LEU C CG  1 
ATOM   2772 C  CD1 . LEU B 1 152 ? -5.343  8.874   14.519  1.00 19.98 ? 151 LEU C CD1 1 
ATOM   2773 C  CD2 . LEU B 1 152 ? -4.939  10.126  16.629  1.00 18.91 ? 151 LEU C CD2 1 
ATOM   2774 N  N   . VAL B 1 153 ? -4.114  6.439   19.552  1.00 19.84 ? 152 VAL C N   1 
ATOM   2775 C  CA  . VAL B 1 153 ? -4.509  5.270   20.331  1.00 19.95 ? 152 VAL C CA  1 
ATOM   2776 C  C   . VAL B 1 153 ? -5.827  4.747   19.766  1.00 19.19 ? 152 VAL C C   1 
ATOM   2777 O  O   . VAL B 1 153 ? -6.807  5.492   19.721  1.00 18.95 ? 152 VAL C O   1 
ATOM   2778 C  CB  . VAL B 1 153 ? -4.678  5.598   21.842  1.00 20.21 ? 152 VAL C CB  1 
ATOM   2779 C  CG1 . VAL B 1 153 ? -4.873  4.322   22.635  1.00 20.67 ? 152 VAL C CG1 1 
ATOM   2780 C  CG2 . VAL B 1 153 ? -3.468  6.366   22.375  1.00 20.79 ? 152 VAL C CG2 1 
ATOM   2781 N  N   . PRO B 1 154 ? -5.853  3.469   19.326  1.00 18.49 ? 153 PRO C N   1 
ATOM   2782 C  CA  . PRO B 1 154 ? -7.060  2.878   18.746  1.00 17.81 ? 153 PRO C CA  1 
ATOM   2783 C  C   . PRO B 1 154 ? -8.159  2.633   19.772  1.00 17.58 ? 153 PRO C C   1 
ATOM   2784 O  O   . PRO B 1 154 ? -7.896  2.089   20.854  1.00 17.29 ? 153 PRO C O   1 
ATOM   2785 C  CB  . PRO B 1 154 ? -6.572  1.543   18.195  1.00 18.05 ? 153 PRO C CB  1 
ATOM   2786 C  CG  . PRO B 1 154 ? -5.384  1.201   19.011  1.00 17.99 ? 153 PRO C CG  1 
ATOM   2787 C  CD  . PRO B 1 154 ? -4.732  2.510   19.357  1.00 18.53 ? 153 PRO C CD  1 
ATOM   2788 N  N   . LEU B 1 155 ? -9.378  3.032   19.421  1.00 16.83 ? 154 LEU C N   1 
ATOM   2789 C  CA  . LEU B 1 155 ? -10.547 2.795   20.260  1.00 16.51 ? 154 LEU C CA  1 
ATOM   2790 C  C   . LEU B 1 155 ? -11.526 1.804   19.633  1.00 16.11 ? 154 LEU C C   1 
ATOM   2791 O  O   . LEU B 1 155 ? -12.026 0.917   20.315  1.00 16.32 ? 154 LEU C O   1 
ATOM   2792 C  CB  . LEU B 1 155 ? -11.264 4.114   20.593  1.00 16.43 ? 154 LEU C CB  1 
ATOM   2793 C  CG  . LEU B 1 155 ? -10.429 5.275   21.155  1.00 16.41 ? 154 LEU C CG  1 
ATOM   2794 C  CD1 . LEU B 1 155 ? -11.325 6.473   21.390  1.00 15.72 ? 154 LEU C CD1 1 
ATOM   2795 C  CD2 . LEU B 1 155 ? -9.680  4.900   22.441  1.00 14.85 ? 154 LEU C CD2 1 
ATOM   2796 N  N   . PHE B 1 156 ? -11.804 1.966   18.342  1.00 15.82 ? 155 PHE C N   1 
ATOM   2797 C  CA  . PHE B 1 156 ? -12.709 1.078   17.625  1.00 15.07 ? 155 PHE C CA  1 
ATOM   2798 C  C   . PHE B 1 156 ? -12.235 0.937   16.192  1.00 15.17 ? 155 PHE C C   1 
ATOM   2799 O  O   . PHE B 1 156 ? -12.009 1.932   15.510  1.00 15.30 ? 155 PHE C O   1 
ATOM   2800 C  CB  . PHE B 1 156 ? -14.140 1.626   17.636  1.00 15.39 ? 155 PHE C CB  1 
ATOM   2801 C  CG  . PHE B 1 156 ? -15.127 0.749   16.913  1.00 15.04 ? 155 PHE C CG  1 
ATOM   2802 C  CD1 . PHE B 1 156 ? -15.484 -0.497  17.435  1.00 15.28 ? 155 PHE C CD1 1 
ATOM   2803 C  CD2 . PHE B 1 156 ? -15.703 1.165   15.717  1.00 14.37 ? 155 PHE C CD2 1 
ATOM   2804 C  CE1 . PHE B 1 156 ? -16.393 -1.314  16.766  1.00 14.84 ? 155 PHE C CE1 1 
ATOM   2805 C  CE2 . PHE B 1 156 ? -16.621 0.359   15.052  1.00 14.57 ? 155 PHE C CE2 1 
ATOM   2806 C  CZ  . PHE B 1 156 ? -16.960 -0.880  15.569  1.00 14.61 ? 155 PHE C CZ  1 
ATOM   2807 N  N   . GLY B 1 157 ? -12.086 -0.303  15.741  1.00 15.07 ? 156 GLY C N   1 
ATOM   2808 C  CA  . GLY B 1 157 ? -11.601 -0.569  14.383  1.00 14.65 ? 156 GLY C CA  1 
ATOM   2809 C  C   . GLY B 1 157 ? -12.551 -1.422  13.578  1.00 14.89 ? 156 GLY C C   1 
ATOM   2810 O  O   . GLY B 1 157 ? -13.288 -2.249  14.128  1.00 14.36 ? 156 GLY C O   1 
ATOM   2811 N  N   . ILE B 1 158 ? -12.500 -1.224  12.267  1.00 14.49 ? 157 ILE C N   1 
ATOM   2812 C  CA  . ILE B 1 158 ? -13.309 -1.964  11.310  1.00 14.64 ? 157 ILE C CA  1 
ATOM   2813 C  C   . ILE B 1 158 ? -12.351 -2.519  10.259  1.00 15.31 ? 157 ILE C C   1 
ATOM   2814 O  O   . ILE B 1 158 ? -11.740 -1.764  9.495   1.00 15.18 ? 157 ILE C O   1 
ATOM   2815 C  CB  . ILE B 1 158 ? -14.381 -1.085  10.606  1.00 14.64 ? 157 ILE C CB  1 
ATOM   2816 C  CG1 . ILE B 1 158 ? -15.245 -0.374  11.640  1.00 13.76 ? 157 ILE C CG1 1 
ATOM   2817 C  CG2 . ILE B 1 158 ? -15.228 -1.930  9.672   1.00 13.65 ? 157 ILE C CG2 1 
ATOM   2818 C  CD1 . ILE B 1 158 ? -15.861 0.903   11.122  1.00 14.59 ? 157 ILE C CD1 1 
ATOM   2819 N  N   . ASP B 1 159 ? -12.212 -3.843  10.247  1.00 15.25 ? 158 ASP C N   1 
ATOM   2820 C  CA  . ASP B 1 159 ? -11.374 -4.549  9.301   1.00 15.26 ? 158 ASP C CA  1 
ATOM   2821 C  C   . ASP B 1 159 ? -12.025 -4.604  7.936   1.00 15.09 ? 158 ASP C C   1 
ATOM   2822 O  O   . ASP B 1 159 ? -13.075 -5.203  7.784   1.00 15.29 ? 158 ASP C O   1 
ATOM   2823 C  CB  . ASP B 1 159 ? -11.098 -5.968  9.845   1.00 15.75 ? 158 ASP C CB  1 
ATOM   2824 C  CG  . ASP B 1 159 ? -10.077 -6.760  9.046   1.00 15.16 ? 158 ASP C CG  1 
ATOM   2825 O  OD1 . ASP B 1 159 ? -9.818  -7.923  9.421   1.00 15.32 ? 158 ASP C OD1 1 
ATOM   2826 O  OD2 . ASP B 1 159 ? -9.540  -6.237  8.050   1.00 15.64 ? 158 ASP C OD2 1 
ATOM   2827 N  N   . VAL B 1 160 ? -11.386 -3.961  6.915   1.00 14.68 ? 159 VAL C N   1 
ATOM   2828 C  CA  . VAL B 1 160 ? -12.020 -4.065  5.562   1.00 14.28 ? 159 VAL C CA  1 
ATOM   2829 C  C   . VAL B 1 160 ? -11.234 -4.889  4.541   1.00 14.07 ? 159 VAL C C   1 
ATOM   2830 O  O   . VAL B 1 160 ? -11.453 -4.767  3.331   1.00 13.57 ? 159 VAL C O   1 
ATOM   2831 C  CB  . VAL B 1 160 ? -12.501 -2.702  4.986   1.00 15.21 ? 159 VAL C CB  1 
ATOM   2832 C  CG1 . VAL B 1 160 ? -13.792 -2.290  5.667   1.00 15.24 ? 159 VAL C CG1 1 
ATOM   2833 C  CG2 . VAL B 1 160 ? -11.416 -1.640  5.140   1.00 15.74 ? 159 VAL C CG2 1 
ATOM   2834 N  N   . TRP B 1 161 ? -10.386 -5.743  5.039   1.00 13.33 ? 160 TRP C N   1 
ATOM   2835 C  CA  . TRP B 1 161 ? -9.724  -6.715  4.229   1.00 13.23 ? 160 TRP C CA  1 
ATOM   2836 C  C   . TRP B 1 161 ? -10.879 -7.503  3.700   1.00 13.13 ? 160 TRP C C   1 
ATOM   2837 O  O   . TRP B 1 161 ? -11.855 -7.708  4.410   1.00 12.33 ? 160 TRP C O   1 
ATOM   2838 C  CB  . TRP B 1 161 ? -8.815  -7.655  5.014   1.00 13.14 ? 160 TRP C CB  1 
ATOM   2839 C  CG  . TRP B 1 161 ? -7.436  -7.122  5.279   1.00 13.49 ? 160 TRP C CG  1 
ATOM   2840 C  CD1 . TRP B 1 161 ? -7.097  -5.989  5.934   1.00 14.34 ? 160 TRP C CD1 1 
ATOM   2841 C  CD2 . TRP B 1 161 ? -6.210  -7.736  4.846   1.00 14.18 ? 160 TRP C CD2 1 
ATOM   2842 N  NE1 . TRP B 1 161 ? -5.728  -5.840  5.952   1.00 14.05 ? 160 TRP C NE1 1 
ATOM   2843 C  CE2 . TRP B 1 161 ? -5.159  -6.898  5.290   1.00 13.39 ? 160 TRP C CE2 1 
ATOM   2844 C  CE3 . TRP B 1 161 ? -5.897  -8.894  4.108   1.00 13.89 ? 160 TRP C CE3 1 
ATOM   2845 C  CZ2 . TRP B 1 161 ? -3.803  -7.192  5.049   1.00 14.74 ? 160 TRP C CZ2 1 
ATOM   2846 C  CZ3 . TRP B 1 161 ? -4.549  -9.195  3.875   1.00 13.95 ? 160 TRP C CZ3 1 
ATOM   2847 C  CH2 . TRP B 1 161 ? -3.520  -8.350  4.358   1.00 14.14 ? 160 TRP C CH2 1 
ATOM   2848 N  N   . GLU B 1 162 ? -10.820 -7.981  2.478   1.00 13.71 ? 161 GLU C N   1 
ATOM   2849 C  CA  . GLU B 1 162 ? -11.927 -8.740  1.895   1.00 13.39 ? 161 GLU C CA  1 
ATOM   2850 C  C   . GLU B 1 162 ? -12.230 -10.011 2.692   1.00 13.74 ? 161 GLU C C   1 
ATOM   2851 O  O   . GLU B 1 162 ? -13.347 -10.514 2.671   1.00 13.72 ? 161 GLU C O   1 
ATOM   2852 C  CB  . GLU B 1 162 ? -11.652 -9.020  0.414   1.00 13.82 ? 161 GLU C CB  1 
ATOM   2853 C  CG  . GLU B 1 162 ? -11.848 -7.770  -0.450  1.00 12.87 ? 161 GLU C CG  1 
ATOM   2854 C  CD  . GLU B 1 162 ? -11.511 -7.927  -1.921  1.00 13.46 ? 161 GLU C CD  1 
ATOM   2855 O  OE1 . GLU B 1 162 ? -10.497 -8.577  -2.241  1.00 12.18 ? 161 GLU C OE1 1 
ATOM   2856 O  OE2 . GLU B 1 162 ? -12.252 -7.381  -2.757  1.00 12.84 ? 161 GLU C OE2 1 
ATOM   2857 N  N   . HIS B 1 163 ? -11.217 -10.538 3.426   1.00 13.54 ? 162 HIS C N   1 
ATOM   2858 C  CA  . HIS B 1 163 ? -11.473 -11.775 4.178   1.00 13.34 ? 162 HIS C CA  1 
ATOM   2859 C  C   . HIS B 1 163 ? -12.416 -11.499 5.360   1.00 13.66 ? 162 HIS C C   1 
ATOM   2860 O  O   . HIS B 1 163 ? -13.001 -12.430 5.921   1.00 13.95 ? 162 HIS C O   1 
ATOM   2861 C  CB  . HIS B 1 163 ? -10.174 -12.436 4.591   1.00 12.97 ? 162 HIS C CB  1 
ATOM   2862 C  CG  . HIS B 1 163 ? -9.359  -11.676 5.639   1.00 13.03 ? 162 HIS C CG  1 
ATOM   2863 N  ND1 . HIS B 1 163 ? -8.055  -11.276 5.392   1.00 13.68 ? 162 HIS C ND1 1 
ATOM   2864 C  CD2 . HIS B 1 163 ? -9.637  -11.253 6.896   1.00 13.94 ? 162 HIS C CD2 1 
ATOM   2865 C  CE1 . HIS B 1 163 ? -7.578  -10.655 6.439   1.00 13.77 ? 162 HIS C CE1 1 
ATOM   2866 N  NE2 . HIS B 1 163 ? -8.514  -10.619 7.374   1.00 13.38 ? 162 HIS C NE2 1 
ATOM   2867 N  N   . ALA B 1 164 ? -12.561 -10.227 5.730   1.00 13.82 ? 163 ALA C N   1 
ATOM   2868 C  CA  . ALA B 1 164 ? -13.389 -9.862  6.878   1.00 13.37 ? 163 ALA C CA  1 
ATOM   2869 C  C   . ALA B 1 164 ? -14.881 -9.877  6.565   1.00 13.73 ? 163 ALA C C   1 
ATOM   2870 O  O   . ALA B 1 164 ? -15.703 -9.830  7.485   1.00 12.69 ? 163 ALA C O   1 
ATOM   2871 C  CB  . ALA B 1 164 ? -12.981 -8.479  7.394   1.00 14.36 ? 163 ALA C CB  1 
ATOM   2872 N  N   . TYR B 1 165 ? -15.234 -9.902  5.281   1.00 13.05 ? 164 TYR C N   1 
ATOM   2873 C  CA  . TYR B 1 165 ? -16.647 -9.875  4.925   1.00 13.19 ? 164 TYR C CA  1 
ATOM   2874 C  C   . TYR B 1 165 ? -17.086 -10.605 3.624   1.00 13.37 ? 164 TYR C C   1 
ATOM   2875 O  O   . TYR B 1 165 ? -18.294 -10.799 3.412   1.00 13.83 ? 164 TYR C O   1 
ATOM   2876 C  CB  . TYR B 1 165 ? -17.050 -8.399  4.734   1.00 13.38 ? 164 TYR C CB  1 
ATOM   2877 C  CG  . TYR B 1 165 ? -16.311 -7.617  3.644   1.00 13.54 ? 164 TYR C CG  1 
ATOM   2878 C  CD1 . TYR B 1 165 ? -15.236 -6.777  3.949   1.00 14.25 ? 164 TYR C CD1 1 
ATOM   2879 C  CD2 . TYR B 1 165 ? -16.703 -7.724  2.304   1.00 14.18 ? 164 TYR C CD2 1 
ATOM   2880 C  CE1 . TYR B 1 165 ? -14.561 -6.078  2.949   1.00 13.97 ? 164 TYR C CE1 1 
ATOM   2881 C  CE2 . TYR B 1 165 ? -16.027 -7.024  1.297   1.00 14.84 ? 164 TYR C CE2 1 
ATOM   2882 C  CZ  . TYR B 1 165 ? -14.962 -6.210  1.628   1.00 14.33 ? 164 TYR C CZ  1 
ATOM   2883 O  OH  . TYR B 1 165 ? -14.302 -5.528  0.632   1.00 14.11 ? 164 TYR C OH  1 
ATOM   2884 N  N   . TYR B 1 166 ? -16.134 -11.009 2.798   1.00 13.80 ? 165 TYR C N   1 
ATOM   2885 C  CA  . TYR B 1 166 ? -16.501 -11.539 1.440   1.00 13.82 ? 165 TYR C CA  1 
ATOM   2886 C  C   . TYR B 1 166 ? -17.388 -12.769 1.418   1.00 13.71 ? 165 TYR C C   1 
ATOM   2887 O  O   . TYR B 1 166 ? -18.363 -12.790 0.670   1.00 13.58 ? 165 TYR C O   1 
ATOM   2888 C  CB  . TYR B 1 166 ? -15.220 -11.751 0.606   1.00 14.18 ? 165 TYR C CB  1 
ATOM   2889 C  CG  . TYR B 1 166 ? -15.482 -11.495 -0.866  1.00 14.14 ? 165 TYR C CG  1 
ATOM   2890 C  CD1 . TYR B 1 166 ? -15.327 -10.221 -1.439  1.00 13.09 ? 165 TYR C CD1 1 
ATOM   2891 C  CD2 . TYR B 1 166 ? -15.920 -12.525 -1.710  1.00 14.39 ? 165 TYR C CD2 1 
ATOM   2892 C  CE1 . TYR B 1 166 ? -15.593 -10.001 -2.770  1.00 13.91 ? 165 TYR C CE1 1 
ATOM   2893 C  CE2 . TYR B 1 166 ? -16.185 -12.292 -3.056  1.00 14.11 ? 165 TYR C CE2 1 
ATOM   2894 C  CZ  . TYR B 1 166 ? -16.013 -11.015 -3.583  1.00 13.94 ? 165 TYR C CZ  1 
ATOM   2895 O  OH  . TYR B 1 166 ? -16.268 -10.785 -4.913  1.00 13.82 ? 165 TYR C OH  1 
ATOM   2896 N  N   . LEU B 1 167 ? -17.082 -13.790 2.213   1.00 13.73 ? 166 LEU C N   1 
ATOM   2897 C  CA  . LEU B 1 167 ? -17.905 -14.994 2.224   1.00 13.51 ? 166 LEU C CA  1 
ATOM   2898 C  C   . LEU B 1 167 ? -19.383 -14.665 2.433   1.00 13.75 ? 166 LEU C C   1 
ATOM   2899 O  O   . LEU B 1 167 ? -20.257 -15.304 1.838   1.00 13.17 ? 166 LEU C O   1 
ATOM   2900 C  CB  . LEU B 1 167 ? -17.412 -15.997 3.277   1.00 13.33 ? 166 LEU C CB  1 
ATOM   2901 C  CG  . LEU B 1 167 ? -16.064 -16.678 3.012   1.00 13.47 ? 166 LEU C CG  1 
ATOM   2902 C  CD1 . LEU B 1 167 ? -15.626 -17.487 4.213   1.00 13.40 ? 166 LEU C CD1 1 
ATOM   2903 C  CD2 . LEU B 1 167 ? -16.140 -17.546 1.775   1.00 14.00 ? 166 LEU C CD2 1 
ATOM   2904 N  N   . GLN B 1 168 ? -19.663 -13.660 3.261   1.00 14.06 ? 167 GLN C N   1 
ATOM   2905 C  CA  . GLN B 1 168 ? -21.053 -13.281 3.541   1.00 14.75 ? 167 GLN C CA  1 
ATOM   2906 C  C   . GLN B 1 168 ? -21.580 -12.207 2.595   1.00 14.67 ? 167 GLN C C   1 
ATOM   2907 O  O   . GLN B 1 168 ? -22.622 -12.398 1.932   1.00 14.34 ? 167 GLN C O   1 
ATOM   2908 C  CB  . GLN B 1 168 ? -21.214 -12.832 5.002   1.00 14.62 ? 167 GLN C CB  1 
ATOM   2909 C  CG  . GLN B 1 168 ? -22.604 -12.292 5.343   1.00 15.45 ? 167 GLN C CG  1 
ATOM   2910 C  CD  . GLN B 1 168 ? -22.816 -12.070 6.837   1.00 15.49 ? 167 GLN C CD  1 
ATOM   2911 O  OE1 . GLN B 1 168 ? -23.752 -11.380 7.244   1.00 18.09 ? 167 GLN C OE1 1 
ATOM   2912 N  NE2 . GLN B 1 168 ? -21.963 -12.657 7.650   1.00 14.14 ? 167 GLN C NE2 1 
ATOM   2913 N  N   . TYR B 1 169 ? -20.854 -11.092 2.538   1.00 14.42 ? 168 TYR C N   1 
ATOM   2914 C  CA  . TYR B 1 169 ? -21.295 -9.874  1.862   1.00 14.67 ? 168 TYR C CA  1 
ATOM   2915 C  C   . TYR B 1 169 ? -20.855 -9.763  0.404   1.00 14.41 ? 168 TYR C C   1 
ATOM   2916 O  O   . TYR B 1 169 ? -21.325 -8.882  -0.317  1.00 14.75 ? 168 TYR C O   1 
ATOM   2917 C  CB  . TYR B 1 169 ? -20.810 -8.648  2.644   1.00 14.67 ? 168 TYR C CB  1 
ATOM   2918 C  CG  . TYR B 1 169 ? -21.456 -8.483  4.003   1.00 14.69 ? 168 TYR C CG  1 
ATOM   2919 C  CD1 . TYR B 1 169 ? -20.902 -9.073  5.137   1.00 14.67 ? 168 TYR C CD1 1 
ATOM   2920 C  CD2 . TYR B 1 169 ? -22.624 -7.730  4.152   1.00 15.21 ? 168 TYR C CD2 1 
ATOM   2921 C  CE1 . TYR B 1 169 ? -21.502 -8.920  6.392   1.00 15.20 ? 168 TYR C CE1 1 
ATOM   2922 C  CE2 . TYR B 1 169 ? -23.227 -7.569  5.394   1.00 15.45 ? 168 TYR C CE2 1 
ATOM   2923 C  CZ  . TYR B 1 169 ? -22.662 -8.166  6.510   1.00 14.63 ? 168 TYR C CZ  1 
ATOM   2924 O  OH  . TYR B 1 169 ? -23.253 -8.011  7.743   1.00 15.23 ? 168 TYR C OH  1 
ATOM   2925 N  N   . LYS B 1 170 ? -19.979 -10.672 -0.024  1.00 14.68 ? 169 LYS C N   1 
ATOM   2926 C  CA  . LYS B 1 170 ? -19.347 -10.623 -1.347  1.00 15.15 ? 169 LYS C CA  1 
ATOM   2927 C  C   . LYS B 1 170 ? -18.711 -9.245  -1.555  1.00 15.12 ? 169 LYS C C   1 
ATOM   2928 O  O   . LYS B 1 170 ? -18.040 -8.741  -0.661  1.00 15.36 ? 169 LYS C O   1 
ATOM   2929 C  CB  . LYS B 1 170 ? -20.347 -10.983 -2.467  1.00 15.33 ? 169 LYS C CB  1 
ATOM   2930 C  CG  . LYS B 1 170 ? -20.660 -12.495 -2.633  1.00 16.38 ? 169 LYS C CG  1 
ATOM   2931 C  CD  . LYS B 1 170 ? -21.048 -13.164 -1.328  1.00 16.28 ? 169 LYS C CD  1 
ATOM   2932 C  CE  . LYS B 1 170 ? -21.562 -14.588 -1.524  1.00 17.60 ? 169 LYS C CE  1 
ATOM   2933 N  NZ  . LYS B 1 170 ? -22.953 -14.577 -2.050  1.00 16.94 ? 169 LYS C NZ  1 
ATOM   2934 N  N   . ASN B 1 171 ? -18.958 -8.623  -2.710  1.00 15.03 ? 170 ASN C N   1 
ATOM   2935 C  CA  . ASN B 1 171 ? -18.364 -7.327  -3.048  1.00 14.93 ? 170 ASN C CA  1 
ATOM   2936 C  C   . ASN B 1 171 ? -18.982 -6.132  -2.305  1.00 15.04 ? 170 ASN C C   1 
ATOM   2937 O  O   . ASN B 1 171 ? -18.449 -5.010  -2.364  1.00 14.72 ? 170 ASN C O   1 
ATOM   2938 C  CB  . ASN B 1 171 ? -18.515 -7.097  -4.543  1.00 15.20 ? 170 ASN C CB  1 
ATOM   2939 C  CG  . ASN B 1 171 ? -19.957 -7.030  -4.948  1.00 14.65 ? 170 ASN C CG  1 
ATOM   2940 O  OD1 . ASN B 1 171 ? -20.677 -8.037  -4.903  1.00 15.68 ? 170 ASN C OD1 1 
ATOM   2941 N  ND2 . ASN B 1 171 ? -20.412 -5.837  -5.286  1.00 16.69 ? 170 ASN C ND2 1 
ATOM   2942 N  N   . VAL B 1 172 ? -20.109 -6.369  -1.628  1.00 14.71 ? 171 VAL C N   1 
ATOM   2943 C  CA  . VAL B 1 172 ? -20.880 -5.285  -1.010  1.00 14.44 ? 171 VAL C CA  1 
ATOM   2944 C  C   . VAL B 1 172 ? -20.326 -4.884  0.363   1.00 14.28 ? 171 VAL C C   1 
ATOM   2945 O  O   . VAL B 1 172 ? -20.980 -5.047  1.398   1.00 14.35 ? 171 VAL C O   1 
ATOM   2946 C  CB  . VAL B 1 172 ? -22.382 -5.601  -0.931  1.00 14.56 ? 171 VAL C CB  1 
ATOM   2947 C  CG1 . VAL B 1 172 ? -23.161 -4.312  -0.727  1.00 15.05 ? 171 VAL C CG1 1 
ATOM   2948 C  CG2 . VAL B 1 172 ? -22.844 -6.301  -2.199  1.00 14.27 ? 171 VAL C CG2 1 
ATOM   2949 N  N   . ARG B 1 173 ? -19.107 -4.349  0.338   1.00 14.04 ? 172 ARG C N   1 
ATOM   2950 C  CA  . ARG B 1 173 ? -18.414 -3.854  1.531   1.00 13.74 ? 172 ARG C CA  1 
ATOM   2951 C  C   . ARG B 1 173 ? -19.238 -2.857  2.364   1.00 13.63 ? 172 ARG C C   1 
ATOM   2952 O  O   . ARG B 1 173 ? -19.233 -2.952  3.596   1.00 13.48 ? 172 ARG C O   1 
ATOM   2953 C  CB  . ARG B 1 173 ? -17.041 -3.248  1.153   1.00 13.66 ? 172 ARG C CB  1 
ATOM   2954 C  CG  . ARG B 1 173 ? -16.296 -2.657  2.348   1.00 14.34 ? 172 ARG C CG  1 
ATOM   2955 C  CD  . ARG B 1 173 ? -15.195 -1.705  1.934   1.00 15.09 ? 172 ARG C CD  1 
ATOM   2956 N  NE  . ARG B 1 173 ? -14.007 -2.428  1.508   1.00 15.72 ? 172 ARG C NE  1 
ATOM   2957 C  CZ  . ARG B 1 173 ? -12.879 -1.853  1.101   1.00 18.08 ? 172 ARG C CZ  1 
ATOM   2958 N  NH1 . ARG B 1 173 ? -12.782 -0.528  1.035   1.00 19.23 ? 172 ARG C NH1 1 
ATOM   2959 N  NH2 . ARG B 1 173 ? -11.857 -2.611  0.741   1.00 19.22 ? 172 ARG C NH2 1 
ATOM   2960 N  N   . PRO B 1 174 ? -19.940 -1.899  1.710   1.00 13.96 ? 173 PRO C N   1 
ATOM   2961 C  CA  . PRO B 1 174 ? -20.708 -0.935  2.511   1.00 13.89 ? 173 PRO C CA  1 
ATOM   2962 C  C   . PRO B 1 174 ? -21.771 -1.539  3.437   1.00 13.93 ? 173 PRO C C   1 
ATOM   2963 O  O   . PRO B 1 174 ? -22.010 -0.993  4.517   1.00 13.84 ? 173 PRO C O   1 
ATOM   2964 C  CB  . PRO B 1 174 ? -21.356 -0.038  1.455   1.00 14.03 ? 173 PRO C CB  1 
ATOM   2965 C  CG  . PRO B 1 174 ? -20.464 -0.167  0.258   1.00 14.06 ? 173 PRO C CG  1 
ATOM   2966 C  CD  . PRO B 1 174 ? -20.039 -1.595  0.267   1.00 13.72 ? 173 PRO C CD  1 
ATOM   2967 N  N   . ASP B 1 175 ? -22.381 -2.655  3.034   1.00 13.39 ? 174 ASP C N   1 
ATOM   2968 C  CA  . ASP B 1 175 ? -23.394 -3.310  3.858   1.00 13.59 ? 174 ASP C CA  1 
ATOM   2969 C  C   . ASP B 1 175 ? -22.778 -3.854  5.141   1.00 13.91 ? 174 ASP C C   1 
ATOM   2970 O  O   . ASP B 1 175 ? -23.385 -3.764  6.202   1.00 13.62 ? 174 ASP C O   1 
ATOM   2971 C  CB  . ASP B 1 175 ? -24.103 -4.428  3.087   1.00 13.39 ? 174 ASP C CB  1 
ATOM   2972 C  CG  . ASP B 1 175 ? -25.125 -3.901  2.084   1.00 14.26 ? 174 ASP C CG  1 
ATOM   2973 O  OD1 . ASP B 1 175 ? -25.260 -2.667  1.926   1.00 15.04 ? 174 ASP C OD1 1 
ATOM   2974 O  OD2 . ASP B 1 175 ? -25.791 -4.733  1.440   1.00 13.34 ? 174 ASP C OD2 1 
ATOM   2975 N  N   . TYR B 1 176 ? -21.561 -4.390  5.024   1.00 13.96 ? 175 TYR C N   1 
ATOM   2976 C  CA  . TYR B 1 176 ? -20.811 -4.920  6.155   1.00 14.63 ? 175 TYR C CA  1 
ATOM   2977 C  C   . TYR B 1 176 ? -20.416 -3.785  7.095   1.00 14.91 ? 175 TYR C C   1 
ATOM   2978 O  O   . TYR B 1 176 ? -20.616 -3.883  8.299   1.00 14.64 ? 175 TYR C O   1 
ATOM   2979 C  CB  . TYR B 1 176 ? -19.576 -5.663  5.632   1.00 14.22 ? 175 TYR C CB  1 
ATOM   2980 C  CG  . TYR B 1 176 ? -18.429 -5.790  6.613   1.00 13.89 ? 175 TYR C CG  1 
ATOM   2981 C  CD1 . TYR B 1 176 ? -17.240 -5.081  6.414   1.00 13.75 ? 175 TYR C CD1 1 
ATOM   2982 C  CD2 . TYR B 1 176 ? -18.527 -6.622  7.722   1.00 13.24 ? 175 TYR C CD2 1 
ATOM   2983 C  CE1 . TYR B 1 176 ? -16.180 -5.197  7.304   1.00 13.34 ? 175 TYR C CE1 1 
ATOM   2984 C  CE2 . TYR B 1 176 ? -17.473 -6.745  8.627   1.00 12.98 ? 175 TYR C CE2 1 
ATOM   2985 C  CZ  . TYR B 1 176 ? -16.301 -6.031  8.405   1.00 13.37 ? 175 TYR C CZ  1 
ATOM   2986 O  OH  . TYR B 1 176 ? -15.252 -6.144  9.286   1.00 13.58 ? 175 TYR C OH  1 
ATOM   2987 N  N   . VAL B 1 177 ? -19.859 -2.712  6.530   1.00 15.37 ? 176 VAL C N   1 
ATOM   2988 C  CA  . VAL B 1 177 ? -19.397 -1.567  7.324   1.00 16.30 ? 176 VAL C CA  1 
ATOM   2989 C  C   . VAL B 1 177 ? -20.552 -0.911  8.097   1.00 16.73 ? 176 VAL C C   1 
ATOM   2990 O  O   . VAL B 1 177 ? -20.416 -0.577  9.278   1.00 16.93 ? 176 VAL C O   1 
ATOM   2991 C  CB  . VAL B 1 177 ? -18.603 -0.548  6.454   1.00 16.24 ? 176 VAL C CB  1 
ATOM   2992 C  CG1 . VAL B 1 177 ? -18.279 0.727   7.228   1.00 16.32 ? 176 VAL C CG1 1 
ATOM   2993 C  CG2 . VAL B 1 177 ? -17.315 -1.188  5.937   1.00 16.29 ? 176 VAL C CG2 1 
ATOM   2994 N  N   . ASN B 1 178 ? -21.704 -0.758  7.455   1.00 16.92 ? 177 ASN C N   1 
ATOM   2995 C  CA  . ASN B 1 178 ? -22.843 -0.215  8.171   1.00 17.50 ? 177 ASN C CA  1 
ATOM   2996 C  C   . ASN B 1 178 ? -23.427 -1.192  9.203   1.00 16.99 ? 177 ASN C C   1 
ATOM   2997 O  O   . ASN B 1 178 ? -23.858 -0.763  10.273  1.00 17.22 ? 177 ASN C O   1 
ATOM   2998 C  CB  . ASN B 1 178 ? -23.893 0.342   7.204   1.00 18.25 ? 177 ASN C CB  1 
ATOM   2999 C  CG  . ASN B 1 178 ? -23.374 1.552   6.420   1.00 20.12 ? 177 ASN C CG  1 
ATOM   3000 O  OD1 . ASN B 1 178 ? -23.979 2.624   6.441   1.00 24.94 ? 177 ASN C OD1 1 
ATOM   3001 N  ND2 . ASN B 1 178 ? -22.247 1.385   5.732   1.00 25.04 ? 177 ASN C ND2 1 
ATOM   3002 N  N   . ALA B 1 179 ? -23.394 -2.493  8.908   1.00 16.50 ? 178 ALA C N   1 
ATOM   3003 C  CA  . ALA B 1 179 ? -23.966 -3.501  9.825   1.00 16.65 ? 178 ALA C CA  1 
ATOM   3004 C  C   . ALA B 1 179 ? -23.102 -3.759  11.049  1.00 16.68 ? 178 ALA C C   1 
ATOM   3005 O  O   . ALA B 1 179 ? -23.610 -4.189  12.089  1.00 16.43 ? 178 ALA C O   1 
ATOM   3006 C  CB  . ALA B 1 179 ? -24.252 -4.815  9.101   1.00 16.60 ? 178 ALA C CB  1 
ATOM   3007 N  N   . ILE B 1 180 ? -21.800 -3.500  10.934  1.00 16.41 ? 179 ILE C N   1 
ATOM   3008 C  CA  . ILE B 1 180 ? -20.884 -3.761  12.044  1.00 16.74 ? 179 ILE C CA  1 
ATOM   3009 C  C   . ILE B 1 180 ? -21.174 -2.888  13.273  1.00 16.86 ? 179 ILE C C   1 
ATOM   3010 O  O   . ILE B 1 180 ? -20.852 -3.264  14.393  1.00 16.98 ? 179 ILE C O   1 
ATOM   3011 C  CB  . ILE B 1 180 ? -19.384 -3.686  11.615  1.00 16.51 ? 179 ILE C CB  1 
ATOM   3012 C  CG1 . ILE B 1 180 ? -18.519 -4.541  12.552  1.00 16.89 ? 179 ILE C CG1 1 
ATOM   3013 C  CG2 . ILE B 1 180 ? -18.892 -2.235  11.518  1.00 16.92 ? 179 ILE C CG2 1 
ATOM   3014 C  CD1 . ILE B 1 180 ? -17.031 -4.583  12.175  1.00 16.03 ? 179 ILE C CD1 1 
ATOM   3015 N  N   . TRP B 1 181 ? -21.810 -1.739  13.056  1.00 17.13 ? 180 TRP C N   1 
ATOM   3016 C  CA  . TRP B 1 181 ? -22.210 -0.869  14.159  1.00 17.40 ? 180 TRP C CA  1 
ATOM   3017 C  C   . TRP B 1 181 ? -23.192 -1.530  15.128  1.00 17.55 ? 180 TRP C C   1 
ATOM   3018 O  O   . TRP B 1 181 ? -23.234 -1.175  16.309  1.00 17.50 ? 180 TRP C O   1 
ATOM   3019 C  CB  . TRP B 1 181 ? -22.764 0.452   13.626  1.00 17.35 ? 180 TRP C CB  1 
ATOM   3020 C  CG  . TRP B 1 181 ? -21.679 1.266   13.017  1.00 17.52 ? 180 TRP C CG  1 
ATOM   3021 C  CD1 . TRP B 1 181 ? -21.459 1.478   11.685  1.00 17.65 ? 180 TRP C CD1 1 
ATOM   3022 C  CD2 . TRP B 1 181 ? -20.631 1.949   13.713  1.00 17.23 ? 180 TRP C CD2 1 
ATOM   3023 N  NE1 . TRP B 1 181 ? -20.345 2.266   11.509  1.00 17.57 ? 180 TRP C NE1 1 
ATOM   3024 C  CE2 . TRP B 1 181 ? -19.814 2.565   12.738  1.00 17.32 ? 180 TRP C CE2 1 
ATOM   3025 C  CE3 . TRP B 1 181 ? -20.299 2.100   15.068  1.00 17.79 ? 180 TRP C CE3 1 
ATOM   3026 C  CZ2 . TRP B 1 181 ? -18.691 3.330   13.073  1.00 16.89 ? 180 TRP C CZ2 1 
ATOM   3027 C  CZ3 . TRP B 1 181 ? -19.173 2.858   15.401  1.00 17.38 ? 180 TRP C CZ3 1 
ATOM   3028 C  CH2 . TRP B 1 181 ? -18.391 3.470   14.405  1.00 16.91 ? 180 TRP C CH2 1 
ATOM   3029 N  N   . LYS B 1 182 ? -23.953 -2.502  14.623  1.00 17.72 ? 181 LYS C N   1 
ATOM   3030 C  CA  . LYS B 1 182 ? -24.911 -3.268  15.423  1.00 18.02 ? 181 LYS C CA  1 
ATOM   3031 C  C   . LYS B 1 182 ? -24.200 -4.096  16.487  1.00 17.63 ? 181 LYS C C   1 
ATOM   3032 O  O   . LYS B 1 182 ? -24.768 -4.380  17.545  1.00 17.59 ? 181 LYS C O   1 
ATOM   3033 C  CB  . LYS B 1 182 ? -25.752 -4.187  14.529  1.00 18.22 ? 181 LYS C CB  1 
ATOM   3034 C  CG  . LYS B 1 182 ? -26.826 -3.482  13.710  1.00 19.61 ? 181 LYS C CG  1 
ATOM   3035 C  CD  . LYS B 1 182 ? -27.265 -4.340  12.525  1.00 21.82 ? 181 LYS C CD  1 
ATOM   3036 C  CE  . LYS B 1 182 ? -28.043 -3.520  11.505  1.00 23.67 ? 181 LYS C CE  1 
ATOM   3037 N  NZ  . LYS B 1 182 ? -27.498 -3.684  10.109  1.00 24.60 ? 181 LYS C NZ  1 
ATOM   3038 N  N   . ILE B 1 183 ? -22.952 -4.469  16.205  1.00 17.10 ? 182 ILE C N   1 
ATOM   3039 C  CA  . ILE B 1 183 ? -22.161 -5.280  17.126  1.00 16.62 ? 182 ILE C CA  1 
ATOM   3040 C  C   . ILE B 1 183 ? -20.948 -4.561  17.735  1.00 16.45 ? 182 ILE C C   1 
ATOM   3041 O  O   . ILE B 1 183 ? -20.043 -5.207  18.254  1.00 16.11 ? 182 ILE C O   1 
ATOM   3042 C  CB  . ILE B 1 183 ? -21.732 -6.642  16.498  1.00 16.55 ? 182 ILE C CB  1 
ATOM   3043 C  CG1 . ILE B 1 183 ? -20.916 -6.438  15.210  1.00 16.39 ? 182 ILE C CG1 1 
ATOM   3044 C  CG2 . ILE B 1 183 ? -22.954 -7.538  16.269  1.00 16.21 ? 182 ILE C CG2 1 
ATOM   3045 C  CD1 . ILE B 1 183 ? -20.214 -7.690  14.714  1.00 16.92 ? 182 ILE C CD1 1 
ATOM   3046 N  N   . ALA B 1 184 ? -20.949 -3.229  17.697  1.00 16.65 ? 183 ALA C N   1 
ATOM   3047 C  CA  . ALA B 1 184 ? -19.856 -2.443  18.278  1.00 17.14 ? 183 ALA C CA  1 
ATOM   3048 C  C   . ALA B 1 184 ? -19.867 -2.505  19.806  1.00 16.98 ? 183 ALA C C   1 
ATOM   3049 O  O   . ALA B 1 184 ? -20.841 -2.105  20.451  1.00 17.25 ? 183 ALA C O   1 
ATOM   3050 C  CB  . ALA B 1 184 ? -19.908 -0.995  17.789  1.00 17.21 ? 183 ALA C CB  1 
ATOM   3051 N  N   . ASN B 1 185 ? -18.784 -3.029  20.374  1.00 17.14 ? 184 ASN C N   1 
ATOM   3052 C  CA  . ASN B 1 185 ? -18.678 -3.191  21.823  1.00 17.25 ? 184 ASN C CA  1 
ATOM   3053 C  C   . ASN B 1 185 ? -18.295 -1.867  22.470  1.00 17.41 ? 184 ASN C C   1 
ATOM   3054 O  O   . ASN B 1 185 ? -17.116 -1.614  22.742  1.00 17.61 ? 184 ASN C O   1 
ATOM   3055 C  CB  . ASN B 1 185 ? -17.675 -4.293  22.175  1.00 17.15 ? 184 ASN C CB  1 
ATOM   3056 C  CG  . ASN B 1 185 ? -17.661 -4.631  23.653  1.00 18.08 ? 184 ASN C CG  1 
ATOM   3057 O  OD1 . ASN B 1 185 ? -18.430 -4.082  24.445  1.00 18.01 ? 184 ASN C OD1 1 
ATOM   3058 N  ND2 . ASN B 1 185 ? -16.778 -5.548  24.033  1.00 19.26 ? 184 ASN C ND2 1 
ATOM   3059 N  N   . TRP B 1 186 ? -19.304 -1.027  22.710  1.00 17.51 ? 185 TRP C N   1 
ATOM   3060 C  CA  . TRP B 1 186 ? -19.086 0.311   23.262  1.00 17.89 ? 185 TRP C CA  1 
ATOM   3061 C  C   . TRP B 1 186 ? -18.448 0.298   24.645  1.00 18.28 ? 185 TRP C C   1 
ATOM   3062 O  O   . TRP B 1 186 ? -17.664 1.192   24.978  1.00 18.52 ? 185 TRP C O   1 
ATOM   3063 C  CB  . TRP B 1 186 ? -20.379 1.126   23.252  1.00 18.10 ? 185 TRP C CB  1 
ATOM   3064 C  CG  . TRP B 1 186 ? -20.744 1.545   21.874  1.00 18.23 ? 185 TRP C CG  1 
ATOM   3065 C  CD1 . TRP B 1 186 ? -21.782 1.079   21.124  1.00 18.93 ? 185 TRP C CD1 1 
ATOM   3066 C  CD2 . TRP B 1 186 ? -20.040 2.484   21.051  1.00 18.50 ? 185 TRP C CD2 1 
ATOM   3067 N  NE1 . TRP B 1 186 ? -21.780 1.682   19.887  1.00 18.13 ? 185 TRP C NE1 1 
ATOM   3068 C  CE2 . TRP B 1 186 ? -20.724 2.551   19.816  1.00 18.27 ? 185 TRP C CE2 1 
ATOM   3069 C  CE3 . TRP B 1 186 ? -18.902 3.283   21.240  1.00 19.11 ? 185 TRP C CE3 1 
ATOM   3070 C  CZ2 . TRP B 1 186 ? -20.310 3.387   18.774  1.00 18.19 ? 185 TRP C CZ2 1 
ATOM   3071 C  CZ3 . TRP B 1 186 ? -18.492 4.114   20.205  1.00 18.31 ? 185 TRP C CZ3 1 
ATOM   3072 C  CH2 . TRP B 1 186 ? -19.197 4.158   18.985  1.00 18.68 ? 185 TRP C CH2 1 
ATOM   3073 N  N   . LYS B 1 187 ? -18.758 -0.733  25.428  1.00 18.26 ? 186 LYS C N   1 
ATOM   3074 C  CA  . LYS B 1 187 ? -18.100 -0.935  26.720  1.00 18.84 ? 186 LYS C CA  1 
ATOM   3075 C  C   . LYS B 1 187 ? -16.580 -1.026  26.548  1.00 18.65 ? 186 LYS C C   1 
ATOM   3076 O  O   . LYS B 1 187 ? -15.832 -0.361  27.269  1.00 18.79 ? 186 LYS C O   1 
ATOM   3077 C  CB  . LYS B 1 187 ? -18.660 -2.169  27.443  1.00 18.70 ? 186 LYS C CB  1 
ATOM   3078 C  CG  . LYS B 1 187 ? -17.986 -2.468  28.780  1.00 19.02 ? 186 LYS C CG  1 
ATOM   3079 C  CD  . LYS B 1 187 ? -18.664 -3.614  29.497  1.00 19.78 ? 186 LYS C CD  1 
ATOM   3080 C  CE  . LYS B 1 187 ? -18.103 -3.801  30.904  1.00 20.65 ? 186 LYS C CE  1 
ATOM   3081 N  NZ  . LYS B 1 187 ? -19.093 -4.502  31.771  1.00 22.76 ? 186 LYS C NZ  1 
ATOM   3082 N  N   . ASN B 1 188 ? -16.131 -1.822  25.579  1.00 18.32 ? 187 ASN C N   1 
ATOM   3083 C  CA  . ASN B 1 188 ? -14.704 -1.945  25.296  1.00 18.09 ? 187 ASN C CA  1 
ATOM   3084 C  C   . ASN B 1 188 ? -14.105 -0.635  24.789  1.00 18.25 ? 187 ASN C C   1 
ATOM   3085 O  O   . ASN B 1 188 ? -13.031 -0.230  25.237  1.00 18.37 ? 187 ASN C O   1 
ATOM   3086 C  CB  . ASN B 1 188 ? -14.436 -3.073  24.299  1.00 18.06 ? 187 ASN C CB  1 
ATOM   3087 C  CG  . ASN B 1 188 ? -12.955 -3.258  24.015  1.00 17.45 ? 187 ASN C CG  1 
ATOM   3088 O  OD1 . ASN B 1 188 ? -12.446 -2.776  23.006  1.00 16.86 ? 187 ASN C OD1 1 
ATOM   3089 N  ND2 . ASN B 1 188 ? -12.252 -3.934  24.920  1.00 15.31 ? 187 ASN C ND2 1 
ATOM   3090 N  N   . VAL B 1 189 ? -14.807 0.022   23.865  1.00 18.14 ? 188 VAL C N   1 
ATOM   3091 C  CA  . VAL B 1 189 ? -14.367 1.307   23.315  1.00 18.19 ? 188 VAL C CA  1 
ATOM   3092 C  C   . VAL B 1 189 ? -14.219 2.363   24.419  1.00 18.34 ? 188 VAL C C   1 
ATOM   3093 O  O   . VAL B 1 189 ? -13.234 3.107   24.447  1.00 18.55 ? 188 VAL C O   1 
ATOM   3094 C  CB  . VAL B 1 189 ? -15.324 1.819   22.195  1.00 18.33 ? 188 VAL C CB  1 
ATOM   3095 C  CG1 . VAL B 1 189 ? -14.813 3.126   21.599  1.00 18.36 ? 188 VAL C CG1 1 
ATOM   3096 C  CG2 . VAL B 1 189 ? -15.476 0.773   21.098  1.00 17.64 ? 188 VAL C CG2 1 
ATOM   3097 N  N   . SER B 1 190 ? -15.194 2.404   25.325  1.00 18.23 ? 189 SER C N   1 
ATOM   3098 C  CA  . SER B 1 190 ? -15.184 3.325   26.461  1.00 18.32 ? 189 SER C CA  1 
ATOM   3099 C  C   . SER B 1 190 ? -13.990 3.060   27.373  1.00 18.49 ? 189 SER C C   1 
ATOM   3100 O  O   . SER B 1 190 ? -13.351 3.997   27.860  1.00 18.51 ? 189 SER C O   1 
ATOM   3101 C  CB  . SER B 1 190 ? -16.486 3.202   27.259  1.00 18.40 ? 189 SER C CB  1 
ATOM   3102 O  OG  . SER B 1 190 ? -17.602 3.628   26.489  1.00 17.48 ? 189 SER C OG  1 
ATOM   3103 N  N   . GLU B 1 191 ? -13.695 1.779   27.591  1.00 18.58 ? 190 GLU C N   1 
ATOM   3104 C  CA  . GLU B 1 191 ? -12.564 1.369   28.415  1.00 19.01 ? 190 GLU C CA  1 
ATOM   3105 C  C   . GLU B 1 191 ? -11.251 1.826   27.801  1.00 19.04 ? 190 GLU C C   1 
ATOM   3106 O  O   . GLU B 1 191 ? -10.385 2.356   28.502  1.00 18.71 ? 190 GLU C O   1 
ATOM   3107 C  CB  . GLU B 1 191 ? -12.560 -0.145  28.601  1.00 19.16 ? 190 GLU C CB  1 
ATOM   3108 C  CG  . GLU B 1 191 ? -13.629 -0.659  29.549  1.00 20.73 ? 190 GLU C CG  1 
ATOM   3109 C  CD  . GLU B 1 191 ? -13.756 -2.169  29.522  1.00 22.37 ? 190 GLU C CD  1 
ATOM   3110 O  OE1 . GLU B 1 191 ? -13.046 -2.811  28.714  1.00 24.04 ? 190 GLU C OE1 1 
ATOM   3111 O  OE2 . GLU B 1 191 ? -14.571 -2.710  30.301  1.00 22.92 ? 190 GLU C OE2 1 
ATOM   3112 N  N   . ARG B 1 192 ? -11.125 1.622   26.487  1.00 19.07 ? 191 ARG C N   1 
ATOM   3113 C  CA  . ARG B 1 192 ? -9.950  2.034   25.725  1.00 19.41 ? 191 ARG C CA  1 
ATOM   3114 C  C   . ARG B 1 192 ? -9.769  3.546   25.775  1.00 19.97 ? 191 ARG C C   1 
ATOM   3115 O  O   . ARG B 1 192 ? -8.647  4.032   25.897  1.00 20.13 ? 191 ARG C O   1 
ATOM   3116 C  CB  . ARG B 1 192 ? -10.029 1.526   24.273  1.00 19.26 ? 191 ARG C CB  1 
ATOM   3117 C  CG  . ARG B 1 192 ? -9.916  0.010   24.163  1.00 18.88 ? 191 ARG C CG  1 
ATOM   3118 C  CD  . ARG B 1 192 ? -9.876  -0.522  22.727  1.00 18.93 ? 191 ARG C CD  1 
ATOM   3119 N  NE  . ARG B 1 192 ? -9.741  -1.980  22.758  1.00 18.56 ? 191 ARG C NE  1 
ATOM   3120 C  CZ  . ARG B 1 192 ? -8.582  -2.633  22.852  1.00 18.84 ? 191 ARG C CZ  1 
ATOM   3121 N  NH1 . ARG B 1 192 ? -7.436  -1.964  22.895  1.00 17.68 ? 191 ARG C NH1 1 
ATOM   3122 N  NH2 . ARG B 1 192 ? -8.567  -3.961  22.910  1.00 18.00 ? 191 ARG C NH2 1 
ATOM   3123 N  N   . PHE B 1 193 ? -10.876 4.282   25.691  1.00 20.64 ? 192 PHE C N   1 
ATOM   3124 C  CA  . PHE B 1 193 ? -10.857 5.741   25.812  1.00 21.43 ? 192 PHE C CA  1 
ATOM   3125 C  C   . PHE B 1 193 ? -10.336 6.203   27.174  1.00 21.84 ? 192 PHE C C   1 
ATOM   3126 O  O   . PHE B 1 193 ? -9.511  7.119   27.258  1.00 21.50 ? 192 PHE C O   1 
ATOM   3127 C  CB  . PHE B 1 193 ? -12.254 6.320   25.565  1.00 21.55 ? 192 PHE C CB  1 
ATOM   3128 C  CG  . PHE B 1 193 ? -12.299 7.820   25.591  1.00 21.86 ? 192 PHE C CG  1 
ATOM   3129 C  CD1 . PHE B 1 193 ? -11.656 8.565   24.604  1.00 22.68 ? 192 PHE C CD1 1 
ATOM   3130 C  CD2 . PHE B 1 193 ? -12.989 8.490   26.595  1.00 22.26 ? 192 PHE C CD2 1 
ATOM   3131 C  CE1 . PHE B 1 193 ? -11.698 9.956   24.621  1.00 22.73 ? 192 PHE C CE1 1 
ATOM   3132 C  CE2 . PHE B 1 193 ? -13.034 9.879   26.625  1.00 22.61 ? 192 PHE C CE2 1 
ATOM   3133 C  CZ  . PHE B 1 193 ? -12.392 10.614  25.633  1.00 22.63 ? 192 PHE C CZ  1 
ATOM   3134 N  N   . ALA B 1 194 ? -10.826 5.564   28.233  1.00 22.62 ? 193 ALA C N   1 
ATOM   3135 C  CA  . ALA B 1 194 ? -10.395 5.876   29.592  1.00 23.51 ? 193 ALA C CA  1 
ATOM   3136 C  C   . ALA B 1 194 ? -8.885  5.662   29.758  1.00 24.02 ? 193 ALA C C   1 
ATOM   3137 O  O   . ALA B 1 194 ? -8.193  6.528   30.297  1.00 23.85 ? 193 ALA C O   1 
ATOM   3138 C  CB  . ALA B 1 194 ? -11.183 5.059   30.603  1.00 23.38 ? 193 ALA C CB  1 
ATOM   3139 N  N   . LYS B 1 195 ? -8.379  4.529   29.265  1.00 25.03 ? 194 LYS C N   1 
ATOM   3140 C  CA  . LYS B 1 195 ? -6.943  4.229   29.315  1.00 26.22 ? 194 LYS C CA  1 
ATOM   3141 C  C   . LYS B 1 195 ? -6.124  5.213   28.481  1.00 26.84 ? 194 LYS C C   1 
ATOM   3142 O  O   . LYS B 1 195 ? -5.024  5.598   28.879  1.00 26.87 ? 194 LYS C O   1 
ATOM   3143 C  CB  . LYS B 1 195 ? -6.641  2.798   28.837  1.00 26.33 ? 194 LYS C CB  1 
ATOM   3144 C  CG  . LYS B 1 195 ? -7.562  1.720   29.395  1.00 27.52 ? 194 LYS C CG  1 
ATOM   3145 C  CD  . LYS B 1 195 ? -6.912  0.343   29.374  1.00 28.76 ? 194 LYS C CD  1 
ATOM   3146 C  CE  . LYS B 1 195 ? -6.387  -0.049  30.755  1.00 30.26 ? 194 LYS C CE  1 
ATOM   3147 N  NZ  . LYS B 1 195 ? -5.192  0.742   31.183  1.00 31.12 ? 194 LYS C NZ  1 
ATOM   3148 N  N   . ALA B 1 196 ? -6.659  5.609   27.325  1.00 27.52 ? 195 ALA C N   1 
ATOM   3149 C  CA  . ALA B 1 196 ? -5.948  6.498   26.401  1.00 28.38 ? 195 ALA C CA  1 
ATOM   3150 C  C   . ALA B 1 196 ? -5.757  7.905   26.970  1.00 29.12 ? 195 ALA C C   1 
ATOM   3151 O  O   . ALA B 1 196 ? -4.840  8.625   26.566  1.00 29.34 ? 195 ALA C O   1 
ATOM   3152 C  CB  . ALA B 1 196 ? -6.661  6.549   25.048  1.00 28.35 ? 195 ALA C CB  1 
ATOM   3153 N  N   . GLN B 1 197 ? -6.617  8.274   27.918  1.00 29.76 ? 196 GLN C N   1 
ATOM   3154 C  CA  . GLN B 1 197 ? -6.554  9.569   28.599  1.00 30.71 ? 196 GLN C CA  1 
ATOM   3155 C  C   . GLN B 1 197 ? -5.649  9.556   29.832  1.00 31.08 ? 196 GLN C C   1 
ATOM   3156 O  O   . GLN B 1 197 ? -5.499  10.574  30.511  1.00 31.15 ? 196 GLN C O   1 
ATOM   3157 C  CB  . GLN B 1 197 ? -7.957  10.020  29.003  1.00 30.55 ? 196 GLN C CB  1 
ATOM   3158 C  CG  . GLN B 1 197 ? -8.834  10.415  27.836  1.00 31.41 ? 196 GLN C CG  1 
ATOM   3159 C  CD  . GLN B 1 197 ? -10.128 11.065  28.272  1.00 32.39 ? 196 GLN C CD  1 
ATOM   3160 O  OE1 . GLN B 1 197 ? -10.851 10.538  29.118  1.00 33.38 ? 196 GLN C OE1 1 
ATOM   3161 N  NE2 . GLN B 1 197 ? -10.432 12.219  27.688  1.00 32.90 ? 196 GLN C NE2 1 
ATOM   3162 N  N   . GLN B 1 198 ? -5.048  8.404   30.116  1.00 31.57 ? 197 GLN C N   1 
ATOM   3163 C  CA  . GLN B 1 198 ? -4.161  8.258   31.264  1.00 32.06 ? 197 GLN C CA  1 
ATOM   3164 C  C   . GLN B 1 198 ? -2.708  8.540   30.885  1.00 32.13 ? 197 GLN C C   1 
ATOM   3165 O  O   . GLN B 1 198 ? -2.323  8.433   29.718  1.00 32.30 ? 197 GLN C O   1 
ATOM   3166 C  CB  . GLN B 1 198 ? -4.293  6.858   31.873  1.00 32.15 ? 197 GLN C CB  1 
ATOM   3167 C  CG  . GLN B 1 198 ? -5.677  6.562   32.458  1.00 32.47 ? 197 GLN C CG  1 
ATOM   3168 C  CD  . GLN B 1 198 ? -5.909  5.084   32.762  1.00 32.41 ? 197 GLN C CD  1 
ATOM   3169 O  OE1 . GLN B 1 198 ? -7.024  4.686   33.109  1.00 33.60 ? 197 GLN C OE1 1 
ATOM   3170 N  NE2 . GLN B 1 198 ? -4.863  4.270   32.641  1.00 32.26 ? 197 GLN C NE2 1 
HETATM 3171 MN MN  . MN  C 2 .   ? 24.707  12.193  2.195   1.00 8.69  ? 198 MN  A MN  1 
HETATM 3172 S  S   . SO4 D 3 .   ? 39.218  18.662  11.016  0.75 45.92 ? 199 SO4 A S   1 
HETATM 3173 O  O1  . SO4 D 3 .   ? 39.189  18.722  9.513   0.75 45.71 ? 199 SO4 A O1  1 
HETATM 3174 O  O2  . SO4 D 3 .   ? 37.826  18.700  11.568  0.75 46.38 ? 199 SO4 A O2  1 
HETATM 3175 O  O3  . SO4 D 3 .   ? 39.881  17.383  11.443  0.75 46.14 ? 199 SO4 A O3  1 
HETATM 3176 O  O4  . SO4 D 3 .   ? 39.977  19.845  11.553  0.75 45.35 ? 199 SO4 A O4  1 
HETATM 3177 S  S   . SO4 E 3 .   ? 30.019  -0.276  12.469  0.60 27.40 ? 200 SO4 A S   1 
HETATM 3178 O  O1  . SO4 E 3 .   ? 30.592  1.033   12.932  0.60 24.16 ? 200 SO4 A O1  1 
HETATM 3179 O  O2  . SO4 E 3 .   ? 29.823  -1.194  13.645  0.60 25.90 ? 200 SO4 A O2  1 
HETATM 3180 O  O3  . SO4 E 3 .   ? 28.694  -0.068  11.818  0.60 26.92 ? 200 SO4 A O3  1 
HETATM 3181 O  O4  . SO4 E 3 .   ? 30.959  -0.931  11.502  0.60 27.67 ? 200 SO4 A O4  1 
HETATM 3182 MN MN  . MN  F 2 .   ? -8.466  -9.349  9.130   1.00 18.75 ? 198 MN  C MN  1 
HETATM 3183 S  S   . SO4 G 3 .   ? 0.615   -11.071 23.319  0.50 28.43 ? 199 SO4 C S   1 
HETATM 3184 O  O1  . SO4 G 3 .   ? -0.621  -10.309 23.686  0.50 28.72 ? 199 SO4 C O1  1 
HETATM 3185 O  O2  . SO4 G 3 .   ? 0.283   -12.530 23.168  0.50 25.96 ? 199 SO4 C O2  1 
HETATM 3186 O  O3  . SO4 G 3 .   ? 1.176   -10.517 22.051  0.50 25.47 ? 199 SO4 C O3  1 
HETATM 3187 O  O4  . SO4 G 3 .   ? 1.633   -10.913 24.421  0.50 28.33 ? 199 SO4 C O4  1 
HETATM 3188 O  O   . HOH H 4 .   ? 30.704  13.919  -0.240  1.00 8.56  ? 201 HOH A O   1 
HETATM 3189 O  O   . HOH H 4 .   ? 22.902  11.475  2.027   1.00 8.86  ? 202 HOH A O   1 
HETATM 3190 O  O   . HOH H 4 .   ? 18.322  21.101  -8.446  1.00 10.95 ? 203 HOH A O   1 
HETATM 3191 O  O   . HOH H 4 .   ? 13.291  13.290  -0.001  0.50 8.44  ? 204 HOH A O   1 
HETATM 3192 O  O   . HOH H 4 .   ? 23.157  -1.628  0.998   1.00 11.84 ? 205 HOH A O   1 
HETATM 3193 O  O   . HOH H 4 .   ? 26.619  20.841  -0.017  1.00 9.67  ? 206 HOH A O   1 
HETATM 3194 O  O   . HOH H 4 .   ? 18.471  16.508  0.119   1.00 6.93  ? 207 HOH A O   1 
HETATM 3195 O  O   . HOH H 4 .   ? 21.648  -2.463  3.157   1.00 10.74 ? 208 HOH A O   1 
HETATM 3196 O  O   . HOH H 4 .   ? 15.315  6.549   4.581   1.00 10.16 ? 209 HOH A O   1 
HETATM 3197 O  O   . HOH H 4 .   ? 13.932  3.420   -1.592  1.00 10.41 ? 210 HOH A O   1 
HETATM 3198 O  O   . HOH H 4 .   ? 10.766  5.787   14.035  1.00 12.54 ? 211 HOH A O   1 
HETATM 3199 O  O   . HOH H 4 .   ? 20.605  4.241   -0.721  1.00 9.96  ? 212 HOH A O   1 
HETATM 3200 O  O   . HOH H 4 .   ? 31.924  24.019  -1.618  1.00 14.37 ? 213 HOH A O   1 
HETATM 3201 O  O   . HOH H 4 .   ? 23.255  1.088   0.375   1.00 11.77 ? 214 HOH A O   1 
HETATM 3202 O  O   . HOH H 4 .   ? 35.798  24.087  0.619   1.00 13.56 ? 215 HOH A O   1 
HETATM 3203 O  O   . HOH H 4 .   ? 19.391  20.509  -6.054  1.00 10.74 ? 216 HOH A O   1 
HETATM 3204 O  O   . HOH H 4 .   ? 14.760  16.570  -6.679  1.00 9.30  ? 217 HOH A O   1 
HETATM 3205 O  O   . HOH H 4 .   ? 36.177  5.099   4.840   1.00 13.83 ? 218 HOH A O   1 
HETATM 3206 O  O   . HOH H 4 .   ? 29.236  -4.027  -1.325  1.00 15.67 ? 219 HOH A O   1 
HETATM 3207 O  O   . HOH H 4 .   ? 13.249  10.691  -2.773  1.00 14.76 ? 220 HOH A O   1 
HETATM 3208 O  O   . HOH H 4 .   ? 25.018  -3.584  1.601   1.00 14.14 ? 221 HOH A O   1 
HETATM 3209 O  O   . HOH H 4 .   ? 27.821  19.695  2.347   1.00 16.73 ? 222 HOH A O   1 
HETATM 3210 O  O   . HOH H 4 .   ? 24.056  -3.353  4.087   1.00 15.40 ? 223 HOH A O   1 
HETATM 3211 O  O   . HOH H 4 .   ? 38.684  10.942  8.271   1.00 16.91 ? 224 HOH A O   1 
HETATM 3212 O  O   . HOH H 4 .   ? 12.459  9.437   -7.281  1.00 13.25 ? 225 HOH A O   1 
HETATM 3213 O  O   . HOH H 4 .   ? 37.827  16.847  -1.313  1.00 11.34 ? 226 HOH A O   1 
HETATM 3214 O  O   . HOH H 4 .   ? 19.364  13.801  7.442   1.00 12.08 ? 227 HOH A O   1 
HETATM 3215 O  O   . HOH H 4 .   ? 14.612  15.587  -9.436  1.00 17.79 ? 228 HOH A O   1 
HETATM 3216 O  O   . HOH H 4 .   ? 31.907  14.283  14.000  1.00 13.91 ? 229 HOH A O   1 
HETATM 3217 O  O   . HOH H 4 .   ? 37.080  18.189  -12.630 1.00 18.28 ? 230 HOH A O   1 
HETATM 3218 O  O   . HOH H 4 .   ? 33.525  4.153   5.315   1.00 13.94 ? 231 HOH A O   1 
HETATM 3219 O  O   . HOH H 4 .   ? 14.769  0.737   -1.965  1.00 15.07 ? 232 HOH A O   1 
HETATM 3220 O  O   . HOH H 4 .   ? 29.160  14.275  -2.427  1.00 10.02 ? 233 HOH A O   1 
HETATM 3221 O  O   . HOH H 4 .   ? 13.011  8.459   -4.640  1.00 15.95 ? 234 HOH A O   1 
HETATM 3222 O  O   . HOH H 4 .   ? 10.135  1.924   8.253   1.00 21.92 ? 235 HOH A O   1 
HETATM 3223 O  O   . HOH H 4 .   ? 24.311  8.017   20.377  1.00 18.78 ? 236 HOH A O   1 
HETATM 3224 O  O   . HOH H 4 .   ? 17.645  12.035  -15.714 1.00 21.64 ? 237 HOH A O   1 
HETATM 3225 O  O   . HOH H 4 .   ? 33.593  1.937   6.807   1.00 19.49 ? 238 HOH A O   1 
HETATM 3226 O  O   . HOH H 4 .   ? 30.506  -6.484  -1.914  1.00 16.15 ? 239 HOH A O   1 
HETATM 3227 O  O   . HOH H 4 .   ? 31.476  7.624   16.070  1.00 14.51 ? 240 HOH A O   1 
HETATM 3228 O  O   . HOH H 4 .   ? 19.806  13.483  9.960   1.00 14.49 ? 241 HOH A O   1 
HETATM 3229 O  O   . HOH H 4 .   ? 31.260  2.002   8.768   1.00 16.62 ? 242 HOH A O   1 
HETATM 3230 O  O   . HOH H 4 .   ? 12.255  0.879   23.509  1.00 20.19 ? 243 HOH A O   1 
HETATM 3231 O  O   . HOH H 4 .   ? 22.547  13.628  9.034   1.00 15.54 ? 244 HOH A O   1 
HETATM 3232 O  O   . HOH H 4 .   ? 18.008  18.241  -8.282  1.00 19.77 ? 245 HOH A O   1 
HETATM 3233 O  O   . HOH H 4 .   ? 42.367  9.039   -2.679  1.00 19.63 ? 246 HOH A O   1 
HETATM 3234 O  O   . HOH H 4 .   ? 14.916  0.899   -4.710  1.00 21.33 ? 247 HOH A O   1 
HETATM 3235 O  O   . HOH H 4 .   ? 26.762  24.744  -10.725 1.00 15.87 ? 248 HOH A O   1 
HETATM 3236 O  O   . HOH H 4 .   ? 37.845  -7.143  -19.262 1.00 29.64 ? 249 HOH A O   1 
HETATM 3237 O  O   . HOH H 4 .   ? 35.944  21.148  -5.062  1.00 17.59 ? 250 HOH A O   1 
HETATM 3238 O  O   . HOH H 4 .   ? 12.163  -11.222 22.549  1.00 21.60 ? 251 HOH A O   1 
HETATM 3239 O  O   . HOH H 4 .   ? 12.572  5.788   7.229   1.00 21.25 ? 252 HOH A O   1 
HETATM 3240 O  O   . HOH H 4 .   ? 44.059  10.632  -1.212  1.00 22.14 ? 253 HOH A O   1 
HETATM 3241 O  O   . HOH H 4 .   ? 26.223  21.395  13.619  1.00 17.01 ? 254 HOH A O   1 
HETATM 3242 O  O   . HOH H 4 .   ? 42.171  18.167  3.585   1.00 20.07 ? 255 HOH A O   1 
HETATM 3243 O  O   . HOH H 4 .   ? 15.270  7.617   -11.115 1.00 18.52 ? 256 HOH A O   1 
HETATM 3244 O  O   . HOH H 4 .   ? 16.940  18.163  -5.709  1.00 17.19 ? 257 HOH A O   1 
HETATM 3245 O  O   . HOH H 4 .   ? 6.204   2.457   11.818  1.00 22.35 ? 258 HOH A O   1 
HETATM 3246 O  O   . HOH H 4 .   ? 28.898  15.785  14.795  1.00 22.36 ? 259 HOH A O   1 
HETATM 3247 O  O   . HOH H 4 .   ? 32.677  22.026  8.165   1.00 19.16 ? 260 HOH A O   1 
HETATM 3248 O  O   . HOH H 4 .   ? 29.074  -8.361  -0.491  1.00 24.36 ? 261 HOH A O   1 
HETATM 3249 O  O   . HOH H 4 .   ? 24.375  13.710  -14.895 1.00 17.24 ? 262 HOH A O   1 
HETATM 3250 O  O   . HOH H 4 .   ? 34.845  6.566   -14.129 1.00 20.02 ? 263 HOH A O   1 
HETATM 3251 O  O   . HOH H 4 .   ? 36.595  -7.485  -9.787  1.00 26.54 ? 264 HOH A O   1 
HETATM 3252 O  O   . HOH H 4 .   ? 17.551  -8.482  24.977  1.00 21.37 ? 265 HOH A O   1 
HETATM 3253 O  O   . HOH H 4 .   ? 14.593  -11.564 24.695  1.00 20.08 ? 266 HOH A O   1 
HETATM 3254 O  O   . HOH H 4 .   ? 43.723  7.834   -4.717  1.00 23.39 ? 267 HOH A O   1 
HETATM 3255 O  O   . HOH H 4 .   ? 32.257  25.691  0.365   1.00 21.23 ? 268 HOH A O   1 
HETATM 3256 O  O   . HOH H 4 .   ? 15.421  1.522   -8.687  1.00 19.43 ? 269 HOH A O   1 
HETATM 3257 O  O   . HOH H 4 .   ? 15.735  13.827  -15.056 1.00 24.90 ? 270 HOH A O   1 
HETATM 3258 O  O   . HOH H 4 .   ? 20.683  -3.551  14.446  1.00 21.16 ? 271 HOH A O   1 
HETATM 3259 O  O   . HOH H 4 .   ? 32.947  13.021  -15.845 1.00 21.37 ? 272 HOH A O   1 
HETATM 3260 O  O   . HOH H 4 .   ? 24.117  20.451  -16.575 1.00 17.14 ? 273 HOH A O   1 
HETATM 3261 O  O   . HOH H 4 .   ? 38.791  -0.599  -1.420  1.00 20.98 ? 274 HOH A O   1 
HETATM 3262 O  O   . HOH H 4 .   ? 31.326  11.925  15.521  1.00 18.37 ? 275 HOH A O   1 
HETATM 3263 O  O   . HOH H 4 .   ? 11.175  10.203  -1.200  1.00 18.18 ? 276 HOH A O   1 
HETATM 3264 O  O   . HOH H 4 .   ? 30.341  28.012  2.947   1.00 22.42 ? 277 HOH A O   1 
HETATM 3265 O  O   . HOH H 4 .   ? 7.821   12.923  -5.182  1.00 23.50 ? 278 HOH A O   1 
HETATM 3266 O  O   . HOH H 4 .   ? 2.964   -4.097  21.595  1.00 20.53 ? 279 HOH A O   1 
HETATM 3267 O  O   . HOH H 4 .   ? 25.984  -1.984  17.829  1.00 25.04 ? 280 HOH A O   1 
HETATM 3268 O  O   . HOH H 4 .   ? 24.743  13.973  16.457  1.00 29.34 ? 281 HOH A O   1 
HETATM 3269 O  O   . HOH H 4 .   ? 23.253  10.570  -18.475 1.00 20.38 ? 282 HOH A O   1 
HETATM 3270 O  O   . HOH H 4 .   ? 17.133  0.987   25.356  1.00 27.85 ? 283 HOH A O   1 
HETATM 3271 O  O   . HOH H 4 .   ? 32.002  20.336  10.021  1.00 25.73 ? 284 HOH A O   1 
HETATM 3272 O  O   . HOH H 4 .   ? 20.924  15.774  6.118   1.00 17.49 ? 285 HOH A O   1 
HETATM 3273 O  O   . HOH H 4 .   ? 27.822  10.547  -16.820 1.00 28.13 ? 286 HOH A O   1 
HETATM 3274 O  O   . HOH H 4 .   ? 15.980  10.118  13.372  1.00 24.91 ? 287 HOH A O   1 
HETATM 3275 O  O   . HOH H 4 .   ? 32.427  2.255   11.377  1.00 18.85 ? 288 HOH A O   1 
HETATM 3276 O  O   . HOH H 4 .   ? 19.800  -1.837  -14.722 1.00 24.15 ? 289 HOH A O   1 
HETATM 3277 O  O   . HOH H 4 .   ? 39.425  5.659   -1.336  1.00 16.83 ? 290 HOH A O   1 
HETATM 3278 O  O   . HOH H 4 .   ? 13.936  3.242   -7.302  1.00 27.97 ? 291 HOH A O   1 
HETATM 3279 O  O   . HOH H 4 .   ? 12.244  6.512   2.745   1.00 25.11 ? 292 HOH A O   1 
HETATM 3280 O  O   . HOH H 4 .   ? 29.462  9.779   15.129  1.00 16.25 ? 293 HOH A O   1 
HETATM 3281 O  O   . HOH H 4 .   ? 28.830  27.976  -1.433  1.00 21.18 ? 294 HOH A O   1 
HETATM 3282 O  O   . HOH H 4 .   ? 21.478  5.648   24.003  1.00 43.54 ? 295 HOH A O   1 
HETATM 3283 O  O   . HOH H 4 .   ? 18.148  16.146  -3.605  1.00 24.67 ? 296 HOH A O   1 
HETATM 3284 O  O   . HOH H 4 .   ? 0.245   -3.310  21.300  1.00 28.68 ? 297 HOH A O   1 
HETATM 3285 O  O   . HOH H 4 .   ? 18.528  23.185  -11.976 0.50 27.42 ? 298 HOH A O   1 
HETATM 3286 O  O   . HOH H 4 .   ? 42.002  6.605   -1.353  1.00 24.56 ? 299 HOH A O   1 
HETATM 3287 O  O   . HOH H 4 .   ? 18.719  11.673  11.612  1.00 23.74 ? 300 HOH A O   1 
HETATM 3288 O  O   . HOH H 4 .   ? 26.383  25.767  -13.310 1.00 13.62 ? 301 HOH A O   1 
HETATM 3289 O  O   . HOH H 4 .   ? 22.131  16.238  9.807   1.00 16.05 ? 302 HOH A O   1 
HETATM 3290 O  O   . HOH H 4 .   ? 23.745  23.521  -16.618 1.00 14.85 ? 303 HOH A O   1 
HETATM 3291 O  O   . HOH H 4 .   ? 27.456  24.001  12.991  1.00 13.85 ? 304 HOH A O   1 
HETATM 3292 O  O   . HOH H 4 .   ? 19.652  15.742  11.279  1.00 18.19 ? 305 HOH A O   1 
HETATM 3293 O  O   . HOH H 4 .   ? 21.254  24.183  -15.260 1.00 19.72 ? 306 HOH A O   1 
HETATM 3294 O  O   . HOH H 4 .   ? 27.714  -3.291  16.569  1.00 25.49 ? 307 HOH A O   1 
HETATM 3295 O  O   . HOH H 4 .   ? 27.948  23.148  10.529  1.00 14.38 ? 308 HOH A O   1 
HETATM 3296 O  O   . HOH H 4 .   ? 27.431  7.357   18.614  1.00 23.77 ? 309 HOH A O   1 
HETATM 3297 O  O   . HOH H 4 .   ? 37.800  4.252   11.131  1.00 25.98 ? 310 HOH A O   1 
HETATM 3298 O  O   . HOH H 4 .   ? 13.946  7.317   -8.734  1.00 23.23 ? 311 HOH A O   1 
HETATM 3299 O  O   . HOH H 4 .   ? 11.438  -3.216  14.028  1.00 15.93 ? 312 HOH A O   1 
HETATM 3300 O  O   . HOH H 4 .   ? 27.068  -6.962  1.194   1.00 25.74 ? 313 HOH A O   1 
HETATM 3301 O  O   . HOH H 4 .   ? 8.284   0.360   8.854   0.50 25.07 ? 314 HOH A O   1 
HETATM 3302 O  O   . HOH H 4 .   ? 38.000  3.934   7.975   1.00 30.63 ? 315 HOH A O   1 
HETATM 3303 O  O   . HOH H 4 .   ? 38.473  3.113   -0.578  1.00 22.81 ? 316 HOH A O   1 
HETATM 3304 O  O   . HOH H 4 .   ? 39.950  12.700  6.408   1.00 30.22 ? 317 HOH A O   1 
HETATM 3305 O  O   . HOH H 4 .   ? 18.681  5.163   23.357  1.00 25.32 ? 318 HOH A O   1 
HETATM 3306 O  O   . HOH H 4 .   ? 19.229  20.832  -12.544 1.00 31.45 ? 319 HOH A O   1 
HETATM 3307 O  O   . HOH H 4 .   ? 35.169  -1.955  0.745   1.00 27.86 ? 320 HOH A O   1 
HETATM 3308 O  O   . HOH H 4 .   ? 32.711  19.357  12.366  1.00 35.48 ? 321 HOH A O   1 
HETATM 3309 O  O   . HOH H 4 .   ? 29.293  13.608  16.747  1.00 28.79 ? 322 HOH A O   1 
HETATM 3310 O  O   . HOH H 4 .   ? 40.703  19.501  7.228   1.00 27.19 ? 323 HOH A O   1 
HETATM 3311 O  O   . HOH H 4 .   ? 25.269  -10.058 0.576   1.00 30.95 ? 324 HOH A O   1 
HETATM 3312 O  O   . HOH H 4 .   ? 33.081  3.025   -22.697 1.00 25.43 ? 325 HOH A O   1 
HETATM 3313 O  O   . HOH H 4 .   ? 35.701  4.186   13.743  1.00 44.21 ? 326 HOH A O   1 
HETATM 3314 O  O   . HOH H 4 .   ? 35.896  9.111   11.814  1.00 22.25 ? 327 HOH A O   1 
HETATM 3315 O  O   . HOH H 4 .   ? 40.328  1.698   -2.130  1.00 30.70 ? 328 HOH A O   1 
HETATM 3316 O  O   . HOH H 4 .   ? 36.898  -3.786  -0.348  1.00 29.42 ? 329 HOH A O   1 
HETATM 3317 O  O   . HOH H 4 .   ? 25.854  11.634  -18.396 1.00 28.18 ? 330 HOH A O   1 
HETATM 3318 O  O   . HOH H 4 .   ? 33.677  0.084   -22.082 1.00 27.56 ? 331 HOH A O   1 
HETATM 3319 O  O   . HOH H 4 .   ? 41.309  9.810   7.315   1.00 38.47 ? 332 HOH A O   1 
HETATM 3320 O  O   . HOH H 4 .   ? 38.718  2.264   1.919   1.00 25.83 ? 333 HOH A O   1 
HETATM 3321 O  O   . HOH H 4 .   ? 37.801  2.983   4.420   1.00 19.36 ? 334 HOH A O   1 
HETATM 3322 O  O   . HOH H 4 .   ? 14.912  -7.378  1.469   1.00 39.99 ? 335 HOH A O   1 
HETATM 3323 O  O   . HOH H 4 .   ? 12.490  13.087  -12.093 1.00 26.07 ? 336 HOH A O   1 
HETATM 3324 O  O   . HOH H 4 .   ? 36.981  -8.368  -3.033  1.00 32.25 ? 337 HOH A O   1 
HETATM 3325 O  O   . HOH H 4 .   ? 35.180  7.006   14.928  1.00 35.98 ? 338 HOH A O   1 
HETATM 3326 O  O   . HOH H 4 .   ? 12.051  9.521   -11.041 1.00 31.03 ? 339 HOH A O   1 
HETATM 3327 O  O   . HOH H 4 .   ? 32.880  -10.947 -15.350 1.00 35.15 ? 340 HOH A O   1 
HETATM 3328 O  O   . HOH H 4 .   ? 14.476  6.171   -5.490  0.50 34.87 ? 341 HOH A O   1 
HETATM 3329 O  O   . HOH H 4 .   ? 40.780  -1.200  -10.124 1.00 42.05 ? 342 HOH A O   1 
HETATM 3330 O  O   . HOH H 4 .   ? 30.103  6.079   17.884  1.00 31.23 ? 343 HOH A O   1 
HETATM 3331 O  O   . HOH H 4 .   ? 39.046  -8.385  -5.174  1.00 36.80 ? 344 HOH A O   1 
HETATM 3332 O  O   . HOH H 4 .   ? 9.133   3.232   20.252  1.00 23.01 ? 345 HOH A O   1 
HETATM 3333 O  O   . HOH H 4 .   ? 11.031  3.124   22.215  1.00 28.23 ? 346 HOH A O   1 
HETATM 3334 O  O   . HOH H 4 .   ? 27.829  -4.036  1.138   1.00 19.23 ? 347 HOH A O   1 
HETATM 3335 O  O   . HOH H 4 .   ? 11.866  -12.748 26.181  1.00 29.21 ? 348 HOH A O   1 
HETATM 3336 O  O   . HOH H 4 .   ? 32.480  2.343   18.988  1.00 33.95 ? 349 HOH A O   1 
HETATM 3337 O  O   . HOH H 4 .   ? 12.343  1.119   1.737   1.00 30.18 ? 350 HOH A O   1 
HETATM 3338 O  O   . HOH H 4 .   ? 12.900  -4.759  2.750   1.00 34.46 ? 351 HOH A O   1 
HETATM 3339 O  O   . HOH H 4 .   ? 17.698  9.184   17.765  1.00 36.28 ? 352 HOH A O   1 
HETATM 3340 O  O   . HOH H 4 .   ? 31.365  -9.000  -21.819 1.00 28.47 ? 353 HOH A O   1 
HETATM 3341 O  O   . HOH H 4 .   ? 37.384  7.104   -11.838 1.00 27.30 ? 354 HOH A O   1 
HETATM 3342 O  O   . HOH H 4 .   ? 27.718  -10.347 -13.502 1.00 40.20 ? 355 HOH A O   1 
HETATM 3343 O  O   . HOH H 4 .   ? 16.080  9.605   15.893  1.00 36.74 ? 356 HOH A O   1 
HETATM 3344 O  O   . HOH H 4 .   ? 9.812   11.110  -4.824  1.00 26.83 ? 357 HOH A O   1 
HETATM 3345 O  O   . HOH H 4 .   ? 30.846  27.093  -5.949  0.50 27.68 ? 358 HOH A O   1 
HETATM 3346 O  O   . HOH H 4 .   ? 38.537  24.151  -0.398  1.00 27.17 ? 359 HOH A O   1 
HETATM 3347 O  O   . HOH H 4 .   ? 16.763  -1.785  -10.535 1.00 34.07 ? 360 HOH A O   1 
HETATM 3348 O  O   . HOH H 4 .   ? 12.355  -2.677  -3.694  1.00 41.03 ? 361 HOH A O   1 
HETATM 3349 O  O   . HOH H 4 .   ? 15.079  4.698   -10.509 1.00 34.05 ? 362 HOH A O   1 
HETATM 3350 O  O   . HOH H 4 .   ? 40.434  9.438   -10.529 1.00 37.36 ? 363 HOH A O   1 
HETATM 3351 O  O   . HOH H 4 .   ? 33.031  25.369  -3.928  1.00 25.63 ? 364 HOH A O   1 
HETATM 3352 O  O   . HOH H 4 .   ? 43.037  19.745  -2.732  1.00 33.01 ? 365 HOH A O   1 
HETATM 3353 O  O   . HOH H 4 .   ? 31.748  17.924  14.397  1.00 36.68 ? 366 HOH A O   1 
HETATM 3354 O  O   . HOH H 4 .   ? 18.086  -7.982  1.784   1.00 32.38 ? 367 HOH A O   1 
HETATM 3355 O  O   . HOH H 4 .   ? 38.261  12.496  10.500  1.00 35.64 ? 368 HOH A O   1 
HETATM 3356 O  O   . HOH H 4 .   ? 30.171  11.655  -16.678 1.00 35.81 ? 369 HOH A O   1 
HETATM 3357 O  O   . HOH H 4 .   ? 41.677  15.138  6.581   0.50 22.20 ? 370 HOH A O   1 
HETATM 3358 O  O   . HOH H 4 .   ? 32.174  -1.734  -25.078 1.00 37.82 ? 371 HOH A O   1 
HETATM 3359 O  O   . HOH H 4 .   ? 36.718  24.427  3.580   1.00 31.51 ? 372 HOH A O   1 
HETATM 3360 O  O   . HOH H 4 .   ? 42.206  -6.786  -13.560 1.00 36.26 ? 373 HOH A O   1 
HETATM 3361 O  O   . HOH H 4 .   ? 3.401   -2.341  23.748  1.00 35.18 ? 374 HOH A O   1 
HETATM 3362 O  O   . HOH H 4 .   ? 29.199  2.801   -25.984 1.00 40.40 ? 375 HOH A O   1 
HETATM 3363 O  O   . HOH H 4 .   ? 25.350  4.134   22.475  1.00 34.26 ? 376 HOH A O   1 
HETATM 3364 O  O   . HOH H 4 .   ? 9.662   9.628   -7.123  1.00 34.83 ? 377 HOH A O   1 
HETATM 3365 O  O   . HOH H 4 .   ? 46.078  12.320  1.600   1.00 37.17 ? 378 HOH A O   1 
HETATM 3366 O  O   . HOH H 4 .   ? 18.413  2.751   -15.229 1.00 30.20 ? 379 HOH A O   1 
HETATM 3367 O  O   . HOH H 4 .   ? 37.755  -1.600  -23.348 1.00 48.59 ? 380 HOH A O   1 
HETATM 3368 O  O   . HOH H 4 .   ? 18.574  5.678   -17.017 1.00 33.07 ? 381 HOH A O   1 
HETATM 3369 O  O   . HOH H 4 .   ? 20.749  -4.394  -15.706 1.00 28.19 ? 382 HOH A O   1 
HETATM 3370 O  O   . HOH H 4 .   ? 25.416  -14.803 -6.327  1.00 51.04 ? 383 HOH A O   1 
HETATM 3371 O  O   . HOH H 4 .   ? 9.589   3.754   4.101   1.00 34.89 ? 384 HOH A O   1 
HETATM 3372 O  O   . HOH H 4 .   ? 19.100  6.017   -19.485 1.00 39.39 ? 385 HOH A O   1 
HETATM 3373 O  O   . HOH H 4 .   ? 19.083  14.374  14.679  1.00 25.62 ? 386 HOH A O   1 
HETATM 3374 O  O   . HOH H 4 .   ? 9.821   4.231   6.869   1.00 32.15 ? 387 HOH A O   1 
HETATM 3375 O  O   . HOH H 4 .   ? 21.578  -9.579  2.327   1.00 32.48 ? 388 HOH A O   1 
HETATM 3376 O  O   . HOH H 4 .   ? 46.013  9.292   -5.069  1.00 39.65 ? 389 HOH A O   1 
HETATM 3377 O  O   . HOH H 4 .   ? 32.642  0.647   15.496  1.00 34.78 ? 390 HOH A O   1 
HETATM 3378 O  O   . HOH H 4 .   ? 26.781  15.922  14.043  1.00 30.32 ? 391 HOH A O   1 
HETATM 3379 O  O   . HOH H 4 .   ? 27.966  0.121   5.116   1.00 27.44 ? 392 HOH A O   1 
HETATM 3380 O  O   . HOH H 4 .   ? 3.272   -6.685  21.834  1.00 32.63 ? 393 HOH A O   1 
HETATM 3381 O  O   . HOH H 4 .   ? 20.996  -3.901  -18.423 1.00 35.55 ? 394 HOH A O   1 
HETATM 3382 O  O   . HOH H 4 .   ? 13.075  2.091   25.645  1.00 37.97 ? 395 HOH A O   1 
HETATM 3383 O  O   . HOH H 4 .   ? 10.100  14.007  -11.931 1.00 41.61 ? 396 HOH A O   1 
HETATM 3384 O  O   . HOH H 4 .   ? 40.153  -3.158  -17.055 1.00 51.67 ? 397 HOH A O   1 
HETATM 3385 O  O   . HOH H 4 .   ? 41.928  23.013  -0.793  1.00 37.90 ? 398 HOH A O   1 
HETATM 3386 O  O   . HOH H 4 .   ? 41.882  3.305   -5.637  1.00 35.07 ? 399 HOH A O   1 
HETATM 3387 O  O   . HOH H 4 .   ? 17.239  1.017   -13.351 1.00 32.11 ? 400 HOH A O   1 
HETATM 3388 O  O   . HOH H 4 .   ? 26.331  5.952   -24.024 1.00 42.44 ? 401 HOH A O   1 
HETATM 3389 O  O   . HOH H 4 .   ? 11.062  4.926   0.866   1.00 45.70 ? 402 HOH A O   1 
HETATM 3390 O  O   . HOH H 4 .   ? 16.073  15.588  -12.472 1.00 45.03 ? 403 HOH A O   1 
HETATM 3391 O  O   . HOH H 4 .   ? 9.662   5.536   18.444  1.00 28.74 ? 404 HOH A O   1 
HETATM 3392 O  O   . HOH H 4 .   ? 45.431  1.504   -4.104  1.00 44.62 ? 405 HOH A O   1 
HETATM 3393 O  O   . HOH H 4 .   ? 41.628  5.844   6.755   1.00 40.69 ? 406 HOH A O   1 
HETATM 3394 O  O   . HOH H 4 .   ? 21.494  -9.625  -1.191  1.00 44.31 ? 407 HOH A O   1 
HETATM 3395 O  O   . HOH H 4 .   ? 36.311  -6.413  -21.524 1.00 50.33 ? 408 HOH A O   1 
HETATM 3396 O  O   . HOH H 4 .   ? 42.057  -4.727  -4.995  1.00 36.00 ? 409 HOH A O   1 
HETATM 3397 O  O   . HOH H 4 .   ? 37.093  -10.980 -17.754 1.00 45.05 ? 410 HOH A O   1 
HETATM 3398 O  O   . HOH H 4 .   ? 43.237  0.412   -12.420 1.00 44.97 ? 411 HOH A O   1 
HETATM 3399 O  O   . HOH H 4 .   ? 29.495  10.285  18.736  1.00 41.97 ? 412 HOH A O   1 
HETATM 3400 O  O   . HOH H 4 .   ? 39.074  15.977  -11.112 1.00 21.43 ? 413 HOH A O   1 
HETATM 3401 O  O   . HOH H 4 .   ? 25.824  18.200  14.818  1.00 31.84 ? 414 HOH A O   1 
HETATM 3402 O  O   . HOH H 4 .   ? 27.552  -0.284  7.702   1.00 35.44 ? 415 HOH A O   1 
HETATM 3403 O  O   . HOH H 4 .   ? 46.695  10.944  -2.513  1.00 41.84 ? 416 HOH A O   1 
HETATM 3404 O  O   . HOH H 4 .   ? 9.878   11.882  -13.283 1.00 42.92 ? 417 HOH A O   1 
HETATM 3405 O  O   . HOH H 4 .   ? 41.450  22.982  2.217   1.00 41.91 ? 418 HOH A O   1 
HETATM 3406 O  O   . HOH H 4 .   ? 26.495  -0.826  10.189  1.00 31.04 ? 419 HOH A O   1 
HETATM 3407 O  O   . HOH H 4 .   ? 35.074  -12.563 -16.923 1.00 36.12 ? 420 HOH A O   1 
HETATM 3408 O  O   . HOH H 4 .   ? 16.254  7.557   -16.245 1.00 42.56 ? 421 HOH A O   1 
HETATM 3409 O  O   . HOH H 4 .   ? 40.752  23.763  4.601   1.00 46.72 ? 422 HOH A O   1 
HETATM 3410 O  O   . HOH H 4 .   ? 43.749  2.445   -7.445  1.00 33.61 ? 423 HOH A O   1 
HETATM 3411 O  O   . HOH H 4 .   ? 19.465  -8.277  3.811   1.00 36.24 ? 424 HOH A O   1 
HETATM 3412 O  O   . HOH H 4 .   ? 16.012  10.615  -17.315 1.00 41.31 ? 425 HOH A O   1 
HETATM 3413 O  O   . HOH H 4 .   ? 43.218  5.031   -3.960  1.00 41.70 ? 426 HOH A O   1 
HETATM 3414 O  O   . HOH H 4 .   ? 27.402  -10.489 -1.056  1.00 36.68 ? 427 HOH A O   1 
HETATM 3415 O  O   . HOH H 4 .   ? 10.082  5.361   -1.969  1.00 41.45 ? 428 HOH A O   1 
HETATM 3416 O  O   . HOH H 4 .   ? 41.763  -7.520  -4.433  1.00 51.60 ? 429 HOH A O   1 
HETATM 3417 O  O   . HOH H 4 .   ? 12.114  3.957   -3.448  0.50 25.72 ? 430 HOH A O   1 
HETATM 3418 O  O   . HOH H 4 .   ? 14.455  7.331   -13.681 1.00 36.19 ? 431 HOH A O   1 
HETATM 3419 O  O   . HOH H 4 .   ? 8.080   10.352  -12.789 1.00 31.30 ? 432 HOH A O   1 
HETATM 3420 O  O   . HOH H 4 .   ? 43.052  20.716  3.390   1.00 30.91 ? 433 HOH A O   1 
HETATM 3421 O  O   . HOH H 4 .   ? 10.801  6.971   -4.240  1.00 32.51 ? 434 HOH A O   1 
HETATM 3422 O  O   . HOH H 4 .   ? 38.438  -0.294  1.381   1.00 44.73 ? 435 HOH A O   1 
HETATM 3423 O  O   . HOH H 4 .   ? 10.475  5.961   -6.683  1.00 44.62 ? 436 HOH A O   1 
HETATM 3424 O  O   . HOH H 4 .   ? 35.348  1.995   11.327  1.00 34.13 ? 437 HOH A O   1 
HETATM 3425 O  O   . HOH H 4 .   ? 17.737  -5.291  25.364  1.00 21.23 ? 438 HOH A O   1 
HETATM 3426 O  O   . HOH H 4 .   ? 38.939  -6.879  -7.786  1.00 39.67 ? 439 HOH A O   1 
HETATM 3427 O  O   . HOH H 4 .   ? 36.557  -10.151 -9.676  0.50 22.40 ? 440 HOH A O   1 
HETATM 3428 O  O   . HOH H 4 .   ? 13.091  13.040  -14.876 1.00 33.79 ? 441 HOH A O   1 
HETATM 3429 O  O   . HOH H 4 .   ? 12.938  16.017  -11.548 1.00 41.99 ? 442 HOH A O   1 
HETATM 3430 O  O   . HOH H 4 .   ? 22.553  13.219  -16.561 1.00 34.04 ? 443 HOH A O   1 
HETATM 3431 O  O   . HOH H 4 .   ? 17.851  17.349  -14.770 1.00 32.24 ? 444 HOH A O   1 
HETATM 3432 O  O   . HOH H 4 .   ? 19.827  13.480  -16.847 1.00 25.81 ? 445 HOH A O   1 
HETATM 3433 O  O   . HOH H 4 .   ? 19.792  16.047  -16.811 1.00 27.82 ? 446 HOH A O   1 
HETATM 3434 O  O   . HOH H 4 .   ? 12.507  -12.618 20.495  1.00 23.75 ? 447 HOH A O   1 
HETATM 3435 O  O   . HOH H 4 .   ? 17.825  3.574   25.341  1.00 33.60 ? 448 HOH A O   1 
HETATM 3436 O  O   . HOH H 4 .   ? -0.169  -1.288  19.676  1.00 21.83 ? 449 HOH A O   1 
HETATM 3437 O  O   . HOH H 4 .   ? 30.054  -2.530  2.728   1.00 27.31 ? 450 HOH A O   1 
HETATM 3438 O  O   . HOH H 4 .   ? 32.352  -5.737  0.041   1.00 25.88 ? 451 HOH A O   1 
HETATM 3439 O  O   . HOH H 4 .   ? 11.499  6.747   16.507  1.00 21.73 ? 452 HOH A O   1 
HETATM 3440 O  O   . HOH H 4 .   ? 16.864  -4.566  27.250  1.00 30.98 ? 453 HOH A O   1 
HETATM 3441 O  O   . HOH H 4 .   ? 13.844  -10.400 26.454  0.50 23.72 ? 454 HOH A O   1 
HETATM 3442 O  O   . HOH H 4 .   ? 12.523  1.699   -5.855  0.50 31.67 ? 455 HOH A O   1 
HETATM 3443 O  O   . HOH H 4 .   ? 34.521  13.776  13.284  1.00 31.25 ? 456 HOH A O   1 
HETATM 3444 O  O   . HOH H 4 .   ? 30.060  -0.995  4.723   1.00 35.21 ? 457 HOH A O   1 
HETATM 3445 O  O   . HOH H 4 .   ? 10.338  -0.691  24.810  0.50 17.61 ? 458 HOH A O   1 
HETATM 3446 O  O   . HOH H 4 .   ? 21.067  17.921  -17.903 1.00 30.68 ? 459 HOH A O   1 
HETATM 3447 O  O   . HOH H 4 .   ? 24.194  17.042  11.286  0.50 31.11 ? 460 HOH A O   1 
HETATM 3448 O  O   . HOH H 4 .   ? 18.990  0.847   27.309  0.50 23.34 ? 461 HOH A O   1 
HETATM 3449 O  O   . HOH H 4 .   ? 43.750  10.573  5.140   1.00 39.30 ? 462 HOH A O   1 
HETATM 3450 O  O   . HOH H 4 .   ? 15.450  -6.304  28.173  1.00 34.25 ? 463 HOH A O   1 
HETATM 3451 O  O   . HOH H 4 .   ? 14.950  -0.919  -6.678  1.00 30.46 ? 464 HOH A O   1 
HETATM 3452 O  O   . HOH H 4 .   ? 21.572  20.543  -16.101 1.00 33.83 ? 465 HOH A O   1 
HETATM 3453 O  O   . HOH H 4 .   ? 42.114  17.095  5.983   0.50 31.91 ? 466 HOH A O   1 
HETATM 3454 O  O   . HOH H 4 .   ? 39.565  14.794  -9.303  1.00 37.35 ? 467 HOH A O   1 
HETATM 3455 O  O   . HOH H 4 .   ? 12.935  4.484   -5.290  0.50 35.82 ? 468 HOH A O   1 
HETATM 3456 O  O   . HOH H 4 .   ? 40.040  -4.069  -7.151  1.00 36.93 ? 469 HOH A O   1 
HETATM 3457 O  O   . HOH H 4 .   ? 33.752  -12.635 -12.720 1.00 49.47 ? 470 HOH A O   1 
HETATM 3458 O  O   . HOH H 4 .   ? 27.414  -14.642 -7.817  1.00 40.61 ? 471 HOH A O   1 
HETATM 3459 O  O   . HOH H 4 .   ? 15.756  5.427   -14.576 1.00 46.16 ? 472 HOH A O   1 
HETATM 3460 O  O   . HOH H 4 .   ? 32.095  0.308   3.550   1.00 39.29 ? 473 HOH A O   1 
HETATM 3461 O  O   . HOH H 4 .   ? 42.050  22.198  -4.519  1.00 42.12 ? 474 HOH A O   1 
HETATM 3462 O  O   . HOH H 4 .   ? 22.162  13.391  16.922  1.00 42.95 ? 475 HOH A O   1 
HETATM 3463 O  O   . HOH H 4 .   ? 34.848  -5.517  -1.050  1.00 43.81 ? 476 HOH A O   1 
HETATM 3464 O  O   . HOH H 4 .   ? 36.824  23.470  -3.365  1.00 37.70 ? 477 HOH A O   1 
HETATM 3465 O  O   . HOH H 4 .   ? 29.887  18.053  15.809  1.00 36.75 ? 478 HOH A O   1 
HETATM 3466 O  O   . HOH H 4 .   ? 22.199  -1.139  20.432  1.00 36.84 ? 479 HOH A O   1 
HETATM 3467 O  O   . HOH H 4 .   ? 38.213  7.432   14.267  1.00 48.03 ? 480 HOH A O   1 
HETATM 3468 O  O   . HOH H 4 .   ? 22.579  -15.788 -14.900 1.00 42.88 ? 481 HOH A O   1 
HETATM 3469 O  O   . HOH H 4 .   ? 35.621  25.526  -2.475  1.00 36.00 ? 482 HOH A O   1 
HETATM 3470 O  O   . HOH I 4 .   ? -3.838  -3.805  0.005   0.50 10.08 ? 200 HOH C O   1 
HETATM 3471 O  O   . HOH I 4 .   ? 10.548  -8.123  5.746   1.00 12.80 ? 201 HOH C O   1 
HETATM 3472 O  O   . HOH I 4 .   ? -1.131  2.726   6.881   1.00 13.15 ? 202 HOH C O   1 
HETATM 3473 O  O   . HOH I 4 .   ? 16.472  -14.346 18.829  1.00 10.18 ? 203 HOH C O   1 
HETATM 3474 O  O   . HOH I 4 .   ? -0.710  4.232   9.283   1.00 15.70 ? 204 HOH C O   1 
HETATM 3475 O  O   . HOH I 4 .   ? 1.041   -3.889  6.819   1.00 11.95 ? 205 HOH C O   1 
HETATM 3476 O  O   . HOH I 4 .   ? -4.562  -0.479  1.292   1.00 19.97 ? 206 HOH C O   1 
HETATM 3477 O  O   . HOH I 4 .   ? -8.121  -7.986  1.314   1.00 14.36 ? 207 HOH C O   1 
HETATM 3478 O  O   . HOH I 4 .   ? 13.188  -2.824  4.661   1.00 16.36 ? 208 HOH C O   1 
HETATM 3479 O  O   . HOH I 4 .   ? 8.946   -6.735  19.375  1.00 15.54 ? 209 HOH C O   1 
HETATM 3480 O  O   . HOH I 4 .   ? 8.477   -1.616  7.161   1.00 20.15 ? 210 HOH C O   1 
HETATM 3481 O  O   . HOH I 4 .   ? -2.451  0.370   17.340  1.00 17.08 ? 211 HOH C O   1 
HETATM 3482 O  O   . HOH I 4 .   ? -4.762  -0.998  11.246  1.00 15.24 ? 212 HOH C O   1 
HETATM 3483 O  O   . HOH I 4 .   ? -4.215  -0.845  15.432  1.00 15.81 ? 213 HOH C O   1 
HETATM 3484 O  O   . HOH I 4 .   ? -2.472  0.215   20.159  1.00 20.05 ? 214 HOH C O   1 
HETATM 3485 O  O   . HOH I 4 .   ? 0.325   -0.031  17.231  1.00 16.11 ? 215 HOH C O   1 
HETATM 3486 O  O   . HOH I 4 .   ? -3.112  -14.041 7.671   1.00 20.61 ? 216 HOH C O   1 
HETATM 3487 O  O   . HOH I 4 .   ? -6.855  3.783   0.916   1.00 18.09 ? 217 HOH C O   1 
HETATM 3488 O  O   . HOH I 4 .   ? 13.938  -3.181  12.645  1.00 17.44 ? 218 HOH C O   1 
HETATM 3489 O  O   . HOH I 4 .   ? 4.828   -4.142  6.000   1.00 21.70 ? 219 HOH C O   1 
HETATM 3490 O  O   . HOH I 4 .   ? -7.191  -7.935  8.251   1.00 14.22 ? 220 HOH C O   1 
HETATM 3491 O  O   . HOH I 4 .   ? 18.286  -12.333 11.931  1.00 15.26 ? 221 HOH C O   1 
HETATM 3492 O  O   . HOH I 4 .   ? -2.422  -11.755 5.212   1.00 19.92 ? 222 HOH C O   1 
HETATM 3493 O  O   . HOH I 4 .   ? 4.558   -16.300 27.000  1.00 22.54 ? 223 HOH C O   1 
HETATM 3494 O  O   . HOH I 4 .   ? 17.064  -10.073 7.674   1.00 20.12 ? 224 HOH C O   1 
HETATM 3495 O  O   . HOH I 4 .   ? 24.670  -4.135  8.611   1.00 19.65 ? 225 HOH C O   1 
HETATM 3496 O  O   . HOH I 4 .   ? 22.353  -12.546 17.768  1.00 13.90 ? 226 HOH C O   1 
HETATM 3497 O  O   . HOH I 4 .   ? 17.239  -12.711 9.462   1.00 31.82 ? 227 HOH C O   1 
HETATM 3498 O  O   . HOH I 4 .   ? -15.994 -4.424  -3.344  1.00 23.73 ? 228 HOH C O   1 
HETATM 3499 O  O   . HOH I 4 .   ? -14.298 -11.071 11.684  1.00 23.22 ? 229 HOH C O   1 
HETATM 3500 O  O   . HOH I 4 .   ? -6.087  8.345   7.756   1.00 26.12 ? 230 HOH C O   1 
HETATM 3501 O  O   . HOH I 4 .   ? -7.975  5.178   3.096   1.00 25.19 ? 231 HOH C O   1 
HETATM 3502 O  O   . HOH I 4 .   ? -10.692 -1.738  -2.460  1.00 14.71 ? 232 HOH C O   1 
HETATM 3503 O  O   . HOH I 4 .   ? -0.630  -13.604 6.129   1.00 17.06 ? 233 HOH C O   1 
HETATM 3504 O  O   . HOH I 4 .   ? -10.398 6.460   3.327   1.00 24.12 ? 234 HOH C O   1 
HETATM 3505 O  O   . HOH I 4 .   ? -14.640 -13.722 3.936   1.00 25.08 ? 235 HOH C O   1 
HETATM 3506 O  O   . HOH I 4 .   ? -16.885 6.128   1.281   1.00 24.57 ? 236 HOH C O   1 
HETATM 3507 O  O   . HOH I 4 .   ? 11.388  -15.314 25.435  1.00 22.05 ? 237 HOH C O   1 
HETATM 3508 O  O   . HOH I 4 .   ? -0.890  -18.788 19.427  1.00 28.91 ? 238 HOH C O   1 
HETATM 3509 O  O   . HOH I 4 .   ? 25.649  -3.242  10.770  1.00 21.39 ? 239 HOH C O   1 
HETATM 3510 O  O   . HOH I 4 .   ? -16.115 -3.376  -5.829  1.00 22.38 ? 240 HOH C O   1 
HETATM 3511 O  O   . HOH I 4 .   ? -9.429  6.434   -0.407  1.00 32.53 ? 241 HOH C O   1 
HETATM 3512 O  O   . HOH I 4 .   ? -15.127 -9.011  10.084  1.00 26.97 ? 242 HOH C O   1 
HETATM 3513 O  O   . HOH I 4 .   ? -12.310 0.770   -2.172  1.00 21.93 ? 243 HOH C O   1 
HETATM 3514 O  O   . HOH I 4 .   ? 5.446   -11.607 23.867  1.00 27.42 ? 244 HOH C O   1 
HETATM 3515 O  O   . HOH I 4 .   ? -11.788 4.811   -2.589  1.00 32.44 ? 245 HOH C O   1 
HETATM 3516 O  O   . HOH I 4 .   ? -4.830  -12.794 4.392   1.00 31.25 ? 246 HOH C O   1 
HETATM 3517 O  O   . HOH I 4 .   ? -8.134  -10.137 21.481  1.00 23.44 ? 247 HOH C O   1 
HETATM 3518 O  O   . HOH I 4 .   ? -6.323  2.550   25.212  1.00 31.79 ? 248 HOH C O   1 
HETATM 3519 O  O   . HOH I 4 .   ? 9.864   -17.641 23.146  1.00 21.67 ? 249 HOH C O   1 
HETATM 3520 O  O   . HOH I 4 .   ? 8.132   -14.495 20.325  1.00 26.68 ? 250 HOH C O   1 
HETATM 3521 O  O   . HOH I 4 .   ? -3.673  3.165   25.656  1.00 33.29 ? 251 HOH C O   1 
HETATM 3522 O  O   . HOH I 4 .   ? -9.597  -4.674  25.844  1.00 38.19 ? 252 HOH C O   1 
HETATM 3523 O  O   . HOH I 4 .   ? 1.686   -13.180 7.051   1.00 25.69 ? 253 HOH C O   1 
HETATM 3524 O  O   . HOH I 4 .   ? 25.572  -9.655  7.086   1.00 40.37 ? 254 HOH C O   1 
HETATM 3525 O  O   . HOH I 4 .   ? -10.341 -4.927  0.781   1.00 24.46 ? 255 HOH C O   1 
HETATM 3526 O  O   . HOH I 4 .   ? -10.116 -11.470 22.543  1.00 28.91 ? 256 HOH C O   1 
HETATM 3527 O  O   . HOH I 4 .   ? -18.806 -3.543  -5.978  1.00 29.61 ? 257 HOH C O   1 
HETATM 3528 O  O   . HOH I 4 .   ? -25.893 -8.147  7.881   1.00 36.28 ? 258 HOH C O   1 
HETATM 3529 O  O   . HOH I 4 .   ? -2.844  6.076   9.005   1.00 29.31 ? 259 HOH C O   1 
HETATM 3530 O  O   . HOH I 4 .   ? -10.528 5.976   -4.519  1.00 36.56 ? 260 HOH C O   1 
HETATM 3531 O  O   . HOH I 4 .   ? -3.536  -10.461 21.883  1.00 28.13 ? 261 HOH C O   1 
HETATM 3532 O  O   . HOH I 4 .   ? -2.622  -12.767 23.173  1.00 29.09 ? 262 HOH C O   1 
HETATM 3533 O  O   . HOH I 4 .   ? -6.485  1.201   22.858  1.00 25.02 ? 263 HOH C O   1 
HETATM 3534 O  O   . HOH I 4 .   ? -14.676 -6.290  -1.808  1.00 20.84 ? 264 HOH C O   1 
HETATM 3535 O  O   . HOH I 4 .   ? -3.135  8.842   9.880   1.00 34.54 ? 265 HOH C O   1 
HETATM 3536 O  O   . HOH I 4 .   ? 7.762   -11.974 22.719  1.00 25.97 ? 266 HOH C O   1 
HETATM 3537 O  O   . HOH I 4 .   ? -5.447  4.866   -1.046  1.00 38.77 ? 267 HOH C O   1 
HETATM 3538 O  O   . HOH I 4 .   ? -4.836  7.017   5.899   1.00 32.32 ? 268 HOH C O   1 
HETATM 3539 O  O   . HOH I 4 .   ? -23.963 -8.792  -0.373  1.00 35.21 ? 269 HOH C O   1 
HETATM 3540 O  O   . HOH I 4 .   ? -21.119 7.071   5.760   1.00 27.72 ? 270 HOH C O   1 
HETATM 3541 O  O   . HOH I 4 .   ? 26.502  -10.207 11.349  1.00 38.86 ? 271 HOH C O   1 
HETATM 3542 O  O   . HOH I 4 .   ? -5.348  -21.537 14.834  1.00 25.73 ? 272 HOH C O   1 
HETATM 3543 O  O   . HOH I 4 .   ? 27.957  -9.131  15.458  1.00 38.83 ? 273 HOH C O   1 
HETATM 3544 O  O   . HOH I 4 .   ? -14.457 -3.068  -1.671  1.00 27.61 ? 274 HOH C O   1 
HETATM 3545 O  O   . HOH I 4 .   ? 12.884  -17.478 14.071  1.00 34.81 ? 275 HOH C O   1 
HETATM 3546 O  O   . HOH I 4 .   ? 6.757   -1.918  4.998   1.00 33.79 ? 276 HOH C O   1 
HETATM 3547 O  O   . HOH I 4 .   ? 3.263   -18.978 17.423  1.00 34.34 ? 277 HOH C O   1 
HETATM 3548 O  O   . HOH I 4 .   ? -26.026 -3.935  6.002   1.00 35.23 ? 278 HOH C O   1 
HETATM 3549 O  O   . HOH I 4 .   ? 2.737   -16.919 5.949   1.00 34.10 ? 279 HOH C O   1 
HETATM 3550 O  O   . HOH I 4 .   ? 5.390   -12.429 6.408   1.00 26.91 ? 280 HOH C O   1 
HETATM 3551 O  O   . HOH I 4 .   ? -14.746 -0.626  -2.106  1.00 36.56 ? 281 HOH C O   1 
HETATM 3552 O  O   . HOH I 4 .   ? -6.721  -15.864 25.298  1.00 42.00 ? 282 HOH C O   1 
HETATM 3553 O  O   . HOH I 4 .   ? 28.028  -4.937  14.555  1.00 44.17 ? 283 HOH C O   1 
HETATM 3554 O  O   . HOH I 4 .   ? -25.784 -19.301 14.585  1.00 42.51 ? 284 HOH C O   1 
HETATM 3555 O  O   . HOH I 4 .   ? -15.738 -0.602  -4.641  1.00 27.16 ? 285 HOH C O   1 
HETATM 3556 O  O   . HOH I 4 .   ? -26.521 -1.636  4.546   1.00 41.71 ? 286 HOH C O   1 
HETATM 3557 O  O   . HOH I 4 .   ? -16.520 -8.349  23.522  1.00 33.97 ? 287 HOH C O   1 
HETATM 3558 O  O   . HOH I 4 .   ? 1.952   -17.505 25.300  1.00 32.06 ? 288 HOH C O   1 
HETATM 3559 O  O   . HOH I 4 .   ? -1.305  -18.949 16.356  1.00 29.00 ? 289 HOH C O   1 
HETATM 3560 O  O   . HOH I 4 .   ? 6.118   5.216   12.719  1.00 33.26 ? 290 HOH C O   1 
HETATM 3561 O  O   . HOH I 4 .   ? 1.772   -18.922 19.712  1.00 34.53 ? 291 HOH C O   1 
HETATM 3562 O  O   . HOH I 4 .   ? -4.817  4.342   4.847   1.00 33.26 ? 292 HOH C O   1 
HETATM 3563 O  O   . HOH I 4 .   ? -1.582  4.413   4.894   1.00 26.74 ? 293 HOH C O   1 
HETATM 3564 O  O   . HOH I 4 .   ? -4.907  -3.512  23.155  1.00 45.75 ? 294 HOH C O   1 
HETATM 3565 O  O   . HOH I 4 .   ? -4.200  2.137   -4.431  1.00 24.42 ? 295 HOH C O   1 
HETATM 3566 O  O   . HOH I 4 .   ? -6.846  -18.763 20.939  1.00 35.51 ? 296 HOH C O   1 
HETATM 3567 O  O   . HOH I 4 .   ? -3.596  -16.095 24.830  1.00 42.46 ? 297 HOH C O   1 
HETATM 3568 O  O   . HOH I 4 .   ? -2.422  1.648   23.687  1.00 36.53 ? 298 HOH C O   1 
HETATM 3569 O  O   . HOH I 4 .   ? -13.110 -15.189 5.998   1.00 40.04 ? 299 HOH C O   1 
HETATM 3570 O  O   . HOH I 4 .   ? -20.466 -15.112 14.280  1.00 37.35 ? 300 HOH C O   1 
HETATM 3571 O  O   . HOH I 4 .   ? -19.900 -17.555 0.686   1.00 39.66 ? 301 HOH C O   1 
HETATM 3572 O  O   . HOH I 4 .   ? 4.828   0.406   4.534   1.00 38.37 ? 302 HOH C O   1 
HETATM 3573 O  O   . HOH I 4 .   ? 22.282  -16.924 16.078  1.00 34.75 ? 303 HOH C O   1 
HETATM 3574 O  O   . HOH I 4 .   ? 16.454  -16.417 15.148  1.00 28.63 ? 304 HOH C O   1 
HETATM 3575 O  O   . HOH I 4 .   ? 20.981  -11.963 12.065  1.00 28.27 ? 305 HOH C O   1 
HETATM 3576 O  O   . HOH I 4 .   ? 1.612   -1.426  4.457   1.00 31.22 ? 306 HOH C O   1 
HETATM 3577 O  O   . HOH I 4 .   ? -11.258 12.941  12.157  1.00 33.88 ? 307 HOH C O   1 
HETATM 3578 O  O   . HOH I 4 .   ? -15.266 10.478  6.308   1.00 47.80 ? 308 HOH C O   1 
HETATM 3579 O  O   . HOH I 4 .   ? 0.736   -20.527 10.456  1.00 33.94 ? 309 HOH C O   1 
HETATM 3580 O  O   . HOH I 4 .   ? 3.086   2.368   7.953   1.00 30.95 ? 310 HOH C O   1 
HETATM 3581 O  O   . HOH I 4 .   ? -13.563 -4.785  27.235  1.00 42.65 ? 311 HOH C O   1 
HETATM 3582 O  O   . HOH I 4 .   ? -19.026 -2.037  -2.970  1.00 36.84 ? 312 HOH C O   1 
HETATM 3583 O  O   . HOH I 4 .   ? 7.375   1.827   5.180   1.00 49.10 ? 313 HOH C O   1 
HETATM 3584 O  O   . HOH I 4 .   ? -6.526  11.284  11.203  1.00 39.73 ? 314 HOH C O   1 
HETATM 3585 O  O   . HOH I 4 .   ? -25.791 -10.338 5.407   1.00 47.48 ? 315 HOH C O   1 
HETATM 3586 O  O   . HOH I 4 .   ? -20.299 -16.026 5.383   1.00 43.95 ? 316 HOH C O   1 
HETATM 3587 O  O   . HOH I 4 .   ? -13.818 12.502  10.405  1.00 46.31 ? 317 HOH C O   1 
HETATM 3588 O  O   . HOH I 4 .   ? 3.550   -12.707 25.741  1.00 36.60 ? 318 HOH C O   1 
HETATM 3589 O  O   . HOH I 4 .   ? -23.108 -15.901 5.239   1.00 34.89 ? 319 HOH C O   1 
HETATM 3590 O  O   . HOH I 4 .   ? 3.318   4.920   8.214   1.00 37.27 ? 320 HOH C O   1 
HETATM 3591 O  O   . HOH I 4 .   ? 0.445   -14.134 25.219  1.00 32.14 ? 321 HOH C O   1 
HETATM 3592 O  O   . HOH I 4 .   ? -0.408  4.480   24.586  1.00 45.68 ? 322 HOH C O   1 
HETATM 3593 O  O   . HOH I 4 .   ? -8.434  7.820   5.527   1.00 41.73 ? 323 HOH C O   1 
HETATM 3594 O  O   . HOH I 4 .   ? 6.067   -19.476 15.167  1.00 34.97 ? 324 HOH C O   1 
HETATM 3595 O  O   . HOH I 4 .   ? -19.616 -18.433 4.644   1.00 38.91 ? 325 HOH C O   1 
HETATM 3596 O  O   . HOH I 4 .   ? -21.780 12.589  28.331  1.00 45.57 ? 326 HOH C O   1 
HETATM 3597 O  O   . HOH I 4 .   ? 2.446   -15.162 26.112  1.00 37.35 ? 327 HOH C O   1 
HETATM 3598 O  O   . HOH I 4 .   ? -12.329 -8.521  26.335  1.00 42.75 ? 328 HOH C O   1 
HETATM 3599 O  O   . HOH I 4 .   ? -23.575 -18.400 8.367   1.00 43.87 ? 329 HOH C O   1 
HETATM 3600 O  O   . HOH I 4 .   ? 10.149  -13.656 19.700  1.00 36.41 ? 330 HOH C O   1 
HETATM 3601 O  O   . HOH I 4 .   ? -26.263 -4.589  21.035  1.00 43.08 ? 331 HOH C O   1 
HETATM 3602 O  O   . HOH I 4 .   ? 27.485  -4.250  12.216  1.00 41.74 ? 332 HOH C O   1 
HETATM 3603 O  O   . HOH I 4 .   ? 25.176  -16.332 16.064  1.00 26.50 ? 333 HOH C O   1 
HETATM 3604 O  O   . HOH I 4 .   ? 1.424   -7.917  20.734  1.00 35.34 ? 334 HOH C O   1 
HETATM 3605 O  O   . HOH I 4 .   ? -4.225  -0.277  22.132  1.00 31.96 ? 335 HOH C O   1 
HETATM 3606 O  O   . HOH I 4 .   ? -2.967  -21.022 16.405  1.00 32.12 ? 336 HOH C O   1 
HETATM 3607 O  O   . HOH I 4 .   ? -0.999  -6.736  20.897  1.00 43.18 ? 337 HOH C O   1 
HETATM 3608 O  O   . HOH I 4 .   ? 18.504  -10.026 5.519   1.00 35.12 ? 338 HOH C O   1 
HETATM 3609 O  O   . HOH I 4 .   ? 6.750   1.770   9.375   0.50 29.19 ? 339 HOH C O   1 
HETATM 3610 O  O   . HOH I 4 .   ? 8.208   -13.255 6.706   1.00 31.65 ? 340 HOH C O   1 
HETATM 3611 O  O   . HOH I 4 .   ? 14.694  -10.438 6.090   1.00 25.40 ? 341 HOH C O   1 
HETATM 3612 O  O   . HOH I 4 .   ? 11.654  -10.715 6.137   1.00 20.58 ? 342 HOH C O   1 
HETATM 3613 O  O   . HOH I 4 .   ? 10.812  -12.617 7.495   1.00 24.83 ? 343 HOH C O   1 
HETATM 3614 O  O   . HOH I 4 .   ? 11.376  -0.950  5.212   0.50 29.11 ? 344 HOH C O   1 
HETATM 3615 O  O   . HOH I 4 .   ? -4.959  2.252   2.225   1.00 26.45 ? 345 HOH C O   1 
HETATM 3616 O  O   . HOH I 4 .   ? -2.128  -0.332  0.450   1.00 28.92 ? 346 HOH C O   1 
HETATM 3617 O  O   . HOH I 4 .   ? -12.009 -4.182  -1.836  1.00 26.27 ? 347 HOH C O   1 
HETATM 3618 O  O   . HOH I 4 .   ? 25.785  -3.523  6.296   1.00 24.11 ? 348 HOH C O   1 
HETATM 3619 O  O   . HOH I 4 .   ? -23.446 -5.152  -6.110  1.00 37.73 ? 349 HOH C O   1 
HETATM 3620 O  O   . HOH I 4 .   ? 10.851  -0.233  6.972   0.50 32.79 ? 350 HOH C O   1 
HETATM 3621 O  O   . HOH I 4 .   ? -6.169  2.709   4.226   1.00 35.13 ? 351 HOH C O   1 
HETATM 3622 O  O   . HOH I 4 .   ? -10.631 -10.520 24.949  1.00 36.10 ? 352 HOH C O   1 
HETATM 3623 O  O   . HOH I 4 .   ? 27.796  -10.934 13.510  1.00 39.17 ? 353 HOH C O   1 
HETATM 3624 O  O   . HOH I 4 .   ? 23.427  -10.549 6.761   1.00 42.42 ? 354 HOH C O   1 
HETATM 3625 O  O   . HOH I 4 .   ? -11.755 -18.149 20.942  1.00 36.15 ? 355 HOH C O   1 
HETATM 3626 O  O   . HOH I 4 .   ? 14.802  -13.841 8.692   1.00 28.32 ? 356 HOH C O   1 
HETATM 3627 O  O   . HOH I 4 .   ? -23.026 -9.155  -5.108  1.00 41.17 ? 357 HOH C O   1 
HETATM 3628 O  O   . HOH I 4 .   ? -26.462 10.267  17.745  1.00 45.71 ? 358 HOH C O   1 
HETATM 3629 O  O   . HOH I 4 .   ? -23.992 -11.698 -4.614  1.00 37.53 ? 359 HOH C O   1 
HETATM 3630 O  O   . HOH I 4 .   ? 24.493  -12.236 10.391  1.00 40.70 ? 360 HOH C O   1 
HETATM 3631 O  O   . HOH I 4 .   ? -14.361 -7.343  24.681  1.00 39.44 ? 361 HOH C O   1 
HETATM 3632 O  O   . HOH I 4 .   ? -10.002 -2.762  28.270  1.00 46.00 ? 362 HOH C O   1 
HETATM 3633 O  O   . HOH I 4 .   ? -3.628  -21.729 11.449  1.00 46.08 ? 363 HOH C O   1 
HETATM 3634 O  O   . HOH I 4 .   ? -24.861 0.188   2.943   1.00 48.17 ? 364 HOH C O   1 
HETATM 3635 O  O   . HOH I 4 .   ? -23.026 1.937   17.556  1.00 38.83 ? 365 HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   0   ?   ?   ?   A . n 
A 1 2   LYS 2   1   1   LYS LYS A . n 
A 1 3   HIS 3   2   2   HIS HIS A . n 
A 1 4   SER 4   3   3   SER SER A . n 
A 1 5   LEU 5   4   4   LEU LEU A . n 
A 1 6   PRO 6   5   5   PRO PRO A . n 
A 1 7   ASP 7   6   6   ASP ASP A . n 
A 1 8   LEU 8   7   7   LEU LEU A . n 
A 1 9   PRO 9   8   8   PRO PRO A . n 
A 1 10  TYR 10  9   9   TYR TYR A . n 
A 1 11  ASP 11  10  10  ASP ASP A . n 
A 1 12  TYR 12  11  11  TYR TYR A . n 
A 1 13  ALA 13  12  12  ALA ALA A . n 
A 1 14  ASP 14  13  13  ASP ASP A . n 
A 1 15  LEU 15  14  14  LEU LEU A . n 
A 1 16  GLU 16  15  15  GLU GLU A . n 
A 1 17  PRO 17  16  16  PRO PRO A . n 
A 1 18  VAL 18  17  17  VAL VAL A . n 
A 1 19  ILE 19  18  18  ILE ILE A . n 
A 1 20  SER 20  19  19  SER SER A . n 
A 1 21  HIS 21  20  20  HIS HIS A . n 
A 1 22  GLU 22  21  21  GLU GLU A . n 
A 1 23  ILE 23  22  22  ILE ILE A . n 
A 1 24  MET 24  23  23  MET MET A . n 
A 1 25  GLN 25  24  24  GLN GLN A . n 
A 1 26  LEU 26  25  25  LEU LEU A . n 
A 1 27  HIS 27  26  26  HIS HIS A . n 
A 1 28  HIS 28  27  27  HIS HIS A . n 
A 1 29  GLN 29  28  28  GLN GLN A . n 
A 1 30  LYS 30  29  29  LYS LYS A . n 
A 1 31  HIS 31  30  30  HIS HIS A . n 
A 1 32  HIS 32  31  31  HIS HIS A . n 
A 1 33  ALA 33  32  32  ALA ALA A . n 
A 1 34  THR 34  33  33  THR THR A . n 
A 1 35  TYR 35  34  34  TYR TYR A . n 
A 1 36  VAL 36  35  35  VAL VAL A . n 
A 1 37  ASN 37  36  36  ASN ASN A . n 
A 1 38  ASN 38  37  37  ASN ASN A . n 
A 1 39  LEU 39  38  38  LEU LEU A . n 
A 1 40  ASN 40  39  39  ASN ASN A . n 
A 1 41  GLN 41  40  40  GLN GLN A . n 
A 1 42  ILE 42  41  41  ILE ILE A . n 
A 1 43  GLU 43  42  42  GLU GLU A . n 
A 1 44  GLU 44  43  43  GLU GLU A . n 
A 1 45  LYS 45  44  44  LYS LYS A . n 
A 1 46  LEU 46  45  45  LEU LEU A . n 
A 1 47  HIS 47  46  46  HIS HIS A . n 
A 1 48  GLU 48  47  47  GLU GLU A . n 
A 1 49  ALA 49  48  48  ALA ALA A . n 
A 1 50  VAL 50  49  49  VAL VAL A . n 
A 1 51  SER 51  50  50  SER SER A . n 
A 1 52  LYS 52  51  51  LYS LYS A . n 
A 1 53  GLY 53  52  52  GLY GLY A . n 
A 1 54  ASN 54  53  53  ASN ASN A . n 
A 1 55  VAL 55  54  54  VAL VAL A . n 
A 1 56  LYS 56  55  55  LYS LYS A . n 
A 1 57  GLU 57  56  56  GLU GLU A . n 
A 1 58  ALA 58  57  57  ALA ALA A . n 
A 1 59  ILE 59  58  58  ILE ILE A . n 
A 1 60  ALA 60  59  59  ALA ALA A . n 
A 1 61  LEU 61  60  60  LEU LEU A . n 
A 1 62  GLN 62  61  61  GLN GLN A . n 
A 1 63  PRO 63  62  62  PRO PRO A . n 
A 1 64  ALA 64  63  63  ALA ALA A . n 
A 1 65  LEU 65  64  64  LEU LEU A . n 
A 1 66  LYS 66  65  65  LYS LYS A . n 
A 1 67  PHE 67  66  66  PHE PHE A . n 
A 1 68  ASN 68  67  67  ASN ASN A . n 
A 1 69  GLY 69  68  68  GLY GLY A . n 
A 1 70  GLY 70  69  69  GLY GLY A . n 
A 1 71  GLY 71  70  70  GLY GLY A . n 
A 1 72  HIS 72  71  71  HIS HIS A . n 
A 1 73  ILE 73  72  72  ILE ILE A . n 
A 1 74  ASN 74  73  73  ASN ASN A . n 
A 1 75  HIS 75  74  74  HIS HIS A . n 
A 1 76  SER 76  75  75  SER SER A . n 
A 1 77  ILE 77  76  76  ILE ILE A . n 
A 1 78  PHE 78  77  77  PHE PHE A . n 
A 1 79  TRP 79  78  78  TRP TRP A . n 
A 1 80  THR 80  79  79  THR THR A . n 
A 1 81  ASN 81  80  80  ASN ASN A . n 
A 1 82  LEU 82  81  81  LEU LEU A . n 
A 1 83  ALA 83  82  82  ALA ALA A . n 
A 1 84  LYS 84  83  83  LYS LYS A . n 
A 1 85  ASP 85  84  84  ASP ASP A . n 
A 1 86  GLY 86  85  85  GLY GLY A . n 
A 1 87  GLY 87  86  86  GLY GLY A . n 
A 1 88  GLU 88  87  87  GLU GLU A . n 
A 1 89  PRO 89  88  88  PRO PRO A . n 
A 1 90  SER 90  89  89  SER SER A . n 
A 1 91  ALA 91  90  90  ALA ALA A . n 
A 1 92  GLU 92  91  91  GLU GLU A . n 
A 1 93  LEU 93  92  92  LEU LEU A . n 
A 1 94  LEU 94  93  93  LEU LEU A . n 
A 1 95  THR 95  94  94  THR THR A . n 
A 1 96  ALA 96  95  95  ALA ALA A . n 
A 1 97  ILE 97  96  96  ILE ILE A . n 
A 1 98  LYS 98  97  97  LYS LYS A . n 
A 1 99  SER 99  98  98  SER SER A . n 
A 1 100 ASP 100 99  99  ASP ASP A . n 
A 1 101 PHE 101 100 100 PHE PHE A . n 
A 1 102 GLY 102 101 101 GLY GLY A . n 
A 1 103 SER 103 102 102 SER SER A . n 
A 1 104 LEU 104 103 103 LEU LEU A . n 
A 1 105 ASP 105 104 104 ASP ASP A . n 
A 1 106 ASN 106 105 105 ASN ASN A . n 
A 1 107 LEU 107 106 106 LEU LEU A . n 
A 1 108 GLN 108 107 107 GLN GLN A . n 
A 1 109 LYS 109 108 108 LYS LYS A . n 
A 1 110 GLN 110 109 109 GLN GLN A . n 
A 1 111 LEU 111 110 110 LEU LEU A . n 
A 1 112 SER 112 111 111 SER SER A . n 
A 1 113 ALA 113 112 112 ALA ALA A . n 
A 1 114 SER 114 113 113 SER SER A . n 
A 1 115 THR 115 114 114 THR THR A . n 
A 1 116 VAL 116 115 115 VAL VAL A . n 
A 1 117 ALA 117 116 116 ALA ALA A . n 
A 1 118 VAL 118 117 117 VAL VAL A . n 
A 1 119 GLN 119 118 118 GLN GLN A . n 
A 1 120 GLY 120 119 119 GLY GLY A . n 
A 1 121 SER 121 120 120 SER SER A . n 
A 1 122 GLY 122 121 121 GLY GLY A . n 
A 1 123 TRP 123 122 122 TRP TRP A . n 
A 1 124 GLY 124 123 123 GLY GLY A . n 
A 1 125 TRP 125 124 124 TRP TRP A . n 
A 1 126 LEU 126 125 125 LEU LEU A . n 
A 1 127 GLY 127 126 126 GLY GLY A . n 
A 1 128 TYR 128 127 127 TYR TYR A . n 
A 1 129 CYS 129 128 128 CYS CYS A . n 
A 1 130 PRO 130 129 129 PRO PRO A . n 
A 1 131 LYS 131 130 130 LYS ALA A . n 
A 1 132 GLY 132 131 131 GLY GLY A . n 
A 1 133 LYS 133 132 132 LYS LYS A . n 
A 1 134 ILE 134 133 133 ILE ILE A . n 
A 1 135 LEU 135 134 134 LEU LEU A . n 
A 1 136 LYS 136 135 135 LYS LYS A . n 
A 1 137 VAL 137 136 136 VAL VAL A . n 
A 1 138 ALA 138 137 137 ALA ALA A . n 
A 1 139 THR 139 138 138 THR THR A . n 
A 1 140 CYS 140 139 139 CYS CYS A . n 
A 1 141 ALA 141 140 140 ALA ALA A . n 
A 1 142 ASN 142 141 141 ASN ASN A . n 
A 1 143 GLN 143 142 142 GLN GLN A . n 
A 1 144 ASP 144 143 143 ASP ASP A . n 
A 1 145 PRO 145 144 144 PRO PRO A . n 
A 1 146 LEU 146 145 145 LEU LEU A . n 
A 1 147 GLU 147 146 146 GLU GLU A . n 
A 1 148 ALA 148 147 147 ALA ALA A . n 
A 1 149 THR 149 148 148 THR THR A . n 
A 1 150 THR 150 149 149 THR THR A . n 
A 1 151 GLY 151 150 150 GLY GLY A . n 
A 1 152 LEU 152 151 151 LEU LEU A . n 
A 1 153 VAL 153 152 152 VAL VAL A . n 
A 1 154 PRO 154 153 153 PRO PRO A . n 
A 1 155 LEU 155 154 154 LEU LEU A . n 
A 1 156 PHE 156 155 155 PHE PHE A . n 
A 1 157 GLY 157 156 156 GLY GLY A . n 
A 1 158 ILE 158 157 157 ILE ILE A . n 
A 1 159 ASP 159 158 158 ASP ASP A . n 
A 1 160 VAL 160 159 159 VAL VAL A . n 
A 1 161 TRP 161 160 160 TRP TRP A . n 
A 1 162 GLU 162 161 161 GLU GLU A . n 
A 1 163 HIS 163 162 162 HIS HIS A . n 
A 1 164 ALA 164 163 163 ALA ALA A . n 
A 1 165 TYR 165 164 164 TYR TYR A . n 
A 1 166 TYR 166 165 165 TYR TYR A . n 
A 1 167 LEU 167 166 166 LEU LEU A . n 
A 1 168 GLN 168 167 167 GLN GLN A . n 
A 1 169 TYR 169 168 168 TYR TYR A . n 
A 1 170 LYS 170 169 169 LYS LYS A . n 
A 1 171 ASN 171 170 170 ASN ASN A . n 
A 1 172 VAL 172 171 171 VAL VAL A . n 
A 1 173 ARG 173 172 172 ARG ARG A . n 
A 1 174 PRO 174 173 173 PRO PRO A . n 
A 1 175 ASP 175 174 174 ASP ASP A . n 
A 1 176 TYR 176 175 175 TYR TYR A . n 
A 1 177 VAL 177 176 176 VAL VAL A . n 
A 1 178 ASN 178 177 177 ASN ASN A . n 
A 1 179 ALA 179 178 178 ALA ALA A . n 
A 1 180 ILE 180 179 179 ILE ILE A . n 
A 1 181 TRP 181 180 180 TRP TRP A . n 
A 1 182 LYS 182 181 181 LYS LYS A . n 
A 1 183 ILE 183 182 182 ILE ILE A . n 
A 1 184 ALA 184 183 183 ALA ALA A . n 
A 1 185 ASN 185 184 184 ASN ASN A . n 
A 1 186 TRP 186 185 185 TRP TRP A . n 
A 1 187 LYS 187 186 186 LYS LYS A . n 
A 1 188 ASN 188 187 187 ASN ASN A . n 
A 1 189 VAL 189 188 188 VAL VAL A . n 
A 1 190 SER 190 189 189 SER SER A . n 
A 1 191 GLU 191 190 190 GLU GLU A . n 
A 1 192 ARG 192 191 191 ARG ARG A . n 
A 1 193 PHE 193 192 192 PHE PHE A . n 
A 1 194 ALA 194 193 193 ALA ALA A . n 
A 1 195 LYS 195 194 194 LYS LYS A . n 
A 1 196 ALA 196 195 195 ALA ALA A . n 
A 1 197 GLN 197 196 196 GLN GLN A . n 
A 1 198 GLN 198 197 197 GLN GLN A . n 
B 1 1   MET 1   0   0   MET MET C . n 
B 1 2   LYS 2   1   1   LYS LYS C . n 
B 1 3   HIS 3   2   2   HIS HIS C . n 
B 1 4   SER 4   3   3   SER SER C . n 
B 1 5   LEU 5   4   4   LEU LEU C . n 
B 1 6   PRO 6   5   5   PRO PRO C . n 
B 1 7   ASP 7   6   6   ASP ASP C . n 
B 1 8   LEU 8   7   7   LEU LEU C . n 
B 1 9   PRO 9   8   8   PRO PRO C . n 
B 1 10  TYR 10  9   9   TYR TYR C . n 
B 1 11  ASP 11  10  10  ASP ASP C . n 
B 1 12  TYR 12  11  11  TYR TYR C . n 
B 1 13  ALA 13  12  12  ALA ALA C . n 
B 1 14  ASP 14  13  13  ASP ASP C . n 
B 1 15  LEU 15  14  14  LEU LEU C . n 
B 1 16  GLU 16  15  15  GLU GLU C . n 
B 1 17  PRO 17  16  16  PRO PRO C . n 
B 1 18  VAL 18  17  17  VAL VAL C . n 
B 1 19  ILE 19  18  18  ILE ILE C . n 
B 1 20  SER 20  19  19  SER SER C . n 
B 1 21  HIS 21  20  20  HIS HIS C . n 
B 1 22  GLU 22  21  21  GLU GLU C . n 
B 1 23  ILE 23  22  22  ILE ILE C . n 
B 1 24  MET 24  23  23  MET MET C . n 
B 1 25  GLN 25  24  24  GLN GLN C . n 
B 1 26  LEU 26  25  25  LEU LEU C . n 
B 1 27  HIS 27  26  26  HIS HIS C . n 
B 1 28  HIS 28  27  27  HIS HIS C . n 
B 1 29  GLN 29  28  28  GLN GLN C . n 
B 1 30  LYS 30  29  29  LYS LYS C . n 
B 1 31  HIS 31  30  30  HIS HIS C . n 
B 1 32  HIS 32  31  31  HIS HIS C . n 
B 1 33  ALA 33  32  32  ALA ALA C . n 
B 1 34  THR 34  33  33  THR THR C . n 
B 1 35  TYR 35  34  34  TYR TYR C . n 
B 1 36  VAL 36  35  35  VAL VAL C . n 
B 1 37  ASN 37  36  36  ASN ASN C . n 
B 1 38  ASN 38  37  37  ASN ASN C . n 
B 1 39  LEU 39  38  38  LEU LEU C . n 
B 1 40  ASN 40  39  39  ASN ASN C . n 
B 1 41  GLN 41  40  40  GLN GLN C . n 
B 1 42  ILE 42  41  41  ILE ILE C . n 
B 1 43  GLU 43  42  42  GLU GLU C . n 
B 1 44  GLU 44  43  43  GLU GLU C . n 
B 1 45  LYS 45  44  44  LYS LYS C . n 
B 1 46  LEU 46  45  45  LEU LEU C . n 
B 1 47  HIS 47  46  46  HIS HIS C . n 
B 1 48  GLU 48  47  47  GLU GLU C . n 
B 1 49  ALA 49  48  48  ALA ALA C . n 
B 1 50  VAL 50  49  49  VAL VAL C . n 
B 1 51  SER 51  50  50  SER SER C . n 
B 1 52  LYS 52  51  51  LYS LYS C . n 
B 1 53  GLY 53  52  52  GLY GLY C . n 
B 1 54  ASN 54  53  53  ASN ASN C . n 
B 1 55  VAL 55  54  54  VAL VAL C . n 
B 1 56  LYS 56  55  55  LYS LYS C . n 
B 1 57  GLU 57  56  56  GLU GLU C . n 
B 1 58  ALA 58  57  57  ALA ALA C . n 
B 1 59  ILE 59  58  58  ILE ILE C . n 
B 1 60  ALA 60  59  59  ALA ALA C . n 
B 1 61  LEU 61  60  60  LEU LEU C . n 
B 1 62  GLN 62  61  61  GLN GLN C . n 
B 1 63  PRO 63  62  62  PRO PRO C . n 
B 1 64  ALA 64  63  63  ALA ALA C . n 
B 1 65  LEU 65  64  64  LEU LEU C . n 
B 1 66  LYS 66  65  65  LYS LYS C . n 
B 1 67  PHE 67  66  66  PHE PHE C . n 
B 1 68  ASN 68  67  67  ASN ASN C . n 
B 1 69  GLY 69  68  68  GLY GLY C . n 
B 1 70  GLY 70  69  69  GLY GLY C . n 
B 1 71  GLY 71  70  70  GLY GLY C . n 
B 1 72  HIS 72  71  71  HIS HIS C . n 
B 1 73  ILE 73  72  72  ILE ILE C . n 
B 1 74  ASN 74  73  73  ASN ASN C . n 
B 1 75  HIS 75  74  74  HIS HIS C . n 
B 1 76  SER 76  75  75  SER SER C . n 
B 1 77  ILE 77  76  76  ILE ILE C . n 
B 1 78  PHE 78  77  77  PHE PHE C . n 
B 1 79  TRP 79  78  78  TRP TRP C . n 
B 1 80  THR 80  79  79  THR THR C . n 
B 1 81  ASN 81  80  80  ASN ASN C . n 
B 1 82  LEU 82  81  81  LEU LEU C . n 
B 1 83  ALA 83  82  82  ALA ALA C . n 
B 1 84  LYS 84  83  83  LYS ALA C . n 
B 1 85  ASP 85  84  84  ASP ALA C . n 
B 1 86  GLY 86  85  85  GLY GLY C . n 
B 1 87  GLY 87  86  86  GLY GLY C . n 
B 1 88  GLU 88  87  87  GLU ALA C . n 
B 1 89  PRO 89  88  88  PRO PRO C . n 
B 1 90  SER 90  89  89  SER SER C . n 
B 1 91  ALA 91  90  90  ALA ALA C . n 
B 1 92  GLU 92  91  91  GLU GLU C . n 
B 1 93  LEU 93  92  92  LEU LEU C . n 
B 1 94  LEU 94  93  93  LEU LEU C . n 
B 1 95  THR 95  94  94  THR THR C . n 
B 1 96  ALA 96  95  95  ALA ALA C . n 
B 1 97  ILE 97  96  96  ILE ILE C . n 
B 1 98  LYS 98  97  97  LYS LYS C . n 
B 1 99  SER 99  98  98  SER SER C . n 
B 1 100 ASP 100 99  99  ASP ASP C . n 
B 1 101 PHE 101 100 100 PHE PHE C . n 
B 1 102 GLY 102 101 101 GLY GLY C . n 
B 1 103 SER 103 102 102 SER SER C . n 
B 1 104 LEU 104 103 103 LEU LEU C . n 
B 1 105 ASP 105 104 104 ASP ASP C . n 
B 1 106 ASN 106 105 105 ASN ASN C . n 
B 1 107 LEU 107 106 106 LEU LEU C . n 
B 1 108 GLN 108 107 107 GLN GLN C . n 
B 1 109 LYS 109 108 108 LYS LYS C . n 
B 1 110 GLN 110 109 109 GLN GLN C . n 
B 1 111 LEU 111 110 110 LEU LEU C . n 
B 1 112 SER 112 111 111 SER SER C . n 
B 1 113 ALA 113 112 112 ALA ALA C . n 
B 1 114 SER 114 113 113 SER SER C . n 
B 1 115 THR 115 114 114 THR THR C . n 
B 1 116 VAL 116 115 115 VAL VAL C . n 
B 1 117 ALA 117 116 116 ALA ALA C . n 
B 1 118 VAL 118 117 117 VAL VAL C . n 
B 1 119 GLN 119 118 118 GLN GLN C . n 
B 1 120 GLY 120 119 119 GLY GLY C . n 
B 1 121 SER 121 120 120 SER SER C . n 
B 1 122 GLY 122 121 121 GLY GLY C . n 
B 1 123 TRP 123 122 122 TRP TRP C . n 
B 1 124 GLY 124 123 123 GLY GLY C . n 
B 1 125 TRP 125 124 124 TRP TRP C . n 
B 1 126 LEU 126 125 125 LEU LEU C . n 
B 1 127 GLY 127 126 126 GLY GLY C . n 
B 1 128 TYR 128 127 127 TYR TYR C . n 
B 1 129 CYS 129 128 128 CYS CYS C . n 
B 1 130 PRO 130 129 129 PRO PRO C . n 
B 1 131 LYS 131 130 130 LYS LYS C . n 
B 1 132 GLY 132 131 131 GLY GLY C . n 
B 1 133 LYS 133 132 132 LYS LYS C . n 
B 1 134 ILE 134 133 133 ILE ILE C . n 
B 1 135 LEU 135 134 134 LEU LEU C . n 
B 1 136 LYS 136 135 135 LYS LYS C . n 
B 1 137 VAL 137 136 136 VAL VAL C . n 
B 1 138 ALA 138 137 137 ALA ALA C . n 
B 1 139 THR 139 138 138 THR THR C . n 
B 1 140 CYS 140 139 139 CYS CYS C . n 
B 1 141 ALA 141 140 140 ALA ALA C . n 
B 1 142 ASN 142 141 141 ASN ASN C . n 
B 1 143 GLN 143 142 142 GLN GLN C . n 
B 1 144 ASP 144 143 143 ASP ASP C . n 
B 1 145 PRO 145 144 144 PRO PRO C . n 
B 1 146 LEU 146 145 145 LEU LEU C . n 
B 1 147 GLU 147 146 146 GLU GLU C . n 
B 1 148 ALA 148 147 147 ALA ALA C . n 
B 1 149 THR 149 148 148 THR THR C . n 
B 1 150 THR 150 149 149 THR THR C . n 
B 1 151 GLY 151 150 150 GLY GLY C . n 
B 1 152 LEU 152 151 151 LEU LEU C . n 
B 1 153 VAL 153 152 152 VAL VAL C . n 
B 1 154 PRO 154 153 153 PRO PRO C . n 
B 1 155 LEU 155 154 154 LEU LEU C . n 
B 1 156 PHE 156 155 155 PHE PHE C . n 
B 1 157 GLY 157 156 156 GLY GLY C . n 
B 1 158 ILE 158 157 157 ILE ILE C . n 
B 1 159 ASP 159 158 158 ASP ASP C . n 
B 1 160 VAL 160 159 159 VAL VAL C . n 
B 1 161 TRP 161 160 160 TRP TRP C . n 
B 1 162 GLU 162 161 161 GLU GLU C . n 
B 1 163 HIS 163 162 162 HIS HIS C . n 
B 1 164 ALA 164 163 163 ALA ALA C . n 
B 1 165 TYR 165 164 164 TYR TYR C . n 
B 1 166 TYR 166 165 165 TYR TYR C . n 
B 1 167 LEU 167 166 166 LEU LEU C . n 
B 1 168 GLN 168 167 167 GLN GLN C . n 
B 1 169 TYR 169 168 168 TYR TYR C . n 
B 1 170 LYS 170 169 169 LYS LYS C . n 
B 1 171 ASN 171 170 170 ASN ASN C . n 
B 1 172 VAL 172 171 171 VAL VAL C . n 
B 1 173 ARG 173 172 172 ARG ARG C . n 
B 1 174 PRO 174 173 173 PRO PRO C . n 
B 1 175 ASP 175 174 174 ASP ASP C . n 
B 1 176 TYR 176 175 175 TYR TYR C . n 
B 1 177 VAL 177 176 176 VAL VAL C . n 
B 1 178 ASN 178 177 177 ASN ASN C . n 
B 1 179 ALA 179 178 178 ALA ALA C . n 
B 1 180 ILE 180 179 179 ILE ILE C . n 
B 1 181 TRP 181 180 180 TRP TRP C . n 
B 1 182 LYS 182 181 181 LYS LYS C . n 
B 1 183 ILE 183 182 182 ILE ILE C . n 
B 1 184 ALA 184 183 183 ALA ALA C . n 
B 1 185 ASN 185 184 184 ASN ASN C . n 
B 1 186 TRP 186 185 185 TRP TRP C . n 
B 1 187 LYS 187 186 186 LYS LYS C . n 
B 1 188 ASN 188 187 187 ASN ASN C . n 
B 1 189 VAL 189 188 188 VAL VAL C . n 
B 1 190 SER 190 189 189 SER SER C . n 
B 1 191 GLU 191 190 190 GLU GLU C . n 
B 1 192 ARG 192 191 191 ARG ARG C . n 
B 1 193 PHE 193 192 192 PHE PHE C . n 
B 1 194 ALA 194 193 193 ALA ALA C . n 
B 1 195 LYS 195 194 194 LYS LYS C . n 
B 1 196 ALA 196 195 195 ALA ALA C . n 
B 1 197 GLN 197 196 196 GLN GLN C . n 
B 1 198 GLN 198 197 197 GLN GLN C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 MN  1   198 2   MN  MN  A . 
D 3 SO4 1   199 1   SO4 SO4 A . 
E 3 SO4 1   200 2   SO4 SO4 A . 
F 2 MN  1   198 1   MN  MN  C . 
G 3 SO4 1   199 3   SO4 SO4 C . 
H 4 HOH 1   201 1   HOH HOH A . 
H 4 HOH 2   202 2   HOH HOH A . 
H 4 HOH 3   203 3   HOH HOH A . 
H 4 HOH 4   204 5   HOH HOH A . 
H 4 HOH 5   205 6   HOH HOH A . 
H 4 HOH 6   206 7   HOH HOH A . 
H 4 HOH 7   207 9   HOH HOH A . 
H 4 HOH 8   208 10  HOH HOH A . 
H 4 HOH 9   209 12  HOH HOH A . 
H 4 HOH 10  210 14  HOH HOH A . 
H 4 HOH 11  211 15  HOH HOH A . 
H 4 HOH 12  212 16  HOH HOH A . 
H 4 HOH 13  213 17  HOH HOH A . 
H 4 HOH 14  214 18  HOH HOH A . 
H 4 HOH 15  215 19  HOH HOH A . 
H 4 HOH 16  216 21  HOH HOH A . 
H 4 HOH 17  217 23  HOH HOH A . 
H 4 HOH 18  218 24  HOH HOH A . 
H 4 HOH 19  219 25  HOH HOH A . 
H 4 HOH 20  220 27  HOH HOH A . 
H 4 HOH 21  221 28  HOH HOH A . 
H 4 HOH 22  222 29  HOH HOH A . 
H 4 HOH 23  223 30  HOH HOH A . 
H 4 HOH 24  224 31  HOH HOH A . 
H 4 HOH 25  225 34  HOH HOH A . 
H 4 HOH 26  226 36  HOH HOH A . 
H 4 HOH 27  227 37  HOH HOH A . 
H 4 HOH 28  228 38  HOH HOH A . 
H 4 HOH 29  229 39  HOH HOH A . 
H 4 HOH 30  230 40  HOH HOH A . 
H 4 HOH 31  231 41  HOH HOH A . 
H 4 HOH 32  232 42  HOH HOH A . 
H 4 HOH 33  233 43  HOH HOH A . 
H 4 HOH 34  234 45  HOH HOH A . 
H 4 HOH 35  235 46  HOH HOH A . 
H 4 HOH 36  236 48  HOH HOH A . 
H 4 HOH 37  237 49  HOH HOH A . 
H 4 HOH 38  238 50  HOH HOH A . 
H 4 HOH 39  239 52  HOH HOH A . 
H 4 HOH 40  240 53  HOH HOH A . 
H 4 HOH 41  241 55  HOH HOH A . 
H 4 HOH 42  242 57  HOH HOH A . 
H 4 HOH 43  243 58  HOH HOH A . 
H 4 HOH 44  244 60  HOH HOH A . 
H 4 HOH 45  245 62  HOH HOH A . 
H 4 HOH 46  246 63  HOH HOH A . 
H 4 HOH 47  247 64  HOH HOH A . 
H 4 HOH 48  248 65  HOH HOH A . 
H 4 HOH 49  249 67  HOH HOH A . 
H 4 HOH 50  250 68  HOH HOH A . 
H 4 HOH 51  251 69  HOH HOH A . 
H 4 HOH 52  252 71  HOH HOH A . 
H 4 HOH 53  253 72  HOH HOH A . 
H 4 HOH 54  254 73  HOH HOH A . 
H 4 HOH 55  255 75  HOH HOH A . 
H 4 HOH 56  256 76  HOH HOH A . 
H 4 HOH 57  257 77  HOH HOH A . 
H 4 HOH 58  258 78  HOH HOH A . 
H 4 HOH 59  259 81  HOH HOH A . 
H 4 HOH 60  260 82  HOH HOH A . 
H 4 HOH 61  261 83  HOH HOH A . 
H 4 HOH 62  262 85  HOH HOH A . 
H 4 HOH 63  263 87  HOH HOH A . 
H 4 HOH 64  264 89  HOH HOH A . 
H 4 HOH 65  265 90  HOH HOH A . 
H 4 HOH 66  266 91  HOH HOH A . 
H 4 HOH 67  267 92  HOH HOH A . 
H 4 HOH 68  268 94  HOH HOH A . 
H 4 HOH 69  269 95  HOH HOH A . 
H 4 HOH 70  270 96  HOH HOH A . 
H 4 HOH 71  271 98  HOH HOH A . 
H 4 HOH 72  272 101 HOH HOH A . 
H 4 HOH 73  273 102 HOH HOH A . 
H 4 HOH 74  274 103 HOH HOH A . 
H 4 HOH 75  275 104 HOH HOH A . 
H 4 HOH 76  276 106 HOH HOH A . 
H 4 HOH 77  277 107 HOH HOH A . 
H 4 HOH 78  278 108 HOH HOH A . 
H 4 HOH 79  279 109 HOH HOH A . 
H 4 HOH 80  280 112 HOH HOH A . 
H 4 HOH 81  281 113 HOH HOH A . 
H 4 HOH 82  282 114 HOH HOH A . 
H 4 HOH 83  283 115 HOH HOH A . 
H 4 HOH 84  284 116 HOH HOH A . 
H 4 HOH 85  285 117 HOH HOH A . 
H 4 HOH 86  286 118 HOH HOH A . 
H 4 HOH 87  287 120 HOH HOH A . 
H 4 HOH 88  288 122 HOH HOH A . 
H 4 HOH 89  289 123 HOH HOH A . 
H 4 HOH 90  290 124 HOH HOH A . 
H 4 HOH 91  291 125 HOH HOH A . 
H 4 HOH 92  292 126 HOH HOH A . 
H 4 HOH 93  293 129 HOH HOH A . 
H 4 HOH 94  294 130 HOH HOH A . 
H 4 HOH 95  295 131 HOH HOH A . 
H 4 HOH 96  296 133 HOH HOH A . 
H 4 HOH 97  297 137 HOH HOH A . 
H 4 HOH 98  298 138 HOH HOH A . 
H 4 HOH 99  299 139 HOH HOH A . 
H 4 HOH 100 300 140 HOH HOH A . 
H 4 HOH 101 301 141 HOH HOH A . 
H 4 HOH 102 302 142 HOH HOH A . 
H 4 HOH 103 303 143 HOH HOH A . 
H 4 HOH 104 304 144 HOH HOH A . 
H 4 HOH 105 305 145 HOH HOH A . 
H 4 HOH 106 306 146 HOH HOH A . 
H 4 HOH 107 307 147 HOH HOH A . 
H 4 HOH 108 308 149 HOH HOH A . 
H 4 HOH 109 309 150 HOH HOH A . 
H 4 HOH 110 310 153 HOH HOH A . 
H 4 HOH 111 311 154 HOH HOH A . 
H 4 HOH 112 312 155 HOH HOH A . 
H 4 HOH 113 313 157 HOH HOH A . 
H 4 HOH 114 314 159 HOH HOH A . 
H 4 HOH 115 315 160 HOH HOH A . 
H 4 HOH 116 316 163 HOH HOH A . 
H 4 HOH 117 317 165 HOH HOH A . 
H 4 HOH 118 318 168 HOH HOH A . 
H 4 HOH 119 319 169 HOH HOH A . 
H 4 HOH 120 320 173 HOH HOH A . 
H 4 HOH 121 321 175 HOH HOH A . 
H 4 HOH 122 322 178 HOH HOH A . 
H 4 HOH 123 323 179 HOH HOH A . 
H 4 HOH 124 324 180 HOH HOH A . 
H 4 HOH 125 325 184 HOH HOH A . 
H 4 HOH 126 326 185 HOH HOH A . 
H 4 HOH 127 327 187 HOH HOH A . 
H 4 HOH 128 328 188 HOH HOH A . 
H 4 HOH 129 329 192 HOH HOH A . 
H 4 HOH 130 330 193 HOH HOH A . 
H 4 HOH 131 331 195 HOH HOH A . 
H 4 HOH 132 332 196 HOH HOH A . 
H 4 HOH 133 333 198 HOH HOH A . 
H 4 HOH 134 334 199 HOH HOH A . 
H 4 HOH 135 335 201 HOH HOH A . 
H 4 HOH 136 336 204 HOH HOH A . 
H 4 HOH 137 337 205 HOH HOH A . 
H 4 HOH 138 338 206 HOH HOH A . 
H 4 HOH 139 339 209 HOH HOH A . 
H 4 HOH 140 340 210 HOH HOH A . 
H 4 HOH 141 341 211 HOH HOH A . 
H 4 HOH 142 342 213 HOH HOH A . 
H 4 HOH 143 343 215 HOH HOH A . 
H 4 HOH 144 344 216 HOH HOH A . 
H 4 HOH 145 345 217 HOH HOH A . 
H 4 HOH 146 346 218 HOH HOH A . 
H 4 HOH 147 347 219 HOH HOH A . 
H 4 HOH 148 348 220 HOH HOH A . 
H 4 HOH 149 349 222 HOH HOH A . 
H 4 HOH 150 350 223 HOH HOH A . 
H 4 HOH 151 351 224 HOH HOH A . 
H 4 HOH 152 352 226 HOH HOH A . 
H 4 HOH 153 353 228 HOH HOH A . 
H 4 HOH 154 354 230 HOH HOH A . 
H 4 HOH 155 355 234 HOH HOH A . 
H 4 HOH 156 356 237 HOH HOH A . 
H 4 HOH 157 357 238 HOH HOH A . 
H 4 HOH 158 358 239 HOH HOH A . 
H 4 HOH 159 359 241 HOH HOH A . 
H 4 HOH 160 360 242 HOH HOH A . 
H 4 HOH 161 361 243 HOH HOH A . 
H 4 HOH 162 362 245 HOH HOH A . 
H 4 HOH 163 363 248 HOH HOH A . 
H 4 HOH 164 364 250 HOH HOH A . 
H 4 HOH 165 365 251 HOH HOH A . 
H 4 HOH 166 366 252 HOH HOH A . 
H 4 HOH 167 367 253 HOH HOH A . 
H 4 HOH 168 368 258 HOH HOH A . 
H 4 HOH 169 369 260 HOH HOH A . 
H 4 HOH 170 370 264 HOH HOH A . 
H 4 HOH 171 371 266 HOH HOH A . 
H 4 HOH 172 372 267 HOH HOH A . 
H 4 HOH 173 373 269 HOH HOH A . 
H 4 HOH 174 374 270 HOH HOH A . 
H 4 HOH 175 375 271 HOH HOH A . 
H 4 HOH 176 376 272 HOH HOH A . 
H 4 HOH 177 377 276 HOH HOH A . 
H 4 HOH 178 378 277 HOH HOH A . 
H 4 HOH 179 379 282 HOH HOH A . 
H 4 HOH 180 380 283 HOH HOH A . 
H 4 HOH 181 381 286 HOH HOH A . 
H 4 HOH 182 382 289 HOH HOH A . 
H 4 HOH 183 383 290 HOH HOH A . 
H 4 HOH 184 384 291 HOH HOH A . 
H 4 HOH 185 385 293 HOH HOH A . 
H 4 HOH 186 386 294 HOH HOH A . 
H 4 HOH 187 387 298 HOH HOH A . 
H 4 HOH 188 388 299 HOH HOH A . 
H 4 HOH 189 389 300 HOH HOH A . 
H 4 HOH 190 390 302 HOH HOH A . 
H 4 HOH 191 391 304 HOH HOH A . 
H 4 HOH 192 392 307 HOH HOH A . 
H 4 HOH 193 393 308 HOH HOH A . 
H 4 HOH 194 394 312 HOH HOH A . 
H 4 HOH 195 395 318 HOH HOH A . 
H 4 HOH 196 396 319 HOH HOH A . 
H 4 HOH 197 397 321 HOH HOH A . 
H 4 HOH 198 398 322 HOH HOH A . 
H 4 HOH 199 399 324 HOH HOH A . 
H 4 HOH 200 400 325 HOH HOH A . 
H 4 HOH 201 401 327 HOH HOH A . 
H 4 HOH 202 402 329 HOH HOH A . 
H 4 HOH 203 403 331 HOH HOH A . 
H 4 HOH 204 404 332 HOH HOH A . 
H 4 HOH 205 405 334 HOH HOH A . 
H 4 HOH 206 406 335 HOH HOH A . 
H 4 HOH 207 407 336 HOH HOH A . 
H 4 HOH 208 408 337 HOH HOH A . 
H 4 HOH 209 409 338 HOH HOH A . 
H 4 HOH 210 410 343 HOH HOH A . 
H 4 HOH 211 411 344 HOH HOH A . 
H 4 HOH 212 412 345 HOH HOH A . 
H 4 HOH 213 413 346 HOH HOH A . 
H 4 HOH 214 414 347 HOH HOH A . 
H 4 HOH 215 415 349 HOH HOH A . 
H 4 HOH 216 416 350 HOH HOH A . 
H 4 HOH 217 417 351 HOH HOH A . 
H 4 HOH 218 418 352 HOH HOH A . 
H 4 HOH 219 419 355 HOH HOH A . 
H 4 HOH 220 420 356 HOH HOH A . 
H 4 HOH 221 421 357 HOH HOH A . 
H 4 HOH 222 422 358 HOH HOH A . 
H 4 HOH 223 423 360 HOH HOH A . 
H 4 HOH 224 424 361 HOH HOH A . 
H 4 HOH 225 425 363 HOH HOH A . 
H 4 HOH 226 426 364 HOH HOH A . 
H 4 HOH 227 427 365 HOH HOH A . 
H 4 HOH 228 428 366 HOH HOH A . 
H 4 HOH 229 429 367 HOH HOH A . 
H 4 HOH 230 430 368 HOH HOH A . 
H 4 HOH 231 431 369 HOH HOH A . 
H 4 HOH 232 432 371 HOH HOH A . 
H 4 HOH 233 433 372 HOH HOH A . 
H 4 HOH 234 434 373 HOH HOH A . 
H 4 HOH 235 435 374 HOH HOH A . 
H 4 HOH 236 436 375 HOH HOH A . 
H 4 HOH 237 437 377 HOH HOH A . 
H 4 HOH 238 438 378 HOH HOH A . 
H 4 HOH 239 439 379 HOH HOH A . 
H 4 HOH 240 440 380 HOH HOH A . 
H 4 HOH 241 441 381 HOH HOH A . 
H 4 HOH 242 442 382 HOH HOH A . 
H 4 HOH 243 443 383 HOH HOH A . 
H 4 HOH 244 444 384 HOH HOH A . 
H 4 HOH 245 445 385 HOH HOH A . 
H 4 HOH 246 446 386 HOH HOH A . 
H 4 HOH 247 447 387 HOH HOH A . 
H 4 HOH 248 448 393 HOH HOH A . 
H 4 HOH 249 449 394 HOH HOH A . 
H 4 HOH 250 450 399 HOH HOH A . 
H 4 HOH 251 451 400 HOH HOH A . 
H 4 HOH 252 452 401 HOH HOH A . 
H 4 HOH 253 453 403 HOH HOH A . 
H 4 HOH 254 454 404 HOH HOH A . 
H 4 HOH 255 455 406 HOH HOH A . 
H 4 HOH 256 456 407 HOH HOH A . 
H 4 HOH 257 457 408 HOH HOH A . 
H 4 HOH 258 458 409 HOH HOH A . 
H 4 HOH 259 459 410 HOH HOH A . 
H 4 HOH 260 460 411 HOH HOH A . 
H 4 HOH 261 461 412 HOH HOH A . 
H 4 HOH 262 462 413 HOH HOH A . 
H 4 HOH 263 463 414 HOH HOH A . 
H 4 HOH 264 464 415 HOH HOH A . 
H 4 HOH 265 465 416 HOH HOH A . 
H 4 HOH 266 466 418 HOH HOH A . 
H 4 HOH 267 467 419 HOH HOH A . 
H 4 HOH 268 468 424 HOH HOH A . 
H 4 HOH 269 469 426 HOH HOH A . 
H 4 HOH 270 470 427 HOH HOH A . 
H 4 HOH 271 471 430 HOH HOH A . 
H 4 HOH 272 472 431 HOH HOH A . 
H 4 HOH 273 473 433 HOH HOH A . 
H 4 HOH 274 474 434 HOH HOH A . 
H 4 HOH 275 475 435 HOH HOH A . 
H 4 HOH 276 476 437 HOH HOH A . 
H 4 HOH 277 477 439 HOH HOH A . 
H 4 HOH 278 478 440 HOH HOH A . 
H 4 HOH 279 479 441 HOH HOH A . 
H 4 HOH 280 480 442 HOH HOH A . 
H 4 HOH 281 481 447 HOH HOH A . 
H 4 HOH 282 482 448 HOH HOH A . 
I 4 HOH 1   200 4   HOH HOH C . 
I 4 HOH 2   201 8   HOH HOH C . 
I 4 HOH 3   202 11  HOH HOH C . 
I 4 HOH 4   203 13  HOH HOH C . 
I 4 HOH 5   204 20  HOH HOH C . 
I 4 HOH 6   205 22  HOH HOH C . 
I 4 HOH 7   206 26  HOH HOH C . 
I 4 HOH 8   207 32  HOH HOH C . 
I 4 HOH 9   208 33  HOH HOH C . 
I 4 HOH 10  209 35  HOH HOH C . 
I 4 HOH 11  210 44  HOH HOH C . 
I 4 HOH 12  211 47  HOH HOH C . 
I 4 HOH 13  212 51  HOH HOH C . 
I 4 HOH 14  213 54  HOH HOH C . 
I 4 HOH 15  214 56  HOH HOH C . 
I 4 HOH 16  215 59  HOH HOH C . 
I 4 HOH 17  216 61  HOH HOH C . 
I 4 HOH 18  217 66  HOH HOH C . 
I 4 HOH 19  218 70  HOH HOH C . 
I 4 HOH 20  219 74  HOH HOH C . 
I 4 HOH 21  220 79  HOH HOH C . 
I 4 HOH 22  221 80  HOH HOH C . 
I 4 HOH 23  222 84  HOH HOH C . 
I 4 HOH 24  223 86  HOH HOH C . 
I 4 HOH 25  224 88  HOH HOH C . 
I 4 HOH 26  225 93  HOH HOH C . 
I 4 HOH 27  226 97  HOH HOH C . 
I 4 HOH 28  227 99  HOH HOH C . 
I 4 HOH 29  228 100 HOH HOH C . 
I 4 HOH 30  229 105 HOH HOH C . 
I 4 HOH 31  230 110 HOH HOH C . 
I 4 HOH 32  231 111 HOH HOH C . 
I 4 HOH 33  232 119 HOH HOH C . 
I 4 HOH 34  233 121 HOH HOH C . 
I 4 HOH 35  234 127 HOH HOH C . 
I 4 HOH 36  235 128 HOH HOH C . 
I 4 HOH 37  236 132 HOH HOH C . 
I 4 HOH 38  237 134 HOH HOH C . 
I 4 HOH 39  238 135 HOH HOH C . 
I 4 HOH 40  239 136 HOH HOH C . 
I 4 HOH 41  240 148 HOH HOH C . 
I 4 HOH 42  241 151 HOH HOH C . 
I 4 HOH 43  242 152 HOH HOH C . 
I 4 HOH 44  243 156 HOH HOH C . 
I 4 HOH 45  244 158 HOH HOH C . 
I 4 HOH 46  245 161 HOH HOH C . 
I 4 HOH 47  246 162 HOH HOH C . 
I 4 HOH 48  247 164 HOH HOH C . 
I 4 HOH 49  248 166 HOH HOH C . 
I 4 HOH 50  249 167 HOH HOH C . 
I 4 HOH 51  250 170 HOH HOH C . 
I 4 HOH 52  251 171 HOH HOH C . 
I 4 HOH 53  252 172 HOH HOH C . 
I 4 HOH 54  253 174 HOH HOH C . 
I 4 HOH 55  254 176 HOH HOH C . 
I 4 HOH 56  255 177 HOH HOH C . 
I 4 HOH 57  256 181 HOH HOH C . 
I 4 HOH 58  257 182 HOH HOH C . 
I 4 HOH 59  258 183 HOH HOH C . 
I 4 HOH 60  259 186 HOH HOH C . 
I 4 HOH 61  260 189 HOH HOH C . 
I 4 HOH 62  261 190 HOH HOH C . 
I 4 HOH 63  262 191 HOH HOH C . 
I 4 HOH 64  263 194 HOH HOH C . 
I 4 HOH 65  264 197 HOH HOH C . 
I 4 HOH 66  265 200 HOH HOH C . 
I 4 HOH 67  266 202 HOH HOH C . 
I 4 HOH 68  267 203 HOH HOH C . 
I 4 HOH 69  268 207 HOH HOH C . 
I 4 HOH 70  269 208 HOH HOH C . 
I 4 HOH 71  270 212 HOH HOH C . 
I 4 HOH 72  271 214 HOH HOH C . 
I 4 HOH 73  272 221 HOH HOH C . 
I 4 HOH 74  273 225 HOH HOH C . 
I 4 HOH 75  274 227 HOH HOH C . 
I 4 HOH 76  275 229 HOH HOH C . 
I 4 HOH 77  276 231 HOH HOH C . 
I 4 HOH 78  277 232 HOH HOH C . 
I 4 HOH 79  278 233 HOH HOH C . 
I 4 HOH 80  279 235 HOH HOH C . 
I 4 HOH 81  280 236 HOH HOH C . 
I 4 HOH 82  281 240 HOH HOH C . 
I 4 HOH 83  282 244 HOH HOH C . 
I 4 HOH 84  283 246 HOH HOH C . 
I 4 HOH 85  284 247 HOH HOH C . 
I 4 HOH 86  285 249 HOH HOH C . 
I 4 HOH 87  286 254 HOH HOH C . 
I 4 HOH 88  287 255 HOH HOH C . 
I 4 HOH 89  288 256 HOH HOH C . 
I 4 HOH 90  289 257 HOH HOH C . 
I 4 HOH 91  290 259 HOH HOH C . 
I 4 HOH 92  291 261 HOH HOH C . 
I 4 HOH 93  292 262 HOH HOH C . 
I 4 HOH 94  293 263 HOH HOH C . 
I 4 HOH 95  294 265 HOH HOH C . 
I 4 HOH 96  295 268 HOH HOH C . 
I 4 HOH 97  296 273 HOH HOH C . 
I 4 HOH 98  297 274 HOH HOH C . 
I 4 HOH 99  298 275 HOH HOH C . 
I 4 HOH 100 299 278 HOH HOH C . 
I 4 HOH 101 300 279 HOH HOH C . 
I 4 HOH 102 301 280 HOH HOH C . 
I 4 HOH 103 302 281 HOH HOH C . 
I 4 HOH 104 303 284 HOH HOH C . 
I 4 HOH 105 304 285 HOH HOH C . 
I 4 HOH 106 305 287 HOH HOH C . 
I 4 HOH 107 306 288 HOH HOH C . 
I 4 HOH 108 307 292 HOH HOH C . 
I 4 HOH 109 308 295 HOH HOH C . 
I 4 HOH 110 309 296 HOH HOH C . 
I 4 HOH 111 310 297 HOH HOH C . 
I 4 HOH 112 311 301 HOH HOH C . 
I 4 HOH 113 312 303 HOH HOH C . 
I 4 HOH 114 313 305 HOH HOH C . 
I 4 HOH 115 314 306 HOH HOH C . 
I 4 HOH 116 315 309 HOH HOH C . 
I 4 HOH 117 316 310 HOH HOH C . 
I 4 HOH 118 317 311 HOH HOH C . 
I 4 HOH 119 318 313 HOH HOH C . 
I 4 HOH 120 319 314 HOH HOH C . 
I 4 HOH 121 320 315 HOH HOH C . 
I 4 HOH 122 321 316 HOH HOH C . 
I 4 HOH 123 322 317 HOH HOH C . 
I 4 HOH 124 323 320 HOH HOH C . 
I 4 HOH 125 324 323 HOH HOH C . 
I 4 HOH 126 325 326 HOH HOH C . 
I 4 HOH 127 326 328 HOH HOH C . 
I 4 HOH 128 327 330 HOH HOH C . 
I 4 HOH 129 328 333 HOH HOH C . 
I 4 HOH 130 329 339 HOH HOH C . 
I 4 HOH 131 330 340 HOH HOH C . 
I 4 HOH 132 331 341 HOH HOH C . 
I 4 HOH 133 332 342 HOH HOH C . 
I 4 HOH 134 333 348 HOH HOH C . 
I 4 HOH 135 334 353 HOH HOH C . 
I 4 HOH 136 335 354 HOH HOH C . 
I 4 HOH 137 336 359 HOH HOH C . 
I 4 HOH 138 337 362 HOH HOH C . 
I 4 HOH 139 338 370 HOH HOH C . 
I 4 HOH 140 339 376 HOH HOH C . 
I 4 HOH 141 340 388 HOH HOH C . 
I 4 HOH 142 341 389 HOH HOH C . 
I 4 HOH 143 342 390 HOH HOH C . 
I 4 HOH 144 343 391 HOH HOH C . 
I 4 HOH 145 344 392 HOH HOH C . 
I 4 HOH 146 345 395 HOH HOH C . 
I 4 HOH 147 346 396 HOH HOH C . 
I 4 HOH 148 347 397 HOH HOH C . 
I 4 HOH 149 348 398 HOH HOH C . 
I 4 HOH 150 349 402 HOH HOH C . 
I 4 HOH 151 350 405 HOH HOH C . 
I 4 HOH 152 351 417 HOH HOH C . 
I 4 HOH 153 352 420 HOH HOH C . 
I 4 HOH 154 353 421 HOH HOH C . 
I 4 HOH 155 354 422 HOH HOH C . 
I 4 HOH 156 355 423 HOH HOH C . 
I 4 HOH 157 356 425 HOH HOH C . 
I 4 HOH 158 357 428 HOH HOH C . 
I 4 HOH 159 358 429 HOH HOH C . 
I 4 HOH 160 359 432 HOH HOH C . 
I 4 HOH 161 360 436 HOH HOH C . 
I 4 HOH 162 361 438 HOH HOH C . 
I 4 HOH 163 362 443 HOH HOH C . 
I 4 HOH 164 363 444 HOH HOH C . 
I 4 HOH 165 364 445 HOH HOH C . 
I 4 HOH 166 365 446 HOH HOH C . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 8600   ? 
1 MORE         -115.4 ? 
1 'SSA (A^2)'  32660  ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z  1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 204 ? H HOH . 
2 1 C HOH 200 ? I HOH . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A ASP 159 ? A ASP 158 ? 1_555 MN ? C MN . ? A MN 198 ? 1_555 NE2 ? A HIS 27  ? A HIS 26  ? 1_555 84.8  ? 
2  OD1 ? A ASP 159 ? A ASP 158 ? 1_555 MN ? C MN . ? A MN 198 ? 1_555 NE2 ? A HIS 75  ? A HIS 74  ? 1_555 113.9 ? 
3  NE2 ? A HIS 27  ? A HIS 26  ? 1_555 MN ? C MN . ? A MN 198 ? 1_555 NE2 ? A HIS 75  ? A HIS 74  ? 1_555 90.1  ? 
4  OD1 ? A ASP 159 ? A ASP 158 ? 1_555 MN ? C MN . ? A MN 198 ? 1_555 NE2 ? A HIS 163 ? A HIS 162 ? 1_555 117.2 ? 
5  NE2 ? A HIS 27  ? A HIS 26  ? 1_555 MN ? C MN . ? A MN 198 ? 1_555 NE2 ? A HIS 163 ? A HIS 162 ? 1_555 90.5  ? 
6  NE2 ? A HIS 75  ? A HIS 74  ? 1_555 MN ? C MN . ? A MN 198 ? 1_555 NE2 ? A HIS 163 ? A HIS 162 ? 1_555 128.7 ? 
7  OD1 ? A ASP 159 ? A ASP 158 ? 1_555 MN ? C MN . ? A MN 198 ? 1_555 O   ? H HOH .   ? A HOH 202 ? 1_555 92.2  ? 
8  NE2 ? A HIS 27  ? A HIS 26  ? 1_555 MN ? C MN . ? A MN 198 ? 1_555 O   ? H HOH .   ? A HOH 202 ? 1_555 176.6 ? 
9  NE2 ? A HIS 75  ? A HIS 74  ? 1_555 MN ? C MN . ? A MN 198 ? 1_555 O   ? H HOH .   ? A HOH 202 ? 1_555 92.4  ? 
10 NE2 ? A HIS 163 ? A HIS 162 ? 1_555 MN ? C MN . ? A MN 198 ? 1_555 O   ? H HOH .   ? A HOH 202 ? 1_555 89.6  ? 
11 OD1 ? B ASP 159 ? C ASP 158 ? 1_555 MN ? F MN . ? C MN 198 ? 1_555 NE2 ? B HIS 27  ? C HIS 26  ? 1_555 84.2  ? 
12 OD1 ? B ASP 159 ? C ASP 158 ? 1_555 MN ? F MN . ? C MN 198 ? 1_555 NE2 ? B HIS 75  ? C HIS 74  ? 1_555 112.3 ? 
13 NE2 ? B HIS 27  ? C HIS 26  ? 1_555 MN ? F MN . ? C MN 198 ? 1_555 NE2 ? B HIS 75  ? C HIS 74  ? 1_555 88.9  ? 
14 OD1 ? B ASP 159 ? C ASP 158 ? 1_555 MN ? F MN . ? C MN 198 ? 1_555 NE2 ? B HIS 163 ? C HIS 162 ? 1_555 121.6 ? 
15 NE2 ? B HIS 27  ? C HIS 26  ? 1_555 MN ? F MN . ? C MN 198 ? 1_555 NE2 ? B HIS 163 ? C HIS 162 ? 1_555 89.6  ? 
16 NE2 ? B HIS 75  ? C HIS 74  ? 1_555 MN ? F MN . ? C MN 198 ? 1_555 NE2 ? B HIS 163 ? C HIS 162 ? 1_555 125.6 ? 
17 OD1 ? B ASP 159 ? C ASP 158 ? 1_555 MN ? F MN . ? C MN 198 ? 1_555 O   ? I HOH .   ? C HOH 220 ? 1_555 89.5  ? 
18 NE2 ? B HIS 27  ? C HIS 26  ? 1_555 MN ? F MN . ? C MN 198 ? 1_555 O   ? I HOH .   ? C HOH 220 ? 1_555 173.7 ? 
19 NE2 ? B HIS 75  ? C HIS 74  ? 1_555 MN ? F MN . ? C MN 198 ? 1_555 O   ? I HOH .   ? C HOH 220 ? 1_555 93.3  ? 
20 NE2 ? B HIS 163 ? C HIS 162 ? 1_555 MN ? F MN . ? C MN 198 ? 1_555 O   ? I HOH .   ? C HOH 220 ? 1_555 94.0  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-06-09 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 26.1720 5.3940  -0.9700 0.0490  0.0176 -0.0115 0.0166 0.0023 -0.0056 0.5920 0.6931 1.1730 0.1245  -0.3005 -0.4522 
-0.0452 0.0267  -0.0616 -0.0464 -0.0066 -0.1059 0.1675  0.0831  0.0518  'X-RAY DIFFRACTION' 
2 ? refined -8.5080 -3.5180 14.3350 -0.0016 0.2685 -0.0452 0.0691 0.0393 0.1226  2.5660 1.4318 3.1288 -0.8458 1.7219  -1.4417 
-0.1147 -0.7337 -0.1566 0.1666  0.5027  0.3467  -0.1798 -1.0738 -0.3879 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 1 A 2 A 197 A 198 ? 'X-RAY DIFFRACTION' ? 
2 2 C 0 B 1 C 197 B 198 ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement        5.2.0005 ? 1 
ADSC   'data collection' Quantum  ? 2 
MOSFLM 'data reduction'  .        ? 3 
SCALA  'data scaling'    .        ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN A 141 ? ? 52.23   -125.30 
2 1 TYR A 164 ? ? -149.39 -12.33  
3 1 LYS A 169 ? ? 53.60   -133.01 
4 1 ASN C 141 ? ? 51.09   -124.97 
5 1 TYR C 164 ? ? -149.05 -11.37  
6 1 LYS C 169 ? ? 52.55   -132.29 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 130 ? CG  ? A LYS 131 CG  
2  1 Y 1 A LYS 130 ? CD  ? A LYS 131 CD  
3  1 Y 1 A LYS 130 ? CE  ? A LYS 131 CE  
4  1 Y 1 A LYS 130 ? NZ  ? A LYS 131 NZ  
5  1 Y 1 C LYS 83  ? CG  ? B LYS 84  CG  
6  1 Y 1 C LYS 83  ? CD  ? B LYS 84  CD  
7  1 Y 1 C LYS 83  ? CE  ? B LYS 84  CE  
8  1 Y 1 C LYS 83  ? NZ  ? B LYS 84  NZ  
9  1 Y 1 C ASP 84  ? CG  ? B ASP 85  CG  
10 1 Y 1 C ASP 84  ? OD1 ? B ASP 85  OD1 
11 1 Y 1 C ASP 84  ? OD2 ? B ASP 85  OD2 
12 1 Y 1 C GLU 87  ? CG  ? B GLU 88  CG  
13 1 Y 1 C GLU 87  ? CD  ? B GLU 88  CD  
14 1 Y 1 C GLU 87  ? OE1 ? B GLU 88  OE1 
15 1 Y 1 C GLU 87  ? OE2 ? B GLU 88  OE2 
# 
_pdbx_unobs_or_zero_occ_residues.id               1 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_residues.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id     A 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id     MET 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id      0 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_residues.label_asym_id    A 
_pdbx_unobs_or_zero_occ_residues.label_comp_id    MET 
_pdbx_unobs_or_zero_occ_residues.label_seq_id     1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MANGANESE (II) ION' MN  
3 'SULFATE ION'        SO4 
4 water                HOH 
#