data_3DCG
# 
_entry.id   3DCG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3DCG         
RCSB  RCSB047864   
WWPDB D_1000047864 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3DCG 
_pdbx_database_status.recvd_initial_deposition_date   2008-06-03 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Stanley, B.J.' 1 
'Ehrlich, E.S.' 2 
'Short, L.'     3 
'Yu, Y.'        4 
'Xiao, Z.'      5 
'Yu, X.-F.'     6 
'Xiong, Y.'     7 
# 
_citation.id                        primary 
_citation.title                     
'Structural insight into the human immunodeficiency virus Vif SOCS box and its role in human E3 ubiquitin ligase assembly' 
_citation.journal_abbrev            J.Virol. 
_citation.journal_volume            82 
_citation.page_first                8656 
_citation.page_last                 8663 
_citation.year                      2008 
_citation.journal_id_ASTM           JOVIAM 
_citation.country                   US 
_citation.journal_id_ISSN           0022-538X 
_citation.journal_id_CSD            0825 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18562529 
_citation.pdbx_database_id_DOI      10.1128/JVI.00767-08 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Stanley, B.J.' 1 
primary 'Ehrlich, E.S.' 2 
primary 'Short, L.'     3 
primary 'Yu, Y.'        4 
primary 'Xiao, Z.'      5 
primary 'Yu, X.-F.'     6 
primary 'Xiong, Y.'     7 
# 
_cell.entry_id           3DCG 
_cell.length_a           55.514 
_cell.length_b           66.913 
_cell.length_c           122.642 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3DCG 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Transcription elongation factor B polypeptide 2' 13147.781 2   ? ? ?                      ? 
2 polymer man 'Transcription elongation factor B polypeptide 1' 10974.616 2   ? ? 'UNP residues 17-112'  ? 
3 polymer man 'Virion infectivity factor'                       4448.283  2   ? ? 'UNP residues 139-176' ? 
4 water   nat water                                             18.015    150 ? ? ?                      ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'ElonginB, RNA polymerase II transcription factor SIII subunit B, SIII p18, Elongin-B, EloB, Elongin 18 kDa subunit' 
2 'ElonginC, RNA polymerase II transcription factor SIII subunit C, SIII p15, Elongin-C, EloC, Elongin 15 kDa subunit' 
3 'Vif, SOR protein, Virion infectivity factor p17, Virion infectivity factor p7'                                      
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFR
ADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
;
;MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFR
ADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
;
A,C ? 
2 'polypeptide(L)' no no 
;MMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPI
APEIALELLMAANFLDC
;
;MMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPI
APEIALELLMAANFLDC
;
B,D ? 
3 'polypeptide(L)' no no SHNKVGSLQYLALAALIKPKQIKPPLPSVRKLTEDRWNK SHNKVGSLQYLALAALIKPKQIKPPLPSVRKLTEDRWNK E,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASP n 
1 3   VAL n 
1 4   PHE n 
1 5   LEU n 
1 6   MET n 
1 7   ILE n 
1 8   ARG n 
1 9   ARG n 
1 10  HIS n 
1 11  LYS n 
1 12  THR n 
1 13  THR n 
1 14  ILE n 
1 15  PHE n 
1 16  THR n 
1 17  ASP n 
1 18  ALA n 
1 19  LYS n 
1 20  GLU n 
1 21  SER n 
1 22  SER n 
1 23  THR n 
1 24  VAL n 
1 25  PHE n 
1 26  GLU n 
1 27  LEU n 
1 28  LYS n 
1 29  ARG n 
1 30  ILE n 
1 31  VAL n 
1 32  GLU n 
1 33  GLY n 
1 34  ILE n 
1 35  LEU n 
1 36  LYS n 
1 37  ARG n 
1 38  PRO n 
1 39  PRO n 
1 40  ASP n 
1 41  GLU n 
1 42  GLN n 
1 43  ARG n 
1 44  LEU n 
1 45  TYR n 
1 46  LYS n 
1 47  ASP n 
1 48  ASP n 
1 49  GLN n 
1 50  LEU n 
1 51  LEU n 
1 52  ASP n 
1 53  ASP n 
1 54  GLY n 
1 55  LYS n 
1 56  THR n 
1 57  LEU n 
1 58  GLY n 
1 59  GLU n 
1 60  CYS n 
1 61  GLY n 
1 62  PHE n 
1 63  THR n 
1 64  SER n 
1 65  GLN n 
1 66  THR n 
1 67  ALA n 
1 68  ARG n 
1 69  PRO n 
1 70  GLN n 
1 71  ALA n 
1 72  PRO n 
1 73  ALA n 
1 74  THR n 
1 75  VAL n 
1 76  GLY n 
1 77  LEU n 
1 78  ALA n 
1 79  PHE n 
1 80  ARG n 
1 81  ALA n 
1 82  ASP n 
1 83  ASP n 
1 84  THR n 
1 85  PHE n 
1 86  GLU n 
1 87  ALA n 
1 88  LEU n 
1 89  CYS n 
1 90  ILE n 
1 91  GLU n 
1 92  PRO n 
1 93  PHE n 
1 94  SER n 
1 95  SER n 
1 96  PRO n 
1 97  PRO n 
1 98  GLU n 
1 99  LEU n 
1 100 PRO n 
1 101 ASP n 
1 102 VAL n 
1 103 MET n 
1 104 LYS n 
1 105 PRO n 
1 106 GLN n 
1 107 ASP n 
1 108 SER n 
1 109 GLY n 
1 110 SER n 
1 111 SER n 
1 112 ALA n 
1 113 ASN n 
1 114 GLU n 
1 115 GLN n 
1 116 ALA n 
1 117 VAL n 
1 118 GLN n 
2 1   MET n 
2 2   MET n 
2 3   TYR n 
2 4   VAL n 
2 5   LYS n 
2 6   LEU n 
2 7   ILE n 
2 8   SER n 
2 9   SER n 
2 10  ASP n 
2 11  GLY n 
2 12  HIS n 
2 13  GLU n 
2 14  PHE n 
2 15  ILE n 
2 16  VAL n 
2 17  LYS n 
2 18  ARG n 
2 19  GLU n 
2 20  HIS n 
2 21  ALA n 
2 22  LEU n 
2 23  THR n 
2 24  SER n 
2 25  GLY n 
2 26  THR n 
2 27  ILE n 
2 28  LYS n 
2 29  ALA n 
2 30  MET n 
2 31  LEU n 
2 32  SER n 
2 33  GLY n 
2 34  PRO n 
2 35  GLY n 
2 36  GLN n 
2 37  PHE n 
2 38  ALA n 
2 39  GLU n 
2 40  ASN n 
2 41  GLU n 
2 42  THR n 
2 43  ASN n 
2 44  GLU n 
2 45  VAL n 
2 46  ASN n 
2 47  PHE n 
2 48  ARG n 
2 49  GLU n 
2 50  ILE n 
2 51  PRO n 
2 52  SER n 
2 53  HIS n 
2 54  VAL n 
2 55  LEU n 
2 56  SER n 
2 57  LYS n 
2 58  VAL n 
2 59  CYS n 
2 60  MET n 
2 61  TYR n 
2 62  PHE n 
2 63  THR n 
2 64  TYR n 
2 65  LYS n 
2 66  VAL n 
2 67  ARG n 
2 68  TYR n 
2 69  THR n 
2 70  ASN n 
2 71  SER n 
2 72  SER n 
2 73  THR n 
2 74  GLU n 
2 75  ILE n 
2 76  PRO n 
2 77  GLU n 
2 78  PHE n 
2 79  PRO n 
2 80  ILE n 
2 81  ALA n 
2 82  PRO n 
2 83  GLU n 
2 84  ILE n 
2 85  ALA n 
2 86  LEU n 
2 87  GLU n 
2 88  LEU n 
2 89  LEU n 
2 90  MET n 
2 91  ALA n 
2 92  ALA n 
2 93  ASN n 
2 94  PHE n 
2 95  LEU n 
2 96  ASP n 
2 97  CYS n 
3 1   SER n 
3 2   HIS n 
3 3   ASN n 
3 4   LYS n 
3 5   VAL n 
3 6   GLY n 
3 7   SER n 
3 8   LEU n 
3 9   GLN n 
3 10  TYR n 
3 11  LEU n 
3 12  ALA n 
3 13  LEU n 
3 14  ALA n 
3 15  ALA n 
3 16  LEU n 
3 17  ILE n 
3 18  LYS n 
3 19  PRO n 
3 20  LYS n 
3 21  GLN n 
3 22  ILE n 
3 23  LYS n 
3 24  PRO n 
3 25  PRO n 
3 26  LEU n 
3 27  PRO n 
3 28  SER n 
3 29  VAL n 
3 30  ARG n 
3 31  LYS n 
3 32  LEU n 
3 33  THR n 
3 34  GLU n 
3 35  ASP n 
3 36  ARG n 
3 37  TRP n 
3 38  ASN n 
3 39  LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? Human ? ElonginB                    ? ?    ? ? ? ? 'Homo sapiens'                                             
9606  ? ? ? ? ? ? ? ? 'Escherichia coli BL21' 511693 ? ? ? ? ? ? BL21 ? ? ? ? ? ? ? Plasmid ? ? ? pACYCDUET-1 ? ? 
2 1 sample ? ? ? Human ? ElonginC                    ? ?    ? ? ? ? 'Homo sapiens'                                             
9606  ? ? ? ? ? ? ? ? 'Escherichia coli BL21' 511693 ? ? ? ? ? ? BL21 ? ? ? ? ? ? ? Plasmid ? ? ? pACYCDUET-1 ? ? 
3 1 sample ? ? ? HIV-1 ? 'Virion Infectivity Factor' ? HXB3 ? ? ? ? 'Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE)' 
11698 ? ? ? ? ? ? ? ? 'Escherichia coli BL21' 511693 ? ? ? ? ? ? BL21 ? ? ? ? ? ? ? Plasmid ? ? ? pETDUET-1   ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP ELOB_HUMAN Q15370 1 
;MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFR
ADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
;
1   ? 
2 UNP ELOC_HUMAN Q15369 2 
;MYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIA
PEIALELLMAANFLDC
;
17  ? 
3 UNP VIF_HV1N5  P12504 3 HNKVGSLQYLALAALIKPKQIKPPLPSVRKLTEDRWNK 139 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3DCG A 1 ? 118 ? Q15370 1   ? 118 ? 1   118 
2 2 3DCG B 2 ? 97  ? Q15369 17  ? 112 ? 17  112 
3 1 3DCG C 1 ? 118 ? Q15370 1   ? 118 ? 1   118 
4 2 3DCG D 2 ? 97  ? Q15369 17  ? 112 ? 17  112 
5 3 3DCG E 2 ? 39  ? P12504 139 ? 176 ? 139 176 
6 3 3DCG F 2 ? 39  ? P12504 139 ? 176 ? 139 176 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
2 3DCG MET B 1 ? UNP Q15369 ? ? 'INITIATING METHIONINE' 16  1 
4 3DCG MET D 1 ? UNP Q15369 ? ? 'INITIATING METHIONINE' 16  2 
5 3DCG SER E 1 ? UNP P12504 ? ? 'EXPRESSION TAG'        138 3 
6 3DCG SER F 1 ? UNP P12504 ? ? 'EXPRESSION TAG'        138 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3DCG 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.99 
_exptl_crystal.density_percent_sol   38.29 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    '0.1M Tris HCl pH 7.0, 40% PEG 350 MME, VAPOR DIFFUSION, SITTING DROP, temperature 295K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2008-03-30 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    Si 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9794 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 24-ID-C' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-C 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9794 
# 
_reflns.entry_id                     3DCG 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   -3 
_reflns.d_resolution_high            2.4 
_reflns.d_resolution_low             29.37 
_reflns.number_all                   ? 
_reflns.number_obs                   18219 
_reflns.percent_possible_obs         98.2 
_reflns.pdbx_Rmerge_I_obs            0.096 
_reflns.pdbx_Rsym_value              0.096 
_reflns.pdbx_netI_over_sigmaI        11.7 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.40 
_reflns_shell.d_res_low              2.49 
_reflns_shell.percent_possible_all   97.3 
_reflns_shell.Rmerge_I_obs           0.441 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.5 
_reflns_shell.pdbx_redundancy        3.3 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1762 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3DCG 
_refine.ls_number_reflns_obs                     17246 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.37 
_refine.ls_d_res_high                            2.40 
_refine.ls_percent_reflns_obs                    98.12 
_refine.ls_R_factor_obs                          0.18826 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.18603 
_refine.ls_R_factor_R_free                       0.23228 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  895 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.951 
_refine.correlation_coeff_Fo_to_Fc_free          0.924 
_refine.B_iso_mean                               41.623 
_refine.aniso_B[1][1]                            -0.16 
_refine.aniso_B[2][2]                            0.74 
_refine.aniso_B[3][3]                            -0.58 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             1.00 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1vcb' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.414 
_refine.pdbx_overall_ESU_R_Free                  0.250 
_refine.overall_SU_ML                            0.172 
_refine.overall_SU_B                             14.777 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3154 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             150 
_refine_hist.number_atoms_total               3304 
_refine_hist.d_res_high                       2.40 
_refine_hist.d_res_low                        29.37 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.008  0.022  ? 3211 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.132  1.989  ? 4331 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.903  5.000  ? 388  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       37.849 23.824 ? 136  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       18.130 15.000 ? 579  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       15.182 15.000 ? 20   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.070  0.200  ? 501  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.003  0.020  ? 2356 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.191  0.200  ? 1386 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.306  0.200  ? 2159 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.157  0.200  ? 168  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.189  0.200  ? 38   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.213  0.200  ? 8    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.900  4.000  ? 2046 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 2.556  6.000  ? 3229 'X-RAY DIFFRACTION' ? 
r_scbond_it                  3.048  6.000  ? 1283 'X-RAY DIFFRACTION' ? 
r_scangle_it                 4.485  9.000  ? 1102 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 1 'LOOSE POSITIONAL' A 747 0.370 5.000  'X-RAY DIFFRACTION' 1 ? ? ? 
1 1 'LOOSE THERMAL'    A 747 2.100 10.000 'X-RAY DIFFRACTION' 2 ? ? ? 
2 1 'LOOSE POSITIONAL' B 647 0.420 5.000  'X-RAY DIFFRACTION' 3 ? ? ? 
2 1 'LOOSE THERMAL'    B 647 1.580 10.000 'X-RAY DIFFRACTION' 4 ? ? ? 
3 1 'LOOSE POSITIONAL' E 119 0.580 5.000  'X-RAY DIFFRACTION' 5 ? ? ? 
3 1 'LOOSE THERMAL'    E 119 1.330 10.000 'X-RAY DIFFRACTION' 6 ? ? ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.400 
_refine_ls_shell.d_res_low                        2.462 
_refine_ls_shell.number_reflns_R_work             1216 
_refine_ls_shell.R_factor_R_work                  0.192 
_refine_ls_shell.percent_reflns_obs               96.90 
_refine_ls_shell.R_factor_R_free                  0.276 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             65 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 A 
1 2 C 
2 1 B 
2 2 D 
3 1 E 
3 2 F 
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
1 1 1 A 1  A 80 6 . . MET ARG A 1   A 80  ? 
1 2 1 C 1  C 80 6 . . MET ARG C 1   C 80  ? 
1 1 2 A 85 A 98 6 . . PHE GLU A 85  A 98  ? 
1 2 2 C 85 C 98 6 . . PHE GLU C 85  C 98  ? 
2 1 1 B 2  B 31 6 . . MET LEU B 17  B 46  ? 
2 2 1 D 2  D 31 6 . . MET LEU D 17  D 46  ? 
2 1 2 B 44 B 68 6 . . GLU TYR B 59  B 83  ? 
2 2 2 D 44 D 68 6 . . GLU TYR D 59  D 83  ? 
2 1 3 B 74 B 97 6 . . GLU CYS B 89  B 112 ? 
2 2 3 D 74 D 97 6 . . GLU CYS D 89  D 112 ? 
2 1 4 B 31 B 43 6 . . LEU ASN B 46  B 58  ? 
2 2 4 D 32 D 43 6 . . SER ASN D 47  D 58  ? 
3 1 1 E 3  E 18 6 . . ASN LYS E 140 E 155 ? 
3 2 1 F 3  F 18 6 . . ASN LYS F 140 F 155 ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
3 ? 
# 
_struct.entry_id                  3DCG 
_struct.title                     'Crystal Structure of the HIV Vif BC-box in Complex with Human ElonginB and ElonginC' 
_struct.pdbx_descriptor           
'Transcription elongation factor B polypeptide 2, Transcription elongation factor B polypeptide 1, Virion infectivity factor' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3DCG 
_struct_keywords.pdbx_keywords   'LIGASE/VIRAL PROTEIN' 
_struct_keywords.text            
;HIV, Vif, AIDS, Host-virus interaction, Membrane, Phosphoprotein, RNA-binding, Ubl conjugation pathway, Virion, Nucleus, Transcription, Transcription regulation, LIGASE-VIRAL PROTEIN COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
K N N 4 ? 
L N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 23 ? LYS A 36 ? THR A 23  LYS A 36  1 ? 14 
HELX_P HELX_P2  2  PRO A 38 ? ASP A 40 ? PRO A 38  ASP A 40  5 ? 3  
HELX_P HELX_P3  3  ARG B 18 ? LEU B 22 ? ARG B 33  LEU B 37  1 ? 5  
HELX_P HELX_P4  4  SER B 24 ? LEU B 31 ? SER B 39  LEU B 46  1 ? 8  
HELX_P HELX_P5  5  PRO B 51 ? THR B 69 ? PRO B 66  THR B 84  1 ? 19 
HELX_P HELX_P6  6  ILE B 84 ? ASP B 96 ? ILE B 99  ASP B 111 1 ? 13 
HELX_P HELX_P7  7  THR C 23 ? LYS C 36 ? THR C 23  LYS C 36  1 ? 14 
HELX_P HELX_P8  8  PRO C 38 ? ASP C 40 ? PRO C 38  ASP C 40  5 ? 3  
HELX_P HELX_P9  9  ARG D 18 ? LEU D 22 ? ARG D 33  LEU D 37  1 ? 5  
HELX_P HELX_P10 10 SER D 24 ? LEU D 31 ? SER D 39  LEU D 46  1 ? 8  
HELX_P HELX_P11 11 PRO D 51 ? THR D 69 ? PRO D 66  THR D 84  1 ? 19 
HELX_P HELX_P12 12 ALA D 81 ? ASP D 96 ? ALA D 96  ASP D 111 1 ? 16 
HELX_P HELX_P13 13 SER E 7  ? LYS E 18 ? SER E 144 LYS E 155 1 ? 12 
HELX_P HELX_P14 14 SER F 7  ? LYS F 18 ? SER F 144 LYS F 155 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 8 ? 
B ? 8 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? anti-parallel 
A 5 6 ? parallel      
A 6 7 ? anti-parallel 
A 7 8 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
B 4 5 ? anti-parallel 
B 5 6 ? parallel      
B 6 7 ? anti-parallel 
B 7 8 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 49 ? LEU A 50 ? GLN A 49 LEU A 50 
A 2 GLN A 42 ? LYS A 46 ? GLN A 42 LYS A 46 
A 3 ALA A 73 ? PHE A 79 ? ALA A 73 PHE A 79 
A 4 ASP A 2  ? ARG A 9  ? ASP A 2  ARG A 9  
A 5 THR A 12 ? LYS A 19 ? THR A 12 LYS A 19 
A 6 GLU B 13 ? LYS B 17 ? GLU B 28 LYS B 32 
A 7 TYR B 3  ? ILE B 7  ? TYR B 18 ILE B 22 
A 8 GLU B 44 ? ASN B 46 ? GLU B 59 ASN B 61 
B 1 GLN C 49 ? LEU C 50 ? GLN C 49 LEU C 50 
B 2 GLN C 42 ? LYS C 46 ? GLN C 42 LYS C 46 
B 3 ALA C 73 ? PHE C 79 ? ALA C 73 PHE C 79 
B 4 ASP C 2  ? ARG C 9  ? ASP C 2  ARG C 9  
B 5 THR C 12 ? LYS C 19 ? THR C 12 LYS C 19 
B 6 GLU D 13 ? LYS D 17 ? GLU D 28 LYS D 32 
B 7 TYR D 3  ? ILE D 7  ? TYR D 18 ILE D 22 
B 8 GLU D 44 ? ASN D 46 ? GLU D 59 ASN D 61 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLN A 49 ? O GLN A 49 N LYS A 46 ? N LYS A 46 
A 2 3 N TYR A 45 ? N TYR A 45 O GLY A 76 ? O GLY A 76 
A 3 4 O VAL A 75 ? O VAL A 75 N ARG A 8  ? N ARG A 8  
A 4 5 N LEU A 5  ? N LEU A 5  O THR A 16 ? O THR A 16 
A 5 6 N THR A 13 ? N THR A 13 O ILE B 15 ? O ILE B 30 
A 6 7 O VAL B 16 ? O VAL B 31 N VAL B 4  ? N VAL B 19 
A 7 8 N LYS B 5  ? N LYS B 20 O VAL B 45 ? O VAL B 60 
B 1 2 O GLN C 49 ? O GLN C 49 N LYS C 46 ? N LYS C 46 
B 2 3 N TYR C 45 ? N TYR C 45 O GLY C 76 ? O GLY C 76 
B 3 4 O VAL C 75 ? O VAL C 75 N ARG C 8  ? N ARG C 8  
B 4 5 N ARG C 9  ? N ARG C 9  O THR C 12 ? O THR C 12 
B 5 6 N THR C 13 ? N THR C 13 O ILE D 15 ? O ILE D 30 
B 6 7 O VAL D 16 ? O VAL D 31 N VAL D 4  ? N VAL D 19 
B 7 8 N ILE D 7  ? N ILE D 22 O VAL D 45 ? O VAL D 60 
# 
_database_PDB_matrix.entry_id          3DCG 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3DCG 
_atom_sites.fract_transf_matrix[1][1]   0.018013 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014945 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008154 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . MET A 1 1   ? 7.974  15.154  5.587   1.00 42.61 ? 1   MET A N   1 
ATOM   2    C CA  . MET A 1 1   ? 8.259  14.450  6.868   1.00 43.22 ? 1   MET A CA  1 
ATOM   3    C C   . MET A 1 1   ? 9.705  13.967  6.905   1.00 40.84 ? 1   MET A C   1 
ATOM   4    O O   . MET A 1 1   ? 10.343 13.812  5.861   1.00 39.06 ? 1   MET A O   1 
ATOM   5    C CB  . MET A 1 1   ? 7.286  13.287  7.064   1.00 46.21 ? 1   MET A CB  1 
ATOM   6    C CG  . MET A 1 1   ? 6.774  13.128  8.501   1.00 54.03 ? 1   MET A CG  1 
ATOM   7    S SD  . MET A 1 1   ? 5.422  11.933  8.707   1.00 60.27 ? 1   MET A SD  1 
ATOM   8    C CE  . MET A 1 1   ? 4.288  12.464  7.424   1.00 55.57 ? 1   MET A CE  1 
ATOM   9    N N   . ASP A 1 2   ? 10.223 13.740  8.108   1.00 39.01 ? 2   ASP A N   1 
ATOM   10   C CA  . ASP A 1 2   ? 11.627 13.367  8.272   1.00 39.72 ? 2   ASP A CA  1 
ATOM   11   C C   . ASP A 1 2   ? 11.877 11.912  7.911   1.00 37.76 ? 2   ASP A C   1 
ATOM   12   O O   . ASP A 1 2   ? 11.039 11.053  8.163   1.00 36.60 ? 2   ASP A O   1 
ATOM   13   C CB  . ASP A 1 2   ? 12.107 13.641  9.700   1.00 42.50 ? 2   ASP A CB  1 
ATOM   14   C CG  . ASP A 1 2   ? 12.160 15.122  10.027  1.00 45.96 ? 2   ASP A CG  1 
ATOM   15   O OD1 . ASP A 1 2   ? 12.165 15.957  9.098   1.00 50.22 ? 2   ASP A OD1 1 
ATOM   16   O OD2 . ASP A 1 2   ? 12.201 15.457  11.224  1.00 51.84 ? 2   ASP A OD2 1 
ATOM   17   N N   . VAL A 1 3   ? 13.027 11.654  7.297   1.00 35.40 ? 3   VAL A N   1 
ATOM   18   C CA  . VAL A 1 3   ? 13.454 10.298  7.014   1.00 34.72 ? 3   VAL A CA  1 
ATOM   19   C C   . VAL A 1 3   ? 14.755 10.013  7.771   1.00 36.45 ? 3   VAL A C   1 
ATOM   20   O O   . VAL A 1 3   ? 15.564 10.916  7.996   1.00 34.87 ? 3   VAL A O   1 
ATOM   21   C CB  . VAL A 1 3   ? 13.613 10.028  5.492   1.00 34.71 ? 3   VAL A CB  1 
ATOM   22   C CG1 . VAL A 1 3   ? 12.272 10.102  4.802   1.00 34.72 ? 3   VAL A CG1 1 
ATOM   23   C CG2 . VAL A 1 3   ? 14.604 10.982  4.848   1.00 31.75 ? 3   VAL A CG2 1 
ATOM   24   N N   . PHE A 1 4   ? 14.942 8.760   8.175   1.00 34.80 ? 4   PHE A N   1 
ATOM   25   C CA  . PHE A 1 4   ? 16.086 8.397   8.996   1.00 32.32 ? 4   PHE A CA  1 
ATOM   26   C C   . PHE A 1 4   ? 16.898 7.364   8.254   1.00 33.70 ? 4   PHE A C   1 
ATOM   27   O O   . PHE A 1 4   ? 16.352 6.428   7.666   1.00 32.48 ? 4   PHE A O   1 
ATOM   28   C CB  . PHE A 1 4   ? 15.619 7.915   10.367  1.00 32.39 ? 4   PHE A CB  1 
ATOM   29   C CG  . PHE A 1 4   ? 14.848 8.962   11.129  1.00 29.86 ? 4   PHE A CG  1 
ATOM   30   C CD1 . PHE A 1 4   ? 13.489 9.157   10.895  1.00 28.89 ? 4   PHE A CD1 1 
ATOM   31   C CD2 . PHE A 1 4   ? 15.490 9.778   12.047  1.00 31.58 ? 4   PHE A CD2 1 
ATOM   32   C CE1 . PHE A 1 4   ? 12.780 10.134  11.578  1.00 28.70 ? 4   PHE A CE1 1 
ATOM   33   C CE2 . PHE A 1 4   ? 14.786 10.756  12.740  1.00 29.61 ? 4   PHE A CE2 1 
ATOM   34   C CZ  . PHE A 1 4   ? 13.430 10.931  12.504  1.00 29.40 ? 4   PHE A CZ  1 
ATOM   35   N N   . LEU A 1 5   ? 18.208 7.570   8.256   1.00 34.83 ? 5   LEU A N   1 
ATOM   36   C CA  . LEU A 1 5   ? 19.095 6.894   7.329   1.00 37.15 ? 5   LEU A CA  1 
ATOM   37   C C   . LEU A 1 5   ? 20.359 6.387   7.992   1.00 37.29 ? 5   LEU A C   1 
ATOM   38   O O   . LEU A 1 5   ? 20.899 7.029   8.887   1.00 37.65 ? 5   LEU A O   1 
ATOM   39   C CB  . LEU A 1 5   ? 19.472 7.842   6.182   1.00 36.56 ? 5   LEU A CB  1 
ATOM   40   C CG  . LEU A 1 5   ? 18.347 8.578   5.440   1.00 39.66 ? 5   LEU A CG  1 
ATOM   41   C CD1 . LEU A 1 5   ? 18.913 9.674   4.555   1.00 41.38 ? 5   LEU A CD1 1 
ATOM   42   C CD2 . LEU A 1 5   ? 17.453 7.639   4.635   1.00 37.11 ? 5   LEU A CD2 1 
ATOM   43   N N   . MET A 1 6   ? 20.817 5.224   7.543   1.00 37.37 ? 6   MET A N   1 
ATOM   44   C CA  . MET A 1 6   ? 22.149 4.747   7.848   1.00 36.94 ? 6   MET A CA  1 
ATOM   45   C C   . MET A 1 6   ? 22.931 4.915   6.552   1.00 36.02 ? 6   MET A C   1 
ATOM   46   O O   . MET A 1 6   ? 22.671 4.215   5.586   1.00 38.00 ? 6   MET A O   1 
ATOM   47   C CB  . MET A 1 6   ? 22.125 3.268   8.234   1.00 38.12 ? 6   MET A CB  1 
ATOM   48   C CG  . MET A 1 6   ? 21.540 2.953   9.593   1.00 44.19 ? 6   MET A CG  1 
ATOM   49   S SD  . MET A 1 6   ? 21.730 1.209   10.067  1.00 48.36 ? 6   MET A SD  1 
ATOM   50   C CE  . MET A 1 6   ? 20.695 0.370   8.861   1.00 45.34 ? 6   MET A CE  1 
ATOM   51   N N   . ILE A 1 7   ? 23.872 5.853   6.515   1.00 36.31 ? 7   ILE A N   1 
ATOM   52   C CA  . ILE A 1 7   ? 24.766 5.962   5.365   1.00 33.71 ? 7   ILE A CA  1 
ATOM   53   C C   . ILE A 1 7   ? 25.962 5.043   5.596   1.00 34.37 ? 7   ILE A C   1 
ATOM   54   O O   . ILE A 1 7   ? 26.689 5.181   6.574   1.00 35.39 ? 7   ILE A O   1 
ATOM   55   C CB  . ILE A 1 7   ? 25.169 7.423   5.061   1.00 32.57 ? 7   ILE A CB  1 
ATOM   56   C CG1 . ILE A 1 7   ? 23.895 8.268   4.870   1.00 35.35 ? 7   ILE A CG1 1 
ATOM   57   C CG2 . ILE A 1 7   ? 26.060 7.467   3.791   1.00 29.22 ? 7   ILE A CG2 1 
ATOM   58   C CD1 . ILE A 1 7   ? 24.084 9.764   4.834   1.00 36.28 ? 7   ILE A CD1 1 
ATOM   59   N N   . ARG A 1 8   ? 26.147 4.079   4.705   1.00 35.19 ? 8   ARG A N   1 
ATOM   60   C CA  . ARG A 1 8   ? 27.098 3.004   4.975   1.00 33.97 ? 8   ARG A CA  1 
ATOM   61   C C   . ARG A 1 8   ? 28.154 2.882   3.890   1.00 34.68 ? 8   ARG A C   1 
ATOM   62   O O   . ARG A 1 8   ? 27.829 2.799   2.700   1.00 33.02 ? 8   ARG A O   1 
ATOM   63   C CB  . ARG A 1 8   ? 26.367 1.669   5.180   1.00 32.82 ? 8   ARG A CB  1 
ATOM   64   C CG  . ARG A 1 8   ? 25.258 1.705   6.261   1.00 33.19 ? 8   ARG A CG  1 
ATOM   65   C CD  . ARG A 1 8   ? 24.963 0.321   6.813   1.00 33.24 ? 8   ARG A CD  1 
ATOM   66   N NE  . ARG A 1 8   ? 26.195 -0.269  7.309   1.00 39.08 ? 8   ARG A NE  1 
ATOM   67   C CZ  . ARG A 1 8   ? 26.480 -1.564  7.290   1.00 39.88 ? 8   ARG A CZ  1 
ATOM   68   N NH1 . ARG A 1 8   ? 25.611 -2.439  6.807   1.00 39.99 ? 8   ARG A NH1 1 
ATOM   69   N NH2 . ARG A 1 8   ? 27.650 -1.979  7.754   1.00 42.42 ? 8   ARG A NH2 1 
ATOM   70   N N   . ARG A 1 9   ? 29.414 2.927   4.324   1.00 33.52 ? 9   ARG A N   1 
ATOM   71   C CA  . ARG A 1 9   ? 30.562 2.543   3.513   1.00 34.18 ? 9   ARG A CA  1 
ATOM   72   C C   . ARG A 1 9   ? 31.524 1.707   4.359   1.00 34.16 ? 9   ARG A C   1 
ATOM   73   O O   . ARG A 1 9   ? 31.928 2.116   5.455   1.00 33.11 ? 9   ARG A O   1 
ATOM   74   C CB  . ARG A 1 9   ? 31.297 3.754   2.941   1.00 36.44 ? 9   ARG A CB  1 
ATOM   75   C CG  . ARG A 1 9   ? 32.513 3.333   2.119   1.00 39.73 ? 9   ARG A CG  1 
ATOM   76   C CD  . ARG A 1 9   ? 33.133 4.466   1.342   1.00 45.79 ? 9   ARG A CD  1 
ATOM   77   N NE  . ARG A 1 9   ? 34.396 4.893   1.929   1.00 55.29 ? 9   ARG A NE  1 
ATOM   78   C CZ  . ARG A 1 9   ? 35.584 4.359   1.652   1.00 58.84 ? 9   ARG A CZ  1 
ATOM   79   N NH1 . ARG A 1 9   ? 35.704 3.360   0.783   1.00 60.78 ? 9   ARG A NH1 1 
ATOM   80   N NH2 . ARG A 1 9   ? 36.663 4.834   2.251   1.00 61.94 ? 9   ARG A NH2 1 
ATOM   81   N N   . HIS A 1 10  ? 31.890 0.546   3.824   1.00 34.45 ? 10  HIS A N   1 
ATOM   82   C CA  . HIS A 1 10  ? 32.750 -0.433  4.490   1.00 36.15 ? 10  HIS A CA  1 
ATOM   83   C C   . HIS A 1 10  ? 32.302 -0.705  5.935   1.00 35.67 ? 10  HIS A C   1 
ATOM   84   O O   . HIS A 1 10  ? 31.228 -1.276  6.138   1.00 35.38 ? 10  HIS A O   1 
ATOM   85   C CB  . HIS A 1 10  ? 34.240 -0.074  4.365   1.00 36.65 ? 10  HIS A CB  1 
ATOM   86   C CG  . HIS A 1 10  ? 35.157 -1.244  4.581   1.00 44.55 ? 10  HIS A CG  1 
ATOM   87   N ND1 . HIS A 1 10  ? 36.096 -1.283  5.590   1.00 47.46 ? 10  HIS A ND1 1 
ATOM   88   C CD2 . HIS A 1 10  ? 35.257 -2.429  3.931   1.00 45.76 ? 10  HIS A CD2 1 
ATOM   89   C CE1 . HIS A 1 10  ? 36.746 -2.432  5.544   1.00 47.43 ? 10  HIS A CE1 1 
ATOM   90   N NE2 . HIS A 1 10  ? 36.253 -3.147  4.548   1.00 47.97 ? 10  HIS A NE2 1 
ATOM   91   N N   . LYS A 1 11  ? 33.095 -0.287  6.920   1.00 35.16 ? 11  LYS A N   1 
ATOM   92   C CA  . LYS A 1 11  ? 32.733 -0.481  8.335   1.00 35.49 ? 11  LYS A CA  1 
ATOM   93   C C   . LYS A 1 11  ? 32.321 0.816   9.054   1.00 34.00 ? 11  LYS A C   1 
ATOM   94   O O   . LYS A 1 11  ? 32.432 0.927   10.277  1.00 34.17 ? 11  LYS A O   1 
ATOM   95   C CB  . LYS A 1 11  ? 33.861 -1.196  9.083   1.00 35.41 ? 11  LYS A CB  1 
ATOM   96   C CG  . LYS A 1 11  ? 33.978 -2.682  8.732   1.00 37.32 ? 11  LYS A CG  1 
ATOM   97   C CD  . LYS A 1 11  ? 35.316 -3.227  9.135   1.00 38.13 ? 11  LYS A CD  1 
ATOM   98   C CE  . LYS A 1 11  ? 35.324 -3.700  10.575  1.00 43.36 ? 11  LYS A CE  1 
ATOM   99   N NZ  . LYS A 1 11  ? 35.303 -5.188  10.660  1.00 45.98 ? 11  LYS A NZ  1 
ATOM   100  N N   . THR A 1 12  ? 31.837 1.784   8.280   1.00 34.64 ? 12  THR A N   1 
ATOM   101  C CA  . THR A 1 12  ? 31.400 3.090   8.791   1.00 33.89 ? 12  THR A CA  1 
ATOM   102  C C   . THR A 1 12  ? 29.906 3.285   8.510   1.00 33.65 ? 12  THR A C   1 
ATOM   103  O O   . THR A 1 12  ? 29.457 3.133   7.375   1.00 31.53 ? 12  THR A O   1 
ATOM   104  C CB  . THR A 1 12  ? 32.227 4.242   8.149   1.00 34.15 ? 12  THR A CB  1 
ATOM   105  O OG1 . THR A 1 12  ? 33.604 4.124   8.541   1.00 37.57 ? 12  THR A OG1 1 
ATOM   106  C CG2 . THR A 1 12  ? 31.708 5.610   8.578   1.00 35.65 ? 12  THR A CG2 1 
ATOM   107  N N   . THR A 1 13  ? 29.150 3.602   9.560   1.00 35.08 ? 13  THR A N   1 
ATOM   108  C CA  . THR A 1 13  ? 27.730 3.911   9.465   1.00 31.37 ? 13  THR A CA  1 
ATOM   109  C C   . THR A 1 13  ? 27.467 5.291   10.053  1.00 31.94 ? 13  THR A C   1 
ATOM   110  O O   . THR A 1 13  ? 27.815 5.567   11.203  1.00 31.40 ? 13  THR A O   1 
ATOM   111  C CB  . THR A 1 13  ? 26.883 2.879   10.230  1.00 33.07 ? 13  THR A CB  1 
ATOM   112  O OG1 . THR A 1 13  ? 27.128 1.576   9.693   1.00 32.56 ? 13  THR A OG1 1 
ATOM   113  C CG2 . THR A 1 13  ? 25.361 3.210   10.130  1.00 29.44 ? 13  THR A CG2 1 
ATOM   114  N N   . ILE A 1 14  ? 26.874 6.160   9.247   1.00 32.59 ? 14  ILE A N   1 
ATOM   115  C CA  . ILE A 1 14  ? 26.439 7.469   9.700   1.00 31.69 ? 14  ILE A CA  1 
ATOM   116  C C   . ILE A 1 14  ? 24.927 7.417   9.941   1.00 32.13 ? 14  ILE A C   1 
ATOM   117  O O   . ILE A 1 14  ? 24.146 7.209   9.007   1.00 31.36 ? 14  ILE A O   1 
ATOM   118  C CB  . ILE A 1 14  ? 26.763 8.562   8.661   1.00 32.42 ? 14  ILE A CB  1 
ATOM   119  C CG1 . ILE A 1 14  ? 28.279 8.728   8.488   1.00 37.18 ? 14  ILE A CG1 1 
ATOM   120  C CG2 . ILE A 1 14  ? 26.132 9.895   9.060   1.00 33.04 ? 14  ILE A CG2 1 
ATOM   121  C CD1 . ILE A 1 14  ? 28.672 9.521   7.230   1.00 36.05 ? 14  ILE A CD1 1 
ATOM   122  N N   . PHE A 1 15  ? 24.524 7.583   11.195  1.00 33.32 ? 15  PHE A N   1 
ATOM   123  C CA  . PHE A 1 15  ? 23.115 7.715   11.526  1.00 34.59 ? 15  PHE A CA  1 
ATOM   124  C C   . PHE A 1 15  ? 22.749 9.177   11.412  1.00 34.77 ? 15  PHE A C   1 
ATOM   125  O O   . PHE A 1 15  ? 23.230 10.012  12.181  1.00 33.98 ? 15  PHE A O   1 
ATOM   126  C CB  . PHE A 1 15  ? 22.813 7.212   12.936  1.00 34.95 ? 15  PHE A CB  1 
ATOM   127  C CG  . PHE A 1 15  ? 22.647 5.721   13.029  1.00 38.10 ? 15  PHE A CG  1 
ATOM   128  C CD1 . PHE A 1 15  ? 23.753 4.891   13.204  1.00 36.46 ? 15  PHE A CD1 1 
ATOM   129  C CD2 . PHE A 1 15  ? 21.375 5.143   12.973  1.00 40.93 ? 15  PHE A CD2 1 
ATOM   130  C CE1 . PHE A 1 15  ? 23.599 3.499   13.300  1.00 38.68 ? 15  PHE A CE1 1 
ATOM   131  C CE2 . PHE A 1 15  ? 21.213 3.753   13.071  1.00 39.97 ? 15  PHE A CE2 1 
ATOM   132  C CZ  . PHE A 1 15  ? 22.328 2.932   13.226  1.00 35.94 ? 15  PHE A CZ  1 
ATOM   133  N N   . THR A 1 16  ? 21.898 9.475   10.438  1.00 36.19 ? 16  THR A N   1 
ATOM   134  C CA  . THR A 1 16  ? 21.475 10.843  10.181  1.00 37.51 ? 16  THR A CA  1 
ATOM   135  C C   . THR A 1 16  ? 20.015 10.900  9.745   1.00 37.52 ? 16  THR A C   1 
ATOM   136  O O   . THR A 1 16  ? 19.396 9.877   9.497   1.00 38.20 ? 16  THR A O   1 
ATOM   137  C CB  . THR A 1 16  ? 22.391 11.526  9.120   1.00 38.61 ? 16  THR A CB  1 
ATOM   138  O OG1 . THR A 1 16  ? 22.143 12.931  9.112   1.00 35.89 ? 16  THR A OG1 1 
ATOM   139  C CG2 . THR A 1 16  ? 22.173 10.938  7.712   1.00 35.50 ? 16  THR A CG2 1 
ATOM   140  N N   . ASP A 1 17  ? 19.481 12.109  9.648   1.00 38.71 ? 17  ASP A N   1 
ATOM   141  C CA  . ASP A 1 17  ? 18.111 12.321  9.230   1.00 39.22 ? 17  ASP A CA  1 
ATOM   142  C C   . ASP A 1 17  ? 18.037 13.487  8.249   1.00 39.73 ? 17  ASP A C   1 
ATOM   143  O O   . ASP A 1 17  ? 18.904 14.356  8.233   1.00 41.07 ? 17  ASP A O   1 
ATOM   144  C CB  . ASP A 1 17  ? 17.198 12.556  10.444  1.00 40.42 ? 17  ASP A CB  1 
ATOM   145  C CG  . ASP A 1 17  ? 17.738 13.608  11.393  1.00 45.84 ? 17  ASP A CG  1 
ATOM   146  O OD1 . ASP A 1 17  ? 18.390 13.236  12.393  1.00 51.38 ? 17  ASP A OD1 1 
ATOM   147  O OD2 . ASP A 1 17  ? 17.521 14.809  11.141  1.00 49.10 ? 17  ASP A OD2 1 
ATOM   148  N N   . ALA A 1 18  ? 17.001 13.479  7.424   1.00 37.32 ? 18  ALA A N   1 
ATOM   149  C CA  . ALA A 1 18  ? 16.781 14.507  6.428   1.00 38.47 ? 18  ALA A CA  1 
ATOM   150  C C   . ALA A 1 18  ? 15.278 14.616  6.217   1.00 36.69 ? 18  ALA A C   1 
ATOM   151  O O   . ALA A 1 18  ? 14.508 13.979  6.921   1.00 38.40 ? 18  ALA A O   1 
ATOM   152  C CB  . ALA A 1 18  ? 17.493 14.138  5.127   1.00 37.16 ? 18  ALA A CB  1 
ATOM   153  N N   . LYS A 1 19  ? 14.860 15.433  5.266   1.00 36.83 ? 19  LYS A N   1 
ATOM   154  C CA  . LYS A 1 19  ? 13.453 15.492  4.908   1.00 38.20 ? 19  LYS A CA  1 
ATOM   155  C C   . LYS A 1 19  ? 13.235 14.692  3.629   1.00 37.29 ? 19  LYS A C   1 
ATOM   156  O O   . LYS A 1 19  ? 14.161 14.538  2.831   1.00 38.62 ? 19  LYS A O   1 
ATOM   157  C CB  . LYS A 1 19  ? 12.998 16.945  4.724   1.00 38.62 ? 19  LYS A CB  1 
ATOM   158  C CG  . LYS A 1 19  ? 13.471 17.905  5.812   1.00 39.81 ? 19  LYS A CG  1 
ATOM   159  C CD  . LYS A 1 19  ? 12.386 18.877  6.248   1.00 49.90 ? 19  LYS A CD  1 
ATOM   160  C CE  . LYS A 1 19  ? 11.376 18.196  7.192   1.00 54.32 ? 19  LYS A CE  1 
ATOM   161  N NZ  . LYS A 1 19  ? 10.684 19.138  8.127   1.00 55.43 ? 19  LYS A NZ  1 
ATOM   162  N N   . GLU A 1 20  ? 12.016 14.183  3.447   1.00 35.52 ? 20  GLU A N   1 
ATOM   163  C CA  . GLU A 1 20  ? 11.574 13.590  2.176   1.00 35.04 ? 20  GLU A CA  1 
ATOM   164  C C   . GLU A 1 20  ? 11.776 14.554  0.999   1.00 33.64 ? 20  GLU A C   1 
ATOM   165  O O   . GLU A 1 20  ? 11.996 14.122  -0.139  1.00 34.02 ? 20  GLU A O   1 
ATOM   166  C CB  . GLU A 1 20  ? 10.085 13.225  2.244   1.00 34.21 ? 20  GLU A CB  1 
ATOM   167  C CG  . GLU A 1 20  ? 9.735  12.058  3.161   1.00 38.38 ? 20  GLU A CG  1 
ATOM   168  C CD  . GLU A 1 20  ? 8.243  11.968  3.460   1.00 40.83 ? 20  GLU A CD  1 
ATOM   169  O OE1 . GLU A 1 20  ? 7.609  13.026  3.692   1.00 41.74 ? 20  GLU A OE1 1 
ATOM   170  O OE2 . GLU A 1 20  ? 7.703  10.839  3.474   1.00 40.81 ? 20  GLU A OE2 1 
ATOM   171  N N   . SER A 1 21  ? 11.672 15.852  1.285   1.00 29.44 ? 21  SER A N   1 
ATOM   172  C CA  . SER A 1 21  ? 11.878 16.905  0.298   1.00 31.26 ? 21  SER A CA  1 
ATOM   173  C C   . SER A 1 21  ? 13.352 17.287  0.117   1.00 31.66 ? 21  SER A C   1 
ATOM   174  O O   . SER A 1 21  ? 13.669 18.099  -0.742  1.00 33.28 ? 21  SER A O   1 
ATOM   175  C CB  . SER A 1 21  ? 11.091 18.141  0.697   1.00 30.50 ? 21  SER A CB  1 
ATOM   176  O OG  . SER A 1 21  ? 11.508 18.555  1.984   1.00 33.41 ? 21  SER A OG  1 
ATOM   177  N N   . SER A 1 22  ? 14.244 16.717  0.923   1.00 30.87 ? 22  SER A N   1 
ATOM   178  C CA  . SER A 1 22  ? 15.676 16.913  0.720   1.00 31.91 ? 22  SER A CA  1 
ATOM   179  C C   . SER A 1 22  ? 16.100 16.275  -0.591  1.00 31.75 ? 22  SER A C   1 
ATOM   180  O O   . SER A 1 22  ? 15.647 15.182  -0.940  1.00 30.58 ? 22  SER A O   1 
ATOM   181  C CB  . SER A 1 22  ? 16.491 16.313  1.864   1.00 31.43 ? 22  SER A CB  1 
ATOM   182  O OG  . SER A 1 22  ? 16.026 16.780  3.116   1.00 37.01 ? 22  SER A OG  1 
ATOM   183  N N   . THR A 1 23  ? 16.953 16.971  -1.328  1.00 30.97 ? 23  THR A N   1 
ATOM   184  C CA  . THR A 1 23  ? 17.554 16.389  -2.509  1.00 29.99 ? 23  THR A CA  1 
ATOM   185  C C   . THR A 1 23  ? 18.673 15.443  -2.067  1.00 31.53 ? 23  THR A C   1 
ATOM   186  O O   . THR A 1 23  ? 19.190 15.562  -0.951  1.00 30.27 ? 23  THR A O   1 
ATOM   187  C CB  . THR A 1 23  ? 18.115 17.462  -3.442  1.00 29.88 ? 23  THR A CB  1 
ATOM   188  O OG1 . THR A 1 23  ? 19.082 18.249  -2.734  1.00 31.62 ? 23  THR A OG1 1 
ATOM   189  C CG2 . THR A 1 23  ? 16.996 18.373  -3.951  1.00 27.92 ? 23  THR A CG2 1 
ATOM   190  N N   . VAL A 1 24  ? 19.015 14.495  -2.942  1.00 31.66 ? 24  VAL A N   1 
ATOM   191  C CA  . VAL A 1 24  ? 20.185 13.637  -2.777  1.00 33.29 ? 24  VAL A CA  1 
ATOM   192  C C   . VAL A 1 24  ? 21.465 14.468  -2.589  1.00 35.24 ? 24  VAL A C   1 
ATOM   193  O O   . VAL A 1 24  ? 22.342 14.089  -1.813  1.00 36.58 ? 24  VAL A O   1 
ATOM   194  C CB  . VAL A 1 24  ? 20.321 12.664  -3.972  1.00 32.85 ? 24  VAL A CB  1 
ATOM   195  C CG1 . VAL A 1 24  ? 21.641 11.902  -3.923  1.00 35.85 ? 24  VAL A CG1 1 
ATOM   196  C CG2 . VAL A 1 24  ? 19.147 11.688  -3.993  1.00 32.88 ? 24  VAL A CG2 1 
ATOM   197  N N   . PHE A 1 25  ? 21.550 15.610  -3.275  1.00 36.08 ? 25  PHE A N   1 
ATOM   198  C CA  . PHE A 1 25  ? 22.690 16.517  -3.139  1.00 37.57 ? 25  PHE A CA  1 
ATOM   199  C C   . PHE A 1 25  ? 22.884 17.013  -1.704  1.00 39.77 ? 25  PHE A C   1 
ATOM   200  O O   . PHE A 1 25  ? 24.017 17.064  -1.211  1.00 38.60 ? 25  PHE A O   1 
ATOM   201  C CB  . PHE A 1 25  ? 22.561 17.710  -4.092  1.00 36.95 ? 25  PHE A CB  1 
ATOM   202  C CG  . PHE A 1 25  ? 23.779 18.587  -4.124  1.00 36.98 ? 25  PHE A CG  1 
ATOM   203  C CD1 . PHE A 1 25  ? 24.852 18.278  -4.961  1.00 37.29 ? 25  PHE A CD1 1 
ATOM   204  C CD2 . PHE A 1 25  ? 23.861 19.714  -3.315  1.00 36.26 ? 25  PHE A CD2 1 
ATOM   205  C CE1 . PHE A 1 25  ? 25.982 19.082  -4.999  1.00 36.34 ? 25  PHE A CE1 1 
ATOM   206  C CE2 . PHE A 1 25  ? 24.992 20.523  -3.338  1.00 37.75 ? 25  PHE A CE2 1 
ATOM   207  C CZ  . PHE A 1 25  ? 26.055 20.210  -4.186  1.00 35.70 ? 25  PHE A CZ  1 
ATOM   208  N N   . GLU A 1 26  ? 21.778 17.375  -1.046  1.00 41.94 ? 26  GLU A N   1 
ATOM   209  C CA  . GLU A 1 26  ? 21.787 17.812  0.356   1.00 41.80 ? 26  GLU A CA  1 
ATOM   210  C C   . GLU A 1 26  ? 22.313 16.730  1.297   1.00 40.12 ? 26  GLU A C   1 
ATOM   211  O O   . GLU A 1 26  ? 23.003 17.034  2.262   1.00 43.34 ? 26  GLU A O   1 
ATOM   212  C CB  . GLU A 1 26  ? 20.390 18.264  0.794   1.00 42.74 ? 26  GLU A CB  1 
ATOM   213  C CG  . GLU A 1 26  ? 19.943 19.587  0.176   1.00 49.61 ? 26  GLU A CG  1 
ATOM   214  C CD  . GLU A 1 26  ? 18.464 19.895  0.407   1.00 55.32 ? 26  GLU A CD  1 
ATOM   215  O OE1 . GLU A 1 26  ? 17.923 19.537  1.478   1.00 61.38 ? 26  GLU A OE1 1 
ATOM   216  O OE2 . GLU A 1 26  ? 17.838 20.507  -0.485  1.00 57.86 ? 26  GLU A OE2 1 
ATOM   217  N N   . LEU A 1 27  ? 21.989 15.472  1.015   1.00 39.37 ? 27  LEU A N   1 
ATOM   218  C CA  . LEU A 1 27  ? 22.555 14.336  1.755   1.00 39.21 ? 27  LEU A CA  1 
ATOM   219  C C   . LEU A 1 27  ? 24.059 14.240  1.609   1.00 37.26 ? 27  LEU A C   1 
ATOM   220  O O   . LEU A 1 27  ? 24.762 13.929  2.564   1.00 38.97 ? 27  LEU A O   1 
ATOM   221  C CB  . LEU A 1 27  ? 21.961 13.013  1.282   1.00 38.59 ? 27  LEU A CB  1 
ATOM   222  C CG  . LEU A 1 27  ? 21.022 12.223  2.186   1.00 44.71 ? 27  LEU A CG  1 
ATOM   223  C CD1 . LEU A 1 27  ? 21.133 10.762  1.787   1.00 43.24 ? 27  LEU A CD1 1 
ATOM   224  C CD2 . LEU A 1 27  ? 21.372 12.407  3.660   1.00 46.06 ? 27  LEU A CD2 1 
ATOM   225  N N   . LYS A 1 28  ? 24.540 14.477  0.393   1.00 36.74 ? 28  LYS A N   1 
ATOM   226  C CA  . LYS A 1 28  ? 25.964 14.436  0.101   1.00 35.42 ? 28  LYS A CA  1 
ATOM   227  C C   . LYS A 1 28  ? 26.712 15.518  0.860   1.00 34.02 ? 28  LYS A C   1 
ATOM   228  O O   . LYS A 1 28  ? 27.875 15.340  1.195   1.00 35.51 ? 28  LYS A O   1 
ATOM   229  C CB  . LYS A 1 28  ? 26.204 14.593  -1.396  1.00 33.60 ? 28  LYS A CB  1 
ATOM   230  C CG  . LYS A 1 28  ? 25.893 13.363  -2.186  1.00 33.08 ? 28  LYS A CG  1 
ATOM   231  C CD  . LYS A 1 28  ? 26.345 13.529  -3.615  1.00 33.65 ? 28  LYS A CD  1 
ATOM   232  C CE  . LYS A 1 28  ? 26.053 12.284  -4.409  1.00 34.90 ? 28  LYS A CE  1 
ATOM   233  N NZ  . LYS A 1 28  ? 26.742 12.365  -5.716  1.00 39.22 ? 28  LYS A NZ  1 
ATOM   234  N N   . ARG A 1 29  ? 26.036 16.636  1.119   1.00 34.91 ? 29  ARG A N   1 
ATOM   235  C CA  . ARG A 1 29  ? 26.593 17.731  1.904   1.00 37.80 ? 29  ARG A CA  1 
ATOM   236  C C   . ARG A 1 29  ? 26.763 17.334  3.368   1.00 38.74 ? 29  ARG A C   1 
ATOM   237  O O   . ARG A 1 29  ? 27.813 17.595  3.965   1.00 38.50 ? 29  ARG A O   1 
ATOM   238  C CB  . ARG A 1 29  ? 25.727 18.984  1.771   1.00 39.61 ? 29  ARG A CB  1 
ATOM   239  C CG  . ARG A 1 29  ? 25.732 19.573  0.357   1.00 47.56 ? 29  ARG A CG  1 
ATOM   240  C CD  . ARG A 1 29  ? 26.871 20.560  0.153   1.00 50.59 ? 29  ARG A CD  1 
ATOM   241  N NE  . ARG A 1 29  ? 26.426 21.932  0.388   1.00 59.39 ? 29  ARG A NE  1 
ATOM   242  C CZ  . ARG A 1 29  ? 26.518 22.579  1.549   1.00 63.01 ? 29  ARG A CZ  1 
ATOM   243  N NH1 . ARG A 1 29  ? 27.053 21.994  2.617   1.00 66.52 ? 29  ARG A NH1 1 
ATOM   244  N NH2 . ARG A 1 29  ? 26.076 23.825  1.641   1.00 64.18 ? 29  ARG A NH2 1 
ATOM   245  N N   . ILE A 1 30  ? 25.736 16.698  3.936   1.00 38.19 ? 30  ILE A N   1 
ATOM   246  C CA  . ILE A 1 30  ? 25.842 16.095  5.269   1.00 39.79 ? 30  ILE A CA  1 
ATOM   247  C C   . ILE A 1 30  ? 27.073 15.194  5.370   1.00 37.53 ? 30  ILE A C   1 
ATOM   248  O O   . ILE A 1 30  ? 27.853 15.313  6.310   1.00 37.37 ? 30  ILE A O   1 
ATOM   249  C CB  . ILE A 1 30  ? 24.569 15.291  5.643   1.00 41.97 ? 30  ILE A CB  1 
ATOM   250  C CG1 . ILE A 1 30  ? 23.386 16.245  5.846   1.00 43.91 ? 30  ILE A CG1 1 
ATOM   251  C CG2 . ILE A 1 30  ? 24.809 14.466  6.904   1.00 41.82 ? 30  ILE A CG2 1 
ATOM   252  C CD1 . ILE A 1 30  ? 22.025 15.596  5.670   1.00 44.89 ? 30  ILE A CD1 1 
ATOM   253  N N   . VAL A 1 31  ? 27.236 14.307  4.389   1.00 35.59 ? 31  VAL A N   1 
ATOM   254  C CA  . VAL A 1 31  ? 28.384 13.397  4.306   1.00 35.22 ? 31  VAL A CA  1 
ATOM   255  C C   . VAL A 1 31  ? 29.719 14.143  4.162   1.00 34.70 ? 31  VAL A C   1 
ATOM   256  O O   . VAL A 1 31  ? 30.721 13.753  4.774   1.00 34.03 ? 31  VAL A O   1 
ATOM   257  C CB  . VAL A 1 31  ? 28.220 12.401  3.132   1.00 36.05 ? 31  VAL A CB  1 
ATOM   258  C CG1 . VAL A 1 31  ? 29.464 11.525  2.964   1.00 36.41 ? 31  VAL A CG1 1 
ATOM   259  C CG2 . VAL A 1 31  ? 26.963 11.552  3.318   1.00 36.40 ? 31  VAL A CG2 1 
ATOM   260  N N   . GLU A 1 32  ? 29.727 15.201  3.346   1.00 33.62 ? 32  GLU A N   1 
ATOM   261  C CA  . GLU A 1 32  ? 30.886 16.085  3.227   1.00 33.38 ? 32  GLU A CA  1 
ATOM   262  C C   . GLU A 1 32  ? 31.267 16.712  4.570   1.00 32.29 ? 32  GLU A C   1 
ATOM   263  O O   . GLU A 1 32  ? 32.448 16.845  4.889   1.00 32.56 ? 32  GLU A O   1 
ATOM   264  C CB  . GLU A 1 32  ? 30.626 17.190  2.203   1.00 34.65 ? 32  GLU A CB  1 
ATOM   265  C CG  . GLU A 1 32  ? 31.741 18.225  2.139   1.00 29.78 ? 32  GLU A CG  1 
ATOM   266  C CD  . GLU A 1 32  ? 31.442 19.388  1.204   1.00 35.13 ? 32  GLU A CD  1 
ATOM   267  O OE1 . GLU A 1 32  ? 30.255 19.718  0.988   1.00 40.17 ? 32  GLU A OE1 1 
ATOM   268  O OE2 . GLU A 1 32  ? 32.405 19.983  0.685   1.00 32.39 ? 32  GLU A OE2 1 
ATOM   269  N N   . GLY A 1 33  ? 30.259 17.102  5.345   1.00 31.04 ? 33  GLY A N   1 
ATOM   270  C CA  . GLY A 1 33  ? 30.479 17.664  6.675   1.00 31.82 ? 33  GLY A CA  1 
ATOM   271  C C   . GLY A 1 33  ? 31.106 16.686  7.650   1.00 32.52 ? 33  GLY A C   1 
ATOM   272  O O   . GLY A 1 33  ? 31.859 17.084  8.536   1.00 33.05 ? 33  GLY A O   1 
ATOM   273  N N   . ILE A 1 34  ? 30.791 15.404  7.489   1.00 34.39 ? 34  ILE A N   1 
ATOM   274  C CA  . ILE A 1 34  ? 31.299 14.357  8.378   1.00 34.50 ? 34  ILE A CA  1 
ATOM   275  C C   . ILE A 1 34  ? 32.604 13.741  7.858   1.00 34.93 ? 34  ILE A C   1 
ATOM   276  O O   . ILE A 1 34  ? 33.580 13.637  8.611   1.00 34.00 ? 34  ILE A O   1 
ATOM   277  C CB  . ILE A 1 34  ? 30.224 13.260  8.643   1.00 35.17 ? 34  ILE A CB  1 
ATOM   278  C CG1 . ILE A 1 34  ? 29.079 13.840  9.479   1.00 35.67 ? 34  ILE A CG1 1 
ATOM   279  C CG2 . ILE A 1 34  ? 30.830 12.062  9.367   1.00 34.13 ? 34  ILE A CG2 1 
ATOM   280  C CD1 . ILE A 1 34  ? 27.736 13.232  9.206   1.00 34.86 ? 34  ILE A CD1 1 
ATOM   281  N N   . LEU A 1 35  ? 32.624 13.354  6.579   1.00 33.11 ? 35  LEU A N   1 
ATOM   282  C CA  . LEU A 1 35  ? 33.756 12.595  6.027   1.00 33.02 ? 35  LEU A CA  1 
ATOM   283  C C   . LEU A 1 35  ? 34.745 13.409  5.177   1.00 33.73 ? 35  LEU A C   1 
ATOM   284  O O   . LEU A 1 35  ? 35.757 12.878  4.714   1.00 35.08 ? 35  LEU A O   1 
ATOM   285  C CB  . LEU A 1 35  ? 33.268 11.350  5.275   1.00 33.73 ? 35  LEU A CB  1 
ATOM   286  C CG  . LEU A 1 35  ? 32.435 10.341  6.083   1.00 32.52 ? 35  LEU A CG  1 
ATOM   287  C CD1 . LEU A 1 35  ? 31.888 9.253   5.182   1.00 30.76 ? 35  LEU A CD1 1 
ATOM   288  C CD2 . LEU A 1 35  ? 33.218 9.736   7.246   1.00 31.29 ? 35  LEU A CD2 1 
ATOM   289  N N   . LYS A 1 36  ? 34.452 14.695  4.999   1.00 34.31 ? 36  LYS A N   1 
ATOM   290  C CA  . LYS A 1 36  ? 35.348 15.650  4.326   1.00 33.40 ? 36  LYS A CA  1 
ATOM   291  C C   . LYS A 1 36  ? 35.668 15.300  2.864   1.00 33.27 ? 36  LYS A C   1 
ATOM   292  O O   . LYS A 1 36  ? 36.781 15.500  2.391   1.00 34.01 ? 36  LYS A O   1 
ATOM   293  C CB  . LYS A 1 36  ? 36.614 15.901  5.162   1.00 33.64 ? 36  LYS A CB  1 
ATOM   294  C CG  . LYS A 1 36  ? 36.351 16.367  6.611   1.00 35.92 ? 36  LYS A CG  1 
ATOM   295  C CD  . LYS A 1 36  ? 35.379 17.562  6.671   1.00 40.73 ? 36  LYS A CD  1 
ATOM   296  C CE  . LYS A 1 36  ? 34.913 17.874  8.093   1.00 40.63 ? 36  LYS A CE  1 
ATOM   297  N NZ  . LYS A 1 36  ? 35.918 18.659  8.860   1.00 46.24 ? 36  LYS A NZ  1 
ATOM   298  N N   . ARG A 1 37  ? 34.665 14.773  2.168   1.00 33.79 ? 37  ARG A N   1 
ATOM   299  C CA  . ARG A 1 37  ? 34.719 14.523  0.728   1.00 34.45 ? 37  ARG A CA  1 
ATOM   300  C C   . ARG A 1 37  ? 33.498 15.168  0.078   1.00 31.95 ? 37  ARG A C   1 
ATOM   301  O O   . ARG A 1 37  ? 32.360 14.831  0.432   1.00 31.28 ? 37  ARG A O   1 
ATOM   302  C CB  . ARG A 1 37  ? 34.707 13.020  0.424   1.00 36.87 ? 37  ARG A CB  1 
ATOM   303  C CG  . ARG A 1 37  ? 35.805 12.197  1.081   1.00 38.73 ? 37  ARG A CG  1 
ATOM   304  C CD  . ARG A 1 37  ? 37.037 12.150  0.214   1.00 42.11 ? 37  ARG A CD  1 
ATOM   305  N NE  . ARG A 1 37  ? 37.712 10.861  0.325   1.00 46.34 ? 37  ARG A NE  1 
ATOM   306  C CZ  . ARG A 1 37  ? 37.977 10.052  -0.698  1.00 48.28 ? 37  ARG A CZ  1 
ATOM   307  N NH1 . ARG A 1 37  ? 37.645 10.394  -1.942  1.00 45.38 ? 37  ARG A NH1 1 
ATOM   308  N NH2 . ARG A 1 37  ? 38.595 8.897   -0.473  1.00 49.25 ? 37  ARG A NH2 1 
ATOM   309  N N   . PRO A 1 38  ? 33.723 16.091  -0.878  1.00 30.88 ? 38  PRO A N   1 
ATOM   310  C CA  . PRO A 1 38  ? 32.636 16.865  -1.490  1.00 30.92 ? 38  PRO A CA  1 
ATOM   311  C C   . PRO A 1 38  ? 31.673 15.997  -2.320  1.00 30.94 ? 38  PRO A C   1 
ATOM   312  O O   . PRO A 1 38  ? 32.010 14.852  -2.639  1.00 29.87 ? 38  PRO A O   1 
ATOM   313  C CB  . PRO A 1 38  ? 33.374 17.887  -2.358  1.00 29.66 ? 38  PRO A CB  1 
ATOM   314  C CG  . PRO A 1 38  ? 34.690 17.310  -2.605  1.00 31.04 ? 38  PRO A CG  1 
ATOM   315  C CD  . PRO A 1 38  ? 35.037 16.454  -1.438  1.00 32.50 ? 38  PRO A CD  1 
ATOM   316  N N   . PRO A 1 39  ? 30.464 16.523  -2.629  1.00 31.35 ? 39  PRO A N   1 
ATOM   317  C CA  . PRO A 1 39  ? 29.415 15.771  -3.341  1.00 29.98 ? 39  PRO A CA  1 
ATOM   318  C C   . PRO A 1 39  ? 29.848 15.121  -4.654  1.00 30.13 ? 39  PRO A C   1 
ATOM   319  O O   . PRO A 1 39  ? 29.432 14.012  -4.943  1.00 33.27 ? 39  PRO A O   1 
ATOM   320  C CB  . PRO A 1 39  ? 28.337 16.829  -3.586  1.00 30.88 ? 39  PRO A CB  1 
ATOM   321  C CG  . PRO A 1 39  ? 28.487 17.758  -2.429  1.00 30.24 ? 39  PRO A CG  1 
ATOM   322  C CD  . PRO A 1 39  ? 29.991 17.874  -2.269  1.00 30.78 ? 39  PRO A CD  1 
ATOM   323  N N   . ASP A 1 40  ? 30.693 15.789  -5.426  1.00 30.05 ? 40  ASP A N   1 
ATOM   324  C CA  . ASP A 1 40  ? 31.158 15.253  -6.703  1.00 31.44 ? 40  ASP A CA  1 
ATOM   325  C C   . ASP A 1 40  ? 32.183 14.112  -6.531  1.00 31.60 ? 40  ASP A C   1 
ATOM   326  O O   . ASP A 1 40  ? 32.598 13.478  -7.507  1.00 30.40 ? 40  ASP A O   1 
ATOM   327  C CB  . ASP A 1 40  ? 31.762 16.376  -7.544  1.00 31.83 ? 40  ASP A CB  1 
ATOM   328  C CG  . ASP A 1 40  ? 33.062 16.886  -6.964  1.00 35.47 ? 40  ASP A CG  1 
ATOM   329  O OD1 . ASP A 1 40  ? 33.028 17.483  -5.867  1.00 37.34 ? 40  ASP A OD1 1 
ATOM   330  O OD2 . ASP A 1 40  ? 34.120 16.666  -7.589  1.00 38.87 ? 40  ASP A OD2 1 
ATOM   331  N N   . GLU A 1 41  ? 32.606 13.866  -5.297  1.00 31.71 ? 41  GLU A N   1 
ATOM   332  C CA  . GLU A 1 41  ? 33.479 12.728  -5.008  1.00 33.76 ? 41  GLU A CA  1 
ATOM   333  C C   . GLU A 1 41  ? 32.700 11.539  -4.409  1.00 32.89 ? 41  GLU A C   1 
ATOM   334  O O   . GLU A 1 41  ? 33.290 10.549  -3.966  1.00 35.78 ? 41  GLU A O   1 
ATOM   335  C CB  . GLU A 1 41  ? 34.642 13.157  -4.102  1.00 34.25 ? 41  GLU A CB  1 
ATOM   336  C CG  . GLU A 1 41  ? 35.556 14.201  -4.733  1.00 36.67 ? 41  GLU A CG  1 
ATOM   337  C CD  . GLU A 1 41  ? 36.771 14.561  -3.870  1.00 42.22 ? 41  GLU A CD  1 
ATOM   338  O OE1 . GLU A 1 41  ? 37.181 13.718  -3.038  1.00 39.74 ? 41  GLU A OE1 1 
ATOM   339  O OE2 . GLU A 1 41  ? 37.322 15.682  -4.041  1.00 39.32 ? 41  GLU A OE2 1 
ATOM   340  N N   . GLN A 1 42  ? 31.376 11.640  -4.420  1.00 31.63 ? 42  GLN A N   1 
ATOM   341  C CA  . GLN A 1 42  ? 30.506 10.630  -3.815  1.00 31.70 ? 42  GLN A CA  1 
ATOM   342  C C   . GLN A 1 42  ? 29.498 10.110  -4.832  1.00 34.27 ? 42  GLN A C   1 
ATOM   343  O O   . GLN A 1 42  ? 28.988 10.862  -5.674  1.00 33.86 ? 42  GLN A O   1 
ATOM   344  C CB  . GLN A 1 42  ? 29.693 11.216  -2.648  1.00 30.33 ? 42  GLN A CB  1 
ATOM   345  C CG  . GLN A 1 42  ? 30.461 11.943  -1.559  1.00 27.36 ? 42  GLN A CG  1 
ATOM   346  C CD  . GLN A 1 42  ? 29.524 12.628  -0.569  1.00 30.20 ? 42  GLN A CD  1 
ATOM   347  O OE1 . GLN A 1 42  ? 28.435 12.133  -0.288  1.00 32.60 ? 42  GLN A OE1 1 
ATOM   348  N NE2 . GLN A 1 42  ? 29.940 13.777  -0.049  1.00 29.48 ? 42  GLN A NE2 1 
ATOM   349  N N   . ARG A 1 43  ? 29.200 8.823   -4.735  1.00 33.42 ? 43  ARG A N   1 
ATOM   350  C CA  . ARG A 1 43  ? 28.023 8.274   -5.367  1.00 32.37 ? 43  ARG A CA  1 
ATOM   351  C C   . ARG A 1 43  ? 27.193 7.718   -4.233  1.00 33.40 ? 43  ARG A C   1 
ATOM   352  O O   . ARG A 1 43  ? 27.738 7.119   -3.301  1.00 35.14 ? 43  ARG A O   1 
ATOM   353  C CB  . ARG A 1 43  ? 28.400 7.157   -6.340  1.00 33.25 ? 43  ARG A CB  1 
ATOM   354  C CG  . ARG A 1 43  ? 28.831 7.629   -7.708  1.00 30.45 ? 43  ARG A CG  1 
ATOM   355  C CD  . ARG A 1 43  ? 29.249 6.447   -8.554  1.00 31.43 ? 43  ARG A CD  1 
ATOM   356  N NE  . ARG A 1 43  ? 29.313 6.778   -9.980  1.00 34.50 ? 43  ARG A NE  1 
ATOM   357  C CZ  . ARG A 1 43  ? 29.678 5.926   -10.931 1.00 33.76 ? 43  ARG A CZ  1 
ATOM   358  N NH1 . ARG A 1 43  ? 30.016 4.679   -10.617 1.00 36.87 ? 43  ARG A NH1 1 
ATOM   359  N NH2 . ARG A 1 43  ? 29.701 6.317   -12.195 1.00 32.91 ? 43  ARG A NH2 1 
ATOM   360  N N   . LEU A 1 44  ? 25.885 7.930   -4.285  1.00 34.40 ? 44  LEU A N   1 
ATOM   361  C CA  . LEU A 1 44  ? 24.989 7.273   -3.331  1.00 34.90 ? 44  LEU A CA  1 
ATOM   362  C C   . LEU A 1 44  ? 24.085 6.264   -4.042  1.00 35.39 ? 44  LEU A C   1 
ATOM   363  O O   . LEU A 1 44  ? 23.616 6.518   -5.157  1.00 38.18 ? 44  LEU A O   1 
ATOM   364  C CB  . LEU A 1 44  ? 24.175 8.301   -2.527  1.00 32.77 ? 44  LEU A CB  1 
ATOM   365  C CG  . LEU A 1 44  ? 24.958 9.337   -1.697  1.00 36.18 ? 44  LEU A CG  1 
ATOM   366  C CD1 . LEU A 1 44  ? 24.015 10.379  -1.078  1.00 30.15 ? 44  LEU A CD1 1 
ATOM   367  C CD2 . LEU A 1 44  ? 25.812 8.664   -0.615  1.00 32.65 ? 44  LEU A CD2 1 
ATOM   368  N N   . TYR A 1 45  ? 23.854 5.130   -3.386  1.00 34.43 ? 45  TYR A N   1 
ATOM   369  C CA  . TYR A 1 45  ? 23.035 4.041   -3.918  1.00 34.93 ? 45  TYR A CA  1 
ATOM   370  C C   . TYR A 1 45  ? 21.918 3.659   -2.958  1.00 38.37 ? 45  TYR A C   1 
ATOM   371  O O   . TYR A 1 45  ? 22.086 3.702   -1.739  1.00 38.89 ? 45  TYR A O   1 
ATOM   372  C CB  . TYR A 1 45  ? 23.880 2.780   -4.176  1.00 32.64 ? 45  TYR A CB  1 
ATOM   373  C CG  . TYR A 1 45  ? 24.930 2.903   -5.265  1.00 33.15 ? 45  TYR A CG  1 
ATOM   374  C CD1 . TYR A 1 45  ? 26.182 3.453   -4.996  1.00 30.67 ? 45  TYR A CD1 1 
ATOM   375  C CD2 . TYR A 1 45  ? 24.679 2.437   -6.558  1.00 32.61 ? 45  TYR A CD2 1 
ATOM   376  C CE1 . TYR A 1 45  ? 27.156 3.551   -5.983  1.00 34.22 ? 45  TYR A CE1 1 
ATOM   377  C CE2 . TYR A 1 45  ? 25.644 2.534   -7.556  1.00 35.19 ? 45  TYR A CE2 1 
ATOM   378  C CZ  . TYR A 1 45  ? 26.882 3.094   -7.262  1.00 39.71 ? 45  TYR A CZ  1 
ATOM   379  O OH  . TYR A 1 45  ? 27.846 3.192   -8.247  1.00 42.10 ? 45  TYR A OH  1 
ATOM   380  N N   . LYS A 1 46  ? 20.775 3.286   -3.526  1.00 41.36 ? 46  LYS A N   1 
ATOM   381  C CA  . LYS A 1 46  ? 19.769 2.533   -2.803  1.00 40.49 ? 46  LYS A CA  1 
ATOM   382  C C   . LYS A 1 46  ? 19.426 1.294   -3.616  1.00 39.32 ? 46  LYS A C   1 
ATOM   383  O O   . LYS A 1 46  ? 19.176 1.382   -4.823  1.00 37.64 ? 46  LYS A O   1 
ATOM   384  C CB  . LYS A 1 46  ? 18.510 3.360   -2.556  1.00 43.59 ? 46  LYS A CB  1 
ATOM   385  C CG  . LYS A 1 46  ? 17.676 2.801   -1.416  1.00 48.31 ? 46  LYS A CG  1 
ATOM   386  C CD  . LYS A 1 46  ? 16.196 3.156   -1.520  1.00 56.97 ? 46  LYS A CD  1 
ATOM   387  C CE  . LYS A 1 46  ? 15.451 2.613   -0.289  1.00 63.04 ? 46  LYS A CE  1 
ATOM   388  N NZ  . LYS A 1 46  ? 13.962 2.670   -0.391  1.00 66.62 ? 46  LYS A NZ  1 
ATOM   389  N N   . ASP A 1 47  ? 19.422 0.142   -2.950  1.00 40.29 ? 47  ASP A N   1 
ATOM   390  C CA  . ASP A 1 47  ? 19.094 -1.139  -3.583  1.00 39.28 ? 47  ASP A CA  1 
ATOM   391  C C   . ASP A 1 47  ? 19.905 -1.362  -4.863  1.00 38.92 ? 47  ASP A C   1 
ATOM   392  O O   . ASP A 1 47  ? 19.358 -1.754  -5.898  1.00 39.72 ? 47  ASP A O   1 
ATOM   393  C CB  . ASP A 1 47  ? 17.590 -1.222  -3.850  1.00 40.10 ? 47  ASP A CB  1 
ATOM   394  C CG  . ASP A 1 47  ? 16.765 -0.999  -2.593  1.00 44.38 ? 47  ASP A CG  1 
ATOM   395  O OD1 . ASP A 1 47  ? 16.978 -1.745  -1.619  1.00 46.31 ? 47  ASP A OD1 1 
ATOM   396  O OD2 . ASP A 1 47  ? 15.906 -0.085  -2.577  1.00 44.36 ? 47  ASP A OD2 1 
ATOM   397  N N   . ASP A 1 48  ? 21.209 -1.081  -4.766  1.00 38.31 ? 48  ASP A N   1 
ATOM   398  C CA  . ASP A 1 48  ? 22.189 -1.208  -5.862  1.00 39.60 ? 48  ASP A CA  1 
ATOM   399  C C   . ASP A 1 48  ? 21.907 -0.308  -7.070  1.00 39.31 ? 48  ASP A C   1 
ATOM   400  O O   . ASP A 1 48  ? 22.413 -0.555  -8.166  1.00 39.90 ? 48  ASP A O   1 
ATOM   401  C CB  . ASP A 1 48  ? 22.377 -2.672  -6.293  1.00 40.78 ? 48  ASP A CB  1 
ATOM   402  C CG  . ASP A 1 48  ? 22.799 -3.573  -5.137  1.00 47.40 ? 48  ASP A CG  1 
ATOM   403  O OD1 . ASP A 1 48  ? 22.066 -4.552  -4.850  1.00 51.36 ? 48  ASP A OD1 1 
ATOM   404  O OD2 . ASP A 1 48  ? 23.848 -3.296  -4.508  1.00 46.31 ? 48  ASP A OD2 1 
ATOM   405  N N   . GLN A 1 49  ? 21.107 0.733   -6.852  1.00 37.81 ? 49  GLN A N   1 
ATOM   406  C CA  . GLN A 1 49  ? 20.716 1.668   -7.907  1.00 36.47 ? 49  GLN A CA  1 
ATOM   407  C C   . GLN A 1 49  ? 21.235 3.068   -7.571  1.00 36.55 ? 49  GLN A C   1 
ATOM   408  O O   . GLN A 1 49  ? 21.053 3.570   -6.453  1.00 33.92 ? 49  GLN A O   1 
ATOM   409  C CB  . GLN A 1 49  ? 19.192 1.664   -8.089  1.00 36.39 ? 49  GLN A CB  1 
ATOM   410  C CG  . GLN A 1 49  ? 18.624 0.266   -8.404  1.00 39.45 ? 49  GLN A CG  1 
ATOM   411  C CD  . GLN A 1 49  ? 17.162 0.109   -8.023  1.00 41.29 ? 49  GLN A CD  1 
ATOM   412  O OE1 . GLN A 1 49  ? 16.295 0.769   -8.584  1.00 43.98 ? 49  GLN A OE1 1 
ATOM   413  N NE2 . GLN A 1 49  ? 16.884 -0.777  -7.074  1.00 35.40 ? 49  GLN A NE2 1 
ATOM   414  N N   . LEU A 1 50  ? 21.906 3.673   -8.541  1.00 35.59 ? 50  LEU A N   1 
ATOM   415  C CA  . LEU A 1 50  ? 22.566 4.948   -8.346  1.00 38.78 ? 50  LEU A CA  1 
ATOM   416  C C   . LEU A 1 50  ? 21.503 6.019   -8.133  1.00 39.09 ? 50  LEU A C   1 
ATOM   417  O O   . LEU A 1 50  ? 20.498 6.045   -8.842  1.00 39.75 ? 50  LEU A O   1 
ATOM   418  C CB  . LEU A 1 50  ? 23.408 5.292   -9.583  1.00 37.67 ? 50  LEU A CB  1 
ATOM   419  C CG  . LEU A 1 50  ? 24.873 5.733   -9.496  1.00 42.12 ? 50  LEU A CG  1 
ATOM   420  C CD1 . LEU A 1 50  ? 25.279 6.307   -10.849 1.00 42.65 ? 50  LEU A CD1 1 
ATOM   421  C CD2 . LEU A 1 50  ? 25.162 6.738   -8.390  1.00 41.15 ? 50  LEU A CD2 1 
ATOM   422  N N   . LEU A 1 51  ? 21.733 6.889   -7.154  1.00 38.69 ? 51  LEU A N   1 
ATOM   423  C CA  . LEU A 1 51  ? 20.827 7.995   -6.859  1.00 38.64 ? 51  LEU A CA  1 
ATOM   424  C C   . LEU A 1 51  ? 21.222 9.309   -7.547  1.00 38.97 ? 51  LEU A C   1 
ATOM   425  O O   . LEU A 1 51  ? 22.362 9.771   -7.449  1.00 38.64 ? 51  LEU A O   1 
ATOM   426  C CB  . LEU A 1 51  ? 20.694 8.197   -5.343  1.00 39.31 ? 51  LEU A CB  1 
ATOM   427  C CG  . LEU A 1 51  ? 20.194 6.987   -4.537  1.00 37.95 ? 51  LEU A CG  1 
ATOM   428  C CD1 . LEU A 1 51  ? 20.127 7.301   -3.046  1.00 35.29 ? 51  LEU A CD1 1 
ATOM   429  C CD2 . LEU A 1 51  ? 18.842 6.509   -5.062  1.00 36.70 ? 51  LEU A CD2 1 
ATOM   430  N N   . ASP A 1 52  ? 20.239 9.895   -8.223  1.00 38.20 ? 52  ASP A N   1 
ATOM   431  C CA  . ASP A 1 52  ? 20.333 11.163  -8.930  1.00 38.13 ? 52  ASP A CA  1 
ATOM   432  C C   . ASP A 1 52  ? 20.381 12.337  -7.944  1.00 38.47 ? 52  ASP A C   1 
ATOM   433  O O   . ASP A 1 52  ? 19.501 12.469  -7.094  1.00 41.03 ? 52  ASP A O   1 
ATOM   434  C CB  . ASP A 1 52  ? 19.089 11.265  -9.825  1.00 39.33 ? 52  ASP A CB  1 
ATOM   435  C CG  . ASP A 1 52  ? 19.115 12.447  -10.780 1.00 42.70 ? 52  ASP A CG  1 
ATOM   436  O OD1 . ASP A 1 52  ? 19.682 13.517  -10.470 1.00 41.45 ? 52  ASP A OD1 1 
ATOM   437  O OD2 . ASP A 1 52  ? 18.518 12.297  -11.861 1.00 48.32 ? 52  ASP A OD2 1 
ATOM   438  N N   . ASP A 1 53  ? 21.393 13.193  -8.090  1.00 38.55 ? 53  ASP A N   1 
ATOM   439  C CA  . ASP A 1 53  ? 21.643 14.348  -7.209  1.00 38.17 ? 53  ASP A CA  1 
ATOM   440  C C   . ASP A 1 53  ? 20.464 15.314  -7.077  1.00 39.11 ? 53  ASP A C   1 
ATOM   441  O O   . ASP A 1 53  ? 20.251 15.901  -6.013  1.00 37.07 ? 53  ASP A O   1 
ATOM   442  C CB  . ASP A 1 53  ? 22.844 15.147  -7.719  1.00 39.85 ? 53  ASP A CB  1 
ATOM   443  C CG  . ASP A 1 53  ? 24.178 14.574  -7.278  1.00 44.96 ? 53  ASP A CG  1 
ATOM   444  O OD1 . ASP A 1 53  ? 24.215 13.760  -6.340  1.00 46.79 ? 53  ASP A OD1 1 
ATOM   445  O OD2 . ASP A 1 53  ? 25.206 14.957  -7.874  1.00 51.44 ? 53  ASP A OD2 1 
ATOM   446  N N   . GLY A 1 54  ? 19.727 15.492  -8.174  1.00 38.34 ? 54  GLY A N   1 
ATOM   447  C CA  . GLY A 1 54  ? 18.602 16.419  -8.231  1.00 36.54 ? 54  GLY A CA  1 
ATOM   448  C C   . GLY A 1 54  ? 17.261 15.882  -7.741  1.00 34.91 ? 54  GLY A C   1 
ATOM   449  O O   . GLY A 1 54  ? 16.297 16.631  -7.661  1.00 34.74 ? 54  GLY A O   1 
ATOM   450  N N   . LYS A 1 55  ? 17.193 14.597  -7.414  1.00 33.52 ? 55  LYS A N   1 
ATOM   451  C CA  . LYS A 1 55  ? 15.949 13.999  -6.919  1.00 35.94 ? 55  LYS A CA  1 
ATOM   452  C C   . LYS A 1 55  ? 15.797 14.182  -5.411  1.00 34.40 ? 55  LYS A C   1 
ATOM   453  O O   . LYS A 1 55  ? 16.782 14.147  -4.662  1.00 33.73 ? 55  LYS A O   1 
ATOM   454  C CB  . LYS A 1 55  ? 15.888 12.501  -7.236  1.00 37.73 ? 55  LYS A CB  1 
ATOM   455  C CG  . LYS A 1 55  ? 15.917 12.145  -8.716  1.00 43.63 ? 55  LYS A CG  1 
ATOM   456  C CD  . LYS A 1 55  ? 14.547 11.902  -9.296  1.00 51.17 ? 55  LYS A CD  1 
ATOM   457  C CE  . LYS A 1 55  ? 14.659 11.283  -10.685 1.00 57.09 ? 55  LYS A CE  1 
ATOM   458  N NZ  . LYS A 1 55  ? 13.329 10.839  -11.215 1.00 63.28 ? 55  LYS A NZ  1 
ATOM   459  N N   . THR A 1 56  ? 14.556 14.362  -4.970  1.00 30.65 ? 56  THR A N   1 
ATOM   460  C CA  . THR A 1 56  ? 14.251 14.322  -3.546  1.00 30.70 ? 56  THR A CA  1 
ATOM   461  C C   . THR A 1 56  ? 14.425 12.888  -3.004  1.00 30.51 ? 56  THR A C   1 
ATOM   462  O O   . THR A 1 56  ? 14.378 11.912  -3.761  1.00 26.89 ? 56  THR A O   1 
ATOM   463  C CB  . THR A 1 56  ? 12.815 14.859  -3.223  1.00 32.05 ? 56  THR A CB  1 
ATOM   464  O OG1 . THR A 1 56  ? 11.825 13.977  -3.768  1.00 33.34 ? 56  THR A OG1 1 
ATOM   465  C CG2 . THR A 1 56  ? 12.600 16.278  -3.774  1.00 25.80 ? 56  THR A CG2 1 
ATOM   466  N N   . LEU A 1 57  ? 14.624 12.772  -1.695  1.00 30.39 ? 57  LEU A N   1 
ATOM   467  C CA  . LEU A 1 57  ? 14.754 11.481  -1.055  1.00 32.25 ? 57  LEU A CA  1 
ATOM   468  C C   . LEU A 1 57  ? 13.476 10.656  -1.189  1.00 33.96 ? 57  LEU A C   1 
ATOM   469  O O   . LEU A 1 57  ? 13.540 9.436   -1.376  1.00 33.14 ? 57  LEU A O   1 
ATOM   470  C CB  . LEU A 1 57  ? 15.153 11.648  0.407   1.00 32.60 ? 57  LEU A CB  1 
ATOM   471  C CG  . LEU A 1 57  ? 16.526 12.317  0.560   1.00 35.48 ? 57  LEU A CG  1 
ATOM   472  C CD1 . LEU A 1 57  ? 16.917 12.431  2.031   1.00 33.26 ? 57  LEU A CD1 1 
ATOM   473  C CD2 . LEU A 1 57  ? 17.612 11.567  -0.253  1.00 31.50 ? 57  LEU A CD2 1 
ATOM   474  N N   . GLY A 1 58  ? 12.330 11.337  -1.125  1.00 33.33 ? 58  GLY A N   1 
ATOM   475  C CA  . GLY A 1 58  ? 11.027 10.697  -1.282  1.00 34.73 ? 58  GLY A CA  1 
ATOM   476  C C   . GLY A 1 58  ? 10.827 10.085  -2.658  1.00 35.81 ? 58  GLY A C   1 
ATOM   477  O O   . GLY A 1 58  ? 10.297 8.974   -2.769  1.00 36.16 ? 58  GLY A O   1 
ATOM   478  N N   . GLU A 1 59  ? 11.252 10.809  -3.699  1.00 34.95 ? 59  GLU A N   1 
ATOM   479  C CA  . GLU A 1 59  ? 11.246 10.292  -5.071  1.00 37.61 ? 59  GLU A CA  1 
ATOM   480  C C   . GLU A 1 59  ? 12.160 9.082   -5.201  1.00 39.19 ? 59  GLU A C   1 
ATOM   481  O O   . GLU A 1 59  ? 11.932 8.222   -6.045  1.00 40.96 ? 59  GLU A O   1 
ATOM   482  C CB  . GLU A 1 59  ? 11.693 11.359  -6.064  1.00 37.75 ? 59  GLU A CB  1 
ATOM   483  C CG  . GLU A 1 59  ? 10.712 12.489  -6.255  1.00 41.50 ? 59  GLU A CG  1 
ATOM   484  C CD  . GLU A 1 59  ? 11.273 13.624  -7.103  1.00 44.02 ? 59  GLU A CD  1 
ATOM   485  O OE1 . GLU A 1 59  ? 12.368 14.142  -6.790  1.00 43.82 ? 59  GLU A OE1 1 
ATOM   486  O OE2 . GLU A 1 59  ? 10.602 14.012  -8.079  1.00 47.34 ? 59  GLU A OE2 1 
ATOM   487  N N   . CYS A 1 60  ? 13.195 9.022   -4.363  1.00 40.34 ? 60  CYS A N   1 
ATOM   488  C CA  . CYS A 1 60  ? 14.121 7.887   -4.348  1.00 42.04 ? 60  CYS A CA  1 
ATOM   489  C C   . CYS A 1 60  ? 13.629 6.695   -3.517  1.00 42.37 ? 60  CYS A C   1 
ATOM   490  O O   . CYS A 1 60  ? 14.290 5.657   -3.467  1.00 44.57 ? 60  CYS A O   1 
ATOM   491  C CB  . CYS A 1 60  ? 15.503 8.338   -3.862  1.00 43.52 ? 60  CYS A CB  1 
ATOM   492  S SG  . CYS A 1 60  ? 16.321 9.487   -4.996  1.00 42.90 ? 60  CYS A SG  1 
ATOM   493  N N   . GLY A 1 61  ? 12.480 6.841   -2.863  1.00 40.35 ? 61  GLY A N   1 
ATOM   494  C CA  . GLY A 1 61  ? 11.925 5.749   -2.073  1.00 39.77 ? 61  GLY A CA  1 
ATOM   495  C C   . GLY A 1 61  ? 12.143 5.828   -0.570  1.00 38.66 ? 61  GLY A C   1 
ATOM   496  O O   . GLY A 1 61  ? 11.786 4.899   0.142   1.00 39.23 ? 61  GLY A O   1 
ATOM   497  N N   . PHE A 1 62  ? 12.715 6.934   -0.092  1.00 34.94 ? 62  PHE A N   1 
ATOM   498  C CA  . PHE A 1 62  ? 12.841 7.204   1.339   1.00 34.68 ? 62  PHE A CA  1 
ATOM   499  C C   . PHE A 1 62  ? 11.656 8.025   1.848   1.00 36.62 ? 62  PHE A C   1 
ATOM   500  O O   . PHE A 1 62  ? 11.583 9.251   1.635   1.00 36.92 ? 62  PHE A O   1 
ATOM   501  C CB  . PHE A 1 62  ? 14.149 7.942   1.640   1.00 35.25 ? 62  PHE A CB  1 
ATOM   502  C CG  . PHE A 1 62  ? 15.379 7.214   1.184   1.00 35.35 ? 62  PHE A CG  1 
ATOM   503  C CD1 . PHE A 1 62  ? 15.863 6.119   1.898   1.00 38.46 ? 62  PHE A CD1 1 
ATOM   504  C CD2 . PHE A 1 62  ? 16.054 7.618   0.039   1.00 33.85 ? 62  PHE A CD2 1 
ATOM   505  C CE1 . PHE A 1 62  ? 17.014 5.444   1.482   1.00 39.90 ? 62  PHE A CE1 1 
ATOM   506  C CE2 . PHE A 1 62  ? 17.199 6.957   -0.388  1.00 37.51 ? 62  PHE A CE2 1 
ATOM   507  C CZ  . PHE A 1 62  ? 17.684 5.869   0.335   1.00 41.79 ? 62  PHE A CZ  1 
ATOM   508  N N   . THR A 1 63  ? 10.726 7.335   2.510   1.00 35.20 ? 63  THR A N   1 
ATOM   509  C CA  . THR A 1 63  ? 9.526  7.941   3.062   1.00 33.85 ? 63  THR A CA  1 
ATOM   510  C C   . THR A 1 63  ? 9.471  7.711   4.576   1.00 34.52 ? 63  THR A C   1 
ATOM   511  O O   . THR A 1 63  ? 10.280 6.963   5.130   1.00 32.05 ? 63  THR A O   1 
ATOM   512  C CB  . THR A 1 63  ? 8.231  7.364   2.402   1.00 36.82 ? 63  THR A CB  1 
ATOM   513  O OG1 . THR A 1 63  ? 8.052  5.989   2.781   1.00 34.89 ? 63  THR A OG1 1 
ATOM   514  C CG2 . THR A 1 63  ? 8.272  7.488   0.865   1.00 33.78 ? 63  THR A CG2 1 
ATOM   515  N N   . SER A 1 64  ? 8.510  8.344   5.243   1.00 35.71 ? 64  SER A N   1 
ATOM   516  C CA  . SER A 1 64  ? 8.305  8.136   6.679   1.00 42.47 ? 64  SER A CA  1 
ATOM   517  C C   . SER A 1 64  ? 7.990  6.694   7.079   1.00 42.64 ? 64  SER A C   1 
ATOM   518  O O   . SER A 1 64  ? 8.325  6.281   8.186   1.00 43.66 ? 64  SER A O   1 
ATOM   519  C CB  . SER A 1 64  ? 7.209  9.062   7.202   1.00 45.38 ? 64  SER A CB  1 
ATOM   520  O OG  . SER A 1 64  ? 7.739  10.361  7.386   1.00 53.88 ? 64  SER A OG  1 
ATOM   521  N N   . GLN A 1 65  ? 7.350  5.945   6.180   1.00 42.72 ? 65  GLN A N   1 
ATOM   522  C CA  . GLN A 1 65  ? 6.998  4.538   6.409   1.00 45.05 ? 65  GLN A CA  1 
ATOM   523  C C   . GLN A 1 65  ? 8.166  3.593   6.134   1.00 43.55 ? 65  GLN A C   1 
ATOM   524  O O   . GLN A 1 65  ? 8.192  2.459   6.592   1.00 44.77 ? 65  GLN A O   1 
ATOM   525  C CB  . GLN A 1 65  ? 5.825  4.145   5.507   1.00 46.71 ? 65  GLN A CB  1 
ATOM   526  C CG  . GLN A 1 65  ? 4.476  4.735   5.913   1.00 53.85 ? 65  GLN A CG  1 
ATOM   527  C CD  . GLN A 1 65  ? 4.479  6.252   5.944   1.00 59.57 ? 65  GLN A CD  1 
ATOM   528  O OE1 . GLN A 1 65  ? 4.972  6.909   5.019   1.00 62.02 ? 65  GLN A OE1 1 
ATOM   529  N NE2 . GLN A 1 65  ? 3.934  6.820   7.017   1.00 62.57 ? 65  GLN A NE2 1 
ATOM   530  N N   . THR A 1 66  ? 9.130  4.094   5.380   1.00 42.59 ? 66  THR A N   1 
ATOM   531  C CA  . THR A 1 66  ? 10.200 3.313   4.805   1.00 40.80 ? 66  THR A CA  1 
ATOM   532  C C   . THR A 1 66  ? 11.520 3.557   5.555   1.00 41.90 ? 66  THR A C   1 
ATOM   533  O O   . THR A 1 66  ? 12.409 2.683   5.606   1.00 43.80 ? 66  THR A O   1 
ATOM   534  C CB  . THR A 1 66  ? 10.329 3.725   3.319   1.00 42.26 ? 66  THR A CB  1 
ATOM   535  O OG1 . THR A 1 66  ? 9.595  2.803   2.496   1.00 43.12 ? 66  THR A OG1 1 
ATOM   536  C CG2 . THR A 1 66  ? 11.764 3.813   2.877   1.00 36.91 ? 66  THR A CG2 1 
ATOM   537  N N   . ALA A 1 67  ? 11.645 4.746   6.136   1.00 36.43 ? 67  ALA A N   1 
ATOM   538  C CA  . ALA A 1 67  ? 12.898 5.167   6.737   1.00 34.73 ? 67  ALA A CA  1 
ATOM   539  C C   . ALA A 1 67  ? 12.619 5.751   8.121   1.00 33.49 ? 67  ALA A C   1 
ATOM   540  O O   . ALA A 1 67  ? 12.612 6.966   8.301   1.00 34.53 ? 67  ALA A O   1 
ATOM   541  C CB  . ALA A 1 67  ? 13.595 6.169   5.824   1.00 31.36 ? 67  ALA A CB  1 
ATOM   542  N N   . ARG A 1 68  ? 12.367 4.860   9.084   1.00 33.77 ? 68  ARG A N   1 
ATOM   543  C CA  . ARG A 1 68  ? 11.897 5.216   10.433  1.00 33.22 ? 68  ARG A CA  1 
ATOM   544  C C   . ARG A 1 68  ? 13.026 5.217   11.480  1.00 34.31 ? 68  ARG A C   1 
ATOM   545  O O   . ARG A 1 68  ? 14.025 4.525   11.306  1.00 31.63 ? 68  ARG A O   1 
ATOM   546  C CB  . ARG A 1 68  ? 10.792 4.246   10.886  1.00 33.53 ? 68  ARG A CB  1 
ATOM   547  C CG  . ARG A 1 68  ? 9.715  3.954   9.838   1.00 37.81 ? 68  ARG A CG  1 
ATOM   548  C CD  . ARG A 1 68  ? 9.967  2.620   9.143   1.00 41.67 ? 68  ARG A CD  1 
ATOM   549  N NE  . ARG A 1 68  ? 8.938  1.646   9.488   1.00 42.55 ? 68  ARG A NE  1 
ATOM   550  C CZ  . ARG A 1 68  ? 9.021  0.332   9.295   1.00 45.31 ? 68  ARG A CZ  1 
ATOM   551  N NH1 . ARG A 1 68  ? 10.107 -0.226  8.766   1.00 46.50 ? 68  ARG A NH1 1 
ATOM   552  N NH2 . ARG A 1 68  ? 7.997  -0.432  9.643   1.00 47.93 ? 68  ARG A NH2 1 
ATOM   553  N N   . PRO A 1 69  ? 12.867 5.984   12.583  1.00 34.31 ? 69  PRO A N   1 
ATOM   554  C CA  . PRO A 1 69  ? 13.924 5.982   13.609  1.00 35.40 ? 69  PRO A CA  1 
ATOM   555  C C   . PRO A 1 69  ? 14.241 4.591   14.183  1.00 37.63 ? 69  PRO A C   1 
ATOM   556  O O   . PRO A 1 69  ? 15.418 4.276   14.379  1.00 39.49 ? 69  PRO A O   1 
ATOM   557  C CB  . PRO A 1 69  ? 13.366 6.912   14.696  1.00 35.59 ? 69  PRO A CB  1 
ATOM   558  C CG  . PRO A 1 69  ? 12.332 7.730   14.016  1.00 32.75 ? 69  PRO A CG  1 
ATOM   559  C CD  . PRO A 1 69  ? 11.759 6.891   12.933  1.00 32.29 ? 69  PRO A CD  1 
ATOM   560  N N   . GLN A 1 70  ? 13.209 3.778   14.429  1.00 37.61 ? 70  GLN A N   1 
ATOM   561  C CA  . GLN A 1 70  ? 13.352 2.382   14.886  1.00 38.50 ? 70  GLN A CA  1 
ATOM   562  C C   . GLN A 1 70  ? 13.993 1.495   13.837  1.00 36.91 ? 70  GLN A C   1 
ATOM   563  O O   . GLN A 1 70  ? 14.552 0.447   14.169  1.00 38.63 ? 70  GLN A O   1 
ATOM   564  C CB  . GLN A 1 70  ? 11.994 1.709   15.172  1.00 38.75 ? 70  GLN A CB  1 
ATOM   565  C CG  . GLN A 1 70  ? 10.857 2.578   15.579  1.00 42.98 ? 70  GLN A CG  1 
ATOM   566  C CD  . GLN A 1 70  ? 10.250 3.340   14.435  1.00 39.53 ? 70  GLN A CD  1 
ATOM   567  O OE1 . GLN A 1 70  ? 9.508  2.790   13.625  1.00 44.30 ? 70  GLN A OE1 1 
ATOM   568  N NE2 . GLN A 1 70  ? 10.538 4.626   14.377  1.00 37.63 ? 70  GLN A NE2 1 
ATOM   569  N N   . ALA A 1 71  ? 13.849 1.883   12.572  1.00 35.05 ? 71  ALA A N   1 
ATOM   570  C CA  . ALA A 1 71  ? 14.183 1.008   11.446  1.00 33.75 ? 71  ALA A CA  1 
ATOM   571  C C   . ALA A 1 71  ? 14.641 1.838   10.261  1.00 32.24 ? 71  ALA A C   1 
ATOM   572  O O   . ALA A 1 71  ? 13.912 1.964   9.275   1.00 35.25 ? 71  ALA A O   1 
ATOM   573  C CB  . ALA A 1 71  ? 12.966 0.144   11.064  1.00 30.25 ? 71  ALA A CB  1 
ATOM   574  N N   . PRO A 1 72  ? 15.847 2.428   10.351  1.00 34.25 ? 72  PRO A N   1 
ATOM   575  C CA  . PRO A 1 72  ? 16.238 3.371   9.302   1.00 33.16 ? 72  PRO A CA  1 
ATOM   576  C C   . PRO A 1 72  ? 16.533 2.665   7.984   1.00 35.98 ? 72  PRO A C   1 
ATOM   577  O O   . PRO A 1 72  ? 16.735 1.447   7.969   1.00 37.13 ? 72  PRO A O   1 
ATOM   578  C CB  . PRO A 1 72  ? 17.492 4.028   9.875   1.00 32.48 ? 72  PRO A CB  1 
ATOM   579  C CG  . PRO A 1 72  ? 18.057 3.025   10.803  1.00 31.60 ? 72  PRO A CG  1 
ATOM   580  C CD  . PRO A 1 72  ? 16.892 2.282   11.382  1.00 33.15 ? 72  PRO A CD  1 
ATOM   581  N N   . ALA A 1 73  ? 16.525 3.418   6.886   1.00 35.82 ? 73  ALA A N   1 
ATOM   582  C CA  . ALA A 1 73  ? 16.864 2.865   5.584   1.00 34.73 ? 73  ALA A CA  1 
ATOM   583  C C   . ALA A 1 73  ? 18.358 3.038   5.361   1.00 35.84 ? 73  ALA A C   1 
ATOM   584  O O   . ALA A 1 73  ? 18.948 3.998   5.824   1.00 36.19 ? 73  ALA A O   1 
ATOM   585  C CB  . ALA A 1 73  ? 16.088 3.559   4.499   1.00 32.45 ? 73  ALA A CB  1 
ATOM   586  N N   . THR A 1 74  ? 18.961 2.094   4.654   1.00 38.33 ? 74  THR A N   1 
ATOM   587  C CA  . THR A 1 74  ? 20.367 2.186   4.290   1.00 40.38 ? 74  THR A CA  1 
ATOM   588  C C   . THR A 1 74  ? 20.560 2.989   2.996   1.00 40.32 ? 74  THR A C   1 
ATOM   589  O O   . THR A 1 74  ? 19.781 2.869   2.046   1.00 35.65 ? 74  THR A O   1 
ATOM   590  C CB  . THR A 1 74  ? 21.009 0.783   4.163   1.00 39.46 ? 74  THR A CB  1 
ATOM   591  O OG1 . THR A 1 74  ? 20.992 0.147   5.444   1.00 41.23 ? 74  THR A OG1 1 
ATOM   592  C CG2 . THR A 1 74  ? 22.468 0.889   3.700   1.00 43.62 ? 74  THR A CG2 1 
ATOM   593  N N   . VAL A 1 75  ? 21.590 3.832   2.996   1.00 39.18 ? 75  VAL A N   1 
ATOM   594  C CA  . VAL A 1 75  ? 22.091 4.440   1.782   1.00 37.96 ? 75  VAL A CA  1 
ATOM   595  C C   . VAL A 1 75  ? 23.516 3.911   1.656   1.00 37.05 ? 75  VAL A C   1 
ATOM   596  O O   . VAL A 1 75  ? 24.283 3.989   2.614   1.00 38.50 ? 75  VAL A O   1 
ATOM   597  C CB  . VAL A 1 75  ? 22.115 5.989   1.876   1.00 39.71 ? 75  VAL A CB  1 
ATOM   598  C CG1 . VAL A 1 75  ? 22.528 6.604   0.549   1.00 37.89 ? 75  VAL A CG1 1 
ATOM   599  C CG2 . VAL A 1 75  ? 20.761 6.550   2.323   1.00 40.94 ? 75  VAL A CG2 1 
ATOM   600  N N   . GLY A 1 76  ? 23.859 3.346   0.501   1.00 33.44 ? 76  GLY A N   1 
ATOM   601  C CA  . GLY A 1 76  ? 25.236 2.932   0.236   1.00 33.20 ? 76  GLY A CA  1 
ATOM   602  C C   . GLY A 1 76  ? 26.077 4.097   -0.269  1.00 34.00 ? 76  GLY A C   1 
ATOM   603  O O   . GLY A 1 76  ? 25.591 4.949   -1.007  1.00 34.17 ? 76  GLY A O   1 
ATOM   604  N N   . LEU A 1 77  ? 27.343 4.134   0.130   1.00 33.57 ? 77  LEU A N   1 
ATOM   605  C CA  . LEU A 1 77  ? 28.217 5.235   -0.217  1.00 32.33 ? 77  LEU A CA  1 
ATOM   606  C C   . LEU A 1 77  ? 29.506 4.731   -0.855  1.00 34.36 ? 77  LEU A C   1 
ATOM   607  O O   . LEU A 1 77  ? 30.212 3.884   -0.279  1.00 33.58 ? 77  LEU A O   1 
ATOM   608  C CB  . LEU A 1 77  ? 28.512 6.093   1.024   1.00 31.75 ? 77  LEU A CB  1 
ATOM   609  C CG  . LEU A 1 77  ? 29.673 7.090   1.016   1.00 30.18 ? 77  LEU A CG  1 
ATOM   610  C CD1 . LEU A 1 77  ? 29.434 8.248   0.031   1.00 29.62 ? 77  LEU A CD1 1 
ATOM   611  C CD2 . LEU A 1 77  ? 29.910 7.599   2.435   1.00 27.32 ? 77  LEU A CD2 1 
ATOM   612  N N   . ALA A 1 78  ? 29.796 5.260   -2.045  1.00 32.73 ? 78  ALA A N   1 
ATOM   613  C CA  . ALA A 1 78  ? 31.024 4.946   -2.770  1.00 33.04 ? 78  ALA A CA  1 
ATOM   614  C C   . ALA A 1 78  ? 31.798 6.233   -3.025  1.00 34.15 ? 78  ALA A C   1 
ATOM   615  O O   . ALA A 1 78  ? 31.228 7.248   -3.419  1.00 34.04 ? 78  ALA A O   1 
ATOM   616  C CB  . ALA A 1 78  ? 30.712 4.229   -4.078  1.00 30.52 ? 78  ALA A CB  1 
ATOM   617  N N   . PHE A 1 79  ? 33.097 6.189   -2.771  1.00 36.55 ? 79  PHE A N   1 
ATOM   618  C CA  . PHE A 1 79  ? 33.951 7.348   -2.941  1.00 37.97 ? 79  PHE A CA  1 
ATOM   619  C C   . PHE A 1 79  ? 34.745 7.250   -4.237  1.00 39.98 ? 79  PHE A C   1 
ATOM   620  O O   . PHE A 1 79  ? 35.007 6.158   -4.748  1.00 37.37 ? 79  PHE A O   1 
ATOM   621  C CB  . PHE A 1 79  ? 34.924 7.483   -1.765  1.00 38.45 ? 79  PHE A CB  1 
ATOM   622  C CG  . PHE A 1 79  ? 34.347 8.171   -0.551  1.00 39.07 ? 79  PHE A CG  1 
ATOM   623  C CD1 . PHE A 1 79  ? 33.529 9.285   -0.676  1.00 36.50 ? 79  PHE A CD1 1 
ATOM   624  C CD2 . PHE A 1 79  ? 34.682 7.731   0.727   1.00 39.96 ? 79  PHE A CD2 1 
ATOM   625  C CE1 . PHE A 1 79  ? 33.023 9.921   0.448   1.00 36.47 ? 79  PHE A CE1 1 
ATOM   626  C CE2 . PHE A 1 79  ? 34.183 8.364   1.863   1.00 38.21 ? 79  PHE A CE2 1 
ATOM   627  C CZ  . PHE A 1 79  ? 33.348 9.461   1.721   1.00 39.32 ? 79  PHE A CZ  1 
ATOM   628  N N   . ARG A 1 80  ? 35.109 8.410   -4.764  1.00 41.64 ? 80  ARG A N   1 
ATOM   629  C CA  . ARG A 1 80  ? 36.033 8.497   -5.871  1.00 46.15 ? 80  ARG A CA  1 
ATOM   630  C C   . ARG A 1 80  ? 37.431 8.271   -5.296  1.00 47.80 ? 80  ARG A C   1 
ATOM   631  O O   . ARG A 1 80  ? 37.843 8.963   -4.358  1.00 48.07 ? 80  ARG A O   1 
ATOM   632  C CB  . ARG A 1 80  ? 35.929 9.877   -6.507  1.00 46.04 ? 80  ARG A CB  1 
ATOM   633  C CG  . ARG A 1 80  ? 36.360 9.933   -7.938  1.00 48.64 ? 80  ARG A CG  1 
ATOM   634  C CD  . ARG A 1 80  ? 36.449 11.372  -8.392  1.00 51.41 ? 80  ARG A CD  1 
ATOM   635  N NE  . ARG A 1 80  ? 35.136 11.950  -8.656  1.00 49.06 ? 80  ARG A NE  1 
ATOM   636  C CZ  . ARG A 1 80  ? 34.502 11.861  -9.820  1.00 51.42 ? 80  ARG A CZ  1 
ATOM   637  N NH1 . ARG A 1 80  ? 35.052 11.207  -10.837 1.00 50.65 ? 80  ARG A NH1 1 
ATOM   638  N NH2 . ARG A 1 80  ? 33.311 12.424  -9.967  1.00 52.63 ? 80  ARG A NH2 1 
ATOM   639  N N   . ALA A 1 81  ? 38.139 7.286   -5.845  1.00 48.73 ? 81  ALA A N   1 
ATOM   640  C CA  . ALA A 1 81  ? 39.441 6.869   -5.328  1.00 49.72 ? 81  ALA A CA  1 
ATOM   641  C C   . ALA A 1 81  ? 40.584 7.784   -5.782  1.00 50.92 ? 81  ALA A C   1 
ATOM   642  O O   . ALA A 1 81  ? 40.752 8.057   -6.972  1.00 51.12 ? 81  ALA A O   1 
ATOM   643  C CB  . ALA A 1 81  ? 39.722 5.419   -5.715  1.00 49.99 ? 81  ALA A CB  1 
ATOM   644  N N   . ASP A 1 83  ? 40.085 9.583   -8.941  1.00 39.94 ? 83  ASP A N   1 
ATOM   645  C CA  . ASP A 1 83  ? 39.914 9.390   -10.387 1.00 39.94 ? 83  ASP A CA  1 
ATOM   646  C C   . ASP A 1 83  ? 38.688 8.506   -10.684 1.00 39.94 ? 83  ASP A C   1 
ATOM   647  O O   . ASP A 1 83  ? 37.763 8.934   -11.382 1.00 50.15 ? 83  ASP A O   1 
ATOM   648  C CB  . ASP A 1 83  ? 41.197 8.826   -10.980 1.00 39.94 ? 83  ASP A CB  1 
ATOM   649  C CG  . ASP A 1 83  ? 42.280 9.895   -11.088 1.00 39.94 ? 83  ASP A CG  1 
ATOM   650  O OD1 . ASP A 1 83  ? 41.928 11.047  -10.643 1.00 39.94 ? 83  ASP A OD1 1 
ATOM   651  O OD2 . ASP A 1 83  ? 43.448 9.639   -11.613 1.00 39.94 ? 83  ASP A OD2 1 
ATOM   652  N N   . THR A 1 84  ? 38.683 7.295   -10.129 1.00 50.67 ? 84  THR A N   1 
ATOM   653  C CA  . THR A 1 84  ? 37.661 6.294   -10.429 1.00 52.09 ? 84  THR A CA  1 
ATOM   654  C C   . THR A 1 84  ? 36.851 5.956   -9.183  1.00 52.14 ? 84  THR A C   1 
ATOM   655  O O   . THR A 1 84  ? 37.392 5.872   -8.081  1.00 53.72 ? 84  THR A O   1 
ATOM   656  C CB  . THR A 1 84  ? 38.306 5.015   -11.042 1.00 51.79 ? 84  THR A CB  1 
ATOM   657  O OG1 . THR A 1 84  ? 38.909 5.351   -12.300 1.00 54.43 ? 84  THR A OG1 1 
ATOM   658  C CG2 . THR A 1 84  ? 37.283 3.907   -11.275 1.00 51.95 ? 84  THR A CG2 1 
ATOM   659  N N   . PHE A 1 85  ? 35.548 5.775   -9.362  1.00 51.57 ? 85  PHE A N   1 
ATOM   660  C CA  . PHE A 1 85  ? 34.704 5.329   -8.269  1.00 51.65 ? 85  PHE A CA  1 
ATOM   661  C C   . PHE A 1 85  ? 34.900 3.848   -8.016  1.00 52.63 ? 85  PHE A C   1 
ATOM   662  O O   . PHE A 1 85  ? 34.889 3.041   -8.948  1.00 55.88 ? 85  PHE A O   1 
ATOM   663  C CB  . PHE A 1 85  ? 33.234 5.610   -8.561  1.00 50.39 ? 85  PHE A CB  1 
ATOM   664  C CG  . PHE A 1 85  ? 32.823 7.021   -8.286  1.00 48.43 ? 85  PHE A CG  1 
ATOM   665  C CD1 . PHE A 1 85  ? 32.604 7.452   -6.982  1.00 46.76 ? 85  PHE A CD1 1 
ATOM   666  C CD2 . PHE A 1 85  ? 32.645 7.921   -9.328  1.00 47.73 ? 85  PHE A CD2 1 
ATOM   667  C CE1 . PHE A 1 85  ? 32.221 8.757   -6.722  1.00 45.76 ? 85  PHE A CE1 1 
ATOM   668  C CE2 . PHE A 1 85  ? 32.260 9.231   -9.076  1.00 47.30 ? 85  PHE A CE2 1 
ATOM   669  C CZ  . PHE A 1 85  ? 32.045 9.649   -7.769  1.00 45.73 ? 85  PHE A CZ  1 
ATOM   670  N N   . GLU A 1 86  ? 35.103 3.508   -6.747  1.00 51.80 ? 86  GLU A N   1 
ATOM   671  C CA  . GLU A 1 86  ? 35.072 2.128   -6.278  1.00 49.59 ? 86  GLU A CA  1 
ATOM   672  C C   . GLU A 1 86  ? 33.655 1.581   -6.451  1.00 50.04 ? 86  GLU A C   1 
ATOM   673  O O   . GLU A 1 86  ? 32.680 2.348   -6.492  1.00 50.15 ? 86  GLU A O   1 
ATOM   674  C CB  . GLU A 1 86  ? 35.466 2.082   -4.796  1.00 49.53 ? 86  GLU A CB  1 
ATOM   675  C CG  . GLU A 1 86  ? 34.423 2.730   -3.851  1.00 48.55 ? 86  GLU A CG  1 
ATOM   676  C CD  . GLU A 1 86  ? 34.965 3.125   -2.483  1.00 48.71 ? 86  GLU A CD  1 
ATOM   677  O OE1 . GLU A 1 86  ? 36.197 3.168   -2.290  1.00 48.11 ? 86  GLU A OE1 1 
ATOM   678  O OE2 . GLU A 1 86  ? 34.141 3.408   -1.589  1.00 50.32 ? 86  GLU A OE2 1 
ATOM   679  N N   . ALA A 1 87  ? 33.535 0.261   -6.559  1.00 49.38 ? 87  ALA A N   1 
ATOM   680  C CA  . ALA A 1 87  ? 32.225 -0.383  -6.455  1.00 48.34 ? 87  ALA A CA  1 
ATOM   681  C C   . ALA A 1 87  ? 31.753 -0.279  -5.004  1.00 46.69 ? 87  ALA A C   1 
ATOM   682  O O   . ALA A 1 87  ? 32.566 -0.140  -4.086  1.00 44.95 ? 87  ALA A O   1 
ATOM   683  C CB  . ALA A 1 87  ? 32.294 -1.840  -6.902  1.00 49.30 ? 87  ALA A CB  1 
ATOM   684  N N   . LEU A 1 88  ? 30.442 -0.323  -4.803  1.00 45.78 ? 88  LEU A N   1 
ATOM   685  C CA  . LEU A 1 88  ? 29.878 -0.210  -3.467  1.00 44.71 ? 88  LEU A CA  1 
ATOM   686  C C   . LEU A 1 88  ? 30.467 -1.273  -2.538  1.00 45.57 ? 88  LEU A C   1 
ATOM   687  O O   . LEU A 1 88  ? 30.289 -2.477  -2.758  1.00 46.53 ? 88  LEU A O   1 
ATOM   688  C CB  . LEU A 1 88  ? 28.349 -0.293  -3.518  1.00 42.96 ? 88  LEU A CB  1 
ATOM   689  C CG  . LEU A 1 88  ? 27.542 0.007   -2.252  1.00 44.09 ? 88  LEU A CG  1 
ATOM   690  C CD1 . LEU A 1 88  ? 28.026 1.260   -1.529  1.00 40.37 ? 88  LEU A CD1 1 
ATOM   691  C CD2 . LEU A 1 88  ? 26.070 0.124   -2.600  1.00 44.03 ? 88  LEU A CD2 1 
ATOM   692  N N   . CYS A 1 89  ? 31.210 -0.824  -1.528  1.00 44.16 ? 89  CYS A N   1 
ATOM   693  C CA  . CYS A 1 89  ? 31.691 -1.731  -0.494  1.00 43.66 ? 89  CYS A CA  1 
ATOM   694  C C   . CYS A 1 89  ? 31.026 -1.432  0.846   1.00 42.72 ? 89  CYS A C   1 
ATOM   695  O O   . CYS A 1 89  ? 31.258 -0.379  1.446   1.00 43.03 ? 89  CYS A O   1 
ATOM   696  C CB  . CYS A 1 89  ? 33.212 -1.681  -0.365  1.00 44.84 ? 89  CYS A CB  1 
ATOM   697  S SG  . CYS A 1 89  ? 33.876 -2.978  0.710   1.00 48.13 ? 89  CYS A SG  1 
ATOM   698  N N   . ILE A 1 90  ? 30.165 -2.348  1.285   1.00 39.66 ? 90  ILE A N   1 
ATOM   699  C CA  . ILE A 1 90  ? 29.540 -2.260  2.600   1.00 37.65 ? 90  ILE A CA  1 
ATOM   700  C C   . ILE A 1 90  ? 29.786 -3.567  3.347   1.00 38.68 ? 90  ILE A C   1 
ATOM   701  O O   . ILE A 1 90  ? 29.527 -4.648  2.817   1.00 39.09 ? 90  ILE A O   1 
ATOM   702  C CB  . ILE A 1 90  ? 28.031 -1.980  2.516   1.00 36.82 ? 90  ILE A CB  1 
ATOM   703  C CG1 . ILE A 1 90  ? 27.754 -0.649  1.800   1.00 34.62 ? 90  ILE A CG1 1 
ATOM   704  C CG2 . ILE A 1 90  ? 27.410 -1.944  3.919   1.00 36.90 ? 90  ILE A CG2 1 
ATOM   705  C CD1 . ILE A 1 90  ? 26.259 -0.375  1.601   1.00 30.87 ? 90  ILE A CD1 1 
ATOM   706  N N   . GLU A 1 91  ? 30.311 -3.461  4.565   1.00 38.54 ? 91  GLU A N   1 
ATOM   707  C CA  . GLU A 1 91  ? 30.611 -4.638  5.380   1.00 38.85 ? 91  GLU A CA  1 
ATOM   708  C C   . GLU A 1 91  ? 29.394 -4.980  6.239   1.00 36.28 ? 91  GLU A C   1 
ATOM   709  O O   . GLU A 1 91  ? 28.773 -4.091  6.817   1.00 36.48 ? 91  GLU A O   1 
ATOM   710  C CB  . GLU A 1 91  ? 31.840 -4.378  6.254   1.00 40.50 ? 91  GLU A CB  1 
ATOM   711  C CG  . GLU A 1 91  ? 32.603 -5.624  6.696   1.00 47.31 ? 91  GLU A CG  1 
ATOM   712  C CD  . GLU A 1 91  ? 33.481 -6.218  5.601   1.00 51.34 ? 91  GLU A CD  1 
ATOM   713  O OE1 . GLU A 1 91  ? 33.882 -5.485  4.667   1.00 50.59 ? 91  GLU A OE1 1 
ATOM   714  O OE2 . GLU A 1 91  ? 33.780 -7.431  5.686   1.00 55.33 ? 91  GLU A OE2 1 
ATOM   715  N N   . PRO A 1 92  ? 29.032 -6.271  6.321   1.00 35.53 ? 92  PRO A N   1 
ATOM   716  C CA  . PRO A 1 92  ? 27.842 -6.561  7.125   1.00 34.98 ? 92  PRO A CA  1 
ATOM   717  C C   . PRO A 1 92  ? 28.126 -6.387  8.615   1.00 34.49 ? 92  PRO A C   1 
ATOM   718  O O   . PRO A 1 92  ? 29.283 -6.502  9.038   1.00 33.97 ? 92  PRO A O   1 
ATOM   719  C CB  . PRO A 1 92  ? 27.564 -8.032  6.816   1.00 34.85 ? 92  PRO A CB  1 
ATOM   720  C CG  . PRO A 1 92  ? 28.909 -8.605  6.453   1.00 32.73 ? 92  PRO A CG  1 
ATOM   721  C CD  . PRO A 1 92  ? 29.638 -7.492  5.750   1.00 33.27 ? 92  PRO A CD  1 
ATOM   722  N N   . PHE A 1 93  ? 27.086 -6.103  9.398   1.00 33.26 ? 93  PHE A N   1 
ATOM   723  C CA  . PHE A 1 93  ? 27.197 -6.199  10.855  1.00 33.80 ? 93  PHE A CA  1 
ATOM   724  C C   . PHE A 1 93  ? 27.421 -7.665  11.238  1.00 33.71 ? 93  PHE A C   1 
ATOM   725  O O   . PHE A 1 93  ? 27.181 -8.568  10.428  1.00 35.46 ? 93  PHE A O   1 
ATOM   726  C CB  . PHE A 1 93  ? 25.940 -5.669  11.550  1.00 32.64 ? 93  PHE A CB  1 
ATOM   727  C CG  . PHE A 1 93  ? 25.636 -4.232  11.255  1.00 35.94 ? 93  PHE A CG  1 
ATOM   728  C CD1 . PHE A 1 93  ? 26.652 -3.277  11.211  1.00 38.96 ? 93  PHE A CD1 1 
ATOM   729  C CD2 . PHE A 1 93  ? 24.326 -3.822  11.044  1.00 36.13 ? 93  PHE A CD2 1 
ATOM   730  C CE1 . PHE A 1 93  ? 26.366 -1.941  10.932  1.00 38.71 ? 93  PHE A CE1 1 
ATOM   731  C CE2 . PHE A 1 93  ? 24.030 -2.480  10.776  1.00 37.68 ? 93  PHE A CE2 1 
ATOM   732  C CZ  . PHE A 1 93  ? 25.055 -1.542  10.719  1.00 35.15 ? 93  PHE A CZ  1 
ATOM   733  N N   . SER A 1 94  ? 27.883 -7.900  12.462  1.00 32.75 ? 94  SER A N   1 
ATOM   734  C CA  . SER A 1 94  ? 28.026 -9.257  12.971  1.00 33.35 ? 94  SER A CA  1 
ATOM   735  C C   . SER A 1 94  ? 26.668 -9.991  12.987  1.00 34.61 ? 94  SER A C   1 
ATOM   736  O O   . SER A 1 94  ? 25.610 -9.373  13.133  1.00 34.63 ? 94  SER A O   1 
ATOM   737  C CB  . SER A 1 94  ? 28.663 -9.241  14.363  1.00 33.52 ? 94  SER A CB  1 
ATOM   738  O OG  . SER A 1 94  ? 27.908 -8.446  15.265  1.00 39.86 ? 94  SER A OG  1 
ATOM   739  N N   . SER A 1 95  ? 26.716 -11.307 12.810  1.00 35.08 ? 95  SER A N   1 
ATOM   740  C CA  . SER A 1 95  ? 25.525 -12.147 12.747  1.00 35.96 ? 95  SER A CA  1 
ATOM   741  C C   . SER A 1 95  ? 24.943 -12.423 14.147  1.00 36.77 ? 95  SER A C   1 
ATOM   742  O O   . SER A 1 95  ? 25.656 -12.913 15.029  1.00 32.79 ? 95  SER A O   1 
ATOM   743  C CB  . SER A 1 95  ? 25.857 -13.461 12.033  1.00 34.15 ? 95  SER A CB  1 
ATOM   744  O OG  . SER A 1 95  ? 24.690 -14.211 11.763  1.00 33.12 ? 95  SER A OG  1 
ATOM   745  N N   . PRO A 1 96  ? 23.655 -12.069 14.358  1.00 39.49 ? 96  PRO A N   1 
ATOM   746  C CA  . PRO A 1 96  ? 22.930 -12.371 15.600  1.00 40.46 ? 96  PRO A CA  1 
ATOM   747  C C   . PRO A 1 96  ? 22.909 -13.867 15.901  1.00 42.36 ? 96  PRO A C   1 
ATOM   748  O O   . PRO A 1 96  ? 22.800 -14.671 14.970  1.00 42.04 ? 96  PRO A O   1 
ATOM   749  C CB  . PRO A 1 96  ? 21.501 -11.884 15.319  1.00 40.33 ? 96  PRO A CB  1 
ATOM   750  C CG  . PRO A 1 96  ? 21.430 -11.594 13.858  1.00 41.39 ? 96  PRO A CG  1 
ATOM   751  C CD  . PRO A 1 96  ? 22.823 -11.308 13.405  1.00 40.55 ? 96  PRO A CD  1 
ATOM   752  N N   . PRO A 1 97  ? 23.000 -14.240 17.197  1.00 44.01 ? 97  PRO A N   1 
ATOM   753  C CA  . PRO A 1 97  ? 22.989 -15.650 17.600  1.00 46.22 ? 97  PRO A CA  1 
ATOM   754  C C   . PRO A 1 97  ? 21.651 -16.313 17.298  1.00 48.72 ? 97  PRO A C   1 
ATOM   755  O O   . PRO A 1 97  ? 20.703 -15.641 16.903  1.00 48.60 ? 97  PRO A O   1 
ATOM   756  C CB  . PRO A 1 97  ? 23.211 -15.597 19.122  1.00 45.50 ? 97  PRO A CB  1 
ATOM   757  C CG  . PRO A 1 97  ? 23.652 -14.206 19.428  1.00 45.15 ? 97  PRO A CG  1 
ATOM   758  C CD  . PRO A 1 97  ? 23.095 -13.333 18.357  1.00 43.41 ? 97  PRO A CD  1 
ATOM   759  N N   . GLU A 1 98  ? 21.582 -17.625 17.477  1.00 53.79 ? 98  GLU A N   1 
ATOM   760  C CA  . GLU A 1 98  ? 20.329 -18.345 17.321  1.00 59.08 ? 98  GLU A CA  1 
ATOM   761  C C   . GLU A 1 98  ? 19.817 -18.803 18.685  1.00 63.02 ? 98  GLU A C   1 
ATOM   762  O O   . GLU A 1 98  ? 20.591 -18.925 19.636  1.00 63.53 ? 98  GLU A O   1 
ATOM   763  C CB  . GLU A 1 98  ? 20.508 -19.529 16.376  1.00 58.77 ? 98  GLU A CB  1 
ATOM   764  C CG  . GLU A 1 98  ? 19.284 -19.818 15.530  1.00 60.20 ? 98  GLU A CG  1 
ATOM   765  C CD  . GLU A 1 98  ? 19.514 -20.920 14.514  1.00 62.18 ? 98  GLU A CD  1 
ATOM   766  O OE1 . GLU A 1 98  ? 18.638 -21.107 13.644  1.00 63.22 ? 98  GLU A OE1 1 
ATOM   767  O OE2 . GLU A 1 98  ? 20.560 -21.605 14.579  1.00 62.87 ? 98  GLU A OE2 1 
ATOM   768  N N   . LEU A 1 99  ? 18.512 -19.049 18.767  1.00 68.83 ? 99  LEU A N   1 
ATOM   769  C CA  . LEU A 1 99  ? 17.846 -19.435 20.016  1.00 72.99 ? 99  LEU A CA  1 
ATOM   770  C C   . LEU A 1 99  ? 17.959 -20.947 20.308  1.00 76.03 ? 99  LEU A C   1 
ATOM   771  O O   . LEU A 1 99  ? 18.507 -21.695 19.489  1.00 76.03 ? 99  LEU A O   1 
ATOM   772  C CB  . LEU A 1 99  ? 16.380 -18.977 19.979  1.00 73.01 ? 99  LEU A CB  1 
ATOM   773  C CG  . LEU A 1 99  ? 16.119 -17.464 19.944  1.00 73.41 ? 99  LEU A CG  1 
ATOM   774  C CD1 . LEU A 1 99  ? 14.708 -17.172 19.443  1.00 73.36 ? 99  LEU A CD1 1 
ATOM   775  C CD2 . LEU A 1 99  ? 16.362 -16.814 21.307  1.00 71.41 ? 99  LEU A CD2 1 
ATOM   776  N N   . PRO A 1 100 ? 17.470 -21.402 21.485  1.00 78.67 ? 100 PRO A N   1 
ATOM   777  C CA  . PRO A 1 100 ? 17.519 -22.834 21.767  1.00 80.33 ? 100 PRO A CA  1 
ATOM   778  C C   . PRO A 1 100 ? 16.226 -23.543 21.355  1.00 82.02 ? 100 PRO A C   1 
ATOM   779  O O   . PRO A 1 100 ? 16.111 -24.763 21.499  1.00 83.58 ? 100 PRO A O   1 
ATOM   780  C CB  . PRO A 1 100 ? 17.693 -22.875 23.287  1.00 80.35 ? 100 PRO A CB  1 
ATOM   781  C CG  . PRO A 1 100 ? 17.034 -21.603 23.785  1.00 79.89 ? 100 PRO A CG  1 
ATOM   782  C CD  . PRO A 1 100 ? 16.881 -20.655 22.615  1.00 79.31 ? 100 PRO A CD  1 
ATOM   783  N N   . MET B 2 2   ? 29.139 18.102  17.323  1.00 44.84 ? 17  MET B N   1 
ATOM   784  C CA  . MET B 2 2   ? 27.774 17.826  16.787  1.00 45.08 ? 17  MET B CA  1 
ATOM   785  C C   . MET B 2 2   ? 27.506 16.328  16.645  1.00 42.25 ? 17  MET B C   1 
ATOM   786  O O   . MET B 2 2   ? 26.414 15.857  16.967  1.00 42.85 ? 17  MET B O   1 
ATOM   787  C CB  . MET B 2 2   ? 27.574 18.525  15.443  1.00 47.27 ? 17  MET B CB  1 
ATOM   788  C CG  . MET B 2 2   ? 26.131 18.904  15.171  1.00 53.28 ? 17  MET B CG  1 
ATOM   789  S SD  . MET B 2 2   ? 25.914 19.933  13.707  1.00 61.96 ? 17  MET B SD  1 
ATOM   790  C CE  . MET B 2 2   ? 27.050 21.292  14.021  1.00 59.26 ? 17  MET B CE  1 
ATOM   791  N N   . TYR B 2 3   ? 28.503 15.595  16.157  1.00 39.23 ? 18  TYR B N   1 
ATOM   792  C CA  . TYR B 2 3   ? 28.425 14.140  16.019  1.00 37.07 ? 18  TYR B CA  1 
ATOM   793  C C   . TYR B 2 3   ? 29.476 13.437  16.890  1.00 36.23 ? 18  TYR B C   1 
ATOM   794  O O   . TYR B 2 3   ? 30.549 13.981  17.139  1.00 37.51 ? 18  TYR B O   1 
ATOM   795  C CB  . TYR B 2 3   ? 28.599 13.729  14.549  1.00 36.96 ? 18  TYR B CB  1 
ATOM   796  C CG  . TYR B 2 3   ? 27.359 13.873  13.672  1.00 35.52 ? 18  TYR B CG  1 
ATOM   797  C CD1 . TYR B 2 3   ? 27.091 15.064  12.996  1.00 35.35 ? 18  TYR B CD1 1 
ATOM   798  C CD2 . TYR B 2 3   ? 26.474 12.804  13.496  1.00 35.92 ? 18  TYR B CD2 1 
ATOM   799  C CE1 . TYR B 2 3   ? 25.966 15.198  12.181  1.00 38.67 ? 18  TYR B CE1 1 
ATOM   800  C CE2 . TYR B 2 3   ? 25.340 12.921  12.682  1.00 36.70 ? 18  TYR B CE2 1 
ATOM   801  C CZ  . TYR B 2 3   ? 25.093 14.122  12.030  1.00 40.82 ? 18  TYR B CZ  1 
ATOM   802  O OH  . TYR B 2 3   ? 23.979 14.259  11.227  1.00 42.84 ? 18  TYR B OH  1 
ATOM   803  N N   . VAL B 2 4   ? 29.154 12.234  17.358  1.00 35.43 ? 19  VAL B N   1 
ATOM   804  C CA  . VAL B 2 4   ? 30.100 11.397  18.099  1.00 33.36 ? 19  VAL B CA  1 
ATOM   805  C C   . VAL B 2 4   ? 30.290 10.059  17.397  1.00 33.05 ? 19  VAL B C   1 
ATOM   806  O O   . VAL B 2 4   ? 29.399 9.586   16.694  1.00 33.75 ? 19  VAL B O   1 
ATOM   807  C CB  . VAL B 2 4   ? 29.669 11.138  19.579  1.00 34.73 ? 19  VAL B CB  1 
ATOM   808  C CG1 . VAL B 2 4   ? 29.651 12.426  20.381  1.00 35.57 ? 19  VAL B CG1 1 
ATOM   809  C CG2 . VAL B 2 4   ? 28.320 10.416  19.658  1.00 34.75 ? 19  VAL B CG2 1 
ATOM   810  N N   . LYS B 2 5   ? 31.454 9.451   17.603  1.00 32.50 ? 20  LYS B N   1 
ATOM   811  C CA  . LYS B 2 5   ? 31.772 8.178   16.987  1.00 33.65 ? 20  LYS B CA  1 
ATOM   812  C C   . LYS B 2 5   ? 31.801 7.044   18.021  1.00 34.34 ? 20  LYS B C   1 
ATOM   813  O O   . LYS B 2 5   ? 32.594 7.066   18.961  1.00 32.70 ? 20  LYS B O   1 
ATOM   814  C CB  . LYS B 2 5   ? 33.098 8.282   16.229  1.00 33.34 ? 20  LYS B CB  1 
ATOM   815  C CG  . LYS B 2 5   ? 33.600 6.963   15.655  1.00 37.55 ? 20  LYS B CG  1 
ATOM   816  C CD  . LYS B 2 5   ? 35.011 7.103   15.097  1.00 39.09 ? 20  LYS B CD  1 
ATOM   817  C CE  . LYS B 2 5   ? 34.985 7.617   13.673  1.00 37.14 ? 20  LYS B CE  1 
ATOM   818  N NZ  . LYS B 2 5   ? 36.354 7.837   13.159  1.00 38.15 ? 20  LYS B NZ  1 
ATOM   819  N N   . LEU B 2 6   ? 30.923 6.062   17.839  1.00 34.43 ? 21  LEU B N   1 
ATOM   820  C CA  . LEU B 2 6   ? 30.879 4.888   18.712  1.00 34.57 ? 21  LEU B CA  1 
ATOM   821  C C   . LEU B 2 6   ? 31.397 3.671   17.958  1.00 34.92 ? 21  LEU B C   1 
ATOM   822  O O   . LEU B 2 6   ? 30.925 3.361   16.865  1.00 36.01 ? 21  LEU B O   1 
ATOM   823  C CB  . LEU B 2 6   ? 29.454 4.637   19.218  1.00 34.87 ? 21  LEU B CB  1 
ATOM   824  C CG  . LEU B 2 6   ? 28.620 5.863   19.607  1.00 35.93 ? 21  LEU B CG  1 
ATOM   825  C CD1 . LEU B 2 6   ? 27.174 5.460   19.860  1.00 38.01 ? 21  LEU B CD1 1 
ATOM   826  C CD2 . LEU B 2 6   ? 29.206 6.589   20.816  1.00 37.53 ? 21  LEU B CD2 1 
ATOM   827  N N   . ILE B 2 7   ? 32.375 2.992   18.549  1.00 36.20 ? 22  ILE B N   1 
ATOM   828  C CA  . ILE B 2 7   ? 33.068 1.885   17.897  1.00 34.54 ? 22  ILE B CA  1 
ATOM   829  C C   . ILE B 2 7   ? 32.751 0.557   18.580  1.00 33.99 ? 22  ILE B C   1 
ATOM   830  O O   . ILE B 2 7   ? 32.891 0.422   19.797  1.00 33.64 ? 22  ILE B O   1 
ATOM   831  C CB  . ILE B 2 7   ? 34.606 2.124   17.851  1.00 34.24 ? 22  ILE B CB  1 
ATOM   832  C CG1 . ILE B 2 7   ? 34.912 3.458   17.162  1.00 35.74 ? 22  ILE B CG1 1 
ATOM   833  C CG2 . ILE B 2 7   ? 35.324 0.964   17.140  1.00 30.68 ? 22  ILE B CG2 1 
ATOM   834  C CD1 . ILE B 2 7   ? 36.325 3.972   17.385  1.00 40.34 ? 22  ILE B CD1 1 
ATOM   835  N N   . SER B 2 8   ? 32.329 -0.420  17.783  1.00 33.00 ? 23  SER B N   1 
ATOM   836  C CA  . SER B 2 8   ? 31.968 -1.736  18.302  1.00 32.80 ? 23  SER B CA  1 
ATOM   837  C C   . SER B 2 8   ? 33.190 -2.642  18.447  1.00 32.79 ? 23  SER B C   1 
ATOM   838  O O   . SER B 2 8   ? 34.295 -2.288  18.019  1.00 32.24 ? 23  SER B O   1 
ATOM   839  C CB  . SER B 2 8   ? 30.903 -2.392  17.413  1.00 32.55 ? 23  SER B CB  1 
ATOM   840  O OG  . SER B 2 8   ? 31.443 -2.783  16.163  1.00 33.65 ? 23  SER B OG  1 
ATOM   841  N N   . SER B 2 9   ? 32.974 -3.810  19.049  1.00 33.89 ? 24  SER B N   1 
ATOM   842  C CA  . SER B 2 9   ? 34.036 -4.780  19.321  1.00 34.21 ? 24  SER B CA  1 
ATOM   843  C C   . SER B 2 9   ? 34.592 -5.406  18.050  1.00 33.73 ? 24  SER B C   1 
ATOM   844  O O   . SER B 2 9   ? 35.750 -5.811  18.011  1.00 32.49 ? 24  SER B O   1 
ATOM   845  C CB  . SER B 2 9   ? 33.519 -5.881  20.247  1.00 35.52 ? 24  SER B CB  1 
ATOM   846  O OG  . SER B 2 9   ? 32.314 -6.439  19.750  1.00 38.77 ? 24  SER B OG  1 
ATOM   847  N N   . ASP B 2 10  ? 33.762 -5.494  17.016  1.00 33.41 ? 25  ASP B N   1 
ATOM   848  C CA  . ASP B 2 10  ? 34.213 -6.016  15.729  1.00 32.44 ? 25  ASP B CA  1 
ATOM   849  C C   . ASP B 2 10  ? 34.672 -4.903  14.786  1.00 32.92 ? 25  ASP B C   1 
ATOM   850  O O   . ASP B 2 10  ? 34.860 -5.128  13.586  1.00 34.38 ? 25  ASP B O   1 
ATOM   851  C CB  . ASP B 2 10  ? 33.143 -6.907  15.082  1.00 32.45 ? 25  ASP B CB  1 
ATOM   852  C CG  . ASP B 2 10  ? 31.796 -6.212  14.930  1.00 32.46 ? 25  ASP B CG  1 
ATOM   853  O OD1 . ASP B 2 10  ? 31.388 -5.454  15.837  1.00 30.30 ? 25  ASP B OD1 1 
ATOM   854  O OD2 . ASP B 2 10  ? 31.129 -6.447  13.896  1.00 34.60 ? 25  ASP B OD2 1 
ATOM   855  N N   . GLY B 2 11  ? 34.854 -3.704  15.337  1.00 32.25 ? 26  GLY B N   1 
ATOM   856  C CA  . GLY B 2 11  ? 35.478 -2.595  14.611  1.00 31.93 ? 26  GLY B CA  1 
ATOM   857  C C   . GLY B 2 11  ? 34.601 -1.755  13.696  1.00 30.77 ? 26  GLY B C   1 
ATOM   858  O O   . GLY B 2 11  ? 35.117 -1.102  12.790  1.00 31.14 ? 26  GLY B O   1 
ATOM   859  N N   . HIS B 2 12  ? 33.288 -1.773  13.911  1.00 29.96 ? 27  HIS B N   1 
ATOM   860  C CA  . HIS B 2 12  ? 32.384 -0.887  13.172  1.00 30.74 ? 27  HIS B CA  1 
ATOM   861  C C   . HIS B 2 12  ? 32.327 0.464   13.866  1.00 31.03 ? 27  HIS B C   1 
ATOM   862  O O   . HIS B 2 12  ? 32.318 0.525   15.090  1.00 29.82 ? 27  HIS B O   1 
ATOM   863  C CB  . HIS B 2 12  ? 30.969 -1.476  13.067  1.00 30.06 ? 27  HIS B CB  1 
ATOM   864  C CG  . HIS B 2 12  ? 30.765 -2.366  11.878  1.00 31.63 ? 27  HIS B CG  1 
ATOM   865  N ND1 . HIS B 2 12  ? 31.057 -3.715  11.897  1.00 35.22 ? 27  HIS B ND1 1 
ATOM   866  C CD2 . HIS B 2 12  ? 30.293 -2.104  10.638  1.00 32.61 ? 27  HIS B CD2 1 
ATOM   867  C CE1 . HIS B 2 12  ? 30.781 -4.242  10.717  1.00 33.19 ? 27  HIS B CE1 1 
ATOM   868  N NE2 . HIS B 2 12  ? 30.315 -3.285  9.936   1.00 35.99 ? 27  HIS B NE2 1 
ATOM   869  N N   . GLU B 2 13  ? 32.308 1.539   13.077  1.00 33.06 ? 28  GLU B N   1 
ATOM   870  C CA  . GLU B 2 13  ? 32.154 2.898   13.599  1.00 32.67 ? 28  GLU B CA  1 
ATOM   871  C C   . GLU B 2 13  ? 30.771 3.414   13.278  1.00 31.63 ? 28  GLU B C   1 
ATOM   872  O O   . GLU B 2 13  ? 30.335 3.377   12.120  1.00 31.28 ? 28  GLU B O   1 
ATOM   873  C CB  . GLU B 2 13  ? 33.152 3.875   12.984  1.00 33.78 ? 28  GLU B CB  1 
ATOM   874  C CG  . GLU B 2 13  ? 34.308 3.266   12.265  1.00 39.47 ? 28  GLU B CG  1 
ATOM   875  C CD  . GLU B 2 13  ? 35.282 4.320   11.789  1.00 45.88 ? 28  GLU B CD  1 
ATOM   876  O OE1 . GLU B 2 13  ? 34.866 5.213   11.010  1.00 44.18 ? 28  GLU B OE1 1 
ATOM   877  O OE2 . GLU B 2 13  ? 36.464 4.245   12.197  1.00 46.52 ? 28  GLU B OE2 1 
ATOM   878  N N   . PHE B 2 14  ? 30.107 3.929   14.304  1.00 30.73 ? 29  PHE B N   1 
ATOM   879  C CA  . PHE B 2 14  ? 28.759 4.456   14.183  1.00 30.85 ? 29  PHE B CA  1 
ATOM   880  C C   . PHE B 2 14  ? 28.797 5.938   14.501  1.00 30.62 ? 29  PHE B C   1 
ATOM   881  O O   . PHE B 2 14  ? 29.144 6.334   15.613  1.00 33.79 ? 29  PHE B O   1 
ATOM   882  C CB  . PHE B 2 14  ? 27.814 3.713   15.134  1.00 30.09 ? 29  PHE B CB  1 
ATOM   883  C CG  . PHE B 2 14  ? 27.656 2.259   14.807  1.00 33.28 ? 29  PHE B CG  1 
ATOM   884  C CD1 . PHE B 2 14  ? 28.478 1.306   15.399  1.00 35.66 ? 29  PHE B CD1 1 
ATOM   885  C CD2 . PHE B 2 14  ? 26.698 1.839   13.891  1.00 37.08 ? 29  PHE B CD2 1 
ATOM   886  C CE1 . PHE B 2 14  ? 28.342 -0.042  15.092  1.00 36.01 ? 29  PHE B CE1 1 
ATOM   887  C CE2 . PHE B 2 14  ? 26.562 0.489   13.572  1.00 38.18 ? 29  PHE B CE2 1 
ATOM   888  C CZ  . PHE B 2 14  ? 27.386 -0.452  14.175  1.00 34.26 ? 29  PHE B CZ  1 
ATOM   889  N N   . ILE B 2 15  ? 28.471 6.758   13.515  1.00 30.64 ? 30  ILE B N   1 
ATOM   890  C CA  . ILE B 2 15  ? 28.507 8.205   13.696  1.00 31.11 ? 30  ILE B CA  1 
ATOM   891  C C   . ILE B 2 15  ? 27.095 8.723   13.973  1.00 32.72 ? 30  ILE B C   1 
ATOM   892  O O   . ILE B 2 15  ? 26.225 8.704   13.104  1.00 35.08 ? 30  ILE B O   1 
ATOM   893  C CB  . ILE B 2 15  ? 29.236 8.919   12.520  1.00 28.47 ? 30  ILE B CB  1 
ATOM   894  C CG1 . ILE B 2 15  ? 30.687 8.400   12.435  1.00 26.73 ? 30  ILE B CG1 1 
ATOM   895  C CG2 . ILE B 2 15  ? 29.193 10.463  12.684  1.00 22.11 ? 30  ILE B CG2 1 
ATOM   896  C CD1 . ILE B 2 15  ? 31.373 8.613   11.080  1.00 27.98 ? 30  ILE B CD1 1 
ATOM   897  N N   . VAL B 2 16  ? 26.894 9.155   15.214  1.00 35.70 ? 31  VAL B N   1 
ATOM   898  C CA  . VAL B 2 16  ? 25.583 9.541   15.752  1.00 37.50 ? 31  VAL B CA  1 
ATOM   899  C C   . VAL B 2 16  ? 25.632 10.994  16.227  1.00 36.46 ? 31  VAL B C   1 
ATOM   900  O O   . VAL B 2 16  ? 26.700 11.475  16.638  1.00 34.19 ? 31  VAL B O   1 
ATOM   901  C CB  . VAL B 2 16  ? 25.204 8.659   16.975  1.00 39.34 ? 31  VAL B CB  1 
ATOM   902  C CG1 . VAL B 2 16  ? 23.706 8.717   17.240  1.00 44.46 ? 31  VAL B CG1 1 
ATOM   903  C CG2 . VAL B 2 16  ? 25.634 7.209   16.755  1.00 42.10 ? 31  VAL B CG2 1 
ATOM   904  N N   . LYS B 2 17  ? 24.488 11.682  16.177  1.00 33.11 ? 32  LYS B N   1 
ATOM   905  C CA  . LYS B 2 17  ? 24.374 13.028  16.745  1.00 34.73 ? 32  LYS B CA  1 
ATOM   906  C C   . LYS B 2 17  ? 24.624 13.015  18.249  1.00 34.94 ? 32  LYS B C   1 
ATOM   907  O O   . LYS B 2 17  ? 24.081 12.171  18.971  1.00 32.50 ? 32  LYS B O   1 
ATOM   908  C CB  . LYS B 2 17  ? 23.000 13.646  16.449  1.00 35.79 ? 32  LYS B CB  1 
ATOM   909  C CG  . LYS B 2 17  ? 22.865 14.179  15.037  1.00 38.42 ? 32  LYS B CG  1 
ATOM   910  C CD  . LYS B 2 17  ? 21.461 14.649  14.740  1.00 42.01 ? 32  LYS B CD  1 
ATOM   911  C CE  . LYS B 2 17  ? 21.271 14.806  13.241  1.00 46.53 ? 32  LYS B CE  1 
ATOM   912  N NZ  . LYS B 2 17  ? 20.092 15.648  12.906  1.00 48.72 ? 32  LYS B NZ  1 
ATOM   913  N N   . ARG B 2 18  ? 25.445 13.962  18.702  1.00 35.85 ? 33  ARG B N   1 
ATOM   914  C CA  . ARG B 2 18  ? 25.849 14.072  20.106  1.00 37.37 ? 33  ARG B CA  1 
ATOM   915  C C   . ARG B 2 18  ? 24.657 14.054  21.071  1.00 38.16 ? 33  ARG B C   1 
ATOM   916  O O   . ARG B 2 18  ? 24.619 13.237  21.995  1.00 37.93 ? 33  ARG B O   1 
ATOM   917  C CB  . ARG B 2 18  ? 26.697 15.330  20.311  1.00 38.18 ? 33  ARG B CB  1 
ATOM   918  C CG  . ARG B 2 18  ? 27.410 15.379  21.641  1.00 41.86 ? 33  ARG B CG  1 
ATOM   919  C CD  . ARG B 2 18  ? 28.038 16.744  21.896  1.00 44.11 ? 33  ARG B CD  1 
ATOM   920  N NE  . ARG B 2 18  ? 28.832 16.733  23.124  1.00 46.42 ? 33  ARG B NE  1 
ATOM   921  C CZ  . ARG B 2 18  ? 28.359 17.011  24.339  1.00 48.82 ? 33  ARG B CZ  1 
ATOM   922  N NH1 . ARG B 2 18  ? 27.081 17.339  24.514  1.00 48.56 ? 33  ARG B NH1 1 
ATOM   923  N NH2 . ARG B 2 18  ? 29.172 16.969  25.387  1.00 51.48 ? 33  ARG B NH2 1 
ATOM   924  N N   . GLU B 2 19  ? 23.688 14.940  20.833  1.00 39.42 ? 34  GLU B N   1 
ATOM   925  C CA  . GLU B 2 19  ? 22.443 14.999  21.609  1.00 41.22 ? 34  GLU B CA  1 
ATOM   926  C C   . GLU B 2 19  ? 21.688 13.677  21.713  1.00 39.87 ? 34  GLU B C   1 
ATOM   927  O O   . GLU B 2 19  ? 21.105 13.383  22.757  1.00 40.82 ? 34  GLU B O   1 
ATOM   928  C CB  . GLU B 2 19  ? 21.503 16.078  21.058  1.00 43.37 ? 34  GLU B CB  1 
ATOM   929  C CG  . GLU B 2 19  ? 21.291 17.253  21.997  1.00 50.16 ? 34  GLU B CG  1 
ATOM   930  C CD  . GLU B 2 19  ? 22.464 18.216  22.013  1.00 56.02 ? 34  GLU B CD  1 
ATOM   931  O OE1 . GLU B 2 19  ? 22.693 18.890  20.987  1.00 60.44 ? 34  GLU B OE1 1 
ATOM   932  O OE2 . GLU B 2 19  ? 23.149 18.309  23.056  1.00 58.08 ? 34  GLU B OE2 1 
ATOM   933  N N   . HIS B 2 20  ? 21.693 12.887  20.640  1.00 39.40 ? 35  HIS B N   1 
ATOM   934  C CA  . HIS B 2 20  ? 21.036 11.574  20.657  1.00 39.08 ? 35  HIS B CA  1 
ATOM   935  C C   . HIS B 2 20  ? 21.792 10.597  21.552  1.00 39.72 ? 35  HIS B C   1 
ATOM   936  O O   . HIS B 2 20  ? 21.181 9.908   22.364  1.00 42.33 ? 35  HIS B O   1 
ATOM   937  C CB  . HIS B 2 20  ? 20.882 10.992  19.247  1.00 37.81 ? 35  HIS B CB  1 
ATOM   938  C CG  . HIS B 2 20  ? 19.892 11.719  18.388  1.00 39.83 ? 35  HIS B CG  1 
ATOM   939  N ND1 . HIS B 2 20  ? 19.753 13.092  18.400  1.00 40.81 ? 35  HIS B ND1 1 
ATOM   940  C CD2 . HIS B 2 20  ? 19.020 11.264  17.459  1.00 40.98 ? 35  HIS B CD2 1 
ATOM   941  C CE1 . HIS B 2 20  ? 18.823 13.448  17.533  1.00 38.12 ? 35  HIS B CE1 1 
ATOM   942  N NE2 . HIS B 2 20  ? 18.369 12.360  16.942  1.00 40.31 ? 35  HIS B NE2 1 
ATOM   943  N N   . ALA B 2 21  ? 23.117 10.559  21.409  1.00 38.03 ? 36  ALA B N   1 
ATOM   944  C CA  . ALA B 2 21  ? 23.980 9.684   22.210  1.00 37.45 ? 36  ALA B CA  1 
ATOM   945  C C   . ALA B 2 21  ? 23.927 9.979   23.718  1.00 36.58 ? 36  ALA B C   1 
ATOM   946  O O   . ALA B 2 21  ? 24.248 9.113   24.531  1.00 36.91 ? 36  ALA B O   1 
ATOM   947  C CB  . ALA B 2 21  ? 25.423 9.747   21.698  1.00 36.28 ? 36  ALA B CB  1 
ATOM   948  N N   . LEU B 2 22  ? 23.507 11.190  24.084  1.00 37.29 ? 37  LEU B N   1 
ATOM   949  C CA  . LEU B 2 22  ? 23.373 11.576  25.494  1.00 38.46 ? 37  LEU B CA  1 
ATOM   950  C C   . LEU B 2 22  ? 22.144 10.956  26.160  1.00 39.52 ? 37  LEU B C   1 
ATOM   951  O O   . LEU B 2 22  ? 21.916 11.158  27.352  1.00 40.02 ? 37  LEU B O   1 
ATOM   952  C CB  . LEU B 2 22  ? 23.366 13.106  25.660  1.00 38.13 ? 37  LEU B CB  1 
ATOM   953  C CG  . LEU B 2 22  ? 24.615 13.904  25.237  1.00 39.66 ? 37  LEU B CG  1 
ATOM   954  C CD1 . LEU B 2 22  ? 24.325 15.406  25.248  1.00 38.51 ? 37  LEU B CD1 1 
ATOM   955  C CD2 . LEU B 2 22  ? 25.853 13.590  26.080  1.00 35.29 ? 37  LEU B CD2 1 
ATOM   956  N N   . THR B 2 23  ? 21.351 10.218  25.378  1.00 40.65 ? 38  THR B N   1 
ATOM   957  C CA  . THR B 2 23  ? 20.299 9.361   25.910  1.00 40.73 ? 38  THR B CA  1 
ATOM   958  C C   . THR B 2 23  ? 20.944 8.311   26.823  1.00 39.72 ? 38  THR B C   1 
ATOM   959  O O   . THR B 2 23  ? 20.371 7.944   27.841  1.00 38.99 ? 38  THR B O   1 
ATOM   960  C CB  . THR B 2 23  ? 19.492 8.672   24.774  1.00 43.00 ? 38  THR B CB  1 
ATOM   961  O OG1 . THR B 2 23  ? 18.906 9.660   23.915  1.00 42.82 ? 38  THR B OG1 1 
ATOM   962  C CG2 . THR B 2 23  ? 18.394 7.777   25.324  1.00 42.45 ? 38  THR B CG2 1 
ATOM   963  N N   . SER B 2 24  ? 22.142 7.848   26.461  1.00 39.76 ? 39  SER B N   1 
ATOM   964  C CA  . SER B 2 24  ? 22.935 6.957   27.323  1.00 37.82 ? 39  SER B CA  1 
ATOM   965  C C   . SER B 2 24  ? 23.626 7.738   28.444  1.00 38.95 ? 39  SER B C   1 
ATOM   966  O O   . SER B 2 24  ? 24.404 8.662   28.186  1.00 40.51 ? 39  SER B O   1 
ATOM   967  C CB  . SER B 2 24  ? 23.955 6.170   26.488  1.00 36.72 ? 39  SER B CB  1 
ATOM   968  O OG  . SER B 2 24  ? 25.014 5.641   27.278  1.00 32.52 ? 39  SER B OG  1 
ATOM   969  N N   . GLY B 2 25  ? 23.334 7.365   29.689  1.00 39.68 ? 40  GLY B N   1 
ATOM   970  C CA  . GLY B 2 25  ? 23.934 8.014   30.858  1.00 37.34 ? 40  GLY B CA  1 
ATOM   971  C C   . GLY B 2 25  ? 25.426 7.741   30.965  1.00 38.05 ? 40  GLY B C   1 
ATOM   972  O O   . GLY B 2 25  ? 26.201 8.606   31.395  1.00 35.30 ? 40  GLY B O   1 
ATOM   973  N N   . THR B 2 26  ? 25.814 6.525   30.575  1.00 37.94 ? 41  THR B N   1 
ATOM   974  C CA  . THR B 2 26  ? 27.209 6.097   30.507  1.00 38.11 ? 41  THR B CA  1 
ATOM   975  C C   . THR B 2 26  ? 28.012 6.926   29.498  1.00 38.36 ? 41  THR B C   1 
ATOM   976  O O   . THR B 2 26  ? 29.092 7.416   29.823  1.00 38.53 ? 41  THR B O   1 
ATOM   977  C CB  . THR B 2 26  ? 27.297 4.597   30.146  1.00 38.73 ? 41  THR B CB  1 
ATOM   978  O OG1 . THR B 2 26  ? 26.739 3.818   31.210  1.00 37.11 ? 41  THR B OG1 1 
ATOM   979  C CG2 . THR B 2 26  ? 28.744 4.162   29.896  1.00 38.41 ? 41  THR B CG2 1 
ATOM   980  N N   . ILE B 2 27  ? 27.475 7.081   28.287  1.00 39.39 ? 42  ILE B N   1 
ATOM   981  C CA  . ILE B 2 27  ? 28.106 7.892   27.244  1.00 39.03 ? 42  ILE B CA  1 
ATOM   982  C C   . ILE B 2 27  ? 28.190 9.361   27.672  1.00 40.93 ? 42  ILE B C   1 
ATOM   983  O O   . ILE B 2 27  ? 29.227 9.997   27.494  1.00 41.17 ? 42  ILE B O   1 
ATOM   984  C CB  . ILE B 2 27  ? 27.388 7.743   25.878  1.00 38.35 ? 42  ILE B CB  1 
ATOM   985  C CG1 . ILE B 2 27  ? 27.667 6.359   25.279  1.00 37.14 ? 42  ILE B CG1 1 
ATOM   986  C CG2 . ILE B 2 27  ? 27.807 8.851   24.901  1.00 36.89 ? 42  ILE B CG2 1 
ATOM   987  C CD1 . ILE B 2 27  ? 26.744 5.985   24.113  1.00 33.26 ? 42  ILE B CD1 1 
ATOM   988  N N   . LYS B 2 28  ? 27.107 9.878   28.251  1.00 42.79 ? 43  LYS B N   1 
ATOM   989  C CA  . LYS B 2 28  ? 27.073 11.236  28.803  1.00 45.29 ? 43  LYS B CA  1 
ATOM   990  C C   . LYS B 2 28  ? 28.130 11.454  29.895  1.00 46.81 ? 43  LYS B C   1 
ATOM   991  O O   . LYS B 2 28  ? 28.593 12.579  30.100  1.00 46.57 ? 43  LYS B O   1 
ATOM   992  C CB  . LYS B 2 28  ? 25.677 11.550  29.343  1.00 46.84 ? 43  LYS B CB  1 
ATOM   993  C CG  . LYS B 2 28  ? 25.515 12.941  29.938  1.00 49.44 ? 43  LYS B CG  1 
ATOM   994  C CD  . LYS B 2 28  ? 24.119 13.110  30.507  1.00 53.96 ? 43  LYS B CD  1 
ATOM   995  C CE  . LYS B 2 28  ? 23.968 14.444  31.207  1.00 56.45 ? 43  LYS B CE  1 
ATOM   996  N NZ  . LYS B 2 28  ? 22.551 14.660  31.609  1.00 58.84 ? 43  LYS B NZ  1 
ATOM   997  N N   . ALA B 2 29  ? 28.504 10.377  30.584  1.00 47.47 ? 44  ALA B N   1 
ATOM   998  C CA  . ALA B 2 29  ? 29.577 10.425  31.573  1.00 48.37 ? 44  ALA B CA  1 
ATOM   999  C C   . ALA B 2 29  ? 30.955 10.466  30.912  1.00 49.24 ? 44  ALA B C   1 
ATOM   1000 O O   . ALA B 2 29  ? 31.872 11.096  31.439  1.00 49.48 ? 44  ALA B O   1 
ATOM   1001 C CB  . ALA B 2 29  ? 29.474 9.252   32.535  1.00 48.27 ? 44  ALA B CB  1 
ATOM   1002 N N   . MET B 2 30  ? 31.099 9.799   29.764  1.00 50.79 ? 45  MET B N   1 
ATOM   1003 C CA  . MET B 2 30  ? 32.347 9.838   28.992  1.00 52.53 ? 45  MET B CA  1 
ATOM   1004 C C   . MET B 2 30  ? 32.649 11.273  28.569  1.00 53.61 ? 45  MET B C   1 
ATOM   1005 O O   . MET B 2 30  ? 33.731 11.794  28.837  1.00 54.89 ? 45  MET B O   1 
ATOM   1006 C CB  . MET B 2 30  ? 32.276 8.953   27.737  1.00 54.38 ? 45  MET B CB  1 
ATOM   1007 C CG  . MET B 2 30  ? 31.735 7.536   27.929  1.00 56.32 ? 45  MET B CG  1 
ATOM   1008 S SD  . MET B 2 30  ? 32.933 6.394   28.632  1.00 58.61 ? 45  MET B SD  1 
ATOM   1009 C CE  . MET B 2 30  ? 32.175 4.810   28.266  1.00 56.81 ? 45  MET B CE  1 
ATOM   1010 N N   . LEU B 2 31  ? 31.681 11.910  27.914  1.00 54.81 ? 46  LEU B N   1 
ATOM   1011 C CA  . LEU B 2 31  ? 31.845 13.277  27.416  1.00 56.00 ? 46  LEU B CA  1 
ATOM   1012 C C   . LEU B 2 31  ? 30.992 14.269  28.200  1.00 56.20 ? 46  LEU B C   1 
ATOM   1013 O O   . LEU B 2 31  ? 31.096 14.351  29.424  1.00 56.54 ? 46  LEU B O   1 
ATOM   1014 C CB  . LEU B 2 31  ? 31.538 13.363  25.910  1.00 55.66 ? 46  LEU B CB  1 
ATOM   1015 C CG  . LEU B 2 31  ? 30.797 12.217  25.212  1.00 55.70 ? 46  LEU B CG  1 
ATOM   1016 C CD1 . LEU B 2 31  ? 29.803 12.733  24.172  1.00 55.41 ? 46  LEU B CD1 1 
ATOM   1017 C CD2 . LEU B 2 31  ? 31.790 11.239  24.585  1.00 55.26 ? 46  LEU B CD2 1 
ATOM   1018 N N   . THR B 2 42  ? 36.295 12.236  24.138  1.00 53.78 ? 57  THR B N   1 
ATOM   1019 C CA  . THR B 2 42  ? 36.279 13.297  23.125  1.00 54.09 ? 57  THR B CA  1 
ATOM   1020 C C   . THR B 2 42  ? 35.039 13.119  22.247  1.00 54.40 ? 57  THR B C   1 
ATOM   1021 O O   . THR B 2 42  ? 33.910 13.179  22.746  1.00 55.17 ? 57  THR B O   1 
ATOM   1022 C CB  . THR B 2 42  ? 37.584 13.283  22.294  1.00 54.64 ? 57  THR B CB  1 
ATOM   1023 C CG2 . THR B 2 42  ? 37.697 12.074  21.521  1.00 54.15 ? 57  THR B CG2 1 
ATOM   1024 N N   . ASN B 2 43  ? 35.243 12.892  20.953  1.00 54.72 ? 58  ASN B N   1 
ATOM   1025 C CA  . ASN B 2 43  ? 34.140 12.594  20.047  1.00 54.92 ? 58  ASN B CA  1 
ATOM   1026 C C   . ASN B 2 43  ? 34.105 11.115  19.666  1.00 53.21 ? 58  ASN B C   1 
ATOM   1027 O O   . ASN B 2 43  ? 33.425 10.729  18.714  1.00 52.53 ? 58  ASN B O   1 
ATOM   1028 C CB  . ASN B 2 43  ? 34.231 13.470  18.793  1.00 57.06 ? 58  ASN B CB  1 
ATOM   1029 C CG  . ASN B 2 43  ? 33.924 14.931  19.077  1.00 60.34 ? 58  ASN B CG  1 
ATOM   1030 O OD1 . ASN B 2 43  ? 32.843 15.269  19.578  1.00 62.97 ? 58  ASN B OD1 1 
ATOM   1031 N ND2 . ASN B 2 43  ? 34.874 15.808  18.750  1.00 60.63 ? 58  ASN B ND2 1 
ATOM   1032 N N   . GLU B 2 44  ? 34.833 10.298  20.427  1.00 51.02 ? 59  GLU B N   1 
ATOM   1033 C CA  . GLU B 2 44  ? 35.044 8.895   20.092  1.00 49.87 ? 59  GLU B CA  1 
ATOM   1034 C C   . GLU B 2 44  ? 34.997 8.003   21.329  1.00 48.80 ? 59  GLU B C   1 
ATOM   1035 O O   . GLU B 2 44  ? 35.760 8.206   22.268  1.00 49.82 ? 59  GLU B O   1 
ATOM   1036 C CB  . GLU B 2 44  ? 36.384 8.738   19.377  1.00 49.48 ? 59  GLU B CB  1 
ATOM   1037 C CG  . GLU B 2 44  ? 36.749 7.313   19.015  1.00 52.59 ? 59  GLU B CG  1 
ATOM   1038 C CD  . GLU B 2 44  ? 37.965 7.240   18.112  1.00 55.26 ? 59  GLU B CD  1 
ATOM   1039 O OE1 . GLU B 2 44  ? 38.945 6.559   18.490  1.00 57.88 ? 59  GLU B OE1 1 
ATOM   1040 O OE2 . GLU B 2 44  ? 37.948 7.869   17.030  1.00 55.50 ? 59  GLU B OE2 1 
ATOM   1041 N N   . VAL B 2 45  ? 34.097 7.023   21.318  1.00 46.53 ? 60  VAL B N   1 
ATOM   1042 C CA  . VAL B 2 45  ? 33.959 6.064   22.417  1.00 45.25 ? 60  VAL B CA  1 
ATOM   1043 C C   . VAL B 2 45  ? 34.054 4.636   21.889  1.00 44.58 ? 60  VAL B C   1 
ATOM   1044 O O   . VAL B 2 45  ? 33.340 4.258   20.953  1.00 43.23 ? 60  VAL B O   1 
ATOM   1045 C CB  . VAL B 2 45  ? 32.616 6.217   23.173  1.00 45.84 ? 60  VAL B CB  1 
ATOM   1046 C CG1 . VAL B 2 45  ? 32.632 5.396   24.449  1.00 45.41 ? 60  VAL B CG1 1 
ATOM   1047 C CG2 . VAL B 2 45  ? 32.322 7.681   23.485  1.00 47.59 ? 60  VAL B CG2 1 
ATOM   1048 N N   . ASN B 2 46  ? 34.925 3.849   22.515  1.00 44.57 ? 61  ASN B N   1 
ATOM   1049 C CA  . ASN B 2 46  ? 35.208 2.478   22.105  1.00 46.62 ? 61  ASN B CA  1 
ATOM   1050 C C   . ASN B 2 46  ? 34.505 1.463   23.004  1.00 47.38 ? 61  ASN B C   1 
ATOM   1051 O O   . ASN B 2 46  ? 34.606 1.539   24.231  1.00 48.30 ? 61  ASN B O   1 
ATOM   1052 C CB  . ASN B 2 46  ? 36.719 2.239   22.148  1.00 49.03 ? 61  ASN B CB  1 
ATOM   1053 C CG  . ASN B 2 46  ? 37.194 1.292   21.069  1.00 52.30 ? 61  ASN B CG  1 
ATOM   1054 O OD1 . ASN B 2 46  ? 36.817 0.115   21.034  1.00 54.10 ? 61  ASN B OD1 1 
ATOM   1055 N ND2 . ASN B 2 46  ? 38.043 1.801   20.180  1.00 54.44 ? 61  ASN B ND2 1 
ATOM   1056 N N   . PHE B 2 47  ? 33.793 0.519   22.390  1.00 47.49 ? 62  PHE B N   1 
ATOM   1057 C CA  . PHE B 2 47  ? 33.132 -0.561  23.125  1.00 47.21 ? 62  PHE B CA  1 
ATOM   1058 C C   . PHE B 2 47  ? 33.703 -1.920  22.742  1.00 48.55 ? 62  PHE B C   1 
ATOM   1059 O O   . PHE B 2 47  ? 33.392 -2.455  21.676  1.00 48.81 ? 62  PHE B O   1 
ATOM   1060 C CB  . PHE B 2 47  ? 31.619 -0.535  22.895  1.00 46.23 ? 62  PHE B CB  1 
ATOM   1061 C CG  . PHE B 2 47  ? 30.969 0.746   23.315  1.00 46.34 ? 62  PHE B CG  1 
ATOM   1062 C CD1 . PHE B 2 47  ? 30.877 1.086   24.662  1.00 46.24 ? 62  PHE B CD1 1 
ATOM   1063 C CD2 . PHE B 2 47  ? 30.454 1.623   22.364  1.00 45.93 ? 62  PHE B CD2 1 
ATOM   1064 C CE1 . PHE B 2 47  ? 30.280 2.278   25.056  1.00 46.43 ? 62  PHE B CE1 1 
ATOM   1065 C CE2 . PHE B 2 47  ? 29.851 2.813   22.749  1.00 46.15 ? 62  PHE B CE2 1 
ATOM   1066 C CZ  . PHE B 2 47  ? 29.763 3.142   24.098  1.00 44.98 ? 62  PHE B CZ  1 
ATOM   1067 N N   . ARG B 2 48  ? 34.537 -2.473  23.621  1.00 49.40 ? 63  ARG B N   1 
ATOM   1068 C CA  . ARG B 2 48  ? 35.210 -3.748  23.364  1.00 49.76 ? 63  ARG B CA  1 
ATOM   1069 C C   . ARG B 2 48  ? 34.282 -4.942  23.579  1.00 48.45 ? 63  ARG B C   1 
ATOM   1070 O O   . ARG B 2 48  ? 34.606 -6.066  23.187  1.00 47.66 ? 63  ARG B O   1 
ATOM   1071 C CB  . ARG B 2 48  ? 36.464 -3.890  24.237  1.00 52.04 ? 63  ARG B CB  1 
ATOM   1072 C CG  . ARG B 2 48  ? 37.571 -2.869  23.960  1.00 56.74 ? 63  ARG B CG  1 
ATOM   1073 C CD  . ARG B 2 48  ? 37.324 -1.563  24.709  1.00 61.85 ? 63  ARG B CD  1 
ATOM   1074 N NE  . ARG B 2 48  ? 38.488 -0.679  24.704  1.00 64.95 ? 63  ARG B NE  1 
ATOM   1075 C CZ  . ARG B 2 48  ? 38.520 0.527   25.269  1.00 67.05 ? 63  ARG B CZ  1 
ATOM   1076 N NH1 . ARG B 2 48  ? 37.446 1.011   25.887  1.00 68.60 ? 63  ARG B NH1 1 
ATOM   1077 N NH2 . ARG B 2 48  ? 39.628 1.256   25.214  1.00 67.17 ? 63  ARG B NH2 1 
ATOM   1078 N N   . GLU B 2 49  ? 33.124 -4.685  24.182  1.00 47.37 ? 64  GLU B N   1 
ATOM   1079 C CA  . GLU B 2 49  ? 32.181 -5.734  24.564  1.00 47.30 ? 64  GLU B CA  1 
ATOM   1080 C C   . GLU B 2 49  ? 30.845 -5.700  23.799  1.00 46.50 ? 64  GLU B C   1 
ATOM   1081 O O   . GLU B 2 49  ? 30.037 -6.625  23.922  1.00 47.90 ? 64  GLU B O   1 
ATOM   1082 C CB  . GLU B 2 49  ? 31.919 -5.682  26.079  1.00 49.26 ? 64  GLU B CB  1 
ATOM   1083 C CG  . GLU B 2 49  ? 31.244 -4.385  26.579  1.00 54.36 ? 64  GLU B CG  1 
ATOM   1084 C CD  . GLU B 2 49  ? 32.240 -3.292  26.943  1.00 57.81 ? 64  GLU B CD  1 
ATOM   1085 O OE1 . GLU B 2 49  ? 32.923 -3.432  27.983  1.00 62.43 ? 64  GLU B OE1 1 
ATOM   1086 O OE2 . GLU B 2 49  ? 32.337 -2.294  26.196  1.00 55.23 ? 64  GLU B OE2 1 
ATOM   1087 N N   . ILE B 2 50  ? 30.597 -4.641  23.031  1.00 42.81 ? 65  ILE B N   1 
ATOM   1088 C CA  . ILE B 2 50  ? 29.332 -4.539  22.299  1.00 39.00 ? 65  ILE B CA  1 
ATOM   1089 C C   . ILE B 2 50  ? 29.553 -4.764  20.791  1.00 38.95 ? 65  ILE B C   1 
ATOM   1090 O O   . ILE B 2 50  ? 30.270 -3.993  20.146  1.00 38.04 ? 65  ILE B O   1 
ATOM   1091 C CB  . ILE B 2 50  ? 28.569 -3.214  22.615  1.00 38.35 ? 65  ILE B CB  1 
ATOM   1092 C CG1 . ILE B 2 50  ? 28.497 -2.987  24.138  1.00 36.40 ? 65  ILE B CG1 1 
ATOM   1093 C CG2 . ILE B 2 50  ? 27.159 -3.251  22.024  1.00 35.27 ? 65  ILE B CG2 1 
ATOM   1094 C CD1 . ILE B 2 50  ? 27.867 -1.678  24.560  1.00 32.85 ? 65  ILE B CD1 1 
ATOM   1095 N N   . PRO B 2 51  ? 28.972 -5.849  20.233  1.00 38.33 ? 66  PRO B N   1 
ATOM   1096 C CA  . PRO B 2 51  ? 29.140 -6.102  18.800  1.00 37.25 ? 66  PRO B CA  1 
ATOM   1097 C C   . PRO B 2 51  ? 28.229 -5.227  17.929  1.00 38.39 ? 66  PRO B C   1 
ATOM   1098 O O   . PRO B 2 51  ? 27.224 -4.685  18.414  1.00 37.42 ? 66  PRO B O   1 
ATOM   1099 C CB  . PRO B 2 51  ? 28.788 -7.585  18.657  1.00 36.50 ? 66  PRO B CB  1 
ATOM   1100 C CG  . PRO B 2 51  ? 27.892 -7.889  19.796  1.00 36.20 ? 66  PRO B CG  1 
ATOM   1101 C CD  . PRO B 2 51  ? 28.156 -6.888  20.893  1.00 37.11 ? 66  PRO B CD  1 
ATOM   1102 N N   . SER B 2 52  ? 28.615 -5.092  16.657  1.00 38.96 ? 67  SER B N   1 
ATOM   1103 C CA  . SER B 2 52  ? 27.879 -4.348  15.620  1.00 36.72 ? 67  SER B CA  1 
ATOM   1104 C C   . SER B 2 52  ? 26.361 -4.447  15.673  1.00 35.62 ? 67  SER B C   1 
ATOM   1105 O O   . SER B 2 52  ? 25.680 -3.431  15.699  1.00 37.29 ? 67  SER B O   1 
ATOM   1106 C CB  . SER B 2 52  ? 28.301 -4.859  14.250  1.00 33.90 ? 67  SER B CB  1 
ATOM   1107 O OG  . SER B 2 52  ? 29.622 -4.495  13.973  1.00 44.33 ? 67  SER B OG  1 
ATOM   1108 N N   . HIS B 2 53  ? 25.842 -5.674  15.647  1.00 35.30 ? 68  HIS B N   1 
ATOM   1109 C CA  . HIS B 2 53  ? 24.405 -5.910  15.530  1.00 37.38 ? 68  HIS B CA  1 
ATOM   1110 C C   . HIS B 2 53  ? 23.634 -5.449  16.768  1.00 37.83 ? 68  HIS B C   1 
ATOM   1111 O O   . HIS B 2 53  ? 22.424 -5.271  16.714  1.00 41.21 ? 68  HIS B O   1 
ATOM   1112 C CB  . HIS B 2 53  ? 24.105 -7.384  15.210  1.00 37.68 ? 68  HIS B CB  1 
ATOM   1113 C CG  . HIS B 2 53  ? 24.511 -8.343  16.289  1.00 38.76 ? 68  HIS B CG  1 
ATOM   1114 N ND1 . HIS B 2 53  ? 25.710 -9.023  16.269  1.00 41.42 ? 68  HIS B ND1 1 
ATOM   1115 C CD2 . HIS B 2 53  ? 23.869 -8.749  17.409  1.00 40.01 ? 68  HIS B CD2 1 
ATOM   1116 C CE1 . HIS B 2 53  ? 25.793 -9.799  17.335  1.00 39.10 ? 68  HIS B CE1 1 
ATOM   1117 N NE2 . HIS B 2 53  ? 24.687 -9.655  18.041  1.00 39.47 ? 68  HIS B NE2 1 
ATOM   1118 N N   . VAL B 2 54  ? 24.347 -5.261  17.875  1.00 36.70 ? 69  VAL B N   1 
ATOM   1119 C CA  . VAL B 2 54  ? 23.769 -4.697  19.081  1.00 35.31 ? 69  VAL B CA  1 
ATOM   1120 C C   . VAL B 2 54  ? 23.910 -3.171  19.092  1.00 36.66 ? 69  VAL B C   1 
ATOM   1121 O O   . VAL B 2 54  ? 22.922 -2.466  19.316  1.00 36.94 ? 69  VAL B O   1 
ATOM   1122 C CB  . VAL B 2 54  ? 24.379 -5.326  20.349  1.00 35.57 ? 69  VAL B CB  1 
ATOM   1123 C CG1 . VAL B 2 54  ? 23.753 -4.729  21.599  1.00 34.49 ? 69  VAL B CG1 1 
ATOM   1124 C CG2 . VAL B 2 54  ? 24.178 -6.832  20.331  1.00 34.75 ? 69  VAL B CG2 1 
ATOM   1125 N N   . LEU B 2 55  ? 25.119 -2.665  18.832  1.00 34.60 ? 70  LEU B N   1 
ATOM   1126 C CA  . LEU B 2 55  ? 25.366 -1.217  18.828  1.00 36.27 ? 70  LEU B CA  1 
ATOM   1127 C C   . LEU B 2 55  ? 24.518 -0.478  17.782  1.00 38.14 ? 70  LEU B C   1 
ATOM   1128 O O   . LEU B 2 55  ? 24.038 0.627   18.041  1.00 40.30 ? 70  LEU B O   1 
ATOM   1129 C CB  . LEU B 2 55  ? 26.853 -0.899  18.606  1.00 36.29 ? 70  LEU B CB  1 
ATOM   1130 C CG  . LEU B 2 55  ? 27.580 0.075   19.548  1.00 39.98 ? 70  LEU B CG  1 
ATOM   1131 C CD1 . LEU B 2 55  ? 28.890 0.561   18.935  1.00 37.51 ? 70  LEU B CD1 1 
ATOM   1132 C CD2 . LEU B 2 55  ? 26.734 1.264   19.994  1.00 42.34 ? 70  LEU B CD2 1 
ATOM   1133 N N   . SER B 2 56  ? 24.344 -1.078  16.603  1.00 37.26 ? 71  SER B N   1 
ATOM   1134 C CA  . SER B 2 56  ? 23.434 -0.527  15.606  1.00 38.94 ? 71  SER B CA  1 
ATOM   1135 C C   . SER B 2 56  ? 22.039 -0.294  16.202  1.00 38.72 ? 71  SER B C   1 
ATOM   1136 O O   . SER B 2 56  ? 21.500 0.807   16.074  1.00 41.31 ? 71  SER B O   1 
ATOM   1137 C CB  . SER B 2 56  ? 23.363 -1.406  14.346  1.00 38.64 ? 71  SER B CB  1 
ATOM   1138 O OG  . SER B 2 56  ? 23.198 -2.778  14.670  1.00 44.06 ? 71  SER B OG  1 
ATOM   1139 N N   . LYS B 2 57  ? 21.483 -1.314  16.866  1.00 37.65 ? 72  LYS B N   1 
ATOM   1140 C CA  . LYS B 2 57  ? 20.164 -1.217  17.519  1.00 39.82 ? 72  LYS B CA  1 
ATOM   1141 C C   . LYS B 2 57  ? 20.123 -0.155  18.608  1.00 40.05 ? 72  LYS B C   1 
ATOM   1142 O O   . LYS B 2 57  ? 19.131 0.574   18.739  1.00 40.24 ? 72  LYS B O   1 
ATOM   1143 C CB  . LYS B 2 57  ? 19.741 -2.553  18.135  1.00 39.23 ? 72  LYS B CB  1 
ATOM   1144 C CG  . LYS B 2 57  ? 18.727 -3.322  17.331  1.00 46.60 ? 72  LYS B CG  1 
ATOM   1145 C CD  . LYS B 2 57  ? 17.368 -2.628  17.254  1.00 45.67 ? 72  LYS B CD  1 
ATOM   1146 C CE  . LYS B 2 57  ? 16.583 -3.193  16.082  1.00 49.23 ? 72  LYS B CE  1 
ATOM   1147 N NZ  . LYS B 2 57  ? 15.495 -2.273  15.650  1.00 53.37 ? 72  LYS B NZ  1 
ATOM   1148 N N   . VAL B 2 58  ? 21.195 -0.096  19.395  1.00 39.07 ? 73  VAL B N   1 
ATOM   1149 C CA  . VAL B 2 58  ? 21.344 0.904   20.445  1.00 38.87 ? 73  VAL B CA  1 
ATOM   1150 C C   . VAL B 2 58  ? 21.187 2.306   19.835  1.00 39.23 ? 73  VAL B C   1 
ATOM   1151 O O   . VAL B 2 58  ? 20.400 3.122   20.337  1.00 39.02 ? 73  VAL B O   1 
ATOM   1152 C CB  . VAL B 2 58  ? 22.694 0.731   21.188  1.00 37.57 ? 73  VAL B CB  1 
ATOM   1153 C CG1 . VAL B 2 58  ? 23.028 1.946   22.023  1.00 38.17 ? 73  VAL B CG1 1 
ATOM   1154 C CG2 . VAL B 2 58  ? 22.674 -0.532  22.051  1.00 37.29 ? 73  VAL B CG2 1 
ATOM   1155 N N   . CYS B 2 59  ? 21.901 2.555   18.732  1.00 37.43 ? 74  CYS B N   1 
ATOM   1156 C CA  . CYS B 2 59  ? 21.836 3.834   18.019  1.00 36.08 ? 74  CYS B CA  1 
ATOM   1157 C C   . CYS B 2 59  ? 20.434 4.158   17.515  1.00 35.59 ? 74  CYS B C   1 
ATOM   1158 O O   . CYS B 2 59  ? 19.969 5.295   17.637  1.00 36.43 ? 74  CYS B O   1 
ATOM   1159 C CB  . CYS B 2 59  ? 22.838 3.864   16.867  1.00 36.81 ? 74  CYS B CB  1 
ATOM   1160 S SG  . CYS B 2 59  ? 24.581 3.865   17.380  1.00 42.40 ? 74  CYS B SG  1 
ATOM   1161 N N   . MET B 2 60  ? 19.753 3.160   16.960  1.00 35.70 ? 75  MET B N   1 
ATOM   1162 C CA  . MET B 2 60  ? 18.365 3.336   16.517  1.00 35.07 ? 75  MET B CA  1 
ATOM   1163 C C   . MET B 2 60  ? 17.457 3.688   17.679  1.00 35.07 ? 75  MET B C   1 
ATOM   1164 O O   . MET B 2 60  ? 16.507 4.459   17.519  1.00 39.11 ? 75  MET B O   1 
ATOM   1165 C CB  . MET B 2 60  ? 17.849 2.080   15.827  1.00 34.82 ? 75  MET B CB  1 
ATOM   1166 C CG  . MET B 2 60  ? 18.639 1.693   14.608  1.00 37.62 ? 75  MET B CG  1 
ATOM   1167 S SD  . MET B 2 60  ? 18.171 0.067   14.031  1.00 39.28 ? 75  MET B SD  1 
ATOM   1168 C CE  . MET B 2 60  ? 19.442 -0.242  12.804  1.00 33.78 ? 75  MET B CE  1 
ATOM   1169 N N   . TYR B 2 61  ? 17.756 3.126   18.847  1.00 33.64 ? 76  TYR B N   1 
ATOM   1170 C CA  . TYR B 2 61  ? 17.020 3.433   20.059  1.00 33.64 ? 76  TYR B CA  1 
ATOM   1171 C C   . TYR B 2 61  ? 17.153 4.891   20.464  1.00 34.89 ? 76  TYR B C   1 
ATOM   1172 O O   . TYR B 2 61  ? 16.148 5.500   20.824  1.00 34.96 ? 76  TYR B O   1 
ATOM   1173 C CB  . TYR B 2 61  ? 17.443 2.535   21.223  1.00 34.64 ? 76  TYR B CB  1 
ATOM   1174 C CG  . TYR B 2 61  ? 16.717 2.886   22.501  1.00 36.03 ? 76  TYR B CG  1 
ATOM   1175 C CD1 . TYR B 2 61  ? 15.372 2.533   22.683  1.00 34.67 ? 76  TYR B CD1 1 
ATOM   1176 C CD2 . TYR B 2 61  ? 17.358 3.593   23.514  1.00 36.73 ? 76  TYR B CD2 1 
ATOM   1177 C CE1 . TYR B 2 61  ? 14.694 2.862   23.840  1.00 35.62 ? 76  TYR B CE1 1 
ATOM   1178 C CE2 . TYR B 2 61  ? 16.690 3.917   24.695  1.00 37.79 ? 76  TYR B CE2 1 
ATOM   1179 C CZ  . TYR B 2 61  ? 15.360 3.550   24.841  1.00 38.99 ? 76  TYR B CZ  1 
ATOM   1180 O OH  . TYR B 2 61  ? 14.694 3.880   25.984  1.00 41.76 ? 76  TYR B OH  1 
ATOM   1181 N N   . PHE B 2 62  ? 18.381 5.433   20.421  1.00 34.57 ? 77  PHE B N   1 
ATOM   1182 C CA  . PHE B 2 62  ? 18.638 6.853   20.717  1.00 33.70 ? 77  PHE B CA  1 
ATOM   1183 C C   . PHE B 2 62  ? 17.710 7.770   19.913  1.00 36.25 ? 77  PHE B C   1 
ATOM   1184 O O   . PHE B 2 62  ? 17.003 8.615   20.480  1.00 37.76 ? 77  PHE B O   1 
ATOM   1185 C CB  . PHE B 2 62  ? 20.094 7.237   20.430  1.00 35.22 ? 77  PHE B CB  1 
ATOM   1186 C CG  . PHE B 2 62  ? 21.124 6.556   21.326  1.00 36.00 ? 77  PHE B CG  1 
ATOM   1187 C CD1 . PHE B 2 62  ? 20.794 6.098   22.604  1.00 35.49 ? 77  PHE B CD1 1 
ATOM   1188 C CD2 . PHE B 2 62  ? 22.443 6.412   20.886  1.00 36.68 ? 77  PHE B CD2 1 
ATOM   1189 C CE1 . PHE B 2 62  ? 21.757 5.478   23.415  1.00 39.37 ? 77  PHE B CE1 1 
ATOM   1190 C CE2 . PHE B 2 62  ? 23.418 5.808   21.695  1.00 38.53 ? 77  PHE B CE2 1 
ATOM   1191 C CZ  . PHE B 2 62  ? 23.076 5.346   22.959  1.00 37.92 ? 77  PHE B CZ  1 
ATOM   1192 N N   . THR B 2 63  ? 17.693 7.565   18.595  1.00 35.76 ? 78  THR B N   1 
ATOM   1193 C CA  . THR B 2 63  ? 16.894 8.361   17.664  1.00 37.20 ? 78  THR B CA  1 
ATOM   1194 C C   . THR B 2 63  ? 15.395 8.182   17.896  1.00 36.31 ? 78  THR B C   1 
ATOM   1195 O O   . THR B 2 63  ? 14.636 9.152   17.894  1.00 36.72 ? 78  THR B O   1 
ATOM   1196 C CB  . THR B 2 63  ? 17.217 8.009   16.185  1.00 37.19 ? 78  THR B CB  1 
ATOM   1197 O OG1 . THR B 2 63  ? 18.637 7.961   15.993  1.00 40.99 ? 78  THR B OG1 1 
ATOM   1198 C CG2 . THR B 2 63  ? 16.635 9.051   15.261  1.00 38.37 ? 78  THR B CG2 1 
ATOM   1199 N N   . TYR B 2 64  ? 14.991 6.931   18.088  1.00 36.34 ? 79  TYR B N   1 
ATOM   1200 C CA  . TYR B 2 64  ? 13.602 6.562   18.338  1.00 34.75 ? 79  TYR B CA  1 
ATOM   1201 C C   . TYR B 2 64  ? 13.114 7.217   19.624  1.00 35.61 ? 79  TYR B C   1 
ATOM   1202 O O   . TYR B 2 64  ? 11.993 7.751   19.671  1.00 33.29 ? 79  TYR B O   1 
ATOM   1203 C CB  . TYR B 2 64  ? 13.506 5.037   18.408  1.00 32.40 ? 79  TYR B CB  1 
ATOM   1204 C CG  . TYR B 2 64  ? 12.233 4.443   18.978  1.00 34.85 ? 79  TYR B CG  1 
ATOM   1205 C CD1 . TYR B 2 64  ? 11.093 4.283   18.185  1.00 35.48 ? 79  TYR B CD1 1 
ATOM   1206 C CD2 . TYR B 2 64  ? 12.187 3.991   20.294  1.00 33.56 ? 79  TYR B CD2 1 
ATOM   1207 C CE1 . TYR B 2 64  ? 9.934  3.708   18.702  1.00 38.02 ? 79  TYR B CE1 1 
ATOM   1208 C CE2 . TYR B 2 64  ? 11.033 3.411   20.821  1.00 36.04 ? 79  TYR B CE2 1 
ATOM   1209 C CZ  . TYR B 2 64  ? 9.916  3.273   20.020  1.00 37.68 ? 79  TYR B CZ  1 
ATOM   1210 O OH  . TYR B 2 64  ? 8.782  2.708   20.537  1.00 40.83 ? 79  TYR B OH  1 
ATOM   1211 N N   . LYS B 2 65  ? 13.967 7.203   20.654  1.00 35.74 ? 80  LYS B N   1 
ATOM   1212 C CA  . LYS B 2 65  ? 13.605 7.814   21.930  1.00 36.35 ? 80  LYS B CA  1 
ATOM   1213 C C   . LYS B 2 65  ? 13.497 9.330   21.845  1.00 36.75 ? 80  LYS B C   1 
ATOM   1214 O O   . LYS B 2 65  ? 12.524 9.899   22.326  1.00 39.86 ? 80  LYS B O   1 
ATOM   1215 C CB  . LYS B 2 65  ? 14.558 7.421   23.050  1.00 37.14 ? 80  LYS B CB  1 
ATOM   1216 C CG  . LYS B 2 65  ? 14.009 7.801   24.418  1.00 40.09 ? 80  LYS B CG  1 
ATOM   1217 C CD  . LYS B 2 65  ? 14.935 7.397   25.515  1.00 43.33 ? 80  LYS B CD  1 
ATOM   1218 C CE  . LYS B 2 65  ? 14.492 7.981   26.827  1.00 45.64 ? 80  LYS B CE  1 
ATOM   1219 N NZ  . LYS B 2 65  ? 15.229 7.313   27.920  1.00 51.21 ? 80  LYS B NZ  1 
ATOM   1220 N N   . VAL B 2 66  ? 14.486 9.981   21.237  1.00 35.57 ? 81  VAL B N   1 
ATOM   1221 C CA  . VAL B 2 66  ? 14.484 11.442  21.122  1.00 35.66 ? 81  VAL B CA  1 
ATOM   1222 C C   . VAL B 2 66  ? 13.253 11.928  20.350  1.00 38.22 ? 81  VAL B C   1 
ATOM   1223 O O   . VAL B 2 66  ? 12.639 12.942  20.698  1.00 39.46 ? 81  VAL B O   1 
ATOM   1224 C CB  . VAL B 2 66  ? 15.792 11.949  20.470  1.00 35.37 ? 81  VAL B CB  1 
ATOM   1225 C CG1 . VAL B 2 66  ? 15.668 13.402  20.001  1.00 33.33 ? 81  VAL B CG1 1 
ATOM   1226 C CG2 . VAL B 2 66  ? 16.952 11.787  21.444  1.00 34.97 ? 81  VAL B CG2 1 
ATOM   1227 N N   . ARG B 2 67  ? 12.882 11.160  19.332  1.00 36.94 ? 82  ARG B N   1 
ATOM   1228 C CA  . ARG B 2 67  ? 11.804 11.502  18.441  1.00 35.46 ? 82  ARG B CA  1 
ATOM   1229 C C   . ARG B 2 67  ? 10.423 11.290  19.061  1.00 36.28 ? 82  ARG B C   1 
ATOM   1230 O O   . ARG B 2 67  ? 9.558  12.156  18.942  1.00 36.84 ? 82  ARG B O   1 
ATOM   1231 C CB  . ARG B 2 67  ? 11.947 10.682  17.158  1.00 36.56 ? 82  ARG B CB  1 
ATOM   1232 C CG  . ARG B 2 67  ? 11.699 11.467  15.885  1.00 42.10 ? 82  ARG B CG  1 
ATOM   1233 C CD  . ARG B 2 67  ? 10.242 11.831  15.754  1.00 42.72 ? 82  ARG B CD  1 
ATOM   1234 N NE  . ARG B 2 67  ? 9.840  12.097  14.378  1.00 46.34 ? 82  ARG B NE  1 
ATOM   1235 C CZ  . ARG B 2 67  ? 8.588  12.359  14.010  1.00 48.12 ? 82  ARG B CZ  1 
ATOM   1236 N NH1 . ARG B 2 67  ? 7.614  12.400  14.922  1.00 42.68 ? 82  ARG B NH1 1 
ATOM   1237 N NH2 . ARG B 2 67  ? 8.308  12.578  12.729  1.00 50.99 ? 82  ARG B NH2 1 
ATOM   1238 N N   . TYR B 2 68  ? 10.217 10.146  19.718  1.00 36.70 ? 83  TYR B N   1 
ATOM   1239 C CA  . TYR B 2 68  ? 8.888  9.763   20.221  1.00 37.53 ? 83  TYR B CA  1 
ATOM   1240 C C   . TYR B 2 68  ? 8.638  10.032  21.709  1.00 38.86 ? 83  TYR B C   1 
ATOM   1241 O O   . TYR B 2 68  ? 7.528  9.809   22.190  1.00 40.54 ? 83  TYR B O   1 
ATOM   1242 C CB  . TYR B 2 68  ? 8.570  8.291   19.895  1.00 34.92 ? 83  TYR B CB  1 
ATOM   1243 C CG  . TYR B 2 68  ? 8.343  8.024   18.423  1.00 36.57 ? 83  TYR B CG  1 
ATOM   1244 C CD1 . TYR B 2 68  ? 7.254  8.584   17.739  1.00 36.86 ? 83  TYR B CD1 1 
ATOM   1245 C CD2 . TYR B 2 68  ? 9.212  7.213   17.713  1.00 33.34 ? 83  TYR B CD2 1 
ATOM   1246 C CE1 . TYR B 2 68  ? 7.059  8.336   16.381  1.00 38.06 ? 83  TYR B CE1 1 
ATOM   1247 C CE2 . TYR B 2 68  ? 9.026  6.961   16.371  1.00 33.71 ? 83  TYR B CE2 1 
ATOM   1248 C CZ  . TYR B 2 68  ? 7.961  7.519   15.708  1.00 37.99 ? 83  TYR B CZ  1 
ATOM   1249 O OH  . TYR B 2 68  ? 7.811  7.240   14.365  1.00 43.70 ? 83  TYR B OH  1 
ATOM   1250 N N   . THR B 2 69  ? 9.649  10.504  22.433  1.00 40.80 ? 84  THR B N   1 
ATOM   1251 C CA  . THR B 2 69  ? 9.464  10.838  23.845  1.00 46.05 ? 84  THR B CA  1 
ATOM   1252 C C   . THR B 2 69  ? 8.593  12.096  23.944  1.00 48.12 ? 84  THR B C   1 
ATOM   1253 O O   . THR B 2 69  ? 8.940  13.145  23.396  1.00 50.97 ? 84  THR B O   1 
ATOM   1254 C CB  . THR B 2 69  ? 10.822 10.943  24.621  1.00 45.06 ? 84  THR B CB  1 
ATOM   1255 O OG1 . THR B 2 69  ? 10.592 10.764  26.021  1.00 51.50 ? 84  THR B OG1 1 
ATOM   1256 C CG2 . THR B 2 69  ? 11.529 12.275  24.387  1.00 44.08 ? 84  THR B CG2 1 
ATOM   1257 N N   . ASN B 2 70  ? 7.441  11.975  24.595  1.00 49.48 ? 85  ASN B N   1 
ATOM   1258 C CA  . ASN B 2 70  ? 6.440  13.050  24.601  1.00 52.31 ? 85  ASN B CA  1 
ATOM   1259 C C   . ASN B 2 70  ? 5.597  13.164  23.322  1.00 52.86 ? 85  ASN B C   1 
ATOM   1260 O O   . ASN B 2 70  ? 4.918  14.171  23.124  1.00 52.33 ? 85  ASN B O   1 
ATOM   1261 C CB  . ASN B 2 70  ? 7.082  14.412  24.907  1.00 53.40 ? 85  ASN B CB  1 
ATOM   1262 C CG  . ASN B 2 70  ? 7.429  14.582  26.365  1.00 57.02 ? 85  ASN B CG  1 
ATOM   1263 O OD1 . ASN B 2 70  ? 8.254  13.847  26.914  1.00 58.49 ? 85  ASN B OD1 1 
ATOM   1264 N ND2 . ASN B 2 70  ? 6.803  15.565  27.007  1.00 59.76 ? 85  ASN B ND2 1 
ATOM   1265 N N   . SER B 2 71  ? 5.623  12.147  22.462  1.00 53.82 ? 86  SER B N   1 
ATOM   1266 C CA  . SER B 2 71  ? 4.861  12.205  21.207  1.00 55.08 ? 86  SER B CA  1 
ATOM   1267 C C   . SER B 2 71  ? 3.364  12.354  21.460  1.00 54.59 ? 86  SER B C   1 
ATOM   1268 O O   . SER B 2 71  ? 2.856  11.905  22.486  1.00 54.75 ? 86  SER B O   1 
ATOM   1269 C CB  . SER B 2 71  ? 5.122  10.978  20.331  1.00 55.61 ? 86  SER B CB  1 
ATOM   1270 O OG  . SER B 2 71  ? 4.302  9.889   20.718  1.00 58.34 ? 86  SER B OG  1 
ATOM   1271 N N   . GLU B 2 74  ? 0.563  8.374   19.201  1.00 58.24 ? 89  GLU B N   1 
ATOM   1272 C CA  . GLU B 2 74  ? 0.747  6.946   19.452  1.00 58.57 ? 89  GLU B CA  1 
ATOM   1273 C C   . GLU B 2 74  ? 2.119  6.477   18.988  1.00 56.41 ? 89  GLU B C   1 
ATOM   1274 O O   . GLU B 2 74  ? 2.521  6.729   17.849  1.00 57.14 ? 89  GLU B O   1 
ATOM   1275 C CB  . GLU B 2 74  ? -0.372 6.104   18.814  1.00 60.42 ? 89  GLU B CB  1 
ATOM   1276 C CG  . GLU B 2 74  ? -0.934 6.636   17.486  1.00 64.45 ? 89  GLU B CG  1 
ATOM   1277 C CD  . GLU B 2 74  ? -2.095 7.617   17.666  1.00 67.79 ? 89  GLU B CD  1 
ATOM   1278 O OE1 . GLU B 2 74  ? -2.883 7.469   18.630  1.00 69.26 ? 89  GLU B OE1 1 
ATOM   1279 O OE2 . GLU B 2 74  ? -2.227 8.536   16.827  1.00 69.21 ? 89  GLU B OE2 1 
ATOM   1280 N N   . ILE B 2 75  ? 2.830  5.799   19.884  1.00 53.93 ? 90  ILE B N   1 
ATOM   1281 C CA  . ILE B 2 75  ? 4.215  5.391   19.648  1.00 51.94 ? 90  ILE B CA  1 
ATOM   1282 C C   . ILE B 2 75  ? 4.277  4.024   18.967  1.00 49.00 ? 90  ILE B C   1 
ATOM   1283 O O   . ILE B 2 75  ? 3.708  3.058   19.475  1.00 50.84 ? 90  ILE B O   1 
ATOM   1284 C CB  . ILE B 2 75  ? 5.028  5.372   20.967  1.00 52.84 ? 90  ILE B CB  1 
ATOM   1285 C CG1 . ILE B 2 75  ? 5.082  6.770   21.582  1.00 53.74 ? 90  ILE B CG1 1 
ATOM   1286 C CG2 . ILE B 2 75  ? 6.449  4.862   20.742  1.00 54.67 ? 90  ILE B CG2 1 
ATOM   1287 C CD1 . ILE B 2 75  ? 5.805  6.825   22.920  1.00 58.89 ? 90  ILE B CD1 1 
ATOM   1288 N N   . PRO B 2 76  ? 4.964  3.938   17.811  1.00 46.62 ? 91  PRO B N   1 
ATOM   1289 C CA  . PRO B 2 76  ? 5.121  2.664   17.117  1.00 44.88 ? 91  PRO B CA  1 
ATOM   1290 C C   . PRO B 2 76  ? 6.059  1.725   17.877  1.00 44.16 ? 91  PRO B C   1 
ATOM   1291 O O   . PRO B 2 76  ? 6.822  2.176   18.743  1.00 42.63 ? 91  PRO B O   1 
ATOM   1292 C CB  . PRO B 2 76  ? 5.734  3.077   15.783  1.00 45.60 ? 91  PRO B CB  1 
ATOM   1293 C CG  . PRO B 2 76  ? 6.484  4.310   16.095  1.00 46.27 ? 91  PRO B CG  1 
ATOM   1294 C CD  . PRO B 2 76  ? 5.640  5.031   17.090  1.00 47.20 ? 91  PRO B CD  1 
ATOM   1295 N N   . GLU B 2 77  ? 5.989  0.433   17.565  1.00 44.04 ? 92  GLU B N   1 
ATOM   1296 C CA  . GLU B 2 77  ? 6.768  -0.575  18.275  1.00 45.83 ? 92  GLU B CA  1 
ATOM   1297 C C   . GLU B 2 77  ? 8.252  -0.402  17.987  1.00 44.29 ? 92  GLU B C   1 
ATOM   1298 O O   . GLU B 2 77  ? 8.636  0.022   16.898  1.00 46.36 ? 92  GLU B O   1 
ATOM   1299 C CB  . GLU B 2 77  ? 6.315  -1.997  17.897  1.00 48.33 ? 92  GLU B CB  1 
ATOM   1300 C CG  . GLU B 2 77  ? 7.228  -2.717  16.895  1.00 53.28 ? 92  GLU B CG  1 
ATOM   1301 C CD  . GLU B 2 77  ? 6.752  -4.115  16.529  1.00 57.96 ? 92  GLU B CD  1 
ATOM   1302 O OE1 . GLU B 2 77  ? 7.434  -5.096  16.911  1.00 59.03 ? 92  GLU B OE1 1 
ATOM   1303 O OE2 . GLU B 2 77  ? 5.709  -4.231  15.848  1.00 59.01 ? 92  GLU B OE2 1 
ATOM   1304 N N   . PHE B 2 78  ? 9.084  -0.718  18.969  1.00 43.13 ? 93  PHE B N   1 
ATOM   1305 C CA  . PHE B 2 78  ? 10.517 -0.788  18.730  1.00 41.98 ? 93  PHE B CA  1 
ATOM   1306 C C   . PHE B 2 78  ? 10.907 -2.240  18.490  1.00 41.96 ? 93  PHE B C   1 
ATOM   1307 O O   . PHE B 2 78  ? 10.885 -3.045  19.420  1.00 43.05 ? 93  PHE B O   1 
ATOM   1308 C CB  . PHE B 2 78  ? 11.309 -0.190  19.889  1.00 39.98 ? 93  PHE B CB  1 
ATOM   1309 C CG  . PHE B 2 78  ? 12.766 -0.084  19.614  1.00 38.12 ? 93  PHE B CG  1 
ATOM   1310 C CD1 . PHE B 2 78  ? 13.259 0.926   18.788  1.00 36.46 ? 93  PHE B CD1 1 
ATOM   1311 C CD2 . PHE B 2 78  ? 13.658 -0.997  20.171  1.00 35.12 ? 93  PHE B CD2 1 
ATOM   1312 C CE1 . PHE B 2 78  ? 14.627 1.024   18.521  1.00 33.22 ? 93  PHE B CE1 1 
ATOM   1313 C CE2 . PHE B 2 78  ? 15.023 -0.900  19.915  1.00 35.52 ? 93  PHE B CE2 1 
ATOM   1314 C CZ  . PHE B 2 78  ? 15.509 0.115   19.089  1.00 33.23 ? 93  PHE B CZ  1 
ATOM   1315 N N   . PRO B 2 79  ? 11.257 -2.579  17.235  1.00 42.68 ? 94  PRO B N   1 
ATOM   1316 C CA  . PRO B 2 79  ? 11.469 -3.969  16.843  1.00 42.98 ? 94  PRO B CA  1 
ATOM   1317 C C   . PRO B 2 79  ? 12.753 -4.525  17.416  1.00 42.18 ? 94  PRO B C   1 
ATOM   1318 O O   . PRO B 2 79  ? 13.817 -3.931  17.239  1.00 43.53 ? 94  PRO B O   1 
ATOM   1319 C CB  . PRO B 2 79  ? 11.570 -3.895  15.306  1.00 43.21 ? 94  PRO B CB  1 
ATOM   1320 C CG  . PRO B 2 79  ? 11.112 -2.515  14.932  1.00 41.47 ? 94  PRO B CG  1 
ATOM   1321 C CD  . PRO B 2 79  ? 11.477 -1.667  16.100  1.00 42.14 ? 94  PRO B CD  1 
ATOM   1322 N N   . ILE B 2 80  ? 12.650 -5.652  18.109  1.00 41.09 ? 95  ILE B N   1 
ATOM   1323 C CA  . ILE B 2 80  ? 13.829 -6.357  18.606  1.00 39.59 ? 95  ILE B CA  1 
ATOM   1324 C C   . ILE B 2 80  ? 13.656 -7.850  18.371  1.00 39.69 ? 95  ILE B C   1 
ATOM   1325 O O   . ILE B 2 80  ? 12.786 -8.492  18.972  1.00 39.26 ? 95  ILE B O   1 
ATOM   1326 C CB  . ILE B 2 80  ? 14.107 -6.094  20.113  1.00 38.69 ? 95  ILE B CB  1 
ATOM   1327 C CG1 . ILE B 2 80  ? 14.292 -4.595  20.394  1.00 37.23 ? 95  ILE B CG1 1 
ATOM   1328 C CG2 . ILE B 2 80  ? 15.343 -6.870  20.570  1.00 37.72 ? 95  ILE B CG2 1 
ATOM   1329 C CD1 . ILE B 2 80  ? 14.042 -4.187  21.864  1.00 34.20 ? 95  ILE B CD1 1 
ATOM   1330 N N   . ALA B 2 81  ? 14.480 -8.390  17.479  1.00 39.75 ? 96  ALA B N   1 
ATOM   1331 C CA  . ALA B 2 81  ? 14.554 -9.825  17.277  1.00 40.61 ? 96  ALA B CA  1 
ATOM   1332 C C   . ALA B 2 81  ? 14.937 -10.484 18.606  1.00 40.55 ? 96  ALA B C   1 
ATOM   1333 O O   . ALA B 2 81  ? 15.860 -10.016 19.278  1.00 40.13 ? 96  ALA B O   1 
ATOM   1334 C CB  . ALA B 2 81  ? 15.576 -10.156 16.187  1.00 39.56 ? 96  ALA B CB  1 
ATOM   1335 N N   . PRO B 2 82  ? 14.203 -11.545 19.007  1.00 41.21 ? 97  PRO B N   1 
ATOM   1336 C CA  . PRO B 2 82  ? 14.498 -12.303 20.227  1.00 42.23 ? 97  PRO B CA  1 
ATOM   1337 C C   . PRO B 2 82  ? 15.938 -12.804 20.283  1.00 43.33 ? 97  PRO B C   1 
ATOM   1338 O O   . PRO B 2 82  ? 16.481 -12.984 21.369  1.00 43.55 ? 97  PRO B O   1 
ATOM   1339 C CB  . PRO B 2 82  ? 13.535 -13.485 20.138  1.00 42.21 ? 97  PRO B CB  1 
ATOM   1340 C CG  . PRO B 2 82  ? 12.393 -12.957 19.363  1.00 42.83 ? 97  PRO B CG  1 
ATOM   1341 C CD  . PRO B 2 82  ? 13.007 -12.072 18.325  1.00 40.77 ? 97  PRO B CD  1 
ATOM   1342 N N   . GLU B 2 83  ? 16.540 -13.000 19.109  1.00 45.22 ? 98  GLU B N   1 
ATOM   1343 C CA  . GLU B 2 83  ? 17.915 -13.490 18.962  1.00 45.30 ? 98  GLU B CA  1 
ATOM   1344 C C   . GLU B 2 83  ? 18.977 -12.495 19.438  1.00 45.07 ? 98  GLU B C   1 
ATOM   1345 O O   . GLU B 2 83  ? 20.088 -12.891 19.780  1.00 47.31 ? 98  GLU B O   1 
ATOM   1346 C CB  . GLU B 2 83  ? 18.195 -13.858 17.497  1.00 45.32 ? 98  GLU B CB  1 
ATOM   1347 C CG  . GLU B 2 83  ? 17.332 -14.982 16.940  1.00 47.30 ? 98  GLU B CG  1 
ATOM   1348 C CD  . GLU B 2 83  ? 16.060 -14.491 16.270  1.00 46.56 ? 98  GLU B CD  1 
ATOM   1349 O OE1 . GLU B 2 83  ? 15.698 -15.054 15.223  1.00 48.48 ? 98  GLU B OE1 1 
ATOM   1350 O OE2 . GLU B 2 83  ? 15.419 -13.549 16.775  1.00 47.67 ? 98  GLU B OE2 1 
ATOM   1351 N N   . ILE B 2 84  ? 18.647 -11.207 19.444  1.00 44.49 ? 99  ILE B N   1 
ATOM   1352 C CA  . ILE B 2 84  ? 19.602 -10.188 19.895  1.00 43.06 ? 99  ILE B CA  1 
ATOM   1353 C C   . ILE B 2 84  ? 19.262 -9.626  21.285  1.00 40.95 ? 99  ILE B C   1 
ATOM   1354 O O   . ILE B 2 84  ? 20.044 -8.861  21.854  1.00 41.72 ? 99  ILE B O   1 
ATOM   1355 C CB  . ILE B 2 84  ? 19.761 -9.021  18.874  1.00 43.11 ? 99  ILE B CB  1 
ATOM   1356 C CG1 . ILE B 2 84  ? 18.544 -8.097  18.886  1.00 43.89 ? 99  ILE B CG1 1 
ATOM   1357 C CG2 . ILE B 2 84  ? 20.010 -9.547  17.458  1.00 41.61 ? 99  ILE B CG2 1 
ATOM   1358 C CD1 . ILE B 2 84  ? 18.883 -6.672  18.531  1.00 44.38 ? 99  ILE B CD1 1 
ATOM   1359 N N   . ALA B 2 85  ? 18.115 -10.030 21.825  1.00 37.80 ? 100 ALA B N   1 
ATOM   1360 C CA  . ALA B 2 85  ? 17.532 -9.387  23.010  1.00 38.35 ? 100 ALA B CA  1 
ATOM   1361 C C   . ALA B 2 85  ? 18.394 -9.438  24.271  1.00 38.79 ? 100 ALA B C   1 
ATOM   1362 O O   . ALA B 2 85  ? 18.532 -8.424  24.960  1.00 41.59 ? 100 ALA B O   1 
ATOM   1363 C CB  . ALA B 2 85  ? 16.130 -9.936  23.291  1.00 37.66 ? 100 ALA B CB  1 
ATOM   1364 N N   . LEU B 2 86  ? 18.976 -10.599 24.569  1.00 36.70 ? 101 LEU B N   1 
ATOM   1365 C CA  . LEU B 2 86  ? 19.807 -10.754 25.773  1.00 38.97 ? 101 LEU B CA  1 
ATOM   1366 C C   . LEU B 2 86  ? 21.079 -9.902  25.721  1.00 37.88 ? 101 LEU B C   1 
ATOM   1367 O O   . LEU B 2 86  ? 21.429 -9.230  26.699  1.00 34.47 ? 101 LEU B O   1 
ATOM   1368 C CB  . LEU B 2 86  ? 20.158 -12.231 26.021  1.00 39.66 ? 101 LEU B CB  1 
ATOM   1369 C CG  . LEU B 2 86  ? 20.839 -12.588 27.352  1.00 41.67 ? 101 LEU B CG  1 
ATOM   1370 C CD1 . LEU B 2 86  ? 20.018 -12.128 28.553  1.00 41.53 ? 101 LEU B CD1 1 
ATOM   1371 C CD2 . LEU B 2 86  ? 21.116 -14.081 27.441  1.00 41.08 ? 101 LEU B CD2 1 
ATOM   1372 N N   . GLU B 2 87  ? 21.759 -9.948  24.577  1.00 37.65 ? 102 GLU B N   1 
ATOM   1373 C CA  . GLU B 2 87  ? 22.920 -9.103  24.303  1.00 40.06 ? 102 GLU B CA  1 
ATOM   1374 C C   . GLU B 2 87  ? 22.566 -7.629  24.375  1.00 39.79 ? 102 GLU B C   1 
ATOM   1375 O O   . GLU B 2 87  ? 23.358 -6.827  24.864  1.00 41.29 ? 102 GLU B O   1 
ATOM   1376 C CB  . GLU B 2 87  ? 23.479 -9.399  22.915  1.00 40.81 ? 102 GLU B CB  1 
ATOM   1377 C CG  . GLU B 2 87  ? 24.323 -10.644 22.817  1.00 42.13 ? 102 GLU B CG  1 
ATOM   1378 C CD  . GLU B 2 87  ? 24.778 -10.902 21.393  1.00 46.70 ? 102 GLU B CD  1 
ATOM   1379 O OE1 . GLU B 2 87  ? 23.953 -10.748 20.466  1.00 50.85 ? 102 GLU B OE1 1 
ATOM   1380 O OE2 . GLU B 2 87  ? 25.960 -11.254 21.195  1.00 47.85 ? 102 GLU B OE2 1 
ATOM   1381 N N   . LEU B 2 88  ? 21.381 -7.286  23.868  1.00 40.18 ? 103 LEU B N   1 
ATOM   1382 C CA  . LEU B 2 88  ? 20.876 -5.907  23.871  1.00 40.82 ? 103 LEU B CA  1 
ATOM   1383 C C   . LEU B 2 88  ? 20.589 -5.437  25.301  1.00 40.82 ? 103 LEU B C   1 
ATOM   1384 O O   . LEU B 2 88  ? 20.875 -4.288  25.653  1.00 43.71 ? 103 LEU B O   1 
ATOM   1385 C CB  . LEU B 2 88  ? 19.592 -5.806  23.040  1.00 37.19 ? 103 LEU B CB  1 
ATOM   1386 C CG  . LEU B 2 88  ? 19.363 -4.700  22.003  1.00 41.29 ? 103 LEU B CG  1 
ATOM   1387 C CD1 . LEU B 2 88  ? 17.881 -4.388  21.932  1.00 39.04 ? 103 LEU B CD1 1 
ATOM   1388 C CD2 . LEU B 2 88  ? 20.169 -3.430  22.222  1.00 38.80 ? 103 LEU B CD2 1 
ATOM   1389 N N   . LEU B 2 89  ? 20.003 -6.334  26.097  1.00 38.96 ? 104 LEU B N   1 
ATOM   1390 C CA  . LEU B 2 89  ? 19.714 -6.108  27.513  1.00 39.74 ? 104 LEU B CA  1 
ATOM   1391 C C   . LEU B 2 89  ? 20.999 -5.766  28.264  1.00 41.09 ? 104 LEU B C   1 
ATOM   1392 O O   . LEU B 2 89  ? 21.078 -4.754  28.963  1.00 42.21 ? 104 LEU B O   1 
ATOM   1393 C CB  . LEU B 2 89  ? 19.089 -7.371  28.126  1.00 37.32 ? 104 LEU B CB  1 
ATOM   1394 C CG  . LEU B 2 89  ? 18.116 -7.347  29.314  1.00 37.27 ? 104 LEU B CG  1 
ATOM   1395 C CD1 . LEU B 2 89  ? 18.162 -8.698  30.033  1.00 35.10 ? 104 LEU B CD1 1 
ATOM   1396 C CD2 . LEU B 2 89  ? 18.367 -6.203  30.288  1.00 36.70 ? 104 LEU B CD2 1 
ATOM   1397 N N   . MET B 2 90  ? 22.000 -6.628  28.105  1.00 42.33 ? 105 MET B N   1 
ATOM   1398 C CA  . MET B 2 90  ? 23.308 -6.435  28.711  1.00 42.89 ? 105 MET B CA  1 
ATOM   1399 C C   . MET B 2 90  ? 23.912 -5.105  28.296  1.00 41.19 ? 105 MET B C   1 
ATOM   1400 O O   . MET B 2 90  ? 24.359 -4.342  29.148  1.00 41.73 ? 105 MET B O   1 
ATOM   1401 C CB  . MET B 2 90  ? 24.242 -7.577  28.319  1.00 45.27 ? 105 MET B CB  1 
ATOM   1402 C CG  . MET B 2 90  ? 23.792 -8.938  28.823  1.00 49.36 ? 105 MET B CG  1 
ATOM   1403 S SD  . MET B 2 90  ? 25.005 -10.207 28.464  1.00 55.83 ? 105 MET B SD  1 
ATOM   1404 C CE  . MET B 2 90  ? 26.157 -9.926  29.813  1.00 53.02 ? 105 MET B CE  1 
ATOM   1405 N N   . ALA B 2 91  ? 23.911 -4.834  26.990  1.00 40.17 ? 106 ALA B N   1 
ATOM   1406 C CA  . ALA B 2 91  ? 24.436 -3.579  26.437  1.00 38.28 ? 106 ALA B CA  1 
ATOM   1407 C C   . ALA B 2 91  ? 23.717 -2.363  27.010  1.00 37.74 ? 106 ALA B C   1 
ATOM   1408 O O   . ALA B 2 91  ? 24.368 -1.447  27.503  1.00 39.46 ? 106 ALA B O   1 
ATOM   1409 C CB  . ALA B 2 91  ? 24.352 -3.581  24.921  1.00 35.44 ? 106 ALA B CB  1 
ATOM   1410 N N   . ALA B 2 92  ? 22.381 -2.368  26.958  1.00 37.62 ? 107 ALA B N   1 
ATOM   1411 C CA  . ALA B 2 92  ? 21.565 -1.272  27.501  1.00 35.70 ? 107 ALA B CA  1 
ATOM   1412 C C   . ALA B 2 92  ? 21.787 -1.047  29.001  1.00 35.65 ? 107 ALA B C   1 
ATOM   1413 O O   . ALA B 2 92  ? 21.832 0.090   29.459  1.00 36.80 ? 107 ALA B O   1 
ATOM   1414 C CB  . ALA B 2 92  ? 20.104 -1.508  27.216  1.00 33.44 ? 107 ALA B CB  1 
ATOM   1415 N N   . ASN B 2 93  ? 21.909 -2.129  29.764  1.00 36.79 ? 108 ASN B N   1 
ATOM   1416 C CA  . ASN B 2 93  ? 22.271 -2.021  31.170  1.00 38.95 ? 108 ASN B CA  1 
ATOM   1417 C C   . ASN B 2 93  ? 23.615 -1.309  31.325  1.00 39.13 ? 108 ASN B C   1 
ATOM   1418 O O   . ASN B 2 93  ? 23.713 -0.317  32.046  1.00 39.38 ? 108 ASN B O   1 
ATOM   1419 C CB  . ASN B 2 93  ? 22.303 -3.394  31.849  1.00 39.09 ? 108 ASN B CB  1 
ATOM   1420 C CG  . ASN B 2 93  ? 22.706 -3.311  33.316  1.00 42.71 ? 108 ASN B CG  1 
ATOM   1421 O OD1 . ASN B 2 93  ? 21.883 -3.019  34.181  1.00 45.95 ? 108 ASN B OD1 1 
ATOM   1422 N ND2 . ASN B 2 93  ? 23.979 -3.564  33.598  1.00 43.22 ? 108 ASN B ND2 1 
ATOM   1423 N N   . PHE B 2 94  ? 24.641 -1.809  30.639  1.00 40.70 ? 109 PHE B N   1 
ATOM   1424 C CA  . PHE B 2 94  ? 25.957 -1.172  30.660  1.00 41.68 ? 109 PHE B CA  1 
ATOM   1425 C C   . PHE B 2 94  ? 25.876 0.311   30.268  1.00 41.33 ? 109 PHE B C   1 
ATOM   1426 O O   . PHE B 2 94  ? 26.519 1.159   30.887  1.00 39.41 ? 109 PHE B O   1 
ATOM   1427 C CB  . PHE B 2 94  ? 26.948 -1.921  29.758  1.00 42.73 ? 109 PHE B CB  1 
ATOM   1428 C CG  . PHE B 2 94  ? 28.315 -1.279  29.696  1.00 45.28 ? 109 PHE B CG  1 
ATOM   1429 C CD1 . PHE B 2 94  ? 29.254 -1.511  30.698  1.00 45.17 ? 109 PHE B CD1 1 
ATOM   1430 C CD2 . PHE B 2 94  ? 28.658 -0.435  28.637  1.00 46.14 ? 109 PHE B CD2 1 
ATOM   1431 C CE1 . PHE B 2 94  ? 30.521 -0.913  30.652  1.00 46.95 ? 109 PHE B CE1 1 
ATOM   1432 C CE2 . PHE B 2 94  ? 29.919 0.169   28.580  1.00 46.74 ? 109 PHE B CE2 1 
ATOM   1433 C CZ  . PHE B 2 94  ? 30.851 -0.070  29.589  1.00 47.21 ? 109 PHE B CZ  1 
ATOM   1434 N N   . LEU B 2 95  ? 25.068 0.609   29.250  1.00 40.06 ? 110 LEU B N   1 
ATOM   1435 C CA  . LEU B 2 95  ? 24.947 1.963   28.716  1.00 39.62 ? 110 LEU B CA  1 
ATOM   1436 C C   . LEU B 2 95  ? 23.998 2.875   29.490  1.00 40.58 ? 110 LEU B C   1 
ATOM   1437 O O   . LEU B 2 95  ? 23.954 4.081   29.233  1.00 40.68 ? 110 LEU B O   1 
ATOM   1438 C CB  . LEU B 2 95  ? 24.547 1.915   27.239  1.00 39.36 ? 110 LEU B CB  1 
ATOM   1439 C CG  . LEU B 2 95  ? 25.650 1.452   26.288  1.00 37.26 ? 110 LEU B CG  1 
ATOM   1440 C CD1 . LEU B 2 95  ? 25.095 1.309   24.892  1.00 36.91 ? 110 LEU B CD1 1 
ATOM   1441 C CD2 . LEU B 2 95  ? 26.858 2.414   26.305  1.00 32.50 ? 110 LEU B CD2 1 
ATOM   1442 N N   . ASP B 2 96  ? 23.252 2.299   30.434  1.00 41.93 ? 111 ASP B N   1 
ATOM   1443 C CA  . ASP B 2 96  ? 22.300 3.036   31.269  1.00 43.98 ? 111 ASP B CA  1 
ATOM   1444 C C   . ASP B 2 96  ? 21.261 3.788   30.425  1.00 46.08 ? 111 ASP B C   1 
ATOM   1445 O O   . ASP B 2 96  ? 21.157 5.016   30.485  1.00 47.27 ? 111 ASP B O   1 
ATOM   1446 C CB  . ASP B 2 96  ? 23.045 3.982   32.228  1.00 44.60 ? 111 ASP B CB  1 
ATOM   1447 C CG  . ASP B 2 96  ? 22.155 4.526   33.341  1.00 46.98 ? 111 ASP B CG  1 
ATOM   1448 O OD1 . ASP B 2 96  ? 21.127 3.892   33.668  1.00 49.58 ? 111 ASP B OD1 1 
ATOM   1449 O OD2 . ASP B 2 96  ? 22.495 5.590   33.900  1.00 47.79 ? 111 ASP B OD2 1 
ATOM   1450 N N   . CYS B 2 97  ? 20.506 3.043   29.621  1.00 48.99 ? 112 CYS B N   1 
ATOM   1451 C CA  . CYS B 2 97  ? 19.461 3.634   28.785  1.00 52.93 ? 112 CYS B CA  1 
ATOM   1452 C C   . CYS B 2 97  ? 18.266 2.701   28.563  1.00 54.50 ? 112 CYS B C   1 
ATOM   1453 O O   . CYS B 2 97  ? 18.246 1.543   28.992  1.00 56.31 ? 112 CYS B O   1 
ATOM   1454 C CB  . CYS B 2 97  ? 20.037 4.091   27.442  1.00 53.07 ? 112 CYS B CB  1 
ATOM   1455 S SG  . CYS B 2 97  ? 20.668 2.757   26.428  1.00 58.55 ? 112 CYS B SG  1 
ATOM   1456 O OXT . CYS B 2 97  ? 17.280 3.099   27.939  1.00 55.97 ? 112 CYS B OXT 1 
ATOM   1457 N N   . MET C 1 1   ? -1.496 -3.621  -2.055  1.00 49.03 ? 1   MET C N   1 
ATOM   1458 C CA  . MET C 1 1   ? -0.929 -3.221  -3.381  1.00 47.82 ? 1   MET C CA  1 
ATOM   1459 C C   . MET C 1 1   ? 0.384  -3.954  -3.657  1.00 44.63 ? 1   MET C C   1 
ATOM   1460 O O   . MET C 1 1   ? 1.077  -4.373  -2.730  1.00 41.16 ? 1   MET C O   1 
ATOM   1461 C CB  . MET C 1 1   ? -0.708 -1.709  -3.450  1.00 50.97 ? 1   MET C CB  1 
ATOM   1462 C CG  . MET C 1 1   ? -1.956 -0.857  -3.221  1.00 57.42 ? 1   MET C CG  1 
ATOM   1463 S SD  . MET C 1 1   ? -1.713 0.880   -3.671  1.00 64.95 ? 1   MET C SD  1 
ATOM   1464 C CE  . MET C 1 1   ? -0.557 1.427   -2.417  1.00 61.50 ? 1   MET C CE  1 
ATOM   1465 N N   . ASP C 1 2   ? 0.717  -4.091  -4.938  1.00 43.74 ? 2   ASP C N   1 
ATOM   1466 C CA  . ASP C 1 2   ? 1.843  -4.915  -5.368  1.00 42.14 ? 2   ASP C CA  1 
ATOM   1467 C C   . ASP C 1 2   ? 3.190  -4.334  -4.993  1.00 39.92 ? 2   ASP C C   1 
ATOM   1468 O O   . ASP C 1 2   ? 3.383  -3.113  -4.957  1.00 37.41 ? 2   ASP C O   1 
ATOM   1469 C CB  . ASP C 1 2   ? 1.782  -5.203  -6.871  1.00 44.59 ? 2   ASP C CB  1 
ATOM   1470 C CG  . ASP C 1 2   ? 0.838  -6.355  -7.213  1.00 50.63 ? 2   ASP C CG  1 
ATOM   1471 O OD1 . ASP C 1 2   ? 0.002  -6.739  -6.365  1.00 53.45 ? 2   ASP C OD1 1 
ATOM   1472 O OD2 . ASP C 1 2   ? 0.930  -6.887  -8.342  1.00 56.37 ? 2   ASP C OD2 1 
ATOM   1473 N N   . VAL C 1 3   ? 4.115  -5.241  -4.721  1.00 36.68 ? 3   VAL C N   1 
ATOM   1474 C CA  . VAL C 1 3   ? 5.433  -4.898  -4.230  1.00 37.06 ? 3   VAL C CA  1 
ATOM   1475 C C   . VAL C 1 3   ? 6.458  -5.725  -5.009  1.00 35.30 ? 3   VAL C C   1 
ATOM   1476 O O   . VAL C 1 3   ? 6.277  -6.927  -5.208  1.00 34.85 ? 3   VAL C O   1 
ATOM   1477 C CB  . VAL C 1 3   ? 5.497  -5.122  -2.689  1.00 38.20 ? 3   VAL C CB  1 
ATOM   1478 C CG1 . VAL C 1 3   ? 6.833  -5.671  -2.241  1.00 39.72 ? 3   VAL C CG1 1 
ATOM   1479 C CG2 . VAL C 1 3   ? 5.154  -3.844  -1.951  1.00 34.34 ? 3   VAL C CG2 1 
ATOM   1480 N N   . PHE C 1 4   ? 7.516  -5.063  -5.466  1.00 34.19 ? 4   PHE C N   1 
ATOM   1481 C CA  . PHE C 1 4   ? 8.501  -5.677  -6.352  1.00 33.55 ? 4   PHE C CA  1 
ATOM   1482 C C   . PHE C 1 4   ? 9.883  -5.689  -5.725  1.00 32.01 ? 4   PHE C C   1 
ATOM   1483 O O   . PHE C 1 4   ? 10.356 -4.674  -5.211  1.00 31.32 ? 4   PHE C O   1 
ATOM   1484 C CB  . PHE C 1 4   ? 8.492  -4.975  -7.715  1.00 32.88 ? 4   PHE C CB  1 
ATOM   1485 C CG  . PHE C 1 4   ? 7.191  -5.126  -8.441  1.00 31.81 ? 4   PHE C CG  1 
ATOM   1486 C CD1 . PHE C 1 4   ? 6.137  -4.242  -8.200  1.00 29.93 ? 4   PHE C CD1 1 
ATOM   1487 C CD2 . PHE C 1 4   ? 7.005  -6.169  -9.343  1.00 30.34 ? 4   PHE C CD2 1 
ATOM   1488 C CE1 . PHE C 1 4   ? 4.914  -4.394  -8.851  1.00 31.28 ? 4   PHE C CE1 1 
ATOM   1489 C CE2 . PHE C 1 4   ? 5.786  -6.335  -10.002 1.00 30.15 ? 4   PHE C CE2 1 
ATOM   1490 C CZ  . PHE C 1 4   ? 4.740  -5.444  -9.759  1.00 31.67 ? 4   PHE C CZ  1 
ATOM   1491 N N   . LEU C 1 5   ? 10.521 -6.853  -5.772  1.00 32.76 ? 5   LEU C N   1 
ATOM   1492 C CA  . LEU C 1 5   ? 11.663 -7.144  -4.916  1.00 34.23 ? 5   LEU C CA  1 
ATOM   1493 C C   . LEU C 1 5   ? 12.828 -7.750  -5.669  1.00 36.03 ? 5   LEU C C   1 
ATOM   1494 O O   . LEU C 1 5   ? 12.648 -8.411  -6.692  1.00 37.03 ? 5   LEU C O   1 
ATOM   1495 C CB  . LEU C 1 5   ? 11.251 -8.095  -3.782  1.00 35.51 ? 5   LEU C CB  1 
ATOM   1496 C CG  . LEU C 1 5   ? 10.023 -7.691  -2.952  1.00 38.82 ? 5   LEU C CG  1 
ATOM   1497 C CD1 . LEU C 1 5   ? 9.546  -8.815  -2.052  1.00 38.32 ? 5   LEU C CD1 1 
ATOM   1498 C CD2 . LEU C 1 5   ? 10.289 -6.410  -2.156  1.00 38.27 ? 5   LEU C CD2 1 
ATOM   1499 N N   . MET C 1 6   ? 14.024 -7.485  -5.152  1.00 34.58 ? 6   MET C N   1 
ATOM   1500 C CA  . MET C 1 6   ? 15.213 -8.221  -5.504  1.00 35.80 ? 6   MET C CA  1 
ATOM   1501 C C   . MET C 1 6   ? 15.645 -8.915  -4.226  1.00 35.65 ? 6   MET C C   1 
ATOM   1502 O O   . MET C 1 6   ? 16.057 -8.257  -3.260  1.00 35.10 ? 6   MET C O   1 
ATOM   1503 C CB  . MET C 1 6   ? 16.323 -7.287  -5.963  1.00 35.21 ? 6   MET C CB  1 
ATOM   1504 C CG  . MET C 1 6   ? 16.171 -6.741  -7.354  1.00 38.53 ? 6   MET C CG  1 
ATOM   1505 S SD  . MET C 1 6   ? 17.598 -5.743  -7.824  1.00 43.54 ? 6   MET C SD  1 
ATOM   1506 C CE  . MET C 1 6   ? 17.665 -4.528  -6.508  1.00 39.77 ? 6   MET C CE  1 
ATOM   1507 N N   . ILE C 1 7   ? 15.510 -10.236 -4.213  1.00 33.51 ? 7   ILE C N   1 
ATOM   1508 C CA  . ILE C 1 7   ? 15.990 -11.052 -3.109  1.00 34.93 ? 7   ILE C CA  1 
ATOM   1509 C C   . ILE C 1 7   ? 17.430 -11.411 -3.449  1.00 34.74 ? 7   ILE C C   1 
ATOM   1510 O O   . ILE C 1 7   ? 17.697 -12.102 -4.433  1.00 36.07 ? 7   ILE C O   1 
ATOM   1511 C CB  . ILE C 1 7   ? 15.117 -12.322 -2.892  1.00 35.78 ? 7   ILE C CB  1 
ATOM   1512 C CG1 . ILE C 1 7   ? 13.649 -11.926 -2.660  1.00 35.48 ? 7   ILE C CG1 1 
ATOM   1513 C CG2 . ILE C 1 7   ? 15.676 -13.171 -1.739  1.00 32.77 ? 7   ILE C CG2 1 
ATOM   1514 C CD1 . ILE C 1 7   ? 12.717 -13.089 -2.443  1.00 38.08 ? 7   ILE C CD1 1 
ATOM   1515 N N   . ARG C 1 8   ? 18.355 -10.915 -2.638  1.00 34.06 ? 8   ARG C N   1 
ATOM   1516 C CA  . ARG C 1 8   ? 19.765 -10.959 -2.981  1.00 33.77 ? 8   ARG C CA  1 
ATOM   1517 C C   . ARG C 1 8   ? 20.598 -11.697 -1.940  1.00 34.22 ? 8   ARG C C   1 
ATOM   1518 O O   . ARG C 1 8   ? 20.451 -11.473 -0.737  1.00 35.27 ? 8   ARG C O   1 
ATOM   1519 C CB  . ARG C 1 8   ? 20.310 -9.537  -3.186  1.00 32.14 ? 8   ARG C CB  1 
ATOM   1520 C CG  . ARG C 1 8   ? 19.717 -8.785  -4.381  1.00 31.34 ? 8   ARG C CG  1 
ATOM   1521 C CD  . ARG C 1 8   ? 20.735 -7.810  -4.984  1.00 34.61 ? 8   ARG C CD  1 
ATOM   1522 N NE  . ARG C 1 8   ? 21.915 -8.544  -5.438  1.00 34.33 ? 8   ARG C NE  1 
ATOM   1523 C CZ  . ARG C 1 8   ? 23.146 -8.054  -5.497  1.00 35.61 ? 8   ARG C CZ  1 
ATOM   1524 N NH1 . ARG C 1 8   ? 23.397 -6.794  -5.140  1.00 34.92 ? 8   ARG C NH1 1 
ATOM   1525 N NH2 . ARG C 1 8   ? 24.130 -8.839  -5.909  1.00 32.69 ? 8   ARG C NH2 1 
ATOM   1526 N N   . ARG C 1 9   ? 21.462 -12.582 -2.423  1.00 32.81 ? 9   ARG C N   1 
ATOM   1527 C CA  . ARG C 1 9   ? 22.481 -13.227 -1.608  1.00 33.74 ? 9   ARG C CA  1 
ATOM   1528 C C   . ARG C 1 9   ? 23.685 -13.455 -2.489  1.00 32.92 ? 9   ARG C C   1 
ATOM   1529 O O   . ARG C 1 9   ? 23.545 -13.972 -3.600  1.00 33.00 ? 9   ARG C O   1 
ATOM   1530 C CB  . ARG C 1 9   ? 21.995 -14.574 -1.075  1.00 37.22 ? 9   ARG C CB  1 
ATOM   1531 C CG  . ARG C 1 9   ? 23.004 -15.264 -0.177  1.00 39.18 ? 9   ARG C CG  1 
ATOM   1532 C CD  . ARG C 1 9   ? 22.533 -16.623 0.253   1.00 43.13 ? 9   ARG C CD  1 
ATOM   1533 N NE  . ARG C 1 9   ? 23.059 -17.665 -0.619  1.00 50.02 ? 9   ARG C NE  1 
ATOM   1534 C CZ  . ARG C 1 9   ? 24.196 -18.323 -0.406  1.00 53.12 ? 9   ARG C CZ  1 
ATOM   1535 N NH1 . ARG C 1 9   ? 24.946 -18.060 0.655   1.00 54.37 ? 9   ARG C NH1 1 
ATOM   1536 N NH2 . ARG C 1 9   ? 24.584 -19.254 -1.264  1.00 56.93 ? 9   ARG C NH2 1 
ATOM   1537 N N   . HIS C 1 10  ? 24.860 -13.077 -1.995  1.00 31.95 ? 10  HIS C N   1 
ATOM   1538 C CA  . HIS C 1 10  ? 26.103 -13.237 -2.735  1.00 32.92 ? 10  HIS C CA  1 
ATOM   1539 C C   . HIS C 1 10  ? 25.940 -12.673 -4.152  1.00 32.27 ? 10  HIS C C   1 
ATOM   1540 O O   . HIS C 1 10  ? 25.686 -11.481 -4.303  1.00 31.84 ? 10  HIS C O   1 
ATOM   1541 C CB  . HIS C 1 10  ? 26.532 -14.714 -2.748  1.00 34.50 ? 10  HIS C CB  1 
ATOM   1542 C CG  . HIS C 1 10  ? 26.880 -15.257 -1.396  1.00 39.79 ? 10  HIS C CG  1 
ATOM   1543 N ND1 . HIS C 1 10  ? 28.008 -16.015 -1.169  1.00 43.93 ? 10  HIS C ND1 1 
ATOM   1544 C CD2 . HIS C 1 10  ? 26.259 -15.141 -0.198  1.00 44.24 ? 10  HIS C CD2 1 
ATOM   1545 C CE1 . HIS C 1 10  ? 28.062 -16.347 0.109   1.00 47.53 ? 10  HIS C CE1 1 
ATOM   1546 N NE2 . HIS C 1 10  ? 27.011 -15.830 0.721   1.00 44.54 ? 10  HIS C NE2 1 
ATOM   1547 N N   . LYS C 1 11  ? 26.062 -13.531 -5.169  1.00 30.94 ? 11  LYS C N   1 
ATOM   1548 C CA  . LYS C 1 11  ? 25.954 -13.134 -6.581  1.00 31.41 ? 11  LYS C CA  1 
ATOM   1549 C C   . LYS C 1 11  ? 24.625 -13.548 -7.223  1.00 31.94 ? 11  LYS C C   1 
ATOM   1550 O O   . LYS C 1 11  ? 24.484 -13.522 -8.453  1.00 30.33 ? 11  LYS C O   1 
ATOM   1551 C CB  . LYS C 1 11  ? 27.122 -13.708 -7.389  1.00 32.50 ? 11  LYS C CB  1 
ATOM   1552 C CG  . LYS C 1 11  ? 28.289 -12.754 -7.587  1.00 35.96 ? 11  LYS C CG  1 
ATOM   1553 C CD  . LYS C 1 11  ? 29.525 -13.498 -8.076  1.00 39.99 ? 11  LYS C CD  1 
ATOM   1554 C CE  . LYS C 1 11  ? 30.538 -12.572 -8.727  1.00 43.03 ? 11  LYS C CE  1 
ATOM   1555 N NZ  . LYS C 1 11  ? 30.799 -11.356 -7.909  1.00 47.92 ? 11  LYS C NZ  1 
ATOM   1556 N N   . THR C 1 12  ? 23.656 -13.916 -6.382  1.00 33.11 ? 12  THR C N   1 
ATOM   1557 C CA  . THR C 1 12  ? 22.331 -14.354 -6.827  1.00 33.37 ? 12  THR C CA  1 
ATOM   1558 C C   . THR C 1 12  ? 21.271 -13.289 -6.553  1.00 34.79 ? 12  THR C C   1 
ATOM   1559 O O   . THR C 1 12  ? 21.133 -12.810 -5.425  1.00 37.42 ? 12  THR C O   1 
ATOM   1560 C CB  . THR C 1 12  ? 21.923 -15.675 -6.139  1.00 33.76 ? 12  THR C CB  1 
ATOM   1561 O OG1 . THR C 1 12  ? 22.961 -16.652 -6.316  1.00 35.01 ? 12  THR C OG1 1 
ATOM   1562 C CG2 . THR C 1 12  ? 20.614 -16.214 -6.706  1.00 32.29 ? 12  THR C CG2 1 
ATOM   1563 N N   . THR C 1 13  ? 20.535 -12.913 -7.592  1.00 34.12 ? 13  THR C N   1 
ATOM   1564 C CA  . THR C 1 13  ? 19.426 -11.985 -7.445  1.00 34.22 ? 13  THR C CA  1 
ATOM   1565 C C   . THR C 1 13  ? 18.148 -12.624 -7.972  1.00 35.02 ? 13  THR C C   1 
ATOM   1566 O O   . THR C 1 13  ? 18.061 -12.979 -9.156  1.00 35.43 ? 13  THR C O   1 
ATOM   1567 C CB  . THR C 1 13  ? 19.683 -10.657 -8.187  1.00 34.74 ? 13  THR C CB  1 
ATOM   1568 O OG1 . THR C 1 13  ? 20.866 -10.042 -7.672  1.00 36.11 ? 13  THR C OG1 1 
ATOM   1569 C CG2 . THR C 1 13  ? 18.506 -9.694  -8.009  1.00 34.79 ? 13  THR C CG2 1 
ATOM   1570 N N   . ILE C 1 14  ? 17.170 -12.786 -7.085  1.00 33.49 ? 14  ILE C N   1 
ATOM   1571 C CA  . ILE C 1 14  ? 15.851 -13.258 -7.480  1.00 34.24 ? 14  ILE C CA  1 
ATOM   1572 C C   . ILE C 1 14  ? 14.938 -12.055 -7.635  1.00 35.23 ? 14  ILE C C   1 
ATOM   1573 O O   . ILE C 1 14  ? 14.668 -11.347 -6.665  1.00 34.31 ? 14  ILE C O   1 
ATOM   1574 C CB  . ILE C 1 14  ? 15.233 -14.242 -6.448  1.00 35.33 ? 14  ILE C CB  1 
ATOM   1575 C CG1 . ILE C 1 14  ? 16.136 -15.458 -6.236  1.00 33.15 ? 14  ILE C CG1 1 
ATOM   1576 C CG2 . ILE C 1 14  ? 13.841 -14.698 -6.905  1.00 34.54 ? 14  ILE C CG2 1 
ATOM   1577 C CD1 . ILE C 1 14  ? 15.832 -16.240 -4.980  1.00 32.23 ? 14  ILE C CD1 1 
ATOM   1578 N N   . PHE C 1 15  ? 14.489 -11.817 -8.867  1.00 36.99 ? 15  PHE C N   1 
ATOM   1579 C CA  . PHE C 1 15  ? 13.459 -10.826 -9.143  1.00 36.64 ? 15  PHE C CA  1 
ATOM   1580 C C   . PHE C 1 15  ? 12.118 -11.490 -8.941  1.00 38.13 ? 15  PHE C C   1 
ATOM   1581 O O   . PHE C 1 15  ? 11.739 -12.388 -9.702  1.00 40.76 ? 15  PHE C O   1 
ATOM   1582 C CB  . PHE C 1 15  ? 13.565 -10.303 -10.581 1.00 37.86 ? 15  PHE C CB  1 
ATOM   1583 C CG  . PHE C 1 15  ? 14.672 -9.318  -10.784 1.00 37.33 ? 15  PHE C CG  1 
ATOM   1584 C CD1 . PHE C 1 15  ? 15.951 -9.750  -11.128 1.00 37.07 ? 15  PHE C CD1 1 
ATOM   1585 C CD2 . PHE C 1 15  ? 14.442 -7.955  -10.626 1.00 36.02 ? 15  PHE C CD2 1 
ATOM   1586 C CE1 . PHE C 1 15  ? 16.984 -8.838  -11.307 1.00 36.42 ? 15  PHE C CE1 1 
ATOM   1587 C CE2 . PHE C 1 15  ? 15.469 -7.037  -10.812 1.00 35.47 ? 15  PHE C CE2 1 
ATOM   1588 C CZ  . PHE C 1 15  ? 16.739 -7.477  -11.149 1.00 34.09 ? 15  PHE C CZ  1 
ATOM   1589 N N   . THR C 1 16  ? 11.416 -11.072 -7.895  1.00 38.04 ? 16  THR C N   1 
ATOM   1590 C CA  . THR C 1 16  ? 10.089 -11.604 -7.592  1.00 37.46 ? 16  THR C CA  1 
ATOM   1591 C C   . THR C 1 16  ? 9.168  -10.488 -7.104  1.00 37.70 ? 16  THR C C   1 
ATOM   1592 O O   . THR C 1 16  ? 9.591  -9.331  -6.941  1.00 35.95 ? 16  THR C O   1 
ATOM   1593 C CB  . THR C 1 16  ? 10.139 -12.769 -6.566  1.00 38.85 ? 16  THR C CB  1 
ATOM   1594 O OG1 . THR C 1 16  ? 8.931  -13.544 -6.653  1.00 42.29 ? 16  THR C OG1 1 
ATOM   1595 C CG2 . THR C 1 16  ? 10.312 -12.253 -5.132  1.00 36.51 ? 16  THR C CG2 1 
ATOM   1596 N N   . ASP C 1 17  ? 7.904  -10.831 -6.898  1.00 36.81 ? 17  ASP C N   1 
ATOM   1597 C CA  . ASP C 1 17  ? 6.922  -9.851  -6.480  1.00 38.56 ? 17  ASP C CA  1 
ATOM   1598 C C   . ASP C 1 17  ? 5.963  -10.454 -5.466  1.00 38.32 ? 17  ASP C C   1 
ATOM   1599 O O   . ASP C 1 17  ? 5.752  -11.663 -5.434  1.00 39.21 ? 17  ASP C O   1 
ATOM   1600 C CB  . ASP C 1 17  ? 6.173  -9.278  -7.697  1.00 38.77 ? 17  ASP C CB  1 
ATOM   1601 C CG  . ASP C 1 17  ? 5.701  -10.352 -8.650  1.00 45.24 ? 17  ASP C CG  1 
ATOM   1602 O OD1 . ASP C 1 17  ? 6.328  -10.509 -9.722  1.00 50.76 ? 17  ASP C OD1 1 
ATOM   1603 O OD2 . ASP C 1 17  ? 4.713  -11.055 -8.330  1.00 47.01 ? 17  ASP C OD2 1 
ATOM   1604 N N   . ALA C 1 18  ? 5.401  -9.603  -4.622  1.00 37.10 ? 18  ALA C N   1 
ATOM   1605 C CA  . ALA C 1 18  ? 4.417  -10.032 -3.649  1.00 35.65 ? 18  ALA C CA  1 
ATOM   1606 C C   . ALA C 1 18  ? 3.495  -8.853  -3.375  1.00 35.15 ? 18  ALA C C   1 
ATOM   1607 O O   . ALA C 1 18  ? 3.382  -7.951  -4.199  1.00 36.77 ? 18  ALA C O   1 
ATOM   1608 C CB  . ALA C 1 18  ? 5.104  -10.518 -2.377  1.00 34.45 ? 18  ALA C CB  1 
ATOM   1609 N N   . LYS C 1 19  ? 2.831  -8.856  -2.229  1.00 36.00 ? 19  LYS C N   1 
ATOM   1610 C CA  . LYS C 1 19  ? 1.982  -7.734  -1.858  1.00 34.49 ? 19  LYS C CA  1 
ATOM   1611 C C   . LYS C 1 19  ? 2.420  -7.140  -0.526  1.00 32.82 ? 19  LYS C C   1 
ATOM   1612 O O   . LYS C 1 19  ? 3.159  -7.773  0.223   1.00 33.49 ? 19  LYS C O   1 
ATOM   1613 C CB  . LYS C 1 19  ? 0.516  -8.172  -1.833  1.00 37.03 ? 19  LYS C CB  1 
ATOM   1614 C CG  . LYS C 1 19  ? 0.019  -8.694  -3.189  1.00 40.02 ? 19  LYS C CG  1 
ATOM   1615 C CD  . LYS C 1 19  ? -1.454 -8.384  -3.423  1.00 46.71 ? 19  LYS C CD  1 
ATOM   1616 C CE  . LYS C 1 19  ? -1.692 -6.895  -3.652  1.00 49.61 ? 19  LYS C CE  1 
ATOM   1617 N NZ  . LYS C 1 19  ? -3.132 -6.551  -3.487  1.00 56.18 ? 19  LYS C NZ  1 
ATOM   1618 N N   . GLU C 1 20  ? 1.991  -5.911  -0.247  1.00 32.45 ? 20  GLU C N   1 
ATOM   1619 C CA  . GLU C 1 20  ? 2.234  -5.278  1.050   1.00 32.63 ? 20  GLU C CA  1 
ATOM   1620 C C   . GLU C 1 20  ? 1.696  -6.139  2.201   1.00 32.09 ? 20  GLU C C   1 
ATOM   1621 O O   . GLU C 1 20  ? 2.281  -6.183  3.287   1.00 32.50 ? 20  GLU C O   1 
ATOM   1622 C CB  . GLU C 1 20  ? 1.590  -3.892  1.086   1.00 34.36 ? 20  GLU C CB  1 
ATOM   1623 C CG  . GLU C 1 20  ? 2.398  -2.790  0.378   1.00 37.14 ? 20  GLU C CG  1 
ATOM   1624 C CD  . GLU C 1 20  ? 1.580  -1.544  0.093   1.00 39.84 ? 20  GLU C CD  1 
ATOM   1625 O OE1 . GLU C 1 20  ? 0.338  -1.645  -0.007  1.00 49.25 ? 20  GLU C OE1 1 
ATOM   1626 O OE2 . GLU C 1 20  ? 2.169  -0.457  -0.053  1.00 40.37 ? 20  GLU C OE2 1 
ATOM   1627 N N   . SER C 1 21  ? 0.594  -6.837  1.942   1.00 28.79 ? 21  SER C N   1 
ATOM   1628 C CA  . SER C 1 21  ? -0.022 -7.730  2.922   1.00 30.84 ? 21  SER C CA  1 
ATOM   1629 C C   . SER C 1 21  ? 0.557  -9.156  2.942   1.00 31.97 ? 21  SER C C   1 
ATOM   1630 O O   . SER C 1 21  ? 0.167  -9.947  3.797   1.00 32.55 ? 21  SER C O   1 
ATOM   1631 C CB  . SER C 1 21  ? -1.535 -7.773  2.724   1.00 28.32 ? 21  SER C CB  1 
ATOM   1632 O OG  . SER C 1 21  ? -1.834 -7.902  1.350   1.00 30.86 ? 21  SER C OG  1 
ATOM   1633 N N   . SER C 1 22  ? 1.476  -9.483  2.025   1.00 30.48 ? 22  SER C N   1 
ATOM   1634 C CA  . SER C 1 22  ? 2.233  -10.739 2.125   1.00 31.50 ? 22  SER C CA  1 
ATOM   1635 C C   . SER C 1 22  ? 3.101  -10.743 3.383   1.00 33.04 ? 22  SER C C   1 
ATOM   1636 O O   . SER C 1 22  ? 3.658  -9.715  3.753   1.00 34.12 ? 22  SER C O   1 
ATOM   1637 C CB  . SER C 1 22  ? 3.140  -10.956 0.913   1.00 30.27 ? 22  SER C CB  1 
ATOM   1638 O OG  . SER C 1 22  ? 2.403  -11.057 -0.280  1.00 32.08 ? 22  SER C OG  1 
ATOM   1639 N N   . THR C 1 23  ? 3.204  -11.899 4.033   1.00 33.52 ? 23  THR C N   1 
ATOM   1640 C CA  . THR C 1 23  ? 4.082  -12.063 5.182   1.00 34.57 ? 23  THR C CA  1 
ATOM   1641 C C   . THR C 1 23  ? 5.518  -12.311 4.719   1.00 35.71 ? 23  THR C C   1 
ATOM   1642 O O   . THR C 1 23  ? 5.756  -12.658 3.559   1.00 37.36 ? 23  THR C O   1 
ATOM   1643 C CB  . THR C 1 23  ? 3.633  -13.242 6.085   1.00 36.12 ? 23  THR C CB  1 
ATOM   1644 O OG1 . THR C 1 23  ? 3.655  -14.463 5.331   1.00 36.05 ? 23  THR C OG1 1 
ATOM   1645 C CG2 . THR C 1 23  ? 2.222  -13.007 6.661   1.00 33.33 ? 23  THR C CG2 1 
ATOM   1646 N N   . VAL C 1 24  ? 6.472  -12.137 5.626   1.00 35.01 ? 24  VAL C N   1 
ATOM   1647 C CA  . VAL C 1 24  ? 7.869  -12.489 5.367   1.00 35.67 ? 24  VAL C CA  1 
ATOM   1648 C C   . VAL C 1 24  ? 8.030  -13.986 5.059   1.00 36.87 ? 24  VAL C C   1 
ATOM   1649 O O   . VAL C 1 24  ? 8.822  -14.374 4.188   1.00 37.81 ? 24  VAL C O   1 
ATOM   1650 C CB  . VAL C 1 24  ? 8.765  -12.092 6.555   1.00 35.38 ? 24  VAL C CB  1 
ATOM   1651 C CG1 . VAL C 1 24  ? 10.131 -12.794 6.491   1.00 35.30 ? 24  VAL C CG1 1 
ATOM   1652 C CG2 . VAL C 1 24  ? 8.926  -10.597 6.597   1.00 31.91 ? 24  VAL C CG2 1 
ATOM   1653 N N   . PHE C 1 25  ? 7.262  -14.813 5.764   1.00 36.17 ? 25  PHE C N   1 
ATOM   1654 C CA  . PHE C 1 25  ? 7.266  -16.253 5.549   1.00 38.15 ? 25  PHE C CA  1 
ATOM   1655 C C   . PHE C 1 25  ? 6.914  -16.626 4.104   1.00 40.05 ? 25  PHE C C   1 
ATOM   1656 O O   . PHE C 1 25  ? 7.454  -17.592 3.561   1.00 39.55 ? 25  PHE C O   1 
ATOM   1657 C CB  . PHE C 1 25  ? 6.306  -16.944 6.526   1.00 37.10 ? 25  PHE C CB  1 
ATOM   1658 C CG  . PHE C 1 25  ? 6.430  -18.443 6.537   1.00 36.06 ? 25  PHE C CG  1 
ATOM   1659 C CD1 . PHE C 1 25  ? 7.395  -19.067 7.321   1.00 35.15 ? 25  PHE C CD1 1 
ATOM   1660 C CD2 . PHE C 1 25  ? 5.590  -19.230 5.757   1.00 36.08 ? 25  PHE C CD2 1 
ATOM   1661 C CE1 . PHE C 1 25  ? 7.519  -20.446 7.325   1.00 36.28 ? 25  PHE C CE1 1 
ATOM   1662 C CE2 . PHE C 1 25  ? 5.708  -20.613 5.760   1.00 34.73 ? 25  PHE C CE2 1 
ATOM   1663 C CZ  . PHE C 1 25  ? 6.673  -21.221 6.542   1.00 34.67 ? 25  PHE C CZ  1 
ATOM   1664 N N   . GLU C 1 26  ? 6.010  -15.864 3.490   1.00 42.67 ? 26  GLU C N   1 
ATOM   1665 C CA  . GLU C 1 26  ? 5.653  -16.079 2.084   1.00 45.07 ? 26  GLU C CA  1 
ATOM   1666 C C   . GLU C 1 26  ? 6.854  -15.931 1.145   1.00 44.74 ? 26  GLU C C   1 
ATOM   1667 O O   . GLU C 1 26  ? 7.033  -16.748 0.242   1.00 48.13 ? 26  GLU C O   1 
ATOM   1668 C CB  . GLU C 1 26  ? 4.495  -15.168 1.654   1.00 46.99 ? 26  GLU C CB  1 
ATOM   1669 C CG  . GLU C 1 26  ? 3.126  -15.659 2.152   1.00 52.81 ? 26  GLU C CG  1 
ATOM   1670 C CD  . GLU C 1 26  ? 1.976  -14.715 1.817   1.00 57.30 ? 26  GLU C CD  1 
ATOM   1671 O OE1 . GLU C 1 26  ? 1.918  -14.186 0.681   1.00 60.13 ? 26  GLU C OE1 1 
ATOM   1672 O OE2 . GLU C 1 26  ? 1.115  -14.518 2.697   1.00 60.43 ? 26  GLU C OE2 1 
ATOM   1673 N N   . LEU C 1 27  ? 7.675  -14.904 1.374   1.00 42.60 ? 27  LEU C N   1 
ATOM   1674 C CA  . LEU C 1 27  ? 8.916  -14.711 0.622   1.00 41.56 ? 27  LEU C CA  1 
ATOM   1675 C C   . LEU C 1 27  ? 9.902  -15.855 0.790   1.00 40.00 ? 27  LEU C C   1 
ATOM   1676 O O   . LEU C 1 27  ? 10.650 -16.167 -0.142  1.00 42.96 ? 27  LEU C O   1 
ATOM   1677 C CB  . LEU C 1 27  ? 9.613  -13.411 1.023   1.00 43.13 ? 27  LEU C CB  1 
ATOM   1678 C CG  . LEU C 1 27  ? 9.002  -12.061 0.662   1.00 47.64 ? 27  LEU C CG  1 
ATOM   1679 C CD1 . LEU C 1 27  ? 10.033 -10.979 0.951   1.00 48.40 ? 27  LEU C CD1 1 
ATOM   1680 C CD2 . LEU C 1 27  ? 8.553  -12.024 -0.800  1.00 47.24 ? 27  LEU C CD2 1 
ATOM   1681 N N   . LYS C 1 28  ? 9.922  -16.451 1.982   1.00 36.57 ? 28  LYS C N   1 
ATOM   1682 C CA  . LYS C 1 28  ? 10.757 -17.619 2.256   1.00 35.25 ? 28  LYS C CA  1 
ATOM   1683 C C   . LYS C 1 28  ? 10.291 -18.825 1.462   1.00 35.38 ? 28  LYS C C   1 
ATOM   1684 O O   . LYS C 1 28  ? 11.112 -19.641 1.034   1.00 35.54 ? 28  LYS C O   1 
ATOM   1685 C CB  . LYS C 1 28  ? 10.772 -17.961 3.745   1.00 34.51 ? 28  LYS C CB  1 
ATOM   1686 C CG  . LYS C 1 28  ? 11.594 -17.024 4.582   1.00 33.91 ? 28  LYS C CG  1 
ATOM   1687 C CD  . LYS C 1 28  ? 11.730 -17.517 6.000   1.00 37.06 ? 28  LYS C CD  1 
ATOM   1688 C CE  . LYS C 1 28  ? 12.664 -16.619 6.796   1.00 39.09 ? 28  LYS C CE  1 
ATOM   1689 N NZ  . LYS C 1 28  ? 12.696 -17.005 8.235   1.00 38.78 ? 28  LYS C NZ  1 
ATOM   1690 N N   . ARG C 1 29  ? 8.976  -18.935 1.270   1.00 35.38 ? 29  ARG C N   1 
ATOM   1691 C CA  . ARG C 1 29  ? 8.406  -20.016 0.472   1.00 35.01 ? 29  ARG C CA  1 
ATOM   1692 C C   . ARG C 1 29  ? 8.729  -19.847 -1.005  1.00 35.64 ? 29  ARG C C   1 
ATOM   1693 O O   . ARG C 1 29  ? 8.925  -20.837 -1.716  1.00 34.22 ? 29  ARG C O   1 
ATOM   1694 C CB  . ARG C 1 29  ? 6.896  -20.137 0.696   1.00 35.66 ? 29  ARG C CB  1 
ATOM   1695 C CG  . ARG C 1 29  ? 6.507  -20.826 2.003   1.00 37.20 ? 29  ARG C CG  1 
ATOM   1696 C CD  . ARG C 1 29  ? 6.861  -22.319 1.997   1.00 40.26 ? 29  ARG C CD  1 
ATOM   1697 N NE  . ARG C 1 29  ? 6.344  -23.030 3.168   1.00 41.29 ? 29  ARG C NE  1 
ATOM   1698 C CZ  . ARG C 1 29  ? 6.654  -24.287 3.487   1.00 44.23 ? 29  ARG C CZ  1 
ATOM   1699 N NH1 . ARG C 1 29  ? 7.487  -24.987 2.732   1.00 47.16 ? 29  ARG C NH1 1 
ATOM   1700 N NH2 . ARG C 1 29  ? 6.130  -24.851 4.565   1.00 43.70 ? 29  ARG C NH2 1 
ATOM   1701 N N   . ILE C 1 30  ? 8.792  -18.591 -1.455  1.00 37.59 ? 30  ILE C N   1 
ATOM   1702 C CA  . ILE C 1 30  ? 9.233  -18.260 -2.818  1.00 38.91 ? 30  ILE C CA  1 
ATOM   1703 C C   . ILE C 1 30  ? 10.695 -18.671 -3.034  1.00 39.44 ? 30  ILE C C   1 
ATOM   1704 O O   . ILE C 1 30  ? 11.022 -19.314 -4.033  1.00 41.04 ? 30  ILE C O   1 
ATOM   1705 C CB  . ILE C 1 30  ? 9.023  -16.759 -3.154  1.00 38.91 ? 30  ILE C CB  1 
ATOM   1706 C CG1 . ILE C 1 30  ? 7.530  -16.471 -3.351  1.00 41.33 ? 30  ILE C CG1 1 
ATOM   1707 C CG2 . ILE C 1 30  ? 9.805  -16.365 -4.404  1.00 35.23 ? 30  ILE C CG2 1 
ATOM   1708 C CD1 . ILE C 1 30  ? 7.165  -14.978 -3.405  1.00 43.03 ? 30  ILE C CD1 1 
ATOM   1709 N N   . VAL C 1 31  ? 11.560 -18.317 -2.089  1.00 38.13 ? 31  VAL C N   1 
ATOM   1710 C CA  . VAL C 1 31  ? 12.960 -18.730 -2.139  1.00 38.68 ? 31  VAL C CA  1 
ATOM   1711 C C   . VAL C 1 31  ? 13.089 -20.254 -2.174  1.00 38.51 ? 31  VAL C C   1 
ATOM   1712 O O   . VAL C 1 31  ? 13.879 -20.789 -2.950  1.00 41.07 ? 31  VAL C O   1 
ATOM   1713 C CB  . VAL C 1 31  ? 13.775 -18.157 -0.955  1.00 38.13 ? 31  VAL C CB  1 
ATOM   1714 C CG1 . VAL C 1 31  ? 15.134 -18.824 -0.855  1.00 38.88 ? 31  VAL C CG1 1 
ATOM   1715 C CG2 . VAL C 1 31  ? 13.937 -16.647 -1.100  1.00 40.41 ? 31  VAL C CG2 1 
ATOM   1716 N N   . GLU C 1 32  ? 12.308 -20.945 -1.346  1.00 37.85 ? 32  GLU C N   1 
ATOM   1717 C CA  . GLU C 1 32  ? 12.348 -22.403 -1.292  1.00 37.67 ? 32  GLU C CA  1 
ATOM   1718 C C   . GLU C 1 32  ? 12.005 -23.052 -2.630  1.00 38.06 ? 32  GLU C C   1 
ATOM   1719 O O   . GLU C 1 32  ? 12.604 -24.058 -2.996  1.00 39.45 ? 32  GLU C O   1 
ATOM   1720 C CB  . GLU C 1 32  ? 11.419 -22.948 -0.202  1.00 38.41 ? 32  GLU C CB  1 
ATOM   1721 C CG  . GLU C 1 32  ? 11.529 -24.459 -0.017  1.00 35.57 ? 32  GLU C CG  1 
ATOM   1722 C CD  . GLU C 1 32  ? 10.524 -25.025 0.968   1.00 37.50 ? 32  GLU C CD  1 
ATOM   1723 O OE1 . GLU C 1 32  ? 9.604  -24.292 1.387   1.00 36.32 ? 32  GLU C OE1 1 
ATOM   1724 O OE2 . GLU C 1 32  ? 10.657 -26.219 1.321   1.00 37.54 ? 32  GLU C OE2 1 
ATOM   1725 N N   . GLY C 1 33  ? 11.039 -22.480 -3.347  1.00 37.51 ? 33  GLY C N   1 
ATOM   1726 C CA  . GLY C 1 33  ? 10.632 -22.994 -4.655  1.00 37.48 ? 33  GLY C CA  1 
ATOM   1727 C C   . GLY C 1 33  ? 11.734 -22.891 -5.695  1.00 37.68 ? 33  GLY C C   1 
ATOM   1728 O O   . GLY C 1 33  ? 11.800 -23.689 -6.631  1.00 36.50 ? 33  GLY C O   1 
ATOM   1729 N N   . ILE C 1 34  ? 12.612 -21.912 -5.507  1.00 37.68 ? 34  ILE C N   1 
ATOM   1730 C CA  . ILE C 1 34  ? 13.677 -21.611 -6.459  1.00 36.94 ? 34  ILE C CA  1 
ATOM   1731 C C   . ILE C 1 34  ? 15.029 -22.189 -6.024  1.00 37.07 ? 34  ILE C C   1 
ATOM   1732 O O   . ILE C 1 34  ? 15.735 -22.784 -6.835  1.00 35.08 ? 34  ILE C O   1 
ATOM   1733 C CB  . ILE C 1 34  ? 13.789 -20.088 -6.681  1.00 35.79 ? 34  ILE C CB  1 
ATOM   1734 C CG1 . ILE C 1 34  ? 12.423 -19.526 -7.105  1.00 36.83 ? 34  ILE C CG1 1 
ATOM   1735 C CG2 . ILE C 1 34  ? 14.887 -19.760 -7.702  1.00 32.96 ? 34  ILE C CG2 1 
ATOM   1736 C CD1 . ILE C 1 34  ? 12.287 -18.019 -6.968  1.00 38.48 ? 34  ILE C CD1 1 
ATOM   1737 N N   . LEU C 1 35  ? 15.377 -22.016 -4.748  1.00 37.84 ? 35  LEU C N   1 
ATOM   1738 C CA  . LEU C 1 35  ? 16.692 -22.413 -4.233  1.00 38.47 ? 35  LEU C CA  1 
ATOM   1739 C C   . LEU C 1 35  ? 16.687 -23.731 -3.452  1.00 40.14 ? 35  LEU C C   1 
ATOM   1740 O O   . LEU C 1 35  ? 17.748 -24.253 -3.093  1.00 40.07 ? 35  LEU C O   1 
ATOM   1741 C CB  . LEU C 1 35  ? 17.304 -21.279 -3.400  1.00 38.36 ? 35  LEU C CB  1 
ATOM   1742 C CG  . LEU C 1 35  ? 17.531 -19.969 -4.159  1.00 38.40 ? 35  LEU C CG  1 
ATOM   1743 C CD1 . LEU C 1 35  ? 18.141 -18.888 -3.268  1.00 38.29 ? 35  LEU C CD1 1 
ATOM   1744 C CD2 . LEU C 1 35  ? 18.399 -20.200 -5.394  1.00 40.84 ? 35  LEU C CD2 1 
ATOM   1745 N N   . LYS C 1 36  ? 15.488 -24.261 -3.205  1.00 40.99 ? 36  LYS C N   1 
ATOM   1746 C CA  . LYS C 1 36  ? 15.286 -25.556 -2.543  1.00 41.47 ? 36  LYS C CA  1 
ATOM   1747 C C   . LYS C 1 36  ? 15.776 -25.621 -1.095  1.00 41.27 ? 36  LYS C C   1 
ATOM   1748 O O   . LYS C 1 36  ? 16.130 -26.686 -0.594  1.00 41.53 ? 36  LYS C O   1 
ATOM   1749 C CB  . LYS C 1 36  ? 15.861 -26.711 -3.380  1.00 42.43 ? 36  LYS C CB  1 
ATOM   1750 C CG  . LYS C 1 36  ? 15.186 -26.909 -4.731  1.00 44.26 ? 36  LYS C CG  1 
ATOM   1751 C CD  . LYS C 1 36  ? 13.690 -27.191 -4.600  1.00 44.80 ? 36  LYS C CD  1 
ATOM   1752 C CE  . LYS C 1 36  ? 13.045 -27.373 -5.970  1.00 47.79 ? 36  LYS C CE  1 
ATOM   1753 N NZ  . LYS C 1 36  ? 13.297 -26.215 -6.888  1.00 46.64 ? 36  LYS C NZ  1 
ATOM   1754 N N   . ARG C 1 37  ? 15.778 -24.475 -0.427  1.00 42.07 ? 37  ARG C N   1 
ATOM   1755 C CA  . ARG C 1 37  ? 16.118 -24.413 0.987   1.00 42.36 ? 37  ARG C CA  1 
ATOM   1756 C C   . ARG C 1 37  ? 14.860 -24.055 1.765   1.00 40.66 ? 37  ARG C C   1 
ATOM   1757 O O   . ARG C 1 37  ? 14.191 -23.079 1.427   1.00 43.81 ? 37  ARG C O   1 
ATOM   1758 C CB  . ARG C 1 37  ? 17.230 -23.388 1.241   1.00 43.78 ? 37  ARG C CB  1 
ATOM   1759 C CG  . ARG C 1 37  ? 18.556 -23.679 0.529   1.00 47.55 ? 37  ARG C CG  1 
ATOM   1760 C CD  . ARG C 1 37  ? 19.254 -24.919 1.087   1.00 53.31 ? 37  ARG C CD  1 
ATOM   1761 N NE  . ARG C 1 37  ? 19.540 -24.786 2.517   1.00 56.53 ? 37  ARG C NE  1 
ATOM   1762 C CZ  . ARG C 1 37  ? 20.720 -24.443 3.028   1.00 57.38 ? 37  ARG C CZ  1 
ATOM   1763 N NH1 . ARG C 1 37  ? 21.761 -24.200 2.236   1.00 57.07 ? 37  ARG C NH1 1 
ATOM   1764 N NH2 . ARG C 1 37  ? 20.861 -24.350 4.344   1.00 57.61 ? 37  ARG C NH2 1 
ATOM   1765 N N   . PRO C 1 38  ? 14.526 -24.843 2.804   1.00 38.68 ? 38  PRO C N   1 
ATOM   1766 C CA  . PRO C 1 38  ? 13.290 -24.607 3.545   1.00 37.46 ? 38  PRO C CA  1 
ATOM   1767 C C   . PRO C 1 38  ? 13.351 -23.302 4.337   1.00 36.75 ? 38  PRO C C   1 
ATOM   1768 O O   . PRO C 1 38  ? 14.448 -22.858 4.693   1.00 35.49 ? 38  PRO C O   1 
ATOM   1769 C CB  . PRO C 1 38  ? 13.209 -25.814 4.484   1.00 36.49 ? 38  PRO C CB  1 
ATOM   1770 C CG  . PRO C 1 38  ? 14.605 -26.251 4.656   1.00 35.99 ? 38  PRO C CG  1 
ATOM   1771 C CD  . PRO C 1 38  ? 15.279 -25.989 3.349   1.00 38.52 ? 38  PRO C CD  1 
ATOM   1772 N N   . PRO C 1 39  ? 12.180 -22.685 4.605   1.00 37.32 ? 39  PRO C N   1 
ATOM   1773 C CA  . PRO C 1 39  ? 12.107 -21.392 5.283   1.00 36.33 ? 39  PRO C CA  1 
ATOM   1774 C C   . PRO C 1 39  ? 12.907 -21.329 6.588   1.00 37.22 ? 39  PRO C C   1 
ATOM   1775 O O   . PRO C 1 39  ? 13.457 -20.280 6.917   1.00 38.99 ? 39  PRO C O   1 
ATOM   1776 C CB  . PRO C 1 39  ? 10.612 -21.242 5.561   1.00 35.70 ? 39  PRO C CB  1 
ATOM   1777 C CG  . PRO C 1 39  ? 9.973  -21.959 4.438   1.00 33.75 ? 39  PRO C CG  1 
ATOM   1778 C CD  . PRO C 1 39  ? 10.830 -23.181 4.271   1.00 36.97 ? 39  PRO C CD  1 
ATOM   1779 N N   . ASP C 1 40  ? 12.997 -22.444 7.304   1.00 37.31 ? 40  ASP C N   1 
ATOM   1780 C CA  . ASP C 1 40  ? 13.707 -22.477 8.583   1.00 38.59 ? 40  ASP C CA  1 
ATOM   1781 C C   . ASP C 1 40  ? 15.231 -22.564 8.440   1.00 37.90 ? 40  ASP C C   1 
ATOM   1782 O O   . ASP C 1 40  ? 15.951 -22.611 9.439   1.00 39.26 ? 40  ASP C O   1 
ATOM   1783 C CB  . ASP C 1 40  ? 13.166 -23.603 9.482   1.00 39.85 ? 40  ASP C CB  1 
ATOM   1784 C CG  . ASP C 1 40  ? 13.208 -24.976 8.813   1.00 43.15 ? 40  ASP C CG  1 
ATOM   1785 O OD1 . ASP C 1 40  ? 12.729 -25.116 7.663   1.00 43.23 ? 40  ASP C OD1 1 
ATOM   1786 O OD2 . ASP C 1 40  ? 13.699 -25.929 9.458   1.00 46.38 ? 40  ASP C OD2 1 
ATOM   1787 N N   . GLU C 1 41  ? 15.715 -22.586 7.201   1.00 36.76 ? 41  GLU C N   1 
ATOM   1788 C CA  . GLU C 1 41  ? 17.146 -22.490 6.922   1.00 35.04 ? 41  GLU C CA  1 
ATOM   1789 C C   . GLU C 1 41  ? 17.472 -21.146 6.262   1.00 34.33 ? 41  GLU C C   1 
ATOM   1790 O O   . GLU C 1 41  ? 18.544 -20.971 5.662   1.00 33.22 ? 41  GLU C O   1 
ATOM   1791 C CB  . GLU C 1 41  ? 17.609 -23.667 6.058   1.00 36.27 ? 41  GLU C CB  1 
ATOM   1792 C CG  . GLU C 1 41  ? 17.359 -25.022 6.721   1.00 39.63 ? 41  GLU C CG  1 
ATOM   1793 C CD  . GLU C 1 41  ? 18.189 -26.148 6.141   1.00 41.09 ? 41  GLU C CD  1 
ATOM   1794 O OE1 . GLU C 1 41  ? 18.458 -26.148 4.920   1.00 42.89 ? 41  GLU C OE1 1 
ATOM   1795 O OE2 . GLU C 1 41  ? 18.569 -27.045 6.920   1.00 43.31 ? 41  GLU C OE2 1 
ATOM   1796 N N   . GLN C 1 42  ? 16.540 -20.200 6.401   1.00 32.48 ? 42  GLN C N   1 
ATOM   1797 C CA  . GLN C 1 42  ? 16.649 -18.878 5.797   1.00 32.75 ? 42  GLN C CA  1 
ATOM   1798 C C   . GLN C 1 42  ? 16.516 -17.759 6.819   1.00 33.25 ? 42  GLN C C   1 
ATOM   1799 O O   . GLN C 1 42  ? 15.725 -17.852 7.761   1.00 32.86 ? 42  GLN C O   1 
ATOM   1800 C CB  . GLN C 1 42  ? 15.563 -18.680 4.741   1.00 31.89 ? 42  GLN C CB  1 
ATOM   1801 C CG  . GLN C 1 42  ? 15.738 -19.494 3.481   1.00 32.66 ? 42  GLN C CG  1 
ATOM   1802 C CD  . GLN C 1 42  ? 14.535 -19.390 2.569   1.00 34.61 ? 42  GLN C CD  1 
ATOM   1803 O OE1 . GLN C 1 42  ? 14.043 -18.299 2.305   1.00 33.88 ? 42  GLN C OE1 1 
ATOM   1804 N NE2 . GLN C 1 42  ? 14.047 -20.533 2.088   1.00 36.37 ? 42  GLN C NE2 1 
ATOM   1805 N N   . ARG C 1 43  ? 17.299 -16.704 6.609   1.00 33.36 ? 43  ARG C N   1 
ATOM   1806 C CA  . ARG C 1 43  ? 17.119 -15.421 7.292   1.00 33.23 ? 43  ARG C CA  1 
ATOM   1807 C C   . ARG C 1 43  ? 16.918 -14.335 6.236   1.00 33.70 ? 43  ARG C C   1 
ATOM   1808 O O   . ARG C 1 43  ? 17.742 -14.175 5.329   1.00 33.49 ? 43  ARG C O   1 
ATOM   1809 C CB  . ARG C 1 43  ? 18.335 -15.079 8.166   1.00 31.89 ? 43  ARG C CB  1 
ATOM   1810 C CG  . ARG C 1 43  ? 18.372 -15.777 9.516   1.00 28.59 ? 43  ARG C CG  1 
ATOM   1811 C CD  . ARG C 1 43  ? 19.554 -15.300 10.350  1.00 28.72 ? 43  ARG C CD  1 
ATOM   1812 N NE  . ARG C 1 43  ? 19.445 -15.726 11.748  1.00 32.64 ? 43  ARG C NE  1 
ATOM   1813 C CZ  . ARG C 1 43  ? 20.311 -15.408 12.711  1.00 32.51 ? 43  ARG C CZ  1 
ATOM   1814 N NH1 . ARG C 1 43  ? 21.371 -14.654 12.441  1.00 30.84 ? 43  ARG C NH1 1 
ATOM   1815 N NH2 . ARG C 1 43  ? 20.116 -15.844 13.951  1.00 29.17 ? 43  ARG C NH2 1 
ATOM   1816 N N   . LEU C 1 44  ? 15.810 -13.613 6.339   1.00 34.56 ? 44  LEU C N   1 
ATOM   1817 C CA  . LEU C 1 44  ? 15.567 -12.463 5.473   1.00 34.74 ? 44  LEU C CA  1 
ATOM   1818 C C   . LEU C 1 44  ? 15.848 -11.160 6.215   1.00 34.46 ? 44  LEU C C   1 
ATOM   1819 O O   . LEU C 1 44  ? 15.496 -11.023 7.393   1.00 34.52 ? 44  LEU C O   1 
ATOM   1820 C CB  . LEU C 1 44  ? 14.148 -12.499 4.899   1.00 33.54 ? 44  LEU C CB  1 
ATOM   1821 C CG  . LEU C 1 44  ? 13.859 -13.712 3.998   1.00 34.81 ? 44  LEU C CG  1 
ATOM   1822 C CD1 . LEU C 1 44  ? 12.472 -13.610 3.341   1.00 29.63 ? 44  LEU C CD1 1 
ATOM   1823 C CD2 . LEU C 1 44  ? 14.960 -13.918 2.939   1.00 29.14 ? 44  LEU C CD2 1 
ATOM   1824 N N   . TYR C 1 45  ? 16.491 -10.223 5.514   1.00 34.73 ? 45  TYR C N   1 
ATOM   1825 C CA  . TYR C 1 45  ? 16.935 -8.941  6.076   1.00 34.64 ? 45  TYR C CA  1 
ATOM   1826 C C   . TYR C 1 45  ? 16.474 -7.747  5.228   1.00 36.71 ? 45  TYR C C   1 
ATOM   1827 O O   . TYR C 1 45  ? 16.459 -7.820  3.999   1.00 37.97 ? 45  TYR C O   1 
ATOM   1828 C CB  . TYR C 1 45  ? 18.466 -8.882  6.122   1.00 34.03 ? 45  TYR C CB  1 
ATOM   1829 C CG  . TYR C 1 45  ? 19.156 -9.692  7.200   1.00 33.99 ? 45  TYR C CG  1 
ATOM   1830 C CD1 . TYR C 1 45  ? 19.486 -11.034 6.993   1.00 34.46 ? 45  TYR C CD1 1 
ATOM   1831 C CD2 . TYR C 1 45  ? 19.529 -9.098  8.407   1.00 34.13 ? 45  TYR C CD2 1 
ATOM   1832 C CE1 . TYR C 1 45  ? 20.131 -11.778 7.983   1.00 35.00 ? 45  TYR C CE1 1 
ATOM   1833 C CE2 . TYR C 1 45  ? 20.178 -9.826  9.396   1.00 35.79 ? 45  TYR C CE2 1 
ATOM   1834 C CZ  . TYR C 1 45  ? 20.476 -11.163 9.179   1.00 35.70 ? 45  TYR C CZ  1 
ATOM   1835 O OH  . TYR C 1 45  ? 21.120 -11.877 10.164  1.00 40.07 ? 45  TYR C OH  1 
ATOM   1836 N N   . LYS C 1 46  ? 16.123 -6.649  5.894   1.00 38.27 ? 46  LYS C N   1 
ATOM   1837 C CA  . LYS C 1 46  ? 15.940 -5.351  5.246   1.00 38.84 ? 46  LYS C CA  1 
ATOM   1838 C C   . LYS C 1 46  ? 16.774 -4.294  5.967   1.00 38.48 ? 46  LYS C C   1 
ATOM   1839 O O   . LYS C 1 46  ? 16.604 -4.072  7.170   1.00 37.80 ? 46  LYS C O   1 
ATOM   1840 C CB  . LYS C 1 46  ? 14.463 -4.931  5.211   1.00 39.84 ? 46  LYS C CB  1 
ATOM   1841 C CG  . LYS C 1 46  ? 14.190 -3.631  4.428   1.00 41.11 ? 46  LYS C CG  1 
ATOM   1842 C CD  . LYS C 1 46  ? 14.966 -3.626  3.108   1.00 46.19 ? 46  LYS C CD  1 
ATOM   1843 C CE  . LYS C 1 46  ? 14.650 -2.446  2.185   1.00 47.86 ? 46  LYS C CE  1 
ATOM   1844 N NZ  . LYS C 1 46  ? 15.525 -2.551  0.948   1.00 42.73 ? 46  LYS C NZ  1 
ATOM   1845 N N   . ASP C 1 47  ? 17.670 -3.654  5.220   1.00 39.61 ? 47  ASP C N   1 
ATOM   1846 C CA  . ASP C 1 47  ? 18.595 -2.645  5.748   1.00 40.11 ? 47  ASP C CA  1 
ATOM   1847 C C   . ASP C 1 47  ? 19.393 -3.170  6.937   1.00 39.57 ? 47  ASP C C   1 
ATOM   1848 O O   . ASP C 1 47  ? 19.472 -2.521  7.973   1.00 41.75 ? 47  ASP C O   1 
ATOM   1849 C CB  . ASP C 1 47  ? 17.855 -1.353  6.115   1.00 41.01 ? 47  ASP C CB  1 
ATOM   1850 C CG  . ASP C 1 47  ? 17.121 -0.746  4.933   1.00 45.84 ? 47  ASP C CG  1 
ATOM   1851 O OD1 . ASP C 1 47  ? 17.794 -0.205  4.028   1.00 49.51 ? 47  ASP C OD1 1 
ATOM   1852 O OD2 . ASP C 1 47  ? 15.872 -0.801  4.912   1.00 42.36 ? 47  ASP C OD2 1 
ATOM   1853 N N   . ASP C 1 48  ? 19.972 -4.358  6.776   1.00 41.08 ? 48  ASP C N   1 
ATOM   1854 C CA  . ASP C 1 48  ? 20.806 -4.993  7.807   1.00 41.39 ? 48  ASP C CA  1 
ATOM   1855 C C   . ASP C 1 48  ? 20.024 -5.318  9.083   1.00 40.43 ? 48  ASP C C   1 
ATOM   1856 O O   . ASP C 1 48  ? 20.608 -5.509  10.141  1.00 41.63 ? 48  ASP C O   1 
ATOM   1857 C CB  . ASP C 1 48  ? 22.040 -4.134  8.115   1.00 43.68 ? 48  ASP C CB  1 
ATOM   1858 C CG  . ASP C 1 48  ? 22.958 -3.976  6.906   1.00 50.11 ? 48  ASP C CG  1 
ATOM   1859 O OD1 . ASP C 1 48  ? 23.004 -2.867  6.318   1.00 50.99 ? 48  ASP C OD1 1 
ATOM   1860 O OD2 . ASP C 1 48  ? 23.620 -4.973  6.530   1.00 52.65 ? 48  ASP C OD2 1 
ATOM   1861 N N   . GLN C 1 49  ? 18.701 -5.390  8.965   1.00 38.11 ? 49  GLN C N   1 
ATOM   1862 C CA  . GLN C 1 49  ? 17.829 -5.686  10.095  1.00 37.21 ? 49  GLN C CA  1 
ATOM   1863 C C   . GLN C 1 49  ? 17.033 -6.955  9.822   1.00 36.44 ? 49  GLN C C   1 
ATOM   1864 O O   . GLN C 1 49  ? 16.495 -7.151  8.730   1.00 35.94 ? 49  GLN C O   1 
ATOM   1865 C CB  . GLN C 1 49  ? 16.910 -4.493  10.393  1.00 37.48 ? 49  GLN C CB  1 
ATOM   1866 C CG  . GLN C 1 49  ? 17.681 -3.237  10.837  1.00 41.75 ? 49  GLN C CG  1 
ATOM   1867 C CD  . GLN C 1 49  ? 16.938 -1.949  10.541  1.00 46.12 ? 49  GLN C CD  1 
ATOM   1868 O OE1 . GLN C 1 49  ? 15.894 -1.671  11.137  1.00 45.71 ? 49  GLN C OE1 1 
ATOM   1869 N NE2 . GLN C 1 49  ? 17.474 -1.150  9.612   1.00 40.56 ? 49  GLN C NE2 1 
ATOM   1870 N N   . LEU C 1 50  ? 16.987 -7.826  10.818  1.00 36.96 ? 50  LEU C N   1 
ATOM   1871 C CA  . LEU C 1 50  ? 16.351 -9.124  10.687  1.00 40.09 ? 50  LEU C CA  1 
ATOM   1872 C C   . LEU C 1 50  ? 14.834 -8.980  10.572  1.00 40.12 ? 50  LEU C C   1 
ATOM   1873 O O   . LEU C 1 50  ? 14.223 -8.194  11.294  1.00 40.65 ? 50  LEU C O   1 
ATOM   1874 C CB  . LEU C 1 50  ? 16.701 -9.987  11.899  1.00 40.63 ? 50  LEU C CB  1 
ATOM   1875 C CG  . LEU C 1 50  ? 17.163 -11.433 11.721  1.00 41.78 ? 50  LEU C CG  1 
ATOM   1876 C CD1 . LEU C 1 50  ? 17.273 -12.066 13.109  1.00 41.81 ? 50  LEU C CD1 1 
ATOM   1877 C CD2 . LEU C 1 50  ? 16.255 -12.262 10.804  1.00 38.99 ? 50  LEU C CD2 1 
ATOM   1878 N N   . LEU C 1 51  ? 14.241 -9.740  9.656   1.00 40.51 ? 51  LEU C N   1 
ATOM   1879 C CA  . LEU C 1 51  ? 12.798 -9.711  9.429   1.00 39.01 ? 51  LEU C CA  1 
ATOM   1880 C C   . LEU C 1 51  ? 12.072 -10.859 10.121  1.00 40.89 ? 51  LEU C C   1 
ATOM   1881 O O   . LEU C 1 51  ? 12.436 -12.031 9.956   1.00 41.10 ? 51  LEU C O   1 
ATOM   1882 C CB  . LEU C 1 51  ? 12.487 -9.752  7.934   1.00 37.28 ? 51  LEU C CB  1 
ATOM   1883 C CG  . LEU C 1 51  ? 13.042 -8.632  7.058   1.00 35.18 ? 51  LEU C CG  1 
ATOM   1884 C CD1 . LEU C 1 51  ? 12.474 -8.757  5.659   1.00 28.89 ? 51  LEU C CD1 1 
ATOM   1885 C CD2 . LEU C 1 51  ? 12.728 -7.273  7.664   1.00 33.24 ? 51  LEU C CD2 1 
ATOM   1886 N N   . ASP C 1 52  ? 11.031 -10.513 10.872  1.00 39.38 ? 52  ASP C N   1 
ATOM   1887 C CA  . ASP C 1 52  ? 10.199 -11.501 11.532  1.00 41.16 ? 52  ASP C CA  1 
ATOM   1888 C C   . ASP C 1 52  ? 9.242  -12.125 10.518  1.00 41.61 ? 52  ASP C C   1 
ATOM   1889 O O   . ASP C 1 52  ? 8.651  -11.408 9.719   1.00 43.66 ? 52  ASP C O   1 
ATOM   1890 C CB  . ASP C 1 52  ? 9.421  -10.848 12.675  1.00 41.15 ? 52  ASP C CB  1 
ATOM   1891 C CG  . ASP C 1 52  ? 8.597  -11.841 13.463  1.00 41.20 ? 52  ASP C CG  1 
ATOM   1892 O OD1 . ASP C 1 52  ? 7.542  -12.286 12.965  1.00 43.48 ? 52  ASP C OD1 1 
ATOM   1893 O OD2 . ASP C 1 52  ? 9.004  -12.173 14.594  1.00 46.65 ? 52  ASP C OD2 1 
ATOM   1894 N N   . ASP C 1 53  ? 9.084  -13.450 10.583  1.00 40.97 ? 53  ASP C N   1 
ATOM   1895 C CA  . ASP C 1 53  ? 8.263  -14.227 9.643   1.00 40.87 ? 53  ASP C CA  1 
ATOM   1896 C C   . ASP C 1 53  ? 6.783  -13.854 9.621   1.00 39.58 ? 53  ASP C C   1 
ATOM   1897 O O   . ASP C 1 53  ? 6.128  -13.964 8.585   1.00 38.00 ? 53  ASP C O   1 
ATOM   1898 C CB  . ASP C 1 53  ? 8.384  -15.727 9.949   1.00 43.08 ? 53  ASP C CB  1 
ATOM   1899 C CG  . ASP C 1 53  ? 9.670  -16.335 9.424   1.00 47.92 ? 53  ASP C CG  1 
ATOM   1900 O OD1 . ASP C 1 53  ? 10.439 -15.629 8.740   1.00 53.97 ? 53  ASP C OD1 1 
ATOM   1901 O OD2 . ASP C 1 53  ? 9.914  -17.530 9.693   1.00 53.78 ? 53  ASP C OD2 1 
ATOM   1902 N N   . GLY C 1 54  ? 6.259  -13.446 10.774  1.00 38.63 ? 54  GLY C N   1 
ATOM   1903 C CA  . GLY C 1 54  ? 4.844  -13.119 10.911  1.00 37.61 ? 54  GLY C CA  1 
ATOM   1904 C C   . GLY C 1 54  ? 4.444  -11.747 10.403  1.00 37.08 ? 54  GLY C C   1 
ATOM   1905 O O   . GLY C 1 54  ? 3.265  -11.502 10.161  1.00 38.17 ? 54  GLY C O   1 
ATOM   1906 N N   . LYS C 1 55  ? 5.417  -10.850 10.247  1.00 36.30 ? 55  LYS C N   1 
ATOM   1907 C CA  . LYS C 1 55  ? 5.141  -9.478  9.825   1.00 36.00 ? 55  LYS C CA  1 
ATOM   1908 C C   . LYS C 1 55  ? 4.782  -9.454  8.350   1.00 35.69 ? 55  LYS C C   1 
ATOM   1909 O O   . LYS C 1 55  ? 5.257  -10.288 7.576   1.00 36.03 ? 55  LYS C O   1 
ATOM   1910 C CB  . LYS C 1 55  ? 6.366  -8.584  10.025  1.00 35.85 ? 55  LYS C CB  1 
ATOM   1911 C CG  . LYS C 1 55  ? 6.997  -8.636  11.386  1.00 40.11 ? 55  LYS C CG  1 
ATOM   1912 C CD  . LYS C 1 55  ? 6.745  -7.378  12.178  1.00 42.84 ? 55  LYS C CD  1 
ATOM   1913 C CE  . LYS C 1 55  ? 7.497  -7.439  13.495  1.00 47.85 ? 55  LYS C CE  1 
ATOM   1914 N NZ  . LYS C 1 55  ? 7.680  -6.093  14.104  1.00 54.09 ? 55  LYS C NZ  1 
ATOM   1915 N N   . THR C 1 56  ? 3.955  -8.490  7.959   1.00 35.06 ? 56  THR C N   1 
ATOM   1916 C CA  . THR C 1 56  ? 3.723  -8.240  6.546   1.00 33.93 ? 56  THR C CA  1 
ATOM   1917 C C   . THR C 1 56  ? 4.878  -7.422  5.966   1.00 33.73 ? 56  THR C C   1 
ATOM   1918 O O   . THR C 1 56  ? 5.642  -6.777  6.693   1.00 33.58 ? 56  THR C O   1 
ATOM   1919 C CB  . THR C 1 56  ? 2.400  -7.508  6.290   1.00 34.66 ? 56  THR C CB  1 
ATOM   1920 O OG1 . THR C 1 56  ? 2.449  -6.214  6.898   1.00 36.77 ? 56  THR C OG1 1 
ATOM   1921 C CG2 . THR C 1 56  ? 1.201  -8.307  6.832   1.00 31.83 ? 56  THR C CG2 1 
ATOM   1922 N N   . LEU C 1 57  ? 5.003  -7.454  4.648   1.00 32.23 ? 57  LEU C N   1 
ATOM   1923 C CA  . LEU C 1 57  ? 6.045  -6.703  3.969   1.00 31.56 ? 57  LEU C CA  1 
ATOM   1924 C C   . LEU C 1 57  ? 5.863  -5.200  4.136   1.00 31.82 ? 57  LEU C C   1 
ATOM   1925 O O   . LEU C 1 57  ? 6.850  -4.468  4.212   1.00 35.73 ? 57  LEU C O   1 
ATOM   1926 C CB  . LEU C 1 57  ? 6.121  -7.103  2.493   1.00 30.45 ? 57  LEU C CB  1 
ATOM   1927 C CG  . LEU C 1 57  ? 6.404  -8.593  2.274   1.00 31.77 ? 57  LEU C CG  1 
ATOM   1928 C CD1 . LEU C 1 57  ? 6.504  -8.931  0.777   1.00 32.90 ? 57  LEU C CD1 1 
ATOM   1929 C CD2 . LEU C 1 57  ? 7.670  -9.037  3.036   1.00 30.11 ? 57  LEU C CD2 1 
ATOM   1930 N N   . GLY C 1 58  ? 4.606  -4.756  4.202   1.00 31.26 ? 58  GLY C N   1 
ATOM   1931 C CA  . GLY C 1 58  ? 4.264  -3.368  4.491   1.00 34.05 ? 58  GLY C CA  1 
ATOM   1932 C C   . GLY C 1 58  ? 4.792  -2.917  5.844   1.00 38.03 ? 58  GLY C C   1 
ATOM   1933 O O   . GLY C 1 58  ? 5.363  -1.828  5.965   1.00 41.00 ? 58  GLY C O   1 
ATOM   1934 N N   . GLU C 1 59  ? 4.623  -3.761  6.859   1.00 38.96 ? 59  GLU C N   1 
ATOM   1935 C CA  . GLU C 1 59  ? 5.167  -3.492  8.189   1.00 41.83 ? 59  GLU C CA  1 
ATOM   1936 C C   . GLU C 1 59  ? 6.694  -3.444  8.191   1.00 43.07 ? 59  GLU C C   1 
ATOM   1937 O O   . GLU C 1 59  ? 7.294  -2.801  9.056   1.00 43.97 ? 59  GLU C O   1 
ATOM   1938 C CB  . GLU C 1 59  ? 4.669  -4.534  9.195   1.00 42.70 ? 59  GLU C CB  1 
ATOM   1939 C CG  . GLU C 1 59  ? 3.236  -4.314  9.633   1.00 46.16 ? 59  GLU C CG  1 
ATOM   1940 C CD  . GLU C 1 59  ? 2.588  -5.556  10.236  1.00 52.09 ? 59  GLU C CD  1 
ATOM   1941 O OE1 . GLU C 1 59  ? 3.291  -6.563  10.475  1.00 51.56 ? 59  GLU C OE1 1 
ATOM   1942 O OE2 . GLU C 1 59  ? 1.358  -5.518  10.472  1.00 55.61 ? 59  GLU C OE2 1 
ATOM   1943 N N   . CYS C 1 60  ? 7.308  -4.122  7.222   1.00 42.67 ? 60  CYS C N   1 
ATOM   1944 C CA  . CYS C 1 60  ? 8.763  -4.214  7.118   1.00 44.03 ? 60  CYS C CA  1 
ATOM   1945 C C   . CYS C 1 60  ? 9.402  -3.105  6.282   1.00 45.26 ? 60  CYS C C   1 
ATOM   1946 O O   . CYS C 1 60  ? 10.631 -3.069  6.140   1.00 45.59 ? 60  CYS C O   1 
ATOM   1947 C CB  . CYS C 1 60  ? 9.175  -5.576  6.544   1.00 44.03 ? 60  CYS C CB  1 
ATOM   1948 S SG  . CYS C 1 60  ? 8.920  -6.947  7.671   1.00 46.09 ? 60  CYS C SG  1 
ATOM   1949 N N   . GLY C 1 61  ? 8.579  -2.220  5.722   1.00 43.84 ? 61  GLY C N   1 
ATOM   1950 C CA  . GLY C 1 61  ? 9.088  -1.106  4.922   1.00 42.57 ? 61  GLY C CA  1 
ATOM   1951 C C   . GLY C 1 61  ? 9.043  -1.314  3.414   1.00 41.98 ? 61  GLY C C   1 
ATOM   1952 O O   . GLY C 1 61  ? 9.600  -0.514  2.657   1.00 42.59 ? 61  GLY C O   1 
ATOM   1953 N N   . PHE C 1 62  ? 8.389  -2.386  2.969   1.00 39.94 ? 62  PHE C N   1 
ATOM   1954 C CA  . PHE C 1 62  ? 8.151  -2.599  1.540   1.00 38.88 ? 62  PHE C CA  1 
ATOM   1955 C C   . PHE C 1 62  ? 6.756  -2.112  1.160   1.00 39.66 ? 62  PHE C C   1 
ATOM   1956 O O   . PHE C 1 62  ? 5.761  -2.842  1.308   1.00 41.78 ? 62  PHE C O   1 
ATOM   1957 C CB  . PHE C 1 62  ? 8.324  -4.074  1.163   1.00 38.53 ? 62  PHE C CB  1 
ATOM   1958 C CG  . PHE C 1 62  ? 9.660  -4.645  1.544   1.00 36.01 ? 62  PHE C CG  1 
ATOM   1959 C CD1 . PHE C 1 62  ? 10.752 -4.509  0.698   1.00 37.93 ? 62  PHE C CD1 1 
ATOM   1960 C CD2 . PHE C 1 62  ? 9.826  -5.325  2.749   1.00 32.70 ? 62  PHE C CD2 1 
ATOM   1961 C CE1 . PHE C 1 62  ? 12.003 -5.036  1.051   1.00 38.28 ? 62  PHE C CE1 1 
ATOM   1962 C CE2 . PHE C 1 62  ? 11.071 -5.853  3.113   1.00 32.58 ? 62  PHE C CE2 1 
ATOM   1963 C CZ  . PHE C 1 62  ? 12.155 -5.709  2.263   1.00 34.91 ? 62  PHE C CZ  1 
ATOM   1964 N N   . THR C 1 63  ? 6.683  -0.867  0.698   1.00 38.44 ? 63  THR C N   1 
ATOM   1965 C CA  . THR C 1 63  ? 5.422  -0.289  0.218   1.00 36.58 ? 63  THR C CA  1 
ATOM   1966 C C   . THR C 1 63  ? 5.396  -0.227  -1.312  1.00 37.97 ? 63  THR C C   1 
ATOM   1967 O O   . THR C 1 63  ? 6.436  -0.287  -1.967  1.00 38.03 ? 63  THR C O   1 
ATOM   1968 C CB  . THR C 1 63  ? 5.147  1.124   0.818   1.00 37.31 ? 63  THR C CB  1 
ATOM   1969 O OG1 . THR C 1 63  ? 6.007  2.108   0.211   1.00 35.14 ? 63  THR C OG1 1 
ATOM   1970 C CG2 . THR C 1 63  ? 5.325  1.128   2.342   1.00 30.18 ? 63  THR C CG2 1 
ATOM   1971 N N   . SER C 1 64  ? 4.200  -0.091  -1.870  1.00 41.11 ? 64  SER C N   1 
ATOM   1972 C CA  . SER C 1 64  ? 3.997  -0.074  -3.314  1.00 43.09 ? 64  SER C CA  1 
ATOM   1973 C C   . SER C 1 64  ? 4.638  1.128   -4.015  1.00 44.46 ? 64  SER C C   1 
ATOM   1974 O O   . SER C 1 64  ? 4.954  1.056   -5.199  1.00 43.70 ? 64  SER C O   1 
ATOM   1975 C CB  . SER C 1 64  ? 2.504  -0.141  -3.613  1.00 44.08 ? 64  SER C CB  1 
ATOM   1976 O OG  . SER C 1 64  ? 2.252  -0.042  -4.998  1.00 50.63 ? 64  SER C OG  1 
ATOM   1977 N N   . GLN C 1 65  ? 4.826  2.223   -3.278  1.00 46.60 ? 65  GLN C N   1 
ATOM   1978 C CA  . GLN C 1 65  ? 5.567  3.389   -3.767  1.00 48.91 ? 65  GLN C CA  1 
ATOM   1979 C C   . GLN C 1 65  ? 7.074  3.189   -3.644  1.00 49.14 ? 65  GLN C C   1 
ATOM   1980 O O   . GLN C 1 65  ? 7.848  3.785   -4.378  1.00 50.36 ? 65  GLN C O   1 
ATOM   1981 C CB  . GLN C 1 65  ? 5.165  4.647   -2.993  1.00 49.64 ? 65  GLN C CB  1 
ATOM   1982 C CG  . GLN C 1 65  ? 3.924  5.350   -3.525  1.00 54.96 ? 65  GLN C CG  1 
ATOM   1983 C CD  . GLN C 1 65  ? 2.665  4.507   -3.419  1.00 58.67 ? 65  GLN C CD  1 
ATOM   1984 O OE1 . GLN C 1 65  ? 1.891  4.414   -4.374  1.00 62.95 ? 65  GLN C OE1 1 
ATOM   1985 N NE2 . GLN C 1 65  ? 2.457  3.881   -2.259  1.00 58.72 ? 65  GLN C NE2 1 
ATOM   1986 N N   . THR C 1 66  ? 7.475  2.352   -2.697  1.00 50.68 ? 66  THR C N   1 
ATOM   1987 C CA  . THR C 1 66  ? 8.878  2.093   -2.390  1.00 49.32 ? 66  THR C CA  1 
ATOM   1988 C C   . THR C 1 66  ? 9.456  1.000   -3.297  1.00 47.42 ? 66  THR C C   1 
ATOM   1989 O O   . THR C 1 66  ? 10.602 1.084   -3.735  1.00 49.63 ? 66  THR C O   1 
ATOM   1990 C CB  . THR C 1 66  ? 9.018  1.710   -0.881  1.00 49.58 ? 66  THR C CB  1 
ATOM   1991 O OG1 . THR C 1 66  ? 9.654  2.778   -0.176  1.00 55.58 ? 66  THR C OG1 1 
ATOM   1992 C CG2 . THR C 1 66  ? 9.814  0.408   -0.659  1.00 49.74 ? 66  THR C CG2 1 
ATOM   1993 N N   . ALA C 1 67  ? 8.651  -0.018  -3.580  1.00 42.37 ? 67  ALA C N   1 
ATOM   1994 C CA  . ALA C 1 67  ? 9.134  -1.209  -4.264  1.00 39.90 ? 67  ALA C CA  1 
ATOM   1995 C C   . ALA C 1 67  ? 8.491  -1.358  -5.653  1.00 37.83 ? 67  ALA C C   1 
ATOM   1996 O O   . ALA C 1 67  ? 7.518  -2.092  -5.817  1.00 35.20 ? 67  ALA C O   1 
ATOM   1997 C CB  . ALA C 1 67  ? 8.881  -2.434  -3.395  1.00 37.25 ? 67  ALA C CB  1 
ATOM   1998 N N   . ARG C 1 68  ? 9.049  -0.646  -6.633  1.00 36.28 ? 68  ARG C N   1 
ATOM   1999 C CA  . ARG C 1 68  ? 8.498  -0.553  -7.995  1.00 36.14 ? 68  ARG C CA  1 
ATOM   2000 C C   . ARG C 1 68  ? 9.143  -1.561  -8.951  1.00 35.40 ? 68  ARG C C   1 
ATOM   2001 O O   . ARG C 1 68  ? 10.228 -2.062  -8.675  1.00 33.19 ? 68  ARG C O   1 
ATOM   2002 C CB  . ARG C 1 68  ? 8.722  0.855   -8.560  1.00 37.99 ? 68  ARG C CB  1 
ATOM   2003 C CG  . ARG C 1 68  ? 7.716  1.903   -8.148  1.00 41.70 ? 68  ARG C CG  1 
ATOM   2004 C CD  . ARG C 1 68  ? 8.095  2.536   -6.833  1.00 47.41 ? 68  ARG C CD  1 
ATOM   2005 N NE  . ARG C 1 68  ? 8.936  3.735   -6.943  1.00 51.60 ? 68  ARG C NE  1 
ATOM   2006 C CZ  . ARG C 1 68  ? 10.193 3.840   -6.501  1.00 51.39 ? 68  ARG C CZ  1 
ATOM   2007 N NH1 . ARG C 1 68  ? 10.798 2.810   -5.917  1.00 56.20 ? 68  ARG C NH1 1 
ATOM   2008 N NH2 . ARG C 1 68  ? 10.847 4.985   -6.639  1.00 45.55 ? 68  ARG C NH2 1 
ATOM   2009 N N   . PRO C 1 69  ? 8.469  -1.874  -10.076 1.00 35.40 ? 69  PRO C N   1 
ATOM   2010 C CA  . PRO C 1 69  ? 9.077  -2.708  -11.123 1.00 35.06 ? 69  PRO C CA  1 
ATOM   2011 C C   . PRO C 1 69  ? 10.350 -2.110  -11.726 1.00 35.03 ? 69  PRO C C   1 
ATOM   2012 O O   . PRO C 1 69  ? 11.307 -2.848  -11.984 1.00 35.53 ? 69  PRO C O   1 
ATOM   2013 C CB  . PRO C 1 69  ? 7.980  -2.791  -12.187 1.00 35.20 ? 69  PRO C CB  1 
ATOM   2014 C CG  . PRO C 1 69  ? 6.715  -2.495  -11.469 1.00 35.15 ? 69  PRO C CG  1 
ATOM   2015 C CD  . PRO C 1 69  ? 7.072  -1.525  -10.396 1.00 35.33 ? 69  PRO C CD  1 
ATOM   2016 N N   . GLN C 1 70  ? 10.347 -0.793  -11.942 1.00 33.99 ? 70  GLN C N   1 
ATOM   2017 C CA  . GLN C 1 70  ? 11.482 -0.045  -12.511 1.00 33.88 ? 70  GLN C CA  1 
ATOM   2018 C C   . GLN C 1 70  ? 12.586 0.237   -11.495 1.00 31.33 ? 70  GLN C C   1 
ATOM   2019 O O   . GLN C 1 70  ? 13.652 0.741   -11.859 1.00 33.23 ? 70  GLN C O   1 
ATOM   2020 C CB  . GLN C 1 70  ? 11.036 1.337   -13.018 1.00 33.64 ? 70  GLN C CB  1 
ATOM   2021 C CG  . GLN C 1 70  ? 9.590  1.504   -13.389 1.00 41.11 ? 70  GLN C CG  1 
ATOM   2022 C CD  . GLN C 1 70  ? 8.687  1.836   -12.217 1.00 39.64 ? 70  GLN C CD  1 
ATOM   2023 O OE1 . GLN C 1 70  ? 8.776  2.904   -11.617 1.00 43.40 ? 70  GLN C OE1 1 
ATOM   2024 N NE2 . GLN C 1 70  ? 7.793  0.929   -11.912 1.00 36.60 ? 70  GLN C NE2 1 
ATOM   2025 N N   . ALA C 1 71  ? 12.300 -0.015  -10.223 1.00 29.20 ? 71  ALA C N   1 
ATOM   2026 C CA  . ALA C 1 71  ? 13.192 0.350   -9.121  1.00 30.07 ? 71  ALA C CA  1 
ATOM   2027 C C   . ALA C 1 71  ? 12.798 -0.472  -7.904  1.00 32.02 ? 71  ALA C C   1 
ATOM   2028 O O   . ALA C 1 71  ? 12.173 0.055   -6.976  1.00 35.50 ? 71  ALA C O   1 
ATOM   2029 C CB  . ALA C 1 71  ? 13.091 1.846   -8.814  1.00 25.98 ? 71  ALA C CB  1 
ATOM   2030 N N   . PRO C 1 72  ? 13.133 -1.775  -7.909  1.00 33.36 ? 72  PRO C N   1 
ATOM   2031 C CA  . PRO C 1 72  ? 12.654 -2.649  -6.839  1.00 33.86 ? 72  PRO C CA  1 
ATOM   2032 C C   . PRO C 1 72  ? 13.469 -2.558  -5.557  1.00 34.53 ? 72  PRO C C   1 
ATOM   2033 O O   . PRO C 1 72  ? 14.611 -2.099  -5.573  1.00 35.37 ? 72  PRO C O   1 
ATOM   2034 C CB  . PRO C 1 72  ? 12.731 -4.052  -7.460  1.00 32.06 ? 72  PRO C CB  1 
ATOM   2035 C CG  . PRO C 1 72  ? 13.756 -3.960  -8.538  1.00 35.42 ? 72  PRO C CG  1 
ATOM   2036 C CD  . PRO C 1 72  ? 13.940 -2.505  -8.907  1.00 35.24 ? 72  PRO C CD  1 
ATOM   2037 N N   . ALA C 1 73  ? 12.862 -2.989  -4.456  1.00 34.78 ? 73  ALA C N   1 
ATOM   2038 C CA  . ALA C 1 73  ? 13.507 -2.990  -3.157  1.00 34.17 ? 73  ALA C CA  1 
ATOM   2039 C C   . ALA C 1 73  ? 14.266 -4.291  -2.950  1.00 35.97 ? 73  ALA C C   1 
ATOM   2040 O O   . ALA C 1 73  ? 13.775 -5.354  -3.297  1.00 38.60 ? 73  ALA C O   1 
ATOM   2041 C CB  . ALA C 1 73  ? 12.474 -2.814  -2.069  1.00 30.86 ? 73  ALA C CB  1 
ATOM   2042 N N   . THR C 1 74  ? 15.454 -4.197  -2.362  1.00 38.44 ? 74  THR C N   1 
ATOM   2043 C CA  . THR C 1 74  ? 16.239 -5.372  -1.986  1.00 38.24 ? 74  THR C CA  1 
ATOM   2044 C C   . THR C 1 74  ? 15.794 -5.990  -0.648  1.00 37.91 ? 74  THR C C   1 
ATOM   2045 O O   . THR C 1 74  ? 15.528 -5.280  0.332   1.00 34.46 ? 74  THR C O   1 
ATOM   2046 C CB  . THR C 1 74  ? 17.747 -5.034  -1.911  1.00 39.40 ? 74  THR C CB  1 
ATOM   2047 O OG1 . THR C 1 74  ? 18.220 -4.666  -3.212  1.00 41.46 ? 74  THR C OG1 1 
ATOM   2048 C CG2 . THR C 1 74  ? 18.557 -6.243  -1.423  1.00 45.01 ? 74  THR C CG2 1 
ATOM   2049 N N   . VAL C 1 75  ? 15.699 -7.319  -0.651  1.00 37.05 ? 75  VAL C N   1 
ATOM   2050 C CA  . VAL C 1 75  ? 15.602 -8.143  0.549   1.00 36.00 ? 75  VAL C CA  1 
ATOM   2051 C C   . VAL C 1 75  ? 16.894 -8.971  0.600   1.00 35.52 ? 75  VAL C C   1 
ATOM   2052 O O   . VAL C 1 75  ? 17.299 -9.564  -0.408  1.00 34.50 ? 75  VAL C O   1 
ATOM   2053 C CB  . VAL C 1 75  ? 14.381 -9.117  0.476   1.00 38.72 ? 75  VAL C CB  1 
ATOM   2054 C CG1 . VAL C 1 75  ? 14.202 -9.899  1.777   1.00 37.71 ? 75  VAL C CG1 1 
ATOM   2055 C CG2 . VAL C 1 75  ? 13.106 -8.374  0.121   1.00 40.63 ? 75  VAL C CG2 1 
ATOM   2056 N N   . GLY C 1 76  ? 17.553 -8.998  1.755   1.00 33.60 ? 76  GLY C N   1 
ATOM   2057 C CA  . GLY C 1 76  ? 18.772 -9.782  1.908   1.00 32.12 ? 76  GLY C CA  1 
ATOM   2058 C C   . GLY C 1 76  ? 18.470 -11.195 2.388   1.00 32.56 ? 76  GLY C C   1 
ATOM   2059 O O   . GLY C 1 76  ? 17.593 -11.400 3.227   1.00 31.50 ? 76  GLY C O   1 
ATOM   2060 N N   . LEU C 1 77  ? 19.203 -12.169 1.861   1.00 31.02 ? 77  LEU C N   1 
ATOM   2061 C CA  . LEU C 1 77  ? 19.013 -13.570 2.244   1.00 31.35 ? 77  LEU C CA  1 
ATOM   2062 C C   . LEU C 1 77  ? 20.303 -14.169 2.801   1.00 32.80 ? 77  LEU C C   1 
ATOM   2063 O O   . LEU C 1 77  ? 21.373 -14.054 2.183   1.00 33.49 ? 77  LEU C O   1 
ATOM   2064 C CB  . LEU C 1 77  ? 18.506 -14.385 1.040   1.00 30.58 ? 77  LEU C CB  1 
ATOM   2065 C CG  . LEU C 1 77  ? 18.519 -15.919 1.057   1.00 28.49 ? 77  LEU C CG  1 
ATOM   2066 C CD1 . LEU C 1 77  ? 17.475 -16.488 2.018   1.00 27.65 ? 77  LEU C CD1 1 
ATOM   2067 C CD2 . LEU C 1 77  ? 18.278 -16.449 -0.345  1.00 25.61 ? 77  LEU C CD2 1 
ATOM   2068 N N   . ALA C 1 78  ? 20.200 -14.787 3.976   1.00 33.27 ? 78  ALA C N   1 
ATOM   2069 C CA  . ALA C 1 78  ? 21.313 -15.531 4.564   1.00 33.88 ? 78  ALA C CA  1 
ATOM   2070 C C   . ALA C 1 78  ? 20.892 -16.971 4.872   1.00 36.02 ? 78  ALA C C   1 
ATOM   2071 O O   . ALA C 1 78  ? 19.826 -17.205 5.453   1.00 38.40 ? 78  ALA C O   1 
ATOM   2072 C CB  . ALA C 1 78  ? 21.830 -14.834 5.811   1.00 31.79 ? 78  ALA C CB  1 
ATOM   2073 N N   . PHE C 1 79  ? 21.727 -17.928 4.472   1.00 37.10 ? 79  PHE C N   1 
ATOM   2074 C CA  . PHE C 1 79  ? 21.440 -19.353 4.676   1.00 38.23 ? 79  PHE C CA  1 
ATOM   2075 C C   . PHE C 1 79  ? 22.101 -19.926 5.918   1.00 38.67 ? 79  PHE C C   1 
ATOM   2076 O O   . PHE C 1 79  ? 23.111 -19.416 6.405   1.00 38.94 ? 79  PHE C O   1 
ATOM   2077 C CB  . PHE C 1 79  ? 21.876 -20.191 3.471   1.00 37.64 ? 79  PHE C CB  1 
ATOM   2078 C CG  . PHE C 1 79  ? 20.945 -20.116 2.292   1.00 38.47 ? 79  PHE C CG  1 
ATOM   2079 C CD1 . PHE C 1 79  ? 19.567 -20.202 2.459   1.00 40.14 ? 79  PHE C CD1 1 
ATOM   2080 C CD2 . PHE C 1 79  ? 21.457 -20.001 1.003   1.00 38.97 ? 79  PHE C CD2 1 
ATOM   2081 C CE1 . PHE C 1 79  ? 18.711 -20.136 1.362   1.00 41.11 ? 79  PHE C CE1 1 
ATOM   2082 C CE2 . PHE C 1 79  ? 20.613 -19.946 -0.099  1.00 39.28 ? 79  PHE C CE2 1 
ATOM   2083 C CZ  . PHE C 1 79  ? 19.237 -20.015 0.079   1.00 39.92 ? 79  PHE C CZ  1 
ATOM   2084 N N   . ARG C 1 80  ? 21.514 -21.008 6.413   1.00 40.14 ? 80  ARG C N   1 
ATOM   2085 C CA  . ARG C 1 80  ? 22.048 -21.758 7.535   1.00 41.48 ? 80  ARG C CA  1 
ATOM   2086 C C   . ARG C 1 80  ? 23.003 -22.847 7.018   1.00 41.90 ? 80  ARG C C   1 
ATOM   2087 O O   . ARG C 1 80  ? 22.806 -23.381 5.924   1.00 40.28 ? 80  ARG C O   1 
ATOM   2088 C CB  . ARG C 1 80  ? 20.885 -22.380 8.306   1.00 41.47 ? 80  ARG C CB  1 
ATOM   2089 C CG  . ARG C 1 80  ? 21.235 -22.951 9.651   1.00 42.30 ? 80  ARG C CG  1 
ATOM   2090 C CD  . ARG C 1 80  ? 20.227 -24.009 10.031  1.00 46.18 ? 80  ARG C CD  1 
ATOM   2091 N NE  . ARG C 1 80  ? 20.636 -24.724 11.234  1.00 49.88 ? 80  ARG C NE  1 
ATOM   2092 C CZ  . ARG C 1 80  ? 20.315 -24.345 12.465  1.00 51.34 ? 80  ARG C CZ  1 
ATOM   2093 N NH1 . ARG C 1 80  ? 19.571 -23.261 12.650  1.00 51.20 ? 80  ARG C NH1 1 
ATOM   2094 N NH2 . ARG C 1 80  ? 20.730 -25.050 13.508  1.00 50.79 ? 80  ARG C NH2 1 
ATOM   2095 N N   . ALA C 1 81  ? 24.033 -23.167 7.800   1.00 43.71 ? 81  ALA C N   1 
ATOM   2096 C CA  . ALA C 1 81  ? 24.952 -24.257 7.455   1.00 45.24 ? 81  ALA C CA  1 
ATOM   2097 C C   . ALA C 1 81  ? 25.007 -25.336 8.532   1.00 46.28 ? 81  ALA C C   1 
ATOM   2098 O O   . ALA C 1 81  ? 25.693 -25.178 9.548   1.00 49.07 ? 81  ALA C O   1 
ATOM   2099 C CB  . ALA C 1 81  ? 26.352 -23.719 7.160   1.00 45.16 ? 81  ALA C CB  1 
ATOM   2100 N N   . ASP C 1 82  ? 24.273 -26.425 8.297   1.00 45.89 ? 82  ASP C N   1 
ATOM   2101 C CA  . ASP C 1 82  ? 24.267 -27.622 9.160   1.00 44.49 ? 82  ASP C CA  1 
ATOM   2102 C C   . ASP C 1 82  ? 24.028 -27.356 10.654  1.00 43.91 ? 82  ASP C C   1 
ATOM   2103 O O   . ASP C 1 82  ? 23.502 -26.311 11.045  1.00 43.64 ? 82  ASP C O   1 
ATOM   2104 C CB  . ASP C 1 82  ? 25.554 -28.444 8.978   1.00 43.86 ? 82  ASP C CB  1 
ATOM   2105 C CG  . ASP C 1 82  ? 25.778 -28.907 7.538   1.00 43.34 ? 82  ASP C CG  1 
ATOM   2106 O OD1 . ASP C 1 82  ? 25.197 -28.316 6.599   1.00 45.79 ? 82  ASP C OD1 1 
ATOM   2107 O OD2 . ASP C 1 82  ? 26.561 -29.860 7.342   1.00 40.06 ? 82  ASP C OD2 1 
ATOM   2108 N N   . THR C 1 84  ? 24.628 -23.313 12.053  1.00 52.22 ? 84  THR C N   1 
ATOM   2109 C CA  . THR C 1 84  ? 24.205 -21.940 12.346  1.00 52.04 ? 84  THR C CA  1 
ATOM   2110 C C   . THR C 1 84  ? 24.104 -21.076 11.085  1.00 50.97 ? 84  THR C C   1 
ATOM   2111 O O   . THR C 1 84  ? 24.422 -21.534 9.984   1.00 50.71 ? 84  THR C O   1 
ATOM   2112 C CB  . THR C 1 84  ? 25.150 -21.258 13.360  1.00 52.51 ? 84  THR C CB  1 
ATOM   2113 O OG1 . THR C 1 84  ? 26.506 -21.390 12.912  1.00 52.86 ? 84  THR C OG1 1 
ATOM   2114 C CG2 . THR C 1 84  ? 24.998 -21.883 14.749  1.00 51.22 ? 84  THR C CG2 1 
ATOM   2115 N N   . PHE C 1 85  ? 23.667 -19.828 11.261  1.00 49.51 ? 85  PHE C N   1 
ATOM   2116 C CA  . PHE C 1 85  ? 23.481 -18.899 10.146  1.00 49.02 ? 85  PHE C CA  1 
ATOM   2117 C C   . PHE C 1 85  ? 24.718 -18.101 9.763   1.00 49.18 ? 85  PHE C C   1 
ATOM   2118 O O   . PHE C 1 85  ? 25.401 -17.534 10.625  1.00 48.12 ? 85  PHE C O   1 
ATOM   2119 C CB  . PHE C 1 85  ? 22.302 -17.954 10.407  1.00 48.79 ? 85  PHE C CB  1 
ATOM   2120 C CG  . PHE C 1 85  ? 20.980 -18.552 10.055  1.00 47.32 ? 85  PHE C CG  1 
ATOM   2121 C CD1 . PHE C 1 85  ? 20.492 -18.460 8.760   1.00 44.92 ? 85  PHE C CD1 1 
ATOM   2122 C CD2 . PHE C 1 85  ? 20.239 -19.242 11.006  1.00 45.80 ? 85  PHE C CD2 1 
ATOM   2123 C CE1 . PHE C 1 85  ? 19.279 -19.029 8.419   1.00 45.74 ? 85  PHE C CE1 1 
ATOM   2124 C CE2 . PHE C 1 85  ? 19.024 -19.815 10.675  1.00 46.20 ? 85  PHE C CE2 1 
ATOM   2125 C CZ  . PHE C 1 85  ? 18.544 -19.710 9.376   1.00 46.68 ? 85  PHE C CZ  1 
ATOM   2126 N N   . GLU C 1 86  ? 24.979 -18.055 8.455   1.00 48.36 ? 86  GLU C N   1 
ATOM   2127 C CA  . GLU C 1 86  ? 26.035 -17.224 7.885   1.00 48.71 ? 86  GLU C CA  1 
ATOM   2128 C C   . GLU C 1 86  ? 25.665 -15.748 8.008   1.00 47.46 ? 86  GLU C C   1 
ATOM   2129 O O   . GLU C 1 86  ? 24.485 -15.409 8.128   1.00 46.49 ? 86  GLU C O   1 
ATOM   2130 C CB  . GLU C 1 86  ? 26.266 -17.583 6.412   1.00 49.91 ? 86  GLU C CB  1 
ATOM   2131 C CG  . GLU C 1 86  ? 25.157 -17.107 5.468   1.00 53.35 ? 86  GLU C CG  1 
ATOM   2132 C CD  . GLU C 1 86  ? 25.522 -17.216 4.001   1.00 54.66 ? 86  GLU C CD  1 
ATOM   2133 O OE1 . GLU C 1 86  ? 26.697 -16.961 3.648   1.00 56.25 ? 86  GLU C OE1 1 
ATOM   2134 O OE2 . GLU C 1 86  ? 24.623 -17.542 3.199   1.00 53.53 ? 86  GLU C OE2 1 
ATOM   2135 N N   . ALA C 1 87  ? 26.672 -14.877 7.977   1.00 46.55 ? 87  ALA C N   1 
ATOM   2136 C CA  . ALA C 1 87  ? 26.435 -13.430 7.981   1.00 46.19 ? 87  ALA C CA  1 
ATOM   2137 C C   . ALA C 1 87  ? 25.848 -12.989 6.637   1.00 45.64 ? 87  ALA C C   1 
ATOM   2138 O O   . ALA C 1 87  ? 26.066 -13.646 5.615   1.00 45.85 ? 87  ALA C O   1 
ATOM   2139 C CB  . ALA C 1 87  ? 27.722 -12.670 8.290   1.00 44.32 ? 87  ALA C CB  1 
ATOM   2140 N N   . LEU C 1 88  ? 25.095 -11.891 6.644   1.00 45.09 ? 88  LEU C N   1 
ATOM   2141 C CA  . LEU C 1 88  ? 24.496 -11.373 5.419   1.00 43.56 ? 88  LEU C CA  1 
ATOM   2142 C C   . LEU C 1 88  ? 25.599 -10.934 4.467   1.00 43.60 ? 88  LEU C C   1 
ATOM   2143 O O   . LEU C 1 88  ? 26.398 -10.058 4.790   1.00 44.73 ? 88  LEU C O   1 
ATOM   2144 C CB  . LEU C 1 88  ? 23.545 -10.213 5.713   1.00 41.63 ? 88  LEU C CB  1 
ATOM   2145 C CG  . LEU C 1 88  ? 22.792 -9.605  4.526   1.00 42.44 ? 88  LEU C CG  1 
ATOM   2146 C CD1 . LEU C 1 88  ? 21.891 -10.634 3.838   1.00 40.56 ? 88  LEU C CD1 1 
ATOM   2147 C CD2 . LEU C 1 88  ? 21.983 -8.389  4.975   1.00 42.43 ? 88  LEU C CD2 1 
ATOM   2148 N N   . CYS C 1 89  ? 25.650 -11.566 3.303   1.00 41.98 ? 89  CYS C N   1 
ATOM   2149 C CA  . CYS C 1 89  ? 26.678 -11.258 2.334   1.00 41.79 ? 89  CYS C CA  1 
ATOM   2150 C C   . CYS C 1 89  ? 26.058 -11.065 0.959   1.00 40.16 ? 89  CYS C C   1 
ATOM   2151 O O   . CYS C 1 89  ? 25.521 -12.009 0.375   1.00 37.91 ? 89  CYS C O   1 
ATOM   2152 C CB  . CYS C 1 89  ? 27.730 -12.361 2.316   1.00 44.58 ? 89  CYS C CB  1 
ATOM   2153 S SG  . CYS C 1 89  ? 29.284 -11.859 1.575   1.00 53.49 ? 89  CYS C SG  1 
ATOM   2154 N N   . ILE C 1 90  ? 26.124 -9.824  0.472   1.00 37.99 ? 90  ILE C N   1 
ATOM   2155 C CA  . ILE C 1 90  ? 25.591 -9.427  -0.829  1.00 35.73 ? 90  ILE C CA  1 
ATOM   2156 C C   . ILE C 1 90  ? 26.681 -8.754  -1.664  1.00 35.72 ? 90  ILE C C   1 
ATOM   2157 O O   . ILE C 1 90  ? 27.223 -7.713  -1.276  1.00 35.67 ? 90  ILE C O   1 
ATOM   2158 C CB  . ILE C 1 90  ? 24.410 -8.427  -0.680  1.00 35.79 ? 90  ILE C CB  1 
ATOM   2159 C CG1 . ILE C 1 90  ? 23.235 -9.073  0.058   1.00 36.99 ? 90  ILE C CG1 1 
ATOM   2160 C CG2 . ILE C 1 90  ? 23.973 -7.910  -2.046  1.00 34.99 ? 90  ILE C CG2 1 
ATOM   2161 C CD1 . ILE C 1 90  ? 22.075 -8.141  0.337   1.00 34.04 ? 90  ILE C CD1 1 
ATOM   2162 N N   . GLU C 1 91  ? 26.993 -9.342  -2.814  1.00 35.08 ? 91  GLU C N   1 
ATOM   2163 C CA  . GLU C 1 91  ? 27.951 -8.738  -3.741  1.00 35.16 ? 91  GLU C CA  1 
ATOM   2164 C C   . GLU C 1 91  ? 27.320 -7.533  -4.435  1.00 33.63 ? 91  GLU C C   1 
ATOM   2165 O O   . GLU C 1 91  ? 26.159 -7.589  -4.836  1.00 33.91 ? 91  GLU C O   1 
ATOM   2166 C CB  . GLU C 1 91  ? 28.427 -9.750  -4.792  1.00 34.32 ? 91  GLU C CB  1 
ATOM   2167 C CG  . GLU C 1 91  ? 29.350 -10.833 -4.248  1.00 41.26 ? 91  GLU C CG  1 
ATOM   2168 C CD  . GLU C 1 91  ? 30.763 -10.330 -4.001  1.00 45.71 ? 91  GLU C CD  1 
ATOM   2169 O OE1 . GLU C 1 91  ? 31.313 -9.642  -4.888  1.00 49.46 ? 91  GLU C OE1 1 
ATOM   2170 O OE2 . GLU C 1 91  ? 31.327 -10.627 -2.925  1.00 47.19 ? 91  GLU C OE2 1 
ATOM   2171 N N   . PRO C 1 92  ? 28.076 -6.428  -4.560  1.00 32.61 ? 92  PRO C N   1 
ATOM   2172 C CA  . PRO C 1 92  ? 27.599 -5.329  -5.388  1.00 31.88 ? 92  PRO C CA  1 
ATOM   2173 C C   . PRO C 1 92  ? 27.591 -5.730  -6.864  1.00 31.28 ? 92  PRO C C   1 
ATOM   2174 O O   . PRO C 1 92  ? 28.388 -6.573  -7.277  1.00 32.29 ? 92  PRO C O   1 
ATOM   2175 C CB  . PRO C 1 92  ? 28.664 -4.250  -5.166  1.00 33.20 ? 92  PRO C CB  1 
ATOM   2176 C CG  . PRO C 1 92  ? 29.909 -5.027  -4.829  1.00 32.67 ? 92  PRO C CG  1 
ATOM   2177 C CD  . PRO C 1 92  ? 29.388 -6.129  -3.957  1.00 30.53 ? 92  PRO C CD  1 
ATOM   2178 N N   . PHE C 1 93  ? 26.695 -5.131  -7.639  1.00 29.16 ? 93  PHE C N   1 
ATOM   2179 C CA  . PHE C 1 93  ? 26.804 -5.141  -9.086  1.00 30.49 ? 93  PHE C CA  1 
ATOM   2180 C C   . PHE C 1 93  ? 28.055 -4.352  -9.483  1.00 32.17 ? 93  PHE C C   1 
ATOM   2181 O O   . PHE C 1 93  ? 28.570 -3.539  -8.690  1.00 31.64 ? 93  PHE C O   1 
ATOM   2182 C CB  . PHE C 1 93  ? 25.577 -4.479  -9.728  1.00 28.70 ? 93  PHE C CB  1 
ATOM   2183 C CG  . PHE C 1 93  ? 24.271 -5.166  -9.420  1.00 33.05 ? 93  PHE C CG  1 
ATOM   2184 C CD1 . PHE C 1 93  ? 24.189 -6.559  -9.338  1.00 32.53 ? 93  PHE C CD1 1 
ATOM   2185 C CD2 . PHE C 1 93  ? 23.108 -4.420  -9.247  1.00 33.06 ? 93  PHE C CD2 1 
ATOM   2186 C CE1 . PHE C 1 93  ? 22.971 -7.184  -9.070  1.00 33.18 ? 93  PHE C CE1 1 
ATOM   2187 C CE2 . PHE C 1 93  ? 21.884 -5.045  -8.975  1.00 32.03 ? 93  PHE C CE2 1 
ATOM   2188 C CZ  . PHE C 1 93  ? 21.816 -6.423  -8.892  1.00 30.62 ? 93  PHE C CZ  1 
ATOM   2189 N N   . SER C 1 94  ? 28.538 -4.592  -10.703 1.00 31.68 ? 94  SER C N   1 
ATOM   2190 C CA  . SER C 1 94  ? 29.648 -3.835  -11.259 1.00 33.26 ? 94  SER C CA  1 
ATOM   2191 C C   . SER C 1 94  ? 29.393 -2.326  -11.182 1.00 35.58 ? 94  SER C C   1 
ATOM   2192 O O   . SER C 1 94  ? 28.238 -1.880  -11.169 1.00 35.11 ? 94  SER C O   1 
ATOM   2193 C CB  . SER C 1 94  ? 29.918 -4.263  -12.706 1.00 34.00 ? 94  SER C CB  1 
ATOM   2194 O OG  . SER C 1 94  ? 28.718 -4.316  -13.455 1.00 33.63 ? 94  SER C OG  1 
ATOM   2195 N N   . SER C 1 95  ? 30.476 -1.550  -11.126 1.00 36.64 ? 95  SER C N   1 
ATOM   2196 C CA  . SER C 1 95  ? 30.391 -0.090  -11.036 1.00 37.06 ? 95  SER C CA  1 
ATOM   2197 C C   . SER C 1 95  ? 30.052 0.531   -12.395 1.00 36.99 ? 95  SER C C   1 
ATOM   2198 O O   . SER C 1 95  ? 30.710 0.238   -13.384 1.00 35.74 ? 95  SER C O   1 
ATOM   2199 C CB  . SER C 1 95  ? 31.707 0.479   -10.504 1.00 36.40 ? 95  SER C CB  1 
ATOM   2200 O OG  . SER C 1 95  ? 31.611 1.874   -10.284 1.00 41.11 ? 95  SER C OG  1 
ATOM   2201 N N   . PRO C 1 96  ? 29.013 1.386   -12.450 1.00 38.75 ? 96  PRO C N   1 
ATOM   2202 C CA  . PRO C 1 96  ? 28.711 2.080   -13.706 1.00 38.59 ? 96  PRO C CA  1 
ATOM   2203 C C   . PRO C 1 96  ? 29.880 2.962   -14.165 1.00 40.68 ? 96  PRO C C   1 
ATOM   2204 O O   . PRO C 1 96  ? 30.558 3.572   -13.326 1.00 38.02 ? 96  PRO C O   1 
ATOM   2205 C CB  . PRO C 1 96  ? 27.509 2.957   -13.346 1.00 38.43 ? 96  PRO C CB  1 
ATOM   2206 C CG  . PRO C 1 96  ? 26.886 2.277   -12.132 1.00 38.72 ? 96  PRO C CG  1 
ATOM   2207 C CD  . PRO C 1 96  ? 28.062 1.746   -11.377 1.00 38.78 ? 96  PRO C CD  1 
ATOM   2208 N N   . PRO C 1 97  ? 30.122 3.028   -15.490 1.00 41.43 ? 97  PRO C N   1 
ATOM   2209 C CA  . PRO C 1 97  ? 31.146 3.937   -16.001 1.00 42.87 ? 97  PRO C CA  1 
ATOM   2210 C C   . PRO C 1 97  ? 30.788 5.383   -15.665 1.00 44.17 ? 97  PRO C C   1 
ATOM   2211 O O   . PRO C 1 97  ? 29.662 5.657   -15.252 1.00 43.42 ? 97  PRO C O   1 
ATOM   2212 C CB  . PRO C 1 97  ? 31.114 3.696   -17.520 1.00 41.94 ? 97  PRO C CB  1 
ATOM   2213 C CG  . PRO C 1 97  ? 29.790 3.084   -17.791 1.00 40.76 ? 97  PRO C CG  1 
ATOM   2214 C CD  . PRO C 1 97  ? 29.463 2.275   -16.573 1.00 40.81 ? 97  PRO C CD  1 
ATOM   2215 N N   . GLU C 1 98  ? 31.736 6.298   -15.818 1.00 47.02 ? 98  GLU C N   1 
ATOM   2216 C CA  . GLU C 1 98  ? 31.457 7.698   -15.519 1.00 51.60 ? 98  GLU C CA  1 
ATOM   2217 C C   . GLU C 1 98  ? 31.839 8.635   -16.655 1.00 51.87 ? 98  GLU C C   1 
ATOM   2218 O O   . GLU C 1 98  ? 30.964 9.221   -17.288 1.00 53.88 ? 98  GLU C O   1 
ATOM   2219 C CB  . GLU C 1 98  ? 32.115 8.121   -14.201 1.00 53.72 ? 98  GLU C CB  1 
ATOM   2220 C CG  . GLU C 1 98  ? 33.632 8.239   -14.230 1.00 57.37 ? 98  GLU C CG  1 
ATOM   2221 C CD  . GLU C 1 98  ? 34.183 8.906   -12.981 1.00 59.79 ? 98  GLU C CD  1 
ATOM   2222 O OE1 . GLU C 1 98  ? 33.384 9.250   -12.084 1.00 60.84 ? 98  GLU C OE1 1 
ATOM   2223 O OE2 . GLU C 1 98  ? 35.415 9.095   -12.898 1.00 61.95 ? 98  GLU C OE2 1 
ATOM   2224 N N   . MET D 2 2   ? 9.095  -22.270 -14.776 1.00 45.57 ? 17  MET D N   1 
ATOM   2225 C CA  . MET D 2 2   ? 8.494  -20.965 -14.382 1.00 46.30 ? 17  MET D CA  1 
ATOM   2226 C C   . MET D 2 2   ? 9.536  -19.844 -14.290 1.00 45.33 ? 17  MET D C   1 
ATOM   2227 O O   . MET D 2 2   ? 9.287  -18.734 -14.754 1.00 46.20 ? 17  MET D O   1 
ATOM   2228 C CB  . MET D 2 2   ? 7.725  -21.102 -13.064 1.00 47.38 ? 17  MET D CB  1 
ATOM   2229 C CG  . MET D 2 2   ? 7.128  -19.796 -12.545 1.00 50.40 ? 17  MET D CG  1 
ATOM   2230 S SD  . MET D 2 2   ? 6.160  -19.968 -11.035 1.00 57.13 ? 17  MET D SD  1 
ATOM   2231 C CE  . MET D 2 2   ? 7.341  -20.712 -9.906  1.00 56.43 ? 17  MET D CE  1 
ATOM   2232 N N   . TYR D 2 3   ? 10.687 -20.133 -13.684 1.00 43.26 ? 18  TYR D N   1 
ATOM   2233 C CA  . TYR D 2 3   ? 11.774 -19.156 -13.571 1.00 42.38 ? 18  TYR D CA  1 
ATOM   2234 C C   . TYR D 2 3   ? 12.929 -19.500 -14.507 1.00 41.91 ? 18  TYR D C   1 
ATOM   2235 O O   . TYR D 2 3   ? 13.142 -20.676 -14.822 1.00 42.29 ? 18  TYR D O   1 
ATOM   2236 C CB  . TYR D 2 3   ? 12.284 -19.063 -12.125 1.00 41.77 ? 18  TYR D CB  1 
ATOM   2237 C CG  . TYR D 2 3   ? 11.464 -18.169 -11.212 1.00 40.98 ? 18  TYR D CG  1 
ATOM   2238 C CD1 . TYR D 2 3   ? 10.326 -18.651 -10.562 1.00 41.97 ? 18  TYR D CD1 1 
ATOM   2239 C CD2 . TYR D 2 3   ? 11.838 -16.841 -10.985 1.00 40.27 ? 18  TYR D CD2 1 
ATOM   2240 C CE1 . TYR D 2 3   ? 9.574  -17.829 -9.717  1.00 41.27 ? 18  TYR D CE1 1 
ATOM   2241 C CE2 . TYR D 2 3   ? 11.096 -16.014 -10.141 1.00 36.99 ? 18  TYR D CE2 1 
ATOM   2242 C CZ  . TYR D 2 3   ? 9.967  -16.513 -9.515  1.00 40.46 ? 18  TYR D CZ  1 
ATOM   2243 O OH  . TYR D 2 3   ? 9.236  -15.699 -8.679  1.00 42.13 ? 18  TYR D OH  1 
ATOM   2244 N N   . VAL D 2 4   ? 13.657 -18.478 -14.961 1.00 38.91 ? 19  VAL D N   1 
ATOM   2245 C CA  . VAL D 2 4   ? 14.894 -18.680 -15.731 1.00 39.61 ? 19  VAL D CA  1 
ATOM   2246 C C   . VAL D 2 4   ? 16.086 -17.928 -15.133 1.00 40.10 ? 19  VAL D C   1 
ATOM   2247 O O   . VAL D 2 4   ? 15.919 -16.875 -14.504 1.00 42.95 ? 19  VAL D O   1 
ATOM   2248 C CB  . VAL D 2 4   ? 14.746 -18.353 -17.255 1.00 39.80 ? 19  VAL D CB  1 
ATOM   2249 C CG1 . VAL D 2 4   ? 13.920 -19.424 -17.960 1.00 43.90 ? 19  VAL D CG1 1 
ATOM   2250 C CG2 . VAL D 2 4   ? 14.147 -16.985 -17.481 1.00 42.48 ? 19  VAL D CG2 1 
ATOM   2251 N N   . LYS D 2 5   ? 17.282 -18.478 -15.333 1.00 38.86 ? 20  LYS D N   1 
ATOM   2252 C CA  . LYS D 2 5   ? 18.505 -17.907 -14.788 1.00 37.38 ? 20  LYS D CA  1 
ATOM   2253 C C   . LYS D 2 5   ? 19.354 -17.303 -15.894 1.00 38.08 ? 20  LYS D C   1 
ATOM   2254 O O   . LYS D 2 5   ? 19.750 -17.991 -16.828 1.00 38.79 ? 20  LYS D O   1 
ATOM   2255 C CB  . LYS D 2 5   ? 19.302 -18.966 -14.023 1.00 37.31 ? 20  LYS D CB  1 
ATOM   2256 C CG  . LYS D 2 5   ? 20.595 -18.453 -13.404 1.00 36.13 ? 20  LYS D CG  1 
ATOM   2257 C CD  . LYS D 2 5   ? 21.495 -19.594 -12.983 1.00 36.78 ? 20  LYS D CD  1 
ATOM   2258 C CE  . LYS D 2 5   ? 21.071 -20.169 -11.647 1.00 39.96 ? 20  LYS D CE  1 
ATOM   2259 N NZ  . LYS D 2 5   ? 21.814 -21.421 -11.331 1.00 42.57 ? 20  LYS D NZ  1 
ATOM   2260 N N   . LEU D 2 6   ? 19.616 -16.004 -15.781 1.00 38.53 ? 21  LEU D N   1 
ATOM   2261 C CA  . LEU D 2 6   ? 20.504 -15.302 -16.698 1.00 37.11 ? 21  LEU D CA  1 
ATOM   2262 C C   . LEU D 2 6   ? 21.793 -14.950 -15.962 1.00 36.64 ? 21  LEU D C   1 
ATOM   2263 O O   . LEU D 2 6   ? 21.760 -14.474 -14.826 1.00 36.79 ? 21  LEU D O   1 
ATOM   2264 C CB  . LEU D 2 6   ? 19.832 -14.040 -17.253 1.00 37.35 ? 21  LEU D CB  1 
ATOM   2265 C CG  . LEU D 2 6   ? 18.354 -14.130 -17.666 1.00 38.56 ? 21  LEU D CG  1 
ATOM   2266 C CD1 . LEU D 2 6   ? 17.821 -12.754 -17.994 1.00 39.72 ? 21  LEU D CD1 1 
ATOM   2267 C CD2 . LEU D 2 6   ? 18.122 -15.088 -18.834 1.00 36.68 ? 21  LEU D CD2 1 
ATOM   2268 N N   . ILE D 2 7   ? 22.926 -15.206 -16.605 1.00 36.28 ? 22  ILE D N   1 
ATOM   2269 C CA  . ILE D 2 7   ? 24.231 -14.996 -15.982 1.00 35.85 ? 22  ILE D CA  1 
ATOM   2270 C C   . ILE D 2 7   ? 24.982 -13.876 -16.693 1.00 35.17 ? 22  ILE D C   1 
ATOM   2271 O O   . ILE D 2 7   ? 25.161 -13.926 -17.903 1.00 33.34 ? 22  ILE D O   1 
ATOM   2272 C CB  . ILE D 2 7   ? 25.085 -16.302 -15.965 1.00 35.74 ? 22  ILE D CB  1 
ATOM   2273 C CG1 . ILE D 2 7   ? 24.311 -17.439 -15.284 1.00 35.77 ? 22  ILE D CG1 1 
ATOM   2274 C CG2 . ILE D 2 7   ? 26.436 -16.064 -15.265 1.00 32.50 ? 22  ILE D CG2 1 
ATOM   2275 C CD1 . ILE D 2 7   ? 24.997 -18.788 -15.347 1.00 39.77 ? 22  ILE D CD1 1 
ATOM   2276 N N   . SER D 2 8   ? 25.405 -12.871 -15.927 1.00 35.68 ? 23  SER D N   1 
ATOM   2277 C CA  . SER D 2 8   ? 26.163 -11.734 -16.460 1.00 35.56 ? 23  SER D CA  1 
ATOM   2278 C C   . SER D 2 8   ? 27.617 -12.109 -16.732 1.00 35.14 ? 23  SER D C   1 
ATOM   2279 O O   . SER D 2 8   ? 28.072 -13.192 -16.332 1.00 34.90 ? 23  SER D O   1 
ATOM   2280 C CB  . SER D 2 8   ? 26.087 -10.535 -15.505 1.00 34.03 ? 23  SER D CB  1 
ATOM   2281 O OG  . SER D 2 8   ? 26.841 -10.762 -14.330 1.00 36.75 ? 23  SER D OG  1 
ATOM   2282 N N   . SER D 2 9   ? 28.345 -11.216 -17.407 1.00 35.67 ? 24  SER D N   1 
ATOM   2283 C CA  . SER D 2 9   ? 29.762 -11.456 -17.724 1.00 35.17 ? 24  SER D CA  1 
ATOM   2284 C C   . SER D 2 9   ? 30.621 -11.534 -16.472 1.00 33.77 ? 24  SER D C   1 
ATOM   2285 O O   . SER D 2 9   ? 31.637 -12.209 -16.466 1.00 34.77 ? 24  SER D O   1 
ATOM   2286 C CB  . SER D 2 9   ? 30.321 -10.389 -18.671 1.00 35.05 ? 24  SER D CB  1 
ATOM   2287 O OG  . SER D 2 9   ? 30.214 -9.092  -18.121 1.00 39.70 ? 24  SER D OG  1 
ATOM   2288 N N   . ASP D 2 10  ? 30.207 -10.840 -15.415 1.00 33.61 ? 25  ASP D N   1 
ATOM   2289 C CA  . ASP D 2 10  ? 30.950 -10.843 -14.158 1.00 30.20 ? 25  ASP D CA  1 
ATOM   2290 C C   . ASP D 2 10  ? 30.415 -11.859 -13.142 1.00 29.89 ? 25  ASP D C   1 
ATOM   2291 O O   . ASP D 2 10  ? 30.767 -11.819 -11.958 1.00 28.79 ? 25  ASP D O   1 
ATOM   2292 C CB  . ASP D 2 10  ? 31.031 -9.428  -13.575 1.00 30.49 ? 25  ASP D CB  1 
ATOM   2293 C CG  . ASP D 2 10  ? 29.664 -8.807  -13.315 1.00 31.20 ? 25  ASP D CG  1 
ATOM   2294 O OD1 . ASP D 2 10  ? 28.736 -8.969  -14.134 1.00 31.43 ? 25  ASP D OD1 1 
ATOM   2295 O OD2 . ASP D 2 10  ? 29.523 -8.126  -12.279 1.00 34.38 ? 25  ASP D OD2 1 
ATOM   2296 N N   . GLY D 2 11  ? 29.567 -12.771 -13.619 1.00 29.42 ? 26  GLY D N   1 
ATOM   2297 C CA  . GLY D 2 11  ? 29.157 -13.941 -12.847 1.00 29.15 ? 26  GLY D CA  1 
ATOM   2298 C C   . GLY D 2 11  ? 27.949 -13.803 -11.938 1.00 32.16 ? 26  GLY D C   1 
ATOM   2299 O O   . GLY D 2 11  ? 27.696 -14.695 -11.125 1.00 33.05 ? 26  GLY D O   1 
ATOM   2300 N N   . HIS D 2 12  ? 27.206 -12.702 -12.059 1.00 30.07 ? 27  HIS D N   1 
ATOM   2301 C CA  . HIS D 2 12  ? 25.968 -12.531 -11.293 1.00 32.19 ? 27  HIS D CA  1 
ATOM   2302 C C   . HIS D 2 12  ? 24.839 -13.368 -11.905 1.00 33.02 ? 27  HIS D C   1 
ATOM   2303 O O   . HIS D 2 12  ? 24.662 -13.381 -13.121 1.00 34.40 ? 27  HIS D O   1 
ATOM   2304 C CB  . HIS D 2 12  ? 25.544 -11.048 -11.214 1.00 30.54 ? 27  HIS D CB  1 
ATOM   2305 C CG  . HIS D 2 12  ? 26.137 -10.295 -10.062 1.00 25.58 ? 27  HIS D CG  1 
ATOM   2306 N ND1 . HIS D 2 12  ? 27.406 -9.758  -10.096 1.00 28.57 ? 27  HIS D ND1 1 
ATOM   2307 C CD2 . HIS D 2 12  ? 25.625 -9.966  -8.852  1.00 28.81 ? 27  HIS D CD2 1 
ATOM   2308 C CE1 . HIS D 2 12  ? 27.656 -9.143  -8.953  1.00 26.90 ? 27  HIS D CE1 1 
ATOM   2309 N NE2 . HIS D 2 12  ? 26.592 -9.258  -8.178  1.00 26.89 ? 27  HIS D NE2 1 
ATOM   2310 N N   . GLU D 2 13  ? 24.094 -14.066 -11.051 1.00 33.12 ? 28  GLU D N   1 
ATOM   2311 C CA  . GLU D 2 13  ? 22.930 -14.846 -11.463 1.00 33.57 ? 28  GLU D CA  1 
ATOM   2312 C C   . GLU D 2 13  ? 21.650 -14.047 -11.270 1.00 33.38 ? 28  GLU D C   1 
ATOM   2313 O O   . GLU D 2 13  ? 21.350 -13.599 -10.158 1.00 34.16 ? 28  GLU D O   1 
ATOM   2314 C CB  . GLU D 2 13  ? 22.826 -16.125 -10.636 1.00 33.44 ? 28  GLU D CB  1 
ATOM   2315 C CG  . GLU D 2 13  ? 23.770 -17.221 -11.049 1.00 37.36 ? 28  GLU D CG  1 
ATOM   2316 C CD  . GLU D 2 13  ? 23.855 -18.334 -10.023 1.00 43.20 ? 28  GLU D CD  1 
ATOM   2317 O OE1 . GLU D 2 13  ? 23.014 -18.368 -9.093  1.00 44.39 ? 28  GLU D OE1 1 
ATOM   2318 O OE2 . GLU D 2 13  ? 24.771 -19.178 -10.144 1.00 46.72 ? 28  GLU D OE2 1 
ATOM   2319 N N   . PHE D 2 14  ? 20.893 -13.883 -12.348 1.00 32.65 ? 29  PHE D N   1 
ATOM   2320 C CA  . PHE D 2 14  ? 19.609 -13.191 -12.284 1.00 32.74 ? 29  PHE D CA  1 
ATOM   2321 C C   . PHE D 2 14  ? 18.479 -14.152 -12.576 1.00 32.75 ? 29  PHE D C   1 
ATOM   2322 O O   . PHE D 2 14  ? 18.386 -14.711 -13.668 1.00 33.75 ? 29  PHE D O   1 
ATOM   2323 C CB  . PHE D 2 14  ? 19.583 -11.984 -13.224 1.00 33.59 ? 29  PHE D CB  1 
ATOM   2324 C CG  . PHE D 2 14  ? 20.600 -10.938 -12.871 1.00 33.77 ? 29  PHE D CG  1 
ATOM   2325 C CD1 . PHE D 2 14  ? 21.849 -10.931 -13.483 1.00 33.23 ? 29  PHE D CD1 1 
ATOM   2326 C CD2 . PHE D 2 14  ? 20.322 -9.978  -11.898 1.00 35.58 ? 29  PHE D CD2 1 
ATOM   2327 C CE1 . PHE D 2 14  ? 22.799 -9.971  -13.148 1.00 35.89 ? 29  PHE D CE1 1 
ATOM   2328 C CE2 . PHE D 2 14  ? 21.266 -9.012  -11.559 1.00 36.16 ? 29  PHE D CE2 1 
ATOM   2329 C CZ  . PHE D 2 14  ? 22.507 -9.012  -12.182 1.00 35.01 ? 29  PHE D CZ  1 
ATOM   2330 N N   . ILE D 2 15  ? 17.640 -14.360 -11.569 1.00 33.78 ? 30  ILE D N   1 
ATOM   2331 C CA  . ILE D 2 15  ? 16.552 -15.328 -11.656 1.00 33.13 ? 30  ILE D CA  1 
ATOM   2332 C C   . ILE D 2 15  ? 15.212 -14.601 -11.832 1.00 34.09 ? 30  ILE D C   1 
ATOM   2333 O O   . ILE D 2 15  ? 14.702 -13.966 -10.907 1.00 32.14 ? 30  ILE D O   1 
ATOM   2334 C CB  . ILE D 2 15  ? 16.569 -16.297 -10.448 1.00 30.90 ? 30  ILE D CB  1 
ATOM   2335 C CG1 . ILE D 2 15  ? 17.928 -17.007 -10.387 1.00 29.74 ? 30  ILE D CG1 1 
ATOM   2336 C CG2 . ILE D 2 15  ? 15.424 -17.305 -10.544 1.00 31.65 ? 30  ILE D CG2 1 
ATOM   2337 C CD1 . ILE D 2 15  ? 18.218 -17.755 -9.124  1.00 28.19 ? 30  ILE D CD1 1 
ATOM   2338 N N   . VAL D 2 16  ? 14.678 -14.690 -13.049 1.00 36.08 ? 31  VAL D N   1 
ATOM   2339 C CA  . VAL D 2 16  ? 13.425 -14.037 -13.426 1.00 37.34 ? 31  VAL D CA  1 
ATOM   2340 C C   . VAL D 2 16  ? 12.384 -15.063 -13.882 1.00 38.34 ? 31  VAL D C   1 
ATOM   2341 O O   . VAL D 2 16  ? 12.736 -16.139 -14.363 1.00 38.48 ? 31  VAL D O   1 
ATOM   2342 C CB  . VAL D 2 16  ? 13.639 -12.956 -14.532 1.00 37.80 ? 31  VAL D CB  1 
ATOM   2343 C CG1 . VAL D 2 16  ? 14.379 -11.757 -13.972 1.00 37.83 ? 31  VAL D CG1 1 
ATOM   2344 C CG2 . VAL D 2 16  ? 14.383 -13.516 -15.747 1.00 36.66 ? 31  VAL D CG2 1 
ATOM   2345 N N   . LYS D 2 17  ? 11.107 -14.735 -13.702 1.00 37.86 ? 32  LYS D N   1 
ATOM   2346 C CA  . LYS D 2 17  ? 10.021 -15.530 -14.259 1.00 38.41 ? 32  LYS D CA  1 
ATOM   2347 C C   . LYS D 2 17  ? 10.185 -15.663 -15.772 1.00 37.95 ? 32  LYS D C   1 
ATOM   2348 O O   . LYS D 2 17  ? 10.500 -14.678 -16.459 1.00 35.51 ? 32  LYS D O   1 
ATOM   2349 C CB  . LYS D 2 17  ? 8.676  -14.886 -13.931 1.00 39.70 ? 32  LYS D CB  1 
ATOM   2350 C CG  . LYS D 2 17  ? 8.185  -15.193 -12.535 1.00 42.99 ? 32  LYS D CG  1 
ATOM   2351 C CD  . LYS D 2 17  ? 7.227  -14.134 -12.042 1.00 45.84 ? 32  LYS D CD  1 
ATOM   2352 C CE  . LYS D 2 17  ? 6.925  -14.327 -10.570 1.00 47.12 ? 32  LYS D CE  1 
ATOM   2353 N NZ  . LYS D 2 17  ? 6.149  -13.187 -10.024 1.00 50.33 ? 32  LYS D NZ  1 
ATOM   2354 N N   . ARG D 2 18  ? 9.979  -16.880 -16.277 1.00 37.92 ? 33  ARG D N   1 
ATOM   2355 C CA  . ARG D 2 18  ? 10.139 -17.191 -17.704 1.00 39.17 ? 33  ARG D CA  1 
ATOM   2356 C C   . ARG D 2 18  ? 9.343  -16.247 -18.605 1.00 39.22 ? 33  ARG D C   1 
ATOM   2357 O O   . ARG D 2 18  ? 9.888  -15.699 -19.563 1.00 38.37 ? 33  ARG D O   1 
ATOM   2358 C CB  . ARG D 2 18  ? 9.765  -18.650 -17.987 1.00 40.28 ? 33  ARG D CB  1 
ATOM   2359 C CG  . ARG D 2 18  ? 9.694  -19.017 -19.468 1.00 42.29 ? 33  ARG D CG  1 
ATOM   2360 C CD  . ARG D 2 18  ? 9.231  -20.450 -19.649 1.00 46.88 ? 33  ARG D CD  1 
ATOM   2361 N NE  . ARG D 2 18  ? 8.470  -20.634 -20.884 1.00 48.94 ? 33  ARG D NE  1 
ATOM   2362 C CZ  . ARG D 2 18  ? 7.161  -20.414 -21.007 1.00 50.83 ? 33  ARG D CZ  1 
ATOM   2363 N NH1 . ARG D 2 18  ? 6.443  -19.989 -19.970 1.00 50.94 ? 33  ARG D NH1 1 
ATOM   2364 N NH2 . ARG D 2 18  ? 6.565  -20.618 -22.177 1.00 51.05 ? 33  ARG D NH2 1 
ATOM   2365 N N   . GLU D 2 19  ? 8.067  -16.054 -18.276 1.00 41.13 ? 34  GLU D N   1 
ATOM   2366 C CA  . GLU D 2 19  ? 7.161  -15.212 -19.063 1.00 43.05 ? 34  GLU D CA  1 
ATOM   2367 C C   . GLU D 2 19  ? 7.651  -13.783 -19.234 1.00 41.97 ? 34  GLU D C   1 
ATOM   2368 O O   . GLU D 2 19  ? 7.476  -13.191 -20.299 1.00 44.16 ? 34  GLU D O   1 
ATOM   2369 C CB  . GLU D 2 19  ? 5.767  -15.202 -18.445 1.00 44.84 ? 34  GLU D CB  1 
ATOM   2370 C CG  . GLU D 2 19  ? 4.906  -16.391 -18.837 1.00 51.86 ? 34  GLU D CG  1 
ATOM   2371 C CD  . GLU D 2 19  ? 3.563  -16.389 -18.132 1.00 57.40 ? 34  GLU D CD  1 
ATOM   2372 O OE1 . GLU D 2 19  ? 3.112  -15.299 -17.705 1.00 59.91 ? 34  GLU D OE1 1 
ATOM   2373 O OE2 . GLU D 2 19  ? 2.957  -17.476 -18.000 1.00 59.16 ? 34  GLU D OE2 1 
ATOM   2374 N N   . HIS D 2 20  ? 8.259  -13.238 -18.184 1.00 39.85 ? 35  HIS D N   1 
ATOM   2375 C CA  . HIS D 2 20  ? 8.804  -11.886 -18.202 1.00 37.80 ? 35  HIS D CA  1 
ATOM   2376 C C   . HIS D 2 20  ? 10.039 -11.812 -19.094 1.00 39.25 ? 35  HIS D C   1 
ATOM   2377 O O   . HIS D 2 20  ? 10.189 -10.871 -19.885 1.00 37.04 ? 35  HIS D O   1 
ATOM   2378 C CB  . HIS D 2 20  ? 9.140  -11.429 -16.776 1.00 36.91 ? 35  HIS D CB  1 
ATOM   2379 C CG  . HIS D 2 20  ? 7.937  -11.206 -15.914 1.00 37.85 ? 35  HIS D CG  1 
ATOM   2380 N ND1 . HIS D 2 20  ? 6.940  -12.149 -15.764 1.00 40.26 ? 35  HIS D ND1 1 
ATOM   2381 C CD2 . HIS D 2 20  ? 7.571  -10.149 -15.152 1.00 37.94 ? 35  HIS D CD2 1 
ATOM   2382 C CE1 . HIS D 2 20  ? 6.013  -11.683 -14.947 1.00 41.35 ? 35  HIS D CE1 1 
ATOM   2383 N NE2 . HIS D 2 20  ? 6.372  -10.471 -14.562 1.00 42.30 ? 35  HIS D NE2 1 
ATOM   2384 N N   . ALA D 2 21  ? 10.910 -12.815 -18.962 1.00 38.51 ? 36  ALA D N   1 
ATOM   2385 C CA  . ALA D 2 21  ? 12.107 -12.936 -19.783 1.00 37.75 ? 36  ALA D CA  1 
ATOM   2386 C C   . ALA D 2 21  ? 11.781 -13.070 -21.266 1.00 37.71 ? 36  ALA D C   1 
ATOM   2387 O O   . ALA D 2 21  ? 12.592 -12.671 -22.107 1.00 38.38 ? 36  ALA D O   1 
ATOM   2388 C CB  . ALA D 2 21  ? 12.945 -14.116 -19.328 1.00 38.87 ? 36  ALA D CB  1 
ATOM   2389 N N   . LEU D 2 22  ? 10.609 -13.629 -21.585 1.00 37.87 ? 37  LEU D N   1 
ATOM   2390 C CA  . LEU D 2 22  ? 10.172 -13.793 -22.986 1.00 38.27 ? 37  LEU D CA  1 
ATOM   2391 C C   . LEU D 2 22  ? 9.989  -12.451 -23.705 1.00 39.10 ? 37  LEU D C   1 
ATOM   2392 O O   . LEU D 2 22  ? 9.824  -12.410 -24.923 1.00 40.80 ? 37  LEU D O   1 
ATOM   2393 C CB  . LEU D 2 22  ? 8.890  -14.631 -23.092 1.00 36.92 ? 37  LEU D CB  1 
ATOM   2394 C CG  . LEU D 2 22  ? 8.935  -16.135 -22.793 1.00 39.12 ? 37  LEU D CG  1 
ATOM   2395 C CD1 . LEU D 2 22  ? 7.577  -16.780 -23.064 1.00 38.16 ? 37  LEU D CD1 1 
ATOM   2396 C CD2 . LEU D 2 22  ? 10.026 -16.861 -23.579 1.00 37.99 ? 37  LEU D CD2 1 
ATOM   2397 N N   . THR D 2 23  ? 10.018 -11.364 -22.936 1.00 39.05 ? 38  THR D N   1 
ATOM   2398 C CA  . THR D 2 23  ? 10.050 -10.001 -23.463 1.00 39.73 ? 38  THR D CA  1 
ATOM   2399 C C   . THR D 2 23  ? 11.246 -9.810  -24.399 1.00 39.81 ? 38  THR D C   1 
ATOM   2400 O O   . THR D 2 23  ? 11.176 -9.057  -25.364 1.00 38.52 ? 38  THR D O   1 
ATOM   2401 C CB  . THR D 2 23  ? 10.110 -8.993  -22.297 1.00 39.50 ? 38  THR D CB  1 
ATOM   2402 O OG1 . THR D 2 23  ? 8.849  -8.996  -21.614 1.00 43.80 ? 38  THR D OG1 1 
ATOM   2403 C CG2 . THR D 2 23  ? 10.447 -7.578  -22.763 1.00 37.26 ? 38  THR D CG2 1 
ATOM   2404 N N   . SER D 2 24  ? 12.340 -10.501 -24.089 1.00 40.47 ? 39  SER D N   1 
ATOM   2405 C CA  . SER D 2 24  ? 13.534 -10.506 -24.924 1.00 40.95 ? 39  SER D CA  1 
ATOM   2406 C C   . SER D 2 24  ? 13.352 -11.527 -26.043 1.00 40.31 ? 39  SER D C   1 
ATOM   2407 O O   . SER D 2 24  ? 13.051 -12.692 -25.783 1.00 41.84 ? 39  SER D O   1 
ATOM   2408 C CB  . SER D 2 24  ? 14.778 -10.813 -24.076 1.00 37.58 ? 39  SER D CB  1 
ATOM   2409 O OG  . SER D 2 24  ? 15.773 -11.466 -24.832 1.00 35.23 ? 39  SER D OG  1 
ATOM   2410 N N   . GLY D 2 25  ? 13.516 -11.073 -27.285 1.00 41.27 ? 40  GLY D N   1 
ATOM   2411 C CA  . GLY D 2 25  ? 13.362 -11.932 -28.461 1.00 38.55 ? 40  GLY D CA  1 
ATOM   2412 C C   . GLY D 2 25  ? 14.470 -12.965 -28.539 1.00 39.38 ? 40  GLY D C   1 
ATOM   2413 O O   . GLY D 2 25  ? 14.242 -14.106 -28.954 1.00 39.17 ? 40  GLY D O   1 
ATOM   2414 N N   . THR D 2 26  ? 15.669 -12.556 -28.124 1.00 39.11 ? 41  THR D N   1 
ATOM   2415 C CA  . THR D 2 26  ? 16.849 -13.419 -28.097 1.00 39.50 ? 41  THR D CA  1 
ATOM   2416 C C   . THR D 2 26  ? 16.676 -14.589 -27.129 1.00 39.28 ? 41  THR D C   1 
ATOM   2417 O O   . THR D 2 26  ? 16.867 -15.742 -27.513 1.00 36.57 ? 41  THR D O   1 
ATOM   2418 C CB  . THR D 2 26  ? 18.111 -12.616 -27.734 1.00 40.46 ? 41  THR D CB  1 
ATOM   2419 O OG1 . THR D 2 26  ? 18.230 -11.509 -28.632 1.00 42.85 ? 41  THR D OG1 1 
ATOM   2420 C CG2 . THR D 2 26  ? 19.359 -13.480 -27.836 1.00 39.83 ? 41  THR D CG2 1 
ATOM   2421 N N   . ILE D 2 27  ? 16.319 -14.279 -25.882 1.00 40.86 ? 42  ILE D N   1 
ATOM   2422 C CA  . ILE D 2 27  ? 16.015 -15.293 -24.871 1.00 40.27 ? 42  ILE D CA  1 
ATOM   2423 C C   . ILE D 2 27  ? 14.851 -16.188 -25.299 1.00 40.66 ? 42  ILE D C   1 
ATOM   2424 O O   . ILE D 2 27  ? 14.908 -17.408 -25.126 1.00 39.81 ? 42  ILE D O   1 
ATOM   2425 C CB  . ILE D 2 27  ? 15.719 -14.658 -23.497 1.00 39.89 ? 42  ILE D CB  1 
ATOM   2426 C CG1 . ILE D 2 27  ? 16.973 -13.971 -22.958 1.00 38.50 ? 42  ILE D CG1 1 
ATOM   2427 C CG2 . ILE D 2 27  ? 15.214 -15.714 -22.505 1.00 39.54 ? 42  ILE D CG2 1 
ATOM   2428 C CD1 . ILE D 2 27  ? 16.725 -13.102 -21.738 1.00 37.66 ? 42  ILE D CD1 1 
ATOM   2429 N N   . LYS D 2 28  ? 13.805 -15.581 -25.857 1.00 41.74 ? 43  LYS D N   1 
ATOM   2430 C CA  . LYS D 2 28  ? 12.664 -16.336 -26.388 1.00 43.23 ? 43  LYS D CA  1 
ATOM   2431 C C   . LYS D 2 28  ? 13.119 -17.336 -27.456 1.00 43.64 ? 43  LYS D C   1 
ATOM   2432 O O   . LYS D 2 28  ? 12.600 -18.453 -27.527 1.00 44.93 ? 43  LYS D O   1 
ATOM   2433 C CB  . LYS D 2 28  ? 11.586 -15.383 -26.924 1.00 43.59 ? 43  LYS D CB  1 
ATOM   2434 C CG  . LYS D 2 28  ? 10.510 -16.026 -27.794 1.00 44.54 ? 43  LYS D CG  1 
ATOM   2435 C CD  . LYS D 2 28  ? 9.247  -15.175 -27.833 1.00 46.88 ? 43  LYS D CD  1 
ATOM   2436 C CE  . LYS D 2 28  ? 8.636  -15.117 -29.227 1.00 49.23 ? 43  LYS D CE  1 
ATOM   2437 N NZ  . LYS D 2 28  ? 8.577  -16.427 -29.935 1.00 50.21 ? 43  LYS D NZ  1 
ATOM   2438 N N   . ALA D 2 29  ? 14.100 -16.934 -28.265 1.00 44.68 ? 44  ALA D N   1 
ATOM   2439 C CA  . ALA D 2 29  ? 14.723 -17.835 -29.238 1.00 45.65 ? 44  ALA D CA  1 
ATOM   2440 C C   . ALA D 2 29  ? 15.626 -18.871 -28.564 1.00 45.79 ? 44  ALA D C   1 
ATOM   2441 O O   . ALA D 2 29  ? 15.636 -20.032 -28.973 1.00 45.72 ? 44  ALA D O   1 
ATOM   2442 C CB  . ALA D 2 29  ? 15.489 -17.052 -30.296 1.00 45.70 ? 44  ALA D CB  1 
ATOM   2443 N N   . MET D 2 30  ? 16.370 -18.452 -27.537 1.00 46.73 ? 45  MET D N   1 
ATOM   2444 C CA  . MET D 2 30  ? 17.201 -19.365 -26.740 1.00 49.15 ? 45  MET D CA  1 
ATOM   2445 C C   . MET D 2 30  ? 16.371 -20.524 -26.192 1.00 49.77 ? 45  MET D C   1 
ATOM   2446 O O   . MET D 2 30  ? 16.756 -21.683 -26.329 1.00 49.90 ? 45  MET D O   1 
ATOM   2447 C CB  . MET D 2 30  ? 17.862 -18.649 -25.559 1.00 50.65 ? 45  MET D CB  1 
ATOM   2448 C CG  . MET D 2 30  ? 18.818 -17.519 -25.902 1.00 56.43 ? 45  MET D CG  1 
ATOM   2449 S SD  . MET D 2 30  ? 20.481 -18.065 -26.291 1.00 61.45 ? 45  MET D SD  1 
ATOM   2450 C CE  . MET D 2 30  ? 21.395 -16.545 -26.043 1.00 58.98 ? 45  MET D CE  1 
ATOM   2451 N N   . LEU D 2 31  ? 15.228 -20.200 -25.584 1.00 49.78 ? 46  LEU D N   1 
ATOM   2452 C CA  . LEU D 2 31  ? 14.387 -21.192 -24.909 1.00 50.57 ? 46  LEU D CA  1 
ATOM   2453 C C   . LEU D 2 31  ? 13.422 -21.944 -25.835 1.00 51.73 ? 46  LEU D C   1 
ATOM   2454 O O   . LEU D 2 31  ? 12.667 -22.807 -25.378 1.00 51.66 ? 46  LEU D O   1 
ATOM   2455 C CB  . LEU D 2 31  ? 13.625 -20.552 -23.741 1.00 50.03 ? 46  LEU D CB  1 
ATOM   2456 C CG  . LEU D 2 31  ? 14.423 -19.797 -22.669 1.00 50.34 ? 46  LEU D CG  1 
ATOM   2457 C CD1 . LEU D 2 31  ? 13.478 -19.108 -21.692 1.00 49.56 ? 46  LEU D CD1 1 
ATOM   2458 C CD2 . LEU D 2 31  ? 15.417 -20.694 -21.927 1.00 49.69 ? 46  LEU D CD2 1 
ATOM   2459 N N   . SER D 2 32  ? 13.457 -21.624 -27.128 1.00 52.96 ? 47  SER D N   1 
ATOM   2460 C CA  . SER D 2 32  ? 12.662 -22.337 -28.132 1.00 53.70 ? 47  SER D CA  1 
ATOM   2461 C C   . SER D 2 32  ? 13.542 -23.264 -28.962 1.00 54.08 ? 47  SER D C   1 
ATOM   2462 O O   . SER D 2 32  ? 13.346 -24.481 -28.971 1.00 55.44 ? 47  SER D O   1 
ATOM   2463 C CB  . SER D 2 32  ? 11.931 -21.353 -29.051 1.00 54.19 ? 47  SER D CB  1 
ATOM   2464 N N   . ASN D 2 43  ? 15.345 -22.562 -17.401 1.00 53.93 ? 58  ASN D N   1 
ATOM   2465 C CA  . ASN D 2 43  ? 16.746 -22.950 -17.522 1.00 53.31 ? 58  ASN D CA  1 
ATOM   2466 C C   . ASN D 2 43  ? 17.719 -21.759 -17.490 1.00 52.70 ? 58  ASN D C   1 
ATOM   2467 O O   . ASN D 2 43  ? 17.341 -20.637 -17.146 1.00 51.85 ? 58  ASN D O   1 
ATOM   2468 C CB  . ASN D 2 43  ? 16.958 -23.798 -18.783 1.00 53.83 ? 58  ASN D CB  1 
ATOM   2469 C CG  . ASN D 2 43  ? 18.284 -24.547 -18.772 1.00 55.14 ? 58  ASN D CG  1 
ATOM   2470 O OD1 . ASN D 2 43  ? 18.678 -25.128 -17.756 1.00 57.17 ? 58  ASN D OD1 1 
ATOM   2471 N ND2 . ASN D 2 43  ? 18.982 -24.531 -19.904 1.00 54.12 ? 58  ASN D ND2 1 
ATOM   2472 N N   . GLU D 2 44  ? 18.968 -22.026 -17.862 1.00 51.63 ? 59  GLU D N   1 
ATOM   2473 C CA  . GLU D 2 44  ? 20.070 -21.086 -17.732 1.00 50.91 ? 59  GLU D CA  1 
ATOM   2474 C C   . GLU D 2 44  ? 20.392 -20.419 -19.067 1.00 50.19 ? 59  GLU D C   1 
ATOM   2475 O O   . GLU D 2 44  ? 20.245 -21.036 -20.121 1.00 50.05 ? 59  GLU D O   1 
ATOM   2476 C CB  . GLU D 2 44  ? 21.293 -21.838 -17.211 1.00 50.96 ? 59  GLU D CB  1 
ATOM   2477 C CG  . GLU D 2 44  ? 22.416 -20.968 -16.693 1.00 53.48 ? 59  GLU D CG  1 
ATOM   2478 C CD  . GLU D 2 44  ? 23.504 -21.776 -16.009 1.00 54.38 ? 59  GLU D CD  1 
ATOM   2479 O OE1 . GLU D 2 44  ? 24.594 -21.921 -16.603 1.00 54.64 ? 59  GLU D OE1 1 
ATOM   2480 O OE2 . GLU D 2 44  ? 23.269 -22.267 -14.882 1.00 54.39 ? 59  GLU D OE2 1 
ATOM   2481 N N   . VAL D 2 45  ? 20.812 -19.154 -19.015 1.00 48.98 ? 60  VAL D N   1 
ATOM   2482 C CA  . VAL D 2 45  ? 21.283 -18.424 -20.196 1.00 48.12 ? 60  VAL D CA  1 
ATOM   2483 C C   . VAL D 2 45  ? 22.484 -17.566 -19.806 1.00 48.07 ? 60  VAL D C   1 
ATOM   2484 O O   . VAL D 2 45  ? 22.445 -16.854 -18.805 1.00 48.50 ? 60  VAL D O   1 
ATOM   2485 C CB  . VAL D 2 45  ? 20.195 -17.520 -20.837 1.00 47.92 ? 60  VAL D CB  1 
ATOM   2486 C CG1 . VAL D 2 45  ? 20.649 -17.045 -22.204 1.00 47.97 ? 60  VAL D CG1 1 
ATOM   2487 C CG2 . VAL D 2 45  ? 18.856 -18.244 -20.965 1.00 48.80 ? 60  VAL D CG2 1 
ATOM   2488 N N   . ASN D 2 46  ? 23.541 -17.632 -20.610 1.00 48.67 ? 61  ASN D N   1 
ATOM   2489 C CA  . ASN D 2 46  ? 24.824 -17.026 -20.267 1.00 48.71 ? 61  ASN D CA  1 
ATOM   2490 C C   . ASN D 2 46  ? 25.151 -15.832 -21.149 1.00 48.57 ? 61  ASN D C   1 
ATOM   2491 O O   . ASN D 2 46  ? 25.187 -15.954 -22.372 1.00 49.92 ? 61  ASN D O   1 
ATOM   2492 C CB  . ASN D 2 46  ? 25.932 -18.075 -20.377 1.00 50.24 ? 61  ASN D CB  1 
ATOM   2493 C CG  . ASN D 2 46  ? 26.986 -17.928 -19.304 1.00 52.21 ? 61  ASN D CG  1 
ATOM   2494 O OD1 . ASN D 2 46  ? 27.570 -16.859 -19.124 1.00 55.16 ? 61  ASN D OD1 1 
ATOM   2495 N ND2 . ASN D 2 46  ? 27.241 -19.014 -18.583 1.00 53.63 ? 61  ASN D ND2 1 
ATOM   2496 N N   . PHE D 2 47  ? 25.385 -14.682 -20.521 1.00 48.09 ? 62  PHE D N   1 
ATOM   2497 C CA  . PHE D 2 47  ? 25.718 -13.455 -21.238 1.00 48.43 ? 62  PHE D CA  1 
ATOM   2498 C C   . PHE D 2 47  ? 27.114 -12.953 -20.890 1.00 49.71 ? 62  PHE D C   1 
ATOM   2499 O O   . PHE D 2 47  ? 27.282 -12.077 -20.030 1.00 50.68 ? 62  PHE D O   1 
ATOM   2500 C CB  . PHE D 2 47  ? 24.663 -12.371 -20.993 1.00 48.90 ? 62  PHE D CB  1 
ATOM   2501 C CG  . PHE D 2 47  ? 23.284 -12.761 -21.442 1.00 50.09 ? 62  PHE D CG  1 
ATOM   2502 C CD1 . PHE D 2 47  ? 23.008 -12.965 -22.792 1.00 52.08 ? 62  PHE D CD1 1 
ATOM   2503 C CD2 . PHE D 2 47  ? 22.266 -12.939 -20.521 1.00 48.23 ? 62  PHE D CD2 1 
ATOM   2504 C CE1 . PHE D 2 47  ? 21.733 -13.341 -23.213 1.00 52.08 ? 62  PHE D CE1 1 
ATOM   2505 C CE2 . PHE D 2 47  ? 20.989 -13.309 -20.934 1.00 49.07 ? 62  PHE D CE2 1 
ATOM   2506 C CZ  . PHE D 2 47  ? 20.722 -13.509 -22.280 1.00 48.05 ? 62  PHE D CZ  1 
ATOM   2507 N N   . ARG D 2 48  ? 28.102 -13.517 -21.583 1.00 48.94 ? 63  ARG D N   1 
ATOM   2508 C CA  . ARG D 2 48  ? 29.510 -13.137 -21.475 1.00 50.21 ? 63  ARG D CA  1 
ATOM   2509 C C   . ARG D 2 48  ? 29.777 -11.679 -21.831 1.00 50.06 ? 63  ARG D C   1 
ATOM   2510 O O   . ARG D 2 48  ? 30.859 -11.156 -21.553 1.00 50.22 ? 63  ARG D O   1 
ATOM   2511 C CB  . ARG D 2 48  ? 30.354 -14.000 -22.416 1.00 51.49 ? 63  ARG D CB  1 
ATOM   2512 C CG  . ARG D 2 48  ? 30.739 -15.362 -21.893 1.00 54.10 ? 63  ARG D CG  1 
ATOM   2513 C CD  . ARG D 2 48  ? 31.759 -15.982 -22.830 1.00 57.28 ? 63  ARG D CD  1 
ATOM   2514 N NE  . ARG D 2 48  ? 31.964 -17.404 -22.575 1.00 59.99 ? 63  ARG D NE  1 
ATOM   2515 C CZ  . ARG D 2 48  ? 32.699 -18.207 -23.343 1.00 61.42 ? 63  ARG D CZ  1 
ATOM   2516 N NH1 . ARG D 2 48  ? 33.305 -17.738 -24.427 1.00 60.68 ? 63  ARG D NH1 1 
ATOM   2517 N NH2 . ARG D 2 48  ? 32.821 -19.489 -23.028 1.00 61.63 ? 63  ARG D NH2 1 
ATOM   2518 N N   . GLU D 2 49  ? 28.804 -11.033 -22.463 1.00 49.30 ? 64  GLU D N   1 
ATOM   2519 C CA  . GLU D 2 49  ? 28.979 -9.670  -22.947 1.00 49.58 ? 64  GLU D CA  1 
ATOM   2520 C C   . GLU D 2 49  ? 28.425 -8.629  -21.972 1.00 48.01 ? 64  GLU D C   1 
ATOM   2521 O O   . GLU D 2 49  ? 28.940 -7.510  -21.894 1.00 48.80 ? 64  GLU D O   1 
ATOM   2522 C CB  . GLU D 2 49  ? 28.314 -9.489  -24.321 1.00 51.97 ? 64  GLU D CB  1 
ATOM   2523 C CG  . GLU D 2 49  ? 28.222 -10.749 -25.192 1.00 55.66 ? 64  GLU D CG  1 
ATOM   2524 C CD  . GLU D 2 49  ? 26.991 -11.595 -24.886 1.00 58.66 ? 64  GLU D CD  1 
ATOM   2525 O OE1 . GLU D 2 49  ? 26.995 -12.799 -25.230 1.00 61.30 ? 64  GLU D OE1 1 
ATOM   2526 O OE2 . GLU D 2 49  ? 26.022 -11.061 -24.301 1.00 59.08 ? 64  GLU D OE2 1 
ATOM   2527 N N   . ILE D 2 50  ? 27.379 -9.005  -21.234 1.00 44.38 ? 65  ILE D N   1 
ATOM   2528 C CA  . ILE D 2 50  ? 26.580 -8.051  -20.468 1.00 41.29 ? 65  ILE D CA  1 
ATOM   2529 C C   . ILE D 2 50  ? 26.901 -8.083  -18.961 1.00 40.59 ? 65  ILE D C   1 
ATOM   2530 O O   . ILE D 2 50  ? 26.723 -9.108  -18.315 1.00 39.58 ? 65  ILE D O   1 
ATOM   2531 C CB  . ILE D 2 50  ? 25.071 -8.268  -20.738 1.00 40.63 ? 65  ILE D CB  1 
ATOM   2532 C CG1 . ILE D 2 50  ? 24.826 -8.418  -22.253 1.00 42.98 ? 65  ILE D CG1 1 
ATOM   2533 C CG2 . ILE D 2 50  ? 24.261 -7.116  -20.176 1.00 39.45 ? 65  ILE D CG2 1 
ATOM   2534 C CD1 . ILE D 2 50  ? 23.444 -8.952  -22.664 1.00 40.38 ? 65  ILE D CD1 1 
ATOM   2535 N N   . PRO D 2 51  ? 27.400 -6.958  -18.407 1.00 40.49 ? 66  PRO D N   1 
ATOM   2536 C CA  . PRO D 2 51  ? 27.726 -6.879  -16.975 1.00 39.86 ? 66  PRO D CA  1 
ATOM   2537 C C   . PRO D 2 51  ? 26.506 -6.717  -16.049 1.00 39.97 ? 66  PRO D C   1 
ATOM   2538 O O   . PRO D 2 51  ? 25.428 -6.305  -16.498 1.00 39.01 ? 66  PRO D O   1 
ATOM   2539 C CB  . PRO D 2 51  ? 28.630 -5.644  -16.893 1.00 39.56 ? 66  PRO D CB  1 
ATOM   2540 C CG  . PRO D 2 51  ? 28.170 -4.776  -18.016 1.00 37.92 ? 66  PRO D CG  1 
ATOM   2541 C CD  . PRO D 2 51  ? 27.718 -5.701  -19.115 1.00 40.04 ? 66  PRO D CD  1 
ATOM   2542 N N   . SER D 2 52  ? 26.705 -7.049  -14.769 1.00 39.95 ? 67  SER D N   1 
ATOM   2543 C CA  . SER D 2 52  ? 25.691 -6.946  -13.697 1.00 39.14 ? 67  SER D CA  1 
ATOM   2544 C C   . SER D 2 52  ? 24.836 -5.693  -13.725 1.00 38.68 ? 67  SER D C   1 
ATOM   2545 O O   . SER D 2 52  ? 23.607 -5.776  -13.659 1.00 39.32 ? 67  SER D O   1 
ATOM   2546 C CB  . SER D 2 52  ? 26.363 -6.969  -12.319 1.00 37.74 ? 67  SER D CB  1 
ATOM   2547 O OG  . SER D 2 52  ? 27.076 -8.156  -12.107 1.00 46.70 ? 67  SER D OG  1 
ATOM   2548 N N   . HIS D 2 53  ? 25.490 -4.532  -13.763 1.00 37.92 ? 68  HIS D N   1 
ATOM   2549 C CA  . HIS D 2 53  ? 24.790 -3.262  -13.578 1.00 38.71 ? 68  HIS D CA  1 
ATOM   2550 C C   . HIS D 2 53  ? 23.849 -2.978  -14.746 1.00 38.79 ? 68  HIS D C   1 
ATOM   2551 O O   . HIS D 2 53  ? 22.851 -2.283  -14.592 1.00 41.82 ? 68  HIS D O   1 
ATOM   2552 C CB  . HIS D 2 53  ? 25.763 -2.104  -13.305 1.00 37.21 ? 68  HIS D CB  1 
ATOM   2553 C CG  . HIS D 2 53  ? 26.595 -1.699  -14.484 1.00 39.27 ? 68  HIS D CG  1 
ATOM   2554 N ND1 . HIS D 2 53  ? 27.758 -2.350  -14.836 1.00 41.74 ? 68  HIS D ND1 1 
ATOM   2555 C CD2 . HIS D 2 53  ? 26.453 -0.683  -15.368 1.00 40.11 ? 68  HIS D CD2 1 
ATOM   2556 C CE1 . HIS D 2 53  ? 28.293 -1.759  -15.889 1.00 37.37 ? 68  HIS D CE1 1 
ATOM   2557 N NE2 . HIS D 2 53  ? 27.518 -0.747  -16.234 1.00 40.17 ? 68  HIS D NE2 1 
ATOM   2558 N N   . VAL D 2 54  ? 24.164 -3.567  -15.894 1.00 38.27 ? 69  VAL D N   1 
ATOM   2559 C CA  . VAL D 2 54  ? 23.318 -3.502  -17.077 1.00 38.40 ? 69  VAL D CA  1 
ATOM   2560 C C   . VAL D 2 54  ? 22.232 -4.600  -17.043 1.00 38.55 ? 69  VAL D C   1 
ATOM   2561 O O   . VAL D 2 54  ? 21.039 -4.293  -17.170 1.00 38.39 ? 69  VAL D O   1 
ATOM   2562 C CB  . VAL D 2 54  ? 24.177 -3.556  -18.368 1.00 37.95 ? 69  VAL D CB  1 
ATOM   2563 C CG1 . VAL D 2 54  ? 23.318 -3.437  -19.600 1.00 37.38 ? 69  VAL D CG1 1 
ATOM   2564 C CG2 . VAL D 2 54  ? 25.199 -2.438  -18.351 1.00 37.26 ? 69  VAL D CG2 1 
ATOM   2565 N N   . LEU D 2 55  ? 22.639 -5.856  -16.832 1.00 37.12 ? 70  LEU D N   1 
ATOM   2566 C CA  . LEU D 2 55  ? 21.711 -6.995  -16.838 1.00 36.65 ? 70  LEU D CA  1 
ATOM   2567 C C   . LEU D 2 55  ? 20.611 -6.856  -15.783 1.00 37.24 ? 70  LEU D C   1 
ATOM   2568 O O   . LEU D 2 55  ? 19.467 -7.260  -16.013 1.00 38.18 ? 70  LEU D O   1 
ATOM   2569 C CB  . LEU D 2 55  ? 22.458 -8.325  -16.648 1.00 38.32 ? 70  LEU D CB  1 
ATOM   2570 C CG  . LEU D 2 55  ? 22.156 -9.532  -17.565 1.00 38.03 ? 70  LEU D CG  1 
ATOM   2571 C CD1 . LEU D 2 55  ? 22.594 -10.829 -16.915 1.00 34.83 ? 70  LEU D CD1 1 
ATOM   2572 C CD2 . LEU D 2 55  ? 20.694 -9.643  -18.019 1.00 37.63 ? 70  LEU D CD2 1 
ATOM   2573 N N   . SER D 2 56  ? 20.945 -6.278  -14.631 1.00 37.80 ? 71  SER D N   1 
ATOM   2574 C CA  . SER D 2 56  ? 19.919 -5.957  -13.633 1.00 38.47 ? 71  SER D CA  1 
ATOM   2575 C C   . SER D 2 56  ? 18.864 -4.978  -14.159 1.00 36.96 ? 71  SER D C   1 
ATOM   2576 O O   . SER D 2 56  ? 17.686 -5.208  -13.951 1.00 38.11 ? 71  SER D O   1 
ATOM   2577 C CB  . SER D 2 56  ? 20.525 -5.453  -12.318 1.00 36.93 ? 71  SER D CB  1 
ATOM   2578 O OG  . SER D 2 56  ? 21.295 -4.293  -12.532 1.00 45.15 ? 71  SER D OG  1 
ATOM   2579 N N   . LYS D 2 57  ? 19.280 -3.907  -14.842 1.00 36.91 ? 72  LYS D N   1 
ATOM   2580 C CA  . LYS D 2 57  ? 18.321 -2.961  -15.448 1.00 39.79 ? 72  LYS D CA  1 
ATOM   2581 C C   . LYS D 2 57  ? 17.417 -3.590  -16.511 1.00 39.70 ? 72  LYS D C   1 
ATOM   2582 O O   . LYS D 2 57  ? 16.239 -3.229  -16.632 1.00 39.73 ? 72  LYS D O   1 
ATOM   2583 C CB  . LYS D 2 57  ? 19.025 -1.748  -16.056 1.00 41.57 ? 72  LYS D CB  1 
ATOM   2584 C CG  . LYS D 2 57  ? 18.997 -0.529  -15.187 1.00 48.16 ? 72  LYS D CG  1 
ATOM   2585 C CD  . LYS D 2 57  ? 17.615 0.078   -15.072 1.00 47.81 ? 72  LYS D CD  1 
ATOM   2586 C CE  . LYS D 2 57  ? 17.621 1.086   -13.941 1.00 44.58 ? 72  LYS D CE  1 
ATOM   2587 N NZ  . LYS D 2 57  ? 16.259 1.266   -13.385 1.00 51.19 ? 72  LYS D NZ  1 
ATOM   2588 N N   . VAL D 2 58  ? 17.978 -4.513  -17.285 1.00 38.58 ? 73  VAL D N   1 
ATOM   2589 C CA  . VAL D 2 58  ? 17.206 -5.222  -18.291 1.00 38.48 ? 73  VAL D CA  1 
ATOM   2590 C C   . VAL D 2 58  ? 16.052 -5.995  -17.622 1.00 40.33 ? 73  VAL D C   1 
ATOM   2591 O O   . VAL D 2 58  ? 14.903 -5.874  -18.043 1.00 40.03 ? 73  VAL D O   1 
ATOM   2592 C CB  . VAL D 2 58  ? 18.108 -6.125  -19.165 1.00 38.69 ? 73  VAL D CB  1 
ATOM   2593 C CG1 . VAL D 2 58  ? 17.280 -6.856  -20.197 1.00 38.92 ? 73  VAL D CG1 1 
ATOM   2594 C CG2 . VAL D 2 58  ? 19.212 -5.289  -19.865 1.00 31.94 ? 73  VAL D CG2 1 
ATOM   2595 N N   . CYS D 2 59  ? 16.355 -6.751  -16.562 1.00 40.45 ? 74  CYS D N   1 
ATOM   2596 C CA  . CYS D 2 59  ? 15.338 -7.514  -15.831 1.00 39.14 ? 74  CYS D CA  1 
ATOM   2597 C C   . CYS D 2 59  ? 14.256 -6.616  -15.206 1.00 39.70 ? 74  CYS D C   1 
ATOM   2598 O O   . CYS D 2 59  ? 13.088 -6.992  -15.137 1.00 41.55 ? 74  CYS D O   1 
ATOM   2599 C CB  . CYS D 2 59  ? 15.987 -8.389  -14.756 1.00 39.05 ? 74  CYS D CB  1 
ATOM   2600 S SG  . CYS D 2 59  ? 17.167 -9.608  -15.391 1.00 44.87 ? 74  CYS D SG  1 
ATOM   2601 N N   . MET D 2 60  ? 14.642 -5.433  -14.747 1.00 36.33 ? 75  MET D N   1 
ATOM   2602 C CA  . MET D 2 60  ? 13.667 -4.480  -14.236 1.00 36.78 ? 75  MET D CA  1 
ATOM   2603 C C   . MET D 2 60  ? 12.763 -4.015  -15.381 1.00 38.20 ? 75  MET D C   1 
ATOM   2604 O O   . MET D 2 60  ? 11.562 -3.812  -15.184 1.00 37.73 ? 75  MET D O   1 
ATOM   2605 C CB  . MET D 2 60  ? 14.354 -3.290  -13.554 1.00 37.67 ? 75  MET D CB  1 
ATOM   2606 C CG  . MET D 2 60  ? 15.309 -3.662  -12.399 1.00 34.48 ? 75  MET D CG  1 
ATOM   2607 S SD  . MET D 2 60  ? 16.216 -2.211  -11.837 1.00 36.98 ? 75  MET D SD  1 
ATOM   2608 C CE  . MET D 2 60  ? 17.278 -2.881  -10.549 1.00 32.79 ? 75  MET D CE  1 
ATOM   2609 N N   . TYR D 2 61  ? 13.335 -3.872  -16.579 1.00 38.00 ? 76  TYR D N   1 
ATOM   2610 C CA  . TYR D 2 61  ? 12.539 -3.557  -17.768 1.00 35.89 ? 76  TYR D CA  1 
ATOM   2611 C C   . TYR D 2 61  ? 11.489 -4.627  -18.082 1.00 35.27 ? 76  TYR D C   1 
ATOM   2612 O O   . TYR D 2 61  ? 10.346 -4.287  -18.382 1.00 37.63 ? 76  TYR D O   1 
ATOM   2613 C CB  . TYR D 2 61  ? 13.412 -3.293  -19.001 1.00 34.37 ? 76  TYR D CB  1 
ATOM   2614 C CG  . TYR D 2 61  ? 12.584 -3.035  -20.244 1.00 33.96 ? 76  TYR D CG  1 
ATOM   2615 C CD1 . TYR D 2 61  ? 11.917 -1.820  -20.418 1.00 32.94 ? 76  TYR D CD1 1 
ATOM   2616 C CD2 . TYR D 2 61  ? 12.441 -4.013  -21.226 1.00 33.79 ? 76  TYR D CD2 1 
ATOM   2617 C CE1 . TYR D 2 61  ? 11.137 -1.581  -21.547 1.00 35.84 ? 76  TYR D CE1 1 
ATOM   2618 C CE2 . TYR D 2 61  ? 11.667 -3.784  -22.363 1.00 35.40 ? 76  TYR D CE2 1 
ATOM   2619 C CZ  . TYR D 2 61  ? 11.018 -2.566  -22.513 1.00 36.12 ? 76  TYR D CZ  1 
ATOM   2620 O OH  . TYR D 2 61  ? 10.251 -2.331  -23.625 1.00 35.01 ? 76  TYR D OH  1 
ATOM   2621 N N   . PHE D 2 62  ? 11.873 -5.904  -18.026 1.00 34.21 ? 77  PHE D N   1 
ATOM   2622 C CA  . PHE D 2 62  ? 10.939 -7.007  -18.286 1.00 34.40 ? 77  PHE D CA  1 
ATOM   2623 C C   . PHE D 2 62  ? 9.669  -6.845  -17.457 1.00 36.08 ? 77  PHE D C   1 
ATOM   2624 O O   . PHE D 2 62  ? 8.561  -6.862  -17.995 1.00 38.40 ? 77  PHE D O   1 
ATOM   2625 C CB  . PHE D 2 62  ? 11.569 -8.385  -17.982 1.00 36.51 ? 77  PHE D CB  1 
ATOM   2626 C CG  . PHE D 2 62  ? 12.767 -8.756  -18.857 1.00 36.03 ? 77  PHE D CG  1 
ATOM   2627 C CD1 . PHE D 2 62  ? 12.971 -8.172  -20.114 1.00 34.36 ? 77  PHE D CD1 1 
ATOM   2628 C CD2 . PHE D 2 62  ? 13.671 -9.734  -18.421 1.00 35.57 ? 77  PHE D CD2 1 
ATOM   2629 C CE1 . PHE D 2 62  ? 14.073 -8.528  -20.905 1.00 34.93 ? 77  PHE D CE1 1 
ATOM   2630 C CE2 . PHE D 2 62  ? 14.776 -10.105 -19.207 1.00 33.77 ? 77  PHE D CE2 1 
ATOM   2631 C CZ  . PHE D 2 62  ? 14.973 -9.501  -20.455 1.00 35.67 ? 77  PHE D CZ  1 
ATOM   2632 N N   . THR D 2 63  ? 9.846  -6.671  -16.147 1.00 36.00 ? 78  THR D N   1 
ATOM   2633 C CA  . THR D 2 63  ? 8.745  -6.560  -15.190 1.00 36.28 ? 78  THR D CA  1 
ATOM   2634 C C   . THR D 2 63  ? 7.937  -5.291  -15.430 1.00 34.50 ? 78  THR D C   1 
ATOM   2635 O O   . THR D 2 63  ? 6.700  -5.296  -15.373 1.00 35.50 ? 78  THR D O   1 
ATOM   2636 C CB  . THR D 2 63  ? 9.287  -6.558  -13.733 1.00 36.60 ? 78  THR D CB  1 
ATOM   2637 O OG1 . THR D 2 63  ? 10.090 -7.724  -13.520 1.00 41.20 ? 78  THR D OG1 1 
ATOM   2638 C CG2 . THR D 2 63  ? 8.158  -6.559  -12.741 1.00 37.18 ? 78  THR D CG2 1 
ATOM   2639 N N   . TYR D 2 64  ? 8.664  -4.210  -15.682 1.00 33.89 ? 79  TYR D N   1 
ATOM   2640 C CA  . TYR D 2 64  ? 8.106  -2.904  -15.989 1.00 33.48 ? 79  TYR D CA  1 
ATOM   2641 C C   . TYR D 2 64  ? 7.220  -2.969  -17.235 1.00 31.92 ? 79  TYR D C   1 
ATOM   2642 O O   . TYR D 2 64  ? 6.072  -2.530  -17.197 1.00 30.13 ? 79  TYR D O   1 
ATOM   2643 C CB  . TYR D 2 64  ? 9.246  -1.891  -16.158 1.00 32.95 ? 79  TYR D CB  1 
ATOM   2644 C CG  . TYR D 2 64  ? 8.849  -0.544  -16.722 1.00 36.24 ? 79  TYR D CG  1 
ATOM   2645 C CD1 . TYR D 2 64  ? 8.265  0.434   -15.914 1.00 37.99 ? 79  TYR D CD1 1 
ATOM   2646 C CD2 . TYR D 2 64  ? 9.074  -0.240  -18.063 1.00 34.88 ? 79  TYR D CD2 1 
ATOM   2647 C CE1 . TYR D 2 64  ? 7.914  1.688   -16.438 1.00 38.19 ? 79  TYR D CE1 1 
ATOM   2648 C CE2 . TYR D 2 64  ? 8.735  0.995   -18.587 1.00 36.01 ? 79  TYR D CE2 1 
ATOM   2649 C CZ  . TYR D 2 64  ? 8.157  1.951   -17.777 1.00 37.41 ? 79  TYR D CZ  1 
ATOM   2650 O OH  . TYR D 2 64  ? 7.827  3.165   -18.320 1.00 39.47 ? 79  TYR D OH  1 
ATOM   2651 N N   . LYS D 2 65  ? 7.749  -3.549  -18.312 1.00 32.80 ? 80  LYS D N   1 
ATOM   2652 C CA  . LYS D 2 65  ? 6.995  -3.737  -19.559 1.00 34.27 ? 80  LYS D CA  1 
ATOM   2653 C C   . LYS D 2 65  ? 5.742  -4.596  -19.382 1.00 33.67 ? 80  LYS D C   1 
ATOM   2654 O O   . LYS D 2 65  ? 4.674  -4.240  -19.865 1.00 33.18 ? 80  LYS D O   1 
ATOM   2655 C CB  . LYS D 2 65  ? 7.874  -4.345  -20.647 1.00 34.70 ? 80  LYS D CB  1 
ATOM   2656 C CG  . LYS D 2 65  ? 7.310  -4.139  -22.035 1.00 38.57 ? 80  LYS D CG  1 
ATOM   2657 C CD  . LYS D 2 65  ? 7.729  -5.231  -22.991 1.00 41.58 ? 80  LYS D CD  1 
ATOM   2658 C CE  . LYS D 2 65  ? 7.725  -4.742  -24.436 1.00 43.76 ? 80  LYS D CE  1 
ATOM   2659 N NZ  . LYS D 2 65  ? 6.474  -4.016  -24.767 1.00 45.81 ? 80  LYS D NZ  1 
ATOM   2660 N N   . VAL D 2 66  ? 5.874  -5.721  -18.687 1.00 33.09 ? 81  VAL D N   1 
ATOM   2661 C CA  . VAL D 2 66  ? 4.737  -6.622  -18.475 1.00 34.03 ? 81  VAL D CA  1 
ATOM   2662 C C   . VAL D 2 66  ? 3.629  -5.951  -17.627 1.00 35.52 ? 81  VAL D C   1 
ATOM   2663 O O   . VAL D 2 66  ? 2.436  -6.159  -17.868 1.00 33.87 ? 81  VAL D O   1 
ATOM   2664 C CB  . VAL D 2 66  ? 5.204  -7.978  -17.874 1.00 33.27 ? 81  VAL D CB  1 
ATOM   2665 C CG1 . VAL D 2 66  ? 4.036  -8.770  -17.287 1.00 31.23 ? 81  VAL D CG1 1 
ATOM   2666 C CG2 . VAL D 2 66  ? 5.929  -8.794  -18.934 1.00 30.25 ? 81  VAL D CG2 1 
ATOM   2667 N N   . ARG D 2 67  ? 4.042  -5.132  -16.659 1.00 36.16 ? 82  ARG D N   1 
ATOM   2668 C CA  . ARG D 2 67  ? 3.121  -4.376  -15.810 1.00 34.95 ? 82  ARG D CA  1 
ATOM   2669 C C   . ARG D 2 67  ? 2.334  -3.320  -16.558 1.00 35.45 ? 82  ARG D C   1 
ATOM   2670 O O   . ARG D 2 67  ? 1.110  -3.251  -16.444 1.00 33.55 ? 82  ARG D O   1 
ATOM   2671 C CB  . ARG D 2 67  ? 3.899  -3.680  -14.701 1.00 36.78 ? 82  ARG D CB  1 
ATOM   2672 C CG  . ARG D 2 67  ? 3.695  -4.266  -13.352 1.00 37.59 ? 82  ARG D CG  1 
ATOM   2673 C CD  . ARG D 2 67  ? 2.704  -3.446  -12.575 1.00 39.15 ? 82  ARG D CD  1 
ATOM   2674 N NE  . ARG D 2 67  ? 1.903  -4.314  -11.723 1.00 42.08 ? 82  ARG D NE  1 
ATOM   2675 C CZ  . ARG D 2 67  ? 1.247  -3.919  -10.642 1.00 39.33 ? 82  ARG D CZ  1 
ATOM   2676 N NH1 . ARG D 2 67  ? 1.284  -2.654  -10.243 1.00 39.51 ? 82  ARG D NH1 1 
ATOM   2677 N NH2 . ARG D 2 67  ? 0.557  -4.806  -9.957  1.00 40.58 ? 82  ARG D NH2 1 
ATOM   2678 N N   . TYR D 2 68  ? 3.042  -2.490  -17.319 1.00 36.76 ? 83  TYR D N   1 
ATOM   2679 C CA  . TYR D 2 68  ? 2.444  -1.267  -17.847 1.00 39.07 ? 83  TYR D CA  1 
ATOM   2680 C C   . TYR D 2 68  ? 2.035  -1.336  -19.310 1.00 40.11 ? 83  TYR D C   1 
ATOM   2681 O O   . TYR D 2 68  ? 1.524  -0.360  -19.860 1.00 41.32 ? 83  TYR D O   1 
ATOM   2682 C CB  . TYR D 2 68  ? 3.350  -0.064  -17.563 1.00 37.23 ? 83  TYR D CB  1 
ATOM   2683 C CG  . TYR D 2 68  ? 3.526  0.175   -16.081 1.00 38.75 ? 83  TYR D CG  1 
ATOM   2684 C CD1 . TYR D 2 68  ? 2.493  0.721   -15.313 1.00 35.92 ? 83  TYR D CD1 1 
ATOM   2685 C CD2 . TYR D 2 68  ? 4.720  -0.163  -15.441 1.00 36.82 ? 83  TYR D CD2 1 
ATOM   2686 C CE1 . TYR D 2 68  ? 2.652  0.928   -13.939 1.00 38.16 ? 83  TYR D CE1 1 
ATOM   2687 C CE2 . TYR D 2 68  ? 4.888  0.044   -14.076 1.00 38.46 ? 83  TYR D CE2 1 
ATOM   2688 C CZ  . TYR D 2 68  ? 3.851  0.582   -13.332 1.00 39.23 ? 83  TYR D CZ  1 
ATOM   2689 O OH  . TYR D 2 68  ? 4.028  0.784   -11.985 1.00 42.76 ? 83  TYR D OH  1 
ATOM   2690 N N   . THR D 2 69  ? 2.241  -2.492  -19.931 1.00 42.51 ? 84  THR D N   1 
ATOM   2691 C CA  . THR D 2 69  ? 1.795  -2.699  -21.299 1.00 46.92 ? 84  THR D CA  1 
ATOM   2692 C C   . THR D 2 69  ? 0.259  -2.791  -21.280 1.00 49.85 ? 84  THR D C   1 
ATOM   2693 O O   . THR D 2 69  ? -0.314 -3.530  -20.473 1.00 51.07 ? 84  THR D O   1 
ATOM   2694 C CB  . THR D 2 69  ? 2.516  -3.920  -21.950 1.00 46.20 ? 84  THR D CB  1 
ATOM   2695 O OG1 . THR D 2 69  ? 3.118  -3.523  -23.188 1.00 48.79 ? 84  THR D OG1 1 
ATOM   2696 C CG2 . THR D 2 69  ? 1.590  -5.117  -22.166 1.00 45.75 ? 84  THR D CG2 1 
ATOM   2697 N N   . ASN D 2 70  ? -0.394 -1.999  -22.128 1.00 52.32 ? 85  ASN D N   1 
ATOM   2698 C CA  . ASN D 2 70  ? -1.866 -1.856  -22.128 1.00 55.09 ? 85  ASN D CA  1 
ATOM   2699 C C   . ASN D 2 70  ? -2.449 -1.226  -20.854 1.00 56.87 ? 85  ASN D C   1 
ATOM   2700 O O   . ASN D 2 70  ? -3.564 -1.563  -20.446 1.00 57.33 ? 85  ASN D O   1 
ATOM   2701 C CB  . ASN D 2 70  ? -2.564 -3.192  -22.426 1.00 55.27 ? 85  ASN D CB  1 
ATOM   2702 C CG  . ASN D 2 70  ? -2.033 -3.866  -23.671 1.00 56.72 ? 85  ASN D CG  1 
ATOM   2703 O OD1 . ASN D 2 70  ? -1.541 -4.992  -23.611 1.00 58.25 ? 85  ASN D OD1 1 
ATOM   2704 N ND2 . ASN D 2 70  ? -2.121 -3.180  -24.808 1.00 56.73 ? 85  ASN D ND2 1 
ATOM   2705 N N   . SER D 2 71  ? -1.700 -0.310  -20.238 1.00 58.83 ? 86  SER D N   1 
ATOM   2706 C CA  . SER D 2 71  ? -2.151 0.384   -19.028 1.00 61.35 ? 86  SER D CA  1 
ATOM   2707 C C   . SER D 2 71  ? -3.176 1.476   -19.341 1.00 63.84 ? 86  SER D C   1 
ATOM   2708 O O   . SER D 2 71  ? -3.110 2.119   -20.396 1.00 64.77 ? 86  SER D O   1 
ATOM   2709 C CB  . SER D 2 71  ? -0.964 0.979   -18.269 1.00 60.99 ? 86  SER D CB  1 
ATOM   2710 O OG  . SER D 2 71  ? -1.335 1.337   -16.950 1.00 60.40 ? 86  SER D OG  1 
ATOM   2711 N N   . SER D 2 72  ? -4.116 1.677   -18.416 1.00 65.55 ? 87  SER D N   1 
ATOM   2712 C CA  . SER D 2 72  ? -5.209 2.644   -18.585 1.00 66.86 ? 87  SER D CA  1 
ATOM   2713 C C   . SER D 2 72  ? -4.746 4.092   -18.415 1.00 67.43 ? 87  SER D C   1 
ATOM   2714 O O   . SER D 2 72  ? -5.063 4.955   -19.242 1.00 67.56 ? 87  SER D O   1 
ATOM   2715 C CB  . SER D 2 72  ? -6.348 2.347   -17.603 1.00 66.87 ? 87  SER D CB  1 
ATOM   2716 O OG  . SER D 2 72  ? -6.754 0.993   -17.675 1.00 67.73 ? 87  SER D OG  1 
ATOM   2717 N N   . THR D 2 73  ? -4.007 4.346   -17.335 1.00 67.57 ? 88  THR D N   1 
ATOM   2718 C CA  . THR D 2 73  ? -3.493 5.681   -17.021 1.00 67.56 ? 88  THR D CA  1 
ATOM   2719 C C   . THR D 2 73  ? -2.092 5.888   -17.604 1.00 67.50 ? 88  THR D C   1 
ATOM   2720 O O   . THR D 2 73  ? -1.589 5.035   -18.344 1.00 67.91 ? 88  THR D O   1 
ATOM   2721 C CB  . THR D 2 73  ? -3.459 5.931   -15.493 1.00 67.64 ? 88  THR D CB  1 
ATOM   2722 O OG1 . THR D 2 73  ? -2.771 4.854   -14.844 1.00 67.54 ? 88  THR D OG1 1 
ATOM   2723 C CG2 . THR D 2 73  ? -4.874 6.055   -14.926 1.00 67.81 ? 88  THR D CG2 1 
ATOM   2724 N N   . GLU D 2 74  ? -1.477 7.026   -17.273 1.00 66.64 ? 89  GLU D N   1 
ATOM   2725 C CA  . GLU D 2 74  ? -0.109 7.339   -17.702 1.00 64.44 ? 89  GLU D CA  1 
ATOM   2726 C C   . GLU D 2 74  ? 0.881  6.401   -17.024 1.00 61.68 ? 89  GLU D C   1 
ATOM   2727 O O   . GLU D 2 74  ? 0.743  6.085   -15.839 1.00 62.62 ? 89  GLU D O   1 
ATOM   2728 C CB  . GLU D 2 74  ? 0.268  8.796   -17.391 1.00 65.31 ? 89  GLU D CB  1 
ATOM   2729 C CG  . GLU D 2 74  ? -0.691 9.859   -17.929 1.00 66.95 ? 89  GLU D CG  1 
ATOM   2730 C CD  . GLU D 2 74  ? -1.814 10.207  -16.957 1.00 69.22 ? 89  GLU D CD  1 
ATOM   2731 O OE1 . GLU D 2 74  ? -1.860 9.627   -15.847 1.00 69.61 ? 89  GLU D OE1 1 
ATOM   2732 O OE2 . GLU D 2 74  ? -2.653 11.068  -17.305 1.00 69.90 ? 89  GLU D OE2 1 
ATOM   2733 N N   . ILE D 2 75  ? 1.871  5.966   -17.793 1.00 58.01 ? 90  ILE D N   1 
ATOM   2734 C CA  . ILE D 2 75  ? 2.898  5.038   -17.338 1.00 54.90 ? 90  ILE D CA  1 
ATOM   2735 C C   . ILE D 2 75  ? 4.025  5.806   -16.631 1.00 52.70 ? 90  ILE D C   1 
ATOM   2736 O O   . ILE D 2 75  ? 4.432  6.866   -17.103 1.00 53.02 ? 90  ILE D O   1 
ATOM   2737 C CB  . ILE D 2 75  ? 3.446  4.224   -18.542 1.00 54.48 ? 90  ILE D CB  1 
ATOM   2738 C CG1 . ILE D 2 75  ? 2.342  3.338   -19.128 1.00 53.29 ? 90  ILE D CG1 1 
ATOM   2739 C CG2 . ILE D 2 75  ? 4.640  3.368   -18.147 1.00 55.17 ? 90  ILE D CG2 1 
ATOM   2740 C CD1 . ILE D 2 75  ? 2.571  2.951   -20.570 1.00 52.67 ? 90  ILE D CD1 1 
ATOM   2741 N N   . PRO D 2 76  ? 4.516  5.285   -15.486 1.00 50.80 ? 91  PRO D N   1 
ATOM   2742 C CA  . PRO D 2 76  ? 5.645  5.915   -14.798 1.00 49.49 ? 91  PRO D CA  1 
ATOM   2743 C C   . PRO D 2 76  ? 6.945  5.837   -15.596 1.00 47.57 ? 91  PRO D C   1 
ATOM   2744 O O   . PRO D 2 76  ? 7.124  4.926   -16.405 1.00 45.39 ? 91  PRO D O   1 
ATOM   2745 C CB  . PRO D 2 76  ? 5.766  5.103   -13.504 1.00 49.44 ? 91  PRO D CB  1 
ATOM   2746 C CG  . PRO D 2 76  ? 5.165  3.794   -13.826 1.00 50.54 ? 91  PRO D CG  1 
ATOM   2747 C CD  . PRO D 2 76  ? 4.035  4.097   -14.758 1.00 50.93 ? 91  PRO D CD  1 
ATOM   2748 N N   . GLU D 2 77  ? 7.828  6.805   -15.367 1.00 47.13 ? 92  GLU D N   1 
ATOM   2749 C CA  . GLU D 2 77  ? 9.126  6.863   -16.038 1.00 47.97 ? 92  GLU D CA  1 
ATOM   2750 C C   . GLU D 2 77  ? 9.990  5.652   -15.694 1.00 44.96 ? 92  GLU D C   1 
ATOM   2751 O O   . GLU D 2 77  ? 9.987  5.168   -14.560 1.00 45.72 ? 92  GLU D O   1 
ATOM   2752 C CB  . GLU D 2 77  ? 9.869  8.152   -15.662 1.00 50.05 ? 92  GLU D CB  1 
ATOM   2753 C CG  . GLU D 2 77  ? 9.269  9.444   -16.244 1.00 57.10 ? 92  GLU D CG  1 
ATOM   2754 C CD  . GLU D 2 77  ? 9.766  9.768   -17.655 1.00 63.38 ? 92  GLU D CD  1 
ATOM   2755 O OE1 . GLU D 2 77  ? 10.995 9.684   -17.895 1.00 64.25 ? 92  GLU D OE1 1 
ATOM   2756 O OE2 . GLU D 2 77  ? 8.925  10.121  -18.519 1.00 64.28 ? 92  GLU D OE2 1 
ATOM   2757 N N   . PHE D 2 78  ? 10.718 5.156   -16.684 1.00 43.01 ? 93  PHE D N   1 
ATOM   2758 C CA  . PHE D 2 78  ? 11.699 4.114   -16.453 1.00 40.60 ? 93  PHE D CA  1 
ATOM   2759 C C   . PHE D 2 78  ? 13.055 4.782   -16.234 1.00 41.50 ? 93  PHE D C   1 
ATOM   2760 O O   . PHE D 2 78  ? 13.625 5.333   -17.173 1.00 41.56 ? 93  PHE D O   1 
ATOM   2761 C CB  . PHE D 2 78  ? 11.748 3.149   -17.633 1.00 37.78 ? 93  PHE D CB  1 
ATOM   2762 C CG  . PHE D 2 78  ? 12.608 1.941   -17.389 1.00 37.53 ? 93  PHE D CG  1 
ATOM   2763 C CD1 . PHE D 2 78  ? 12.187 0.934   -16.533 1.00 32.90 ? 93  PHE D CD1 1 
ATOM   2764 C CD2 . PHE D 2 78  ? 13.840 1.808   -18.027 1.00 36.04 ? 93  PHE D CD2 1 
ATOM   2765 C CE1 . PHE D 2 78  ? 12.990 -0.188  -16.310 1.00 35.04 ? 93  PHE D CE1 1 
ATOM   2766 C CE2 . PHE D 2 78  ? 14.644 0.697   -17.817 1.00 33.97 ? 93  PHE D CE2 1 
ATOM   2767 C CZ  . PHE D 2 78  ? 14.223 -0.303  -16.955 1.00 34.63 ? 93  PHE D CZ  1 
ATOM   2768 N N   . PRO D 2 79  ? 13.578 4.732   -14.992 1.00 42.65 ? 94  PRO D N   1 
ATOM   2769 C CA  . PRO D 2 79  ? 14.782 5.498   -14.689 1.00 42.61 ? 94  PRO D CA  1 
ATOM   2770 C C   . PRO D 2 79  ? 16.002 4.824   -15.285 1.00 41.26 ? 94  PRO D C   1 
ATOM   2771 O O   . PRO D 2 79  ? 16.200 3.623   -15.105 1.00 39.93 ? 94  PRO D O   1 
ATOM   2772 C CB  . PRO D 2 79  ? 14.857 5.481   -13.149 1.00 41.96 ? 94  PRO D CB  1 
ATOM   2773 C CG  . PRO D 2 79  ? 13.650 4.727   -12.672 1.00 42.19 ? 94  PRO D CG  1 
ATOM   2774 C CD  . PRO D 2 79  ? 13.128 3.946   -13.829 1.00 42.63 ? 94  PRO D CD  1 
ATOM   2775 N N   . ILE D 2 80  ? 16.788 5.599   -16.021 1.00 40.14 ? 95  ILE D N   1 
ATOM   2776 C CA  . ILE D 2 80  ? 18.029 5.115   -16.598 1.00 40.13 ? 95  ILE D CA  1 
ATOM   2777 C C   . ILE D 2 80  ? 19.085 6.184   -16.377 1.00 40.11 ? 95  ILE D C   1 
ATOM   2778 O O   . ILE D 2 80  ? 18.971 7.287   -16.914 1.00 41.29 ? 95  ILE D O   1 
ATOM   2779 C CB  . ILE D 2 80  ? 17.904 4.839   -18.121 1.00 40.10 ? 95  ILE D CB  1 
ATOM   2780 C CG1 . ILE D 2 80  ? 16.837 3.776   -18.405 1.00 37.18 ? 95  ILE D CG1 1 
ATOM   2781 C CG2 . ILE D 2 80  ? 19.261 4.418   -18.699 1.00 40.36 ? 95  ILE D CG2 1 
ATOM   2782 C CD1 . ILE D 2 80  ? 16.541 3.566   -19.894 1.00 36.80 ? 95  ILE D CD1 1 
ATOM   2783 N N   . ALA D 2 81  ? 20.094 5.861   -15.571 1.00 39.49 ? 96  ALA D N   1 
ATOM   2784 C CA  . ALA D 2 81  ? 21.256 6.730   -15.403 1.00 38.39 ? 96  ALA D CA  1 
ATOM   2785 C C   . ALA D 2 81  ? 21.956 6.867   -16.754 1.00 37.70 ? 96  ALA D C   1 
ATOM   2786 O O   . ALA D 2 81  ? 22.249 5.856   -17.394 1.00 39.56 ? 96  ALA D O   1 
ATOM   2787 C CB  . ALA D 2 81  ? 22.204 6.153   -14.365 1.00 36.67 ? 96  ALA D CB  1 
ATOM   2788 N N   . PRO D 2 82  ? 22.171 8.110   -17.224 1.00 36.23 ? 97  PRO D N   1 
ATOM   2789 C CA  . PRO D 2 82  ? 22.945 8.347   -18.450 1.00 36.24 ? 97  PRO D CA  1 
ATOM   2790 C C   . PRO D 2 82  ? 24.280 7.579   -18.504 1.00 37.16 ? 97  PRO D C   1 
ATOM   2791 O O   . PRO D 2 82  ? 24.718 7.192   -19.596 1.00 35.39 ? 97  PRO D O   1 
ATOM   2792 C CB  . PRO D 2 82  ? 23.193 9.868   -18.438 1.00 37.04 ? 97  PRO D CB  1 
ATOM   2793 C CG  . PRO D 2 82  ? 22.637 10.383  -17.139 1.00 37.20 ? 97  PRO D CG  1 
ATOM   2794 C CD  . PRO D 2 82  ? 21.647 9.364   -16.660 1.00 36.21 ? 97  PRO D CD  1 
ATOM   2795 N N   . GLU D 2 83  ? 24.899 7.361   -17.339 1.00 37.66 ? 98  GLU D N   1 
ATOM   2796 C CA  . GLU D 2 83  ? 26.137 6.574   -17.206 1.00 39.04 ? 98  GLU D CA  1 
ATOM   2797 C C   . GLU D 2 83  ? 26.031 5.182   -17.824 1.00 39.50 ? 98  GLU D C   1 
ATOM   2798 O O   . GLU D 2 83  ? 26.984 4.697   -18.423 1.00 40.83 ? 98  GLU D O   1 
ATOM   2799 C CB  . GLU D 2 83  ? 26.535 6.416   -15.731 1.00 40.29 ? 98  GLU D CB  1 
ATOM   2800 C CG  . GLU D 2 83  ? 27.037 7.682   -15.043 1.00 43.56 ? 98  GLU D CG  1 
ATOM   2801 C CD  . GLU D 2 83  ? 25.936 8.493   -14.367 1.00 46.39 ? 98  GLU D CD  1 
ATOM   2802 O OE1 . GLU D 2 83  ? 26.272 9.315   -13.487 1.00 48.64 ? 98  GLU D OE1 1 
ATOM   2803 O OE2 . GLU D 2 83  ? 24.744 8.319   -14.706 1.00 46.81 ? 98  GLU D OE2 1 
ATOM   2804 N N   . ILE D 2 84  ? 24.875 4.541   -17.673 1.00 39.39 ? 99  ILE D N   1 
ATOM   2805 C CA  . ILE D 2 84  ? 24.695 3.170   -18.164 1.00 40.20 ? 99  ILE D CA  1 
ATOM   2806 C C   . ILE D 2 84  ? 23.972 3.093   -19.514 1.00 39.93 ? 99  ILE D C   1 
ATOM   2807 O O   . ILE D 2 84  ? 23.879 2.020   -20.107 1.00 40.90 ? 99  ILE D O   1 
ATOM   2808 C CB  . ILE D 2 84  ? 23.954 2.278   -17.137 1.00 39.92 ? 99  ILE D CB  1 
ATOM   2809 C CG1 . ILE D 2 84  ? 22.459 2.615   -17.102 1.00 40.39 ? 99  ILE D CG1 1 
ATOM   2810 C CG2 . ILE D 2 84  ? 24.615 2.376   -15.751 1.00 37.80 ? 99  ILE D CG2 1 
ATOM   2811 C CD1 . ILE D 2 84  ? 21.602 1.507   -16.539 1.00 41.43 ? 99  ILE D CD1 1 
ATOM   2812 N N   . ALA D 2 85  ? 23.484 4.237   -19.992 1.00 40.19 ? 100 ALA D N   1 
ATOM   2813 C CA  . ALA D 2 85  ? 22.617 4.300   -21.168 1.00 38.92 ? 100 ALA D CA  1 
ATOM   2814 C C   . ALA D 2 85  ? 23.193 3.628   -22.424 1.00 39.45 ? 100 ALA D C   1 
ATOM   2815 O O   . ALA D 2 85  ? 22.499 2.828   -23.065 1.00 42.48 ? 100 ALA D O   1 
ATOM   2816 C CB  . ALA D 2 85  ? 22.197 5.733   -21.444 1.00 38.66 ? 100 ALA D CB  1 
ATOM   2817 N N   . LEU D 2 86  ? 24.451 3.918   -22.764 1.00 37.80 ? 101 LEU D N   1 
ATOM   2818 C CA  . LEU D 2 86  ? 25.064 3.315   -23.964 1.00 38.56 ? 101 LEU D CA  1 
ATOM   2819 C C   . LEU D 2 86  ? 25.208 1.793   -23.853 1.00 38.15 ? 101 LEU D C   1 
ATOM   2820 O O   . LEU D 2 86  ? 24.889 1.066   -24.795 1.00 38.23 ? 101 LEU D O   1 
ATOM   2821 C CB  . LEU D 2 86  ? 26.422 3.938   -24.298 1.00 38.43 ? 101 LEU D CB  1 
ATOM   2822 C CG  . LEU D 2 86  ? 26.765 4.257   -25.766 1.00 40.67 ? 101 LEU D CG  1 
ATOM   2823 C CD1 . LEU D 2 86  ? 28.199 3.836   -26.084 1.00 41.36 ? 101 LEU D CD1 1 
ATOM   2824 C CD2 . LEU D 2 86  ? 25.810 3.658   -26.789 1.00 35.70 ? 101 LEU D CD2 1 
ATOM   2825 N N   . GLU D 2 87  ? 25.689 1.321   -22.707 1.00 37.31 ? 102 GLU D N   1 
ATOM   2826 C CA  . GLU D 2 87  ? 25.744 -0.111  -22.425 1.00 39.51 ? 102 GLU D CA  1 
ATOM   2827 C C   . GLU D 2 87  ? 24.361 -0.756  -22.471 1.00 39.92 ? 102 GLU D C   1 
ATOM   2828 O O   . GLU D 2 87  ? 24.202 -1.847  -23.014 1.00 40.62 ? 102 GLU D O   1 
ATOM   2829 C CB  . GLU D 2 87  ? 26.375 -0.357  -21.057 1.00 41.77 ? 102 GLU D CB  1 
ATOM   2830 C CG  . GLU D 2 87  ? 27.876 -0.144  -21.016 1.00 46.22 ? 102 GLU D CG  1 
ATOM   2831 C CD  . GLU D 2 87  ? 28.423 -0.173  -19.608 1.00 48.74 ? 102 GLU D CD  1 
ATOM   2832 O OE1 . GLU D 2 87  ? 27.798 0.437   -18.712 1.00 48.39 ? 102 GLU D OE1 1 
ATOM   2833 O OE2 . GLU D 2 87  ? 29.479 -0.807  -19.401 1.00 51.75 ? 102 GLU D OE2 1 
ATOM   2834 N N   . LEU D 2 88  ? 23.370 -0.071  -21.897 1.00 40.21 ? 103 LEU D N   1 
ATOM   2835 C CA  . LEU D 2 88  ? 21.988 -0.544  -21.882 1.00 39.88 ? 103 LEU D CA  1 
ATOM   2836 C C   . LEU D 2 88  ? 21.459 -0.688  -23.305 1.00 39.12 ? 103 LEU D C   1 
ATOM   2837 O O   . LEU D 2 88  ? 20.820 -1.688  -23.628 1.00 40.39 ? 103 LEU D O   1 
ATOM   2838 C CB  . LEU D 2 88  ? 21.100 0.431   -21.107 1.00 40.74 ? 103 LEU D CB  1 
ATOM   2839 C CG  . LEU D 2 88  ? 20.200 -0.070  -19.979 1.00 42.00 ? 103 LEU D CG  1 
ATOM   2840 C CD1 . LEU D 2 88  ? 18.980 0.820   -19.903 1.00 41.76 ? 103 LEU D CD1 1 
ATOM   2841 C CD2 . LEU D 2 88  ? 19.791 -1.516  -20.133 1.00 38.38 ? 103 LEU D CD2 1 
ATOM   2842 N N   . LEU D 2 89  ? 21.729 0.319   -24.138 1.00 38.79 ? 104 LEU D N   1 
ATOM   2843 C CA  . LEU D 2 89  ? 21.371 0.310   -25.559 1.00 39.68 ? 104 LEU D CA  1 
ATOM   2844 C C   . LEU D 2 89  ? 21.902 -0.942  -26.250 1.00 40.98 ? 104 LEU D C   1 
ATOM   2845 O O   . LEU D 2 89  ? 21.141 -1.666  -26.895 1.00 43.35 ? 104 LEU D O   1 
ATOM   2846 C CB  . LEU D 2 89  ? 21.948 1.547   -26.252 1.00 39.09 ? 104 LEU D CB  1 
ATOM   2847 C CG  . LEU D 2 89  ? 21.238 2.227   -27.426 1.00 40.25 ? 104 LEU D CG  1 
ATOM   2848 C CD1 . LEU D 2 89  ? 22.174 3.232   -28.098 1.00 34.66 ? 104 LEU D CD1 1 
ATOM   2849 C CD2 . LEU D 2 89  ? 20.678 1.243   -28.446 1.00 42.67 ? 104 LEU D CD2 1 
ATOM   2850 N N   . MET D 2 90  ? 23.206 -1.189  -26.104 1.00 41.40 ? 105 MET D N   1 
ATOM   2851 C CA  . MET D 2 90  ? 23.881 -2.326  -26.740 1.00 41.07 ? 105 MET D CA  1 
ATOM   2852 C C   . MET D 2 90  ? 23.316 -3.657  -26.242 1.00 39.95 ? 105 MET D C   1 
ATOM   2853 O O   . MET D 2 90  ? 23.108 -4.589  -27.040 1.00 36.74 ? 105 MET D O   1 
ATOM   2854 C CB  . MET D 2 90  ? 25.395 -2.265  -26.499 1.00 41.22 ? 105 MET D CB  1 
ATOM   2855 C CG  . MET D 2 90  ? 26.070 -1.009  -27.058 1.00 45.67 ? 105 MET D CG  1 
ATOM   2856 S SD  . MET D 2 90  ? 27.878 -0.978  -26.900 1.00 52.32 ? 105 MET D SD  1 
ATOM   2857 C CE  . MET D 2 90  ? 28.095 -0.680  -25.152 1.00 49.00 ? 105 MET D CE  1 
ATOM   2858 N N   . ALA D 2 91  ? 23.065 -3.724  -24.929 1.00 36.37 ? 106 ALA D N   1 
ATOM   2859 C CA  . ALA D 2 91  ? 22.477 -4.898  -24.289 1.00 37.71 ? 106 ALA D CA  1 
ATOM   2860 C C   . ALA D 2 91  ? 21.062 -5.128  -24.785 1.00 37.76 ? 106 ALA D C   1 
ATOM   2861 O O   . ALA D 2 91  ? 20.688 -6.259  -25.069 1.00 37.38 ? 106 ALA D O   1 
ATOM   2862 C CB  . ALA D 2 91  ? 22.481 -4.757  -22.756 1.00 36.15 ? 106 ALA D CB  1 
ATOM   2863 N N   . ALA D 2 92  ? 20.281 -4.050  -24.878 1.00 38.84 ? 107 ALA D N   1 
ATOM   2864 C CA  . ALA D 2 92  ? 18.887 -4.134  -25.314 1.00 39.40 ? 107 ALA D CA  1 
ATOM   2865 C C   . ALA D 2 92  ? 18.823 -4.621  -26.758 1.00 39.93 ? 107 ALA D C   1 
ATOM   2866 O O   . ALA D 2 92  ? 17.981 -5.450  -27.106 1.00 38.13 ? 107 ALA D O   1 
ATOM   2867 C CB  . ALA D 2 92  ? 18.195 -2.789  -25.163 1.00 39.22 ? 107 ALA D CB  1 
ATOM   2868 N N   . ASN D 2 93  ? 19.736 -4.112  -27.585 1.00 41.30 ? 108 ASN D N   1 
ATOM   2869 C CA  . ASN D 2 93  ? 19.862 -4.541  -28.976 1.00 42.47 ? 108 ASN D CA  1 
ATOM   2870 C C   . ASN D 2 93  ? 20.162 -6.041  -29.093 1.00 42.54 ? 108 ASN D C   1 
ATOM   2871 O O   . ASN D 2 93  ? 19.448 -6.763  -29.792 1.00 42.34 ? 108 ASN D O   1 
ATOM   2872 C CB  . ASN D 2 93  ? 20.934 -3.726  -29.700 1.00 42.07 ? 108 ASN D CB  1 
ATOM   2873 C CG  . ASN D 2 93  ? 21.192 -4.233  -31.107 1.00 47.12 ? 108 ASN D CG  1 
ATOM   2874 O OD1 . ASN D 2 93  ? 20.425 -3.954  -32.030 1.00 51.06 ? 108 ASN D OD1 1 
ATOM   2875 N ND2 . ASN D 2 93  ? 22.274 -4.988  -31.278 1.00 48.14 ? 108 ASN D ND2 1 
ATOM   2876 N N   . PHE D 2 94  ? 21.205 -6.503  -28.401 1.00 41.45 ? 109 PHE D N   1 
ATOM   2877 C CA  . PHE D 2 94  ? 21.574 -7.918  -28.428 1.00 41.59 ? 109 PHE D CA  1 
ATOM   2878 C C   . PHE D 2 94  ? 20.433 -8.808  -27.953 1.00 39.78 ? 109 PHE D C   1 
ATOM   2879 O O   . PHE D 2 94  ? 20.225 -9.895  -28.481 1.00 37.52 ? 109 PHE D O   1 
ATOM   2880 C CB  . PHE D 2 94  ? 22.826 -8.195  -27.590 1.00 42.81 ? 109 PHE D CB  1 
ATOM   2881 C CG  . PHE D 2 94  ? 23.222 -9.654  -27.560 1.00 45.24 ? 109 PHE D CG  1 
ATOM   2882 C CD1 . PHE D 2 94  ? 23.784 -10.262 -28.679 1.00 47.78 ? 109 PHE D CD1 1 
ATOM   2883 C CD2 . PHE D 2 94  ? 23.027 -10.418 -26.413 1.00 47.37 ? 109 PHE D CD2 1 
ATOM   2884 C CE1 . PHE D 2 94  ? 24.146 -11.611 -28.659 1.00 48.59 ? 109 PHE D CE1 1 
ATOM   2885 C CE2 . PHE D 2 94  ? 23.391 -11.764 -26.378 1.00 49.71 ? 109 PHE D CE2 1 
ATOM   2886 C CZ  . PHE D 2 94  ? 23.948 -12.362 -27.504 1.00 48.71 ? 109 PHE D CZ  1 
ATOM   2887 N N   . LEU D 2 95  ? 19.705 -8.329  -26.951 1.00 39.72 ? 110 LEU D N   1 
ATOM   2888 C CA  . LEU D 2 95  ? 18.616 -9.084  -26.353 1.00 40.41 ? 110 LEU D CA  1 
ATOM   2889 C C   . LEU D 2 95  ? 17.301 -8.975  -27.118 1.00 41.31 ? 110 LEU D C   1 
ATOM   2890 O O   . LEU D 2 95  ? 16.373 -9.739  -26.861 1.00 43.58 ? 110 LEU D O   1 
ATOM   2891 C CB  . LEU D 2 95  ? 18.432 -8.675  -24.892 1.00 39.60 ? 110 LEU D CB  1 
ATOM   2892 C CG  . LEU D 2 95  ? 19.503 -9.231  -23.952 1.00 37.26 ? 110 LEU D CG  1 
ATOM   2893 C CD1 . LEU D 2 95  ? 19.338 -8.640  -22.578 1.00 39.93 ? 110 LEU D CD1 1 
ATOM   2894 C CD2 . LEU D 2 95  ? 19.407 -10.746 -23.891 1.00 36.72 ? 110 LEU D CD2 1 
ATOM   2895 N N   . ASP D 2 96  ? 17.239 -8.043  -28.068 1.00 42.91 ? 111 ASP D N   1 
ATOM   2896 C CA  . ASP D 2 96  ? 16.031 -7.786  -28.858 1.00 43.88 ? 111 ASP D CA  1 
ATOM   2897 C C   . ASP D 2 96  ? 14.819 -7.406  -27.980 1.00 44.32 ? 111 ASP D C   1 
ATOM   2898 O O   . ASP D 2 96  ? 13.774 -8.065  -28.018 1.00 42.38 ? 111 ASP D O   1 
ATOM   2899 C CB  . ASP D 2 96  ? 15.721 -8.982  -29.775 1.00 42.23 ? 111 ASP D CB  1 
ATOM   2900 C CG  . ASP D 2 96  ? 14.674 -8.658  -30.825 1.00 47.01 ? 111 ASP D CG  1 
ATOM   2901 O OD1 . ASP D 2 96  ? 14.495 -7.460  -31.144 1.00 51.24 ? 111 ASP D OD1 1 
ATOM   2902 O OD2 . ASP D 2 96  ? 14.028 -9.600  -31.338 1.00 46.11 ? 111 ASP D OD2 1 
ATOM   2903 N N   . CYS D 2 97  ? 14.976 -6.352  -27.176 1.00 46.06 ? 112 CYS D N   1 
ATOM   2904 C CA  . CYS D 2 97  ? 13.863 -5.837  -26.357 1.00 48.01 ? 112 CYS D CA  1 
ATOM   2905 C C   . CYS D 2 97  ? 13.778 -4.296  -26.254 1.00 46.61 ? 112 CYS D C   1 
ATOM   2906 O O   . CYS D 2 97  ? 14.534 -3.542  -26.870 1.00 43.77 ? 112 CYS D O   1 
ATOM   2907 C CB  . CYS D 2 97  ? 13.861 -6.487  -24.969 1.00 47.26 ? 112 CYS D CB  1 
ATOM   2908 S SG  . CYS D 2 97  ? 15.299 -6.115  -23.985 1.00 52.70 ? 112 CYS D SG  1 
ATOM   2909 O OXT . CYS D 2 97  ? 12.914 -3.761  -25.556 1.00 47.14 ? 112 CYS D OXT 1 
ATOM   2910 N N   . ASN E 3 3   ? -0.678 3.379   -24.828 1.00 58.21 ? 140 ASN E N   1 
ATOM   2911 C CA  . ASN E 3 3   ? -1.044 2.142   -24.004 1.00 57.58 ? 140 ASN E CA  1 
ATOM   2912 C C   . ASN E 3 3   ? 0.043  1.525   -23.056 1.00 55.93 ? 140 ASN E C   1 
ATOM   2913 O O   . ASN E 3 3   ? -0.275 0.678   -22.139 1.00 58.54 ? 140 ASN E O   1 
ATOM   2914 C CB  . ASN E 3 3   ? -1.903 1.101   -24.800 1.00 59.12 ? 140 ASN E CB  1 
ATOM   2915 C CG  . ASN E 3 3   ? -2.383 1.643   -26.213 1.00 59.92 ? 140 ASN E CG  1 
ATOM   2916 O OD1 . ASN E 3 3   ? -1.874 2.659   -26.739 1.00 61.63 ? 140 ASN E OD1 1 
ATOM   2917 N ND2 . ASN E 3 3   ? -3.395 0.939   -26.829 1.00 60.05 ? 140 ASN E ND2 1 
ATOM   2918 N N   . LYS E 3 4   ? 1.377  1.733   -23.271 1.00 52.57 ? 141 LYS E N   1 
ATOM   2919 C CA  . LYS E 3 4   ? 2.120  1.010   -24.354 1.00 46.90 ? 141 LYS E CA  1 
ATOM   2920 C C   . LYS E 3 4   ? 3.593  1.366   -24.130 1.00 44.53 ? 141 LYS E C   1 
ATOM   2921 O O   . LYS E 3 4   ? 4.006  2.519   -24.285 1.00 43.59 ? 141 LYS E O   1 
ATOM   2922 C CB  . LYS E 3 4   ? 1.655  1.272   -25.782 1.00 47.25 ? 141 LYS E CB  1 
ATOM   2923 C CG  . LYS E 3 4   ? 1.735  -0.024  -26.614 1.00 43.33 ? 141 LYS E CG  1 
ATOM   2924 C CD  . LYS E 3 4   ? 0.575  -0.161  -27.569 1.00 47.13 ? 141 LYS E CD  1 
ATOM   2925 C CE  . LYS E 3 4   ? -0.549 -1.038  -27.003 1.00 47.90 ? 141 LYS E CE  1 
ATOM   2926 N NZ  . LYS E 3 4   ? -0.492 -2.461  -27.450 1.00 48.34 ? 141 LYS E NZ  1 
ATOM   2927 N N   . VAL E 3 5   ? 4.365  0.370   -23.713 1.00 41.61 ? 142 VAL E N   1 
ATOM   2928 C CA  . VAL E 3 5   ? 5.708  0.596   -23.198 1.00 39.74 ? 142 VAL E CA  1 
ATOM   2929 C C   . VAL E 3 5   ? 6.772  0.552   -24.296 1.00 38.19 ? 142 VAL E C   1 
ATOM   2930 O O   . VAL E 3 5   ? 6.925  -0.459  -24.979 1.00 37.77 ? 142 VAL E O   1 
ATOM   2931 C CB  . VAL E 3 5   ? 6.040  -0.413  -22.068 1.00 40.45 ? 142 VAL E CB  1 
ATOM   2932 C CG1 . VAL E 3 5   ? 7.491  -0.282  -21.620 1.00 38.19 ? 142 VAL E CG1 1 
ATOM   2933 C CG2 . VAL E 3 5   ? 5.091  -0.203  -20.887 1.00 39.23 ? 142 VAL E CG2 1 
ATOM   2934 N N   . GLY E 3 6   ? 7.508  1.656   -24.438 1.00 36.60 ? 143 GLY E N   1 
ATOM   2935 C CA  . GLY E 3 6   ? 8.554  1.784   -25.443 1.00 35.06 ? 143 GLY E CA  1 
ATOM   2936 C C   . GLY E 3 6   ? 9.635  0.745   -25.264 1.00 34.18 ? 143 GLY E C   1 
ATOM   2937 O O   . GLY E 3 6   ? 9.881  0.287   -24.149 1.00 35.43 ? 143 GLY E O   1 
ATOM   2938 N N   . SER E 3 7   ? 10.283 0.366   -26.361 1.00 35.87 ? 144 SER E N   1 
ATOM   2939 C CA  . SER E 3 7   ? 11.345 -0.644  -26.312 1.00 35.48 ? 144 SER E CA  1 
ATOM   2940 C C   . SER E 3 7   ? 12.509 -0.145  -25.469 1.00 34.29 ? 144 SER E C   1 
ATOM   2941 O O   . SER E 3 7   ? 12.761 1.063   -25.398 1.00 32.10 ? 144 SER E O   1 
ATOM   2942 C CB  . SER E 3 7   ? 11.818 -1.022  -27.720 1.00 36.25 ? 144 SER E CB  1 
ATOM   2943 O OG  . SER E 3 7   ? 12.574 0.017   -28.307 1.00 39.75 ? 144 SER E OG  1 
ATOM   2944 N N   . LEU E 3 8   ? 13.213 -1.071  -24.820 1.00 33.42 ? 145 LEU E N   1 
ATOM   2945 C CA  . LEU E 3 8   ? 14.349 -0.691  -23.990 1.00 33.17 ? 145 LEU E CA  1 
ATOM   2946 C C   . LEU E 3 8   ? 15.420 0.063   -24.807 1.00 35.08 ? 145 LEU E C   1 
ATOM   2947 O O   . LEU E 3 8   ? 16.072 0.978   -24.289 1.00 37.03 ? 145 LEU E O   1 
ATOM   2948 C CB  . LEU E 3 8   ? 14.921 -1.907  -23.255 1.00 32.77 ? 145 LEU E CB  1 
ATOM   2949 C CG  . LEU E 3 8   ? 16.108 -1.709  -22.301 1.00 32.54 ? 145 LEU E CG  1 
ATOM   2950 C CD1 . LEU E 3 8   ? 15.807 -0.669  -21.233 1.00 32.31 ? 145 LEU E CD1 1 
ATOM   2951 C CD2 . LEU E 3 8   ? 16.517 -3.031  -21.679 1.00 31.96 ? 145 LEU E CD2 1 
ATOM   2952 N N   . GLN E 3 9   ? 15.569 -0.292  -26.085 1.00 35.04 ? 146 GLN E N   1 
ATOM   2953 C CA  . GLN E 3 9   ? 16.491 0.420   -26.986 1.00 35.84 ? 146 GLN E CA  1 
ATOM   2954 C C   . GLN E 3 9   ? 16.115 1.887   -27.181 1.00 35.54 ? 146 GLN E C   1 
ATOM   2955 O O   . GLN E 3 9   ? 16.970 2.769   -27.053 1.00 37.48 ? 146 GLN E O   1 
ATOM   2956 C CB  . GLN E 3 9   ? 16.608 -0.287  -28.335 1.00 34.10 ? 146 GLN E CB  1 
ATOM   2957 C CG  . GLN E 3 9   ? 17.021 -1.715  -28.174 1.00 34.30 ? 146 GLN E CG  1 
ATOM   2958 C CD  . GLN E 3 9   ? 16.811 -2.508  -29.415 1.00 32.82 ? 146 GLN E CD  1 
ATOM   2959 O OE1 . GLN E 3 9   ? 17.429 -2.237  -30.440 1.00 36.57 ? 146 GLN E OE1 1 
ATOM   2960 N NE2 . GLN E 3 9   ? 15.944 -3.513  -29.336 1.00 28.88 ? 146 GLN E NE2 1 
ATOM   2961 N N   . TYR E 3 10  ? 14.844 2.140   -27.486 1.00 33.95 ? 147 TYR E N   1 
ATOM   2962 C CA  . TYR E 3 10  ? 14.313 3.509   -27.519 1.00 34.28 ? 147 TYR E CA  1 
ATOM   2963 C C   . TYR E 3 10  ? 14.538 4.273   -26.186 1.00 33.77 ? 147 TYR E C   1 
ATOM   2964 O O   . TYR E 3 10  ? 14.992 5.425   -26.187 1.00 34.10 ? 147 TYR E O   1 
ATOM   2965 C CB  . TYR E 3 10  ? 12.827 3.483   -27.890 1.00 32.98 ? 147 TYR E CB  1 
ATOM   2966 C CG  . TYR E 3 10  ? 12.107 4.795   -27.681 1.00 34.21 ? 147 TYR E CG  1 
ATOM   2967 C CD1 . TYR E 3 10  ? 12.232 5.832   -28.599 1.00 33.75 ? 147 TYR E CD1 1 
ATOM   2968 C CD2 . TYR E 3 10  ? 11.297 4.996   -26.565 1.00 36.65 ? 147 TYR E CD2 1 
ATOM   2969 C CE1 . TYR E 3 10  ? 11.576 7.033   -28.413 1.00 35.82 ? 147 TYR E CE1 1 
ATOM   2970 C CE2 . TYR E 3 10  ? 10.633 6.199   -26.372 1.00 36.94 ? 147 TYR E CE2 1 
ATOM   2971 C CZ  . TYR E 3 10  ? 10.778 7.208   -27.303 1.00 36.48 ? 147 TYR E CZ  1 
ATOM   2972 O OH  . TYR E 3 10  ? 10.127 8.398   -27.128 1.00 38.80 ? 147 TYR E OH  1 
ATOM   2973 N N   . LEU E 3 11  ? 14.220 3.633   -25.063 1.00 32.49 ? 148 LEU E N   1 
ATOM   2974 C CA  . LEU E 3 11  ? 14.376 4.277   -23.753 1.00 34.91 ? 148 LEU E CA  1 
ATOM   2975 C C   . LEU E 3 11  ? 15.841 4.609   -23.459 1.00 36.94 ? 148 LEU E C   1 
ATOM   2976 O O   . LEU E 3 11  ? 16.144 5.734   -23.061 1.00 37.34 ? 148 LEU E O   1 
ATOM   2977 C CB  . LEU E 3 11  ? 13.743 3.449   -22.627 1.00 33.78 ? 148 LEU E CB  1 
ATOM   2978 C CG  . LEU E 3 11  ? 12.222 3.205   -22.659 1.00 33.74 ? 148 LEU E CG  1 
ATOM   2979 C CD1 . LEU E 3 11  ? 11.815 2.201   -21.574 1.00 32.96 ? 148 LEU E CD1 1 
ATOM   2980 C CD2 . LEU E 3 11  ? 11.389 4.515   -22.551 1.00 32.07 ? 148 LEU E CD2 1 
ATOM   2981 N N   . ALA E 3 12  ? 16.744 3.654   -23.709 1.00 37.50 ? 149 ALA E N   1 
ATOM   2982 C CA  . ALA E 3 12  ? 18.182 3.873   -23.513 1.00 36.66 ? 149 ALA E CA  1 
ATOM   2983 C C   . ALA E 3 12  ? 18.724 5.029   -24.354 1.00 37.80 ? 149 ALA E C   1 
ATOM   2984 O O   . ALA E 3 12  ? 19.494 5.842   -23.852 1.00 37.47 ? 149 ALA E O   1 
ATOM   2985 C CB  . ALA E 3 12  ? 18.973 2.603   -23.784 1.00 36.84 ? 149 ALA E CB  1 
ATOM   2986 N N   . LEU E 3 13  ? 18.320 5.098   -25.623 1.00 38.26 ? 150 LEU E N   1 
ATOM   2987 C CA  . LEU E 3 13  ? 18.737 6.189   -26.510 1.00 38.71 ? 150 LEU E CA  1 
ATOM   2988 C C   . LEU E 3 13  ? 18.151 7.542   -26.089 1.00 39.13 ? 150 LEU E C   1 
ATOM   2989 O O   . LEU E 3 13  ? 18.835 8.561   -26.166 1.00 39.29 ? 150 LEU E O   1 
ATOM   2990 C CB  . LEU E 3 13  ? 18.411 5.891   -27.982 1.00 36.97 ? 150 LEU E CB  1 
ATOM   2991 C CG  . LEU E 3 13  ? 18.838 6.972   -28.987 1.00 36.92 ? 150 LEU E CG  1 
ATOM   2992 C CD1 . LEU E 3 13  ? 20.353 7.116   -29.012 1.00 35.92 ? 150 LEU E CD1 1 
ATOM   2993 C CD2 . LEU E 3 13  ? 18.284 6.725   -30.404 1.00 34.20 ? 150 LEU E CD2 1 
ATOM   2994 N N   . ALA E 3 14  ? 16.892 7.545   -25.652 1.00 40.30 ? 151 ALA E N   1 
ATOM   2995 C CA  . ALA E 3 14  ? 16.277 8.747   -25.068 1.00 40.92 ? 151 ALA E CA  1 
ATOM   2996 C C   . ALA E 3 14  ? 17.073 9.254   -23.858 1.00 41.18 ? 151 ALA E C   1 
ATOM   2997 O O   . ALA E 3 14  ? 17.242 10.456  -23.691 1.00 42.27 ? 151 ALA E O   1 
ATOM   2998 C CB  . ALA E 3 14  ? 14.829 8.482   -24.682 1.00 38.62 ? 151 ALA E CB  1 
ATOM   2999 N N   . ALA E 3 15  ? 17.571 8.329   -23.035 1.00 43.02 ? 152 ALA E N   1 
ATOM   3000 C CA  . ALA E 3 15  ? 18.395 8.659   -21.863 1.00 44.22 ? 152 ALA E CA  1 
ATOM   3001 C C   . ALA E 3 15  ? 19.737 9.263   -22.266 1.00 46.01 ? 152 ALA E C   1 
ATOM   3002 O O   . ALA E 3 15  ? 20.310 10.068  -21.531 1.00 45.29 ? 152 ALA E O   1 
ATOM   3003 C CB  . ALA E 3 15  ? 18.612 7.423   -20.988 1.00 41.76 ? 152 ALA E CB  1 
ATOM   3004 N N   . LEU E 3 16  ? 20.227 8.855   -23.434 1.00 48.41 ? 153 LEU E N   1 
ATOM   3005 C CA  . LEU E 3 16  ? 21.442 9.403   -24.011 1.00 50.99 ? 153 LEU E CA  1 
ATOM   3006 C C   . LEU E 3 16  ? 21.202 10.779  -24.619 1.00 53.09 ? 153 LEU E C   1 
ATOM   3007 O O   . LEU E 3 16  ? 22.135 11.567  -24.757 1.00 54.72 ? 153 LEU E O   1 
ATOM   3008 C CB  . LEU E 3 16  ? 21.984 8.470   -25.098 1.00 50.33 ? 153 LEU E CB  1 
ATOM   3009 C CG  . LEU E 3 16  ? 22.924 7.311   -24.771 1.00 49.62 ? 153 LEU E CG  1 
ATOM   3010 C CD1 . LEU E 3 16  ? 23.365 6.643   -26.065 1.00 47.96 ? 153 LEU E CD1 1 
ATOM   3011 C CD2 . LEU E 3 16  ? 24.140 7.783   -23.988 1.00 50.65 ? 153 LEU E CD2 1 
ATOM   3012 N N   . ILE E 3 17  ? 19.953 11.056  -24.986 1.00 55.85 ? 154 ILE E N   1 
ATOM   3013 C CA  . ILE E 3 17  ? 19.606 12.245  -25.775 1.00 59.22 ? 154 ILE E CA  1 
ATOM   3014 C C   . ILE E 3 17  ? 19.082 13.435  -24.955 1.00 61.31 ? 154 ILE E C   1 
ATOM   3015 O O   . ILE E 3 17  ? 19.191 14.585  -25.400 1.00 62.63 ? 154 ILE E O   1 
ATOM   3016 C CB  . ILE E 3 17  ? 18.654 11.873  -26.972 1.00 58.99 ? 154 ILE E CB  1 
ATOM   3017 C CG1 . ILE E 3 17  ? 19.429 11.872  -28.292 1.00 58.88 ? 154 ILE E CG1 1 
ATOM   3018 C CG2 . ILE E 3 17  ? 17.458 12.824  -27.089 1.00 58.39 ? 154 ILE E CG2 1 
ATOM   3019 C CD1 . ILE E 3 17  ? 20.489 10.795  -28.409 1.00 60.51 ? 154 ILE E CD1 1 
ATOM   3020 N N   . LYS E 3 18  ? 18.536 13.157  -23.768 1.00 63.39 ? 155 LYS E N   1 
ATOM   3021 C CA  . LYS E 3 18  ? 18.006 14.198  -22.882 1.00 65.34 ? 155 LYS E CA  1 
ATOM   3022 C C   . LYS E 3 18  ? 19.068 15.243  -22.515 1.00 66.80 ? 155 LYS E C   1 
ATOM   3023 O O   . LYS E 3 18  ? 19.986 14.948  -21.741 1.00 67.13 ? 155 LYS E O   1 
ATOM   3024 C CB  . LYS E 3 18  ? 17.425 13.574  -21.612 1.00 65.90 ? 155 LYS E CB  1 
ATOM   3025 C CG  . LYS E 3 18  ? 15.979 13.125  -21.726 1.00 66.64 ? 155 LYS E CG  1 
ATOM   3026 C CD  . LYS E 3 18  ? 15.579 12.306  -20.499 1.00 69.39 ? 155 LYS E CD  1 
ATOM   3027 C CE  . LYS E 3 18  ? 14.086 12.397  -20.202 1.00 70.19 ? 155 LYS E CE  1 
ATOM   3028 N NZ  . LYS E 3 18  ? 13.247 11.828  -21.293 1.00 71.91 ? 155 LYS E NZ  1 
ATOM   3029 N N   . PRO E 3 19  ? 18.945 16.470  -23.070 1.00 67.84 ? 156 PRO E N   1 
ATOM   3030 C CA  . PRO E 3 19  ? 19.948 17.509  -22.846 1.00 67.80 ? 156 PRO E CA  1 
ATOM   3031 C C   . PRO E 3 19  ? 19.632 18.385  -21.634 1.00 67.93 ? 156 PRO E C   1 
ATOM   3032 O O   . PRO E 3 19  ? 18.687 18.090  -20.888 1.00 67.83 ? 156 PRO E O   1 
ATOM   3033 C CB  . PRO E 3 19  ? 19.880 18.339  -24.134 1.00 67.95 ? 156 PRO E CB  1 
ATOM   3034 C CG  . PRO E 3 19  ? 18.497 18.080  -24.713 1.00 67.88 ? 156 PRO E CG  1 
ATOM   3035 C CD  . PRO E 3 19  ? 17.853 16.956  -23.937 1.00 67.97 ? 156 PRO E CD  1 
ATOM   3036 N N   . ASN F 3 3   ? 2.742  10.312  25.798  1.00 55.84 ? 140 ASN F N   1 
ATOM   3037 C CA  . ASN F 3 3   ? 3.434  9.079   25.336  1.00 54.67 ? 140 ASN F CA  1 
ATOM   3038 C C   . ASN F 3 3   ? 4.902  9.085   25.751  1.00 52.88 ? 140 ASN F C   1 
ATOM   3039 O O   . ASN F 3 3   ? 5.624  10.057  25.506  1.00 53.15 ? 140 ASN F O   1 
ATOM   3040 C CB  . ASN F 3 3   ? 3.313  8.936   23.814  1.00 57.22 ? 140 ASN F CB  1 
ATOM   3041 C CG  . ASN F 3 3   ? 1.912  8.529   23.358  1.00 59.98 ? 140 ASN F CG  1 
ATOM   3042 O OD1 . ASN F 3 3   ? 1.100  8.031   24.142  1.00 62.82 ? 140 ASN F OD1 1 
ATOM   3043 N ND2 . ASN F 3 3   ? 1.632  8.732   22.073  1.00 60.60 ? 140 ASN F ND2 1 
ATOM   3044 N N   . LYS F 3 4   ? 5.336  7.996   26.378  1.00 48.86 ? 141 LYS F N   1 
ATOM   3045 C CA  . LYS F 3 4   ? 6.684  7.911   26.910  1.00 43.30 ? 141 LYS F CA  1 
ATOM   3046 C C   . LYS F 3 4   ? 7.356  6.613   26.467  1.00 41.25 ? 141 LYS F C   1 
ATOM   3047 O O   . LYS F 3 4   ? 6.812  5.525   26.640  1.00 42.35 ? 141 LYS F O   1 
ATOM   3048 C CB  . LYS F 3 4   ? 6.652  8.026   28.435  1.00 43.30 ? 141 LYS F CB  1 
ATOM   3049 C CG  . LYS F 3 4   ? 7.624  9.045   28.999  1.00 42.47 ? 141 LYS F CG  1 
ATOM   3050 C CD  . LYS F 3 4   ? 6.940  10.372  29.205  1.00 42.78 ? 141 LYS F CD  1 
ATOM   3051 C CE  . LYS F 3 4   ? 7.939  11.484  29.431  1.00 43.45 ? 141 LYS F CE  1 
ATOM   3052 N NZ  . LYS F 3 4   ? 7.255  12.713  29.924  1.00 42.81 ? 141 LYS F NZ  1 
ATOM   3053 N N   . VAL F 3 5   ? 8.538  6.741   25.879  1.00 38.35 ? 142 VAL F N   1 
ATOM   3054 C CA  . VAL F 3 5   ? 9.281  5.602   25.365  1.00 37.26 ? 142 VAL F CA  1 
ATOM   3055 C C   . VAL F 3 5   ? 9.933  4.793   26.495  1.00 37.27 ? 142 VAL F C   1 
ATOM   3056 O O   . VAL F 3 5   ? 10.620 5.348   27.350  1.00 37.85 ? 142 VAL F O   1 
ATOM   3057 C CB  . VAL F 3 5   ? 10.344 6.062   24.339  1.00 36.61 ? 142 VAL F CB  1 
ATOM   3058 C CG1 . VAL F 3 5   ? 11.338 4.954   24.043  1.00 35.79 ? 142 VAL F CG1 1 
ATOM   3059 C CG2 . VAL F 3 5   ? 9.667  6.554   23.060  1.00 35.23 ? 142 VAL F CG2 1 
ATOM   3060 N N   . GLY F 3 6   ? 9.716  3.478   26.478  1.00 37.08 ? 143 GLY F N   1 
ATOM   3061 C CA  . GLY F 3 6   ? 10.284 2.577   27.472  1.00 35.62 ? 143 GLY F CA  1 
ATOM   3062 C C   . GLY F 3 6   ? 11.795 2.518   27.378  1.00 34.62 ? 143 GLY F C   1 
ATOM   3063 O O   . GLY F 3 6   ? 12.359 2.676   26.289  1.00 33.96 ? 143 GLY F O   1 
ATOM   3064 N N   . SER F 3 7   ? 12.452 2.301   28.517  1.00 33.80 ? 144 SER F N   1 
ATOM   3065 C CA  . SER F 3 7   ? 13.904 2.116   28.525  1.00 35.25 ? 144 SER F CA  1 
ATOM   3066 C C   . SER F 3 7   ? 14.267 0.879   27.707  1.00 35.95 ? 144 SER F C   1 
ATOM   3067 O O   . SER F 3 7   ? 13.501 -0.091  27.647  1.00 37.28 ? 144 SER F O   1 
ATOM   3068 C CB  . SER F 3 7   ? 14.456 2.021   29.949  1.00 34.57 ? 144 SER F CB  1 
ATOM   3069 O OG  . SER F 3 7   ? 14.701 0.686   30.336  1.00 36.27 ? 144 SER F OG  1 
ATOM   3070 N N   . LEU F 3 8   ? 15.427 0.920   27.066  1.00 35.96 ? 145 LEU F N   1 
ATOM   3071 C CA  . LEU F 3 8   ? 15.862 -0.171  26.205  1.00 36.70 ? 145 LEU F CA  1 
ATOM   3072 C C   . LEU F 3 8   ? 16.017 -1.504  26.961  1.00 36.88 ? 145 LEU F C   1 
ATOM   3073 O O   . LEU F 3 8   ? 15.841 -2.570  26.375  1.00 40.59 ? 145 LEU F O   1 
ATOM   3074 C CB  . LEU F 3 8   ? 17.165 0.208   25.493  1.00 37.54 ? 145 LEU F CB  1 
ATOM   3075 C CG  . LEU F 3 8   ? 17.697 -0.710  24.385  1.00 36.72 ? 145 LEU F CG  1 
ATOM   3076 C CD1 . LEU F 3 8   ? 16.666 -0.890  23.283  1.00 32.44 ? 145 LEU F CD1 1 
ATOM   3077 C CD2 . LEU F 3 8   ? 19.012 -0.176  23.826  1.00 35.94 ? 145 LEU F CD2 1 
ATOM   3078 N N   . GLN F 3 9   ? 16.337 -1.438  28.253  1.00 33.13 ? 146 GLN F N   1 
ATOM   3079 C CA  . GLN F 3 9   ? 16.470 -2.639  29.063  1.00 34.62 ? 146 GLN F CA  1 
ATOM   3080 C C   . GLN F 3 9   ? 15.122 -3.338  29.178  1.00 35.44 ? 146 GLN F C   1 
ATOM   3081 O O   . GLN F 3 9   ? 15.034 -4.552  29.019  1.00 35.98 ? 146 GLN F O   1 
ATOM   3082 C CB  . GLN F 3 9   ? 17.026 -2.316  30.453  1.00 33.37 ? 146 GLN F CB  1 
ATOM   3083 C CG  . GLN F 3 9   ? 18.440 -1.757  30.429  1.00 31.72 ? 146 GLN F CG  1 
ATOM   3084 C CD  . GLN F 3 9   ? 18.842 -1.146  31.754  1.00 35.81 ? 146 GLN F CD  1 
ATOM   3085 O OE1 . GLN F 3 9   ? 18.801 -1.805  32.797  1.00 36.66 ? 146 GLN F OE1 1 
ATOM   3086 N NE2 . GLN F 3 9   ? 19.239 0.121   31.721  1.00 38.11 ? 146 GLN F NE2 1 
ATOM   3087 N N   . TYR F 3 10  ? 14.082 -2.549  29.440  1.00 34.51 ? 147 TYR F N   1 
ATOM   3088 C CA  . TYR F 3 10  ? 12.722 -3.037  29.536  1.00 34.54 ? 147 TYR F CA  1 
ATOM   3089 C C   . TYR F 3 10  ? 12.254 -3.639  28.204  1.00 33.64 ? 147 TYR F C   1 
ATOM   3090 O O   . TYR F 3 10  ? 11.702 -4.739  28.171  1.00 34.60 ? 147 TYR F O   1 
ATOM   3091 C CB  . TYR F 3 10  ? 11.802 -1.896  29.991  1.00 34.13 ? 147 TYR F CB  1 
ATOM   3092 C CG  . TYR F 3 10  ? 10.347 -2.109  29.673  1.00 33.95 ? 147 TYR F CG  1 
ATOM   3093 C CD1 . TYR F 3 10  ? 9.571  -2.995  30.428  1.00 33.44 ? 147 TYR F CD1 1 
ATOM   3094 C CD2 . TYR F 3 10  ? 9.741  -1.425  28.620  1.00 35.63 ? 147 TYR F CD2 1 
ATOM   3095 C CE1 . TYR F 3 10  ? 8.242  -3.192  30.147  1.00 32.77 ? 147 TYR F CE1 1 
ATOM   3096 C CE2 . TYR F 3 10  ? 8.399  -1.617  28.325  1.00 35.96 ? 147 TYR F CE2 1 
ATOM   3097 C CZ  . TYR F 3 10  ? 7.659  -2.500  29.097  1.00 36.86 ? 147 TYR F CZ  1 
ATOM   3098 O OH  . TYR F 3 10  ? 6.333  -2.700  28.813  1.00 37.72 ? 147 TYR F OH  1 
ATOM   3099 N N   . LEU F 3 11  ? 12.483 -2.914  27.117  1.00 33.71 ? 148 LEU F N   1 
ATOM   3100 C CA  . LEU F 3 11  ? 12.123 -3.385  25.779  1.00 34.83 ? 148 LEU F CA  1 
ATOM   3101 C C   . LEU F 3 11  ? 12.852 -4.681  25.408  1.00 36.61 ? 148 LEU F C   1 
ATOM   3102 O O   . LEU F 3 11  ? 12.248 -5.589  24.842  1.00 37.75 ? 148 LEU F O   1 
ATOM   3103 C CB  . LEU F 3 11  ? 12.379 -2.295  24.723  1.00 34.43 ? 148 LEU F CB  1 
ATOM   3104 C CG  . LEU F 3 11  ? 11.684 -0.930  24.863  1.00 36.73 ? 148 LEU F CG  1 
ATOM   3105 C CD1 . LEU F 3 11  ? 12.141 0.010   23.757  1.00 37.51 ? 148 LEU F CD1 1 
ATOM   3106 C CD2 . LEU F 3 11  ? 10.146 -1.032  24.880  1.00 36.67 ? 148 LEU F CD2 1 
ATOM   3107 N N   . ALA F 3 12  ? 14.141 -4.770  25.737  1.00 36.86 ? 149 ALA F N   1 
ATOM   3108 C CA  . ALA F 3 12  ? 14.915 -5.981  25.456  1.00 37.63 ? 149 ALA F CA  1 
ATOM   3109 C C   . ALA F 3 12  ? 14.405 -7.188  26.252  1.00 40.12 ? 149 ALA F C   1 
ATOM   3110 O O   . ALA F 3 12  ? 14.347 -8.305  25.716  1.00 41.77 ? 149 ALA F O   1 
ATOM   3111 C CB  . ALA F 3 12  ? 16.399 -5.750  25.705  1.00 35.58 ? 149 ALA F CB  1 
ATOM   3112 N N   . LEU F 3 13  ? 14.022 -6.966  27.514  1.00 38.18 ? 150 LEU F N   1 
ATOM   3113 C CA  . LEU F 3 13  ? 13.465 -8.041  28.336  1.00 37.83 ? 150 LEU F CA  1 
ATOM   3114 C C   . LEU F 3 13  ? 12.099 -8.485  27.815  1.00 39.93 ? 150 LEU F C   1 
ATOM   3115 O O   . LEU F 3 13  ? 11.812 -9.684  27.763  1.00 43.12 ? 150 LEU F O   1 
ATOM   3116 C CB  . LEU F 3 13  ? 13.378 -7.646  29.822  1.00 35.80 ? 150 LEU F CB  1 
ATOM   3117 C CG  . LEU F 3 13  ? 12.857 -8.732  30.785  1.00 36.07 ? 150 LEU F CG  1 
ATOM   3118 C CD1 . LEU F 3 13  ? 13.725 -10.000 30.755  1.00 33.59 ? 150 LEU F CD1 1 
ATOM   3119 C CD2 . LEU F 3 13  ? 12.724 -8.208  32.211  1.00 34.41 ? 150 LEU F CD2 1 
ATOM   3120 N N   . ALA F 3 14  ? 11.260 -7.520  27.440  1.00 40.10 ? 151 ALA F N   1 
ATOM   3121 C CA  . ALA F 3 14  ? 9.956  -7.813  26.854  1.00 41.39 ? 151 ALA F CA  1 
ATOM   3122 C C   . ALA F 3 14  ? 10.096 -8.646  25.571  1.00 43.40 ? 151 ALA F C   1 
ATOM   3123 O O   . ALA F 3 14  ? 9.255  -9.496  25.289  1.00 44.53 ? 151 ALA F O   1 
ATOM   3124 C CB  . ALA F 3 14  ? 9.195  -6.527  26.583  1.00 39.78 ? 151 ALA F CB  1 
ATOM   3125 N N   . ALA F 3 15  ? 11.165 -8.404  24.810  1.00 44.41 ? 152 ALA F N   1 
ATOM   3126 C CA  . ALA F 3 15  ? 11.453 -9.178  23.594  1.00 46.73 ? 152 ALA F CA  1 
ATOM   3127 C C   . ALA F 3 15  ? 11.894 -10.621 23.887  1.00 48.36 ? 152 ALA F C   1 
ATOM   3128 O O   . ALA F 3 15  ? 11.748 -11.494 23.038  1.00 48.35 ? 152 ALA F O   1 
ATOM   3129 C CB  . ALA F 3 15  ? 12.485 -8.460  22.726  1.00 46.27 ? 152 ALA F CB  1 
ATOM   3130 N N   . LEU F 3 16  ? 12.432 -10.861 25.083  1.00 51.68 ? 153 LEU F N   1 
ATOM   3131 C CA  . LEU F 3 16  ? 12.790 -12.210 25.526  1.00 53.17 ? 153 LEU F CA  1 
ATOM   3132 C C   . LEU F 3 16  ? 11.575 -12.970 26.042  1.00 55.48 ? 153 LEU F C   1 
ATOM   3133 O O   . LEU F 3 16  ? 11.560 -14.201 26.045  1.00 55.59 ? 153 LEU F O   1 
ATOM   3134 C CB  . LEU F 3 16  ? 13.862 -12.163 26.616  1.00 53.19 ? 153 LEU F CB  1 
ATOM   3135 C CG  . LEU F 3 16  ? 15.333 -12.005 26.232  1.00 54.66 ? 153 LEU F CG  1 
ATOM   3136 C CD1 . LEU F 3 16  ? 16.195 -11.965 27.489  1.00 54.46 ? 153 LEU F CD1 1 
ATOM   3137 C CD2 . LEU F 3 16  ? 15.792 -13.128 25.301  1.00 55.42 ? 153 LEU F CD2 1 
ATOM   3138 N N   . ILE F 3 17  ? 10.568 -12.224 26.492  1.00 58.57 ? 154 ILE F N   1 
ATOM   3139 C CA  . ILE F 3 17  ? 9.300  -12.793 26.956  1.00 60.83 ? 154 ILE F CA  1 
ATOM   3140 C C   . ILE F 3 17  ? 8.451  -13.280 25.776  1.00 62.59 ? 154 ILE F C   1 
ATOM   3141 O O   . ILE F 3 17  ? 7.589  -14.149 25.928  1.00 62.14 ? 154 ILE F O   1 
ATOM   3142 C CB  . ILE F 3 17  ? 8.536  -11.777 27.862  1.00 60.97 ? 154 ILE F CB  1 
ATOM   3143 C CG1 . ILE F 3 17  ? 8.795  -12.078 29.340  1.00 60.86 ? 154 ILE F CG1 1 
ATOM   3144 C CG2 . ILE F 3 17  ? 7.030  -11.782 27.599  1.00 61.92 ? 154 ILE F CG2 1 
ATOM   3145 C CD1 . ILE F 3 17  ? 10.224 -11.858 29.789  1.00 62.11 ? 154 ILE F CD1 1 
ATOM   3146 N N   . LYS F 3 18  ? 8.729  -12.726 24.598  1.00 65.69 ? 155 LYS F N   1 
ATOM   3147 C CA  . LYS F 3 18  ? 8.020  -13.078 23.371  1.00 67.02 ? 155 LYS F CA  1 
ATOM   3148 C C   . LYS F 3 18  ? 8.850  -14.005 22.489  1.00 66.73 ? 155 LYS F C   1 
ATOM   3149 O O   . LYS F 3 18  ? 8.657  -15.221 22.501  1.00 67.08 ? 155 LYS F O   1 
ATOM   3150 C CB  . LYS F 3 18  ? 7.624  -11.814 22.605  1.00 67.69 ? 155 LYS F CB  1 
ATOM   3151 C CG  . LYS F 3 18  ? 6.728  -10.881 23.404  1.00 69.49 ? 155 LYS F CG  1 
ATOM   3152 C CD  . LYS F 3 18  ? 6.538  -9.542  22.709  1.00 71.73 ? 155 LYS F CD  1 
ATOM   3153 C CE  . LYS F 3 18  ? 6.378  -8.412  23.722  1.00 72.16 ? 155 LYS F CE  1 
ATOM   3154 N NZ  . LYS F 3 18  ? 5.395  -8.736  24.798  1.00 72.03 ? 155 LYS F NZ  1 
HETATM 3155 O O   . HOH G 4 .   ? 22.680 -0.010  -1.361  1.00 39.89 ? 119 HOH A O   1 
HETATM 3156 O O   . HOH G 4 .   ? 36.613 18.958  2.144   1.00 53.99 ? 120 HOH A O   1 
HETATM 3157 O O   . HOH G 4 .   ? 5.597  4.844   1.448   1.00 33.74 ? 121 HOH A O   1 
HETATM 3158 O O   . HOH G 4 .   ? 30.627 -7.277  1.252   1.00 46.46 ? 122 HOH A O   1 
HETATM 3159 O O   . HOH G 4 .   ? 8.906  8.153   10.589  1.00 47.44 ? 123 HOH A O   1 
HETATM 3160 O O   . HOH G 4 .   ? 12.950 0.145   -0.085  1.00 34.44 ? 124 HOH A O   1 
HETATM 3161 O O   . HOH G 4 .   ? 13.295 0.167   5.362   1.00 44.12 ? 125 HOH A O   1 
HETATM 3162 O O   . HOH G 4 .   ? 24.802 9.393   -6.536  1.00 32.80 ? 126 HOH A O   1 
HETATM 3163 O O   . HOH G 4 .   ? 24.425 -9.554  9.356   1.00 52.21 ? 127 HOH A O   1 
HETATM 3164 O O   . HOH G 4 .   ? 35.152 1.882   7.497   1.00 38.96 ? 128 HOH A O   1 
HETATM 3165 O O   . HOH G 4 .   ? 31.875 1.882   -0.974  1.00 32.23 ? 129 HOH A O   1 
HETATM 3166 O O   . HOH G 4 .   ? 22.053 10.475  14.674  1.00 39.31 ? 130 HOH A O   1 
HETATM 3167 O O   . HOH G 4 .   ? 29.513 -12.846 12.117  1.00 48.56 ? 131 HOH A O   1 
HETATM 3168 O O   . HOH G 4 .   ? 29.431 0.588   10.387  1.00 36.74 ? 132 HOH A O   1 
HETATM 3169 O O   . HOH G 4 .   ? 20.872 16.061  9.758   1.00 47.57 ? 133 HOH A O   1 
HETATM 3170 O O   . HOH G 4 .   ? 17.885 1.131   1.423   1.00 37.24 ? 134 HOH A O   1 
HETATM 3171 O O   . HOH G 4 .   ? 21.933 2.441   -11.312 1.00 45.23 ? 135 HOH A O   1 
HETATM 3172 O O   . HOH G 4 .   ? 19.567 10.628  13.707  1.00 45.75 ? 136 HOH A O   1 
HETATM 3173 O O   . HOH G 4 .   ? 18.949 7.445   11.772  1.00 38.70 ? 137 HOH A O   1 
HETATM 3174 O O   . HOH G 4 .   ? 33.939 20.610  5.424   1.00 49.22 ? 138 HOH A O   1 
HETATM 3175 O O   . HOH G 4 .   ? 29.194 12.205  -8.569  1.00 50.50 ? 139 HOH A O   1 
HETATM 3176 O O   . HOH G 4 .   ? 16.538 16.014  -11.624 1.00 55.38 ? 140 HOH A O   1 
HETATM 3177 O O   . HOH G 4 .   ? 13.619 9.222   -13.458 1.00 50.25 ? 141 HOH A O   1 
HETATM 3178 O O   . HOH G 4 .   ? 18.348 7.757   -12.408 1.00 55.84 ? 142 HOH A O   1 
HETATM 3179 O O   . HOH G 4 .   ? 17.507 9.647   -13.709 1.00 54.76 ? 143 HOH A O   1 
HETATM 3180 O O   . HOH G 4 .   ? 14.399 6.590   -8.832  1.00 48.00 ? 144 HOH A O   1 
HETATM 3181 O O   . HOH G 4 .   ? 4.696  12.178  3.862   1.00 40.50 ? 145 HOH A O   1 
HETATM 3182 O O   . HOH G 4 .   ? 4.986  9.896   2.604   1.00 66.22 ? 146 HOH A O   1 
HETATM 3183 O O   . HOH G 4 .   ? 12.677 -0.052  7.497   1.00 44.43 ? 147 HOH A O   1 
HETATM 3184 O O   . HOH G 4 .   ? 30.662 3.077   -7.975  1.00 50.64 ? 148 HOH A O   1 
HETATM 3185 O O   . HOH G 4 .   ? 12.803 17.431  -7.882  1.00 53.63 ? 149 HOH A O   1 
HETATM 3186 O O   . HOH G 4 .   ? 34.488 5.139   5.130   1.00 49.12 ? 150 HOH A O   1 
HETATM 3187 O O   . HOH G 4 .   ? 40.445 13.294  3.712   1.00 54.35 ? 151 HOH A O   1 
HETATM 3188 O O   . HOH G 4 .   ? 17.913 5.847   13.524  1.00 41.98 ? 152 HOH A O   1 
HETATM 3189 O O   . HOH G 4 .   ? 8.342  9.347   -8.160  1.00 69.52 ? 153 HOH A O   1 
HETATM 3190 O O   . HOH G 4 .   ? 26.602 20.984  6.148   1.00 58.04 ? 154 HOH A O   1 
HETATM 3191 O O   . HOH G 4 .   ? 28.820 20.799  4.655   1.00 57.26 ? 155 HOH A O   1 
HETATM 3192 O O   . HOH G 4 .   ? 5.294  1.404   7.362   1.00 69.01 ? 156 HOH A O   1 
HETATM 3193 O O   . HOH G 4 .   ? 13.677 20.395  2.249   1.00 49.35 ? 157 HOH A O   1 
HETATM 3194 O O   . HOH G 4 .   ? 12.530 15.472  -9.614  1.00 53.46 ? 158 HOH A O   1 
HETATM 3195 O O   . HOH G 4 .   ? 15.784 4.486   -6.350  1.00 43.85 ? 159 HOH A O   1 
HETATM 3196 O O   . HOH G 4 .   ? 25.701 -2.054  -6.722  1.00 44.67 ? 160 HOH A O   1 
HETATM 3197 O O   . HOH G 4 .   ? 45.730 -4.367  -2.873  1.00 67.00 ? 161 HOH A O   1 
HETATM 3198 O O   . HOH G 4 .   ? 37.107 12.348  8.497   1.00 59.60 ? 162 HOH A O   1 
HETATM 3199 O O   . HOH G 4 .   ? 37.243 10.011  4.590   1.00 54.75 ? 163 HOH A O   1 
HETATM 3200 O O   . HOH H 4 .   ? 23.296 16.678  10.350  1.00 53.72 ? 113 HOH B O   1 
HETATM 3201 O O   . HOH H 4 .   ? 8.420  14.433  10.779  1.00 56.22 ? 114 HOH B O   1 
HETATM 3202 O O   . HOH H 4 .   ? 16.289 -6.833  15.572  1.00 24.80 ? 115 HOH B O   1 
HETATM 3203 O O   . HOH H 4 .   ? 19.885 1.657   33.920  1.00 46.11 ? 116 HOH B O   1 
HETATM 3204 O O   . HOH H 4 .   ? 15.129 -2.990  13.217  1.00 42.95 ? 117 HOH B O   1 
HETATM 3205 O O   . HOH H 4 .   ? 8.296  -2.084  21.299  1.00 43.85 ? 118 HOH B O   1 
HETATM 3206 O O   . HOH H 4 .   ? 11.666 -7.850  14.527  1.00 47.94 ? 119 HOH B O   1 
HETATM 3207 O O   . HOH H 4 .   ? 37.191 -2.251  19.317  1.00 58.20 ? 120 HOH B O   1 
HETATM 3208 O O   . HOH H 4 .   ? 33.655 13.819  31.339  1.00 67.12 ? 121 HOH B O   1 
HETATM 3209 O O   . HOH H 4 .   ? 14.950 11.686  25.608  1.00 54.30 ? 122 HOH B O   1 
HETATM 3210 O O   . HOH H 4 .   ? 9.691  -4.308  21.603  1.00 39.94 ? 123 HOH B O   1 
HETATM 3211 O O   . HOH H 4 .   ? 6.648  4.714   12.171  1.00 64.87 ? 124 HOH B O   1 
HETATM 3212 O O   . HOH H 4 .   ? 31.572 -7.788  11.143  1.00 60.87 ? 125 HOH B O   1 
HETATM 3213 O O   . HOH H 4 .   ? 26.481 -7.161  24.261  1.00 51.06 ? 126 HOH B O   1 
HETATM 3214 O O   . HOH H 4 .   ? 18.397 -13.275 22.828  1.00 56.91 ? 127 HOH B O   1 
HETATM 3215 O O   . HOH H 4 .   ? 4.522  9.077   13.379  1.00 66.38 ? 128 HOH B O   1 
HETATM 3216 O O   . HOH H 4 .   ? 5.832  12.292  16.768  1.00 69.53 ? 129 HOH B O   1 
HETATM 3217 O O   . HOH H 4 .   ? 23.619 17.012  18.094  1.00 47.88 ? 130 HOH B O   1 
HETATM 3218 O O   . HOH H 4 .   ? 30.988 16.499  13.162  1.00 73.62 ? 131 HOH B O   1 
HETATM 3219 O O   . HOH H 4 .   ? 32.881 17.230  25.937  1.00 57.88 ? 132 HOH B O   1 
HETATM 3220 O O   . HOH H 4 .   ? 36.553 8.028   9.757   1.00 64.54 ? 133 HOH B O   1 
HETATM 3221 O O   . HOH H 4 .   ? 37.816 1.891   14.078  1.00 58.77 ? 134 HOH B O   1 
HETATM 3222 O O   . HOH H 4 .   ? 20.739 13.587  29.561  1.00 69.14 ? 135 HOH B O   1 
HETATM 3223 O O   . HOH H 4 .   ? 23.065 15.160  34.336  1.00 82.97 ? 136 HOH B O   1 
HETATM 3224 O O   . HOH H 4 .   ? 31.107 4.429   32.996  1.00 73.43 ? 137 HOH B O   1 
HETATM 3225 O O   . HOH H 4 .   ? 25.512 6.360   34.501  1.00 57.18 ? 138 HOH B O   1 
HETATM 3226 O O   . HOH H 4 .   ? 34.418 1.733   27.404  1.00 70.70 ? 139 HOH B O   1 
HETATM 3227 O O   . HOH I 4 .   ? 7.838  -24.076 -1.949  1.00 58.37 ? 119 HOH C O   1 
HETATM 3228 O O   . HOH I 4 .   ? 13.456 -28.169 0.282   1.00 63.23 ? 120 HOH C O   1 
HETATM 3229 O O   . HOH I 4 .   ? 19.867 -5.778  3.516   1.00 42.28 ? 121 HOH C O   1 
HETATM 3230 O O   . HOH I 4 .   ? 22.564 -2.435  3.501   1.00 56.86 ? 122 HOH C O   1 
HETATM 3231 O O   . HOH I 4 .   ? 13.563 1.749   -4.149  1.00 43.24 ? 123 HOH C O   1 
HETATM 3232 O O   . HOH I 4 .   ? -1.733 -5.704  -0.106  1.00 26.72 ? 124 HOH C O   1 
HETATM 3233 O O   . HOH I 4 .   ? 10.338 -11.813 -12.218 1.00 37.82 ? 125 HOH C O   1 
HETATM 3234 O O   . HOH I 4 .   ? 22.988 -11.233 -8.528  1.00 34.71 ? 126 HOH C O   1 
HETATM 3235 O O   . HOH I 4 .   ? 24.065 -13.912 2.780   1.00 37.11 ? 127 HOH C O   1 
HETATM 3236 O O   . HOH I 4 .   ? 1.968  -9.270  -6.836  1.00 51.92 ? 128 HOH C O   1 
HETATM 3237 O O   . HOH I 4 .   ? 10.968 -7.100  -9.499  1.00 29.52 ? 129 HOH C O   1 
HETATM 3238 O O   . HOH I 4 .   ? 18.075 -6.875  13.493  1.00 43.51 ? 130 HOH C O   1 
HETATM 3239 O O   . HOH I 4 .   ? 25.902 -16.421 -5.528  1.00 39.67 ? 131 HOH C O   1 
HETATM 3240 O O   . HOH I 4 .   ? 33.159 -2.924  -10.950 1.00 53.10 ? 132 HOH C O   1 
HETATM 3241 O O   . HOH I 4 .   ? 13.504 -13.907 8.522   1.00 38.75 ? 133 HOH C O   1 
HETATM 3242 O O   . HOH I 4 .   ? 30.544 10.282  -12.673 1.00 76.56 ? 134 HOH C O   1 
HETATM 3243 O O   . HOH I 4 .   ? 10.210 -20.654 9.823   1.00 47.47 ? 135 HOH C O   1 
HETATM 3244 O O   . HOH I 4 .   ? 12.515 -12.369 14.879  1.00 56.40 ? 136 HOH C O   1 
HETATM 3245 O O   . HOH I 4 .   ? 10.822 -4.537  11.071  1.00 42.12 ? 137 HOH C O   1 
HETATM 3246 O O   . HOH I 4 .   ? 26.541 -4.309  -0.961  1.00 39.53 ? 138 HOH C O   1 
HETATM 3247 O O   . HOH I 4 .   ? 20.251 -4.326  13.580  1.00 52.37 ? 139 HOH C O   1 
HETATM 3248 O O   . HOH I 4 .   ? 2.154  -18.420 4.145   1.00 48.42 ? 140 HOH C O   1 
HETATM 3249 O O   . HOH I 4 .   ? -1.049 -13.118 2.639   1.00 49.84 ? 141 HOH C O   1 
HETATM 3250 O O   . HOH I 4 .   ? 9.682  -24.956 7.582   1.00 60.08 ? 142 HOH C O   1 
HETATM 3251 O O   . HOH I 4 .   ? 0.904  1.915   0.137   1.00 66.42 ? 143 HOH C O   1 
HETATM 3252 O O   . HOH I 4 .   ? 21.326 -3.606  -1.049  1.00 50.71 ? 144 HOH C O   1 
HETATM 3253 O O   . HOH I 4 .   ? 15.495 2.276   -5.373  1.00 51.59 ? 145 HOH C O   1 
HETATM 3254 O O   . HOH I 4 .   ? 8.780  -10.089 -11.153 1.00 46.36 ? 146 HOH C O   1 
HETATM 3255 O O   . HOH I 4 .   ? 1.101  -8.617  11.800  1.00 71.30 ? 147 HOH C O   1 
HETATM 3256 O O   . HOH I 4 .   ? 22.808 -14.073 9.787   1.00 40.19 ? 148 HOH C O   1 
HETATM 3257 O O   . HOH I 4 .   ? 25.387 -5.848  4.142   1.00 51.18 ? 149 HOH C O   1 
HETATM 3258 O O   . HOH I 4 .   ? 26.699 -7.433  2.730   1.00 43.22 ? 150 HOH C O   1 
HETATM 3259 O O   . HOH I 4 .   ? 22.188 -20.040 -4.025  1.00 49.58 ? 151 HOH C O   1 
HETATM 3260 O O   . HOH I 4 .   ? 22.770 -17.575 -3.398  1.00 47.25 ? 152 HOH C O   1 
HETATM 3261 O O   . HOH I 4 .   ? 21.183 -23.570 -1.337  1.00 63.11 ? 153 HOH C O   1 
HETATM 3262 O O   . HOH I 4 .   ? 11.875 -5.356  -11.032 1.00 32.66 ? 154 HOH C O   1 
HETATM 3263 O O   . HOH I 4 .   ? 24.104 -6.949  8.480   1.00 47.32 ? 155 HOH C O   1 
HETATM 3264 O O   . HOH I 4 .   ? 33.555 3.860   -12.350 1.00 55.52 ? 156 HOH C O   1 
HETATM 3265 O O   . HOH I 4 .   ? 10.117 5.490   -11.282 1.00 48.15 ? 157 HOH C O   1 
HETATM 3266 O O   . HOH I 4 .   ? 31.290 -8.397  -0.797  1.00 61.20 ? 158 HOH C O   1 
HETATM 3267 O O   . HOH I 4 .   ? 27.326 -0.878  -7.638  1.00 39.43 ? 159 HOH C O   1 
HETATM 3268 O O   . HOH I 4 .   ? 30.957 -8.614  -7.533  1.00 59.89 ? 160 HOH C O   1 
HETATM 3269 O O   . HOH I 4 .   ? 6.642  -27.387 5.731   1.00 53.80 ? 161 HOH C O   1 
HETATM 3270 O O   . HOH I 4 .   ? 23.957 -18.077 13.601  1.00 55.72 ? 162 HOH C O   1 
HETATM 3271 O O   . HOH I 4 .   ? 12.785 -2.596  8.501   1.00 64.11 ? 163 HOH C O   1 
HETATM 3272 O O   . HOH I 4 .   ? -0.556 -4.680  5.483   1.00 59.66 ? 164 HOH C O   1 
HETATM 3273 O O   . HOH I 4 .   ? 2.720  -16.682 6.320   1.00 49.17 ? 165 HOH C O   1 
HETATM 3274 O O   . HOH J 4 .   ? 22.198 9.197   -12.397 1.00 46.91 ? 113 HOH D O   1 
HETATM 3275 O O   . HOH J 4 .   ? 16.045 8.507   -17.300 1.00 53.90 ? 114 HOH D O   1 
HETATM 3276 O O   . HOH J 4 .   ? 26.404 -6.283  -26.590 1.00 52.22 ? 115 HOH D O   1 
HETATM 3277 O O   . HOH J 4 .   ? 19.946 3.602   -13.688 1.00 29.94 ? 116 HOH D O   1 
HETATM 3278 O O   . HOH J 4 .   ? 13.634 6.636   -20.060 1.00 48.22 ? 117 HOH D O   1 
HETATM 3279 O O   . HOH J 4 .   ? 5.422  -14.741 -7.126  1.00 55.57 ? 118 HOH D O   1 
HETATM 3280 O O   . HOH J 4 .   ? 16.828 1.910   -10.898 1.00 47.09 ? 119 HOH D O   1 
HETATM 3281 O O   . HOH J 4 .   ? 27.155 2.962   -20.521 1.00 50.41 ? 120 HOH D O   1 
HETATM 3282 O O   . HOH J 4 .   ? 28.469 9.630   -11.358 1.00 44.44 ? 121 HOH D O   1 
HETATM 3283 O O   . HOH J 4 .   ? 20.955 -1.379  -11.611 1.00 50.25 ? 122 HOH D O   1 
HETATM 3284 O O   . HOH J 4 .   ? 16.055 -12.825 -32.247 1.00 66.14 ? 123 HOH D O   1 
HETATM 3285 O O   . HOH J 4 .   ? 26.517 -4.079  -22.734 1.00 54.78 ? 124 HOH D O   1 
HETATM 3286 O O   . HOH J 4 .   ? 32.226 -16.007 -9.734  1.00 38.92 ? 125 HOH D O   1 
HETATM 3287 O O   . HOH J 4 .   ? 30.851 -7.462  -9.850  1.00 45.00 ? 126 HOH D O   1 
HETATM 3288 O O   . HOH J 4 .   ? 24.683 -16.587 -24.958 1.00 59.57 ? 127 HOH D O   1 
HETATM 3289 O O   . HOH J 4 .   ? 3.154  -7.577  -12.929 1.00 52.88 ? 128 HOH D O   1 
HETATM 3290 O O   . HOH J 4 .   ? 24.261 -14.334 -34.269 1.00 79.61 ? 129 HOH D O   1 
HETATM 3291 O O   . HOH J 4 .   ? 4.027  -1.970  -25.161 1.00 45.45 ? 130 HOH D O   1 
HETATM 3292 O O   . HOH J 4 .   ? 15.142 -5.149  -31.656 1.00 48.80 ? 131 HOH D O   1 
HETATM 3293 O O   . HOH J 4 .   ? 34.029 -10.872 -10.682 1.00 67.63 ? 132 HOH D O   1 
HETATM 3294 O O   . HOH J 4 .   ? 4.987  -8.039  -23.016 1.00 58.28 ? 133 HOH D O   1 
HETATM 3295 O O   . HOH J 4 .   ? 34.684 -16.802 -26.410 1.00 65.46 ? 134 HOH D O   1 
HETATM 3296 O O   . HOH J 4 .   ? -0.623 -5.168  -18.649 1.00 66.38 ? 135 HOH D O   1 
HETATM 3297 O O   . HOH J 4 .   ? 7.924  -19.653 -6.758  1.00 53.05 ? 136 HOH D O   1 
HETATM 3298 O O   . HOH J 4 .   ? 6.902  -17.222 -7.431  1.00 56.71 ? 137 HOH D O   1 
HETATM 3299 O O   . HOH J 4 .   ? 6.274  -17.368 -15.819 1.00 58.46 ? 138 HOH D O   1 
HETATM 3300 O O   . HOH K 4 .   ? 19.944 -0.841  -31.130 1.00 51.14 ? 177 HOH E O   1 
HETATM 3301 O O   . HOH K 4 .   ? 7.071  5.270   -23.957 1.00 58.77 ? 178 HOH E O   1 
HETATM 3302 O O   . HOH K 4 .   ? 21.771 13.248  -20.620 1.00 59.45 ? 179 HOH E O   1 
HETATM 3303 O O   . HOH K 4 .   ? -3.047 -2.251  -28.333 1.00 67.16 ? 180 HOH E O   1 
HETATM 3304 O O   . HOH L 4 .   ? 7.884  2.020   24.161  1.00 58.11 ? 177 HOH F O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   ASP 2   2   2   ASP ASP A . n 
A 1 3   VAL 3   3   3   VAL VAL A . n 
A 1 4   PHE 4   4   4   PHE PHE A . n 
A 1 5   LEU 5   5   5   LEU LEU A . n 
A 1 6   MET 6   6   6   MET MET A . n 
A 1 7   ILE 7   7   7   ILE ILE A . n 
A 1 8   ARG 8   8   8   ARG ARG A . n 
A 1 9   ARG 9   9   9   ARG ARG A . n 
A 1 10  HIS 10  10  10  HIS HIS A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  THR 12  12  12  THR THR A . n 
A 1 13  THR 13  13  13  THR THR A . n 
A 1 14  ILE 14  14  14  ILE ILE A . n 
A 1 15  PHE 15  15  15  PHE PHE A . n 
A 1 16  THR 16  16  16  THR THR A . n 
A 1 17  ASP 17  17  17  ASP ASP A . n 
A 1 18  ALA 18  18  18  ALA ALA A . n 
A 1 19  LYS 19  19  19  LYS LYS A . n 
A 1 20  GLU 20  20  20  GLU GLU A . n 
A 1 21  SER 21  21  21  SER SER A . n 
A 1 22  SER 22  22  22  SER SER A . n 
A 1 23  THR 23  23  23  THR THR A . n 
A 1 24  VAL 24  24  24  VAL VAL A . n 
A 1 25  PHE 25  25  25  PHE PHE A . n 
A 1 26  GLU 26  26  26  GLU GLU A . n 
A 1 27  LEU 27  27  27  LEU LEU A . n 
A 1 28  LYS 28  28  28  LYS LYS A . n 
A 1 29  ARG 29  29  29  ARG ARG A . n 
A 1 30  ILE 30  30  30  ILE ILE A . n 
A 1 31  VAL 31  31  31  VAL VAL A . n 
A 1 32  GLU 32  32  32  GLU GLU A . n 
A 1 33  GLY 33  33  33  GLY GLY A . n 
A 1 34  ILE 34  34  34  ILE ILE A . n 
A 1 35  LEU 35  35  35  LEU LEU A . n 
A 1 36  LYS 36  36  36  LYS LYS A . n 
A 1 37  ARG 37  37  37  ARG ARG A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  ASP 40  40  40  ASP ASP A . n 
A 1 41  GLU 41  41  41  GLU GLU A . n 
A 1 42  GLN 42  42  42  GLN GLN A . n 
A 1 43  ARG 43  43  43  ARG ARG A . n 
A 1 44  LEU 44  44  44  LEU LEU A . n 
A 1 45  TYR 45  45  45  TYR TYR A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  ASP 47  47  47  ASP ASP A . n 
A 1 48  ASP 48  48  48  ASP ASP A . n 
A 1 49  GLN 49  49  49  GLN GLN A . n 
A 1 50  LEU 50  50  50  LEU LEU A . n 
A 1 51  LEU 51  51  51  LEU LEU A . n 
A 1 52  ASP 52  52  52  ASP ASP A . n 
A 1 53  ASP 53  53  53  ASP ASP A . n 
A 1 54  GLY 54  54  54  GLY GLY A . n 
A 1 55  LYS 55  55  55  LYS LYS A . n 
A 1 56  THR 56  56  56  THR THR A . n 
A 1 57  LEU 57  57  57  LEU LEU A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  GLU 59  59  59  GLU GLU A . n 
A 1 60  CYS 60  60  60  CYS CYS A . n 
A 1 61  GLY 61  61  61  GLY GLY A . n 
A 1 62  PHE 62  62  62  PHE PHE A . n 
A 1 63  THR 63  63  63  THR THR A . n 
A 1 64  SER 64  64  64  SER SER A . n 
A 1 65  GLN 65  65  65  GLN GLN A . n 
A 1 66  THR 66  66  66  THR THR A . n 
A 1 67  ALA 67  67  67  ALA ALA A . n 
A 1 68  ARG 68  68  68  ARG ARG A . n 
A 1 69  PRO 69  69  69  PRO PRO A . n 
A 1 70  GLN 70  70  70  GLN GLN A . n 
A 1 71  ALA 71  71  71  ALA ALA A . n 
A 1 72  PRO 72  72  72  PRO PRO A . n 
A 1 73  ALA 73  73  73  ALA ALA A . n 
A 1 74  THR 74  74  74  THR THR A . n 
A 1 75  VAL 75  75  75  VAL VAL A . n 
A 1 76  GLY 76  76  76  GLY GLY A . n 
A 1 77  LEU 77  77  77  LEU LEU A . n 
A 1 78  ALA 78  78  78  ALA ALA A . n 
A 1 79  PHE 79  79  79  PHE PHE A . n 
A 1 80  ARG 80  80  80  ARG ARG A . n 
A 1 81  ALA 81  81  81  ALA ALA A . n 
A 1 82  ASP 82  82  ?   ?   ?   A . n 
A 1 83  ASP 83  83  83  ASP ASP A . n 
A 1 84  THR 84  84  84  THR THR A . n 
A 1 85  PHE 85  85  85  PHE PHE A . n 
A 1 86  GLU 86  86  86  GLU GLU A . n 
A 1 87  ALA 87  87  87  ALA ALA A . n 
A 1 88  LEU 88  88  88  LEU LEU A . n 
A 1 89  CYS 89  89  89  CYS CYS A . n 
A 1 90  ILE 90  90  90  ILE ILE A . n 
A 1 91  GLU 91  91  91  GLU GLU A . n 
A 1 92  PRO 92  92  92  PRO PRO A . n 
A 1 93  PHE 93  93  93  PHE PHE A . n 
A 1 94  SER 94  94  94  SER SER A . n 
A 1 95  SER 95  95  95  SER SER A . n 
A 1 96  PRO 96  96  96  PRO PRO A . n 
A 1 97  PRO 97  97  97  PRO PRO A . n 
A 1 98  GLU 98  98  98  GLU GLU A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 PRO 100 100 100 PRO PRO A . n 
A 1 101 ASP 101 101 ?   ?   ?   A . n 
A 1 102 VAL 102 102 ?   ?   ?   A . n 
A 1 103 MET 103 103 ?   ?   ?   A . n 
A 1 104 LYS 104 104 ?   ?   ?   A . n 
A 1 105 PRO 105 105 ?   ?   ?   A . n 
A 1 106 GLN 106 106 ?   ?   ?   A . n 
A 1 107 ASP 107 107 ?   ?   ?   A . n 
A 1 108 SER 108 108 ?   ?   ?   A . n 
A 1 109 GLY 109 109 ?   ?   ?   A . n 
A 1 110 SER 110 110 ?   ?   ?   A . n 
A 1 111 SER 111 111 ?   ?   ?   A . n 
A 1 112 ALA 112 112 ?   ?   ?   A . n 
A 1 113 ASN 113 113 ?   ?   ?   A . n 
A 1 114 GLU 114 114 ?   ?   ?   A . n 
A 1 115 GLN 115 115 ?   ?   ?   A . n 
A 1 116 ALA 116 116 ?   ?   ?   A . n 
A 1 117 VAL 117 117 ?   ?   ?   A . n 
A 1 118 GLN 118 118 ?   ?   ?   A . n 
B 2 1   MET 1   16  ?   ?   ?   B . n 
B 2 2   MET 2   17  17  MET MET B . n 
B 2 3   TYR 3   18  18  TYR TYR B . n 
B 2 4   VAL 4   19  19  VAL VAL B . n 
B 2 5   LYS 5   20  20  LYS LYS B . n 
B 2 6   LEU 6   21  21  LEU LEU B . n 
B 2 7   ILE 7   22  22  ILE ILE B . n 
B 2 8   SER 8   23  23  SER SER B . n 
B 2 9   SER 9   24  24  SER SER B . n 
B 2 10  ASP 10  25  25  ASP ASP B . n 
B 2 11  GLY 11  26  26  GLY GLY B . n 
B 2 12  HIS 12  27  27  HIS HIS B . n 
B 2 13  GLU 13  28  28  GLU GLU B . n 
B 2 14  PHE 14  29  29  PHE PHE B . n 
B 2 15  ILE 15  30  30  ILE ILE B . n 
B 2 16  VAL 16  31  31  VAL VAL B . n 
B 2 17  LYS 17  32  32  LYS LYS B . n 
B 2 18  ARG 18  33  33  ARG ARG B . n 
B 2 19  GLU 19  34  34  GLU GLU B . n 
B 2 20  HIS 20  35  35  HIS HIS B . n 
B 2 21  ALA 21  36  36  ALA ALA B . n 
B 2 22  LEU 22  37  37  LEU LEU B . n 
B 2 23  THR 23  38  38  THR THR B . n 
B 2 24  SER 24  39  39  SER SER B . n 
B 2 25  GLY 25  40  40  GLY GLY B . n 
B 2 26  THR 26  41  41  THR THR B . n 
B 2 27  ILE 27  42  42  ILE ILE B . n 
B 2 28  LYS 28  43  43  LYS LYS B . n 
B 2 29  ALA 29  44  44  ALA ALA B . n 
B 2 30  MET 30  45  45  MET MET B . n 
B 2 31  LEU 31  46  46  LEU LEU B . n 
B 2 32  SER 32  47  ?   ?   ?   B . n 
B 2 33  GLY 33  48  ?   ?   ?   B . n 
B 2 34  PRO 34  49  ?   ?   ?   B . n 
B 2 35  GLY 35  50  ?   ?   ?   B . n 
B 2 36  GLN 36  51  ?   ?   ?   B . n 
B 2 37  PHE 37  52  ?   ?   ?   B . n 
B 2 38  ALA 38  53  ?   ?   ?   B . n 
B 2 39  GLU 39  54  ?   ?   ?   B . n 
B 2 40  ASN 40  55  ?   ?   ?   B . n 
B 2 41  GLU 41  56  ?   ?   ?   B . n 
B 2 42  THR 42  57  57  THR SER B . n 
B 2 43  ASN 43  58  58  ASN ASN B . n 
B 2 44  GLU 44  59  59  GLU GLU B . n 
B 2 45  VAL 45  60  60  VAL VAL B . n 
B 2 46  ASN 46  61  61  ASN ASN B . n 
B 2 47  PHE 47  62  62  PHE PHE B . n 
B 2 48  ARG 48  63  63  ARG ARG B . n 
B 2 49  GLU 49  64  64  GLU GLU B . n 
B 2 50  ILE 50  65  65  ILE ILE B . n 
B 2 51  PRO 51  66  66  PRO PRO B . n 
B 2 52  SER 52  67  67  SER SER B . n 
B 2 53  HIS 53  68  68  HIS HIS B . n 
B 2 54  VAL 54  69  69  VAL VAL B . n 
B 2 55  LEU 55  70  70  LEU LEU B . n 
B 2 56  SER 56  71  71  SER SER B . n 
B 2 57  LYS 57  72  72  LYS LYS B . n 
B 2 58  VAL 58  73  73  VAL VAL B . n 
B 2 59  CYS 59  74  74  CYS CYS B . n 
B 2 60  MET 60  75  75  MET MET B . n 
B 2 61  TYR 61  76  76  TYR TYR B . n 
B 2 62  PHE 62  77  77  PHE PHE B . n 
B 2 63  THR 63  78  78  THR THR B . n 
B 2 64  TYR 64  79  79  TYR TYR B . n 
B 2 65  LYS 65  80  80  LYS LYS B . n 
B 2 66  VAL 66  81  81  VAL VAL B . n 
B 2 67  ARG 67  82  82  ARG ARG B . n 
B 2 68  TYR 68  83  83  TYR TYR B . n 
B 2 69  THR 69  84  84  THR THR B . n 
B 2 70  ASN 70  85  85  ASN ASN B . n 
B 2 71  SER 71  86  86  SER SER B . n 
B 2 72  SER 72  87  ?   ?   ?   B . n 
B 2 73  THR 73  88  ?   ?   ?   B . n 
B 2 74  GLU 74  89  89  GLU GLU B . n 
B 2 75  ILE 75  90  90  ILE ILE B . n 
B 2 76  PRO 76  91  91  PRO PRO B . n 
B 2 77  GLU 77  92  92  GLU GLU B . n 
B 2 78  PHE 78  93  93  PHE PHE B . n 
B 2 79  PRO 79  94  94  PRO PRO B . n 
B 2 80  ILE 80  95  95  ILE ILE B . n 
B 2 81  ALA 81  96  96  ALA ALA B . n 
B 2 82  PRO 82  97  97  PRO PRO B . n 
B 2 83  GLU 83  98  98  GLU GLU B . n 
B 2 84  ILE 84  99  99  ILE ILE B . n 
B 2 85  ALA 85  100 100 ALA ALA B . n 
B 2 86  LEU 86  101 101 LEU LEU B . n 
B 2 87  GLU 87  102 102 GLU GLU B . n 
B 2 88  LEU 88  103 103 LEU LEU B . n 
B 2 89  LEU 89  104 104 LEU LEU B . n 
B 2 90  MET 90  105 105 MET MET B . n 
B 2 91  ALA 91  106 106 ALA ALA B . n 
B 2 92  ALA 92  107 107 ALA ALA B . n 
B 2 93  ASN 93  108 108 ASN ASN B . n 
B 2 94  PHE 94  109 109 PHE PHE B . n 
B 2 95  LEU 95  110 110 LEU LEU B . n 
B 2 96  ASP 96  111 111 ASP ASP B . n 
B 2 97  CYS 97  112 112 CYS CYS B . n 
C 1 1   MET 1   1   1   MET MET C . n 
C 1 2   ASP 2   2   2   ASP ASP C . n 
C 1 3   VAL 3   3   3   VAL VAL C . n 
C 1 4   PHE 4   4   4   PHE PHE C . n 
C 1 5   LEU 5   5   5   LEU LEU C . n 
C 1 6   MET 6   6   6   MET MET C . n 
C 1 7   ILE 7   7   7   ILE ILE C . n 
C 1 8   ARG 8   8   8   ARG ARG C . n 
C 1 9   ARG 9   9   9   ARG ARG C . n 
C 1 10  HIS 10  10  10  HIS HIS C . n 
C 1 11  LYS 11  11  11  LYS LYS C . n 
C 1 12  THR 12  12  12  THR THR C . n 
C 1 13  THR 13  13  13  THR THR C . n 
C 1 14  ILE 14  14  14  ILE ILE C . n 
C 1 15  PHE 15  15  15  PHE PHE C . n 
C 1 16  THR 16  16  16  THR THR C . n 
C 1 17  ASP 17  17  17  ASP ASP C . n 
C 1 18  ALA 18  18  18  ALA ALA C . n 
C 1 19  LYS 19  19  19  LYS LYS C . n 
C 1 20  GLU 20  20  20  GLU GLU C . n 
C 1 21  SER 21  21  21  SER SER C . n 
C 1 22  SER 22  22  22  SER SER C . n 
C 1 23  THR 23  23  23  THR THR C . n 
C 1 24  VAL 24  24  24  VAL VAL C . n 
C 1 25  PHE 25  25  25  PHE PHE C . n 
C 1 26  GLU 26  26  26  GLU GLU C . n 
C 1 27  LEU 27  27  27  LEU LEU C . n 
C 1 28  LYS 28  28  28  LYS LYS C . n 
C 1 29  ARG 29  29  29  ARG ARG C . n 
C 1 30  ILE 30  30  30  ILE ILE C . n 
C 1 31  VAL 31  31  31  VAL VAL C . n 
C 1 32  GLU 32  32  32  GLU GLU C . n 
C 1 33  GLY 33  33  33  GLY GLY C . n 
C 1 34  ILE 34  34  34  ILE ILE C . n 
C 1 35  LEU 35  35  35  LEU LEU C . n 
C 1 36  LYS 36  36  36  LYS LYS C . n 
C 1 37  ARG 37  37  37  ARG ARG C . n 
C 1 38  PRO 38  38  38  PRO PRO C . n 
C 1 39  PRO 39  39  39  PRO PRO C . n 
C 1 40  ASP 40  40  40  ASP ASP C . n 
C 1 41  GLU 41  41  41  GLU GLU C . n 
C 1 42  GLN 42  42  42  GLN GLN C . n 
C 1 43  ARG 43  43  43  ARG ARG C . n 
C 1 44  LEU 44  44  44  LEU LEU C . n 
C 1 45  TYR 45  45  45  TYR TYR C . n 
C 1 46  LYS 46  46  46  LYS LYS C . n 
C 1 47  ASP 47  47  47  ASP ASP C . n 
C 1 48  ASP 48  48  48  ASP ASP C . n 
C 1 49  GLN 49  49  49  GLN GLN C . n 
C 1 50  LEU 50  50  50  LEU LEU C . n 
C 1 51  LEU 51  51  51  LEU LEU C . n 
C 1 52  ASP 52  52  52  ASP ASP C . n 
C 1 53  ASP 53  53  53  ASP ASP C . n 
C 1 54  GLY 54  54  54  GLY GLY C . n 
C 1 55  LYS 55  55  55  LYS LYS C . n 
C 1 56  THR 56  56  56  THR THR C . n 
C 1 57  LEU 57  57  57  LEU LEU C . n 
C 1 58  GLY 58  58  58  GLY GLY C . n 
C 1 59  GLU 59  59  59  GLU GLU C . n 
C 1 60  CYS 60  60  60  CYS CYS C . n 
C 1 61  GLY 61  61  61  GLY GLY C . n 
C 1 62  PHE 62  62  62  PHE PHE C . n 
C 1 63  THR 63  63  63  THR THR C . n 
C 1 64  SER 64  64  64  SER SER C . n 
C 1 65  GLN 65  65  65  GLN GLN C . n 
C 1 66  THR 66  66  66  THR THR C . n 
C 1 67  ALA 67  67  67  ALA ALA C . n 
C 1 68  ARG 68  68  68  ARG ARG C . n 
C 1 69  PRO 69  69  69  PRO PRO C . n 
C 1 70  GLN 70  70  70  GLN GLN C . n 
C 1 71  ALA 71  71  71  ALA ALA C . n 
C 1 72  PRO 72  72  72  PRO PRO C . n 
C 1 73  ALA 73  73  73  ALA ALA C . n 
C 1 74  THR 74  74  74  THR THR C . n 
C 1 75  VAL 75  75  75  VAL VAL C . n 
C 1 76  GLY 76  76  76  GLY GLY C . n 
C 1 77  LEU 77  77  77  LEU LEU C . n 
C 1 78  ALA 78  78  78  ALA ALA C . n 
C 1 79  PHE 79  79  79  PHE PHE C . n 
C 1 80  ARG 80  80  80  ARG ARG C . n 
C 1 81  ALA 81  81  81  ALA ALA C . n 
C 1 82  ASP 82  82  82  ASP ASP C . n 
C 1 83  ASP 83  83  ?   ?   ?   C . n 
C 1 84  THR 84  84  84  THR THR C . n 
C 1 85  PHE 85  85  85  PHE PHE C . n 
C 1 86  GLU 86  86  86  GLU GLU C . n 
C 1 87  ALA 87  87  87  ALA ALA C . n 
C 1 88  LEU 88  88  88  LEU LEU C . n 
C 1 89  CYS 89  89  89  CYS CYS C . n 
C 1 90  ILE 90  90  90  ILE ILE C . n 
C 1 91  GLU 91  91  91  GLU GLU C . n 
C 1 92  PRO 92  92  92  PRO PRO C . n 
C 1 93  PHE 93  93  93  PHE PHE C . n 
C 1 94  SER 94  94  94  SER SER C . n 
C 1 95  SER 95  95  95  SER SER C . n 
C 1 96  PRO 96  96  96  PRO PRO C . n 
C 1 97  PRO 97  97  97  PRO PRO C . n 
C 1 98  GLU 98  98  98  GLU GLU C . n 
C 1 99  LEU 99  99  ?   ?   ?   C . n 
C 1 100 PRO 100 100 ?   ?   ?   C . n 
C 1 101 ASP 101 101 ?   ?   ?   C . n 
C 1 102 VAL 102 102 ?   ?   ?   C . n 
C 1 103 MET 103 103 ?   ?   ?   C . n 
C 1 104 LYS 104 104 ?   ?   ?   C . n 
C 1 105 PRO 105 105 ?   ?   ?   C . n 
C 1 106 GLN 106 106 ?   ?   ?   C . n 
C 1 107 ASP 107 107 ?   ?   ?   C . n 
C 1 108 SER 108 108 ?   ?   ?   C . n 
C 1 109 GLY 109 109 ?   ?   ?   C . n 
C 1 110 SER 110 110 ?   ?   ?   C . n 
C 1 111 SER 111 111 ?   ?   ?   C . n 
C 1 112 ALA 112 112 ?   ?   ?   C . n 
C 1 113 ASN 113 113 ?   ?   ?   C . n 
C 1 114 GLU 114 114 ?   ?   ?   C . n 
C 1 115 GLN 115 115 ?   ?   ?   C . n 
C 1 116 ALA 116 116 ?   ?   ?   C . n 
C 1 117 VAL 117 117 ?   ?   ?   C . n 
C 1 118 GLN 118 118 ?   ?   ?   C . n 
D 2 1   MET 1   16  ?   ?   ?   D . n 
D 2 2   MET 2   17  17  MET MET D . n 
D 2 3   TYR 3   18  18  TYR TYR D . n 
D 2 4   VAL 4   19  19  VAL VAL D . n 
D 2 5   LYS 5   20  20  LYS LYS D . n 
D 2 6   LEU 6   21  21  LEU LEU D . n 
D 2 7   ILE 7   22  22  ILE ILE D . n 
D 2 8   SER 8   23  23  SER SER D . n 
D 2 9   SER 9   24  24  SER SER D . n 
D 2 10  ASP 10  25  25  ASP ASP D . n 
D 2 11  GLY 11  26  26  GLY GLY D . n 
D 2 12  HIS 12  27  27  HIS HIS D . n 
D 2 13  GLU 13  28  28  GLU GLU D . n 
D 2 14  PHE 14  29  29  PHE PHE D . n 
D 2 15  ILE 15  30  30  ILE ILE D . n 
D 2 16  VAL 16  31  31  VAL VAL D . n 
D 2 17  LYS 17  32  32  LYS LYS D . n 
D 2 18  ARG 18  33  33  ARG ARG D . n 
D 2 19  GLU 19  34  34  GLU GLU D . n 
D 2 20  HIS 20  35  35  HIS HIS D . n 
D 2 21  ALA 21  36  36  ALA ALA D . n 
D 2 22  LEU 22  37  37  LEU LEU D . n 
D 2 23  THR 23  38  38  THR THR D . n 
D 2 24  SER 24  39  39  SER SER D . n 
D 2 25  GLY 25  40  40  GLY GLY D . n 
D 2 26  THR 26  41  41  THR THR D . n 
D 2 27  ILE 27  42  42  ILE ILE D . n 
D 2 28  LYS 28  43  43  LYS LYS D . n 
D 2 29  ALA 29  44  44  ALA ALA D . n 
D 2 30  MET 30  45  45  MET MET D . n 
D 2 31  LEU 31  46  46  LEU LEU D . n 
D 2 32  SER 32  47  47  SER SER D . n 
D 2 33  GLY 33  48  ?   ?   ?   D . n 
D 2 34  PRO 34  49  ?   ?   ?   D . n 
D 2 35  GLY 35  50  ?   ?   ?   D . n 
D 2 36  GLN 36  51  ?   ?   ?   D . n 
D 2 37  PHE 37  52  ?   ?   ?   D . n 
D 2 38  ALA 38  53  ?   ?   ?   D . n 
D 2 39  GLU 39  54  ?   ?   ?   D . n 
D 2 40  ASN 40  55  ?   ?   ?   D . n 
D 2 41  GLU 41  56  ?   ?   ?   D . n 
D 2 42  THR 42  57  ?   ?   ?   D . n 
D 2 43  ASN 43  58  58  ASN ASN D . n 
D 2 44  GLU 44  59  59  GLU GLU D . n 
D 2 45  VAL 45  60  60  VAL VAL D . n 
D 2 46  ASN 46  61  61  ASN ASN D . n 
D 2 47  PHE 47  62  62  PHE PHE D . n 
D 2 48  ARG 48  63  63  ARG ARG D . n 
D 2 49  GLU 49  64  64  GLU GLU D . n 
D 2 50  ILE 50  65  65  ILE ILE D . n 
D 2 51  PRO 51  66  66  PRO PRO D . n 
D 2 52  SER 52  67  67  SER SER D . n 
D 2 53  HIS 53  68  68  HIS HIS D . n 
D 2 54  VAL 54  69  69  VAL VAL D . n 
D 2 55  LEU 55  70  70  LEU LEU D . n 
D 2 56  SER 56  71  71  SER SER D . n 
D 2 57  LYS 57  72  72  LYS LYS D . n 
D 2 58  VAL 58  73  73  VAL VAL D . n 
D 2 59  CYS 59  74  74  CYS CYS D . n 
D 2 60  MET 60  75  75  MET MET D . n 
D 2 61  TYR 61  76  76  TYR TYR D . n 
D 2 62  PHE 62  77  77  PHE PHE D . n 
D 2 63  THR 63  78  78  THR THR D . n 
D 2 64  TYR 64  79  79  TYR TYR D . n 
D 2 65  LYS 65  80  80  LYS LYS D . n 
D 2 66  VAL 66  81  81  VAL VAL D . n 
D 2 67  ARG 67  82  82  ARG ARG D . n 
D 2 68  TYR 68  83  83  TYR TYR D . n 
D 2 69  THR 69  84  84  THR THR D . n 
D 2 70  ASN 70  85  85  ASN ASN D . n 
D 2 71  SER 71  86  86  SER SER D . n 
D 2 72  SER 72  87  87  SER SER D . n 
D 2 73  THR 73  88  88  THR THR D . n 
D 2 74  GLU 74  89  89  GLU GLU D . n 
D 2 75  ILE 75  90  90  ILE ILE D . n 
D 2 76  PRO 76  91  91  PRO PRO D . n 
D 2 77  GLU 77  92  92  GLU GLU D . n 
D 2 78  PHE 78  93  93  PHE PHE D . n 
D 2 79  PRO 79  94  94  PRO PRO D . n 
D 2 80  ILE 80  95  95  ILE ILE D . n 
D 2 81  ALA 81  96  96  ALA ALA D . n 
D 2 82  PRO 82  97  97  PRO PRO D . n 
D 2 83  GLU 83  98  98  GLU GLU D . n 
D 2 84  ILE 84  99  99  ILE ILE D . n 
D 2 85  ALA 85  100 100 ALA ALA D . n 
D 2 86  LEU 86  101 101 LEU LEU D . n 
D 2 87  GLU 87  102 102 GLU GLU D . n 
D 2 88  LEU 88  103 103 LEU LEU D . n 
D 2 89  LEU 89  104 104 LEU LEU D . n 
D 2 90  MET 90  105 105 MET MET D . n 
D 2 91  ALA 91  106 106 ALA ALA D . n 
D 2 92  ALA 92  107 107 ALA ALA D . n 
D 2 93  ASN 93  108 108 ASN ASN D . n 
D 2 94  PHE 94  109 109 PHE PHE D . n 
D 2 95  LEU 95  110 110 LEU LEU D . n 
D 2 96  ASP 96  111 111 ASP ASP D . n 
D 2 97  CYS 97  112 112 CYS CYS D . n 
E 3 1   SER 1   138 ?   ?   ?   E . n 
E 3 2   HIS 2   139 ?   ?   ?   E . n 
E 3 3   ASN 3   140 140 ASN ASN E . n 
E 3 4   LYS 4   141 141 LYS LYS E . n 
E 3 5   VAL 5   142 142 VAL VAL E . n 
E 3 6   GLY 6   143 143 GLY GLY E . n 
E 3 7   SER 7   144 144 SER SER E . n 
E 3 8   LEU 8   145 145 LEU LEU E . n 
E 3 9   GLN 9   146 146 GLN GLN E . n 
E 3 10  TYR 10  147 147 TYR TYR E . n 
E 3 11  LEU 11  148 148 LEU LEU E . n 
E 3 12  ALA 12  149 149 ALA ALA E . n 
E 3 13  LEU 13  150 150 LEU LEU E . n 
E 3 14  ALA 14  151 151 ALA ALA E . n 
E 3 15  ALA 15  152 152 ALA ALA E . n 
E 3 16  LEU 16  153 153 LEU LEU E . n 
E 3 17  ILE 17  154 154 ILE ILE E . n 
E 3 18  LYS 18  155 155 LYS LYS E . n 
E 3 19  PRO 19  156 156 PRO PRO E . n 
E 3 20  LYS 20  157 ?   ?   ?   E . n 
E 3 21  GLN 21  158 ?   ?   ?   E . n 
E 3 22  ILE 22  159 ?   ?   ?   E . n 
E 3 23  LYS 23  160 ?   ?   ?   E . n 
E 3 24  PRO 24  161 ?   ?   ?   E . n 
E 3 25  PRO 25  162 ?   ?   ?   E . n 
E 3 26  LEU 26  163 ?   ?   ?   E . n 
E 3 27  PRO 27  164 ?   ?   ?   E . n 
E 3 28  SER 28  165 ?   ?   ?   E . n 
E 3 29  VAL 29  166 ?   ?   ?   E . n 
E 3 30  ARG 30  167 ?   ?   ?   E . n 
E 3 31  LYS 31  168 ?   ?   ?   E . n 
E 3 32  LEU 32  169 ?   ?   ?   E . n 
E 3 33  THR 33  170 ?   ?   ?   E . n 
E 3 34  GLU 34  171 ?   ?   ?   E . n 
E 3 35  ASP 35  172 ?   ?   ?   E . n 
E 3 36  ARG 36  173 ?   ?   ?   E . n 
E 3 37  TRP 37  174 ?   ?   ?   E . n 
E 3 38  ASN 38  175 ?   ?   ?   E . n 
E 3 39  LYS 39  176 ?   ?   ?   E . n 
F 3 1   SER 1   138 ?   ?   ?   F . n 
F 3 2   HIS 2   139 ?   ?   ?   F . n 
F 3 3   ASN 3   140 140 ASN ASN F . n 
F 3 4   LYS 4   141 141 LYS LYS F . n 
F 3 5   VAL 5   142 142 VAL VAL F . n 
F 3 6   GLY 6   143 143 GLY GLY F . n 
F 3 7   SER 7   144 144 SER SER F . n 
F 3 8   LEU 8   145 145 LEU LEU F . n 
F 3 9   GLN 9   146 146 GLN GLN F . n 
F 3 10  TYR 10  147 147 TYR TYR F . n 
F 3 11  LEU 11  148 148 LEU LEU F . n 
F 3 12  ALA 12  149 149 ALA ALA F . n 
F 3 13  LEU 13  150 150 LEU LEU F . n 
F 3 14  ALA 14  151 151 ALA ALA F . n 
F 3 15  ALA 15  152 152 ALA ALA F . n 
F 3 16  LEU 16  153 153 LEU LEU F . n 
F 3 17  ILE 17  154 154 ILE ILE F . n 
F 3 18  LYS 18  155 155 LYS LYS F . n 
F 3 19  PRO 19  156 ?   ?   ?   F . n 
F 3 20  LYS 20  157 ?   ?   ?   F . n 
F 3 21  GLN 21  158 ?   ?   ?   F . n 
F 3 22  ILE 22  159 ?   ?   ?   F . n 
F 3 23  LYS 23  160 ?   ?   ?   F . n 
F 3 24  PRO 24  161 ?   ?   ?   F . n 
F 3 25  PRO 25  162 ?   ?   ?   F . n 
F 3 26  LEU 26  163 ?   ?   ?   F . n 
F 3 27  PRO 27  164 ?   ?   ?   F . n 
F 3 28  SER 28  165 ?   ?   ?   F . n 
F 3 29  VAL 29  166 ?   ?   ?   F . n 
F 3 30  ARG 30  167 ?   ?   ?   F . n 
F 3 31  LYS 31  168 ?   ?   ?   F . n 
F 3 32  LEU 32  169 ?   ?   ?   F . n 
F 3 33  THR 33  170 ?   ?   ?   F . n 
F 3 34  GLU 34  171 ?   ?   ?   F . n 
F 3 35  ASP 35  172 ?   ?   ?   F . n 
F 3 36  ARG 36  173 ?   ?   ?   F . n 
F 3 37  TRP 37  174 ?   ?   ?   F . n 
F 3 38  ASN 38  175 ?   ?   ?   F . n 
F 3 39  LYS 39  176 ?   ?   ?   F . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 4 HOH 1  119 3   HOH HOH A . 
G 4 HOH 2  120 8   HOH HOH A . 
G 4 HOH 3  121 10  HOH HOH A . 
G 4 HOH 4  122 26  HOH HOH A . 
G 4 HOH 5  123 27  HOH HOH A . 
G 4 HOH 6  124 37  HOH HOH A . 
G 4 HOH 7  125 41  HOH HOH A . 
G 4 HOH 8  126 43  HOH HOH A . 
G 4 HOH 9  127 46  HOH HOH A . 
G 4 HOH 10 128 47  HOH HOH A . 
G 4 HOH 11 129 52  HOH HOH A . 
G 4 HOH 12 130 54  HOH HOH A . 
G 4 HOH 13 131 66  HOH HOH A . 
G 4 HOH 14 132 67  HOH HOH A . 
G 4 HOH 15 133 80  HOH HOH A . 
G 4 HOH 16 134 82  HOH HOH A . 
G 4 HOH 17 135 84  HOH HOH A . 
G 4 HOH 18 136 90  HOH HOH A . 
G 4 HOH 19 137 91  HOH HOH A . 
G 4 HOH 20 138 93  HOH HOH A . 
G 4 HOH 21 139 95  HOH HOH A . 
G 4 HOH 22 140 96  HOH HOH A . 
G 4 HOH 23 141 97  HOH HOH A . 
G 4 HOH 24 142 120 HOH HOH A . 
G 4 HOH 25 143 121 HOH HOH A . 
G 4 HOH 26 144 122 HOH HOH A . 
G 4 HOH 27 145 127 HOH HOH A . 
G 4 HOH 28 146 128 HOH HOH A . 
G 4 HOH 29 147 131 HOH HOH A . 
G 4 HOH 30 148 142 HOH HOH A . 
G 4 HOH 31 149 150 HOH HOH A . 
G 4 HOH 32 150 153 HOH HOH A . 
G 4 HOH 33 151 154 HOH HOH A . 
G 4 HOH 34 152 156 HOH HOH A . 
G 4 HOH 35 153 157 HOH HOH A . 
G 4 HOH 36 154 161 HOH HOH A . 
G 4 HOH 37 155 162 HOH HOH A . 
G 4 HOH 38 156 163 HOH HOH A . 
G 4 HOH 39 157 166 HOH HOH A . 
G 4 HOH 40 158 173 HOH HOH A . 
G 4 HOH 41 159 174 HOH HOH A . 
G 4 HOH 42 160 176 HOH HOH A . 
G 4 HOH 43 161 181 HOH HOH A . 
G 4 HOH 44 162 182 HOH HOH A . 
G 4 HOH 45 163 190 HOH HOH A . 
H 4 HOH 1  113 13  HOH HOH B . 
H 4 HOH 2  114 36  HOH HOH B . 
H 4 HOH 3  115 48  HOH HOH B . 
H 4 HOH 4  116 68  HOH HOH B . 
H 4 HOH 5  117 79  HOH HOH B . 
H 4 HOH 6  118 81  HOH HOH B . 
H 4 HOH 7  119 88  HOH HOH B . 
H 4 HOH 8  120 100 HOH HOH B . 
H 4 HOH 9  121 103 HOH HOH B . 
H 4 HOH 10 122 105 HOH HOH B . 
H 4 HOH 11 123 107 HOH HOH B . 
H 4 HOH 12 124 116 HOH HOH B . 
H 4 HOH 13 125 126 HOH HOH B . 
H 4 HOH 14 126 139 HOH HOH B . 
H 4 HOH 15 127 140 HOH HOH B . 
H 4 HOH 16 128 145 HOH HOH B . 
H 4 HOH 17 129 149 HOH HOH B . 
H 4 HOH 18 130 160 HOH HOH B . 
H 4 HOH 19 131 167 HOH HOH B . 
H 4 HOH 20 132 168 HOH HOH B . 
H 4 HOH 21 133 183 HOH HOH B . 
H 4 HOH 22 134 184 HOH HOH B . 
H 4 HOH 23 135 191 HOH HOH B . 
H 4 HOH 24 136 192 HOH HOH B . 
H 4 HOH 25 137 193 HOH HOH B . 
H 4 HOH 26 138 117 HOH HOH B . 
H 4 HOH 27 139 170 HOH HOH B . 
I 4 HOH 1  119 124 HOH HOH C . 
I 4 HOH 2  120 180 HOH HOH C . 
I 4 HOH 3  121 7   HOH HOH C . 
I 4 HOH 4  122 24  HOH HOH C . 
I 4 HOH 5  123 35  HOH HOH C . 
I 4 HOH 6  124 38  HOH HOH C . 
I 4 HOH 7  125 39  HOH HOH C . 
I 4 HOH 8  126 42  HOH HOH C . 
I 4 HOH 9  127 53  HOH HOH C . 
I 4 HOH 10 128 55  HOH HOH C . 
I 4 HOH 11 129 58  HOH HOH C . 
I 4 HOH 12 130 62  HOH HOH C . 
I 4 HOH 13 131 71  HOH HOH C . 
I 4 HOH 14 132 75  HOH HOH C . 
I 4 HOH 15 133 76  HOH HOH C . 
I 4 HOH 16 134 83  HOH HOH C . 
I 4 HOH 17 135 85  HOH HOH C . 
I 4 HOH 18 136 87  HOH HOH C . 
I 4 HOH 19 137 89  HOH HOH C . 
I 4 HOH 20 138 98  HOH HOH C . 
I 4 HOH 21 139 104 HOH HOH C . 
I 4 HOH 22 140 108 HOH HOH C . 
I 4 HOH 23 141 109 HOH HOH C . 
I 4 HOH 24 142 110 HOH HOH C . 
I 4 HOH 25 143 115 HOH HOH C . 
I 4 HOH 26 144 119 HOH HOH C . 
I 4 HOH 27 145 129 HOH HOH C . 
I 4 HOH 28 146 130 HOH HOH C . 
I 4 HOH 29 147 135 HOH HOH C . 
I 4 HOH 30 148 136 HOH HOH C . 
I 4 HOH 31 149 137 HOH HOH C . 
I 4 HOH 32 150 138 HOH HOH C . 
I 4 HOH 33 151 146 HOH HOH C . 
I 4 HOH 34 152 147 HOH HOH C . 
I 4 HOH 35 153 148 HOH HOH C . 
I 4 HOH 36 154 151 HOH HOH C . 
I 4 HOH 37 155 152 HOH HOH C . 
I 4 HOH 38 156 155 HOH HOH C . 
I 4 HOH 39 157 158 HOH HOH C . 
I 4 HOH 40 158 164 HOH HOH C . 
I 4 HOH 41 159 175 HOH HOH C . 
I 4 HOH 42 160 178 HOH HOH C . 
I 4 HOH 43 161 179 HOH HOH C . 
I 4 HOH 44 162 187 HOH HOH C . 
I 4 HOH 45 163 188 HOH HOH C . 
I 4 HOH 46 164 194 HOH HOH C . 
I 4 HOH 47 165 132 HOH HOH C . 
J 4 HOH 1  113 5   HOH HOH D . 
J 4 HOH 2  114 14  HOH HOH D . 
J 4 HOH 3  115 17  HOH HOH D . 
J 4 HOH 4  116 40  HOH HOH D . 
J 4 HOH 5  117 45  HOH HOH D . 
J 4 HOH 6  118 56  HOH HOH D . 
J 4 HOH 7  119 57  HOH HOH D . 
J 4 HOH 8  120 69  HOH HOH D . 
J 4 HOH 9  121 72  HOH HOH D . 
J 4 HOH 10 122 74  HOH HOH D . 
J 4 HOH 11 123 112 HOH HOH D . 
J 4 HOH 12 124 123 HOH HOH D . 
J 4 HOH 13 125 133 HOH HOH D . 
J 4 HOH 14 126 134 HOH HOH D . 
J 4 HOH 15 127 144 HOH HOH D . 
J 4 HOH 16 128 159 HOH HOH D . 
J 4 HOH 17 129 165 HOH HOH D . 
J 4 HOH 18 130 169 HOH HOH D . 
J 4 HOH 19 131 172 HOH HOH D . 
J 4 HOH 20 132 195 HOH HOH D . 
J 4 HOH 21 133 196 HOH HOH D . 
J 4 HOH 22 134 197 HOH HOH D . 
J 4 HOH 23 135 198 HOH HOH D . 
J 4 HOH 24 136 125 HOH HOH D . 
J 4 HOH 25 137 185 HOH HOH D . 
J 4 HOH 26 138 186 HOH HOH D . 
K 4 HOH 1  177 111 HOH HOH E . 
K 4 HOH 2  178 171 HOH HOH E . 
K 4 HOH 3  179 199 HOH HOH E . 
K 4 HOH 4  180 200 HOH HOH E . 
L 4 HOH 1  177 118 HOH HOH F . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA trimeric 3 
2 author_and_software_defined_assembly PISA trimeric 3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,F,G,H,L 
2 1 C,D,E,I,J,K 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3610  ? 
1 MORE         -27   ? 
1 'SSA (A^2)'  10170 ? 
2 'ABSA (A^2)' 3380  ? 
2 MORE         -24   ? 
2 'SSA (A^2)'  10350 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-07-08 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 23.3970 7.0640   2.0590   -0.1976 -0.1248 -0.0725 -0.0117 -0.0055 0.0133  2.3527 2.8224 5.8068 0.2471  -0.5268 -1.1686 
-0.0208 0.0490  0.0357  -0.0717 -0.0102 -0.1326 -0.0297 0.3098  0.0310 'X-RAY DIFFRACTION' 
2 ? refined 21.0620 2.2850   21.9620  -0.1472 -0.0332 -0.1545 0.0004  -0.0341 0.0266  3.7510 3.8927 6.0630 0.0055  -1.2164 -0.6844 
0.0395  -0.1565 0.0821  0.2402  -0.1023 -0.1046 0.0141  0.3021  0.0628 'X-RAY DIFFRACTION' 
3 ? refined 14.7040 -10.8660 0.2000   0.0001  -0.1252 -0.0236 -0.0290 0.0299  -0.0051 3.1263 2.0978 4.9249 0.7147  -1.9147 -0.8502 
-0.1841 -0.1041 -0.3053 0.0109  -0.0506 0.0054  0.7121  0.0857  0.2347 'X-RAY DIFFRACTION' 
4 ? refined 15.6560 -5.6140  -19.9220 -0.0550 -0.0712 -0.1363 -0.0237 0.0154  -0.0557 3.1242 3.7505 6.8736 -0.2621 -0.2768 -0.7845 
-0.1267 0.1471  -0.1258 -0.1094 0.0949  0.1460  0.4068  -0.1949 0.0319 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 1   A 1 A 98  A 98 ? 'X-RAY DIFFRACTION' ? 
2 2 B 17  B 2 B 112 B 97 ? 'X-RAY DIFFRACTION' ? 
3 2 F 140 F 3 F 155 F 18 ? 'X-RAY DIFFRACTION' ? 
4 3 C 1   C 1 C 98  C 98 ? 'X-RAY DIFFRACTION' ? 
5 4 D 17  D 2 D 112 D 97 ? 'X-RAY DIFFRACTION' ? 
6 4 E 140 E 3 E 156 E 19 ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement        5.2.0019 ? 1 
ADSC      'data collection' Quantum  ? 2 
HKL-2000  'data reduction'  .        ? 3 
SCALEPACK 'data scaling'    .        ? 4 
PHASER    phasing           .        ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 HIS A 10  ? ? 47.78   -111.59 
2 1 HIS C 10  ? ? 49.76   -117.07 
3 1 ALA C 18  ? ? -151.29 -157.64 
4 1 ALA C 71  ? ? -161.40 73.96   
5 1 LYS E 141 ? ? -172.12 110.95  
6 1 LYS E 155 ? ? -57.90  108.14  
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   ASN 
_pdbx_validate_peptide_omega.auth_asym_id_1   E 
_pdbx_validate_peptide_omega.auth_seq_id_1    140 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   LYS 
_pdbx_validate_peptide_omega.auth_asym_id_2   E 
_pdbx_validate_peptide_omega.auth_seq_id_2    141 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -75.95 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 B THR 57 ? OG1 ? B THR 42 OG1 
2 1 Y 1 D SER 47 ? OG  ? D SER 32 OG  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A ASP 82  ? A ASP 82  
2   1 Y 1 A ASP 101 ? A ASP 101 
3   1 Y 1 A VAL 102 ? A VAL 102 
4   1 Y 1 A MET 103 ? A MET 103 
5   1 Y 1 A LYS 104 ? A LYS 104 
6   1 Y 1 A PRO 105 ? A PRO 105 
7   1 Y 1 A GLN 106 ? A GLN 106 
8   1 Y 1 A ASP 107 ? A ASP 107 
9   1 Y 1 A SER 108 ? A SER 108 
10  1 Y 1 A GLY 109 ? A GLY 109 
11  1 Y 1 A SER 110 ? A SER 110 
12  1 Y 1 A SER 111 ? A SER 111 
13  1 Y 1 A ALA 112 ? A ALA 112 
14  1 Y 1 A ASN 113 ? A ASN 113 
15  1 Y 1 A GLU 114 ? A GLU 114 
16  1 Y 1 A GLN 115 ? A GLN 115 
17  1 Y 1 A ALA 116 ? A ALA 116 
18  1 Y 1 A VAL 117 ? A VAL 117 
19  1 Y 1 A GLN 118 ? A GLN 118 
20  1 Y 1 B MET 16  ? B MET 1   
21  1 Y 1 B SER 47  ? B SER 32  
22  1 Y 1 B GLY 48  ? B GLY 33  
23  1 Y 1 B PRO 49  ? B PRO 34  
24  1 Y 1 B GLY 50  ? B GLY 35  
25  1 Y 1 B GLN 51  ? B GLN 36  
26  1 Y 1 B PHE 52  ? B PHE 37  
27  1 Y 1 B ALA 53  ? B ALA 38  
28  1 Y 1 B GLU 54  ? B GLU 39  
29  1 Y 1 B ASN 55  ? B ASN 40  
30  1 Y 1 B GLU 56  ? B GLU 41  
31  1 Y 1 B SER 87  ? B SER 72  
32  1 Y 1 B THR 88  ? B THR 73  
33  1 Y 1 C ASP 83  ? C ASP 83  
34  1 Y 1 C LEU 99  ? C LEU 99  
35  1 Y 1 C PRO 100 ? C PRO 100 
36  1 Y 1 C ASP 101 ? C ASP 101 
37  1 Y 1 C VAL 102 ? C VAL 102 
38  1 Y 1 C MET 103 ? C MET 103 
39  1 Y 1 C LYS 104 ? C LYS 104 
40  1 Y 1 C PRO 105 ? C PRO 105 
41  1 Y 1 C GLN 106 ? C GLN 106 
42  1 Y 1 C ASP 107 ? C ASP 107 
43  1 Y 1 C SER 108 ? C SER 108 
44  1 Y 1 C GLY 109 ? C GLY 109 
45  1 Y 1 C SER 110 ? C SER 110 
46  1 Y 1 C SER 111 ? C SER 111 
47  1 Y 1 C ALA 112 ? C ALA 112 
48  1 Y 1 C ASN 113 ? C ASN 113 
49  1 Y 1 C GLU 114 ? C GLU 114 
50  1 Y 1 C GLN 115 ? C GLN 115 
51  1 Y 1 C ALA 116 ? C ALA 116 
52  1 Y 1 C VAL 117 ? C VAL 117 
53  1 Y 1 C GLN 118 ? C GLN 118 
54  1 Y 1 D MET 16  ? D MET 1   
55  1 Y 1 D GLY 48  ? D GLY 33  
56  1 Y 1 D PRO 49  ? D PRO 34  
57  1 Y 1 D GLY 50  ? D GLY 35  
58  1 Y 1 D GLN 51  ? D GLN 36  
59  1 Y 1 D PHE 52  ? D PHE 37  
60  1 Y 1 D ALA 53  ? D ALA 38  
61  1 Y 1 D GLU 54  ? D GLU 39  
62  1 Y 1 D ASN 55  ? D ASN 40  
63  1 Y 1 D GLU 56  ? D GLU 41  
64  1 Y 1 D THR 57  ? D THR 42  
65  1 Y 1 E SER 138 ? E SER 1   
66  1 Y 1 E HIS 139 ? E HIS 2   
67  1 Y 1 E LYS 157 ? E LYS 20  
68  1 Y 1 E GLN 158 ? E GLN 21  
69  1 Y 1 E ILE 159 ? E ILE 22  
70  1 Y 1 E LYS 160 ? E LYS 23  
71  1 Y 1 E PRO 161 ? E PRO 24  
72  1 Y 1 E PRO 162 ? E PRO 25  
73  1 Y 1 E LEU 163 ? E LEU 26  
74  1 Y 1 E PRO 164 ? E PRO 27  
75  1 Y 1 E SER 165 ? E SER 28  
76  1 Y 1 E VAL 166 ? E VAL 29  
77  1 Y 1 E ARG 167 ? E ARG 30  
78  1 Y 1 E LYS 168 ? E LYS 31  
79  1 Y 1 E LEU 169 ? E LEU 32  
80  1 Y 1 E THR 170 ? E THR 33  
81  1 Y 1 E GLU 171 ? E GLU 34  
82  1 Y 1 E ASP 172 ? E ASP 35  
83  1 Y 1 E ARG 173 ? E ARG 36  
84  1 Y 1 E TRP 174 ? E TRP 37  
85  1 Y 1 E ASN 175 ? E ASN 38  
86  1 Y 1 E LYS 176 ? E LYS 39  
87  1 Y 1 F SER 138 ? F SER 1   
88  1 Y 1 F HIS 139 ? F HIS 2   
89  1 Y 1 F PRO 156 ? F PRO 19  
90  1 Y 1 F LYS 157 ? F LYS 20  
91  1 Y 1 F GLN 158 ? F GLN 21  
92  1 Y 1 F ILE 159 ? F ILE 22  
93  1 Y 1 F LYS 160 ? F LYS 23  
94  1 Y 1 F PRO 161 ? F PRO 24  
95  1 Y 1 F PRO 162 ? F PRO 25  
96  1 Y 1 F LEU 163 ? F LEU 26  
97  1 Y 1 F PRO 164 ? F PRO 27  
98  1 Y 1 F SER 165 ? F SER 28  
99  1 Y 1 F VAL 166 ? F VAL 29  
100 1 Y 1 F ARG 167 ? F ARG 30  
101 1 Y 1 F LYS 168 ? F LYS 31  
102 1 Y 1 F LEU 169 ? F LEU 32  
103 1 Y 1 F THR 170 ? F THR 33  
104 1 Y 1 F GLU 171 ? F GLU 34  
105 1 Y 1 F ASP 172 ? F ASP 35  
106 1 Y 1 F ARG 173 ? F ARG 36  
107 1 Y 1 F TRP 174 ? F TRP 37  
108 1 Y 1 F ASN 175 ? F ASN 38  
109 1 Y 1 F LYS 176 ? F LYS 39  
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#