data_3DLH
# 
_entry.id   3DLH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3DLH         
NDB   PD1155       
RCSB  RCSB048186   
WWPDB D_1000048186 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3DLB 
_pdbx_database_related.details        'same protein complexed with different length of DNA' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        3DLH 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2008-06-27 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wang, Y.'    1 
'Sheng, G.'   2 
'Patel, D.J.' 3 
# 
_citation.id                        primary 
_citation.title                     'Structure of the guide-strand-containing argonaute silencing complex.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            456 
_citation.page_first                209 
_citation.page_last                 213 
_citation.year                      2008 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18754009 
_citation.pdbx_database_id_DOI      10.1038/nature07315 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wang, Y.'    1 
primary 'Sheng, G.'   2 
primary 'Juranek, S.' 3 
primary 'Tuschl, T.'  4 
primary 'Patel, D.J.' 5 
# 
_cell.entry_id           3DLH 
_cell.length_a           74.744 
_cell.length_b           114.629 
_cell.length_c           175.689 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3DLH 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Argonaute                                                                                           76728.734 2  
? ? ? ? 
2 polymer     syn 
;DNA (5'-D(DTP*DGP*DAP*DGP*DGP*DTP*DAP*DGP*DTP*DAP*DGP*DGP*DTP*DTP*DGP*DTP*DAP*DTP*DAP*DGP*DT)-3')
;
6588.266  2  ? ? ? ? 
3 non-polymer syn 'MAGNESIUM ION'                                                                                     24.305    3  
? ? ? ? 
4 non-polymer syn 'TRIETHYLENE GLYCOL'                                                                                150.173   1  
? ? ? ? 
5 non-polymer syn 'PHOSPHATE ION'                                                                                     94.971    2  
? ? ? ? 
6 non-polymer syn 'ACETIC ACID'                                                                                       60.052    2  
? ? ? ? 
7 water       nat water                                                                                               18.015    75 
? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MNHLGKTEVFLNRFALRPLNPEELRPWRLEVVLDPPPGREEVYPLLAQVARRAGGVTVRMGDGLASWSPPEVLVLEGTLA
RMGQTYAYRLYPKGRRPLDPKDPGERSVLSALARRLLQERLRRLEGVWVEGLAVYRREHARGPGWRVLGGAVLDLWVSDS
GAFLLEVDPAYRILCEMSLEAWLAQGHPLPKRVRNAYDRRTWELLRLGEEDPKELPLPGGLSLLDYHASKGRLQGREGGR
VAWVADPKDPRKPIPHLTGLLVPVLTLEDLHEEEGSLALSLPWEERRRRTREIASWIGRRLGLGTPEAVRAQAYRLSIPK
LMGRRAVSKPADALRVGFYRAQETALALLRLDGAQGWPEFLRRALLRAFGASGASLRLHTLHAHPSQGLAFREALRKAKE
EGVQAVLVLTPPMAWEDRNRLKALLLREGLPSQILNVPLREEERHRWENALLGLLAKAGLQVVALSGAYPAELAVGFDAG
GRESFRFGGAACAVGGDGGHLLWTLPEAQAGERIPQEVVWDLLEETLWAFRRKAGRLPSRVLLLRDGRVPQDEFALALEA
LAREGIAYDLVSVRKSGGGRVYPVQGRLADGLYVPLEDKTFLLLTVHRDFRGTPRPLKLVHEAGDTPLEALAHQIFHLTR
LYPASGFAFPRLPAPLHLADRLVKEVGRLGIRHLKEVDREKLFFV
;
;MNHLGKTEVFLNRFALRPLNPEELRPWRLEVVLDPPPGREEVYPLLAQVARRAGGVTVRMGDGLASWSPPEVLVLEGTLA
RMGQTYAYRLYPKGRRPLDPKDPGERSVLSALARRLLQERLRRLEGVWVEGLAVYRREHARGPGWRVLGGAVLDLWVSDS
GAFLLEVDPAYRILCEMSLEAWLAQGHPLPKRVRNAYDRRTWELLRLGEEDPKELPLPGGLSLLDYHASKGRLQGREGGR
VAWVADPKDPRKPIPHLTGLLVPVLTLEDLHEEEGSLALSLPWEERRRRTREIASWIGRRLGLGTPEAVRAQAYRLSIPK
LMGRRAVSKPADALRVGFYRAQETALALLRLDGAQGWPEFLRRALLRAFGASGASLRLHTLHAHPSQGLAFREALRKAKE
EGVQAVLVLTPPMAWEDRNRLKALLLREGLPSQILNVPLREEERHRWENALLGLLAKAGLQVVALSGAYPAELAVGFDAG
GRESFRFGGAACAVGGDGGHLLWTLPEAQAGERIPQEVVWDLLEETLWAFRRKAGRLPSRVLLLRDGRVPQDEFALALEA
LAREGIAYDLVSVRKSGGGRVYPVQGRLADGLYVPLEDKTFLLLTVHRDFRGTPRPLKLVHEAGDTPLEALAHQIFHLTR
LYPASGFAFPRLPAPLHLADRLVKEVGRLGIRHLKEVDREKLFFV
;
A,B ? 
2 polydeoxyribonucleotide no no 
;(DT)(DG)(DA)(DG)(DG)(DT)(DA)(DG)(DT)(DA)(DG)(DG)(DT)(DT)(DG)(DT)(DA)(DT)(DA)(DG)
(DT)
;
TGAGGTAGTAGGTTGTATAGT X,Y ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASN n 
1 3   HIS n 
1 4   LEU n 
1 5   GLY n 
1 6   LYS n 
1 7   THR n 
1 8   GLU n 
1 9   VAL n 
1 10  PHE n 
1 11  LEU n 
1 12  ASN n 
1 13  ARG n 
1 14  PHE n 
1 15  ALA n 
1 16  LEU n 
1 17  ARG n 
1 18  PRO n 
1 19  LEU n 
1 20  ASN n 
1 21  PRO n 
1 22  GLU n 
1 23  GLU n 
1 24  LEU n 
1 25  ARG n 
1 26  PRO n 
1 27  TRP n 
1 28  ARG n 
1 29  LEU n 
1 30  GLU n 
1 31  VAL n 
1 32  VAL n 
1 33  LEU n 
1 34  ASP n 
1 35  PRO n 
1 36  PRO n 
1 37  PRO n 
1 38  GLY n 
1 39  ARG n 
1 40  GLU n 
1 41  GLU n 
1 42  VAL n 
1 43  TYR n 
1 44  PRO n 
1 45  LEU n 
1 46  LEU n 
1 47  ALA n 
1 48  GLN n 
1 49  VAL n 
1 50  ALA n 
1 51  ARG n 
1 52  ARG n 
1 53  ALA n 
1 54  GLY n 
1 55  GLY n 
1 56  VAL n 
1 57  THR n 
1 58  VAL n 
1 59  ARG n 
1 60  MET n 
1 61  GLY n 
1 62  ASP n 
1 63  GLY n 
1 64  LEU n 
1 65  ALA n 
1 66  SER n 
1 67  TRP n 
1 68  SER n 
1 69  PRO n 
1 70  PRO n 
1 71  GLU n 
1 72  VAL n 
1 73  LEU n 
1 74  VAL n 
1 75  LEU n 
1 76  GLU n 
1 77  GLY n 
1 78  THR n 
1 79  LEU n 
1 80  ALA n 
1 81  ARG n 
1 82  MET n 
1 83  GLY n 
1 84  GLN n 
1 85  THR n 
1 86  TYR n 
1 87  ALA n 
1 88  TYR n 
1 89  ARG n 
1 90  LEU n 
1 91  TYR n 
1 92  PRO n 
1 93  LYS n 
1 94  GLY n 
1 95  ARG n 
1 96  ARG n 
1 97  PRO n 
1 98  LEU n 
1 99  ASP n 
1 100 PRO n 
1 101 LYS n 
1 102 ASP n 
1 103 PRO n 
1 104 GLY n 
1 105 GLU n 
1 106 ARG n 
1 107 SER n 
1 108 VAL n 
1 109 LEU n 
1 110 SER n 
1 111 ALA n 
1 112 LEU n 
1 113 ALA n 
1 114 ARG n 
1 115 ARG n 
1 116 LEU n 
1 117 LEU n 
1 118 GLN n 
1 119 GLU n 
1 120 ARG n 
1 121 LEU n 
1 122 ARG n 
1 123 ARG n 
1 124 LEU n 
1 125 GLU n 
1 126 GLY n 
1 127 VAL n 
1 128 TRP n 
1 129 VAL n 
1 130 GLU n 
1 131 GLY n 
1 132 LEU n 
1 133 ALA n 
1 134 VAL n 
1 135 TYR n 
1 136 ARG n 
1 137 ARG n 
1 138 GLU n 
1 139 HIS n 
1 140 ALA n 
1 141 ARG n 
1 142 GLY n 
1 143 PRO n 
1 144 GLY n 
1 145 TRP n 
1 146 ARG n 
1 147 VAL n 
1 148 LEU n 
1 149 GLY n 
1 150 GLY n 
1 151 ALA n 
1 152 VAL n 
1 153 LEU n 
1 154 ASP n 
1 155 LEU n 
1 156 TRP n 
1 157 VAL n 
1 158 SER n 
1 159 ASP n 
1 160 SER n 
1 161 GLY n 
1 162 ALA n 
1 163 PHE n 
1 164 LEU n 
1 165 LEU n 
1 166 GLU n 
1 167 VAL n 
1 168 ASP n 
1 169 PRO n 
1 170 ALA n 
1 171 TYR n 
1 172 ARG n 
1 173 ILE n 
1 174 LEU n 
1 175 CYS n 
1 176 GLU n 
1 177 MET n 
1 178 SER n 
1 179 LEU n 
1 180 GLU n 
1 181 ALA n 
1 182 TRP n 
1 183 LEU n 
1 184 ALA n 
1 185 GLN n 
1 186 GLY n 
1 187 HIS n 
1 188 PRO n 
1 189 LEU n 
1 190 PRO n 
1 191 LYS n 
1 192 ARG n 
1 193 VAL n 
1 194 ARG n 
1 195 ASN n 
1 196 ALA n 
1 197 TYR n 
1 198 ASP n 
1 199 ARG n 
1 200 ARG n 
1 201 THR n 
1 202 TRP n 
1 203 GLU n 
1 204 LEU n 
1 205 LEU n 
1 206 ARG n 
1 207 LEU n 
1 208 GLY n 
1 209 GLU n 
1 210 GLU n 
1 211 ASP n 
1 212 PRO n 
1 213 LYS n 
1 214 GLU n 
1 215 LEU n 
1 216 PRO n 
1 217 LEU n 
1 218 PRO n 
1 219 GLY n 
1 220 GLY n 
1 221 LEU n 
1 222 SER n 
1 223 LEU n 
1 224 LEU n 
1 225 ASP n 
1 226 TYR n 
1 227 HIS n 
1 228 ALA n 
1 229 SER n 
1 230 LYS n 
1 231 GLY n 
1 232 ARG n 
1 233 LEU n 
1 234 GLN n 
1 235 GLY n 
1 236 ARG n 
1 237 GLU n 
1 238 GLY n 
1 239 GLY n 
1 240 ARG n 
1 241 VAL n 
1 242 ALA n 
1 243 TRP n 
1 244 VAL n 
1 245 ALA n 
1 246 ASP n 
1 247 PRO n 
1 248 LYS n 
1 249 ASP n 
1 250 PRO n 
1 251 ARG n 
1 252 LYS n 
1 253 PRO n 
1 254 ILE n 
1 255 PRO n 
1 256 HIS n 
1 257 LEU n 
1 258 THR n 
1 259 GLY n 
1 260 LEU n 
1 261 LEU n 
1 262 VAL n 
1 263 PRO n 
1 264 VAL n 
1 265 LEU n 
1 266 THR n 
1 267 LEU n 
1 268 GLU n 
1 269 ASP n 
1 270 LEU n 
1 271 HIS n 
1 272 GLU n 
1 273 GLU n 
1 274 GLU n 
1 275 GLY n 
1 276 SER n 
1 277 LEU n 
1 278 ALA n 
1 279 LEU n 
1 280 SER n 
1 281 LEU n 
1 282 PRO n 
1 283 TRP n 
1 284 GLU n 
1 285 GLU n 
1 286 ARG n 
1 287 ARG n 
1 288 ARG n 
1 289 ARG n 
1 290 THR n 
1 291 ARG n 
1 292 GLU n 
1 293 ILE n 
1 294 ALA n 
1 295 SER n 
1 296 TRP n 
1 297 ILE n 
1 298 GLY n 
1 299 ARG n 
1 300 ARG n 
1 301 LEU n 
1 302 GLY n 
1 303 LEU n 
1 304 GLY n 
1 305 THR n 
1 306 PRO n 
1 307 GLU n 
1 308 ALA n 
1 309 VAL n 
1 310 ARG n 
1 311 ALA n 
1 312 GLN n 
1 313 ALA n 
1 314 TYR n 
1 315 ARG n 
1 316 LEU n 
1 317 SER n 
1 318 ILE n 
1 319 PRO n 
1 320 LYS n 
1 321 LEU n 
1 322 MET n 
1 323 GLY n 
1 324 ARG n 
1 325 ARG n 
1 326 ALA n 
1 327 VAL n 
1 328 SER n 
1 329 LYS n 
1 330 PRO n 
1 331 ALA n 
1 332 ASP n 
1 333 ALA n 
1 334 LEU n 
1 335 ARG n 
1 336 VAL n 
1 337 GLY n 
1 338 PHE n 
1 339 TYR n 
1 340 ARG n 
1 341 ALA n 
1 342 GLN n 
1 343 GLU n 
1 344 THR n 
1 345 ALA n 
1 346 LEU n 
1 347 ALA n 
1 348 LEU n 
1 349 LEU n 
1 350 ARG n 
1 351 LEU n 
1 352 ASP n 
1 353 GLY n 
1 354 ALA n 
1 355 GLN n 
1 356 GLY n 
1 357 TRP n 
1 358 PRO n 
1 359 GLU n 
1 360 PHE n 
1 361 LEU n 
1 362 ARG n 
1 363 ARG n 
1 364 ALA n 
1 365 LEU n 
1 366 LEU n 
1 367 ARG n 
1 368 ALA n 
1 369 PHE n 
1 370 GLY n 
1 371 ALA n 
1 372 SER n 
1 373 GLY n 
1 374 ALA n 
1 375 SER n 
1 376 LEU n 
1 377 ARG n 
1 378 LEU n 
1 379 HIS n 
1 380 THR n 
1 381 LEU n 
1 382 HIS n 
1 383 ALA n 
1 384 HIS n 
1 385 PRO n 
1 386 SER n 
1 387 GLN n 
1 388 GLY n 
1 389 LEU n 
1 390 ALA n 
1 391 PHE n 
1 392 ARG n 
1 393 GLU n 
1 394 ALA n 
1 395 LEU n 
1 396 ARG n 
1 397 LYS n 
1 398 ALA n 
1 399 LYS n 
1 400 GLU n 
1 401 GLU n 
1 402 GLY n 
1 403 VAL n 
1 404 GLN n 
1 405 ALA n 
1 406 VAL n 
1 407 LEU n 
1 408 VAL n 
1 409 LEU n 
1 410 THR n 
1 411 PRO n 
1 412 PRO n 
1 413 MET n 
1 414 ALA n 
1 415 TRP n 
1 416 GLU n 
1 417 ASP n 
1 418 ARG n 
1 419 ASN n 
1 420 ARG n 
1 421 LEU n 
1 422 LYS n 
1 423 ALA n 
1 424 LEU n 
1 425 LEU n 
1 426 LEU n 
1 427 ARG n 
1 428 GLU n 
1 429 GLY n 
1 430 LEU n 
1 431 PRO n 
1 432 SER n 
1 433 GLN n 
1 434 ILE n 
1 435 LEU n 
1 436 ASN n 
1 437 VAL n 
1 438 PRO n 
1 439 LEU n 
1 440 ARG n 
1 441 GLU n 
1 442 GLU n 
1 443 GLU n 
1 444 ARG n 
1 445 HIS n 
1 446 ARG n 
1 447 TRP n 
1 448 GLU n 
1 449 ASN n 
1 450 ALA n 
1 451 LEU n 
1 452 LEU n 
1 453 GLY n 
1 454 LEU n 
1 455 LEU n 
1 456 ALA n 
1 457 LYS n 
1 458 ALA n 
1 459 GLY n 
1 460 LEU n 
1 461 GLN n 
1 462 VAL n 
1 463 VAL n 
1 464 ALA n 
1 465 LEU n 
1 466 SER n 
1 467 GLY n 
1 468 ALA n 
1 469 TYR n 
1 470 PRO n 
1 471 ALA n 
1 472 GLU n 
1 473 LEU n 
1 474 ALA n 
1 475 VAL n 
1 476 GLY n 
1 477 PHE n 
1 478 ASP n 
1 479 ALA n 
1 480 GLY n 
1 481 GLY n 
1 482 ARG n 
1 483 GLU n 
1 484 SER n 
1 485 PHE n 
1 486 ARG n 
1 487 PHE n 
1 488 GLY n 
1 489 GLY n 
1 490 ALA n 
1 491 ALA n 
1 492 CYS n 
1 493 ALA n 
1 494 VAL n 
1 495 GLY n 
1 496 GLY n 
1 497 ASP n 
1 498 GLY n 
1 499 GLY n 
1 500 HIS n 
1 501 LEU n 
1 502 LEU n 
1 503 TRP n 
1 504 THR n 
1 505 LEU n 
1 506 PRO n 
1 507 GLU n 
1 508 ALA n 
1 509 GLN n 
1 510 ALA n 
1 511 GLY n 
1 512 GLU n 
1 513 ARG n 
1 514 ILE n 
1 515 PRO n 
1 516 GLN n 
1 517 GLU n 
1 518 VAL n 
1 519 VAL n 
1 520 TRP n 
1 521 ASP n 
1 522 LEU n 
1 523 LEU n 
1 524 GLU n 
1 525 GLU n 
1 526 THR n 
1 527 LEU n 
1 528 TRP n 
1 529 ALA n 
1 530 PHE n 
1 531 ARG n 
1 532 ARG n 
1 533 LYS n 
1 534 ALA n 
1 535 GLY n 
1 536 ARG n 
1 537 LEU n 
1 538 PRO n 
1 539 SER n 
1 540 ARG n 
1 541 VAL n 
1 542 LEU n 
1 543 LEU n 
1 544 LEU n 
1 545 ARG n 
1 546 ASP n 
1 547 GLY n 
1 548 ARG n 
1 549 VAL n 
1 550 PRO n 
1 551 GLN n 
1 552 ASP n 
1 553 GLU n 
1 554 PHE n 
1 555 ALA n 
1 556 LEU n 
1 557 ALA n 
1 558 LEU n 
1 559 GLU n 
1 560 ALA n 
1 561 LEU n 
1 562 ALA n 
1 563 ARG n 
1 564 GLU n 
1 565 GLY n 
1 566 ILE n 
1 567 ALA n 
1 568 TYR n 
1 569 ASP n 
1 570 LEU n 
1 571 VAL n 
1 572 SER n 
1 573 VAL n 
1 574 ARG n 
1 575 LYS n 
1 576 SER n 
1 577 GLY n 
1 578 GLY n 
1 579 GLY n 
1 580 ARG n 
1 581 VAL n 
1 582 TYR n 
1 583 PRO n 
1 584 VAL n 
1 585 GLN n 
1 586 GLY n 
1 587 ARG n 
1 588 LEU n 
1 589 ALA n 
1 590 ASP n 
1 591 GLY n 
1 592 LEU n 
1 593 TYR n 
1 594 VAL n 
1 595 PRO n 
1 596 LEU n 
1 597 GLU n 
1 598 ASP n 
1 599 LYS n 
1 600 THR n 
1 601 PHE n 
1 602 LEU n 
1 603 LEU n 
1 604 LEU n 
1 605 THR n 
1 606 VAL n 
1 607 HIS n 
1 608 ARG n 
1 609 ASP n 
1 610 PHE n 
1 611 ARG n 
1 612 GLY n 
1 613 THR n 
1 614 PRO n 
1 615 ARG n 
1 616 PRO n 
1 617 LEU n 
1 618 LYS n 
1 619 LEU n 
1 620 VAL n 
1 621 HIS n 
1 622 GLU n 
1 623 ALA n 
1 624 GLY n 
1 625 ASP n 
1 626 THR n 
1 627 PRO n 
1 628 LEU n 
1 629 GLU n 
1 630 ALA n 
1 631 LEU n 
1 632 ALA n 
1 633 HIS n 
1 634 GLN n 
1 635 ILE n 
1 636 PHE n 
1 637 HIS n 
1 638 LEU n 
1 639 THR n 
1 640 ARG n 
1 641 LEU n 
1 642 TYR n 
1 643 PRO n 
1 644 ALA n 
1 645 SER n 
1 646 GLY n 
1 647 PHE n 
1 648 ALA n 
1 649 PHE n 
1 650 PRO n 
1 651 ARG n 
1 652 LEU n 
1 653 PRO n 
1 654 ALA n 
1 655 PRO n 
1 656 LEU n 
1 657 HIS n 
1 658 LEU n 
1 659 ALA n 
1 660 ASP n 
1 661 ARG n 
1 662 LEU n 
1 663 VAL n 
1 664 LYS n 
1 665 GLU n 
1 666 VAL n 
1 667 GLY n 
1 668 ARG n 
1 669 LEU n 
1 670 GLY n 
1 671 ILE n 
1 672 ARG n 
1 673 HIS n 
1 674 LEU n 
1 675 LYS n 
1 676 GLU n 
1 677 VAL n 
1 678 ASP n 
1 679 ARG n 
1 680 GLU n 
1 681 LYS n 
1 682 LEU n 
1 683 PHE n 
1 684 PHE n 
1 685 VAL n 
2 1   DT  n 
2 2   DG  n 
2 3   DA  n 
2 4   DG  n 
2 5   DG  n 
2 6   DT  n 
2 7   DA  n 
2 8   DG  n 
2 9   DT  n 
2 10  DA  n 
2 11  DG  n 
2 12  DG  n 
2 13  DT  n 
2 14  DT  n 
2 15  DG  n 
2 16  DT  n 
2 17  DA  n 
2 18  DT  n 
2 19  DA  n 
2 20  DG  n 
2 21  DT  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 TT_P0026 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    HB27 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Thermus thermophilus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     262724 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'ROSETTA 2 (DE3)pLysS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET-Sumo 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP Q746M7_THET2 Q746M7 1 
;MNHLGKTEVFLNRFALRPLNPEELRPWRLEVVLDPPPGREEVYPLLAQVARRAGGVTVRMGDGLASWSPPEVLVLEGTLA
RMGQTYAYRLYPKGRRPLDPKDPGERSVLSALARRLLQERLRRLEGVWVEGLAVYRREHARGPGWRVLGGAVLDLWVSDS
GAFLLEVDPAYRILCEMSLEAWLAQGHPLPKRVRNAYDRRTWELLRLGEEDPKELPLPGGLSLLDYHASKGRLQGREGGR
VAWVADPKDPRKPIPHLTGLLVPVLTLEDLHEEEGSLALSLPWEERRRRTREIASWIGRRLGLGTPEAVRAQAYRLSIPK
LMGRRAVSKPADALRVGFYRAQETALALLRLDGAQGWPEFLRRALLRAFGASGASLRLHTLHAHPSQGLAFREALRKAKE
EGVQAVLVLTPPMAWEDRNRLKALLLREGLPSQILNVPLREEERHRWENALLGLLAKAGLQVVALSGAYPAELAVGFDAG
GRESFRFGGAACAVGGDGGHLLWTLPEAQAGERIPQEVVWDLLEETLWAFRRKAGRLPSRVLLLRDGRVPQDEFALALEA
LAREGIAYDLVSVRKSGGGRVYPVQGRLADGLYVPLEDKTFLLLTVHRDFRGTPRPLKLVHEAGDTPLEALAHQIFHLTR
LYPASGFAFPRLPAPLHLADRLVKEVGRLGIRHLKEVDREKLFFV
;
1 ? 
2 PDB 3DLH         3DLH   2 TGAGGTAGTAGGTTGTATAGT 1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3DLH A 1 ? 685 ? Q746M7 1   ? 685 ? 1   685 
2 1 3DLH B 1 ? 685 ? Q746M7 1   ? 685 ? 1   685 
3 2 3DLH X 1 ? 21  ? 3DLH   1   ? 21  ? 1   21  
4 2 3DLH Y 1 ? 21  ? 3DLH   101 ? 121 ? 101 121 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACY non-polymer         . 'ACETIC ACID'                        ? 'C2 H4 O2'        60.052  
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'            24.305  
PGE non-polymer         . 'TRIETHYLENE GLYCOL'                 ? 'C6 H14 O4'       150.173 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PO4 non-polymer         . 'PHOSPHATE ION'                      ? 'O4 P -3'         94.971  
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3DLH 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.26 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   45.54 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.temp            308 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'18% PEG8000, 200mM KCl, 80mM MgAc2, 50mM Mes, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 308K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1 1 Mes     ? ? ? 
1 2 2 Mes     ? ? ? 
1 3 2 KCl     ? ? ? 
1 4 2 MgAc2   ? ? ? 
1 5 2 PEG8000 ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2007-12-16 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97926 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 24-ID-C' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97926 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-C 
# 
_reflns.entry_id                     3DLH 
_reflns.observed_criterion_sigma_F   -3 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            3 
_reflns.d_resolution_low             50 
_reflns.number_all                   ? 
_reflns.number_obs                   30932 
_reflns.percent_possible_obs         99.3 
_reflns.pdbx_Rmerge_I_obs            0.089 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        14 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3 
_reflns_shell.d_res_low              3.11 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   95.8 
_reflns_shell.Rmerge_I_obs           0.447 
_reflns_shell.meanI_over_sigI_obs    2 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_redundancy        4.4 
_reflns_shell.number_unique_all      2926 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3DLH 
_refine.ls_d_res_high                            3.000 
_refine.ls_d_res_low                             30.000 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    93.000 
_refine.ls_number_reflns_obs                     28771 
_refine.ls_R_factor_R_work                       0.226 
_refine.ls_R_factor_R_free                       0.284 
_refine.ls_percent_reflns_R_free                 6.600 
_refine.ls_number_reflns_R_free                  2037 
_refine.B_iso_mean                               58.357 
_refine.solvent_model_param_bsol                 29.252 
_refine.aniso_B[1][1]                            -6.191 
_refine.aniso_B[2][2]                            8.963 
_refine.aniso_B[3][3]                            -2.772 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.pdbx_method_to_determine_struct          ? 
_refine.B_iso_max                                151.86 
_refine.B_iso_min                                11.27 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            0.00 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.details                                  ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        10292 
_refine_hist.pdbx_number_atoms_nucleic_acid   588 
_refine_hist.pdbx_number_atoms_ligand         23 
_refine_hist.number_atoms_solvent             83 
_refine_hist.number_atoms_total               10986 
_refine_hist.d_res_high                       3.000 
_refine_hist.d_res_low                        30.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    ? 0.009 ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg ? 1.634 ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 CNS_TOPPAR:protein_rep.param ? 'X-RAY DIFFRACTION' 
2 CNS_TOPPAR:dna-rna_rep.param ? 'X-RAY DIFFRACTION' 
3 CNS_TOPPAR:water_rep.param   ? 'X-RAY DIFFRACTION' 
4 CNS_TOPPAR:ion.param         ? 'X-RAY DIFFRACTION' 
5 acy_xplor_par.param          ? 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3DLH 
_struct.title                     'Crystal structure of the guide-strand-containing Argonaute protein silencing complex' 
_struct.pdbx_descriptor           'Argonaute/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            Y 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3DLH 
_struct_keywords.pdbx_keywords   'Nucleic Acid Binding Protein/dna' 
_struct_keywords.text            'argonaute, PROTEIN-DNA COMPLEX, Plasmid, Nucleic Acid Binding Protein-dna COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 5 ? 
I N N 6 ? 
J N N 6 ? 
K N N 5 ? 
L N N 3 ? 
M N N 7 ? 
N N N 7 ? 
O N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 38  ? GLU A 40  ? GLY A 38  GLU A 40  5 ? 3  
HELX_P HELX_P2  2  GLU A 41  ? ALA A 53  ? GLU A 41  ALA A 53  1 ? 13 
HELX_P HELX_P3  3  ASP A 102 ? ARG A 123 ? ASP A 102 ARG A 123 1 ? 22 
HELX_P HELX_P4  4  SER A 178 ? ALA A 184 ? SER A 178 ALA A 184 1 ? 7  
HELX_P HELX_P5  5  SER A 222 ? SER A 229 ? SER A 222 SER A 229 1 ? 8  
HELX_P HELX_P6  6  PRO A 282 ? GLY A 302 ? PRO A 282 GLY A 302 1 ? 21 
HELX_P HELX_P7  7  LYS A 329 ? ALA A 331 ? LYS A 329 ALA A 331 5 ? 3  
HELX_P HELX_P8  8  ASP A 332 ? GLY A 337 ? ASP A 332 GLY A 337 1 ? 6  
HELX_P HELX_P9  9  PRO A 358 ? GLY A 373 ? PRO A 358 GLY A 373 1 ? 16 
HELX_P HELX_P10 10 GLN A 387 ? GLU A 401 ? GLN A 387 GLU A 401 1 ? 15 
HELX_P HELX_P11 11 ALA A 414 ? GLU A 428 ? ALA A 414 GLU A 428 1 ? 15 
HELX_P HELX_P12 12 HIS A 445 ? ALA A 458 ? HIS A 445 ALA A 458 1 ? 14 
HELX_P HELX_P13 13 ILE A 514 ? GLY A 535 ? ILE A 514 GLY A 535 1 ? 22 
HELX_P HELX_P14 14 PRO A 550 ? GLU A 553 ? PRO A 550 GLU A 553 5 ? 4  
HELX_P HELX_P15 15 PHE A 554 ? GLU A 564 ? PHE A 554 GLU A 564 1 ? 11 
HELX_P HELX_P16 16 PRO A 627 ? THR A 639 ? PRO A 627 THR A 639 1 ? 13 
HELX_P HELX_P17 17 PRO A 653 ? LEU A 669 ? PRO A 653 LEU A 669 1 ? 17 
HELX_P HELX_P18 18 ASN B 20  ? ARG B 25  ? ASN B 20  ARG B 25  1 ? 6  
HELX_P HELX_P19 19 GLY B 38  ? GLU B 40  ? GLY B 38  GLU B 40  5 ? 3  
HELX_P HELX_P20 20 GLU B 41  ? ARG B 52  ? GLU B 41  ARG B 52  1 ? 12 
HELX_P HELX_P21 21 ASP B 102 ? ARG B 122 ? ASP B 102 ARG B 122 1 ? 21 
HELX_P HELX_P22 22 SER B 178 ? GLN B 185 ? SER B 178 GLN B 185 1 ? 8  
HELX_P HELX_P23 23 ASP B 211 ? GLU B 214 ? ASP B 211 GLU B 214 5 ? 4  
HELX_P HELX_P24 24 LEU B 223 ? SER B 229 ? LEU B 223 SER B 229 1 ? 7  
HELX_P HELX_P25 25 GLY B 231 ? ARG B 236 ? GLY B 231 ARG B 236 1 ? 6  
HELX_P HELX_P26 26 LEU B 257 ? GLY B 259 ? LEU B 257 GLY B 259 5 ? 3  
HELX_P HELX_P27 27 THR B 266 ? LEU B 270 ? THR B 266 LEU B 270 5 ? 5  
HELX_P HELX_P28 28 PRO B 282 ? GLY B 302 ? PRO B 282 GLY B 302 1 ? 21 
HELX_P HELX_P29 29 PRO B 330 ? LEU B 334 ? PRO B 330 LEU B 334 5 ? 5  
HELX_P HELX_P30 30 PRO B 358 ? PHE B 369 ? PRO B 358 PHE B 369 1 ? 12 
HELX_P HELX_P31 31 GLN B 387 ? GLU B 401 ? GLN B 387 GLU B 401 1 ? 15 
HELX_P HELX_P32 32 ALA B 414 ? GLU B 428 ? ALA B 414 GLU B 428 1 ? 15 
HELX_P HELX_P33 33 HIS B 445 ? ALA B 458 ? HIS B 445 ALA B 458 1 ? 14 
HELX_P HELX_P34 34 ILE B 514 ? LYS B 533 ? ILE B 514 LYS B 533 1 ? 20 
HELX_P HELX_P35 35 PRO B 550 ? GLU B 553 ? PRO B 550 GLU B 553 5 ? 4  
HELX_P HELX_P36 36 PHE B 554 ? GLU B 564 ? PHE B 554 GLU B 564 1 ? 11 
HELX_P HELX_P37 37 PRO B 627 ? LEU B 638 ? PRO B 627 LEU B 638 1 ? 12 
HELX_P HELX_P38 38 THR B 639 ? LEU B 641 ? THR B 639 LEU B 641 5 ? 3  
HELX_P HELX_P39 39 TYR B 642 ? GLY B 646 ? TYR B 642 GLY B 646 5 ? 5  
HELX_P HELX_P40 40 PRO B 653 ? GLY B 670 ? PRO B 653 GLY B 670 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A VAL 685 OXT ? ? ? 1_555 E MG . MG ? ? A VAL 685 A MG 686 1_555 ? ? ? ? ? ? ? 2.468 ? 
metalc2 metalc ? ? B VAL 685 OXT ? ? ? 1_555 L MG . MG ? ? B VAL 685 Y MG 2   1_555 ? ? ? ? ? ? ? 2.311 ? 
metalc3 metalc ? ? C DT  1   OP1 ? ? ? 1_555 E MG . MG ? ? X DT  1   A MG 686 1_555 ? ? ? ? ? ? ? 2.317 ? 
metalc4 metalc ? ? C DA  3   OP1 ? ? ? 1_555 E MG . MG ? ? X DA  3   A MG 686 1_555 ? ? ? ? ? ? ? 2.139 ? 
metalc5 metalc ? ? D DT  1   OP2 ? ? ? 1_555 L MG . MG ? ? Y DT  101 Y MG 2   1_555 ? ? ? ? ? ? ? 2.360 ? 
metalc6 metalc ? ? D DA  3   OP1 ? ? ? 1_555 L MG . MG ? ? Y DA  103 Y MG 2   1_555 ? ? ? ? ? ? ? 2.091 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ASP 34 A . ? ASP 34 A PRO 35 A ? PRO 35 A 1 2.19  
2 ASP 34 B . ? ASP 34 B PRO 35 B ? PRO 35 B 1 -1.15 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 13 ? 
B ? 5  ? 
C ? 5  ? 
D ? 5  ? 
E ? 2  ? 
F ? 4  ? 
G ? 14 ? 
H ? 6  ? 
I ? 5  ? 
J ? 5  ? 
K ? 2  ? 
L ? 2  ? 
M ? 2  ? 
N ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? anti-parallel 
A 3  4  ? anti-parallel 
A 4  5  ? anti-parallel 
A 5  6  ? anti-parallel 
A 6  7  ? anti-parallel 
A 7  8  ? anti-parallel 
A 8  9  ? anti-parallel 
A 9  10 ? parallel      
A 10 11 ? parallel      
A 11 12 ? anti-parallel 
A 12 13 ? anti-parallel 
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? anti-parallel 
B 4  5  ? anti-parallel 
C 1  2  ? anti-parallel 
C 2  3  ? anti-parallel 
C 3  4  ? anti-parallel 
C 4  5  ? anti-parallel 
D 1  2  ? anti-parallel 
D 2  3  ? anti-parallel 
D 3  4  ? anti-parallel 
D 4  5  ? anti-parallel 
E 1  2  ? anti-parallel 
F 1  2  ? parallel      
F 2  3  ? parallel      
F 3  4  ? parallel      
G 1  2  ? anti-parallel 
G 2  3  ? anti-parallel 
G 3  4  ? anti-parallel 
G 4  5  ? anti-parallel 
G 5  6  ? anti-parallel 
G 6  7  ? anti-parallel 
G 7  8  ? anti-parallel 
G 8  9  ? anti-parallel 
G 9  10 ? anti-parallel 
G 10 11 ? parallel      
G 11 12 ? parallel      
G 12 13 ? anti-parallel 
G 13 14 ? anti-parallel 
H 1  2  ? anti-parallel 
H 2  3  ? anti-parallel 
H 3  4  ? anti-parallel 
H 4  5  ? anti-parallel 
H 5  6  ? anti-parallel 
I 1  2  ? anti-parallel 
I 2  3  ? anti-parallel 
I 3  4  ? anti-parallel 
I 4  5  ? anti-parallel 
J 1  2  ? anti-parallel 
J 2  3  ? anti-parallel 
J 3  4  ? anti-parallel 
J 4  5  ? anti-parallel 
K 1  2  ? anti-parallel 
L 1  2  ? anti-parallel 
M 1  2  ? parallel      
N 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  ALA A 133 ? GLY A 142 ? ALA A 133 GLY A 142 
A 2  TRP A 145 ? VAL A 157 ? TRP A 145 VAL A 157 
A 3  ALA A 162 ? CYS A 175 ? ALA A 162 CYS A 175 
A 4  THR A 7   ? PRO A 18  ? THR A 7   PRO A 18  
A 5  GLU A 307 ? ARG A 315 ? GLU A 307 ARG A 315 
A 6  LEU A 592 ? PRO A 595 ? LEU A 592 PRO A 595 
A 7  THR A 600 ? LEU A 604 ? THR A 600 LEU A 604 
A 8  LEU A 617 ? ALA A 623 ? LEU A 617 ALA A 623 
A 9  ALA A 567 ? ARG A 574 ? ALA A 567 ARG A 574 
A 10 ARG A 540 ? ASP A 546 ? ARG A 540 ASP A 546 
A 11 LEU A 473 ? ASP A 478 ? LEU A 473 ASP A 478 
A 12 ALA A 490 ? VAL A 494 ? ALA A 490 VAL A 494 
A 13 LEU A 501 ? THR A 504 ? LEU A 501 THR A 504 
B 1  ALA A 133 ? GLY A 142 ? ALA A 133 GLY A 142 
B 2  TRP A 145 ? VAL A 157 ? TRP A 145 VAL A 157 
B 3  ALA A 162 ? CYS A 175 ? ALA A 162 CYS A 175 
B 4  THR A 7   ? PRO A 18  ? THR A 7   PRO A 18  
B 5  TYR A 582 ? PRO A 583 ? TYR A 582 PRO A 583 
C 1  THR A 57  ? MET A 60  ? THR A 57  MET A 60  
C 2  GLY A 63  ? SER A 66  ? GLY A 63  SER A 66  
C 3  TRP A 27  ? ASP A 34  ? TRP A 27  ASP A 34  
C 4  GLN A 84  ? ARG A 95  ? GLN A 84  ARG A 95  
C 5  GLU A 76  ? ARG A 81  ? GLU A 76  ARG A 81  
D 1  ASP A 249 ? LEU A 257 ? ASP A 249 LEU A 257 
D 2  VAL A 241 ? ASP A 246 ? VAL A 241 ASP A 246 
D 3  THR A 201 ? GLY A 208 ? THR A 201 GLY A 208 
D 4  ARG A 192 ? ASN A 195 ? ARG A 192 ASN A 195 
D 5  LEU A 261 ? PRO A 263 ? LEU A 261 PRO A 263 
E 1  LEU A 321 ? MET A 322 ? LEU A 321 MET A 322 
E 2  ALA A 464 ? LEU A 465 ? ALA A 464 LEU A 465 
F 1  LEU A 376 ? LEU A 378 ? LEU A 376 LEU A 378 
F 2  THR A 344 ? ARG A 350 ? THR A 344 ARG A 350 
F 3  VAL A 403 ? THR A 410 ? VAL A 403 THR A 410 
F 4  SER A 432 ? ASN A 436 ? SER A 432 ASN A 436 
G 1  TRP B 128 ? GLU B 130 ? TRP B 128 GLU B 130 
G 2  ALA B 133 ? GLY B 142 ? ALA B 133 GLY B 142 
G 3  TRP B 145 ? VAL B 157 ? TRP B 145 VAL B 157 
G 4  ALA B 162 ? CYS B 175 ? ALA B 162 CYS B 175 
G 5  LYS B 6   ? PRO B 18  ? LYS B 6   PRO B 18  
G 6  GLU B 307 ? ARG B 315 ? GLU B 307 ARG B 315 
G 7  LEU B 592 ? PRO B 595 ? LEU B 592 PRO B 595 
G 8  THR B 600 ? LEU B 604 ? THR B 600 LEU B 604 
G 9  LEU B 617 ? ALA B 623 ? LEU B 617 ALA B 623 
G 10 ALA B 567 ? ARG B 574 ? ALA B 567 ARG B 574 
G 11 ARG B 540 ? ASP B 546 ? ARG B 540 ASP B 546 
G 12 LEU B 473 ? ASP B 478 ? LEU B 473 ASP B 478 
G 13 ALA B 490 ? VAL B 494 ? ALA B 490 VAL B 494 
G 14 LEU B 501 ? THR B 504 ? LEU B 501 THR B 504 
H 1  TRP B 128 ? GLU B 130 ? TRP B 128 GLU B 130 
H 2  ALA B 133 ? GLY B 142 ? ALA B 133 GLY B 142 
H 3  TRP B 145 ? VAL B 157 ? TRP B 145 VAL B 157 
H 4  ALA B 162 ? CYS B 175 ? ALA B 162 CYS B 175 
H 5  LYS B 6   ? PRO B 18  ? LYS B 6   PRO B 18  
H 6  VAL B 581 ? PRO B 583 ? VAL B 581 PRO B 583 
I 1  THR B 57  ? MET B 60  ? THR B 57  MET B 60  
I 2  GLY B 63  ? SER B 66  ? GLY B 63  SER B 66  
I 3  TRP B 27  ? VAL B 31  ? TRP B 27  VAL B 31  
I 4  THR B 85  ? ARG B 95  ? THR B 85  ARG B 95  
I 5  GLU B 76  ? ALA B 80  ? GLU B 76  ALA B 80  
J 1  ASP B 249 ? ILE B 254 ? ASP B 249 ILE B 254 
J 2  VAL B 241 ? ASP B 246 ? VAL B 241 ASP B 246 
J 3  THR B 201 ? GLY B 208 ? THR B 201 GLY B 208 
J 4  ARG B 192 ? ASN B 195 ? ARG B 192 ASN B 195 
J 5  LEU B 261 ? PRO B 263 ? LEU B 261 PRO B 263 
K 1  PRO B 216 ? LEU B 217 ? PRO B 216 LEU B 217 
K 2  LEU B 221 ? SER B 222 ? LEU B 221 SER B 222 
L 1  LEU B 321 ? MET B 322 ? LEU B 321 MET B 322 
L 2  ALA B 464 ? LEU B 465 ? ALA B 464 LEU B 465 
M 1  THR B 344 ? ALA B 345 ? THR B 344 ALA B 345 
M 2  LEU B 376 ? ARG B 377 ? LEU B 376 ARG B 377 
N 1  VAL B 406 ? VAL B 408 ? VAL B 406 VAL B 408 
N 2  SER B 432 ? ILE B 434 ? SER B 432 ILE B 434 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N HIS A 139 ? N HIS A 139 O VAL A 147 ? O VAL A 147 
A 2  3  N GLY A 150 ? N GLY A 150 O ALA A 170 ? O ALA A 170 
A 3  4  O VAL A 167 ? O VAL A 167 N ASN A 12  ? N ASN A 12  
A 4  5  N THR A 7   ? N THR A 7   O ALA A 313 ? O ALA A 313 
A 5  6  N TYR A 314 ? N TYR A 314 O TYR A 593 ? O TYR A 593 
A 6  7  N LEU A 592 ? N LEU A 592 O LEU A 604 ? O LEU A 604 
A 7  8  N PHE A 601 ? N PHE A 601 O LEU A 619 ? O LEU A 619 
A 8  9  O VAL A 620 ? O VAL A 620 N SER A 572 ? N SER A 572 
A 9  10 O VAL A 573 ? O VAL A 573 N ARG A 545 ? N ARG A 545 
A 10 11 O LEU A 542 ? O LEU A 542 N LEU A 473 ? N LEU A 473 
A 11 12 N ALA A 474 ? N ALA A 474 O VAL A 494 ? O VAL A 494 
A 12 13 N ALA A 491 ? N ALA A 491 O THR A 504 ? O THR A 504 
B 1  2  N HIS A 139 ? N HIS A 139 O VAL A 147 ? O VAL A 147 
B 2  3  N GLY A 150 ? N GLY A 150 O ALA A 170 ? O ALA A 170 
B 3  4  O VAL A 167 ? O VAL A 167 N ASN A 12  ? N ASN A 12  
B 4  5  N PHE A 10  ? N PHE A 10  O TYR A 582 ? O TYR A 582 
C 1  2  N VAL A 58  ? N VAL A 58  O ALA A 65  ? O ALA A 65  
C 2  3  O LEU A 64  ? O LEU A 64  N LEU A 29  ? N LEU A 29  
C 3  4  N ARG A 28  ? N ARG A 28  O GLY A 94  ? O GLY A 94  
C 4  5  O TYR A 86  ? O TYR A 86  N LEU A 79  ? N LEU A 79  
D 1  2  O ILE A 254 ? O ILE A 254 N VAL A 244 ? N VAL A 244 
D 2  3  O ALA A 245 ? O ALA A 245 N GLU A 203 ? N GLU A 203 
D 3  4  O TRP A 202 ? O TRP A 202 N VAL A 193 ? N VAL A 193 
D 4  5  N ARG A 194 ? N ARG A 194 O VAL A 262 ? O VAL A 262 
E 1  2  N MET A 322 ? N MET A 322 O ALA A 464 ? O ALA A 464 
F 1  2  O ARG A 377 ? O ARG A 377 N THR A 344 ? N THR A 344 
F 2  3  N ALA A 345 ? N ALA A 345 O GLN A 404 ? O GLN A 404 
F 3  4  N VAL A 408 ? N VAL A 408 O GLN A 433 ? O GLN A 433 
G 1  2  N TRP B 128 ? N TRP B 128 O TYR B 135 ? O TYR B 135 
G 2  3  N HIS B 139 ? N HIS B 139 O VAL B 147 ? O VAL B 147 
G 3  4  N LEU B 148 ? N LEU B 148 O ARG B 172 ? O ARG B 172 
G 4  5  O PHE B 163 ? O PHE B 163 N LEU B 16  ? N LEU B 16  
G 5  6  N VAL B 9   ? N VAL B 9   O ALA B 311 ? O ALA B 311 
G 6  7  N TYR B 314 ? N TYR B 314 O TYR B 593 ? O TYR B 593 
G 7  8  N VAL B 594 ? N VAL B 594 O LEU B 602 ? O LEU B 602 
G 8  9  N LEU B 603 ? N LEU B 603 O LEU B 617 ? O LEU B 617 
G 9  10 O GLU B 622 ? O GLU B 622 N LEU B 570 ? N LEU B 570 
G 10 11 O ALA B 567 ? O ALA B 567 N VAL B 541 ? N VAL B 541 
G 11 12 O LEU B 544 ? O LEU B 544 N PHE B 477 ? N PHE B 477 
G 12 13 N ALA B 474 ? N ALA B 474 O VAL B 494 ? O VAL B 494 
G 13 14 N ALA B 493 ? N ALA B 493 O LEU B 502 ? O LEU B 502 
H 1  2  N TRP B 128 ? N TRP B 128 O TYR B 135 ? O TYR B 135 
H 2  3  N HIS B 139 ? N HIS B 139 O VAL B 147 ? O VAL B 147 
H 3  4  N LEU B 148 ? N LEU B 148 O ARG B 172 ? O ARG B 172 
H 4  5  O PHE B 163 ? O PHE B 163 N LEU B 16  ? N LEU B 16  
H 5  6  N PHE B 10  ? N PHE B 10  O TYR B 582 ? O TYR B 582 
I 1  2  N VAL B 58  ? N VAL B 58  O ALA B 65  ? O ALA B 65  
I 2  3  O LEU B 64  ? O LEU B 64  N LEU B 29  ? N LEU B 29  
I 3  4  N ARG B 28  ? N ARG B 28  O LYS B 93  ? O LYS B 93  
I 4  5  O TYR B 86  ? O TYR B 86  N LEU B 79  ? N LEU B 79  
J 1  2  O ASP B 249 ? O ASP B 249 N ASP B 246 ? N ASP B 246 
J 2  3  O ALA B 245 ? O ALA B 245 N GLU B 203 ? N GLU B 203 
J 3  4  O TRP B 202 ? O TRP B 202 N VAL B 193 ? N VAL B 193 
J 4  5  N ARG B 194 ? N ARG B 194 O VAL B 262 ? O VAL B 262 
K 1  2  N LEU B 217 ? N LEU B 217 O LEU B 221 ? O LEU B 221 
L 1  2  N MET B 322 ? N MET B 322 O ALA B 464 ? O ALA B 464 
M 1  2  N THR B 344 ? N THR B 344 O ARG B 377 ? O ARG B 377 
N 1  2  N VAL B 406 ? N VAL B 406 O GLN B 433 ? O GLN B 433 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 686'  
AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG A 687'  
AC3 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PGE A 688' 
AC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PO4 A 689' 
AC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE ACY B 686' 
AC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ACY B 687' 
AC7 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE PO4 X 22'  
AC8 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG Y 2'    
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 GLN A 433 ? GLN A 433 . ? 1_555 ? 
2  AC1 6 LYS A 457 ? LYS A 457 . ? 1_555 ? 
3  AC1 6 VAL A 685 ? VAL A 685 . ? 1_555 ? 
4  AC1 6 DT  C 1   ? DT  X 1   . ? 1_555 ? 
5  AC1 6 DG  C 2   ? DG  X 2   . ? 1_555 ? 
6  AC1 6 DA  C 3   ? DA  X 3   . ? 1_555 ? 
7  AC2 3 GLN A 342 ? GLN A 342 . ? 1_555 ? 
8  AC2 3 GLY A 459 ? GLY A 459 . ? 1_555 ? 
9  AC2 3 GLU A 680 ? GLU A 680 . ? 1_555 ? 
10 AC3 1 GLU A 524 ? GLU A 524 . ? 1_555 ? 
11 AC4 1 GLU A 40  ? GLU A 40  . ? 1_555 ? 
12 AC5 3 TRP B 156 ? TRP B 156 . ? 1_555 ? 
13 AC5 3 ACY J .   ? ACY B 687 . ? 1_555 ? 
14 AC5 3 HOH N .   ? HOH B 705 . ? 1_555 ? 
15 AC6 5 ARG B 13  ? ARG B 13  . ? 1_555 ? 
16 AC6 5 LEU B 596 ? LEU B 596 . ? 1_555 ? 
17 AC6 5 GLU B 597 ? GLU B 597 . ? 1_555 ? 
18 AC6 5 LYS B 618 ? LYS B 618 . ? 1_555 ? 
19 AC6 5 ACY I .   ? ACY B 686 . ? 1_555 ? 
20 AC7 3 LYS A 93  ? LYS A 93  . ? 4_455 ? 
21 AC7 3 GLY A 94  ? GLY A 94  . ? 4_455 ? 
22 AC7 3 DT  C 18  ? DT  X 18  . ? 1_555 ? 
23 AC8 3 VAL B 685 ? VAL B 685 . ? 1_555 ? 
24 AC8 3 DT  D 1   ? DT  Y 101 . ? 1_555 ? 
25 AC8 3 DA  D 3   ? DA  Y 103 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3DLH 
_atom_sites.fract_transf_matrix[1][1]   0.013379 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008724 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005692 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . HIS A 1 3   ? 25.084  -4.269  32.066  1.00 88.60  ? 3   HIS A N     1 
ATOM   2     C  CA    . HIS A 1 3   ? 26.062  -4.554  33.150  1.00 89.13  ? 3   HIS A CA    1 
ATOM   3     C  C     . HIS A 1 3   ? 27.348  -3.788  32.883  1.00 89.26  ? 3   HIS A C     1 
ATOM   4     O  O     . HIS A 1 3   ? 27.920  -3.906  31.800  1.00 89.50  ? 3   HIS A O     1 
ATOM   5     C  CB    . HIS A 1 3   ? 26.345  -6.045  33.204  1.00 89.25  ? 3   HIS A CB    1 
ATOM   6     N  N     . LEU A 1 4   ? 27.805  -3.012  33.865  1.00 89.25  ? 4   LEU A N     1 
ATOM   7     C  CA    . LEU A 1 4   ? 29.028  -2.224  33.700  1.00 89.26  ? 4   LEU A CA    1 
ATOM   8     C  C     . LEU A 1 4   ? 30.344  -3.025  33.607  1.00 89.33  ? 4   LEU A C     1 
ATOM   9     O  O     . LEU A 1 4   ? 30.622  -3.905  34.432  1.00 89.20  ? 4   LEU A O     1 
ATOM   10    C  CB    . LEU A 1 4   ? 29.147  -1.173  34.819  1.00 88.55  ? 4   LEU A CB    1 
ATOM   11    C  CG    . LEU A 1 4   ? 28.266  0.086   34.764  1.00 88.32  ? 4   LEU A CG    1 
ATOM   12    C  CD1   . LEU A 1 4   ? 28.628  1.006   35.931  1.00 88.42  ? 4   LEU A CD1   1 
ATOM   13    C  CD2   . LEU A 1 4   ? 28.459  0.816   33.437  1.00 86.99  ? 4   LEU A CD2   1 
ATOM   14    N  N     . GLY A 1 5   ? 31.123  -2.703  32.567  1.00 89.25  ? 5   GLY A N     1 
ATOM   15    C  CA    . GLY A 1 5   ? 32.436  -3.292  32.299  1.00 87.67  ? 5   GLY A CA    1 
ATOM   16    C  C     . GLY A 1 5   ? 32.623  -4.776  32.025  1.00 85.89  ? 5   GLY A C     1 
ATOM   17    O  O     . GLY A 1 5   ? 33.392  -5.427  32.736  1.00 86.90  ? 5   GLY A O     1 
ATOM   18    N  N     . LYS A 1 6   ? 31.984  -5.315  30.987  1.00 82.91  ? 6   LYS A N     1 
ATOM   19    C  CA    . LYS A 1 6   ? 32.118  -6.747  30.721  1.00 79.57  ? 6   LYS A CA    1 
ATOM   20    C  C     . LYS A 1 6   ? 33.131  -7.166  29.633  1.00 76.43  ? 6   LYS A C     1 
ATOM   21    O  O     . LYS A 1 6   ? 34.044  -7.947  29.914  1.00 77.13  ? 6   LYS A O     1 
ATOM   22    C  CB    . LYS A 1 6   ? 30.736  -7.364  30.403  1.00 79.53  ? 6   LYS A CB    1 
ATOM   23    C  CG    . LYS A 1 6   ? 29.537  -6.759  31.162  1.00 77.61  ? 6   LYS A CG    1 
ATOM   24    C  CD    . LYS A 1 6   ? 28.965  -7.649  32.292  1.00 76.84  ? 6   LYS A CD    1 
ATOM   25    C  CE    . LYS A 1 6   ? 28.675  -9.098  31.855  1.00 75.52  ? 6   LYS A CE    1 
ATOM   26    N  NZ    . LYS A 1 6   ? 27.702  -9.795  32.750  1.00 72.57  ? 6   LYS A NZ    1 
ATOM   27    N  N     . THR A 1 7   ? 32.995  -6.665  28.406  1.00 71.99  ? 7   THR A N     1 
ATOM   28    C  CA    . THR A 1 7   ? 33.918  -7.087  27.352  1.00 66.86  ? 7   THR A CA    1 
ATOM   29    C  C     . THR A 1 7   ? 34.472  -6.031  26.388  1.00 63.67  ? 7   THR A C     1 
ATOM   30    O  O     . THR A 1 7   ? 34.109  -4.856  26.436  1.00 62.24  ? 7   THR A O     1 
ATOM   31    C  CB    . THR A 1 7   ? 33.302  -8.269  26.539  1.00 66.84  ? 7   THR A CB    1 
ATOM   32    O  OG1   . THR A 1 7   ? 34.081  -8.507  25.360  1.00 67.48  ? 7   THR A OG1   1 
ATOM   33    C  CG2   . THR A 1 7   ? 31.864  -7.976  26.154  1.00 66.51  ? 7   THR A CG2   1 
ATOM   34    N  N     . GLU A 1 8   ? 35.370  -6.484  25.519  1.00 60.76  ? 8   GLU A N     1 
ATOM   35    C  CA    . GLU A 1 8   ? 36.052  -5.642  24.548  1.00 59.21  ? 8   GLU A CA    1 
ATOM   36    C  C     . GLU A 1 8   ? 35.954  -6.344  23.195  1.00 57.16  ? 8   GLU A C     1 
ATOM   37    O  O     . GLU A 1 8   ? 35.993  -7.568  23.136  1.00 56.21  ? 8   GLU A O     1 
ATOM   38    C  CB    . GLU A 1 8   ? 37.516  -5.499  24.985  1.00 60.30  ? 8   GLU A CB    1 
ATOM   39    C  CG    . GLU A 1 8   ? 38.200  -4.189  24.630  1.00 63.29  ? 8   GLU A CG    1 
ATOM   40    C  CD    . GLU A 1 8   ? 39.490  -3.965  25.428  1.00 65.56  ? 8   GLU A CD    1 
ATOM   41    O  OE1   . GLU A 1 8   ? 40.374  -4.859  25.436  1.00 65.18  ? 8   GLU A OE1   1 
ATOM   42    O  OE2   . GLU A 1 8   ? 39.624  -2.886  26.046  1.00 67.22  ? 8   GLU A OE2   1 
ATOM   43    N  N     . VAL A 1 9   ? 35.824  -5.578  22.114  1.00 55.38  ? 9   VAL A N     1 
ATOM   44    C  CA    . VAL A 1 9   ? 35.706  -6.163  20.778  1.00 53.86  ? 9   VAL A CA    1 
ATOM   45    C  C     . VAL A 1 9   ? 36.453  -5.410  19.702  1.00 52.64  ? 9   VAL A C     1 
ATOM   46    O  O     . VAL A 1 9   ? 36.826  -4.260  19.881  1.00 53.77  ? 9   VAL A O     1 
ATOM   47    C  CB    . VAL A 1 9   ? 34.257  -6.224  20.330  1.00 54.09  ? 9   VAL A CB    1 
ATOM   48    C  CG1   . VAL A 1 9   ? 33.499  -7.223  21.171  1.00 56.60  ? 9   VAL A CG1   1 
ATOM   49    C  CG2   . VAL A 1 9   ? 33.630  -4.856  20.459  1.00 54.88  ? 9   VAL A CG2   1 
ATOM   50    N  N     . PHE A 1 10  ? 36.662  -6.066  18.570  1.00 51.71  ? 10  PHE A N     1 
ATOM   51    C  CA    . PHE A 1 10  ? 37.355  -5.437  17.460  1.00 51.30  ? 10  PHE A CA    1 
ATOM   52    C  C     . PHE A 1 10  ? 36.386  -4.771  16.524  1.00 49.54  ? 10  PHE A C     1 
ATOM   53    O  O     . PHE A 1 10  ? 35.347  -5.320  16.185  1.00 49.54  ? 10  PHE A O     1 
ATOM   54    C  CB    . PHE A 1 10  ? 38.165  -6.456  16.668  1.00 54.47  ? 10  PHE A CB    1 
ATOM   55    C  CG    . PHE A 1 10  ? 39.461  -6.803  17.302  1.00 58.22  ? 10  PHE A CG    1 
ATOM   56    C  CD1   . PHE A 1 10  ? 40.358  -5.799  17.666  1.00 59.97  ? 10  PHE A CD1   1 
ATOM   57    C  CD2   . PHE A 1 10  ? 39.791  -8.123  17.557  1.00 59.91  ? 10  PHE A CD2   1 
ATOM   58    C  CE1   . PHE A 1 10  ? 41.572  -6.107  18.288  1.00 61.39  ? 10  PHE A CE1   1 
ATOM   59    C  CE2   . PHE A 1 10  ? 41.006  -8.446  18.178  1.00 62.49  ? 10  PHE A CE2   1 
ATOM   60    C  CZ    . PHE A 1 10  ? 41.899  -7.432  18.545  1.00 61.42  ? 10  PHE A CZ    1 
ATOM   61    N  N     . LEU A 1 11  ? 36.719  -3.572  16.094  1.00 48.03  ? 11  LEU A N     1 
ATOM   62    C  CA    . LEU A 1 11  ? 35.834  -2.904  15.177  1.00 45.20  ? 11  LEU A CA    1 
ATOM   63    C  C     . LEU A 1 11  ? 36.301  -3.151  13.764  1.00 45.00  ? 11  LEU A C     1 
ATOM   64    O  O     . LEU A 1 11  ? 37.353  -3.739  13.516  1.00 44.33  ? 11  LEU A O     1 
ATOM   65    C  CB    . LEU A 1 11  ? 35.787  -1.401  15.446  1.00 42.62  ? 11  LEU A CB    1 
ATOM   66    C  CG    . LEU A 1 11  ? 35.107  -0.958  16.732  1.00 38.66  ? 11  LEU A CG    1 
ATOM   67    C  CD1   . LEU A 1 11  ? 35.145  0.537   16.807  1.00 38.69  ? 11  LEU A CD1   1 
ATOM   68    C  CD2   . LEU A 1 11  ? 33.695  -1.437  16.756  1.00 37.31  ? 11  LEU A CD2   1 
ATOM   69    N  N     . ASN A 1 12  ? 35.471  -2.674  12.856  1.00 45.69  ? 12  ASN A N     1 
ATOM   70    C  CA    . ASN A 1 12  ? 35.630  -2.745  11.415  1.00 44.50  ? 12  ASN A CA    1 
ATOM   71    C  C     . ASN A 1 12  ? 36.611  -1.622  11.042  1.00 42.28  ? 12  ASN A C     1 
ATOM   72    O  O     . ASN A 1 12  ? 36.795  -1.307  9.868   1.00 40.25  ? 12  ASN A O     1 
ATOM   73    C  CB    . ASN A 1 12  ? 34.238  -2.468  10.825  1.00 46.93  ? 12  ASN A CB    1 
ATOM   74    C  CG    . ASN A 1 12  ? 34.082  -2.956  9.421   1.00 49.94  ? 12  ASN A CG    1 
ATOM   75    O  OD1   . ASN A 1 12  ? 34.272  -4.141  9.135   1.00 52.78  ? 12  ASN A OD1   1 
ATOM   76    N  ND2   . ASN A 1 12  ? 33.713  -2.050  8.525   1.00 51.18  ? 12  ASN A ND2   1 
ATOM   77    N  N     . ARG A 1 13  ? 37.233  -1.038  12.069  1.00 40.52  ? 13  ARG A N     1 
ATOM   78    C  CA    . ARG A 1 13  ? 38.142  0.097   11.925  1.00 39.18  ? 13  ARG A CA    1 
ATOM   79    C  C     . ARG A 1 13  ? 39.617  -0.176  12.151  1.00 39.49  ? 13  ARG A C     1 
ATOM   80    O  O     . ARG A 1 13  ? 39.982  -1.127  12.820  1.00 41.30  ? 13  ARG A O     1 
ATOM   81    C  CB    . ARG A 1 13  ? 37.679  1.193   12.878  1.00 37.07  ? 13  ARG A CB    1 
ATOM   82    C  CG    . ARG A 1 13  ? 36.209  1.441   12.727  1.00 36.88  ? 13  ARG A CG    1 
ATOM   83    C  CD    . ARG A 1 13  ? 35.653  2.513   13.617  1.00 37.13  ? 13  ARG A CD    1 
ATOM   84    N  NE    . ARG A 1 13  ? 34.246  2.724   13.278  1.00 37.05  ? 13  ARG A NE    1 
ATOM   85    C  CZ    . ARG A 1 13  ? 33.445  3.587   13.890  1.00 36.05  ? 13  ARG A CZ    1 
ATOM   86    N  NH1   . ARG A 1 13  ? 33.909  4.330   14.887  1.00 33.00  ? 13  ARG A NH1   1 
ATOM   87    N  NH2   . ARG A 1 13  ? 32.182  3.708   13.490  1.00 37.40  ? 13  ARG A NH2   1 
ATOM   88    N  N     . PHE A 1 14  ? 40.469  0.676   11.594  1.00 39.69  ? 14  PHE A N     1 
ATOM   89    C  CA    . PHE A 1 14  ? 41.916  0.527   11.748  1.00 39.60  ? 14  PHE A CA    1 
ATOM   90    C  C     . PHE A 1 14  ? 42.579  1.874   11.837  1.00 39.81  ? 14  PHE A C     1 
ATOM   91    O  O     . PHE A 1 14  ? 42.394  2.710   10.960  1.00 39.62  ? 14  PHE A O     1 
ATOM   92    C  CB    . PHE A 1 14  ? 42.544  -0.191  10.558  1.00 37.34  ? 14  PHE A CB    1 
ATOM   93    C  CG    . PHE A 1 14  ? 41.944  -1.517  10.266  1.00 36.69  ? 14  PHE A CG    1 
ATOM   94    C  CD1   . PHE A 1 14  ? 40.743  -1.615  9.581   1.00 36.08  ? 14  PHE A CD1   1 
ATOM   95    C  CD2   . PHE A 1 14  ? 42.603  -2.675  10.636  1.00 36.90  ? 14  PHE A CD2   1 
ATOM   96    C  CE1   . PHE A 1 14  ? 40.209  -2.855  9.261   1.00 36.55  ? 14  PHE A CE1   1 
ATOM   97    C  CE2   . PHE A 1 14  ? 42.081  -3.922  10.325  1.00 37.43  ? 14  PHE A CE2   1 
ATOM   98    C  CZ    . PHE A 1 14  ? 40.881  -4.014  9.632   1.00 37.09  ? 14  PHE A CZ    1 
ATOM   99    N  N     . ALA A 1 15  ? 43.371  2.078   12.884  1.00 41.46  ? 15  ALA A N     1 
ATOM   100   C  CA    . ALA A 1 15  ? 44.086  3.341   13.055  1.00 41.58  ? 15  ALA A CA    1 
ATOM   101   C  C     . ALA A 1 15  ? 45.300  3.344   12.142  1.00 41.20  ? 15  ALA A C     1 
ATOM   102   O  O     . ALA A 1 15  ? 45.976  2.323   11.988  1.00 41.00  ? 15  ALA A O     1 
ATOM   103   C  CB    . ALA A 1 15  ? 44.515  3.512   14.492  1.00 40.33  ? 15  ALA A CB    1 
ATOM   104   N  N     . LEU A 1 16  ? 45.568  4.485   11.525  1.00 40.98  ? 16  LEU A N     1 
ATOM   105   C  CA    . LEU A 1 16  ? 46.707  4.570   10.635  1.00 42.82  ? 16  LEU A CA    1 
ATOM   106   C  C     . LEU A 1 16  ? 47.628  5.716   11.033  1.00 42.74  ? 16  LEU A C     1 
ATOM   107   O  O     . LEU A 1 16  ? 47.342  6.446   11.980  1.00 42.34  ? 16  LEU A O     1 
ATOM   108   C  CB    . LEU A 1 16  ? 46.224  4.728   9.196   1.00 44.27  ? 16  LEU A CB    1 
ATOM   109   C  CG    . LEU A 1 16  ? 45.413  3.567   8.608   1.00 44.56  ? 16  LEU A CG    1 
ATOM   110   C  CD1   . LEU A 1 16  ? 44.864  3.969   7.238   1.00 47.56  ? 16  LEU A CD1   1 
ATOM   111   C  CD2   . LEU A 1 16  ? 46.275  2.338   8.485   1.00 42.14  ? 16  LEU A CD2   1 
ATOM   112   N  N     . ARG A 1 17  ? 48.729  5.882   10.312  1.00 43.04  ? 17  ARG A N     1 
ATOM   113   C  CA    . ARG A 1 17  ? 49.671  6.934   10.653  1.00 44.53  ? 17  ARG A CA    1 
ATOM   114   C  C     . ARG A 1 17  ? 48.986  8.247   10.973  1.00 45.85  ? 17  ARG A C     1 
ATOM   115   O  O     . ARG A 1 17  ? 47.829  8.465   10.624  1.00 45.12  ? 17  ARG A O     1 
ATOM   116   C  CB    . ARG A 1 17  ? 50.684  7.161   9.526   1.00 44.17  ? 17  ARG A CB    1 
ATOM   117   C  CG    . ARG A 1 17  ? 50.233  8.113   8.439   1.00 43.06  ? 17  ARG A CG    1 
ATOM   118   C  CD    . ARG A 1 17  ? 51.419  8.746   7.724   1.00 42.29  ? 17  ARG A CD    1 
ATOM   119   N  NE    . ARG A 1 17  ? 51.046  10.052  7.194   1.00 42.60  ? 17  ARG A NE    1 
ATOM   120   C  CZ    . ARG A 1 17  ? 50.414  10.231  6.041   1.00 41.60  ? 17  ARG A CZ    1 
ATOM   121   N  NH1   . ARG A 1 17  ? 50.111  9.170   5.304   1.00 39.41  ? 17  ARG A NH1   1 
ATOM   122   N  NH2   . ARG A 1 17  ? 50.052  11.454  5.649   1.00 37.58  ? 17  ARG A NH2   1 
ATOM   123   N  N     . PRO A 1 18  ? 49.687  9.131   11.688  1.00 48.06  ? 18  PRO A N     1 
ATOM   124   C  CA    . PRO A 1 18  ? 49.064  10.418  12.005  1.00 49.56  ? 18  PRO A CA    1 
ATOM   125   C  C     . PRO A 1 18  ? 49.252  11.355  10.799  1.00 50.30  ? 18  PRO A C     1 
ATOM   126   O  O     . PRO A 1 18  ? 50.025  11.061  9.876   1.00 48.59  ? 18  PRO A O     1 
ATOM   127   C  CB    . PRO A 1 18  ? 49.840  10.886  13.241  1.00 49.35  ? 18  PRO A CB    1 
ATOM   128   C  CG    . PRO A 1 18  ? 50.371  9.597   13.834  1.00 49.03  ? 18  PRO A CG    1 
ATOM   129   C  CD    . PRO A 1 18  ? 50.807  8.858   12.604  1.00 47.83  ? 18  PRO A CD    1 
ATOM   130   N  N     . LEU A 1 19  ? 48.537  12.470  10.794  1.00 50.85  ? 19  LEU A N     1 
ATOM   131   C  CA    . LEU A 1 19  ? 48.666  13.408  9.693   1.00 51.24  ? 19  LEU A CA    1 
ATOM   132   C  C     . LEU A 1 19  ? 49.952  14.197  9.910   1.00 53.19  ? 19  LEU A C     1 
ATOM   133   O  O     . LEU A 1 19  ? 50.241  14.639  11.026  1.00 54.43  ? 19  LEU A O     1 
ATOM   134   C  CB    . LEU A 1 19  ? 47.464  14.364  9.652   1.00 49.05  ? 19  LEU A CB    1 
ATOM   135   C  CG    . LEU A 1 19  ? 46.056  13.855  9.323   1.00 47.02  ? 19  LEU A CG    1 
ATOM   136   C  CD1   . LEU A 1 19  ? 45.568  12.840  10.337  1.00 46.09  ? 19  LEU A CD1   1 
ATOM   137   C  CD2   . LEU A 1 19  ? 45.129  15.040  9.303   1.00 45.57  ? 19  LEU A CD2   1 
ATOM   138   N  N     . ASN A 1 20  ? 50.737  14.360  8.851   1.00 54.54  ? 20  ASN A N     1 
ATOM   139   C  CA    . ASN A 1 20  ? 51.973  15.118  8.959   1.00 55.37  ? 20  ASN A CA    1 
ATOM   140   C  C     . ASN A 1 20  ? 51.660  16.610  9.089   1.00 56.47  ? 20  ASN A C     1 
ATOM   141   O  O     . ASN A 1 20  ? 50.557  17.052  8.782   1.00 56.59  ? 20  ASN A O     1 
ATOM   142   C  CB    . ASN A 1 20  ? 52.892  14.846  7.748   1.00 55.08  ? 20  ASN A CB    1 
ATOM   143   C  CG    . ASN A 1 20  ? 52.224  15.121  6.404   1.00 55.68  ? 20  ASN A CG    1 
ATOM   144   O  OD1   . ASN A 1 20  ? 51.761  16.230  6.135   1.00 55.52  ? 20  ASN A OD1   1 
ATOM   145   N  ND2   . ASN A 1 20  ? 52.191  14.104  5.546   1.00 55.86  ? 20  ASN A ND2   1 
ATOM   146   N  N     . PRO A 1 21  ? 52.628  17.407  9.559   1.00 57.49  ? 21  PRO A N     1 
ATOM   147   C  CA    . PRO A 1 21  ? 52.399  18.845  9.710   1.00 57.26  ? 21  PRO A CA    1 
ATOM   148   C  C     . PRO A 1 21  ? 51.761  19.561  8.511   1.00 56.91  ? 21  PRO A C     1 
ATOM   149   O  O     . PRO A 1 21  ? 50.905  20.415  8.698   1.00 56.00  ? 21  PRO A O     1 
ATOM   150   C  CB    . PRO A 1 21  ? 53.791  19.375  10.049  1.00 57.51  ? 21  PRO A CB    1 
ATOM   151   C  CG    . PRO A 1 21  ? 54.722  18.323  9.443   1.00 56.75  ? 21  PRO A CG    1 
ATOM   152   C  CD    . PRO A 1 21  ? 54.034  17.069  9.835   1.00 56.60  ? 21  PRO A CD    1 
ATOM   153   N  N     . GLU A 1 22  ? 52.159  19.217  7.290   1.00 58.37  ? 22  GLU A N     1 
ATOM   154   C  CA    . GLU A 1 22  ? 51.590  19.872  6.101   1.00 61.28  ? 22  GLU A CA    1 
ATOM   155   C  C     . GLU A 1 22  ? 50.088  19.619  5.954   1.00 60.51  ? 22  GLU A C     1 
ATOM   156   O  O     . GLU A 1 22  ? 49.345  20.471  5.447   1.00 60.55  ? 22  GLU A O     1 
ATOM   157   C  CB    . GLU A 1 22  ? 52.294  19.410  4.813   1.00 63.97  ? 22  GLU A CB    1 
ATOM   158   C  CG    . GLU A 1 22  ? 53.775  19.760  4.709   1.00 69.22  ? 22  GLU A CG    1 
ATOM   159   C  CD    . GLU A 1 22  ? 54.652  18.973  5.685   1.00 73.16  ? 22  GLU A CD    1 
ATOM   160   O  OE1   . GLU A 1 22  ? 54.628  17.719  5.648   1.00 74.88  ? 22  GLU A OE1   1 
ATOM   161   O  OE2   . GLU A 1 22  ? 55.375  19.609  6.486   1.00 75.14  ? 22  GLU A OE2   1 
ATOM   162   N  N     . GLU A 1 23  ? 49.648  18.443  6.388   1.00 58.99  ? 23  GLU A N     1 
ATOM   163   C  CA    . GLU A 1 23  ? 48.243  18.085  6.300   1.00 57.05  ? 23  GLU A CA    1 
ATOM   164   C  C     . GLU A 1 23  ? 47.457  18.889  7.337   1.00 56.40  ? 23  GLU A C     1 
ATOM   165   O  O     . GLU A 1 23  ? 46.327  19.281  7.097   1.00 55.61  ? 23  GLU A O     1 
ATOM   166   C  CB    . GLU A 1 23  ? 48.076  16.558  6.501   1.00 55.94  ? 23  GLU A CB    1 
ATOM   167   C  CG    . GLU A 1 23  ? 48.884  15.733  5.479   1.00 56.06  ? 23  GLU A CG    1 
ATOM   168   C  CD    . GLU A 1 23  ? 48.743  14.211  5.599   1.00 56.26  ? 23  GLU A CD    1 
ATOM   169   O  OE1   . GLU A 1 23  ? 48.832  13.671  6.723   1.00 55.97  ? 23  GLU A OE1   1 
ATOM   170   O  OE2   . GLU A 1 23  ? 48.573  13.546  4.550   1.00 56.70  ? 23  GLU A OE2   1 
ATOM   171   N  N     . LEU A 1 24  ? 48.073  19.168  8.478   1.00 57.55  ? 24  LEU A N     1 
ATOM   172   C  CA    . LEU A 1 24  ? 47.407  19.922  9.544   1.00 59.31  ? 24  LEU A CA    1 
ATOM   173   C  C     . LEU A 1 24  ? 47.211  21.388  9.197   1.00 59.99  ? 24  LEU A C     1 
ATOM   174   O  O     . LEU A 1 24  ? 46.534  22.123  9.925   1.00 58.81  ? 24  LEU A O     1 
ATOM   175   C  CB    . LEU A 1 24  ? 48.210  19.837  10.846  1.00 59.24  ? 24  LEU A CB    1 
ATOM   176   C  CG    . LEU A 1 24  ? 48.205  18.534  11.641  1.00 58.83  ? 24  LEU A CG    1 
ATOM   177   C  CD1   . LEU A 1 24  ? 49.257  18.617  12.731  1.00 59.06  ? 24  LEU A CD1   1 
ATOM   178   C  CD2   . LEU A 1 24  ? 46.819  18.291  12.234  1.00 59.02  ? 24  LEU A CD2   1 
ATOM   179   N  N     . ARG A 1 25  ? 47.816  21.804  8.088   1.00 61.23  ? 25  ARG A N     1 
ATOM   180   C  CA    . ARG A 1 25  ? 47.735  23.186  7.636   1.00 62.22  ? 25  ARG A CA    1 
ATOM   181   C  C     . ARG A 1 25  ? 47.496  23.215  6.145   1.00 61.76  ? 25  ARG A C     1 
ATOM   182   O  O     . ARG A 1 25  ? 48.386  23.547  5.371   1.00 60.36  ? 25  ARG A O     1 
ATOM   183   C  CB    . ARG A 1 25  ? 49.033  23.895  7.951   1.00 64.47  ? 25  ARG A CB    1 
ATOM   184   C  CG    . ARG A 1 25  ? 49.593  23.501  9.296   1.00 68.70  ? 25  ARG A CG    1 
ATOM   185   C  CD    . ARG A 1 25  ? 50.757  24.374  9.626   1.00 71.99  ? 25  ARG A CD    1 
ATOM   186   N  NE    . ARG A 1 25  ? 50.467  25.730  9.185   1.00 75.09  ? 25  ARG A NE    1 
ATOM   187   C  CZ    . ARG A 1 25  ? 50.924  26.821  9.781   1.00 77.08  ? 25  ARG A CZ    1 
ATOM   188   N  NH1   . ARG A 1 25  ? 51.698  26.713  10.857  1.00 78.56  ? 25  ARG A NH1   1 
ATOM   189   N  NH2   . ARG A 1 25  ? 50.610  28.017  9.295   1.00 77.65  ? 25  ARG A NH2   1 
ATOM   190   N  N     . PRO A 1 26  ? 46.280  22.855  5.725   1.00 62.48  ? 26  PRO A N     1 
ATOM   191   C  CA    . PRO A 1 26  ? 45.913  22.836  4.313   1.00 63.22  ? 26  PRO A CA    1 
ATOM   192   C  C     . PRO A 1 26  ? 45.961  24.251  3.759   1.00 64.37  ? 26  PRO A C     1 
ATOM   193   O  O     . PRO A 1 26  ? 45.958  25.216  4.524   1.00 65.12  ? 26  PRO A O     1 
ATOM   194   C  CB    . PRO A 1 26  ? 44.496  22.264  4.343   1.00 62.41  ? 26  PRO A CB    1 
ATOM   195   C  CG    . PRO A 1 26  ? 43.950  22.821  5.614   1.00 61.82  ? 26  PRO A CG    1 
ATOM   196   C  CD    . PRO A 1 26  ? 45.100  22.594  6.572   1.00 62.84  ? 26  PRO A CD    1 
ATOM   197   N  N     . TRP A 1 27  ? 46.022  24.377  2.437   1.00 64.68  ? 27  TRP A N     1 
ATOM   198   C  CA    . TRP A 1 27  ? 46.047  25.689  1.820   1.00 64.76  ? 27  TRP A CA    1 
ATOM   199   C  C     . TRP A 1 27  ? 44.624  26.193  1.845   1.00 63.55  ? 27  TRP A C     1 
ATOM   200   O  O     . TRP A 1 27  ? 43.690  25.418  1.644   1.00 62.53  ? 27  TRP A O     1 
ATOM   201   C  CB    . TRP A 1 27  ? 46.499  25.612  0.368   1.00 68.13  ? 27  TRP A CB    1 
ATOM   202   C  CG    . TRP A 1 27  ? 47.841  25.016  0.150   1.00 72.92  ? 27  TRP A CG    1 
ATOM   203   C  CD1   . TRP A 1 27  ? 48.185  23.697  0.245   1.00 74.60  ? 27  TRP A CD1   1 
ATOM   204   C  CD2   . TRP A 1 27  ? 49.017  25.709  -0.264  1.00 75.39  ? 27  TRP A CD2   1 
ATOM   205   N  NE1   . TRP A 1 27  ? 49.509  23.525  -0.093  1.00 76.20  ? 27  TRP A NE1   1 
ATOM   206   C  CE2   . TRP A 1 27  ? 50.044  24.748  -0.408  1.00 76.22  ? 27  TRP A CE2   1 
ATOM   207   C  CE3   . TRP A 1 27  ? 49.308  27.055  -0.528  1.00 77.05  ? 27  TRP A CE3   1 
ATOM   208   C  CZ2   . TRP A 1 27  ? 51.337  25.087  -0.811  1.00 76.93  ? 27  TRP A CZ2   1 
ATOM   209   C  CZ3   . TRP A 1 27  ? 50.596  27.393  -0.930  1.00 78.16  ? 27  TRP A CZ3   1 
ATOM   210   C  CH2   . TRP A 1 27  ? 51.595  26.410  -1.065  1.00 77.73  ? 27  TRP A CH2   1 
ATOM   211   N  N     . ARG A 1 28  ? 44.455  27.484  2.106   1.00 62.98  ? 28  ARG A N     1 
ATOM   212   C  CA    . ARG A 1 28  ? 43.123  28.072  2.122   1.00 62.67  ? 28  ARG A CA    1 
ATOM   213   C  C     . ARG A 1 28  ? 42.936  28.848  0.830   1.00 61.52  ? 28  ARG A C     1 
ATOM   214   O  O     . ARG A 1 28  ? 43.759  29.691  0.488   1.00 61.60  ? 28  ARG A O     1 
ATOM   215   C  CB    . ARG A 1 28  ? 42.952  29.001  3.325   1.00 62.07  ? 28  ARG A CB    1 
ATOM   216   C  CG    . ARG A 1 28  ? 42.170  30.252  3.014   1.00 64.23  ? 28  ARG A CG    1 
ATOM   217   C  CD    . ARG A 1 28  ? 41.395  30.730  4.215   1.00 68.93  ? 28  ARG A CD    1 
ATOM   218   N  NE    . ARG A 1 28  ? 40.055  30.145  4.272   1.00 72.91  ? 28  ARG A NE    1 
ATOM   219   C  CZ    . ARG A 1 28  ? 39.021  30.540  3.524   1.00 73.86  ? 28  ARG A CZ    1 
ATOM   220   N  NH1   . ARG A 1 28  ? 39.157  31.532  2.647   1.00 73.04  ? 28  ARG A NH1   1 
ATOM   221   N  NH2   . ARG A 1 28  ? 37.843  29.940  3.654   1.00 74.43  ? 28  ARG A NH2   1 
ATOM   222   N  N     . LEU A 1 29  ? 41.869  28.554  0.099   1.00 59.88  ? 29  LEU A N     1 
ATOM   223   C  CA    . LEU A 1 29  ? 41.630  29.268  -1.141  1.00 59.31  ? 29  LEU A CA    1 
ATOM   224   C  C     . LEU A 1 29  ? 40.396  30.141  -1.068  1.00 58.72  ? 29  LEU A C     1 
ATOM   225   O  O     . LEU A 1 29  ? 39.353  29.730  -0.574  1.00 58.40  ? 29  LEU A O     1 
ATOM   226   C  CB    . LEU A 1 29  ? 41.508  28.300  -2.324  1.00 60.03  ? 29  LEU A CB    1 
ATOM   227   C  CG    . LEU A 1 29  ? 42.794  27.598  -2.783  1.00 60.01  ? 29  LEU A CG    1 
ATOM   228   C  CD1   . LEU A 1 29  ? 43.004  26.344  -1.963  1.00 59.29  ? 29  LEU A CD1   1 
ATOM   229   C  CD2   . LEU A 1 29  ? 42.695  27.235  -4.255  1.00 59.26  ? 29  LEU A CD2   1 
ATOM   230   N  N     . GLU A 1 30  ? 40.532  31.364  -1.554  1.00 58.95  ? 30  GLU A N     1 
ATOM   231   C  CA    . GLU A 1 30  ? 39.426  32.297  -1.560  1.00 60.16  ? 30  GLU A CA    1 
ATOM   232   C  C     . GLU A 1 30  ? 38.686  32.016  -2.871  1.00 59.97  ? 30  GLU A C     1 
ATOM   233   O  O     . GLU A 1 30  ? 39.313  31.680  -3.881  1.00 60.09  ? 30  GLU A O     1 
ATOM   234   C  CB    . GLU A 1 30  ? 39.962  33.732  -1.532  1.00 61.52  ? 30  GLU A CB    1 
ATOM   235   C  CG    . GLU A 1 30  ? 39.048  34.743  -0.850  1.00 65.28  ? 30  GLU A CG    1 
ATOM   236   C  CD    . GLU A 1 30  ? 39.189  34.739  0.660   1.00 67.71  ? 30  GLU A CD    1 
ATOM   237   O  OE1   . GLU A 1 30  ? 40.298  35.040  1.154   1.00 68.45  ? 30  GLU A OE1   1 
ATOM   238   O  OE2   . GLU A 1 30  ? 38.191  34.437  1.350   1.00 70.18  ? 30  GLU A OE2   1 
ATOM   239   N  N     . VAL A 1 31  ? 37.361  32.128  -2.860  1.00 58.58  ? 31  VAL A N     1 
ATOM   240   C  CA    . VAL A 1 31  ? 36.589  31.875  -4.069  1.00 56.41  ? 31  VAL A CA    1 
ATOM   241   C  C     . VAL A 1 31  ? 35.834  33.112  -4.492  1.00 55.29  ? 31  VAL A C     1 
ATOM   242   O  O     . VAL A 1 31  ? 35.302  33.841  -3.661  1.00 55.23  ? 31  VAL A O     1 
ATOM   243   C  CB    . VAL A 1 31  ? 35.568  30.727  -3.874  1.00 56.65  ? 31  VAL A CB    1 
ATOM   244   C  CG1   . VAL A 1 31  ? 34.802  30.478  -5.166  1.00 55.63  ? 31  VAL A CG1   1 
ATOM   245   C  CG2   . VAL A 1 31  ? 36.283  29.467  -3.449  1.00 56.05  ? 31  VAL A CG2   1 
ATOM   246   N  N     . VAL A 1 32  ? 35.800  33.338  -5.797  1.00 55.00  ? 32  VAL A N     1 
ATOM   247   C  CA    . VAL A 1 32  ? 35.098  34.471  -6.378  1.00 54.95  ? 32  VAL A CA    1 
ATOM   248   C  C     . VAL A 1 32  ? 34.112  33.933  -7.406  1.00 55.52  ? 32  VAL A C     1 
ATOM   249   O  O     . VAL A 1 32  ? 34.507  33.269  -8.364  1.00 56.69  ? 32  VAL A O     1 
ATOM   250   C  CB    . VAL A 1 32  ? 36.075  35.451  -7.079  1.00 53.73  ? 32  VAL A CB    1 
ATOM   251   C  CG1   . VAL A 1 32  ? 35.298  36.483  -7.867  1.00 52.94  ? 32  VAL A CG1   1 
ATOM   252   C  CG2   . VAL A 1 32  ? 36.949  36.145  -6.054  1.00 52.22  ? 32  VAL A CG2   1 
ATOM   253   N  N     . LEU A 1 33  ? 32.829  34.204  -7.200  1.00 55.24  ? 33  LEU A N     1 
ATOM   254   C  CA    . LEU A 1 33  ? 31.811  33.741  -8.130  1.00 56.15  ? 33  LEU A CA    1 
ATOM   255   C  C     . LEU A 1 33  ? 31.197  34.904  -8.893  1.00 56.87  ? 33  LEU A C     1 
ATOM   256   O  O     . LEU A 1 33  ? 30.949  35.969  -8.333  1.00 56.34  ? 33  LEU A O     1 
ATOM   257   C  CB    . LEU A 1 33  ? 30.738  32.951  -7.380  1.00 56.18  ? 33  LEU A CB    1 
ATOM   258   C  CG    . LEU A 1 33  ? 31.189  31.522  -7.056  1.00 55.78  ? 33  LEU A CG    1 
ATOM   259   C  CD1   . LEU A 1 33  ? 30.380  30.940  -5.920  1.00 53.82  ? 33  LEU A CD1   1 
ATOM   260   C  CD2   . LEU A 1 33  ? 31.067  30.671  -8.303  1.00 55.24  ? 33  LEU A CD2   1 
ATOM   261   N  N     . ASP A 1 34  ? 30.954  34.688  -10.179 1.00 58.50  ? 34  ASP A N     1 
ATOM   262   C  CA    . ASP A 1 34  ? 30.393  35.722  -11.033 1.00 60.69  ? 34  ASP A CA    1 
ATOM   263   C  C     . ASP A 1 34  ? 29.389  35.174  -12.050 1.00 61.73  ? 34  ASP A C     1 
ATOM   264   O  O     . ASP A 1 34  ? 29.752  34.411  -12.947 1.00 61.11  ? 34  ASP A O     1 
ATOM   265   C  CB    . ASP A 1 34  ? 31.529  36.405  -11.788 1.00 62.20  ? 34  ASP A CB    1 
ATOM   266   C  CG    . ASP A 1 34  ? 31.038  37.458  -12.747 1.00 64.74  ? 34  ASP A CG    1 
ATOM   267   O  OD1   . ASP A 1 34  ? 30.240  37.113  -13.650 1.00 65.51  ? 34  ASP A OD1   1 
ATOM   268   O  OD2   . ASP A 1 34  ? 31.450  38.631  -12.593 1.00 66.05  ? 34  ASP A OD2   1 
ATOM   269   N  N     . PRO A 1 35  ? 28.107  35.599  -11.948 1.00 62.57  ? 35  PRO A N     1 
ATOM   270   C  CA    . PRO A 1 35  ? 27.551  36.572  -10.994 1.00 63.86  ? 35  PRO A CA    1 
ATOM   271   C  C     . PRO A 1 35  ? 27.449  36.152  -9.524  1.00 65.94  ? 35  PRO A C     1 
ATOM   272   O  O     . PRO A 1 35  ? 27.327  34.973  -9.207  1.00 66.70  ? 35  PRO A O     1 
ATOM   273   C  CB    . PRO A 1 35  ? 26.178  36.854  -11.579 1.00 63.99  ? 35  PRO A CB    1 
ATOM   274   C  CG    . PRO A 1 35  ? 25.809  35.530  -12.166 1.00 63.11  ? 35  PRO A CG    1 
ATOM   275   C  CD    . PRO A 1 35  ? 27.068  35.125  -12.874 1.00 62.22  ? 35  PRO A CD    1 
ATOM   276   N  N     . PRO A 1 36  ? 27.476  37.136  -8.607  1.00 67.55  ? 36  PRO A N     1 
ATOM   277   C  CA    . PRO A 1 36  ? 27.390  36.879  -7.167  1.00 68.65  ? 36  PRO A CA    1 
ATOM   278   C  C     . PRO A 1 36  ? 26.155  36.061  -6.846  1.00 70.10  ? 36  PRO A C     1 
ATOM   279   O  O     . PRO A 1 36  ? 25.045  36.446  -7.195  1.00 70.65  ? 36  PRO A O     1 
ATOM   280   C  CB    . PRO A 1 36  ? 27.321  38.278  -6.568  1.00 68.75  ? 36  PRO A CB    1 
ATOM   281   C  CG    . PRO A 1 36  ? 28.103  39.105  -7.550  1.00 68.63  ? 36  PRO A CG    1 
ATOM   282   C  CD    . PRO A 1 36  ? 27.598  38.580  -8.873  1.00 68.27  ? 36  PRO A CD    1 
ATOM   283   N  N     . PRO A 1 37  ? 26.337  34.918  -6.177  1.00 71.45  ? 37  PRO A N     1 
ATOM   284   C  CA    . PRO A 1 37  ? 25.278  33.988  -5.778  1.00 73.13  ? 37  PRO A CA    1 
ATOM   285   C  C     . PRO A 1 37  ? 24.347  34.531  -4.688  1.00 74.88  ? 37  PRO A C     1 
ATOM   286   O  O     . PRO A 1 37  ? 24.535  35.648  -4.194  1.00 75.37  ? 37  PRO A O     1 
ATOM   287   C  CB    . PRO A 1 37  ? 26.059  32.768  -5.294  1.00 72.59  ? 37  PRO A CB    1 
ATOM   288   C  CG    . PRO A 1 37  ? 27.379  32.902  -5.990  1.00 72.35  ? 37  PRO A CG    1 
ATOM   289   C  CD    . PRO A 1 37  ? 27.655  34.354  -5.866  1.00 71.80  ? 37  PRO A CD    1 
ATOM   290   N  N     . GLY A 1 38  ? 23.347  33.726  -4.326  1.00 75.49  ? 38  GLY A N     1 
ATOM   291   C  CA    . GLY A 1 38  ? 22.406  34.107  -3.289  1.00 76.71  ? 38  GLY A CA    1 
ATOM   292   C  C     . GLY A 1 38  ? 22.598  33.223  -2.068  1.00 78.00  ? 38  GLY A C     1 
ATOM   293   O  O     . GLY A 1 38  ? 22.648  32.004  -2.195  1.00 77.85  ? 38  GLY A O     1 
ATOM   294   N  N     . ARG A 1 39  ? 22.700  33.839  -0.892  1.00 79.41  ? 39  ARG A N     1 
ATOM   295   C  CA    . ARG A 1 39  ? 22.910  33.127  0.369   1.00 81.26  ? 39  ARG A CA    1 
ATOM   296   C  C     . ARG A 1 39  ? 22.797  31.602  0.302   1.00 81.10  ? 39  ARG A C     1 
ATOM   297   O  O     . ARG A 1 39  ? 23.789  30.889  0.439   1.00 81.04  ? 39  ARG A O     1 
ATOM   298   C  CB    . ARG A 1 39  ? 21.955  33.663  1.451   1.00 83.12  ? 39  ARG A CB    1 
ATOM   299   C  CG    . ARG A 1 39  ? 22.121  33.004  2.835   1.00 85.73  ? 39  ARG A CG    1 
ATOM   300   C  CD    . ARG A 1 39  ? 21.265  33.692  3.904   1.00 87.36  ? 39  ARG A CD    1 
ATOM   301   N  NE    . ARG A 1 39  ? 21.228  32.964  5.177   1.00 89.60  ? 39  ARG A NE    1 
ATOM   302   C  CZ    . ARG A 1 39  ? 22.216  32.923  6.069   1.00 90.13  ? 39  ARG A CZ    1 
ATOM   303   N  NH1   . ARG A 1 39  ? 23.354  33.574  5.847   1.00 89.70  ? 39  ARG A NH1   1 
ATOM   304   N  NH2   . ARG A 1 39  ? 22.060  32.230  7.194   1.00 90.08  ? 39  ARG A NH2   1 
ATOM   305   N  N     . GLU A 1 40  ? 21.596  31.094  0.079   1.00 80.83  ? 40  GLU A N     1 
ATOM   306   C  CA    . GLU A 1 40  ? 21.427  29.653  0.044   1.00 80.51  ? 40  GLU A CA    1 
ATOM   307   C  C     . GLU A 1 40  ? 21.970  28.940  -1.189  1.00 78.18  ? 40  GLU A C     1 
ATOM   308   O  O     . GLU A 1 40  ? 21.742  27.746  -1.357  1.00 77.63  ? 40  GLU A O     1 
ATOM   309   C  CB    . GLU A 1 40  ? 19.952  29.288  0.243   1.00 83.13  ? 40  GLU A CB    1 
ATOM   310   C  CG    . GLU A 1 40  ? 19.525  29.127  1.716   1.00 86.77  ? 40  GLU A CG    1 
ATOM   311   C  CD    . GLU A 1 40  ? 18.921  30.393  2.325   1.00 89.02  ? 40  GLU A CD    1 
ATOM   312   O  OE1   . GLU A 1 40  ? 18.386  31.227  1.554   1.00 90.22  ? 40  GLU A OE1   1 
ATOM   313   O  OE2   . GLU A 1 40  ? 18.960  30.537  3.575   1.00 88.27  ? 40  GLU A OE2   1 
ATOM   314   N  N     . GLU A 1 41  ? 22.699  29.651  -2.041  1.00 75.95  ? 41  GLU A N     1 
ATOM   315   C  CA    . GLU A 1 41  ? 23.248  29.029  -3.244  1.00 74.32  ? 41  GLU A CA    1 
ATOM   316   C  C     . GLU A 1 41  ? 24.768  29.000  -3.216  1.00 72.53  ? 41  GLU A C     1 
ATOM   317   O  O     . GLU A 1 41  ? 25.404  28.470  -4.126  1.00 71.75  ? 41  GLU A O     1 
ATOM   318   C  CB    . GLU A 1 41  ? 22.768  29.763  -4.508  1.00 73.92  ? 41  GLU A CB    1 
ATOM   319   C  CG    . GLU A 1 41  ? 21.257  29.794  -4.680  0.00 74.27  ? 41  GLU A CG    1 
ATOM   320   C  CD    . GLU A 1 41  ? 20.832  30.519  -5.944  0.00 74.31  ? 41  GLU A CD    1 
ATOM   321   O  OE1   . GLU A 1 41  ? 21.667  31.249  -6.519  0.00 74.37  ? 41  GLU A OE1   1 
ATOM   322   O  OE2   . GLU A 1 41  ? 19.663  30.369  -6.356  0.00 74.37  ? 41  GLU A OE2   1 
ATOM   323   N  N     . VAL A 1 42  ? 25.347  29.557  -2.158  1.00 71.10  ? 42  VAL A N     1 
ATOM   324   C  CA    . VAL A 1 42  ? 26.803  29.601  -2.024  1.00 69.60  ? 42  VAL A CA    1 
ATOM   325   C  C     . VAL A 1 42  ? 27.390  28.244  -1.664  1.00 68.77  ? 42  VAL A C     1 
ATOM   326   O  O     . VAL A 1 42  ? 28.318  27.766  -2.316  1.00 68.43  ? 42  VAL A O     1 
ATOM   327   C  CB    . VAL A 1 42  ? 27.243  30.598  -0.938  1.00 68.35  ? 42  VAL A CB    1 
ATOM   328   C  CG1   . VAL A 1 42  ? 28.748  30.718  -0.929  1.00 67.28  ? 42  VAL A CG1   1 
ATOM   329   C  CG2   . VAL A 1 42  ? 26.607  31.945  -1.178  1.00 68.72  ? 42  VAL A CG2   1 
ATOM   330   N  N     . TYR A 1 43  ? 26.845  27.641  -0.613  1.00 67.48  ? 43  TYR A N     1 
ATOM   331   C  CA    . TYR A 1 43  ? 27.301  26.346  -0.141  1.00 66.43  ? 43  TYR A CA    1 
ATOM   332   C  C     . TYR A 1 43  ? 27.410  25.284  -1.222  1.00 64.27  ? 43  TYR A C     1 
ATOM   333   O  O     . TYR A 1 43  ? 28.413  24.585  -1.310  1.00 65.65  ? 43  TYR A O     1 
ATOM   334   C  CB    . TYR A 1 43  ? 26.380  25.830  0.952   1.00 68.82  ? 43  TYR A CB    1 
ATOM   335   C  CG    . TYR A 1 43  ? 26.619  26.439  2.306   1.00 73.19  ? 43  TYR A CG    1 
ATOM   336   C  CD1   . TYR A 1 43  ? 27.892  26.873  2.687   1.00 74.82  ? 43  TYR A CD1   1 
ATOM   337   C  CD2   . TYR A 1 43  ? 25.590  26.497  3.251   1.00 75.73  ? 43  TYR A CD2   1 
ATOM   338   C  CE1   . TYR A 1 43  ? 28.136  27.343  3.982   1.00 76.65  ? 43  TYR A CE1   1 
ATOM   339   C  CE2   . TYR A 1 43  ? 25.818  26.963  4.549   1.00 76.68  ? 43  TYR A CE2   1 
ATOM   340   C  CZ    . TYR A 1 43  ? 27.092  27.381  4.910   1.00 77.60  ? 43  TYR A CZ    1 
ATOM   341   O  OH    . TYR A 1 43  ? 27.323  27.811  6.202   1.00 78.44  ? 43  TYR A OH    1 
ATOM   342   N  N     . PRO A 1 44  ? 26.373  25.130  -2.051  1.00 61.15  ? 44  PRO A N     1 
ATOM   343   C  CA    . PRO A 1 44  ? 26.424  24.119  -3.109  1.00 58.88  ? 44  PRO A CA    1 
ATOM   344   C  C     . PRO A 1 44  ? 27.517  24.441  -4.108  1.00 56.13  ? 44  PRO A C     1 
ATOM   345   O  O     . PRO A 1 44  ? 28.406  23.633  -4.356  1.00 56.12  ? 44  PRO A O     1 
ATOM   346   C  CB    . PRO A 1 44  ? 25.036  24.207  -3.745  1.00 60.29  ? 44  PRO A CB    1 
ATOM   347   C  CG    . PRO A 1 44  ? 24.184  24.732  -2.641  1.00 61.59  ? 44  PRO A CG    1 
ATOM   348   C  CD    . PRO A 1 44  ? 25.063  25.792  -2.033  1.00 61.65  ? 44  PRO A CD    1 
ATOM   349   N  N     . LEU A 1 45  ? 27.429  25.639  -4.674  1.00 53.67  ? 45  LEU A N     1 
ATOM   350   C  CA    . LEU A 1 45  ? 28.387  26.118  -5.657  1.00 50.47  ? 45  LEU A CA    1 
ATOM   351   C  C     . LEU A 1 45  ? 29.826  25.888  -5.205  1.00 48.09  ? 45  LEU A C     1 
ATOM   352   O  O     . LEU A 1 45  ? 30.648  25.361  -5.957  1.00 46.43  ? 45  LEU A O     1 
ATOM   353   C  CB    . LEU A 1 45  ? 28.140  27.605  -5.919  1.00 50.84  ? 45  LEU A CB    1 
ATOM   354   C  CG    . LEU A 1 45  ? 26.905  27.945  -6.762  1.00 50.28  ? 45  LEU A CG    1 
ATOM   355   C  CD1   . LEU A 1 45  ? 26.610  29.435  -6.688  1.00 51.06  ? 45  LEU A CD1   1 
ATOM   356   C  CD2   . LEU A 1 45  ? 27.150  27.530  -8.200  1.00 49.99  ? 45  LEU A CD2   1 
ATOM   357   N  N     . LEU A 1 46  ? 30.121  26.289  -3.974  1.00 46.18  ? 46  LEU A N     1 
ATOM   358   C  CA    . LEU A 1 46  ? 31.450  26.114  -3.411  1.00 44.72  ? 46  LEU A CA    1 
ATOM   359   C  C     . LEU A 1 46  ? 31.850  24.655  -3.530  1.00 43.77  ? 46  LEU A C     1 
ATOM   360   O  O     . LEU A 1 46  ? 32.874  24.329  -4.129  1.00 43.63  ? 46  LEU A O     1 
ATOM   361   C  CB    . LEU A 1 46  ? 31.455  26.547  -1.948  1.00 44.42  ? 46  LEU A CB    1 
ATOM   362   C  CG    . LEU A 1 46  ? 31.343  28.057  -1.745  1.00 44.58  ? 46  LEU A CG    1 
ATOM   363   C  CD1   . LEU A 1 46  ? 31.128  28.358  -0.272  1.00 45.34  ? 46  LEU A CD1   1 
ATOM   364   C  CD2   . LEU A 1 46  ? 32.614  28.741  -2.270  1.00 44.69  ? 46  LEU A CD2   1 
ATOM   365   N  N     . ALA A 1 47  ? 31.026  23.784  -2.954  1.00 42.62  ? 47  ALA A N     1 
ATOM   366   C  CA    . ALA A 1 47  ? 31.250  22.346  -3.007  1.00 41.37  ? 47  ALA A CA    1 
ATOM   367   C  C     . ALA A 1 47  ? 31.608  21.967  -4.440  1.00 40.89  ? 47  ALA A C     1 
ATOM   368   O  O     . ALA A 1 47  ? 32.680  21.427  -4.701  1.00 39.39  ? 47  ALA A O     1 
ATOM   369   C  CB    . ALA A 1 47  ? 29.999  21.624  -2.575  1.00 40.29  ? 47  ALA A CB    1 
ATOM   370   N  N     . GLN A 1 48  ? 30.703  22.270  -5.363  1.00 41.06  ? 48  GLN A N     1 
ATOM   371   C  CA    . GLN A 1 48  ? 30.918  21.989  -6.771  1.00 42.80  ? 48  GLN A CA    1 
ATOM   372   C  C     . GLN A 1 48  ? 32.272  22.489  -7.259  1.00 42.60  ? 48  GLN A C     1 
ATOM   373   O  O     . GLN A 1 48  ? 32.950  21.804  -8.015  1.00 43.55  ? 48  GLN A O     1 
ATOM   374   C  CB    . GLN A 1 48  ? 29.821  22.625  -7.608  1.00 44.91  ? 48  GLN A CB    1 
ATOM   375   C  CG    . GLN A 1 48  ? 29.968  22.346  -9.085  1.00 50.94  ? 48  GLN A CG    1 
ATOM   376   C  CD    . GLN A 1 48  ? 28.669  22.558  -9.847  1.00 54.42  ? 48  GLN A CD    1 
ATOM   377   O  OE1   . GLN A 1 48  ? 28.605  22.340  -11.064 1.00 55.18  ? 48  GLN A OE1   1 
ATOM   378   N  NE2   . GLN A 1 48  ? 27.622  22.979  -9.132  1.00 55.01  ? 48  GLN A NE2   1 
ATOM   379   N  N     . VAL A 1 49  ? 32.677  23.678  -6.833  1.00 41.68  ? 49  VAL A N     1 
ATOM   380   C  CA    . VAL A 1 49  ? 33.963  24.199  -7.270  1.00 41.21  ? 49  VAL A CA    1 
ATOM   381   C  C     . VAL A 1 49  ? 35.102  23.359  -6.736  1.00 39.86  ? 49  VAL A C     1 
ATOM   382   O  O     . VAL A 1 49  ? 36.042  23.063  -7.452  1.00 38.71  ? 49  VAL A O     1 
ATOM   383   C  CB    . VAL A 1 49  ? 34.190  25.650  -6.808  1.00 42.16  ? 49  VAL A CB    1 
ATOM   384   C  CG1   . VAL A 1 49  ? 35.614  26.076  -7.102  1.00 43.36  ? 49  VAL A CG1   1 
ATOM   385   C  CG2   . VAL A 1 49  ? 33.249  26.575  -7.535  1.00 44.42  ? 49  VAL A CG2   1 
ATOM   386   N  N     . ALA A 1 50  ? 35.015  22.984  -5.469  1.00 40.49  ? 50  ALA A N     1 
ATOM   387   C  CA    . ALA A 1 50  ? 36.065  22.195  -4.845  1.00 42.29  ? 50  ALA A CA    1 
ATOM   388   C  C     . ALA A 1 50  ? 36.232  20.918  -5.628  1.00 44.19  ? 50  ALA A C     1 
ATOM   389   O  O     . ALA A 1 50  ? 37.272  20.255  -5.584  1.00 43.97  ? 50  ALA A O     1 
ATOM   390   C  CB    . ALA A 1 50  ? 35.701  21.880  -3.414  1.00 41.66  ? 50  ALA A CB    1 
ATOM   391   N  N     . ARG A 1 51  ? 35.187  20.573  -6.357  1.00 46.12  ? 51  ARG A N     1 
ATOM   392   C  CA    . ARG A 1 51  ? 35.219  19.370  -7.144  1.00 48.32  ? 51  ARG A CA    1 
ATOM   393   C  C     . ARG A 1 51  ? 35.891  19.693  -8.467  1.00 47.94  ? 51  ARG A C     1 
ATOM   394   O  O     . ARG A 1 51  ? 36.713  18.926  -8.958  1.00 48.18  ? 51  ARG A O     1 
ATOM   395   C  CB    . ARG A 1 51  ? 33.799  18.876  -7.368  1.00 51.87  ? 51  ARG A CB    1 
ATOM   396   C  CG    . ARG A 1 51  ? 33.588  17.403  -7.061  1.00 58.89  ? 51  ARG A CG    1 
ATOM   397   C  CD    . ARG A 1 51  ? 32.213  16.954  -7.593  1.00 65.79  ? 51  ARG A CD    1 
ATOM   398   N  NE    . ARG A 1 51  ? 32.084  15.498  -7.751  1.00 69.74  ? 51  ARG A NE    1 
ATOM   399   C  CZ    . ARG A 1 51  ? 32.055  14.858  -8.922  1.00 69.61  ? 51  ARG A CZ    1 
ATOM   400   N  NH1   . ARG A 1 51  ? 32.148  15.537  -10.061 1.00 68.17  ? 51  ARG A NH1   1 
ATOM   401   N  NH2   . ARG A 1 51  ? 31.924  13.534  -8.951  1.00 69.81  ? 51  ARG A NH2   1 
ATOM   402   N  N     . ARG A 1 52  ? 35.554  20.845  -9.034  1.00 47.86  ? 52  ARG A N     1 
ATOM   403   C  CA    . ARG A 1 52  ? 36.129  21.245  -10.311 1.00 48.07  ? 52  ARG A CA    1 
ATOM   404   C  C     . ARG A 1 52  ? 37.614  21.549  -10.229 1.00 47.34  ? 52  ARG A C     1 
ATOM   405   O  O     . ARG A 1 52  ? 38.358  21.218  -11.143 1.00 47.61  ? 52  ARG A O     1 
ATOM   406   C  CB    . ARG A 1 52  ? 35.393  22.460  -10.882 1.00 49.47  ? 52  ARG A CB    1 
ATOM   407   C  CG    . ARG A 1 52  ? 33.970  22.171  -11.335 1.00 52.90  ? 52  ARG A CG    1 
ATOM   408   C  CD    . ARG A 1 52  ? 33.908  21.055  -12.370 1.00 56.66  ? 52  ARG A CD    1 
ATOM   409   N  NE    . ARG A 1 52  ? 34.256  21.491  -13.727 1.00 62.15  ? 52  ARG A NE    1 
ATOM   410   C  CZ    . ARG A 1 52  ? 34.401  20.662  -14.767 1.00 63.48  ? 52  ARG A CZ    1 
ATOM   411   N  NH1   . ARG A 1 52  ? 34.234  19.348  -14.612 1.00 63.73  ? 52  ARG A NH1   1 
ATOM   412   N  NH2   . ARG A 1 52  ? 34.708  21.144  -15.969 1.00 63.01  ? 52  ARG A NH2   1 
ATOM   413   N  N     . ALA A 1 53  ? 38.037  22.174  -9.135  1.00 46.78  ? 53  ALA A N     1 
ATOM   414   C  CA    . ALA A 1 53  ? 39.435  22.543  -8.926  1.00 46.13  ? 53  ALA A CA    1 
ATOM   415   C  C     . ALA A 1 53  ? 40.360  21.328  -8.924  1.00 46.62  ? 53  ALA A C     1 
ATOM   416   O  O     . ALA A 1 53  ? 41.549  21.425  -9.270  1.00 44.44  ? 53  ALA A O     1 
ATOM   417   C  CB    . ALA A 1 53  ? 39.569  23.298  -7.617  1.00 46.34  ? 53  ALA A CB    1 
ATOM   418   N  N     . GLY A 1 54  ? 39.807  20.188  -8.517  1.00 47.20  ? 54  GLY A N     1 
ATOM   419   C  CA    . GLY A 1 54  ? 40.580  18.960  -8.489  1.00 48.24  ? 54  GLY A CA    1 
ATOM   420   C  C     . GLY A 1 54  ? 41.413  18.780  -7.240  1.00 48.48  ? 54  GLY A C     1 
ATOM   421   O  O     . GLY A 1 54  ? 41.115  19.356  -6.199  1.00 49.35  ? 54  GLY A O     1 
ATOM   422   N  N     . GLY A 1 55  ? 42.469  17.981  -7.343  1.00 47.87  ? 55  GLY A N     1 
ATOM   423   C  CA    . GLY A 1 55  ? 43.304  17.734  -6.188  1.00 45.38  ? 55  GLY A CA    1 
ATOM   424   C  C     . GLY A 1 55  ? 42.454  17.371  -4.983  1.00 44.85  ? 55  GLY A C     1 
ATOM   425   O  O     . GLY A 1 55  ? 41.254  17.094  -5.083  1.00 44.19  ? 55  GLY A O     1 
ATOM   426   N  N     . VAL A 1 56  ? 43.088  17.363  -3.824  1.00 44.87  ? 56  VAL A N     1 
ATOM   427   C  CA    . VAL A 1 56  ? 42.394  17.056  -2.591  1.00 43.61  ? 56  VAL A CA    1 
ATOM   428   C  C     . VAL A 1 56  ? 41.928  18.372  -2.009  1.00 41.98  ? 56  VAL A C     1 
ATOM   429   O  O     . VAL A 1 56  ? 42.636  18.991  -1.223  1.00 42.04  ? 56  VAL A O     1 
ATOM   430   C  CB    . VAL A 1 56  ? 43.332  16.361  -1.608  1.00 43.98  ? 56  VAL A CB    1 
ATOM   431   C  CG1   . VAL A 1 56  ? 42.629  16.124  -0.285  1.00 44.51  ? 56  VAL A CG1   1 
ATOM   432   C  CG2   . VAL A 1 56  ? 43.797  15.048  -2.207  1.00 45.11  ? 56  VAL A CG2   1 
ATOM   433   N  N     . THR A 1 57  ? 40.739  18.803  -2.408  1.00 40.46  ? 57  THR A N     1 
ATOM   434   C  CA    . THR A 1 57  ? 40.209  20.059  -1.919  1.00 40.08  ? 57  THR A CA    1 
ATOM   435   C  C     . THR A 1 57  ? 38.735  19.968  -1.523  1.00 39.42  ? 57  THR A C     1 
ATOM   436   O  O     . THR A 1 57  ? 37.955  19.245  -2.137  1.00 38.97  ? 57  THR A O     1 
ATOM   437   C  CB    . THR A 1 57  ? 40.448  21.171  -2.971  1.00 40.21  ? 57  THR A CB    1 
ATOM   438   O  OG1   . THR A 1 57  ? 39.759  22.360  -2.585  1.00 40.60  ? 57  THR A OG1   1 
ATOM   439   C  CG2   . THR A 1 57  ? 39.978  20.737  -4.319  1.00 39.28  ? 57  THR A CG2   1 
ATOM   440   N  N     . VAL A 1 58  ? 38.371  20.705  -0.479  1.00 39.99  ? 58  VAL A N     1 
ATOM   441   C  CA    . VAL A 1 58  ? 37.009  20.710  0.052   1.00 41.15  ? 58  VAL A CA    1 
ATOM   442   C  C     . VAL A 1 58  ? 36.499  22.116  0.443   1.00 41.72  ? 58  VAL A C     1 
ATOM   443   O  O     . VAL A 1 58  ? 37.234  23.101  0.417   1.00 41.16  ? 58  VAL A O     1 
ATOM   444   C  CB    . VAL A 1 58  ? 36.947  19.824  1.305   1.00 41.44  ? 58  VAL A CB    1 
ATOM   445   C  CG1   . VAL A 1 58  ? 35.510  19.631  1.737   1.00 46.37  ? 58  VAL A CG1   1 
ATOM   446   C  CG2   . VAL A 1 58  ? 37.612  18.498  1.034   1.00 41.60  ? 58  VAL A CG2   1 
ATOM   447   N  N     . ARG A 1 59  ? 35.237  22.217  0.818   1.00 42.89  ? 59  ARG A N     1 
ATOM   448   C  CA    . ARG A 1 59  ? 34.715  23.503  1.224   1.00 46.34  ? 59  ARG A CA    1 
ATOM   449   C  C     . ARG A 1 59  ? 35.047  23.765  2.690   1.00 48.13  ? 59  ARG A C     1 
ATOM   450   O  O     . ARG A 1 59  ? 34.896  22.886  3.535   1.00 48.29  ? 59  ARG A O     1 
ATOM   451   C  CB    . ARG A 1 59  ? 33.202  23.538  1.061   1.00 49.82  ? 59  ARG A CB    1 
ATOM   452   C  CG    . ARG A 1 59  ? 32.618  24.924  1.251   1.00 55.12  ? 59  ARG A CG    1 
ATOM   453   C  CD    . ARG A 1 59  ? 31.129  24.904  1.563   1.00 60.96  ? 59  ARG A CD    1 
ATOM   454   N  NE    . ARG A 1 59  ? 30.844  24.439  2.921   1.00 65.99  ? 59  ARG A NE    1 
ATOM   455   C  CZ    . ARG A 1 59  ? 30.423  23.215  3.223   1.00 67.34  ? 59  ARG A CZ    1 
ATOM   456   N  NH1   . ARG A 1 59  ? 30.233  22.315  2.264   1.00 68.45  ? 59  ARG A NH1   1 
ATOM   457   N  NH2   . ARG A 1 59  ? 30.188  22.894  4.485   1.00 67.48  ? 59  ARG A NH2   1 
ATOM   458   N  N     . MET A 1 60  ? 35.507  24.974  2.990   1.00 50.15  ? 60  MET A N     1 
ATOM   459   C  CA    . MET A 1 60  ? 35.811  25.371  4.364   1.00 51.54  ? 60  MET A CA    1 
ATOM   460   C  C     . MET A 1 60  ? 35.247  26.774  4.614   1.00 52.58  ? 60  MET A C     1 
ATOM   461   O  O     . MET A 1 60  ? 35.865  27.787  4.271   1.00 52.55  ? 60  MET A O     1 
ATOM   462   C  CB    . MET A 1 60  ? 37.314  25.372  4.621   1.00 52.64  ? 60  MET A CB    1 
ATOM   463   C  CG    . MET A 1 60  ? 37.662  25.919  5.990   1.00 55.25  ? 60  MET A CG    1 
ATOM   464   S  SD    . MET A 1 60  ? 39.399  25.785  6.392   1.00 59.72  ? 60  MET A SD    1 
ATOM   465   C  CE    . MET A 1 60  ? 40.056  27.282  5.617   1.00 58.17  ? 60  MET A CE    1 
ATOM   466   N  N     . GLY A 1 61  ? 34.065  26.828  5.216   1.00 52.69  ? 61  GLY A N     1 
ATOM   467   C  CA    . GLY A 1 61  ? 33.446  28.110  5.468   1.00 53.34  ? 61  GLY A CA    1 
ATOM   468   C  C     . GLY A 1 61  ? 32.909  28.602  4.144   1.00 53.57  ? 61  GLY A C     1 
ATOM   469   O  O     . GLY A 1 61  ? 32.264  27.845  3.418   1.00 54.02  ? 61  GLY A O     1 
ATOM   470   N  N     . ASP A 1 62  ? 33.168  29.864  3.824   1.00 53.51  ? 62  ASP A N     1 
ATOM   471   C  CA    . ASP A 1 62  ? 32.712  30.433  2.564   1.00 52.83  ? 62  ASP A CA    1 
ATOM   472   C  C     . ASP A 1 62  ? 33.771  30.207  1.488   1.00 52.16  ? 62  ASP A C     1 
ATOM   473   O  O     . ASP A 1 62  ? 33.565  30.543  0.314   1.00 52.95  ? 62  ASP A O     1 
ATOM   474   C  CB    . ASP A 1 62  ? 32.414  31.938  2.722   1.00 54.78  ? 62  ASP A CB    1 
ATOM   475   C  CG    . ASP A 1 62  ? 33.501  32.698  3.506   1.00 58.46  ? 62  ASP A CG    1 
ATOM   476   O  OD1   . ASP A 1 62  ? 33.402  33.945  3.607   1.00 60.21  ? 62  ASP A OD1   1 
ATOM   477   O  OD2   . ASP A 1 62  ? 34.447  32.067  4.030   1.00 61.14  ? 62  ASP A OD2   1 
ATOM   478   N  N     . GLY A 1 63  ? 34.894  29.611  1.890   1.00 49.71  ? 63  GLY A N     1 
ATOM   479   C  CA    . GLY A 1 63  ? 35.980  29.367  0.955   1.00 47.37  ? 63  GLY A CA    1 
ATOM   480   C  C     . GLY A 1 63  ? 36.398  27.917  0.793   1.00 44.94  ? 63  GLY A C     1 
ATOM   481   O  O     . GLY A 1 63  ? 35.601  27.013  1.001   1.00 45.57  ? 63  GLY A O     1 
ATOM   482   N  N     . LEU A 1 64  ? 37.654  27.694  0.418   1.00 42.09  ? 64  LEU A N     1 
ATOM   483   C  CA    . LEU A 1 64  ? 38.167  26.344  0.219   1.00 39.57  ? 64  LEU A CA    1 
ATOM   484   C  C     . LEU A 1 64  ? 39.419  26.026  1.034   1.00 40.16  ? 64  LEU A C     1 
ATOM   485   O  O     . LEU A 1 64  ? 40.062  26.912  1.606   1.00 41.14  ? 64  LEU A O     1 
ATOM   486   C  CB    . LEU A 1 64  ? 38.486  26.113  -1.261  1.00 34.92  ? 64  LEU A CB    1 
ATOM   487   C  CG    . LEU A 1 64  ? 37.331  26.122  -2.250  1.00 32.58  ? 64  LEU A CG    1 
ATOM   488   C  CD1   . LEU A 1 64  ? 37.856  25.877  -3.640  1.00 31.03  ? 64  LEU A CD1   1 
ATOM   489   C  CD2   . LEU A 1 64  ? 36.317  25.062  -1.869  1.00 31.14  ? 64  LEU A CD2   1 
ATOM   490   N  N     . ALA A 1 65  ? 39.754  24.740  1.062   1.00 39.51  ? 65  ALA A N     1 
ATOM   491   C  CA    . ALA A 1 65  ? 40.933  24.232  1.753   1.00 38.62  ? 65  ALA A CA    1 
ATOM   492   C  C     . ALA A 1 65  ? 41.377  22.987  0.998   1.00 38.04  ? 65  ALA A C     1 
ATOM   493   O  O     . ALA A 1 65  ? 40.575  22.110  0.691   1.00 36.44  ? 65  ALA A O     1 
ATOM   494   C  CB    . ALA A 1 65  ? 40.595  23.888  3.184   1.00 40.68  ? 65  ALA A CB    1 
ATOM   495   N  N     . SER A 1 66  ? 42.657  22.907  0.679   1.00 38.19  ? 66  SER A N     1 
ATOM   496   C  CA    . SER A 1 66  ? 43.141  21.764  -0.065  1.00 39.28  ? 66  SER A CA    1 
ATOM   497   C  C     . SER A 1 66  ? 44.397  21.190  0.542   1.00 40.79  ? 66  SER A C     1 
ATOM   498   O  O     . SER A 1 66  ? 44.987  21.786  1.427   1.00 41.89  ? 66  SER A O     1 
ATOM   499   C  CB    . SER A 1 66  ? 43.432  22.170  -1.503  1.00 37.85  ? 66  SER A CB    1 
ATOM   500   O  OG    . SER A 1 66  ? 44.051  21.098  -2.196  1.00 40.74  ? 66  SER A OG    1 
ATOM   501   N  N     . TRP A 1 67  ? 44.798  20.017  0.080   1.00 42.45  ? 67  TRP A N     1 
ATOM   502   C  CA    . TRP A 1 67  ? 46.023  19.433  0.566   1.00 44.05  ? 67  TRP A CA    1 
ATOM   503   C  C     . TRP A 1 67  ? 47.019  19.490  -0.570  1.00 45.77  ? 67  TRP A C     1 
ATOM   504   O  O     . TRP A 1 67  ? 48.220  19.602  -0.342  1.00 45.80  ? 67  TRP A O     1 
ATOM   505   C  CB    . TRP A 1 67  ? 45.805  18.004  1.044   1.00 44.74  ? 67  TRP A CB    1 
ATOM   506   C  CG    . TRP A 1 67  ? 45.526  17.941  2.514   1.00 46.17  ? 67  TRP A CG    1 
ATOM   507   C  CD1   . TRP A 1 67  ? 45.745  18.930  3.424   1.00 46.56  ? 67  TRP A CD1   1 
ATOM   508   C  CD2   . TRP A 1 67  ? 45.023  16.821  3.255   1.00 47.76  ? 67  TRP A CD2   1 
ATOM   509   N  NE1   . TRP A 1 67  ? 45.412  18.501  4.683   1.00 45.69  ? 67  TRP A NE1   1 
ATOM   510   C  CE2   . TRP A 1 67  ? 44.966  17.212  4.611   1.00 46.71  ? 67  TRP A CE2   1 
ATOM   511   C  CE3   . TRP A 1 67  ? 44.616  15.525  2.907   1.00 49.92  ? 67  TRP A CE3   1 
ATOM   512   C  CZ2   . TRP A 1 67  ? 44.519  16.352  5.622   1.00 46.44  ? 67  TRP A CZ2   1 
ATOM   513   C  CZ3   . TRP A 1 67  ? 44.172  14.665  3.921   1.00 49.14  ? 67  TRP A CZ3   1 
ATOM   514   C  CH2   . TRP A 1 67  ? 44.129  15.090  5.259   1.00 47.54  ? 67  TRP A CH2   1 
ATOM   515   N  N     . SER A 1 68  ? 46.511  19.453  -1.797  1.00 47.56  ? 68  SER A N     1 
ATOM   516   C  CA    . SER A 1 68  ? 47.374  19.519  -2.969  1.00 52.14  ? 68  SER A CA    1 
ATOM   517   C  C     . SER A 1 68  ? 47.696  20.978  -3.311  1.00 54.32  ? 68  SER A C     1 
ATOM   518   O  O     . SER A 1 68  ? 46.834  21.851  -3.195  1.00 54.48  ? 68  SER A O     1 
ATOM   519   C  CB    . SER A 1 68  ? 46.697  18.823  -4.154  1.00 52.76  ? 68  SER A CB    1 
ATOM   520   O  OG    . SER A 1 68  ? 45.335  19.200  -4.236  1.00 54.63  ? 68  SER A OG    1 
ATOM   521   N  N     . PRO A 1 69  ? 48.943  21.255  -3.750  1.00 55.71  ? 69  PRO A N     1 
ATOM   522   C  CA    . PRO A 1 69  ? 49.454  22.583  -4.123  1.00 56.45  ? 69  PRO A CA    1 
ATOM   523   C  C     . PRO A 1 69  ? 48.594  23.376  -5.099  1.00 57.68  ? 69  PRO A C     1 
ATOM   524   O  O     . PRO A 1 69  ? 48.044  22.813  -6.043  1.00 58.28  ? 69  PRO A O     1 
ATOM   525   C  CB    . PRO A 1 69  ? 50.836  22.274  -4.693  1.00 56.34  ? 69  PRO A CB    1 
ATOM   526   C  CG    . PRO A 1 69  ? 50.676  20.910  -5.238  1.00 55.90  ? 69  PRO A CG    1 
ATOM   527   C  CD    . PRO A 1 69  ? 49.903  20.214  -4.150  1.00 56.25  ? 69  PRO A CD    1 
ATOM   528   N  N     . PRO A 1 70  ? 48.485  24.707  -4.887  1.00 58.78  ? 70  PRO A N     1 
ATOM   529   C  CA    . PRO A 1 70  ? 47.705  25.644  -5.704  1.00 59.12  ? 70  PRO A CA    1 
ATOM   530   C  C     . PRO A 1 70  ? 47.745  25.427  -7.203  1.00 59.99  ? 70  PRO A C     1 
ATOM   531   O  O     . PRO A 1 70  ? 46.744  25.623  -7.887  1.00 59.54  ? 70  PRO A O     1 
ATOM   532   C  CB    . PRO A 1 70  ? 48.279  26.995  -5.313  1.00 58.09  ? 70  PRO A CB    1 
ATOM   533   C  CG    . PRO A 1 70  ? 48.516  26.820  -3.874  1.00 58.63  ? 70  PRO A CG    1 
ATOM   534   C  CD    . PRO A 1 70  ? 49.182  25.443  -3.816  1.00 59.33  ? 70  PRO A CD    1 
ATOM   535   N  N     . GLU A 1 71  ? 48.892  25.016  -7.722  1.00 61.85  ? 71  GLU A N     1 
ATOM   536   C  CA    . GLU A 1 71  ? 48.983  24.821  -9.156  1.00 63.68  ? 71  GLU A CA    1 
ATOM   537   C  C     . GLU A 1 71  ? 48.956  23.368  -9.604  1.00 62.03  ? 71  GLU A C     1 
ATOM   538   O  O     . GLU A 1 71  ? 49.817  22.909  -10.347 1.00 62.66  ? 71  GLU A O     1 
ATOM   539   C  CB    . GLU A 1 71  ? 50.221  25.530  -9.704  1.00 66.76  ? 71  GLU A CB    1 
ATOM   540   C  CG    . GLU A 1 71  ? 50.371  26.983  -9.216  1.00 71.66  ? 71  GLU A CG    1 
ATOM   541   C  CD    . GLU A 1 71  ? 49.221  27.914  -9.621  1.00 73.44  ? 71  GLU A CD    1 
ATOM   542   O  OE1   . GLU A 1 71  ? 49.258  29.102  -9.216  1.00 74.58  ? 71  GLU A OE1   1 
ATOM   543   O  OE2   . GLU A 1 71  ? 48.291  27.469  -10.336 1.00 73.74  ? 71  GLU A OE2   1 
ATOM   544   N  N     . VAL A 1 72  ? 47.951  22.658  -9.119  1.00 59.24  ? 72  VAL A N     1 
ATOM   545   C  CA    . VAL A 1 72  ? 47.697  21.276  -9.473  1.00 56.46  ? 72  VAL A CA    1 
ATOM   546   C  C     . VAL A 1 72  ? 46.224  21.466  -9.719  1.00 55.27  ? 72  VAL A C     1 
ATOM   547   O  O     . VAL A 1 72  ? 45.598  20.793  -10.537 1.00 55.40  ? 72  VAL A O     1 
ATOM   548   C  CB    . VAL A 1 72  ? 47.896  20.326  -8.277  1.00 55.45  ? 72  VAL A CB    1 
ATOM   549   C  CG1   . VAL A 1 72  ? 47.256  18.976  -8.559  1.00 56.18  ? 72  VAL A CG1   1 
ATOM   550   C  CG2   . VAL A 1 72  ? 49.361  20.142  -8.018  1.00 55.97  ? 72  VAL A CG2   1 
ATOM   551   N  N     . LEU A 1 73  ? 45.710  22.462  -9.005  1.00 53.69  ? 73  LEU A N     1 
ATOM   552   C  CA    . LEU A 1 73  ? 44.310  22.849  -9.031  1.00 52.31  ? 73  LEU A CA    1 
ATOM   553   C  C     . LEU A 1 73  ? 43.976  23.776  -10.204 1.00 51.96  ? 73  LEU A C     1 
ATOM   554   O  O     . LEU A 1 73  ? 44.838  24.496  -10.719 1.00 50.85  ? 73  LEU A O     1 
ATOM   555   C  CB    . LEU A 1 73  ? 43.963  23.536  -7.703  1.00 49.96  ? 73  LEU A CB    1 
ATOM   556   C  CG    . LEU A 1 73  ? 44.334  22.796  -6.414  1.00 45.87  ? 73  LEU A CG    1 
ATOM   557   C  CD1   . LEU A 1 73  ? 44.284  23.758  -5.260  1.00 44.09  ? 73  LEU A CD1   1 
ATOM   558   C  CD2   . LEU A 1 73  ? 43.399  21.624  -6.192  1.00 44.85  ? 73  LEU A CD2   1 
ATOM   559   N  N     . VAL A 1 74  ? 42.709  23.745  -10.606 1.00 51.90  ? 74  VAL A N     1 
ATOM   560   C  CA    . VAL A 1 74  ? 42.204  24.552  -11.708 1.00 52.07  ? 74  VAL A CA    1 
ATOM   561   C  C     . VAL A 1 74  ? 41.713  25.897  -11.172 1.00 52.82  ? 74  VAL A C     1 
ATOM   562   O  O     . VAL A 1 74  ? 40.517  26.107  -10.994 1.00 51.30  ? 74  VAL A O     1 
ATOM   563   C  CB    . VAL A 1 74  ? 41.043  23.822  -12.403 1.00 51.95  ? 74  VAL A CB    1 
ATOM   564   C  CG1   . VAL A 1 74  ? 40.723  24.475  -13.747 1.00 50.24  ? 74  VAL A CG1   1 
ATOM   565   C  CG2   . VAL A 1 74  ? 41.400  22.354  -12.566 1.00 50.21  ? 74  VAL A CG2   1 
ATOM   566   N  N     . LEU A 1 75  ? 42.660  26.798  -10.929 1.00 54.88  ? 75  LEU A N     1 
ATOM   567   C  CA    . LEU A 1 75  ? 42.407  28.139  -10.393 1.00 56.83  ? 75  LEU A CA    1 
ATOM   568   C  C     . LEU A 1 75  ? 41.313  28.970  -11.052 1.00 58.33  ? 75  LEU A C     1 
ATOM   569   O  O     . LEU A 1 75  ? 40.858  29.959  -10.474 1.00 57.40  ? 75  LEU A O     1 
ATOM   570   C  CB    . LEU A 1 75  ? 43.689  28.961  -10.439 1.00 57.29  ? 75  LEU A CB    1 
ATOM   571   C  CG    . LEU A 1 75  ? 44.947  28.360  -9.825  1.00 58.21  ? 75  LEU A CG    1 
ATOM   572   C  CD1   . LEU A 1 75  ? 46.116  29.267  -10.156 1.00 59.40  ? 75  LEU A CD1   1 
ATOM   573   C  CD2   . LEU A 1 75  ? 44.787  28.208  -8.323  1.00 58.03  ? 75  LEU A CD2   1 
ATOM   574   N  N     . GLU A 1 76  ? 40.913  28.594  -12.262 1.00 60.94  ? 76  GLU A N     1 
ATOM   575   C  CA    . GLU A 1 76  ? 39.882  29.339  -12.975 1.00 62.68  ? 76  GLU A CA    1 
ATOM   576   C  C     . GLU A 1 76  ? 39.047  28.430  -13.870 1.00 62.07  ? 76  GLU A C     1 
ATOM   577   O  O     . GLU A 1 76  ? 39.570  27.526  -14.515 1.00 62.63  ? 76  GLU A O     1 
ATOM   578   C  CB    . GLU A 1 76  ? 40.531  30.467  -13.801 1.00 65.76  ? 76  GLU A CB    1 
ATOM   579   C  CG    . GLU A 1 76  ? 41.424  30.021  -14.962 1.00 70.16  ? 76  GLU A CG    1 
ATOM   580   C  CD    . GLU A 1 76  ? 40.675  29.952  -16.296 1.00 74.21  ? 76  GLU A CD    1 
ATOM   581   O  OE1   . GLU A 1 76  ? 41.309  29.587  -17.319 1.00 75.80  ? 76  GLU A OE1   1 
ATOM   582   O  OE2   . GLU A 1 76  ? 39.457  30.268  -16.324 1.00 74.44  ? 76  GLU A OE2   1 
ATOM   583   N  N     . GLY A 1 77  ? 37.742  28.665  -13.898 1.00 61.63  ? 77  GLY A N     1 
ATOM   584   C  CA    . GLY A 1 77  ? 36.879  27.852  -14.729 1.00 61.45  ? 77  GLY A CA    1 
ATOM   585   C  C     . GLY A 1 77  ? 35.432  28.275  -14.665 1.00 61.21  ? 77  GLY A C     1 
ATOM   586   O  O     . GLY A 1 77  ? 35.106  29.353  -14.190 1.00 60.20  ? 77  GLY A O     1 
ATOM   587   N  N     . THR A 1 78  ? 34.552  27.419  -15.154 1.00 62.75  ? 78  THR A N     1 
ATOM   588   C  CA    . THR A 1 78  ? 33.137  27.725  -15.133 1.00 65.81  ? 78  THR A CA    1 
ATOM   589   C  C     . THR A 1 78  ? 32.315  26.456  -14.982 1.00 67.06  ? 78  THR A C     1 
ATOM   590   O  O     . THR A 1 78  ? 32.712  25.389  -15.442 1.00 68.04  ? 78  THR A O     1 
ATOM   591   C  CB    . THR A 1 78  ? 32.714  28.445  -16.416 1.00 67.04  ? 78  THR A CB    1 
ATOM   592   O  OG1   . THR A 1 78  ? 33.121  27.675  -17.551 1.00 68.30  ? 78  THR A OG1   1 
ATOM   593   C  CG2   . THR A 1 78  ? 33.364  29.818  -16.490 1.00 68.37  ? 78  THR A CG2   1 
ATOM   594   N  N     . LEU A 1 79  ? 31.178  26.583  -14.308 1.00 68.47  ? 79  LEU A N     1 
ATOM   595   C  CA    . LEU A 1 79  ? 30.266  25.468  -14.086 1.00 69.38  ? 79  LEU A CA    1 
ATOM   596   C  C     . LEU A 1 79  ? 28.841  25.998  -14.169 1.00 70.56  ? 79  LEU A C     1 
ATOM   597   O  O     . LEU A 1 79  ? 28.551  27.114  -13.748 1.00 70.06  ? 79  LEU A O     1 
ATOM   598   C  CB    . LEU A 1 79  ? 30.533  24.800  -12.724 1.00 68.36  ? 79  LEU A CB    1 
ATOM   599   C  CG    . LEU A 1 79  ? 30.562  25.550  -11.380 1.00 67.15  ? 79  LEU A CG    1 
ATOM   600   C  CD1   . LEU A 1 79  ? 31.697  26.550  -11.380 1.00 65.59  ? 79  LEU A CD1   1 
ATOM   601   C  CD2   . LEU A 1 79  ? 29.232  26.225  -11.102 1.00 65.88  ? 79  LEU A CD2   1 
ATOM   602   N  N     . ALA A 1 80  ? 27.944  25.204  -14.723 1.00 73.09  ? 80  ALA A N     1 
ATOM   603   C  CA    . ALA A 1 80  ? 26.573  25.658  -14.869 1.00 76.31  ? 80  ALA A CA    1 
ATOM   604   C  C     . ALA A 1 80  ? 25.625  24.969  -13.910 1.00 77.79  ? 80  ALA A C     1 
ATOM   605   O  O     . ALA A 1 80  ? 25.168  23.865  -14.183 1.00 79.60  ? 80  ALA A O     1 
ATOM   606   C  CB    . ALA A 1 80  ? 26.112  25.428  -16.301 1.00 77.23  ? 80  ALA A CB    1 
ATOM   607   N  N     . ARG A 1 81  ? 25.313  25.609  -12.792 1.00 78.73  ? 81  ARG A N     1 
ATOM   608   C  CA    . ARG A 1 81  ? 24.394  24.988  -11.852 1.00 79.97  ? 81  ARG A CA    1 
ATOM   609   C  C     . ARG A 1 81  ? 22.954  25.444  -12.090 1.00 80.98  ? 81  ARG A C     1 
ATOM   610   O  O     . ARG A 1 81  ? 22.689  26.641  -12.233 1.00 80.56  ? 81  ARG A O     1 
ATOM   611   C  CB    . ARG A 1 81  ? 24.774  25.317  -10.403 1.00 80.01  ? 81  ARG A CB    1 
ATOM   612   C  CG    . ARG A 1 81  ? 24.035  26.527  -9.844  1.00 81.43  ? 81  ARG A CG    1 
ATOM   613   C  CD    . ARG A 1 81  ? 24.018  26.568  -8.325  1.00 82.89  ? 81  ARG A CD    1 
ATOM   614   N  NE    . ARG A 1 81  ? 23.298  25.443  -7.726  1.00 84.13  ? 81  ARG A NE    1 
ATOM   615   C  CZ    . ARG A 1 81  ? 22.975  25.364  -6.434  1.00 83.71  ? 81  ARG A CZ    1 
ATOM   616   N  NH1   . ARG A 1 81  ? 23.301  26.346  -5.601  1.00 83.31  ? 81  ARG A NH1   1 
ATOM   617   N  NH2   . ARG A 1 81  ? 22.335  24.299  -5.970  1.00 81.90  ? 81  ARG A NH2   1 
ATOM   618   N  N     . MET A 1 82  ? 22.038  24.480  -12.162 1.00 81.81  ? 82  MET A N     1 
ATOM   619   C  CA    . MET A 1 82  ? 20.613  24.765  -12.308 1.00 82.78  ? 82  MET A CA    1 
ATOM   620   C  C     . MET A 1 82  ? 20.184  25.741  -13.420 1.00 82.26  ? 82  MET A C     1 
ATOM   621   O  O     . MET A 1 82  ? 19.326  26.605  -13.203 1.00 81.25  ? 82  MET A O     1 
ATOM   622   C  CB    . MET A 1 82  ? 20.110  25.279  -10.964 1.00 84.53  ? 82  MET A CB    1 
ATOM   623   C  CG    . MET A 1 82  ? 18.620  25.244  -10.774 1.00 87.01  ? 82  MET A CG    1 
ATOM   624   S  SD    . MET A 1 82  ? 18.263  25.834  -9.120  1.00 91.03  ? 82  MET A SD    1 
ATOM   625   C  CE    . MET A 1 82  ? 18.934  24.512  -8.149  1.00 89.55  ? 82  MET A CE    1 
ATOM   626   N  N     . GLY A 1 83  ? 20.767  25.606  -14.605 1.00 81.28  ? 83  GLY A N     1 
ATOM   627   C  CA    . GLY A 1 83  ? 20.397  26.492  -15.696 1.00 80.03  ? 83  GLY A CA    1 
ATOM   628   C  C     . GLY A 1 83  ? 21.182  27.792  -15.743 1.00 79.58  ? 83  GLY A C     1 
ATOM   629   O  O     . GLY A 1 83  ? 21.239  28.455  -16.788 1.00 80.24  ? 83  GLY A O     1 
ATOM   630   N  N     . GLN A 1 84  ? 21.779  28.171  -14.615 1.00 77.66  ? 84  GLN A N     1 
ATOM   631   C  CA    . GLN A 1 84  ? 22.576  29.390  -14.552 1.00 74.80  ? 84  GLN A CA    1 
ATOM   632   C  C     . GLN A 1 84  ? 24.045  29.023  -14.596 1.00 73.44  ? 84  GLN A C     1 
ATOM   633   O  O     . GLN A 1 84  ? 24.500  28.139  -13.870 1.00 73.51  ? 84  GLN A O     1 
ATOM   634   C  CB    . GLN A 1 84  ? 22.273  30.171  -13.273 1.00 74.11  ? 84  GLN A CB    1 
ATOM   635   C  CG    . GLN A 1 84  ? 20.921  30.865  -13.286 1.00 71.72  ? 84  GLN A CG    1 
ATOM   636   C  CD    . GLN A 1 84  ? 20.607  31.562  -11.979 1.00 69.49  ? 84  GLN A CD    1 
ATOM   637   O  OE1   . GLN A 1 84  ? 19.967  32.611  -11.965 1.00 67.61  ? 84  GLN A OE1   1 
ATOM   638   N  NE2   . GLN A 1 84  ? 21.042  30.972  -10.870 1.00 68.06  ? 84  GLN A NE2   1 
ATOM   639   N  N     . THR A 1 85  ? 24.779  29.689  -15.476 1.00 71.44  ? 85  THR A N     1 
ATOM   640   C  CA    . THR A 1 85  ? 26.198  29.436  -15.614 1.00 69.15  ? 85  THR A CA    1 
ATOM   641   C  C     . THR A 1 85  ? 26.951  30.466  -14.795 1.00 67.98  ? 85  THR A C     1 
ATOM   642   O  O     . THR A 1 85  ? 26.593  31.648  -14.783 1.00 67.49  ? 85  THR A O     1 
ATOM   643   C  CB    . THR A 1 85  ? 26.637  29.568  -17.065 1.00 68.78  ? 85  THR A CB    1 
ATOM   644   O  OG1   . THR A 1 85  ? 26.121  30.796  -17.589 1.00 68.92  ? 85  THR A OG1   1 
ATOM   645   C  CG2   . THR A 1 85  ? 26.134  28.396  -17.896 1.00 67.73  ? 85  THR A CG2   1 
ATOM   646   N  N     . TYR A 1 86  ? 27.987  30.011  -14.102 1.00 66.03  ? 86  TYR A N     1 
ATOM   647   C  CA    . TYR A 1 86  ? 28.800  30.903  -13.296 1.00 64.03  ? 86  TYR A CA    1 
ATOM   648   C  C     . TYR A 1 86  ? 30.263  30.831  -13.733 1.00 62.14  ? 86  TYR A C     1 
ATOM   649   O  O     . TYR A 1 86  ? 30.673  29.913  -14.449 1.00 61.41  ? 86  TYR A O     1 
ATOM   650   C  CB    . TYR A 1 86  ? 28.714  30.534  -11.813 1.00 63.96  ? 86  TYR A CB    1 
ATOM   651   C  CG    . TYR A 1 86  ? 27.348  30.644  -11.174 1.00 63.88  ? 86  TYR A CG    1 
ATOM   652   C  CD1   . TYR A 1 86  ? 26.412  29.626  -11.301 1.00 63.16  ? 86  TYR A CD1   1 
ATOM   653   C  CD2   . TYR A 1 86  ? 27.031  31.730  -10.357 1.00 64.75  ? 86  TYR A CD2   1 
ATOM   654   C  CE1   . TYR A 1 86  ? 25.197  29.681  -10.617 1.00 64.57  ? 86  TYR A CE1   1 
ATOM   655   C  CE2   . TYR A 1 86  ? 25.818  31.794  -9.669  1.00 64.40  ? 86  TYR A CE2   1 
ATOM   656   C  CZ    . TYR A 1 86  ? 24.911  30.767  -9.800  1.00 64.36  ? 86  TYR A CZ    1 
ATOM   657   O  OH    . TYR A 1 86  ? 23.730  30.807  -9.093  1.00 65.50  ? 86  TYR A OH    1 
ATOM   658   N  N     . ALA A 1 87  ? 31.040  31.814  -13.298 1.00 59.75  ? 87  ALA A N     1 
ATOM   659   C  CA    . ALA A 1 87  ? 32.457  31.868  -13.600 1.00 56.81  ? 87  ALA A CA    1 
ATOM   660   C  C     . ALA A 1 87  ? 33.132  31.907  -12.245 1.00 55.95  ? 87  ALA A C     1 
ATOM   661   O  O     . ALA A 1 87  ? 33.002  32.895  -11.524 1.00 56.08  ? 87  ALA A O     1 
ATOM   662   C  CB    . ALA A 1 87  ? 32.775  33.121  -14.370 1.00 56.41  ? 87  ALA A CB    1 
ATOM   663   N  N     . TYR A 1 88  ? 33.825  30.830  -11.878 1.00 54.78  ? 88  TYR A N     1 
ATOM   664   C  CA    . TYR A 1 88  ? 34.512  30.793  -10.590 1.00 52.00  ? 88  TYR A CA    1 
ATOM   665   C  C     . TYR A 1 88  ? 35.954  31.261  -10.724 1.00 50.28  ? 88  TYR A C     1 
ATOM   666   O  O     . TYR A 1 88  ? 36.520  31.310  -11.816 1.00 48.34  ? 88  TYR A O     1 
ATOM   667   C  CB    . TYR A 1 88  ? 34.452  29.387  -9.952  1.00 52.86  ? 88  TYR A CB    1 
ATOM   668   C  CG    . TYR A 1 88  ? 35.430  28.338  -10.462 1.00 53.82  ? 88  TYR A CG    1 
ATOM   669   C  CD1   . TYR A 1 88  ? 35.026  27.342  -11.357 1.00 53.54  ? 88  TYR A CD1   1 
ATOM   670   C  CD2   . TYR A 1 88  ? 36.748  28.306  -10.000 1.00 53.91  ? 88  TYR A CD2   1 
ATOM   671   C  CE1   . TYR A 1 88  ? 35.910  26.345  -11.769 1.00 53.38  ? 88  TYR A CE1   1 
ATOM   672   C  CE2   . TYR A 1 88  ? 37.634  27.316  -10.412 1.00 53.19  ? 88  TYR A CE2   1 
ATOM   673   C  CZ    . TYR A 1 88  ? 37.209  26.344  -11.292 1.00 53.17  ? 88  TYR A CZ    1 
ATOM   674   O  OH    . TYR A 1 88  ? 38.093  25.382  -11.701 1.00 55.47  ? 88  TYR A OH    1 
ATOM   675   N  N     . ARG A 1 89  ? 36.550  31.629  -9.606  1.00 49.25  ? 89  ARG A N     1 
ATOM   676   C  CA    . ARG A 1 89  ? 37.915  32.103  -9.651  1.00 49.02  ? 89  ARG A CA    1 
ATOM   677   C  C     . ARG A 1 89  ? 38.527  31.923  -8.288  1.00 46.88  ? 89  ARG A C     1 
ATOM   678   O  O     . ARG A 1 89  ? 38.034  32.470  -7.318  1.00 45.73  ? 89  ARG A O     1 
ATOM   679   C  CB    . ARG A 1 89  ? 37.931  33.571  -10.056 1.00 50.50  ? 89  ARG A CB    1 
ATOM   680   C  CG    . ARG A 1 89  ? 39.190  33.989  -10.778 1.00 52.01  ? 89  ARG A CG    1 
ATOM   681   C  CD    . ARG A 1 89  ? 38.840  34.778  -12.006 1.00 51.74  ? 89  ARG A CD    1 
ATOM   682   N  NE    . ARG A 1 89  ? 38.138  36.002  -11.644 1.00 53.97  ? 89  ARG A NE    1 
ATOM   683   C  CZ    . ARG A 1 89  ? 36.931  36.339  -12.090 1.00 55.56  ? 89  ARG A CZ    1 
ATOM   684   N  NH1   . ARG A 1 89  ? 36.278  35.538  -12.925 1.00 57.24  ? 89  ARG A NH1   1 
ATOM   685   N  NH2   . ARG A 1 89  ? 36.376  37.481  -11.703 1.00 54.50  ? 89  ARG A NH2   1 
ATOM   686   N  N     . LEU A 1 90  ? 39.606  31.153  -8.223  1.00 45.97  ? 90  LEU A N     1 
ATOM   687   C  CA    . LEU A 1 90  ? 40.256  30.874  -6.958  1.00 45.39  ? 90  LEU A CA    1 
ATOM   688   C  C     . LEU A 1 90  ? 41.501  31.712  -6.746  1.00 45.56  ? 90  LEU A C     1 
ATOM   689   O  O     . LEU A 1 90  ? 42.224  32.013  -7.689  1.00 45.15  ? 90  LEU A O     1 
ATOM   690   C  CB    . LEU A 1 90  ? 40.605  29.388  -6.878  1.00 44.38  ? 90  LEU A CB    1 
ATOM   691   C  CG    . LEU A 1 90  ? 39.438  28.427  -7.129  1.00 44.81  ? 90  LEU A CG    1 
ATOM   692   C  CD1   . LEU A 1 90  ? 39.964  27.017  -7.181  1.00 44.81  ? 90  LEU A CD1   1 
ATOM   693   C  CD2   . LEU A 1 90  ? 38.382  28.558  -6.043  1.00 45.07  ? 90  LEU A CD2   1 
ATOM   694   N  N     . TYR A 1 91  ? 41.729  32.088  -5.492  1.00 45.79  ? 91  TYR A N     1 
ATOM   695   C  CA    . TYR A 1 91  ? 42.873  32.892  -5.109  1.00 47.36  ? 91  TYR A CA    1 
ATOM   696   C  C     . TYR A 1 91  ? 43.544  32.292  -3.889  1.00 50.11  ? 91  TYR A C     1 
ATOM   697   O  O     . TYR A 1 91  ? 43.005  32.349  -2.784  1.00 49.57  ? 91  TYR A O     1 
ATOM   698   C  CB    . TYR A 1 91  ? 42.444  34.333  -4.795  1.00 47.08  ? 91  TYR A CB    1 
ATOM   699   C  CG    . TYR A 1 91  ? 41.894  35.068  -5.994  1.00 47.40  ? 91  TYR A CG    1 
ATOM   700   C  CD1   . TYR A 1 91  ? 40.566  34.901  -6.390  1.00 49.05  ? 91  TYR A CD1   1 
ATOM   701   C  CD2   . TYR A 1 91  ? 42.724  35.853  -6.797  1.00 46.03  ? 91  TYR A CD2   1 
ATOM   702   C  CE1   . TYR A 1 91  ? 40.075  35.489  -7.566  1.00 48.14  ? 91  TYR A CE1   1 
ATOM   703   C  CE2   . TYR A 1 91  ? 42.249  36.440  -7.969  1.00 45.74  ? 91  TYR A CE2   1 
ATOM   704   C  CZ    . TYR A 1 91  ? 40.924  36.249  -8.348  1.00 47.10  ? 91  TYR A CZ    1 
ATOM   705   O  OH    . TYR A 1 91  ? 40.445  36.774  -9.522  1.00 46.11  ? 91  TYR A OH    1 
ATOM   706   N  N     . PRO A 1 92  ? 44.732  31.693  -4.076  1.00 53.64  ? 92  PRO A N     1 
ATOM   707   C  CA    . PRO A 1 92  ? 45.503  31.071  -2.991  1.00 54.90  ? 92  PRO A CA    1 
ATOM   708   C  C     . PRO A 1 92  ? 45.809  32.116  -1.941  1.00 56.64  ? 92  PRO A C     1 
ATOM   709   O  O     . PRO A 1 92  ? 46.580  33.033  -2.206  1.00 57.78  ? 92  PRO A O     1 
ATOM   710   C  CB    . PRO A 1 92  ? 46.779  30.611  -3.683  1.00 53.28  ? 92  PRO A CB    1 
ATOM   711   C  CG    . PRO A 1 92  ? 46.325  30.324  -5.061  1.00 56.46  ? 92  PRO A CG    1 
ATOM   712   C  CD    . PRO A 1 92  ? 45.389  31.475  -5.376  1.00 55.33  ? 92  PRO A CD    1 
ATOM   713   N  N     . LYS A 1 93  ? 45.207  32.003  -0.761  1.00 58.00  ? 93  LYS A N     1 
ATOM   714   C  CA    . LYS A 1 93  ? 45.478  32.984  0.278   1.00 59.83  ? 93  LYS A CA    1 
ATOM   715   C  C     . LYS A 1 93  ? 46.247  32.392  1.461   1.00 61.10  ? 93  LYS A C     1 
ATOM   716   O  O     . LYS A 1 93  ? 45.858  32.560  2.618   1.00 61.72  ? 93  LYS A O     1 
ATOM   717   C  CB    . LYS A 1 93  ? 44.179  33.643  0.758   1.00 59.02  ? 93  LYS A CB    1 
ATOM   718   C  CG    . LYS A 1 93  ? 44.388  35.075  1.238   1.00 60.06  ? 93  LYS A CG    1 
ATOM   719   C  CD    . LYS A 1 93  ? 43.097  35.725  1.706   1.00 60.70  ? 93  LYS A CD    1 
ATOM   720   C  CE    . LYS A 1 93  ? 43.292  37.208  2.031   1.00 60.47  ? 93  LYS A CE    1 
ATOM   721   N  NZ    . LYS A 1 93  ? 44.272  37.458  3.131   1.00 59.42  ? 93  LYS A NZ    1 
ATOM   722   N  N     . GLY A 1 94  ? 47.339  31.694  1.148   1.00 62.26  ? 94  GLY A N     1 
ATOM   723   C  CA    . GLY A 1 94  ? 48.190  31.105  2.168   1.00 63.56  ? 94  GLY A CA    1 
ATOM   724   C  C     . GLY A 1 94  ? 47.711  29.861  2.875   1.00 64.41  ? 94  GLY A C     1 
ATOM   725   O  O     . GLY A 1 94  ? 46.801  29.179  2.419   1.00 65.50  ? 94  GLY A O     1 
ATOM   726   N  N     . ARG A 1 95  ? 48.331  29.564  4.008   1.00 65.25  ? 95  ARG A N     1 
ATOM   727   C  CA    . ARG A 1 95  ? 47.969  28.387  4.767   1.00 66.63  ? 95  ARG A CA    1 
ATOM   728   C  C     . ARG A 1 95  ? 47.275  28.714  6.069   1.00 67.59  ? 95  ARG A C     1 
ATOM   729   O  O     . ARG A 1 95  ? 47.376  29.824  6.587   1.00 67.55  ? 95  ARG A O     1 
ATOM   730   C  CB    . ARG A 1 95  ? 49.206  27.537  5.026   1.00 67.20  ? 95  ARG A CB    1 
ATOM   731   C  CG    . ARG A 1 95  ? 49.654  26.764  3.800   1.00 69.58  ? 95  ARG A CG    1 
ATOM   732   C  CD    . ARG A 1 95  ? 51.000  26.111  4.012   1.00 70.79  ? 95  ARG A CD    1 
ATOM   733   N  NE    . ARG A 1 95  ? 51.281  25.104  2.992   1.00 72.62  ? 95  ARG A NE    1 
ATOM   734   C  CZ    . ARG A 1 95  ? 51.121  23.794  3.168   1.00 73.66  ? 95  ARG A CZ    1 
ATOM   735   N  NH1   . ARG A 1 95  ? 50.682  23.319  4.330   1.00 73.51  ? 95  ARG A NH1   1 
ATOM   736   N  NH2   . ARG A 1 95  ? 51.404  22.953  2.181   1.00 73.75  ? 95  ARG A NH2   1 
ATOM   737   N  N     . ARG A 1 96  ? 46.555  27.729  6.584   1.00 68.58  ? 96  ARG A N     1 
ATOM   738   C  CA    . ARG A 1 96  ? 45.823  27.892  7.819   1.00 69.26  ? 96  ARG A CA    1 
ATOM   739   C  C     . ARG A 1 96  ? 45.722  26.560  8.546   1.00 70.11  ? 96  ARG A C     1 
ATOM   740   O  O     . ARG A 1 96  ? 45.172  25.592  8.022   1.00 70.42  ? 96  ARG A O     1 
ATOM   741   C  CB    . ARG A 1 96  ? 44.438  28.448  7.522   1.00 68.97  ? 96  ARG A CB    1 
ATOM   742   C  CG    . ARG A 1 96  ? 44.113  29.638  8.381   1.00 71.06  ? 96  ARG A CG    1 
ATOM   743   C  CD    . ARG A 1 96  ? 43.397  30.715  7.603   1.00 72.39  ? 96  ARG A CD    1 
ATOM   744   N  NE    . ARG A 1 96  ? 44.226  31.291  6.546   1.00 73.44  ? 96  ARG A NE    1 
ATOM   745   C  CZ    . ARG A 1 96  ? 43.939  32.433  5.923   1.00 74.30  ? 96  ARG A CZ    1 
ATOM   746   N  NH1   . ARG A 1 96  ? 42.852  33.117  6.258   1.00 74.27  ? 96  ARG A NH1   1 
ATOM   747   N  NH2   . ARG A 1 96  ? 44.722  32.887  4.956   1.00 74.66  ? 96  ARG A NH2   1 
ATOM   748   N  N     . PRO A 1 97  ? 46.261  26.501  9.777   1.00 70.42  ? 97  PRO A N     1 
ATOM   749   C  CA    . PRO A 1 97  ? 46.251  25.294  10.605  1.00 69.43  ? 97  PRO A CA    1 
ATOM   750   C  C     . PRO A 1 97  ? 44.858  24.958  11.134  1.00 68.16  ? 97  PRO A C     1 
ATOM   751   O  O     . PRO A 1 97  ? 43.989  25.825  11.219  1.00 67.93  ? 97  PRO A O     1 
ATOM   752   C  CB    . PRO A 1 97  ? 47.222  25.655  11.722  1.00 69.49  ? 97  PRO A CB    1 
ATOM   753   C  CG    . PRO A 1 97  ? 46.911  27.103  11.940  1.00 69.20  ? 97  PRO A CG    1 
ATOM   754   C  CD    . PRO A 1 97  ? 46.853  27.632  10.520  1.00 70.17  ? 97  PRO A CD    1 
ATOM   755   N  N     . LEU A 1 98  ? 44.646  23.689  11.465  1.00 66.36  ? 98  LEU A N     1 
ATOM   756   C  CA    . LEU A 1 98  ? 43.375  23.245  12.014  1.00 64.25  ? 98  LEU A CA    1 
ATOM   757   C  C     . LEU A 1 98  ? 43.696  22.298  13.170  1.00 63.42  ? 98  LEU A C     1 
ATOM   758   O  O     . LEU A 1 98  ? 44.708  21.595  13.136  1.00 63.40  ? 98  LEU A O     1 
ATOM   759   C  CB    . LEU A 1 98  ? 42.539  22.535  10.941  1.00 63.50  ? 98  LEU A CB    1 
ATOM   760   C  CG    . LEU A 1 98  ? 41.868  23.371  9.836   1.00 63.42  ? 98  LEU A CG    1 
ATOM   761   C  CD1   . LEU A 1 98  ? 42.902  24.165  9.062   1.00 63.91  ? 98  LEU A CD1   1 
ATOM   762   C  CD2   . LEU A 1 98  ? 41.115  22.450  8.880   1.00 62.29  ? 98  LEU A CD2   1 
ATOM   763   N  N     . ASP A 1 99  ? 42.850  22.298  14.198  1.00 62.50  ? 99  ASP A N     1 
ATOM   764   C  CA    . ASP A 1 99  ? 43.061  21.437  15.362  1.00 61.67  ? 99  ASP A CA    1 
ATOM   765   C  C     . ASP A 1 99  ? 41.970  20.383  15.509  1.00 60.54  ? 99  ASP A C     1 
ATOM   766   O  O     . ASP A 1 99  ? 40.821  20.698  15.837  1.00 58.09  ? 99  ASP A O     1 
ATOM   767   C  CB    . ASP A 1 99  ? 43.117  22.270  16.649  1.00 62.22  ? 99  ASP A CB    1 
ATOM   768   C  CG    . ASP A 1 99  ? 43.570  21.459  17.857  1.00 61.47  ? 99  ASP A CG    1 
ATOM   769   O  OD1   . ASP A 1 99  ? 43.483  20.211  17.826  1.00 61.94  ? 99  ASP A OD1   1 
ATOM   770   O  OD2   . ASP A 1 99  ? 44.005  22.079  18.846  1.00 60.48  ? 99  ASP A OD2   1 
ATOM   771   N  N     . PRO A 1 100 ? 42.331  19.109  15.290  1.00 60.50  ? 100 PRO A N     1 
ATOM   772   C  CA    . PRO A 1 100 ? 41.376  18.010  15.399  1.00 61.56  ? 100 PRO A CA    1 
ATOM   773   C  C     . PRO A 1 100 ? 40.683  17.927  16.749  1.00 62.95  ? 100 PRO A C     1 
ATOM   774   O  O     . PRO A 1 100 ? 39.757  17.137  16.924  1.00 64.84  ? 100 PRO A O     1 
ATOM   775   C  CB    . PRO A 1 100 ? 42.227  16.774  15.093  1.00 61.22  ? 100 PRO A CB    1 
ATOM   776   C  CG    . PRO A 1 100 ? 43.597  17.180  15.523  1.00 61.79  ? 100 PRO A CG    1 
ATOM   777   C  CD    . PRO A 1 100 ? 43.682  18.596  15.001  1.00 60.99  ? 100 PRO A CD    1 
ATOM   778   N  N     . LYS A 1 101 ? 41.110  18.736  17.710  1.00 63.34  ? 101 LYS A N     1 
ATOM   779   C  CA    . LYS A 1 101 ? 40.466  18.685  19.017  1.00 64.04  ? 101 LYS A CA    1 
ATOM   780   C  C     . LYS A 1 101 ? 39.339  19.698  19.108  1.00 62.97  ? 101 LYS A C     1 
ATOM   781   O  O     . LYS A 1 101 ? 38.788  19.968  20.177  1.00 61.26  ? 101 LYS A O     1 
ATOM   782   C  CB    . LYS A 1 101 ? 41.488  18.901  20.130  1.00 65.61  ? 101 LYS A CB    1 
ATOM   783   C  CG    . LYS A 1 101 ? 42.601  17.872  20.108  1.00 64.57  ? 101 LYS A CG    1 
ATOM   784   C  CD    . LYS A 1 101 ? 43.005  17.456  21.500  1.00 63.17  ? 101 LYS A CD    1 
ATOM   785   C  CE    . LYS A 1 101 ? 44.269  16.637  21.440  1.00 63.35  ? 101 LYS A CE    1 
ATOM   786   N  NZ    . LYS A 1 101 ? 44.277  15.651  22.539  1.00 65.34  ? 101 LYS A NZ    1 
ATOM   787   N  N     . ASP A 1 102 ? 39.019  20.258  17.954  1.00 62.87  ? 102 ASP A N     1 
ATOM   788   C  CA    . ASP A 1 102 ? 37.939  21.208  17.833  1.00 63.04  ? 102 ASP A CA    1 
ATOM   789   C  C     . ASP A 1 102 ? 36.979  20.535  16.868  1.00 62.22  ? 102 ASP A C     1 
ATOM   790   O  O     . ASP A 1 102 ? 37.388  20.068  15.799  1.00 61.54  ? 102 ASP A O     1 
ATOM   791   C  CB    . ASP A 1 102 ? 38.443  22.527  17.248  1.00 64.99  ? 102 ASP A CB    1 
ATOM   792   C  CG    . ASP A 1 102 ? 37.316  23.513  16.974  1.00 66.68  ? 102 ASP A CG    1 
ATOM   793   O  OD1   . ASP A 1 102 ? 36.478  23.732  17.878  1.00 67.61  ? 102 ASP A OD1   1 
ATOM   794   O  OD2   . ASP A 1 102 ? 37.271  24.076  15.857  1.00 67.50  ? 102 ASP A OD2   1 
ATOM   795   N  N     . PRO A 1 103 ? 35.695  20.438  17.245  1.00 60.90  ? 103 PRO A N     1 
ATOM   796   C  CA    . PRO A 1 103 ? 34.704  19.806  16.376  1.00 60.09  ? 103 PRO A CA    1 
ATOM   797   C  C     . PRO A 1 103 ? 34.667  20.467  15.003  1.00 59.68  ? 103 PRO A C     1 
ATOM   798   O  O     . PRO A 1 103 ? 34.639  19.788  13.972  1.00 58.19  ? 103 PRO A O     1 
ATOM   799   C  CB    . PRO A 1 103 ? 33.412  19.991  17.155  1.00 58.54  ? 103 PRO A CB    1 
ATOM   800   C  CG    . PRO A 1 103 ? 33.876  19.849  18.550  1.00 59.61  ? 103 PRO A CG    1 
ATOM   801   C  CD    . PRO A 1 103 ? 35.115  20.716  18.568  1.00 60.00  ? 103 PRO A CD    1 
ATOM   802   N  N     . GLY A 1 104 ? 34.682  21.796  15.008  1.00 59.43  ? 104 GLY A N     1 
ATOM   803   C  CA    . GLY A 1 104 ? 34.643  22.547  13.767  1.00 59.14  ? 104 GLY A CA    1 
ATOM   804   C  C     . GLY A 1 104 ? 35.734  22.174  12.786  1.00 58.91  ? 104 GLY A C     1 
ATOM   805   O  O     . GLY A 1 104 ? 35.466  21.572  11.753  1.00 59.45  ? 104 GLY A O     1 
ATOM   806   N  N     . GLU A 1 105 ? 36.970  22.535  13.104  1.00 59.00  ? 105 GLU A N     1 
ATOM   807   C  CA    . GLU A 1 105 ? 38.101  22.245  12.236  1.00 58.32  ? 105 GLU A CA    1 
ATOM   808   C  C     . GLU A 1 105 ? 38.250  20.752  11.958  1.00 57.74  ? 105 GLU A C     1 
ATOM   809   O  O     . GLU A 1 105 ? 38.643  20.356  10.863  1.00 57.25  ? 105 GLU A O     1 
ATOM   810   C  CB    . GLU A 1 105 ? 39.392  22.782  12.860  1.00 60.06  ? 105 GLU A CB    1 
ATOM   811   C  CG    . GLU A 1 105 ? 39.437  24.297  13.034  1.00 62.63  ? 105 GLU A CG    1 
ATOM   812   C  CD    . GLU A 1 105 ? 40.768  24.777  13.588  1.00 63.89  ? 105 GLU A CD    1 
ATOM   813   O  OE1   . GLU A 1 105 ? 41.187  24.266  14.648  1.00 63.94  ? 105 GLU A OE1   1 
ATOM   814   O  OE2   . GLU A 1 105 ? 41.392  25.664  12.967  1.00 64.24  ? 105 GLU A OE2   1 
ATOM   815   N  N     . ARG A 1 106 ? 37.937  19.923  12.948  1.00 57.40  ? 106 ARG A N     1 
ATOM   816   C  CA    . ARG A 1 106 ? 38.057  18.479  12.787  1.00 56.81  ? 106 ARG A CA    1 
ATOM   817   C  C     . ARG A 1 106 ? 37.287  17.969  11.561  1.00 55.05  ? 106 ARG A C     1 
ATOM   818   O  O     . ARG A 1 106 ? 37.783  17.122  10.824  1.00 54.82  ? 106 ARG A O     1 
ATOM   819   C  CB    . ARG A 1 106 ? 37.561  17.781  14.045  1.00 59.44  ? 106 ARG A CB    1 
ATOM   820   C  CG    . ARG A 1 106 ? 37.933  16.324  14.106  1.00 64.01  ? 106 ARG A CG    1 
ATOM   821   C  CD    . ARG A 1 106 ? 37.152  15.623  15.188  1.00 68.43  ? 106 ARG A CD    1 
ATOM   822   N  NE    . ARG A 1 106 ? 37.342  14.183  15.123  1.00 74.23  ? 106 ARG A NE    1 
ATOM   823   C  CZ    . ARG A 1 106 ? 36.521  13.305  15.685  1.00 78.77  ? 106 ARG A CZ    1 
ATOM   824   N  NH1   . ARG A 1 106 ? 35.453  13.733  16.350  1.00 80.66  ? 106 ARG A NH1   1 
ATOM   825   N  NH2   . ARG A 1 106 ? 36.762  12.000  15.586  1.00 81.69  ? 106 ARG A NH2   1 
ATOM   826   N  N     . SER A 1 107 ? 36.080  18.491  11.350  1.00 52.26  ? 107 SER A N     1 
ATOM   827   C  CA    . SER A 1 107 ? 35.248  18.121  10.208  1.00 50.13  ? 107 SER A CA    1 
ATOM   828   C  C     . SER A 1 107 ? 35.922  18.408  8.869   1.00 48.81  ? 107 SER A C     1 
ATOM   829   O  O     . SER A 1 107 ? 35.855  17.595  7.947   1.00 47.74  ? 107 SER A O     1 
ATOM   830   C  CB    . SER A 1 107 ? 33.925  18.874  10.258  1.00 50.59  ? 107 SER A CB    1 
ATOM   831   O  OG    . SER A 1 107 ? 33.220  18.531  11.434  1.00 55.38  ? 107 SER A OG    1 
ATOM   832   N  N     . VAL A 1 108 ? 36.550  19.574  8.751   1.00 48.19  ? 108 VAL A N     1 
ATOM   833   C  CA    . VAL A 1 108 ? 37.243  19.935  7.517   1.00 45.80  ? 108 VAL A CA    1 
ATOM   834   C  C     . VAL A 1 108 ? 38.347  18.919  7.278   1.00 45.82  ? 108 VAL A C     1 
ATOM   835   O  O     . VAL A 1 108 ? 38.598  18.526  6.136   1.00 47.00  ? 108 VAL A O     1 
ATOM   836   C  CB    . VAL A 1 108 ? 37.871  21.332  7.603   1.00 45.42  ? 108 VAL A CB    1 
ATOM   837   C  CG1   . VAL A 1 108 ? 38.592  21.661  6.316   1.00 44.84  ? 108 VAL A CG1   1 
ATOM   838   C  CG2   . VAL A 1 108 ? 36.794  22.363  7.868   1.00 46.93  ? 108 VAL A CG2   1 
ATOM   839   N  N     . LEU A 1 109 ? 38.997  18.483  8.358   1.00 44.33  ? 109 LEU A N     1 
ATOM   840   C  CA    . LEU A 1 109 ? 40.070  17.497  8.253   1.00 42.12  ? 109 LEU A CA    1 
ATOM   841   C  C     . LEU A 1 109 ? 39.572  16.134  7.798   1.00 39.61  ? 109 LEU A C     1 
ATOM   842   O  O     . LEU A 1 109 ? 40.222  15.475  6.999   1.00 40.03  ? 109 LEU A O     1 
ATOM   843   C  CB    . LEU A 1 109 ? 40.810  17.364  9.582   1.00 43.82  ? 109 LEU A CB    1 
ATOM   844   C  CG    . LEU A 1 109 ? 41.801  18.497  9.884   1.00 45.03  ? 109 LEU A CG    1 
ATOM   845   C  CD1   . LEU A 1 109 ? 42.364  18.300  11.275  1.00 45.16  ? 109 LEU A CD1   1 
ATOM   846   C  CD2   . LEU A 1 109 ? 42.928  18.523  8.848   1.00 42.97  ? 109 LEU A CD2   1 
ATOM   847   N  N     . SER A 1 110 ? 38.417  15.713  8.297   1.00 37.37  ? 110 SER A N     1 
ATOM   848   C  CA    . SER A 1 110 ? 37.849  14.430  7.892   1.00 36.14  ? 110 SER A CA    1 
ATOM   849   C  C     . SER A 1 110 ? 37.269  14.515  6.472   1.00 35.41  ? 110 SER A C     1 
ATOM   850   O  O     . SER A 1 110 ? 37.234  13.524  5.748   1.00 36.02  ? 110 SER A O     1 
ATOM   851   C  CB    . SER A 1 110 ? 36.756  13.983  8.870   1.00 36.74  ? 110 SER A CB    1 
ATOM   852   O  OG    . SER A 1 110 ? 37.256  13.856  10.190  1.00 35.19  ? 110 SER A OG    1 
ATOM   853   N  N     . ALA A 1 111 ? 36.799  15.690  6.070   1.00 34.06  ? 111 ALA A N     1 
ATOM   854   C  CA    . ALA A 1 111 ? 36.272  15.839  4.719   1.00 32.73  ? 111 ALA A CA    1 
ATOM   855   C  C     . ALA A 1 111 ? 37.469  15.709  3.783   1.00 32.44  ? 111 ALA A C     1 
ATOM   856   O  O     . ALA A 1 111 ? 37.413  15.044  2.741   1.00 31.03  ? 111 ALA A O     1 
ATOM   857   C  CB    . ALA A 1 111 ? 35.629  17.194  4.561   1.00 31.30  ? 111 ALA A CB    1 
ATOM   858   N  N     . LEU A 1 112 ? 38.555  16.362  4.176   1.00 31.84  ? 112 LEU A N     1 
ATOM   859   C  CA    . LEU A 1 112 ? 39.773  16.318  3.411   1.00 33.39  ? 112 LEU A CA    1 
ATOM   860   C  C     . LEU A 1 112 ? 40.236  14.879  3.269   1.00 34.85  ? 112 LEU A C     1 
ATOM   861   O  O     . LEU A 1 112 ? 40.613  14.447  2.187   1.00 35.61  ? 112 LEU A O     1 
ATOM   862   C  CB    . LEU A 1 112 ? 40.849  17.152  4.101   1.00 34.30  ? 112 LEU A CB    1 
ATOM   863   C  CG    . LEU A 1 112 ? 40.896  18.628  3.676   1.00 34.93  ? 112 LEU A CG    1 
ATOM   864   C  CD1   . LEU A 1 112 ? 41.904  19.420  4.502   1.00 33.67  ? 112 LEU A CD1   1 
ATOM   865   C  CD2   . LEU A 1 112 ? 41.265  18.696  2.206   1.00 34.24  ? 112 LEU A CD2   1 
ATOM   866   N  N     . ALA A 1 113 ? 40.197  14.129  4.361   1.00 35.75  ? 113 ALA A N     1 
ATOM   867   C  CA    . ALA A 1 113 ? 40.633  12.738  4.330   1.00 37.83  ? 113 ALA A CA    1 
ATOM   868   C  C     . ALA A 1 113 ? 39.882  11.889  3.307   1.00 39.98  ? 113 ALA A C     1 
ATOM   869   O  O     . ALA A 1 113 ? 40.491  11.148  2.519   1.00 38.50  ? 113 ALA A O     1 
ATOM   870   C  CB    . ALA A 1 113 ? 40.485  12.128  5.702   1.00 35.63  ? 113 ALA A CB    1 
ATOM   871   N  N     . ARG A 1 114 ? 38.557  12.001  3.333   1.00 43.18  ? 114 ARG A N     1 
ATOM   872   C  CA    . ARG A 1 114 ? 37.697  11.239  2.436   1.00 45.43  ? 114 ARG A CA    1 
ATOM   873   C  C     . ARG A 1 114 ? 38.005  11.559  0.986   1.00 46.08  ? 114 ARG A C     1 
ATOM   874   O  O     . ARG A 1 114 ? 38.050  10.666  0.142   1.00 46.75  ? 114 ARG A O     1 
ATOM   875   C  CB    . ARG A 1 114 ? 36.217  11.509  2.761   1.00 46.69  ? 114 ARG A CB    1 
ATOM   876   C  CG    . ARG A 1 114 ? 35.453  10.250  3.192   1.00 48.01  ? 114 ARG A CG    1 
ATOM   877   C  CD    . ARG A 1 114 ? 34.167  10.539  3.961   1.00 48.67  ? 114 ARG A CD    1 
ATOM   878   N  NE    . ARG A 1 114 ? 34.427  10.923  5.347   1.00 49.91  ? 114 ARG A NE    1 
ATOM   879   C  CZ    . ARG A 1 114 ? 34.445  12.177  5.786   1.00 49.99  ? 114 ARG A CZ    1 
ATOM   880   N  NH1   . ARG A 1 114 ? 34.694  12.426  7.063   1.00 48.72  ? 114 ARG A NH1   1 
ATOM   881   N  NH2   . ARG A 1 114 ? 34.198  13.182  4.951   1.00 50.50  ? 114 ARG A NH2   1 
ATOM   882   N  N     . ARG A 1 115 ? 38.238  12.832  0.695   1.00 47.28  ? 115 ARG A N     1 
ATOM   883   C  CA    . ARG A 1 115 ? 38.557  13.222  -0.670  1.00 47.63  ? 115 ARG A CA    1 
ATOM   884   C  C     . ARG A 1 115 ? 39.903  12.636  -1.078  1.00 45.75  ? 115 ARG A C     1 
ATOM   885   O  O     . ARG A 1 115 ? 40.081  12.268  -2.226  1.00 45.89  ? 115 ARG A O     1 
ATOM   886   C  CB    . ARG A 1 115 ? 38.598  14.740  -0.798  1.00 50.28  ? 115 ARG A CB    1 
ATOM   887   C  CG    . ARG A 1 115 ? 38.506  15.239  -2.227  1.00 54.80  ? 115 ARG A CG    1 
ATOM   888   C  CD    . ARG A 1 115 ? 37.081  15.150  -2.772  1.00 59.35  ? 115 ARG A CD    1 
ATOM   889   N  NE    . ARG A 1 115 ? 36.961  15.856  -4.048  1.00 65.57  ? 115 ARG A NE    1 
ATOM   890   C  CZ    . ARG A 1 115 ? 37.456  15.416  -5.205  1.00 68.44  ? 115 ARG A CZ    1 
ATOM   891   N  NH1   . ARG A 1 115 ? 38.103  14.257  -5.255  1.00 70.19  ? 115 ARG A NH1   1 
ATOM   892   N  NH2   . ARG A 1 115 ? 37.330  16.146  -6.310  1.00 69.45  ? 115 ARG A NH2   1 
ATOM   893   N  N     . LEU A 1 116 ? 40.844  12.549  -0.137  1.00 44.89  ? 116 LEU A N     1 
ATOM   894   C  CA    . LEU A 1 116 ? 42.170  11.989  -0.411  1.00 43.60  ? 116 LEU A CA    1 
ATOM   895   C  C     . LEU A 1 116 ? 42.066  10.503  -0.684  1.00 43.69  ? 116 LEU A C     1 
ATOM   896   O  O     . LEU A 1 116 ? 42.683  9.997   -1.617  1.00 43.07  ? 116 LEU A O     1 
ATOM   897   C  CB    . LEU A 1 116 ? 43.105  12.209  0.773   1.00 44.19  ? 116 LEU A CB    1 
ATOM   898   C  CG    . LEU A 1 116 ? 44.434  11.453  0.704   1.00 44.14  ? 116 LEU A CG    1 
ATOM   899   C  CD1   . LEU A 1 116 ? 45.519  12.262  1.365   1.00 45.62  ? 116 LEU A CD1   1 
ATOM   900   C  CD2   . LEU A 1 116 ? 44.303  10.112  1.382   1.00 44.20  ? 116 LEU A CD2   1 
ATOM   901   N  N     . LEU A 1 117 ? 41.285  9.815   0.148   1.00 43.85  ? 117 LEU A N     1 
ATOM   902   C  CA    . LEU A 1 117 ? 41.056  8.379   0.019   1.00 42.84  ? 117 LEU A CA    1 
ATOM   903   C  C     . LEU A 1 117 ? 40.540  7.999   -1.354  1.00 43.83  ? 117 LEU A C     1 
ATOM   904   O  O     . LEU A 1 117 ? 40.793  6.896   -1.825  1.00 45.50  ? 117 LEU A O     1 
ATOM   905   C  CB    . LEU A 1 117 ? 40.026  7.889   1.047   1.00 41.00  ? 117 LEU A CB    1 
ATOM   906   C  CG    . LEU A 1 117 ? 39.566  6.428   0.882   1.00 37.61  ? 117 LEU A CG    1 
ATOM   907   C  CD1   . LEU A 1 117 ? 40.769  5.518   1.059   1.00 37.72  ? 117 LEU A CD1   1 
ATOM   908   C  CD2   . LEU A 1 117 ? 38.486  6.072   1.886   1.00 34.05  ? 117 LEU A CD2   1 
ATOM   909   N  N     . GLN A 1 118 ? 39.803  8.891   -1.999  1.00 42.88  ? 118 GLN A N     1 
ATOM   910   C  CA    . GLN A 1 118 ? 39.272  8.543   -3.291  1.00 44.59  ? 118 GLN A CA    1 
ATOM   911   C  C     . GLN A 1 118 ? 40.053  9.135   -4.439  1.00 47.18  ? 118 GLN A C     1 
ATOM   912   O  O     . GLN A 1 118 ? 39.868  8.748   -5.591  1.00 48.41  ? 118 GLN A O     1 
ATOM   913   C  CB    . GLN A 1 118 ? 37.811  8.949   -3.371  1.00 44.35  ? 118 GLN A CB    1 
ATOM   914   C  CG    . GLN A 1 118 ? 37.551  10.422  -3.201  1.00 45.77  ? 118 GLN A CG    1 
ATOM   915   C  CD    . GLN A 1 118 ? 36.069  10.718  -3.040  1.00 46.57  ? 118 GLN A CD    1 
ATOM   916   O  OE1   . GLN A 1 118 ? 35.220  10.037  -3.632  1.00 46.07  ? 118 GLN A OE1   1 
ATOM   917   N  NE2   . GLN A 1 118 ? 35.747  11.742  -2.246  1.00 45.70  ? 118 GLN A NE2   1 
ATOM   918   N  N     . GLU A 1 119 ? 40.929  10.082  -4.143  1.00 49.75  ? 119 GLU A N     1 
ATOM   919   C  CA    . GLU A 1 119 ? 41.732  10.682  -5.198  1.00 51.71  ? 119 GLU A CA    1 
ATOM   920   C  C     . GLU A 1 119 ? 42.944  9.794   -5.391  1.00 51.88  ? 119 GLU A C     1 
ATOM   921   O  O     . GLU A 1 119 ? 43.365  9.531   -6.525  1.00 52.90  ? 119 GLU A O     1 
ATOM   922   C  CB    . GLU A 1 119 ? 42.145  12.107  -4.823  1.00 54.80  ? 119 GLU A CB    1 
ATOM   923   C  CG    . GLU A 1 119 ? 41.149  13.172  -5.302  1.00 61.04  ? 119 GLU A CG    1 
ATOM   924   C  CD    . GLU A 1 119 ? 41.520  13.781  -6.662  1.00 64.33  ? 119 GLU A CD    1 
ATOM   925   O  OE1   . GLU A 1 119 ? 40.600  14.125  -7.447  1.00 64.80  ? 119 GLU A OE1   1 
ATOM   926   O  OE2   . GLU A 1 119 ? 42.737  13.933  -6.936  1.00 65.97  ? 119 GLU A OE2   1 
ATOM   927   N  N     . ARG A 1 120 ? 43.499  9.320   -4.280  1.00 50.31  ? 120 ARG A N     1 
ATOM   928   C  CA    . ARG A 1 120 ? 44.643  8.424   -4.344  1.00 49.59  ? 120 ARG A CA    1 
ATOM   929   C  C     . ARG A 1 120 ? 44.120  7.122   -4.938  1.00 48.52  ? 120 ARG A C     1 
ATOM   930   O  O     . ARG A 1 120 ? 44.714  6.518   -5.834  1.00 48.88  ? 120 ARG A O     1 
ATOM   931   C  CB    . ARG A 1 120 ? 45.184  8.146   -2.943  1.00 49.49  ? 120 ARG A CB    1 
ATOM   932   C  CG    . ARG A 1 120 ? 45.651  9.369   -2.170  1.00 51.68  ? 120 ARG A CG    1 
ATOM   933   C  CD    . ARG A 1 120 ? 46.940  9.936   -2.728  1.00 51.53  ? 120 ARG A CD    1 
ATOM   934   N  NE    . ARG A 1 120 ? 47.485  11.007  -1.896  1.00 52.07  ? 120 ARG A NE    1 
ATOM   935   C  CZ    . ARG A 1 120 ? 47.866  10.864  -0.627  1.00 52.91  ? 120 ARG A CZ    1 
ATOM   936   N  NH1   . ARG A 1 120 ? 47.761  9.690   -0.010  1.00 50.52  ? 120 ARG A NH1   1 
ATOM   937   N  NH2   . ARG A 1 120 ? 48.379  11.900  0.020   1.00 54.17  ? 120 ARG A NH2   1 
ATOM   938   N  N     . LEU A 1 121 ? 42.974  6.716   -4.425  1.00 47.14  ? 121 LEU A N     1 
ATOM   939   C  CA    . LEU A 1 121 ? 42.333  5.495   -4.842  1.00 46.90  ? 121 LEU A CA    1 
ATOM   940   C  C     . LEU A 1 121 ? 42.045  5.485   -6.329  1.00 46.74  ? 121 LEU A C     1 
ATOM   941   O  O     . LEU A 1 121 ? 42.339  4.515   -7.022  1.00 46.06  ? 121 LEU A O     1 
ATOM   942   C  CB    . LEU A 1 121 ? 41.026  5.330   -4.066  1.00 47.17  ? 121 LEU A CB    1 
ATOM   943   C  CG    . LEU A 1 121 ? 40.695  3.958   -3.487  1.00 47.77  ? 121 LEU A CG    1 
ATOM   944   C  CD1   . LEU A 1 121 ? 39.431  4.049   -2.649  1.00 47.48  ? 121 LEU A CD1   1 
ATOM   945   C  CD2   . LEU A 1 121 ? 40.521  2.960   -4.614  1.00 48.32  ? 121 LEU A CD2   1 
ATOM   946   N  N     . ARG A 1 122 ? 41.479  6.579   -6.817  1.00 47.67  ? 122 ARG A N     1 
ATOM   947   C  CA    . ARG A 1 122 ? 41.094  6.659   -8.211  1.00 48.26  ? 122 ARG A CA    1 
ATOM   948   C  C     . ARG A 1 122 ? 42.249  6.479   -9.173  1.00 48.21  ? 122 ARG A C     1 
ATOM   949   O  O     . ARG A 1 122 ? 42.065  6.066   -10.318 1.00 48.83  ? 122 ARG A O     1 
ATOM   950   C  CB    . ARG A 1 122 ? 40.361  7.965   -8.474  1.00 48.55  ? 122 ARG A CB    1 
ATOM   951   C  CG    . ARG A 1 122 ? 39.592  7.945   -9.769  1.00 51.44  ? 122 ARG A CG    1 
ATOM   952   C  CD    . ARG A 1 122 ? 38.650  9.119   -9.851  1.00 54.74  ? 122 ARG A CD    1 
ATOM   953   N  NE    . ARG A 1 122 ? 37.499  8.957   -8.970  1.00 55.70  ? 122 ARG A NE    1 
ATOM   954   C  CZ    . ARG A 1 122 ? 36.535  8.064   -9.169  1.00 56.49  ? 122 ARG A CZ    1 
ATOM   955   N  NH1   . ARG A 1 122 ? 36.591  7.248   -10.224 1.00 55.79  ? 122 ARG A NH1   1 
ATOM   956   N  NH2   . ARG A 1 122 ? 35.510  7.997   -8.322  1.00 54.91  ? 122 ARG A NH2   1 
ATOM   957   N  N     . ARG A 1 123 ? 43.448  6.776   -8.715  1.00 48.70  ? 123 ARG A N     1 
ATOM   958   C  CA    . ARG A 1 123 ? 44.595  6.591   -9.577  1.00 50.15  ? 123 ARG A CA    1 
ATOM   959   C  C     . ARG A 1 123 ? 45.197  5.214   -9.263  1.00 50.98  ? 123 ARG A C     1 
ATOM   960   O  O     . ARG A 1 123 ? 46.308  5.102   -8.753  1.00 52.14  ? 123 ARG A O     1 
ATOM   961   C  CB    . ARG A 1 123 ? 45.603  7.701   -9.336  1.00 51.13  ? 123 ARG A CB    1 
ATOM   962   N  N     . LEU A 1 124 ? 44.430  4.165   -9.535  1.00 50.68  ? 124 LEU A N     1 
ATOM   963   C  CA    . LEU A 1 124 ? 44.876  2.794   -9.304  1.00 50.18  ? 124 LEU A CA    1 
ATOM   964   C  C     . LEU A 1 124 ? 44.378  1.967   -10.472 1.00 51.25  ? 124 LEU A C     1 
ATOM   965   O  O     . LEU A 1 124 ? 43.194  2.003   -10.808 1.00 53.28  ? 124 LEU A O     1 
ATOM   966   C  CB    . LEU A 1 124 ? 44.299  2.222   -8.003  1.00 49.04  ? 124 LEU A CB    1 
ATOM   967   C  CG    . LEU A 1 124 ? 44.869  2.556   -6.615  1.00 48.85  ? 124 LEU A CG    1 
ATOM   968   C  CD1   . LEU A 1 124 ? 44.177  1.658   -5.595  1.00 46.58  ? 124 LEU A CD1   1 
ATOM   969   C  CD2   . LEU A 1 124 ? 46.374  2.330   -6.550  1.00 47.40  ? 124 LEU A CD2   1 
ATOM   970   N  N     . GLU A 1 125 ? 45.271  1.218   -11.097 1.00 51.27  ? 125 GLU A N     1 
ATOM   971   C  CA    . GLU A 1 125 ? 44.873  0.418   -12.240 1.00 51.30  ? 125 GLU A CA    1 
ATOM   972   C  C     . GLU A 1 125 ? 44.211  -0.888  -11.846 1.00 49.04  ? 125 GLU A C     1 
ATOM   973   O  O     . GLU A 1 125 ? 44.549  -1.479  -10.827 1.00 48.56  ? 125 GLU A O     1 
ATOM   974   C  CB    . GLU A 1 125 ? 46.085  0.126   -13.113 1.00 55.17  ? 125 GLU A CB    1 
ATOM   975   C  CG    . GLU A 1 125 ? 46.853  1.364   -13.539 1.00 59.79  ? 125 GLU A CG    1 
ATOM   976   C  CD    . GLU A 1 125 ? 47.964  1.049   -14.525 1.00 62.90  ? 125 GLU A CD    1 
ATOM   977   O  OE1   . GLU A 1 125 ? 48.503  -0.084  -14.480 1.00 64.87  ? 125 GLU A OE1   1 
ATOM   978   O  OE2   . GLU A 1 125 ? 48.308  1.942   -15.334 1.00 64.72  ? 125 GLU A OE2   1 
ATOM   979   N  N     . GLY A 1 126 ? 43.263  -1.326  -12.664 1.00 46.94  ? 126 GLY A N     1 
ATOM   980   C  CA    . GLY A 1 126 ? 42.568  -2.576  -12.409 1.00 46.02  ? 126 GLY A CA    1 
ATOM   981   C  C     . GLY A 1 126 ? 41.561  -2.532  -11.280 1.00 45.35  ? 126 GLY A C     1 
ATOM   982   O  O     . GLY A 1 126 ? 41.533  -3.422  -10.431 1.00 45.05  ? 126 GLY A O     1 
ATOM   983   N  N     . VAL A 1 127 ? 40.714  -1.511  -11.275 1.00 44.72  ? 127 VAL A N     1 
ATOM   984   C  CA    . VAL A 1 127 ? 39.735  -1.374  -10.212 1.00 44.83  ? 127 VAL A CA    1 
ATOM   985   C  C     . VAL A 1 127 ? 38.694  -0.294  -10.478 1.00 44.85  ? 127 VAL A C     1 
ATOM   986   O  O     . VAL A 1 127 ? 39.036  0.804   -10.901 1.00 46.41  ? 127 VAL A O     1 
ATOM   987   C  CB    . VAL A 1 127 ? 40.444  -1.044  -8.874  1.00 44.24  ? 127 VAL A CB    1 
ATOM   988   C  CG1   . VAL A 1 127 ? 41.488  0.016   -9.099  1.00 44.24  ? 127 VAL A CG1   1 
ATOM   989   C  CG2   . VAL A 1 127 ? 39.445  -0.542  -7.862  1.00 43.86  ? 127 VAL A CG2   1 
ATOM   990   N  N     . TRP A 1 128 ? 37.427  -0.612  -10.221 1.00 43.80  ? 128 TRP A N     1 
ATOM   991   C  CA    . TRP A 1 128 ? 36.339  0.346   -10.396 1.00 42.35  ? 128 TRP A CA    1 
ATOM   992   C  C     . TRP A 1 128 ? 36.006  0.965   -9.045  1.00 42.02  ? 128 TRP A C     1 
ATOM   993   O  O     . TRP A 1 128 ? 35.702  0.268   -8.082  1.00 41.51  ? 128 TRP A O     1 
ATOM   994   C  CB    . TRP A 1 128 ? 35.094  -0.339  -10.960 1.00 42.77  ? 128 TRP A CB    1 
ATOM   995   C  CG    . TRP A 1 128 ? 33.911  0.583   -11.114 1.00 41.24  ? 128 TRP A CG    1 
ATOM   996   C  CD1   . TRP A 1 128 ? 33.873  1.745   -11.816 1.00 41.15  ? 128 TRP A CD1   1 
ATOM   997   C  CD2   . TRP A 1 128 ? 32.592  0.394   -10.577 1.00 40.37  ? 128 TRP A CD2   1 
ATOM   998   N  NE1   . TRP A 1 128 ? 32.616  2.294   -11.756 1.00 42.14  ? 128 TRP A NE1   1 
ATOM   999   C  CE2   . TRP A 1 128 ? 31.808  1.483   -11.005 1.00 40.09  ? 128 TRP A CE2   1 
ATOM   1000  C  CE3   . TRP A 1 128 ? 31.997  -0.593  -9.782  1.00 40.01  ? 128 TRP A CE3   1 
ATOM   1001  C  CZ2   . TRP A 1 128 ? 30.458  1.620   -10.665 1.00 38.69  ? 128 TRP A CZ2   1 
ATOM   1002  C  CZ3   . TRP A 1 128 ? 30.651  -0.454  -9.443  1.00 39.70  ? 128 TRP A CZ3   1 
ATOM   1003  C  CH2   . TRP A 1 128 ? 29.899  0.644   -9.889  1.00 37.55  ? 128 TRP A CH2   1 
ATOM   1004  N  N     . VAL A 1 129 ? 36.051  2.284   -8.986  1.00 42.71  ? 129 VAL A N     1 
ATOM   1005  C  CA    . VAL A 1 129 ? 35.780  2.997   -7.750  1.00 44.07  ? 129 VAL A CA    1 
ATOM   1006  C  C     . VAL A 1 129 ? 34.487  3.801   -7.773  1.00 45.07  ? 129 VAL A C     1 
ATOM   1007  O  O     . VAL A 1 129 ? 34.436  4.890   -8.337  1.00 46.79  ? 129 VAL A O     1 
ATOM   1008  C  CB    . VAL A 1 129 ? 36.937  3.958   -7.421  1.00 42.67  ? 129 VAL A CB    1 
ATOM   1009  C  CG1   . VAL A 1 129 ? 38.098  3.204   -6.849  1.00 43.19  ? 129 VAL A CG1   1 
ATOM   1010  C  CG2   . VAL A 1 129 ? 37.383  4.651   -8.684  1.00 44.65  ? 129 VAL A CG2   1 
ATOM   1011  N  N     . GLU A 1 130 ? 33.442  3.267   -7.155  1.00 45.34  ? 130 GLU A N     1 
ATOM   1012  C  CA    . GLU A 1 130 ? 32.161  3.965   -7.086  1.00 45.16  ? 130 GLU A CA    1 
ATOM   1013  C  C     . GLU A 1 130 ? 32.038  4.592   -5.697  1.00 44.23  ? 130 GLU A C     1 
ATOM   1014  O  O     . GLU A 1 130 ? 31.759  3.911   -4.712  1.00 44.30  ? 130 GLU A O     1 
ATOM   1015  C  CB    . GLU A 1 130 ? 31.008  2.989   -7.338  1.00 45.73  ? 130 GLU A CB    1 
ATOM   1016  C  CG    . GLU A 1 130 ? 29.636  3.586   -7.176  1.00 49.41  ? 130 GLU A CG    1 
ATOM   1017  C  CD    . GLU A 1 130 ? 28.535  2.554   -7.336  1.00 53.53  ? 130 GLU A CD    1 
ATOM   1018  O  OE1   . GLU A 1 130 ? 28.610  1.493   -6.676  1.00 54.27  ? 130 GLU A OE1   1 
ATOM   1019  O  OE2   . GLU A 1 130 ? 27.586  2.806   -8.115  1.00 57.63  ? 130 GLU A OE2   1 
ATOM   1020  N  N     . GLY A 1 131 ? 32.268  5.897   -5.626  1.00 43.86  ? 131 GLY A N     1 
ATOM   1021  C  CA    . GLY A 1 131 ? 32.193  6.598   -4.357  1.00 42.96  ? 131 GLY A CA    1 
ATOM   1022  C  C     . GLY A 1 131 ? 33.360  6.247   -3.456  1.00 42.26  ? 131 GLY A C     1 
ATOM   1023  O  O     . GLY A 1 131 ? 34.516  6.279   -3.870  1.00 42.73  ? 131 GLY A O     1 
ATOM   1024  N  N     . LEU A 1 132 ? 33.056  5.921   -2.210  1.00 40.31  ? 132 LEU A N     1 
ATOM   1025  C  CA    . LEU A 1 132 ? 34.082  5.541   -1.264  1.00 38.87  ? 132 LEU A CA    1 
ATOM   1026  C  C     . LEU A 1 132 ? 34.094  4.020   -1.210  1.00 38.91  ? 132 LEU A C     1 
ATOM   1027  O  O     . LEU A 1 132 ? 34.163  3.413   -0.141  1.00 39.62  ? 132 LEU A O     1 
ATOM   1028  C  CB    . LEU A 1 132 ? 33.758  6.125   0.104   1.00 39.40  ? 132 LEU A CB    1 
ATOM   1029  C  CG    . LEU A 1 132 ? 33.898  7.641   0.156   1.00 38.42  ? 132 LEU A CG    1 
ATOM   1030  C  CD1   . LEU A 1 132 ? 33.182  8.187   1.366   1.00 38.66  ? 132 LEU A CD1   1 
ATOM   1031  C  CD2   . LEU A 1 132 ? 35.362  7.993   0.179   1.00 36.35  ? 132 LEU A CD2   1 
ATOM   1032  N  N     . ALA A 1 133 ? 34.007  3.405   -2.383  1.00 37.24  ? 133 ALA A N     1 
ATOM   1033  C  CA    . ALA A 1 133 ? 34.010  1.958   -2.474  1.00 35.10  ? 133 ALA A CA    1 
ATOM   1034  C  C     . ALA A 1 133 ? 34.941  1.519   -3.594  1.00 34.43  ? 133 ALA A C     1 
ATOM   1035  O  O     . ALA A 1 133 ? 35.170  2.236   -4.560  1.00 33.37  ? 133 ALA A O     1 
ATOM   1036  C  CB    . ALA A 1 133 ? 32.609  1.452   -2.718  1.00 35.50  ? 133 ALA A CB    1 
ATOM   1037  N  N     . VAL A 1 134 ? 35.479  0.326   -3.452  1.00 34.18  ? 134 VAL A N     1 
ATOM   1038  C  CA    . VAL A 1 134 ? 36.398  -0.187  -4.431  1.00 34.57  ? 134 VAL A CA    1 
ATOM   1039  C  C     . VAL A 1 134 ? 35.916  -1.574  -4.845  1.00 35.01  ? 134 VAL A C     1 
ATOM   1040  O  O     . VAL A 1 134 ? 35.421  -2.351  -4.025  1.00 33.00  ? 134 VAL A O     1 
ATOM   1041  C  CB    . VAL A 1 134 ? 37.852  -0.246  -3.822  1.00 35.68  ? 134 VAL A CB    1 
ATOM   1042  C  CG1   . VAL A 1 134 ? 37.966  -1.371  -2.788  1.00 35.73  ? 134 VAL A CG1   1 
ATOM   1043  C  CG2   . VAL A 1 134 ? 38.869  -0.429  -4.902  1.00 33.87  ? 134 VAL A CG2   1 
ATOM   1044  N  N     . TYR A 1 135 ? 36.030  -1.860  -6.134  1.00 36.25  ? 135 TYR A N     1 
ATOM   1045  C  CA    . TYR A 1 135 ? 35.649  -3.156  -6.663  1.00 37.57  ? 135 TYR A CA    1 
ATOM   1046  C  C     . TYR A 1 135 ? 36.767  -3.630  -7.580  1.00 39.18  ? 135 TYR A C     1 
ATOM   1047  O  O     . TYR A 1 135 ? 37.186  -2.917  -8.488  1.00 38.01  ? 135 TYR A O     1 
ATOM   1048  C  CB    . TYR A 1 135 ? 34.315  -3.054  -7.391  1.00 36.91  ? 135 TYR A CB    1 
ATOM   1049  C  CG    . TYR A 1 135 ? 33.188  -2.717  -6.449  1.00 36.93  ? 135 TYR A CG    1 
ATOM   1050  C  CD1   . TYR A 1 135 ? 32.844  -1.395  -6.186  1.00 35.92  ? 135 TYR A CD1   1 
ATOM   1051  C  CD2   . TYR A 1 135 ? 32.520  -3.722  -5.750  1.00 35.77  ? 135 TYR A CD2   1 
ATOM   1052  C  CE1   . TYR A 1 135 ? 31.867  -1.085  -5.244  1.00 34.19  ? 135 TYR A CE1   1 
ATOM   1053  C  CE2   . TYR A 1 135 ? 31.548  -3.421  -4.812  1.00 34.04  ? 135 TYR A CE2   1 
ATOM   1054  C  CZ    . TYR A 1 135 ? 31.225  -2.104  -4.562  1.00 34.19  ? 135 TYR A CZ    1 
ATOM   1055  O  OH    . TYR A 1 135 ? 30.244  -1.810  -3.642  1.00 33.90  ? 135 TYR A OH    1 
ATOM   1056  N  N     . ARG A 1 136 ? 37.254  -4.840  -7.332  1.00 42.08  ? 136 ARG A N     1 
ATOM   1057  C  CA    . ARG A 1 136 ? 38.367  -5.374  -8.106  1.00 45.36  ? 136 ARG A CA    1 
ATOM   1058  C  C     . ARG A 1 136 ? 38.150  -6.716  -8.801  1.00 46.18  ? 136 ARG A C     1 
ATOM   1059  O  O     . ARG A 1 136 ? 39.004  -7.158  -9.574  1.00 47.44  ? 136 ARG A O     1 
ATOM   1060  C  CB    . ARG A 1 136 ? 39.592  -5.488  -7.194  1.00 46.05  ? 136 ARG A CB    1 
ATOM   1061  C  CG    . ARG A 1 136 ? 39.992  -4.188  -6.528  1.00 46.95  ? 136 ARG A CG    1 
ATOM   1062  C  CD    . ARG A 1 136 ? 40.609  -4.452  -5.170  1.00 46.98  ? 136 ARG A CD    1 
ATOM   1063  N  NE    . ARG A 1 136 ? 39.666  -5.128  -4.284  0.00 47.03  ? 136 ARG A NE    1 
ATOM   1064  C  CZ    . ARG A 1 136 ? 39.921  -5.454  -3.021  0.00 47.06  ? 136 ARG A CZ    1 
ATOM   1065  N  NH1   . ARG A 1 136 ? 41.098  -5.166  -2.482  0.00 47.07  ? 136 ARG A NH1   1 
ATOM   1066  N  NH2   . ARG A 1 136 ? 38.996  -6.065  -2.294  0.00 47.07  ? 136 ARG A NH2   1 
ATOM   1067  N  N     . ARG A 1 137 ? 37.034  -7.378  -8.542  1.00 46.06  ? 137 ARG A N     1 
ATOM   1068  C  CA    . ARG A 1 137 ? 36.838  -8.661  -9.175  1.00 46.70  ? 137 ARG A CA    1 
ATOM   1069  C  C     . ARG A 1 137 ? 35.398  -8.929  -9.509  1.00 45.97  ? 137 ARG A C     1 
ATOM   1070  O  O     . ARG A 1 137 ? 34.490  -8.362  -8.905  1.00 45.62  ? 137 ARG A O     1 
ATOM   1071  C  CB    . ARG A 1 137 ? 37.380  -9.771  -8.274  1.00 50.44  ? 137 ARG A CB    1 
ATOM   1072  C  CG    . ARG A 1 137 ? 36.625  -9.969  -6.955  1.00 55.75  ? 137 ARG A CG    1 
ATOM   1073  C  CD    . ARG A 1 137 ? 37.470  -10.772 -5.949  1.00 61.26  ? 137 ARG A CD    1 
ATOM   1074  N  NE    . ARG A 1 137 ? 38.610  -10.009 -5.412  1.00 64.09  ? 137 ARG A NE    1 
ATOM   1075  C  CZ    . ARG A 1 137 ? 38.533  -9.121  -4.415  1.00 65.28  ? 137 ARG A CZ    1 
ATOM   1076  N  NH1   . ARG A 1 137 ? 37.374  -8.860  -3.809  1.00 64.12  ? 137 ARG A NH1   1 
ATOM   1077  N  NH2   . ARG A 1 137 ? 39.623  -8.478  -4.024  1.00 66.34  ? 137 ARG A NH2   1 
ATOM   1078  N  N     . GLU A 1 138 ? 35.201  -9.793  -10.497 1.00 44.73  ? 138 GLU A N     1 
ATOM   1079  C  CA    . GLU A 1 138 ? 33.870  -10.184 -10.929 1.00 45.06  ? 138 GLU A CA    1 
ATOM   1080  C  C     . GLU A 1 138 ? 33.518  -11.378 -10.045 1.00 43.50  ? 138 GLU A C     1 
ATOM   1081  O  O     . GLU A 1 138 ? 34.241  -12.369 -10.028 1.00 44.94  ? 138 GLU A O     1 
ATOM   1082  C  CB    . GLU A 1 138 ? 33.905  -10.595 -12.406 1.00 46.94  ? 138 GLU A CB    1 
ATOM   1083  C  CG    . GLU A 1 138 ? 32.540  -10.808 -13.065 1.00 50.20  ? 138 GLU A CG    1 
ATOM   1084  C  CD    . GLU A 1 138 ? 32.655  -11.392 -14.472 1.00 53.25  ? 138 GLU A CD    1 
ATOM   1085  O  OE1   . GLU A 1 138 ? 33.097  -12.555 -14.603 1.00 54.22  ? 138 GLU A OE1   1 
ATOM   1086  O  OE2   . GLU A 1 138 ? 32.311  -10.692 -15.449 1.00 54.56  ? 138 GLU A OE2   1 
ATOM   1087  N  N     . HIS A 1 139 ? 32.428  -11.291 -9.297  1.00 40.45  ? 139 HIS A N     1 
ATOM   1088  C  CA    . HIS A 1 139 ? 32.071  -12.393 -8.419  1.00 38.77  ? 139 HIS A CA    1 
ATOM   1089  C  C     . HIS A 1 139 ? 31.103  -13.375 -9.052  1.00 38.58  ? 139 HIS A C     1 
ATOM   1090  O  O     . HIS A 1 139 ? 31.186  -14.578 -8.841  1.00 38.72  ? 139 HIS A O     1 
ATOM   1091  C  CB    . HIS A 1 139 ? 31.470  -11.849 -7.131  1.00 38.57  ? 139 HIS A CB    1 
ATOM   1092  C  CG    . HIS A 1 139 ? 30.897  -12.905 -6.247  1.00 38.81  ? 139 HIS A CG    1 
ATOM   1093  N  ND1   . HIS A 1 139 ? 31.677  -13.867 -5.642  1.00 38.26  ? 139 HIS A ND1   1 
ATOM   1094  C  CD2   . HIS A 1 139 ? 29.617  -13.185 -5.903  1.00 38.44  ? 139 HIS A CD2   1 
ATOM   1095  C  CE1   . HIS A 1 139 ? 30.901  -14.694 -4.967  1.00 38.65  ? 139 HIS A CE1   1 
ATOM   1096  N  NE2   . HIS A 1 139 ? 29.646  -14.303 -5.110  1.00 37.99  ? 139 HIS A NE2   1 
ATOM   1097  N  N     . ALA A 1 140 ? 30.176  -12.847 -9.830  1.00 38.62  ? 140 ALA A N     1 
ATOM   1098  C  CA    . ALA A 1 140 ? 29.174  -13.655 -10.498 1.00 38.05  ? 140 ALA A CA    1 
ATOM   1099  C  C     . ALA A 1 140 ? 28.699  -12.830 -11.694 1.00 38.72  ? 140 ALA A C     1 
ATOM   1100  O  O     . ALA A 1 140 ? 28.856  -11.615 -11.691 1.00 38.80  ? 140 ALA A O     1 
ATOM   1101  C  CB    . ALA A 1 140 ? 28.030  -13.918 -9.534  1.00 35.79  ? 140 ALA A CB    1 
ATOM   1102  N  N     . ARG A 1 141 ? 28.159  -13.466 -12.729 1.00 39.93  ? 141 ARG A N     1 
ATOM   1103  C  CA    . ARG A 1 141 ? 27.663  -12.697 -13.869 1.00 41.53  ? 141 ARG A CA    1 
ATOM   1104  C  C     . ARG A 1 141 ? 26.622  -13.457 -14.678 1.00 41.66  ? 141 ARG A C     1 
ATOM   1105  O  O     . ARG A 1 141 ? 26.716  -14.667 -14.856 1.00 41.98  ? 141 ARG A O     1 
ATOM   1106  C  CB    . ARG A 1 141 ? 28.825  -12.226 -14.761 1.00 43.57  ? 141 ARG A CB    1 
ATOM   1107  C  CG    . ARG A 1 141 ? 29.500  -13.282 -15.605 1.00 49.47  ? 141 ARG A CG    1 
ATOM   1108  C  CD    . ARG A 1 141 ? 28.731  -13.546 -16.890 1.00 56.31  ? 141 ARG A CD    1 
ATOM   1109  N  NE    . ARG A 1 141 ? 29.423  -14.478 -17.786 1.00 62.42  ? 141 ARG A NE    1 
ATOM   1110  C  CZ    . ARG A 1 141 ? 28.911  -14.947 -18.926 1.00 64.99  ? 141 ARG A CZ    1 
ATOM   1111  N  NH1   . ARG A 1 141 ? 27.693  -14.579 -19.328 1.00 63.84  ? 141 ARG A NH1   1 
ATOM   1112  N  NH2   . ARG A 1 141 ? 29.623  -15.786 -19.670 1.00 65.98  ? 141 ARG A NH2   1 
ATOM   1113  N  N     . GLY A 1 142 ? 25.612  -12.733 -15.145 1.00 42.18  ? 142 GLY A N     1 
ATOM   1114  C  CA    . GLY A 1 142 ? 24.552  -13.343 -15.927 1.00 42.51  ? 142 GLY A CA    1 
ATOM   1115  C  C     . GLY A 1 142 ? 24.091  -12.492 -17.103 1.00 43.37  ? 142 GLY A C     1 
ATOM   1116  O  O     . GLY A 1 142 ? 24.632  -11.411 -17.351 1.00 43.70  ? 142 GLY A O     1 
ATOM   1117  N  N     . PRO A 1 143 ? 23.086  -12.960 -17.860 1.00 43.80  ? 143 PRO A N     1 
ATOM   1118  C  CA    . PRO A 1 143 ? 22.625  -12.162 -18.997 1.00 43.11  ? 143 PRO A CA    1 
ATOM   1119  C  C     . PRO A 1 143 ? 22.113  -10.801 -18.530 1.00 42.58  ? 143 PRO A C     1 
ATOM   1120  O  O     . PRO A 1 143 ? 21.048  -10.708 -17.899 1.00 43.17  ? 143 PRO A O     1 
ATOM   1121  C  CB    . PRO A 1 143 ? 21.503  -13.015 -19.594 1.00 43.47  ? 143 PRO A CB    1 
ATOM   1122  C  CG    . PRO A 1 143 ? 21.836  -14.413 -19.143 1.00 43.24  ? 143 PRO A CG    1 
ATOM   1123  C  CD    . PRO A 1 143 ? 22.301  -14.201 -17.737 1.00 43.55  ? 143 PRO A CD    1 
ATOM   1124  N  N     . GLY A 1 144 ? 22.883  -9.755  -18.819 1.00 40.03  ? 144 GLY A N     1 
ATOM   1125  C  CA    . GLY A 1 144 ? 22.460  -8.417  -18.456 1.00 36.56  ? 144 GLY A CA    1 
ATOM   1126  C  C     . GLY A 1 144 ? 22.898  -7.910  -17.104 1.00 34.95  ? 144 GLY A C     1 
ATOM   1127  O  O     . GLY A 1 144 ? 22.652  -6.747  -16.775 1.00 34.68  ? 144 GLY A O     1 
ATOM   1128  N  N     . TRP A 1 145 ? 23.543  -8.764  -16.315 1.00 32.89  ? 145 TRP A N     1 
ATOM   1129  C  CA    . TRP A 1 145 ? 24.011  -8.341  -15.009 1.00 30.23  ? 145 TRP A CA    1 
ATOM   1130  C  C     . TRP A 1 145 ? 25.327  -8.950  -14.562 1.00 28.70  ? 145 TRP A C     1 
ATOM   1131  O  O     . TRP A 1 145 ? 25.792  -9.938  -15.108 1.00 28.86  ? 145 TRP A O     1 
ATOM   1132  C  CB    . TRP A 1 145 ? 22.963  -8.667  -13.964 1.00 30.12  ? 145 TRP A CB    1 
ATOM   1133  C  CG    . TRP A 1 145 ? 22.611  -10.115 -13.915 1.00 32.95  ? 145 TRP A CG    1 
ATOM   1134  C  CD1   . TRP A 1 145 ? 21.629  -10.745 -14.623 1.00 34.80  ? 145 TRP A CD1   1 
ATOM   1135  C  CD2   . TRP A 1 145 ? 23.247  -11.130 -13.125 1.00 33.61  ? 145 TRP A CD2   1 
ATOM   1136  N  NE1   . TRP A 1 145 ? 21.609  -12.086 -14.319 1.00 35.24  ? 145 TRP A NE1   1 
ATOM   1137  C  CE2   . TRP A 1 145 ? 22.590  -12.348 -13.402 1.00 33.23  ? 145 TRP A CE2   1 
ATOM   1138  C  CE3   . TRP A 1 145 ? 24.304  -11.126 -12.204 1.00 32.69  ? 145 TRP A CE3   1 
ATOM   1139  C  CZ2   . TRP A 1 145 ? 22.969  -13.552 -12.811 1.00 32.19  ? 145 TRP A CZ2   1 
ATOM   1140  C  CZ3   . TRP A 1 145 ? 24.678  -12.324 -11.617 1.00 32.23  ? 145 TRP A CZ3   1 
ATOM   1141  C  CH2   . TRP A 1 145 ? 24.006  -13.522 -11.920 1.00 31.89  ? 145 TRP A CH2   1 
ATOM   1142  N  N     . ARG A 1 146 ? 25.950  -8.312  -13.584 1.00 27.75  ? 146 ARG A N     1 
ATOM   1143  C  CA    . ARG A 1 146 ? 27.156  -8.844  -12.977 1.00 28.39  ? 146 ARG A CA    1 
ATOM   1144  C  C     . ARG A 1 146 ? 27.351  -8.307  -11.562 1.00 28.16  ? 146 ARG A C     1 
ATOM   1145  O  O     . ARG A 1 146 ? 27.086  -7.146  -11.278 1.00 28.50  ? 146 ARG A O     1 
ATOM   1146  C  CB    . ARG A 1 146 ? 28.421  -8.657  -13.845 1.00 27.64  ? 146 ARG A CB    1 
ATOM   1147  C  CG    . ARG A 1 146 ? 28.526  -7.454  -14.743 1.00 29.56  ? 146 ARG A CG    1 
ATOM   1148  C  CD    . ARG A 1 146 ? 29.488  -7.772  -15.910 1.00 28.42  ? 146 ARG A CD    1 
ATOM   1149  N  NE    . ARG A 1 146 ? 30.846  -8.055  -15.455 1.00 28.09  ? 146 ARG A NE    1 
ATOM   1150  C  CZ    . ARG A 1 146 ? 31.743  -7.117  -15.162 1.00 31.30  ? 146 ARG A CZ    1 
ATOM   1151  N  NH1   . ARG A 1 146 ? 31.424  -5.833  -15.288 1.00 32.79  ? 146 ARG A NH1   1 
ATOM   1152  N  NH2   . ARG A 1 146 ? 32.950  -7.447  -14.714 1.00 30.91  ? 146 ARG A NH2   1 
ATOM   1153  N  N     . VAL A 1 147 ? 27.751  -9.201  -10.664 1.00 27.56  ? 147 VAL A N     1 
ATOM   1154  C  CA    . VAL A 1 147 ? 27.994  -8.860  -9.272  1.00 27.53  ? 147 VAL A CA    1 
ATOM   1155  C  C     . VAL A 1 147 ? 29.492  -8.640  -9.056  1.00 28.62  ? 147 VAL A C     1 
ATOM   1156  O  O     . VAL A 1 147 ? 30.308  -9.540  -9.261  1.00 28.00  ? 147 VAL A O     1 
ATOM   1157  C  CB    . VAL A 1 147 ? 27.507  -9.983  -8.320  1.00 24.89  ? 147 VAL A CB    1 
ATOM   1158  C  CG1   . VAL A 1 147 ? 27.951  -9.684  -6.913  1.00 22.61  ? 147 VAL A CG1   1 
ATOM   1159  C  CG2   . VAL A 1 147 ? 26.000  -10.108 -8.384  1.00 21.26  ? 147 VAL A CG2   1 
ATOM   1160  N  N     . LEU A 1 148 ? 29.853  -7.435  -8.645  1.00 29.98  ? 148 LEU A N     1 
ATOM   1161  C  CA    . LEU A 1 148 ? 31.253  -7.129  -8.415  1.00 31.58  ? 148 LEU A CA    1 
ATOM   1162  C  C     . LEU A 1 148 ? 31.628  -7.341  -6.954  1.00 32.61  ? 148 LEU A C     1 
ATOM   1163  O  O     . LEU A 1 148 ? 30.789  -7.216  -6.059  1.00 33.11  ? 148 LEU A O     1 
ATOM   1164  C  CB    . LEU A 1 148 ? 31.543  -5.687  -8.816  1.00 30.76  ? 148 LEU A CB    1 
ATOM   1165  C  CG    . LEU A 1 148 ? 31.248  -5.400  -10.279 1.00 30.71  ? 148 LEU A CG    1 
ATOM   1166  C  CD1   . LEU A 1 148 ? 31.532  -3.944  -10.546 1.00 30.64  ? 148 LEU A CD1   1 
ATOM   1167  C  CD2   . LEU A 1 148 ? 32.100  -6.294  -11.171 1.00 31.52  ? 148 LEU A CD2   1 
ATOM   1168  N  N     . GLY A 1 149 ? 32.895  -7.672  -6.723  1.00 32.63  ? 149 GLY A N     1 
ATOM   1169  C  CA    . GLY A 1 149 ? 33.362  -7.890  -5.370  1.00 31.42  ? 149 GLY A CA    1 
ATOM   1170  C  C     . GLY A 1 149 ? 34.392  -6.862  -4.955  1.00 31.21  ? 149 GLY A C     1 
ATOM   1171  O  O     . GLY A 1 149 ? 35.333  -6.573  -5.694  1.00 30.67  ? 149 GLY A O     1 
ATOM   1172  N  N     . GLY A 1 150 ? 34.208  -6.300  -3.767  1.00 30.40  ? 150 GLY A N     1 
ATOM   1173  C  CA    . GLY A 1 150 ? 35.146  -5.313  -3.287  1.00 30.56  ? 150 GLY A CA    1 
ATOM   1174  C  C     . GLY A 1 150 ? 34.996  -5.026  -1.813  1.00 30.18  ? 150 GLY A C     1 
ATOM   1175  O  O     . GLY A 1 150 ? 34.882  -5.931  -0.987  1.00 31.37  ? 150 GLY A O     1 
ATOM   1176  N  N     . ALA A 1 151 ? 35.012  -3.745  -1.487  1.00 29.20  ? 151 ALA A N     1 
ATOM   1177  C  CA    . ALA A 1 151 ? 34.872  -3.312  -0.116  1.00 28.06  ? 151 ALA A CA    1 
ATOM   1178  C  C     . ALA A 1 151 ? 34.397  -1.869  -0.118  1.00 27.69  ? 151 ALA A C     1 
ATOM   1179  O  O     . ALA A 1 151 ? 34.724  -1.103  -1.028  1.00 27.06  ? 151 ALA A O     1 
ATOM   1180  C  CB    . ALA A 1 151 ? 36.202  -3.424  0.602   1.00 26.07  ? 151 ALA A CB    1 
ATOM   1181  N  N     . VAL A 1 152 ? 33.589  -1.512  0.874   1.00 26.05  ? 152 VAL A N     1 
ATOM   1182  C  CA    . VAL A 1 152 ? 33.139  -0.148  0.981   1.00 27.09  ? 152 VAL A CA    1 
ATOM   1183  C  C     . VAL A 1 152 ? 34.076  0.426   2.032   1.00 28.45  ? 152 VAL A C     1 
ATOM   1184  O  O     . VAL A 1 152 ? 34.303  -0.185  3.069   1.00 29.55  ? 152 VAL A O     1 
ATOM   1185  C  CB    . VAL A 1 152 ? 31.688  -0.047  1.444   1.00 26.31  ? 152 VAL A CB    1 
ATOM   1186  C  CG1   . VAL A 1 152 ? 31.274  1.413   1.471   1.00 28.81  ? 152 VAL A CG1   1 
ATOM   1187  C  CG2   . VAL A 1 152 ? 30.784  -0.806  0.506   1.00 25.23  ? 152 VAL A CG2   1 
ATOM   1188  N  N     . LEU A 1 153 ? 34.641  1.590   1.750   1.00 29.47  ? 153 LEU A N     1 
ATOM   1189  C  CA    . LEU A 1 153 ? 35.582  2.193   2.666   1.00 30.27  ? 153 LEU A CA    1 
ATOM   1190  C  C     . LEU A 1 153 ? 35.169  3.567   3.160   1.00 32.72  ? 153 LEU A C     1 
ATOM   1191  O  O     . LEU A 1 153 ? 34.250  4.201   2.640   1.00 36.18  ? 153 LEU A O     1 
ATOM   1192  C  CB    . LEU A 1 153 ? 36.932  2.335   1.974   1.00 29.05  ? 153 LEU A CB    1 
ATOM   1193  C  CG    . LEU A 1 153 ? 37.469  1.170   1.147   1.00 30.34  ? 153 LEU A CG    1 
ATOM   1194  C  CD1   . LEU A 1 153 ? 38.735  1.600   0.437   1.00 29.46  ? 153 LEU A CD1   1 
ATOM   1195  C  CD2   . LEU A 1 153 ? 37.745  -0.020  2.024   1.00 29.64  ? 153 LEU A CD2   1 
ATOM   1196  N  N     . ASP A 1 154 ? 35.850  4.011   4.201   1.00 33.55  ? 154 ASP A N     1 
ATOM   1197  C  CA    . ASP A 1 154 ? 35.657  5.343   4.720   1.00 34.71  ? 154 ASP A CA    1 
ATOM   1198  C  C     . ASP A 1 154 ? 36.975  5.689   5.395   1.00 34.88  ? 154 ASP A C     1 
ATOM   1199  O  O     . ASP A 1 154 ? 37.656  4.820   5.937   1.00 35.55  ? 154 ASP A O     1 
ATOM   1200  C  CB    . ASP A 1 154 ? 34.501  5.433   5.716   1.00 34.81  ? 154 ASP A CB    1 
ATOM   1201  C  CG    . ASP A 1 154 ? 34.099  6.887   5.997   1.00 37.02  ? 154 ASP A CG    1 
ATOM   1202  O  OD1   . ASP A 1 154 ? 33.262  7.135   6.890   1.00 39.41  ? 154 ASP A OD1   1 
ATOM   1203  O  OD2   . ASP A 1 154 ? 34.623  7.796   5.315   1.00 36.49  ? 154 ASP A OD2   1 
ATOM   1204  N  N     . LEU A 1 155 ? 37.364  6.949   5.313   1.00 34.30  ? 155 LEU A N     1 
ATOM   1205  C  CA    . LEU A 1 155 ? 38.590  7.386   5.952   1.00 35.03  ? 155 LEU A CA    1 
ATOM   1206  C  C     . LEU A 1 155 ? 38.359  8.782   6.518   1.00 36.39  ? 155 LEU A C     1 
ATOM   1207  O  O     . LEU A 1 155 ? 37.990  9.703   5.785   1.00 36.61  ? 155 LEU A O     1 
ATOM   1208  C  CB    . LEU A 1 155 ? 39.740  7.402   4.950   1.00 32.53  ? 155 LEU A CB    1 
ATOM   1209  C  CG    . LEU A 1 155 ? 41.031  7.998   5.495   1.00 29.91  ? 155 LEU A CG    1 
ATOM   1210  C  CD1   . LEU A 1 155 ? 41.451  7.260   6.756   1.00 29.95  ? 155 LEU A CD1   1 
ATOM   1211  C  CD2   . LEU A 1 155 ? 42.092  7.910   4.428   1.00 28.86  ? 155 LEU A CD2   1 
ATOM   1212  N  N     . TRP A 1 156 ? 38.536  8.929   7.827   1.00 36.22  ? 156 TRP A N     1 
ATOM   1213  C  CA    . TRP A 1 156 ? 38.354  10.224  8.463   1.00 36.01  ? 156 TRP A CA    1 
ATOM   1214  C  C     . TRP A 1 156 ? 39.466  10.451  9.460   1.00 38.14  ? 156 TRP A C     1 
ATOM   1215  O  O     . TRP A 1 156 ? 40.336  9.598   9.640   1.00 37.31  ? 156 TRP A O     1 
ATOM   1216  C  CB    . TRP A 1 156 ? 36.979  10.324  9.141   1.00 34.24  ? 156 TRP A CB    1 
ATOM   1217  C  CG    . TRP A 1 156 ? 36.757  9.425   10.347  1.00 32.57  ? 156 TRP A CG    1 
ATOM   1218  C  CD1   . TRP A 1 156 ? 36.916  9.758   11.656  1.00 30.42  ? 156 TRP A CD1   1 
ATOM   1219  C  CD2   . TRP A 1 156 ? 36.310  8.064   10.330  1.00 30.87  ? 156 TRP A CD2   1 
ATOM   1220  N  NE1   . TRP A 1 156 ? 36.606  8.691   12.453  1.00 30.15  ? 156 TRP A NE1   1 
ATOM   1221  C  CE2   . TRP A 1 156 ? 36.245  7.636   11.668  1.00 29.16  ? 156 TRP A CE2   1 
ATOM   1222  C  CE3   . TRP A 1 156 ? 35.997  7.159   9.312   1.00 29.78  ? 156 TRP A CE3   1 
ATOM   1223  C  CZ2   . TRP A 1 156 ? 35.832  6.354   12.016  1.00 29.94  ? 156 TRP A CZ2   1 
ATOM   1224  C  CZ3   . TRP A 1 156 ? 35.591  5.887   9.660   1.00 30.17  ? 156 TRP A CZ3   1 
ATOM   1225  C  CH2   . TRP A 1 156 ? 35.526  5.489   10.999  1.00 30.45  ? 156 TRP A CH2   1 
ATOM   1226  N  N     . VAL A 1 157 ? 39.445  11.614  10.093  1.00 41.50  ? 157 VAL A N     1 
ATOM   1227  C  CA    . VAL A 1 157 ? 40.474  11.958  11.051  1.00 45.47  ? 157 VAL A CA    1 
ATOM   1228  C  C     . VAL A 1 157 ? 39.953  11.839  12.488  1.00 48.12  ? 157 VAL A C     1 
ATOM   1229  O  O     . VAL A 1 157 ? 38.799  12.163  12.787  1.00 46.42  ? 157 VAL A O     1 
ATOM   1230  C  CB    . VAL A 1 157 ? 41.008  13.387  10.768  1.00 46.32  ? 157 VAL A CB    1 
ATOM   1231  C  CG1   . VAL A 1 157 ? 40.017  14.429  11.263  1.00 47.24  ? 157 VAL A CG1   1 
ATOM   1232  C  CG2   . VAL A 1 157 ? 42.376  13.571  11.389  1.00 46.85  ? 157 VAL A CG2   1 
ATOM   1233  N  N     . SER A 1 158 ? 40.820  11.341  13.366  1.00 51.92  ? 158 SER A N     1 
ATOM   1234  C  CA    . SER A 1 158 ? 40.490  11.155  14.768  1.00 54.76  ? 158 SER A CA    1 
ATOM   1235  C  C     . SER A 1 158 ? 40.946  12.353  15.547  1.00 56.68  ? 158 SER A C     1 
ATOM   1236  O  O     . SER A 1 158 ? 41.895  13.033  15.157  1.00 55.95  ? 158 SER A O     1 
ATOM   1237  C  CB    . SER A 1 158 ? 41.198  9.922   15.327  1.00 55.90  ? 158 SER A CB    1 
ATOM   1238  O  OG    . SER A 1 158 ? 41.097  9.867   16.744  1.00 57.15  ? 158 SER A OG    1 
ATOM   1239  N  N     . ASP A 1 159 ? 40.268  12.607  16.657  1.00 59.72  ? 159 ASP A N     1 
ATOM   1240  C  CA    . ASP A 1 159 ? 40.644  13.716  17.516  1.00 62.74  ? 159 ASP A CA    1 
ATOM   1241  C  C     . ASP A 1 159 ? 42.119  13.576  17.933  1.00 61.11  ? 159 ASP A C     1 
ATOM   1242  O  O     . ASP A 1 159 ? 42.791  14.568  18.208  1.00 60.02  ? 159 ASP A O     1 
ATOM   1243  C  CB    . ASP A 1 159 ? 39.745  13.749  18.752  1.00 67.96  ? 159 ASP A CB    1 
ATOM   1244  C  CG    . ASP A 1 159 ? 40.099  14.884  19.692  1.00 73.21  ? 159 ASP A CG    1 
ATOM   1245  O  OD1   . ASP A 1 159 ? 41.169  14.810  20.337  1.00 76.99  ? 159 ASP A OD1   1 
ATOM   1246  O  OD2   . ASP A 1 159 ? 39.316  15.857  19.779  1.00 76.06  ? 159 ASP A OD2   1 
ATOM   1247  N  N     . SER A 1 160 ? 42.611  12.339  17.975  1.00 59.91  ? 160 SER A N     1 
ATOM   1248  C  CA    . SER A 1 160 ? 44.000  12.079  18.324  1.00 58.81  ? 160 SER A CA    1 
ATOM   1249  C  C     . SER A 1 160 ? 44.898  12.732  17.270  1.00 58.64  ? 160 SER A C     1 
ATOM   1250  O  O     . SER A 1 160 ? 46.047  13.084  17.553  1.00 59.74  ? 160 SER A O     1 
ATOM   1251  C  CB    . SER A 1 160 ? 44.265  10.567  18.379  1.00 58.88  ? 160 SER A CB    1 
ATOM   1252  O  OG    . SER A 1 160 ? 44.075  9.963   17.112  0.00 58.82  ? 160 SER A OG    1 
ATOM   1253  N  N     . GLY A 1 161 ? 44.365  12.890  16.056  1.00 57.05  ? 161 GLY A N     1 
ATOM   1254  C  CA    . GLY A 1 161 ? 45.118  13.511  14.977  1.00 52.62  ? 161 GLY A CA    1 
ATOM   1255  C  C     . GLY A 1 161 ? 45.574  12.554  13.889  1.00 50.25  ? 161 GLY A C     1 
ATOM   1256  O  O     . GLY A 1 161 ? 46.349  12.922  13.011  1.00 48.58  ? 161 GLY A O     1 
ATOM   1257  N  N     . ALA A 1 162 ? 45.097  11.319  13.929  1.00 48.82  ? 162 ALA A N     1 
ATOM   1258  C  CA    . ALA A 1 162 ? 45.511  10.367  12.918  1.00 48.23  ? 162 ALA A CA    1 
ATOM   1259  C  C     . ALA A 1 162 ? 44.360  9.933   12.023  1.00 47.93  ? 162 ALA A C     1 
ATOM   1260  O  O     . ALA A 1 162 ? 43.193  10.144  12.342  1.00 47.99  ? 162 ALA A O     1 
ATOM   1261  C  CB    . ALA A 1 162 ? 46.135  9.162   13.583  1.00 47.89  ? 162 ALA A CB    1 
ATOM   1262  N  N     . PHE A 1 163 ? 44.698  9.339   10.887  1.00 46.73  ? 163 PHE A N     1 
ATOM   1263  C  CA    . PHE A 1 163 ? 43.683  8.853   9.978   1.00 45.85  ? 163 PHE A CA    1 
ATOM   1264  C  C     . PHE A 1 163 ? 43.058  7.595   10.564  1.00 44.53  ? 163 PHE A C     1 
ATOM   1265  O  O     . PHE A 1 163 ? 43.682  6.870   11.334  1.00 43.13  ? 163 PHE A O     1 
ATOM   1266  C  CB    . PHE A 1 163 ? 44.292  8.533   8.612   1.00 47.45  ? 163 PHE A CB    1 
ATOM   1267  C  CG    . PHE A 1 163 ? 44.681  9.746   7.817   1.00 47.80  ? 163 PHE A CG    1 
ATOM   1268  C  CD1   . PHE A 1 163 ? 46.010  10.086  7.646   1.00 47.00  ? 163 PHE A CD1   1 
ATOM   1269  C  CD2   . PHE A 1 163 ? 43.710  10.535  7.211   1.00 49.01  ? 163 PHE A CD2   1 
ATOM   1270  C  CE1   . PHE A 1 163 ? 46.366  11.186  6.883   1.00 46.71  ? 163 PHE A CE1   1 
ATOM   1271  C  CE2   . PHE A 1 163 ? 44.062  11.640  6.445   1.00 48.11  ? 163 PHE A CE2   1 
ATOM   1272  C  CZ    . PHE A 1 163 ? 45.391  11.963  6.281   1.00 47.21  ? 163 PHE A CZ    1 
ATOM   1273  N  N     . LEU A 1 164 ? 41.820  7.337   10.179  1.00 43.97  ? 164 LEU A N     1 
ATOM   1274  C  CA    . LEU A 1 164 ? 41.102  6.181   10.668  1.00 44.04  ? 164 LEU A CA    1 
ATOM   1275  C  C     . LEU A 1 164 ? 40.328  5.593   9.489   1.00 44.57  ? 164 LEU A C     1 
ATOM   1276  O  O     . LEU A 1 164 ? 39.451  6.252   8.925   1.00 46.22  ? 164 LEU A O     1 
ATOM   1277  C  CB    . LEU A 1 164 ? 40.148  6.625   11.773  1.00 44.70  ? 164 LEU A CB    1 
ATOM   1278  C  CG    . LEU A 1 164 ? 39.722  5.596   12.812  1.00 45.69  ? 164 LEU A CG    1 
ATOM   1279  C  CD1   . LEU A 1 164 ? 40.949  5.146   13.581  1.00 46.32  ? 164 LEU A CD1   1 
ATOM   1280  C  CD2   . LEU A 1 164 ? 38.703  6.201   13.762  1.00 45.43  ? 164 LEU A CD2   1 
ATOM   1281  N  N     . LEU A 1 165 ? 40.660  4.361   9.114   1.00 43.20  ? 165 LEU A N     1 
ATOM   1282  C  CA    . LEU A 1 165 ? 40.018  3.675   7.989   1.00 41.03  ? 165 LEU A CA    1 
ATOM   1283  C  C     . LEU A 1 165 ? 38.974  2.655   8.437   1.00 40.02  ? 165 LEU A C     1 
ATOM   1284  O  O     . LEU A 1 165 ? 39.216  1.886   9.358   1.00 40.01  ? 165 LEU A O     1 
ATOM   1285  C  CB    . LEU A 1 165 ? 41.087  2.964   7.158   1.00 40.73  ? 165 LEU A CB    1 
ATOM   1286  C  CG    . LEU A 1 165 ? 40.707  2.121   5.939   1.00 40.83  ? 165 LEU A CG    1 
ATOM   1287  C  CD1   . LEU A 1 165 ? 40.161  3.016   4.838   1.00 39.84  ? 165 LEU A CD1   1 
ATOM   1288  C  CD2   . LEU A 1 165 ? 41.942  1.364   5.453   1.00 38.11  ? 165 LEU A CD2   1 
ATOM   1289  N  N     . GLU A 1 166 ? 37.812  2.656   7.790   1.00 39.72  ? 166 GLU A N     1 
ATOM   1290  C  CA    . GLU A 1 166 ? 36.747  1.700   8.102   1.00 38.52  ? 166 GLU A CA    1 
ATOM   1291  C  C     . GLU A 1 166 ? 36.646  0.841   6.863   1.00 36.67  ? 166 GLU A C     1 
ATOM   1292  O  O     . GLU A 1 166 ? 36.560  1.367   5.765   1.00 37.03  ? 166 GLU A O     1 
ATOM   1293  C  CB    . GLU A 1 166 ? 35.422  2.414   8.353   1.00 39.95  ? 166 GLU A CB    1 
ATOM   1294  C  CG    . GLU A 1 166 ? 34.284  1.478   8.709   1.00 43.09  ? 166 GLU A CG    1 
ATOM   1295  C  CD    . GLU A 1 166 ? 33.120  2.189   9.382   1.00 46.94  ? 166 GLU A CD    1 
ATOM   1296  O  OE1   . GLU A 1 166 ? 32.141  1.505   9.750   1.00 51.25  ? 166 GLU A OE1   1 
ATOM   1297  O  OE2   . GLU A 1 166 ? 33.177  3.427   9.552   1.00 49.19  ? 166 GLU A OE2   1 
ATOM   1298  N  N     . VAL A 1 167 ? 36.661  -0.473  7.024   1.00 34.71  ? 167 VAL A N     1 
ATOM   1299  C  CA    . VAL A 1 167 ? 36.625  -1.343  5.864   1.00 34.78  ? 167 VAL A CA    1 
ATOM   1300  C  C     . VAL A 1 167 ? 35.741  -2.552  6.004   1.00 35.19  ? 167 VAL A C     1 
ATOM   1301  O  O     . VAL A 1 167 ? 35.986  -3.389  6.856   1.00 36.63  ? 167 VAL A O     1 
ATOM   1302  C  CB    . VAL A 1 167 ? 38.034  -1.850  5.537   1.00 34.81  ? 167 VAL A CB    1 
ATOM   1303  C  CG1   . VAL A 1 167 ? 37.974  -2.930  4.471   1.00 36.10  ? 167 VAL A CG1   1 
ATOM   1304  C  CG2   . VAL A 1 167 ? 38.893  -0.702  5.067   1.00 36.73  ? 167 VAL A CG2   1 
ATOM   1305  N  N     . ASP A 1 168 ? 34.729  -2.662  5.153   1.00 35.49  ? 168 ASP A N     1 
ATOM   1306  C  CA    . ASP A 1 168 ? 33.843  -3.814  5.197   1.00 36.53  ? 168 ASP A CA    1 
ATOM   1307  C  C     . ASP A 1 168 ? 33.647  -4.358  3.790   1.00 35.34  ? 168 ASP A C     1 
ATOM   1308  O  O     . ASP A 1 168 ? 32.951  -3.753  2.988   1.00 34.80  ? 168 ASP A O     1 
ATOM   1309  C  CB    . ASP A 1 168 ? 32.494  -3.425  5.796   1.00 40.35  ? 168 ASP A CB    1 
ATOM   1310  C  CG    . ASP A 1 168 ? 31.640  -4.641  6.145   1.00 45.07  ? 168 ASP A CG    1 
ATOM   1311  O  OD1   . ASP A 1 168 ? 32.235  -5.744  6.272   1.00 46.18  ? 168 ASP A OD1   1 
ATOM   1312  O  OD2   . ASP A 1 168 ? 30.393  -4.493  6.305   1.00 44.63  ? 168 ASP A OD2   1 
ATOM   1313  N  N     . PRO A 1 169 ? 34.233  -5.531  3.483   1.00 34.27  ? 169 PRO A N     1 
ATOM   1314  C  CA    . PRO A 1 169 ? 34.100  -6.115  2.146   1.00 31.92  ? 169 PRO A CA    1 
ATOM   1315  C  C     . PRO A 1 169 ? 32.646  -6.277  1.804   1.00 30.04  ? 169 PRO A C     1 
ATOM   1316  O  O     . PRO A 1 169 ? 31.848  -6.611  2.673   1.00 29.17  ? 169 PRO A O     1 
ATOM   1317  C  CB    . PRO A 1 169 ? 34.814  -7.452  2.286   1.00 31.73  ? 169 PRO A CB    1 
ATOM   1318  C  CG    . PRO A 1 169 ? 34.426  -7.860  3.645   1.00 33.07  ? 169 PRO A CG    1 
ATOM   1319  C  CD    . PRO A 1 169 ? 34.659  -6.569  4.440   1.00 34.49  ? 169 PRO A CD    1 
ATOM   1320  N  N     . ALA A 1 170 ? 32.313  -6.043  0.537   1.00 30.15  ? 170 ALA A N     1 
ATOM   1321  C  CA    . ALA A 1 170 ? 30.935  -6.148  0.057   1.00 30.48  ? 170 ALA A CA    1 
ATOM   1322  C  C     . ALA A 1 170 ? 30.831  -6.317  -1.462  1.00 30.29  ? 170 ALA A C     1 
ATOM   1323  O  O     . ALA A 1 170 ? 31.836  -6.215  -2.173  1.00 29.16  ? 170 ALA A O     1 
ATOM   1324  C  CB    . ALA A 1 170 ? 30.158  -4.918  0.488   1.00 29.07  ? 170 ALA A CB    1 
ATOM   1325  N  N     . TYR A 1 171 ? 29.610  -6.573  -1.944  1.00 30.43  ? 171 TYR A N     1 
ATOM   1326  C  CA    . TYR A 1 171 ? 29.342  -6.737  -3.373  1.00 31.31  ? 171 TYR A CA    1 
ATOM   1327  C  C     . TYR A 1 171 ? 28.546  -5.582  -3.985  1.00 32.32  ? 171 TYR A C     1 
ATOM   1328  O  O     . TYR A 1 171 ? 28.187  -4.620  -3.307  1.00 32.90  ? 171 TYR A O     1 
ATOM   1329  C  CB    . TYR A 1 171 ? 28.603  -8.046  -3.650  1.00 30.89  ? 171 TYR A CB    1 
ATOM   1330  C  CG    . TYR A 1 171 ? 29.384  -9.276  -3.281  1.00 31.40  ? 171 TYR A CG    1 
ATOM   1331  C  CD1   . TYR A 1 171 ? 28.972  -10.084 -2.226  1.00 33.44  ? 171 TYR A CD1   1 
ATOM   1332  C  CD2   . TYR A 1 171 ? 30.557  -9.614  -3.954  1.00 31.98  ? 171 TYR A CD2   1 
ATOM   1333  C  CE1   . TYR A 1 171 ? 29.704  -11.192 -1.839  1.00 33.58  ? 171 TYR A CE1   1 
ATOM   1334  C  CE2   . TYR A 1 171 ? 31.304  -10.726 -3.576  1.00 32.72  ? 171 TYR A CE2   1 
ATOM   1335  C  CZ    . TYR A 1 171 ? 30.865  -11.507 -2.516  1.00 34.68  ? 171 TYR A CZ    1 
ATOM   1336  O  OH    . TYR A 1 171 ? 31.571  -12.613 -2.127  1.00 36.91  ? 171 TYR A OH    1 
ATOM   1337  N  N     . ARG A 1 172 ? 28.272  -5.701  -5.279  1.00 33.17  ? 172 ARG A N     1 
ATOM   1338  C  CA    . ARG A 1 172 ? 27.551  -4.682  -6.022  1.00 33.76  ? 172 ARG A CA    1 
ATOM   1339  C  C     . ARG A 1 172 ? 26.779  -5.339  -7.143  1.00 34.14  ? 172 ARG A C     1 
ATOM   1340  O  O     . ARG A 1 172 ? 27.385  -5.983  -7.999  1.00 33.44  ? 172 ARG A O     1 
ATOM   1341  C  CB    . ARG A 1 172 ? 28.542  -3.711  -6.641  1.00 33.45  ? 172 ARG A CB    1 
ATOM   1342  C  CG    . ARG A 1 172 ? 28.188  -2.277  -6.487  1.00 36.49  ? 172 ARG A CG    1 
ATOM   1343  C  CD    . ARG A 1 172 ? 26.826  -1.952  -7.031  1.00 40.03  ? 172 ARG A CD    1 
ATOM   1344  N  NE    . ARG A 1 172 ? 26.616  -0.509  -6.971  1.00 44.10  ? 172 ARG A NE    1 
ATOM   1345  C  CZ    . ARG A 1 172 ? 25.473  0.107   -7.251  1.00 45.97  ? 172 ARG A CZ    1 
ATOM   1346  N  NH1   . ARG A 1 172 ? 24.397  -0.588  -7.616  1.00 46.48  ? 172 ARG A NH1   1 
ATOM   1347  N  NH2   . ARG A 1 172 ? 25.415  1.429   -7.167  1.00 46.91  ? 172 ARG A NH2   1 
ATOM   1348  N  N     . ILE A 1 173 ? 25.455  -5.186  -7.150  1.00 34.53  ? 173 ILE A N     1 
ATOM   1349  C  CA    . ILE A 1 173 ? 24.653  -5.769  -8.228  1.00 34.75  ? 173 ILE A CA    1 
ATOM   1350  C  C     . ILE A 1 173 ? 24.607  -4.751  -9.340  1.00 34.86  ? 173 ILE A C     1 
ATOM   1351  O  O     . ILE A 1 173 ? 24.093  -3.666  -9.149  1.00 34.64  ? 173 ILE A O     1 
ATOM   1352  C  CB    . ILE A 1 173 ? 23.184  -6.055  -7.840  1.00 35.00  ? 173 ILE A CB    1 
ATOM   1353  C  CG1   . ILE A 1 173 ? 23.091  -6.816  -6.515  1.00 34.02  ? 173 ILE A CG1   1 
ATOM   1354  C  CG2   . ILE A 1 173 ? 22.543  -6.899  -8.942  1.00 33.18  ? 173 ILE A CG2   1 
ATOM   1355  C  CD1   . ILE A 1 173 ? 23.620  -8.233  -6.594  1.00 38.12  ? 173 ILE A CD1   1 
ATOM   1356  N  N     . LEU A 1 174 ? 25.134  -5.115  -10.501 1.00 37.10  ? 174 LEU A N     1 
ATOM   1357  C  CA    . LEU A 1 174 ? 25.183  -4.229  -11.663 1.00 37.97  ? 174 LEU A CA    1 
ATOM   1358  C  C     . LEU A 1 174 ? 24.270  -4.686  -12.807 1.00 38.22  ? 174 LEU A C     1 
ATOM   1359  O  O     . LEU A 1 174 ? 24.161  -5.872  -13.082 1.00 37.46  ? 174 LEU A O     1 
ATOM   1360  C  CB    . LEU A 1 174 ? 26.626  -4.168  -12.189 1.00 40.05  ? 174 LEU A CB    1 
ATOM   1361  C  CG    . LEU A 1 174 ? 27.463  -2.884  -12.157 1.00 41.13  ? 174 LEU A CG    1 
ATOM   1362  C  CD1   . LEU A 1 174 ? 26.915  -1.850  -13.170 1.00 42.21  ? 174 LEU A CD1   1 
ATOM   1363  C  CD2   . LEU A 1 174 ? 27.467  -2.342  -10.741 1.00 41.62  ? 174 LEU A CD2   1 
ATOM   1364  N  N     . CYS A 1 175 ? 23.614  -3.741  -13.468 1.00 39.76  ? 175 CYS A N     1 
ATOM   1365  C  CA    . CYS A 1 175 ? 22.782  -4.069  -14.617 1.00 41.66  ? 175 CYS A CA    1 
ATOM   1366  C  C     . CYS A 1 175 ? 23.609  -3.627  -15.834 1.00 41.03  ? 175 CYS A C     1 
ATOM   1367  O  O     . CYS A 1 175 ? 23.965  -2.456  -15.983 1.00 39.12  ? 175 CYS A O     1 
ATOM   1368  C  CB    . CYS A 1 175 ? 21.440  -3.321  -14.570 1.00 44.50  ? 175 CYS A CB    1 
ATOM   1369  S  SG    . CYS A 1 175 ? 20.172  -3.930  -15.764 1.00 48.59  ? 175 CYS A SG    1 
ATOM   1370  N  N     . GLU A 1 176 ? 23.938  -4.573  -16.697 1.00 40.97  ? 176 GLU A N     1 
ATOM   1371  C  CA    . GLU A 1 176 ? 24.744  -4.241  -17.848 1.00 41.76  ? 176 GLU A CA    1 
ATOM   1372  C  C     . GLU A 1 176 ? 23.927  -4.003  -19.104 1.00 41.35  ? 176 GLU A C     1 
ATOM   1373  O  O     . GLU A 1 176 ? 24.475  -4.055  -20.205 1.00 41.81  ? 176 GLU A O     1 
ATOM   1374  C  CB    . GLU A 1 176 ? 25.788  -5.340  -18.095 1.00 43.30  ? 176 GLU A CB    1 
ATOM   1375  C  CG    . GLU A 1 176 ? 26.799  -5.532  -16.968 1.00 45.72  ? 176 GLU A CG    1 
ATOM   1376  C  CD    . GLU A 1 176 ? 27.733  -4.332  -16.784 1.00 49.73  ? 176 GLU A CD    1 
ATOM   1377  O  OE1   . GLU A 1 176 ? 27.247  -3.210  -16.521 1.00 51.91  ? 176 GLU A OE1   1 
ATOM   1378  O  OE2   . GLU A 1 176 ? 28.965  -4.505  -16.895 1.00 51.81  ? 176 GLU A OE2   1 
ATOM   1379  N  N     . MET A 1 177 ? 22.625  -3.755  -18.957 1.00 40.20  ? 177 MET A N     1 
ATOM   1380  C  CA    . MET A 1 177 ? 21.792  -3.487  -20.134 1.00 39.68  ? 177 MET A CA    1 
ATOM   1381  C  C     . MET A 1 177 ? 20.618  -2.536  -19.914 1.00 38.31  ? 177 MET A C     1 
ATOM   1382  O  O     . MET A 1 177 ? 20.218  -2.299  -18.783 1.00 41.19  ? 177 MET A O     1 
ATOM   1383  C  CB    . MET A 1 177 ? 21.300  -4.791  -20.767 1.00 39.66  ? 177 MET A CB    1 
ATOM   1384  C  CG    . MET A 1 177 ? 20.275  -5.590  -20.010 1.00 38.76  ? 177 MET A CG    1 
ATOM   1385  S  SD    . MET A 1 177 ? 19.857  -6.976  -21.098 1.00 41.42  ? 177 MET A SD    1 
ATOM   1386  C  CE    . MET A 1 177 ? 19.440  -8.270  -19.991 1.00 42.73  ? 177 MET A CE    1 
ATOM   1387  N  N     . SER A 1 178 ? 20.085  -1.978  -21.000 1.00 35.37  ? 178 SER A N     1 
ATOM   1388  C  CA    . SER A 1 178 ? 18.975  -1.035  -20.924 1.00 33.70  ? 178 SER A CA    1 
ATOM   1389  C  C     . SER A 1 178 ? 17.703  -1.689  -20.424 1.00 33.34  ? 178 SER A C     1 
ATOM   1390  O  O     . SER A 1 178 ? 17.569  -2.905  -20.446 1.00 32.54  ? 178 SER A O     1 
ATOM   1391  C  CB    . SER A 1 178 ? 18.693  -0.434  -22.296 1.00 34.13  ? 178 SER A CB    1 
ATOM   1392  O  OG    . SER A 1 178 ? 18.015  -1.370  -23.120 1.00 34.76  ? 178 SER A OG    1 
ATOM   1393  N  N     . LEU A 1 179 ? 16.761  -0.860  -19.990 1.00 34.16  ? 179 LEU A N     1 
ATOM   1394  C  CA    . LEU A 1 179 ? 15.467  -1.320  -19.480 1.00 35.37  ? 179 LEU A CA    1 
ATOM   1395  C  C     . LEU A 1 179 ? 14.713  -2.082  -20.576 1.00 36.68  ? 179 LEU A C     1 
ATOM   1396  O  O     . LEU A 1 179 ? 14.037  -3.084  -20.309 1.00 35.42  ? 179 LEU A O     1 
ATOM   1397  C  CB    . LEU A 1 179 ? 14.633  -0.113  -19.038 1.00 32.92  ? 179 LEU A CB    1 
ATOM   1398  C  CG    . LEU A 1 179 ? 13.437  -0.249  -18.098 1.00 30.83  ? 179 LEU A CG    1 
ATOM   1399  C  CD1   . LEU A 1 179 ? 12.581  0.986   -18.284 1.00 31.25  ? 179 LEU A CD1   1 
ATOM   1400  C  CD2   . LEU A 1 179 ? 12.623  -1.481  -18.374 1.00 28.16  ? 179 LEU A CD2   1 
ATOM   1401  N  N     . GLU A 1 180 ? 14.833  -1.590  -21.808 1.00 38.42  ? 180 GLU A N     1 
ATOM   1402  C  CA    . GLU A 1 180 ? 14.170  -2.208  -22.944 1.00 39.92  ? 180 GLU A CA    1 
ATOM   1403  C  C     . GLU A 1 180 ? 14.700  -3.610  -23.158 1.00 39.57  ? 180 GLU A C     1 
ATOM   1404  O  O     . GLU A 1 180 ? 13.925  -4.562  -23.261 1.00 40.11  ? 180 GLU A O     1 
ATOM   1405  C  CB    . GLU A 1 180 ? 14.390  -1.388  -24.211 1.00 42.31  ? 180 GLU A CB    1 
ATOM   1406  C  CG    . GLU A 1 180 ? 13.740  -2.011  -25.438 1.00 46.44  ? 180 GLU A CG    1 
ATOM   1407  C  CD    . GLU A 1 180 ? 12.231  -1.831  -25.458 1.00 49.74  ? 180 GLU A CD    1 
ATOM   1408  O  OE1   . GLU A 1 180 ? 11.547  -2.670  -26.085 1.00 52.55  ? 180 GLU A OE1   1 
ATOM   1409  O  OE2   . GLU A 1 180 ? 11.728  -0.848  -24.864 1.00 49.17  ? 180 GLU A OE2   1 
ATOM   1410  N  N     . ALA A 1 181 ? 16.024  -3.732  -23.211 1.00 38.01  ? 181 ALA A N     1 
ATOM   1411  C  CA    . ALA A 1 181 ? 16.673  -5.022  -23.410 1.00 37.78  ? 181 ALA A CA    1 
ATOM   1412  C  C     . ALA A 1 181 ? 16.305  -6.029  -22.322 1.00 39.17  ? 181 ALA A C     1 
ATOM   1413  O  O     . ALA A 1 181 ? 16.003  -7.192  -22.606 1.00 39.79  ? 181 ALA A O     1 
ATOM   1414  C  CB    . ALA A 1 181 ? 18.148  -4.832  -23.434 1.00 36.91  ? 181 ALA A CB    1 
ATOM   1415  N  N     . TRP A 1 182 ? 16.346  -5.563  -21.077 1.00 38.88  ? 182 TRP A N     1 
ATOM   1416  C  CA    . TRP A 1 182 ? 16.032  -6.366  -19.907 1.00 37.41  ? 182 TRP A CA    1 
ATOM   1417  C  C     . TRP A 1 182 ? 14.597  -6.861  -19.929 1.00 38.55  ? 182 TRP A C     1 
ATOM   1418  O  O     . TRP A 1 182 ? 14.330  -8.011  -19.571 1.00 39.62  ? 182 TRP A O     1 
ATOM   1419  C  CB    . TRP A 1 182 ? 16.277  -5.532  -18.649 1.00 35.69  ? 182 TRP A CB    1 
ATOM   1420  C  CG    . TRP A 1 182 ? 16.039  -6.227  -17.338 1.00 32.26  ? 182 TRP A CG    1 
ATOM   1421  C  CD1   . TRP A 1 182 ? 14.945  -6.112  -16.539 1.00 31.13  ? 182 TRP A CD1   1 
ATOM   1422  C  CD2   . TRP A 1 182 ? 16.955  -7.075  -16.642 1.00 31.19  ? 182 TRP A CD2   1 
ATOM   1423  N  NE1   . TRP A 1 182 ? 15.127  -6.820  -15.384 1.00 30.61  ? 182 TRP A NE1   1 
ATOM   1424  C  CE2   . TRP A 1 182 ? 16.357  -7.414  -15.415 1.00 30.13  ? 182 TRP A CE2   1 
ATOM   1425  C  CE3   . TRP A 1 182 ? 18.240  -7.557  -16.927 1.00 31.76  ? 182 TRP A CE3   1 
ATOM   1426  C  CZ2   . TRP A 1 182 ? 16.983  -8.237  -14.481 1.00 30.94  ? 182 TRP A CZ2   1 
ATOM   1427  C  CZ3   . TRP A 1 182 ? 18.867  -8.374  -16.000 1.00 31.88  ? 182 TRP A CZ3   1 
ATOM   1428  C  CH2   . TRP A 1 182 ? 18.242  -8.697  -14.784 1.00 32.68  ? 182 TRP A CH2   1 
ATOM   1429  N  N     . LEU A 1 183 ? 13.667  -6.005  -20.336 1.00 38.27  ? 183 LEU A N     1 
ATOM   1430  C  CA    . LEU A 1 183 ? 12.279  -6.432  -20.372 1.00 40.11  ? 183 LEU A CA    1 
ATOM   1431  C  C     . LEU A 1 183 ? 12.149  -7.445  -21.476 1.00 41.80  ? 183 LEU A C     1 
ATOM   1432  O  O     . LEU A 1 183 ? 11.470  -8.464  -21.332 1.00 42.41  ? 183 LEU A O     1 
ATOM   1433  C  CB    . LEU A 1 183 ? 11.352  -5.254  -20.633 1.00 38.00  ? 183 LEU A CB    1 
ATOM   1434  C  CG    . LEU A 1 183 ? 11.253  -4.313  -19.438 1.00 37.08  ? 183 LEU A CG    1 
ATOM   1435  C  CD1   . LEU A 1 183 ? 10.370  -3.136  -19.803 1.00 36.96  ? 183 LEU A CD1   1 
ATOM   1436  C  CD2   . LEU A 1 183 ? 10.710  -5.066  -18.233 1.00 35.34  ? 183 LEU A CD2   1 
ATOM   1437  N  N     . ALA A 1 184 ? 12.835  -7.156  -22.574 1.00 43.07  ? 184 ALA A N     1 
ATOM   1438  C  CA    . ALA A 1 184 ? 12.837  -8.019  -23.743 1.00 44.34  ? 184 ALA A CA    1 
ATOM   1439  C  C     . ALA A 1 184 ? 13.318  -9.409  -23.377 1.00 45.08  ? 184 ALA A C     1 
ATOM   1440  O  O     . ALA A 1 184 ? 13.281  -10.317 -24.196 1.00 45.75  ? 184 ALA A O     1 
ATOM   1441  C  CB    . ALA A 1 184 ? 13.736  -7.433  -24.819 1.00 44.36  ? 184 ALA A CB    1 
ATOM   1442  N  N     . GLN A 1 185 ? 13.784  -9.575  -22.149 1.00 46.28  ? 185 GLN A N     1 
ATOM   1443  C  CA    . GLN A 1 185 ? 14.265  -10.870 -21.712 1.00 47.79  ? 185 GLN A CA    1 
ATOM   1444  C  C     . GLN A 1 185 ? 13.224  -11.546 -20.838 1.00 48.45  ? 185 GLN A C     1 
ATOM   1445  O  O     . GLN A 1 185 ? 13.402  -12.696 -20.445 1.00 50.07  ? 185 GLN A O     1 
ATOM   1446  C  CB    . GLN A 1 185 ? 15.593  -10.719 -20.966 1.00 48.58  ? 185 GLN A CB    1 
ATOM   1447  C  CG    . GLN A 1 185 ? 16.761  -10.297 -21.871 1.00 53.25  ? 185 GLN A CG    1 
ATOM   1448  C  CD    . GLN A 1 185 ? 17.383  -11.462 -22.659 1.00 55.94  ? 185 GLN A CD    1 
ATOM   1449  O  OE1   . GLN A 1 185 ? 17.945  -12.394 -22.067 1.00 56.85  ? 185 GLN A OE1   1 
ATOM   1450  N  NE2   . GLN A 1 185 ? 17.292  -11.407 -23.996 1.00 53.91  ? 185 GLN A NE2   1 
ATOM   1451  N  N     . GLY A 1 186 ? 12.142  -10.827 -20.534 1.00 47.79  ? 186 GLY A N     1 
ATOM   1452  C  CA    . GLY A 1 186 ? 11.072  -11.395 -19.731 1.00 46.14  ? 186 GLY A CA    1 
ATOM   1453  C  C     . GLY A 1 186 ? 11.076  -11.112 -18.242 1.00 45.84  ? 186 GLY A C     1 
ATOM   1454  O  O     . GLY A 1 186 ? 10.227  -11.611 -17.500 1.00 45.36  ? 186 GLY A O     1 
ATOM   1455  N  N     . HIS A 1 187 ? 12.027  -10.326 -17.773 1.00 45.62  ? 187 HIS A N     1 
ATOM   1456  C  CA    . HIS A 1 187 ? 12.024  -10.042 -16.361 1.00 46.66  ? 187 HIS A CA    1 
ATOM   1457  C  C     . HIS A 1 187 ? 10.914  -9.046  -16.083 1.00 47.26  ? 187 HIS A C     1 
ATOM   1458  O  O     . HIS A 1 187 ? 10.499  -8.294  -16.960 1.00 46.96  ? 187 HIS A O     1 
ATOM   1459  C  CB    . HIS A 1 187 ? 13.355  -9.460  -15.916 1.00 48.10  ? 187 HIS A CB    1 
ATOM   1460  C  CG    . HIS A 1 187 ? 14.525  -10.344 -16.197 1.00 50.24  ? 187 HIS A CG    1 
ATOM   1461  N  ND1   . HIS A 1 187 ? 15.081  -10.465 -17.453 1.00 51.68  ? 187 HIS A ND1   1 
ATOM   1462  C  CD2   . HIS A 1 187 ? 15.248  -11.148 -15.384 1.00 50.53  ? 187 HIS A CD2   1 
ATOM   1463  C  CE1   . HIS A 1 187 ? 16.101  -11.304 -17.400 1.00 51.93  ? 187 HIS A CE1   1 
ATOM   1464  N  NE2   . HIS A 1 187 ? 16.224  -11.733 -16.156 1.00 51.75  ? 187 HIS A NE2   1 
ATOM   1465  N  N     . PRO A 1 188 ? 10.401  -9.041  -14.852 1.00 48.46  ? 188 PRO A N     1 
ATOM   1466  C  CA    . PRO A 1 188 ? 9.330   -8.121  -14.463 1.00 48.56  ? 188 PRO A CA    1 
ATOM   1467  C  C     . PRO A 1 188 ? 9.851   -6.695  -14.420 1.00 48.37  ? 188 PRO A C     1 
ATOM   1468  O  O     . PRO A 1 188 ? 11.059  -6.468  -14.341 1.00 48.89  ? 188 PRO A O     1 
ATOM   1469  C  CB    . PRO A 1 188 ? 8.937   -8.621  -13.081 1.00 49.24  ? 188 PRO A CB    1 
ATOM   1470  C  CG    . PRO A 1 188 ? 10.248  -9.172  -12.549 1.00 50.16  ? 188 PRO A CG    1 
ATOM   1471  C  CD    . PRO A 1 188 ? 10.771  -9.930  -13.736 1.00 49.40  ? 188 PRO A CD    1 
ATOM   1472  N  N     . LEU A 1 189 ? 8.945   -5.731  -14.464 1.00 47.58  ? 189 LEU A N     1 
ATOM   1473  C  CA    . LEU A 1 189 ? 9.366   -4.343  -14.426 1.00 47.00  ? 189 LEU A CA    1 
ATOM   1474  C  C     . LEU A 1 189 ? 10.129  -4.001  -13.166 1.00 45.96  ? 189 LEU A C     1 
ATOM   1475  O  O     . LEU A 1 189 ? 9.709   -4.323  -12.060 1.00 45.75  ? 189 LEU A O     1 
ATOM   1476  C  CB    . LEU A 1 189 ? 8.174   -3.402  -14.520 1.00 48.73  ? 189 LEU A CB    1 
ATOM   1477  C  CG    . LEU A 1 189 ? 7.464   -3.338  -15.855 1.00 49.33  ? 189 LEU A CG    1 
ATOM   1478  C  CD1   . LEU A 1 189 ? 6.731   -4.646  -16.097 1.00 51.26  ? 189 LEU A CD1   1 
ATOM   1479  C  CD2   . LEU A 1 189 ? 6.506   -2.169  -15.826 1.00 51.38  ? 189 LEU A CD2   1 
ATOM   1480  N  N     . PRO A 1 190 ? 11.275  -3.344  -13.321 1.00 45.03  ? 190 PRO A N     1 
ATOM   1481  C  CA    . PRO A 1 190 ? 12.085  -2.956  -12.167 1.00 44.29  ? 190 PRO A CA    1 
ATOM   1482  C  C     . PRO A 1 190 ? 11.360  -1.867  -11.384 1.00 43.67  ? 190 PRO A C     1 
ATOM   1483  O  O     . PRO A 1 190 ? 10.625  -1.064  -11.953 1.00 43.28  ? 190 PRO A O     1 
ATOM   1484  C  CB    . PRO A 1 190 ? 13.366  -2.448  -12.807 1.00 44.88  ? 190 PRO A CB    1 
ATOM   1485  C  CG    . PRO A 1 190 ? 13.448  -3.263  -14.071 1.00 45.51  ? 190 PRO A CG    1 
ATOM   1486  C  CD    . PRO A 1 190 ? 12.038  -3.216  -14.571 1.00 44.80  ? 190 PRO A CD    1 
ATOM   1487  N  N     . LYS A 1 191 ? 11.562  -1.838  -10.078 1.00 43.66  ? 191 LYS A N     1 
ATOM   1488  C  CA    . LYS A 1 191 ? 10.903  -0.844  -9.263  1.00 44.91  ? 191 LYS A CA    1 
ATOM   1489  C  C     . LYS A 1 191 ? 11.587  0.481   -9.406  1.00 45.73  ? 191 LYS A C     1 
ATOM   1490  O  O     . LYS A 1 191 ? 10.943  1.525   -9.416  1.00 47.30  ? 191 LYS A O     1 
ATOM   1491  C  CB    . LYS A 1 191 ? 10.896  -1.272  -7.806  1.00 45.65  ? 191 LYS A CB    1 
ATOM   1492  C  CG    . LYS A 1 191 ? 10.001  -2.460  -7.579  1.00 48.48  ? 191 LYS A CG    1 
ATOM   1493  C  CD    . LYS A 1 191 ? 9.368   -2.425  -6.214  1.00 51.52  ? 191 LYS A CD    1 
ATOM   1494  C  CE    . LYS A 1 191 ? 8.029   -3.135  -6.257  1.00 54.92  ? 191 LYS A CE    1 
ATOM   1495  N  NZ    . LYS A 1 191 ? 7.066   -2.417  -7.152  1.00 55.42  ? 191 LYS A NZ    1 
ATOM   1496  N  N     . ARG A 1 192 ? 12.903  0.426   -9.526  1.00 46.63  ? 192 ARG A N     1 
ATOM   1497  C  CA    . ARG A 1 192 ? 13.726  1.613   -9.671  1.00 46.74  ? 192 ARG A CA    1 
ATOM   1498  C  C     . ARG A 1 192 ? 14.435  1.535   -11.008 1.00 45.86  ? 192 ARG A C     1 
ATOM   1499  O  O     . ARG A 1 192 ? 14.707  0.444   -11.505 1.00 47.01  ? 192 ARG A O     1 
ATOM   1500  C  CB    . ARG A 1 192 ? 14.764  1.657   -8.557  1.00 49.56  ? 192 ARG A CB    1 
ATOM   1501  C  CG    . ARG A 1 192 ? 14.195  1.846   -7.173  1.00 53.78  ? 192 ARG A CG    1 
ATOM   1502  C  CD    . ARG A 1 192 ? 14.593  3.206   -6.660  1.00 58.42  ? 192 ARG A CD    1 
ATOM   1503  N  NE    . ARG A 1 192 ? 13.809  3.623   -5.504  1.00 64.11  ? 192 ARG A NE    1 
ATOM   1504  C  CZ    . ARG A 1 192 ? 13.773  4.875   -5.052  1.00 66.83  ? 192 ARG A CZ    1 
ATOM   1505  N  NH1   . ARG A 1 192 ? 14.485  5.814   -5.671  1.00 67.54  ? 192 ARG A NH1   1 
ATOM   1506  N  NH2   . ARG A 1 192 ? 13.023  5.191   -3.995  1.00 66.77  ? 192 ARG A NH2   1 
ATOM   1507  N  N     . VAL A 1 193 ? 14.748  2.690   -11.581 1.00 44.21  ? 193 VAL A N     1 
ATOM   1508  C  CA    . VAL A 1 193 ? 15.429  2.741   -12.863 1.00 42.29  ? 193 VAL A CA    1 
ATOM   1509  C  C     . VAL A 1 193 ? 16.234  4.055   -12.927 1.00 42.97  ? 193 VAL A C     1 
ATOM   1510  O  O     . VAL A 1 193 ? 15.799  5.070   -12.372 1.00 44.01  ? 193 VAL A O     1 
ATOM   1511  C  CB    . VAL A 1 193 ? 14.383  2.660   -13.998 1.00 40.05  ? 193 VAL A CB    1 
ATOM   1512  C  CG1   . VAL A 1 193 ? 13.735  4.005   -14.220 1.00 41.33  ? 193 VAL A CG1   1 
ATOM   1513  C  CG2   . VAL A 1 193 ? 15.012  2.155   -15.241 1.00 41.74  ? 193 VAL A CG2   1 
ATOM   1514  N  N     . ARG A 1 194 ? 17.414  4.036   -13.559 1.00 42.11  ? 194 ARG A N     1 
ATOM   1515  C  CA    . ARG A 1 194 ? 18.234  5.253   -13.684 1.00 39.81  ? 194 ARG A CA    1 
ATOM   1516  C  C     . ARG A 1 194 ? 18.582  5.656   -15.128 1.00 38.37  ? 194 ARG A C     1 
ATOM   1517  O  O     . ARG A 1 194 ? 18.528  4.855   -16.067 1.00 35.37  ? 194 ARG A O     1 
ATOM   1518  C  CB    . ARG A 1 194 ? 19.523  5.156   -12.850 1.00 40.72  ? 194 ARG A CB    1 
ATOM   1519  C  CG    . ARG A 1 194 ? 20.537  4.102   -13.283 1.00 43.49  ? 194 ARG A CG    1 
ATOM   1520  C  CD    . ARG A 1 194 ? 21.772  4.716   -13.935 1.00 48.04  ? 194 ARG A CD    1 
ATOM   1521  N  NE    . ARG A 1 194 ? 22.757  3.702   -14.338 1.00 51.93  ? 194 ARG A NE    1 
ATOM   1522  C  CZ    . ARG A 1 194 ? 23.650  3.856   -15.318 1.00 52.73  ? 194 ARG A CZ    1 
ATOM   1523  N  NH1   . ARG A 1 194 ? 23.696  4.984   -16.010 1.00 54.25  ? 194 ARG A NH1   1 
ATOM   1524  N  NH2   . ARG A 1 194 ? 24.496  2.880   -15.620 1.00 52.83  ? 194 ARG A NH2   1 
ATOM   1525  N  N     . ASN A 1 195 ? 18.927  6.929   -15.275 1.00 37.60  ? 195 ASN A N     1 
ATOM   1526  C  CA    . ASN A 1 195 ? 19.260  7.515   -16.559 1.00 37.15  ? 195 ASN A CA    1 
ATOM   1527  C  C     . ASN A 1 195 ? 20.475  6.911   -17.194 1.00 37.58  ? 195 ASN A C     1 
ATOM   1528  O  O     . ASN A 1 195 ? 21.577  7.011   -16.667 1.00 38.09  ? 195 ASN A O     1 
ATOM   1529  C  CB    . ASN A 1 195 ? 19.497  9.021   -16.437 1.00 36.74  ? 195 ASN A CB    1 
ATOM   1530  C  CG    . ASN A 1 195 ? 18.215  9.808   -16.347 1.00 36.16  ? 195 ASN A CG    1 
ATOM   1531  O  OD1   . ASN A 1 195 ? 17.177  9.362   -16.818 1.00 36.95  ? 195 ASN A OD1   1 
ATOM   1532  N  ND2   . ASN A 1 195 ? 18.283  11.002  -15.759 1.00 35.80  ? 195 ASN A ND2   1 
ATOM   1533  N  N     . ALA A 1 196 ? 20.265  6.313   -18.355 1.00 37.68  ? 196 ALA A N     1 
ATOM   1534  C  CA    . ALA A 1 196 ? 21.339  5.708   -19.113 1.00 36.69  ? 196 ALA A CA    1 
ATOM   1535  C  C     . ALA A 1 196 ? 22.458  6.737   -19.301 1.00 35.17  ? 196 ALA A C     1 
ATOM   1536  O  O     . ALA A 1 196 ? 23.645  6.409   -19.238 1.00 34.67  ? 196 ALA A O     1 
ATOM   1537  C  CB    . ALA A 1 196 ? 20.798  5.247   -20.471 1.00 36.32  ? 196 ALA A CB    1 
ATOM   1538  N  N     . TYR A 1 197 ? 22.057  7.987   -19.495 1.00 34.16  ? 197 TYR A N     1 
ATOM   1539  C  CA    . TYR A 1 197 ? 22.979  9.091   -19.730 1.00 34.49  ? 197 TYR A CA    1 
ATOM   1540  C  C     . TYR A 1 197 ? 23.580  9.832   -18.545 1.00 35.81  ? 197 TYR A C     1 
ATOM   1541  O  O     . TYR A 1 197 ? 24.403  10.726  -18.741 1.00 35.45  ? 197 TYR A O     1 
ATOM   1542  C  CB    . TYR A 1 197 ? 22.318  10.112  -20.638 1.00 34.63  ? 197 TYR A CB    1 
ATOM   1543  C  CG    . TYR A 1 197 ? 20.880  10.417  -20.289 1.00 34.30  ? 197 TYR A CG    1 
ATOM   1544  C  CD1   . TYR A 1 197 ? 19.841  9.626   -20.788 1.00 34.48  ? 197 TYR A CD1   1 
ATOM   1545  C  CD2   . TYR A 1 197 ? 20.557  11.512  -19.495 1.00 31.15  ? 197 TYR A CD2   1 
ATOM   1546  C  CE1   . TYR A 1 197 ? 18.524  9.919   -20.516 1.00 33.81  ? 197 TYR A CE1   1 
ATOM   1547  C  CE2   . TYR A 1 197 ? 19.245  11.817  -19.215 1.00 32.51  ? 197 TYR A CE2   1 
ATOM   1548  C  CZ    . TYR A 1 197 ? 18.225  11.018  -19.730 1.00 34.05  ? 197 TYR A CZ    1 
ATOM   1549  O  OH    . TYR A 1 197 ? 16.902  11.335  -19.489 1.00 32.76  ? 197 TYR A OH    1 
ATOM   1550  N  N     . ASP A 1 198 ? 23.156  9.500   -17.330 1.00 37.87  ? 198 ASP A N     1 
ATOM   1551  C  CA    . ASP A 1 198 ? 23.710  10.123  -16.136 1.00 39.48  ? 198 ASP A CA    1 
ATOM   1552  C  C     . ASP A 1 198 ? 23.331  9.346   -14.860 1.00 41.52  ? 198 ASP A C     1 
ATOM   1553  O  O     . ASP A 1 198 ? 22.855  8.215   -14.942 1.00 40.95  ? 198 ASP A O     1 
ATOM   1554  C  CB    . ASP A 1 198 ? 23.320  11.611  -16.057 1.00 38.94  ? 198 ASP A CB    1 
ATOM   1555  C  CG    . ASP A 1 198 ? 21.872  11.834  -15.686 1.00 40.10  ? 198 ASP A CG    1 
ATOM   1556  O  OD1   . ASP A 1 198 ? 21.411  11.228  -14.705 1.00 42.55  ? 198 ASP A OD1   1 
ATOM   1557  O  OD2   . ASP A 1 198 ? 21.195  12.640  -16.354 1.00 40.15  ? 198 ASP A OD2   1 
ATOM   1558  N  N     . ARG A 1 199 ? 23.543  9.946   -13.689 1.00 43.06  ? 199 ARG A N     1 
ATOM   1559  C  CA    . ARG A 1 199 ? 23.285  9.282   -12.406 1.00 43.93  ? 199 ARG A CA    1 
ATOM   1560  C  C     . ARG A 1 199 ? 21.865  9.257   -11.835 1.00 42.38  ? 199 ARG A C     1 
ATOM   1561  O  O     . ARG A 1 199 ? 21.543  8.379   -11.034 1.00 42.45  ? 199 ARG A O     1 
ATOM   1562  C  CB    . ARG A 1 199 ? 24.220  9.872   -11.343 1.00 48.72  ? 199 ARG A CB    1 
ATOM   1563  C  CG    . ARG A 1 199 ? 25.706  9.587   -11.542 1.00 55.42  ? 199 ARG A CG    1 
ATOM   1564  C  CD    . ARG A 1 199 ? 26.177  8.417   -10.673 1.00 61.82  ? 199 ARG A CD    1 
ATOM   1565  N  NE    . ARG A 1 199 ? 25.561  7.136   -11.042 1.00 67.96  ? 199 ARG A NE    1 
ATOM   1566  C  CZ    . ARG A 1 199 ? 26.039  6.297   -11.965 1.00 71.07  ? 199 ARG A CZ    1 
ATOM   1567  N  NH1   . ARG A 1 199 ? 27.160  6.595   -12.630 1.00 71.42  ? 199 ARG A NH1   1 
ATOM   1568  N  NH2   . ARG A 1 199 ? 25.396  5.155   -12.227 1.00 71.00  ? 199 ARG A NH2   1 
ATOM   1569  N  N     . ARG A 1 200 ? 21.034  10.220  -12.228 1.00 39.96  ? 200 ARG A N     1 
ATOM   1570  C  CA    . ARG A 1 200 ? 19.645  10.353  -11.753 1.00 37.82  ? 200 ARG A CA    1 
ATOM   1571  C  C     . ARG A 1 200 ? 18.784  9.066   -11.785 1.00 34.59  ? 200 ARG A C     1 
ATOM   1572  O  O     . ARG A 1 200 ? 18.746  8.356   -12.773 1.00 31.51  ? 200 ARG A O     1 
ATOM   1573  C  CB    . ARG A 1 200 ? 18.973  11.460  -12.569 1.00 38.58  ? 200 ARG A CB    1 
ATOM   1574  C  CG    . ARG A 1 200 ? 17.810  12.172  -11.931 1.00 41.59  ? 200 ARG A CG    1 
ATOM   1575  C  CD    . ARG A 1 200 ? 17.240  13.165  -12.937 1.00 46.79  ? 200 ARG A CD    1 
ATOM   1576  N  NE    . ARG A 1 200 ? 15.998  13.797  -12.493 1.00 52.27  ? 200 ARG A NE    1 
ATOM   1577  C  CZ    . ARG A 1 200 ? 15.935  14.816  -11.645 1.00 54.10  ? 200 ARG A CZ    1 
ATOM   1578  N  NH1   . ARG A 1 200 ? 17.057  15.325  -11.147 1.00 56.62  ? 200 ARG A NH1   1 
ATOM   1579  N  NH2   . ARG A 1 200 ? 14.754  15.322  -11.295 1.00 53.82  ? 200 ARG A NH2   1 
ATOM   1580  N  N     . THR A 1 201 ? 18.095  8.762   -10.691 1.00 34.45  ? 201 THR A N     1 
ATOM   1581  C  CA    . THR A 1 201 ? 17.256  7.563   -10.655 1.00 35.66  ? 201 THR A CA    1 
ATOM   1582  C  C     . THR A 1 201 ? 15.781  7.914   -10.426 1.00 36.23  ? 201 THR A C     1 
ATOM   1583  O  O     . THR A 1 201 ? 15.459  8.908   -9.781  1.00 35.05  ? 201 THR A O     1 
ATOM   1584  C  CB    . THR A 1 201 ? 17.689  6.577   -9.543  1.00 34.28  ? 201 THR A CB    1 
ATOM   1585  O  OG1   . THR A 1 201 ? 16.880  6.783   -8.388  1.00 35.70  ? 201 THR A OG1   1 
ATOM   1586  C  CG2   . THR A 1 201 ? 19.131  6.789   -9.163  1.00 32.25  ? 201 THR A CG2   1 
ATOM   1587  N  N     . TRP A 1 202 ? 14.882  7.102   -10.967 1.00 37.32  ? 202 TRP A N     1 
ATOM   1588  C  CA    . TRP A 1 202 ? 13.471  7.374   -10.796 1.00 38.53  ? 202 TRP A CA    1 
ATOM   1589  C  C     . TRP A 1 202 ? 12.757  6.131   -10.355 1.00 39.18  ? 202 TRP A C     1 
ATOM   1590  O  O     . TRP A 1 202 ? 13.364  5.085   -10.164 1.00 39.98  ? 202 TRP A O     1 
ATOM   1591  C  CB    . TRP A 1 202 ? 12.805  7.820   -12.092 1.00 38.32  ? 202 TRP A CB    1 
ATOM   1592  C  CG    . TRP A 1 202 ? 13.606  8.637   -13.023 1.00 39.12  ? 202 TRP A CG    1 
ATOM   1593  C  CD1   . TRP A 1 202 ? 14.604  8.202   -13.834 1.00 39.47  ? 202 TRP A CD1   1 
ATOM   1594  C  CD2   . TRP A 1 202 ? 13.423  10.030  -13.316 1.00 40.82  ? 202 TRP A CD2   1 
ATOM   1595  N  NE1   . TRP A 1 202 ? 15.056  9.233   -14.627 1.00 40.24  ? 202 TRP A NE1   1 
ATOM   1596  C  CE2   . TRP A 1 202 ? 14.349  10.368  -14.330 1.00 40.41  ? 202 TRP A CE2   1 
ATOM   1597  C  CE3   . TRP A 1 202 ? 12.562  11.026  -12.823 1.00 41.57  ? 202 TRP A CE3   1 
ATOM   1598  C  CZ2   . TRP A 1 202 ? 14.445  11.660  -14.866 1.00 40.08  ? 202 TRP A CZ2   1 
ATOM   1599  C  CZ3   . TRP A 1 202 ? 12.655  12.315  -13.355 1.00 42.07  ? 202 TRP A CZ3   1 
ATOM   1600  C  CH2   . TRP A 1 202 ? 13.595  12.618  -14.370 1.00 41.05  ? 202 TRP A CH2   1 
ATOM   1601  N  N     . GLU A 1 203 ? 11.444  6.268   -10.217 1.00 39.44  ? 203 GLU A N     1 
ATOM   1602  C  CA    . GLU A 1 203 ? 10.578  5.175   -9.824  1.00 39.22  ? 203 GLU A CA    1 
ATOM   1603  C  C     . GLU A 1 203 ? 9.912   4.694   -11.115 1.00 37.19  ? 203 GLU A C     1 
ATOM   1604  O  O     . GLU A 1 203 ? 9.304   5.485   -11.834 1.00 36.93  ? 203 GLU A O     1 
ATOM   1605  C  CB    . GLU A 1 203 ? 9.515   5.689   -8.851  1.00 41.89  ? 203 GLU A CB    1 
ATOM   1606  C  CG    . GLU A 1 203 ? 10.041  6.644   -7.778  1.00 47.14  ? 203 GLU A CG    1 
ATOM   1607  C  CD    . GLU A 1 203 ? 10.575  5.926   -6.549  1.00 51.10  ? 203 GLU A CD    1 
ATOM   1608  O  OE1   . GLU A 1 203 ? 10.680  4.677   -6.584  1.00 52.06  ? 203 GLU A OE1   1 
ATOM   1609  O  OE2   . GLU A 1 203 ? 10.892  6.614   -5.548  1.00 53.54  ? 203 GLU A OE2   1 
ATOM   1610  N  N     . LEU A 1 204 ? 10.038  3.414   -11.435 1.00 34.43  ? 204 LEU A N     1 
ATOM   1611  C  CA    . LEU A 1 204 ? 9.398   2.929   -12.637 1.00 34.27  ? 204 LEU A CA    1 
ATOM   1612  C  C     . LEU A 1 204 ? 7.905   2.634   -12.352 1.00 36.09  ? 204 LEU A C     1 
ATOM   1613  O  O     . LEU A 1 204 ? 7.575   1.737   -11.577 1.00 37.06  ? 204 LEU A O     1 
ATOM   1614  C  CB    . LEU A 1 204 ? 10.095  1.670   -13.137 1.00 31.71  ? 204 LEU A CB    1 
ATOM   1615  C  CG    . LEU A 1 204 ? 10.167  1.470   -14.657 1.00 32.06  ? 204 LEU A CG    1 
ATOM   1616  C  CD1   . LEU A 1 204 ? 9.943   -0.001  -14.963 1.00 32.89  ? 204 LEU A CD1   1 
ATOM   1617  C  CD2   . LEU A 1 204 ? 9.142   2.296   -15.389 1.00 30.21  ? 204 LEU A CD2   1 
ATOM   1618  N  N     . LEU A 1 205 ? 7.015   3.397   -12.982 1.00 36.22  ? 205 LEU A N     1 
ATOM   1619  C  CA    . LEU A 1 205 ? 5.578   3.230   -12.820 1.00 36.74  ? 205 LEU A CA    1 
ATOM   1620  C  C     . LEU A 1 205 ? 4.969   2.244   -13.830 1.00 38.49  ? 205 LEU A C     1 
ATOM   1621  O  O     . LEU A 1 205 ? 4.475   1.176   -13.454 1.00 38.02  ? 205 LEU A O     1 
ATOM   1622  C  CB    . LEU A 1 205 ? 4.880   4.579   -12.980 1.00 36.43  ? 205 LEU A CB    1 
ATOM   1623  C  CG    . LEU A 1 205 ? 5.313   5.779   -12.138 1.00 36.61  ? 205 LEU A CG    1 
ATOM   1624  C  CD1   . LEU A 1 205 ? 4.652   7.050   -12.681 1.00 37.38  ? 205 LEU A CD1   1 
ATOM   1625  C  CD2   . LEU A 1 205 ? 4.928   5.568   -10.701 1.00 37.14  ? 205 LEU A CD2   1 
ATOM   1626  N  N     . ARG A 1 206 ? 4.982   2.619   -15.109 1.00 39.89  ? 206 ARG A N     1 
ATOM   1627  C  CA    . ARG A 1 206 ? 4.415   1.775   -16.165 1.00 41.08  ? 206 ARG A CA    1 
ATOM   1628  C  C     . ARG A 1 206 ? 5.202   1.842   -17.441 1.00 41.64  ? 206 ARG A C     1 
ATOM   1629  O  O     . ARG A 1 206 ? 6.198   2.535   -17.571 1.00 41.74  ? 206 ARG A O     1 
ATOM   1630  C  CB    . ARG A 1 206 ? 3.029   2.230   -16.622 1.00 40.34  ? 206 ARG A CB    1 
ATOM   1631  C  CG    . ARG A 1 206 ? 2.048   2.678   -15.620 1.00 41.86  ? 206 ARG A CG    1 
ATOM   1632  C  CD    . ARG A 1 206 ? 1.428   3.988   -16.107 1.00 41.99  ? 206 ARG A CD    1 
ATOM   1633  N  NE    . ARG A 1 206 ? 1.141   3.993   -17.538 1.00 41.79  ? 206 ARG A NE    1 
ATOM   1634  C  CZ    . ARG A 1 206 ? 0.874   5.098   -18.232 1.00 44.00  ? 206 ARG A CZ    1 
ATOM   1635  N  NH1   . ARG A 1 206 ? 0.858   6.280   -17.627 1.00 44.21  ? 206 ARG A NH1   1 
ATOM   1636  N  NH2   . ARG A 1 206 ? 0.629   5.035   -19.534 1.00 44.79  ? 206 ARG A NH2   1 
ATOM   1637  N  N     . LEU A 1 207 ? 4.664   1.128   -18.410 1.00 42.98  ? 207 LEU A N     1 
ATOM   1638  C  CA    . LEU A 1 207 ? 5.180   1.128   -19.744 1.00 45.76  ? 207 LEU A CA    1 
ATOM   1639  C  C     . LEU A 1 207 ? 4.017   1.842   -20.427 1.00 47.21  ? 207 LEU A C     1 
ATOM   1640  O  O     . LEU A 1 207 ? 3.011   2.115   -19.785 1.00 46.58  ? 207 LEU A O     1 
ATOM   1641  C  CB    . LEU A 1 207 ? 5.337   -0.301  -20.254 1.00 46.83  ? 207 LEU A CB    1 
ATOM   1642  C  CG    . LEU A 1 207 ? 6.797   -0.756  -20.347 1.00 47.25  ? 207 LEU A CG    1 
ATOM   1643  C  CD1   . LEU A 1 207 ? 7.407   -0.857  -18.970 1.00 46.74  ? 207 LEU A CD1   1 
ATOM   1644  C  CD2   . LEU A 1 207 ? 6.857   -2.094  -21.026 1.00 47.68  ? 207 LEU A CD2   1 
ATOM   1645  N  N     . GLY A 1 208 ? 4.142   2.163   -21.706 1.00 49.96  ? 208 GLY A N     1 
ATOM   1646  C  CA    . GLY A 1 208 ? 3.061   2.847   -22.383 1.00 51.98  ? 208 GLY A CA    1 
ATOM   1647  C  C     . GLY A 1 208 ? 3.012   2.439   -23.831 1.00 54.49  ? 208 GLY A C     1 
ATOM   1648  O  O     . GLY A 1 208 ? 4.051   2.182   -24.441 1.00 54.11  ? 208 GLY A O     1 
ATOM   1649  N  N     . GLU A 1 209 ? 1.804   2.348   -24.376 1.00 57.47  ? 209 GLU A N     1 
ATOM   1650  C  CA    . GLU A 1 209 ? 1.627   1.989   -25.777 1.00 60.02  ? 209 GLU A CA    1 
ATOM   1651  C  C     . GLU A 1 209 ? 1.751   3.287   -26.570 1.00 59.25  ? 209 GLU A C     1 
ATOM   1652  O  O     . GLU A 1 209 ? 1.801   3.287   -27.803 1.00 59.28  ? 209 GLU A O     1 
ATOM   1653  C  CB    . GLU A 1 209 ? 0.249   1.371   -26.011 1.00 63.33  ? 209 GLU A CB    1 
ATOM   1654  C  CG    . GLU A 1 209 ? 0.266   -0.079  -26.495 1.00 69.26  ? 209 GLU A CG    1 
ATOM   1655  C  CD    . GLU A 1 209 ? 0.209   -1.088  -25.360 1.00 73.57  ? 209 GLU A CD    1 
ATOM   1656  O  OE1   . GLU A 1 209 ? -0.645  -0.923  -24.454 1.00 76.82  ? 209 GLU A OE1   1 
ATOM   1657  O  OE2   . GLU A 1 209 ? 1.007   -2.052  -25.383 1.00 75.41  ? 209 GLU A OE2   1 
ATOM   1658  N  N     . GLU A 1 210 ? 1.807   4.393   -25.836 1.00 57.61  ? 210 GLU A N     1 
ATOM   1659  C  CA    . GLU A 1 210 ? 1.929   5.706   -26.434 1.00 57.04  ? 210 GLU A CA    1 
ATOM   1660  C  C     . GLU A 1 210 ? 3.112   5.816   -27.390 1.00 57.17  ? 210 GLU A C     1 
ATOM   1661  O  O     . GLU A 1 210 ? 4.195   5.292   -27.144 1.00 56.38  ? 210 GLU A O     1 
ATOM   1662  C  CB    . GLU A 1 210 ? 2.054   6.741   -25.333 1.00 56.50  ? 210 GLU A CB    1 
ATOM   1663  C  CG    . GLU A 1 210 ? 0.884   6.728   -24.410 1.00 59.52  ? 210 GLU A CG    1 
ATOM   1664  C  CD    . GLU A 1 210 ? 1.259   7.152   -23.022 1.00 61.80  ? 210 GLU A CD    1 
ATOM   1665  O  OE1   . GLU A 1 210 ? 1.882   8.227   -22.892 1.00 62.28  ? 210 GLU A OE1   1 
ATOM   1666  O  OE2   . GLU A 1 210 ? 0.930   6.411   -22.067 1.00 63.21  ? 210 GLU A OE2   1 
ATOM   1667  N  N     . ASP A 1 211 ? 2.884   6.510   -28.491 1.00 57.71  ? 211 ASP A N     1 
ATOM   1668  C  CA    . ASP A 1 211 ? 3.902   6.718   -29.496 1.00 57.99  ? 211 ASP A CA    1 
ATOM   1669  C  C     . ASP A 1 211 ? 4.870   7.812   -29.049 1.00 58.01  ? 211 ASP A C     1 
ATOM   1670  O  O     . ASP A 1 211 ? 4.455   8.938   -28.782 1.00 58.34  ? 211 ASP A O     1 
ATOM   1671  C  CB    . ASP A 1 211 ? 3.225   7.121   -30.794 1.00 60.52  ? 211 ASP A CB    1 
ATOM   1672  C  CG    . ASP A 1 211 ? 4.200   7.597   -31.830 1.00 63.09  ? 211 ASP A CG    1 
ATOM   1673  O  OD1   . ASP A 1 211 ? 5.183   6.866   -32.101 1.00 64.31  ? 211 ASP A OD1   1 
ATOM   1674  O  OD2   . ASP A 1 211 ? 3.976   8.702   -32.375 1.00 64.85  ? 211 ASP A OD2   1 
ATOM   1675  N  N     . PRO A 1 212 ? 6.173   7.491   -28.954 1.00 57.38  ? 212 PRO A N     1 
ATOM   1676  C  CA    . PRO A 1 212 ? 7.234   8.421   -28.541 1.00 56.78  ? 212 PRO A CA    1 
ATOM   1677  C  C     . PRO A 1 212 ? 7.253   9.703   -29.360 1.00 57.21  ? 212 PRO A C     1 
ATOM   1678  O  O     . PRO A 1 212 ? 7.695   10.757  -28.890 1.00 56.38  ? 212 PRO A O     1 
ATOM   1679  C  CB    . PRO A 1 212 ? 8.500   7.602   -28.736 1.00 55.99  ? 212 PRO A CB    1 
ATOM   1680  C  CG    . PRO A 1 212 ? 8.038   6.222   -28.388 1.00 56.94  ? 212 PRO A CG    1 
ATOM   1681  C  CD    . PRO A 1 212 ? 6.713   6.130   -29.116 1.00 57.56  ? 212 PRO A CD    1 
ATOM   1682  N  N     . LYS A 1 213 ? 6.772   9.597   -30.593 1.00 58.06  ? 213 LYS A N     1 
ATOM   1683  C  CA    . LYS A 1 213 ? 6.715   10.732  -31.497 1.00 59.17  ? 213 LYS A CA    1 
ATOM   1684  C  C     . LYS A 1 213 ? 5.476   11.605  -31.287 1.00 60.11  ? 213 LYS A C     1 
ATOM   1685  O  O     . LYS A 1 213 ? 5.367   12.674  -31.878 1.00 60.70  ? 213 LYS A O     1 
ATOM   1686  C  CB    . LYS A 1 213 ? 6.726   10.247  -32.935 1.00 58.87  ? 213 LYS A CB    1 
ATOM   1687  C  CG    . LYS A 1 213 ? 7.952   10.616  -33.718 1.00 59.11  ? 213 LYS A CG    1 
ATOM   1688  C  CD    . LYS A 1 213 ? 8.992   9.532   -33.613 1.00 59.98  ? 213 LYS A CD    1 
ATOM   1689  C  CE    . LYS A 1 213 ? 9.847   9.474   -34.878 1.00 59.42  ? 213 LYS A CE    1 
ATOM   1690  N  NZ    . LYS A 1 213 ? 9.059   8.976   -36.042 1.00 58.71  ? 213 LYS A NZ    1 
ATOM   1691  N  N     . GLU A 1 214 ? 4.537   11.154  -30.462 1.00 61.36  ? 214 GLU A N     1 
ATOM   1692  C  CA    . GLU A 1 214 ? 3.318   11.927  -30.209 1.00 61.84  ? 214 GLU A CA    1 
ATOM   1693  C  C     . GLU A 1 214 ? 3.384   12.672  -28.877 1.00 61.39  ? 214 GLU A C     1 
ATOM   1694  O  O     . GLU A 1 214 ? 2.842   13.770  -28.751 1.00 62.57  ? 214 GLU A O     1 
ATOM   1695  C  CB    . GLU A 1 214 ? 2.086   11.010  -30.239 1.00 61.97  ? 214 GLU A CB    1 
ATOM   1696  N  N     . LEU A 1 215 ? 4.045   12.075  -27.888 1.00 60.00  ? 215 LEU A N     1 
ATOM   1697  C  CA    . LEU A 1 215 ? 4.175   12.699  -26.581 1.00 57.86  ? 215 LEU A CA    1 
ATOM   1698  C  C     . LEU A 1 215 ? 4.692   14.105  -26.706 1.00 58.48  ? 215 LEU A C     1 
ATOM   1699  O  O     . LEU A 1 215 ? 5.813   14.341  -27.144 1.00 58.28  ? 215 LEU A O     1 
ATOM   1700  C  CB    . LEU A 1 215 ? 5.111   11.904  -25.680 1.00 55.83  ? 215 LEU A CB    1 
ATOM   1701  C  CG    . LEU A 1 215 ? 4.383   10.956  -24.745 1.00 54.39  ? 215 LEU A CG    1 
ATOM   1702  C  CD1   . LEU A 1 215 ? 3.484   11.760  -23.827 1.00 55.02  ? 215 LEU A CD1   1 
ATOM   1703  C  CD2   . LEU A 1 215 ? 3.564   9.978   -25.561 1.00 54.88  ? 215 LEU A CD2   1 
ATOM   1704  N  N     . PRO A 1 216 ? 3.862   15.071  -26.336 1.00 60.16  ? 216 PRO A N     1 
ATOM   1705  C  CA    . PRO A 1 216 ? 4.272   16.466  -26.417 1.00 61.26  ? 216 PRO A CA    1 
ATOM   1706  C  C     . PRO A 1 216 ? 4.697   16.959  -25.042 1.00 61.58  ? 216 PRO A C     1 
ATOM   1707  O  O     . PRO A 1 216 ? 4.077   16.624  -24.037 1.00 61.38  ? 216 PRO A O     1 
ATOM   1708  C  CB    . PRO A 1 216 ? 3.018   17.148  -26.948 1.00 61.84  ? 216 PRO A CB    1 
ATOM   1709  C  CG    . PRO A 1 216 ? 1.888   16.346  -26.323 1.00 61.07  ? 216 PRO A CG    1 
ATOM   1710  C  CD    . PRO A 1 216 ? 2.421   14.946  -26.052 1.00 60.91  ? 216 PRO A CD    1 
ATOM   1711  N  N     . LEU A 1 217 ? 5.773   17.731  -25.000 1.00 62.36  ? 217 LEU A N     1 
ATOM   1712  C  CA    . LEU A 1 217 ? 6.261   18.264  -23.741 1.00 63.84  ? 217 LEU A CA    1 
ATOM   1713  C  C     . LEU A 1 217 ? 5.846   19.721  -23.580 1.00 65.88  ? 217 LEU A C     1 
ATOM   1714  O  O     . LEU A 1 217 ? 5.538   20.405  -24.558 1.00 65.59  ? 217 LEU A O     1 
ATOM   1715  C  CB    . LEU A 1 217 ? 7.787   18.143  -23.662 1.00 62.24  ? 217 LEU A CB    1 
ATOM   1716  C  CG    . LEU A 1 217 ? 8.369   16.731  -23.584 1.00 60.19  ? 217 LEU A CG    1 
ATOM   1717  C  CD1   . LEU A 1 217 ? 9.870   16.805  -23.393 1.00 59.22  ? 217 LEU A CD1   1 
ATOM   1718  C  CD2   . LEU A 1 217 ? 7.741   15.991  -22.428 1.00 59.53  ? 217 LEU A CD2   1 
ATOM   1719  N  N     . PRO A 1 218 ? 5.825   20.209  -22.332 1.00 67.89  ? 218 PRO A N     1 
ATOM   1720  C  CA    . PRO A 1 218 ? 5.456   21.578  -21.974 1.00 69.66  ? 218 PRO A CA    1 
ATOM   1721  C  C     . PRO A 1 218 ? 5.983   22.651  -22.923 1.00 71.30  ? 218 PRO A C     1 
ATOM   1722  O  O     . PRO A 1 218 ? 5.545   23.803  -22.876 1.00 71.47  ? 218 PRO A O     1 
ATOM   1723  C  CB    . PRO A 1 218 ? 6.023   21.712  -20.570 1.00 70.21  ? 218 PRO A CB    1 
ATOM   1724  C  CG    . PRO A 1 218 ? 5.745   20.349  -20.001 1.00 70.08  ? 218 PRO A CG    1 
ATOM   1725  C  CD    . PRO A 1 218 ? 6.188   19.438  -21.127 1.00 69.21  ? 218 PRO A CD    1 
ATOM   1726  N  N     . GLY A 1 219 ? 6.922   22.276  -23.784 1.00 73.06  ? 219 GLY A N     1 
ATOM   1727  C  CA    . GLY A 1 219 ? 7.469   23.241  -24.719 1.00 75.50  ? 219 GLY A CA    1 
ATOM   1728  C  C     . GLY A 1 219 ? 6.813   23.171  -26.086 1.00 76.99  ? 219 GLY A C     1 
ATOM   1729  O  O     . GLY A 1 219 ? 6.839   24.144  -26.853 1.00 77.96  ? 219 GLY A O     1 
ATOM   1730  N  N     . GLY A 1 220 ? 6.201   22.026  -26.382 1.00 76.72  ? 220 GLY A N     1 
ATOM   1731  C  CA    . GLY A 1 220 ? 5.572   21.823  -27.676 1.00 75.10  ? 220 GLY A CA    1 
ATOM   1732  C  C     . GLY A 1 220 ? 6.478   20.911  -28.494 1.00 73.87  ? 220 GLY A C     1 
ATOM   1733  O  O     . GLY A 1 220 ? 6.217   20.610  -29.661 1.00 73.64  ? 220 GLY A O     1 
ATOM   1734  N  N     . LEU A 1 221 ? 7.559   20.472  -27.852 1.00 71.92  ? 221 LEU A N     1 
ATOM   1735  C  CA    . LEU A 1 221 ? 8.539   19.592  -28.465 1.00 68.75  ? 221 LEU A CA    1 
ATOM   1736  C  C     . LEU A 1 221 ? 8.097   18.149  -28.266 1.00 66.74  ? 221 LEU A C     1 
ATOM   1737  O  O     . LEU A 1 221 ? 7.190   17.876  -27.490 1.00 67.58  ? 221 LEU A O     1 
ATOM   1738  C  CB    . LEU A 1 221 ? 9.895   19.829  -27.811 1.00 68.61  ? 221 LEU A CB    1 
ATOM   1739  C  CG    . LEU A 1 221 ? 11.114  19.176  -28.454 1.00 68.90  ? 221 LEU A CG    1 
ATOM   1740  C  CD1   . LEU A 1 221 ? 11.130  19.441  -29.962 1.00 68.47  ? 221 LEU A CD1   1 
ATOM   1741  C  CD2   . LEU A 1 221 ? 12.370  19.723  -27.779 1.00 68.72  ? 221 LEU A CD2   1 
ATOM   1742  N  N     . SER A 1 222 ? 8.726   17.215  -28.958 1.00 64.37  ? 222 SER A N     1 
ATOM   1743  C  CA    . SER A 1 222 ? 8.326   15.827  -28.806 1.00 62.47  ? 222 SER A CA    1 
ATOM   1744  C  C     . SER A 1 222 ? 9.271   15.013  -27.932 1.00 61.42  ? 222 SER A C     1 
ATOM   1745  O  O     . SER A 1 222 ? 10.483  15.232  -27.944 1.00 60.98  ? 222 SER A O     1 
ATOM   1746  C  CB    . SER A 1 222 ? 8.209   15.168  -30.169 1.00 63.16  ? 222 SER A CB    1 
ATOM   1747  O  OG    . SER A 1 222 ? 7.897   13.798  -30.022 1.00 64.93  ? 222 SER A OG    1 
ATOM   1748  N  N     . LEU A 1 223 ? 8.701   14.068  -27.183 1.00 59.23  ? 223 LEU A N     1 
ATOM   1749  C  CA    . LEU A 1 223 ? 9.464   13.201  -26.288 1.00 55.97  ? 223 LEU A CA    1 
ATOM   1750  C  C     . LEU A 1 223 ? 10.721  12.731  -26.996 1.00 55.87  ? 223 LEU A C     1 
ATOM   1751  O  O     . LEU A 1 223 ? 11.837  13.002  -26.546 1.00 55.31  ? 223 LEU A O     1 
ATOM   1752  C  CB    . LEU A 1 223 ? 8.636   11.975  -25.901 1.00 52.92  ? 223 LEU A CB    1 
ATOM   1753  C  CG    . LEU A 1 223 ? 8.852   11.294  -24.544 1.00 50.29  ? 223 LEU A CG    1 
ATOM   1754  C  CD1   . LEU A 1 223 ? 8.338   9.858   -24.647 1.00 48.12  ? 223 LEU A CD1   1 
ATOM   1755  C  CD2   . LEU A 1 223 ? 10.311  11.312  -24.131 1.00 48.38  ? 223 LEU A CD2   1 
ATOM   1756  N  N     . LEU A 1 224 ? 10.529  12.032  -28.111 1.00 55.31  ? 224 LEU A N     1 
ATOM   1757  C  CA    . LEU A 1 224 ? 11.648  11.514  -28.879 1.00 56.22  ? 224 LEU A CA    1 
ATOM   1758  C  C     . LEU A 1 224 ? 12.594  12.642  -29.287 1.00 56.81  ? 224 LEU A C     1 
ATOM   1759  O  O     . LEU A 1 224 ? 13.809  12.561  -29.093 1.00 55.96  ? 224 LEU A O     1 
ATOM   1760  C  CB    . LEU A 1 224 ? 11.141  10.784  -30.123 1.00 56.70  ? 224 LEU A CB    1 
ATOM   1761  C  CG    . LEU A 1 224 ? 12.213  9.976   -30.865 1.00 58.01  ? 224 LEU A CG    1 
ATOM   1762  C  CD1   . LEU A 1 224 ? 12.491  8.689   -30.113 1.00 58.49  ? 224 LEU A CD1   1 
ATOM   1763  C  CD2   . LEU A 1 224 ? 11.754  9.654   -32.265 1.00 58.10  ? 224 LEU A CD2   1 
ATOM   1764  N  N     . ASP A 1 225 ? 12.025  13.703  -29.845 1.00 57.93  ? 225 ASP A N     1 
ATOM   1765  C  CA    . ASP A 1 225 ? 12.805  14.852  -30.292 1.00 58.72  ? 225 ASP A CA    1 
ATOM   1766  C  C     . ASP A 1 225 ? 13.597  15.494  -29.155 1.00 56.87  ? 225 ASP A C     1 
ATOM   1767  O  O     . ASP A 1 225 ? 14.746  15.893  -29.337 1.00 56.08  ? 225 ASP A O     1 
ATOM   1768  C  CB    . ASP A 1 225 ? 11.877  15.896  -30.921 1.00 62.76  ? 225 ASP A CB    1 
ATOM   1769  C  CG    . ASP A 1 225 ? 11.137  15.364  -32.139 1.00 65.57  ? 225 ASP A CG    1 
ATOM   1770  O  OD1   . ASP A 1 225 ? 10.441  14.333  -32.018 1.00 67.82  ? 225 ASP A OD1   1 
ATOM   1771  O  OD2   . ASP A 1 225 ? 11.249  15.980  -33.218 1.00 67.66  ? 225 ASP A OD2   1 
ATOM   1772  N  N     . TYR A 1 226 ? 12.970  15.592  -27.986 1.00 55.57  ? 226 TYR A N     1 
ATOM   1773  C  CA    . TYR A 1 226 ? 13.590  16.192  -26.806 1.00 54.12  ? 226 TYR A CA    1 
ATOM   1774  C  C     . TYR A 1 226 ? 14.932  15.553  -26.466 1.00 54.07  ? 226 TYR A C     1 
ATOM   1775  O  O     . TYR A 1 226 ? 15.933  16.253  -26.245 1.00 53.79  ? 226 TYR A O     1 
ATOM   1776  C  CB    . TYR A 1 226 ? 12.654  16.071  -25.605 1.00 53.06  ? 226 TYR A CB    1 
ATOM   1777  C  CG    . TYR A 1 226 ? 13.293  16.507  -24.311 1.00 52.45  ? 226 TYR A CG    1 
ATOM   1778  C  CD1   . TYR A 1 226 ? 13.569  17.851  -24.057 1.00 51.96  ? 226 TYR A CD1   1 
ATOM   1779  C  CD2   . TYR A 1 226 ? 13.684  15.569  -23.364 1.00 52.89  ? 226 TYR A CD2   1 
ATOM   1780  C  CE1   . TYR A 1 226 ? 14.225  18.242  -22.889 1.00 50.63  ? 226 TYR A CE1   1 
ATOM   1781  C  CE2   . TYR A 1 226 ? 14.339  15.950  -22.201 1.00 52.14  ? 226 TYR A CE2   1 
ATOM   1782  C  CZ    . TYR A 1 226 ? 14.604  17.279  -21.971 1.00 51.12  ? 226 TYR A CZ    1 
ATOM   1783  O  OH    . TYR A 1 226 ? 15.246  17.619  -20.811 1.00 52.17  ? 226 TYR A OH    1 
ATOM   1784  N  N     . HIS A 1 227 ? 14.943  14.223  -26.403 1.00 52.82  ? 227 HIS A N     1 
ATOM   1785  C  CA    . HIS A 1 227 ? 16.166  13.486  -26.108 1.00 50.98  ? 227 HIS A CA    1 
ATOM   1786  C  C     . HIS A 1 227 ? 17.098  13.537  -27.307 1.00 50.28  ? 227 HIS A C     1 
ATOM   1787  O  O     . HIS A 1 227 ? 18.324  13.520  -27.163 1.00 48.94  ? 227 HIS A O     1 
ATOM   1788  C  CB    . HIS A 1 227 ? 15.839  12.036  -25.764 1.00 49.30  ? 227 HIS A CB    1 
ATOM   1789  C  CG    . HIS A 1 227 ? 15.169  11.874  -24.439 1.00 47.80  ? 227 HIS A CG    1 
ATOM   1790  N  ND1   . HIS A 1 227 ? 15.630  12.491  -23.297 1.00 46.88  ? 227 HIS A ND1   1 
ATOM   1791  C  CD2   . HIS A 1 227 ? 14.092  11.144  -24.066 1.00 48.03  ? 227 HIS A CD2   1 
ATOM   1792  C  CE1   . HIS A 1 227 ? 14.866  12.147  -22.277 1.00 47.39  ? 227 HIS A CE1   1 
ATOM   1793  N  NE2   . HIS A 1 227 ? 13.926  11.330  -22.715 1.00 47.10  ? 227 HIS A NE2   1 
ATOM   1794  N  N     . ALA A 1 228 ? 16.492  13.606  -28.488 1.00 50.43  ? 228 ALA A N     1 
ATOM   1795  C  CA    . ALA A 1 228 ? 17.225  13.667  -29.736 1.00 51.56  ? 228 ALA A CA    1 
ATOM   1796  C  C     . ALA A 1 228 ? 17.953  15.003  -29.802 1.00 52.41  ? 228 ALA A C     1 
ATOM   1797  O  O     . ALA A 1 228 ? 19.070  15.099  -30.313 1.00 52.82  ? 228 ALA A O     1 
ATOM   1798  C  CB    . ALA A 1 228 ? 16.262  13.528  -30.895 1.00 51.18  ? 228 ALA A CB    1 
ATOM   1799  N  N     . SER A 1 229 ? 17.311  16.030  -29.264 1.00 53.37  ? 229 SER A N     1 
ATOM   1800  C  CA    . SER A 1 229 ? 17.877  17.368  -29.248 1.00 55.04  ? 229 SER A CA    1 
ATOM   1801  C  C     . SER A 1 229 ? 19.001  17.492  -28.222 1.00 55.83  ? 229 SER A C     1 
ATOM   1802  O  O     . SER A 1 229 ? 19.731  18.479  -28.205 1.00 56.55  ? 229 SER A O     1 
ATOM   1803  C  CB    . SER A 1 229 ? 16.786  18.386  -28.923 1.00 55.88  ? 229 SER A CB    1 
ATOM   1804  O  OG    . SER A 1 229 ? 16.271  18.185  -27.622 0.00 55.47  ? 229 SER A OG    1 
ATOM   1805  N  N     . LYS A 1 230 ? 19.136  16.493  -27.361 1.00 56.25  ? 230 LYS A N     1 
ATOM   1806  C  CA    . LYS A 1 230 ? 20.175  16.511  -26.341 1.00 56.27  ? 230 LYS A CA    1 
ATOM   1807  C  C     . LYS A 1 230 ? 21.284  15.547  -26.694 1.00 56.07  ? 230 LYS A C     1 
ATOM   1808  O  O     . LYS A 1 230 ? 22.214  15.353  -25.910 1.00 55.28  ? 230 LYS A O     1 
ATOM   1809  C  CB    . LYS A 1 230 ? 19.589  16.119  -25.002 1.00 57.58  ? 230 LYS A CB    1 
ATOM   1810  C  CG    . LYS A 1 230 ? 18.615  17.118  -24.457 1.00 59.45  ? 230 LYS A CG    1 
ATOM   1811  C  CD    . LYS A 1 230 ? 19.309  18.032  -23.472 1.00 60.88  ? 230 LYS A CD    1 
ATOM   1812  C  CE    . LYS A 1 230 ? 18.286  18.720  -22.584 1.00 61.00  ? 230 LYS A CE    1 
ATOM   1813  N  NZ    . LYS A 1 230 ? 18.758  18.821  -21.172 1.00 61.96  ? 230 LYS A NZ    1 
ATOM   1814  N  N     . GLY A 1 231 ? 21.166  14.937  -27.873 1.00 55.78  ? 231 GLY A N     1 
ATOM   1815  C  CA    . GLY A 1 231 ? 22.167  14.000  -28.347 1.00 54.28  ? 231 GLY A CA    1 
ATOM   1816  C  C     . GLY A 1 231 ? 22.182  12.710  -27.566 1.00 52.92  ? 231 GLY A C     1 
ATOM   1817  O  O     . GLY A 1 231 ? 23.209  12.045  -27.491 1.00 53.74  ? 231 GLY A O     1 
ATOM   1818  N  N     . ARG A 1 232 ? 21.047  12.356  -26.977 1.00 51.18  ? 232 ARG A N     1 
ATOM   1819  C  CA    . ARG A 1 232 ? 20.963  11.128  -26.206 1.00 49.55  ? 232 ARG A CA    1 
ATOM   1820  C  C     . ARG A 1 232 ? 20.595  9.970   -27.118 1.00 49.45  ? 232 ARG A C     1 
ATOM   1821  O  O     . ARG A 1 232 ? 20.724  8.813   -26.738 1.00 50.33  ? 232 ARG A O     1 
ATOM   1822  C  CB    . ARG A 1 232 ? 19.937  11.277  -25.076 1.00 48.09  ? 232 ARG A CB    1 
ATOM   1823  C  CG    . ARG A 1 232 ? 20.484  11.982  -23.848 1.00 46.51  ? 232 ARG A CG    1 
ATOM   1824  C  CD    . ARG A 1 232 ? 19.395  12.659  -23.058 1.00 46.04  ? 232 ARG A CD    1 
ATOM   1825  N  NE    . ARG A 1 232 ? 19.930  13.421  -21.932 1.00 48.82  ? 232 ARG A NE    1 
ATOM   1826  C  CZ    . ARG A 1 232 ? 19.205  14.248  -21.179 1.00 50.10  ? 232 ARG A CZ    1 
ATOM   1827  N  NH1   . ARG A 1 232 ? 17.915  14.418  -21.443 1.00 51.24  ? 232 ARG A NH1   1 
ATOM   1828  N  NH2   . ARG A 1 232 ? 19.758  14.895  -20.159 1.00 48.15  ? 232 ARG A NH2   1 
ATOM   1829  N  N     . LEU A 1 233 ? 20.153  10.279  -28.331 1.00 48.38  ? 233 LEU A N     1 
ATOM   1830  C  CA    . LEU A 1 233 ? 19.775  9.229   -29.257 1.00 47.57  ? 233 LEU A CA    1 
ATOM   1831  C  C     . LEU A 1 233 ? 20.918  8.862   -30.179 1.00 47.03  ? 233 LEU A C     1 
ATOM   1832  O  O     . LEU A 1 233 ? 20.764  8.057   -31.101 1.00 45.95  ? 233 LEU A O     1 
ATOM   1833  C  CB    . LEU A 1 233 ? 18.552  9.657   -30.062 1.00 47.98  ? 233 LEU A CB    1 
ATOM   1834  C  CG    . LEU A 1 233 ? 17.249  9.608   -29.271 1.00 47.14  ? 233 LEU A CG    1 
ATOM   1835  C  CD1   . LEU A 1 233 ? 16.120  10.016  -30.193 1.00 49.30  ? 233 LEU A CD1   1 
ATOM   1836  C  CD2   . LEU A 1 233 ? 17.006  8.204   -28.724 1.00 46.45  ? 233 LEU A CD2   1 
ATOM   1837  N  N     . GLN A 1 234 ? 22.065  9.482   -29.939 1.00 47.41  ? 234 GLN A N     1 
ATOM   1838  C  CA    . GLN A 1 234 ? 23.259  9.195   -30.723 1.00 48.37  ? 234 GLN A CA    1 
ATOM   1839  C  C     . GLN A 1 234 ? 24.067  8.185   -29.929 1.00 47.01  ? 234 GLN A C     1 
ATOM   1840  O  O     . GLN A 1 234 ? 24.898  8.556   -29.102 1.00 46.47  ? 234 GLN A O     1 
ATOM   1841  C  CB    . GLN A 1 234 ? 24.105  10.456  -30.953 1.00 50.08  ? 234 GLN A CB    1 
ATOM   1842  C  CG    . GLN A 1 234 ? 23.675  11.286  -32.143 1.00 53.84  ? 234 GLN A CG    1 
ATOM   1843  C  CD    . GLN A 1 234 ? 22.536  12.225  -31.822 1.00 56.90  ? 234 GLN A CD    1 
ATOM   1844  O  OE1   . GLN A 1 234 ? 22.752  13.398  -31.524 1.00 58.82  ? 234 GLN A OE1   1 
ATOM   1845  N  NE2   . GLN A 1 234 ? 21.312  11.712  -31.870 1.00 59.62  ? 234 GLN A NE2   1 
ATOM   1846  N  N     . GLY A 1 235 ? 23.803  6.907   -30.174 1.00 45.80  ? 235 GLY A N     1 
ATOM   1847  C  CA    . GLY A 1 235 ? 24.510  5.861   -29.467 1.00 46.12  ? 235 GLY A CA    1 
ATOM   1848  C  C     . GLY A 1 235 ? 23.562  4.914   -28.765 1.00 45.86  ? 235 GLY A C     1 
ATOM   1849  O  O     . GLY A 1 235 ? 23.980  3.868   -28.267 1.00 46.53  ? 235 GLY A O     1 
ATOM   1850  N  N     . ARG A 1 236 ? 22.288  5.292   -28.712 1.00 44.57  ? 236 ARG A N     1 
ATOM   1851  C  CA    . ARG A 1 236 ? 21.267  4.470   -28.084 1.00 43.69  ? 236 ARG A CA    1 
ATOM   1852  C  C     . ARG A 1 236 ? 20.017  4.528   -28.925 1.00 44.29  ? 236 ARG A C     1 
ATOM   1853  O  O     . ARG A 1 236 ? 19.758  5.509   -29.610 1.00 44.24  ? 236 ARG A O     1 
ATOM   1854  C  CB    . ARG A 1 236 ? 20.931  4.959   -26.664 1.00 41.80  ? 236 ARG A CB    1 
ATOM   1855  C  CG    . ARG A 1 236 ? 22.088  4.925   -25.714 1.00 40.21  ? 236 ARG A CG    1 
ATOM   1856  C  CD    . ARG A 1 236 ? 21.687  5.146   -24.278 1.00 39.41  ? 236 ARG A CD    1 
ATOM   1857  N  NE    . ARG A 1 236 ? 22.869  5.420   -23.455 1.00 39.08  ? 236 ARG A NE    1 
ATOM   1858  C  CZ    . ARG A 1 236 ? 23.524  6.585   -23.446 1.00 38.67  ? 236 ARG A CZ    1 
ATOM   1859  N  NH1   . ARG A 1 236 ? 24.598  6.746   -22.675 1.00 36.57  ? 236 ARG A NH1   1 
ATOM   1860  N  NH2   . ARG A 1 236 ? 23.098  7.599   -24.194 1.00 35.99  ? 236 ARG A NH2   1 
ATOM   1861  N  N     . GLU A 1 237 ? 19.240  3.462   -28.851 1.00 45.54  ? 237 GLU A N     1 
ATOM   1862  C  CA    . GLU A 1 237 ? 17.988  3.363   -29.572 1.00 46.52  ? 237 GLU A CA    1 
ATOM   1863  C  C     . GLU A 1 237 ? 16.882  3.546   -28.545 1.00 46.71  ? 237 GLU A C     1 
ATOM   1864  O  O     . GLU A 1 237 ? 16.700  2.674   -27.697 1.00 46.90  ? 237 GLU A O     1 
ATOM   1865  C  CB    . GLU A 1 237 ? 17.849  1.966   -30.166 1.00 49.13  ? 237 GLU A CB    1 
ATOM   1866  C  CG    . GLU A 1 237 ? 17.013  1.897   -31.412 1.00 52.85  ? 237 GLU A CG    1 
ATOM   1867  C  CD    . GLU A 1 237 ? 17.771  2.440   -32.606 1.00 55.25  ? 237 GLU A CD    1 
ATOM   1868  O  OE1   . GLU A 1 237 ? 17.953  1.684   -33.593 1.00 56.72  ? 237 GLU A OE1   1 
ATOM   1869  O  OE2   . GLU A 1 237 ? 18.196  3.617   -32.547 1.00 54.37  ? 237 GLU A OE2   1 
ATOM   1870  N  N     . GLY A 1 238 ? 16.158  4.661   -28.583 1.00 46.38  ? 238 GLY A N     1 
ATOM   1871  C  CA    . GLY A 1 238 ? 15.065  4.820   -27.630 1.00 47.22  ? 238 GLY A CA    1 
ATOM   1872  C  C     . GLY A 1 238 ? 14.030  3.745   -27.940 1.00 47.52  ? 238 GLY A C     1 
ATOM   1873  O  O     . GLY A 1 238 ? 13.794  3.451   -29.109 1.00 51.48  ? 238 GLY A O     1 
ATOM   1874  N  N     . GLY A 1 239 ? 13.412  3.136   -26.942 1.00 45.67  ? 239 GLY A N     1 
ATOM   1875  C  CA    . GLY A 1 239 ? 12.442  2.099   -27.261 1.00 45.21  ? 239 GLY A CA    1 
ATOM   1876  C  C     . GLY A 1 239 ? 11.012  2.595   -27.212 1.00 45.88  ? 239 GLY A C     1 
ATOM   1877  O  O     . GLY A 1 239 ? 10.575  3.357   -28.074 1.00 45.61  ? 239 GLY A O     1 
ATOM   1878  N  N     . ARG A 1 240 ? 10.282  2.161   -26.189 1.00 46.11  ? 240 ARG A N     1 
ATOM   1879  C  CA    . ARG A 1 240 ? 8.896   2.561   -25.990 1.00 45.78  ? 240 ARG A CA    1 
ATOM   1880  C  C     . ARG A 1 240 ? 8.807   3.744   -25.033 1.00 44.50  ? 240 ARG A C     1 
ATOM   1881  O  O     . ARG A 1 240 ? 9.803   4.403   -24.761 1.00 45.19  ? 240 ARG A O     1 
ATOM   1882  C  CB    . ARG A 1 240 ? 8.106   1.378   -25.440 1.00 48.10  ? 240 ARG A CB    1 
ATOM   1883  C  CG    . ARG A 1 240 ? 8.166   0.174   -26.362 1.00 50.81  ? 240 ARG A CG    1 
ATOM   1884  C  CD    . ARG A 1 240 ? 8.716   -1.033  -25.651 1.00 54.50  ? 240 ARG A CD    1 
ATOM   1885  N  NE    . ARG A 1 240 ? 7.671   -1.788  -24.970 1.00 57.19  ? 240 ARG A NE    1 
ATOM   1886  C  CZ    . ARG A 1 240 ? 7.898   -2.889  -24.261 1.00 58.18  ? 240 ARG A CZ    1 
ATOM   1887  N  NH1   . ARG A 1 240 ? 9.135   -3.356  -24.135 1.00 57.28  ? 240 ARG A NH1   1 
ATOM   1888  N  NH2   . ARG A 1 240 ? 6.883   -3.538  -23.702 1.00 60.00  ? 240 ARG A NH2   1 
ATOM   1889  N  N     . VAL A 1 241 ? 7.612   4.027   -24.528 1.00 43.52  ? 241 VAL A N     1 
ATOM   1890  C  CA    . VAL A 1 241 ? 7.448   5.135   -23.585 1.00 41.81  ? 241 VAL A CA    1 
ATOM   1891  C  C     . VAL A 1 241 ? 7.297   4.589   -22.176 1.00 41.51  ? 241 VAL A C     1 
ATOM   1892  O  O     . VAL A 1 241 ? 6.312   3.937   -21.859 1.00 41.89  ? 241 VAL A O     1 
ATOM   1893  C  CB    . VAL A 1 241 ? 6.197   6.018   -23.882 1.00 39.83  ? 241 VAL A CB    1 
ATOM   1894  C  CG1   . VAL A 1 241 ? 6.116   7.148   -22.858 1.00 37.59  ? 241 VAL A CG1   1 
ATOM   1895  C  CG2   . VAL A 1 241 ? 6.260   6.590   -25.291 1.00 36.11  ? 241 VAL A CG2   1 
ATOM   1896  N  N     . ALA A 1 242 ? 8.289   4.849   -21.336 1.00 41.75  ? 242 ALA A N     1 
ATOM   1897  C  CA    . ALA A 1 242 ? 8.253   4.396   -19.957 1.00 40.20  ? 242 ALA A CA    1 
ATOM   1898  C  C     . ALA A 1 242 ? 7.799   5.561   -19.100 1.00 39.24  ? 242 ALA A C     1 
ATOM   1899  O  O     . ALA A 1 242 ? 8.287   6.679   -19.234 1.00 38.52  ? 242 ALA A O     1 
ATOM   1900  C  CB    . ALA A 1 242 ? 9.634   3.928   -19.522 1.00 39.66  ? 242 ALA A CB    1 
ATOM   1901  N  N     . TRP A 1 243 ? 6.833   5.312   -18.236 1.00 39.38  ? 243 TRP A N     1 
ATOM   1902  C  CA    . TRP A 1 243 ? 6.367   6.364   -17.363 1.00 40.08  ? 243 TRP A CA    1 
ATOM   1903  C  C     . TRP A 1 243 ? 7.083   6.204   -16.044 1.00 40.77  ? 243 TRP A C     1 
ATOM   1904  O  O     . TRP A 1 243 ? 6.984   5.178   -15.375 1.00 40.20  ? 243 TRP A O     1 
ATOM   1905  C  CB    . TRP A 1 243 ? 4.858   6.297   -17.200 1.00 40.31  ? 243 TRP A CB    1 
ATOM   1906  C  CG    . TRP A 1 243 ? 4.164   6.915   -18.363 1.00 39.75  ? 243 TRP A CG    1 
ATOM   1907  C  CD1   . TRP A 1 243 ? 3.648   6.279   -19.454 1.00 39.26  ? 243 TRP A CD1   1 
ATOM   1908  C  CD2   . TRP A 1 243 ? 3.942   8.313   -18.569 1.00 39.36  ? 243 TRP A CD2   1 
ATOM   1909  N  NE1   . TRP A 1 243 ? 3.115   7.198   -20.327 1.00 39.32  ? 243 TRP A NE1   1 
ATOM   1910  C  CE2   . TRP A 1 243 ? 3.284   8.452   -19.807 1.00 38.71  ? 243 TRP A CE2   1 
ATOM   1911  C  CE3   . TRP A 1 243 ? 4.241   9.461   -17.825 1.00 39.28  ? 243 TRP A CE3   1 
ATOM   1912  C  CZ2   . TRP A 1 243 ? 2.917   9.695   -20.315 1.00 38.29  ? 243 TRP A CZ2   1 
ATOM   1913  C  CZ3   . TRP A 1 243 ? 3.877   10.693  -18.331 1.00 38.00  ? 243 TRP A CZ3   1 
ATOM   1914  C  CH2   . TRP A 1 243 ? 3.224   10.802  -19.563 1.00 38.25  ? 243 TRP A CH2   1 
ATOM   1915  N  N     . VAL A 1 244 ? 7.812   7.245   -15.682 1.00 41.73  ? 244 VAL A N     1 
ATOM   1916  C  CA    . VAL A 1 244 ? 8.615   7.237   -14.485 1.00 41.66  ? 244 VAL A CA    1 
ATOM   1917  C  C     . VAL A 1 244 ? 8.187   8.310   -13.487 1.00 42.25  ? 244 VAL A C     1 
ATOM   1918  O  O     . VAL A 1 244 ? 7.335   9.137   -13.776 1.00 43.08  ? 244 VAL A O     1 
ATOM   1919  C  CB    . VAL A 1 244 ? 10.061  7.439   -14.908 1.00 41.71  ? 244 VAL A CB    1 
ATOM   1920  C  CG1   . VAL A 1 244 ? 10.400  8.919   -14.968 1.00 39.39  ? 244 VAL A CG1   1 
ATOM   1921  C  CG2   . VAL A 1 244 ? 10.946  6.661   -14.019 1.00 45.07  ? 244 VAL A CG2   1 
ATOM   1922  N  N     . ALA A 1 245 ? 8.761   8.297   -12.298 1.00 43.38  ? 245 ALA A N     1 
ATOM   1923  C  CA    . ALA A 1 245 ? 8.394   9.306   -11.319 1.00 45.51  ? 245 ALA A CA    1 
ATOM   1924  C  C     . ALA A 1 245 ? 9.594   9.734   -10.490 1.00 47.56  ? 245 ALA A C     1 
ATOM   1925  O  O     . ALA A 1 245 ? 10.468  8.933   -10.148 1.00 47.47  ? 245 ALA A O     1 
ATOM   1926  C  CB    . ALA A 1 245 ? 7.279   8.793   -10.411 1.00 44.46  ? 245 ALA A CB    1 
ATOM   1927  N  N     . ASP A 1 246 ? 9.631   11.018  -10.180 1.00 49.60  ? 246 ASP A N     1 
ATOM   1928  C  CA    . ASP A 1 246 ? 10.706  11.571  -9.391  1.00 51.09  ? 246 ASP A CA    1 
ATOM   1929  C  C     . ASP A 1 246 ? 10.470  11.231  -7.926  1.00 52.28  ? 246 ASP A C     1 
ATOM   1930  O  O     . ASP A 1 246 ? 9.461   11.611  -7.345  1.00 52.23  ? 246 ASP A O     1 
ATOM   1931  C  CB    . ASP A 1 246 ? 10.751  13.080  -9.589  1.00 53.07  ? 246 ASP A CB    1 
ATOM   1932  C  CG    . ASP A 1 246 ? 11.817  13.731  -8.761  1.00 55.35  ? 246 ASP A CG    1 
ATOM   1933  O  OD1   . ASP A 1 246 ? 12.814  13.042  -8.459  1.00 57.67  ? 246 ASP A OD1   1 
ATOM   1934  O  OD2   . ASP A 1 246 ? 11.668  14.925  -8.422  1.00 56.38  ? 246 ASP A OD2   1 
ATOM   1935  N  N     . PRO A 1 247 ? 11.404  10.501  -7.311  1.00 53.30  ? 247 PRO A N     1 
ATOM   1936  C  CA    . PRO A 1 247 ? 11.337  10.082  -5.912  1.00 53.86  ? 247 PRO A CA    1 
ATOM   1937  C  C     . PRO A 1 247 ? 10.874  11.151  -4.929  1.00 54.85  ? 247 PRO A C     1 
ATOM   1938  O  O     . PRO A 1 247 ? 10.320  10.827  -3.875  1.00 54.73  ? 247 PRO A O     1 
ATOM   1939  C  CB    . PRO A 1 247 ? 12.758  9.628   -5.637  1.00 53.04  ? 247 PRO A CB    1 
ATOM   1940  C  CG    . PRO A 1 247 ? 13.133  9.010   -6.921  1.00 53.06  ? 247 PRO A CG    1 
ATOM   1941  C  CD    . PRO A 1 247 ? 12.658  10.036  -7.922  1.00 53.50  ? 247 PRO A CD    1 
ATOM   1942  N  N     . LYS A 1 248 ? 11.102  12.418  -5.266  1.00 56.21  ? 248 LYS A N     1 
ATOM   1943  C  CA    . LYS A 1 248 ? 10.700  13.515  -4.387  1.00 58.00  ? 248 LYS A CA    1 
ATOM   1944  C  C     . LYS A 1 248 ? 9.195   13.837  -4.508  1.00 59.18  ? 248 LYS A C     1 
ATOM   1945  O  O     . LYS A 1 248 ? 8.626   14.534  -3.663  1.00 59.41  ? 248 LYS A O     1 
ATOM   1946  C  CB    . LYS A 1 248 ? 11.554  14.756  -4.679  1.00 57.14  ? 248 LYS A CB    1 
ATOM   1947  N  N     . ASP A 1 249 ? 8.562   13.309  -5.555  1.00 60.09  ? 249 ASP A N     1 
ATOM   1948  C  CA    . ASP A 1 249 ? 7.133   13.489  -5.815  1.00 60.65  ? 249 ASP A CA    1 
ATOM   1949  C  C     . ASP A 1 249 ? 6.767   12.279  -6.659  1.00 59.91  ? 249 ASP A C     1 
ATOM   1950  O  O     . ASP A 1 249 ? 6.661   12.365  -7.886  1.00 60.27  ? 249 ASP A O     1 
ATOM   1951  C  CB    . ASP A 1 249 ? 6.886   14.762  -6.619  1.00 64.40  ? 249 ASP A CB    1 
ATOM   1952  C  CG    . ASP A 1 249 ? 5.422   15.151  -6.655  1.00 68.55  ? 249 ASP A CG    1 
ATOM   1953  O  OD1   . ASP A 1 249 ? 4.570   14.251  -6.839  1.00 72.26  ? 249 ASP A OD1   1 
ATOM   1954  O  OD2   . ASP A 1 249 ? 5.124   16.359  -6.505  1.00 70.24  ? 249 ASP A OD2   1 
ATOM   1955  N  N     . PRO A 1 250 ? 6.578   11.127  -6.010  1.00 58.73  ? 250 PRO A N     1 
ATOM   1956  C  CA    . PRO A 1 250 ? 6.239   9.886   -6.706  1.00 58.07  ? 250 PRO A CA    1 
ATOM   1957  C  C     . PRO A 1 250 ? 4.862   9.846   -7.317  1.00 57.79  ? 250 PRO A C     1 
ATOM   1958  O  O     . PRO A 1 250 ? 4.504   8.880   -7.974  1.00 58.75  ? 250 PRO A O     1 
ATOM   1959  C  CB    . PRO A 1 250 ? 6.414   8.841   -5.620  1.00 57.72  ? 250 PRO A CB    1 
ATOM   1960  C  CG    . PRO A 1 250 ? 5.951   9.575   -4.409  1.00 57.59  ? 250 PRO A CG    1 
ATOM   1961  C  CD    . PRO A 1 250 ? 6.602   10.922  -4.551  1.00 56.77  ? 250 PRO A CD    1 
ATOM   1962  N  N     . ARG A 1 251 ? 4.084   10.892  -7.107  1.00 57.77  ? 251 ARG A N     1 
ATOM   1963  C  CA    . ARG A 1 251 ? 2.744   10.895  -7.642  1.00 58.79  ? 251 ARG A CA    1 
ATOM   1964  C  C     . ARG A 1 251 ? 2.524   11.852  -8.782  1.00 58.51  ? 251 ARG A C     1 
ATOM   1965  O  O     . ARG A 1 251 ? 1.432   12.386  -8.953  1.00 58.90  ? 251 ARG A O     1 
ATOM   1966  C  CB    . ARG A 1 251 ? 1.760   11.171  -6.526  1.00 61.08  ? 251 ARG A CB    1 
ATOM   1967  C  CG    . ARG A 1 251 ? 1.823   10.106  -5.488  1.00 63.78  ? 251 ARG A CG    1 
ATOM   1968  C  CD    . ARG A 1 251 ? 0.687   10.224  -4.526  1.00 68.96  ? 251 ARG A CD    1 
ATOM   1969  N  NE    . ARG A 1 251 ? 0.652   9.057   -3.653  1.00 73.63  ? 251 ARG A NE    1 
ATOM   1970  C  CZ    . ARG A 1 251 ? -0.395  8.706   -2.915  1.00 75.62  ? 251 ARG A CZ    1 
ATOM   1971  N  NH1   . ARG A 1 251 ? -1.505  9.438   -2.942  1.00 76.53  ? 251 ARG A NH1   1 
ATOM   1972  N  NH2   . ARG A 1 251 ? -0.331  7.617   -2.157  1.00 76.89  ? 251 ARG A NH2   1 
ATOM   1973  N  N     . LYS A 1 252 ? 3.576   12.079  -9.554  1.00 58.15  ? 252 LYS A N     1 
ATOM   1974  C  CA    . LYS A 1 252 ? 3.482   12.938  -10.714 1.00 57.60  ? 252 LYS A CA    1 
ATOM   1975  C  C     . LYS A 1 252 ? 4.258   12.217  -11.789 1.00 55.76  ? 252 LYS A C     1 
ATOM   1976  O  O     . LYS A 1 252 ? 5.486   12.253  -11.804 1.00 54.79  ? 252 LYS A O     1 
ATOM   1977  C  CB    . LYS A 1 252 ? 4.098   14.306  -10.458 1.00 60.45  ? 252 LYS A CB    1 
ATOM   1978  C  CG    . LYS A 1 252 ? 3.909   15.238  -11.643 1.00 65.19  ? 252 LYS A CG    1 
ATOM   1979  C  CD    . LYS A 1 252 ? 4.653   16.549  -11.468 1.00 69.10  ? 252 LYS A CD    1 
ATOM   1980  C  CE    . LYS A 1 252 ? 4.696   17.327  -12.782 1.00 71.09  ? 252 LYS A CE    1 
ATOM   1981  N  NZ    . LYS A 1 252 ? 5.435   18.621  -12.642 1.00 72.78  ? 252 LYS A NZ    1 
ATOM   1982  N  N     . PRO A 1 253 ? 3.543   11.521  -12.686 1.00 54.82  ? 253 PRO A N     1 
ATOM   1983  C  CA    . PRO A 1 253 ? 4.098   10.751  -13.804 1.00 54.91  ? 253 PRO A CA    1 
ATOM   1984  C  C     . PRO A 1 253 ? 4.976   11.593  -14.731 1.00 54.04  ? 253 PRO A C     1 
ATOM   1985  O  O     . PRO A 1 253 ? 4.689   12.764  -14.959 1.00 56.66  ? 253 PRO A O     1 
ATOM   1986  C  CB    . PRO A 1 253 ? 2.848   10.238  -14.516 1.00 54.49  ? 253 PRO A CB    1 
ATOM   1987  C  CG    . PRO A 1 253 ? 1.867   10.107  -13.397 1.00 54.51  ? 253 PRO A CG    1 
ATOM   1988  C  CD    . PRO A 1 253 ? 2.077   11.392  -12.657 1.00 54.20  ? 253 PRO A CD    1 
ATOM   1989  N  N     . ILE A 1 254 ? 6.039   10.994  -15.260 1.00 50.81  ? 254 ILE A N     1 
ATOM   1990  C  CA    . ILE A 1 254 ? 6.952   11.678  -16.166 1.00 47.55  ? 254 ILE A CA    1 
ATOM   1991  C  C     . ILE A 1 254 ? 7.255   10.700  -17.297 1.00 47.15  ? 254 ILE A C     1 
ATOM   1992  O  O     . ILE A 1 254 ? 7.652   9.561   -17.047 1.00 46.08  ? 254 ILE A O     1 
ATOM   1993  C  CB    . ILE A 1 254 ? 8.288   12.032  -15.467 1.00 48.12  ? 254 ILE A CB    1 
ATOM   1994  C  CG1   . ILE A 1 254 ? 8.019   12.669  -14.099 1.00 47.67  ? 254 ILE A CG1   1 
ATOM   1995  C  CG2   . ILE A 1 254 ? 9.128   12.936  -16.366 1.00 45.10  ? 254 ILE A CG2   1 
ATOM   1996  C  CD1   . ILE A 1 254 ? 7.152   13.904  -14.141 1.00 51.04  ? 254 ILE A CD1   1 
ATOM   1997  N  N     . PRO A 1 255 ? 7.062   11.121  -18.560 1.00 46.72  ? 255 PRO A N     1 
ATOM   1998  C  CA    . PRO A 1 255 ? 7.348   10.203  -19.668 1.00 45.36  ? 255 PRO A CA    1 
ATOM   1999  C  C     . PRO A 1 255 ? 8.862   10.025  -19.822 1.00 44.77  ? 255 PRO A C     1 
ATOM   2000  O  O     . PRO A 1 255 ? 9.649   10.885  -19.405 1.00 44.22  ? 255 PRO A O     1 
ATOM   2001  C  CB    . PRO A 1 255 ? 6.718   10.908  -20.860 1.00 44.21  ? 255 PRO A CB    1 
ATOM   2002  C  CG    . PRO A 1 255 ? 7.014   12.348  -20.553 1.00 44.17  ? 255 PRO A CG    1 
ATOM   2003  C  CD    . PRO A 1 255 ? 6.667   12.449  -19.072 1.00 46.21  ? 255 PRO A CD    1 
ATOM   2004  N  N     . HIS A 1 256 ? 9.266   8.909   -20.419 1.00 43.16  ? 256 HIS A N     1 
ATOM   2005  C  CA    . HIS A 1 256 ? 10.681  8.629   -20.611 1.00 41.46  ? 256 HIS A CA    1 
ATOM   2006  C  C     . HIS A 1 256 ? 10.806  7.467   -21.594 1.00 41.80  ? 256 HIS A C     1 
ATOM   2007  O  O     . HIS A 1 256 ? 9.805   6.863   -21.968 1.00 42.19  ? 256 HIS A O     1 
ATOM   2008  C  CB    . HIS A 1 256 ? 11.307  8.270   -19.268 1.00 39.40  ? 256 HIS A CB    1 
ATOM   2009  C  CG    . HIS A 1 256 ? 12.762  8.582   -19.178 1.00 37.46  ? 256 HIS A CG    1 
ATOM   2010  N  ND1   . HIS A 1 256 ? 13.297  9.336   -18.156 1.00 35.44  ? 256 HIS A ND1   1 
ATOM   2011  C  CD2   . HIS A 1 256 ? 13.798  8.249   -19.982 1.00 36.57  ? 256 HIS A CD2   1 
ATOM   2012  C  CE1   . HIS A 1 256 ? 14.596  9.456   -18.336 1.00 35.26  ? 256 HIS A CE1   1 
ATOM   2013  N  NE2   . HIS A 1 256 ? 14.926  8.805   -19.438 1.00 37.10  ? 256 HIS A NE2   1 
ATOM   2014  N  N     . LEU A 1 257 ? 12.024  7.155   -22.023 1.00 41.84  ? 257 LEU A N     1 
ATOM   2015  C  CA    . LEU A 1 257 ? 12.216  6.060   -22.974 1.00 41.59  ? 257 LEU A CA    1 
ATOM   2016  C  C     . LEU A 1 257 ? 13.014  4.893   -22.385 1.00 39.75  ? 257 LEU A C     1 
ATOM   2017  O  O     . LEU A 1 257 ? 14.071  5.077   -21.774 1.00 37.90  ? 257 LEU A O     1 
ATOM   2018  C  CB    . LEU A 1 257 ? 12.896  6.576   -24.252 1.00 43.44  ? 257 LEU A CB    1 
ATOM   2019  C  CG    . LEU A 1 257 ? 12.107  7.621   -25.056 1.00 43.81  ? 257 LEU A CG    1 
ATOM   2020  C  CD1   . LEU A 1 257 ? 12.966  8.134   -26.197 1.00 46.95  ? 257 LEU A CD1   1 
ATOM   2021  C  CD2   . LEU A 1 257 ? 10.815  7.017   -25.588 1.00 42.72  ? 257 LEU A CD2   1 
ATOM   2022  N  N     . THR A 1 258 ? 12.489  3.687   -22.584 1.00 37.61  ? 258 THR A N     1 
ATOM   2023  C  CA    . THR A 1 258 ? 13.107  2.466   -22.076 1.00 34.50  ? 258 THR A CA    1 
ATOM   2024  C  C     . THR A 1 258 ? 14.524  2.228   -22.588 1.00 32.81  ? 258 THR A C     1 
ATOM   2025  O  O     . THR A 1 258 ? 15.308  1.554   -21.938 1.00 32.28  ? 258 THR A O     1 
ATOM   2026  C  CB    . THR A 1 258 ? 12.235  1.235   -22.412 1.00 34.34  ? 258 THR A CB    1 
ATOM   2027  O  OG1   . THR A 1 258 ? 11.944  1.220   -23.813 1.00 32.33  ? 258 THR A OG1   1 
ATOM   2028  C  CG2   . THR A 1 258 ? 10.922  1.283   -21.630 1.00 33.22  ? 258 THR A CG2   1 
ATOM   2029  N  N     . GLY A 1 259 ? 14.847  2.778   -23.754 1.00 31.59  ? 259 GLY A N     1 
ATOM   2030  C  CA    . GLY A 1 259 ? 16.174  2.606   -24.310 1.00 28.58  ? 259 GLY A CA    1 
ATOM   2031  C  C     . GLY A 1 259 ? 17.189  3.471   -23.591 1.00 28.67  ? 259 GLY A C     1 
ATOM   2032  O  O     . GLY A 1 259 ? 18.385  3.174   -23.578 1.00 28.72  ? 259 GLY A O     1 
ATOM   2033  N  N     . LEU A 1 260 ? 16.706  4.541   -22.973 1.00 29.62  ? 260 LEU A N     1 
ATOM   2034  C  CA    . LEU A 1 260 ? 17.566  5.481   -22.250 1.00 30.22  ? 260 LEU A CA    1 
ATOM   2035  C  C     . LEU A 1 260 ? 17.458  5.317   -20.734 1.00 30.73  ? 260 LEU A C     1 
ATOM   2036  O  O     . LEU A 1 260 ? 17.690  6.256   -19.985 1.00 30.57  ? 260 LEU A O     1 
ATOM   2037  C  CB    . LEU A 1 260 ? 17.190  6.924   -22.627 1.00 29.08  ? 260 LEU A CB    1 
ATOM   2038  C  CG    . LEU A 1 260 ? 17.063  7.208   -24.124 1.00 28.39  ? 260 LEU A CG    1 
ATOM   2039  C  CD1   . LEU A 1 260 ? 16.664  8.642   -24.337 1.00 27.17  ? 260 LEU A CD1   1 
ATOM   2040  C  CD2   . LEU A 1 260 ? 18.392  6.902   -24.819 1.00 29.48  ? 260 LEU A CD2   1 
ATOM   2041  N  N     . LEU A 1 261 ? 17.098  4.126   -20.283 1.00 31.50  ? 261 LEU A N     1 
ATOM   2042  C  CA    . LEU A 1 261 ? 16.952  3.867   -18.859 1.00 31.94  ? 261 LEU A CA    1 
ATOM   2043  C  C     . LEU A 1 261 ? 17.575  2.529   -18.531 1.00 33.52  ? 261 LEU A C     1 
ATOM   2044  O  O     . LEU A 1 261 ? 17.429  1.573   -19.291 1.00 33.64  ? 261 LEU A O     1 
ATOM   2045  C  CB    . LEU A 1 261 ? 15.471  3.823   -18.467 1.00 30.94  ? 261 LEU A CB    1 
ATOM   2046  C  CG    . LEU A 1 261 ? 14.588  5.074   -18.372 1.00 29.29  ? 261 LEU A CG    1 
ATOM   2047  C  CD1   . LEU A 1 261 ? 13.154  4.628   -18.220 1.00 27.00  ? 261 LEU A CD1   1 
ATOM   2048  C  CD2   . LEU A 1 261 ? 14.994  5.941   -17.194 1.00 26.47  ? 261 LEU A CD2   1 
ATOM   2049  N  N     . VAL A 1 262 ? 18.268  2.460   -17.398 1.00 35.39  ? 262 VAL A N     1 
ATOM   2050  C  CA    . VAL A 1 262 ? 18.895  1.212   -16.969 1.00 36.49  ? 262 VAL A CA    1 
ATOM   2051  C  C     . VAL A 1 262 ? 18.277  0.732   -15.653 1.00 37.17  ? 262 VAL A C     1 
ATOM   2052  O  O     . VAL A 1 262 ? 18.145  1.499   -14.692 1.00 36.41  ? 262 VAL A O     1 
ATOM   2053  C  CB    . VAL A 1 262 ? 20.413  1.367   -16.774 1.00 37.02  ? 262 VAL A CB    1 
ATOM   2054  C  CG1   . VAL A 1 262 ? 21.016  0.027   -16.411 1.00 36.84  ? 262 VAL A CG1   1 
ATOM   2055  C  CG2   . VAL A 1 262 ? 21.052  1.901   -18.047 1.00 38.98  ? 262 VAL A CG2   1 
ATOM   2056  N  N     . PRO A 1 263 ? 17.888  -0.556  -15.596 1.00 37.26  ? 263 PRO A N     1 
ATOM   2057  C  CA    . PRO A 1 263 ? 17.281  -1.113  -14.386 1.00 36.12  ? 263 PRO A CA    1 
ATOM   2058  C  C     . PRO A 1 263 ? 18.222  -1.057  -13.208 1.00 36.26  ? 263 PRO A C     1 
ATOM   2059  O  O     . PRO A 1 263 ? 19.409  -1.339  -13.349 1.00 37.36  ? 263 PRO A O     1 
ATOM   2060  C  CB    . PRO A 1 263 ? 16.981  -2.559  -14.773 1.00 35.03  ? 263 PRO A CB    1 
ATOM   2061  C  CG    . PRO A 1 263 ? 16.858  -2.512  -16.250 1.00 36.42  ? 263 PRO A CG    1 
ATOM   2062  C  CD    . PRO A 1 263 ? 17.968  -1.581  -16.649 1.00 36.75  ? 263 PRO A CD    1 
ATOM   2063  N  N     . VAL A 1 264 ? 17.689  -0.671  -12.055 1.00 35.90  ? 264 VAL A N     1 
ATOM   2064  C  CA    . VAL A 1 264 ? 18.458  -0.648  -10.819 1.00 35.00  ? 264 VAL A CA    1 
ATOM   2065  C  C     . VAL A 1 264 ? 18.081  -1.986  -10.166 1.00 37.75  ? 264 VAL A C     1 
ATOM   2066  O  O     . VAL A 1 264 ? 17.013  -2.113  -9.568  1.00 37.86  ? 264 VAL A O     1 
ATOM   2067  C  CB    . VAL A 1 264 ? 18.024  0.495   -9.929  1.00 31.46  ? 264 VAL A CB    1 
ATOM   2068  C  CG1   . VAL A 1 264 ? 18.785  0.450   -8.636  1.00 27.99  ? 264 VAL A CG1   1 
ATOM   2069  C  CG2   . VAL A 1 264 ? 18.227  1.794   -10.652 1.00 28.71  ? 264 VAL A CG2   1 
ATOM   2070  N  N     . LEU A 1 265 ? 18.951  -2.986  -10.313 1.00 39.82  ? 265 LEU A N     1 
ATOM   2071  C  CA    . LEU A 1 265 ? 18.691  -4.329  -9.804  1.00 40.94  ? 265 LEU A CA    1 
ATOM   2072  C  C     . LEU A 1 265 ? 18.886  -4.530  -8.313  1.00 42.06  ? 265 LEU A C     1 
ATOM   2073  O  O     . LEU A 1 265 ? 19.909  -4.162  -7.757  1.00 42.63  ? 265 LEU A O     1 
ATOM   2074  C  CB    . LEU A 1 265 ? 19.538  -5.346  -10.576 1.00 38.99  ? 265 LEU A CB    1 
ATOM   2075  C  CG    . LEU A 1 265 ? 19.311  -5.355  -12.092 1.00 38.39  ? 265 LEU A CG    1 
ATOM   2076  C  CD1   . LEU A 1 265 ? 20.147  -6.446  -12.704 1.00 39.01  ? 265 LEU A CD1   1 
ATOM   2077  C  CD2   . LEU A 1 265 ? 17.848  -5.586  -12.425 1.00 37.16  ? 265 LEU A CD2   1 
ATOM   2078  N  N     . THR A 1 266 ? 17.878  -5.114  -7.673  1.00 43.79  ? 266 THR A N     1 
ATOM   2079  C  CA    . THR A 1 266 ? 17.922  -5.390  -6.247  1.00 44.79  ? 266 THR A CA    1 
ATOM   2080  C  C     . THR A 1 266 ? 18.130  -6.879  -6.118  1.00 45.56  ? 266 THR A C     1 
ATOM   2081  O  O     . THR A 1 266 ? 17.971  -7.616  -7.088  1.00 44.63  ? 266 THR A O     1 
ATOM   2082  C  CB    . THR A 1 266 ? 16.612  -5.006  -5.539  1.00 44.86  ? 266 THR A CB    1 
ATOM   2083  O  OG1   . THR A 1 266 ? 16.327  -3.625  -5.783  1.00 43.80  ? 266 THR A OG1   1 
ATOM   2084  C  CG2   . THR A 1 266 ? 16.740  -5.227  -4.028  1.00 45.91  ? 266 THR A CG2   1 
ATOM   2085  N  N     . LEU A 1 267 ? 18.477  -7.322  -4.918  1.00 47.08  ? 267 LEU A N     1 
ATOM   2086  C  CA    . LEU A 1 267 ? 18.739  -8.728  -4.701  1.00 49.09  ? 267 LEU A CA    1 
ATOM   2087  C  C     . LEU A 1 267 ? 17.554  -9.574  -5.108  1.00 51.09  ? 267 LEU A C     1 
ATOM   2088  O  O     . LEU A 1 267 ? 17.709  -10.754 -5.408  1.00 51.96  ? 267 LEU A O     1 
ATOM   2089  C  CB    . LEU A 1 267 ? 19.101  -8.971  -3.238  1.00 48.65  ? 267 LEU A CB    1 
ATOM   2090  C  CG    . LEU A 1 267 ? 20.142  -10.069 -3.025  1.00 47.58  ? 267 LEU A CG    1 
ATOM   2091  C  CD1   . LEU A 1 267 ? 20.786  -9.887  -1.676  1.00 48.64  ? 267 LEU A CD1   1 
ATOM   2092  C  CD2   . LEU A 1 267 ? 19.498  -11.434 -3.151  1.00 47.81  ? 267 LEU A CD2   1 
ATOM   2093  N  N     . GLU A 1 268 ? 16.375  -8.962  -5.143  1.00 53.75  ? 268 GLU A N     1 
ATOM   2094  C  CA    . GLU A 1 268 ? 15.158  -9.674  -5.511  1.00 56.74  ? 268 GLU A CA    1 
ATOM   2095  C  C     . GLU A 1 268 ? 15.039  -9.925  -7.004  1.00 57.88  ? 268 GLU A C     1 
ATOM   2096  O  O     . GLU A 1 268 ? 14.611  -11.007 -7.424  1.00 58.53  ? 268 GLU A O     1 
ATOM   2097  C  CB    . GLU A 1 268 ? 13.913  -8.915  -5.018  1.00 59.29  ? 268 GLU A CB    1 
ATOM   2098  C  CG    . GLU A 1 268 ? 14.113  -7.416  -4.746  1.00 64.51  ? 268 GLU A CG    1 
ATOM   2099  C  CD    . GLU A 1 268 ? 13.105  -6.525  -5.481  1.00 67.69  ? 268 GLU A CD    1 
ATOM   2100  O  OE1   . GLU A 1 268 ? 11.899  -6.888  -5.516  1.00 69.34  ? 268 GLU A OE1   1 
ATOM   2101  O  OE2   . GLU A 1 268 ? 13.519  -5.458  -6.012  1.00 67.12  ? 268 GLU A OE2   1 
ATOM   2102  N  N     . ASP A 1 269 ? 15.430  -8.932  -7.802  1.00 59.52  ? 269 ASP A N     1 
ATOM   2103  C  CA    . ASP A 1 269 ? 15.346  -9.021  -9.260  1.00 59.59  ? 269 ASP A CA    1 
ATOM   2104  C  C     . ASP A 1 269 ? 16.161  -10.150 -9.860  1.00 59.06  ? 269 ASP A C     1 
ATOM   2105  O  O     . ASP A 1 269 ? 16.022  -10.463 -11.035 1.00 58.64  ? 269 ASP A O     1 
ATOM   2106  C  CB    . ASP A 1 269 ? 15.736  -7.687  -9.890  1.00 61.78  ? 269 ASP A CB    1 
ATOM   2107  C  CG    . ASP A 1 269 ? 14.720  -6.592  -9.597  1.00 64.59  ? 269 ASP A CG    1 
ATOM   2108  O  OD1   . ASP A 1 269 ? 13.542  -6.768  -9.982  1.00 65.89  ? 269 ASP A OD1   1 
ATOM   2109  O  OD2   . ASP A 1 269 ? 15.091  -5.563  -8.982  1.00 65.70  ? 269 ASP A OD2   1 
ATOM   2110  N  N     . LEU A 1 270 ? 17.010  -10.760 -9.046  1.00 58.84  ? 270 LEU A N     1 
ATOM   2111  C  CA    . LEU A 1 270 ? 17.799  -11.887 -9.496  1.00 58.99  ? 270 LEU A CA    1 
ATOM   2112  C  C     . LEU A 1 270 ? 17.263  -13.146 -8.799  1.00 61.48  ? 270 LEU A C     1 
ATOM   2113  O  O     . LEU A 1 270 ? 17.982  -13.807 -8.047  1.00 62.77  ? 270 LEU A O     1 
ATOM   2114  C  CB    . LEU A 1 270 ? 19.272  -11.673 -9.157  1.00 55.43  ? 270 LEU A CB    1 
ATOM   2115  C  CG    . LEU A 1 270 ? 19.986  -10.525 -9.866  1.00 52.83  ? 270 LEU A CG    1 
ATOM   2116  C  CD1   . LEU A 1 270 ? 21.455  -10.577 -9.503  1.00 51.22  ? 270 LEU A CD1   1 
ATOM   2117  C  CD2   . LEU A 1 270 ? 19.818  -10.633 -11.362 1.00 50.56  ? 270 LEU A CD2   1 
ATOM   2118  N  N     . HIS A 1 271 ? 15.991  -13.463 -9.035  1.00 62.69  ? 271 HIS A N     1 
ATOM   2119  C  CA    . HIS A 1 271 ? 15.373  -14.641 -8.439  1.00 63.67  ? 271 HIS A CA    1 
ATOM   2120  C  C     . HIS A 1 271 ? 16.070  -15.915 -8.956  1.00 65.52  ? 271 HIS A C     1 
ATOM   2121  O  O     . HIS A 1 271 ? 16.246  -16.091 -10.169 1.00 65.85  ? 271 HIS A O     1 
ATOM   2122  C  CB    . HIS A 1 271 ? 13.889  -14.666 -8.773  1.00 63.23  ? 271 HIS A CB    1 
ATOM   2123  N  N     . GLU A 1 272 ? 16.468  -16.785 -8.021  1.00 66.97  ? 272 GLU A N     1 
ATOM   2124  C  CA    . GLU A 1 272 ? 17.166  -18.058 -8.297  1.00 67.36  ? 272 GLU A CA    1 
ATOM   2125  C  C     . GLU A 1 272 ? 18.445  -17.889 -9.116  1.00 67.16  ? 272 GLU A C     1 
ATOM   2126  O  O     . GLU A 1 272 ? 19.359  -17.168 -8.714  1.00 66.77  ? 272 GLU A O     1 
ATOM   2127  C  CB    . GLU A 1 272 ? 16.230  -19.046 -8.997  1.00 67.21  ? 272 GLU A CB    1 
ATOM   2128  N  N     . SER A 1 276 ? 22.347  -19.586 -8.734  1.00 64.57  ? 276 SER A N     1 
ATOM   2129  C  CA    . SER A 1 276 ? 22.099  -19.019 -7.412  1.00 65.87  ? 276 SER A CA    1 
ATOM   2130  C  C     . SER A 1 276 ? 23.411  -18.584 -6.737  1.00 65.28  ? 276 SER A C     1 
ATOM   2131  O  O     . SER A 1 276 ? 24.239  -19.421 -6.354  1.00 65.02  ? 276 SER A O     1 
ATOM   2132  C  CB    . SER A 1 276 ? 21.356  -20.041 -6.540  1.00 66.91  ? 276 SER A CB    1 
ATOM   2133  N  N     . LEU A 1 277 ? 23.586  -17.268 -6.595  1.00 64.46  ? 277 LEU A N     1 
ATOM   2134  C  CA    . LEU A 1 277 ? 24.797  -16.689 -5.992  1.00 62.82  ? 277 LEU A CA    1 
ATOM   2135  C  C     . LEU A 1 277 ? 24.656  -16.518 -4.490  1.00 60.72  ? 277 LEU A C     1 
ATOM   2136  O  O     . LEU A 1 277 ? 23.584  -16.162 -3.997  1.00 62.29  ? 277 LEU A O     1 
ATOM   2137  C  CB    . LEU A 1 277 ? 25.122  -15.321 -6.642  1.00 62.71  ? 277 LEU A CB    1 
ATOM   2138  N  N     . ALA A 1 278 ? 25.741  -16.769 -3.766  1.00 56.49  ? 278 ALA A N     1 
ATOM   2139  C  CA    . ALA A 1 278 ? 25.732  -16.631 -2.316  1.00 53.18  ? 278 ALA A CA    1 
ATOM   2140  C  C     . ALA A 1 278 ? 26.632  -15.460 -1.940  1.00 50.13  ? 278 ALA A C     1 
ATOM   2141  O  O     . ALA A 1 278 ? 27.853  -15.546 -2.049  1.00 48.53  ? 278 ALA A O     1 
ATOM   2142  C  CB    . ALA A 1 278 ? 26.222  -17.916 -1.664  1.00 54.27  ? 278 ALA A CB    1 
ATOM   2143  N  N     . LEU A 1 279 ? 26.015  -14.373 -1.489  1.00 46.55  ? 279 LEU A N     1 
ATOM   2144  C  CA    . LEU A 1 279 ? 26.730  -13.156 -1.129  1.00 44.28  ? 279 LEU A CA    1 
ATOM   2145  C  C     . LEU A 1 279 ? 27.178  -13.032 0.329   1.00 45.14  ? 279 LEU A C     1 
ATOM   2146  O  O     . LEU A 1 279 ? 27.769  -12.022 0.709   1.00 45.61  ? 279 LEU A O     1 
ATOM   2147  C  CB    . LEU A 1 279 ? 25.861  -11.961 -1.468  1.00 41.84  ? 279 LEU A CB    1 
ATOM   2148  C  CG    . LEU A 1 279 ? 25.259  -12.001 -2.860  1.00 41.02  ? 279 LEU A CG    1 
ATOM   2149  C  CD1   . LEU A 1 279 ? 24.090  -11.048 -2.934  1.00 42.00  ? 279 LEU A CD1   1 
ATOM   2150  C  CD2   . LEU A 1 279 ? 26.318  -11.646 -3.876  1.00 41.98  ? 279 LEU A CD2   1 
ATOM   2151  N  N     . SER A 1 280 ? 26.901  -14.038 1.150   1.00 44.74  ? 280 SER A N     1 
ATOM   2152  C  CA    . SER A 1 280 ? 27.291  -13.988 2.555   1.00 43.76  ? 280 SER A CA    1 
ATOM   2153  C  C     . SER A 1 280 ? 28.741  -14.399 2.753   1.00 41.75  ? 280 SER A C     1 
ATOM   2154  O  O     . SER A 1 280 ? 29.386  -14.866 1.825   1.00 40.71  ? 280 SER A O     1 
ATOM   2155  C  CB    . SER A 1 280 ? 26.387  -14.905 3.369   1.00 47.00  ? 280 SER A CB    1 
ATOM   2156  O  OG    . SER A 1 280 ? 26.406  -16.214 2.815   1.00 54.32  ? 280 SER A OG    1 
ATOM   2157  N  N     . LEU A 1 281 ? 29.243  -14.237 3.971   1.00 40.88  ? 281 LEU A N     1 
ATOM   2158  C  CA    . LEU A 1 281 ? 30.618  -14.595 4.299   1.00 41.10  ? 281 LEU A CA    1 
ATOM   2159  C  C     . LEU A 1 281 ? 30.763  -14.870 5.777   1.00 42.79  ? 281 LEU A C     1 
ATOM   2160  O  O     . LEU A 1 281 ? 30.306  -14.087 6.594   1.00 43.52  ? 281 LEU A O     1 
ATOM   2161  C  CB    . LEU A 1 281 ? 31.580  -13.454 3.983   1.00 40.48  ? 281 LEU A CB    1 
ATOM   2162  C  CG    . LEU A 1 281 ? 32.062  -13.072 2.591   1.00 39.64  ? 281 LEU A CG    1 
ATOM   2163  C  CD1   . LEU A 1 281 ? 33.083  -11.939 2.700   1.00 37.16  ? 281 LEU A CD1   1 
ATOM   2164  C  CD2   . LEU A 1 281 ? 32.685  -14.275 1.945   1.00 40.64  ? 281 LEU A CD2   1 
ATOM   2165  N  N     . PRO A 1 282 ? 31.422  -15.974 6.145   1.00 45.15  ? 282 PRO A N     1 
ATOM   2166  C  CA    . PRO A 1 282 ? 31.663  -16.382 7.543   1.00 46.86  ? 282 PRO A CA    1 
ATOM   2167  C  C     . PRO A 1 282 ? 32.420  -15.294 8.318   1.00 48.18  ? 282 PRO A C     1 
ATOM   2168  O  O     . PRO A 1 282 ? 33.369  -14.714 7.803   1.00 48.53  ? 282 PRO A O     1 
ATOM   2169  C  CB    . PRO A 1 282 ? 32.494  -17.646 7.386   1.00 46.86  ? 282 PRO A CB    1 
ATOM   2170  C  CG    . PRO A 1 282 ? 31.934  -18.238 6.126   1.00 47.46  ? 282 PRO A CG    1 
ATOM   2171  C  CD    . PRO A 1 282 ? 31.814  -17.040 5.210   1.00 45.95  ? 282 PRO A CD    1 
ATOM   2172  N  N     . TRP A 1 283 ? 32.030  -15.035 9.560   1.00 50.15  ? 283 TRP A N     1 
ATOM   2173  C  CA    . TRP A 1 283 ? 32.679  -13.976 10.329  1.00 52.02  ? 283 TRP A CA    1 
ATOM   2174  C  C     . TRP A 1 283 ? 34.204  -14.014 10.324  1.00 52.52  ? 283 TRP A C     1 
ATOM   2175  O  O     . TRP A 1 283 ? 34.862  -12.968 10.360  1.00 51.71  ? 283 TRP A O     1 
ATOM   2176  C  CB    . TRP A 1 283 ? 32.175  -13.965 11.773  1.00 52.95  ? 283 TRP A CB    1 
ATOM   2177  C  CG    . TRP A 1 283 ? 32.810  -14.983 12.664  1.00 55.62  ? 283 TRP A CG    1 
ATOM   2178  C  CD1   . TRP A 1 283 ? 32.407  -16.270 12.856  1.00 56.55  ? 283 TRP A CD1   1 
ATOM   2179  C  CD2   . TRP A 1 283 ? 33.938  -14.782 13.532  1.00 56.72  ? 283 TRP A CD2   1 
ATOM   2180  N  NE1   . TRP A 1 283 ? 33.206  -16.883 13.796  1.00 56.50  ? 283 TRP A NE1   1 
ATOM   2181  C  CE2   . TRP A 1 283 ? 34.152  -15.992 14.223  1.00 56.38  ? 283 TRP A CE2   1 
ATOM   2182  C  CE3   . TRP A 1 283 ? 34.788  -13.699 13.787  1.00 56.88  ? 283 TRP A CE3   1 
ATOM   2183  C  CZ2   . TRP A 1 283 ? 35.176  -16.144 15.160  1.00 55.95  ? 283 TRP A CZ2   1 
ATOM   2184  C  CZ3   . TRP A 1 283 ? 35.806  -13.856 14.718  1.00 55.48  ? 283 TRP A CZ3   1 
ATOM   2185  C  CH2   . TRP A 1 283 ? 35.991  -15.068 15.388  1.00 55.46  ? 283 TRP A CH2   1 
ATOM   2186  N  N     . GLU A 1 284 ? 34.771  -15.211 10.276  1.00 53.74  ? 284 GLU A N     1 
ATOM   2187  C  CA    . GLU A 1 284 ? 36.216  -15.325 10.276  1.00 55.22  ? 284 GLU A CA    1 
ATOM   2188  C  C     . GLU A 1 284 ? 36.838  -15.135 8.912   1.00 54.66  ? 284 GLU A C     1 
ATOM   2189  O  O     . GLU A 1 284 ? 38.028  -14.876 8.805   1.00 55.48  ? 284 GLU A O     1 
ATOM   2190  C  CB    . GLU A 1 284 ? 36.645  -16.660 10.872  1.00 57.12  ? 284 GLU A CB    1 
ATOM   2191  C  CG    . GLU A 1 284 ? 36.851  -16.567 12.370  1.00 63.35  ? 284 GLU A CG    1 
ATOM   2192  C  CD    . GLU A 1 284 ? 37.398  -17.844 12.980  1.00 66.94  ? 284 GLU A CD    1 
ATOM   2193  O  OE1   . GLU A 1 284 ? 37.972  -18.656 12.225  1.00 68.90  ? 284 GLU A OE1   1 
ATOM   2194  O  OE2   . GLU A 1 284 ? 37.271  -18.029 14.215  1.00 68.25  ? 284 GLU A OE2   1 
ATOM   2195  N  N     . GLU A 1 285 ? 36.045  -15.260 7.858   1.00 55.12  ? 285 GLU A N     1 
ATOM   2196  C  CA    . GLU A 1 285 ? 36.594  -15.064 6.527   1.00 54.91  ? 285 GLU A CA    1 
ATOM   2197  C  C     . GLU A 1 285 ? 36.570  -13.576 6.252   1.00 52.54  ? 285 GLU A C     1 
ATOM   2198  O  O     . GLU A 1 285 ? 37.569  -12.985 5.851   1.00 52.11  ? 285 GLU A O     1 
ATOM   2199  C  CB    . GLU A 1 285 ? 35.771  -15.781 5.467   1.00 57.84  ? 285 GLU A CB    1 
ATOM   2200  C  CG    . GLU A 1 285 ? 36.568  -15.971 4.188   1.00 64.89  ? 285 GLU A CG    1 
ATOM   2201  C  CD    . GLU A 1 285 ? 35.713  -16.269 2.962   1.00 69.65  ? 285 GLU A CD    1 
ATOM   2202  O  OE1   . GLU A 1 285 ? 34.920  -17.244 2.993   1.00 70.73  ? 285 GLU A OE1   1 
ATOM   2203  O  OE2   . GLU A 1 285 ? 35.853  -15.522 1.961   1.00 71.75  ? 285 GLU A OE2   1 
ATOM   2204  N  N     . ARG A 1 286 ? 35.411  -12.975 6.478   1.00 50.56  ? 286 ARG A N     1 
ATOM   2205  C  CA    . ARG A 1 286 ? 35.235  -11.546 6.278   1.00 48.39  ? 286 ARG A CA    1 
ATOM   2206  C  C     . ARG A 1 286 ? 36.289  -10.793 7.082   1.00 47.16  ? 286 ARG A C     1 
ATOM   2207  O  O     . ARG A 1 286 ? 36.975  -9.925  6.534   1.00 47.29  ? 286 ARG A O     1 
ATOM   2208  C  CB    . ARG A 1 286 ? 33.818  -11.132 6.703   1.00 48.10  ? 286 ARG A CB    1 
ATOM   2209  C  CG    . ARG A 1 286 ? 33.598  -9.644  6.913   1.00 45.36  ? 286 ARG A CG    1 
ATOM   2210  C  CD    . ARG A 1 286 ? 32.132  -9.334  7.136   1.00 42.40  ? 286 ARG A CD    1 
ATOM   2211  N  NE    . ARG A 1 286 ? 31.537  -8.756  5.936   1.00 44.71  ? 286 ARG A NE    1 
ATOM   2212  C  CZ    . ARG A 1 286 ? 30.648  -9.360  5.146   1.00 45.80  ? 286 ARG A CZ    1 
ATOM   2213  N  NH1   . ARG A 1 286 ? 30.212  -10.583 5.410   1.00 43.74  ? 286 ARG A NH1   1 
ATOM   2214  N  NH2   . ARG A 1 286 ? 30.214  -8.743  4.059   1.00 47.59  ? 286 ARG A NH2   1 
ATOM   2215  N  N     . ARG A 1 287 ? 36.431  -11.131 8.365   1.00 45.01  ? 287 ARG A N     1 
ATOM   2216  C  CA    . ARG A 1 287 ? 37.430  -10.472 9.213   1.00 43.98  ? 287 ARG A CA    1 
ATOM   2217  C  C     . ARG A 1 287 ? 38.829  -10.536 8.600   1.00 42.03  ? 287 ARG A C     1 
ATOM   2218  O  O     . ARG A 1 287 ? 39.649  -9.658  8.812   1.00 39.34  ? 287 ARG A O     1 
ATOM   2219  C  CB    . ARG A 1 287 ? 37.488  -11.110 10.603  1.00 44.55  ? 287 ARG A CB    1 
ATOM   2220  C  CG    . ARG A 1 287 ? 38.506  -10.428 11.491  0.00 45.34  ? 287 ARG A CG    1 
ATOM   2221  C  CD    . ARG A 1 287 ? 38.585  -11.053 12.856  0.00 46.12  ? 287 ARG A CD    1 
ATOM   2222  N  NE    . ARG A 1 287 ? 39.514  -10.310 13.696  0.00 47.03  ? 287 ARG A NE    1 
ATOM   2223  C  CZ    . ARG A 1 287 ? 39.810  -10.638 14.945  0.00 47.52  ? 287 ARG A CZ    1 
ATOM   2224  N  NH1   . ARG A 1 287 ? 39.255  -11.699 15.505  1.00 47.79  ? 287 ARG A NH1   1 
ATOM   2225  N  NH2   . ARG A 1 287 ? 40.653  -9.896  15.634  1.00 48.52  ? 287 ARG A NH2   1 
ATOM   2226  N  N     . ARG A 1 288 ? 39.082  -11.595 7.843   1.00 42.96  ? 288 ARG A N     1 
ATOM   2227  C  CA    . ARG A 1 288 ? 40.366  -11.811 7.200   1.00 43.65  ? 288 ARG A CA    1 
ATOM   2228  C  C     . ARG A 1 288 ? 40.479  -10.957 5.958   1.00 43.31  ? 288 ARG A C     1 
ATOM   2229  O  O     . ARG A 1 288 ? 41.497  -10.293 5.749   1.00 41.72  ? 288 ARG A O     1 
ATOM   2230  C  CB    . ARG A 1 288 ? 40.525  -13.280 6.803   1.00 46.60  ? 288 ARG A CB    1 
ATOM   2231  C  CG    . ARG A 1 288 ? 41.957  -13.667 6.435   1.00 51.71  ? 288 ARG A CG    1 
ATOM   2232  C  CD    . ARG A 1 288 ? 41.995  -14.821 5.444   1.00 55.52  ? 288 ARG A CD    1 
ATOM   2233  N  NE    . ARG A 1 288 ? 41.078  -15.886 5.835   1.00 60.50  ? 288 ARG A NE    1 
ATOM   2234  C  CZ    . ARG A 1 288 ? 40.086  -16.333 5.067   1.00 62.83  ? 288 ARG A CZ    1 
ATOM   2235  N  NH1   . ARG A 1 288 ? 39.884  -15.809 3.860   1.00 61.83  ? 288 ARG A NH1   1 
ATOM   2236  N  NH2   . ARG A 1 288 ? 39.278  -17.288 5.516   1.00 63.76  ? 288 ARG A NH2   1 
ATOM   2237  N  N     . ARG A 1 289 ? 39.440  -10.996 5.123   1.00 43.47  ? 289 ARG A N     1 
ATOM   2238  C  CA    . ARG A 1 289 ? 39.427  -10.205 3.896   1.00 43.36  ? 289 ARG A CA    1 
ATOM   2239  C  C     . ARG A 1 289 ? 39.545  -8.731  4.271   1.00 42.60  ? 289 ARG A C     1 
ATOM   2240  O  O     . ARG A 1 289 ? 40.216  -7.956  3.576   1.00 42.44  ? 289 ARG A O     1 
ATOM   2241  C  CB    . ARG A 1 289 ? 38.138  -10.435 3.104   1.00 44.65  ? 289 ARG A CB    1 
ATOM   2242  C  CG    . ARG A 1 289 ? 38.096  -11.741 2.331   1.00 49.30  ? 289 ARG A CG    1 
ATOM   2243  C  CD    . ARG A 1 289 ? 36.881  -11.837 1.405   1.00 52.35  ? 289 ARG A CD    1 
ATOM   2244  N  NE    . ARG A 1 289 ? 37.258  -12.303 0.067   1.00 58.76  ? 289 ARG A NE    1 
ATOM   2245  C  CZ    . ARG A 1 289 ? 38.050  -11.631 -0.783  1.00 61.57  ? 289 ARG A CZ    1 
ATOM   2246  N  NH1   . ARG A 1 289 ? 38.560  -10.442 -0.439  1.00 61.67  ? 289 ARG A NH1   1 
ATOM   2247  N  NH2   . ARG A 1 289 ? 38.340  -12.148 -1.983  1.00 59.70  ? 289 ARG A NH2   1 
ATOM   2248  N  N     . THR A 1 290 ? 38.902  -8.356  5.379   1.00 39.31  ? 290 THR A N     1 
ATOM   2249  C  CA    . THR A 1 290 ? 38.939  -6.980  5.852   1.00 37.42  ? 290 THR A CA    1 
ATOM   2250  C  C     . THR A 1 290 ? 40.378  -6.541  6.137   1.00 38.24  ? 290 THR A C     1 
ATOM   2251  O  O     . THR A 1 290 ? 40.835  -5.523  5.621   1.00 37.41  ? 290 THR A O     1 
ATOM   2252  C  CB    . THR A 1 290 ? 38.081  -6.800  7.132   1.00 36.32  ? 290 THR A CB    1 
ATOM   2253  O  OG1   . THR A 1 290 ? 36.716  -7.138  6.858   1.00 35.39  ? 290 THR A OG1   1 
ATOM   2254  C  CG2   . THR A 1 290 ? 38.130  -5.367  7.607   1.00 35.98  ? 290 THR A CG2   1 
ATOM   2255  N  N     . ARG A 1 291 ? 41.093  -7.321  6.947   1.00 40.36  ? 291 ARG A N     1 
ATOM   2256  C  CA    . ARG A 1 291 ? 42.472  -7.004  7.304   1.00 41.10  ? 291 ARG A CA    1 
ATOM   2257  C  C     . ARG A 1 291 ? 43.377  -6.955  6.107   0.00 40.74  ? 291 ARG A C     1 
ATOM   2258  O  O     . ARG A 1 291 ? 44.330  -6.201  6.080   1.00 37.20  ? 291 ARG A O     1 
ATOM   2259  C  CB    . ARG A 1 291 ? 43.035  -8.019  8.296   1.00 43.99  ? 291 ARG A CB    1 
ATOM   2260  C  CG    . ARG A 1 291 ? 42.718  -7.702  9.746   1.00 48.94  ? 291 ARG A CG    1 
ATOM   2261  C  CD    . ARG A 1 291 ? 43.519  -8.591  10.697  1.00 52.36  ? 291 ARG A CD    1 
ATOM   2262  N  NE    . ARG A 1 291 ? 44.274  -7.811  11.673  0.00 51.39  ? 291 ARG A NE    1 
ATOM   2263  C  CZ    . ARG A 1 291 ? 45.310  -7.035  11.369  0.00 51.70  ? 291 ARG A CZ    1 
ATOM   2264  N  NH1   . ARG A 1 291 ? 45.720  -6.935  10.112  0.00 51.61  ? 291 ARG A NH1   1 
ATOM   2265  N  NH2   . ARG A 1 291 ? 45.935  -6.357  12.322  0.00 51.61  ? 291 ARG A NH2   1 
ATOM   2266  N  N     . GLU A 1 292 ? 43.085  -7.771  5.113   1.00 40.92  ? 292 GLU A N     1 
ATOM   2267  C  CA    . GLU A 1 292 ? 43.915  -7.788  3.929   1.00 43.81  ? 292 GLU A CA    1 
ATOM   2268  C  C     . GLU A 1 292 ? 43.595  -6.627  3.012   1.00 43.59  ? 292 GLU A C     1 
ATOM   2269  O  O     . GLU A 1 292 ? 44.335  -6.344  2.081   1.00 44.73  ? 292 GLU A O     1 
ATOM   2270  C  CB    . GLU A 1 292 ? 43.765  -9.121  3.193   1.00 47.48  ? 292 GLU A CB    1 
ATOM   2271  C  CG    . GLU A 1 292 ? 44.365  -10.298 3.972   1.00 54.59  ? 292 GLU A CG    1 
ATOM   2272  C  CD    . GLU A 1 292 ? 44.598  -11.537 3.118   1.00 57.91  ? 292 GLU A CD    1 
ATOM   2273  O  OE1   . GLU A 1 292 ? 43.603  -12.195 2.728   1.00 60.45  ? 292 GLU A OE1   1 
ATOM   2274  O  OE2   . GLU A 1 292 ? 45.783  -11.845 2.838   1.00 58.47  ? 292 GLU A OE2   1 
ATOM   2275  N  N     . ILE A 1 293 ? 42.490  -5.946  3.273   1.00 42.97  ? 293 ILE A N     1 
ATOM   2276  C  CA    . ILE A 1 293 ? 42.114  -4.804  2.458   1.00 39.87  ? 293 ILE A CA    1 
ATOM   2277  C  C     . ILE A 1 293 ? 42.637  -3.578  3.163   1.00 38.32  ? 293 ILE A C     1 
ATOM   2278  O  O     . ILE A 1 293 ? 43.149  -2.664  2.547   1.00 37.06  ? 293 ILE A O     1 
ATOM   2279  C  CB    . ILE A 1 293 ? 40.605  -4.710  2.324   1.00 39.22  ? 293 ILE A CB    1 
ATOM   2280  C  CG1   . ILE A 1 293 ? 40.094  -5.974  1.657   1.00 38.31  ? 293 ILE A CG1   1 
ATOM   2281  C  CG2   . ILE A 1 293 ? 40.218  -3.503  1.498   1.00 38.25  ? 293 ILE A CG2   1 
ATOM   2282  C  CD1   . ILE A 1 293 ? 38.610  -6.097  1.731   1.00 41.89  ? 293 ILE A CD1   1 
ATOM   2283  N  N     . ALA A 1 294 ? 42.514  -3.571  4.475   1.00 38.54  ? 294 ALA A N     1 
ATOM   2284  C  CA    . ALA A 1 294 ? 43.002  -2.450  5.246   1.00 41.09  ? 294 ALA A CA    1 
ATOM   2285  C  C     . ALA A 1 294 ? 44.510  -2.323  5.059   1.00 42.53  ? 294 ALA A C     1 
ATOM   2286  O  O     . ALA A 1 294 ? 45.043  -1.228  4.961   1.00 43.69  ? 294 ALA A O     1 
ATOM   2287  C  CB    . ALA A 1 294 ? 42.669  -2.648  6.721   1.00 40.73  ? 294 ALA A CB    1 
ATOM   2288  N  N     . SER A 1 295 ? 45.203  -3.447  4.996   1.00 44.24  ? 295 SER A N     1 
ATOM   2289  C  CA    . SER A 1 295 ? 46.639  -3.401  4.847   1.00 47.01  ? 295 SER A CA    1 
ATOM   2290  C  C     . SER A 1 295 ? 46.990  -2.989  3.454   1.00 48.71  ? 295 SER A C     1 
ATOM   2291  O  O     . SER A 1 295 ? 47.983  -2.312  3.218   1.00 50.69  ? 295 SER A O     1 
ATOM   2292  C  CB    . SER A 1 295 ? 47.240  -4.763  5.150   1.00 49.71  ? 295 SER A CB    1 
ATOM   2293  O  OG    . SER A 1 295 ? 47.061  -5.104  6.520   1.00 53.53  ? 295 SER A OG    1 
ATOM   2294  N  N     . TRP A 1 296 ? 46.159  -3.409  2.521   1.00 51.13  ? 296 TRP A N     1 
ATOM   2295  C  CA    . TRP A 1 296 ? 46.365  -3.094  1.121   1.00 51.59  ? 296 TRP A CA    1 
ATOM   2296  C  C     . TRP A 1 296 ? 46.359  -1.587  0.926   1.00 50.60  ? 296 TRP A C     1 
ATOM   2297  O  O     . TRP A 1 296 ? 47.205  -1.044  0.239   1.00 51.73  ? 296 TRP A O     1 
ATOM   2298  C  CB    . TRP A 1 296 ? 45.262  -3.765  0.293   1.00 53.32  ? 296 TRP A CB    1 
ATOM   2299  C  CG    . TRP A 1 296 ? 45.224  -3.390  -1.146  1.00 54.86  ? 296 TRP A CG    1 
ATOM   2300  C  CD1   . TRP A 1 296 ? 46.248  -3.463  -2.041  1.00 55.11  ? 296 TRP A CD1   1 
ATOM   2301  C  CD2   . TRP A 1 296 ? 44.093  -2.887  -1.864  1.00 55.42  ? 296 TRP A CD2   1 
ATOM   2302  N  NE1   . TRP A 1 296 ? 45.826  -3.035  -3.274  1.00 56.33  ? 296 TRP A NE1   1 
ATOM   2303  C  CE2   . TRP A 1 296 ? 44.505  -2.677  -3.193  1.00 56.29  ? 296 TRP A CE2   1 
ATOM   2304  C  CE3   . TRP A 1 296 ? 42.768  -2.598  -1.512  1.00 54.75  ? 296 TRP A CE3   1 
ATOM   2305  C  CZ2   . TRP A 1 296 ? 43.641  -2.182  -4.176  1.00 56.66  ? 296 TRP A CZ2   1 
ATOM   2306  C  CZ3   . TRP A 1 296 ? 41.913  -2.110  -2.482  1.00 55.40  ? 296 TRP A CZ3   1 
ATOM   2307  C  CH2   . TRP A 1 296 ? 42.352  -1.907  -3.802  1.00 56.01  ? 296 TRP A CH2   1 
ATOM   2308  N  N     . ILE A 1 297 ? 45.421  -0.912  1.566   1.00 50.33  ? 297 ILE A N     1 
ATOM   2309  C  CA    . ILE A 1 297 ? 45.307  0.526   1.432   1.00 51.84  ? 297 ILE A CA    1 
ATOM   2310  C  C     . ILE A 1 297 ? 46.457  1.314   2.022   1.00 52.97  ? 297 ILE A C     1 
ATOM   2311  O  O     . ILE A 1 297 ? 47.058  2.146   1.346   1.00 54.21  ? 297 ILE A O     1 
ATOM   2312  C  CB    . ILE A 1 297 ? 44.015  1.015   2.060   1.00 52.73  ? 297 ILE A CB    1 
ATOM   2313  C  CG1   . ILE A 1 297 ? 42.839  0.489   1.235   1.00 53.13  ? 297 ILE A CG1   1 
ATOM   2314  C  CG2   . ILE A 1 297 ? 44.030  2.539   2.166   1.00 53.33  ? 297 ILE A CG2   1 
ATOM   2315  C  CD1   . ILE A 1 297 ? 41.491  0.811   1.816   1.00 56.01  ? 297 ILE A CD1   1 
ATOM   2316  N  N     . GLY A 1 298 ? 46.754  1.078   3.290   1.00 52.76  ? 298 GLY A N     1 
ATOM   2317  C  CA    . GLY A 1 298 ? 47.849  1.799   3.900   1.00 53.55  ? 298 GLY A CA    1 
ATOM   2318  C  C     . GLY A 1 298 ? 49.118  1.666   3.075   1.00 53.90  ? 298 GLY A C     1 
ATOM   2319  O  O     . GLY A 1 298 ? 49.938  2.574   3.034   1.00 54.77  ? 298 GLY A O     1 
ATOM   2320  N  N     . ARG A 1 299 ? 49.285  0.535   2.405   1.00 53.54  ? 299 ARG A N     1 
ATOM   2321  C  CA    . ARG A 1 299 ? 50.479  0.328   1.612   1.00 54.00  ? 299 ARG A CA    1 
ATOM   2322  C  C     . ARG A 1 299 ? 50.491  1.247   0.407   1.00 54.72  ? 299 ARG A C     1 
ATOM   2323  O  O     . ARG A 1 299 ? 51.338  2.133   0.307   1.00 54.31  ? 299 ARG A O     1 
ATOM   2324  C  CB    . ARG A 1 299 ? 50.563  -1.121  1.133   1.00 55.41  ? 299 ARG A CB    1 
ATOM   2325  C  CG    . ARG A 1 299 ? 51.981  -1.682  1.118   1.00 54.89  ? 299 ARG A CG    1 
ATOM   2326  C  CD    . ARG A 1 299 ? 52.271  -2.526  -0.116  1.00 55.36  ? 299 ARG A CD    1 
ATOM   2327  N  NE    . ARG A 1 299 ? 51.231  -3.505  -0.434  1.00 57.86  ? 299 ARG A NE    1 
ATOM   2328  C  CZ    . ARG A 1 299 ? 50.632  -4.309  0.448   1.00 59.69  ? 299 ARG A CZ    1 
ATOM   2329  N  NH1   . ARG A 1 299 ? 50.948  -4.265  1.744   1.00 59.34  ? 299 ARG A NH1   1 
ATOM   2330  N  NH2   . ARG A 1 299 ? 49.723  -5.182  0.025   1.00 58.96  ? 299 ARG A NH2   1 
ATOM   2331  N  N     . ARG A 1 300 ? 49.539  1.020   -0.502  1.00 55.57  ? 300 ARG A N     1 
ATOM   2332  C  CA    . ARG A 1 300 ? 49.404  1.782   -1.747  1.00 55.43  ? 300 ARG A CA    1 
ATOM   2333  C  C     . ARG A 1 300 ? 49.085  3.258   -1.539  1.00 54.82  ? 300 ARG A C     1 
ATOM   2334  O  O     . ARG A 1 300 ? 49.526  4.110   -2.310  1.00 54.39  ? 300 ARG A O     1 
ATOM   2335  C  CB    . ARG A 1 300 ? 48.333  1.137   -2.632  1.00 56.39  ? 300 ARG A CB    1 
ATOM   2336  C  CG    . ARG A 1 300 ? 48.508  -0.368  -2.794  1.00 58.20  ? 300 ARG A CG    1 
ATOM   2337  C  CD    . ARG A 1 300 ? 48.169  -0.835  -4.207  1.00 60.96  ? 300 ARG A CD    1 
ATOM   2338  N  NE    . ARG A 1 300 ? 49.147  -0.369  -5.187  1.00 63.06  ? 300 ARG A NE    1 
ATOM   2339  C  CZ    . ARG A 1 300 ? 49.088  -0.634  -6.489  1.00 64.85  ? 300 ARG A CZ    1 
ATOM   2340  N  NH1   . ARG A 1 300 ? 48.089  -1.368  -6.970  1.00 64.89  ? 300 ARG A NH1   1 
ATOM   2341  N  NH2   . ARG A 1 300 ? 50.024  -0.158  -7.311  1.00 64.26  ? 300 ARG A NH2   1 
ATOM   2342  N  N     . LEU A 1 301 ? 48.316  3.548   -0.496  1.00 54.07  ? 301 LEU A N     1 
ATOM   2343  C  CA    . LEU A 1 301 ? 47.941  4.913   -0.152  1.00 53.32  ? 301 LEU A CA    1 
ATOM   2344  C  C     . LEU A 1 301 ? 49.056  5.601   0.639   1.00 53.08  ? 301 LEU A C     1 
ATOM   2345  O  O     . LEU A 1 301 ? 49.265  6.809   0.535   1.00 52.66  ? 301 LEU A O     1 
ATOM   2346  C  CB    . LEU A 1 301 ? 46.657  4.893   0.679   1.00 53.49  ? 301 LEU A CB    1 
ATOM   2347  C  CG    . LEU A 1 301 ? 45.341  4.846   -0.094  1.00 52.69  ? 301 LEU A CG    1 
ATOM   2348  C  CD1   . LEU A 1 301 ? 44.974  6.266   -0.505  1.00 50.97  ? 301 LEU A CD1   1 
ATOM   2349  C  CD2   . LEU A 1 301 ? 45.463  3.907   -1.301  1.00 49.57  ? 301 LEU A CD2   1 
ATOM   2350  N  N     . GLY A 1 302 ? 49.769  4.822   1.437   1.00 53.40  ? 302 GLY A N     1 
ATOM   2351  C  CA    . GLY A 1 302 ? 50.845  5.383   2.229   1.00 54.59  ? 302 GLY A CA    1 
ATOM   2352  C  C     . GLY A 1 302 ? 50.299  6.045   3.474   1.00 55.29  ? 302 GLY A C     1 
ATOM   2353  O  O     . GLY A 1 302 ? 50.534  7.220   3.717   1.00 57.07  ? 302 GLY A O     1 
ATOM   2354  N  N     . LEU A 1 303 ? 49.567  5.285   4.275   1.00 55.19  ? 303 LEU A N     1 
ATOM   2355  C  CA    . LEU A 1 303 ? 48.975  5.820   5.490   1.00 54.96  ? 303 LEU A CA    1 
ATOM   2356  C  C     . LEU A 1 303 ? 49.545  5.130   6.713   1.00 55.31  ? 303 LEU A C     1 
ATOM   2357  O  O     . LEU A 1 303 ? 49.147  5.406   7.845   1.00 53.60  ? 303 LEU A O     1 
ATOM   2358  C  CB    . LEU A 1 303 ? 47.470  5.616   5.447   1.00 54.33  ? 303 LEU A CB    1 
ATOM   2359  C  CG    . LEU A 1 303 ? 46.797  6.297   4.263   1.00 54.06  ? 303 LEU A CG    1 
ATOM   2360  C  CD1   . LEU A 1 303 ? 45.385  5.751   4.093   1.00 53.66  ? 303 LEU A CD1   1 
ATOM   2361  C  CD2   . LEU A 1 303 ? 46.808  7.802   4.489   1.00 52.91  ? 303 LEU A CD2   1 
ATOM   2362  N  N     . GLY A 1 304 ? 50.480  4.222   6.473   1.00 56.20  ? 304 GLY A N     1 
ATOM   2363  C  CA    . GLY A 1 304 ? 51.088  3.491   7.568   1.00 56.58  ? 304 GLY A CA    1 
ATOM   2364  C  C     . GLY A 1 304 ? 50.443  2.132   7.748   1.00 55.58  ? 304 GLY A C     1 
ATOM   2365  O  O     . GLY A 1 304 ? 49.448  1.819   7.091   1.00 55.28  ? 304 GLY A O     1 
ATOM   2366  N  N     . THR A 1 305 ? 51.015  1.315   8.627   1.00 54.51  ? 305 THR A N     1 
ATOM   2367  C  CA    . THR A 1 305 ? 50.464  -0.003  8.869   1.00 53.07  ? 305 THR A CA    1 
ATOM   2368  C  C     . THR A 1 305 ? 49.221  0.217   9.695   1.00 52.90  ? 305 THR A C     1 
ATOM   2369  O  O     . THR A 1 305 ? 49.191  1.101   10.553  1.00 53.19  ? 305 THR A O     1 
ATOM   2370  C  CB    . THR A 1 305 ? 51.424  -0.907  9.657   1.00 52.25  ? 305 THR A CB    1 
ATOM   2371  O  OG1   . THR A 1 305 ? 52.710  -0.919  9.026   1.00 51.55  ? 305 THR A OG1   1 
ATOM   2372  C  CG2   . THR A 1 305 ? 50.883  -2.326  9.695   1.00 52.15  ? 305 THR A CG2   1 
ATOM   2373  N  N     . PRO A 1 306 ? 48.161  -0.558  9.422   1.00 52.58  ? 306 PRO A N     1 
ATOM   2374  C  CA    . PRO A 1 306 ? 46.914  -0.415  10.175  1.00 51.64  ? 306 PRO A CA    1 
ATOM   2375  C  C     . PRO A 1 306 ? 46.940  -1.245  11.453  1.00 50.64  ? 306 PRO A C     1 
ATOM   2376  O  O     . PRO A 1 306 ? 47.719  -2.189  11.575  1.00 50.44  ? 306 PRO A O     1 
ATOM   2377  C  CB    . PRO A 1 306 ? 45.862  -0.890  9.174   1.00 51.76  ? 306 PRO A CB    1 
ATOM   2378  C  CG    . PRO A 1 306 ? 46.579  -1.971  8.441   1.00 50.45  ? 306 PRO A CG    1 
ATOM   2379  C  CD    . PRO A 1 306 ? 47.957  -1.386  8.216   1.00 51.56  ? 306 PRO A CD    1 
ATOM   2380  N  N     . GLU A 1 307 ? 46.094  -0.876  12.406  1.00 49.99  ? 307 GLU A N     1 
ATOM   2381  C  CA    . GLU A 1 307 ? 46.005  -1.590  13.674  1.00 48.27  ? 307 GLU A CA    1 
ATOM   2382  C  C     . GLU A 1 307 ? 44.535  -1.676  14.035  1.00 47.32  ? 307 GLU A C     1 
ATOM   2383  O  O     . GLU A 1 307 ? 43.892  -0.667  14.309  1.00 47.42  ? 307 GLU A O     1 
ATOM   2384  C  CB    . GLU A 1 307 ? 46.777  -0.846  14.752  1.00 47.83  ? 307 GLU A CB    1 
ATOM   2385  N  N     . ALA A 1 308 ? 43.999  -2.887  14.021  1.00 47.08  ? 308 ALA A N     1 
ATOM   2386  C  CA    . ALA A 1 308 ? 42.592  -3.083  14.326  1.00 47.11  ? 308 ALA A CA    1 
ATOM   2387  C  C     . ALA A 1 308 ? 42.153  -2.358  15.600  1.00 47.55  ? 308 ALA A C     1 
ATOM   2388  O  O     . ALA A 1 308 ? 42.745  -2.518  16.665  1.00 46.78  ? 308 ALA A O     1 
ATOM   2389  C  CB    . ALA A 1 308 ? 42.294  -4.563  14.423  1.00 46.52  ? 308 ALA A CB    1 
ATOM   2390  N  N     . VAL A 1 309 ? 41.107  -1.553  15.475  1.00 48.75  ? 309 VAL A N     1 
ATOM   2391  C  CA    . VAL A 1 309 ? 40.581  -0.802  16.600  1.00 50.64  ? 309 VAL A CA    1 
ATOM   2392  C  C     . VAL A 1 309 ? 39.829  -1.681  17.584  1.00 52.14  ? 309 VAL A C     1 
ATOM   2393  O  O     . VAL A 1 309 ? 39.008  -2.515  17.204  1.00 52.23  ? 309 VAL A O     1 
ATOM   2394  C  CB    . VAL A 1 309 ? 39.636  0.311   16.132  1.00 50.35  ? 309 VAL A CB    1 
ATOM   2395  C  CG1   . VAL A 1 309 ? 39.068  1.050   17.330  1.00 48.98  ? 309 VAL A CG1   1 
ATOM   2396  C  CG2   . VAL A 1 309 ? 40.390  1.268   15.225  1.00 51.99  ? 309 VAL A CG2   1 
ATOM   2397  N  N     . ARG A 1 310 ? 40.122  -1.468  18.859  1.00 53.68  ? 310 ARG A N     1 
ATOM   2398  C  CA    . ARG A 1 310 ? 39.506  -2.211  19.947  1.00 54.20  ? 310 ARG A CA    1 
ATOM   2399  C  C     . ARG A 1 310 ? 38.603  -1.234  20.705  1.00 53.46  ? 310 ARG A C     1 
ATOM   2400  O  O     . ARG A 1 310 ? 39.034  -0.130  21.052  1.00 54.52  ? 310 ARG A O     1 
ATOM   2401  C  CB    . ARG A 1 310 ? 40.601  -2.752  20.872  1.00 56.65  ? 310 ARG A CB    1 
ATOM   2402  C  CG    . ARG A 1 310 ? 40.120  -3.763  21.892  1.00 59.78  ? 310 ARG A CG    1 
ATOM   2403  C  CD    . ARG A 1 310 ? 41.188  -4.086  22.935  1.00 61.59  ? 310 ARG A CD    1 
ATOM   2404  N  NE    . ARG A 1 310 ? 42.416  -4.613  22.353  1.00 64.47  ? 310 ARG A NE    1 
ATOM   2405  C  CZ    . ARG A 1 310 ? 43.041  -5.705  22.785  1.00 65.38  ? 310 ARG A CZ    1 
ATOM   2406  N  NH1   . ARG A 1 310 ? 42.549  -6.399  23.812  1.00 63.18  ? 310 ARG A NH1   1 
ATOM   2407  N  NH2   . ARG A 1 310 ? 44.162  -6.097  22.186  1.00 65.17  ? 310 ARG A NH2   1 
ATOM   2408  N  N     . ALA A 1 311 ? 37.357  -1.632  20.956  1.00 51.54  ? 311 ALA A N     1 
ATOM   2409  C  CA    . ALA A 1 311 ? 36.405  -0.772  21.656  1.00 48.95  ? 311 ALA A CA    1 
ATOM   2410  C  C     . ALA A 1 311 ? 35.801  -1.451  22.874  1.00 47.79  ? 311 ALA A C     1 
ATOM   2411  O  O     . ALA A 1 311 ? 35.773  -2.677  22.967  1.00 45.79  ? 311 ALA A O     1 
ATOM   2412  C  CB    . ALA A 1 311 ? 35.299  -0.341  20.705  1.00 48.57  ? 311 ALA A CB    1 
ATOM   2413  N  N     . GLN A 1 312 ? 35.318  -0.642  23.809  1.00 47.51  ? 312 GLN A N     1 
ATOM   2414  C  CA    . GLN A 1 312 ? 34.717  -1.174  25.018  1.00 47.40  ? 312 GLN A CA    1 
ATOM   2415  C  C     . GLN A 1 312 ? 33.330  -1.657  24.646  1.00 46.95  ? 312 GLN A C     1 
ATOM   2416  O  O     . GLN A 1 312 ? 32.642  -1.023  23.857  1.00 46.80  ? 312 GLN A O     1 
ATOM   2417  C  CB    . GLN A 1 312 ? 34.607  -0.095  26.108  1.00 48.44  ? 312 GLN A CB    1 
ATOM   2418  C  CG    . GLN A 1 312 ? 35.557  1.077   25.968  0.00 48.05  ? 312 GLN A CG    1 
ATOM   2419  C  CD    . GLN A 1 312 ? 34.902  2.287   25.331  0.00 48.14  ? 312 GLN A CD    1 
ATOM   2420  O  OE1   . GLN A 1 312 ? 33.965  2.863   25.884  0.00 48.09  ? 312 GLN A OE1   1 
ATOM   2421  N  NE2   . GLN A 1 312 ? 35.394  2.678   24.162  0.00 48.09  ? 312 GLN A NE2   1 
ATOM   2422  N  N     . ALA A 1 313 ? 32.926  -2.781  25.219  1.00 47.23  ? 313 ALA A N     1 
ATOM   2423  C  CA    . ALA A 1 313 ? 31.618  -3.349  24.952  1.00 47.85  ? 313 ALA A CA    1 
ATOM   2424  C  C     . ALA A 1 313 ? 30.960  -3.757  26.265  1.00 49.96  ? 313 ALA A C     1 
ATOM   2425  O  O     . ALA A 1 313 ? 31.637  -4.163  27.205  1.00 51.63  ? 313 ALA A O     1 
ATOM   2426  C  CB    . ALA A 1 313 ? 31.760  -4.549  24.051  1.00 45.53  ? 313 ALA A CB    1 
ATOM   2427  N  N     . TYR A 1 314 ? 29.641  -3.636  26.335  1.00 51.65  ? 314 TYR A N     1 
ATOM   2428  C  CA    . TYR A 1 314 ? 28.911  -4.015  27.536  1.00 52.55  ? 314 TYR A CA    1 
ATOM   2429  C  C     . TYR A 1 314 ? 27.809  -4.981  27.193  1.00 52.86  ? 314 TYR A C     1 
ATOM   2430  O  O     . TYR A 1 314 ? 26.994  -4.728  26.309  1.00 52.74  ? 314 TYR A O     1 
ATOM   2431  C  CB    . TYR A 1 314 ? 28.240  -2.823  28.179  1.00 54.31  ? 314 TYR A CB    1 
ATOM   2432  C  CG    . TYR A 1 314 ? 29.129  -1.655  28.380  1.00 56.98  ? 314 TYR A CG    1 
ATOM   2433  C  CD1   . TYR A 1 314 ? 29.960  -1.572  29.490  1.00 58.99  ? 314 TYR A CD1   1 
ATOM   2434  C  CD2   . TYR A 1 314 ? 29.134  -0.614  27.463  1.00 57.98  ? 314 TYR A CD2   1 
ATOM   2435  C  CE1   . TYR A 1 314 ? 30.780  -0.464  29.685  1.00 61.55  ? 314 TYR A CE1   1 
ATOM   2436  C  CE2   . TYR A 1 314 ? 29.939  0.489   27.641  1.00 60.78  ? 314 TYR A CE2   1 
ATOM   2437  C  CZ    . TYR A 1 314 ? 30.763  0.567   28.752  1.00 62.41  ? 314 TYR A CZ    1 
ATOM   2438  O  OH    . TYR A 1 314 ? 31.563  1.676   28.931  1.00 63.52  ? 314 TYR A OH    1 
ATOM   2439  N  N     . ARG A 1 315 ? 27.776  -6.081  27.920  1.00 53.04  ? 315 ARG A N     1 
ATOM   2440  C  CA    . ARG A 1 315 ? 26.744  -7.068  27.729  1.00 52.94  ? 315 ARG A CA    1 
ATOM   2441  C  C     . ARG A 1 315 ? 25.490  -6.616  28.471  1.00 51.28  ? 315 ARG A C     1 
ATOM   2442  O  O     . ARG A 1 315 ? 25.535  -6.378  29.669  1.00 51.48  ? 315 ARG A O     1 
ATOM   2443  C  CB    . ARG A 1 315 ? 27.199  -8.405  28.295  1.00 54.38  ? 315 ARG A CB    1 
ATOM   2444  C  CG    . ARG A 1 315 ? 26.078  -9.133  29.023  1.00 58.51  ? 315 ARG A CG    1 
ATOM   2445  C  CD    . ARG A 1 315 ? 25.733  -10.427 28.342  1.00 60.70  ? 315 ARG A CD    1 
ATOM   2446  N  NE    . ARG A 1 315 ? 26.920  -11.269 28.287  1.00 62.63  ? 315 ARG A NE    1 
ATOM   2447  C  CZ    . ARG A 1 315 ? 26.909  -12.550 27.951  1.00 62.76  ? 315 ARG A CZ    1 
ATOM   2448  N  NH1   . ARG A 1 315 ? 25.758  -13.137 27.637  1.00 62.45  ? 315 ARG A NH1   1 
ATOM   2449  N  NH2   . ARG A 1 315 ? 28.048  -13.236 27.937  1.00 61.44  ? 315 ARG A NH2   1 
ATOM   2450  N  N     . LEU A 1 316 ? 24.375  -6.496  27.766  1.00 51.48  ? 316 LEU A N     1 
ATOM   2451  C  CA    . LEU A 1 316 ? 23.124  -6.115  28.410  1.00 51.59  ? 316 LEU A CA    1 
ATOM   2452  C  C     . LEU A 1 316 ? 22.512  -7.385  29.003  1.00 52.54  ? 316 LEU A C     1 
ATOM   2453  O  O     . LEU A 1 316 ? 22.848  -8.503  28.602  1.00 51.24  ? 316 LEU A O     1 
ATOM   2454  C  CB    . LEU A 1 316 ? 22.166  -5.509  27.396  1.00 49.93  ? 316 LEU A CB    1 
ATOM   2455  C  CG    . LEU A 1 316 ? 22.779  -4.382  26.581  1.00 48.75  ? 316 LEU A CG    1 
ATOM   2456  C  CD1   . LEU A 1 316 ? 21.958  -4.194  25.334  1.00 48.91  ? 316 LEU A CD1   1 
ATOM   2457  C  CD2   . LEU A 1 316 ? 22.860  -3.114  27.398  1.00 47.95  ? 316 LEU A CD2   1 
ATOM   2458  N  N     . SER A 1 317 ? 21.612  -7.210  29.960  1.00 54.46  ? 317 SER A N     1 
ATOM   2459  C  CA    . SER A 1 317 ? 20.981  -8.348  30.613  1.00 57.00  ? 317 SER A CA    1 
ATOM   2460  C  C     . SER A 1 317 ? 20.010  -9.073  29.707  1.00 58.06  ? 317 SER A C     1 
ATOM   2461  O  O     . SER A 1 317 ? 19.239  -8.448  28.978  1.00 57.79  ? 317 SER A O     1 
ATOM   2462  C  CB    . SER A 1 317 ? 20.245  -7.890  31.867  1.00 57.94  ? 317 SER A CB    1 
ATOM   2463  O  OG    . SER A 1 317 ? 19.251  -6.938  31.538  1.00 58.99  ? 317 SER A OG    1 
ATOM   2464  N  N     . ILE A 1 318 ? 20.051  -10.400 29.766  1.00 59.96  ? 318 ILE A N     1 
ATOM   2465  C  CA    . ILE A 1 318 ? 19.168  -11.227 28.956  1.00 61.90  ? 318 ILE A CA    1 
ATOM   2466  C  C     . ILE A 1 318 ? 17.721  -10.874 29.335  1.00 63.31  ? 318 ILE A C     1 
ATOM   2467  O  O     . ILE A 1 318 ? 17.363  -10.835 30.516  1.00 64.26  ? 318 ILE A O     1 
ATOM   2468  C  CB    . ILE A 1 318 ? 19.487  -12.741 29.173  1.00 61.30  ? 318 ILE A CB    1 
ATOM   2469  C  CG1   . ILE A 1 318 ? 18.680  -13.609 28.202  1.00 62.89  ? 318 ILE A CG1   1 
ATOM   2470  C  CG2   . ILE A 1 318 ? 19.221  -13.136 30.612  1.00 62.34  ? 318 ILE A CG2   1 
ATOM   2471  C  CD1   . ILE A 1 318 ? 17.206  -13.776 28.558  1.00 64.05  ? 318 ILE A CD1   1 
ATOM   2472  N  N     . PRO A 1 319 ? 16.876  -10.590 28.329  1.00 63.87  ? 319 PRO A N     1 
ATOM   2473  C  CA    . PRO A 1 319 ? 15.471  -10.228 28.542  1.00 64.20  ? 319 PRO A CA    1 
ATOM   2474  C  C     . PRO A 1 319 ? 14.672  -11.258 29.330  1.00 64.53  ? 319 PRO A C     1 
ATOM   2475  O  O     . PRO A 1 319 ? 14.701  -12.456 29.027  1.00 65.29  ? 319 PRO A O     1 
ATOM   2476  C  CB    . PRO A 1 319 ? 14.927  -10.079 27.122  1.00 64.03  ? 319 PRO A CB    1 
ATOM   2477  C  CG    . PRO A 1 319 ? 16.130  -9.763  26.314  1.00 64.71  ? 319 PRO A CG    1 
ATOM   2478  C  CD    . PRO A 1 319 ? 17.170  -10.677 26.890  1.00 64.13  ? 319 PRO A CD    1 
ATOM   2479  N  N     . LYS A 1 320 ? 13.952  -10.783 30.338  1.00 63.47  ? 320 LYS A N     1 
ATOM   2480  C  CA    . LYS A 1 320 ? 13.114  -11.662 31.136  1.00 63.30  ? 320 LYS A CA    1 
ATOM   2481  C  C     . LYS A 1 320 ? 11.686  -11.564 30.579  1.00 62.49  ? 320 LYS A C     1 
ATOM   2482  O  O     . LYS A 1 320 ? 10.903  -10.732 31.025  1.00 62.77  ? 320 LYS A O     1 
ATOM   2483  C  CB    . LYS A 1 320 ? 13.151  -11.230 32.601  1.00 62.12  ? 320 LYS A CB    1 
ATOM   2484  N  N     . LEU A 1 321 ? 11.347  -12.396 29.598  1.00 61.57  ? 321 LEU A N     1 
ATOM   2485  C  CA    . LEU A 1 321 ? 10.007  -12.337 29.028  1.00 62.26  ? 321 LEU A CA    1 
ATOM   2486  C  C     . LEU A 1 321 ? 9.112   -13.463 29.535  1.00 62.88  ? 321 LEU A C     1 
ATOM   2487  O  O     . LEU A 1 321 ? 9.536   -14.613 29.632  1.00 61.78  ? 321 LEU A O     1 
ATOM   2488  C  CB    . LEU A 1 321 ? 10.078  -12.345 27.500  1.00 62.19  ? 321 LEU A CB    1 
ATOM   2489  C  CG    . LEU A 1 321 ? 10.578  -13.591 26.783  1.00 61.61  ? 321 LEU A CG    1 
ATOM   2490  C  CD1   . LEU A 1 321 ? 9.451   -14.564 26.643  1.00 61.07  ? 321 LEU A CD1   1 
ATOM   2491  C  CD2   . LEU A 1 321 ? 11.080  -13.224 25.408  1.00 62.48  ? 321 LEU A CD2   1 
ATOM   2492  N  N     . MET A 1 322 ? 7.862   -13.124 29.843  1.00 64.50  ? 322 MET A N     1 
ATOM   2493  C  CA    . MET A 1 322 ? 6.930   -14.102 30.388  1.00 65.87  ? 322 MET A CA    1 
ATOM   2494  C  C     . MET A 1 322 ? 5.504   -14.106 29.848  1.00 66.52  ? 322 MET A C     1 
ATOM   2495  O  O     . MET A 1 322 ? 4.987   -13.082 29.389  1.00 66.09  ? 322 MET A O     1 
ATOM   2496  C  CB    . MET A 1 322 ? 6.866   -13.934 31.913  1.00 65.86  ? 322 MET A CB    1 
ATOM   2497  C  CG    . MET A 1 322 ? 6.443   -12.547 32.374  0.00 65.92  ? 322 MET A CG    1 
ATOM   2498  S  SD    . MET A 1 322 ? 6.426   -12.390 34.171  0.00 65.94  ? 322 MET A SD    1 
ATOM   2499  C  CE    . MET A 1 322 ? 8.138   -11.966 34.491  0.00 65.97  ? 322 MET A CE    1 
ATOM   2500  N  N     . GLY A 1 323 ? 4.894   -15.290 29.907  1.00 67.24  ? 323 GLY A N     1 
ATOM   2501  C  CA    . GLY A 1 323 ? 3.505   -15.471 29.520  1.00 69.91  ? 323 GLY A CA    1 
ATOM   2502  C  C     . GLY A 1 323 ? 2.859   -15.452 30.893  1.00 71.19  ? 323 GLY A C     1 
ATOM   2503  O  O     . GLY A 1 323 ? 3.133   -14.531 31.659  1.00 72.21  ? 323 GLY A O     1 
ATOM   2504  N  N     . ARG A 1 324 ? 2.023   -16.429 31.234  1.00 72.00  ? 324 ARG A N     1 
ATOM   2505  C  CA    . ARG A 1 324 ? 1.447   -16.453 32.580  1.00 72.54  ? 324 ARG A CA    1 
ATOM   2506  C  C     . ARG A 1 324 ? 2.637   -16.756 33.478  1.00 72.18  ? 324 ARG A C     1 
ATOM   2507  O  O     . ARG A 1 324 ? 2.716   -16.320 34.629  1.00 73.13  ? 324 ARG A O     1 
ATOM   2508  C  CB    . ARG A 1 324 ? 0.448   -17.593 32.735  1.00 72.56  ? 324 ARG A CB    1 
ATOM   2509  C  CG    . ARG A 1 324 ? -1.017  -17.193 32.770  1.00 72.45  ? 324 ARG A CG    1 
ATOM   2510  C  CD    . ARG A 1 324 ? -1.686  -18.242 33.611  1.00 72.20  ? 324 ARG A CD    1 
ATOM   2511  N  NE    . ARG A 1 324 ? -3.120  -18.106 33.787  0.00 72.43  ? 324 ARG A NE    1 
ATOM   2512  C  CZ    . ARG A 1 324 ? -3.779  -18.796 34.708  0.00 72.45  ? 324 ARG A CZ    1 
ATOM   2513  N  NH1   . ARG A 1 324 ? -3.106  -19.626 35.489  0.00 72.50  ? 324 ARG A NH1   1 
ATOM   2514  N  NH2   . ARG A 1 324 ? -5.089  -18.670 34.850  0.00 72.50  ? 324 ARG A NH2   1 
ATOM   2515  N  N     . ARG A 1 325 ? 3.565   -17.523 32.918  1.00 71.27  ? 325 ARG A N     1 
ATOM   2516  C  CA    . ARG A 1 325 ? 4.762   -17.929 33.631  1.00 70.30  ? 325 ARG A CA    1 
ATOM   2517  C  C     . ARG A 1 325 ? 6.036   -17.521 32.897  1.00 69.48  ? 325 ARG A C     1 
ATOM   2518  O  O     . ARG A 1 325 ? 5.987   -16.988 31.783  1.00 70.27  ? 325 ARG A O     1 
ATOM   2519  C  CB    . ARG A 1 325 ? 4.742   -19.429 33.833  1.00 70.45  ? 325 ARG A CB    1 
ATOM   2520  N  N     . ALA A 1 326 ? 7.174   -17.774 33.536  1.00 67.10  ? 326 ALA A N     1 
ATOM   2521  C  CA    . ALA A 1 326 ? 8.469   -17.453 32.962  1.00 64.54  ? 326 ALA A CA    1 
ATOM   2522  C  C     . ALA A 1 326 ? 8.718   -18.336 31.741  1.00 63.48  ? 326 ALA A C     1 
ATOM   2523  O  O     . ALA A 1 326 ? 8.819   -19.559 31.846  1.00 63.12  ? 326 ALA A O     1 
ATOM   2524  C  CB    . ALA A 1 326 ? 9.550   -17.668 33.996  1.00 64.79  ? 326 ALA A CB    1 
ATOM   2525  N  N     . VAL A 1 327 ? 8.827   -17.706 30.580  1.00 61.88  ? 327 VAL A N     1 
ATOM   2526  C  CA    . VAL A 1 327 ? 9.041   -18.435 29.342  1.00 60.40  ? 327 VAL A CA    1 
ATOM   2527  C  C     . VAL A 1 327 ? 10.424  -18.145 28.739  1.00 59.36  ? 327 VAL A C     1 
ATOM   2528  O  O     . VAL A 1 327 ? 11.063  -17.155 29.095  1.00 58.49  ? 327 VAL A O     1 
ATOM   2529  C  CB    . VAL A 1 327 ? 7.896   -18.085 28.349  1.00 60.56  ? 327 VAL A CB    1 
ATOM   2530  C  CG1   . VAL A 1 327 ? 7.721   -16.587 28.270  1.00 59.67  ? 327 VAL A CG1   1 
ATOM   2531  C  CG2   . VAL A 1 327 ? 8.174   -18.664 26.983  1.00 61.74  ? 327 VAL A CG2   1 
ATOM   2532  N  N     . SER A 1 328 ? 10.893  -19.029 27.855  1.00 59.08  ? 328 SER A N     1 
ATOM   2533  C  CA    . SER A 1 328 ? 12.192  -18.873 27.188  1.00 58.65  ? 328 SER A CA    1 
ATOM   2534  C  C     . SER A 1 328 ? 12.099  -18.425 25.720  1.00 58.79  ? 328 SER A C     1 
ATOM   2535  O  O     . SER A 1 328 ? 12.950  -17.675 25.238  1.00 58.65  ? 328 SER A O     1 
ATOM   2536  C  CB    . SER A 1 328 ? 12.972  -20.169 27.231  1.00 58.12  ? 328 SER A CB    1 
ATOM   2537  O  OG    . SER A 1 328 ? 14.002  -20.108 26.263  1.00 58.93  ? 328 SER A OG    1 
ATOM   2538  N  N     . LYS A 1 329 ? 11.093  -18.932 25.010  1.00 58.51  ? 329 LYS A N     1 
ATOM   2539  C  CA    . LYS A 1 329 ? 10.831  -18.570 23.618  1.00 57.84  ? 329 LYS A CA    1 
ATOM   2540  C  C     . LYS A 1 329 ? 9.316   -18.493 23.507  1.00 57.01  ? 329 LYS A C     1 
ATOM   2541  O  O     . LYS A 1 329 ? 8.603   -19.305 24.094  1.00 57.05  ? 329 LYS A O     1 
ATOM   2542  C  CB    . LYS A 1 329 ? 11.383  -19.617 22.649  1.00 59.64  ? 329 LYS A CB    1 
ATOM   2543  C  CG    . LYS A 1 329 ? 10.743  -20.990 22.721  1.00 62.51  ? 329 LYS A CG    1 
ATOM   2544  C  CD    . LYS A 1 329 ? 11.431  -21.938 21.750  1.00 64.86  ? 329 LYS A CD    1 
ATOM   2545  C  CE    . LYS A 1 329 ? 11.038  -23.391 21.998  1.00 67.66  ? 329 LYS A CE    1 
ATOM   2546  N  NZ    . LYS A 1 329 ? 11.747  -24.335 21.065  1.00 69.81  ? 329 LYS A NZ    1 
ATOM   2547  N  N     . PRO A 1 330 ? 8.800   -17.514 22.755  1.00 55.83  ? 330 PRO A N     1 
ATOM   2548  C  CA    . PRO A 1 330 ? 7.357   -17.346 22.594  1.00 54.98  ? 330 PRO A CA    1 
ATOM   2549  C  C     . PRO A 1 330 ? 6.563   -18.637 22.543  1.00 55.42  ? 330 PRO A C     1 
ATOM   2550  O  O     . PRO A 1 330 ? 5.472   -18.720 23.104  1.00 55.33  ? 330 PRO A O     1 
ATOM   2551  C  CB    . PRO A 1 330 ? 7.258   -16.540 21.312  1.00 53.95  ? 330 PRO A CB    1 
ATOM   2552  C  CG    . PRO A 1 330 ? 8.437   -15.652 21.428  1.00 53.31  ? 330 PRO A CG    1 
ATOM   2553  C  CD    . PRO A 1 330 ? 9.525   -16.612 21.846  1.00 54.29  ? 330 PRO A CD    1 
ATOM   2554  N  N     . ALA A 1 331 ? 7.117   -19.651 21.891  1.00 56.01  ? 331 ALA A N     1 
ATOM   2555  C  CA    . ALA A 1 331 ? 6.429   -20.931 21.767  1.00 57.66  ? 331 ALA A CA    1 
ATOM   2556  C  C     . ALA A 1 331 ? 6.129   -21.647 23.095  1.00 58.68  ? 331 ALA A C     1 
ATOM   2557  O  O     . ALA A 1 331 ? 5.193   -22.450 23.179  1.00 58.06  ? 331 ALA A O     1 
ATOM   2558  C  CB    . ALA A 1 331 ? 7.223   -21.841 20.850  1.00 57.43  ? 331 ALA A CB    1 
ATOM   2559  N  N     . ASP A 1 332 ? 6.912   -21.359 24.131  1.00 59.64  ? 332 ASP A N     1 
ATOM   2560  C  CA    . ASP A 1 332 ? 6.700   -22.002 25.418  1.00 60.83  ? 332 ASP A CA    1 
ATOM   2561  C  C     . ASP A 1 332 ? 5.413   -21.531 26.052  1.00 62.52  ? 332 ASP A C     1 
ATOM   2562  O  O     . ASP A 1 332 ? 5.019   -22.033 27.097  1.00 64.43  ? 332 ASP A O     1 
ATOM   2563  C  CB    . ASP A 1 332 ? 7.843   -21.702 26.386  1.00 61.58  ? 332 ASP A CB    1 
ATOM   2564  C  CG    . ASP A 1 332 ? 9.207   -22.079 25.833  1.00 63.39  ? 332 ASP A CG    1 
ATOM   2565  O  OD1   . ASP A 1 332 ? 9.336   -23.163 25.221  1.00 64.99  ? 332 ASP A OD1   1 
ATOM   2566  O  OD2   . ASP A 1 332 ? 10.161  -21.294 26.028  1.00 62.06  ? 332 ASP A OD2   1 
ATOM   2567  N  N     . ALA A 1 333 ? 4.755   -20.562 25.429  1.00 64.31  ? 333 ALA A N     1 
ATOM   2568  C  CA    . ALA A 1 333 ? 3.514   -20.024 25.978  1.00 65.71  ? 333 ALA A CA    1 
ATOM   2569  C  C     . ALA A 1 333 ? 2.287   -20.849 25.602  1.00 66.33  ? 333 ALA A C     1 
ATOM   2570  O  O     . ALA A 1 333 ? 1.179   -20.584 26.083  1.00 66.69  ? 333 ALA A O     1 
ATOM   2571  C  CB    . ALA A 1 333 ? 3.329   -18.583 25.524  1.00 65.77  ? 333 ALA A CB    1 
ATOM   2572  N  N     . LEU A 1 334 ? 2.489   -21.842 24.741  1.00 66.05  ? 334 LEU A N     1 
ATOM   2573  C  CA    . LEU A 1 334 ? 1.400   -22.703 24.305  1.00 66.07  ? 334 LEU A CA    1 
ATOM   2574  C  C     . LEU A 1 334 ? 1.216   -23.811 25.330  1.00 67.31  ? 334 LEU A C     1 
ATOM   2575  O  O     . LEU A 1 334 ? 0.105   -24.323 25.524  1.00 67.42  ? 334 LEU A O     1 
ATOM   2576  C  CB    . LEU A 1 334 ? 1.717   -23.304 22.929  1.00 64.80  ? 334 LEU A CB    1 
ATOM   2577  C  CG    . LEU A 1 334 ? 1.729   -22.380 21.700  1.00 63.21  ? 334 LEU A CG    1 
ATOM   2578  C  CD1   . LEU A 1 334 ? 2.238   -23.139 20.493  1.00 60.65  ? 334 LEU A CD1   1 
ATOM   2579  C  CD2   . LEU A 1 334 ? 0.332   -21.843 21.432  1.00 62.85  ? 334 LEU A CD2   1 
ATOM   2580  N  N     . ARG A 1 335 ? 2.319   -24.162 25.992  1.00 68.14  ? 335 ARG A N     1 
ATOM   2581  C  CA    . ARG A 1 335 ? 2.319   -25.212 27.005  1.00 68.50  ? 335 ARG A CA    1 
ATOM   2582  C  C     . ARG A 1 335 ? 2.089   -24.640 28.393  1.00 68.73  ? 335 ARG A C     1 
ATOM   2583  O  O     . ARG A 1 335 ? 1.296   -25.172 29.166  1.00 70.54  ? 335 ARG A O     1 
ATOM   2584  C  CB    . ARG A 1 335 ? 3.645   -25.980 26.969  1.00 67.54  ? 335 ARG A CB    1 
ATOM   2585  N  N     . VAL A 1 336 ? 2.762   -23.541 28.700  1.00 68.29  ? 336 VAL A N     1 
ATOM   2586  C  CA    . VAL A 1 336 ? 2.633   -22.931 30.011  1.00 69.66  ? 336 VAL A CA    1 
ATOM   2587  C  C     . VAL A 1 336 ? 1.457   -21.954 30.167  1.00 71.47  ? 336 VAL A C     1 
ATOM   2588  O  O     . VAL A 1 336 ? 1.003   -21.702 31.282  1.00 72.23  ? 336 VAL A O     1 
ATOM   2589  C  CB    . VAL A 1 336 ? 3.950   -22.223 30.379  1.00 69.10  ? 336 VAL A CB    1 
ATOM   2590  C  CG1   . VAL A 1 336 ? 3.882   -21.694 31.786  1.00 69.56  ? 336 VAL A CG1   1 
ATOM   2591  C  CG2   . VAL A 1 336 ? 5.111   -23.194 30.237  1.00 68.47  ? 336 VAL A CG2   1 
ATOM   2592  N  N     . GLY A 1 337 ? 0.953   -21.418 29.056  1.00 73.30  ? 337 GLY A N     1 
ATOM   2593  C  CA    . GLY A 1 337 ? -0.150  -20.467 29.117  1.00 74.56  ? 337 GLY A CA    1 
ATOM   2594  C  C     . GLY A 1 337 ? 0.391   -19.081 28.830  1.00 75.65  ? 337 GLY A C     1 
ATOM   2595  O  O     . GLY A 1 337 ? 1.601   -18.894 28.870  1.00 75.31  ? 337 GLY A O     1 
ATOM   2596  N  N     . PHE A 1 338 ? -0.463  -18.103 28.546  1.00 77.35  ? 338 PHE A N     1 
ATOM   2597  C  CA    . PHE A 1 338 ? 0.063   -16.773 28.258  1.00 79.60  ? 338 PHE A CA    1 
ATOM   2598  C  C     . PHE A 1 338 ? -0.266  -15.645 29.218  1.00 80.32  ? 338 PHE A C     1 
ATOM   2599  O  O     . PHE A 1 338 ? -1.030  -15.812 30.160  1.00 80.50  ? 338 PHE A O     1 
ATOM   2600  C  CB    . PHE A 1 338 ? -0.298  -16.337 26.837  1.00 81.00  ? 338 PHE A CB    1 
ATOM   2601  C  CG    . PHE A 1 338 ? -1.329  -17.187 26.180  1.00 82.09  ? 338 PHE A CG    1 
ATOM   2602  C  CD1   . PHE A 1 338 ? -2.651  -17.143 26.598  1.00 82.24  ? 338 PHE A CD1   1 
ATOM   2603  C  CD2   . PHE A 1 338 ? -0.977  -18.025 25.124  1.00 82.80  ? 338 PHE A CD2   1 
ATOM   2604  C  CE1   . PHE A 1 338 ? -3.616  -17.920 25.971  1.00 83.20  ? 338 PHE A CE1   1 
ATOM   2605  C  CE2   . PHE A 1 338 ? -1.931  -18.808 24.489  1.00 83.29  ? 338 PHE A CE2   1 
ATOM   2606  C  CZ    . PHE A 1 338 ? -3.256  -18.757 24.913  1.00 83.47  ? 338 PHE A CZ    1 
ATOM   2607  N  N     . TYR A 1 339 ? 0.339   -14.491 28.943  1.00 81.82  ? 339 TYR A N     1 
ATOM   2608  C  CA    . TYR A 1 339 ? 0.202   -13.272 29.740  1.00 83.78  ? 339 TYR A CA    1 
ATOM   2609  C  C     . TYR A 1 339 ? -1.219  -12.724 29.876  1.00 85.27  ? 339 TYR A C     1 
ATOM   2610  O  O     . TYR A 1 339 ? -1.756  -12.663 30.986  1.00 85.26  ? 339 TYR A O     1 
ATOM   2611  C  CB    . TYR A 1 339 ? 1.107   -12.178 29.158  1.00 82.80  ? 339 TYR A CB    1 
ATOM   2612  C  CG    . TYR A 1 339 ? 1.312   -10.990 30.073  1.00 82.51  ? 339 TYR A CG    1 
ATOM   2613  C  CD1   . TYR A 1 339 ? 2.077   -11.107 31.236  1.00 81.82  ? 339 TYR A CD1   1 
ATOM   2614  C  CD2   . TYR A 1 339 ? 0.736   -9.751  29.782  1.00 82.26  ? 339 TYR A CD2   1 
ATOM   2615  C  CE1   . TYR A 1 339 ? 2.262   -10.021 32.088  1.00 81.74  ? 339 TYR A CE1   1 
ATOM   2616  C  CE2   . TYR A 1 339 ? 0.914   -8.657  30.627  1.00 82.11  ? 339 TYR A CE2   1 
ATOM   2617  C  CZ    . TYR A 1 339 ? 1.676   -8.801  31.776  1.00 82.49  ? 339 TYR A CZ    1 
ATOM   2618  O  OH    . TYR A 1 339 ? 1.839   -7.725  32.614  1.00 83.06  ? 339 TYR A OH    1 
ATOM   2619  N  N     . ARG A 1 340 ? -1.811  -12.306 28.757  1.00 86.81  ? 340 ARG A N     1 
ATOM   2620  C  CA    . ARG A 1 340 ? -3.169  -11.754 28.759  1.00 88.53  ? 340 ARG A CA    1 
ATOM   2621  C  C     . ARG A 1 340 ? -4.146  -12.540 27.884  1.00 88.93  ? 340 ARG A C     1 
ATOM   2622  O  O     . ARG A 1 340 ? -4.126  -12.432 26.652  1.00 88.39  ? 340 ARG A O     1 
ATOM   2623  C  CB    . ARG A 1 340 ? -3.163  -10.299 28.288  1.00 89.82  ? 340 ARG A CB    1 
ATOM   2624  C  CG    . ARG A 1 340 ? -4.552  -9.666  28.256  1.00 92.45  ? 340 ARG A CG    1 
ATOM   2625  C  CD    . ARG A 1 340 ? -4.534  -8.371  27.480  1.00 94.74  ? 340 ARG A CD    1 
ATOM   2626  N  NE    . ARG A 1 340 ? -3.512  -7.463  27.987  1.00 97.38  ? 340 ARG A NE    1 
ATOM   2627  C  CZ    . ARG A 1 340 ? -3.061  -6.405  27.324  1.00 98.56  ? 340 ARG A CZ    1 
ATOM   2628  N  NH1   . ARG A 1 340 ? -3.544  -6.122  26.119  1.00 98.59  ? 340 ARG A NH1   1 
ATOM   2629  N  NH2   . ARG A 1 340 ? -2.127  -5.633  27.865  1.00 99.34  ? 340 ARG A NH2   1 
ATOM   2630  N  N     . ALA A 1 341 ? -5.019  -13.306 28.534  1.00 89.19  ? 341 ALA A N     1 
ATOM   2631  C  CA    . ALA A 1 341 ? -6.014  -14.114 27.837  1.00 88.84  ? 341 ALA A CA    1 
ATOM   2632  C  C     . ALA A 1 341 ? -7.361  -13.407 27.731  1.00 88.24  ? 341 ALA A C     1 
ATOM   2633  O  O     . ALA A 1 341 ? -7.657  -12.484 28.490  1.00 88.12  ? 341 ALA A O     1 
ATOM   2634  C  CB    . ALA A 1 341 ? -6.185  -15.439 28.552  1.00 88.98  ? 341 ALA A CB    1 
ATOM   2635  N  N     . GLN A 1 342 ? -8.177  -13.851 26.784  1.00 87.79  ? 342 GLN A N     1 
ATOM   2636  C  CA    . GLN A 1 342 ? -9.499  -13.274 26.583  1.00 88.32  ? 342 GLN A CA    1 
ATOM   2637  C  C     . GLN A 1 342 ? -10.420 -14.326 26.008  1.00 87.68  ? 342 GLN A C     1 
ATOM   2638  O  O     . GLN A 1 342 ? -9.967  -15.384 25.573  1.00 88.20  ? 342 GLN A O     1 
ATOM   2639  C  CB    . GLN A 1 342 ? -9.443  -12.112 25.594  1.00 90.14  ? 342 GLN A CB    1 
ATOM   2640  C  CG    . GLN A 1 342 ? -8.773  -10.852 26.094  1.00 92.49  ? 342 GLN A CG    1 
ATOM   2641  C  CD    . GLN A 1 342 ? -8.557  -9.853  24.972  1.00 93.82  ? 342 GLN A CD    1 
ATOM   2642  O  OE1   . GLN A 1 342 ? -7.829  -10.127 24.012  1.00 94.13  ? 342 GLN A OE1   1 
ATOM   2643  N  NE2   . GLN A 1 342 ? -9.195  -8.692  25.080  1.00 93.91  ? 342 GLN A NE2   1 
ATOM   2644  N  N     . GLU A 1 343 ? -11.716 -14.035 26.009  1.00 86.38  ? 343 GLU A N     1 
ATOM   2645  C  CA    . GLU A 1 343 ? -12.685 -14.955 25.435  1.00 85.63  ? 343 GLU A CA    1 
ATOM   2646  C  C     . GLU A 1 343 ? -12.540 -14.769 23.929  1.00 83.81  ? 343 GLU A C     1 
ATOM   2647  O  O     . GLU A 1 343 ? -12.766 -13.673 23.417  1.00 84.45  ? 343 GLU A O     1 
ATOM   2648  C  CB    . GLU A 1 343 ? -14.109 -14.587 25.884  1.00 87.35  ? 343 GLU A CB    1 
ATOM   2649  C  CG    . GLU A 1 343 ? -15.251 -15.403 25.234  1.00 90.58  ? 343 GLU A CG    1 
ATOM   2650  C  CD    . GLU A 1 343 ? -15.529 -15.026 23.766  1.00 93.44  ? 343 GLU A CD    1 
ATOM   2651  O  OE1   . GLU A 1 343 ? -15.612 -13.812 23.467  1.00 95.01  ? 343 GLU A OE1   1 
ATOM   2652  O  OE2   . GLU A 1 343 ? -15.681 -15.936 22.911  1.00 93.07  ? 343 GLU A OE2   1 
ATOM   2653  N  N     . THR A 1 344 ? -12.137 -15.814 23.217  1.00 80.74  ? 344 THR A N     1 
ATOM   2654  C  CA    . THR A 1 344 ? -11.999 -15.679 21.781  1.00 78.59  ? 344 THR A CA    1 
ATOM   2655  C  C     . THR A 1 344 ? -12.504 -16.904 21.039  1.00 77.51  ? 344 THR A C     1 
ATOM   2656  O  O     . THR A 1 344 ? -12.292 -18.039 21.470  1.00 77.79  ? 344 THR A O     1 
ATOM   2657  C  CB    . THR A 1 344 ? -10.542 -15.413 21.381  1.00 78.67  ? 344 THR A CB    1 
ATOM   2658  O  OG1   . THR A 1 344 ? -10.012 -14.349 22.181  1.00 78.96  ? 344 THR A OG1   1 
ATOM   2659  C  CG2   . THR A 1 344 ? -10.471 -15.000 19.917  1.00 78.09  ? 344 THR A CG2   1 
ATOM   2660  N  N     . ALA A 1 345 ? -13.185 -16.655 19.923  1.00 75.07  ? 345 ALA A N     1 
ATOM   2661  C  CA    . ALA A 1 345 ? -13.730 -17.716 19.088  1.00 72.36  ? 345 ALA A CA    1 
ATOM   2662  C  C     . ALA A 1 345 ? -12.954 -17.791 17.780  1.00 70.51  ? 345 ALA A C     1 
ATOM   2663  O  O     . ALA A 1 345 ? -12.899 -16.826 17.020  1.00 71.19  ? 345 ALA A O     1 
ATOM   2664  C  CB    . ALA A 1 345 ? -15.203 -17.451 18.801  1.00 72.69  ? 345 ALA A CB    1 
ATOM   2665  N  N     . LEU A 1 346 ? -12.348 -18.939 17.523  1.00 67.41  ? 346 LEU A N     1 
ATOM   2666  C  CA    . LEU A 1 346 ? -11.589 -19.125 16.299  1.00 65.07  ? 346 LEU A CA    1 
ATOM   2667  C  C     . LEU A 1 346 ? -12.389 -20.002 15.340  1.00 63.44  ? 346 LEU A C     1 
ATOM   2668  O  O     . LEU A 1 346 ? -13.166 -20.836 15.776  1.00 63.10  ? 346 LEU A O     1 
ATOM   2669  C  CB    . LEU A 1 346 ? -10.249 -19.793 16.615  1.00 64.24  ? 346 LEU A CB    1 
ATOM   2670  C  CG    . LEU A 1 346 ? -9.138  -18.991 17.292  1.00 62.69  ? 346 LEU A CG    1 
ATOM   2671  C  CD1   . LEU A 1 346 ? -9.670  -18.125 18.419  1.00 61.28  ? 346 LEU A CD1   1 
ATOM   2672  C  CD2   . LEU A 1 346 ? -8.108  -19.982 17.803  1.00 62.17  ? 346 LEU A CD2   1 
ATOM   2673  N  N     . ALA A 1 347 ? -12.201 -19.811 14.039  1.00 62.01  ? 347 ALA A N     1 
ATOM   2674  C  CA    . ALA A 1 347 ? -12.904 -20.609 13.041  1.00 61.50  ? 347 ALA A CA    1 
ATOM   2675  C  C     . ALA A 1 347 ? -11.903 -21.394 12.199  1.00 60.55  ? 347 ALA A C     1 
ATOM   2676  O  O     . ALA A 1 347 ? -10.754 -20.992 12.047  1.00 60.74  ? 347 ALA A O     1 
ATOM   2677  C  CB    . ALA A 1 347 ? -13.754 -19.715 12.146  1.00 62.25  ? 347 ALA A CB    1 
ATOM   2678  N  N     . LEU A 1 348 ? -12.342 -22.516 11.652  1.00 59.20  ? 348 LEU A N     1 
ATOM   2679  C  CA    . LEU A 1 348 ? -11.470 -23.339 10.838  1.00 58.52  ? 348 LEU A CA    1 
ATOM   2680  C  C     . LEU A 1 348 ? -11.917 -23.238 9.391   1.00 58.41  ? 348 LEU A C     1 
ATOM   2681  O  O     . LEU A 1 348 ? -13.105 -23.114 9.126   1.00 58.40  ? 348 LEU A O     1 
ATOM   2682  C  CB    . LEU A 1 348 ? -11.556 -24.782 11.309  1.00 58.98  ? 348 LEU A CB    1 
ATOM   2683  C  CG    . LEU A 1 348 ? -10.680 -25.802 10.588  1.00 59.18  ? 348 LEU A CG    1 
ATOM   2684  C  CD1   . LEU A 1 348 ? -9.225  -25.532 10.884  1.00 60.20  ? 348 LEU A CD1   1 
ATOM   2685  C  CD2   . LEU A 1 348 ? -11.052 -27.190 11.067  1.00 60.25  ? 348 LEU A CD2   1 
ATOM   2686  N  N     . LEU A 1 349 ? -10.980 -23.259 8.452   1.00 58.21  ? 349 LEU A N     1 
ATOM   2687  C  CA    . LEU A 1 349 ? -11.367 -23.189 7.053   1.00 59.57  ? 349 LEU A CA    1 
ATOM   2688  C  C     . LEU A 1 349 ? -10.531 -24.177 6.292   1.00 61.40  ? 349 LEU A C     1 
ATOM   2689  O  O     . LEU A 1 349 ? -9.498  -23.831 5.729   1.00 60.86  ? 349 LEU A O     1 
ATOM   2690  C  CB    . LEU A 1 349 ? -11.174 -21.790 6.455   1.00 58.83  ? 349 LEU A CB    1 
ATOM   2691  C  CG    . LEU A 1 349 ? -12.028 -21.459 5.211   1.00 58.48  ? 349 LEU A CG    1 
ATOM   2692  C  CD1   . LEU A 1 349 ? -11.621 -20.112 4.627   1.00 58.04  ? 349 LEU A CD1   1 
ATOM   2693  C  CD2   . LEU A 1 349 ? -11.864 -22.527 4.155   1.00 58.19  ? 349 LEU A CD2   1 
ATOM   2694  N  N     . ARG A 1 350 ? -10.998 -25.419 6.310   1.00 64.14  ? 350 ARG A N     1 
ATOM   2695  C  CA    . ARG A 1 350 ? -10.373 -26.536 5.621   1.00 65.94  ? 350 ARG A CA    1 
ATOM   2696  C  C     . ARG A 1 350 ? -10.827 -26.329 4.177   1.00 67.19  ? 350 ARG A C     1 
ATOM   2697  O  O     . ARG A 1 350 ? -11.890 -26.798 3.801   1.00 67.28  ? 350 ARG A O     1 
ATOM   2698  C  CB    . ARG A 1 350 ? -10.962 -27.838 6.180   1.00 66.07  ? 350 ARG A CB    1 
ATOM   2699  C  CG    . ARG A 1 350 ? -10.145 -29.097 5.974   1.00 66.68  ? 350 ARG A CG    1 
ATOM   2700  C  CD    . ARG A 1 350 ? -9.169  -29.325 7.118   1.00 65.71  ? 350 ARG A CD    1 
ATOM   2701  N  NE    . ARG A 1 350 ? -8.336  -30.500 6.880   1.00 66.48  ? 350 ARG A NE    1 
ATOM   2702  C  CZ    . ARG A 1 350 ? -7.683  -30.735 5.742   1.00 67.26  ? 350 ARG A CZ    1 
ATOM   2703  N  NH1   . ARG A 1 350 ? -7.767  -29.880 4.727   1.00 66.59  ? 350 ARG A NH1   1 
ATOM   2704  N  NH2   . ARG A 1 350 ? -6.927  -31.819 5.618   1.00 67.26  ? 350 ARG A NH2   1 
ATOM   2705  N  N     . LEU A 1 351 ? -10.056 -25.615 3.363   1.00 69.89  ? 351 LEU A N     1 
ATOM   2706  C  CA    . LEU A 1 351 ? -10.516 -25.391 1.997   1.00 72.70  ? 351 LEU A CA    1 
ATOM   2707  C  C     . LEU A 1 351 ? -9.958  -26.316 0.918   1.00 75.77  ? 351 LEU A C     1 
ATOM   2708  O  O     . LEU A 1 351 ? -9.795  -25.932 -0.244  1.00 77.09  ? 351 LEU A O     1 
ATOM   2709  C  CB    . LEU A 1 351 ? -10.347 -23.921 1.587   1.00 70.50  ? 351 LEU A CB    1 
ATOM   2710  C  CG    . LEU A 1 351 ? -9.026  -23.186 1.374   1.00 69.71  ? 351 LEU A CG    1 
ATOM   2711  C  CD1   . LEU A 1 351 ? -8.163  -23.838 0.306   1.00 68.53  ? 351 LEU A CD1   1 
ATOM   2712  C  CD2   . LEU A 1 351 ? -9.381  -21.775 0.950   1.00 69.68  ? 351 LEU A CD2   1 
ATOM   2713  N  N     . ASP A 1 352 ? -9.684  -27.546 1.327   1.00 77.68  ? 352 ASP A N     1 
ATOM   2714  C  CA    . ASP A 1 352 ? -9.217  -28.609 0.449   1.00 79.89  ? 352 ASP A CA    1 
ATOM   2715  C  C     . ASP A 1 352 ? -8.891  -29.731 1.410   1.00 81.14  ? 352 ASP A C     1 
ATOM   2716  O  O     . ASP A 1 352 ? -7.895  -29.669 2.136   1.00 81.61  ? 352 ASP A O     1 
ATOM   2717  C  CB    . ASP A 1 352 ? -7.979  -28.212 -0.366  1.00 79.73  ? 352 ASP A CB    1 
ATOM   2718  C  CG    . ASP A 1 352 ? -7.965  -28.864 -1.754  1.00 80.25  ? 352 ASP A CG    1 
ATOM   2719  O  OD1   . ASP A 1 352 ? -6.976  -29.552 -2.093  1.00 81.21  ? 352 ASP A OD1   1 
ATOM   2720  O  OD2   . ASP A 1 352 ? -8.950  -28.686 -2.507  1.00 78.55  ? 352 ASP A OD2   1 
ATOM   2721  N  N     . GLY A 1 353 ? -9.764  -30.734 1.444   1.00 81.41  ? 353 GLY A N     1 
ATOM   2722  C  CA    . GLY A 1 353 ? -9.557  -31.850 2.344   1.00 81.36  ? 353 GLY A CA    1 
ATOM   2723  C  C     . GLY A 1 353 ? -10.823 -32.580 2.743   1.00 81.04  ? 353 GLY A C     1 
ATOM   2724  O  O     . GLY A 1 353 ? -11.743 -32.740 1.947   1.00 81.49  ? 353 GLY A O     1 
ATOM   2725  N  N     . ALA A 1 354 ? -10.866 -33.027 3.990   0.00 80.63  ? 354 ALA A N     1 
ATOM   2726  C  CA    . ALA A 1 354 ? -12.012 -33.764 4.497   0.00 80.08  ? 354 ALA A CA    1 
ATOM   2727  C  C     . ALA A 1 354 ? -12.961 -32.852 5.252   0.00 79.63  ? 354 ALA A C     1 
ATOM   2728  O  O     . ALA A 1 354 ? -14.085 -32.609 4.818   0.00 79.65  ? 354 ALA A O     1 
ATOM   2729  C  CB    . ALA A 1 354 ? -11.533 -34.885 5.406   0.00 80.13  ? 354 ALA A CB    1 
ATOM   2730  N  N     . GLN A 1 355 ? -12.478 -32.354 6.384   1.00 79.21  ? 355 GLN A N     1 
ATOM   2731  C  CA    . GLN A 1 355 ? -13.215 -31.468 7.280   1.00 78.09  ? 355 GLN A CA    1 
ATOM   2732  C  C     . GLN A 1 355 ? -12.980 -31.989 8.689   1.00 77.77  ? 355 GLN A C     1 
ATOM   2733  O  O     . GLN A 1 355 ? -12.774 -33.186 8.889   1.00 77.46  ? 355 GLN A O     1 
ATOM   2734  C  CB    . GLN A 1 355 ? -14.702 -31.479 6.964   1.00 76.45  ? 355 GLN A CB    1 
ATOM   2735  N  N     . GLY A 1 356 ? -13.000 -31.087 9.661   1.00 77.91  ? 356 GLY A N     1 
ATOM   2736  C  CA    . GLY A 1 356 ? -12.781 -31.486 11.035  1.00 77.70  ? 356 GLY A CA    1 
ATOM   2737  C  C     . GLY A 1 356 ? -11.459 -30.948 11.527  1.00 77.81  ? 356 GLY A C     1 
ATOM   2738  O  O     . GLY A 1 356 ? -10.486 -30.885 10.774  1.00 77.25  ? 356 GLY A O     1 
ATOM   2739  N  N     . TRP A 1 357 ? -11.428 -30.557 12.795  1.00 77.92  ? 357 TRP A N     1 
ATOM   2740  C  CA    . TRP A 1 357 ? -10.224 -30.019 13.402  1.00 77.97  ? 357 TRP A CA    1 
ATOM   2741  C  C     . TRP A 1 357 ? -9.169  -31.089 13.662  1.00 77.90  ? 357 TRP A C     1 
ATOM   2742  O  O     . TRP A 1 357 ? -9.465  -32.111 14.275  1.00 78.11  ? 357 TRP A O     1 
ATOM   2743  C  CB    . TRP A 1 357 ? -10.566 -29.349 14.728  1.00 77.65  ? 357 TRP A CB    1 
ATOM   2744  C  CG    . TRP A 1 357 ? -10.839 -27.889 14.635  1.00 78.03  ? 357 TRP A CG    1 
ATOM   2745  C  CD1   . TRP A 1 357 ? -12.052 -27.283 14.513  1.00 78.39  ? 357 TRP A CD1   1 
ATOM   2746  C  CD2   . TRP A 1 357 ? -9.871  -26.840 14.721  1.00 79.22  ? 357 TRP A CD2   1 
ATOM   2747  N  NE1   . TRP A 1 357 ? -11.903 -25.915 14.527  1.00 78.16  ? 357 TRP A NE1   1 
ATOM   2748  C  CE2   . TRP A 1 357 ? -10.575 -25.618 14.653  1.00 79.05  ? 357 TRP A CE2   1 
ATOM   2749  C  CE3   . TRP A 1 357 ? -8.474  -26.815 14.850  1.00 80.02  ? 357 TRP A CE3   1 
ATOM   2750  C  CZ2   . TRP A 1 357 ? -9.927  -24.379 14.716  1.00 79.09  ? 357 TRP A CZ2   1 
ATOM   2751  C  CZ3   . TRP A 1 357 ? -7.830  -25.583 14.911  1.00 79.12  ? 357 TRP A CZ3   1 
ATOM   2752  C  CH2   . TRP A 1 357 ? -8.559  -24.382 14.845  1.00 78.82  ? 357 TRP A CH2   1 
ATOM   2753  N  N     . PRO A 1 358 ? -7.924  -30.871 13.191  1.00 77.88  ? 358 PRO A N     1 
ATOM   2754  C  CA    . PRO A 1 358 ? -6.850  -31.847 13.409  1.00 77.56  ? 358 PRO A CA    1 
ATOM   2755  C  C     . PRO A 1 358 ? -6.671  -32.111 14.902  1.00 76.62  ? 358 PRO A C     1 
ATOM   2756  O  O     . PRO A 1 358 ? -6.409  -31.200 15.681  1.00 76.28  ? 358 PRO A O     1 
ATOM   2757  C  CB    . PRO A 1 358 ? -5.635  -31.165 12.791  1.00 77.72  ? 358 PRO A CB    1 
ATOM   2758  C  CG    . PRO A 1 358 ? -6.239  -30.438 11.634  1.00 77.76  ? 358 PRO A CG    1 
ATOM   2759  C  CD    . PRO A 1 358 ? -7.480  -29.818 12.259  1.00 77.77  ? 358 PRO A CD    1 
ATOM   2760  N  N     . GLU A 1 359 ? -6.828  -33.371 15.278  1.00 76.06  ? 359 GLU A N     1 
ATOM   2761  C  CA    . GLU A 1 359 ? -6.717  -33.821 16.658  1.00 75.55  ? 359 GLU A CA    1 
ATOM   2762  C  C     . GLU A 1 359 ? -5.786  -33.004 17.568  1.00 74.31  ? 359 GLU A C     1 
ATOM   2763  O  O     . GLU A 1 359 ? -6.218  -32.491 18.603  1.00 73.18  ? 359 GLU A O     1 
ATOM   2764  C  CB    . GLU A 1 359 ? -6.280  -35.291 16.664  1.00 76.97  ? 359 GLU A CB    1 
ATOM   2765  C  CG    . GLU A 1 359 ? -6.802  -36.102 15.468  1.00 78.37  ? 359 GLU A CG    1 
ATOM   2766  C  CD    . GLU A 1 359 ? -5.798  -36.205 14.311  1.00 79.10  ? 359 GLU A CD    1 
ATOM   2767  O  OE1   . GLU A 1 359 ? -6.153  -36.764 13.247  1.00 78.20  ? 359 GLU A OE1   1 
ATOM   2768  O  OE2   . GLU A 1 359 ? -4.650  -35.739 14.469  1.00 79.79  ? 359 GLU A OE2   1 
ATOM   2769  N  N     . PHE A 1 360 ? -4.517  -32.887 17.179  1.00 73.17  ? 360 PHE A N     1 
ATOM   2770  C  CA    . PHE A 1 360 ? -3.515  -32.167 17.974  1.00 72.14  ? 360 PHE A CA    1 
ATOM   2771  C  C     . PHE A 1 360 ? -3.702  -30.661 18.118  1.00 70.52  ? 360 PHE A C     1 
ATOM   2772  O  O     . PHE A 1 360 ? -3.429  -30.099 19.178  1.00 69.53  ? 360 PHE A O     1 
ATOM   2773  C  CB    . PHE A 1 360 ? -2.119  -32.444 17.427  1.00 73.25  ? 360 PHE A CB    1 
ATOM   2774  C  CG    . PHE A 1 360 ? -1.950  -32.087 15.985  1.00 74.94  ? 360 PHE A CG    1 
ATOM   2775  C  CD1   . PHE A 1 360 ? -2.700  -32.719 15.003  1.00 75.54  ? 360 PHE A CD1   1 
ATOM   2776  C  CD2   . PHE A 1 360 ? -1.027  -31.119 15.604  1.00 76.32  ? 360 PHE A CD2   1 
ATOM   2777  C  CE1   . PHE A 1 360 ? -2.531  -32.397 13.663  1.00 76.90  ? 360 PHE A CE1   1 
ATOM   2778  C  CE2   . PHE A 1 360 ? -0.848  -30.789 14.263  1.00 76.92  ? 360 PHE A CE2   1 
ATOM   2779  C  CZ    . PHE A 1 360 ? -1.603  -31.430 13.294  1.00 77.40  ? 360 PHE A CZ    1 
ATOM   2780  N  N     . LEU A 1 361 ? -4.141  -30.006 17.051  1.00 69.69  ? 361 LEU A N     1 
ATOM   2781  C  CA    . LEU A 1 361 ? -4.385  -28.567 17.092  1.00 68.23  ? 361 LEU A CA    1 
ATOM   2782  C  C     . LEU A 1 361 ? -5.495  -28.322 18.100  1.00 67.37  ? 361 LEU A C     1 
ATOM   2783  O  O     . LEU A 1 361 ? -5.326  -27.560 19.055  1.00 67.38  ? 361 LEU A O     1 
ATOM   2784  C  CB    . LEU A 1 361 ? -4.813  -28.057 15.714  1.00 67.70  ? 361 LEU A CB    1 
ATOM   2785  C  CG    . LEU A 1 361 ? -3.691  -28.077 14.677  1.00 66.88  ? 361 LEU A CG    1 
ATOM   2786  C  CD1   . LEU A 1 361 ? -4.243  -27.844 13.284  1.00 66.76  ? 361 LEU A CD1   1 
ATOM   2787  C  CD2   . LEU A 1 361 ? -2.671  -27.017 15.054  1.00 65.95  ? 361 LEU A CD2   1 
ATOM   2788  N  N     . ARG A 1 362 ? -6.628  -28.986 17.881  1.00 65.91  ? 362 ARG A N     1 
ATOM   2789  C  CA    . ARG A 1 362 ? -7.775  -28.870 18.770  1.00 64.20  ? 362 ARG A CA    1 
ATOM   2790  C  C     . ARG A 1 362 ? -7.295  -29.135 20.196  1.00 63.45  ? 362 ARG A C     1 
ATOM   2791  O  O     . ARG A 1 362 ? -7.798  -28.548 21.156  1.00 63.16  ? 362 ARG A O     1 
ATOM   2792  C  CB    . ARG A 1 362 ? -8.856  -29.879 18.356  1.00 64.07  ? 362 ARG A CB    1 
ATOM   2793  C  CG    . ARG A 1 362 ? -10.150 -29.794 19.158  1.00 63.74  ? 362 ARG A CG    1 
ATOM   2794  C  CD    . ARG A 1 362 ? -11.350 -30.301 18.357  1.00 62.52  ? 362 ARG A CD    1 
ATOM   2795  N  NE    . ARG A 1 362 ? -12.531 -29.487 18.651  1.00 63.09  ? 362 ARG A NE    1 
ATOM   2796  C  CZ    . ARG A 1 362 ? -13.541 -29.268 17.807  1.00 63.32  ? 362 ARG A CZ    1 
ATOM   2797  N  NH1   . ARG A 1 362 ? -13.539 -29.804 16.591  1.00 63.52  ? 362 ARG A NH1   1 
ATOM   2798  N  NH2   . ARG A 1 362 ? -14.550 -28.487 18.175  1.00 62.07  ? 362 ARG A NH2   1 
ATOM   2799  N  N     . ARG A 1 363 ? -6.298  -30.006 20.325  1.00 62.43  ? 363 ARG A N     1 
ATOM   2800  C  CA    . ARG A 1 363 ? -5.752  -30.333 21.630  1.00 62.05  ? 363 ARG A CA    1 
ATOM   2801  C  C     . ARG A 1 363 ? -4.881  -29.189 22.131  1.00 62.23  ? 363 ARG A C     1 
ATOM   2802  O  O     . ARG A 1 363 ? -5.061  -28.705 23.253  1.00 62.31  ? 363 ARG A O     1 
ATOM   2803  C  CB    . ARG A 1 363 ? -4.934  -31.624 21.554  1.00 62.12  ? 363 ARG A CB    1 
ATOM   2804  C  CG    . ARG A 1 363 ? -4.530  -32.184 22.926  1.00 63.68  ? 363 ARG A CG    1 
ATOM   2805  C  CD    . ARG A 1 363 ? -3.933  -33.596 22.842  1.00 64.32  ? 363 ARG A CD    1 
ATOM   2806  N  NE    . ARG A 1 363 ? -4.833  -34.528 22.165  1.00 65.80  ? 363 ARG A NE    1 
ATOM   2807  C  CZ    . ARG A 1 363 ? -4.621  -35.032 20.950  1.00 66.84  ? 363 ARG A CZ    1 
ATOM   2808  N  NH1   . ARG A 1 363 ? -3.529  -34.701 20.270  1.00 67.27  ? 363 ARG A NH1   1 
ATOM   2809  N  NH2   . ARG A 1 363 ? -5.506  -35.858 20.404  1.00 66.33  ? 363 ARG A NH2   1 
ATOM   2810  N  N     . ALA A 1 364 ? -3.945  -28.759 21.289  1.00 61.86  ? 364 ALA A N     1 
ATOM   2811  C  CA    . ALA A 1 364 ? -3.033  -27.671 21.626  1.00 61.68  ? 364 ALA A CA    1 
ATOM   2812  C  C     . ALA A 1 364 ? -3.786  -26.399 21.990  1.00 62.25  ? 364 ALA A C     1 
ATOM   2813  O  O     . ALA A 1 364 ? -3.423  -25.705 22.941  1.00 61.26  ? 364 ALA A O     1 
ATOM   2814  C  CB    . ALA A 1 364 ? -2.107  -27.402 20.468  1.00 60.67  ? 364 ALA A CB    1 
ATOM   2815  N  N     . LEU A 1 365 ? -4.828  -26.091 21.224  1.00 62.89  ? 365 LEU A N     1 
ATOM   2816  C  CA    . LEU A 1 365 ? -5.623  -24.905 21.493  1.00 64.55  ? 365 LEU A CA    1 
ATOM   2817  C  C     . LEU A 1 365 ? -6.115  -24.938 22.937  1.00 66.16  ? 365 LEU A C     1 
ATOM   2818  O  O     . LEU A 1 365 ? -5.768  -24.070 23.741  1.00 66.23  ? 365 LEU A O     1 
ATOM   2819  C  CB    . LEU A 1 365 ? -6.819  -24.826 20.536  1.00 65.64  ? 365 LEU A CB    1 
ATOM   2820  C  CG    . LEU A 1 365 ? -6.680  -24.127 19.173  1.00 64.42  ? 365 LEU A CG    1 
ATOM   2821  C  CD1   . LEU A 1 365 ? -6.069  -22.747 19.378  1.00 64.48  ? 365 LEU A CD1   1 
ATOM   2822  C  CD2   . LEU A 1 365 ? -5.829  -24.946 18.233  1.00 63.72  ? 365 LEU A CD2   1 
ATOM   2823  N  N     . LEU A 1 366 ? -6.925  -25.939 23.266  1.00 67.64  ? 366 LEU A N     1 
ATOM   2824  C  CA    . LEU A 1 366 ? -7.437  -26.069 24.625  1.00 69.33  ? 366 LEU A CA    1 
ATOM   2825  C  C     . LEU A 1 366 ? -6.270  -26.074 25.601  1.00 70.37  ? 366 LEU A C     1 
ATOM   2826  O  O     . LEU A 1 366 ? -6.297  -25.411 26.632  1.00 69.86  ? 366 LEU A O     1 
ATOM   2827  C  CB    . LEU A 1 366 ? -8.228  -27.371 24.778  1.00 69.20  ? 366 LEU A CB    1 
ATOM   2828  C  CG    . LEU A 1 366 ? -9.729  -27.337 24.489  1.00 68.82  ? 366 LEU A CG    1 
ATOM   2829  C  CD1   . LEU A 1 366 ? -10.384 -26.326 25.421  1.00 68.45  ? 366 LEU A CD1   1 
ATOM   2830  C  CD2   . LEU A 1 366 ? -9.983  -26.989 23.033  1.00 69.09  ? 366 LEU A CD2   1 
ATOM   2831  N  N     . ARG A 1 367 ? -5.240  -26.830 25.251  1.00 72.64  ? 367 ARG A N     1 
ATOM   2832  C  CA    . ARG A 1 367 ? -4.050  -26.957 26.075  1.00 75.42  ? 367 ARG A CA    1 
ATOM   2833  C  C     . ARG A 1 367 ? -3.536  -25.608 26.557  1.00 75.24  ? 367 ARG A C     1 
ATOM   2834  O  O     . ARG A 1 367 ? -3.154  -25.458 27.715  1.00 73.93  ? 367 ARG A O     1 
ATOM   2835  C  CB    . ARG A 1 367 ? -2.961  -27.676 25.274  1.00 78.71  ? 367 ARG A CB    1 
ATOM   2836  C  CG    . ARG A 1 367 ? -1.738  -28.098 26.070  1.00 82.81  ? 367 ARG A CG    1 
ATOM   2837  C  CD    . ARG A 1 367 ? -1.006  -29.180 25.304  1.00 86.56  ? 367 ARG A CD    1 
ATOM   2838  N  NE    . ARG A 1 367 ? -0.037  -29.903 26.122  1.00 91.87  ? 367 ARG A NE    1 
ATOM   2839  C  CZ    . ARG A 1 367 ? 1.230   -29.533 26.297  1.00 94.67  ? 367 ARG A CZ    1 
ATOM   2840  N  NH1   . ARG A 1 367 ? 1.690   -28.434 25.707  1.00 95.52  ? 367 ARG A NH1   1 
ATOM   2841  N  NH2   . ARG A 1 367 ? 2.045   -30.274 27.048  1.00 95.40  ? 367 ARG A NH2   1 
ATOM   2842  N  N     . ALA A 1 368 ? -3.543  -24.626 25.662  1.00 75.96  ? 368 ALA A N     1 
ATOM   2843  C  CA    . ALA A 1 368 ? -3.047  -23.294 25.983  1.00 76.28  ? 368 ALA A CA    1 
ATOM   2844  C  C     . ALA A 1 368 ? -4.007  -22.440 26.797  1.00 76.04  ? 368 ALA A C     1 
ATOM   2845  O  O     . ALA A 1 368 ? -3.596  -21.796 27.759  1.00 75.37  ? 368 ALA A O     1 
ATOM   2846  C  CB    . ALA A 1 368 ? -2.672  -22.569 24.710  1.00 76.49  ? 368 ALA A CB    1 
ATOM   2847  N  N     . PHE A 1 369 ? -5.276  -22.416 26.407  1.00 76.14  ? 369 PHE A N     1 
ATOM   2848  C  CA    . PHE A 1 369 ? -6.257  -21.622 27.135  1.00 76.53  ? 369 PHE A CA    1 
ATOM   2849  C  C     . PHE A 1 369 ? -6.507  -22.182 28.520  1.00 76.86  ? 369 PHE A C     1 
ATOM   2850  O  O     . PHE A 1 369 ? -6.957  -21.474 29.414  1.00 76.66  ? 369 PHE A O     1 
ATOM   2851  C  CB    . PHE A 1 369 ? -7.577  -21.556 26.376  1.00 76.34  ? 369 PHE A CB    1 
ATOM   2852  C  CG    . PHE A 1 369 ? -7.563  -20.605 25.228  1.00 75.45  ? 369 PHE A CG    1 
ATOM   2853  C  CD1   . PHE A 1 369 ? -6.806  -20.875 24.097  1.00 75.95  ? 369 PHE A CD1   1 
ATOM   2854  C  CD2   . PHE A 1 369 ? -8.312  -19.435 25.273  1.00 75.02  ? 369 PHE A CD2   1 
ATOM   2855  C  CE1   . PHE A 1 369 ? -6.792  -19.990 23.023  1.00 75.37  ? 369 PHE A CE1   1 
ATOM   2856  C  CE2   . PHE A 1 369 ? -8.307  -18.545 24.209  1.00 75.09  ? 369 PHE A CE2   1 
ATOM   2857  C  CZ    . PHE A 1 369 ? -7.547  -18.823 23.079  1.00 75.15  ? 369 PHE A CZ    1 
ATOM   2858  N  N     . GLY A 1 370 ? -6.236  -23.463 28.696  1.00 77.70  ? 370 GLY A N     1 
ATOM   2859  C  CA    . GLY A 1 370 ? -6.435  -24.044 30.002  1.00 79.79  ? 370 GLY A CA    1 
ATOM   2860  C  C     . GLY A 1 370 ? -5.362  -23.464 30.890  1.00 81.32  ? 370 GLY A C     1 
ATOM   2861  O  O     . GLY A 1 370 ? -5.648  -22.920 31.958  1.00 80.80  ? 370 GLY A O     1 
ATOM   2862  N  N     . ALA A 1 371 ? -4.119  -23.569 30.423  1.00 83.26  ? 371 ALA A N     1 
ATOM   2863  C  CA    . ALA A 1 371 ? -2.961  -23.064 31.149  1.00 84.94  ? 371 ALA A CA    1 
ATOM   2864  C  C     . ALA A 1 371 ? -3.092  -21.563 31.331  1.00 86.61  ? 371 ALA A C     1 
ATOM   2865  O  O     . ALA A 1 371 ? -2.369  -20.961 32.126  1.00 87.10  ? 371 ALA A O     1 
ATOM   2866  C  CB    . ALA A 1 371 ? -1.679  -23.390 30.389  1.00 83.85  ? 371 ALA A CB    1 
ATOM   2867  N  N     . SER A 1 372 ? -4.023  -20.967 30.589  1.00 88.80  ? 372 SER A N     1 
ATOM   2868  C  CA    . SER A 1 372 ? -4.268  -19.528 30.656  1.00 90.05  ? 372 SER A CA    1 
ATOM   2869  C  C     . SER A 1 372 ? -5.506  -19.259 31.506  1.00 90.49  ? 372 SER A C     1 
ATOM   2870  O  O     . SER A 1 372 ? -5.568  -18.270 32.241  1.00 91.42  ? 372 SER A O     1 
ATOM   2871  C  CB    . SER A 1 372 ? -4.461  -18.958 29.248  1.00 89.52  ? 372 SER A CB    1 
ATOM   2872  O  OG    . SER A 1 372 ? -4.562  -17.547 29.280  0.00 89.79  ? 372 SER A OG    1 
ATOM   2873  N  N     . GLY A 1 373 ? -6.483  -20.156 31.402  1.00 90.38  ? 373 GLY A N     1 
ATOM   2874  C  CA    . GLY A 1 373 ? -7.711  -20.022 32.166  1.00 89.81  ? 373 GLY A CA    1 
ATOM   2875  C  C     . GLY A 1 373 ? -8.769  -19.160 31.502  1.00 89.20  ? 373 GLY A C     1 
ATOM   2876  O  O     . GLY A 1 373 ? -9.351  -18.281 32.144  1.00 89.90  ? 373 GLY A O     1 
ATOM   2877  N  N     . ALA A 1 374 ? -9.031  -19.412 30.223  1.00 87.92  ? 374 ALA A N     1 
ATOM   2878  C  CA    . ALA A 1 374 ? -10.023 -18.633 29.497  1.00 86.56  ? 374 ALA A CA    1 
ATOM   2879  C  C     . ALA A 1 374 ? -10.988 -19.500 28.713  1.00 85.68  ? 374 ALA A C     1 
ATOM   2880  O  O     . ALA A 1 374 ? -10.736 -20.678 28.473  1.00 84.95  ? 374 ALA A O     1 
ATOM   2881  C  CB    . ALA A 1 374 ? -9.328  -17.660 28.562  1.00 86.91  ? 374 ALA A CB    1 
ATOM   2882  N  N     . SER A 1 375 ? -12.096 -18.895 28.307  1.00 85.57  ? 375 SER A N     1 
ATOM   2883  C  CA    . SER A 1 375 ? -13.116 -19.595 27.539  1.00 86.87  ? 375 SER A CA    1 
ATOM   2884  C  C     . SER A 1 375 ? -12.763 -19.639 26.046  1.00 87.04  ? 375 SER A C     1 
ATOM   2885  O  O     . SER A 1 375 ? -12.554 -18.604 25.412  1.00 88.05  ? 375 SER A O     1 
ATOM   2886  C  CB    . SER A 1 375 ? -14.470 -18.905 27.728  1.00 86.90  ? 375 SER A CB    1 
ATOM   2887  O  OG    . SER A 1 375 ? -14.720 -18.653 29.099  1.00 85.67  ? 375 SER A OG    1 
ATOM   2888  N  N     . LEU A 1 376 ? -12.703 -20.841 25.486  1.00 86.14  ? 376 LEU A N     1 
ATOM   2889  C  CA    . LEU A 1 376 ? -12.379 -21.004 24.078  1.00 84.60  ? 376 LEU A CA    1 
ATOM   2890  C  C     . LEU A 1 376 ? -13.518 -21.693 23.336  1.00 83.91  ? 376 LEU A C     1 
ATOM   2891  O  O     . LEU A 1 376 ? -14.048 -22.698 23.800  1.00 84.63  ? 376 LEU A O     1 
ATOM   2892  C  CB    . LEU A 1 376 ? -11.101 -21.827 23.937  1.00 84.19  ? 376 LEU A CB    1 
ATOM   2893  C  CG    . LEU A 1 376 ? -10.711 -22.189 22.506  1.00 84.85  ? 376 LEU A CG    1 
ATOM   2894  C  CD1   . LEU A 1 376 ? -10.415 -20.921 21.727  1.00 85.53  ? 376 LEU A CD1   1 
ATOM   2895  C  CD2   . LEU A 1 376 ? -9.503  -23.107 22.521  1.00 85.07  ? 376 LEU A CD2   1 
ATOM   2896  N  N     . ARG A 1 377 ? -13.899 -21.146 22.187  1.00 82.57  ? 377 ARG A N     1 
ATOM   2897  C  CA    . ARG A 1 377 ? -14.964 -21.731 21.384  1.00 80.99  ? 377 ARG A CA    1 
ATOM   2898  C  C     . ARG A 1 377 ? -14.456 -21.884 19.955  1.00 80.75  ? 377 ARG A C     1 
ATOM   2899  O  O     . ARG A 1 377 ? -14.214 -20.899 19.265  1.00 81.67  ? 377 ARG A O     1 
ATOM   2900  C  CB    . ARG A 1 377 ? -16.210 -20.839 21.425  1.00 79.90  ? 377 ARG A CB    1 
ATOM   2901  C  CG    . ARG A 1 377 ? -16.770 -20.649 22.832  1.00 79.99  ? 377 ARG A CG    1 
ATOM   2902  C  CD    . ARG A 1 377 ? -17.934 -19.669 22.863  1.00 80.21  ? 377 ARG A CD    1 
ATOM   2903  N  NE    . ARG A 1 377 ? -18.529 -19.560 24.192  0.00 80.36  ? 377 ARG A NE    1 
ATOM   2904  C  CZ    . ARG A 1 377 ? -19.533 -18.744 24.496  0.00 80.45  ? 377 ARG A CZ    1 
ATOM   2905  N  NH1   . ARG A 1 377 ? -20.060 -17.960 23.565  0.00 80.51  ? 377 ARG A NH1   1 
ATOM   2906  N  NH2   . ARG A 1 377 ? -20.009 -18.706 25.734  0.00 80.51  ? 377 ARG A NH2   1 
ATOM   2907  N  N     . LEU A 1 378 ? -14.271 -23.129 19.526  1.00 80.08  ? 378 LEU A N     1 
ATOM   2908  C  CA    . LEU A 1 378 ? -13.783 -23.423 18.184  1.00 79.50  ? 378 LEU A CA    1 
ATOM   2909  C  C     . LEU A 1 378 ? -14.919 -23.781 17.225  1.00 79.70  ? 378 LEU A C     1 
ATOM   2910  O  O     . LEU A 1 378 ? -15.545 -24.832 17.351  1.00 79.89  ? 378 LEU A O     1 
ATOM   2911  C  CB    . LEU A 1 378 ? -12.776 -24.579 18.230  1.00 78.82  ? 378 LEU A CB    1 
ATOM   2912  C  CG    . LEU A 1 378 ? -11.451 -24.376 18.971  1.00 78.53  ? 378 LEU A CG    1 
ATOM   2913  C  CD1   . LEU A 1 378 ? -10.688 -25.695 19.042  1.00 77.64  ? 378 LEU A CD1   1 
ATOM   2914  C  CD2   . LEU A 1 378 ? -10.626 -23.326 18.256  1.00 79.27  ? 378 LEU A CD2   1 
ATOM   2915  N  N     . HIS A 1 379 ? -15.177 -22.896 16.267  1.00 80.06  ? 379 HIS A N     1 
ATOM   2916  C  CA    . HIS A 1 379 ? -16.221 -23.105 15.268  1.00 80.18  ? 379 HIS A CA    1 
ATOM   2917  C  C     . HIS A 1 379 ? -15.645 -23.700 13.988  1.00 80.64  ? 379 HIS A C     1 
ATOM   2918  O  O     . HIS A 1 379 ? -14.465 -24.047 13.913  1.00 80.13  ? 379 HIS A O     1 
ATOM   2919  C  CB    . HIS A 1 379 ? -16.911 -21.780 14.931  1.00 79.42  ? 379 HIS A CB    1 
ATOM   2920  C  CG    . HIS A 1 379 ? -17.828 -21.287 16.002  1.00 79.12  ? 379 HIS A CG    1 
ATOM   2921  N  ND1   . HIS A 1 379 ? -19.108 -21.772 16.167  1.00 78.94  ? 379 HIS A ND1   1 
ATOM   2922  C  CD2   . HIS A 1 379 ? -17.642 -20.378 16.988  1.00 80.07  ? 379 HIS A CD2   1 
ATOM   2923  C  CE1   . HIS A 1 379 ? -19.669 -21.183 17.207  1.00 79.59  ? 379 HIS A CE1   1 
ATOM   2924  N  NE2   . HIS A 1 379 ? -18.800 -20.332 17.724  1.00 80.36  ? 379 HIS A NE2   1 
ATOM   2925  N  N     . THR A 1 380 ? -16.496 -23.818 12.978  1.00 81.70  ? 380 THR A N     1 
ATOM   2926  C  CA    . THR A 1 380 ? -16.081 -24.356 11.694  1.00 82.07  ? 380 THR A CA    1 
ATOM   2927  C  C     . THR A 1 380 ? -16.752 -23.575 10.568  1.00 82.06  ? 380 THR A C     1 
ATOM   2928  O  O     . THR A 1 380 ? -17.927 -23.208 10.654  1.00 81.59  ? 380 THR A O     1 
ATOM   2929  C  CB    . THR A 1 380 ? -16.432 -25.850 11.574  1.00 81.71  ? 380 THR A CB    1 
ATOM   2930  O  OG1   . THR A 1 380 ? -15.855 -26.561 12.675  1.00 81.64  ? 380 THR A OG1   1 
ATOM   2931  C  CG2   . THR A 1 380 ? -15.881 -26.418 10.277  1.00 81.30  ? 380 THR A CG2   1 
ATOM   2932  N  N     . LEU A 1 381 ? -15.985 -23.313 9.516   1.00 82.45  ? 381 LEU A N     1 
ATOM   2933  C  CA    . LEU A 1 381 ? -16.484 -22.559 8.383   1.00 82.72  ? 381 LEU A CA    1 
ATOM   2934  C  C     . LEU A 1 381 ? -16.730 -23.490 7.207   1.00 83.65  ? 381 LEU A C     1 
ATOM   2935  O  O     . LEU A 1 381 ? -15.794 -23.997 6.588   1.00 82.81  ? 381 LEU A O     1 
ATOM   2936  C  CB    . LEU A 1 381 ? -15.485 -21.458 8.013   1.00 81.30  ? 381 LEU A CB    1 
ATOM   2937  C  CG    . LEU A 1 381 ? -16.087 -20.168 7.459   1.00 79.29  ? 381 LEU A CG    1 
ATOM   2938  C  CD1   . LEU A 1 381 ? -15.255 -18.992 7.915   1.00 77.93  ? 381 LEU A CD1   1 
ATOM   2939  C  CD2   . LEU A 1 381 ? -16.171 -20.242 5.942   1.00 79.24  ? 381 LEU A CD2   1 
ATOM   2940  N  N     . HIS A 1 382 ? -18.012 -23.712 6.931   1.00 85.66  ? 382 HIS A N     1 
ATOM   2941  C  CA    . HIS A 1 382 ? -18.467 -24.573 5.846   1.00 87.15  ? 382 HIS A CA    1 
ATOM   2942  C  C     . HIS A 1 382 ? -18.882 -23.696 4.655   1.00 87.59  ? 382 HIS A C     1 
ATOM   2943  O  O     . HIS A 1 382 ? -20.045 -23.305 4.559   1.00 87.26  ? 382 HIS A O     1 
ATOM   2944  C  CB    . HIS A 1 382 ? -19.677 -25.410 6.308   1.00 88.07  ? 382 HIS A CB    1 
ATOM   2945  C  CG    . HIS A 1 382 ? -19.433 -26.232 7.542   1.00 89.05  ? 382 HIS A CG    1 
ATOM   2946  N  ND1   . HIS A 1 382 ? -20.151 -26.057 8.711   1.00 89.39  ? 382 HIS A ND1   1 
ATOM   2947  C  CD2   . HIS A 1 382 ? -18.588 -27.266 7.781   1.00 88.60  ? 382 HIS A CD2   1 
ATOM   2948  C  CE1   . HIS A 1 382 ? -19.761 -26.945 9.607   1.00 88.38  ? 382 HIS A CE1   1 
ATOM   2949  N  NE2   . HIS A 1 382 ? -18.812 -27.692 9.067   1.00 88.07  ? 382 HIS A NE2   1 
ATOM   2950  N  N     . ALA A 1 383 ? -17.935 -23.390 3.765   1.00 88.34  ? 383 ALA A N     1 
ATOM   2951  C  CA    . ALA A 1 383 ? -18.189 -22.558 2.578   1.00 88.77  ? 383 ALA A CA    1 
ATOM   2952  C  C     . ALA A 1 383 ? -17.124 -22.779 1.497   1.00 89.28  ? 383 ALA A C     1 
ATOM   2953  O  O     . ALA A 1 383 ? -16.481 -23.823 1.469   1.00 89.63  ? 383 ALA A O     1 
ATOM   2954  C  CB    . ALA A 1 383 ? -18.238 -21.096 2.973   1.00 89.11  ? 383 ALA A CB    1 
ATOM   2955  N  N     . HIS A 1 384 ? -16.911 -21.806 0.615   1.00 90.47  ? 384 HIS A N     1 
ATOM   2956  C  CA    . HIS A 1 384 ? -15.923 -22.011 -0.442  1.00 92.27  ? 384 HIS A CA    1 
ATOM   2957  C  C     . HIS A 1 384 ? -15.831 -20.808 -1.383  1.00 92.82  ? 384 HIS A C     1 
ATOM   2958  O  O     . HIS A 1 384 ? -16.757 -20.002 -1.455  1.00 92.40  ? 384 HIS A O     1 
ATOM   2959  C  CB    . HIS A 1 384 ? -16.332 -23.262 -1.229  1.00 94.12  ? 384 HIS A CB    1 
ATOM   2960  C  CG    . HIS A 1 384 ? -15.214 -23.946 -1.948  1.00 96.09  ? 384 HIS A CG    1 
ATOM   2961  N  ND1   . HIS A 1 384 ? -14.596 -23.411 -3.064  1.00 96.78  ? 384 HIS A ND1   1 
ATOM   2962  C  CD2   . HIS A 1 384 ? -14.652 -25.164 -1.764  1.00 96.78  ? 384 HIS A CD2   1 
ATOM   2963  C  CE1   . HIS A 1 384 ? -13.715 -24.270 -3.533  1.00 97.04  ? 384 HIS A CE1   1 
ATOM   2964  N  NE2   . HIS A 1 384 ? -13.728 -25.347 -2.762  1.00 97.68  ? 384 HIS A NE2   1 
ATOM   2965  N  N     . PRO A 1 385 ? -14.710 -20.686 -2.094  1.00 93.71  ? 385 PRO A N     1 
ATOM   2966  C  CA    . PRO A 1 385 ? -14.527 -19.596 -3.052  1.00 94.17  ? 385 PRO A CA    1 
ATOM   2967  C  C     . PRO A 1 385 ? -15.560 -19.816 -4.147  1.00 94.32  ? 385 PRO A C     1 
ATOM   2968  O  O     . PRO A 1 385 ? -16.050 -18.866 -4.760  1.00 94.98  ? 385 PRO A O     1 
ATOM   2969  C  CB    . PRO A 1 385 ? -13.121 -19.625 -3.644  1.00 93.98  ? 385 PRO A CB    1 
ATOM   2970  N  N     . SER A 1 386 ? -15.877 -21.083 -4.391  1.00 94.00  ? 386 SER A N     1 
ATOM   2971  C  CA    . SER A 1 386 ? -16.875 -21.427 -5.384  1.00 94.00  ? 386 SER A CA    1 
ATOM   2972  C  C     . SER A 1 386 ? -18.137 -20.692 -4.956  1.00 94.24  ? 386 SER A C     1 
ATOM   2973  O  O     . SER A 1 386 ? -18.456 -19.620 -5.470  1.00 94.99  ? 386 SER A O     1 
ATOM   2974  C  CB    . SER A 1 386 ? -17.117 -22.928 -5.386  1.00 93.90  ? 386 SER A CB    1 
ATOM   2975  N  N     . GLN A 1 387 ? -18.827 -21.268 -3.979  1.00 93.66  ? 387 GLN A N     1 
ATOM   2976  C  CA    . GLN A 1 387 ? -20.066 -20.715 -3.444  1.00 92.95  ? 387 GLN A CA    1 
ATOM   2977  C  C     . GLN A 1 387 ? -19.870 -19.330 -2.803  1.00 92.18  ? 387 GLN A C     1 
ATOM   2978  O  O     . GLN A 1 387 ? -20.119 -19.145 -1.612  1.00 92.83  ? 387 GLN A O     1 
ATOM   2979  C  CB    . GLN A 1 387 ? -20.628 -21.721 -2.433  1.00 92.95  ? 387 GLN A CB    1 
ATOM   2980  C  CG    . GLN A 1 387 ? -20.487 -23.155 -2.938  1.00 92.28  ? 387 GLN A CG    1 
ATOM   2981  C  CD    . GLN A 1 387 ? -20.783 -24.201 -1.890  0.00 92.60  ? 387 GLN A CD    1 
ATOM   2982  O  OE1   . GLN A 1 387 ? -20.579 -23.977 -0.699  0.00 92.57  ? 387 GLN A OE1   1 
ATOM   2983  N  NE2   . GLN A 1 387 ? -21.244 -25.366 -2.333  0.00 92.57  ? 387 GLN A NE2   1 
ATOM   2984  N  N     . GLY A 1 388 ? -19.438 -18.362 -3.607  1.00 90.79  ? 388 GLY A N     1 
ATOM   2985  C  CA    . GLY A 1 388 ? -19.198 -17.013 -3.118  1.00 89.88  ? 388 GLY A CA    1 
ATOM   2986  C  C     . GLY A 1 388 ? -20.292 -16.397 -2.260  1.00 89.19  ? 388 GLY A C     1 
ATOM   2987  O  O     . GLY A 1 388 ? -20.077 -16.104 -1.084  1.00 89.17  ? 388 GLY A O     1 
ATOM   2988  N  N     . LEU A 1 389 ? -21.464 -16.186 -2.847  1.00 88.38  ? 389 LEU A N     1 
ATOM   2989  C  CA    . LEU A 1 389 ? -22.586 -15.593 -2.124  1.00 87.60  ? 389 LEU A CA    1 
ATOM   2990  C  C     . LEU A 1 389 ? -22.829 -16.246 -0.761  1.00 87.39  ? 389 LEU A C     1 
ATOM   2991  O  O     . LEU A 1 389 ? -23.140 -15.564 0.225   1.00 86.88  ? 389 LEU A O     1 
ATOM   2992  C  CB    . LEU A 1 389 ? -23.854 -15.676 -2.981  1.00 85.97  ? 389 LEU A CB    1 
ATOM   2993  C  CG    . LEU A 1 389 ? -23.905 -14.706 -4.164  1.00 84.20  ? 389 LEU A CG    1 
ATOM   2994  C  CD1   . LEU A 1 389 ? -25.064 -15.056 -5.088  1.00 82.54  ? 389 LEU A CD1   1 
ATOM   2995  C  CD2   . LEU A 1 389 ? -24.030 -13.286 -3.631  1.00 83.40  ? 389 LEU A CD2   1 
ATOM   2996  N  N     . ALA A 1 390 ? -22.686 -17.568 -0.710  1.00 87.09  ? 390 ALA A N     1 
ATOM   2997  C  CA    . ALA A 1 390 ? -22.886 -18.314 0.530   1.00 86.47  ? 390 ALA A CA    1 
ATOM   2998  C  C     . ALA A 1 390 ? -21.620 -18.253 1.366   1.00 85.58  ? 390 ALA A C     1 
ATOM   2999  O  O     . ALA A 1 390 ? -21.668 -18.338 2.590   1.00 84.75  ? 390 ALA A O     1 
ATOM   3000  C  CB    . ALA A 1 390 ? -23.238 -19.762 0.222   1.00 87.33  ? 390 ALA A CB    1 
ATOM   3001  N  N     . PHE A 1 391 ? -20.486 -18.112 0.692   1.00 84.62  ? 391 PHE A N     1 
ATOM   3002  C  CA    . PHE A 1 391 ? -19.215 -18.020 1.378   1.00 84.04  ? 391 PHE A CA    1 
ATOM   3003  C  C     . PHE A 1 391 ? -19.261 -16.778 2.241   1.00 83.57  ? 391 PHE A C     1 
ATOM   3004  O  O     . PHE A 1 391 ? -18.904 -16.819 3.411   1.00 83.85  ? 391 PHE A O     1 
ATOM   3005  C  CB    . PHE A 1 391 ? -18.073 -17.908 0.379   1.00 84.78  ? 391 PHE A CB    1 
ATOM   3006  C  CG    . PHE A 1 391 ? -16.726 -17.962 1.012   1.00 85.36  ? 391 PHE A CG    1 
ATOM   3007  C  CD1   . PHE A 1 391 ? -16.395 -19.008 1.859   1.00 85.07  ? 391 PHE A CD1   1 
ATOM   3008  C  CD2   . PHE A 1 391 ? -15.795 -16.963 0.784   1.00 86.45  ? 391 PHE A CD2   1 
ATOM   3009  C  CE1   . PHE A 1 391 ? -15.164 -19.068 2.470   1.00 86.03  ? 391 PHE A CE1   1 
ATOM   3010  C  CE2   . PHE A 1 391 ? -14.548 -17.010 1.394   1.00 87.11  ? 391 PHE A CE2   1 
ATOM   3011  C  CZ    . PHE A 1 391 ? -14.234 -18.066 2.241   1.00 87.15  ? 391 PHE A CZ    1 
ATOM   3012  N  N     . ARG A 1 392 ? -19.706 -15.672 1.654   1.00 83.54  ? 392 ARG A N     1 
ATOM   3013  C  CA    . ARG A 1 392 ? -19.826 -14.411 2.377   1.00 83.67  ? 392 ARG A CA    1 
ATOM   3014  C  C     . ARG A 1 392 ? -20.955 -14.533 3.376   1.00 83.05  ? 392 ARG A C     1 
ATOM   3015  O  O     . ARG A 1 392 ? -20.912 -13.950 4.457   1.00 83.09  ? 392 ARG A O     1 
ATOM   3016  C  CB    . ARG A 1 392 ? -20.117 -13.256 1.414   1.00 84.96  ? 392 ARG A CB    1 
ATOM   3017  C  CG    . ARG A 1 392 ? -18.870 -12.643 0.781   1.00 86.74  ? 392 ARG A CG    1 
ATOM   3018  C  CD    . ARG A 1 392 ? -19.006 -12.491 -0.733  1.00 87.46  ? 392 ARG A CD    1 
ATOM   3019  N  NE    . ARG A 1 392 ? -18.093 -13.379 -1.456  1.00 87.93  ? 392 ARG A NE    1 
ATOM   3020  C  CZ    . ARG A 1 392 ? -17.097 -12.964 -2.237  1.00 87.76  ? 392 ARG A CZ    1 
ATOM   3021  N  NH1   . ARG A 1 392 ? -16.322 -13.851 -2.850  1.00 87.34  ? 392 ARG A NH1   1 
ATOM   3022  N  NH2   . ARG A 1 392 ? -16.879 -11.665 -2.408  1.00 87.05  ? 392 ARG A NH2   1 
ATOM   3023  N  N     . GLU A 1 393 ? -21.975 -15.295 3.006   1.00 82.78  ? 393 GLU A N     1 
ATOM   3024  C  CA    . GLU A 1 393 ? -23.098 -15.489 3.901   1.00 83.19  ? 393 GLU A CA    1 
ATOM   3025  C  C     . GLU A 1 393 ? -22.581 -16.217 5.141   1.00 82.20  ? 393 GLU A C     1 
ATOM   3026  O  O     . GLU A 1 393 ? -23.014 -15.945 6.263   1.00 82.07  ? 393 GLU A O     1 
ATOM   3027  C  CB    . GLU A 1 393 ? -24.193 -16.317 3.217   1.00 84.34  ? 393 GLU A CB    1 
ATOM   3028  C  CG    . GLU A 1 393 ? -25.483 -16.420 4.038   1.00 85.31  ? 393 GLU A CG    1 
ATOM   3029  C  CD    . GLU A 1 393 ? -26.544 -17.272 3.368   1.00 85.46  ? 393 GLU A CD    1 
ATOM   3030  O  OE1   . GLU A 1 393 ? -26.333 -17.688 2.208   1.00 85.61  ? 393 GLU A OE1   1 
ATOM   3031  O  OE2   . GLU A 1 393 ? -27.591 -17.522 4.004   1.00 85.16  ? 393 GLU A OE2   1 
ATOM   3032  N  N     . ALA A 1 394 ? -21.642 -17.135 4.926   1.00 80.83  ? 394 ALA A N     1 
ATOM   3033  C  CA    . ALA A 1 394 ? -21.057 -17.916 6.009   1.00 79.30  ? 394 ALA A CA    1 
ATOM   3034  C  C     . ALA A 1 394 ? -20.144 -17.058 6.862   1.00 78.75  ? 394 ALA A C     1 
ATOM   3035  O  O     . ALA A 1 394 ? -20.169 -17.146 8.087   1.00 78.73  ? 394 ALA A O     1 
ATOM   3036  C  CB    . ALA A 1 394 ? -20.282 -19.086 5.444   1.00 79.31  ? 394 ALA A CB    1 
ATOM   3037  N  N     . LEU A 1 395 ? -19.331 -16.237 6.204   1.00 78.47  ? 395 LEU A N     1 
ATOM   3038  C  CA    . LEU A 1 395 ? -18.408 -15.350 6.900   1.00 78.22  ? 395 LEU A CA    1 
ATOM   3039  C  C     . LEU A 1 395 ? -19.198 -14.339 7.713   1.00 78.98  ? 395 LEU A C     1 
ATOM   3040  O  O     . LEU A 1 395 ? -18.908 -14.126 8.890   1.00 78.99  ? 395 LEU A O     1 
ATOM   3041  C  CB    . LEU A 1 395 ? -17.524 -14.592 5.906   1.00 77.37  ? 395 LEU A CB    1 
ATOM   3042  C  CG    . LEU A 1 395 ? -16.606 -15.359 4.957   1.00 76.29  ? 395 LEU A CG    1 
ATOM   3043  C  CD1   . LEU A 1 395 ? -15.981 -14.377 3.979   1.00 76.32  ? 395 LEU A CD1   1 
ATOM   3044  C  CD2   . LEU A 1 395 ? -15.537 -16.096 5.739   1.00 75.37  ? 395 LEU A CD2   1 
ATOM   3045  N  N     . ARG A 1 396 ? -20.195 -13.720 7.079   1.00 79.47  ? 396 ARG A N     1 
ATOM   3046  C  CA    . ARG A 1 396 ? -21.017 -12.719 7.749   1.00 80.88  ? 396 ARG A CA    1 
ATOM   3047  C  C     . ARG A 1 396 ? -21.747 -13.311 8.961   1.00 81.59  ? 396 ARG A C     1 
ATOM   3048  O  O     . ARG A 1 396 ? -21.980 -12.619 9.956   1.00 82.44  ? 396 ARG A O     1 
ATOM   3049  C  CB    . ARG A 1 396 ? -22.039 -12.107 6.777   1.00 81.23  ? 396 ARG A CB    1 
ATOM   3050  C  CG    . ARG A 1 396 ? -23.335 -12.910 6.641   1.00 83.22  ? 396 ARG A CG    1 
ATOM   3051  C  CD    . ARG A 1 396 ? -24.563 -12.020 6.394   1.00 82.39  ? 396 ARG A CD    1 
ATOM   3052  N  NE    . ARG A 1 396 ? -25.739 -12.511 7.119   1.00 82.05  ? 396 ARG A NE    1 
ATOM   3053  C  CZ    . ARG A 1 396 ? -25.998 -12.271 8.408   1.00 80.94  ? 396 ARG A CZ    1 
ATOM   3054  N  NH1   . ARG A 1 396 ? -25.175 -11.535 9.142   1.00 79.52  ? 396 ARG A NH1   1 
ATOM   3055  N  NH2   . ARG A 1 396 ? -27.085 -12.783 8.971   1.00 80.58  ? 396 ARG A NH2   1 
ATOM   3056  N  N     . LYS A 1 397 ? -22.109 -14.588 8.877   1.00 81.72  ? 397 LYS A N     1 
ATOM   3057  C  CA    . LYS A 1 397 ? -22.806 -15.252 9.976   1.00 81.90  ? 397 LYS A CA    1 
ATOM   3058  C  C     . LYS A 1 397 ? -21.806 -15.567 11.075  1.00 81.67  ? 397 LYS A C     1 
ATOM   3059  O  O     . LYS A 1 397 ? -21.951 -15.132 12.217  1.00 81.18  ? 397 LYS A O     1 
ATOM   3060  C  CB    . LYS A 1 397 ? -23.455 -16.556 9.491   1.00 82.41  ? 397 LYS A CB    1 
ATOM   3061  C  CG    . LYS A 1 397 ? -24.195 -17.330 10.573  0.00 82.36  ? 397 LYS A CG    1 
ATOM   3062  C  CD    . LYS A 1 397 ? -24.591 -18.727 10.103  0.00 82.48  ? 397 LYS A CD    1 
ATOM   3063  C  CE    . LYS A 1 397 ? -25.570 -18.686 8.939   0.00 82.50  ? 397 LYS A CE    1 
ATOM   3064  N  NZ    . LYS A 1 397 ? -25.963 -20.057 8.504   0.00 82.55  ? 397 LYS A NZ    1 
ATOM   3065  N  N     . ALA A 1 398 ? -20.782 -16.323 10.700  1.00 81.76  ? 398 ALA A N     1 
ATOM   3066  C  CA    . ALA A 1 398 ? -19.736 -16.743 11.617  1.00 81.59  ? 398 ALA A CA    1 
ATOM   3067  C  C     . ALA A 1 398 ? -19.106 -15.616 12.426  1.00 81.21  ? 398 ALA A C     1 
ATOM   3068  O  O     . ALA A 1 398 ? -18.974 -15.724 13.640  1.00 80.81  ? 398 ALA A O     1 
ATOM   3069  C  CB    . ALA A 1 398 ? -18.659 -17.494 10.851  1.00 82.07  ? 398 ALA A CB    1 
ATOM   3070  N  N     . LYS A 1 399 ? -18.708 -14.534 11.772  1.00 81.29  ? 399 LYS A N     1 
ATOM   3071  C  CA    . LYS A 1 399 ? -18.085 -13.461 12.522  1.00 82.38  ? 399 LYS A CA    1 
ATOM   3072  C  C     . LYS A 1 399 ? -19.080 -12.888 13.512  1.00 82.77  ? 399 LYS A C     1 
ATOM   3073  O  O     . LYS A 1 399 ? -18.712 -12.515 14.627  1.00 83.40  ? 399 LYS A O     1 
ATOM   3074  C  CB    . LYS A 1 399 ? -17.578 -12.356 11.596  1.00 83.19  ? 399 LYS A CB    1 
ATOM   3075  C  CG    . LYS A 1 399 ? -18.598 -11.289 11.263  1.00 84.71  ? 399 LYS A CG    1 
ATOM   3076  C  CD    . LYS A 1 399 ? -17.912 -10.046 10.714  1.00 86.20  ? 399 LYS A CD    1 
ATOM   3077  C  CE    . LYS A 1 399 ? -16.967 -9.432  11.742  1.00 86.58  ? 399 LYS A CE    1 
ATOM   3078  N  NZ    . LYS A 1 399 ? -17.681 -9.034  12.987  1.00 87.38  ? 399 LYS A NZ    1 
ATOM   3079  N  N     . GLU A 1 400 ? -20.345 -12.828 13.107  1.00 83.02  ? 400 GLU A N     1 
ATOM   3080  C  CA    . GLU A 1 400 ? -21.386 -12.296 13.973  1.00 83.21  ? 400 GLU A CA    1 
ATOM   3081  C  C     . GLU A 1 400 ? -21.516 -13.138 15.236  1.00 82.92  ? 400 GLU A C     1 
ATOM   3082  O  O     . GLU A 1 400 ? -22.068 -12.691 16.238  1.00 82.51  ? 400 GLU A O     1 
ATOM   3083  C  CB    . GLU A 1 400 ? -22.729 -12.264 13.241  1.00 83.28  ? 400 GLU A CB    1 
ATOM   3084  C  CG    . GLU A 1 400 ? -23.854 -11.662 14.073  1.00 83.97  ? 400 GLU A CG    1 
ATOM   3085  C  CD    . GLU A 1 400 ? -25.191 -11.695 13.364  1.00 84.21  ? 400 GLU A CD    1 
ATOM   3086  O  OE1   . GLU A 1 400 ? -25.692 -12.804 13.079  1.00 84.03  ? 400 GLU A OE1   1 
ATOM   3087  O  OE2   . GLU A 1 400 ? -25.740 -10.607 13.092  1.00 84.17  ? 400 GLU A OE2   1 
ATOM   3088  N  N     . GLU A 1 401 ? -21.002 -14.360 15.185  1.00 83.22  ? 401 GLU A N     1 
ATOM   3089  C  CA    . GLU A 1 401 ? -21.074 -15.252 16.333  1.00 83.79  ? 401 GLU A CA    1 
ATOM   3090  C  C     . GLU A 1 401 ? -19.905 -15.042 17.288  1.00 82.56  ? 401 GLU A C     1 
ATOM   3091  O  O     . GLU A 1 401 ? -19.750 -15.778 18.265  1.00 82.59  ? 401 GLU A O     1 
ATOM   3092  C  CB    . GLU A 1 401 ? -21.122 -16.709 15.865  1.00 85.71  ? 401 GLU A CB    1 
ATOM   3093  C  CG    . GLU A 1 401 ? -22.280 -16.994 14.913  1.00 89.63  ? 401 GLU A CG    1 
ATOM   3094  C  CD    . GLU A 1 401 ? -22.377 -18.456 14.496  1.00 91.73  ? 401 GLU A CD    1 
ATOM   3095  O  OE1   . GLU A 1 401 ? -22.759 -18.713 13.328  1.00 93.48  ? 401 GLU A OE1   1 
ATOM   3096  O  OE2   . GLU A 1 401 ? -22.086 -19.344 15.332  1.00 91.92  ? 401 GLU A OE2   1 
ATOM   3097  N  N     . GLY A 1 402 ? -19.084 -14.035 17.000  1.00 80.92  ? 402 GLY A N     1 
ATOM   3098  C  CA    . GLY A 1 402 ? -17.952 -13.741 17.860  1.00 78.76  ? 402 GLY A CA    1 
ATOM   3099  C  C     . GLY A 1 402 ? -16.609 -14.252 17.376  1.00 77.20  ? 402 GLY A C     1 
ATOM   3100  O  O     . GLY A 1 402 ? -15.589 -14.010 18.018  1.00 76.74  ? 402 GLY A O     1 
ATOM   3101  N  N     . VAL A 1 403 ? -16.603 -14.970 16.260  1.00 75.71  ? 403 VAL A N     1 
ATOM   3102  C  CA    . VAL A 1 403 ? -15.361 -15.488 15.711  1.00 74.89  ? 403 VAL A CA    1 
ATOM   3103  C  C     . VAL A 1 403 ? -14.451 -14.292 15.465  1.00 74.54  ? 403 VAL A C     1 
ATOM   3104  O  O     . VAL A 1 403 ? -14.886 -13.295 14.885  1.00 75.30  ? 403 VAL A O     1 
ATOM   3105  C  CB    . VAL A 1 403 ? -15.618 -16.234 14.391  1.00 75.25  ? 403 VAL A CB    1 
ATOM   3106  C  CG1   . VAL A 1 403 ? -14.301 -16.584 13.712  1.00 75.29  ? 403 VAL A CG1   1 
ATOM   3107  C  CG2   . VAL A 1 403 ? -16.407 -17.492 14.673  1.00 74.38  ? 403 VAL A CG2   1 
ATOM   3108  N  N     . GLN A 1 404 ? -13.197 -14.388 15.904  1.00 72.79  ? 404 GLN A N     1 
ATOM   3109  C  CA    . GLN A 1 404 ? -12.263 -13.283 15.750  1.00 71.43  ? 404 GLN A CA    1 
ATOM   3110  C  C     . GLN A 1 404 ? -11.054 -13.579 14.894  1.00 69.65  ? 404 GLN A C     1 
ATOM   3111  O  O     . GLN A 1 404 ? -10.255 -12.688 14.632  1.00 70.50  ? 404 GLN A O     1 
ATOM   3112  C  CB    . GLN A 1 404 ? -11.777 -12.817 17.115  1.00 73.78  ? 404 GLN A CB    1 
ATOM   3113  C  CG    . GLN A 1 404 ? -12.883 -12.512 18.096  1.00 77.54  ? 404 GLN A CG    1 
ATOM   3114  C  CD    . GLN A 1 404 ? -12.352 -12.131 19.464  1.00 80.25  ? 404 GLN A CD    1 
ATOM   3115  O  OE1   . GLN A 1 404 ? -13.101 -12.091 20.439  1.00 82.47  ? 404 GLN A OE1   1 
ATOM   3116  N  NE2   . GLN A 1 404 ? -11.054 -11.841 19.543  1.00 81.54  ? 404 GLN A NE2   1 
ATOM   3117  N  N     . ALA A 1 405 ? -10.898 -14.820 14.465  1.00 67.08  ? 405 ALA A N     1 
ATOM   3118  C  CA    . ALA A 1 405 ? -9.749  -15.165 13.641  1.00 65.19  ? 405 ALA A CA    1 
ATOM   3119  C  C     . ALA A 1 405 ? -10.031 -16.466 12.897  1.00 63.84  ? 405 ALA A C     1 
ATOM   3120  O  O     . ALA A 1 405 ? -10.719 -17.335 13.420  1.00 65.63  ? 405 ALA A O     1 
ATOM   3121  C  CB    . ALA A 1 405 ? -8.504  -15.300 14.523  1.00 63.76  ? 405 ALA A CB    1 
ATOM   3122  N  N     . VAL A 1 406 ? -9.510  -16.594 11.677  1.00 61.14  ? 406 VAL A N     1 
ATOM   3123  C  CA    . VAL A 1 406 ? -9.726  -17.790 10.864  1.00 57.68  ? 406 VAL A CA    1 
ATOM   3124  C  C     . VAL A 1 406 ? -8.447  -18.485 10.481  1.00 56.29  ? 406 VAL A C     1 
ATOM   3125  O  O     . VAL A 1 406 ? -7.591  -17.898 9.842   1.00 55.21  ? 406 VAL A O     1 
ATOM   3126  C  CB    . VAL A 1 406 ? -10.456 -17.463 9.557   1.00 57.29  ? 406 VAL A CB    1 
ATOM   3127  C  CG1   . VAL A 1 406 ? -10.410 -18.662 8.624   1.00 55.06  ? 406 VAL A CG1   1 
ATOM   3128  C  CG2   . VAL A 1 406 ? -11.890 -17.066 9.855   1.00 56.20  ? 406 VAL A CG2   1 
ATOM   3129  N  N     . LEU A 1 407 ? -8.335  -19.749 10.861  1.00 56.27  ? 407 LEU A N     1 
ATOM   3130  C  CA    . LEU A 1 407 ? -7.158  -20.539 10.539  1.00 57.15  ? 407 LEU A CA    1 
ATOM   3131  C  C     . LEU A 1 407 ? -7.425  -21.284 9.241   1.00 56.86  ? 407 LEU A C     1 
ATOM   3132  O  O     . LEU A 1 407 ? -8.098  -22.312 9.239   1.00 58.36  ? 407 LEU A O     1 
ATOM   3133  C  CB    . LEU A 1 407 ? -6.867  -21.546 11.650  1.00 57.16  ? 407 LEU A CB    1 
ATOM   3134  C  CG    . LEU A 1 407 ? -5.706  -22.504 11.356  1.00 59.01  ? 407 LEU A CG    1 
ATOM   3135  C  CD1   . LEU A 1 407 ? -4.368  -21.754 11.345  1.00 56.84  ? 407 LEU A CD1   1 
ATOM   3136  C  CD2   . LEU A 1 407 ? -5.705  -23.607 12.407  1.00 59.81  ? 407 LEU A CD2   1 
ATOM   3137  N  N     . VAL A 1 408 ? -6.892  -20.777 8.138   1.00 55.49  ? 408 VAL A N     1 
ATOM   3138  C  CA    . VAL A 1 408 ? -7.115  -21.410 6.845   1.00 54.23  ? 408 VAL A CA    1 
ATOM   3139  C  C     . VAL A 1 408 ? -6.147  -22.561 6.568   1.00 54.47  ? 408 VAL A C     1 
ATOM   3140  O  O     . VAL A 1 408 ? -4.949  -22.349 6.381   1.00 54.35  ? 408 VAL A O     1 
ATOM   3141  C  CB    . VAL A 1 408 ? -7.007  -20.377 5.726   1.00 52.58  ? 408 VAL A CB    1 
ATOM   3142  C  CG1   . VAL A 1 408 ? -7.698  -20.877 4.494   1.00 51.96  ? 408 VAL A CG1   1 
ATOM   3143  C  CG2   . VAL A 1 408 ? -7.624  -19.073 6.178   1.00 53.50  ? 408 VAL A CG2   1 
ATOM   3144  N  N     . LEU A 1 409 ? -6.688  -23.778 6.543   1.00 54.75  ? 409 LEU A N     1 
ATOM   3145  C  CA    . LEU A 1 409 ? -5.912  -24.995 6.295   1.00 55.20  ? 409 LEU A CA    1 
ATOM   3146  C  C     . LEU A 1 409 ? -6.011  -25.376 4.824   1.00 55.45  ? 409 LEU A C     1 
ATOM   3147  O  O     . LEU A 1 409 ? -6.910  -26.103 4.423   1.00 55.30  ? 409 LEU A O     1 
ATOM   3148  C  CB    . LEU A 1 409 ? -6.450  -26.135 7.168   1.00 55.26  ? 409 LEU A CB    1 
ATOM   3149  C  CG    . LEU A 1 409 ? -5.475  -26.801 8.141   1.00 55.00  ? 409 LEU A CG    1 
ATOM   3150  C  CD1   . LEU A 1 409 ? -6.204  -27.256 9.377   1.00 55.06  ? 409 LEU A CD1   1 
ATOM   3151  C  CD2   . LEU A 1 409 ? -4.801  -27.958 7.464   1.00 55.57  ? 409 LEU A CD2   1 
ATOM   3152  N  N     . THR A 1 410 ? -5.074  -24.890 4.020   1.00 57.46  ? 410 THR A N     1 
ATOM   3153  C  CA    . THR A 1 410 ? -5.089  -25.168 2.589   1.00 59.22  ? 410 THR A CA    1 
ATOM   3154  C  C     . THR A 1 410 ? -3.739  -25.581 2.029   1.00 61.14  ? 410 THR A C     1 
ATOM   3155  O  O     . THR A 1 410 ? -2.688  -25.235 2.570   1.00 61.68  ? 410 THR A O     1 
ATOM   3156  C  CB    . THR A 1 410 ? -5.523  -23.955 1.796   1.00 58.86  ? 410 THR A CB    1 
ATOM   3157  O  OG1   . THR A 1 410 ? -4.411  -23.468 1.042   1.00 57.79  ? 410 THR A OG1   1 
ATOM   3158  C  CG2   . THR A 1 410 ? -6.004  -22.866 2.721   1.00 59.34  ? 410 THR A CG2   1 
ATOM   3159  N  N     . PRO A 1 411 ? -3.755  -26.339 0.931   1.00 62.80  ? 411 PRO A N     1 
ATOM   3160  C  CA    . PRO A 1 411 ? -2.516  -26.790 0.302   1.00 65.37  ? 411 PRO A CA    1 
ATOM   3161  C  C     . PRO A 1 411 ? -1.770  -25.566 -0.212  1.00 66.90  ? 411 PRO A C     1 
ATOM   3162  O  O     . PRO A 1 411 ? -2.359  -24.488 -0.330  1.00 67.24  ? 411 PRO A O     1 
ATOM   3163  C  CB    . PRO A 1 411 ? -3.013  -27.680 -0.836  1.00 65.16  ? 411 PRO A CB    1 
ATOM   3164  C  CG    . PRO A 1 411 ? -4.310  -28.210 -0.306  1.00 64.19  ? 411 PRO A CG    1 
ATOM   3165  C  CD    . PRO A 1 411 ? -4.921  -26.975 0.300   1.00 63.78  ? 411 PRO A CD    1 
ATOM   3166  N  N     . PRO A 1 412 ? -0.469  -25.712 -0.516  1.00 67.56  ? 412 PRO A N     1 
ATOM   3167  C  CA    . PRO A 1 412 ? 0.327   -24.589 -1.018  1.00 68.84  ? 412 PRO A CA    1 
ATOM   3168  C  C     . PRO A 1 412 ? -0.406  -23.761 -2.073  1.00 70.19  ? 412 PRO A C     1 
ATOM   3169  O  O     . PRO A 1 412 ? -0.441  -24.120 -3.254  1.00 70.69  ? 412 PRO A O     1 
ATOM   3170  C  CB    . PRO A 1 412 ? 1.575   -25.278 -1.549  1.00 67.92  ? 412 PRO A CB    1 
ATOM   3171  C  CG    . PRO A 1 412 ? 1.776   -26.357 -0.510  1.00 67.64  ? 412 PRO A CG    1 
ATOM   3172  C  CD    . PRO A 1 412 ? 0.372   -26.911 -0.334  1.00 66.69  ? 412 PRO A CD    1 
ATOM   3173  N  N     . MET A 1 413 ? -0.991  -22.651 -1.623  1.00 71.16  ? 413 MET A N     1 
ATOM   3174  C  CA    . MET A 1 413 ? -1.750  -21.754 -2.490  1.00 72.45  ? 413 MET A CA    1 
ATOM   3175  C  C     . MET A 1 413 ? -0.880  -20.994 -3.482  1.00 73.59  ? 413 MET A C     1 
ATOM   3176  O  O     . MET A 1 413 ? 0.339   -20.913 -3.325  1.00 74.32  ? 413 MET A O     1 
ATOM   3177  C  CB    . MET A 1 413 ? -2.529  -20.736 -1.645  1.00 71.68  ? 413 MET A CB    1 
ATOM   3178  C  CG    . MET A 1 413 ? -3.669  -21.313 -0.819  1.00 70.40  ? 413 MET A CG    1 
ATOM   3179  S  SD    . MET A 1 413 ? -4.747  -20.034 -0.102  1.00 68.66  ? 413 MET A SD    1 
ATOM   3180  C  CE    . MET A 1 413 ? -5.833  -19.663 -1.479  1.00 67.75  ? 413 MET A CE    1 
ATOM   3181  N  N     . ALA A 1 414 ? -1.509  -20.440 -4.511  1.00 74.38  ? 414 ALA A N     1 
ATOM   3182  C  CA    . ALA A 1 414 ? -0.765  -19.650 -5.479  1.00 75.40  ? 414 ALA A CA    1 
ATOM   3183  C  C     . ALA A 1 414 ? -0.882  -18.216 -4.982  1.00 76.02  ? 414 ALA A C     1 
ATOM   3184  O  O     . ALA A 1 414 ? -1.970  -17.767 -4.608  1.00 76.12  ? 414 ALA A O     1 
ATOM   3185  C  CB    . ALA A 1 414 ? -1.372  -19.786 -6.867  1.00 75.17  ? 414 ALA A CB    1 
ATOM   3186  N  N     . TRP A 1 415 ? 0.244   -17.512 -4.954  1.00 76.41  ? 415 TRP A N     1 
ATOM   3187  C  CA    . TRP A 1 415 ? 0.293   -16.128 -4.496  1.00 76.78  ? 415 TRP A CA    1 
ATOM   3188  C  C     . TRP A 1 415 ? -0.993  -15.338 -4.738  1.00 75.87  ? 415 TRP A C     1 
ATOM   3189  O  O     . TRP A 1 415 ? -1.743  -15.074 -3.807  1.00 74.83  ? 415 TRP A O     1 
ATOM   3190  C  CB    . TRP A 1 415 ? 1.483   -15.415 -5.148  1.00 79.57  ? 415 TRP A CB    1 
ATOM   3191  C  CG    . TRP A 1 415 ? 1.573   -13.945 -4.853  1.00 82.60  ? 415 TRP A CG    1 
ATOM   3192  C  CD1   . TRP A 1 415 ? 0.770   -12.957 -5.351  1.00 84.12  ? 415 TRP A CD1   1 
ATOM   3193  C  CD2   . TRP A 1 415 ? 2.517   -13.296 -3.993  1.00 83.63  ? 415 TRP A CD2   1 
ATOM   3194  N  NE1   . TRP A 1 415 ? 1.154   -11.735 -4.854  1.00 84.94  ? 415 TRP A NE1   1 
ATOM   3195  C  CE2   . TRP A 1 415 ? 2.223   -11.913 -4.016  1.00 84.45  ? 415 TRP A CE2   1 
ATOM   3196  C  CE3   . TRP A 1 415 ? 3.579   -13.748 -3.200  1.00 84.52  ? 415 TRP A CE3   1 
ATOM   3197  C  CZ2   . TRP A 1 415 ? 2.954   -10.974 -3.282  1.00 84.93  ? 415 TRP A CZ2   1 
ATOM   3198  C  CZ3   . TRP A 1 415 ? 4.308   -12.814 -2.465  1.00 85.80  ? 415 TRP A CZ3   1 
ATOM   3199  C  CH2   . TRP A 1 415 ? 3.989   -11.442 -2.512  1.00 85.58  ? 415 TRP A CH2   1 
ATOM   3200  N  N     . GLU A 1 416 ? -1.243  -14.966 -5.989  1.00 76.18  ? 416 GLU A N     1 
ATOM   3201  C  CA    . GLU A 1 416 ? -2.431  -14.193 -6.352  1.00 76.99  ? 416 GLU A CA    1 
ATOM   3202  C  C     . GLU A 1 416 ? -3.719  -14.551 -5.582  1.00 77.19  ? 416 GLU A C     1 
ATOM   3203  O  O     . GLU A 1 416 ? -4.475  -13.662 -5.175  1.00 77.06  ? 416 GLU A O     1 
ATOM   3204  C  CB    . GLU A 1 416 ? -2.675  -14.311 -7.864  1.00 77.13  ? 416 GLU A CB    1 
ATOM   3205  C  CG    . GLU A 1 416 ? -2.331  -13.065 -8.660  0.00 77.25  ? 416 GLU A CG    1 
ATOM   3206  C  CD    . GLU A 1 416 ? -2.317  -13.316 -10.157 0.00 77.32  ? 416 GLU A CD    1 
ATOM   3207  O  OE1   . GLU A 1 416 ? -3.197  -14.055 -10.647 0.00 77.37  ? 416 GLU A OE1   1 
ATOM   3208  O  OE2   . GLU A 1 416 ? -1.431  -12.766 -10.844 0.00 77.37  ? 416 GLU A OE2   1 
ATOM   3209  N  N     . ASP A 1 417 ? -3.966  -15.842 -5.374  1.00 77.14  ? 417 ASP A N     1 
ATOM   3210  C  CA    . ASP A 1 417 ? -5.169  -16.276 -4.666  1.00 76.81  ? 417 ASP A CA    1 
ATOM   3211  C  C     . ASP A 1 417 ? -5.011  -16.274 -3.161  1.00 74.99  ? 417 ASP A C     1 
ATOM   3212  O  O     . ASP A 1 417 ? -5.987  -16.450 -2.431  1.00 75.36  ? 417 ASP A O     1 
ATOM   3213  C  CB    . ASP A 1 417 ? -5.589  -17.673 -5.127  1.00 80.23  ? 417 ASP A CB    1 
ATOM   3214  C  CG    . ASP A 1 417 ? -6.317  -17.655 -6.466  1.00 83.45  ? 417 ASP A CG    1 
ATOM   3215  O  OD1   . ASP A 1 417 ? -7.502  -17.245 -6.488  1.00 84.26  ? 417 ASP A OD1   1 
ATOM   3216  O  OD2   . ASP A 1 417 ? -5.703  -18.040 -7.493  1.00 83.35  ? 417 ASP A OD2   1 
ATOM   3217  N  N     . ARG A 1 418 ? -3.782  -16.088 -2.694  1.00 72.43  ? 418 ARG A N     1 
ATOM   3218  C  CA    . ARG A 1 418 ? -3.538  -16.050 -1.264  1.00 70.14  ? 418 ARG A CA    1 
ATOM   3219  C  C     . ARG A 1 418 ? -3.994  -14.693 -0.767  1.00 69.24  ? 418 ARG A C     1 
ATOM   3220  O  O     . ARG A 1 418 ? -4.669  -14.586 0.259   1.00 69.60  ? 418 ARG A O     1 
ATOM   3221  C  CB    . ARG A 1 418 ? -2.052  -16.226 -0.953  1.00 69.50  ? 418 ARG A CB    1 
ATOM   3222  C  CG    . ARG A 1 418 ? -1.789  -16.594 0.496   1.00 67.65  ? 418 ARG A CG    1 
ATOM   3223  C  CD    . ARG A 1 418 ? -0.623  -15.833 1.079   1.00 65.95  ? 418 ARG A CD    1 
ATOM   3224  N  NE    . ARG A 1 418 ? -0.856  -14.395 1.047   1.00 62.42  ? 418 ARG A NE    1 
ATOM   3225  C  CZ    . ARG A 1 418 ? -0.294  -13.530 1.882   1.00 61.37  ? 418 ARG A CZ    1 
ATOM   3226  N  NH1   . ARG A 1 418 ? 0.535   -13.952 2.829   1.00 59.49  ? 418 ARG A NH1   1 
ATOM   3227  N  NH2   . ARG A 1 418 ? -0.558  -12.240 1.763   1.00 61.64  ? 418 ARG A NH2   1 
ATOM   3228  N  N     . ASN A 1 419 ? -3.622  -13.657 -1.512  1.00 67.72  ? 419 ASN A N     1 
ATOM   3229  C  CA    . ASN A 1 419 ? -3.988  -12.298 -1.161  1.00 67.49  ? 419 ASN A CA    1 
ATOM   3230  C  C     . ASN A 1 419 ? -5.491  -12.156 -1.318  1.00 67.80  ? 419 ASN A C     1 
ATOM   3231  O  O     . ASN A 1 419 ? -6.167  -11.590 -0.452  1.00 68.01  ? 419 ASN A O     1 
ATOM   3232  C  CB    . ASN A 1 419 ? -3.278  -11.308 -2.075  1.00 68.82  ? 419 ASN A CB    1 
ATOM   3233  C  CG    . ASN A 1 419 ? -1.774  -11.514 -2.108  1.00 70.18  ? 419 ASN A CG    1 
ATOM   3234  O  OD1   . ASN A 1 419 ? -1.279  -12.464 -2.714  1.00 71.75  ? 419 ASN A OD1   1 
ATOM   3235  N  ND2   . ASN A 1 419 ? -1.038  -10.625 -1.453  1.00 69.92  ? 419 ASN A ND2   1 
ATOM   3236  N  N     . ARG A 1 420 ? -5.998  -12.675 -2.434  1.00 67.60  ? 420 ARG A N     1 
ATOM   3237  C  CA    . ARG A 1 420 ? -7.423  -12.656 -2.744  1.00 67.44  ? 420 ARG A CA    1 
ATOM   3238  C  C     . ARG A 1 420 ? -8.233  -13.210 -1.576  1.00 65.32  ? 420 ARG A C     1 
ATOM   3239  O  O     . ARG A 1 420 ? -9.183  -12.576 -1.116  1.00 65.13  ? 420 ARG A O     1 
ATOM   3240  C  CB    . ARG A 1 420 ? -7.679  -13.503 -3.991  1.00 71.33  ? 420 ARG A CB    1 
ATOM   3241  C  CG    . ARG A 1 420 ? -9.066  -14.149 -4.062  1.00 77.16  ? 420 ARG A CG    1 
ATOM   3242  C  CD    . ARG A 1 420 ? -9.012  -15.485 -4.810  1.00 81.14  ? 420 ARG A CD    1 
ATOM   3243  N  NE    . ARG A 1 420 ? -10.332 -15.935 -5.263  1.00 85.13  ? 420 ARG A NE    1 
ATOM   3244  C  CZ    . ARG A 1 420 ? -10.796 -17.178 -5.133  1.00 86.76  ? 420 ARG A CZ    1 
ATOM   3245  N  NH1   . ARG A 1 420 ? -10.053 -18.116 -4.550  1.00 87.75  ? 420 ARG A NH1   1 
ATOM   3246  N  NH2   . ARG A 1 420 ? -11.998 -17.492 -5.603  1.00 85.60  ? 420 ARG A NH2   1 
ATOM   3247  N  N     . LEU A 1 421 ? -7.844  -14.396 -1.109  1.00 62.97  ? 421 LEU A N     1 
ATOM   3248  C  CA    . LEU A 1 421 ? -8.518  -15.073 -0.003  1.00 61.39  ? 421 LEU A CA    1 
ATOM   3249  C  C     . LEU A 1 421 ? -8.477  -14.255 1.282   1.00 60.45  ? 421 LEU A C     1 
ATOM   3250  O  O     . LEU A 1 421 ? -9.505  -14.019 1.932   1.00 59.55  ? 421 LEU A O     1 
ATOM   3251  C  CB    . LEU A 1 421 ? -7.875  -16.440 0.238   1.00 59.96  ? 421 LEU A CB    1 
ATOM   3252  C  CG    . LEU A 1 421 ? -8.469  -17.255 1.392   1.00 59.47  ? 421 LEU A CG    1 
ATOM   3253  C  CD1   . LEU A 1 421 ? -9.968  -17.489 1.176   1.00 57.44  ? 421 LEU A CD1   1 
ATOM   3254  C  CD2   . LEU A 1 421 ? -7.717  -18.567 1.500   1.00 58.30  ? 421 LEU A CD2   1 
ATOM   3255  N  N     . LYS A 1 422 ? -7.276  -13.831 1.652   1.00 59.25  ? 422 LYS A N     1 
ATOM   3256  C  CA    . LYS A 1 422 ? -7.105  -13.030 2.850   1.00 58.07  ? 422 LYS A CA    1 
ATOM   3257  C  C     . LYS A 1 422 ? -7.917  -11.740 2.756   1.00 57.63  ? 422 LYS A C     1 
ATOM   3258  O  O     . LYS A 1 422 ? -8.627  -11.372 3.701   1.00 57.02  ? 422 LYS A O     1 
ATOM   3259  C  CB    . LYS A 1 422 ? -5.623  -12.713 3.050   1.00 56.49  ? 422 LYS A CB    1 
ATOM   3260  C  CG    . LYS A 1 422 ? -4.830  -13.895 3.570   1.00 55.10  ? 422 LYS A CG    1 
ATOM   3261  C  CD    . LYS A 1 422 ? -3.391  -13.515 3.894   1.00 53.80  ? 422 LYS A CD    1 
ATOM   3262  C  CE    . LYS A 1 422 ? -2.712  -14.531 4.808   1.00 51.21  ? 422 LYS A CE    1 
ATOM   3263  N  NZ    . LYS A 1 422 ? -3.057  -14.346 6.246   1.00 47.86  ? 422 LYS A NZ    1 
ATOM   3264  N  N     . ALA A 1 423 ? -7.810  -11.073 1.606   1.00 55.88  ? 423 ALA A N     1 
ATOM   3265  C  CA    . ALA A 1 423 ? -8.511  -9.825  1.361   1.00 54.91  ? 423 ALA A CA    1 
ATOM   3266  C  C     . ALA A 1 423 ? -10.011 -9.957  1.595   1.00 55.49  ? 423 ALA A C     1 
ATOM   3267  O  O     . ALA A 1 423 ? -10.614 -9.126  2.277   1.00 56.12  ? 423 ALA A O     1 
ATOM   3268  C  CB    . ALA A 1 423 ? -8.242  -9.359  -0.047  1.00 53.42  ? 423 ALA A CB    1 
ATOM   3269  N  N     . LEU A 1 424 ? -10.612 -11.000 1.033   1.00 55.65  ? 424 LEU A N     1 
ATOM   3270  C  CA    . LEU A 1 424 ? -12.048 -11.235 1.184   1.00 56.39  ? 424 LEU A CA    1 
ATOM   3271  C  C     . LEU A 1 424 ? -12.399 -11.454 2.650   1.00 56.55  ? 424 LEU A C     1 
ATOM   3272  O  O     . LEU A 1 424 ? -13.424 -10.967 3.153   1.00 55.55  ? 424 LEU A O     1 
ATOM   3273  C  CB    . LEU A 1 424 ? -12.456 -12.458 0.354   1.00 56.45  ? 424 LEU A CB    1 
ATOM   3274  C  CG    . LEU A 1 424 ? -13.880 -13.007 0.444   1.00 56.02  ? 424 LEU A CG    1 
ATOM   3275  C  CD1   . LEU A 1 424 ? -14.907 -11.902 0.233   1.00 57.16  ? 424 LEU A CD1   1 
ATOM   3276  C  CD2   . LEU A 1 424 ? -14.027 -14.108 -0.604  1.00 55.57  ? 424 LEU A CD2   1 
ATOM   3277  N  N     . LEU A 1 425 ? -11.527 -12.199 3.322   1.00 57.19  ? 425 LEU A N     1 
ATOM   3278  C  CA    . LEU A 1 425 ? -11.688 -12.501 4.729   1.00 58.26  ? 425 LEU A CA    1 
ATOM   3279  C  C     . LEU A 1 425 ? -11.568 -11.227 5.548   1.00 60.67  ? 425 LEU A C     1 
ATOM   3280  O  O     . LEU A 1 425 ? -12.372 -10.968 6.454   1.00 62.57  ? 425 LEU A O     1 
ATOM   3281  C  CB    . LEU A 1 425 ? -10.620 -13.494 5.159   1.00 56.33  ? 425 LEU A CB    1 
ATOM   3282  C  CG    . LEU A 1 425 ? -10.942 -14.912 4.717   1.00 55.66  ? 425 LEU A CG    1 
ATOM   3283  C  CD1   . LEU A 1 425 ? -9.759  -15.827 4.936   1.00 55.90  ? 425 LEU A CD1   1 
ATOM   3284  C  CD2   . LEU A 1 425 ? -12.129 -15.390 5.504   1.00 56.13  ? 425 LEU A CD2   1 
ATOM   3285  N  N     . LEU A 1 426 ? -10.568 -10.421 5.210   1.00 61.03  ? 426 LEU A N     1 
ATOM   3286  C  CA    . LEU A 1 426 ? -10.333 -9.181  5.918   1.00 61.58  ? 426 LEU A CA    1 
ATOM   3287  C  C     . LEU A 1 426 ? -11.515 -8.226  5.849   1.00 62.65  ? 426 LEU A C     1 
ATOM   3288  O  O     . LEU A 1 426 ? -12.051 -7.834  6.880   1.00 63.06  ? 426 LEU A O     1 
ATOM   3289  C  CB    . LEU A 1 426 ? -9.092  -8.499  5.364   1.00 61.61  ? 426 LEU A CB    1 
ATOM   3290  C  CG    . LEU A 1 426 ? -8.212  -7.776  6.390   1.00 62.23  ? 426 LEU A CG    1 
ATOM   3291  C  CD1   . LEU A 1 426 ? -8.814  -7.843  7.804   1.00 61.71  ? 426 LEU A CD1   1 
ATOM   3292  C  CD2   . LEU A 1 426 ? -6.847  -8.423  6.364   1.00 61.42  ? 426 LEU A CD2   1 
ATOM   3293  N  N     . ARG A 1 427 ? -11.921 -7.864  4.635   1.00 64.11  ? 427 ARG A N     1 
ATOM   3294  C  CA    . ARG A 1 427 ? -13.033 -6.937  4.428   1.00 65.64  ? 427 ARG A CA    1 
ATOM   3295  C  C     . ARG A 1 427 ? -14.232 -7.152  5.331   1.00 66.28  ? 427 ARG A C     1 
ATOM   3296  O  O     . ARG A 1 427 ? -14.772 -6.196  5.898   1.00 66.45  ? 427 ARG A O     1 
ATOM   3297  C  CB    . ARG A 1 427 ? -13.507 -6.981  2.981   1.00 65.58  ? 427 ARG A CB    1 
ATOM   3298  C  CG    . ARG A 1 427 ? -12.504 -6.431  2.001   1.00 66.55  ? 427 ARG A CG    1 
ATOM   3299  C  CD    . ARG A 1 427 ? -13.027 -6.581  0.591   1.00 67.83  ? 427 ARG A CD    1 
ATOM   3300  N  NE    . ARG A 1 427 ? -11.946 -6.870  -0.347  1.00 67.93  ? 427 ARG A NE    1 
ATOM   3301  C  CZ    . ARG A 1 427 ? -11.906 -7.943  -1.134  1.00 66.42  ? 427 ARG A CZ    1 
ATOM   3302  N  NH1   . ARG A 1 427 ? -12.893 -8.830  -1.098  1.00 63.74  ? 427 ARG A NH1   1 
ATOM   3303  N  NH2   . ARG A 1 427 ? -10.875 -8.132  -1.948  1.00 65.20  ? 427 ARG A NH2   1 
ATOM   3304  N  N     . GLU A 1 428 ? -14.667 -8.394  5.469   1.00 66.91  ? 428 GLU A N     1 
ATOM   3305  C  CA    . GLU A 1 428 ? -15.816 -8.616  6.315   1.00 68.46  ? 428 GLU A CA    1 
ATOM   3306  C  C     . GLU A 1 428 ? -15.409 -8.982  7.737   1.00 66.47  ? 428 GLU A C     1 
ATOM   3307  O  O     . GLU A 1 428 ? -16.096 -9.728  8.428   1.00 67.38  ? 428 GLU A O     1 
ATOM   3308  C  CB    . GLU A 1 428 ? -16.763 -9.645  5.675   1.00 71.93  ? 428 GLU A CB    1 
ATOM   3309  C  CG    . GLU A 1 428 ? -17.285 -9.229  4.257   1.00 76.79  ? 428 GLU A CG    1 
ATOM   3310  C  CD    . GLU A 1 428 ? -18.324 -8.074  4.239   1.00 79.35  ? 428 GLU A CD    1 
ATOM   3311  O  OE1   . GLU A 1 428 ? -18.703 -7.559  5.315   1.00 80.15  ? 428 GLU A OE1   1 
ATOM   3312  O  OE2   . GLU A 1 428 ? -18.771 -7.687  3.130   1.00 81.31  ? 428 GLU A OE2   1 
ATOM   3313  N  N     . GLY A 1 429 ? -14.265 -8.442  8.150   1.00 63.83  ? 429 GLY A N     1 
ATOM   3314  C  CA    . GLY A 1 429 ? -13.771 -8.604  9.509   1.00 60.75  ? 429 GLY A CA    1 
ATOM   3315  C  C     . GLY A 1 429 ? -12.990 -9.768  10.089  1.00 58.54  ? 429 GLY A C     1 
ATOM   3316  O  O     . GLY A 1 429 ? -12.845 -9.810  11.310  1.00 58.25  ? 429 GLY A O     1 
ATOM   3317  N  N     . LEU A 1 430 ? -12.452 -10.683 9.286   1.00 56.46  ? 430 LEU A N     1 
ATOM   3318  C  CA    . LEU A 1 430 ? -11.736 -11.812 9.886   1.00 54.51  ? 430 LEU A CA    1 
ATOM   3319  C  C     . LEU A 1 430 ? -10.290 -12.060 9.447   1.00 52.65  ? 430 LEU A C     1 
ATOM   3320  O  O     . LEU A 1 430 ? -10.040 -12.505 8.327   1.00 51.45  ? 430 LEU A O     1 
ATOM   3321  C  CB    . LEU A 1 430 ? -12.547 -13.098 9.690   1.00 55.60  ? 430 LEU A CB    1 
ATOM   3322  C  CG    . LEU A 1 430 ? -14.046 -12.983 9.998   1.00 57.05  ? 430 LEU A CG    1 
ATOM   3323  C  CD1   . LEU A 1 430 ? -14.803 -12.714 8.701   1.00 57.96  ? 430 LEU A CD1   1 
ATOM   3324  C  CD2   . LEU A 1 430 ? -14.561 -14.257 10.641  1.00 57.35  ? 430 LEU A CD2   1 
ATOM   3325  N  N     . PRO A 1 431 ? -9.317  -11.781 10.341  1.00 51.20  ? 431 PRO A N     1 
ATOM   3326  C  CA    . PRO A 1 431 ? -7.894  -11.985 10.039  1.00 49.08  ? 431 PRO A CA    1 
ATOM   3327  C  C     . PRO A 1 431 ? -7.710  -13.445 9.731   1.00 47.49  ? 431 PRO A C     1 
ATOM   3328  O  O     . PRO A 1 431 ? -8.520  -14.249 10.148  1.00 48.09  ? 431 PRO A O     1 
ATOM   3329  C  CB    . PRO A 1 431 ? -7.203  -11.594 11.341  1.00 49.20  ? 431 PRO A CB    1 
ATOM   3330  C  CG    . PRO A 1 431 ? -8.108  -10.541 11.903  1.00 49.89  ? 431 PRO A CG    1 
ATOM   3331  C  CD    . PRO A 1 431 ? -9.483  -11.128 11.654  1.00 50.88  ? 431 PRO A CD    1 
ATOM   3332  N  N     . SER A 1 432 ? -6.652  -13.807 9.022   1.00 47.49  ? 432 SER A N     1 
ATOM   3333  C  CA    . SER A 1 432 ? -6.455  -15.215 8.702   1.00 47.52  ? 432 SER A CA    1 
ATOM   3334  C  C     . SER A 1 432 ? -5.023  -15.747 8.731   1.00 46.01  ? 432 SER A C     1 
ATOM   3335  O  O     . SER A 1 432 ? -4.105  -15.146 8.185   1.00 44.38  ? 432 SER A O     1 
ATOM   3336  C  CB    . SER A 1 432 ? -7.092  -15.526 7.337   1.00 48.94  ? 432 SER A CB    1 
ATOM   3337  O  OG    . SER A 1 432 ? -6.667  -14.614 6.337   1.00 51.07  ? 432 SER A OG    1 
ATOM   3338  N  N     . GLN A 1 433 ? -4.855  -16.892 9.383   1.00 46.26  ? 433 GLN A N     1 
ATOM   3339  C  CA    . GLN A 1 433 ? -3.561  -17.563 9.471   1.00 47.56  ? 433 GLN A CA    1 
ATOM   3340  C  C     . GLN A 1 433 ? -3.567  -18.732 8.487   1.00 48.07  ? 433 GLN A C     1 
ATOM   3341  O  O     . GLN A 1 433 ? -4.553  -19.455 8.383   1.00 48.36  ? 433 GLN A O     1 
ATOM   3342  C  CB    . GLN A 1 433 ? -3.315  -18.080 10.897  1.00 46.39  ? 433 GLN A CB    1 
ATOM   3343  C  CG    . GLN A 1 433 ? -2.022  -18.865 11.065  1.00 45.58  ? 433 GLN A CG    1 
ATOM   3344  C  CD    . GLN A 1 433 ? -0.790  -18.111 10.572  1.00 47.53  ? 433 GLN A CD    1 
ATOM   3345  O  OE1   . GLN A 1 433 ? -0.395  -17.078 11.128  1.00 47.77  ? 433 GLN A OE1   1 
ATOM   3346  N  NE2   . GLN A 1 433 ? -0.179  -18.627 9.517   1.00 49.03  ? 433 GLN A NE2   1 
ATOM   3347  N  N     . ILE A 1 434 ? -2.471  -18.917 7.766   1.00 48.69  ? 434 ILE A N     1 
ATOM   3348  C  CA    . ILE A 1 434 ? -2.388  -19.993 6.795   1.00 51.24  ? 434 ILE A CA    1 
ATOM   3349  C  C     . ILE A 1 434 ? -1.362  -21.047 7.171   1.00 53.86  ? 434 ILE A C     1 
ATOM   3350  O  O     . ILE A 1 434 ? -0.241  -20.715 7.536   1.00 54.43  ? 434 ILE A O     1 
ATOM   3351  C  CB    . ILE A 1 434 ? -1.964  -19.464 5.403   1.00 51.61  ? 434 ILE A CB    1 
ATOM   3352  C  CG1   . ILE A 1 434 ? -3.038  -18.547 4.828   1.00 52.44  ? 434 ILE A CG1   1 
ATOM   3353  C  CG2   . ILE A 1 434 ? -1.679  -20.628 4.460   1.00 49.44  ? 434 ILE A CG2   1 
ATOM   3354  C  CD1   . ILE A 1 434 ? -4.243  -19.278 4.311   1.00 57.40  ? 434 ILE A CD1   1 
ATOM   3355  N  N     . LEU A 1 435 ? -1.742  -22.319 7.098   1.00 56.32  ? 435 LEU A N     1 
ATOM   3356  C  CA    . LEU A 1 435 ? -0.777  -23.388 7.331   1.00 58.65  ? 435 LEU A CA    1 
ATOM   3357  C  C     . LEU A 1 435 ? -0.994  -24.409 6.216   1.00 59.94  ? 435 LEU A C     1 
ATOM   3358  O  O     . LEU A 1 435 ? -2.091  -24.954 6.074   1.00 59.64  ? 435 LEU A O     1 
ATOM   3359  C  CB    . LEU A 1 435 ? -0.918  -24.020 8.726   1.00 57.66  ? 435 LEU A CB    1 
ATOM   3360  C  CG    . LEU A 1 435 ? -2.075  -24.862 9.249   1.00 59.31  ? 435 LEU A CG    1 
ATOM   3361  C  CD1   . LEU A 1 435 ? -2.154  -26.208 8.566   1.00 60.32  ? 435 LEU A CD1   1 
ATOM   3362  C  CD2   . LEU A 1 435 ? -1.831  -25.085 10.728  1.00 58.89  ? 435 LEU A CD2   1 
ATOM   3363  N  N     . ASN A 1 436 ? 0.037   -24.613 5.390   1.00 61.03  ? 436 ASN A N     1 
ATOM   3364  C  CA    . ASN A 1 436 ? -0.055  -25.555 4.283   1.00 61.97  ? 436 ASN A CA    1 
ATOM   3365  C  C     . ASN A 1 436 ? -0.583  -26.866 4.795   1.00 63.97  ? 436 ASN A C     1 
ATOM   3366  O  O     . ASN A 1 436 ? -0.313  -27.240 5.934   1.00 64.17  ? 436 ASN A O     1 
ATOM   3367  C  CB    . ASN A 1 436 ? 1.290   -25.729 3.625   1.00 61.49  ? 436 ASN A CB    1 
ATOM   3368  C  CG    . ASN A 1 436 ? 1.691   -24.510 2.861   1.00 61.19  ? 436 ASN A CG    1 
ATOM   3369  O  OD1   . ASN A 1 436 ? 0.844   -23.835 2.276   1.00 59.72  ? 436 ASN A OD1   1 
ATOM   3370  N  ND2   . ASN A 1 436 ? 2.984   -24.217 2.845   1.00 61.83  ? 436 ASN A ND2   1 
ATOM   3371  N  N     . VAL A 1 437 ? -1.300  -27.594 3.946   1.00 66.21  ? 437 VAL A N     1 
ATOM   3372  C  CA    . VAL A 1 437 ? -1.957  -28.801 4.422   1.00 68.31  ? 437 VAL A CA    1 
ATOM   3373  C  C     . VAL A 1 437 ? -1.385  -30.216 4.392   1.00 69.31  ? 437 VAL A C     1 
ATOM   3374  O  O     . VAL A 1 437 ? -2.084  -31.165 4.733   1.00 71.05  ? 437 VAL A O     1 
ATOM   3375  C  CB    . VAL A 1 437 ? -3.389  -28.790 3.892   1.00 68.41  ? 437 VAL A CB    1 
ATOM   3376  C  CG1   . VAL A 1 437 ? -4.242  -29.844 4.569   1.00 68.55  ? 437 VAL A CG1   1 
ATOM   3377  C  CG2   . VAL A 1 437 ? -3.972  -27.444 4.201   1.00 68.86  ? 437 VAL A CG2   1 
ATOM   3378  N  N     . PRO A 1 438 ? -0.149  -30.402 3.918   1.00 69.58  ? 438 PRO A N     1 
ATOM   3379  C  CA    . PRO A 1 438 ? 0.246   -31.811 4.014   1.00 69.51  ? 438 PRO A CA    1 
ATOM   3380  C  C     . PRO A 1 438 ? 0.893   -31.749 5.403   1.00 69.39  ? 438 PRO A C     1 
ATOM   3381  O  O     . PRO A 1 438 ? 2.112   -31.735 5.543   1.00 68.91  ? 438 PRO A O     1 
ATOM   3382  C  CB    . PRO A 1 438 ? 1.255   -31.965 2.885   1.00 69.95  ? 438 PRO A CB    1 
ATOM   3383  C  CG    . PRO A 1 438 ? 0.780   -30.943 1.884   1.00 70.03  ? 438 PRO A CG    1 
ATOM   3384  C  CD    . PRO A 1 438 ? 0.529   -29.760 2.783   1.00 69.81  ? 438 PRO A CD    1 
ATOM   3385  N  N     . LEU A 1 439 ? 0.032   -31.650 6.416   1.00 69.86  ? 439 LEU A N     1 
ATOM   3386  C  CA    . LEU A 1 439 ? 0.419   -31.503 7.819   1.00 69.84  ? 439 LEU A CA    1 
ATOM   3387  C  C     . LEU A 1 439 ? 0.742   -32.779 8.596   1.00 70.93  ? 439 LEU A C     1 
ATOM   3388  O  O     . LEU A 1 439 ? -0.017  -33.746 8.599   1.00 71.91  ? 439 LEU A O     1 
ATOM   3389  C  CB    . LEU A 1 439 ? -0.693  -30.754 8.560   1.00 67.90  ? 439 LEU A CB    1 
ATOM   3390  C  CG    . LEU A 1 439 ? -0.390  -29.644 9.568   1.00 66.33  ? 439 LEU A CG    1 
ATOM   3391  C  CD1   . LEU A 1 439 ? -1.299  -29.837 10.754  1.00 64.13  ? 439 LEU A CD1   1 
ATOM   3392  C  CD2   . LEU A 1 439 ? 1.060   -29.657 10.007  1.00 65.32  ? 439 LEU A CD2   1 
ATOM   3393  N  N     . ARG A 1 440 ? 1.871   -32.751 9.284   1.00 71.85  ? 440 ARG A N     1 
ATOM   3394  C  CA    . ARG A 1 440 ? 2.311   -33.873 10.090  1.00 72.62  ? 440 ARG A CA    1 
ATOM   3395  C  C     . ARG A 1 440 ? 2.324   -33.366 11.527  1.00 72.27  ? 440 ARG A C     1 
ATOM   3396  O  O     . ARG A 1 440 ? 2.927   -32.335 11.806  1.00 72.14  ? 440 ARG A O     1 
ATOM   3397  C  CB    . ARG A 1 440 ? 3.727   -34.264 9.679   1.00 74.39  ? 440 ARG A CB    1 
ATOM   3398  C  CG    . ARG A 1 440 ? 3.976   -35.754 9.626   1.00 77.85  ? 440 ARG A CG    1 
ATOM   3399  C  CD    . ARG A 1 440 ? 5.467   -36.082 9.749   1.00 80.27  ? 440 ARG A CD    1 
ATOM   3400  N  NE    . ARG A 1 440 ? 6.303   -35.396 8.763   1.00 81.90  ? 440 ARG A NE    1 
ATOM   3401  C  CZ    . ARG A 1 440 ? 6.101   -35.435 7.449   1.00 83.60  ? 440 ARG A CZ    1 
ATOM   3402  N  NH1   . ARG A 1 440 ? 5.081   -36.125 6.946   1.00 84.04  ? 440 ARG A NH1   1 
ATOM   3403  N  NH2   . ARG A 1 440 ? 6.933   -34.799 6.632   1.00 84.57  ? 440 ARG A NH2   1 
ATOM   3404  N  N     . GLU A 1 441 ? 1.663   -34.057 12.447  1.00 72.44  ? 441 GLU A N     1 
ATOM   3405  C  CA    . GLU A 1 441 ? 1.692   -33.583 13.827  1.00 73.29  ? 441 GLU A CA    1 
ATOM   3406  C  C     . GLU A 1 441 ? 3.130   -33.523 14.307  1.00 72.41  ? 441 GLU A C     1 
ATOM   3407  O  O     . GLU A 1 441 ? 3.498   -32.651 15.096  1.00 71.53  ? 441 GLU A O     1 
ATOM   3408  C  CB    . GLU A 1 441 ? 0.917   -34.499 14.768  1.00 75.25  ? 441 GLU A CB    1 
ATOM   3409  C  CG    . GLU A 1 441 ? 1.118   -34.103 16.234  1.00 78.96  ? 441 GLU A CG    1 
ATOM   3410  C  CD    . GLU A 1 441 ? 0.243   -34.884 17.202  1.00 81.79  ? 441 GLU A CD    1 
ATOM   3411  O  OE1   . GLU A 1 441 ? -0.986  -34.967 16.967  1.00 82.91  ? 441 GLU A OE1   1 
ATOM   3412  O  OE2   . GLU A 1 441 ? 0.785   -35.403 18.207  1.00 82.35  ? 441 GLU A OE2   1 
ATOM   3413  N  N     . GLU A 1 442 ? 3.934   -34.465 13.824  1.00 71.70  ? 442 GLU A N     1 
ATOM   3414  C  CA    . GLU A 1 442 ? 5.338   -34.549 14.192  1.00 71.07  ? 442 GLU A CA    1 
ATOM   3415  C  C     . GLU A 1 442 ? 6.137   -33.255 13.981  1.00 70.85  ? 442 GLU A C     1 
ATOM   3416  O  O     . GLU A 1 442 ? 7.239   -33.132 14.503  1.00 71.80  ? 442 GLU A O     1 
ATOM   3417  C  CB    . GLU A 1 442 ? 6.006   -35.699 13.436  1.00 70.83  ? 442 GLU A CB    1 
ATOM   3418  C  CG    . GLU A 1 442 ? 5.497   -37.064 13.822  0.00 71.07  ? 442 GLU A CG    1 
ATOM   3419  C  CD    . GLU A 1 442 ? 6.173   -38.167 13.045  0.00 71.11  ? 442 GLU A CD    1 
ATOM   3420  O  OE1   . GLU A 1 442 ? 7.053   -37.866 12.210  0.00 71.16  ? 442 GLU A OE1   1 
ATOM   3421  O  OE2   . GLU A 1 442 ? 5.821   -39.337 13.271  0.00 71.16  ? 442 GLU A OE2   1 
ATOM   3422  N  N     . GLU A 1 443 ? 5.603   -32.297 13.223  1.00 69.83  ? 443 GLU A N     1 
ATOM   3423  C  CA    . GLU A 1 443 ? 6.312   -31.032 13.001  1.00 67.83  ? 443 GLU A CA    1 
ATOM   3424  C  C     . GLU A 1 443 ? 5.643   -29.892 13.764  1.00 67.47  ? 443 GLU A C     1 
ATOM   3425  O  O     . GLU A 1 443 ? 4.887   -29.102 13.200  1.00 66.83  ? 443 GLU A O     1 
ATOM   3426  C  CB    . GLU A 1 443 ? 6.386   -30.714 11.506  1.00 66.78  ? 443 GLU A CB    1 
ATOM   3427  C  CG    . GLU A 1 443 ? 5.073   -30.787 10.774  1.00 65.62  ? 443 GLU A CG    1 
ATOM   3428  C  CD    . GLU A 1 443 ? 5.234   -31.304 9.354   1.00 67.16  ? 443 GLU A CD    1 
ATOM   3429  O  OE1   . GLU A 1 443 ? 4.278   -31.198 8.563   1.00 68.50  ? 443 GLU A OE1   1 
ATOM   3430  O  OE2   . GLU A 1 443 ? 6.316   -31.831 9.022   1.00 68.54  ? 443 GLU A OE2   1 
ATOM   3431  N  N     . ARG A 1 444 ? 5.943   -29.827 15.059  1.00 67.14  ? 444 ARG A N     1 
ATOM   3432  C  CA    . ARG A 1 444 ? 5.386   -28.827 15.963  1.00 66.65  ? 444 ARG A CA    1 
ATOM   3433  C  C     . ARG A 1 444 ? 6.041   -27.461 15.854  1.00 66.52  ? 444 ARG A C     1 
ATOM   3434  O  O     . ARG A 1 444 ? 5.803   -26.596 16.695  1.00 67.94  ? 444 ARG A O     1 
ATOM   3435  C  CB    . ARG A 1 444 ? 5.475   -29.319 17.411  1.00 65.74  ? 444 ARG A CB    1 
ATOM   3436  N  N     . HIS A 1 445 ? 6.880   -27.256 14.847  1.00 64.93  ? 445 HIS A N     1 
ATOM   3437  C  CA    . HIS A 1 445 ? 7.501   -25.950 14.692  1.00 62.93  ? 445 HIS A CA    1 
ATOM   3438  C  C     . HIS A 1 445 ? 6.632   -25.094 13.777  1.00 62.28  ? 445 HIS A C     1 
ATOM   3439  O  O     . HIS A 1 445 ? 6.560   -23.877 13.940  1.00 61.33  ? 445 HIS A O     1 
ATOM   3440  C  CB    . HIS A 1 445 ? 8.915   -26.088 14.133  1.00 62.16  ? 445 HIS A CB    1 
ATOM   3441  C  CG    . HIS A 1 445 ? 9.986   -25.792 15.138  1.00 61.67  ? 445 HIS A CG    1 
ATOM   3442  N  ND1   . HIS A 1 445 ? 9.981   -26.329 16.408  1.00 61.13  ? 445 HIS A ND1   1 
ATOM   3443  C  CD2   . HIS A 1 445 ? 11.100  -25.027 15.060  1.00 61.12  ? 445 HIS A CD2   1 
ATOM   3444  C  CE1   . HIS A 1 445 ? 11.046  -25.909 17.068  1.00 59.60  ? 445 HIS A CE1   1 
ATOM   3445  N  NE2   . HIS A 1 445 ? 11.743  -25.118 16.273  1.00 59.74  ? 445 HIS A NE2   1 
ATOM   3446  N  N     . ARG A 1 446 ? 5.956   -25.749 12.835  1.00 61.37  ? 446 ARG A N     1 
ATOM   3447  C  CA    . ARG A 1 446 ? 5.078   -25.070 11.892  1.00 60.46  ? 446 ARG A CA    1 
ATOM   3448  C  C     . ARG A 1 446 ? 3.734   -24.677 12.497  1.00 59.98  ? 446 ARG A C     1 
ATOM   3449  O  O     . ARG A 1 446 ? 3.382   -23.491 12.538  1.00 59.66  ? 446 ARG A O     1 
ATOM   3450  C  CB    . ARG A 1 446 ? 4.804   -25.950 10.670  1.00 60.95  ? 446 ARG A CB    1 
ATOM   3451  C  CG    . ARG A 1 446 ? 5.735   -25.754 9.485   1.00 61.03  ? 446 ARG A CG    1 
ATOM   3452  C  CD    . ARG A 1 446 ? 4.984   -26.014 8.180   1.00 59.51  ? 446 ARG A CD    1 
ATOM   3453  N  NE    . ARG A 1 446 ? 4.415   -27.356 8.130   1.00 59.22  ? 446 ARG A NE    1 
ATOM   3454  C  CZ    . ARG A 1 446 ? 3.477   -27.735 7.273   1.00 59.73  ? 446 ARG A CZ    1 
ATOM   3455  N  NH1   . ARG A 1 446 ? 3.003   -26.863 6.398   1.00 61.85  ? 446 ARG A NH1   1 
ATOM   3456  N  NH2   . ARG A 1 446 ? 3.016   -28.980 7.286   1.00 60.31  ? 446 ARG A NH2   1 
ATOM   3457  N  N     . TRP A 1 447 ? 2.971   -25.663 12.959  1.00 58.75  ? 447 TRP A N     1 
ATOM   3458  C  CA    . TRP A 1 447 ? 1.666   -25.338 13.507  1.00 58.64  ? 447 TRP A CA    1 
ATOM   3459  C  C     . TRP A 1 447 ? 1.742   -24.577 14.819  1.00 56.98  ? 447 TRP A C     1 
ATOM   3460  O  O     . TRP A 1 447 ? 0.789   -23.896 15.204  1.00 56.27  ? 447 TRP A O     1 
ATOM   3461  C  CB    . TRP A 1 447 ? 0.767   -26.589 13.641  1.00 61.28  ? 447 TRP A CB    1 
ATOM   3462  C  CG    . TRP A 1 447 ? 1.332   -27.750 14.418  1.00 63.80  ? 447 TRP A CG    1 
ATOM   3463  C  CD1   . TRP A 1 447 ? 2.061   -28.794 13.919  1.00 65.44  ? 447 TRP A CD1   1 
ATOM   3464  C  CD2   . TRP A 1 447 ? 1.234   -27.971 15.835  1.00 63.91  ? 447 TRP A CD2   1 
ATOM   3465  N  NE1   . TRP A 1 447 ? 2.426   -29.648 14.936  1.00 66.14  ? 447 TRP A NE1   1 
ATOM   3466  C  CE2   . TRP A 1 447 ? 1.933   -29.163 16.123  1.00 64.66  ? 447 TRP A CE2   1 
ATOM   3467  C  CE3   . TRP A 1 447 ? 0.629   -27.273 16.890  1.00 63.11  ? 447 TRP A CE3   1 
ATOM   3468  C  CZ2   . TRP A 1 447 ? 2.042   -29.674 17.421  1.00 63.24  ? 447 TRP A CZ2   1 
ATOM   3469  C  CZ3   . TRP A 1 447 ? 0.740   -27.783 18.182  1.00 61.65  ? 447 TRP A CZ3   1 
ATOM   3470  C  CH2   . TRP A 1 447 ? 1.442   -28.969 18.433  1.00 61.59  ? 447 TRP A CH2   1 
ATOM   3471  N  N     . GLU A 1 448 ? 2.866   -24.675 15.515  1.00 55.16  ? 448 GLU A N     1 
ATOM   3472  C  CA    . GLU A 1 448 ? 2.969   -23.925 16.751  1.00 54.92  ? 448 GLU A CA    1 
ATOM   3473  C  C     . GLU A 1 448 ? 3.125   -22.468 16.337  1.00 53.50  ? 448 GLU A C     1 
ATOM   3474  O  O     . GLU A 1 448 ? 2.531   -21.572 16.941  1.00 53.62  ? 448 GLU A O     1 
ATOM   3475  C  CB    . GLU A 1 448 ? 4.154   -24.404 17.605  1.00 56.57  ? 448 GLU A CB    1 
ATOM   3476  C  CG    . GLU A 1 448 ? 3.775   -25.525 18.581  1.00 59.91  ? 448 GLU A CG    1 
ATOM   3477  C  CD    . GLU A 1 448 ? 4.907   -25.925 19.514  1.00 63.37  ? 448 GLU A CD    1 
ATOM   3478  O  OE1   . GLU A 1 448 ? 5.501   -25.019 20.140  1.00 66.01  ? 448 GLU A OE1   1 
ATOM   3479  O  OE2   . GLU A 1 448 ? 5.197   -27.143 19.634  1.00 64.58  ? 448 GLU A OE2   1 
ATOM   3480  N  N     . ASN A 1 449 ? 3.907   -22.234 15.284  1.00 50.81  ? 449 ASN A N     1 
ATOM   3481  C  CA    . ASN A 1 449 ? 4.098   -20.880 14.798  1.00 46.90  ? 449 ASN A CA    1 
ATOM   3482  C  C     . ASN A 1 449 ? 2.773   -20.389 14.268  1.00 44.91  ? 449 ASN A C     1 
ATOM   3483  O  O     . ASN A 1 449 ? 2.374   -19.263 14.542  1.00 44.55  ? 449 ASN A O     1 
ATOM   3484  C  CB    . ASN A 1 449 ? 5.156   -20.830 13.703  1.00 46.43  ? 449 ASN A CB    1 
ATOM   3485  C  CG    . ASN A 1 449 ? 6.505   -20.385 14.229  1.00 45.97  ? 449 ASN A CG    1 
ATOM   3486  O  OD1   . ASN A 1 449 ? 6.608   -19.878 15.345  1.00 45.43  ? 449 ASN A OD1   1 
ATOM   3487  N  ND2   . ASN A 1 449 ? 7.544   -20.553 13.424  1.00 45.68  ? 449 ASN A ND2   1 
ATOM   3488  N  N     . ALA A 1 450 ? 2.084   -21.241 13.518  1.00 43.04  ? 450 ALA A N     1 
ATOM   3489  C  CA    . ALA A 1 450 ? 0.778   -20.879 12.986  1.00 41.56  ? 450 ALA A CA    1 
ATOM   3490  C  C     . ALA A 1 450 ? -0.156  -20.501 14.140  1.00 41.49  ? 450 ALA A C     1 
ATOM   3491  O  O     . ALA A 1 450 ? -0.745  -19.429 14.136  1.00 41.78  ? 450 ALA A O     1 
ATOM   3492  C  CB    . ALA A 1 450 ? 0.208   -22.021 12.211  1.00 39.92  ? 450 ALA A CB    1 
ATOM   3493  N  N     . LEU A 1 451 ? -0.290  -21.370 15.133  1.00 41.80  ? 451 LEU A N     1 
ATOM   3494  C  CA    . LEU A 1 451 ? -1.143  -21.057 16.273  1.00 42.48  ? 451 LEU A CA    1 
ATOM   3495  C  C     . LEU A 1 451 ? -0.718  -19.757 16.949  1.00 42.97  ? 451 LEU A C     1 
ATOM   3496  O  O     . LEU A 1 451 ? -1.549  -19.021 17.500  1.00 42.14  ? 451 LEU A O     1 
ATOM   3497  C  CB    . LEU A 1 451 ? -1.100  -22.179 17.306  1.00 42.28  ? 451 LEU A CB    1 
ATOM   3498  C  CG    . LEU A 1 451 ? -1.701  -23.499 16.848  1.00 42.47  ? 451 LEU A CG    1 
ATOM   3499  C  CD1   . LEU A 1 451 ? -1.905  -24.399 18.051  1.00 42.24  ? 451 LEU A CD1   1 
ATOM   3500  C  CD2   . LEU A 1 451 ? -3.024  -23.239 16.160  1.00 41.09  ? 451 LEU A CD2   1 
ATOM   3501  N  N     . LEU A 1 452 ? 0.584   -19.483 16.907  1.00 43.53  ? 452 LEU A N     1 
ATOM   3502  C  CA    . LEU A 1 452 ? 1.143   -18.277 17.519  1.00 43.49  ? 452 LEU A CA    1 
ATOM   3503  C  C     . LEU A 1 452 ? 0.668   -17.012 16.801  1.00 43.39  ? 452 LEU A C     1 
ATOM   3504  O  O     . LEU A 1 452 ? 0.303   -16.015 17.446  1.00 42.99  ? 452 LEU A O     1 
ATOM   3505  C  CB    . LEU A 1 452 ? 2.665   -18.360 17.501  1.00 42.89  ? 452 LEU A CB    1 
ATOM   3506  C  CG    . LEU A 1 452 ? 3.343   -18.313 18.868  1.00 43.13  ? 452 LEU A CG    1 
ATOM   3507  C  CD1   . LEU A 1 452 ? 2.581   -19.141 19.884  1.00 42.85  ? 452 LEU A CD1   1 
ATOM   3508  C  CD2   . LEU A 1 452 ? 4.763   -18.811 18.705  1.00 44.61  ? 452 LEU A CD2   1 
ATOM   3509  N  N     . GLY A 1 453 ? 0.670   -17.071 15.467  1.00 41.67  ? 453 GLY A N     1 
ATOM   3510  C  CA    . GLY A 1 453 ? 0.218   -15.954 14.662  1.00 39.43  ? 453 GLY A CA    1 
ATOM   3511  C  C     . GLY A 1 453 ? -1.284  -15.815 14.776  1.00 38.42  ? 453 GLY A C     1 
ATOM   3512  O  O     . GLY A 1 453 ? -1.795  -14.725 15.026  1.00 38.32  ? 453 GLY A O     1 
ATOM   3513  N  N     . LEU A 1 454 ? -1.979  -16.935 14.600  1.00 37.49  ? 454 LEU A N     1 
ATOM   3514  C  CA    . LEU A 1 454 ? -3.431  -17.020 14.682  1.00 36.44  ? 454 LEU A CA    1 
ATOM   3515  C  C     . LEU A 1 454 ? -3.928  -16.309 15.932  1.00 37.06  ? 454 LEU A C     1 
ATOM   3516  O  O     . LEU A 1 454 ? -4.857  -15.506 15.873  1.00 37.38  ? 454 LEU A O     1 
ATOM   3517  C  CB    . LEU A 1 454 ? -3.839  -18.496 14.716  1.00 36.78  ? 454 LEU A CB    1 
ATOM   3518  C  CG    . LEU A 1 454 ? -5.289  -18.979 14.598  1.00 36.24  ? 454 LEU A CG    1 
ATOM   3519  C  CD1   . LEU A 1 454 ? -6.086  -18.492 15.776  1.00 36.35  ? 454 LEU A CD1   1 
ATOM   3520  C  CD2   . LEU A 1 454 ? -5.897  -18.496 13.294  1.00 37.62  ? 454 LEU A CD2   1 
ATOM   3521  N  N     . LEU A 1 455 ? -3.307  -16.610 17.065  1.00 37.07  ? 455 LEU A N     1 
ATOM   3522  C  CA    . LEU A 1 455 ? -3.683  -15.987 18.324  1.00 38.13  ? 455 LEU A CA    1 
ATOM   3523  C  C     . LEU A 1 455 ? -3.385  -14.493 18.348  1.00 39.81  ? 455 LEU A C     1 
ATOM   3524  O  O     . LEU A 1 455 ? -4.105  -13.706 18.970  1.00 39.96  ? 455 LEU A O     1 
ATOM   3525  C  CB    . LEU A 1 455 ? -2.932  -16.649 19.453  1.00 38.97  ? 455 LEU A CB    1 
ATOM   3526  C  CG    . LEU A 1 455 ? -3.445  -17.998 19.907  1.00 39.15  ? 455 LEU A CG    1 
ATOM   3527  C  CD1   . LEU A 1 455 ? -2.443  -18.591 20.892  1.00 41.01  ? 455 LEU A CD1   1 
ATOM   3528  C  CD2   . LEU A 1 455 ? -4.806  -17.826 20.545  1.00 38.41  ? 455 LEU A CD2   1 
ATOM   3529  N  N     . ALA A 1 456 ? -2.294  -14.108 17.696  1.00 41.42  ? 456 ALA A N     1 
ATOM   3530  C  CA    . ALA A 1 456 ? -1.905  -12.708 17.627  1.00 42.02  ? 456 ALA A CA    1 
ATOM   3531  C  C     . ALA A 1 456 ? -2.970  -11.982 16.824  1.00 42.95  ? 456 ALA A C     1 
ATOM   3532  O  O     . ALA A 1 456 ? -3.447  -10.914 17.216  1.00 42.83  ? 456 ALA A O     1 
ATOM   3533  C  CB    . ALA A 1 456 ? -0.568  -12.584 16.940  1.00 41.15  ? 456 ALA A CB    1 
ATOM   3534  N  N     . LYS A 1 457 ? -3.333  -12.587 15.696  1.00 43.58  ? 457 LYS A N     1 
ATOM   3535  C  CA    . LYS A 1 457 ? -4.338  -12.044 14.800  1.00 44.92  ? 457 LYS A CA    1 
ATOM   3536  C  C     . LYS A 1 457 ? -5.667  -11.895 15.529  1.00 47.38  ? 457 LYS A C     1 
ATOM   3537  O  O     . LYS A 1 457 ? -6.431  -10.972 15.246  1.00 48.52  ? 457 LYS A O     1 
ATOM   3538  C  CB    . LYS A 1 457 ? -4.486  -12.944 13.563  1.00 42.49  ? 457 LYS A CB    1 
ATOM   3539  C  CG    . LYS A 1 457 ? -3.253  -12.952 12.649  1.00 40.82  ? 457 LYS A CG    1 
ATOM   3540  C  CD    . LYS A 1 457 ? -3.472  -13.798 11.401  1.00 38.95  ? 457 LYS A CD    1 
ATOM   3541  C  CE    . LYS A 1 457 ? -2.296  -13.729 10.411  1.00 37.66  ? 457 LYS A CE    1 
ATOM   3542  N  NZ    . LYS A 1 457 ? -1.060  -14.463 10.815  1.00 34.95  ? 457 LYS A NZ    1 
ATOM   3543  N  N     . ALA A 1 458 ? -5.940  -12.792 16.475  1.00 49.41  ? 458 ALA A N     1 
ATOM   3544  C  CA    . ALA A 1 458 ? -7.181  -12.725 17.245  1.00 50.77  ? 458 ALA A CA    1 
ATOM   3545  C  C     . ALA A 1 458 ? -7.080  -11.642 18.317  1.00 51.97  ? 458 ALA A C     1 
ATOM   3546  O  O     . ALA A 1 458 ? -8.066  -11.312 18.976  1.00 52.78  ? 458 ALA A O     1 
ATOM   3547  C  CB    . ALA A 1 458 ? -7.478  -14.062 17.881  1.00 50.10  ? 458 ALA A CB    1 
ATOM   3548  N  N     . GLY A 1 459 ? -5.880  -11.100 18.493  1.00 53.57  ? 459 GLY A N     1 
ATOM   3549  C  CA    . GLY A 1 459 ? -5.678  -10.036 19.458  1.00 56.23  ? 459 GLY A CA    1 
ATOM   3550  C  C     . GLY A 1 459 ? -5.288  -10.456 20.860  1.00 58.43  ? 459 GLY A C     1 
ATOM   3551  O  O     . GLY A 1 459 ? -5.604  -9.759  21.829  1.00 58.22  ? 459 GLY A O     1 
ATOM   3552  N  N     . LEU A 1 460 ? -4.601  -11.585 20.984  1.00 59.82  ? 460 LEU A N     1 
ATOM   3553  C  CA    . LEU A 1 460 ? -4.186  -12.045 22.298  1.00 62.34  ? 460 LEU A CA    1 
ATOM   3554  C  C     . LEU A 1 460 ? -2.696  -11.835 22.529  1.00 64.04  ? 460 LEU A C     1 
ATOM   3555  O  O     . LEU A 1 460 ? -1.864  -12.217 21.704  1.00 64.85  ? 460 LEU A O     1 
ATOM   3556  C  CB    . LEU A 1 460 ? -4.534  -13.527 22.489  1.00 63.61  ? 460 LEU A CB    1 
ATOM   3557  C  CG    . LEU A 1 460 ? -5.956  -13.920 22.926  1.00 66.32  ? 460 LEU A CG    1 
ATOM   3558  C  CD1   . LEU A 1 460 ? -6.977  -13.667 21.812  1.00 66.98  ? 460 LEU A CD1   1 
ATOM   3559  C  CD2   . LEU A 1 460 ? -5.954  -15.391 23.306  1.00 67.05  ? 460 LEU A CD2   1 
ATOM   3560  N  N     . GLN A 1 461 ? -2.366  -11.215 23.656  1.00 65.23  ? 461 GLN A N     1 
ATOM   3561  C  CA    . GLN A 1 461 ? -0.976  -10.973 24.018  1.00 66.78  ? 461 GLN A CA    1 
ATOM   3562  C  C     . GLN A 1 461 ? -0.462  -12.313 24.540  1.00 66.47  ? 461 GLN A C     1 
ATOM   3563  O  O     . GLN A 1 461 ? -0.996  -12.851 25.507  1.00 66.18  ? 461 GLN A O     1 
ATOM   3564  C  CB    . GLN A 1 461 ? -0.901  -9.908  25.116  1.00 68.57  ? 461 GLN A CB    1 
ATOM   3565  C  CG    . GLN A 1 461 ? -2.000  -8.836  24.999  1.00 72.79  ? 461 GLN A CG    1 
ATOM   3566  C  CD    . GLN A 1 461 ? -1.560  -7.549  24.291  1.00 74.43  ? 461 GLN A CD    1 
ATOM   3567  O  OE1   . GLN A 1 461 ? -1.103  -6.607  24.931  1.00 75.20  ? 461 GLN A OE1   1 
ATOM   3568  N  NE2   . GLN A 1 461 ? -1.704  -7.509  22.969  1.00 74.83  ? 461 GLN A NE2   1 
ATOM   3569  N  N     . VAL A 1 462 ? 0.558   -12.859 23.883  1.00 66.45  ? 462 VAL A N     1 
ATOM   3570  C  CA    . VAL A 1 462 ? 1.133   -14.145 24.270  1.00 65.28  ? 462 VAL A CA    1 
ATOM   3571  C  C     . VAL A 1 462 ? 2.251   -13.985 25.293  1.00 64.18  ? 462 VAL A C     1 
ATOM   3572  O  O     . VAL A 1 462 ? 2.353   -14.758 26.239  1.00 63.26  ? 462 VAL A O     1 
ATOM   3573  C  CB    . VAL A 1 462 ? 1.685   -14.897 23.028  1.00 65.64  ? 462 VAL A CB    1 
ATOM   3574  C  CG1   . VAL A 1 462 ? 2.409   -16.152 23.448  1.00 65.87  ? 462 VAL A CG1   1 
ATOM   3575  C  CG2   . VAL A 1 462 ? 0.544   -15.260 22.102  1.00 66.04  ? 462 VAL A CG2   1 
ATOM   3576  N  N     . VAL A 1 463 ? 3.082   -12.970 25.106  1.00 63.93  ? 463 VAL A N     1 
ATOM   3577  C  CA    . VAL A 1 463 ? 4.198   -12.726 26.006  1.00 63.38  ? 463 VAL A CA    1 
ATOM   3578  C  C     . VAL A 1 463 ? 4.349   -11.235 26.260  1.00 63.46  ? 463 VAL A C     1 
ATOM   3579  O  O     . VAL A 1 463 ? 3.861   -10.414 25.482  1.00 63.94  ? 463 VAL A O     1 
ATOM   3580  C  CB    . VAL A 1 463 ? 5.518   -13.251 25.389  1.00 62.60  ? 463 VAL A CB    1 
ATOM   3581  C  CG1   . VAL A 1 463 ? 6.689   -12.915 26.287  1.00 63.77  ? 463 VAL A CG1   1 
ATOM   3582  C  CG2   . VAL A 1 463 ? 5.430   -14.750 25.166  1.00 62.79  ? 463 VAL A CG2   1 
ATOM   3583  N  N     . ALA A 1 464 ? 5.006   -10.893 27.363  1.00 62.79  ? 464 ALA A N     1 
ATOM   3584  C  CA    . ALA A 1 464 ? 5.269   -9.503  27.699  1.00 62.50  ? 464 ALA A CA    1 
ATOM   3585  C  C     . ALA A 1 464 ? 6.602   -9.473  28.429  1.00 63.02  ? 464 ALA A C     1 
ATOM   3586  O  O     . ALA A 1 464 ? 7.178   -10.524 28.719  1.00 63.19  ? 464 ALA A O     1 
ATOM   3587  C  CB    . ALA A 1 464 ? 4.174   -8.946  28.577  1.00 62.62  ? 464 ALA A CB    1 
ATOM   3588  N  N     . LEU A 1 465 ? 7.098   -8.272  28.706  1.00 62.77  ? 465 LEU A N     1 
ATOM   3589  C  CA    . LEU A 1 465 ? 8.364   -8.108  29.411  1.00 61.96  ? 465 LEU A CA    1 
ATOM   3590  C  C     . LEU A 1 465 ? 8.069   -7.544  30.782  1.00 61.66  ? 465 LEU A C     1 
ATOM   3591  O  O     . LEU A 1 465 ? 6.960   -7.108  31.054  1.00 62.17  ? 465 LEU A O     1 
ATOM   3592  C  CB    . LEU A 1 465 ? 9.285   -7.142  28.657  1.00 61.06  ? 465 LEU A CB    1 
ATOM   3593  C  CG    . LEU A 1 465 ? 10.050  -7.673  27.446  1.00 60.21  ? 465 LEU A CG    1 
ATOM   3594  C  CD1   . LEU A 1 465 ? 10.576  -6.521  26.604  1.00 59.03  ? 465 LEU A CD1   1 
ATOM   3595  C  CD2   . LEU A 1 465 ? 11.183  -8.551  27.935  1.00 60.47  ? 465 LEU A CD2   1 
ATOM   3596  N  N     . SER A 1 466 ? 9.069   -7.550  31.646  1.00 61.46  ? 466 SER A N     1 
ATOM   3597  C  CA    . SER A 1 466 ? 8.911   -7.012  32.982  1.00 61.29  ? 466 SER A CA    1 
ATOM   3598  C  C     . SER A 1 466 ? 10.208  -6.303  33.328  1.00 61.13  ? 466 SER A C     1 
ATOM   3599  O  O     . SER A 1 466 ? 11.241  -6.949  33.498  1.00 61.02  ? 466 SER A O     1 
ATOM   3600  C  CB    . SER A 1 466 ? 8.639   -8.150  33.957  1.00 62.49  ? 466 SER A CB    1 
ATOM   3601  O  OG    . SER A 1 466 ? 9.566   -9.204  33.764  1.00 63.92  ? 466 SER A OG    1 
ATOM   3602  N  N     . GLY A 1 467 ? 10.160  -4.974  33.412  1.00 61.50  ? 467 GLY A N     1 
ATOM   3603  C  CA    . GLY A 1 467 ? 11.363  -4.208  33.718  1.00 62.01  ? 467 GLY A CA    1 
ATOM   3604  C  C     . GLY A 1 467 ? 11.177  -2.716  33.968  1.00 61.58  ? 467 GLY A C     1 
ATOM   3605  O  O     . GLY A 1 467 ? 10.064  -2.182  33.911  1.00 60.54  ? 467 GLY A O     1 
ATOM   3606  N  N     . ALA A 1 468 ? 12.282  -2.040  34.264  1.00 61.01  ? 468 ALA A N     1 
ATOM   3607  C  CA    . ALA A 1 468 ? 12.232  -0.609  34.525  1.00 61.40  ? 468 ALA A CA    1 
ATOM   3608  C  C     . ALA A 1 468 ? 12.715  0.138   33.282  1.00 61.12  ? 468 ALA A C     1 
ATOM   3609  O  O     . ALA A 1 468 ? 13.767  0.801   33.294  1.00 62.02  ? 468 ALA A O     1 
ATOM   3610  C  CB    . ALA A 1 468 ? 13.098  -0.256  35.746  1.00 61.70  ? 468 ALA A CB    1 
ATOM   3611  N  N     . TYR A 1 469 ? 11.934  0.024   32.207  1.00 58.70  ? 469 TYR A N     1 
ATOM   3612  C  CA    . TYR A 1 469 ? 12.273  0.674   30.948  1.00 55.78  ? 469 TYR A CA    1 
ATOM   3613  C  C     . TYR A 1 469 ? 11.883  2.145   30.950  1.00 55.61  ? 469 TYR A C     1 
ATOM   3614  O  O     . TYR A 1 469 ? 10.802  2.526   31.399  1.00 54.29  ? 469 TYR A O     1 
ATOM   3615  C  CB    . TYR A 1 469 ? 11.599  -0.041  29.776  1.00 52.26  ? 469 TYR A CB    1 
ATOM   3616  C  CG    . TYR A 1 469 ? 11.849  -1.529  29.749  1.00 48.10  ? 469 TYR A CG    1 
ATOM   3617  C  CD1   . TYR A 1 469 ? 10.854  -2.428  30.141  1.00 45.88  ? 469 TYR A CD1   1 
ATOM   3618  C  CD2   . TYR A 1 469 ? 13.076  -2.042  29.332  1.00 45.76  ? 469 TYR A CD2   1 
ATOM   3619  C  CE1   . TYR A 1 469 ? 11.070  -3.799  30.110  1.00 43.79  ? 469 TYR A CE1   1 
ATOM   3620  C  CE2   . TYR A 1 469 ? 13.306  -3.417  29.298  1.00 44.56  ? 469 TYR A CE2   1 
ATOM   3621  C  CZ    . TYR A 1 469 ? 12.295  -4.290  29.682  1.00 44.50  ? 469 TYR A CZ    1 
ATOM   3622  O  OH    . TYR A 1 469 ? 12.489  -5.652  29.580  1.00 43.93  ? 469 TYR A OH    1 
ATOM   3623  N  N     . PRO A 1 470 ? 12.778  2.993   30.442  1.00 55.64  ? 470 PRO A N     1 
ATOM   3624  C  CA    . PRO A 1 470 ? 12.585  4.441   30.358  1.00 55.45  ? 470 PRO A CA    1 
ATOM   3625  C  C     . PRO A 1 470 ? 11.346  4.840   29.577  1.00 54.80  ? 470 PRO A C     1 
ATOM   3626  O  O     . PRO A 1 470 ? 10.766  5.902   29.819  1.00 55.77  ? 470 PRO A O     1 
ATOM   3627  C  CB    . PRO A 1 470 ? 13.868  4.920   29.682  1.00 55.97  ? 470 PRO A CB    1 
ATOM   3628  C  CG    . PRO A 1 470 ? 14.246  3.746   28.827  1.00 57.48  ? 470 PRO A CG    1 
ATOM   3629  C  CD    . PRO A 1 470 ? 14.025  2.591   29.773  1.00 55.90  ? 470 PRO A CD    1 
ATOM   3630  N  N     . ALA A 1 471 ? 10.940  3.994   28.636  1.00 53.15  ? 471 ALA A N     1 
ATOM   3631  C  CA    . ALA A 1 471 ? 9.767   4.295   27.820  1.00 51.84  ? 471 ALA A CA    1 
ATOM   3632  C  C     . ALA A 1 471 ? 8.573   3.401   28.147  1.00 49.50  ? 471 ALA A C     1 
ATOM   3633  O  O     . ALA A 1 471 ? 8.721   2.193   28.310  1.00 49.92  ? 471 ALA A O     1 
ATOM   3634  C  CB    . ALA A 1 471 ? 10.125  4.176   26.345  1.00 51.94  ? 471 ALA A CB    1 
ATOM   3635  N  N     . GLU A 1 472 ? 7.394   4.001   28.252  1.00 46.38  ? 472 GLU A N     1 
ATOM   3636  C  CA    . GLU A 1 472 ? 6.194   3.236   28.546  1.00 44.74  ? 472 GLU A CA    1 
ATOM   3637  C  C     . GLU A 1 472 ? 5.611   2.730   27.242  1.00 44.19  ? 472 GLU A C     1 
ATOM   3638  O  O     . GLU A 1 472 ? 4.862   1.749   27.222  1.00 45.42  ? 472 GLU A O     1 
ATOM   3639  C  CB    . GLU A 1 472 ? 5.166   4.098   29.286  1.00 44.27  ? 472 GLU A CB    1 
ATOM   3640  C  CG    . GLU A 1 472 ? 5.599   4.470   30.698  0.00 44.41  ? 472 GLU A CG    1 
ATOM   3641  C  CD    . GLU A 1 472 ? 4.543   5.252   31.452  0.00 44.35  ? 472 GLU A CD    1 
ATOM   3642  O  OE1   . GLU A 1 472 ? 3.521   5.622   30.836  0.00 44.35  ? 472 GLU A OE1   1 
ATOM   3643  O  OE2   . GLU A 1 472 ? 4.737   5.503   32.660  0.00 44.35  ? 472 GLU A OE2   1 
ATOM   3644  N  N     . LEU A 1 473 ? 5.981   3.399   26.151  1.00 42.51  ? 473 LEU A N     1 
ATOM   3645  C  CA    . LEU A 1 473 ? 5.513   3.048   24.807  1.00 39.34  ? 473 LEU A CA    1 
ATOM   3646  C  C     . LEU A 1 473 ? 6.635   3.234   23.777  1.00 37.34  ? 473 LEU A C     1 
ATOM   3647  O  O     . LEU A 1 473 ? 7.310   4.257   23.756  1.00 37.02  ? 473 LEU A O     1 
ATOM   3648  C  CB    . LEU A 1 473 ? 4.295   3.918   24.434  1.00 38.46  ? 473 LEU A CB    1 
ATOM   3649  C  CG    . LEU A 1 473 ? 3.655   3.832   23.039  1.00 38.95  ? 473 LEU A CG    1 
ATOM   3650  C  CD1   . LEU A 1 473 ? 3.086   2.431   22.771  1.00 37.70  ? 473 LEU A CD1   1 
ATOM   3651  C  CD2   . LEU A 1 473 ? 2.553   4.871   22.946  1.00 37.24  ? 473 LEU A CD2   1 
ATOM   3652  N  N     . ALA A 1 474 ? 6.850   2.227   22.942  1.00 35.85  ? 474 ALA A N     1 
ATOM   3653  C  CA    . ALA A 1 474 ? 7.871   2.315   21.905  1.00 34.89  ? 474 ALA A CA    1 
ATOM   3654  C  C     . ALA A 1 474 ? 7.167   2.126   20.573  1.00 34.41  ? 474 ALA A C     1 
ATOM   3655  O  O     . ALA A 1 474 ? 6.570   1.075   20.311  1.00 33.18  ? 474 ALA A O     1 
ATOM   3656  C  CB    . ALA A 1 474 ? 8.933   1.243   22.098  1.00 35.19  ? 474 ALA A CB    1 
ATOM   3657  N  N     . VAL A 1 475 ? 7.218   3.155   19.738  1.00 32.94  ? 475 VAL A N     1 
ATOM   3658  C  CA    . VAL A 1 475 ? 6.566   3.081   18.450  1.00 32.63  ? 475 VAL A CA    1 
ATOM   3659  C  C     . VAL A 1 475 ? 7.595   3.260   17.361  1.00 32.47  ? 475 VAL A C     1 
ATOM   3660  O  O     . VAL A 1 475 ? 8.369   4.203   17.398  1.00 31.93  ? 475 VAL A O     1 
ATOM   3661  C  CB    . VAL A 1 475 ? 5.501   4.168   18.312  1.00 31.23  ? 475 VAL A CB    1 
ATOM   3662  C  CG1   . VAL A 1 475 ? 6.133   5.496   18.537  1.00 33.21  ? 475 VAL A CG1   1 
ATOM   3663  C  CG2   . VAL A 1 475 ? 4.884   4.132   16.938  1.00 29.36  ? 475 VAL A CG2   1 
ATOM   3664  N  N     . GLY A 1 476 ? 7.603   2.335   16.409  1.00 32.75  ? 476 GLY A N     1 
ATOM   3665  C  CA    . GLY A 1 476 ? 8.525   2.405   15.296  1.00 35.24  ? 476 GLY A CA    1 
ATOM   3666  C  C     . GLY A 1 476 ? 7.758   2.760   14.034  1.00 37.46  ? 476 GLY A C     1 
ATOM   3667  O  O     . GLY A 1 476 ? 6.578   2.413   13.896  1.00 37.82  ? 476 GLY A O     1 
ATOM   3668  N  N     . PHE A 1 477 ? 8.421   3.449   13.111  1.00 38.49  ? 477 PHE A N     1 
ATOM   3669  C  CA    . PHE A 1 477 ? 7.787   3.872   11.858  1.00 39.75  ? 477 PHE A CA    1 
ATOM   3670  C  C     . PHE A 1 477 ? 8.422   3.240   10.616  1.00 42.26  ? 477 PHE A C     1 
ATOM   3671  O  O     . PHE A 1 477 ? 9.646   3.025   10.563  1.00 44.05  ? 477 PHE A O     1 
ATOM   3672  C  CB    . PHE A 1 477 ? 7.872   5.397   11.697  1.00 36.09  ? 477 PHE A CB    1 
ATOM   3673  C  CG    . PHE A 1 477 ? 7.274   6.176   12.826  1.00 32.51  ? 477 PHE A CG    1 
ATOM   3674  C  CD1   . PHE A 1 477 ? 7.884   6.202   14.076  1.00 31.12  ? 477 PHE A CD1   1 
ATOM   3675  C  CD2   . PHE A 1 477 ? 6.121   6.917   12.629  1.00 29.46  ? 477 PHE A CD2   1 
ATOM   3676  C  CE1   . PHE A 1 477 ? 7.358   6.963   15.110  1.00 29.21  ? 477 PHE A CE1   1 
ATOM   3677  C  CE2   . PHE A 1 477 ? 5.591   7.680   13.659  1.00 29.52  ? 477 PHE A CE2   1 
ATOM   3678  C  CZ    . PHE A 1 477 ? 6.209   7.702   14.900  1.00 28.88  ? 477 PHE A CZ    1 
ATOM   3679  N  N     . ASP A 1 478 ? 7.599   2.953   9.611   1.00 42.96  ? 478 ASP A N     1 
ATOM   3680  C  CA    . ASP A 1 478 ? 8.128   2.395   8.379   1.00 45.34  ? 478 ASP A CA    1 
ATOM   3681  C  C     . ASP A 1 478 ? 7.458   3.031   7.178   1.00 46.66  ? 478 ASP A C     1 
ATOM   3682  O  O     . ASP A 1 478 ? 6.245   2.961   7.036   1.00 47.96  ? 478 ASP A O     1 
ATOM   3683  C  CB    . ASP A 1 478 ? 7.936   0.885   8.338   1.00 46.61  ? 478 ASP A CB    1 
ATOM   3684  C  CG    . ASP A 1 478 ? 8.924   0.200   7.400   1.00 49.72  ? 478 ASP A CG    1 
ATOM   3685  O  OD1   . ASP A 1 478 ? 8.891   0.479   6.184   1.00 49.41  ? 478 ASP A OD1   1 
ATOM   3686  O  OD2   . ASP A 1 478 ? 9.748   -0.615  7.880   1.00 52.60  ? 478 ASP A OD2   1 
ATOM   3687  N  N     . ALA A 1 479 ? 8.253   3.658   6.316   1.00 48.79  ? 479 ALA A N     1 
ATOM   3688  C  CA    . ALA A 1 479 ? 7.735   4.313   5.110   1.00 50.20  ? 479 ALA A CA    1 
ATOM   3689  C  C     . ALA A 1 479 ? 7.974   3.461   3.870   1.00 51.34  ? 479 ALA A C     1 
ATOM   3690  O  O     . ALA A 1 479 ? 8.282   3.990   2.808   1.00 52.39  ? 479 ALA A O     1 
ATOM   3691  C  CB    . ALA A 1 479 ? 8.409   5.661   4.929   1.00 50.02  ? 479 ALA A CB    1 
ATOM   3692  N  N     . GLY A 1 480 ? 7.813   2.149   3.995   1.00 52.71  ? 480 GLY A N     1 
ATOM   3693  C  CA    . GLY A 1 480 ? 8.071   1.277   2.867   1.00 53.02  ? 480 GLY A CA    1 
ATOM   3694  C  C     . GLY A 1 480 ? 9.581   1.227   2.716   1.00 54.21  ? 480 GLY A C     1 
ATOM   3695  O  O     . GLY A 1 480 ? 10.322  1.146   3.705   1.00 53.92  ? 480 GLY A O     1 
ATOM   3696  N  N     . GLY A 1 481 ? 10.054  1.273   1.480   1.00 54.56  ? 481 GLY A N     1 
ATOM   3697  C  CA    . GLY A 1 481 ? 11.485  1.250   1.269   1.00 55.45  ? 481 GLY A CA    1 
ATOM   3698  C  C     . GLY A 1 481 ? 11.871  2.612   0.754   1.00 55.81  ? 481 GLY A C     1 
ATOM   3699  O  O     . GLY A 1 481 ? 12.812  2.760   -0.023  1.00 57.87  ? 481 GLY A O     1 
ATOM   3700  N  N     . ARG A 1 482 ? 11.129  3.624   1.175   1.00 54.69  ? 482 ARG A N     1 
ATOM   3701  C  CA    . ARG A 1 482 ? 11.422  4.961   0.716   1.00 54.06  ? 482 ARG A CA    1 
ATOM   3702  C  C     . ARG A 1 482 ? 12.185  5.698   1.788   1.00 52.86  ? 482 ARG A C     1 
ATOM   3703  O  O     . ARG A 1 482 ? 12.399  5.176   2.877   1.00 52.20  ? 482 ARG A O     1 
ATOM   3704  C  CB    . ARG A 1 482 ? 10.133  5.706   0.374   1.00 55.95  ? 482 ARG A CB    1 
ATOM   3705  C  CG    . ARG A 1 482 ? 10.335  6.871   -0.590  1.00 57.73  ? 482 ARG A CG    1 
ATOM   3706  C  CD    . ARG A 1 482 ? 9.016   7.574   -0.889  1.00 57.89  ? 482 ARG A CD    1 
ATOM   3707  N  NE    . ARG A 1 482 ? 8.740   7.615   -2.318  1.00 56.48  ? 482 ARG A NE    1 
ATOM   3708  C  CZ    . ARG A 1 482 ? 8.356   6.564   -3.032  1.00 55.83  ? 482 ARG A CZ    1 
ATOM   3709  N  NH1   . ARG A 1 482 ? 8.198   5.388   -2.448  1.00 54.88  ? 482 ARG A NH1   1 
ATOM   3710  N  NH2   . ARG A 1 482 ? 8.135   6.688   -4.331  1.00 56.15  ? 482 ARG A NH2   1 
ATOM   3711  N  N     . GLU A 1 483 ? 12.603  6.912   1.467   1.00 52.17  ? 483 GLU A N     1 
ATOM   3712  C  CA    . GLU A 1 483 ? 13.361  7.717   2.398   1.00 51.35  ? 483 GLU A CA    1 
ATOM   3713  C  C     . GLU A 1 483 ? 12.541  8.928   2.790   1.00 51.26  ? 483 GLU A C     1 
ATOM   3714  O  O     . GLU A 1 483 ? 13.083  9.938   3.222   1.00 52.66  ? 483 GLU A O     1 
ATOM   3715  C  CB    . GLU A 1 483 ? 14.678  8.147   1.755   1.00 50.89  ? 483 GLU A CB    1 
ATOM   3716  N  N     . SER A 1 484 ? 11.228  8.832   2.635   1.00 50.31  ? 484 SER A N     1 
ATOM   3717  C  CA    . SER A 1 484 ? 10.370  9.946   2.988   1.00 50.71  ? 484 SER A CA    1 
ATOM   3718  C  C     . SER A 1 484 ? 8.962   9.449   3.224   1.00 50.66  ? 484 SER A C     1 
ATOM   3719  O  O     . SER A 1 484 ? 8.496   8.543   2.550   1.00 50.36  ? 484 SER A O     1 
ATOM   3720  C  CB    . SER A 1 484 ? 10.386  10.999  1.873   1.00 51.46  ? 484 SER A CB    1 
ATOM   3721  O  OG    . SER A 1 484 ? 9.612   12.135  2.219   1.00 51.82  ? 484 SER A OG    1 
ATOM   3722  N  N     . PHE A 1 485 ? 8.290   10.043  4.198   1.00 51.96  ? 485 PHE A N     1 
ATOM   3723  C  CA    . PHE A 1 485 ? 6.933   9.651   4.517   1.00 52.76  ? 485 PHE A CA    1 
ATOM   3724  C  C     . PHE A 1 485 ? 5.907   10.405  3.695   1.00 55.43  ? 485 PHE A C     1 
ATOM   3725  O  O     . PHE A 1 485 ? 4.774   10.589  4.146   1.00 55.07  ? 485 PHE A O     1 
ATOM   3726  C  CB    . PHE A 1 485 ? 6.632   9.874   6.001   1.00 50.89  ? 485 PHE A CB    1 
ATOM   3727  C  CG    . PHE A 1 485 ? 7.047   8.740   6.880   1.00 48.09  ? 485 PHE A CG    1 
ATOM   3728  C  CD1   . PHE A 1 485 ? 8.385   8.543   7.198   1.00 47.21  ? 485 PHE A CD1   1 
ATOM   3729  C  CD2   . PHE A 1 485 ? 6.097   7.846   7.368   1.00 47.14  ? 485 PHE A CD2   1 
ATOM   3730  C  CE1   . PHE A 1 485 ? 8.776   7.467   7.982   1.00 46.80  ? 485 PHE A CE1   1 
ATOM   3731  C  CE2   . PHE A 1 485 ? 6.475   6.767   8.152   1.00 47.52  ? 485 PHE A CE2   1 
ATOM   3732  C  CZ    . PHE A 1 485 ? 7.823   6.576   8.461   1.00 46.78  ? 485 PHE A CZ    1 
ATOM   3733  N  N     . ARG A 1 486 ? 6.282   10.869  2.507   1.00 58.65  ? 486 ARG A N     1 
ATOM   3734  C  CA    . ARG A 1 486 ? 5.282   11.553  1.707   1.00 62.21  ? 486 ARG A CA    1 
ATOM   3735  C  C     . ARG A 1 486 ? 4.567   10.573  0.793   1.00 63.63  ? 486 ARG A C     1 
ATOM   3736  O  O     . ARG A 1 486 ? 3.623   10.958  0.101   1.00 64.82  ? 486 ARG A O     1 
ATOM   3737  C  CB    . ARG A 1 486 ? 5.860   12.730  0.910   1.00 63.80  ? 486 ARG A CB    1 
ATOM   3738  C  CG    . ARG A 1 486 ? 7.190   12.511  0.217   1.00 67.02  ? 486 ARG A CG    1 
ATOM   3739  C  CD    . ARG A 1 486 ? 7.329   13.540  -0.893  1.00 68.36  ? 486 ARG A CD    1 
ATOM   3740  N  NE    . ARG A 1 486 ? 6.763   14.834  -0.510  1.00 70.72  ? 486 ARG A NE    1 
ATOM   3741  C  CZ    . ARG A 1 486 ? 7.449   15.815  0.073   1.00 72.57  ? 486 ARG A CZ    1 
ATOM   3742  N  NH1   . ARG A 1 486 ? 8.742   15.656  0.341   1.00 71.77  ? 486 ARG A NH1   1 
ATOM   3743  N  NH2   . ARG A 1 486 ? 6.841   16.958  0.386   1.00 72.81  ? 486 ARG A NH2   1 
ATOM   3744  N  N     . PHE A 1 487 ? 5.002   9.309   0.784   1.00 64.82  ? 487 PHE A N     1 
ATOM   3745  C  CA    . PHE A 1 487 ? 4.303   8.317   -0.033  1.00 65.25  ? 487 PHE A CA    1 
ATOM   3746  C  C     . PHE A 1 487 ? 3.264   7.584   0.808   1.00 62.67  ? 487 PHE A C     1 
ATOM   3747  O  O     . PHE A 1 487 ? 2.067   7.877   0.735   1.00 61.75  ? 487 PHE A O     1 
ATOM   3748  C  CB    . PHE A 1 487 ? 5.236   7.273   -0.663  1.00 69.34  ? 487 PHE A CB    1 
ATOM   3749  C  CG    . PHE A 1 487 ? 4.572   6.498   -1.794  1.00 74.07  ? 487 PHE A CG    1 
ATOM   3750  C  CD1   . PHE A 1 487 ? 4.029   7.189   -2.883  1.00 74.84  ? 487 PHE A CD1   1 
ATOM   3751  C  CD2   . PHE A 1 487 ? 4.427   5.105   -1.747  1.00 74.90  ? 487 PHE A CD2   1 
ATOM   3752  C  CE1   . PHE A 1 487 ? 3.351   6.520   -3.897  1.00 75.60  ? 487 PHE A CE1   1 
ATOM   3753  C  CE2   . PHE A 1 487 ? 3.747   4.423   -2.765  1.00 75.18  ? 487 PHE A CE2   1 
ATOM   3754  C  CZ    . PHE A 1 487 ? 3.209   5.137   -3.840  1.00 76.16  ? 487 PHE A CZ    1 
ATOM   3755  N  N     . GLY A 1 488 ? 3.727   6.633   1.611   1.00 59.76  ? 488 GLY A N     1 
ATOM   3756  C  CA    . GLY A 1 488 ? 2.808   5.878   2.442   1.00 55.27  ? 488 GLY A CA    1 
ATOM   3757  C  C     . GLY A 1 488 ? 3.028   6.025   3.934   1.00 50.46  ? 488 GLY A C     1 
ATOM   3758  O  O     . GLY A 1 488 ? 2.503   6.940   4.556   1.00 49.82  ? 488 GLY A O     1 
ATOM   3759  N  N     . GLY A 1 489 ? 3.807   5.107   4.497   1.00 47.03  ? 489 GLY A N     1 
ATOM   3760  C  CA    . GLY A 1 489 ? 4.090   5.104   5.922   1.00 42.67  ? 489 GLY A CA    1 
ATOM   3761  C  C     . GLY A 1 489 ? 3.062   4.331   6.742   1.00 39.77  ? 489 GLY A C     1 
ATOM   3762  O  O     . GLY A 1 489 ? 1.872   4.411   6.467   1.00 38.06  ? 489 GLY A O     1 
ATOM   3763  N  N     . ALA A 1 490 ? 3.526   3.575   7.736   1.00 37.06  ? 490 ALA A N     1 
ATOM   3764  C  CA    . ALA A 1 490 ? 2.664   2.803   8.635   1.00 34.56  ? 490 ALA A CA    1 
ATOM   3765  C  C     . ALA A 1 490 ? 3.383   2.693   9.981   1.00 34.35  ? 490 ALA A C     1 
ATOM   3766  O  O     . ALA A 1 490 ? 4.603   2.863   10.052  1.00 34.50  ? 490 ALA A O     1 
ATOM   3767  C  CB    . ALA A 1 490 ? 2.412   1.436   8.070   1.00 32.48  ? 490 ALA A CB    1 
ATOM   3768  N  N     . ALA A 1 491 ? 2.651   2.416   11.055  1.00 33.82  ? 491 ALA A N     1 
ATOM   3769  C  CA    . ALA A 1 491 ? 3.307   2.315   12.355  1.00 33.35  ? 491 ALA A CA    1 
ATOM   3770  C  C     . ALA A 1 491 ? 2.827   1.225   13.294  1.00 33.07  ? 491 ALA A C     1 
ATOM   3771  O  O     . ALA A 1 491 ? 1.710   0.724   13.188  1.00 32.07  ? 491 ALA A O     1 
ATOM   3772  C  CB    . ALA A 1 491 ? 3.248   3.644   13.061  1.00 32.35  ? 491 ALA A CB    1 
ATOM   3773  N  N     . CYS A 1 492 ? 3.710   0.868   14.219  1.00 34.60  ? 492 CYS A N     1 
ATOM   3774  C  CA    . CYS A 1 492 ? 3.430   -0.149  15.220  1.00 35.90  ? 492 CYS A CA    1 
ATOM   3775  C  C     . CYS A 1 492 ? 4.019   0.250   16.566  1.00 35.35  ? 492 CYS A C     1 
ATOM   3776  O  O     . CYS A 1 492 ? 5.182   0.630   16.652  1.00 36.25  ? 492 CYS A O     1 
ATOM   3777  C  CB    . CYS A 1 492 ? 3.998   -1.496  14.776  1.00 36.57  ? 492 CYS A CB    1 
ATOM   3778  S  SG    . CYS A 1 492 ? 3.131   -2.175  13.356  1.00 38.96  ? 492 CYS A SG    1 
ATOM   3779  N  N     . ALA A 1 493 ? 3.209   0.164   17.613  1.00 34.04  ? 493 ALA A N     1 
ATOM   3780  C  CA    . ALA A 1 493 ? 3.663   0.518   18.936  1.00 34.12  ? 493 ALA A CA    1 
ATOM   3781  C  C     . ALA A 1 493 ? 3.646   -0.678  19.858  1.00 34.55  ? 493 ALA A C     1 
ATOM   3782  O  O     . ALA A 1 493 ? 2.967   -1.661  19.603  1.00 32.81  ? 493 ALA A O     1 
ATOM   3783  C  CB    . ALA A 1 493 ? 2.785   1.601   19.502  1.00 35.93  ? 493 ALA A CB    1 
ATOM   3784  N  N     . VAL A 1 494 ? 4.407   -0.574  20.940  1.00 36.28  ? 494 VAL A N     1 
ATOM   3785  C  CA    . VAL A 1 494 ? 4.479   -1.617  21.956  1.00 36.00  ? 494 VAL A CA    1 
ATOM   3786  C  C     . VAL A 1 494 ? 4.421   -0.914  23.309  1.00 35.93  ? 494 VAL A C     1 
ATOM   3787  O  O     . VAL A 1 494 ? 5.099   0.088   23.508  1.00 35.85  ? 494 VAL A O     1 
ATOM   3788  C  CB    . VAL A 1 494 ? 5.795   -2.416  21.850  1.00 35.28  ? 494 VAL A CB    1 
ATOM   3789  C  CG1   . VAL A 1 494 ? 5.878   -3.447  22.963  1.00 32.81  ? 494 VAL A CG1   1 
ATOM   3790  C  CG2   . VAL A 1 494 ? 5.866   -3.091  20.508  1.00 34.24  ? 494 VAL A CG2   1 
ATOM   3791  N  N     . GLY A 1 495 ? 3.600   -1.433  24.221  1.00 36.29  ? 495 GLY A N     1 
ATOM   3792  C  CA    . GLY A 1 495 ? 3.468   -0.844  25.547  1.00 37.06  ? 495 GLY A CA    1 
ATOM   3793  C  C     . GLY A 1 495 ? 3.707   -1.830  26.680  1.00 38.54  ? 495 GLY A C     1 
ATOM   3794  O  O     . GLY A 1 495 ? 3.362   -1.586  27.842  1.00 38.45  ? 495 GLY A O     1 
ATOM   3795  N  N     . GLY A 1 498 ? 0.874   -3.911  31.858  1.00 65.70  ? 498 GLY A N     1 
ATOM   3796  C  CA    . GLY A 1 498 ? 0.056   -3.992  30.662  1.00 65.53  ? 498 GLY A CA    1 
ATOM   3797  C  C     . GLY A 1 498 ? 0.859   -3.805  29.390  1.00 65.61  ? 498 GLY A C     1 
ATOM   3798  O  O     . GLY A 1 498 ? 1.297   -2.698  29.067  1.00 65.99  ? 498 GLY A O     1 
ATOM   3799  N  N     . GLY A 1 499 ? 1.080   -4.900  28.675  1.00 64.91  ? 499 GLY A N     1 
ATOM   3800  C  CA    . GLY A 1 499 ? 1.808   -4.812  27.426  1.00 62.60  ? 499 GLY A CA    1 
ATOM   3801  C  C     . GLY A 1 499 ? 0.728   -4.766  26.375  1.00 60.92  ? 499 GLY A C     1 
ATOM   3802  O  O     . GLY A 1 499 ? -0.267  -5.463  26.503  1.00 59.76  ? 499 GLY A O     1 
ATOM   3803  N  N     . HIS A 1 500 ? 0.894   -3.928  25.363  1.00 59.97  ? 500 HIS A N     1 
ATOM   3804  C  CA    . HIS A 1 500 ? -0.096  -3.822  24.300  1.00 58.39  ? 500 HIS A CA    1 
ATOM   3805  C  C     . HIS A 1 500 ? 0.641   -3.790  22.968  1.00 55.90  ? 500 HIS A C     1 
ATOM   3806  O  O     . HIS A 1 500 ? 1.794   -3.371  22.892  1.00 54.28  ? 500 HIS A O     1 
ATOM   3807  C  CB    . HIS A 1 500 ? -0.927  -2.538  24.450  1.00 61.38  ? 500 HIS A CB    1 
ATOM   3808  C  CG    . HIS A 1 500 ? -1.949  -2.575  25.555  1.00 64.56  ? 500 HIS A CG    1 
ATOM   3809  N  ND1   . HIS A 1 500 ? -1.880  -1.754  26.662  1.00 64.91  ? 500 HIS A ND1   1 
ATOM   3810  C  CD2   . HIS A 1 500 ? -3.110  -3.267  25.674  1.00 65.36  ? 500 HIS A CD2   1 
ATOM   3811  C  CE1   . HIS A 1 500 ? -2.955  -1.935  27.412  1.00 64.63  ? 500 HIS A CE1   1 
ATOM   3812  N  NE2   . HIS A 1 500 ? -3.717  -2.846  26.835  1.00 64.91  ? 500 HIS A NE2   1 
ATOM   3813  N  N     . LEU A 1 501 ? -0.022  -4.248  21.918  1.00 53.59  ? 501 LEU A N     1 
ATOM   3814  C  CA    . LEU A 1 501 ? 0.574   -4.236  20.594  1.00 51.16  ? 501 LEU A CA    1 
ATOM   3815  C  C     . LEU A 1 501 ? -0.447  -3.698  19.630  1.00 49.51  ? 501 LEU A C     1 
ATOM   3816  O  O     . LEU A 1 501 ? -1.376  -4.409  19.275  1.00 50.20  ? 501 LEU A O     1 
ATOM   3817  C  CB    . LEU A 1 501 ? 0.959   -5.640  20.146  1.00 50.11  ? 501 LEU A CB    1 
ATOM   3818  C  CG    . LEU A 1 501 ? 2.049   -6.356  20.921  1.00 49.67  ? 501 LEU A CG    1 
ATOM   3819  C  CD1   . LEU A 1 501 ? 2.386   -7.650  20.208  1.00 50.64  ? 501 LEU A CD1   1 
ATOM   3820  C  CD2   . LEU A 1 501 ? 3.270   -5.482  21.008  1.00 50.10  ? 501 LEU A CD2   1 
ATOM   3821  N  N     . LEU A 1 502 ? -0.296  -2.446  19.221  1.00 47.77  ? 502 LEU A N     1 
ATOM   3822  C  CA    . LEU A 1 502 ? -1.233  -1.865  18.272  1.00 46.86  ? 502 LEU A CA    1 
ATOM   3823  C  C     . LEU A 1 502 ? -0.531  -1.482  16.984  1.00 45.25  ? 502 LEU A C     1 
ATOM   3824  O  O     . LEU A 1 502 ? 0.675   -1.287  16.957  1.00 43.72  ? 502 LEU A O     1 
ATOM   3825  C  CB    . LEU A 1 502 ? -1.956  -0.649  18.867  1.00 46.76  ? 502 LEU A CB    1 
ATOM   3826  C  CG    . LEU A 1 502 ? -1.215  0.305   19.811  1.00 49.11  ? 502 LEU A CG    1 
ATOM   3827  C  CD1   . LEU A 1 502 ? -1.901  1.663   19.820  1.00 46.99  ? 502 LEU A CD1   1 
ATOM   3828  C  CD2   . LEU A 1 502 ? -1.164  -0.292  21.226  1.00 48.98  ? 502 LEU A CD2   1 
ATOM   3829  N  N     . TRP A 1 503 ? -1.301  -1.418  15.908  1.00 45.52  ? 503 TRP A N     1 
ATOM   3830  C  CA    . TRP A 1 503 ? -0.784  -1.056  14.595  1.00 44.38  ? 503 TRP A CA    1 
ATOM   3831  C  C     . TRP A 1 503 ? -1.538  0.178   14.194  1.00 43.60  ? 503 TRP A C     1 
ATOM   3832  O  O     . TRP A 1 503 ? -2.669  0.375   14.614  1.00 43.84  ? 503 TRP A O     1 
ATOM   3833  C  CB    . TRP A 1 503 ? -1.054  -2.158  13.563  1.00 44.36  ? 503 TRP A CB    1 
ATOM   3834  C  CG    . TRP A 1 503 ? -2.526  -2.546  13.386  1.00 43.80  ? 503 TRP A CG    1 
ATOM   3835  C  CD1   . TRP A 1 503 ? -3.161  -3.632  13.925  1.00 42.85  ? 503 TRP A CD1   1 
ATOM   3836  C  CD2   . TRP A 1 503 ? -3.522  -1.852  12.609  1.00 44.10  ? 503 TRP A CD2   1 
ATOM   3837  N  NE1   . TRP A 1 503 ? -4.480  -3.659  13.531  1.00 42.15  ? 503 TRP A NE1   1 
ATOM   3838  C  CE2   . TRP A 1 503 ? -4.726  -2.578  12.724  1.00 42.93  ? 503 TRP A CE2   1 
ATOM   3839  C  CE3   . TRP A 1 503 ? -3.510  -0.688  11.825  1.00 44.36  ? 503 TRP A CE3   1 
ATOM   3840  C  CZ2   . TRP A 1 503 ? -5.903  -2.176  12.090  1.00 41.84  ? 503 TRP A CZ2   1 
ATOM   3841  C  CZ3   . TRP A 1 503 ? -4.689  -0.292  11.194  1.00 41.80  ? 503 TRP A CZ3   1 
ATOM   3842  C  CH2   . TRP A 1 503 ? -5.861  -1.034  11.330  1.00 41.14  ? 503 TRP A CH2   1 
ATOM   3843  N  N     . THR A 1 504 ? -0.934  1.011   13.372  1.00 43.51  ? 504 THR A N     1 
ATOM   3844  C  CA    . THR A 1 504 ? -1.628  2.208   12.963  1.00 45.82  ? 504 THR A CA    1 
ATOM   3845  C  C     . THR A 1 504 ? -1.317  2.526   11.502  1.00 47.29  ? 504 THR A C     1 
ATOM   3846  O  O     . THR A 1 504 ? -0.160  2.569   11.093  1.00 47.93  ? 504 THR A O     1 
ATOM   3847  C  CB    . THR A 1 504 ? -1.270  3.372   13.931  1.00 45.55  ? 504 THR A CB    1 
ATOM   3848  O  OG1   . THR A 1 504 ? -1.833  4.602   13.468  1.00 46.56  ? 504 THR A OG1   1 
ATOM   3849  C  CG2   . THR A 1 504 ? 0.212   3.500   14.073  1.00 46.74  ? 504 THR A CG2   1 
ATOM   3850  N  N     . LEU A 1 505 ? -2.372  2.711   10.712  1.00 49.74  ? 505 LEU A N     1 
ATOM   3851  C  CA    . LEU A 1 505 ? -2.250  3.004   9.285   1.00 51.72  ? 505 LEU A CA    1 
ATOM   3852  C  C     . LEU A 1 505 ? -2.704  4.412   8.900   1.00 54.51  ? 505 LEU A C     1 
ATOM   3853  O  O     . LEU A 1 505 ? -3.560  5.008   9.554   1.00 53.41  ? 505 LEU A O     1 
ATOM   3854  C  CB    . LEU A 1 505 ? -3.057  1.994   8.464   1.00 50.28  ? 505 LEU A CB    1 
ATOM   3855  C  CG    . LEU A 1 505 ? -2.540  0.568   8.262   1.00 49.15  ? 505 LEU A CG    1 
ATOM   3856  C  CD1   . LEU A 1 505 ? -3.520  -0.209  7.389   1.00 46.70  ? 505 LEU A CD1   1 
ATOM   3857  C  CD2   . LEU A 1 505 ? -1.173  0.604   7.606   1.00 46.98  ? 505 LEU A CD2   1 
ATOM   3858  N  N     . PRO A 1 506 ? -2.138  4.950   7.809   1.00 57.96  ? 506 PRO A N     1 
ATOM   3859  C  CA    . PRO A 1 506 ? -2.443  6.281   7.287   1.00 61.21  ? 506 PRO A CA    1 
ATOM   3860  C  C     . PRO A 1 506 ? -3.942  6.500   7.188   1.00 64.17  ? 506 PRO A C     1 
ATOM   3861  O  O     . PRO A 1 506 ? -4.669  5.677   6.629   1.00 63.89  ? 506 PRO A O     1 
ATOM   3862  C  CB    . PRO A 1 506 ? -1.741  6.285   5.937   1.00 61.65  ? 506 PRO A CB    1 
ATOM   3863  C  CG    . PRO A 1 506 ? -0.529  5.477   6.223   1.00 61.89  ? 506 PRO A CG    1 
ATOM   3864  C  CD    . PRO A 1 506 ? -1.106  4.301   6.985   1.00 60.22  ? 506 PRO A CD    1 
ATOM   3865  N  N     . GLU A 1 507 ? -4.366  7.634   7.741   1.00 67.76  ? 507 GLU A N     1 
ATOM   3866  C  CA    . GLU A 1 507 ? -5.759  8.078   7.842   1.00 71.56  ? 507 GLU A CA    1 
ATOM   3867  C  C     . GLU A 1 507 ? -6.806  7.740   6.768   1.00 71.68  ? 507 GLU A C     1 
ATOM   3868  O  O     . GLU A 1 507 ? -6.502  7.257   5.679   1.00 72.61  ? 507 GLU A O     1 
ATOM   3869  C  CB    . GLU A 1 507 ? -5.776  9.594   8.107   1.00 74.39  ? 507 GLU A CB    1 
ATOM   3870  C  CG    . GLU A 1 507 ? -5.453  10.513  6.920   1.00 78.15  ? 507 GLU A CG    1 
ATOM   3871  C  CD    . GLU A 1 507 ? -5.570  11.998  7.297   1.00 80.74  ? 507 GLU A CD    1 
ATOM   3872  O  OE1   . GLU A 1 507 ? -5.594  12.858  6.388   1.00 82.03  ? 507 GLU A OE1   1 
ATOM   3873  O  OE2   . GLU A 1 507 ? -5.634  12.304  8.512   1.00 81.22  ? 507 GLU A OE2   1 
ATOM   3874  N  N     . ARG A 1 513 ? 0.828   15.700  -0.354  1.00 54.56  ? 513 ARG A N     1 
ATOM   3875  C  CA    . ARG A 1 513 ? 0.746   15.535  1.094   1.00 54.16  ? 513 ARG A CA    1 
ATOM   3876  C  C     . ARG A 1 513 ? 2.111   15.592  1.807   1.00 52.82  ? 513 ARG A C     1 
ATOM   3877  O  O     . ARG A 1 513 ? 3.038   14.831  1.482   1.00 50.66  ? 513 ARG A O     1 
ATOM   3878  C  CB    . ARG A 1 513 ? 0.038   14.223  1.422   1.00 55.77  ? 513 ARG A CB    1 
ATOM   3879  C  CG    . ARG A 1 513 ? 0.161   13.831  2.875   1.00 59.02  ? 513 ARG A CG    1 
ATOM   3880  C  CD    . ARG A 1 513 ? -0.741  12.665  3.239   1.00 61.21  ? 513 ARG A CD    1 
ATOM   3881  N  NE    . ARG A 1 513 ? -2.112  13.104  3.482   1.00 62.81  ? 513 ARG A NE    1 
ATOM   3882  C  CZ    . ARG A 1 513 ? -3.089  13.087  2.577   1.00 64.91  ? 513 ARG A CZ    1 
ATOM   3883  N  NH1   . ARG A 1 513 ? -2.865  12.643  1.344   1.00 65.29  ? 513 ARG A NH1   1 
ATOM   3884  N  NH2   . ARG A 1 513 ? -4.300  13.520  2.908   1.00 65.34  ? 513 ARG A NH2   1 
ATOM   3885  N  N     . ILE A 1 514 ? 2.196   16.502  2.786   1.00 51.10  ? 514 ILE A N     1 
ATOM   3886  C  CA    . ILE A 1 514 ? 3.393   16.755  3.594   1.00 48.58  ? 514 ILE A CA    1 
ATOM   3887  C  C     . ILE A 1 514 ? 3.759   15.613  4.527   1.00 46.78  ? 514 ILE A C     1 
ATOM   3888  O  O     . ILE A 1 514 ? 2.917   15.129  5.286   1.00 46.75  ? 514 ILE A O     1 
ATOM   3889  C  CB    . ILE A 1 514 ? 3.219   17.999  4.467   1.00 49.46  ? 514 ILE A CB    1 
ATOM   3890  C  CG1   . ILE A 1 514 ? 2.958   19.221  3.588   1.00 50.87  ? 514 ILE A CG1   1 
ATOM   3891  C  CG2   . ILE A 1 514 ? 4.456   18.185  5.343   1.00 49.96  ? 514 ILE A CG2   1 
ATOM   3892  C  CD1   . ILE A 1 514 ? 4.099   19.534  2.612   1.00 55.77  ? 514 ILE A CD1   1 
ATOM   3893  N  N     . PRO A 1 515 ? 5.039   15.197  4.515   1.00 44.57  ? 515 PRO A N     1 
ATOM   3894  C  CA    . PRO A 1 515 ? 5.516   14.099  5.360   1.00 42.57  ? 515 PRO A CA    1 
ATOM   3895  C  C     . PRO A 1 515 ? 5.437   14.339  6.859   1.00 40.82  ? 515 PRO A C     1 
ATOM   3896  O  O     . PRO A 1 515 ? 5.148   13.423  7.631   1.00 38.91  ? 515 PRO A O     1 
ATOM   3897  C  CB    . PRO A 1 515 ? 6.951   13.880  4.862   1.00 41.39  ? 515 PRO A CB    1 
ATOM   3898  C  CG    . PRO A 1 515 ? 7.352   15.212  4.423   1.00 41.87  ? 515 PRO A CG    1 
ATOM   3899  C  CD    . PRO A 1 515 ? 6.138   15.715  3.684   1.00 43.13  ? 515 PRO A CD    1 
ATOM   3900  N  N     . GLN A 1 516 ? 5.683   15.568  7.277   1.00 40.20  ? 516 GLN A N     1 
ATOM   3901  C  CA    . GLN A 1 516 ? 5.641   15.846  8.695   1.00 40.41  ? 516 GLN A CA    1 
ATOM   3902  C  C     . GLN A 1 516 ? 4.241   15.635  9.231   1.00 41.54  ? 516 GLN A C     1 
ATOM   3903  O  O     . GLN A 1 516 ? 4.060   15.344  10.418  1.00 42.38  ? 516 GLN A O     1 
ATOM   3904  C  CB    . GLN A 1 516 ? 6.130   17.257  8.965   1.00 38.03  ? 516 GLN A CB    1 
ATOM   3905  C  CG    . GLN A 1 516 ? 7.563   17.412  8.576   1.00 37.17  ? 516 GLN A CG    1 
ATOM   3906  C  CD    . GLN A 1 516 ? 8.150   18.720  9.011   1.00 36.99  ? 516 GLN A CD    1 
ATOM   3907  O  OE1   . GLN A 1 516 ? 8.041   19.105  10.182  1.00 36.55  ? 516 GLN A OE1   1 
ATOM   3908  N  NE2   . GLN A 1 516 ? 8.798   19.415  8.077   1.00 35.61  ? 516 GLN A NE2   1 
ATOM   3909  N  N     . GLU A 1 517 ? 3.254   15.769  8.352   1.00 41.22  ? 517 GLU A N     1 
ATOM   3910  C  CA    . GLU A 1 517 ? 1.867   15.562  8.744   1.00 41.26  ? 517 GLU A CA    1 
ATOM   3911  C  C     . GLU A 1 517 ? 1.646   14.067  8.950   1.00 39.93  ? 517 GLU A C     1 
ATOM   3912  O  O     . GLU A 1 517 ? 1.171   13.627  10.004  1.00 40.28  ? 517 GLU A O     1 
ATOM   3913  C  CB    . GLU A 1 517 ? 0.929   16.091  7.664   1.00 42.61  ? 517 GLU A CB    1 
ATOM   3914  C  CG    . GLU A 1 517 ? 0.848   17.605  7.597   1.00 45.38  ? 517 GLU A CG    1 
ATOM   3915  C  CD    . GLU A 1 517 ? 0.229   18.225  8.841   1.00 48.05  ? 517 GLU A CD    1 
ATOM   3916  O  OE1   . GLU A 1 517 ? -0.700  17.611  9.427   1.00 50.15  ? 517 GLU A OE1   1 
ATOM   3917  O  OE2   . GLU A 1 517 ? 0.665   19.338  9.220   1.00 48.03  ? 517 GLU A OE2   1 
ATOM   3918  N  N     . VAL A 1 518 ? 2.002   13.296  7.932   1.00 37.44  ? 518 VAL A N     1 
ATOM   3919  C  CA    . VAL A 1 518 ? 1.882   11.853  7.974   1.00 35.59  ? 518 VAL A CA    1 
ATOM   3920  C  C     . VAL A 1 518 ? 2.421   11.299  9.298   1.00 35.34  ? 518 VAL A C     1 
ATOM   3921  O  O     . VAL A 1 518 ? 1.747   10.514  9.963   1.00 34.81  ? 518 VAL A O     1 
ATOM   3922  C  CB    . VAL A 1 518 ? 2.673   11.220  6.812   1.00 35.60  ? 518 VAL A CB    1 
ATOM   3923  C  CG1   . VAL A 1 518 ? 2.522   9.709   6.821   1.00 35.80  ? 518 VAL A CG1   1 
ATOM   3924  C  CG2   . VAL A 1 518 ? 2.200   11.788  5.513   1.00 34.83  ? 518 VAL A CG2   1 
ATOM   3925  N  N     . VAL A 1 519 ? 3.627   11.721  9.680   1.00 33.72  ? 519 VAL A N     1 
ATOM   3926  C  CA    . VAL A 1 519 ? 4.261   11.243  10.909  1.00 32.80  ? 519 VAL A CA    1 
ATOM   3927  C  C     . VAL A 1 519 ? 3.535   11.630  12.193  1.00 33.10  ? 519 VAL A C     1 
ATOM   3928  O  O     . VAL A 1 519 ? 3.312   10.793  13.076  1.00 32.46  ? 519 VAL A O     1 
ATOM   3929  C  CB    . VAL A 1 519 ? 5.727   11.722  10.992  1.00 32.61  ? 519 VAL A CB    1 
ATOM   3930  C  CG1   . VAL A 1 519 ? 6.370   11.257  12.275  1.00 30.93  ? 519 VAL A CG1   1 
ATOM   3931  C  CG2   . VAL A 1 519 ? 6.504   11.183  9.811   1.00 32.86  ? 519 VAL A CG2   1 
ATOM   3932  N  N     . TRP A 1 520 ? 3.164   12.895  12.314  1.00 33.30  ? 520 TRP A N     1 
ATOM   3933  C  CA    . TRP A 1 520 ? 2.467   13.304  13.513  1.00 34.05  ? 520 TRP A CA    1 
ATOM   3934  C  C     . TRP A 1 520 ? 1.117   12.627  13.512  1.00 35.73  ? 520 TRP A C     1 
ATOM   3935  O  O     . TRP A 1 520 ? 0.490   12.481  14.561  1.00 35.51  ? 520 TRP A O     1 
ATOM   3936  C  CB    . TRP A 1 520 ? 2.308   14.819  13.567  1.00 32.86  ? 520 TRP A CB    1 
ATOM   3937  C  CG    . TRP A 1 520 ? 1.336   15.277  14.597  1.00 32.90  ? 520 TRP A CG    1 
ATOM   3938  C  CD1   . TRP A 1 520 ? 0.299   16.137  14.405  1.00 33.37  ? 520 TRP A CD1   1 
ATOM   3939  C  CD2   . TRP A 1 520 ? 1.255   14.851  15.964  1.00 32.24  ? 520 TRP A CD2   1 
ATOM   3940  N  NE1   . TRP A 1 520 ? -0.435  16.266  15.560  1.00 32.74  ? 520 TRP A NE1   1 
ATOM   3941  C  CE2   . TRP A 1 520 ? 0.130   15.483  16.535  1.00 31.48  ? 520 TRP A CE2   1 
ATOM   3942  C  CE3   . TRP A 1 520 ? 2.011   13.986  16.759  1.00 30.66  ? 520 TRP A CE3   1 
ATOM   3943  C  CZ2   . TRP A 1 520 ? -0.249  15.294  17.859  1.00 30.29  ? 520 TRP A CZ2   1 
ATOM   3944  C  CZ3   . TRP A 1 520 ? 1.633   13.799  18.073  1.00 31.71  ? 520 TRP A CZ3   1 
ATOM   3945  C  CH2   . TRP A 1 520 ? 0.506   14.446  18.609  1.00 30.89  ? 520 TRP A CH2   1 
ATOM   3946  N  N     . ASP A 1 521 ? 0.659   12.202  12.338  1.00 38.40  ? 521 ASP A N     1 
ATOM   3947  C  CA    . ASP A 1 521 ? -0.633  11.524  12.285  1.00 42.44  ? 521 ASP A CA    1 
ATOM   3948  C  C     . ASP A 1 521 ? -0.530  10.039  12.629  1.00 41.07  ? 521 ASP A C     1 
ATOM   3949  O  O     . ASP A 1 521 ? -1.482  9.450   13.131  1.00 40.74  ? 521 ASP A O     1 
ATOM   3950  C  CB    . ASP A 1 521 ? -1.337  11.730  10.929  1.00 46.93  ? 521 ASP A CB    1 
ATOM   3951  C  CG    . ASP A 1 521 ? -2.124  13.069  10.865  1.00 54.87  ? 521 ASP A CG    1 
ATOM   3952  O  OD1   . ASP A 1 521 ? -2.558  13.575  11.933  1.00 58.30  ? 521 ASP A OD1   1 
ATOM   3953  O  OD2   . ASP A 1 521 ? -2.331  13.616  9.750   1.00 58.45  ? 521 ASP A OD2   1 
ATOM   3954  N  N     . LEU A 1 522 ? 0.623   9.431   12.382  1.00 39.40  ? 522 LEU A N     1 
ATOM   3955  C  CA    . LEU A 1 522 ? 0.775   8.031   12.722  1.00 36.93  ? 522 LEU A CA    1 
ATOM   3956  C  C     . LEU A 1 522 ? 0.977   8.023   14.213  1.00 38.79  ? 522 LEU A C     1 
ATOM   3957  O  O     . LEU A 1 522 ? 0.513   7.122   14.919  1.00 38.87  ? 522 LEU A O     1 
ATOM   3958  C  CB    . LEU A 1 522 ? 1.987   7.431   12.031  1.00 32.27  ? 522 LEU A CB    1 
ATOM   3959  C  CG    . LEU A 1 522 ? 1.787   7.263   10.535  1.00 31.46  ? 522 LEU A CG    1 
ATOM   3960  C  CD1   . LEU A 1 522 ? 3.077   6.777   9.905   1.00 32.17  ? 522 LEU A CD1   1 
ATOM   3961  C  CD2   . LEU A 1 522 ? 0.641   6.298   10.280  1.00 28.51  ? 522 LEU A CD2   1 
ATOM   3962  N  N     . LEU A 1 523 ? 1.656   9.058   14.695  1.00 39.79  ? 523 LEU A N     1 
ATOM   3963  C  CA    . LEU A 1 523 ? 1.940   9.167   16.111  1.00 40.50  ? 523 LEU A CA    1 
ATOM   3964  C  C     . LEU A 1 523 ? 0.728   9.463   16.967  1.00 43.23  ? 523 LEU A C     1 
ATOM   3965  O  O     . LEU A 1 523 ? 0.502   8.796   17.976  1.00 43.84  ? 523 LEU A O     1 
ATOM   3966  C  CB    . LEU A 1 523 ? 2.989   10.233  16.360  1.00 36.83  ? 523 LEU A CB    1 
ATOM   3967  C  CG    . LEU A 1 523 ? 3.323   10.355  17.842  1.00 33.84  ? 523 LEU A CG    1 
ATOM   3968  C  CD1   . LEU A 1 523 ? 3.587   8.987   18.422  1.00 32.14  ? 523 LEU A CD1   1 
ATOM   3969  C  CD2   . LEU A 1 523 ? 4.526   11.251  18.021  1.00 34.28  ? 523 LEU A CD2   1 
ATOM   3970  N  N     . GLU A 1 524 ? -0.047  10.470  16.574  1.00 47.06  ? 524 GLU A N     1 
ATOM   3971  C  CA    . GLU A 1 524 ? -1.230  10.844  17.342  1.00 49.56  ? 524 GLU A CA    1 
ATOM   3972  C  C     . GLU A 1 524 ? -2.130  9.630   17.508  1.00 49.54  ? 524 GLU A C     1 
ATOM   3973  O  O     . GLU A 1 524 ? -2.369  9.186   18.628  1.00 49.88  ? 524 GLU A O     1 
ATOM   3974  C  CB    . GLU A 1 524 ? -1.979  11.992  16.660  1.00 50.75  ? 524 GLU A CB    1 
ATOM   3975  C  CG    . GLU A 1 524 ? -3.115  12.547  17.484  1.00 54.15  ? 524 GLU A CG    1 
ATOM   3976  C  CD    . GLU A 1 524 ? -3.649  13.849  16.926  1.00 57.53  ? 524 GLU A CD    1 
ATOM   3977  O  OE1   . GLU A 1 524 ? -3.637  14.000  15.683  1.00 59.64  ? 524 GLU A OE1   1 
ATOM   3978  O  OE2   . GLU A 1 524 ? -4.091  14.711  17.724  1.00 58.02  ? 524 GLU A OE2   1 
ATOM   3979  N  N     . GLU A 1 525 ? -2.604  9.077   16.399  1.00 49.98  ? 525 GLU A N     1 
ATOM   3980  C  CA    . GLU A 1 525 ? -3.459  7.906   16.468  1.00 51.53  ? 525 GLU A CA    1 
ATOM   3981  C  C     . GLU A 1 525 ? -2.875  6.853   17.395  1.00 51.20  ? 525 GLU A C     1 
ATOM   3982  O  O     . GLU A 1 525 ? -3.593  6.250   18.181  1.00 53.37  ? 525 GLU A O     1 
ATOM   3983  C  CB    . GLU A 1 525 ? -3.690  7.313   15.074  1.00 53.44  ? 525 GLU A CB    1 
ATOM   3984  C  CG    . GLU A 1 525 ? -4.820  7.998   14.325  1.00 57.01  ? 525 GLU A CG    1 
ATOM   3985  C  CD    . GLU A 1 525 ? -6.138  7.945   15.099  1.00 59.12  ? 525 GLU A CD    1 
ATOM   3986  O  OE1   . GLU A 1 525 ? -6.684  6.828   15.265  1.00 60.43  ? 525 GLU A OE1   1 
ATOM   3987  O  OE2   . GLU A 1 525 ? -6.622  9.015   15.546  1.00 57.50  ? 525 GLU A OE2   1 
ATOM   3988  N  N     . THR A 1 526 ? -1.575  6.625   17.319  1.00 50.42  ? 526 THR A N     1 
ATOM   3989  C  CA    . THR A 1 526 ? -0.980  5.637   18.196  1.00 49.51  ? 526 THR A CA    1 
ATOM   3990  C  C     . THR A 1 526 ? -1.203  6.064   19.637  1.00 50.24  ? 526 THR A C     1 
ATOM   3991  O  O     . THR A 1 526 ? -1.485  5.238   20.503  1.00 52.40  ? 526 THR A O     1 
ATOM   3992  C  CB    . THR A 1 526 ? 0.518   5.478   17.920  1.00 48.37  ? 526 THR A CB    1 
ATOM   3993  O  OG1   . THR A 1 526 ? 0.683   4.839   16.651  1.00 47.09  ? 526 THR A OG1   1 
ATOM   3994  C  CG2   . THR A 1 526 ? 1.183   4.643   18.996  1.00 45.90  ? 526 THR A CG2   1 
ATOM   3995  N  N     . LEU A 1 527 ? -1.091  7.356   19.902  1.00 49.06  ? 527 LEU A N     1 
ATOM   3996  C  CA    . LEU A 1 527 ? -1.312  7.821   21.250  1.00 49.33  ? 527 LEU A CA    1 
ATOM   3997  C  C     . LEU A 1 527 ? -2.783  7.652   21.637  1.00 50.22  ? 527 LEU A C     1 
ATOM   3998  O  O     . LEU A 1 527 ? -3.091  7.262   22.757  1.00 51.09  ? 527 LEU A O     1 
ATOM   3999  C  CB    . LEU A 1 527 ? -0.877  9.272   21.371  1.00 49.99  ? 527 LEU A CB    1 
ATOM   4000  C  CG    . LEU A 1 527 ? 0.644   9.468   21.368  1.00 50.55  ? 527 LEU A CG    1 
ATOM   4001  C  CD1   . LEU A 1 527 ? 0.977   10.942  21.160  1.00 50.26  ? 527 LEU A CD1   1 
ATOM   4002  C  CD2   . LEU A 1 527 ? 1.229   8.961   22.676  1.00 48.37  ? 527 LEU A CD2   1 
ATOM   4003  N  N     . TRP A 1 528 ? -3.693  7.925   20.710  1.00 50.82  ? 528 TRP A N     1 
ATOM   4004  C  CA    . TRP A 1 528 ? -5.122  7.781   20.977  1.00 50.77  ? 528 TRP A CA    1 
ATOM   4005  C  C     . TRP A 1 528 ? -5.532  6.344   21.285  1.00 49.23  ? 528 TRP A C     1 
ATOM   4006  O  O     . TRP A 1 528 ? -6.237  6.097   22.261  1.00 48.61  ? 528 TRP A O     1 
ATOM   4007  C  CB    . TRP A 1 528 ? -5.930  8.298   19.792  1.00 54.18  ? 528 TRP A CB    1 
ATOM   4008  C  CG    . TRP A 1 528 ? -6.166  9.781   19.817  1.00 59.73  ? 528 TRP A CG    1 
ATOM   4009  C  CD1   . TRP A 1 528 ? -6.216  10.614  18.736  1.00 62.30  ? 528 TRP A CD1   1 
ATOM   4010  C  CD2   . TRP A 1 528 ? -6.462  10.599  20.961  1.00 62.48  ? 528 TRP A CD2   1 
ATOM   4011  N  NE1   . TRP A 1 528 ? -6.524  11.896  19.129  1.00 62.49  ? 528 TRP A NE1   1 
ATOM   4012  C  CE2   . TRP A 1 528 ? -6.683  11.915  20.491  1.00 63.52  ? 528 TRP A CE2   1 
ATOM   4013  C  CE3   . TRP A 1 528 ? -6.566  10.349  22.341  1.00 64.57  ? 528 TRP A CE3   1 
ATOM   4014  C  CZ2   . TRP A 1 528 ? -7.005  12.980  21.347  1.00 64.84  ? 528 TRP A CZ2   1 
ATOM   4015  C  CZ3   . TRP A 1 528 ? -6.889  11.414  23.198  1.00 65.24  ? 528 TRP A CZ3   1 
ATOM   4016  C  CH2   . TRP A 1 528 ? -7.104  12.712  22.692  1.00 64.88  ? 528 TRP A CH2   1 
ATOM   4017  N  N     . ALA A 1 529 ? -5.102  5.404   20.447  1.00 47.55  ? 529 ALA A N     1 
ATOM   4018  C  CA    . ALA A 1 529 ? -5.420  3.997   20.653  1.00 46.47  ? 529 ALA A CA    1 
ATOM   4019  C  C     . ALA A 1 529 ? -4.840  3.561   21.989  1.00 47.22  ? 529 ALA A C     1 
ATOM   4020  O  O     . ALA A 1 529 ? -5.474  2.840   22.753  1.00 46.36  ? 529 ALA A O     1 
ATOM   4021  C  CB    . ALA A 1 529 ? -4.839  3.164   19.541  1.00 44.66  ? 529 ALA A CB    1 
ATOM   4022  N  N     . PHE A 1 530 ? -3.628  4.013   22.274  1.00 48.89  ? 530 PHE A N     1 
ATOM   4023  C  CA    . PHE A 1 530 ? -2.989  3.663   23.527  1.00 50.74  ? 530 PHE A CA    1 
ATOM   4024  C  C     . PHE A 1 530 ? -3.810  4.224   24.688  1.00 53.34  ? 530 PHE A C     1 
ATOM   4025  O  O     . PHE A 1 530 ? -3.989  3.567   25.709  1.00 56.11  ? 530 PHE A O     1 
ATOM   4026  C  CB    . PHE A 1 530 ? -1.570  4.230   23.585  1.00 48.18  ? 530 PHE A CB    1 
ATOM   4027  C  CG    . PHE A 1 530 ? -0.767  3.723   24.745  1.00 47.51  ? 530 PHE A CG    1 
ATOM   4028  C  CD1   . PHE A 1 530 ? -0.210  2.451   24.716  1.00 47.08  ? 530 PHE A CD1   1 
ATOM   4029  C  CD2   . PHE A 1 530 ? -0.573  4.512   25.877  1.00 47.94  ? 530 PHE A CD2   1 
ATOM   4030  C  CE1   . PHE A 1 530 ? 0.544   1.972   25.796  1.00 47.53  ? 530 PHE A CE1   1 
ATOM   4031  C  CE2   . PHE A 1 530 ? 0.180   4.042   26.965  1.00 47.74  ? 530 PHE A CE2   1 
ATOM   4032  C  CZ    . PHE A 1 530 ? 0.736   2.768   26.922  1.00 47.08  ? 530 PHE A CZ    1 
ATOM   4033  N  N     . ARG A 1 531 ? -4.321  5.439   24.538  1.00 54.73  ? 531 ARG A N     1 
ATOM   4034  C  CA    . ARG A 1 531 ? -5.091  6.027   25.614  1.00 55.14  ? 531 ARG A CA    1 
ATOM   4035  C  C     . ARG A 1 531 ? -6.375  5.242   25.828  1.00 55.56  ? 531 ARG A C     1 
ATOM   4036  O  O     . ARG A 1 531 ? -6.900  5.207   26.933  1.00 56.14  ? 531 ARG A O     1 
ATOM   4037  C  CB    . ARG A 1 531 ? -5.407  7.501   25.321  1.00 55.42  ? 531 ARG A CB    1 
ATOM   4038  C  CG    . ARG A 1 531 ? -5.758  8.278   26.574  1.00 57.26  ? 531 ARG A CG    1 
ATOM   4039  C  CD    . ARG A 1 531 ? -5.819  9.780   26.358  1.00 60.92  ? 531 ARG A CD    1 
ATOM   4040  N  NE    . ARG A 1 531 ? -5.760  10.498  27.638  1.00 63.91  ? 531 ARG A NE    1 
ATOM   4041  C  CZ    . ARG A 1 531 ? -5.758  11.824  27.772  1.00 64.22  ? 531 ARG A CZ    1 
ATOM   4042  N  NH1   . ARG A 1 531 ? -5.815  12.608  26.699  1.00 64.78  ? 531 ARG A NH1   1 
ATOM   4043  N  NH2   . ARG A 1 531 ? -5.686  12.371  28.981  1.00 62.74  ? 531 ARG A NH2   1 
ATOM   4044  N  N     . ARG A 1 532 ? -6.879  4.593   24.785  1.00 55.87  ? 532 ARG A N     1 
ATOM   4045  C  CA    . ARG A 1 532 ? -8.116  3.833   24.938  1.00 58.06  ? 532 ARG A CA    1 
ATOM   4046  C  C     . ARG A 1 532 ? -7.871  2.509   25.681  1.00 58.02  ? 532 ARG A C     1 
ATOM   4047  O  O     . ARG A 1 532 ? -8.600  2.160   26.616  1.00 58.65  ? 532 ARG A O     1 
ATOM   4048  C  CB    . ARG A 1 532 ? -8.770  3.576   23.566  1.00 59.68  ? 532 ARG A CB    1 
ATOM   4049  C  CG    . ARG A 1 532 ? -8.867  4.828   22.668  1.00 63.25  ? 532 ARG A CG    1 
ATOM   4050  C  CD    . ARG A 1 532 ? -9.915  4.694   21.555  1.00 63.88  ? 532 ARG A CD    1 
ATOM   4051  N  NE    . ARG A 1 532 ? -9.549  5.401   20.317  1.00 66.24  ? 532 ARG A NE    1 
ATOM   4052  C  CZ    . ARG A 1 532 ? -9.133  4.794   19.197  1.00 67.21  ? 532 ARG A CZ    1 
ATOM   4053  N  NH1   . ARG A 1 532 ? -9.029  3.469   19.157  1.00 66.51  ? 532 ARG A NH1   1 
ATOM   4054  N  NH2   . ARG A 1 532 ? -8.837  5.500   18.107  1.00 65.23  ? 532 ARG A NH2   1 
ATOM   4055  N  N     . LYS A 1 533 ? -6.828  1.790   25.280  1.00 56.79  ? 533 LYS A N     1 
ATOM   4056  C  CA    . LYS A 1 533 ? -6.486  0.511   25.888  1.00 54.46  ? 533 LYS A CA    1 
ATOM   4057  C  C     . LYS A 1 533 ? -5.831  0.584   27.271  1.00 53.26  ? 533 LYS A C     1 
ATOM   4058  O  O     . LYS A 1 533 ? -5.949  -0.354  28.048  1.00 53.96  ? 533 LYS A O     1 
ATOM   4059  C  CB    . LYS A 1 533 ? -5.584  -0.273  24.944  1.00 53.76  ? 533 LYS A CB    1 
ATOM   4060  N  N     . ALA A 1 534 ? -5.150  1.682   27.585  1.00 51.40  ? 534 ALA A N     1 
ATOM   4061  C  CA    . ALA A 1 534 ? -4.462  1.803   28.871  1.00 49.89  ? 534 ALA A CA    1 
ATOM   4062  C  C     . ALA A 1 534 ? -5.051  2.836   29.806  1.00 49.90  ? 534 ALA A C     1 
ATOM   4063  O  O     . ALA A 1 534 ? -4.564  3.016   30.925  1.00 46.78  ? 534 ALA A O     1 
ATOM   4064  C  CB    . ALA A 1 534 ? -3.004  2.122   28.638  1.00 50.24  ? 534 ALA A CB    1 
ATOM   4065  N  N     . GLY A 1 535 ? -6.089  3.520   29.333  1.00 51.80  ? 535 GLY A N     1 
ATOM   4066  C  CA    . GLY A 1 535 ? -6.754  4.547   30.126  1.00 53.10  ? 535 GLY A CA    1 
ATOM   4067  C  C     . GLY A 1 535 ? -5.863  5.747   30.380  1.00 53.34  ? 535 GLY A C     1 
ATOM   4068  O  O     . GLY A 1 535 ? -6.273  6.753   30.971  1.00 52.10  ? 535 GLY A O     1 
ATOM   4069  N  N     . ARG A 1 536 ? -4.629  5.647   29.909  1.00 54.21  ? 536 ARG A N     1 
ATOM   4070  C  CA    . ARG A 1 536 ? -3.676  6.714   30.116  1.00 55.14  ? 536 ARG A CA    1 
ATOM   4071  C  C     . ARG A 1 536 ? -2.795  6.993   28.917  1.00 53.76  ? 536 ARG A C     1 
ATOM   4072  O  O     . ARG A 1 536 ? -2.662  6.181   27.992  1.00 54.22  ? 536 ARG A O     1 
ATOM   4073  C  CB    . ARG A 1 536 ? -2.792  6.373   31.311  1.00 58.38  ? 536 ARG A CB    1 
ATOM   4074  C  CG    . ARG A 1 536 ? -2.788  7.431   32.384  1.00 63.70  ? 536 ARG A CG    1 
ATOM   4075  C  CD    . ARG A 1 536 ? -2.766  6.803   33.771  1.00 67.57  ? 536 ARG A CD    1 
ATOM   4076  N  NE    . ARG A 1 536 ? -1.437  6.342   34.161  1.00 71.78  ? 536 ARG A NE    1 
ATOM   4077  C  CZ    . ARG A 1 536 ? -1.171  5.751   35.320  1.00 74.21  ? 536 ARG A CZ    1 
ATOM   4078  N  NH1   . ARG A 1 536 ? -2.152  5.547   36.197  1.00 75.00  ? 536 ARG A NH1   1 
ATOM   4079  N  NH2   . ARG A 1 536 ? 0.075   5.381   35.609  1.00 74.76  ? 536 ARG A NH2   1 
ATOM   4080  N  N     . LEU A 1 537 ? -2.198  8.169   28.946  1.00 50.47  ? 537 LEU A N     1 
ATOM   4081  C  CA    . LEU A 1 537 ? -1.294  8.575   27.907  1.00 47.35  ? 537 LEU A CA    1 
ATOM   4082  C  C     . LEU A 1 537 ? 0.027   8.148   28.520  1.00 45.73  ? 537 LEU A C     1 
ATOM   4083  O  O     . LEU A 1 537 ? 0.132   7.999   29.732  1.00 45.91  ? 537 LEU A O     1 
ATOM   4084  C  CB    . LEU A 1 537 ? -1.384  10.086  27.737  1.00 48.05  ? 537 LEU A CB    1 
ATOM   4085  C  CG    . LEU A 1 537 ? -1.303  10.695  26.334  1.00 48.68  ? 537 LEU A CG    1 
ATOM   4086  C  CD1   . LEU A 1 537 ? -2.126  9.905   25.339  1.00 47.36  ? 537 LEU A CD1   1 
ATOM   4087  C  CD2   . LEU A 1 537 ? -1.798  12.132  26.409  1.00 48.44  ? 537 LEU A CD2   1 
ATOM   4088  N  N     . PRO A 1 538 ? 1.041   7.896   27.700  1.00 44.64  ? 538 PRO A N     1 
ATOM   4089  C  CA    . PRO A 1 538 ? 2.327   7.482   28.256  1.00 44.94  ? 538 PRO A CA    1 
ATOM   4090  C  C     . PRO A 1 538 ? 3.131   8.643   28.812  1.00 45.43  ? 538 PRO A C     1 
ATOM   4091  O  O     . PRO A 1 538 ? 2.944   9.793   28.433  1.00 44.84  ? 538 PRO A O     1 
ATOM   4092  C  CB    . PRO A 1 538 ? 3.018   6.811   27.071  1.00 43.92  ? 538 PRO A CB    1 
ATOM   4093  C  CG    . PRO A 1 538 ? 2.479   7.549   25.916  1.00 44.19  ? 538 PRO A CG    1 
ATOM   4094  C  CD    . PRO A 1 538 ? 1.010   7.695   26.246  1.00 44.91  ? 538 PRO A CD    1 
ATOM   4095  N  N     . SER A 1 539 ? 4.026   8.329   29.733  1.00 47.51  ? 539 SER A N     1 
ATOM   4096  C  CA    . SER A 1 539 ? 4.877   9.340   30.337  1.00 48.52  ? 539 SER A CA    1 
ATOM   4097  C  C     . SER A 1 539 ? 5.994   9.677   29.357  1.00 48.36  ? 539 SER A C     1 
ATOM   4098  O  O     . SER A 1 539 ? 6.342   10.845  29.176  1.00 49.75  ? 539 SER A O     1 
ATOM   4099  C  CB    . SER A 1 539 ? 5.495   8.802   31.624  1.00 49.72  ? 539 SER A CB    1 
ATOM   4100  O  OG    . SER A 1 539 ? 6.310   7.670   31.345  1.00 51.25  ? 539 SER A OG    1 
ATOM   4101  N  N     . ARG A 1 540 ? 6.550   8.640   28.729  1.00 46.43  ? 540 ARG A N     1 
ATOM   4102  C  CA    . ARG A 1 540 ? 7.642   8.795   27.776  1.00 43.90  ? 540 ARG A CA    1 
ATOM   4103  C  C     . ARG A 1 540 ? 7.433   7.840   26.603  1.00 42.96  ? 540 ARG A C     1 
ATOM   4104  O  O     . ARG A 1 540 ? 7.059   6.685   26.811  1.00 43.70  ? 540 ARG A O     1 
ATOM   4105  C  CB    . ARG A 1 540 ? 8.962   8.472   28.476  1.00 43.66  ? 540 ARG A CB    1 
ATOM   4106  C  CG    . ARG A 1 540 ? 10.221  9.027   27.831  1.00 43.34  ? 540 ARG A CG    1 
ATOM   4107  C  CD    . ARG A 1 540 ? 11.343  8.958   28.849  1.00 45.23  ? 540 ARG A CD    1 
ATOM   4108  N  NE    . ARG A 1 540 ? 12.560  9.653   28.442  1.00 48.47  ? 540 ARG A NE    1 
ATOM   4109  C  CZ    . ARG A 1 540 ? 12.708  10.974  28.399  1.00 49.99  ? 540 ARG A CZ    1 
ATOM   4110  N  NH1   . ARG A 1 540 ? 11.709  11.767  28.739  1.00 51.28  ? 540 ARG A NH1   1 
ATOM   4111  N  NH2   . ARG A 1 540 ? 13.865  11.505  28.014  1.00 51.32  ? 540 ARG A NH2   1 
ATOM   4112  N  N     . VAL A 1 541 ? 7.651   8.320   25.376  1.00 40.50  ? 541 VAL A N     1 
ATOM   4113  C  CA    . VAL A 1 541 ? 7.516   7.472   24.193  1.00 38.22  ? 541 VAL A CA    1 
ATOM   4114  C  C     . VAL A 1 541 ? 8.870   7.294   23.538  1.00 38.32  ? 541 VAL A C     1 
ATOM   4115  O  O     . VAL A 1 541 ? 9.665   8.231   23.502  1.00 39.53  ? 541 VAL A O     1 
ATOM   4116  C  CB    . VAL A 1 541 ? 6.568   8.064   23.130  1.00 37.10  ? 541 VAL A CB    1 
ATOM   4117  C  CG1   . VAL A 1 541 ? 5.146   7.997   23.609  1.00 37.45  ? 541 VAL A CG1   1 
ATOM   4118  C  CG2   . VAL A 1 541 ? 6.959   9.485   22.806  1.00 37.45  ? 541 VAL A CG2   1 
ATOM   4119  N  N     . LEU A 1 542 ? 9.141   6.089   23.043  1.00 37.28  ? 542 LEU A N     1 
ATOM   4120  C  CA    . LEU A 1 542 ? 10.394  5.814   22.362  1.00 36.53  ? 542 LEU A CA    1 
ATOM   4121  C  C     . LEU A 1 542 ? 10.069  5.760   20.876  1.00 38.05  ? 542 LEU A C     1 
ATOM   4122  O  O     . LEU A 1 542 ? 9.297   4.894   20.427  1.00 39.66  ? 542 LEU A O     1 
ATOM   4123  C  CB    . LEU A 1 542 ? 10.985  4.481   22.818  1.00 34.26  ? 542 LEU A CB    1 
ATOM   4124  C  CG    . LEU A 1 542 ? 12.244  4.030   22.070  1.00 34.60  ? 542 LEU A CG    1 
ATOM   4125  C  CD1   . LEU A 1 542 ? 13.334  5.084   22.210  1.00 36.40  ? 542 LEU A CD1   1 
ATOM   4126  C  CD2   . LEU A 1 542 ? 12.727  2.695   22.618  1.00 33.80  ? 542 LEU A CD2   1 
ATOM   4127  N  N     . LEU A 1 543 ? 10.631  6.703   20.119  1.00 36.99  ? 543 LEU A N     1 
ATOM   4128  C  CA    . LEU A 1 543 ? 10.406  6.765   18.674  1.00 35.73  ? 543 LEU A CA    1 
ATOM   4129  C  C     . LEU A 1 543 ? 11.515  6.056   17.893  1.00 34.70  ? 543 LEU A C     1 
ATOM   4130  O  O     . LEU A 1 543 ? 12.677  6.416   17.998  1.00 35.42  ? 543 LEU A O     1 
ATOM   4131  C  CB    . LEU A 1 543 ? 10.301  8.223   18.229  1.00 33.19  ? 543 LEU A CB    1 
ATOM   4132  C  CG    . LEU A 1 543 ? 9.200   8.997   18.946  1.00 31.93  ? 543 LEU A CG    1 
ATOM   4133  C  CD1   . LEU A 1 543 ? 9.217   10.428  18.453  1.00 31.29  ? 543 LEU A CD1   1 
ATOM   4134  C  CD2   . LEU A 1 543 ? 7.848   8.347   18.693  1.00 28.22  ? 543 LEU A CD2   1 
ATOM   4135  N  N     . LEU A 1 544 ? 11.145  5.042   17.121  1.00 35.03  ? 544 LEU A N     1 
ATOM   4136  C  CA    . LEU A 1 544 ? 12.097  4.279   16.326  1.00 35.81  ? 544 LEU A CA    1 
ATOM   4137  C  C     . LEU A 1 544 ? 11.798  4.411   14.833  1.00 37.24  ? 544 LEU A C     1 
ATOM   4138  O  O     . LEU A 1 544 ? 10.698  4.095   14.386  1.00 37.79  ? 544 LEU A O     1 
ATOM   4139  C  CB    . LEU A 1 544 ? 12.049  2.809   16.743  1.00 34.81  ? 544 LEU A CB    1 
ATOM   4140  C  CG    . LEU A 1 544 ? 12.478  2.584   18.193  1.00 36.30  ? 544 LEU A CG    1 
ATOM   4141  C  CD1   . LEU A 1 544 ? 12.193  1.161   18.620  1.00 35.50  ? 544 LEU A CD1   1 
ATOM   4142  C  CD2   . LEU A 1 544 ? 13.956  2.906   18.327  1.00 36.70  ? 544 LEU A CD2   1 
ATOM   4143  N  N     . ARG A 1 545 ? 12.782  4.873   14.066  1.00 38.30  ? 545 ARG A N     1 
ATOM   4144  C  CA    . ARG A 1 545 ? 12.621  5.046   12.627  1.00 40.46  ? 545 ARG A CA    1 
ATOM   4145  C  C     . ARG A 1 545 ? 13.842  4.563   11.849  1.00 41.30  ? 545 ARG A C     1 
ATOM   4146  O  O     . ARG A 1 545 ? 14.903  4.328   12.427  1.00 41.70  ? 545 ARG A O     1 
ATOM   4147  C  CB    . ARG A 1 545 ? 12.400  6.517   12.313  1.00 41.42  ? 545 ARG A CB    1 
ATOM   4148  C  CG    . ARG A 1 545 ? 13.654  7.334   12.491  1.00 42.23  ? 545 ARG A CG    1 
ATOM   4149  C  CD    . ARG A 1 545 ? 13.333  8.793   12.685  1.00 42.70  ? 545 ARG A CD    1 
ATOM   4150  N  NE    . ARG A 1 545 ? 14.538  9.602   12.760  1.00 40.87  ? 545 ARG A NE    1 
ATOM   4151  C  CZ    . ARG A 1 545 ? 15.426  9.665   11.787  1.00 39.02  ? 545 ARG A CZ    1 
ATOM   4152  N  NH1   . ARG A 1 545 ? 15.220  8.964   10.689  1.00 40.43  ? 545 ARG A NH1   1 
ATOM   4153  N  NH2   . ARG A 1 545 ? 16.503  10.421  11.912  1.00 40.00  ? 545 ARG A NH2   1 
ATOM   4154  N  N     . ASP A 1 546 ? 13.696  4.434   10.534  1.00 42.05  ? 546 ASP A N     1 
ATOM   4155  C  CA    . ASP A 1 546 ? 14.808  3.994   9.703   1.00 42.23  ? 546 ASP A CA    1 
ATOM   4156  C  C     . ASP A 1 546 ? 15.699  5.190   9.397   1.00 41.51  ? 546 ASP A C     1 
ATOM   4157  O  O     . ASP A 1 546 ? 15.252  6.186   8.841   1.00 40.90  ? 546 ASP A O     1 
ATOM   4158  C  CB    . ASP A 1 546 ? 14.296  3.373   8.408   1.00 46.31  ? 546 ASP A CB    1 
ATOM   4159  C  CG    . ASP A 1 546 ? 15.408  2.754   7.577   1.00 49.05  ? 546 ASP A CG    1 
ATOM   4160  O  OD1   . ASP A 1 546 ? 15.111  2.209   6.485   1.00 50.92  ? 546 ASP A OD1   1 
ATOM   4161  O  OD2   . ASP A 1 546 ? 16.577  2.808   8.017   1.00 48.78  ? 546 ASP A OD2   1 
ATOM   4162  N  N     . GLY A 1 547 ? 16.963  5.071   9.782   1.00 41.64  ? 547 GLY A N     1 
ATOM   4163  C  CA    . GLY A 1 547 ? 17.935  6.128   9.594   1.00 41.12  ? 547 GLY A CA    1 
ATOM   4164  C  C     . GLY A 1 547 ? 17.911  6.862   8.269   1.00 41.52  ? 547 GLY A C     1 
ATOM   4165  O  O     . GLY A 1 547 ? 18.147  8.069   8.225   1.00 41.70  ? 547 GLY A O     1 
ATOM   4166  N  N     . ARG A 1 548 ? 17.638  6.160   7.180   1.00 41.09  ? 548 ARG A N     1 
ATOM   4167  C  CA    . ARG A 1 548 ? 17.625  6.836   5.905   1.00 41.35  ? 548 ARG A CA    1 
ATOM   4168  C  C     . ARG A 1 548 ? 16.341  7.591   5.675   1.00 41.48  ? 548 ARG A C     1 
ATOM   4169  O  O     . ARG A 1 548 ? 15.681  7.428   4.664   1.00 42.30  ? 548 ARG A O     1 
ATOM   4170  C  CB    . ARG A 1 548 ? 17.889  5.856   4.766   1.00 42.90  ? 548 ARG A CB    1 
ATOM   4171  C  CG    . ARG A 1 548 ? 17.091  4.578   4.776   1.00 45.21  ? 548 ARG A CG    1 
ATOM   4172  C  CD    . ARG A 1 548 ? 17.614  3.672   3.666   1.00 46.09  ? 548 ARG A CD    1 
ATOM   4173  N  NE    . ARG A 1 548 ? 17.536  4.346   2.370   1.00 50.50  ? 548 ARG A NE    1 
ATOM   4174  C  CZ    . ARG A 1 548 ? 16.435  4.434   1.620   1.00 51.06  ? 548 ARG A CZ    1 
ATOM   4175  N  NH1   . ARG A 1 548 ? 15.293  3.880   2.019   1.00 49.72  ? 548 ARG A NH1   1 
ATOM   4176  N  NH2   . ARG A 1 548 ? 16.473  5.101   0.472   1.00 51.66  ? 548 ARG A NH2   1 
ATOM   4177  N  N     . VAL A 1 549 ? 15.999  8.427   6.644   1.00 42.52  ? 549 VAL A N     1 
ATOM   4178  C  CA    . VAL A 1 549 ? 14.808  9.262   6.590   1.00 42.32  ? 549 VAL A CA    1 
ATOM   4179  C  C     . VAL A 1 549 ? 15.138  10.610  7.244   1.00 45.50  ? 549 VAL A C     1 
ATOM   4180  O  O     . VAL A 1 549 ? 15.498  10.669  8.426   1.00 45.40  ? 549 VAL A O     1 
ATOM   4181  C  CB    . VAL A 1 549 ? 13.633  8.625   7.347   1.00 38.05  ? 549 VAL A CB    1 
ATOM   4182  C  CG1   . VAL A 1 549 ? 12.488  9.588   7.397   1.00 38.37  ? 549 VAL A CG1   1 
ATOM   4183  C  CG2   . VAL A 1 549 ? 13.199  7.361   6.669   1.00 34.78  ? 549 VAL A CG2   1 
ATOM   4184  N  N     . PRO A 1 550 ? 15.047  11.711  6.478   1.00 47.17  ? 550 PRO A N     1 
ATOM   4185  C  CA    . PRO A 1 550 ? 15.356  12.996  7.105   1.00 48.15  ? 550 PRO A CA    1 
ATOM   4186  C  C     . PRO A 1 550 ? 14.723  13.007  8.498   1.00 49.17  ? 550 PRO A C     1 
ATOM   4187  O  O     . PRO A 1 550 ? 13.605  12.529  8.698   1.00 49.22  ? 550 PRO A O     1 
ATOM   4188  C  CB    . PRO A 1 550 ? 14.704  14.002  6.160   1.00 49.05  ? 550 PRO A CB    1 
ATOM   4189  C  CG    . PRO A 1 550 ? 14.824  13.331  4.830   1.00 48.80  ? 550 PRO A CG    1 
ATOM   4190  C  CD    . PRO A 1 550 ? 14.455  11.902  5.143   1.00 47.46  ? 550 PRO A CD    1 
ATOM   4191  N  N     . GLN A 1 551 ? 15.456  13.538  9.461   1.00 50.08  ? 551 GLN A N     1 
ATOM   4192  C  CA    . GLN A 1 551 ? 15.001  13.604  10.846  1.00 51.12  ? 551 GLN A CA    1 
ATOM   4193  C  C     . GLN A 1 551 ? 13.994  14.742  11.039  1.00 51.49  ? 551 GLN A C     1 
ATOM   4194  O  O     . GLN A 1 551 ? 13.339  14.863  12.077  1.00 50.69  ? 551 GLN A O     1 
ATOM   4195  C  CB    . GLN A 1 551 ? 16.227  13.817  11.721  1.00 50.67  ? 551 GLN A CB    1 
ATOM   4196  C  CG    . GLN A 1 551 ? 16.001  13.845  13.188  1.00 50.02  ? 551 GLN A CG    1 
ATOM   4197  C  CD    . GLN A 1 551 ? 17.183  14.459  13.872  1.00 50.51  ? 551 GLN A CD    1 
ATOM   4198  O  OE1   . GLN A 1 551 ? 18.319  14.247  13.455  1.00 50.70  ? 551 GLN A OE1   1 
ATOM   4199  N  NE2   . GLN A 1 551 ? 16.935  15.223  14.924  1.00 51.22  ? 551 GLN A NE2   1 
ATOM   4200  N  N     . ASP A 1 552 ? 13.878  15.569  10.013  1.00 52.74  ? 552 ASP A N     1 
ATOM   4201  C  CA    . ASP A 1 552 ? 12.979  16.706  10.028  1.00 53.95  ? 552 ASP A CA    1 
ATOM   4202  C  C     . ASP A 1 552 ? 11.538  16.242  9.887   1.00 52.78  ? 552 ASP A C     1 
ATOM   4203  O  O     . ASP A 1 552 ? 10.607  16.949  10.264  1.00 52.54  ? 552 ASP A O     1 
ATOM   4204  C  CB    . ASP A 1 552 ? 13.363  17.635  8.891   1.00 57.65  ? 552 ASP A CB    1 
ATOM   4205  C  CG    . ASP A 1 552 ? 14.848  17.574  8.593   1.00 63.22  ? 552 ASP A CG    1 
ATOM   4206  O  OD1   . ASP A 1 552 ? 15.646  17.576  9.566   1.00 66.30  ? 552 ASP A OD1   1 
ATOM   4207  O  OD2   . ASP A 1 552 ? 15.220  17.516  7.396   1.00 65.88  ? 552 ASP A OD2   1 
ATOM   4208  N  N     . GLU A 1 553 ? 11.360  15.045  9.342   1.00 50.91  ? 553 GLU A N     1 
ATOM   4209  C  CA    . GLU A 1 553 ? 10.033  14.480  9.173   1.00 49.08  ? 553 GLU A CA    1 
ATOM   4210  C  C     . GLU A 1 553 ? 9.416   14.200  10.553  1.00 47.74  ? 553 GLU A C     1 
ATOM   4211  O  O     . GLU A 1 553 ? 8.275   13.751  10.647  1.00 48.05  ? 553 GLU A O     1 
ATOM   4212  C  CB    . GLU A 1 553 ? 10.121  13.172  8.384   1.00 49.68  ? 553 GLU A CB    1 
ATOM   4213  C  CG    . GLU A 1 553 ? 11.147  13.166  7.256   1.00 50.08  ? 553 GLU A CG    1 
ATOM   4214  C  CD    . GLU A 1 553 ? 10.518  13.032  5.873   1.00 51.13  ? 553 GLU A CD    1 
ATOM   4215  O  OE1   . GLU A 1 553 ? 9.478   12.348  5.752   1.00 50.18  ? 553 GLU A OE1   1 
ATOM   4216  O  OE2   . GLU A 1 553 ? 11.074  13.600  4.904   1.00 50.35  ? 553 GLU A OE2   1 
ATOM   4217  N  N     . PHE A 1 554 ? 10.182  14.451  11.616  1.00 45.01  ? 554 PHE A N     1 
ATOM   4218  C  CA    . PHE A 1 554 ? 9.711   14.228  12.982  1.00 42.54  ? 554 PHE A CA    1 
ATOM   4219  C  C     . PHE A 1 554 ? 9.635   15.514  13.803  1.00 42.42  ? 554 PHE A C     1 
ATOM   4220  O  O     . PHE A 1 554 ? 9.234   15.490  14.962  1.00 41.99  ? 554 PHE A O     1 
ATOM   4221  C  CB    . PHE A 1 554 ? 10.610  13.224  13.704  1.00 40.76  ? 554 PHE A CB    1 
ATOM   4222  C  CG    . PHE A 1 554 ? 10.427  11.815  13.249  1.00 37.27  ? 554 PHE A CG    1 
ATOM   4223  C  CD1   . PHE A 1 554 ? 10.838  11.421  11.989  1.00 36.61  ? 554 PHE A CD1   1 
ATOM   4224  C  CD2   . PHE A 1 554 ? 9.816   10.886  14.073  1.00 35.62  ? 554 PHE A CD2   1 
ATOM   4225  C  CE1   . PHE A 1 554 ? 10.645  10.117  11.554  1.00 35.43  ? 554 PHE A CE1   1 
ATOM   4226  C  CE2   . PHE A 1 554 ? 9.617   9.584   13.653  1.00 33.98  ? 554 PHE A CE2   1 
ATOM   4227  C  CZ    . PHE A 1 554 ? 10.031  9.195   12.389  1.00 34.85  ? 554 PHE A CZ    1 
ATOM   4228  N  N     . ALA A 1 555 ? 10.018  16.635  13.198  1.00 42.37  ? 555 ALA A N     1 
ATOM   4229  C  CA    . ALA A 1 555 ? 9.974   17.929  13.873  1.00 40.61  ? 555 ALA A CA    1 
ATOM   4230  C  C     . ALA A 1 555 ? 8.583   18.204  14.443  1.00 40.05  ? 555 ALA A C     1 
ATOM   4231  O  O     . ALA A 1 555 ? 8.442   18.417  15.647  1.00 40.03  ? 555 ALA A O     1 
ATOM   4232  C  CB    . ALA A 1 555 ? 10.364  19.035  12.909  1.00 38.73  ? 555 ALA A CB    1 
ATOM   4233  N  N     . LEU A 1 556 ? 7.558   18.188  13.589  1.00 38.87  ? 556 LEU A N     1 
ATOM   4234  C  CA    . LEU A 1 556 ? 6.195   18.453  14.046  1.00 37.92  ? 556 LEU A CA    1 
ATOM   4235  C  C     . LEU A 1 556 ? 5.735   17.514  15.134  1.00 37.74  ? 556 LEU A C     1 
ATOM   4236  O  O     . LEU A 1 556 ? 5.042   17.928  16.053  1.00 37.75  ? 556 LEU A O     1 
ATOM   4237  C  CB    . LEU A 1 556 ? 5.186   18.370  12.900  1.00 38.55  ? 556 LEU A CB    1 
ATOM   4238  C  CG    . LEU A 1 556 ? 3.711   18.343  13.355  1.00 39.29  ? 556 LEU A CG    1 
ATOM   4239  C  CD1   . LEU A 1 556 ? 3.369   19.585  14.148  1.00 37.10  ? 556 LEU A CD1   1 
ATOM   4240  C  CD2   . LEU A 1 556 ? 2.799   18.227  12.156  1.00 38.43  ? 556 LEU A CD2   1 
ATOM   4241  N  N     . ALA A 1 557 ? 6.100   16.244  15.022  1.00 37.56  ? 557 ALA A N     1 
ATOM   4242  C  CA    . ALA A 1 557 ? 5.690   15.261  16.011  1.00 37.72  ? 557 ALA A CA    1 
ATOM   4243  C  C     . ALA A 1 557 ? 6.293   15.567  17.379  1.00 39.01  ? 557 ALA A C     1 
ATOM   4244  O  O     . ALA A 1 557 ? 5.645   15.381  18.420  1.00 38.35  ? 557 ALA A O     1 
ATOM   4245  C  CB    . ALA A 1 557 ? 6.094   13.867  15.552  1.00 35.40  ? 557 ALA A CB    1 
ATOM   4246  N  N     . LEU A 1 558 ? 7.530   16.051  17.373  1.00 40.40  ? 558 LEU A N     1 
ATOM   4247  C  CA    . LEU A 1 558 ? 8.222   16.366  18.613  1.00 41.86  ? 558 LEU A CA    1 
ATOM   4248  C  C     . LEU A 1 558 ? 7.609   17.584  19.307  1.00 44.46  ? 558 LEU A C     1 
ATOM   4249  O  O     . LEU A 1 558 ? 7.491   17.614  20.528  1.00 46.46  ? 558 LEU A O     1 
ATOM   4250  C  CB    . LEU A 1 558 ? 9.718   16.583  18.342  1.00 38.83  ? 558 LEU A CB    1 
ATOM   4251  C  CG    . LEU A 1 558 ? 10.456  15.381  17.735  1.00 36.22  ? 558 LEU A CG    1 
ATOM   4252  C  CD1   . LEU A 1 558 ? 11.927  15.683  17.525  1.00 33.64  ? 558 LEU A CD1   1 
ATOM   4253  C  CD2   . LEU A 1 558 ? 10.282  14.194  18.640  1.00 33.40  ? 558 LEU A CD2   1 
ATOM   4254  N  N     . GLU A 1 559 ? 7.204   18.583  18.539  1.00 45.96  ? 559 GLU A N     1 
ATOM   4255  C  CA    . GLU A 1 559 ? 6.601   19.760  19.133  1.00 48.85  ? 559 GLU A CA    1 
ATOM   4256  C  C     . GLU A 1 559 ? 5.281   19.378  19.772  1.00 48.72  ? 559 GLU A C     1 
ATOM   4257  O  O     . GLU A 1 559 ? 4.923   19.871  20.840  1.00 48.91  ? 559 GLU A O     1 
ATOM   4258  C  CB    . GLU A 1 559 ? 6.371   20.804  18.063  1.00 52.97  ? 559 GLU A CB    1 
ATOM   4259  C  CG    . GLU A 1 559 ? 7.615   21.035  17.252  1.00 62.10  ? 559 GLU A CG    1 
ATOM   4260  C  CD    . GLU A 1 559 ? 7.970   22.502  17.133  1.00 66.95  ? 559 GLU A CD    1 
ATOM   4261  O  OE1   . GLU A 1 559 ? 9.087   22.807  16.644  1.00 70.08  ? 559 GLU A OE1   1 
ATOM   4262  O  OE2   . GLU A 1 559 ? 7.129   23.347  17.525  1.00 69.01  ? 559 GLU A OE2   1 
ATOM   4263  N  N     . ALA A 1 560 ? 4.555   18.493  19.107  1.00 48.15  ? 560 ALA A N     1 
ATOM   4264  C  CA    . ALA A 1 560 ? 3.277   18.040  19.613  1.00 47.76  ? 560 ALA A CA    1 
ATOM   4265  C  C     . ALA A 1 560 ? 3.504   17.302  20.915  1.00 48.27  ? 560 ALA A C     1 
ATOM   4266  O  O     . ALA A 1 560 ? 2.844   17.576  21.911  1.00 48.77  ? 560 ALA A O     1 
ATOM   4267  C  CB    . ALA A 1 560 ? 2.616   17.125  18.611  1.00 47.68  ? 560 ALA A CB    1 
ATOM   4268  N  N     . LEU A 1 561 ? 4.442   16.364  20.914  1.00 48.51  ? 561 LEU A N     1 
ATOM   4269  C  CA    . LEU A 1 561 ? 4.712   15.609  22.128  1.00 48.97  ? 561 LEU A CA    1 
ATOM   4270  C  C     . LEU A 1 561 ? 5.071   16.539  23.289  1.00 49.35  ? 561 LEU A C     1 
ATOM   4271  O  O     . LEU A 1 561 ? 4.576   16.378  24.410  1.00 48.30  ? 561 LEU A O     1 
ATOM   4272  C  CB    . LEU A 1 561 ? 5.826   14.586  21.876  1.00 48.96  ? 561 LEU A CB    1 
ATOM   4273  C  CG    . LEU A 1 561 ? 5.429   13.400  20.976  1.00 49.21  ? 561 LEU A CG    1 
ATOM   4274  C  CD1   . LEU A 1 561 ? 6.633   12.498  20.683  1.00 47.74  ? 561 LEU A CD1   1 
ATOM   4275  C  CD2   . LEU A 1 561 ? 4.333   12.610  21.661  1.00 46.47  ? 561 LEU A CD2   1 
ATOM   4276  N  N     . ALA A 1 562 ? 5.916   17.526  23.018  1.00 50.14  ? 562 ALA A N     1 
ATOM   4277  C  CA    . ALA A 1 562 ? 6.312   18.468  24.049  1.00 51.32  ? 562 ALA A CA    1 
ATOM   4278  C  C     . ALA A 1 562 ? 5.110   19.320  24.407  1.00 53.68  ? 562 ALA A C     1 
ATOM   4279  O  O     . ALA A 1 562 ? 4.857   19.598  25.576  1.00 54.93  ? 562 ALA A O     1 
ATOM   4280  C  CB    . ALA A 1 562 ? 7.437   19.345  23.552  1.00 49.89  ? 562 ALA A CB    1 
ATOM   4281  N  N     . ARG A 1 563 ? 4.352   19.714  23.393  1.00 55.85  ? 563 ARG A N     1 
ATOM   4282  C  CA    . ARG A 1 563 ? 3.180   20.555  23.597  1.00 58.77  ? 563 ARG A CA    1 
ATOM   4283  C  C     . ARG A 1 563 ? 2.119   19.945  24.508  1.00 59.43  ? 563 ARG A C     1 
ATOM   4284  O  O     . ARG A 1 563 ? 1.225   20.642  24.989  1.00 59.04  ? 563 ARG A O     1 
ATOM   4285  C  CB    . ARG A 1 563 ? 2.559   20.909  22.244  1.00 61.26  ? 563 ARG A CB    1 
ATOM   4286  C  CG    . ARG A 1 563 ? 1.509   21.999  22.291  1.00 63.14  ? 563 ARG A CG    1 
ATOM   4287  C  CD    . ARG A 1 563 ? 0.993   22.273  20.895  1.00 67.40  ? 563 ARG A CD    1 
ATOM   4288  N  NE    . ARG A 1 563 ? 2.057   22.688  19.979  1.00 70.14  ? 563 ARG A NE    1 
ATOM   4289  C  CZ    . ARG A 1 563 ? 1.917   22.776  18.657  1.00 71.62  ? 563 ARG A CZ    1 
ATOM   4290  N  NH1   . ARG A 1 563 ? 0.758   22.474  18.076  1.00 72.27  ? 563 ARG A NH1   1 
ATOM   4291  N  NH2   . ARG A 1 563 ? 2.939   23.173  17.909  1.00 72.17  ? 563 ARG A NH2   1 
ATOM   4292  N  N     . GLU A 1 564 ? 2.201   18.645  24.745  1.00 61.24  ? 564 GLU A N     1 
ATOM   4293  C  CA    . GLU A 1 564 ? 1.222   18.018  25.612  1.00 63.72  ? 564 GLU A CA    1 
ATOM   4294  C  C     . GLU A 1 564 ? 1.949   17.302  26.731  1.00 62.70  ? 564 GLU A C     1 
ATOM   4295  O  O     . GLU A 1 564 ? 1.445   16.351  27.328  1.00 63.32  ? 564 GLU A O     1 
ATOM   4296  C  CB    . GLU A 1 564 ? 0.337   17.050  24.822  1.00 66.87  ? 564 GLU A CB    1 
ATOM   4297  C  CG    . GLU A 1 564 ? -1.162  17.176  25.156  1.00 72.76  ? 564 GLU A CG    1 
ATOM   4298  C  CD    . GLU A 1 564 ? -1.776  18.511  24.719  1.00 75.75  ? 564 GLU A CD    1 
ATOM   4299  O  OE1   . GLU A 1 564 ? -1.658  18.847  23.515  1.00 76.76  ? 564 GLU A OE1   1 
ATOM   4300  O  OE2   . GLU A 1 564 ? -2.380  19.213  25.571  1.00 76.49  ? 564 GLU A OE2   1 
ATOM   4301  N  N     . GLY A 1 565 ? 3.155   17.778  27.005  1.00 61.32  ? 565 GLY A N     1 
ATOM   4302  C  CA    . GLY A 1 565 ? 3.953   17.213  28.070  1.00 59.03  ? 565 GLY A CA    1 
ATOM   4303  C  C     . GLY A 1 565 ? 4.227   15.728  28.001  1.00 57.53  ? 565 GLY A C     1 
ATOM   4304  O  O     . GLY A 1 565 ? 4.189   15.060  29.029  1.00 58.49  ? 565 GLY A O     1 
ATOM   4305  N  N     . ILE A 1 566 ? 4.501   15.201  26.810  1.00 55.44  ? 566 ILE A N     1 
ATOM   4306  C  CA    . ILE A 1 566 ? 4.811   13.778  26.673  1.00 52.93  ? 566 ILE A CA    1 
ATOM   4307  C  C     . ILE A 1 566 ? 6.302   13.611  26.387  1.00 51.71  ? 566 ILE A C     1 
ATOM   4308  O  O     . ILE A 1 566 ? 6.800   14.073  25.364  1.00 51.89  ? 566 ILE A O     1 
ATOM   4309  C  CB    . ILE A 1 566 ? 3.984   13.122  25.543  1.00 51.67  ? 566 ILE A CB    1 
ATOM   4310  C  CG1   . ILE A 1 566 ? 2.498   13.126  25.913  1.00 49.60  ? 566 ILE A CG1   1 
ATOM   4311  C  CG2   . ILE A 1 566 ? 4.452   11.694  25.311  1.00 51.11  ? 566 ILE A CG2   1 
ATOM   4312  C  CD1   . ILE A 1 566 ? 1.589   12.722  24.793  1.00 47.82  ? 566 ILE A CD1   1 
ATOM   4313  N  N     . ALA A 1 567 ? 7.009   12.965  27.311  1.00 50.23  ? 567 ALA A N     1 
ATOM   4314  C  CA    . ALA A 1 567 ? 8.444   12.747  27.178  1.00 48.58  ? 567 ALA A CA    1 
ATOM   4315  C  C     . ALA A 1 567 ? 8.729   11.848  25.988  1.00 48.08  ? 567 ALA A C     1 
ATOM   4316  O  O     . ALA A 1 567 ? 7.905   10.999  25.646  1.00 47.39  ? 567 ALA A O     1 
ATOM   4317  C  CB    . ALA A 1 567 ? 8.978   12.123  28.443  1.00 48.01  ? 567 ALA A CB    1 
ATOM   4318  N  N     . TYR A 1 568 ? 9.893   12.018  25.363  1.00 46.93  ? 568 TYR A N     1 
ATOM   4319  C  CA    . TYR A 1 568 ? 10.227  11.199  24.203  1.00 45.71  ? 568 TYR A CA    1 
ATOM   4320  C  C     . TYR A 1 568 ? 11.721  10.974  23.979  1.00 45.00  ? 568 TYR A C     1 
ATOM   4321  O  O     . TYR A 1 568 ? 12.557  11.561  24.649  1.00 45.09  ? 568 TYR A O     1 
ATOM   4322  C  CB    . TYR A 1 568 ? 9.639   11.839  22.947  1.00 44.21  ? 568 TYR A CB    1 
ATOM   4323  C  CG    . TYR A 1 568 ? 10.245  13.180  22.656  1.00 43.42  ? 568 TYR A CG    1 
ATOM   4324  C  CD1   . TYR A 1 568 ? 9.562   14.354  22.956  1.00 43.50  ? 568 TYR A CD1   1 
ATOM   4325  C  CD2   . TYR A 1 568 ? 11.534  13.277  22.114  1.00 43.44  ? 568 TYR A CD2   1 
ATOM   4326  C  CE1   . TYR A 1 568 ? 10.151  15.611  22.721  1.00 45.91  ? 568 TYR A CE1   1 
ATOM   4327  C  CE2   . TYR A 1 568 ? 12.138  14.513  21.880  1.00 44.04  ? 568 TYR A CE2   1 
ATOM   4328  C  CZ    . TYR A 1 568 ? 11.445  15.681  22.181  1.00 46.13  ? 568 TYR A CZ    1 
ATOM   4329  O  OH    . TYR A 1 568 ? 12.044  16.903  21.939  1.00 44.24  ? 568 TYR A OH    1 
ATOM   4330  N  N     . ASP A 1 569 ? 12.027  10.124  23.003  1.00 44.64  ? 569 ASP A N     1 
ATOM   4331  C  CA    . ASP A 1 569 ? 13.386  9.792   22.603  1.00 43.63  ? 569 ASP A CA    1 
ATOM   4332  C  C     . ASP A 1 569 ? 13.358  9.319   21.173  1.00 42.87  ? 569 ASP A C     1 
ATOM   4333  O  O     . ASP A 1 569 ? 12.793  8.275   20.884  1.00 44.39  ? 569 ASP A O     1 
ATOM   4334  C  CB    . ASP A 1 569 ? 13.952  8.665   23.443  1.00 44.90  ? 569 ASP A CB    1 
ATOM   4335  C  CG    . ASP A 1 569 ? 14.423  9.130   24.779  1.00 45.91  ? 569 ASP A CG    1 
ATOM   4336  O  OD1   . ASP A 1 569 ? 15.304  10.013  24.824  1.00 47.52  ? 569 ASP A OD1   1 
ATOM   4337  O  OD2   . ASP A 1 569 ? 13.915  8.606   25.784  1.00 46.83  ? 569 ASP A OD2   1 
ATOM   4338  N  N     . LEU A 1 570 ? 13.956  10.086  20.276  1.00 41.91  ? 570 LEU A N     1 
ATOM   4339  C  CA    . LEU A 1 570 ? 14.005  9.704   18.874  1.00 40.31  ? 570 LEU A CA    1 
ATOM   4340  C  C     . LEU A 1 570 ? 15.319  8.979   18.645  1.00 40.52  ? 570 LEU A C     1 
ATOM   4341  O  O     . LEU A 1 570 ? 16.398  9.511   18.950  1.00 40.78  ? 570 LEU A O     1 
ATOM   4342  C  CB    . LEU A 1 570 ? 13.930  10.933  17.957  1.00 38.08  ? 570 LEU A CB    1 
ATOM   4343  C  CG    . LEU A 1 570 ? 13.941  10.618  16.457  1.00 36.32  ? 570 LEU A CG    1 
ATOM   4344  C  CD1   . LEU A 1 570 ? 12.622  10.023  16.052  1.00 35.32  ? 570 LEU A CD1   1 
ATOM   4345  C  CD2   . LEU A 1 570 ? 14.186  11.865  15.666  1.00 37.09  ? 570 LEU A CD2   1 
ATOM   4346  N  N     . VAL A 1 571 ? 15.215  7.763   18.114  1.00 40.38  ? 571 VAL A N     1 
ATOM   4347  C  CA    . VAL A 1 571 ? 16.378  6.932   17.817  1.00 40.94  ? 571 VAL A CA    1 
ATOM   4348  C  C     . VAL A 1 571 ? 16.321  6.361   16.402  1.00 41.06  ? 571 VAL A C     1 
ATOM   4349  O  O     . VAL A 1 571 ? 15.422  5.585   16.088  1.00 39.70  ? 571 VAL A O     1 
ATOM   4350  C  CB    . VAL A 1 571 ? 16.474  5.750   18.787  1.00 40.60  ? 571 VAL A CB    1 
ATOM   4351  C  CG1   . VAL A 1 571 ? 17.763  5.000   18.540  1.00 40.62  ? 571 VAL A CG1   1 
ATOM   4352  C  CG2   . VAL A 1 571 ? 16.380  6.240   20.219  1.00 40.19  ? 571 VAL A CG2   1 
ATOM   4353  N  N     . SER A 1 572 ? 17.280  6.733   15.556  1.00 42.37  ? 572 SER A N     1 
ATOM   4354  C  CA    . SER A 1 572 ? 17.304  6.225   14.181  1.00 43.85  ? 572 SER A CA    1 
ATOM   4355  C  C     . SER A 1 572 ? 18.062  4.903   14.143  1.00 43.54  ? 572 SER A C     1 
ATOM   4356  O  O     . SER A 1 572 ? 19.105  4.758   14.785  1.00 43.48  ? 572 SER A O     1 
ATOM   4357  C  CB    . SER A 1 572 ? 17.986  7.218   13.230  1.00 44.43  ? 572 SER A CB    1 
ATOM   4358  O  OG    . SER A 1 572 ? 19.400  7.171   13.368  1.00 45.36  ? 572 SER A OG    1 
ATOM   4359  N  N     . VAL A 1 573 ? 17.534  3.944   13.389  1.00 42.26  ? 573 VAL A N     1 
ATOM   4360  C  CA    . VAL A 1 573 ? 18.162  2.636   13.274  1.00 41.86  ? 573 VAL A CA    1 
ATOM   4361  C  C     . VAL A 1 573 ? 18.773  2.432   11.889  1.00 41.64  ? 573 VAL A C     1 
ATOM   4362  O  O     . VAL A 1 573 ? 18.198  2.848   10.887  1.00 42.58  ? 573 VAL A O     1 
ATOM   4363  C  CB    . VAL A 1 573 ? 17.144  1.533   13.527  1.00 39.94  ? 573 VAL A CB    1 
ATOM   4364  C  CG1   . VAL A 1 573 ? 17.833  0.186   13.527  1.00 41.75  ? 573 VAL A CG1   1 
ATOM   4365  C  CG2   . VAL A 1 573 ? 16.475  1.770   14.838  1.00 40.91  ? 573 VAL A CG2   1 
ATOM   4366  N  N     . ARG A 1 574 ? 19.936  1.792   11.833  1.00 39.92  ? 574 ARG A N     1 
ATOM   4367  C  CA    . ARG A 1 574 ? 20.607  1.543   10.559  1.00 39.24  ? 574 ARG A CA    1 
ATOM   4368  C  C     . ARG A 1 574 ? 20.756  0.036   10.314  1.00 39.83  ? 574 ARG A C     1 
ATOM   4369  O  O     . ARG A 1 574 ? 21.720  -0.586  10.751  1.00 41.29  ? 574 ARG A O     1 
ATOM   4370  C  CB    . ARG A 1 574 ? 21.973  2.206   10.577  1.00 38.14  ? 574 ARG A CB    1 
ATOM   4371  C  CG    . ARG A 1 574 ? 22.283  3.000   9.351   1.00 37.26  ? 574 ARG A CG    1 
ATOM   4372  C  CD    . ARG A 1 574 ? 23.334  2.317   8.521   1.00 36.70  ? 574 ARG A CD    1 
ATOM   4373  N  NE    . ARG A 1 574 ? 24.221  3.301   7.915   1.00 36.10  ? 574 ARG A NE    1 
ATOM   4374  C  CZ    . ARG A 1 574 ? 25.021  3.049   6.890   1.00 37.12  ? 574 ARG A CZ    1 
ATOM   4375  N  NH1   . ARG A 1 574 ? 25.044  1.842   6.347   1.00 37.62  ? 574 ARG A NH1   1 
ATOM   4376  N  NH2   . ARG A 1 574 ? 25.797  4.005   6.407   1.00 39.53  ? 574 ARG A NH2   1 
ATOM   4377  N  N     . LYS A 1 575 ? 19.803  -0.541  9.598   1.00 39.25  ? 575 LYS A N     1 
ATOM   4378  C  CA    . LYS A 1 575 ? 19.799  -1.963  9.324   1.00 38.38  ? 575 LYS A CA    1 
ATOM   4379  C  C     . LYS A 1 575 ? 21.056  -2.483  8.623   1.00 39.89  ? 575 LYS A C     1 
ATOM   4380  O  O     . LYS A 1 575 ? 21.636  -3.483  9.061   1.00 42.17  ? 575 LYS A O     1 
ATOM   4381  C  CB    . LYS A 1 575 ? 18.548  -2.307  8.515   1.00 38.43  ? 575 LYS A CB    1 
ATOM   4382  C  CG    . LYS A 1 575 ? 17.279  -1.706  9.103   1.00 39.64  ? 575 LYS A CG    1 
ATOM   4383  C  CD    . LYS A 1 575 ? 16.115  -1.724  8.131   1.00 43.03  ? 575 LYS A CD    1 
ATOM   4384  C  CE    . LYS A 1 575 ? 14.966  -0.855  8.654   1.00 45.14  ? 575 LYS A CE    1 
ATOM   4385  N  NZ    . LYS A 1 575 ? 13.783  -0.799  7.729   1.00 47.66  ? 575 LYS A NZ    1 
ATOM   4386  N  N     . SER A 1 576 ? 21.500  -1.823  7.553   1.00 39.22  ? 576 SER A N     1 
ATOM   4387  C  CA    . SER A 1 576 ? 22.689  -2.300  6.839   1.00 37.97  ? 576 SER A CA    1 
ATOM   4388  C  C     . SER A 1 576 ? 23.846  -1.304  6.770   1.00 37.31  ? 576 SER A C     1 
ATOM   4389  O  O     . SER A 1 576 ? 23.636  -0.102  6.708   1.00 37.53  ? 576 SER A O     1 
ATOM   4390  C  CB    . SER A 1 576 ? 22.314  -2.739  5.417   1.00 36.89  ? 576 SER A CB    1 
ATOM   4391  O  OG    . SER A 1 576 ? 21.853  -1.644  4.649   0.00 37.25  ? 576 SER A OG    1 
ATOM   4392  N  N     . GLY A 1 577 ? 25.067  -1.830  6.788   1.00 36.85  ? 577 GLY A N     1 
ATOM   4393  C  CA    . GLY A 1 577 ? 26.260  -1.005  6.718   1.00 35.54  ? 577 GLY A CA    1 
ATOM   4394  C  C     . GLY A 1 577 ? 26.675  -0.219  7.954   1.00 34.87  ? 577 GLY A C     1 
ATOM   4395  O  O     . GLY A 1 577 ? 27.328  0.808   7.822   1.00 35.19  ? 577 GLY A O     1 
ATOM   4396  N  N     . GLY A 1 578 ? 26.326  -0.683  9.146   1.00 34.47  ? 578 GLY A N     1 
ATOM   4397  C  CA    . GLY A 1 578 ? 26.700  0.051   10.346  1.00 35.05  ? 578 GLY A CA    1 
ATOM   4398  C  C     . GLY A 1 578 ? 28.047  -0.363  10.920  1.00 35.74  ? 578 GLY A C     1 
ATOM   4399  O  O     . GLY A 1 578 ? 28.509  0.164   11.931  1.00 35.04  ? 578 GLY A O     1 
ATOM   4400  N  N     . GLY A 1 579 ? 28.693  -1.307  10.254  1.00 35.98  ? 579 GLY A N     1 
ATOM   4401  C  CA    . GLY A 1 579 ? 29.969  -1.786  10.731  1.00 34.78  ? 579 GLY A CA    1 
ATOM   4402  C  C     . GLY A 1 579 ? 29.783  -3.195  11.255  1.00 33.75  ? 579 GLY A C     1 
ATOM   4403  O  O     . GLY A 1 579 ? 28.651  -3.675  11.371  1.00 32.66  ? 579 GLY A O     1 
ATOM   4404  N  N     . ARG A 1 580 ? 30.886  -3.860  11.581  1.00 32.95  ? 580 ARG A N     1 
ATOM   4405  C  CA    . ARG A 1 580 ? 30.810  -5.216  12.079  1.00 32.79  ? 580 ARG A CA    1 
ATOM   4406  C  C     . ARG A 1 580 ? 31.601  -5.413  13.358  1.00 34.28  ? 580 ARG A C     1 
ATOM   4407  O  O     . ARG A 1 580 ? 32.448  -4.597  13.705  1.00 34.29  ? 580 ARG A O     1 
ATOM   4408  C  CB    . ARG A 1 580 ? 31.276  -6.144  10.990  1.00 31.18  ? 580 ARG A CB    1 
ATOM   4409  C  CG    . ARG A 1 580 ? 30.772  -5.656  9.674   1.00 30.45  ? 580 ARG A CG    1 
ATOM   4410  C  CD    . ARG A 1 580 ? 30.807  -6.725  8.653   1.00 32.45  ? 580 ARG A CD    1 
ATOM   4411  N  NE    . ARG A 1 580 ? 29.677  -7.623  8.808   1.00 30.49  ? 580 ARG A NE    1 
ATOM   4412  C  CZ    . ARG A 1 580 ? 28.699  -7.732  7.926   1.00 28.85  ? 580 ARG A CZ    1 
ATOM   4413  N  NH1   . ARG A 1 580 ? 28.713  -7.001  6.828   1.00 26.31  ? 580 ARG A NH1   1 
ATOM   4414  N  NH2   . ARG A 1 580 ? 27.711  -8.566  8.154   1.00 31.05  ? 580 ARG A NH2   1 
ATOM   4415  N  N     . VAL A 1 581 ? 31.312  -6.502  14.062  1.00 36.47  ? 581 VAL A N     1 
ATOM   4416  C  CA    . VAL A 1 581 ? 31.962  -6.780  15.336  1.00 37.61  ? 581 VAL A CA    1 
ATOM   4417  C  C     . VAL A 1 581 ? 32.614  -8.152  15.440  1.00 38.54  ? 581 VAL A C     1 
ATOM   4418  O  O     . VAL A 1 581 ? 31.995  -9.176  15.162  1.00 39.24  ? 581 VAL A O     1 
ATOM   4419  C  CB    . VAL A 1 581 ? 30.947  -6.587  16.469  1.00 37.27  ? 581 VAL A CB    1 
ATOM   4420  C  CG1   . VAL A 1 581 ? 31.454  -7.171  17.759  1.00 39.79  ? 581 VAL A CG1   1 
ATOM   4421  C  CG2   . VAL A 1 581 ? 30.692  -5.113  16.636  1.00 38.84  ? 581 VAL A CG2   1 
ATOM   4422  N  N     . TYR A 1 582 ? 33.877  -8.153  15.849  1.00 40.14  ? 582 TYR A N     1 
ATOM   4423  C  CA    . TYR A 1 582 ? 34.646  -9.376  15.994  1.00 42.87  ? 582 TYR A CA    1 
ATOM   4424  C  C     . TYR A 1 582 ? 35.166  -9.484  17.416  1.00 45.09  ? 582 TYR A C     1 
ATOM   4425  O  O     . TYR A 1 582 ? 35.681  -8.516  17.974  1.00 46.32  ? 582 TYR A O     1 
ATOM   4426  C  CB    . TYR A 1 582 ? 35.810  -9.371  15.009  1.00 43.24  ? 582 TYR A CB    1 
ATOM   4427  C  CG    . TYR A 1 582 ? 35.381  -9.082  13.585  1.00 44.29  ? 582 TYR A CG    1 
ATOM   4428  C  CD1   . TYR A 1 582 ? 34.588  -9.983  12.871  1.00 43.67  ? 582 TYR A CD1   1 
ATOM   4429  C  CD2   . TYR A 1 582 ? 35.735  -7.882  12.967  1.00 43.60  ? 582 TYR A CD2   1 
ATOM   4430  C  CE1   . TYR A 1 582 ? 34.162  -9.686  11.581  1.00 44.84  ? 582 TYR A CE1   1 
ATOM   4431  C  CE2   . TYR A 1 582 ? 35.313  -7.577  11.687  1.00 43.31  ? 582 TYR A CE2   1 
ATOM   4432  C  CZ    . TYR A 1 582 ? 34.531  -8.474  10.997  1.00 44.58  ? 582 TYR A CZ    1 
ATOM   4433  O  OH    . TYR A 1 582 ? 34.122  -8.140  9.725   1.00 46.28  ? 582 TYR A OH    1 
ATOM   4434  N  N     . PRO A 1 583 ? 35.038  -10.672 18.024  1.00 46.54  ? 583 PRO A N     1 
ATOM   4435  C  CA    . PRO A 1 583 ? 35.492  -10.903 19.392  1.00 47.30  ? 583 PRO A CA    1 
ATOM   4436  C  C     . PRO A 1 583 ? 37.006  -10.936 19.520  1.00 49.01  ? 583 PRO A C     1 
ATOM   4437  O  O     . PRO A 1 583 ? 37.694  -11.482 18.660  1.00 48.38  ? 583 PRO A O     1 
ATOM   4438  C  CB    . PRO A 1 583 ? 34.858  -12.244 19.722  1.00 47.29  ? 583 PRO A CB    1 
ATOM   4439  C  CG    . PRO A 1 583 ? 34.962  -12.958 18.422  1.00 45.83  ? 583 PRO A CG    1 
ATOM   4440  C  CD    . PRO A 1 583 ? 34.486  -11.912 17.449  1.00 46.48  ? 583 PRO A CD    1 
ATOM   4441  N  N     . VAL A 1 584 ? 37.522  -10.350 20.595  1.00 51.74  ? 584 VAL A N     1 
ATOM   4442  C  CA    . VAL A 1 584 ? 38.962  -10.352 20.824  1.00 55.46  ? 584 VAL A CA    1 
ATOM   4443  C  C     . VAL A 1 584 ? 39.410  -11.787 21.127  1.00 57.68  ? 584 VAL A C     1 
ATOM   4444  O  O     . VAL A 1 584 ? 40.346  -12.300 20.519  1.00 58.54  ? 584 VAL A O     1 
ATOM   4445  C  CB    . VAL A 1 584 ? 39.367  -9.417  22.011  1.00 54.63  ? 584 VAL A CB    1 
ATOM   4446  C  CG1   . VAL A 1 584 ? 38.980  -7.980  21.698  1.00 54.83  ? 584 VAL A CG1   1 
ATOM   4447  C  CG2   . VAL A 1 584 ? 38.697  -9.863  23.296  1.00 55.69  ? 584 VAL A CG2   1 
ATOM   4448  N  N     . GLN A 1 585 ? 38.718  -12.435 22.055  1.00 59.97  ? 585 GLN A N     1 
ATOM   4449  C  CA    . GLN A 1 585 ? 39.036  -13.799 22.436  1.00 61.54  ? 585 GLN A CA    1 
ATOM   4450  C  C     . GLN A 1 585 ? 37.793  -14.404 23.042  1.00 63.28  ? 585 GLN A C     1 
ATOM   4451  O  O     . GLN A 1 585 ? 37.381  -14.030 24.148  1.00 64.94  ? 585 GLN A O     1 
ATOM   4452  C  CB    . GLN A 1 585 ? 40.166  -13.816 23.449  1.00 62.34  ? 585 GLN A CB    1 
ATOM   4453  N  N     . GLY A 1 586 ? 37.191  -15.331 22.309  1.00 63.82  ? 586 GLY A N     1 
ATOM   4454  C  CA    . GLY A 1 586 ? 35.998  -15.983 22.798  1.00 63.77  ? 586 GLY A CA    1 
ATOM   4455  C  C     . GLY A 1 586 ? 34.895  -15.972 21.773  1.00 63.73  ? 586 GLY A C     1 
ATOM   4456  O  O     . GLY A 1 586 ? 35.143  -16.102 20.571  1.00 63.33  ? 586 GLY A O     1 
ATOM   4457  N  N     . ARG A 1 587 ? 33.675  -15.799 22.267  1.00 63.71  ? 587 ARG A N     1 
ATOM   4458  C  CA    . ARG A 1 587 ? 32.477  -15.774 21.447  1.00 63.96  ? 587 ARG A CA    1 
ATOM   4459  C  C     . ARG A 1 587 ? 31.787  -14.421 21.550  1.00 62.46  ? 587 ARG A C     1 
ATOM   4460  O  O     . ARG A 1 587 ? 32.133  -13.594 22.390  1.00 62.53  ? 587 ARG A O     1 
ATOM   4461  C  CB    . ARG A 1 587 ? 31.508  -16.831 21.949  1.00 66.94  ? 587 ARG A CB    1 
ATOM   4462  C  CG    . ARG A 1 587 ? 31.169  -17.951 20.998  1.00 71.69  ? 587 ARG A CG    1 
ATOM   4463  C  CD    . ARG A 1 587 ? 30.079  -18.796 21.661  1.00 75.83  ? 587 ARG A CD    1 
ATOM   4464  N  NE    . ARG A 1 587 ? 29.638  -19.960 20.887  1.00 79.70  ? 587 ARG A NE    1 
ATOM   4465  C  CZ    . ARG A 1 587 ? 30.314  -21.105 20.773  1.00 80.21  ? 587 ARG A CZ    1 
ATOM   4466  N  NH1   . ARG A 1 587 ? 31.486  -21.260 21.379  1.00 80.38  ? 587 ARG A NH1   1 
ATOM   4467  N  NH2   . ARG A 1 587 ? 29.800  -22.110 20.068  1.00 80.03  ? 587 ARG A NH2   1 
ATOM   4468  N  N     . LEU A 1 588 ? 30.805  -14.206 20.684  1.00 60.65  ? 588 LEU A N     1 
ATOM   4469  C  CA    . LEU A 1 588 ? 30.020  -12.980 20.706  1.00 57.76  ? 588 LEU A CA    1 
ATOM   4470  C  C     . LEU A 1 588 ? 28.718  -13.352 21.441  1.00 55.77  ? 588 LEU A C     1 
ATOM   4471  O  O     . LEU A 1 588 ? 28.223  -14.471 21.308  1.00 54.33  ? 588 LEU A O     1 
ATOM   4472  C  CB    . LEU A 1 588 ? 29.729  -12.510 19.266  1.00 57.34  ? 588 LEU A CB    1 
ATOM   4473  C  CG    . LEU A 1 588 ? 30.865  -11.876 18.449  1.00 56.93  ? 588 LEU A CG    1 
ATOM   4474  C  CD1   . LEU A 1 588 ? 30.494  -11.788 16.960  1.00 56.35  ? 588 LEU A CD1   1 
ATOM   4475  C  CD2   . LEU A 1 588 ? 31.171  -10.499 19.017  1.00 54.88  ? 588 LEU A CD2   1 
ATOM   4476  N  N     . ALA A 1 589 ? 28.178  -12.442 22.239  1.00 54.48  ? 589 ALA A N     1 
ATOM   4477  C  CA    . ALA A 1 589 ? 26.939  -12.743 22.948  1.00 54.99  ? 589 ALA A CA    1 
ATOM   4478  C  C     . ALA A 1 589 ? 25.837  -11.806 22.495  1.00 55.65  ? 589 ALA A C     1 
ATOM   4479  O  O     . ALA A 1 589 ? 26.114  -10.726 21.968  1.00 56.77  ? 589 ALA A O     1 
ATOM   4480  C  CB    . ALA A 1 589 ? 27.141  -12.611 24.441  1.00 54.02  ? 589 ALA A CB    1 
ATOM   4481  N  N     . ASP A 1 590 ? 24.587  -12.215 22.695  1.00 55.43  ? 590 ASP A N     1 
ATOM   4482  C  CA    . ASP A 1 590 ? 23.445  -11.385 22.310  1.00 54.69  ? 590 ASP A CA    1 
ATOM   4483  C  C     . ASP A 1 590 ? 23.336  -10.119 23.157  1.00 52.65  ? 590 ASP A C     1 
ATOM   4484  O  O     . ASP A 1 590 ? 23.759  -10.083 24.309  1.00 53.11  ? 590 ASP A O     1 
ATOM   4485  C  CB    . ASP A 1 590 ? 22.135  -12.178 22.430  1.00 57.12  ? 590 ASP A CB    1 
ATOM   4486  C  CG    . ASP A 1 590 ? 21.768  -12.906 21.147  1.00 58.66  ? 590 ASP A CG    1 
ATOM   4487  O  OD1   . ASP A 1 590 ? 21.626  -12.233 20.108  1.00 60.22  ? 590 ASP A OD1   1 
ATOM   4488  O  OD2   . ASP A 1 590 ? 21.613  -14.146 21.171  1.00 60.53  ? 590 ASP A OD2   1 
ATOM   4489  N  N     . GLY A 1 591 ? 22.764  -9.076  22.578  1.00 50.98  ? 591 GLY A N     1 
ATOM   4490  C  CA    . GLY A 1 591 ? 22.597  -7.844  23.317  1.00 50.91  ? 591 GLY A CA    1 
ATOM   4491  C  C     . GLY A 1 591 ? 23.918  -7.255  23.719  1.00 50.68  ? 591 GLY A C     1 
ATOM   4492  O  O     . GLY A 1 591 ? 24.064  -6.711  24.805  1.00 50.95  ? 591 GLY A O     1 
ATOM   4493  N  N     . LEU A 1 592 ? 24.892  -7.381  22.834  1.00 50.64  ? 592 LEU A N     1 
ATOM   4494  C  CA    . LEU A 1 592 ? 26.213  -6.841  23.081  1.00 50.41  ? 592 LEU A CA    1 
ATOM   4495  C  C     . LEU A 1 592 ? 26.090  -5.379  22.649  1.00 51.40  ? 592 LEU A C     1 
ATOM   4496  O  O     . LEU A 1 592 ? 25.795  -5.077  21.492  1.00 52.35  ? 592 LEU A O     1 
ATOM   4497  C  CB    . LEU A 1 592 ? 27.224  -7.614  22.241  1.00 48.63  ? 592 LEU A CB    1 
ATOM   4498  C  CG    . LEU A 1 592 ? 28.683  -7.575  22.658  1.00 47.72  ? 592 LEU A CG    1 
ATOM   4499  C  CD1   . LEU A 1 592 ? 29.292  -8.960  22.513  1.00 47.52  ? 592 LEU A CD1   1 
ATOM   4500  C  CD2   . LEU A 1 592 ? 29.416  -6.566  21.802  1.00 49.48  ? 592 LEU A CD2   1 
ATOM   4501  N  N     . TYR A 1 593 ? 26.285  -4.479  23.603  1.00 51.50  ? 593 TYR A N     1 
ATOM   4502  C  CA    . TYR A 1 593 ? 26.160  -3.043  23.382  1.00 51.28  ? 593 TYR A CA    1 
ATOM   4503  C  C     . TYR A 1 593 ? 27.519  -2.360  23.289  1.00 51.23  ? 593 TYR A C     1 
ATOM   4504  O  O     . TYR A 1 593 ? 28.281  -2.357  24.247  1.00 52.58  ? 593 TYR A O     1 
ATOM   4505  C  CB    . TYR A 1 593 ? 25.320  -2.471  24.531  1.00 51.64  ? 593 TYR A CB    1 
ATOM   4506  C  CG    . TYR A 1 593 ? 25.488  -1.009  24.845  1.00 51.69  ? 593 TYR A CG    1 
ATOM   4507  C  CD1   . TYR A 1 593 ? 25.076  -0.024  23.955  1.00 52.04  ? 593 TYR A CD1   1 
ATOM   4508  C  CD2   . TYR A 1 593 ? 26.038  -0.615  26.056  1.00 52.22  ? 593 TYR A CD2   1 
ATOM   4509  C  CE1   . TYR A 1 593 ? 25.210  1.323   24.270  1.00 53.27  ? 593 TYR A CE1   1 
ATOM   4510  C  CE2   . TYR A 1 593 ? 26.177  0.720   26.380  1.00 53.71  ? 593 TYR A CE2   1 
ATOM   4511  C  CZ    . TYR A 1 593 ? 25.765  1.687   25.491  1.00 53.57  ? 593 TYR A CZ    1 
ATOM   4512  O  OH    . TYR A 1 593 ? 25.920  3.011   25.843  1.00 53.48  ? 593 TYR A OH    1 
ATOM   4513  N  N     . VAL A 1 594 ? 27.818  -1.783  22.129  1.00 50.70  ? 594 VAL A N     1 
ATOM   4514  C  CA    . VAL A 1 594 ? 29.095  -1.107  21.911  1.00 49.30  ? 594 VAL A CA    1 
ATOM   4515  C  C     . VAL A 1 594 ? 28.962  0.403   21.759  1.00 50.76  ? 594 VAL A C     1 
ATOM   4516  O  O     . VAL A 1 594 ? 28.654  0.907   20.673  1.00 49.34  ? 594 VAL A O     1 
ATOM   4517  C  CB    . VAL A 1 594 ? 29.802  -1.634  20.652  1.00 48.11  ? 594 VAL A CB    1 
ATOM   4518  C  CG1   . VAL A 1 594 ? 31.053  -0.839  20.392  1.00 46.58  ? 594 VAL A CG1   1 
ATOM   4519  C  CG2   . VAL A 1 594 ? 30.134  -3.101  20.812  1.00 48.00  ? 594 VAL A CG2   1 
ATOM   4520  N  N     . PRO A 1 595 ? 29.186  1.151   22.854  1.00 52.58  ? 595 PRO A N     1 
ATOM   4521  C  CA    . PRO A 1 595 ? 29.079  2.609   22.751  1.00 53.15  ? 595 PRO A CA    1 
ATOM   4522  C  C     . PRO A 1 595 ? 30.054  2.919   21.638  1.00 53.82  ? 595 PRO A C     1 
ATOM   4523  O  O     . PRO A 1 595 ? 31.035  2.202   21.465  1.00 54.44  ? 595 PRO A O     1 
ATOM   4524  C  CB    . PRO A 1 595 ? 29.572  3.086   24.111  1.00 52.43  ? 595 PRO A CB    1 
ATOM   4525  C  CG    . PRO A 1 595 ? 29.218  1.941   25.014  1.00 52.03  ? 595 PRO A CG    1 
ATOM   4526  C  CD    . PRO A 1 595 ? 29.621  0.749   24.202  1.00 51.78  ? 595 PRO A CD    1 
ATOM   4527  N  N     . LEU A 1 596 ? 29.836  3.976   20.885  1.00 54.90  ? 596 LEU A N     1 
ATOM   4528  C  CA    . LEU A 1 596 ? 30.751  4.160   19.801  1.00 56.19  ? 596 LEU A CA    1 
ATOM   4529  C  C     . LEU A 1 596 ? 31.143  5.557   19.442  1.00 57.65  ? 596 LEU A C     1 
ATOM   4530  O  O     . LEU A 1 596 ? 32.200  5.761   18.860  1.00 60.75  ? 596 LEU A O     1 
ATOM   4531  C  CB    . LEU A 1 596 ? 30.167  3.461   18.586  1.00 56.49  ? 596 LEU A CB    1 
ATOM   4532  C  CG    . LEU A 1 596 ? 30.928  3.519   17.277  1.00 57.31  ? 596 LEU A CG    1 
ATOM   4533  C  CD1   . LEU A 1 596 ? 31.111  2.113   16.766  1.00 57.67  ? 596 LEU A CD1   1 
ATOM   4534  C  CD2   . LEU A 1 596 ? 30.168  4.379   16.275  1.00 58.54  ? 596 LEU A CD2   1 
ATOM   4535  N  N     . GLU A 1 597 ? 30.327  6.534   19.788  1.00 58.27  ? 597 GLU A N     1 
ATOM   4536  C  CA    . GLU A 1 597 ? 30.669  7.887   19.396  1.00 59.88  ? 597 GLU A CA    1 
ATOM   4537  C  C     . GLU A 1 597 ? 29.743  8.851   20.090  1.00 60.51  ? 597 GLU A C     1 
ATOM   4538  O  O     . GLU A 1 597 ? 28.871  8.431   20.855  1.00 61.86  ? 597 GLU A O     1 
ATOM   4539  C  CB    . GLU A 1 597 ? 30.514  7.991   17.886  1.00 61.29  ? 597 GLU A CB    1 
ATOM   4540  C  CG    . GLU A 1 597 ? 30.942  9.272   17.224  1.00 64.29  ? 597 GLU A CG    1 
ATOM   4541  C  CD    . GLU A 1 597 ? 30.774  9.167   15.710  1.00 66.81  ? 597 GLU A CD    1 
ATOM   4542  O  OE1   . GLU A 1 597 ? 30.930  8.029   15.193  1.00 67.27  ? 597 GLU A OE1   1 
ATOM   4543  O  OE2   . GLU A 1 597 ? 30.497  10.197  15.045  1.00 65.50  ? 597 GLU A OE2   1 
ATOM   4544  N  N     . ASP A 1 598 ? 29.943  10.138  19.820  1.00 59.93  ? 598 ASP A N     1 
ATOM   4545  C  CA    . ASP A 1 598 ? 29.137  11.197  20.406  1.00 58.32  ? 598 ASP A CA    1 
ATOM   4546  C  C     . ASP A 1 598 ? 27.801  10.661  20.920  1.00 57.26  ? 598 ASP A C     1 
ATOM   4547  O  O     . ASP A 1 598 ? 27.639  10.429  22.126  1.00 57.74  ? 598 ASP A O     1 
ATOM   4548  C  CB    . ASP A 1 598 ? 28.907  12.301  19.373  1.00 57.95  ? 598 ASP A CB    1 
ATOM   4549  N  N     . LYS A 1 599 ? 26.864  10.432  20.000  1.00 53.99  ? 599 LYS A N     1 
ATOM   4550  C  CA    . LYS A 1 599 ? 25.536  9.941   20.356  1.00 49.84  ? 599 LYS A CA    1 
ATOM   4551  C  C     . LYS A 1 599 ? 25.214  8.578   19.781  1.00 47.52  ? 599 LYS A C     1 
ATOM   4552  O  O     . LYS A 1 599 ? 24.193  8.004   20.104  1.00 46.98  ? 599 LYS A O     1 
ATOM   4553  C  CB    . LYS A 1 599 ? 24.480  10.918  19.857  1.00 50.45  ? 599 LYS A CB    1 
ATOM   4554  C  CG    . LYS A 1 599 ? 24.452  12.268  20.558  1.00 49.43  ? 599 LYS A CG    1 
ATOM   4555  C  CD    . LYS A 1 599 ? 23.800  12.172  21.929  1.00 46.85  ? 599 LYS A CD    1 
ATOM   4556  C  CE    . LYS A 1 599 ? 23.552  13.557  22.500  1.00 45.06  ? 599 LYS A CE    1 
ATOM   4557  N  NZ    . LYS A 1 599 ? 23.233  13.475  23.940  1.00 43.44  ? 599 LYS A NZ    1 
ATOM   4558  N  N     . THR A 1 600 ? 26.075  8.065   18.919  1.00 46.00  ? 600 THR A N     1 
ATOM   4559  C  CA    . THR A 1 600 ? 25.827  6.772   18.292  1.00 43.81  ? 600 THR A CA    1 
ATOM   4560  C  C     . THR A 1 600 ? 26.330  5.582   19.095  1.00 41.82  ? 600 THR A C     1 
ATOM   4561  O  O     . THR A 1 600 ? 27.105  5.731   20.043  1.00 41.10  ? 600 THR A O     1 
ATOM   4562  C  CB    . THR A 1 600 ? 26.487  6.702   16.890  1.00 44.98  ? 600 THR A CB    1 
ATOM   4563  O  OG1   . THR A 1 600 ? 27.911  6.721   17.027  1.00 44.67  ? 600 THR A OG1   1 
ATOM   4564  C  CG2   . THR A 1 600 ? 26.073  7.895   16.043  1.00 46.66  ? 600 THR A CG2   1 
ATOM   4565  N  N     . PHE A 1 601 ? 25.866  4.399   18.706  1.00 39.35  ? 601 PHE A N     1 
ATOM   4566  C  CA    . PHE A 1 601 ? 26.284  3.151   19.333  1.00 37.58  ? 601 PHE A CA    1 
ATOM   4567  C  C     . PHE A 1 601 ? 25.848  1.953   18.494  1.00 36.39  ? 601 PHE A C     1 
ATOM   4568  O  O     . PHE A 1 601 ? 24.909  2.041   17.704  1.00 34.85  ? 601 PHE A O     1 
ATOM   4569  C  CB    . PHE A 1 601 ? 25.726  3.017   20.766  1.00 36.33  ? 601 PHE A CB    1 
ATOM   4570  C  CG    . PHE A 1 601 ? 24.230  2.835   20.838  1.00 33.40  ? 601 PHE A CG    1 
ATOM   4571  C  CD1   . PHE A 1 601 ? 23.379  3.935   20.865  1.00 32.46  ? 601 PHE A CD1   1 
ATOM   4572  C  CD2   . PHE A 1 601 ? 23.677  1.560   20.897  1.00 31.36  ? 601 PHE A CD2   1 
ATOM   4573  C  CE1   . PHE A 1 601 ? 21.998  3.767   20.940  1.00 32.37  ? 601 PHE A CE1   1 
ATOM   4574  C  CE2   . PHE A 1 601 ? 22.299  1.381   20.971  1.00 31.60  ? 601 PHE A CE2   1 
ATOM   4575  C  CZ    . PHE A 1 601 ? 21.455  2.488   20.998  1.00 31.84  ? 601 PHE A CZ    1 
ATOM   4576  N  N     . LEU A 1 602 ? 26.560  0.843   18.649  1.00 35.21  ? 602 LEU A N     1 
ATOM   4577  C  CA    . LEU A 1 602 ? 26.222  -0.373  17.929  1.00 34.85  ? 602 LEU A CA    1 
ATOM   4578  C  C     . LEU A 1 602 ? 25.560  -1.304  18.919  1.00 35.23  ? 602 LEU A C     1 
ATOM   4579  O  O     . LEU A 1 602 ? 25.841  -1.250  20.113  1.00 34.44  ? 602 LEU A O     1 
ATOM   4580  C  CB    . LEU A 1 602 ? 27.467  -1.047  17.357  1.00 33.89  ? 602 LEU A CB    1 
ATOM   4581  C  CG    . LEU A 1 602 ? 28.191  -0.282  16.259  1.00 33.16  ? 602 LEU A CG    1 
ATOM   4582  C  CD1   . LEU A 1 602 ? 29.408  -1.101  15.822  1.00 30.54  ? 602 LEU A CD1   1 
ATOM   4583  C  CD2   . LEU A 1 602 ? 27.225  0.000   15.095  1.00 30.02  ? 602 LEU A CD2   1 
ATOM   4584  N  N     . LEU A 1 603 ? 24.679  -2.156  18.411  1.00 35.85  ? 603 LEU A N     1 
ATOM   4585  C  CA    . LEU A 1 603 ? 23.956  -3.099  19.237  1.00 36.21  ? 603 LEU A CA    1 
ATOM   4586  C  C     . LEU A 1 603 ? 23.842  -4.387  18.469  1.00 36.73  ? 603 LEU A C     1 
ATOM   4587  O  O     . LEU A 1 603 ? 23.250  -4.419  17.399  1.00 35.83  ? 603 LEU A O     1 
ATOM   4588  C  CB    . LEU A 1 603 ? 22.565  -2.549  19.556  1.00 36.73  ? 603 LEU A CB    1 
ATOM   4589  C  CG    . LEU A 1 603 ? 21.479  -3.453  20.151  1.00 39.35  ? 603 LEU A CG    1 
ATOM   4590  C  CD1   . LEU A 1 603 ? 21.884  -3.936  21.538  1.00 39.87  ? 603 LEU A CD1   1 
ATOM   4591  C  CD2   . LEU A 1 603 ? 20.161  -2.673  20.219  1.00 39.28  ? 603 LEU A CD2   1 
ATOM   4592  N  N     . LEU A 1 604 ? 24.444  -5.442  19.004  1.00 39.21  ? 604 LEU A N     1 
ATOM   4593  C  CA    . LEU A 1 604 ? 24.379  -6.746  18.366  1.00 42.61  ? 604 LEU A CA    1 
ATOM   4594  C  C     . LEU A 1 604 ? 23.103  -7.344  18.932  1.00 44.75  ? 604 LEU A C     1 
ATOM   4595  O  O     . LEU A 1 604 ? 22.973  -7.474  20.144  1.00 45.99  ? 604 LEU A O     1 
ATOM   4596  C  CB    . LEU A 1 604 ? 25.599  -7.583  18.740  1.00 40.90  ? 604 LEU A CB    1 
ATOM   4597  C  CG    . LEU A 1 604 ? 25.799  -8.779  17.822  1.00 40.51  ? 604 LEU A CG    1 
ATOM   4598  C  CD1   . LEU A 1 604 ? 27.232  -9.254  17.930  1.00 42.11  ? 604 LEU A CD1   1 
ATOM   4599  C  CD2   . LEU A 1 604 ? 24.809  -9.864  18.175  1.00 38.49  ? 604 LEU A CD2   1 
ATOM   4600  N  N     . THR A 1 605 ? 22.161  -7.694  18.060  1.00 48.02  ? 605 THR A N     1 
ATOM   4601  C  CA    . THR A 1 605 ? 20.873  -8.215  18.502  1.00 49.87  ? 605 THR A CA    1 
ATOM   4602  C  C     . THR A 1 605 ? 20.693  -9.713  18.405  1.00 52.25  ? 605 THR A C     1 
ATOM   4603  O  O     . THR A 1 605 ? 19.994  -10.313 19.215  1.00 53.54  ? 605 THR A O     1 
ATOM   4604  C  CB    . THR A 1 605 ? 19.754  -7.548  17.735  1.00 48.15  ? 605 THR A CB    1 
ATOM   4605  O  OG1   . THR A 1 605 ? 19.915  -6.129  17.816  1.00 47.82  ? 605 THR A OG1   1 
ATOM   4606  C  CG2   . THR A 1 605 ? 18.435  -7.901  18.339  1.00 50.04  ? 605 THR A CG2   1 
ATOM   4607  N  N     . VAL A 1 606 ? 21.305  -10.318 17.406  1.00 55.04  ? 606 VAL A N     1 
ATOM   4608  C  CA    . VAL A 1 606 ? 21.209  -11.750 17.251  1.00 59.03  ? 606 VAL A CA    1 
ATOM   4609  C  C     . VAL A 1 606 ? 22.650  -12.238 17.113  1.00 62.01  ? 606 VAL A C     1 
ATOM   4610  O  O     . VAL A 1 606 ? 23.433  -11.687 16.342  1.00 61.87  ? 606 VAL A O     1 
ATOM   4611  C  CB    . VAL A 1 606 ? 20.341  -12.095 16.024  1.00 58.81  ? 606 VAL A CB    1 
ATOM   4612  C  CG1   . VAL A 1 606 ? 20.174  -13.601 15.885  1.00 60.38  ? 606 VAL A CG1   1 
ATOM   4613  C  CG2   . VAL A 1 606 ? 18.984  -11.430 16.179  1.00 58.22  ? 606 VAL A CG2   1 
ATOM   4614  N  N     . HIS A 1 607 ? 23.010  -13.242 17.907  1.00 66.77  ? 607 HIS A N     1 
ATOM   4615  C  CA    . HIS A 1 607 ? 24.364  -13.783 17.873  1.00 70.62  ? 607 HIS A CA    1 
ATOM   4616  C  C     . HIS A 1 607 ? 24.544  -14.737 16.720  1.00 72.82  ? 607 HIS A C     1 
ATOM   4617  O  O     . HIS A 1 607 ? 25.471  -14.570 15.931  1.00 73.18  ? 607 HIS A O     1 
ATOM   4618  C  CB    . HIS A 1 607 ? 24.702  -14.476 19.207  1.00 70.42  ? 607 HIS A CB    1 
ATOM   4619  N  N     . ARG A 1 608 ? 23.685  -15.702 16.587  1.00 75.56  ? 608 ARG A N     1 
ATOM   4620  C  CA    . ARG A 1 608 ? 23.762  -16.682 15.535  1.00 78.22  ? 608 ARG A CA    1 
ATOM   4621  C  C     . ARG A 1 608 ? 23.067  -15.978 14.322  1.00 80.14  ? 608 ARG A C     1 
ATOM   4622  O  O     . ARG A 1 608 ? 22.011  -16.167 14.027  1.00 81.30  ? 608 ARG A O     1 
ATOM   4623  C  CB    . ARG A 1 608 ? 22.969  -17.937 15.853  1.00 77.72  ? 608 ARG A CB    1 
ATOM   4624  N  N     . ASP A 1 609 ? 23.666  -14.857 13.964  1.00 81.84  ? 609 ASP A N     1 
ATOM   4625  C  CA    . ASP A 1 609 ? 23.286  -14.278 12.689  1.00 82.43  ? 609 ASP A CA    1 
ATOM   4626  C  C     . ASP A 1 609 ? 24.009  -15.048 11.455  1.00 82.52  ? 609 ASP A C     1 
ATOM   4627  O  O     . ASP A 1 609 ? 24.675  -14.490 10.723  1.00 84.20  ? 609 ASP A O     1 
ATOM   4628  C  CB    . ASP A 1 609 ? 23.772  -12.862 12.650  1.00 82.11  ? 609 ASP A CB    1 
ATOM   4629  N  N     . PHE A 1 610 ? 24.132  -16.393 11.611  1.00 80.91  ? 610 PHE A N     1 
ATOM   4630  C  CA    . PHE A 1 610 ? 24.384  -17.166 10.370  1.00 78.43  ? 610 PHE A CA    1 
ATOM   4631  C  C     . PHE A 1 610 ? 25.643  -17.589 9.670   1.00 77.20  ? 610 PHE A C     1 
ATOM   4632  O  O     . PHE A 1 610 ? 26.657  -17.651 10.226  1.00 78.58  ? 610 PHE A O     1 
ATOM   4633  C  CB    . PHE A 1 610 ? 23.142  -16.847 9.470   1.00 77.01  ? 610 PHE A CB    1 
ATOM   4634  N  N     . ARG A 1 611 ? 25.403  -18.176 8.491   1.00 74.42  ? 611 ARG A N     1 
ATOM   4635  C  CA    . ARG A 1 611 ? 26.437  -18.635 7.575   1.00 71.06  ? 611 ARG A CA    1 
ATOM   4636  C  C     . ARG A 1 611 ? 27.455  -17.593 7.184   1.00 69.07  ? 611 ARG A C     1 
ATOM   4637  O  O     . ARG A 1 611 ? 28.568  -17.931 6.744   1.00 71.76  ? 611 ARG A O     1 
ATOM   4638  N  N     . GLY A 1 612 ? 27.120  -16.344 7.505   1.00 64.62  ? 612 GLY A N     1 
ATOM   4639  C  CA    . GLY A 1 612 ? 28.000  -15.286 7.152   1.00 59.84  ? 612 GLY A CA    1 
ATOM   4640  C  C     . GLY A 1 612 ? 28.326  -14.710 8.494   1.00 55.10  ? 612 GLY A C     1 
ATOM   4641  O  O     . GLY A 1 612 ? 28.452  -15.443 9.472   1.00 55.59  ? 612 GLY A O     1 
ATOM   4642  N  N     . THR A 1 613 ? 28.383  -13.395 8.557   1.00 49.52  ? 613 THR A N     1 
ATOM   4643  C  CA    . THR A 1 613 ? 28.723  -12.740 9.783   1.00 45.30  ? 613 THR A CA    1 
ATOM   4644  C  C     . THR A 1 613 ? 27.643  -11.782 10.279  1.00 41.51  ? 613 THR A C     1 
ATOM   4645  O  O     . THR A 1 613 ? 27.096  -10.999 9.508   1.00 40.77  ? 613 THR A O     1 
ATOM   4646  C  CB    . THR A 1 613 ? 30.022  -12.012 9.560   1.00 46.54  ? 613 THR A CB    1 
ATOM   4647  O  OG1   . THR A 1 613 ? 30.291  -11.135 10.654  1.00 50.64  ? 613 THR A OG1   1 
ATOM   4648  C  CG2   . THR A 1 613 ? 29.936  -11.235 8.284   1.00 47.71  ? 613 THR A CG2   1 
ATOM   4649  N  N     . PRO A 1 614 ? 27.318  -11.841 11.584  1.00 37.33  ? 614 PRO A N     1 
ATOM   4650  C  CA    . PRO A 1 614 ? 26.304  -10.977 12.193  1.00 35.07  ? 614 PRO A CA    1 
ATOM   4651  C  C     . PRO A 1 614 ? 26.424  -9.515  11.767  1.00 31.94  ? 614 PRO A C     1 
ATOM   4652  O  O     . PRO A 1 614 ? 27.528  -8.997  11.610  1.00 30.75  ? 614 PRO A O     1 
ATOM   4653  C  CB    . PRO A 1 614 ? 26.551  -11.160 13.693  1.00 37.13  ? 614 PRO A CB    1 
ATOM   4654  C  CG    . PRO A 1 614 ? 27.973  -11.673 13.761  1.00 36.21  ? 614 PRO A CG    1 
ATOM   4655  C  CD    . PRO A 1 614 ? 28.011  -12.619 12.617  1.00 34.64  ? 614 PRO A CD    1 
ATOM   4656  N  N     . ARG A 1 615 ? 25.278  -8.863  11.595  1.00 29.89  ? 615 ARG A N     1 
ATOM   4657  C  CA    . ARG A 1 615 ? 25.211  -7.456  11.194  1.00 29.33  ? 615 ARG A CA    1 
ATOM   4658  C  C     . ARG A 1 615 ? 24.577  -6.653  12.317  1.00 27.88  ? 615 ARG A C     1 
ATOM   4659  O  O     . ARG A 1 615 ? 23.354  -6.571  12.419  1.00 27.07  ? 615 ARG A O     1 
ATOM   4660  C  CB    . ARG A 1 615 ? 24.365  -7.274  9.922   1.00 30.21  ? 615 ARG A CB    1 
ATOM   4661  C  CG    . ARG A 1 615 ? 24.954  -7.894  8.663   1.00 31.21  ? 615 ARG A CG    1 
ATOM   4662  C  CD    . ARG A 1 615 ? 23.986  -7.787  7.507   1.00 32.04  ? 615 ARG A CD    1 
ATOM   4663  N  NE    . ARG A 1 615 ? 22.668  -8.329  7.834   1.00 33.94  ? 615 ARG A NE    1 
ATOM   4664  C  CZ    . ARG A 1 615 ? 21.576  -8.126  7.099   1.00 34.66  ? 615 ARG A CZ    1 
ATOM   4665  N  NH1   . ARG A 1 615 ? 21.653  -7.387  5.992   1.00 35.97  ? 615 ARG A NH1   1 
ATOM   4666  N  NH2   . ARG A 1 615 ? 20.416  -8.663  7.461   1.00 31.86  ? 615 ARG A NH2   1 
ATOM   4667  N  N     . PRO A 1 616 ? 25.407  -6.024  13.161  1.00 27.20  ? 616 PRO A N     1 
ATOM   4668  C  CA    . PRO A 1 616 ? 24.878  -5.237  14.273  1.00 27.63  ? 616 PRO A CA    1 
ATOM   4669  C  C     . PRO A 1 616 ? 24.085  -4.018  13.825  1.00 26.59  ? 616 PRO A C     1 
ATOM   4670  O  O     . PRO A 1 616 ? 24.290  -3.511  12.732  1.00 24.94  ? 616 PRO A O     1 
ATOM   4671  C  CB    . PRO A 1 616 ? 26.140  -4.872  15.066  1.00 28.61  ? 616 PRO A CB    1 
ATOM   4672  C  CG    . PRO A 1 616 ? 27.181  -4.746  13.993  1.00 28.34  ? 616 PRO A CG    1 
ATOM   4673  C  CD    . PRO A 1 616 ? 26.879  -5.925  13.090  1.00 27.39  ? 616 PRO A CD    1 
ATOM   4674  N  N     . LEU A 1 617 ? 23.170  -3.569  14.677  1.00 26.93  ? 617 LEU A N     1 
ATOM   4675  C  CA    . LEU A 1 617 ? 22.361  -2.396  14.398  1.00 27.47  ? 617 LEU A CA    1 
ATOM   4676  C  C     . LEU A 1 617 ? 23.184  -1.172  14.765  1.00 29.39  ? 617 LEU A C     1 
ATOM   4677  O  O     . LEU A 1 617 ? 23.986  -1.238  15.692  1.00 32.31  ? 617 LEU A O     1 
ATOM   4678  C  CB    . LEU A 1 617 ? 21.093  -2.429  15.243  1.00 25.48  ? 617 LEU A CB    1 
ATOM   4679  C  CG    . LEU A 1 617 ? 20.163  -3.614  14.967  1.00 27.75  ? 617 LEU A CG    1 
ATOM   4680  C  CD1   . LEU A 1 617 ? 19.001  -3.542  15.928  1.00 26.69  ? 617 LEU A CD1   1 
ATOM   4681  C  CD2   . LEU A 1 617 ? 19.650  -3.600  13.505  1.00 27.38  ? 617 LEU A CD2   1 
ATOM   4682  N  N     . LYS A 1 618 ? 23.034  -0.074  14.023  1.00 30.54  ? 618 LYS A N     1 
ATOM   4683  C  CA    . LYS A 1 618 ? 23.756  1.163   14.341  1.00 31.49  ? 618 LYS A CA    1 
ATOM   4684  C  C     . LYS A 1 618 ? 22.728  2.214   14.743  1.00 32.34  ? 618 LYS A C     1 
ATOM   4685  O  O     . LYS A 1 618 ? 21.961  2.703   13.912  1.00 33.77  ? 618 LYS A O     1 
ATOM   4686  C  CB    . LYS A 1 618 ? 24.577  1.671   13.160  1.00 29.36  ? 618 LYS A CB    1 
ATOM   4687  C  CG    . LYS A 1 618 ? 25.302  2.956   13.499  1.00 28.78  ? 618 LYS A CG    1 
ATOM   4688  C  CD    . LYS A 1 618 ? 26.503  3.152   12.616  1.00 29.89  ? 618 LYS A CD    1 
ATOM   4689  C  CE    . LYS A 1 618 ? 27.258  4.418   12.984  1.00 31.50  ? 618 LYS A CE    1 
ATOM   4690  N  NZ    . LYS A 1 618 ? 28.593  4.492   12.295  1.00 33.95  ? 618 LYS A NZ    1 
ATOM   4691  N  N     . LEU A 1 619 ? 22.711  2.558   16.024  1.00 31.85  ? 619 LEU A N     1 
ATOM   4692  C  CA    . LEU A 1 619 ? 21.736  3.510   16.507  1.00 32.30  ? 619 LEU A CA    1 
ATOM   4693  C  C     . LEU A 1 619 ? 22.270  4.888   16.842  1.00 33.36  ? 619 LEU A C     1 
ATOM   4694  O  O     . LEU A 1 619 ? 23.405  5.058   17.285  1.00 35.09  ? 619 LEU A O     1 
ATOM   4695  C  CB    . LEU A 1 619 ? 21.004  2.926   17.714  1.00 29.95  ? 619 LEU A CB    1 
ATOM   4696  C  CG    . LEU A 1 619 ? 20.402  1.562   17.398  1.00 29.90  ? 619 LEU A CG    1 
ATOM   4697  C  CD1   . LEU A 1 619 ? 21.459  0.523   17.620  1.00 29.00  ? 619 LEU A CD1   1 
ATOM   4698  C  CD2   . LEU A 1 619 ? 19.187  1.276   18.261  1.00 31.20  ? 619 LEU A CD2   1 
ATOM   4699  N  N     . VAL A 1 620 ? 21.419  5.877   16.636  1.00 33.16  ? 620 VAL A N     1 
ATOM   4700  C  CA    . VAL A 1 620 ? 21.777  7.243   16.906  1.00 32.80  ? 620 VAL A CA    1 
ATOM   4701  C  C     . VAL A 1 620 ? 20.678  7.904   17.703  1.00 34.21  ? 620 VAL A C     1 
ATOM   4702  O  O     . VAL A 1 620 ? 19.531  7.957   17.261  1.00 33.70  ? 620 VAL A O     1 
ATOM   4703  C  CB    . VAL A 1 620 ? 21.965  8.006   15.603  1.00 32.00  ? 620 VAL A CB    1 
ATOM   4704  C  CG1   . VAL A 1 620 ? 22.123  9.490   15.881  1.00 29.38  ? 620 VAL A CG1   1 
ATOM   4705  C  CG2   . VAL A 1 620 ? 23.160  7.450   14.862  1.00 29.84  ? 620 VAL A CG2   1 
ATOM   4706  N  N     . HIS A 1 621 ? 21.044  8.393   18.882  1.00 35.61  ? 621 HIS A N     1 
ATOM   4707  C  CA    . HIS A 1 621 ? 20.126  9.088   19.766  1.00 39.66  ? 621 HIS A CA    1 
ATOM   4708  C  C     . HIS A 1 621 ? 20.108  10.509  19.222  1.00 41.74  ? 621 HIS A C     1 
ATOM   4709  O  O     . HIS A 1 621 ? 21.037  11.278  19.437  1.00 41.50  ? 621 HIS A O     1 
ATOM   4710  C  CB    . HIS A 1 621 ? 20.679  9.046   21.189  1.00 42.04  ? 621 HIS A CB    1 
ATOM   4711  C  CG    . HIS A 1 621 ? 19.760  9.609   22.230  1.00 46.01  ? 621 HIS A CG    1 
ATOM   4712  N  ND1   . HIS A 1 621 ? 18.397  9.401   22.217  1.00 46.69  ? 621 HIS A ND1   1 
ATOM   4713  C  CD2   . HIS A 1 621 ? 20.023  10.322  23.352  1.00 47.34  ? 621 HIS A CD2   1 
ATOM   4714  C  CE1   . HIS A 1 621 ? 17.860  9.962   23.289  1.00 47.08  ? 621 HIS A CE1   1 
ATOM   4715  N  NE2   . HIS A 1 621 ? 18.823  10.526  23.993  1.00 47.91  ? 621 HIS A NE2   1 
ATOM   4716  N  N     . GLU A 1 622 ? 19.052  10.857  18.504  1.00 43.97  ? 622 GLU A N     1 
ATOM   4717  C  CA    . GLU A 1 622 ? 18.983  12.174  17.909  1.00 46.24  ? 622 GLU A CA    1 
ATOM   4718  C  C     . GLU A 1 622 ? 18.205  13.177  18.713  1.00 46.99  ? 622 GLU A C     1 
ATOM   4719  O  O     . GLU A 1 622 ? 18.350  14.382  18.514  1.00 47.71  ? 622 GLU A O     1 
ATOM   4720  C  CB    . GLU A 1 622 ? 18.393  12.067  16.514  1.00 49.21  ? 622 GLU A CB    1 
ATOM   4721  C  CG    . GLU A 1 622 ? 19.286  11.285  15.554  1.00 52.76  ? 622 GLU A CG    1 
ATOM   4722  C  CD    . GLU A 1 622 ? 18.641  11.068  14.199  1.00 54.13  ? 622 GLU A CD    1 
ATOM   4723  O  OE1   . GLU A 1 622 ? 17.553  10.456  14.165  1.00 56.16  ? 622 GLU A OE1   1 
ATOM   4724  O  OE2   . GLU A 1 622 ? 19.215  11.504  13.175  1.00 54.09  ? 622 GLU A OE2   1 
ATOM   4725  N  N     . ALA A 1 623 ? 17.369  12.692  19.617  1.00 46.24  ? 623 ALA A N     1 
ATOM   4726  C  CA    . ALA A 1 623 ? 16.598  13.600  20.437  1.00 45.66  ? 623 ALA A CA    1 
ATOM   4727  C  C     . ALA A 1 623 ? 16.271  12.969  21.780  1.00 45.83  ? 623 ALA A C     1 
ATOM   4728  O  O     . ALA A 1 623 ? 16.076  11.766  21.883  1.00 45.53  ? 623 ALA A O     1 
ATOM   4729  C  CB    . ALA A 1 623 ? 15.332  13.997  19.711  1.00 44.86  ? 623 ALA A CB    1 
ATOM   4730  N  N     . GLY A 1 624 ? 16.236  13.790  22.818  1.00 47.04  ? 624 GLY A N     1 
ATOM   4731  C  CA    . GLY A 1 624 ? 15.914  13.279  24.132  1.00 47.03  ? 624 GLY A CA    1 
ATOM   4732  C  C     . GLY A 1 624 ? 17.112  13.149  25.032  1.00 46.98  ? 624 GLY A C     1 
ATOM   4733  O  O     . GLY A 1 624 ? 18.259  13.222  24.579  1.00 46.22  ? 624 GLY A O     1 
ATOM   4734  N  N     . ASP A 1 625 ? 16.829  12.953  26.318  1.00 47.65  ? 625 ASP A N     1 
ATOM   4735  C  CA    . ASP A 1 625 ? 17.868  12.810  27.331  1.00 47.51  ? 625 ASP A CA    1 
ATOM   4736  C  C     . ASP A 1 625 ? 17.722  11.521  28.105  1.00 45.75  ? 625 ASP A C     1 
ATOM   4737  O  O     . ASP A 1 625 ? 17.155  11.511  29.191  1.00 48.36  ? 625 ASP A O     1 
ATOM   4738  C  CB    . ASP A 1 625 ? 17.810  13.966  28.324  1.00 49.14  ? 625 ASP A CB    1 
ATOM   4739  C  CG    . ASP A 1 625 ? 16.405  14.216  28.833  1.00 50.96  ? 625 ASP A CG    1 
ATOM   4740  O  OD1   . ASP A 1 625 ? 15.717  15.082  28.250  1.00 55.18  ? 625 ASP A OD1   1 
ATOM   4741  O  OD2   . ASP A 1 625 ? 15.976  13.540  29.793  1.00 50.37  ? 625 ASP A OD2   1 
ATOM   4742  N  N     . THR A 1 626 ? 18.208  10.426  27.546  1.00 42.45  ? 626 THR A N     1 
ATOM   4743  C  CA    . THR A 1 626 ? 18.150  9.163   28.250  1.00 39.98  ? 626 THR A CA    1 
ATOM   4744  C  C     . THR A 1 626 ? 19.498  8.542   28.004  1.00 39.73  ? 626 THR A C     1 
ATOM   4745  O  O     . THR A 1 626 ? 20.061  8.669   26.922  1.00 40.03  ? 626 THR A O     1 
ATOM   4746  C  CB    . THR A 1 626 ? 17.042  8.224   27.723  1.00 38.60  ? 626 THR A CB    1 
ATOM   4747  O  OG1   . THR A 1 626 ? 15.777  8.879   27.818  1.00 36.86  ? 626 THR A OG1   1 
ATOM   4748  C  CG2   . THR A 1 626 ? 16.973  6.952   28.554  1.00 37.14  ? 626 THR A CG2   1 
ATOM   4749  N  N     . PRO A 1 627 ? 20.063  7.908   29.026  1.00 39.54  ? 627 PRO A N     1 
ATOM   4750  C  CA    . PRO A 1 627 ? 21.363  7.293   28.821  1.00 39.49  ? 627 PRO A CA    1 
ATOM   4751  C  C     . PRO A 1 627 ? 21.319  6.358   27.613  1.00 39.74  ? 627 PRO A C     1 
ATOM   4752  O  O     . PRO A 1 627 ? 20.323  5.670   27.394  1.00 37.58  ? 627 PRO A O     1 
ATOM   4753  C  CB    . PRO A 1 627 ? 21.586  6.557   30.139  1.00 39.60  ? 627 PRO A CB    1 
ATOM   4754  C  CG    . PRO A 1 627 ? 20.939  7.468   31.126  1.00 37.76  ? 627 PRO A CG    1 
ATOM   4755  C  CD    . PRO A 1 627 ? 19.655  7.826   30.441  1.00 39.30  ? 627 PRO A CD    1 
ATOM   4756  N  N     . LEU A 1 628 ? 22.394  6.359   26.829  1.00 41.27  ? 628 LEU A N     1 
ATOM   4757  C  CA    . LEU A 1 628 ? 22.498  5.504   25.662  1.00 44.29  ? 628 LEU A CA    1 
ATOM   4758  C  C     . LEU A 1 628 ? 22.342  4.060   26.105  1.00 45.95  ? 628 LEU A C     1 
ATOM   4759  O  O     . LEU A 1 628 ? 21.809  3.210   25.385  1.00 47.65  ? 628 LEU A O     1 
ATOM   4760  C  CB    . LEU A 1 628 ? 23.862  5.677   24.999  1.00 44.96  ? 628 LEU A CB    1 
ATOM   4761  C  CG    . LEU A 1 628 ? 24.039  6.883   24.087  1.00 46.09  ? 628 LEU A CG    1 
ATOM   4762  C  CD1   . LEU A 1 628 ? 25.424  6.887   23.434  1.00 44.97  ? 628 LEU A CD1   1 
ATOM   4763  C  CD2   . LEU A 1 628 ? 22.960  6.810   23.027  1.00 47.37  ? 628 LEU A CD2   1 
ATOM   4764  N  N     . GLU A 1 629 ? 22.821  3.793   27.305  1.00 46.80  ? 629 GLU A N     1 
ATOM   4765  C  CA    . GLU A 1 629 ? 22.754  2.463   27.868  1.00 49.57  ? 629 GLU A CA    1 
ATOM   4766  C  C     . GLU A 1 629 ? 21.295  2.118   28.171  1.00 48.38  ? 629 GLU A C     1 
ATOM   4767  O  O     . GLU A 1 629 ? 20.846  0.993   27.935  1.00 48.31  ? 629 GLU A O     1 
ATOM   4768  C  CB    . GLU A 1 629 ? 23.610  2.420   29.132  1.00 54.93  ? 629 GLU A CB    1 
ATOM   4769  C  CG    . GLU A 1 629 ? 24.832  3.364   29.075  1.00 63.04  ? 629 GLU A CG    1 
ATOM   4770  C  CD    . GLU A 1 629 ? 24.561  4.737   29.709  1.00 66.77  ? 629 GLU A CD    1 
ATOM   4771  O  OE1   . GLU A 1 629 ? 24.206  4.758   30.911  1.00 68.09  ? 629 GLU A OE1   1 
ATOM   4772  O  OE2   . GLU A 1 629 ? 24.709  5.782   29.018  1.00 68.30  ? 629 GLU A OE2   1 
ATOM   4773  N  N     . ALA A 1 630 ? 20.558  3.098   28.682  1.00 46.65  ? 630 ALA A N     1 
ATOM   4774  C  CA    . ALA A 1 630 ? 19.147  2.917   29.000  1.00 45.51  ? 630 ALA A CA    1 
ATOM   4775  C  C     . ALA A 1 630 ? 18.389  2.532   27.729  1.00 44.44  ? 630 ALA A C     1 
ATOM   4776  O  O     . ALA A 1 630 ? 17.623  1.566   27.702  1.00 44.92  ? 630 ALA A O     1 
ATOM   4777  C  CB    . ALA A 1 630 ? 18.582  4.205   29.576  1.00 46.23  ? 630 ALA A CB    1 
ATOM   4778  N  N     . LEU A 1 631 ? 18.608  3.308   26.677  1.00 41.78  ? 631 LEU A N     1 
ATOM   4779  C  CA    . LEU A 1 631 ? 17.988  3.056   25.389  1.00 38.34  ? 631 LEU A CA    1 
ATOM   4780  C  C     . LEU A 1 631 ? 18.396  1.690   24.853  1.00 36.91  ? 631 LEU A C     1 
ATOM   4781  O  O     . LEU A 1 631 ? 17.556  0.837   24.583  1.00 36.14  ? 631 LEU A O     1 
ATOM   4782  C  CB    . LEU A 1 631 ? 18.422  4.131   24.402  1.00 37.98  ? 631 LEU A CB    1 
ATOM   4783  C  CG    . LEU A 1 631 ? 17.467  5.303   24.212  1.00 38.60  ? 631 LEU A CG    1 
ATOM   4784  C  CD1   . LEU A 1 631 ? 16.575  5.503   25.432  1.00 38.76  ? 631 LEU A CD1   1 
ATOM   4785  C  CD2   . LEU A 1 631 ? 18.298  6.536   23.904  1.00 39.11  ? 631 LEU A CD2   1 
ATOM   4786  N  N     . ALA A 1 632 ? 19.695  1.492   24.687  1.00 34.62  ? 632 ALA A N     1 
ATOM   4787  C  CA    . ALA A 1 632 ? 20.187  0.231   24.187  1.00 33.30  ? 632 ALA A CA    1 
ATOM   4788  C  C     . ALA A 1 632 ? 19.408  -0.883  24.869  1.00 33.37  ? 632 ALA A C     1 
ATOM   4789  O  O     . ALA A 1 632 ? 18.799  -1.723  24.210  1.00 32.27  ? 632 ALA A O     1 
ATOM   4790  C  CB    . ALA A 1 632 ? 21.664  0.111   24.489  1.00 33.36  ? 632 ALA A CB    1 
ATOM   4791  N  N     . HIS A 1 633 ? 19.414  -0.857  26.198  1.00 33.31  ? 633 HIS A N     1 
ATOM   4792  C  CA    . HIS A 1 633 ? 18.731  -1.857  27.005  1.00 34.58  ? 633 HIS A CA    1 
ATOM   4793  C  C     . HIS A 1 633 ? 17.298  -2.133  26.571  1.00 34.97  ? 633 HIS A C     1 
ATOM   4794  O  O     . HIS A 1 633 ? 16.941  -3.276  26.312  1.00 35.99  ? 633 HIS A O     1 
ATOM   4795  C  CB    . HIS A 1 633 ? 18.746  -1.430  28.477  1.00 36.10  ? 633 HIS A CB    1 
ATOM   4796  C  CG    . HIS A 1 633 ? 18.236  -2.476  29.423  1.00 36.72  ? 633 HIS A CG    1 
ATOM   4797  N  ND1   . HIS A 1 633 ? 16.964  -2.445  29.953  1.00 37.04  ? 633 HIS A ND1   1 
ATOM   4798  C  CD2   . HIS A 1 633 ? 18.828  -3.586  29.924  1.00 35.93  ? 633 HIS A CD2   1 
ATOM   4799  C  CE1   . HIS A 1 633 ? 16.791  -3.491  30.741  1.00 37.09  ? 633 HIS A CE1   1 
ATOM   4800  N  NE2   . HIS A 1 633 ? 17.906  -4.198  30.740  1.00 38.78  ? 633 HIS A NE2   1 
ATOM   4801  N  N     . GLN A 1 634 ? 16.475  -1.092  26.498  1.00 35.08  ? 634 GLN A N     1 
ATOM   4802  C  CA    . GLN A 1 634 ? 15.077  -1.264  26.108  1.00 35.64  ? 634 GLN A CA    1 
ATOM   4803  C  C     . GLN A 1 634 ? 14.935  -1.774  24.687  1.00 36.04  ? 634 GLN A C     1 
ATOM   4804  O  O     . GLN A 1 634 ? 14.166  -2.698  24.425  1.00 37.10  ? 634 GLN A O     1 
ATOM   4805  C  CB    . GLN A 1 634 ? 14.297  0.048   26.254  1.00 34.97  ? 634 GLN A CB    1 
ATOM   4806  C  CG    . GLN A 1 634 ? 12.921  -0.014  25.609  1.00 37.68  ? 634 GLN A CG    1 
ATOM   4807  C  CD    . GLN A 1 634 ? 11.903  0.909   26.268  1.00 41.41  ? 634 GLN A CD    1 
ATOM   4808  O  OE1   . GLN A 1 634 ? 12.228  2.037   26.654  1.00 44.08  ? 634 GLN A OE1   1 
ATOM   4809  N  NE2   . GLN A 1 634 ? 10.656  0.439   26.385  1.00 39.76  ? 634 GLN A NE2   1 
ATOM   4810  N  N     . ILE A 1 635 ? 15.683  -1.157  23.777  1.00 35.41  ? 635 ILE A N     1 
ATOM   4811  C  CA    . ILE A 1 635 ? 15.669  -1.514  22.369  1.00 33.08  ? 635 ILE A CA    1 
ATOM   4812  C  C     . ILE A 1 635 ? 16.041  -2.976  22.133  1.00 33.33  ? 635 ILE A C     1 
ATOM   4813  O  O     . ILE A 1 635 ? 15.432  -3.651  21.299  1.00 34.03  ? 635 ILE A O     1 
ATOM   4814  C  CB    . ILE A 1 635 ? 16.609  -0.581  21.596  1.00 32.09  ? 635 ILE A CB    1 
ATOM   4815  C  CG1   . ILE A 1 635 ? 16.001  0.820   21.605  1.00 30.61  ? 635 ILE A CG1   1 
ATOM   4816  C  CG2   . ILE A 1 635 ? 16.883  -1.120  20.203  1.00 29.35  ? 635 ILE A CG2   1 
ATOM   4817  C  CD1   . ILE A 1 635 ? 16.441  1.694   20.478  1.00 31.54  ? 635 ILE A CD1   1 
ATOM   4818  N  N     . PHE A 1 636 ? 17.028  -3.465  22.874  1.00 31.99  ? 636 PHE A N     1 
ATOM   4819  C  CA    . PHE A 1 636 ? 17.470  -4.850  22.752  1.00 32.12  ? 636 PHE A CA    1 
ATOM   4820  C  C     . PHE A 1 636 ? 16.390  -5.806  23.223  1.00 33.36  ? 636 PHE A C     1 
ATOM   4821  O  O     . PHE A 1 636 ? 16.219  -6.903  22.689  1.00 33.04  ? 636 PHE A O     1 
ATOM   4822  C  CB    . PHE A 1 636 ? 18.728  -5.057  23.588  1.00 30.96  ? 636 PHE A CB    1 
ATOM   4823  C  CG    . PHE A 1 636 ? 19.073  -6.495  23.841  1.00 28.28  ? 636 PHE A CG    1 
ATOM   4824  C  CD1   . PHE A 1 636 ? 19.103  -7.415  22.802  1.00 26.25  ? 636 PHE A CD1   1 
ATOM   4825  C  CD2   . PHE A 1 636 ? 19.418  -6.915  25.124  1.00 27.94  ? 636 PHE A CD2   1 
ATOM   4826  C  CE1   . PHE A 1 636 ? 19.475  -8.735  23.035  1.00 26.50  ? 636 PHE A CE1   1 
ATOM   4827  C  CE2   . PHE A 1 636 ? 19.794  -8.228  25.372  1.00 26.17  ? 636 PHE A CE2   1 
ATOM   4828  C  CZ    . PHE A 1 636 ? 19.822  -9.143  24.328  1.00 26.34  ? 636 PHE A CZ    1 
ATOM   4829  N  N     . HIS A 1 637 ? 15.663  -5.375  24.239  1.00 34.90  ? 637 HIS A N     1 
ATOM   4830  C  CA    . HIS A 1 637 ? 14.616  -6.190  24.803  1.00 35.27  ? 637 HIS A CA    1 
ATOM   4831  C  C     . HIS A 1 637 ? 13.389  -6.224  23.936  1.00 35.04  ? 637 HIS A C     1 
ATOM   4832  O  O     . HIS A 1 637 ? 12.733  -7.248  23.855  1.00 35.57  ? 637 HIS A O     1 
ATOM   4833  C  CB    . HIS A 1 637 ? 14.256  -5.694  26.203  1.00 36.45  ? 637 HIS A CB    1 
ATOM   4834  C  CG    . HIS A 1 637 ? 15.317  -5.961  27.226  1.00 37.60  ? 637 HIS A CG    1 
ATOM   4835  N  ND1   . HIS A 1 637 ? 15.075  -5.902  28.580  1.00 37.28  ? 637 HIS A ND1   1 
ATOM   4836  C  CD2   . HIS A 1 637 ? 16.624  -6.296  27.090  1.00 37.71  ? 637 HIS A CD2   1 
ATOM   4837  C  CE1   . HIS A 1 637 ? 16.187  -6.193  29.234  1.00 37.32  ? 637 HIS A CE1   1 
ATOM   4838  N  NE2   . HIS A 1 637 ? 17.139  -6.436  28.354  1.00 36.45  ? 637 HIS A NE2   1 
ATOM   4839  N  N     . LEU A 1 638 ? 13.074  -5.107  23.287  1.00 36.48  ? 638 LEU A N     1 
ATOM   4840  C  CA    . LEU A 1 638 ? 11.891  -5.035  22.417  1.00 37.04  ? 638 LEU A CA    1 
ATOM   4841  C  C     . LEU A 1 638 ? 11.989  -6.114  21.342  1.00 37.51  ? 638 LEU A C     1 
ATOM   4842  O  O     . LEU A 1 638 ? 10.982  -6.556  20.779  1.00 37.67  ? 638 LEU A O     1 
ATOM   4843  C  CB    . LEU A 1 638 ? 11.779  -3.641  21.780  1.00 35.01  ? 638 LEU A CB    1 
ATOM   4844  C  CG    . LEU A 1 638 ? 11.355  -2.518  22.730  1.00 33.47  ? 638 LEU A CG    1 
ATOM   4845  C  CD1   . LEU A 1 638 ? 11.571  -1.149  22.099  1.00 33.04  ? 638 LEU A CD1   1 
ATOM   4846  C  CD2   . LEU A 1 638 ? 9.895   -2.720  23.078  1.00 34.58  ? 638 LEU A CD2   1 
ATOM   4847  N  N     . THR A 1 639 ? 13.226  -6.535  21.100  1.00 36.83  ? 639 THR A N     1 
ATOM   4848  C  CA    . THR A 1 639 ? 13.575  -7.564  20.139  1.00 36.11  ? 639 THR A CA    1 
ATOM   4849  C  C     . THR A 1 639 ? 12.923  -8.918  20.405  1.00 35.80  ? 639 THR A C     1 
ATOM   4850  O  O     . THR A 1 639 ? 12.566  -9.622  19.483  1.00 36.41  ? 639 THR A O     1 
ATOM   4851  C  CB    . THR A 1 639 ? 15.090  -7.756  20.144  1.00 36.74  ? 639 THR A CB    1 
ATOM   4852  O  OG1   . THR A 1 639 ? 15.705  -6.668  19.455  1.00 38.38  ? 639 THR A OG1   1 
ATOM   4853  C  CG2   . THR A 1 639 ? 15.471  -9.044  19.493  1.00 39.23  ? 639 THR A CG2   1 
ATOM   4854  N  N     . ARG A 1 640 ? 12.791  -9.295  21.666  1.00 36.85  ? 640 ARG A N     1 
ATOM   4855  C  CA    . ARG A 1 640 ? 12.206  -10.584 22.012  1.00 37.43  ? 640 ARG A CA    1 
ATOM   4856  C  C     . ARG A 1 640 ? 10.694  -10.478 22.203  1.00 38.44  ? 640 ARG A C     1 
ATOM   4857  O  O     . ARG A 1 640 ? 10.030  -11.416 22.648  1.00 38.23  ? 640 ARG A O     1 
ATOM   4858  C  CB    . ARG A 1 640 ? 12.882  -11.130 23.281  1.00 36.08  ? 640 ARG A CB    1 
ATOM   4859  C  CG    . ARG A 1 640 ? 14.308  -11.619 23.055  1.00 37.75  ? 640 ARG A CG    1 
ATOM   4860  C  CD    . ARG A 1 640 ? 15.219  -10.470 22.642  1.00 41.74  ? 640 ARG A CD    1 
ATOM   4861  N  NE    . ARG A 1 640 ? 16.386  -10.869 21.847  1.00 44.75  ? 640 ARG A NE    1 
ATOM   4862  C  CZ    . ARG A 1 640 ? 17.391  -11.630 22.283  1.00 47.32  ? 640 ARG A CZ    1 
ATOM   4863  N  NH1   . ARG A 1 640 ? 17.394  -12.108 23.527  1.00 48.36  ? 640 ARG A NH1   1 
ATOM   4864  N  NH2   . ARG A 1 640 ? 18.418  -11.884 21.480  1.00 46.92  ? 640 ARG A NH2   1 
ATOM   4865  N  N     . LEU A 1 641 ? 10.146  -9.337  21.812  1.00 38.92  ? 641 LEU A N     1 
ATOM   4866  C  CA    . LEU A 1 641 ? 8.727   -9.082  21.984  1.00 39.76  ? 641 LEU A CA    1 
ATOM   4867  C  C     . LEU A 1 641 ? 7.859   -9.324  20.736  1.00 41.95  ? 641 LEU A C     1 
ATOM   4868  O  O     . LEU A 1 641 ? 6.747   -8.800  20.644  1.00 43.50  ? 641 LEU A O     1 
ATOM   4869  C  CB    . LEU A 1 641 ? 8.573   -7.641  22.473  1.00 36.93  ? 641 LEU A CB    1 
ATOM   4870  C  CG    . LEU A 1 641 ? 7.596   -7.386  23.610  1.00 34.48  ? 641 LEU A CG    1 
ATOM   4871  C  CD1   . LEU A 1 641 ? 6.198   -7.427  23.073  1.00 34.31  ? 641 LEU A CD1   1 
ATOM   4872  C  CD2   . LEU A 1 641 ? 7.799   -8.412  24.705  1.00 33.80  ? 641 LEU A CD2   1 
ATOM   4873  N  N     . TYR A 1 642 ? 8.354   -10.126 19.794  1.00 42.52  ? 642 TYR A N     1 
ATOM   4874  C  CA    . TYR A 1 642 ? 7.628   -10.404 18.553  1.00 42.77  ? 642 TYR A CA    1 
ATOM   4875  C  C     . TYR A 1 642 ? 6.806   -11.709 18.549  1.00 43.60  ? 642 TYR A C     1 
ATOM   4876  O  O     . TYR A 1 642 ? 7.365   -12.802 18.512  1.00 43.60  ? 642 TYR A O     1 
ATOM   4877  C  CB    . TYR A 1 642 ? 8.619   -10.414 17.390  1.00 43.37  ? 642 TYR A CB    1 
ATOM   4878  C  CG    . TYR A 1 642 ? 7.992   -10.616 16.019  1.00 43.57  ? 642 TYR A CG    1 
ATOM   4879  C  CD1   . TYR A 1 642 ? 7.052   -9.716  15.511  1.00 42.71  ? 642 TYR A CD1   1 
ATOM   4880  C  CD2   . TYR A 1 642 ? 8.341   -11.709 15.234  1.00 42.68  ? 642 TYR A CD2   1 
ATOM   4881  C  CE1   . TYR A 1 642 ? 6.479   -9.907  14.263  1.00 41.84  ? 642 TYR A CE1   1 
ATOM   4882  C  CE2   . TYR A 1 642 ? 7.775   -11.903 13.989  1.00 42.56  ? 642 TYR A CE2   1 
ATOM   4883  C  CZ    . TYR A 1 642 ? 6.846   -11.003 13.510  1.00 42.32  ? 642 TYR A CZ    1 
ATOM   4884  O  OH    . TYR A 1 642 ? 6.283   -11.223 12.278  1.00 44.74  ? 642 TYR A OH    1 
ATOM   4885  N  N     . PRO A 1 643 ? 5.461   -11.596 18.539  1.00 44.68  ? 643 PRO A N     1 
ATOM   4886  C  CA    . PRO A 1 643 ? 4.466   -12.687 18.540  1.00 45.58  ? 643 PRO A CA    1 
ATOM   4887  C  C     . PRO A 1 643 ? 4.652   -13.897 17.622  1.00 46.62  ? 643 PRO A C     1 
ATOM   4888  O  O     . PRO A 1 643 ? 4.532   -15.028 18.079  1.00 46.31  ? 643 PRO A O     1 
ATOM   4889  C  CB    . PRO A 1 643 ? 3.150   -11.961 18.270  1.00 44.86  ? 643 PRO A CB    1 
ATOM   4890  C  CG    . PRO A 1 643 ? 3.585   -10.693 17.568  1.00 43.88  ? 643 PRO A CG    1 
ATOM   4891  C  CD    . PRO A 1 643 ? 4.788   -10.298 18.350  1.00 44.21  ? 643 PRO A CD    1 
ATOM   4892  N  N     . ALA A 1 644 ? 4.905   -13.675 16.333  1.00 48.89  ? 644 ALA A N     1 
ATOM   4893  C  CA    . ALA A 1 644 ? 5.126   -14.788 15.402  1.00 50.42  ? 644 ALA A CA    1 
ATOM   4894  C  C     . ALA A 1 644 ? 6.581   -15.251 15.542  1.00 51.63  ? 644 ALA A C     1 
ATOM   4895  O  O     . ALA A 1 644 ? 7.404   -14.570 16.164  1.00 53.01  ? 644 ALA A O     1 
ATOM   4896  C  CB    . ALA A 1 644 ? 4.841   -14.353 13.963  1.00 50.16  ? 644 ALA A CB    1 
ATOM   4897  N  N     . SER A 1 645 ? 6.909   -16.406 14.977  1.00 51.91  ? 645 SER A N     1 
ATOM   4898  C  CA    . SER A 1 645 ? 8.275   -16.903 15.095  1.00 52.29  ? 645 SER A CA    1 
ATOM   4899  C  C     . SER A 1 645 ? 8.596   -17.112 16.577  1.00 52.96  ? 645 SER A C     1 
ATOM   4900  O  O     . SER A 1 645 ? 9.326   -16.322 17.181  1.00 53.18  ? 645 SER A O     1 
ATOM   4901  C  CB    . SER A 1 645 ? 9.250   -15.887 14.486  1.00 50.77  ? 645 SER A CB    1 
ATOM   4902  O  OG    . SER A 1 645 ? 10.588  -16.330 14.577  1.00 49.53  ? 645 SER A OG    1 
ATOM   4903  N  N     . GLY A 1 646 ? 8.031   -18.167 17.161  1.00 53.23  ? 646 GLY A N     1 
ATOM   4904  C  CA    . GLY A 1 646 ? 8.278   -18.454 18.562  1.00 54.26  ? 646 GLY A CA    1 
ATOM   4905  C  C     . GLY A 1 646 ? 9.511   -19.319 18.754  1.00 54.36  ? 646 GLY A C     1 
ATOM   4906  O  O     . GLY A 1 646 ? 9.622   -20.046 19.745  1.00 55.24  ? 646 GLY A O     1 
ATOM   4907  N  N     . PHE A 1 647 ? 10.444  -19.228 17.810  1.00 53.58  ? 647 PHE A N     1 
ATOM   4908  C  CA    . PHE A 1 647 ? 11.666  -20.016 17.857  1.00 52.58  ? 647 PHE A CA    1 
ATOM   4909  C  C     . PHE A 1 647 ? 12.876  -19.237 17.391  1.00 51.47  ? 647 PHE A C     1 
ATOM   4910  O  O     . PHE A 1 647 ? 13.989  -19.756 17.385  1.00 52.30  ? 647 PHE A O     1 
ATOM   4911  C  CB    . PHE A 1 647 ? 11.512  -21.245 16.979  1.00 54.62  ? 647 PHE A CB    1 
ATOM   4912  C  CG    . PHE A 1 647 ? 10.329  -22.075 17.324  1.00 56.38  ? 647 PHE A CG    1 
ATOM   4913  C  CD1   . PHE A 1 647 ? 10.293  -22.782 18.519  1.00 57.12  ? 647 PHE A CD1   1 
ATOM   4914  C  CD2   . PHE A 1 647 ? 9.235   -22.133 16.469  1.00 57.26  ? 647 PHE A CD2   1 
ATOM   4915  C  CE1   . PHE A 1 647 ? 9.177   -23.537 18.862  1.00 58.43  ? 647 PHE A CE1   1 
ATOM   4916  C  CE2   . PHE A 1 647 ? 8.108   -22.887 16.800  1.00 59.08  ? 647 PHE A CE2   1 
ATOM   4917  C  CZ    . PHE A 1 647 ? 8.077   -23.591 18.000  1.00 58.63  ? 647 PHE A CZ    1 
ATOM   4918  N  N     . ALA A 1 648 ? 12.661  -17.998 16.976  1.00 49.57  ? 648 ALA A N     1 
ATOM   4919  C  CA    . ALA A 1 648 ? 13.762  -17.166 16.522  1.00 47.08  ? 648 ALA A CA    1 
ATOM   4920  C  C     . ALA A 1 648 ? 13.401  -15.716 16.788  1.00 45.30  ? 648 ALA A C     1 
ATOM   4921  O  O     . ALA A 1 648 ? 12.264  -15.305 16.566  1.00 45.46  ? 648 ALA A O     1 
ATOM   4922  C  CB    . ALA A 1 648 ? 14.016  -17.390 15.035  1.00 45.35  ? 648 ALA A CB    1 
ATOM   4923  N  N     . PHE A 1 649 ? 14.359  -14.945 17.286  1.00 42.62  ? 649 PHE A N     1 
ATOM   4924  C  CA    . PHE A 1 649 ? 14.094  -13.545 17.552  1.00 39.61  ? 649 PHE A CA    1 
ATOM   4925  C  C     . PHE A 1 649 ? 14.560  -12.657 16.404  1.00 37.04  ? 649 PHE A C     1 
ATOM   4926  O  O     . PHE A 1 649 ? 15.562  -12.947 15.748  1.00 33.97  ? 649 PHE A O     1 
ATOM   4927  C  CB    . PHE A 1 649 ? 14.775  -13.106 18.845  1.00 39.70  ? 649 PHE A CB    1 
ATOM   4928  C  CG    . PHE A 1 649 ? 14.165  -13.691 20.089  1.00 40.62  ? 649 PHE A CG    1 
ATOM   4929  C  CD1   . PHE A 1 649 ? 14.968  -14.291 21.050  1.00 41.31  ? 649 PHE A CD1   1 
ATOM   4930  C  CD2   . PHE A 1 649 ? 12.793  -13.624 20.315  1.00 41.49  ? 649 PHE A CD2   1 
ATOM   4931  C  CE1   . PHE A 1 649 ? 14.421  -14.813 22.210  1.00 40.80  ? 649 PHE A CE1   1 
ATOM   4932  C  CE2   . PHE A 1 649 ? 12.235  -14.146 21.481  1.00 40.26  ? 649 PHE A CE2   1 
ATOM   4933  C  CZ    . PHE A 1 649 ? 13.053  -14.741 22.426  1.00 40.42  ? 649 PHE A CZ    1 
ATOM   4934  N  N     . PRO A 1 650 ? 13.803  -11.579 16.131  1.00 35.85  ? 650 PRO A N     1 
ATOM   4935  C  CA    . PRO A 1 650 ? 14.092  -10.607 15.080  1.00 35.50  ? 650 PRO A CA    1 
ATOM   4936  C  C     . PRO A 1 650 ? 15.349  -9.821  15.433  1.00 35.94  ? 650 PRO A C     1 
ATOM   4937  O  O     . PRO A 1 650 ? 15.688  -9.671  16.604  1.00 34.03  ? 650 PRO A O     1 
ATOM   4938  C  CB    . PRO A 1 650 ? 12.854  -9.709  15.095  1.00 34.82  ? 650 PRO A CB    1 
ATOM   4939  C  CG    . PRO A 1 650 ? 11.783  -10.623 15.500  1.00 34.34  ? 650 PRO A CG    1 
ATOM   4940  C  CD    . PRO A 1 650 ? 12.421  -11.402 16.614  1.00 35.55  ? 650 PRO A CD    1 
ATOM   4941  N  N     . ARG A 1 651 ? 16.040  -9.321  14.416  1.00 37.70  ? 651 ARG A N     1 
ATOM   4942  C  CA    . ARG A 1 651 ? 17.241  -8.522  14.636  1.00 37.53  ? 651 ARG A CA    1 
ATOM   4943  C  C     . ARG A 1 651 ? 16.750  -7.148  15.086  1.00 37.70  ? 651 ARG A C     1 
ATOM   4944  O  O     . ARG A 1 651 ? 17.362  -6.496  15.918  1.00 37.82  ? 651 ARG A O     1 
ATOM   4945  C  CB    . ARG A 1 651 ? 18.045  -8.409  13.336  1.00 36.51  ? 651 ARG A CB    1 
ATOM   4946  C  CG    . ARG A 1 651 ? 19.312  -7.588  13.459  1.00 36.05  ? 651 ARG A CG    1 
ATOM   4947  C  CD    . ARG A 1 651 ? 20.278  -7.846  12.305  1.00 35.26  ? 651 ARG A CD    1 
ATOM   4948  N  NE    . ARG A 1 651 ? 19.823  -7.345  11.008  1.00 34.35  ? 651 ARG A NE    1 
ATOM   4949  C  CZ    . ARG A 1 651 ? 20.383  -6.318  10.366  1.00 33.55  ? 651 ARG A CZ    1 
ATOM   4950  N  NH1   . ARG A 1 651 ? 21.419  -5.678  10.904  1.00 32.65  ? 651 ARG A NH1   1 
ATOM   4951  N  NH2   . ARG A 1 651 ? 19.918  -5.941  9.180   1.00 28.94  ? 651 ARG A NH2   1 
ATOM   4952  N  N     . LEU A 1 652 ? 15.619  -6.722  14.539  1.00 37.77  ? 652 LEU A N     1 
ATOM   4953  C  CA    . LEU A 1 652 ? 15.059  -5.435  14.897  1.00 37.35  ? 652 LEU A CA    1 
ATOM   4954  C  C     . LEU A 1 652 ? 14.076  -5.530  16.040  1.00 36.91  ? 652 LEU A C     1 
ATOM   4955  O  O     . LEU A 1 652 ? 13.578  -6.603  16.374  1.00 36.83  ? 652 LEU A O     1 
ATOM   4956  C  CB    . LEU A 1 652 ? 14.348  -4.795  13.706  1.00 37.35  ? 652 LEU A CB    1 
ATOM   4957  C  CG    . LEU A 1 652 ? 15.198  -4.377  12.514  1.00 37.50  ? 652 LEU A CG    1 
ATOM   4958  C  CD1   . LEU A 1 652 ? 15.692  -5.611  11.796  1.00 38.58  ? 652 LEU A CD1   1 
ATOM   4959  C  CD2   . LEU A 1 652 ? 14.357  -3.529  11.575  1.00 38.69  ? 652 LEU A CD2   1 
ATOM   4960  N  N     . PRO A 1 653 ? 13.785  -4.386  16.662  1.00 37.20  ? 653 PRO A N     1 
ATOM   4961  C  CA    . PRO A 1 653 ? 12.849  -4.308  17.778  1.00 36.69  ? 653 PRO A CA    1 
ATOM   4962  C  C     . PRO A 1 653 ? 11.461  -4.578  17.254  1.00 35.63  ? 653 PRO A C     1 
ATOM   4963  O  O     . PRO A 1 653 ? 11.119  -4.129  16.174  1.00 35.49  ? 653 PRO A O     1 
ATOM   4964  C  CB    . PRO A 1 653 ? 12.996  -2.870  18.245  1.00 36.94  ? 653 PRO A CB    1 
ATOM   4965  C  CG    . PRO A 1 653 ? 14.402  -2.549  17.905  1.00 37.88  ? 653 PRO A CG    1 
ATOM   4966  C  CD    . PRO A 1 653 ? 14.522  -3.119  16.524  1.00 37.76  ? 653 PRO A CD    1 
ATOM   4967  N  N     . ALA A 1 654 ? 10.665  -5.301  18.024  1.00 35.98  ? 654 ALA A N     1 
ATOM   4968  C  CA    . ALA A 1 654 ? 9.300   -5.623  17.628  1.00 37.54  ? 654 ALA A CA    1 
ATOM   4969  C  C     . ALA A 1 654 ? 8.608   -4.497  16.838  1.00 37.40  ? 654 ALA A C     1 
ATOM   4970  O  O     . ALA A 1 654 ? 8.049   -4.745  15.762  1.00 37.75  ? 654 ALA A O     1 
ATOM   4971  C  CB    . ALA A 1 654 ? 8.459   -6.001  18.879  1.00 36.68  ? 654 ALA A CB    1 
ATOM   4972  N  N     . PRO A 1 655 ? 8.646   -3.247  17.354  1.00 36.57  ? 655 PRO A N     1 
ATOM   4973  C  CA    . PRO A 1 655 ? 8.028   -2.076  16.713  1.00 35.40  ? 655 PRO A CA    1 
ATOM   4974  C  C     . PRO A 1 655 ? 8.418   -1.881  15.252  1.00 34.57  ? 655 PRO A C     1 
ATOM   4975  O  O     . PRO A 1 655 ? 7.549   -1.752  14.394  1.00 34.55  ? 655 PRO A O     1 
ATOM   4976  C  CB    . PRO A 1 655 ? 8.499   -0.922  17.583  1.00 35.66  ? 655 PRO A CB    1 
ATOM   4977  C  CG    . PRO A 1 655 ? 8.588   -1.557  18.932  1.00 37.36  ? 655 PRO A CG    1 
ATOM   4978  C  CD    . PRO A 1 655 ? 9.287   -2.854  18.620  1.00 36.40  ? 655 PRO A CD    1 
ATOM   4979  N  N     . LEU A 1 656 ? 9.719   -1.842  14.974  1.00 32.63  ? 656 LEU A N     1 
ATOM   4980  C  CA    . LEU A 1 656 ? 10.196  -1.689  13.607  1.00 32.60  ? 656 LEU A CA    1 
ATOM   4981  C  C     . LEU A 1 656 ? 9.943   -2.943  12.749  1.00 33.02  ? 656 LEU A C     1 
ATOM   4982  O  O     . LEU A 1 656 ? 9.668   -2.852  11.545  1.00 33.16  ? 656 LEU A O     1 
ATOM   4983  C  CB    . LEU A 1 656 ? 11.685  -1.360  13.606  1.00 31.58  ? 656 LEU A CB    1 
ATOM   4984  C  CG    . LEU A 1 656 ? 12.042  0.081   13.962  1.00 32.01  ? 656 LEU A CG    1 
ATOM   4985  C  CD1   . LEU A 1 656 ? 13.539  0.254   13.835  1.00 31.79  ? 656 LEU A CD1   1 
ATOM   4986  C  CD2   . LEU A 1 656 ? 11.326  1.054   13.040  1.00 32.52  ? 656 LEU A CD2   1 
ATOM   4987  N  N     . HIS A 1 657 ? 10.035  -4.112  13.369  1.00 32.14  ? 657 HIS A N     1 
ATOM   4988  C  CA    . HIS A 1 657 ? 9.803   -5.360  12.663  1.00 32.07  ? 657 HIS A CA    1 
ATOM   4989  C  C     . HIS A 1 657 ? 8.327   -5.477  12.272  1.00 32.12  ? 657 HIS A C     1 
ATOM   4990  O  O     . HIS A 1 657 ? 7.990   -5.916  11.177  1.00 30.74  ? 657 HIS A O     1 
ATOM   4991  C  CB    . HIS A 1 657 ? 10.199  -6.538  13.559  1.00 32.48  ? 657 HIS A CB    1 
ATOM   4992  C  CG    . HIS A 1 657 ? 10.199  -7.865  12.860  1.00 30.95  ? 657 HIS A CG    1 
ATOM   4993  N  ND1   . HIS A 1 657 ? 11.165  -8.227  11.954  1.00 30.55  ? 657 HIS A ND1   1 
ATOM   4994  C  CD2   . HIS A 1 657 ? 9.333   -8.901  12.930  1.00 30.90  ? 657 HIS A CD2   1 
ATOM   4995  C  CE1   . HIS A 1 657 ? 10.895  -9.437  11.486  1.00 31.22  ? 657 HIS A CE1   1 
ATOM   4996  N  NE2   . HIS A 1 657 ? 9.792   -9.865  12.062  1.00 31.82  ? 657 HIS A NE2   1 
ATOM   4997  N  N     . LEU A 1 658 ? 7.447   -5.079  13.174  1.00 32.82  ? 658 LEU A N     1 
ATOM   4998  C  CA    . LEU A 1 658 ? 6.020   -5.160  12.914  1.00 35.30  ? 658 LEU A CA    1 
ATOM   4999  C  C     . LEU A 1 658 ? 5.547   -4.151  11.891  1.00 37.44  ? 658 LEU A C     1 
ATOM   5000  O  O     . LEU A 1 658 ? 4.640   -4.434  11.116  1.00 38.33  ? 658 LEU A O     1 
ATOM   5001  C  CB    . LEU A 1 658 ? 5.250   -4.980  14.215  1.00 35.83  ? 658 LEU A CB    1 
ATOM   5002  C  CG    . LEU A 1 658 ? 5.336   -6.224  15.099  1.00 36.10  ? 658 LEU A CG    1 
ATOM   5003  C  CD1   . LEU A 1 658 ? 5.296   -5.848  16.559  1.00 35.48  ? 658 LEU A CD1   1 
ATOM   5004  C  CD2   . LEU A 1 658 ? 4.208   -7.157  14.729  1.00 35.17  ? 658 LEU A CD2   1 
ATOM   5005  N  N     . ALA A 1 659 ? 6.158   -2.970  11.889  1.00 40.39  ? 659 ALA A N     1 
ATOM   5006  C  CA    . ALA A 1 659 ? 5.790   -1.923  10.943  1.00 41.29  ? 659 ALA A CA    1 
ATOM   5007  C  C     . ALA A 1 659 ? 6.186   -2.369  9.550   1.00 42.11  ? 659 ALA A C     1 
ATOM   5008  O  O     . ALA A 1 659 ? 5.492   -2.068  8.592   1.00 43.60  ? 659 ALA A O     1 
ATOM   5009  C  CB    . ALA A 1 659 ? 6.484   -0.606  11.293  1.00 42.07  ? 659 ALA A CB    1 
ATOM   5010  N  N     . ASP A 1 660 ? 7.296   -3.091  9.436   1.00 42.40  ? 660 ASP A N     1 
ATOM   5011  C  CA    . ASP A 1 660 ? 7.743   -3.576  8.134   1.00 43.61  ? 660 ASP A CA    1 
ATOM   5012  C  C     . ASP A 1 660 ? 6.771   -4.577  7.539   1.00 42.09  ? 660 ASP A C     1 
ATOM   5013  O  O     . ASP A 1 660 ? 6.579   -4.617  6.327   1.00 41.10  ? 660 ASP A O     1 
ATOM   5014  C  CB    . ASP A 1 660 ? 9.117   -4.238  8.243   1.00 49.77  ? 660 ASP A CB    1 
ATOM   5015  C  CG    . ASP A 1 660 ? 9.515   -4.983  6.962   1.00 53.83  ? 660 ASP A CG    1 
ATOM   5016  O  OD1   . ASP A 1 660 ? 9.456   -4.368  5.867   1.00 55.91  ? 660 ASP A OD1   1 
ATOM   5017  O  OD2   . ASP A 1 660 ? 9.891   -6.179  7.055   1.00 55.37  ? 660 ASP A OD2   1 
ATOM   5018  N  N     . ARG A 1 661 ? 6.177   -5.401  8.391   1.00 41.21  ? 661 ARG A N     1 
ATOM   5019  C  CA    . ARG A 1 661 ? 5.225   -6.382  7.917   1.00 41.67  ? 661 ARG A CA    1 
ATOM   5020  C  C     . ARG A 1 661 ? 3.928   -5.655  7.666   1.00 41.18  ? 661 ARG A C     1 
ATOM   5021  O  O     . ARG A 1 661 ? 3.264   -5.898  6.665   1.00 43.07  ? 661 ARG A O     1 
ATOM   5022  C  CB    . ARG A 1 661 ? 5.003   -7.468  8.951   1.00 43.21  ? 661 ARG A CB    1 
ATOM   5023  C  CG    . ARG A 1 661 ? 6.236   -7.772  9.760   1.00 47.54  ? 661 ARG A CG    1 
ATOM   5024  C  CD    . ARG A 1 661 ? 7.413   -8.201  8.911   1.00 50.06  ? 661 ARG A CD    1 
ATOM   5025  N  NE    . ARG A 1 661 ? 7.386   -9.621  8.582   1.00 52.02  ? 661 ARG A NE    1 
ATOM   5026  C  CZ    . ARG A 1 661 ? 8.473   -10.332 8.284   1.00 53.75  ? 661 ARG A CZ    1 
ATOM   5027  N  NH1   . ARG A 1 661 ? 9.676   -9.762  8.274   1.00 50.82  ? 661 ARG A NH1   1 
ATOM   5028  N  NH2   . ARG A 1 661 ? 8.358   -11.621 8.000   1.00 55.51  ? 661 ARG A NH2   1 
ATOM   5029  N  N     . LEU A 1 662 ? 3.568   -4.752  8.570   1.00 39.56  ? 662 LEU A N     1 
ATOM   5030  C  CA    . LEU A 1 662 ? 2.339   -3.991  8.403   1.00 38.44  ? 662 LEU A CA    1 
ATOM   5031  C  C     . LEU A 1 662 ? 2.310   -3.289  7.053   1.00 38.93  ? 662 LEU A C     1 
ATOM   5032  O  O     . LEU A 1 662 ? 1.256   -3.183  6.440   1.00 39.39  ? 662 LEU A O     1 
ATOM   5033  C  CB    . LEU A 1 662 ? 2.180   -2.952  9.510   1.00 36.79  ? 662 LEU A CB    1 
ATOM   5034  C  CG    . LEU A 1 662 ? 0.980   -2.020  9.321   1.00 35.80  ? 662 LEU A CG    1 
ATOM   5035  C  CD1   . LEU A 1 662 ? -0.274  -2.835  9.201   1.00 36.50  ? 662 LEU A CD1   1 
ATOM   5036  C  CD2   . LEU A 1 662 ? 0.860   -1.055  10.481  1.00 37.17  ? 662 LEU A CD2   1 
ATOM   5037  N  N     . VAL A 1 663 ? 3.460   -2.806  6.590   1.00 39.27  ? 663 VAL A N     1 
ATOM   5038  C  CA    . VAL A 1 663 ? 3.519   -2.123  5.301   1.00 40.57  ? 663 VAL A CA    1 
ATOM   5039  C  C     . VAL A 1 663 ? 3.505   -3.150  4.192   1.00 41.44  ? 663 VAL A C     1 
ATOM   5040  O  O     . VAL A 1 663 ? 2.652   -3.113  3.312   1.00 42.18  ? 663 VAL A O     1 
ATOM   5041  C  CB    . VAL A 1 663 ? 4.788   -1.244  5.151   1.00 40.85  ? 663 VAL A CB    1 
ATOM   5042  C  CG1   . VAL A 1 663 ? 4.888   -0.711  3.741   1.00 40.57  ? 663 VAL A CG1   1 
ATOM   5043  C  CG2   . VAL A 1 663 ? 4.724   -0.062  6.110   1.00 41.75  ? 663 VAL A CG2   1 
ATOM   5044  N  N     . LYS A 1 664 ? 4.443   -4.080  4.237   1.00 42.60  ? 664 LYS A N     1 
ATOM   5045  C  CA    . LYS A 1 664 ? 4.489   -5.106  3.215   1.00 45.41  ? 664 LYS A CA    1 
ATOM   5046  C  C     . LYS A 1 664 ? 3.104   -5.680  2.889   1.00 46.74  ? 664 LYS A C     1 
ATOM   5047  O  O     . LYS A 1 664 ? 2.700   -5.695  1.738   1.00 46.97  ? 664 LYS A O     1 
ATOM   5048  C  CB    . LYS A 1 664 ? 5.451   -6.220  3.643   1.00 46.02  ? 664 LYS A CB    1 
ATOM   5049  C  CG    . LYS A 1 664 ? 6.897   -5.757  3.695   1.00 48.24  ? 664 LYS A CG    1 
ATOM   5050  C  CD    . LYS A 1 664 ? 7.880   -6.869  4.047   1.00 51.36  ? 664 LYS A CD    1 
ATOM   5051  C  CE    . LYS A 1 664 ? 9.332   -6.373  3.873   1.00 53.96  ? 664 LYS A CE    1 
ATOM   5052  N  NZ    . LYS A 1 664 ? 10.401  -7.382  4.181   1.00 54.58  ? 664 LYS A NZ    1 
ATOM   5053  N  N     . GLU A 1 665 ? 2.368   -6.126  3.899   1.00 48.92  ? 665 GLU A N     1 
ATOM   5054  C  CA    . GLU A 1 665 ? 1.050   -6.716  3.678   1.00 51.15  ? 665 GLU A CA    1 
ATOM   5055  C  C     . GLU A 1 665 ? -0.022  -5.745  3.253   1.00 52.10  ? 665 GLU A C     1 
ATOM   5056  O  O     . GLU A 1 665 ? -0.991  -6.140  2.608   1.00 51.68  ? 665 GLU A O     1 
ATOM   5057  C  CB    . GLU A 1 665 ? 0.570   -7.438  4.935   1.00 53.48  ? 665 GLU A CB    1 
ATOM   5058  C  CG    . GLU A 1 665 ? 1.344   -8.702  5.239   1.00 56.87  ? 665 GLU A CG    1 
ATOM   5059  C  CD    . GLU A 1 665 ? 1.085   -9.786  4.220   1.00 58.40  ? 665 GLU A CD    1 
ATOM   5060  O  OE1   . GLU A 1 665 ? -0.044  -10.337 4.201   1.00 57.53  ? 665 GLU A OE1   1 
ATOM   5061  O  OE2   . GLU A 1 665 ? 2.015   -10.073 3.434   1.00 61.08  ? 665 GLU A OE2   1 
ATOM   5062  N  N     . VAL A 1 666 ? 0.126   -4.481  3.633   1.00 53.65  ? 666 VAL A N     1 
ATOM   5063  C  CA    . VAL A 1 666 ? -0.865  -3.480  3.261   1.00 55.10  ? 666 VAL A CA    1 
ATOM   5064  C  C     . VAL A 1 666 ? -0.768  -3.274  1.756   1.00 57.70  ? 666 VAL A C     1 
ATOM   5065  O  O     . VAL A 1 666 ? -1.718  -2.806  1.123   1.00 59.40  ? 666 VAL A O     1 
ATOM   5066  C  CB    . VAL A 1 666 ? -0.609  -2.180  3.991   1.00 52.01  ? 666 VAL A CB    1 
ATOM   5067  N  N     . GLY A 1 667 ? 0.388   -3.636  1.193   1.00 58.72  ? 667 GLY A N     1 
ATOM   5068  C  CA    . GLY A 1 667 ? 0.617   -3.518  -0.239  1.00 58.66  ? 667 GLY A CA    1 
ATOM   5069  C  C     . GLY A 1 667 ? 0.348   -4.846  -0.924  1.00 59.51  ? 667 GLY A C     1 
ATOM   5070  O  O     . GLY A 1 667 ? -0.100  -4.893  -2.065  1.00 59.55  ? 667 GLY A O     1 
ATOM   5071  N  N     . ARG A 1 668 ? 0.640   -5.934  -0.219  1.00 61.14  ? 668 ARG A N     1 
ATOM   5072  C  CA    . ARG A 1 668 ? 0.401   -7.277  -0.730  1.00 61.93  ? 668 ARG A CA    1 
ATOM   5073  C  C     . ARG A 1 668 ? -1.080  -7.364  -1.064  1.00 61.78  ? 668 ARG A C     1 
ATOM   5074  O  O     . ARG A 1 668 ? -1.464  -7.765  -2.153  1.00 61.08  ? 668 ARG A O     1 
ATOM   5075  C  CB    . ARG A 1 668 ? 0.729   -8.321  0.344   1.00 63.55  ? 668 ARG A CB    1 
ATOM   5076  C  CG    . ARG A 1 668 ? 1.956   -9.178  0.074   1.00 66.01  ? 668 ARG A CG    1 
ATOM   5077  C  CD    . ARG A 1 668 ? 3.255   -8.435  0.322   1.00 69.24  ? 668 ARG A CD    1 
ATOM   5078  N  NE    . ARG A 1 668 ? 4.425   -9.265  0.033   1.00 72.40  ? 668 ARG A NE    1 
ATOM   5079  C  CZ    . ARG A 1 668 ? 5.457   -8.870  -0.714  1.00 73.42  ? 668 ARG A CZ    1 
ATOM   5080  N  NH1   . ARG A 1 668 ? 6.481   -9.689  -0.928  1.00 72.36  ? 668 ARG A NH1   1 
ATOM   5081  N  NH2   . ARG A 1 668 ? 5.466   -7.655  -1.253  1.00 72.96  ? 668 ARG A NH2   1 
ATOM   5082  N  N     . LEU A 1 669 ? -1.904  -6.971  -0.101  1.00 62.98  ? 669 LEU A N     1 
ATOM   5083  C  CA    . LEU A 1 669 ? -3.354  -6.996  -0.240  1.00 64.31  ? 669 LEU A CA    1 
ATOM   5084  C  C     . LEU A 1 669 ? -3.886  -5.676  -0.810  1.00 65.72  ? 669 LEU A C     1 
ATOM   5085  O  O     . LEU A 1 669 ? -5.062  -5.558  -1.131  1.00 65.86  ? 669 LEU A O     1 
ATOM   5086  C  CB    . LEU A 1 669 ? -3.990  -7.262  1.131   1.00 63.58  ? 669 LEU A CB    1 
ATOM   5087  C  CG    . LEU A 1 669 ? -3.390  -8.404  1.965   1.00 63.26  ? 669 LEU A CG    1 
ATOM   5088  C  CD1   . LEU A 1 669 ? -3.895  -8.326  3.401   1.00 62.18  ? 669 LEU A CD1   1 
ATOM   5089  C  CD2   . LEU A 1 669 ? -3.745  -9.744  1.341   1.00 63.92  ? 669 LEU A CD2   1 
ATOM   5090  N  N     . GLY A 1 670 ? -3.021  -4.677  -0.924  1.00 67.64  ? 670 GLY A N     1 
ATOM   5091  C  CA    . GLY A 1 670 ? -3.456  -3.394  -1.451  1.00 70.62  ? 670 GLY A CA    1 
ATOM   5092  C  C     . GLY A 1 670 ? -4.598  -2.730  -0.693  1.00 72.44  ? 670 GLY A C     1 
ATOM   5093  O  O     . GLY A 1 670 ? -5.319  -1.897  -1.246  1.00 72.49  ? 670 GLY A O     1 
ATOM   5094  N  N     . ILE A 1 671 ? -4.765  -3.085  0.576   1.00 74.08  ? 671 ILE A N     1 
ATOM   5095  C  CA    . ILE A 1 671 ? -5.829  -2.513  1.386   1.00 75.43  ? 671 ILE A CA    1 
ATOM   5096  C  C     . ILE A 1 671 ? -5.663  -1.012  1.581   1.00 76.50  ? 671 ILE A C     1 
ATOM   5097  O  O     . ILE A 1 671 ? -4.597  -0.543  1.975   1.00 75.98  ? 671 ILE A O     1 
ATOM   5098  C  CB    . ILE A 1 671 ? -5.882  -3.190  2.754   1.00 75.12  ? 671 ILE A CB    1 
ATOM   5099  C  CG1   . ILE A 1 671 ? -4.478  -3.243  3.353   1.00 75.03  ? 671 ILE A CG1   1 
ATOM   5100  C  CG2   . ILE A 1 671 ? -6.455  -4.588  2.608   1.00 75.58  ? 671 ILE A CG2   1 
ATOM   5101  C  CD1   . ILE A 1 671 ? -4.401  -3.990  4.658   1.00 76.95  ? 671 ILE A CD1   1 
ATOM   5102  N  N     . ARG A 1 672 ? -6.726  -0.268  1.282   1.00 78.06  ? 672 ARG A N     1 
ATOM   5103  C  CA    . ARG A 1 672 ? -6.733  1.183   1.433   1.00 79.59  ? 672 ARG A CA    1 
ATOM   5104  C  C     . ARG A 1 672 ? -6.796  1.482   2.932   1.00 81.25  ? 672 ARG A C     1 
ATOM   5105  O  O     . ARG A 1 672 ? -6.059  2.329   3.444   1.00 81.58  ? 672 ARG A O     1 
ATOM   5106  C  CB    . ARG A 1 672 ? -7.935  1.776   0.710   1.00 78.21  ? 672 ARG A CB    1 
ATOM   5107  N  N     . HIS A 1 673 ? -7.690  0.784   3.627   1.00 82.70  ? 673 HIS A N     1 
ATOM   5108  C  CA    . HIS A 1 673 ? -7.831  0.906   5.078   1.00 83.96  ? 673 HIS A CA    1 
ATOM   5109  C  C     . HIS A 1 673 ? -8.938  0.000   5.624   1.00 83.25  ? 673 HIS A C     1 
ATOM   5110  O  O     . HIS A 1 673 ? -9.880  -0.350  4.909   1.00 83.24  ? 673 HIS A O     1 
ATOM   5111  C  CB    . HIS A 1 673 ? -8.077  2.360   5.506   1.00 86.50  ? 673 HIS A CB    1 
ATOM   5112  C  CG    . HIS A 1 673 ? -7.844  2.598   6.972   1.00 89.50  ? 673 HIS A CG    1 
ATOM   5113  N  ND1   . HIS A 1 673 ? -7.766  3.863   7.522   1.00 91.14  ? 673 HIS A ND1   1 
ATOM   5114  C  CD2   . HIS A 1 673 ? -7.667  1.734   8.000   1.00 89.74  ? 673 HIS A CD2   1 
ATOM   5115  C  CE1   . HIS A 1 673 ? -7.551  3.763   8.822   1.00 90.78  ? 673 HIS A CE1   1 
ATOM   5116  N  NE2   . HIS A 1 673 ? -7.488  2.482   9.139   1.00 90.54  ? 673 HIS A NE2   1 
ATOM   5117  N  N     . LEU A 1 674 ? -8.809  -0.383  6.892   1.00 81.91  ? 674 LEU A N     1 
ATOM   5118  C  CA    . LEU A 1 674 ? -9.770  -1.268  7.544   1.00 80.99  ? 674 LEU A CA    1 
ATOM   5119  C  C     . LEU A 1 674 ? -10.631 -0.570  8.611   1.00 80.56  ? 674 LEU A C     1 
ATOM   5120  O  O     . LEU A 1 674 ? -10.086 -0.002  9.565   1.00 80.31  ? 674 LEU A O     1 
ATOM   5121  C  CB    . LEU A 1 674 ? -9.026  -2.449  8.152   1.00 79.86  ? 674 LEU A CB    1 
ATOM   5122  N  N     . LYS A 1 675 ? -11.965 -0.632  8.434   1.00 80.29  ? 675 LYS A N     1 
ATOM   5123  C  CA    . LYS A 1 675 ? -12.973 -0.013  9.333   1.00 79.96  ? 675 LYS A CA    1 
ATOM   5124  C  C     . LYS A 1 675 ? -12.729 -0.717  10.596  1.00 79.22  ? 675 LYS A C     1 
ATOM   5125  O  O     . LYS A 1 675 ? -12.134 -0.169  11.518  1.00 79.73  ? 675 LYS A O     1 
ATOM   5126  C  CB    . LYS A 1 675 ? -14.332 -0.288  8.834   1.00 80.33  ? 675 LYS A CB    1 
ATOM   5127  N  N     . GLU A 1 676 ? -13.336 -1.853  10.790  1.00 77.13  ? 676 GLU A N     1 
ATOM   5128  C  CA    . GLU A 1 676 ? -12.595 -2.385  11.810  1.00 74.81  ? 676 GLU A CA    1 
ATOM   5129  C  C     . GLU A 1 676 ? -12.127 -3.736  11.888  1.00 72.29  ? 676 GLU A C     1 
ATOM   5130  O  O     . GLU A 1 676 ? -12.730 -4.712  11.409  1.00 71.44  ? 676 GLU A O     1 
ATOM   5131  C  CB    . GLU A 1 676 ? -12.938 -1.803  13.227  1.00 74.59  ? 676 GLU A CB    1 
ATOM   5132  N  N     . VAL A 1 677 ? -10.805 -3.603  12.064  1.00 69.46  ? 677 VAL A N     1 
ATOM   5133  C  CA    . VAL A 1 677 ? -10.024 -4.636  12.632  1.00 65.67  ? 677 VAL A CA    1 
ATOM   5134  C  C     . VAL A 1 677 ? -9.430  -3.906  13.732  1.00 63.60  ? 677 VAL A C     1 
ATOM   5135  O  O     . VAL A 1 677 ? -8.676  -2.924  13.671  1.00 64.28  ? 677 VAL A O     1 
ATOM   5136  C  CB    . VAL A 1 677 ? -9.261  -5.787  11.889  1.00 65.79  ? 677 VAL A CB    1 
ATOM   5137  C  CG1   . VAL A 1 677 ? -10.209 -6.348  11.082  1.00 65.77  ? 677 VAL A CG1   1 
ATOM   5138  C  CG2   . VAL A 1 677 ? -7.923  -5.544  11.154  1.00 66.27  ? 677 VAL A CG2   1 
ATOM   5139  N  N     . ASP A 1 678 ? -10.025 -4.325  14.821  1.00 61.74  ? 678 ASP A N     1 
ATOM   5140  C  CA    . ASP A 1 678 ? -9.623  -3.811  16.058  1.00 60.37  ? 678 ASP A CA    1 
ATOM   5141  C  C     . ASP A 1 678 ? -8.132  -3.890  15.970  1.00 58.59  ? 678 ASP A C     1 
ATOM   5142  O  O     . ASP A 1 678 ? -7.580  -4.933  15.655  1.00 59.50  ? 678 ASP A O     1 
ATOM   5143  C  CB    . ASP A 1 678 ? -10.108 -4.639  17.238  1.00 61.07  ? 678 ASP A CB    1 
ATOM   5144  C  CG    . ASP A 1 678 ? -9.255  -4.383  18.462  1.00 62.89  ? 678 ASP A CG    1 
ATOM   5145  O  OD1   . ASP A 1 678 ? -9.206  -3.215  18.925  1.00 63.03  ? 678 ASP A OD1   1 
ATOM   5146  O  OD2   . ASP A 1 678 ? -8.596  -5.331  18.948  1.00 62.89  ? 678 ASP A OD2   1 
ATOM   5147  N  N     . ARG A 1 679 ? -7.493  -2.761  16.233  1.00 55.84  ? 679 ARG A N     1 
ATOM   5148  C  CA    . ARG A 1 679 ? -6.043  -2.650  16.139  1.00 55.34  ? 679 ARG A CA    1 
ATOM   5149  C  C     . ARG A 1 679 ? -5.164  -3.610  16.954  1.00 53.78  ? 679 ARG A C     1 
ATOM   5150  O  O     . ARG A 1 679 ? -3.969  -3.711  16.689  1.00 51.70  ? 679 ARG A O     1 
ATOM   5151  C  CB    . ARG A 1 679 ? -5.620  -1.220  16.446  1.00 57.33  ? 679 ARG A CB    1 
ATOM   5152  C  CG    . ARG A 1 679 ? -6.262  -0.164  15.556  1.00 60.37  ? 679 ARG A CG    1 
ATOM   5153  C  CD    . ARG A 1 679 ? -5.263  0.955   15.304  1.00 62.77  ? 679 ARG A CD    1 
ATOM   5154  N  NE    . ARG A 1 679 ? -5.859  2.286   15.230  1.00 64.81  ? 679 ARG A NE    1 
ATOM   5155  C  CZ    . ARG A 1 679 ? -5.167  3.416   15.367  1.00 65.09  ? 679 ARG A CZ    1 
ATOM   5156  N  NH1   . ARG A 1 679 ? -3.861  3.376   15.584  1.00 64.81  ? 679 ARG A NH1   1 
ATOM   5157  N  NH2   . ARG A 1 679 ? -5.777  4.589   15.301  1.00 65.22  ? 679 ARG A NH2   1 
ATOM   5158  N  N     . GLU A 1 680 ? -5.741  -4.290  17.946  1.00 52.95  ? 680 GLU A N     1 
ATOM   5159  C  CA    . GLU A 1 680 ? -4.999  -5.243  18.779  1.00 50.79  ? 680 GLU A CA    1 
ATOM   5160  C  C     . GLU A 1 680 ? -4.809  -6.514  17.967  1.00 48.16  ? 680 GLU A C     1 
ATOM   5161  O  O     . GLU A 1 680 ? -3.970  -7.361  18.276  1.00 47.30  ? 680 GLU A O     1 
ATOM   5162  C  CB    . GLU A 1 680 ? -5.793  -5.578  20.046  1.00 53.55  ? 680 GLU A CB    1 
ATOM   5163  C  CG    . GLU A 1 680 ? -5.959  -4.431  21.039  1.00 57.08  ? 680 GLU A CG    1 
ATOM   5164  C  CD    . GLU A 1 680 ? -4.729  -4.219  21.919  1.00 59.80  ? 680 GLU A CD    1 
ATOM   5165  O  OE1   . GLU A 1 680 ? -4.390  -5.132  22.710  1.00 59.97  ? 680 GLU A OE1   1 
ATOM   5166  O  OE2   . GLU A 1 680 ? -4.102  -3.137  21.822  1.00 61.71  ? 680 GLU A OE2   1 
ATOM   5167  N  N     . LYS A 1 681 ? -5.613  -6.632  16.922  1.00 44.93  ? 681 LYS A N     1 
ATOM   5168  C  CA    . LYS A 1 681 ? -5.579  -7.783  16.048  1.00 42.76  ? 681 LYS A CA    1 
ATOM   5169  C  C     . LYS A 1 681 ? -4.465  -7.602  15.037  1.00 41.18  ? 681 LYS A C     1 
ATOM   5170  O  O     . LYS A 1 681 ? -4.592  -6.818  14.100  1.00 42.06  ? 681 LYS A O     1 
ATOM   5171  C  CB    . LYS A 1 681 ? -6.944  -7.940  15.348  1.00 43.55  ? 681 LYS A CB    1 
ATOM   5172  C  CG    . LYS A 1 681 ? -8.082  -8.420  16.271  1.00 43.16  ? 681 LYS A CG    1 
ATOM   5173  C  CD    . LYS A 1 681 ? -9.418  -7.790  15.945  0.00 43.21  ? 681 LYS A CD    1 
ATOM   5174  C  CE    . LYS A 1 681 ? -10.456 -8.198  16.979  0.00 43.15  ? 681 LYS A CE    1 
ATOM   5175  N  NZ    . LYS A 1 681 ? -11.764 -7.525  16.761  0.00 43.15  ? 681 LYS A NZ    1 
ATOM   5176  N  N     . LEU A 1 682 ? -3.364  -8.322  15.232  1.00 38.77  ? 682 LEU A N     1 
ATOM   5177  C  CA    . LEU A 1 682 ? -2.234  -8.225  14.317  1.00 36.19  ? 682 LEU A CA    1 
ATOM   5178  C  C     . LEU A 1 682 ? -2.433  -9.121  13.093  1.00 35.87  ? 682 LEU A C     1 
ATOM   5179  O  O     . LEU A 1 682 ? -1.860  -10.214 12.983  1.00 35.78  ? 682 LEU A O     1 
ATOM   5180  C  CB    . LEU A 1 682 ? -0.937  -8.581  15.045  1.00 34.03  ? 682 LEU A CB    1 
ATOM   5181  C  CG    . LEU A 1 682 ? -0.686  -7.793  16.332  1.00 32.26  ? 682 LEU A CG    1 
ATOM   5182  C  CD1   . LEU A 1 682 ? 0.705   -8.102  16.852  1.00 30.07  ? 682 LEU A CD1   1 
ATOM   5183  C  CD2   . LEU A 1 682 ? -0.830  -6.300  16.067  1.00 31.81  ? 682 LEU A CD2   1 
ATOM   5184  N  N     . PHE A 1 683 ? -3.251  -8.633  12.168  1.00 34.65  ? 683 PHE A N     1 
ATOM   5185  C  CA    . PHE A 1 683 ? -3.562  -9.353  10.938  1.00 35.06  ? 683 PHE A CA    1 
ATOM   5186  C  C     . PHE A 1 683 ? -2.403  -9.514  9.954   1.00 34.05  ? 683 PHE A C     1 
ATOM   5187  O  O     . PHE A 1 683 ? -2.404  -10.405 9.114   1.00 32.85  ? 683 PHE A O     1 
ATOM   5188  C  CB    . PHE A 1 683 ? -4.677  -8.633  10.202  1.00 35.24  ? 683 PHE A CB    1 
ATOM   5189  C  CG    . PHE A 1 683 ? -4.251  -7.322  9.595   1.00 35.37  ? 683 PHE A CG    1 
ATOM   5190  C  CD1   . PHE A 1 683 ? -4.369  -6.136  10.306  1.00 35.22  ? 683 PHE A CD1   1 
ATOM   5191  C  CD2   . PHE A 1 683 ? -3.739  -7.274  8.300   1.00 34.59  ? 683 PHE A CD2   1 
ATOM   5192  C  CE1   . PHE A 1 683 ? -3.989  -4.928  9.734   1.00 34.05  ? 683 PHE A CE1   1 
ATOM   5193  C  CE2   . PHE A 1 683 ? -3.357  -6.069  7.724   1.00 32.76  ? 683 PHE A CE2   1 
ATOM   5194  C  CZ    . PHE A 1 683 ? -3.483  -4.898  8.443   1.00 32.83  ? 683 PHE A CZ    1 
ATOM   5195  N  N     . PHE A 1 684 ? -1.419  -8.639  10.059  1.00 34.95  ? 684 PHE A N     1 
ATOM   5196  C  CA    . PHE A 1 684 ? -0.300  -8.637  9.134   1.00 35.49  ? 684 PHE A CA    1 
ATOM   5197  C  C     . PHE A 1 684 ? 0.905   -9.518  9.411   1.00 35.95  ? 684 PHE A C     1 
ATOM   5198  O  O     . PHE A 1 684 ? 1.789   -9.605  8.570   1.00 34.17  ? 684 PHE A O     1 
ATOM   5199  C  CB    . PHE A 1 684 ? 0.160   -7.190  8.943   1.00 34.81  ? 684 PHE A CB    1 
ATOM   5200  C  CG    . PHE A 1 684 ? 0.473   -6.488  10.225  1.00 34.35  ? 684 PHE A CG    1 
ATOM   5201  C  CD1   . PHE A 1 684 ? 1.721   -6.625  10.820  1.00 34.73  ? 684 PHE A CD1   1 
ATOM   5202  C  CD2   . PHE A 1 684 ? -0.488  -5.714  10.856  1.00 32.70  ? 684 PHE A CD2   1 
ATOM   5203  C  CE1   . PHE A 1 684 ? 2.004   -5.999  12.033  1.00 34.69  ? 684 PHE A CE1   1 
ATOM   5204  C  CE2   . PHE A 1 684 ? -0.213  -5.087  12.067  1.00 32.91  ? 684 PHE A CE2   1 
ATOM   5205  C  CZ    . PHE A 1 684 ? 1.035   -5.228  12.656  1.00 32.89  ? 684 PHE A CZ    1 
ATOM   5206  N  N     . VAL A 1 685 ? 0.962   -10.172 10.566  1.00 38.38  ? 685 VAL A N     1 
ATOM   5207  C  CA    . VAL A 1 685 ? 2.122   -11.014 10.858  1.00 40.26  ? 685 VAL A CA    1 
ATOM   5208  C  C     . VAL A 1 685 ? 2.072   -12.347 10.124  1.00 42.27  ? 685 VAL A C     1 
ATOM   5209  O  O     . VAL A 1 685 ? 0.966   -12.745 9.699   1.00 43.26  ? 685 VAL A O     1 
ATOM   5210  C  CB    . VAL A 1 685 ? 2.243   -11.302 12.349  1.00 38.65  ? 685 VAL A CB    1 
ATOM   5211  C  CG1   . VAL A 1 685 ? 2.458   -10.015 13.092  1.00 38.09  ? 685 VAL A CG1   1 
ATOM   5212  C  CG2   . VAL A 1 685 ? 0.995   -12.008 12.840  1.00 38.88  ? 685 VAL A CG2   1 
ATOM   5213  O  OXT   . VAL A 1 685 ? 3.144   -12.982 9.992   1.00 45.15  ? 685 VAL A OXT   1 
ATOM   5214  N  N     . MET B 1 1   ? -4.189  14.619  25.090  1.00 84.99  ? 1   MET B N     1 
ATOM   5215  C  CA    . MET B 1 1   ? -4.624  15.652  24.129  1.00 85.03  ? 1   MET B CA    1 
ATOM   5216  C  C     . MET B 1 1   ? -6.047  15.937  24.457  1.00 85.12  ? 1   MET B C     1 
ATOM   5217  O  O     . MET B 1 1   ? -6.908  16.200  23.634  1.00 85.10  ? 1   MET B O     1 
ATOM   5218  C  CB    . MET B 1 1   ? -4.397  15.185  22.720  1.00 85.04  ? 1   MET B CB    1 
ATOM   5219  C  CG    . MET B 1 1   ? -2.952  14.803  22.604  1.00 84.17  ? 1   MET B CG    1 
ATOM   5220  S  SD    . MET B 1 1   ? -2.803  13.289  21.730  1.00 85.56  ? 1   MET B SD    1 
ATOM   5221  C  CE    . MET B 1 1   ? -3.858  12.243  22.702  1.00 84.48  ? 1   MET B CE    1 
ATOM   5222  N  N     . ASN B 1 2   ? -6.290  15.731  25.744  1.00 84.89  ? 2   ASN B N     1 
ATOM   5223  C  CA    . ASN B 1 2   ? -7.536  16.222  26.259  1.00 84.32  ? 2   ASN B CA    1 
ATOM   5224  C  C     . ASN B 1 2   ? -6.990  17.310  27.140  1.00 83.53  ? 2   ASN B C     1 
ATOM   5225  O  O     . ASN B 1 2   ? -7.642  17.869  28.012  1.00 82.91  ? 2   ASN B O     1 
ATOM   5226  C  CB    . ASN B 1 2   ? -8.395  15.263  26.919  1.00 83.73  ? 2   ASN B CB    1 
ATOM   5227  N  N     . HIS B 1 3   ? -5.770  17.670  26.703  1.00 83.12  ? 3   HIS B N     1 
ATOM   5228  C  CA    . HIS B 1 3   ? -4.826  18.628  27.192  1.00 81.50  ? 3   HIS B CA    1 
ATOM   5229  C  C     . HIS B 1 3   ? -4.487  18.353  28.627  1.00 78.69  ? 3   HIS B C     1 
ATOM   5230  O  O     . HIS B 1 3   ? -4.638  17.214  29.062  1.00 77.69  ? 3   HIS B O     1 
ATOM   5231  C  CB    . HIS B 1 3   ? -5.240  20.061  26.760  1.00 84.31  ? 3   HIS B CB    1 
ATOM   5232  C  CG    . HIS B 1 3   ? -6.055  20.874  27.729  1.00 87.08  ? 3   HIS B CG    1 
ATOM   5233  N  ND1   . HIS B 1 3   ? -5.488  21.868  28.497  1.00 88.56  ? 3   HIS B ND1   1 
ATOM   5234  C  CD2   . HIS B 1 3   ? -7.397  21.020  27.860  1.00 88.33  ? 3   HIS B CD2   1 
ATOM   5235  C  CE1   . HIS B 1 3   ? -6.444  22.598  29.050  1.00 89.64  ? 3   HIS B CE1   1 
ATOM   5236  N  NE2   . HIS B 1 3   ? -7.609  22.106  28.681  1.00 90.12  ? 3   HIS B NE2   1 
ATOM   5237  N  N     . LEU B 1 4   ? -4.033  19.317  29.395  1.00 74.99  ? 4   LEU B N     1 
ATOM   5238  C  CA    . LEU B 1 4   ? -3.708  18.954  30.754  1.00 71.01  ? 4   LEU B CA    1 
ATOM   5239  C  C     . LEU B 1 4   ? -3.458  20.205  31.530  1.00 67.67  ? 4   LEU B C     1 
ATOM   5240  O  O     . LEU B 1 4   ? -3.916  21.243  31.147  1.00 68.78  ? 4   LEU B O     1 
ATOM   5241  C  CB    . LEU B 1 4   ? -2.479  18.064  30.776  1.00 71.18  ? 4   LEU B CB    1 
ATOM   5242  C  CG    . LEU B 1 4   ? -1.119  18.687  30.492  1.00 70.75  ? 4   LEU B CG    1 
ATOM   5243  C  CD1   . LEU B 1 4   ? -0.108  17.694  30.837  1.00 70.01  ? 4   LEU B CD1   1 
ATOM   5244  C  CD2   . LEU B 1 4   ? -0.941  19.030  29.057  1.00 71.91  ? 4   LEU B CD2   1 
ATOM   5245  N  N     . GLY B 1 5   ? -2.718  20.117  32.616  1.00 62.95  ? 5   GLY B N     1 
ATOM   5246  C  CA    . GLY B 1 5   ? -2.486  21.289  33.430  1.00 56.33  ? 5   GLY B CA    1 
ATOM   5247  C  C     . GLY B 1 5   ? -1.736  20.751  34.607  1.00 53.52  ? 5   GLY B C     1 
ATOM   5248  O  O     . GLY B 1 5   ? -2.175  20.808  35.756  1.00 52.03  ? 5   GLY B O     1 
ATOM   5249  N  N     . LYS B 1 6   ? -0.599  20.170  34.252  1.00 50.74  ? 6   LYS B N     1 
ATOM   5250  C  CA    . LYS B 1 6   ? 0.319   19.551  35.173  1.00 46.85  ? 6   LYS B CA    1 
ATOM   5251  C  C     . LYS B 1 6   ? 0.674   20.464  36.332  1.00 45.23  ? 6   LYS B C     1 
ATOM   5252  O  O     . LYS B 1 6   ? 0.807   21.665  36.178  1.00 43.48  ? 6   LYS B O     1 
ATOM   5253  C  CB    . LYS B 1 6   ? 1.575   19.145  34.423  1.00 45.78  ? 6   LYS B CB    1 
ATOM   5254  N  N     . THR B 1 7   ? 0.822   19.851  37.496  1.00 46.18  ? 7   THR B N     1 
ATOM   5255  C  CA    . THR B 1 7   ? 1.190   20.505  38.751  1.00 47.35  ? 7   THR B CA    1 
ATOM   5256  C  C     . THR B 1 7   ? 1.807   19.393  39.591  1.00 46.98  ? 7   THR B C     1 
ATOM   5257  O  O     . THR B 1 7   ? 1.685   18.221  39.244  1.00 47.43  ? 7   THR B O     1 
ATOM   5258  C  CB    . THR B 1 7   ? -0.051  21.087  39.484  1.00 48.16  ? 7   THR B CB    1 
ATOM   5259  O  OG1   . THR B 1 7   ? -0.677  22.088  38.664  1.00 50.68  ? 7   THR B OG1   1 
ATOM   5260  C  CG2   . THR B 1 7   ? 0.352   21.732  40.788  1.00 47.30  ? 7   THR B CG2   1 
ATOM   5261  N  N     . GLU B 1 8   ? 2.502   19.730  40.662  1.00 47.77  ? 8   GLU B N     1 
ATOM   5262  C  CA    . GLU B 1 8   ? 3.072   18.668  41.469  1.00 47.95  ? 8   GLU B CA    1 
ATOM   5263  C  C     . GLU B 1 8   ? 2.482   18.755  42.844  1.00 45.60  ? 8   GLU B C     1 
ATOM   5264  O  O     . GLU B 1 8   ? 2.244   19.837  43.362  1.00 46.26  ? 8   GLU B O     1 
ATOM   5265  C  CB    . GLU B 1 8   ? 4.595   18.745  41.525  1.00 50.37  ? 8   GLU B CB    1 
ATOM   5266  C  CG    . GLU B 1 8   ? 5.222   17.376  41.267  1.00 56.21  ? 8   GLU B CG    1 
ATOM   5267  C  CD    . GLU B 1 8   ? 6.740   17.354  41.381  1.00 60.48  ? 8   GLU B CD    1 
ATOM   5268  O  OE1   . GLU B 1 8   ? 7.299   18.265  42.035  1.00 62.57  ? 8   GLU B OE1   1 
ATOM   5269  O  OE2   . GLU B 1 8   ? 7.370   16.412  40.831  1.00 61.57  ? 8   GLU B OE2   1 
ATOM   5270  N  N     . VAL B 1 9   ? 2.240   17.607  43.441  1.00 43.10  ? 9   VAL B N     1 
ATOM   5271  C  CA    . VAL B 1 9   ? 1.626   17.600  44.744  1.00 41.58  ? 9   VAL B CA    1 
ATOM   5272  C  C     . VAL B 1 9   ? 2.360   16.623  45.669  1.00 40.48  ? 9   VAL B C     1 
ATOM   5273  O  O     . VAL B 1 9   ? 3.100   15.757  45.194  1.00 41.73  ? 9   VAL B O     1 
ATOM   5274  C  CB    . VAL B 1 9   ? 0.136   17.219  44.559  1.00 41.16  ? 9   VAL B CB    1 
ATOM   5275  C  CG1   . VAL B 1 9   ? -0.034  15.711  44.527  1.00 40.15  ? 9   VAL B CG1   1 
ATOM   5276  C  CG2   . VAL B 1 9   ? -0.695  17.858  45.616  1.00 42.89  ? 9   VAL B CG2   1 
ATOM   5277  N  N     . PHE B 1 10  ? 2.196   16.776  46.979  1.00 37.31  ? 10  PHE B N     1 
ATOM   5278  C  CA    . PHE B 1 10  ? 2.831   15.854  47.917  1.00 36.40  ? 10  PHE B CA    1 
ATOM   5279  C  C     . PHE B 1 10  ? 1.859   14.777  48.332  1.00 34.43  ? 10  PHE B C     1 
ATOM   5280  O  O     . PHE B 1 10  ? 0.680   15.040  48.555  1.00 36.01  ? 10  PHE B O     1 
ATOM   5281  C  CB    . PHE B 1 10  ? 3.318   16.571  49.178  1.00 38.93  ? 10  PHE B CB    1 
ATOM   5282  C  CG    . PHE B 1 10  ? 4.650   17.227  49.015  1.00 43.03  ? 10  PHE B CG    1 
ATOM   5283  C  CD1   . PHE B 1 10  ? 4.801   18.589  49.250  1.00 44.10  ? 10  PHE B CD1   1 
ATOM   5284  C  CD2   . PHE B 1 10  ? 5.752   16.485  48.589  1.00 43.87  ? 10  PHE B CD2   1 
ATOM   5285  C  CE1   . PHE B 1 10  ? 6.026   19.203  49.054  1.00 45.67  ? 10  PHE B CE1   1 
ATOM   5286  C  CE2   . PHE B 1 10  ? 6.977   17.083  48.391  1.00 44.52  ? 10  PHE B CE2   1 
ATOM   5287  C  CZ    . PHE B 1 10  ? 7.119   18.447  48.623  1.00 46.29  ? 10  PHE B CZ    1 
ATOM   5288  N  N     . LEU B 1 11  ? 2.335   13.553  48.436  1.00 31.95  ? 11  LEU B N     1 
ATOM   5289  C  CA    . LEU B 1 11  ? 1.434   12.513  48.863  1.00 30.91  ? 11  LEU B CA    1 
ATOM   5290  C  C     . LEU B 1 11  ? 1.668   12.116  50.305  1.00 31.09  ? 11  LEU B C     1 
ATOM   5291  O  O     . LEU B 1 11  ? 2.731   12.307  50.897  1.00 30.88  ? 11  LEU B O     1 
ATOM   5292  C  CB    . LEU B 1 11  ? 1.527   11.276  47.971  1.00 29.47  ? 11  LEU B CB    1 
ATOM   5293  C  CG    . LEU B 1 11  ? 0.825   11.330  46.614  1.00 27.91  ? 11  LEU B CG    1 
ATOM   5294  C  CD1   . LEU B 1 11  ? 1.046   10.013  45.898  1.00 27.72  ? 11  LEU B CD1   1 
ATOM   5295  C  CD2   . LEU B 1 11  ? -0.645  11.578  46.791  1.00 25.17  ? 11  LEU B CD2   1 
ATOM   5296  N  N     . ASN B 1 12  ? 0.606   11.571  50.852  1.00 32.00  ? 12  ASN B N     1 
ATOM   5297  C  CA    . ASN B 1 12  ? 0.511   11.069  52.197  1.00 31.49  ? 12  ASN B CA    1 
ATOM   5298  C  C     . ASN B 1 12  ? 1.562   9.964   52.340  1.00 31.21  ? 12  ASN B C     1 
ATOM   5299  O  O     . ASN B 1 12  ? 1.575   9.223   53.311  1.00 29.89  ? 12  ASN B O     1 
ATOM   5300  C  CB    . ASN B 1 12  ? -0.891  10.488  52.296  1.00 33.34  ? 12  ASN B CB    1 
ATOM   5301  C  CG    . ASN B 1 12  ? -1.369  10.393  53.674  1.00 38.70  ? 12  ASN B CG    1 
ATOM   5302  O  OD1   . ASN B 1 12  ? -1.281  11.355  54.439  1.00 43.05  ? 12  ASN B OD1   1 
ATOM   5303  N  ND2   . ASN B 1 12  ? -1.901  9.234   54.029  1.00 42.95  ? 12  ASN B ND2   1 
ATOM   5304  N  N     . ARG B 1 13  ? 2.457   9.867   51.361  1.00 31.98  ? 13  ARG B N     1 
ATOM   5305  C  CA    . ARG B 1 13  ? 3.441   8.790   51.329  1.00 31.47  ? 13  ARG B CA    1 
ATOM   5306  C  C     . ARG B 1 13  ? 4.897   9.166   51.492  1.00 31.94  ? 13  ARG B C     1 
ATOM   5307  O  O     . ARG B 1 13  ? 5.281   10.314  51.266  1.00 31.94  ? 13  ARG B O     1 
ATOM   5308  C  CB    . ARG B 1 13  ? 3.259   8.016   50.024  1.00 30.76  ? 13  ARG B CB    1 
ATOM   5309  C  CG    . ARG B 1 13  ? 1.816   7.584   49.783  1.00 29.72  ? 13  ARG B CG    1 
ATOM   5310  C  CD    . ARG B 1 13  ? 1.651   6.920   48.455  1.00 30.87  ? 13  ARG B CD    1 
ATOM   5311  N  NE    . ARG B 1 13  ? 0.292   6.442   48.237  1.00 31.63  ? 13  ARG B NE    1 
ATOM   5312  C  CZ    . ARG B 1 13  ? -0.151  6.038   47.051  1.00 31.93  ? 13  ARG B CZ    1 
ATOM   5313  N  NH1   . ARG B 1 13  ? 0.669   6.060   46.008  1.00 29.49  ? 13  ARG B NH1   1 
ATOM   5314  N  NH2   . ARG B 1 13  ? -1.408  5.643   46.897  1.00 32.05  ? 13  ARG B NH2   1 
ATOM   5315  N  N     . PHE B 1 14  ? 5.697   8.179   51.900  1.00 32.28  ? 14  PHE B N     1 
ATOM   5316  C  CA    . PHE B 1 14  ? 7.136   8.361   52.106  1.00 32.65  ? 14  PHE B CA    1 
ATOM   5317  C  C     . PHE B 1 14  ? 7.922   7.117   51.701  1.00 34.09  ? 14  PHE B C     1 
ATOM   5318  O  O     . PHE B 1 14  ? 7.580   5.996   52.076  1.00 33.76  ? 14  PHE B O     1 
ATOM   5319  C  CB    . PHE B 1 14  ? 7.453   8.668   53.568  1.00 31.00  ? 14  PHE B CB    1 
ATOM   5320  C  CG    . PHE B 1 14  ? 6.654   9.787   54.133  1.00 31.13  ? 14  PHE B CG    1 
ATOM   5321  C  CD1   . PHE B 1 14  ? 5.309   9.608   54.447  1.00 31.06  ? 14  PHE B CD1   1 
ATOM   5322  C  CD2   . PHE B 1 14  ? 7.231   11.023  54.343  1.00 30.66  ? 14  PHE B CD2   1 
ATOM   5323  C  CE1   . PHE B 1 14  ? 4.553   10.646  54.956  1.00 29.96  ? 14  PHE B CE1   1 
ATOM   5324  C  CE2   . PHE B 1 14  ? 6.486   12.061  54.850  1.00 30.90  ? 14  PHE B CE2   1 
ATOM   5325  C  CZ    . PHE B 1 14  ? 5.143   11.874  55.159  1.00 30.44  ? 14  PHE B CZ    1 
ATOM   5326  N  N     . ALA B 1 15  ? 8.978   7.324   50.924  1.00 35.59  ? 15  ALA B N     1 
ATOM   5327  C  CA    . ALA B 1 15  ? 9.824   6.228   50.486  1.00 36.07  ? 15  ALA B CA    1 
ATOM   5328  C  C     . ALA B 1 15  ? 10.923  6.030   51.540  1.00 37.74  ? 15  ALA B C     1 
ATOM   5329  O  O     . ALA B 1 15  ? 11.590  6.989   51.947  1.00 38.61  ? 15  ALA B O     1 
ATOM   5330  C  CB    . ALA B 1 15  ? 10.428  6.551   49.135  1.00 32.80  ? 15  ALA B CB    1 
ATOM   5331  N  N     . LEU B 1 16  ? 11.088  4.790   51.994  1.00 37.78  ? 16  LEU B N     1 
ATOM   5332  C  CA    . LEU B 1 16  ? 12.091  4.461   52.998  1.00 37.21  ? 16  LEU B CA    1 
ATOM   5333  C  C     . LEU B 1 16  ? 13.259  3.731   52.331  1.00 38.89  ? 16  LEU B C     1 
ATOM   5334  O  O     . LEU B 1 16  ? 13.289  3.600   51.102  1.00 40.69  ? 16  LEU B O     1 
ATOM   5335  C  CB    . LEU B 1 16  ? 11.456  3.606   54.094  1.00 35.82  ? 16  LEU B CB    1 
ATOM   5336  C  CG    . LEU B 1 16  ? 10.277  4.296   54.804  1.00 35.81  ? 16  LEU B CG    1 
ATOM   5337  C  CD1   . LEU B 1 16  ? 9.487   3.312   55.642  1.00 32.78  ? 16  LEU B CD1   1 
ATOM   5338  C  CD2   . LEU B 1 16  ? 10.803  5.403   55.671  1.00 36.16  ? 16  LEU B CD2   1 
ATOM   5339  N  N     . ARG B 1 17  ? 14.219  3.261   53.123  1.00 37.88  ? 17  ARG B N     1 
ATOM   5340  C  CA    . ARG B 1 17  ? 15.382  2.577   52.568  1.00 36.66  ? 17  ARG B CA    1 
ATOM   5341  C  C     . ARG B 1 17  ? 15.028  1.463   51.594  1.00 35.72  ? 17  ARG B C     1 
ATOM   5342  O  O     . ARG B 1 17  ? 13.914  0.967   51.583  1.00 35.09  ? 17  ARG B O     1 
ATOM   5343  C  CB    . ARG B 1 17  ? 16.245  1.997   53.685  1.00 38.16  ? 17  ARG B CB    1 
ATOM   5344  C  CG    . ARG B 1 17  ? 15.627  0.815   54.402  1.00 39.69  ? 17  ARG B CG    1 
ATOM   5345  C  CD    . ARG B 1 17  ? 16.695  -0.012  55.098  1.00 39.86  ? 17  ARG B CD    1 
ATOM   5346  N  NE    . ARG B 1 17  ? 16.446  -1.442  54.926  1.00 41.31  ? 17  ARG B NE    1 
ATOM   5347  C  CZ    . ARG B 1 17  ? 15.755  -2.184  55.778  1.00 39.41  ? 17  ARG B CZ    1 
ATOM   5348  N  NH1   . ARG B 1 17  ? 15.258  -1.619  56.861  1.00 40.33  ? 17  ARG B NH1   1 
ATOM   5349  N  NH2   . ARG B 1 17  ? 15.558  -3.474  55.541  1.00 38.06  ? 17  ARG B NH2   1 
ATOM   5350  N  N     . PRO B 1 18  ? 15.984  1.066   50.743  1.00 36.37  ? 18  PRO B N     1 
ATOM   5351  C  CA    . PRO B 1 18  ? 15.759  -0.005  49.764  1.00 36.70  ? 18  PRO B CA    1 
ATOM   5352  C  C     . PRO B 1 18  ? 15.823  -1.354  50.471  1.00 38.06  ? 18  PRO B C     1 
ATOM   5353  O  O     . PRO B 1 18  ? 16.525  -1.481  51.479  1.00 39.45  ? 18  PRO B O     1 
ATOM   5354  C  CB    . PRO B 1 18  ? 16.920  0.165   48.790  1.00 35.11  ? 18  PRO B CB    1 
ATOM   5355  C  CG    . PRO B 1 18  ? 17.346  1.594   48.984  1.00 34.05  ? 18  PRO B CG    1 
ATOM   5356  C  CD    . PRO B 1 18  ? 17.241  1.773   50.452  1.00 34.70  ? 18  PRO B CD    1 
ATOM   5357  N  N     . LEU B 1 19  ? 15.102  -2.352  49.955  1.00 38.51  ? 19  LEU B N     1 
ATOM   5358  C  CA    . LEU B 1 19  ? 15.099  -3.690  50.557  1.00 38.58  ? 19  LEU B CA    1 
ATOM   5359  C  C     . LEU B 1 19  ? 16.465  -4.342  50.401  1.00 39.54  ? 19  LEU B C     1 
ATOM   5360  O  O     . LEU B 1 19  ? 17.002  -4.388  49.290  1.00 40.54  ? 19  LEU B O     1 
ATOM   5361  C  CB    . LEU B 1 19  ? 14.051  -4.580  49.892  1.00 36.84  ? 19  LEU B CB    1 
ATOM   5362  C  CG    . LEU B 1 19  ? 12.617  -4.338  50.330  1.00 36.48  ? 19  LEU B CG    1 
ATOM   5363  C  CD1   . LEU B 1 19  ? 12.111  -3.052  49.738  1.00 36.20  ? 19  LEU B CD1   1 
ATOM   5364  C  CD2   . LEU B 1 19  ? 11.763  -5.508  49.901  1.00 37.67  ? 19  LEU B CD2   1 
ATOM   5365  N  N     . ASN B 1 20  ? 17.031  -4.843  51.498  1.00 39.09  ? 20  ASN B N     1 
ATOM   5366  C  CA    . ASN B 1 20  ? 18.342  -5.476  51.424  1.00 39.20  ? 20  ASN B CA    1 
ATOM   5367  C  C     . ASN B 1 20  ? 18.215  -6.827  50.753  1.00 39.57  ? 20  ASN B C     1 
ATOM   5368  O  O     . ASN B 1 20  ? 17.119  -7.353  50.602  1.00 40.63  ? 20  ASN B O     1 
ATOM   5369  C  CB    . ASN B 1 20  ? 18.963  -5.633  52.816  1.00 39.99  ? 20  ASN B CB    1 
ATOM   5370  C  CG    . ASN B 1 20  ? 18.104  -6.445  53.752  1.00 41.76  ? 20  ASN B CG    1 
ATOM   5371  O  OD1   . ASN B 1 20  ? 17.765  -7.587  53.460  1.00 44.04  ? 20  ASN B OD1   1 
ATOM   5372  N  ND2   . ASN B 1 20  ? 17.751  -5.862  54.893  1.00 41.46  ? 20  ASN B ND2   1 
ATOM   5373  N  N     . PRO B 1 21  ? 19.337  -7.405  50.330  1.00 39.84  ? 21  PRO B N     1 
ATOM   5374  C  CA    . PRO B 1 21  ? 19.362  -8.703  49.662  1.00 40.60  ? 21  PRO B CA    1 
ATOM   5375  C  C     . PRO B 1 21  ? 18.654  -9.849  50.377  1.00 42.46  ? 21  PRO B C     1 
ATOM   5376  O  O     . PRO B 1 21  ? 18.172  -10.779 49.735  1.00 44.13  ? 21  PRO B O     1 
ATOM   5377  C  CB    . PRO B 1 21  ? 20.849  -8.959  49.478  1.00 40.59  ? 21  PRO B CB    1 
ATOM   5378  C  CG    . PRO B 1 21  ? 21.483  -8.148  50.551  1.00 40.60  ? 21  PRO B CG    1 
ATOM   5379  C  CD    . PRO B 1 21  ? 20.699  -6.890  50.499  1.00 40.63  ? 21  PRO B CD    1 
ATOM   5380  N  N     . GLU B 1 22  ? 18.582  -9.796  51.699  1.00 43.20  ? 22  GLU B N     1 
ATOM   5381  C  CA    . GLU B 1 22  ? 17.913  -10.860 52.434  1.00 43.33  ? 22  GLU B CA    1 
ATOM   5382  C  C     . GLU B 1 22  ? 16.398  -10.715 52.346  1.00 43.03  ? 22  GLU B C     1 
ATOM   5383  O  O     . GLU B 1 22  ? 15.650  -11.653 52.609  1.00 43.43  ? 22  GLU B O     1 
ATOM   5384  C  CB    . GLU B 1 22  ? 18.342  -10.842 53.898  1.00 44.79  ? 22  GLU B CB    1 
ATOM   5385  C  CG    . GLU B 1 22  ? 19.796  -11.229 54.152  1.00 48.76  ? 22  GLU B CG    1 
ATOM   5386  C  CD    . GLU B 1 22  ? 20.797  -10.184 53.679  1.00 50.77  ? 22  GLU B CD    1 
ATOM   5387  O  OE1   . GLU B 1 22  ? 20.554  -8.981  53.916  1.00 53.12  ? 22  GLU B OE1   1 
ATOM   5388  O  OE2   . GLU B 1 22  ? 21.835  -10.565 53.089  1.00 50.68  ? 22  GLU B OE2   1 
ATOM   5389  N  N     . GLU B 1 23  ? 15.942  -9.531  51.974  1.00 43.11  ? 23  GLU B N     1 
ATOM   5390  C  CA    . GLU B 1 23  ? 14.516  -9.291  51.873  1.00 43.96  ? 23  GLU B CA    1 
ATOM   5391  C  C     . GLU B 1 23  ? 14.013  -9.585  50.479  1.00 43.24  ? 23  GLU B C     1 
ATOM   5392  O  O     . GLU B 1 23  ? 12.855  -9.934  50.297  1.00 43.27  ? 23  GLU B O     1 
ATOM   5393  C  CB    . GLU B 1 23  ? 14.192  -7.853  52.284  1.00 45.86  ? 23  GLU B CB    1 
ATOM   5394  C  CG    . GLU B 1 23  ? 14.509  -7.586  53.750  1.00 48.41  ? 23  GLU B CG    1 
ATOM   5395  C  CD    . GLU B 1 23  ? 14.420  -6.126  54.122  1.00 51.28  ? 23  GLU B CD    1 
ATOM   5396  O  OE1   . GLU B 1 23  ? 15.126  -5.297  53.499  1.00 52.51  ? 23  GLU B OE1   1 
ATOM   5397  O  OE2   . GLU B 1 23  ? 13.647  -5.804  55.047  1.00 53.96  ? 23  GLU B OE2   1 
ATOM   5398  N  N     . LEU B 1 24  ? 14.884  -9.457  49.490  1.00 42.78  ? 24  LEU B N     1 
ATOM   5399  C  CA    . LEU B 1 24  ? 14.482  -9.752  48.123  1.00 43.42  ? 24  LEU B CA    1 
ATOM   5400  C  C     . LEU B 1 24  ? 14.431  -11.270 47.912  1.00 44.27  ? 24  LEU B C     1 
ATOM   5401  O  O     . LEU B 1 24  ? 13.767  -11.749 47.002  1.00 45.18  ? 24  LEU B O     1 
ATOM   5402  C  CB    . LEU B 1 24  ? 15.453  -9.104  47.137  1.00 41.30  ? 24  LEU B CB    1 
ATOM   5403  C  CG    . LEU B 1 24  ? 15.481  -7.586  47.282  1.00 40.03  ? 24  LEU B CG    1 
ATOM   5404  C  CD1   . LEU B 1 24  ? 16.661  -6.981  46.522  1.00 37.59  ? 24  LEU B CD1   1 
ATOM   5405  C  CD2   . LEU B 1 24  ? 14.147  -7.041  46.799  1.00 38.33  ? 24  LEU B CD2   1 
ATOM   5406  N  N     . ARG B 1 25  ? 15.123  -12.024 48.758  1.00 44.79  ? 25  ARG B N     1 
ATOM   5407  C  CA    . ARG B 1 25  ? 15.124  -13.474 48.640  1.00 45.88  ? 25  ARG B CA    1 
ATOM   5408  C  C     . ARG B 1 25  ? 14.450  -14.101 49.866  1.00 44.93  ? 25  ARG B C     1 
ATOM   5409  O  O     . ARG B 1 25  ? 15.112  -14.534 50.813  1.00 44.84  ? 25  ARG B O     1 
ATOM   5410  C  CB    . ARG B 1 25  ? 16.560  -14.000 48.506  1.00 49.90  ? 25  ARG B CB    1 
ATOM   5411  C  CG    . ARG B 1 25  ? 17.454  -13.153 47.617  1.00 56.06  ? 25  ARG B CG    1 
ATOM   5412  C  CD    . ARG B 1 25  ? 18.774  -13.845 47.264  1.00 62.25  ? 25  ARG B CD    1 
ATOM   5413  N  NE    . ARG B 1 25  ? 18.601  -14.916 46.275  1.00 68.77  ? 25  ARG B NE    1 
ATOM   5414  C  CZ    . ARG B 1 25  ? 19.584  -15.428 45.527  1.00 71.27  ? 25  ARG B CZ    1 
ATOM   5415  N  NH1   . ARG B 1 25  ? 20.830  -14.976 45.638  1.00 72.20  ? 25  ARG B NH1   1 
ATOM   5416  N  NH2   . ARG B 1 25  ? 19.322  -16.402 44.664  1.00 71.98  ? 25  ARG B NH2   1 
ATOM   5417  N  N     . PRO B 1 26  ? 13.114  -14.133 49.877  1.00 43.35  ? 26  PRO B N     1 
ATOM   5418  C  CA    . PRO B 1 26  ? 12.390  -14.718 51.006  1.00 43.00  ? 26  PRO B CA    1 
ATOM   5419  C  C     . PRO B 1 26  ? 12.386  -16.226 50.909  1.00 43.52  ? 26  PRO B C     1 
ATOM   5420  O  O     . PRO B 1 26  ? 12.721  -16.772 49.867  1.00 43.12  ? 26  PRO B O     1 
ATOM   5421  C  CB    . PRO B 1 26  ? 10.999  -14.141 50.848  1.00 41.64  ? 26  PRO B CB    1 
ATOM   5422  C  CG    . PRO B 1 26  ? 10.871  -14.028 49.369  1.00 41.02  ? 26  PRO B CG    1 
ATOM   5423  C  CD    . PRO B 1 26  ? 12.188  -13.453 48.959  1.00 41.94  ? 26  PRO B CD    1 
ATOM   5424  N  N     . TRP B 1 27  ? 12.011  -16.904 51.987  1.00 45.60  ? 27  TRP B N     1 
ATOM   5425  C  CA    . TRP B 1 27  ? 11.970  -18.356 51.949  1.00 48.39  ? 27  TRP B CA    1 
ATOM   5426  C  C     . TRP B 1 27  ? 10.783  -18.762 51.084  1.00 49.53  ? 27  TRP B C     1 
ATOM   5427  O  O     . TRP B 1 27  ? 9.726   -18.134 51.116  1.00 48.02  ? 27  TRP B O     1 
ATOM   5428  C  CB    . TRP B 1 27  ? 11.791  -18.965 53.347  1.00 50.17  ? 27  TRP B CB    1 
ATOM   5429  C  CG    . TRP B 1 27  ? 12.495  -18.252 54.452  1.00 53.51  ? 27  TRP B CG    1 
ATOM   5430  C  CD1   . TRP B 1 27  ? 12.002  -17.230 55.217  1.00 54.88  ? 27  TRP B CD1   1 
ATOM   5431  C  CD2   . TRP B 1 27  ? 13.821  -18.502 54.927  1.00 55.57  ? 27  TRP B CD2   1 
ATOM   5432  N  NE1   . TRP B 1 27  ? 12.941  -16.827 56.144  1.00 55.02  ? 27  TRP B NE1   1 
ATOM   5433  C  CE2   . TRP B 1 27  ? 14.066  -17.587 55.988  1.00 55.66  ? 27  TRP B CE2   1 
ATOM   5434  C  CE3   . TRP B 1 27  ? 14.826  -19.401 54.560  1.00 56.67  ? 27  TRP B CE3   1 
ATOM   5435  C  CZ2   . TRP B 1 27  ? 15.277  -17.550 56.683  1.00 56.29  ? 27  TRP B CZ2   1 
ATOM   5436  C  CZ3   . TRP B 1 27  ? 16.038  -19.365 55.255  1.00 59.40  ? 27  TRP B CZ3   1 
ATOM   5437  C  CH2   . TRP B 1 27  ? 16.250  -18.442 56.306  1.00 58.75  ? 27  TRP B CH2   1 
ATOM   5438  N  N     . ARG B 1 28  ? 10.968  -19.807 50.295  1.00 52.11  ? 28  ARG B N     1 
ATOM   5439  C  CA    . ARG B 1 28  ? 9.905   -20.304 49.445  1.00 54.18  ? 28  ARG B CA    1 
ATOM   5440  C  C     . ARG B 1 28  ? 9.449   -21.608 50.064  1.00 54.03  ? 28  ARG B C     1 
ATOM   5441  O  O     . ARG B 1 28  ? 10.267  -22.415 50.482  1.00 54.48  ? 28  ARG B O     1 
ATOM   5442  C  CB    . ARG B 1 28  ? 10.427  -20.531 48.020  1.00 56.77  ? 28  ARG B CB    1 
ATOM   5443  C  CG    . ARG B 1 28  ? 9.752   -21.686 47.280  1.00 62.46  ? 28  ARG B CG    1 
ATOM   5444  C  CD    . ARG B 1 28  ? 9.667   -21.459 45.774  1.00 63.84  ? 28  ARG B CD    1 
ATOM   5445  N  NE    . ARG B 1 28  ? 8.401   -20.832 45.392  1.00 66.02  ? 28  ARG B NE    1 
ATOM   5446  C  CZ    . ARG B 1 28  ? 7.232   -21.470 45.342  1.00 66.99  ? 28  ARG B CZ    1 
ATOM   5447  N  NH1   . ARG B 1 28  ? 7.165   -22.758 45.648  1.00 68.34  ? 28  ARG B NH1   1 
ATOM   5448  N  NH2   . ARG B 1 28  ? 6.131   -20.825 44.976  1.00 66.19  ? 28  ARG B NH2   1 
ATOM   5449  N  N     . LEU B 1 29  ? 8.147   -21.814 50.150  1.00 54.98  ? 29  LEU B N     1 
ATOM   5450  C  CA    . LEU B 1 29  ? 7.654   -23.051 50.726  1.00 57.51  ? 29  LEU B CA    1 
ATOM   5451  C  C     . LEU B 1 29  ? 6.643   -23.779 49.852  1.00 58.65  ? 29  LEU B C     1 
ATOM   5452  O  O     . LEU B 1 29  ? 5.698   -23.184 49.331  1.00 59.38  ? 29  LEU B O     1 
ATOM   5453  C  CB    . LEU B 1 29  ? 7.024   -22.800 52.094  1.00 57.64  ? 29  LEU B CB    1 
ATOM   5454  C  CG    . LEU B 1 29  ? 7.945   -22.518 53.269  1.00 56.62  ? 29  LEU B CG    1 
ATOM   5455  C  CD1   . LEU B 1 29  ? 8.352   -21.059 53.275  1.00 56.55  ? 29  LEU B CD1   1 
ATOM   5456  C  CD2   . LEU B 1 29  ? 7.201   -22.863 54.542  1.00 57.09  ? 29  LEU B CD2   1 
ATOM   5457  N  N     . GLU B 1 30  ? 6.847   -25.079 49.704  1.00 59.38  ? 30  GLU B N     1 
ATOM   5458  C  CA    . GLU B 1 30  ? 5.943   -25.897 48.923  1.00 60.71  ? 30  GLU B CA    1 
ATOM   5459  C  C     . GLU B 1 30  ? 4.806   -26.299 49.848  1.00 60.35  ? 30  GLU B C     1 
ATOM   5460  O  O     . GLU B 1 30  ? 5.028   -26.546 51.032  1.00 59.88  ? 30  GLU B O     1 
ATOM   5461  C  CB    . GLU B 1 30  ? 6.657   -27.152 48.433  1.00 62.79  ? 30  GLU B CB    1 
ATOM   5462  C  CG    . GLU B 1 30  ? 6.269   -27.551 47.032  1.00 65.79  ? 30  GLU B CG    1 
ATOM   5463  C  CD    . GLU B 1 30  ? 7.350   -27.198 46.042  1.00 67.84  ? 30  GLU B CD    1 
ATOM   5464  O  OE1   . GLU B 1 30  ? 8.271   -28.025 45.868  1.00 68.48  ? 30  GLU B OE1   1 
ATOM   5465  O  OE2   . GLU B 1 30  ? 7.291   -26.089 45.460  1.00 69.11  ? 30  GLU B OE2   1 
ATOM   5466  N  N     . VAL B 1 31  ? 3.590   -26.360 49.324  1.00 60.15  ? 31  VAL B N     1 
ATOM   5467  C  CA    . VAL B 1 31  ? 2.473   -26.755 50.159  1.00 61.13  ? 31  VAL B CA    1 
ATOM   5468  C  C     . VAL B 1 31  ? 1.917   -28.089 49.695  1.00 62.37  ? 31  VAL B C     1 
ATOM   5469  O  O     . VAL B 1 31  ? 1.906   -28.385 48.506  1.00 63.77  ? 31  VAL B O     1 
ATOM   5470  C  CB    . VAL B 1 31  ? 1.341   -25.723 50.124  1.00 60.86  ? 31  VAL B CB    1 
ATOM   5471  C  CG1   . VAL B 1 31  ? 0.290   -26.076 51.158  1.00 60.77  ? 31  VAL B CG1   1 
ATOM   5472  C  CG2   . VAL B 1 31  ? 1.891   -24.345 50.381  1.00 61.51  ? 31  VAL B CG2   1 
ATOM   5473  N  N     . VAL B 1 32  ? 1.467   -28.891 50.650  1.00 63.80  ? 32  VAL B N     1 
ATOM   5474  C  CA    . VAL B 1 32  ? 0.883   -30.196 50.378  1.00 64.62  ? 32  VAL B CA    1 
ATOM   5475  C  C     . VAL B 1 32  ? -0.445  -30.227 51.111  1.00 65.95  ? 32  VAL B C     1 
ATOM   5476  O  O     . VAL B 1 32  ? -0.491  -30.075 52.323  1.00 65.42  ? 32  VAL B O     1 
ATOM   5477  C  CB    . VAL B 1 32  ? 1.783   -31.338 50.904  1.00 64.38  ? 32  VAL B CB    1 
ATOM   5478  C  CG1   . VAL B 1 32  ? 0.980   -32.613 51.058  1.00 63.67  ? 32  VAL B CG1   1 
ATOM   5479  C  CG2   . VAL B 1 32  ? 2.943   -31.567 49.945  1.00 64.40  ? 32  VAL B CG2   1 
ATOM   5480  N  N     . LEU B 1 33  ? -1.527  -30.412 50.374  1.00 68.28  ? 33  LEU B N     1 
ATOM   5481  C  CA    . LEU B 1 33  ? -2.840  -30.447 50.992  1.00 71.40  ? 33  LEU B CA    1 
ATOM   5482  C  C     . LEU B 1 33  ? -3.513  -31.804 50.871  1.00 73.30  ? 33  LEU B C     1 
ATOM   5483  O  O     . LEU B 1 33  ? -3.443  -32.455 49.824  1.00 74.00  ? 33  LEU B O     1 
ATOM   5484  C  CB    . LEU B 1 33  ? -3.727  -29.366 50.378  1.00 71.05  ? 33  LEU B CB    1 
ATOM   5485  C  CG    . LEU B 1 33  ? -3.389  -27.966 50.878  1.00 71.14  ? 33  LEU B CG    1 
ATOM   5486  C  CD1   . LEU B 1 33  ? -3.911  -26.921 49.922  1.00 71.09  ? 33  LEU B CD1   1 
ATOM   5487  C  CD2   . LEU B 1 33  ? -3.982  -27.788 52.259  1.00 71.27  ? 33  LEU B CD2   1 
ATOM   5488  N  N     . ASP B 1 34  ? -4.167  -32.217 51.954  1.00 75.03  ? 34  ASP B N     1 
ATOM   5489  C  CA    . ASP B 1 34  ? -4.873  -33.496 52.003  1.00 76.20  ? 34  ASP B CA    1 
ATOM   5490  C  C     . ASP B 1 34  ? -6.282  -33.272 52.546  1.00 77.32  ? 34  ASP B C     1 
ATOM   5491  O  O     . ASP B 1 34  ? -6.450  -32.865 53.695  1.00 76.82  ? 34  ASP B O     1 
ATOM   5492  C  CB    . ASP B 1 34  ? -4.130  -34.462 52.917  1.00 75.82  ? 34  ASP B CB    1 
ATOM   5493  C  CG    . ASP B 1 34  ? -4.582  -35.888 52.736  1.00 75.11  ? 34  ASP B CG    1 
ATOM   5494  O  OD1   . ASP B 1 34  ? -4.522  -36.656 53.722  1.00 74.78  ? 34  ASP B OD1   1 
ATOM   5495  O  OD2   . ASP B 1 34  ? -4.981  -36.241 51.604  1.00 74.38  ? 34  ASP B OD2   1 
ATOM   5496  N  N     . PRO B 1 35  ? -7.316  -33.574 51.745  1.00 78.94  ? 35  PRO B N     1 
ATOM   5497  C  CA    . PRO B 1 35  ? -7.312  -34.084 50.371  1.00 81.40  ? 35  PRO B CA    1 
ATOM   5498  C  C     . PRO B 1 35  ? -7.029  -33.039 49.292  1.00 84.15  ? 35  PRO B C     1 
ATOM   5499  O  O     . PRO B 1 35  ? -7.336  -31.857 49.468  1.00 84.42  ? 35  PRO B O     1 
ATOM   5500  C  CB    . PRO B 1 35  ? -8.708  -34.671 50.241  1.00 80.68  ? 35  PRO B CB    1 
ATOM   5501  C  CG    . PRO B 1 35  ? -9.519  -33.695 51.007  1.00 79.40  ? 35  PRO B CG    1 
ATOM   5502  C  CD    . PRO B 1 35  ? -8.693  -33.508 52.259  1.00 79.36  ? 35  PRO B CD    1 
ATOM   5503  N  N     . PRO B 1 36  ? -6.455  -33.470 48.149  1.00 86.54  ? 36  PRO B N     1 
ATOM   5504  C  CA    . PRO B 1 36  ? -6.119  -32.591 47.018  1.00 87.66  ? 36  PRO B CA    1 
ATOM   5505  C  C     . PRO B 1 36  ? -7.269  -31.655 46.674  1.00 88.27  ? 36  PRO B C     1 
ATOM   5506  O  O     . PRO B 1 36  ? -8.390  -32.099 46.438  1.00 88.84  ? 36  PRO B O     1 
ATOM   5507  C  CB    . PRO B 1 36  ? -5.823  -33.575 45.890  1.00 88.16  ? 36  PRO B CB    1 
ATOM   5508  C  CG    . PRO B 1 36  ? -5.240  -34.747 46.623  1.00 88.24  ? 36  PRO B CG    1 
ATOM   5509  C  CD    . PRO B 1 36  ? -6.165  -34.880 47.818  1.00 87.20  ? 36  PRO B CD    1 
ATOM   5510  N  N     . PRO B 1 37  ? -6.999  -30.343 46.637  1.00 88.92  ? 37  PRO B N     1 
ATOM   5511  C  CA    . PRO B 1 37  ? -7.982  -29.295 46.331  1.00 89.60  ? 37  PRO B CA    1 
ATOM   5512  C  C     . PRO B 1 37  ? -8.479  -29.246 44.876  1.00 89.94  ? 37  PRO B C     1 
ATOM   5513  O  O     . PRO B 1 37  ? -8.009  -29.994 44.010  1.00 90.75  ? 37  PRO B O     1 
ATOM   5514  C  CB    . PRO B 1 37  ? -7.246  -28.007 46.714  1.00 89.49  ? 37  PRO B CB    1 
ATOM   5515  C  CG    . PRO B 1 37  ? -6.170  -28.473 47.670  1.00 89.25  ? 37  PRO B CG    1 
ATOM   5516  C  CD    . PRO B 1 37  ? -5.716  -29.747 47.043  1.00 88.81  ? 37  PRO B CD    1 
ATOM   5517  N  N     . GLY B 1 38  ? -9.434  -28.353 44.622  1.00 88.96  ? 38  GLY B N     1 
ATOM   5518  C  CA    . GLY B 1 38  ? -9.968  -28.190 43.285  1.00 87.95  ? 38  GLY B CA    1 
ATOM   5519  C  C     . GLY B 1 38  ? -9.669  -26.784 42.812  1.00 87.79  ? 38  GLY B C     1 
ATOM   5520  O  O     . GLY B 1 38  ? -10.077 -25.824 43.454  1.00 87.82  ? 38  GLY B O     1 
ATOM   5521  N  N     . ARG B 1 39  ? -8.955  -26.668 41.695  1.00 87.85  ? 39  ARG B N     1 
ATOM   5522  C  CA    . ARG B 1 39  ? -8.563  -25.382 41.111  1.00 87.98  ? 39  ARG B CA    1 
ATOM   5523  C  C     . ARG B 1 39  ? -9.103  -24.101 41.764  1.00 87.37  ? 39  ARG B C     1 
ATOM   5524  O  O     . ARG B 1 39  ? -8.329  -23.288 42.267  1.00 87.33  ? 39  ARG B O     1 
ATOM   5525  C  CB    . ARG B 1 39  ? -8.905  -25.360 39.615  1.00 88.91  ? 39  ARG B CB    1 
ATOM   5526  C  CG    . ARG B 1 39  ? -8.440  -24.096 38.902  1.00 90.35  ? 39  ARG B CG    1 
ATOM   5527  C  CD    . ARG B 1 39  ? -8.772  -24.122 37.424  1.00 92.32  ? 39  ARG B CD    1 
ATOM   5528  N  NE    . ARG B 1 39  ? -8.447  -22.855 36.770  1.00 95.23  ? 39  ARG B NE    1 
ATOM   5529  C  CZ    . ARG B 1 39  ? -7.214  -22.431 36.492  1.00 96.47  ? 39  ARG B CZ    1 
ATOM   5530  N  NH1   . ARG B 1 39  ? -6.154  -23.175 36.804  1.00 96.20  ? 39  ARG B NH1   1 
ATOM   5531  N  NH2   . ARG B 1 39  ? -7.041  -21.254 35.897  1.00 96.65  ? 39  ARG B NH2   1 
ATOM   5532  N  N     . GLU B 1 40  ? -10.418 -23.914 41.758  1.00 86.76  ? 40  GLU B N     1 
ATOM   5533  C  CA    . GLU B 1 40  ? -11.013 -22.705 42.328  1.00 86.00  ? 40  GLU B CA    1 
ATOM   5534  C  C     . GLU B 1 40  ? -11.052 -22.596 43.858  1.00 84.09  ? 40  GLU B C     1 
ATOM   5535  O  O     . GLU B 1 40  ? -11.843 -21.830 44.411  1.00 83.61  ? 40  GLU B O     1 
ATOM   5536  C  CB    . GLU B 1 40  ? -12.421 -22.501 41.749  1.00 88.77  ? 40  GLU B CB    1 
ATOM   5537  C  CG    . GLU B 1 40  ? -13.374 -23.684 41.901  1.00 93.21  ? 40  GLU B CG    1 
ATOM   5538  C  CD    . GLU B 1 40  ? -13.836 -23.893 43.336  1.00 96.82  ? 40  GLU B CD    1 
ATOM   5539  O  OE1   . GLU B 1 40  ? -14.364 -22.935 43.947  1.00 98.75  ? 40  GLU B OE1   1 
ATOM   5540  O  OE2   . GLU B 1 40  ? -13.678 -25.020 43.854  1.00 99.01  ? 40  GLU B OE2   1 
ATOM   5541  N  N     . GLU B 1 41  ? -10.194 -23.350 44.539  1.00 81.97  ? 41  GLU B N     1 
ATOM   5542  C  CA    . GLU B 1 41  ? -10.133 -23.303 45.998  1.00 80.03  ? 41  GLU B CA    1 
ATOM   5543  C  C     . GLU B 1 41  ? -8.684  -23.379 46.503  1.00 78.15  ? 41  GLU B C     1 
ATOM   5544  O  O     . GLU B 1 41  ? -8.431  -23.239 47.699  1.00 77.63  ? 41  GLU B O     1 
ATOM   5545  C  CB    . GLU B 1 41  ? -10.952 -24.444 46.614  1.00 81.06  ? 41  GLU B CB    1 
ATOM   5546  C  CG    . GLU B 1 41  ? -10.400 -25.833 46.320  1.00 83.60  ? 41  GLU B CG    1 
ATOM   5547  C  CD    . GLU B 1 41  ? -11.007 -26.918 47.195  1.00 84.89  ? 41  GLU B CD    1 
ATOM   5548  O  OE1   . GLU B 1 41  ? -12.249 -26.983 47.299  1.00 86.58  ? 41  GLU B OE1   1 
ATOM   5549  O  OE2   . GLU B 1 41  ? -10.239 -27.716 47.771  1.00 84.67  ? 41  GLU B OE2   1 
ATOM   5550  N  N     . VAL B 1 42  ? -7.737  -23.601 45.593  1.00 75.94  ? 42  VAL B N     1 
ATOM   5551  C  CA    . VAL B 1 42  ? -6.331  -23.690 45.975  1.00 73.61  ? 42  VAL B CA    1 
ATOM   5552  C  C     . VAL B 1 42  ? -5.873  -22.355 46.543  1.00 73.50  ? 42  VAL B C     1 
ATOM   5553  O  O     . VAL B 1 42  ? -5.573  -22.269 47.729  1.00 74.44  ? 42  VAL B O     1 
ATOM   5554  C  CB    . VAL B 1 42  ? -5.409  -24.082 44.774  1.00 72.98  ? 42  VAL B CB    1 
ATOM   5555  C  CG1   . VAL B 1 42  ? -3.958  -24.200 45.239  1.00 69.83  ? 42  VAL B CG1   1 
ATOM   5556  C  CG2   . VAL B 1 42  ? -5.862  -25.409 44.168  1.00 71.64  ? 42  VAL B CG2   1 
ATOM   5557  N  N     . TYR B 1 43  ? -5.838  -21.315 45.709  1.00 72.51  ? 43  TYR B N     1 
ATOM   5558  C  CA    . TYR B 1 43  ? -5.409  -19.977 46.138  1.00 71.79  ? 43  TYR B CA    1 
ATOM   5559  C  C     . TYR B 1 43  ? -5.917  -19.552 47.506  1.00 70.91  ? 43  TYR B C     1 
ATOM   5560  O  O     . TYR B 1 43  ? -5.131  -19.198 48.386  1.00 70.45  ? 43  TYR B O     1 
ATOM   5561  C  CB    . TYR B 1 43  ? -5.825  -18.920 45.107  1.00 72.35  ? 43  TYR B CB    1 
ATOM   5562  C  CG    . TYR B 1 43  ? -4.866  -18.815 43.950  1.00 73.70  ? 43  TYR B CG    1 
ATOM   5563  C  CD1   . TYR B 1 43  ? -4.095  -19.915 43.577  1.00 75.07  ? 43  TYR B CD1   1 
ATOM   5564  C  CD2   . TYR B 1 43  ? -4.755  -17.642 43.196  1.00 73.86  ? 43  TYR B CD2   1 
ATOM   5565  C  CE1   . TYR B 1 43  ? -3.236  -19.866 42.478  1.00 76.07  ? 43  TYR B CE1   1 
ATOM   5566  C  CE2   . TYR B 1 43  ? -3.896  -17.577 42.088  1.00 74.99  ? 43  TYR B CE2   1 
ATOM   5567  C  CZ    . TYR B 1 43  ? -3.143  -18.701 41.734  1.00 76.06  ? 43  TYR B CZ    1 
ATOM   5568  O  OH    . TYR B 1 43  ? -2.333  -18.694 40.618  1.00 76.16  ? 43  TYR B OH    1 
ATOM   5569  N  N     . PRO B 1 44  ? -7.244  -19.578 47.704  1.00 70.26  ? 44  PRO B N     1 
ATOM   5570  C  CA    . PRO B 1 44  ? -7.792  -19.175 49.001  1.00 69.36  ? 44  PRO B CA    1 
ATOM   5571  C  C     . PRO B 1 44  ? -7.255  -20.046 50.129  1.00 68.40  ? 44  PRO B C     1 
ATOM   5572  O  O     . PRO B 1 44  ? -6.997  -19.558 51.228  1.00 68.13  ? 44  PRO B O     1 
ATOM   5573  C  CB    . PRO B 1 44  ? -9.297  -19.326 48.799  1.00 69.45  ? 44  PRO B CB    1 
ATOM   5574  C  CG    . PRO B 1 44  ? -9.459  -19.117 47.306  1.00 69.88  ? 44  PRO B CG    1 
ATOM   5575  C  CD    . PRO B 1 44  ? -8.325  -19.941 46.775  1.00 69.72  ? 44  PRO B CD    1 
ATOM   5576  N  N     . LEU B 1 45  ? -7.076  -21.333 49.848  1.00 67.36  ? 45  LEU B N     1 
ATOM   5577  C  CA    . LEU B 1 45  ? -6.556  -22.265 50.847  1.00 65.98  ? 45  LEU B CA    1 
ATOM   5578  C  C     . LEU B 1 45  ? -5.120  -21.940 51.252  1.00 64.41  ? 45  LEU B C     1 
ATOM   5579  O  O     . LEU B 1 45  ? -4.783  -21.955 52.437  1.00 63.53  ? 45  LEU B O     1 
ATOM   5580  C  CB    . LEU B 1 45  ? -6.633  -23.702 50.322  1.00 66.52  ? 45  LEU B CB    1 
ATOM   5581  C  CG    . LEU B 1 45  ? -8.000  -24.369 50.455  1.00 67.27  ? 45  LEU B CG    1 
ATOM   5582  C  CD1   . LEU B 1 45  ? -8.045  -25.659 49.660  1.00 67.66  ? 45  LEU B CD1   1 
ATOM   5583  C  CD2   . LEU B 1 45  ? -8.272  -24.630 51.926  1.00 67.75  ? 45  LEU B CD2   1 
ATOM   5584  N  N     . LEU B 1 46  ? -4.280  -21.643 50.266  1.00 62.53  ? 46  LEU B N     1 
ATOM   5585  C  CA    . LEU B 1 46  ? -2.886  -21.316 50.529  1.00 61.11  ? 46  LEU B CA    1 
ATOM   5586  C  C     . LEU B 1 46  ? -2.788  -20.082 51.418  1.00 60.62  ? 46  LEU B C     1 
ATOM   5587  O  O     . LEU B 1 46  ? -1.976  -20.027 52.346  1.00 59.35  ? 46  LEU B O     1 
ATOM   5588  C  CB    . LEU B 1 46  ? -2.145  -21.065 49.211  1.00 60.36  ? 46  LEU B CB    1 
ATOM   5589  C  CG    . LEU B 1 46  ? -1.984  -22.237 48.234  1.00 60.70  ? 46  LEU B CG    1 
ATOM   5590  C  CD1   . LEU B 1 46  ? -1.347  -21.732 46.948  1.00 59.51  ? 46  LEU B CD1   1 
ATOM   5591  C  CD2   . LEU B 1 46  ? -1.133  -23.345 48.856  1.00 59.98  ? 46  LEU B CD2   1 
ATOM   5592  N  N     . ALA B 1 47  ? -3.634  -19.097 51.131  1.00 60.41  ? 47  ALA B N     1 
ATOM   5593  C  CA    . ALA B 1 47  ? -3.650  -17.854 51.883  1.00 60.43  ? 47  ALA B CA    1 
ATOM   5594  C  C     . ALA B 1 47  ? -4.032  -18.088 53.333  1.00 61.34  ? 47  ALA B C     1 
ATOM   5595  O  O     . ALA B 1 47  ? -3.410  -17.531 54.234  1.00 61.57  ? 47  ALA B O     1 
ATOM   5596  C  CB    . ALA B 1 47  ? -4.602  -16.868 51.239  1.00 59.71  ? 47  ALA B CB    1 
ATOM   5597  N  N     . GLN B 1 48  ? -5.054  -18.907 53.564  1.00 62.71  ? 48  GLN B N     1 
ATOM   5598  C  CA    . GLN B 1 48  ? -5.480  -19.205 54.926  1.00 63.61  ? 48  GLN B CA    1 
ATOM   5599  C  C     . GLN B 1 48  ? -4.322  -19.912 55.604  1.00 63.04  ? 48  GLN B C     1 
ATOM   5600  O  O     . GLN B 1 48  ? -4.007  -19.652 56.763  1.00 62.85  ? 48  GLN B O     1 
ATOM   5601  C  CB    . GLN B 1 48  ? -6.700  -20.120 54.924  1.00 65.92  ? 48  GLN B CB    1 
ATOM   5602  C  CG    . GLN B 1 48  ? -7.215  -20.435 56.318  1.00 69.53  ? 48  GLN B CG    1 
ATOM   5603  C  CD    . GLN B 1 48  ? -8.323  -21.476 56.324  1.00 70.66  ? 48  GLN B CD    1 
ATOM   5604  O  OE1   . GLN B 1 48  ? -8.838  -21.835 57.383  1.00 72.44  ? 48  GLN B OE1   1 
ATOM   5605  N  NE2   . GLN B 1 48  ? -8.692  -21.967 55.142  1.00 70.24  ? 48  GLN B NE2   1 
ATOM   5606  N  N     . VAL B 1 49  ? -3.695  -20.816 54.861  1.00 62.77  ? 49  VAL B N     1 
ATOM   5607  C  CA    . VAL B 1 49  ? -2.551  -21.556 55.362  1.00 63.39  ? 49  VAL B CA    1 
ATOM   5608  C  C     . VAL B 1 49  ? -1.501  -20.545 55.797  1.00 63.12  ? 49  VAL B C     1 
ATOM   5609  O  O     . VAL B 1 49  ? -1.112  -20.491 56.961  1.00 62.62  ? 49  VAL B O     1 
ATOM   5610  C  CB    . VAL B 1 49  ? -1.956  -22.465 54.261  1.00 63.82  ? 49  VAL B CB    1 
ATOM   5611  C  CG1   . VAL B 1 49  ? -0.726  -23.205 54.785  1.00 64.55  ? 49  VAL B CG1   1 
ATOM   5612  C  CG2   . VAL B 1 49  ? -2.995  -23.463 53.811  1.00 64.68  ? 49  VAL B CG2   1 
ATOM   5613  N  N     . ALA B 1 50  ? -1.054  -19.734 54.850  1.00 63.37  ? 50  ALA B N     1 
ATOM   5614  C  CA    . ALA B 1 50  ? -0.049  -18.731 55.135  1.00 64.24  ? 50  ALA B CA    1 
ATOM   5615  C  C     . ALA B 1 50  ? -0.391  -17.984 56.418  1.00 65.27  ? 50  ALA B C     1 
ATOM   5616  O  O     . ALA B 1 50  ? 0.473   -17.738 57.252  1.00 65.57  ? 50  ALA B O     1 
ATOM   5617  C  CB    . ALA B 1 50  ? 0.049   -17.765 53.970  1.00 64.65  ? 50  ALA B CB    1 
ATOM   5618  N  N     . ARG B 1 51  ? -1.666  -17.642 56.568  1.00 66.73  ? 51  ARG B N     1 
ATOM   5619  C  CA    . ARG B 1 51  ? -2.169  -16.911 57.730  1.00 68.06  ? 51  ARG B CA    1 
ATOM   5620  C  C     . ARG B 1 51  ? -2.331  -17.805 58.948  1.00 66.95  ? 51  ARG B C     1 
ATOM   5621  O  O     . ARG B 1 51  ? -2.502  -17.322 60.069  1.00 67.00  ? 51  ARG B O     1 
ATOM   5622  C  CB    . ARG B 1 51  ? -3.524  -16.282 57.379  1.00 71.64  ? 51  ARG B CB    1 
ATOM   5623  C  CG    . ARG B 1 51  ? -4.465  -16.021 58.564  1.00 76.16  ? 51  ARG B CG    1 
ATOM   5624  C  CD    . ARG B 1 51  ? -5.917  -15.837 58.092  1.00 78.24  ? 51  ARG B CD    1 
ATOM   5625  N  NE    . ARG B 1 51  ? -6.836  -15.367 59.137  1.00 81.27  ? 51  ARG B NE    1 
ATOM   5626  C  CZ    . ARG B 1 51  ? -6.535  -14.472 60.083  1.00 82.83  ? 51  ARG B CZ    1 
ATOM   5627  N  NH1   . ARG B 1 51  ? -7.458  -14.107 60.968  1.00 82.36  ? 51  ARG B NH1   1 
ATOM   5628  N  NH2   . ARG B 1 51  ? -5.308  -13.961 60.173  1.00 83.28  ? 51  ARG B NH2   1 
ATOM   5629  N  N     . ARG B 1 52  ? -2.286  -19.111 58.724  1.00 65.75  ? 52  ARG B N     1 
ATOM   5630  C  CA    . ARG B 1 52  ? -2.460  -20.062 59.808  1.00 65.58  ? 52  ARG B CA    1 
ATOM   5631  C  C     . ARG B 1 52  ? -1.142  -20.608 60.342  1.00 63.60  ? 52  ARG B C     1 
ATOM   5632  O  O     . ARG B 1 52  ? -1.125  -21.552 61.124  1.00 64.03  ? 52  ARG B O     1 
ATOM   5633  C  CB    . ARG B 1 52  ? -3.367  -21.219 59.348  1.00 68.11  ? 52  ARG B CB    1 
ATOM   5634  C  CG    . ARG B 1 52  ? -4.742  -21.269 60.039  1.00 70.81  ? 52  ARG B CG    1 
ATOM   5635  C  CD    . ARG B 1 52  ? -4.614  -21.704 61.508  1.00 74.56  ? 52  ARG B CD    1 
ATOM   5636  N  NE    . ARG B 1 52  ? -4.901  -23.130 61.711  1.00 77.64  ? 52  ARG B NE    1 
ATOM   5637  C  CZ    . ARG B 1 52  ? -4.297  -23.910 62.613  1.00 79.12  ? 52  ARG B CZ    1 
ATOM   5638  N  NH1   . ARG B 1 52  ? -3.354  -23.412 63.406  1.00 79.41  ? 52  ARG B NH1   1 
ATOM   5639  N  NH2   . ARG B 1 52  ? -4.640  -25.192 62.730  1.00 79.09  ? 52  ARG B NH2   1 
ATOM   5640  N  N     . ALA B 1 53  ? -0.033  -20.016 59.930  1.00 61.23  ? 53  ALA B N     1 
ATOM   5641  C  CA    . ALA B 1 53  ? 1.258   -20.485 60.404  1.00 59.51  ? 53  ALA B CA    1 
ATOM   5642  C  C     . ALA B 1 53  ? 2.218   -19.332 60.343  1.00 58.31  ? 53  ALA B C     1 
ATOM   5643  O  O     . ALA B 1 53  ? 1.941   -18.327 59.696  1.00 57.64  ? 53  ALA B O     1 
ATOM   5644  C  CB    . ALA B 1 53  ? 1.766   -21.635 59.533  1.00 59.15  ? 53  ALA B CB    1 
ATOM   5645  N  N     . GLY B 1 54  ? 3.347   -19.478 61.021  1.00 57.65  ? 54  GLY B N     1 
ATOM   5646  C  CA    . GLY B 1 54  ? 4.337   -18.423 61.012  1.00 57.74  ? 54  GLY B CA    1 
ATOM   5647  C  C     . GLY B 1 54  ? 3.764   -17.014 61.041  1.00 56.43  ? 54  GLY B C     1 
ATOM   5648  O  O     . GLY B 1 54  ? 2.551   -16.813 61.128  1.00 55.98  ? 54  GLY B O     1 
ATOM   5649  N  N     . GLY B 1 55  ? 4.653   -16.030 60.961  1.00 55.08  ? 55  GLY B N     1 
ATOM   5650  C  CA    . GLY B 1 55  ? 4.221   -14.653 61.008  1.00 52.97  ? 55  GLY B CA    1 
ATOM   5651  C  C     . GLY B 1 55  ? 4.210   -13.993 59.652  1.00 51.25  ? 55  GLY B C     1 
ATOM   5652  O  O     . GLY B 1 55  ? 3.173   -13.958 58.980  1.00 51.56  ? 55  GLY B O     1 
ATOM   5653  N  N     . VAL B 1 56  ? 5.367   -13.473 59.244  1.00 48.47  ? 56  VAL B N     1 
ATOM   5654  C  CA    . VAL B 1 56  ? 5.467   -12.785 57.965  1.00 45.10  ? 56  VAL B CA    1 
ATOM   5655  C  C     . VAL B 1 56  ? 5.499   -13.769 56.803  1.00 43.04  ? 56  VAL B C     1 
ATOM   5656  O  O     . VAL B 1 56  ? 6.541   -14.044 56.224  1.00 41.82  ? 56  VAL B O     1 
ATOM   5657  C  CB    . VAL B 1 56  ? 6.704   -11.874 57.920  1.00 43.92  ? 56  VAL B CB    1 
ATOM   5658  C  CG1   . VAL B 1 56  ? 6.558   -10.873 56.777  1.00 43.55  ? 56  VAL B CG1   1 
ATOM   5659  C  CG2   . VAL B 1 56  ? 6.867   -11.147 59.239  1.00 40.13  ? 56  VAL B CG2   1 
ATOM   5660  N  N     . THR B 1 57  ? 4.330   -14.300 56.478  1.00 41.78  ? 57  THR B N     1 
ATOM   5661  C  CA    . THR B 1 57  ? 4.210   -15.258 55.397  1.00 42.01  ? 57  THR B CA    1 
ATOM   5662  C  C     . THR B 1 57  ? 2.920   -15.023 54.588  1.00 41.73  ? 57  THR B C     1 
ATOM   5663  O  O     . THR B 1 57  ? 1.847   -14.808 55.149  1.00 39.57  ? 57  THR B O     1 
ATOM   5664  C  CB    . THR B 1 57  ? 4.317   -16.738 55.948  1.00 41.62  ? 57  THR B CB    1 
ATOM   5665  O  OG1   . THR B 1 57  ? 3.371   -17.583 55.283  1.00 41.07  ? 57  THR B OG1   1 
ATOM   5666  C  CG2   . THR B 1 57  ? 4.094   -16.789 57.452  1.00 40.69  ? 57  THR B CG2   1 
ATOM   5667  N  N     . VAL B 1 58  ? 3.068   -15.031 53.261  1.00 42.69  ? 58  VAL B N     1 
ATOM   5668  C  CA    . VAL B 1 58  ? 1.978   -14.807 52.317  1.00 42.81  ? 58  VAL B CA    1 
ATOM   5669  C  C     . VAL B 1 58  ? 2.034   -15.858 51.218  1.00 43.97  ? 58  VAL B C     1 
ATOM   5670  O  O     . VAL B 1 58  ? 3.043   -16.546 51.061  1.00 43.28  ? 58  VAL B O     1 
ATOM   5671  C  CB    . VAL B 1 58  ? 2.102   -13.435 51.612  1.00 42.02  ? 58  VAL B CB    1 
ATOM   5672  C  CG1   . VAL B 1 58  ? 0.724   -12.970 51.160  1.00 43.51  ? 58  VAL B CG1   1 
ATOM   5673  C  CG2   . VAL B 1 58  ? 2.757   -12.416 52.523  1.00 40.43  ? 58  VAL B CG2   1 
ATOM   5674  N  N     . ARG B 1 59  ? 0.955   -15.972 50.449  1.00 45.84  ? 59  ARG B N     1 
ATOM   5675  C  CA    . ARG B 1 59  ? 0.923   -16.930 49.345  1.00 47.69  ? 59  ARG B CA    1 
ATOM   5676  C  C     . ARG B 1 59  ? 1.722   -16.400 48.160  1.00 46.82  ? 59  ARG B C     1 
ATOM   5677  O  O     . ARG B 1 59  ? 1.685   -15.206 47.874  1.00 46.63  ? 59  ARG B O     1 
ATOM   5678  C  CB    . ARG B 1 59  ? -0.505  -17.193 48.860  1.00 48.73  ? 59  ARG B CB    1 
ATOM   5679  C  CG    . ARG B 1 59  ? -0.536  -18.231 47.729  1.00 51.53  ? 59  ARG B CG    1 
ATOM   5680  C  CD    . ARG B 1 59  ? -1.855  -18.288 46.964  1.00 52.94  ? 59  ARG B CD    1 
ATOM   5681  N  NE    . ARG B 1 59  ? -1.905  -17.333 45.859  1.00 54.09  ? 59  ARG B NE    1 
ATOM   5682  C  CZ    . ARG B 1 59  ? -2.706  -16.272 45.821  1.00 54.89  ? 59  ARG B CZ    1 
ATOM   5683  N  NH1   . ARG B 1 59  ? -3.536  -16.020 46.835  1.00 54.54  ? 59  ARG B NH1   1 
ATOM   5684  N  NH2   . ARG B 1 59  ? -2.675  -15.467 44.766  1.00 54.04  ? 59  ARG B NH2   1 
ATOM   5685  N  N     . MET B 1 60  ? 2.439   -17.288 47.479  1.00 46.34  ? 60  MET B N     1 
ATOM   5686  C  CA    . MET B 1 60  ? 3.217   -16.900 46.308  1.00 46.57  ? 60  MET B CA    1 
ATOM   5687  C  C     . MET B 1 60  ? 2.815   -17.852 45.207  1.00 47.54  ? 60  MET B C     1 
ATOM   5688  O  O     . MET B 1 60  ? 3.522   -18.809 44.909  1.00 47.81  ? 60  MET B O     1 
ATOM   5689  C  CB    . MET B 1 60  ? 4.723   -17.003 46.575  1.00 44.34  ? 60  MET B CB    1 
ATOM   5690  C  CG    . MET B 1 60  ? 5.591   -16.611 45.393  1.00 42.28  ? 60  MET B CG    1 
ATOM   5691  S  SD    . MET B 1 60  ? 7.271   -16.066 45.851  1.00 44.09  ? 60  MET B SD    1 
ATOM   5692  C  CE    . MET B 1 60  ? 8.237   -17.579 45.841  1.00 41.87  ? 60  MET B CE    1 
ATOM   5693  N  N     . GLY B 1 61  ? 1.659   -17.589 44.615  1.00 48.17  ? 61  GLY B N     1 
ATOM   5694  C  CA    . GLY B 1 61  ? 1.180   -18.444 43.556  1.00 49.31  ? 61  GLY B CA    1 
ATOM   5695  C  C     . GLY B 1 61  ? 0.758   -19.801 44.078  1.00 50.38  ? 61  GLY B C     1 
ATOM   5696  O  O     . GLY B 1 61  ? -0.218  -19.919 44.810  1.00 49.83  ? 61  GLY B O     1 
ATOM   5697  N  N     . ASP B 1 62  ? 1.509   -20.830 43.709  1.00 51.97  ? 62  ASP B N     1 
ATOM   5698  C  CA    . ASP B 1 62  ? 1.191   -22.192 44.114  1.00 54.03  ? 62  ASP B CA    1 
ATOM   5699  C  C     . ASP B 1 62  ? 1.698   -22.572 45.496  1.00 53.04  ? 62  ASP B C     1 
ATOM   5700  O  O     . ASP B 1 62  ? 1.337   -23.624 46.020  1.00 53.51  ? 62  ASP B O     1 
ATOM   5701  C  CB    . ASP B 1 62  ? 1.743   -23.177 43.083  1.00 58.55  ? 62  ASP B CB    1 
ATOM   5702  C  CG    . ASP B 1 62  ? 3.237   -22.994 42.839  1.00 63.03  ? 62  ASP B CG    1 
ATOM   5703  O  OD1   . ASP B 1 62  ? 4.039   -23.233 43.780  1.00 65.38  ? 62  ASP B OD1   1 
ATOM   5704  O  OD2   . ASP B 1 62  ? 3.602   -22.606 41.703  1.00 64.70  ? 62  ASP B OD2   1 
ATOM   5705  N  N     . GLY B 1 63  ? 2.536   -21.724 46.083  1.00 51.85  ? 63  GLY B N     1 
ATOM   5706  C  CA    . GLY B 1 63  ? 3.062   -22.014 47.406  1.00 48.89  ? 63  GLY B CA    1 
ATOM   5707  C  C     . GLY B 1 63  ? 3.016   -20.821 48.338  1.00 46.81  ? 63  GLY B C     1 
ATOM   5708  O  O     . GLY B 1 63  ? 2.142   -19.967 48.243  1.00 45.57  ? 63  GLY B O     1 
ATOM   5709  N  N     . LEU B 1 64  ? 3.976   -20.753 49.243  1.00 46.26  ? 64  LEU B N     1 
ATOM   5710  C  CA    . LEU B 1 64  ? 4.023   -19.654 50.189  1.00 46.35  ? 64  LEU B CA    1 
ATOM   5711  C  C     . LEU B 1 64  ? 5.357   -18.957 50.190  1.00 45.47  ? 64  LEU B C     1 
ATOM   5712  O  O     . LEU B 1 64  ? 6.385   -19.580 49.951  1.00 45.99  ? 64  LEU B O     1 
ATOM   5713  C  CB    . LEU B 1 64  ? 3.777   -20.158 51.609  1.00 46.78  ? 64  LEU B CB    1 
ATOM   5714  C  CG    . LEU B 1 64  ? 2.430   -20.765 51.955  1.00 45.24  ? 64  LEU B CG    1 
ATOM   5715  C  CD1   . LEU B 1 64  ? 2.453   -21.160 53.414  1.00 43.81  ? 64  LEU B CD1   1 
ATOM   5716  C  CD2   . LEU B 1 64  ? 1.321   -19.767 51.661  1.00 44.60  ? 64  LEU B CD2   1 
ATOM   5717  N  N     . ALA B 1 65  ? 5.330   -17.662 50.483  1.00 44.96  ? 65  ALA B N     1 
ATOM   5718  C  CA    . ALA B 1 65  ? 6.549   -16.860 50.587  1.00 44.38  ? 65  ALA B CA    1 
ATOM   5719  C  C     . ALA B 1 65  ? 6.598   -16.376 52.037  1.00 42.34  ? 65  ALA B C     1 
ATOM   5720  O  O     . ALA B 1 65  ? 5.616   -15.826 52.533  1.00 41.13  ? 65  ALA B O     1 
ATOM   5721  C  CB    . ALA B 1 65  ? 6.505   -15.664 49.623  1.00 43.77  ? 65  ALA B CB    1 
ATOM   5722  N  N     . SER B 1 66  ? 7.728   -16.590 52.709  1.00 40.23  ? 66  SER B N     1 
ATOM   5723  C  CA    . SER B 1 66  ? 7.872   -16.188 54.104  1.00 39.06  ? 66  SER B CA    1 
ATOM   5724  C  C     . SER B 1 66  ? 9.119   -15.360 54.320  1.00 39.63  ? 66  SER B C     1 
ATOM   5725  O  O     . SER B 1 66  ? 10.132  -15.570 53.654  1.00 39.70  ? 66  SER B O     1 
ATOM   5726  C  CB    . SER B 1 66  ? 7.938   -17.424 55.003  1.00 38.23  ? 66  SER B CB    1 
ATOM   5727  O  OG    . SER B 1 66  ? 7.847   -17.078 56.369  1.00 36.36  ? 66  SER B OG    1 
ATOM   5728  N  N     . TRP B 1 67  ? 9.036   -14.410 55.247  1.00 40.45  ? 67  TRP B N     1 
ATOM   5729  C  CA    . TRP B 1 67  ? 10.171  -13.559 55.574  1.00 40.93  ? 67  TRP B CA    1 
ATOM   5730  C  C     . TRP B 1 67  ? 10.776  -14.038 56.876  1.00 42.83  ? 67  TRP B C     1 
ATOM   5731  O  O     . TRP B 1 67  ? 11.766  -13.482 57.356  1.00 45.43  ? 67  TRP B O     1 
ATOM   5732  C  CB    . TRP B 1 67  ? 9.749   -12.101 55.708  1.00 38.75  ? 67  TRP B CB    1 
ATOM   5733  C  CG    . TRP B 1 67  ? 10.124  -11.285 54.531  1.00 38.18  ? 67  TRP B CG    1 
ATOM   5734  C  CD1   . TRP B 1 67  ? 10.834  -11.698 53.450  1.00 37.62  ? 67  TRP B CD1   1 
ATOM   5735  C  CD2   . TRP B 1 67  ? 9.812   -9.904  54.306  1.00 39.04  ? 67  TRP B CD2   1 
ATOM   5736  N  NE1   . TRP B 1 67  ? 10.986  -10.666 52.560  1.00 37.69  ? 67  TRP B NE1   1 
ATOM   5737  C  CE2   . TRP B 1 67  ? 10.370  -9.553  53.058  1.00 38.23  ? 67  TRP B CE2   1 
ATOM   5738  C  CE3   . TRP B 1 67  ? 9.115   -8.932  55.035  1.00 39.74  ? 67  TRP B CE3   1 
ATOM   5739  C  CZ2   . TRP B 1 67  ? 10.255  -8.263  52.521  1.00 38.31  ? 67  TRP B CZ2   1 
ATOM   5740  C  CZ3   . TRP B 1 67  ? 9.002   -7.649  54.498  1.00 40.06  ? 67  TRP B CZ3   1 
ATOM   5741  C  CH2   . TRP B 1 67  ? 9.572   -7.330  53.251  1.00 38.80  ? 67  TRP B CH2   1 
ATOM   5742  N  N     . SER B 1 68  ? 10.170  -15.075 57.445  1.00 42.90  ? 68  SER B N     1 
ATOM   5743  C  CA    . SER B 1 68  ? 10.654  -15.662 58.680  1.00 42.97  ? 68  SER B CA    1 
ATOM   5744  C  C     . SER B 1 68  ? 11.087  -17.106 58.426  1.00 44.06  ? 68  SER B C     1 
ATOM   5745  O  O     . SER B 1 68  ? 10.448  -17.830 57.661  1.00 41.84  ? 68  SER B O     1 
ATOM   5746  C  CB    . SER B 1 68  ? 9.566   -15.609 59.742  1.00 42.45  ? 68  SER B CB    1 
ATOM   5747  O  OG    . SER B 1 68  ? 8.374   -16.188 59.266  1.00 41.34  ? 68  SER B OG    1 
ATOM   5748  N  N     . PRO B 1 69  ? 12.179  -17.541 59.079  1.00 46.04  ? 69  PRO B N     1 
ATOM   5749  C  CA    . PRO B 1 69  ? 12.720  -18.893 58.936  1.00 48.03  ? 69  PRO B CA    1 
ATOM   5750  C  C     . PRO B 1 69  ? 11.700  -19.984 59.251  1.00 50.52  ? 69  PRO B C     1 
ATOM   5751  O  O     . PRO B 1 69  ? 10.828  -19.818 60.112  1.00 49.87  ? 69  PRO B O     1 
ATOM   5752  C  CB    . PRO B 1 69  ? 13.896  -18.894 59.905  1.00 47.32  ? 69  PRO B CB    1 
ATOM   5753  C  CG    . PRO B 1 69  ? 13.401  -18.025 60.993  1.00 46.15  ? 69  PRO B CG    1 
ATOM   5754  C  CD    . PRO B 1 69  ? 12.797  -16.868 60.235  1.00 46.04  ? 69  PRO B CD    1 
ATOM   5755  N  N     . PRO B 1 70  ? 11.820  -21.128 58.565  1.00 52.47  ? 70  PRO B N     1 
ATOM   5756  C  CA    . PRO B 1 70  ? 10.959  -22.310 58.686  1.00 53.89  ? 70  PRO B CA    1 
ATOM   5757  C  C     . PRO B 1 70  ? 10.710  -22.728 60.128  1.00 54.31  ? 70  PRO B C     1 
ATOM   5758  O  O     . PRO B 1 70  ? 9.623   -23.189 60.481  1.00 53.58  ? 70  PRO B O     1 
ATOM   5759  C  CB    . PRO B 1 70  ? 11.730  -23.372 57.910  1.00 53.96  ? 70  PRO B CB    1 
ATOM   5760  C  CG    . PRO B 1 70  ? 12.463  -22.566 56.883  1.00 54.32  ? 70  PRO B CG    1 
ATOM   5761  C  CD    . PRO B 1 70  ? 12.977  -21.421 57.705  1.00 53.09  ? 70  PRO B CD    1 
ATOM   5762  N  N     . GLU B 1 71  ? 11.739  -22.564 60.947  1.00 55.11  ? 71  GLU B N     1 
ATOM   5763  C  CA    . GLU B 1 71  ? 11.685  -22.912 62.358  1.00 55.96  ? 71  GLU B CA    1 
ATOM   5764  C  C     . GLU B 1 71  ? 10.592  -22.113 63.070  1.00 55.43  ? 71  GLU B C     1 
ATOM   5765  O  O     . GLU B 1 71  ? 9.993   -22.575 64.034  1.00 55.28  ? 71  GLU B O     1 
ATOM   5766  C  CB    . GLU B 1 71  ? 13.047  -22.624 62.992  1.00 57.86  ? 71  GLU B CB    1 
ATOM   5767  C  CG    . GLU B 1 71  ? 14.233  -22.971 62.086  1.00 60.34  ? 71  GLU B CG    1 
ATOM   5768  C  CD    . GLU B 1 71  ? 14.359  -24.464 61.809  1.00 61.04  ? 71  GLU B CD    1 
ATOM   5769  O  OE1   . GLU B 1 71  ? 15.202  -24.839 60.962  1.00 60.23  ? 71  GLU B OE1   1 
ATOM   5770  O  OE2   . GLU B 1 71  ? 13.623  -25.257 62.441  1.00 61.28  ? 71  GLU B OE2   1 
ATOM   5771  N  N     . VAL B 1 72  ? 10.331  -20.909 62.586  1.00 55.61  ? 72  VAL B N     1 
ATOM   5772  C  CA    . VAL B 1 72  ? 9.315   -20.066 63.187  1.00 56.17  ? 72  VAL B CA    1 
ATOM   5773  C  C     . VAL B 1 72  ? 7.923   -20.531 62.769  1.00 56.50  ? 72  VAL B C     1 
ATOM   5774  O  O     . VAL B 1 72  ? 7.024   -20.662 63.595  1.00 57.52  ? 72  VAL B O     1 
ATOM   5775  C  CB    . VAL B 1 72  ? 9.505   -18.598 62.755  1.00 56.94  ? 72  VAL B CB    1 
ATOM   5776  C  CG1   . VAL B 1 72  ? 8.490   -17.698 63.459  1.00 57.68  ? 72  VAL B CG1   1 
ATOM   5777  C  CG2   . VAL B 1 72  ? 10.918  -18.156 63.061  1.00 56.05  ? 72  VAL B CG2   1 
ATOM   5778  N  N     . LEU B 1 73  ? 7.754   -20.781 61.476  1.00 56.06  ? 73  LEU B N     1 
ATOM   5779  C  CA    . LEU B 1 73  ? 6.477   -21.223 60.926  1.00 54.35  ? 73  LEU B CA    1 
ATOM   5780  C  C     . LEU B 1 73  ? 6.074   -22.579 61.490  1.00 53.93  ? 73  LEU B C     1 
ATOM   5781  O  O     . LEU B 1 73  ? 6.912   -23.330 61.982  1.00 52.77  ? 73  LEU B O     1 
ATOM   5782  C  CB    . LEU B 1 73  ? 6.594   -21.332 59.411  1.00 53.28  ? 73  LEU B CB    1 
ATOM   5783  C  CG    . LEU B 1 73  ? 7.230   -20.131 58.722  1.00 52.49  ? 73  LEU B CG    1 
ATOM   5784  C  CD1   . LEU B 1 73  ? 8.011   -20.611 57.519  1.00 53.23  ? 73  LEU B CD1   1 
ATOM   5785  C  CD2   . LEU B 1 73  ? 6.165   -19.121 58.335  1.00 51.54  ? 73  LEU B CD2   1 
ATOM   5786  N  N     . VAL B 1 74  ? 4.785   -22.887 61.401  1.00 54.48  ? 74  VAL B N     1 
ATOM   5787  C  CA    . VAL B 1 74  ? 4.257   -24.162 61.877  1.00 55.64  ? 74  VAL B CA    1 
ATOM   5788  C  C     . VAL B 1 74  ? 4.076   -25.091 60.671  1.00 56.69  ? 74  VAL B C     1 
ATOM   5789  O  O     . VAL B 1 74  ? 2.953   -25.349 60.246  1.00 56.59  ? 74  VAL B O     1 
ATOM   5790  C  CB    . VAL B 1 74  ? 2.886   -23.971 62.546  1.00 56.24  ? 74  VAL B CB    1 
ATOM   5791  C  CG1   . VAL B 1 74  ? 2.554   -25.180 63.409  1.00 55.80  ? 74  VAL B CG1   1 
ATOM   5792  C  CG2   . VAL B 1 74  ? 2.880   -22.685 63.357  1.00 56.39  ? 74  VAL B CG2   1 
ATOM   5793  N  N     . LEU B 1 75  ? 5.192   -25.583 60.132  1.00 58.14  ? 75  LEU B N     1 
ATOM   5794  C  CA    . LEU B 1 75  ? 5.233   -26.465 58.956  1.00 59.09  ? 75  LEU B CA    1 
ATOM   5795  C  C     . LEU B 1 75  ? 4.050   -27.422 58.736  1.00 61.07  ? 75  LEU B C     1 
ATOM   5796  O  O     . LEU B 1 75  ? 3.352   -27.347 57.718  1.00 62.58  ? 75  LEU B O     1 
ATOM   5797  C  CB    . LEU B 1 75  ? 6.536   -27.271 58.973  1.00 57.50  ? 75  LEU B CB    1 
ATOM   5798  C  CG    . LEU B 1 75  ? 7.817   -26.433 59.063  1.00 57.62  ? 75  LEU B CG    1 
ATOM   5799  C  CD1   . LEU B 1 75  ? 9.057   -27.340 59.039  1.00 56.27  ? 75  LEU B CD1   1 
ATOM   5800  C  CD2   . LEU B 1 75  ? 7.842   -25.433 57.916  1.00 56.90  ? 75  LEU B CD2   1 
ATOM   5801  N  N     . GLU B 1 76  ? 3.843   -28.340 59.671  1.00 62.37  ? 76  GLU B N     1 
ATOM   5802  C  CA    . GLU B 1 76  ? 2.747   -29.297 59.570  1.00 63.44  ? 76  GLU B CA    1 
ATOM   5803  C  C     . GLU B 1 76  ? 1.549   -28.723 60.313  1.00 64.06  ? 76  GLU B C     1 
ATOM   5804  O  O     . GLU B 1 76  ? 1.705   -27.871 61.179  1.00 64.65  ? 76  GLU B O     1 
ATOM   5805  C  CB    . GLU B 1 76  ? 3.157   -30.643 60.186  1.00 63.60  ? 76  GLU B CB    1 
ATOM   5806  C  CG    . GLU B 1 76  ? 3.228   -30.660 61.702  1.00 62.75  ? 76  GLU B CG    1 
ATOM   5807  C  CD    . GLU B 1 76  ? 1.869   -30.825 62.346  0.00 63.05  ? 76  GLU B CD    1 
ATOM   5808  O  OE1   . GLU B 1 76  ? 1.769   -30.646 63.577  0.00 63.00  ? 76  GLU B OE1   1 
ATOM   5809  O  OE2   . GLU B 1 76  ? 0.901   -31.143 61.623  0.00 63.00  ? 76  GLU B OE2   1 
ATOM   5810  N  N     . GLY B 1 77  ? 0.353   -29.185 59.983  1.00 64.31  ? 77  GLY B N     1 
ATOM   5811  C  CA    . GLY B 1 77  ? -0.809  -28.653 60.653  1.00 65.40  ? 77  GLY B CA    1 
ATOM   5812  C  C     . GLY B 1 77  ? -2.115  -29.066 60.022  1.00 66.63  ? 77  GLY B C     1 
ATOM   5813  O  O     . GLY B 1 77  ? -2.149  -29.953 59.171  1.00 66.02  ? 77  GLY B O     1 
ATOM   5814  N  N     . THR B 1 78  ? -3.193  -28.409 60.443  1.00 68.46  ? 78  THR B N     1 
ATOM   5815  C  CA    . THR B 1 78  ? -4.528  -28.716 59.947  1.00 69.81  ? 78  THR B CA    1 
ATOM   5816  C  C     . THR B 1 78  ? -5.517  -27.605 60.175  1.00 70.81  ? 78  THR B C     1 
ATOM   5817  O  O     . THR B 1 78  ? -5.398  -26.837 61.124  1.00 71.33  ? 78  THR B O     1 
ATOM   5818  C  CB    . THR B 1 78  ? -5.130  -29.958 60.662  1.00 69.83  ? 78  THR B CB    1 
ATOM   5819  O  OG1   . THR B 1 78  ? -4.760  -31.148 59.961  1.00 70.35  ? 78  THR B OG1   1 
ATOM   5820  C  CG2   . THR B 1 78  ? -6.656  -29.865 60.735  1.00 68.43  ? 78  THR B CG2   1 
ATOM   5821  N  N     . LEU B 1 79  ? -6.500  -27.542 59.289  1.00 72.37  ? 79  LEU B N     1 
ATOM   5822  C  CA    . LEU B 1 79  ? -7.596  -26.610 59.421  1.00 74.74  ? 79  LEU B CA    1 
ATOM   5823  C  C     . LEU B 1 79  ? -8.668  -26.878 58.409  1.00 75.49  ? 79  LEU B C     1 
ATOM   5824  O  O     . LEU B 1 79  ? -8.400  -27.350 57.306  1.00 74.77  ? 79  LEU B O     1 
ATOM   5825  C  CB    . LEU B 1 79  ? -7.153  -25.148 59.365  1.00 75.79  ? 79  LEU B CB    1 
ATOM   5826  C  CG    . LEU B 1 79  ? -7.333  -24.487 60.753  1.00 77.24  ? 79  LEU B CG    1 
ATOM   5827  C  CD1   . LEU B 1 79  ? -7.997  -23.128 60.580  1.00 78.07  ? 79  LEU B CD1   1 
ATOM   5828  C  CD2   . LEU B 1 79  ? -8.186  -25.366 61.695  1.00 76.07  ? 79  LEU B CD2   1 
ATOM   5829  N  N     . ALA B 1 80  ? -9.897  -26.601 58.826  1.00 77.50  ? 80  ALA B N     1 
ATOM   5830  C  CA    . ALA B 1 80  ? -11.070 -26.810 57.997  1.00 79.29  ? 80  ALA B CA    1 
ATOM   5831  C  C     . ALA B 1 80  ? -11.412 -25.551 57.224  1.00 79.74  ? 80  ALA B C     1 
ATOM   5832  O  O     . ALA B 1 80  ? -10.994 -24.448 57.574  1.00 78.33  ? 80  ALA B O     1 
ATOM   5833  C  CB    . ALA B 1 80  ? -12.262 -27.239 58.866  1.00 78.65  ? 80  ALA B CB    1 
ATOM   5834  N  N     . ARG B 1 81  ? -12.172 -25.737 56.157  1.00 81.28  ? 81  ARG B N     1 
ATOM   5835  C  CA    . ARG B 1 81  ? -12.589 -24.635 55.316  1.00 83.36  ? 81  ARG B CA    1 
ATOM   5836  C  C     . ARG B 1 81  ? -13.667 -25.168 54.397  1.00 84.50  ? 81  ARG B C     1 
ATOM   5837  O  O     . ARG B 1 81  ? -13.373 -25.794 53.372  1.00 84.26  ? 81  ARG B O     1 
ATOM   5838  C  CB    . ARG B 1 81  ? -11.414 -24.111 54.507  1.00 82.92  ? 81  ARG B CB    1 
ATOM   5839  N  N     . MET B 1 82  ? -14.915 -24.927 54.792  1.00 85.42  ? 82  MET B N     1 
ATOM   5840  C  CA    . MET B 1 82  ? -16.077 -25.370 54.037  1.00 85.89  ? 82  MET B CA    1 
ATOM   5841  C  C     . MET B 1 82  ? -16.443 -26.773 54.509  1.00 84.58  ? 82  MET B C     1 
ATOM   5842  O  O     . MET B 1 82  ? -16.871 -27.621 53.730  1.00 83.99  ? 82  MET B O     1 
ATOM   5843  C  CB    . MET B 1 82  ? -15.769 -25.350 52.529  1.00 87.99  ? 82  MET B CB    1 
ATOM   5844  C  CG    . MET B 1 82  ? -16.980 -25.480 51.625  1.00 90.36  ? 82  MET B CG    1 
ATOM   5845  S  SD    . MET B 1 82  ? -17.230 -27.156 51.012  1.00 93.97  ? 82  MET B SD    1 
ATOM   5846  C  CE    . MET B 1 82  ? -17.051 -26.891 49.231  1.00 92.62  ? 82  MET B CE    1 
ATOM   5847  N  N     . GLY B 1 83  ? -16.269 -27.006 55.804  1.00 83.73  ? 83  GLY B N     1 
ATOM   5848  C  CA    . GLY B 1 83  ? -16.590 -28.306 56.363  1.00 83.79  ? 83  GLY B CA    1 
ATOM   5849  C  C     . GLY B 1 83  ? -15.556 -29.353 56.001  1.00 83.44  ? 83  GLY B C     1 
ATOM   5850  O  O     . GLY B 1 83  ? -15.409 -30.365 56.696  1.00 83.67  ? 83  GLY B O     1 
ATOM   5851  N  N     . GLN B 1 84  ? -14.847 -29.117 54.900  1.00 82.41  ? 84  GLN B N     1 
ATOM   5852  C  CA    . GLN B 1 84  ? -13.808 -30.036 54.459  1.00 80.15  ? 84  GLN B CA    1 
ATOM   5853  C  C     . GLN B 1 84  ? -12.543 -29.686 55.220  1.00 78.90  ? 84  GLN B C     1 
ATOM   5854  O  O     . GLN B 1 84  ? -11.946 -28.636 54.989  1.00 78.86  ? 84  GLN B O     1 
ATOM   5855  C  CB    . GLN B 1 84  ? -13.551 -29.906 52.952  1.00 78.89  ? 84  GLN B CB    1 
ATOM   5856  C  CG    . GLN B 1 84  ? -14.780 -30.122 52.089  1.00 79.18  ? 84  GLN B CG    1 
ATOM   5857  C  CD    . GLN B 1 84  ? -14.436 -30.532 50.669  1.00 79.94  ? 84  GLN B CD    1 
ATOM   5858  O  OE1   . GLN B 1 84  ? -15.295 -30.515 49.783  1.00 79.68  ? 84  GLN B OE1   1 
ATOM   5859  N  NE2   . GLN B 1 84  ? -13.179 -30.914 50.447  1.00 79.66  ? 84  GLN B NE2   1 
ATOM   5860  N  N     . THR B 1 85  ? -12.158 -30.545 56.156  1.00 77.32  ? 85  THR B N     1 
ATOM   5861  C  CA    . THR B 1 85  ? -10.942 -30.308 56.916  1.00 75.77  ? 85  THR B CA    1 
ATOM   5862  C  C     . THR B 1 85  ? -9.774  -30.711 56.011  1.00 74.42  ? 85  THR B C     1 
ATOM   5863  O  O     . THR B 1 85  ? -9.860  -31.708 55.282  1.00 74.75  ? 85  THR B O     1 
ATOM   5864  C  CB    . THR B 1 85  ? -10.921 -31.133 58.243  1.00 75.83  ? 85  THR B CB    1 
ATOM   5865  O  OG1   . THR B 1 85  ? -11.328 -32.484 57.990  1.00 76.09  ? 85  THR B OG1   1 
ATOM   5866  C  CG2   . THR B 1 85  ? -11.862 -30.515 59.272  1.00 75.13  ? 85  THR B CG2   1 
ATOM   5867  N  N     . TYR B 1 86  ? -8.705  -29.916 56.022  1.00 71.51  ? 86  TYR B N     1 
ATOM   5868  C  CA    . TYR B 1 86  ? -7.534  -30.213 55.202  1.00 67.47  ? 86  TYR B CA    1 
ATOM   5869  C  C     . TYR B 1 86  ? -6.296  -30.385 56.057  1.00 65.53  ? 86  TYR B C     1 
ATOM   5870  O  O     . TYR B 1 86  ? -6.179  -29.793 57.132  1.00 65.74  ? 86  TYR B O     1 
ATOM   5871  C  CB    . TYR B 1 86  ? -7.246  -29.096 54.208  1.00 66.71  ? 86  TYR B CB    1 
ATOM   5872  C  CG    . TYR B 1 86  ? -8.279  -28.885 53.134  1.00 66.45  ? 86  TYR B CG    1 
ATOM   5873  C  CD1   . TYR B 1 86  ? -9.421  -28.128 53.379  1.00 66.37  ? 86  TYR B CD1   1 
ATOM   5874  C  CD2   . TYR B 1 86  ? -8.083  -29.385 51.846  1.00 66.59  ? 86  TYR B CD2   1 
ATOM   5875  C  CE1   . TYR B 1 86  ? -10.340 -27.865 52.370  1.00 66.14  ? 86  TYR B CE1   1 
ATOM   5876  C  CE2   . TYR B 1 86  ? -8.994  -29.131 50.833  1.00 66.51  ? 86  TYR B CE2   1 
ATOM   5877  C  CZ    . TYR B 1 86  ? -10.119 -28.369 51.103  1.00 66.71  ? 86  TYR B CZ    1 
ATOM   5878  O  OH    . TYR B 1 86  ? -11.025 -28.114 50.102  1.00 68.26  ? 86  TYR B OH    1 
ATOM   5879  N  N     . ALA B 1 87  ? -5.370  -31.197 55.566  1.00 63.12  ? 87  ALA B N     1 
ATOM   5880  C  CA    . ALA B 1 87  ? -4.115  -31.424 56.262  1.00 61.02  ? 87  ALA B CA    1 
ATOM   5881  C  C     . ALA B 1 87  ? -3.048  -30.727 55.436  1.00 59.63  ? 87  ALA B C     1 
ATOM   5882  O  O     . ALA B 1 87  ? -2.682  -31.207 54.360  1.00 59.53  ? 87  ALA B O     1 
ATOM   5883  C  CB    . ALA B 1 87  ? -3.821  -32.905 56.349  1.00 60.45  ? 87  ALA B CB    1 
ATOM   5884  N  N     . TYR B 1 88  ? -2.571  -29.582 55.916  1.00 57.66  ? 88  TYR B N     1 
ATOM   5885  C  CA    . TYR B 1 88  ? -1.546  -28.873 55.180  1.00 55.14  ? 88  TYR B CA    1 
ATOM   5886  C  C     . TYR B 1 88  ? -0.195  -29.407 55.608  1.00 53.17  ? 88  TYR B C     1 
ATOM   5887  O  O     . TYR B 1 88  ? -0.098  -30.262 56.487  1.00 50.51  ? 88  TYR B O     1 
ATOM   5888  C  CB    . TYR B 1 88  ? -1.639  -27.339 55.372  1.00 55.42  ? 88  TYR B CB    1 
ATOM   5889  C  CG    . TYR B 1 88  ? -1.090  -26.766 56.660  1.00 55.15  ? 88  TYR B CG    1 
ATOM   5890  C  CD1   . TYR B 1 88  ? -1.917  -26.548 57.755  1.00 55.10  ? 88  TYR B CD1   1 
ATOM   5891  C  CD2   . TYR B 1 88  ? 0.252   -26.410 56.771  1.00 55.76  ? 88  TYR B CD2   1 
ATOM   5892  C  CE1   . TYR B 1 88  ? -1.429  -25.987 58.926  1.00 55.52  ? 88  TYR B CE1   1 
ATOM   5893  C  CE2   . TYR B 1 88  ? 0.750   -25.852 57.940  1.00 56.16  ? 88  TYR B CE2   1 
ATOM   5894  C  CZ    . TYR B 1 88  ? -0.099  -25.643 59.013  1.00 55.95  ? 88  TYR B CZ    1 
ATOM   5895  O  OH    . TYR B 1 88  ? 0.378   -25.081 60.172  1.00 56.62  ? 88  TYR B OH    1 
ATOM   5896  N  N     . ARG B 1 89  ? 0.847   -28.909 54.963  1.00 52.79  ? 89  ARG B N     1 
ATOM   5897  C  CA    . ARG B 1 89  ? 2.185   -29.357 55.252  1.00 50.66  ? 89  ARG B CA    1 
ATOM   5898  C  C     . ARG B 1 89  ? 3.119   -28.584 54.354  1.00 48.33  ? 89  ARG B C     1 
ATOM   5899  O  O     . ARG B 1 89  ? 3.019   -28.652 53.137  1.00 47.00  ? 89  ARG B O     1 
ATOM   5900  C  CB    . ARG B 1 89  ? 2.267   -30.843 54.967  1.00 52.41  ? 89  ARG B CB    1 
ATOM   5901  C  CG    . ARG B 1 89  ? 3.624   -31.398 55.106  1.00 56.41  ? 89  ARG B CG    1 
ATOM   5902  C  CD    . ARG B 1 89  ? 4.216   -31.105 56.460  1.00 61.05  ? 89  ARG B CD    1 
ATOM   5903  N  NE    . ARG B 1 89  ? 5.519   -31.748 56.520  1.00 66.25  ? 89  ARG B NE    1 
ATOM   5904  C  CZ    . ARG B 1 89  ? 5.691   -33.064 56.562  1.00 68.21  ? 89  ARG B CZ    1 
ATOM   5905  N  NH1   . ARG B 1 89  ? 4.635   -33.865 56.580  1.00 70.28  ? 89  ARG B NH1   1 
ATOM   5906  N  NH2   . ARG B 1 89  ? 6.915   -33.582 56.512  1.00 68.66  ? 89  ARG B NH2   1 
ATOM   5907  N  N     . LEU B 1 90  ? 4.028   -27.839 54.959  1.00 47.42  ? 90  LEU B N     1 
ATOM   5908  C  CA    . LEU B 1 90  ? 4.966   -27.032 54.192  1.00 47.11  ? 90  LEU B CA    1 
ATOM   5909  C  C     . LEU B 1 90  ? 6.339   -27.685 54.027  1.00 46.26  ? 90  LEU B C     1 
ATOM   5910  O  O     . LEU B 1 90  ? 6.739   -28.541 54.812  1.00 44.86  ? 90  LEU B O     1 
ATOM   5911  C  CB    . LEU B 1 90  ? 5.103   -25.668 54.857  1.00 47.04  ? 90  LEU B CB    1 
ATOM   5912  C  CG    . LEU B 1 90  ? 3.747   -25.085 55.249  1.00 47.67  ? 90  LEU B CG    1 
ATOM   5913  C  CD1   . LEU B 1 90  ? 3.968   -23.959 56.206  1.00 49.95  ? 90  LEU B CD1   1 
ATOM   5914  C  CD2   . LEU B 1 90  ? 2.991   -24.605 54.033  1.00 48.79  ? 90  LEU B CD2   1 
ATOM   5915  N  N     . TYR B 1 91  ? 7.053   -27.279 52.987  1.00 46.02  ? 91  TYR B N     1 
ATOM   5916  C  CA    . TYR B 1 91  ? 8.376   -27.817 52.717  1.00 45.77  ? 91  TYR B CA    1 
ATOM   5917  C  C     . TYR B 1 91  ? 9.357   -26.720 52.329  1.00 45.93  ? 91  TYR B C     1 
ATOM   5918  O  O     . TYR B 1 91  ? 9.383   -26.264 51.189  1.00 46.33  ? 91  TYR B O     1 
ATOM   5919  C  CB    . TYR B 1 91  ? 8.325   -28.860 51.590  1.00 45.42  ? 91  TYR B CB    1 
ATOM   5920  C  CG    . TYR B 1 91  ? 7.639   -30.143 51.971  1.00 45.68  ? 91  TYR B CG    1 
ATOM   5921  C  CD1   . TYR B 1 91  ? 6.246   -30.246 51.978  1.00 45.60  ? 91  TYR B CD1   1 
ATOM   5922  C  CD2   . TYR B 1 91  ? 8.379   -31.231 52.421  1.00 47.93  ? 91  TYR B CD2   1 
ATOM   5923  C  CE1   . TYR B 1 91  ? 5.605   -31.405 52.436  1.00 44.97  ? 91  TYR B CE1   1 
ATOM   5924  C  CE2   . TYR B 1 91  ? 7.753   -32.392 52.888  1.00 47.67  ? 91  TYR B CE2   1 
ATOM   5925  C  CZ    . TYR B 1 91  ? 6.369   -32.472 52.899  1.00 46.19  ? 91  TYR B CZ    1 
ATOM   5926  O  OH    . TYR B 1 91  ? 5.776   -33.600 53.424  1.00 44.64  ? 91  TYR B OH    1 
ATOM   5927  N  N     . PRO B 1 92  ? 10.173  -26.271 53.281  1.00 45.95  ? 92  PRO B N     1 
ATOM   5928  C  CA    . PRO B 1 92  ? 11.135  -25.227 52.940  1.00 46.98  ? 92  PRO B CA    1 
ATOM   5929  C  C     . PRO B 1 92  ? 11.880  -25.666 51.689  1.00 48.74  ? 92  PRO B C     1 
ATOM   5930  O  O     . PRO B 1 92  ? 12.423  -26.771 51.637  1.00 48.03  ? 92  PRO B O     1 
ATOM   5931  C  CB    . PRO B 1 92  ? 12.039  -25.189 54.161  1.00 45.74  ? 92  PRO B CB    1 
ATOM   5932  C  CG    . PRO B 1 92  ? 11.109  -25.549 55.267  1.00 45.32  ? 92  PRO B CG    1 
ATOM   5933  C  CD    . PRO B 1 92  ? 10.295  -26.673 54.689  1.00 45.39  ? 92  PRO B CD    1 
ATOM   5934  N  N     . LYS B 1 93  ? 11.875  -24.810 50.674  1.00 52.16  ? 93  LYS B N     1 
ATOM   5935  C  CA    . LYS B 1 93  ? 12.550  -25.115 49.423  1.00 55.20  ? 93  LYS B CA    1 
ATOM   5936  C  C     . LYS B 1 93  ? 13.481  -23.976 49.021  1.00 55.86  ? 93  LYS B C     1 
ATOM   5937  O  O     . LYS B 1 93  ? 13.335  -23.381 47.951  1.00 56.51  ? 93  LYS B O     1 
ATOM   5938  C  CB    . LYS B 1 93  ? 11.526  -25.376 48.314  1.00 57.40  ? 93  LYS B CB    1 
ATOM   5939  C  CG    . LYS B 1 93  ? 12.108  -26.156 47.134  1.00 61.47  ? 93  LYS B CG    1 
ATOM   5940  C  CD    . LYS B 1 93  ? 11.256  -27.376 46.786  1.00 62.81  ? 93  LYS B CD    1 
ATOM   5941  C  CE    . LYS B 1 93  ? 12.127  -28.604 46.635  1.00 63.56  ? 93  LYS B CE    1 
ATOM   5942  N  NZ    . LYS B 1 93  ? 13.220  -28.378 45.652  1.00 64.04  ? 93  LYS B NZ    1 
ATOM   5943  N  N     . GLY B 1 94  ? 14.431  -23.679 49.902  1.00 56.28  ? 94  GLY B N     1 
ATOM   5944  C  CA    . GLY B 1 94  ? 15.393  -22.626 49.648  1.00 57.75  ? 94  GLY B CA    1 
ATOM   5945  C  C     . GLY B 1 94  ? 14.819  -21.223 49.628  1.00 59.34  ? 94  GLY B C     1 
ATOM   5946  O  O     . GLY B 1 94  ? 13.728  -20.966 50.151  1.00 59.60  ? 94  GLY B O     1 
ATOM   5947  N  N     . ARG B 1 95  ? 15.570  -20.308 49.021  1.00 59.61  ? 95  ARG B N     1 
ATOM   5948  C  CA    . ARG B 1 95  ? 15.159  -18.922 48.918  1.00 59.49  ? 95  ARG B CA    1 
ATOM   5949  C  C     . ARG B 1 95  ? 15.003  -18.556 47.456  1.00 60.10  ? 95  ARG B C     1 
ATOM   5950  O  O     . ARG B 1 95  ? 15.855  -18.877 46.622  1.00 60.91  ? 95  ARG B O     1 
ATOM   5951  C  CB    . ARG B 1 95  ? 16.194  -18.017 49.589  1.00 60.35  ? 95  ARG B CB    1 
ATOM   5952  C  CG    . ARG B 1 95  ? 16.119  -17.977 51.133  1.00 61.06  ? 95  ARG B CG    1 
ATOM   5953  C  CD    . ARG B 1 95  ? 17.365  -17.304 51.704  1.00 62.27  ? 95  ARG B CD    1 
ATOM   5954  N  NE    . ARG B 1 95  ? 17.276  -16.940 53.117  1.00 61.19  ? 95  ARG B NE    1 
ATOM   5955  C  CZ    . ARG B 1 95  ? 17.060  -15.704 53.559  1.00 60.29  ? 95  ARG B CZ    1 
ATOM   5956  N  NH1   . ARG B 1 95  ? 16.903  -14.708 52.702  1.00 59.23  ? 95  ARG B NH1   1 
ATOM   5957  N  NH2   . ARG B 1 95  ? 17.025  -15.457 54.860  1.00 59.64  ? 95  ARG B NH2   1 
ATOM   5958  N  N     . ARG B 1 96  ? 13.896  -17.897 47.147  1.00 59.82  ? 96  ARG B N     1 
ATOM   5959  C  CA    . ARG B 1 96  ? 13.618  -17.486 45.788  1.00 58.94  ? 96  ARG B CA    1 
ATOM   5960  C  C     . ARG B 1 96  ? 13.720  -15.978 45.711  1.00 59.00  ? 96  ARG B C     1 
ATOM   5961  O  O     . ARG B 1 96  ? 12.996  -15.274 46.406  1.00 59.51  ? 96  ARG B O     1 
ATOM   5962  C  CB    . ARG B 1 96  ? 12.224  -17.932 45.391  1.00 58.37  ? 96  ARG B CB    1 
ATOM   5963  N  N     . PRO B 1 97  ? 14.641  -15.462 44.881  1.00 59.18  ? 97  PRO B N     1 
ATOM   5964  C  CA    . PRO B 1 97  ? 14.853  -14.016 44.695  1.00 58.47  ? 97  PRO B CA    1 
ATOM   5965  C  C     . PRO B 1 97  ? 13.715  -13.347 43.911  1.00 57.24  ? 97  PRO B C     1 
ATOM   5966  O  O     . PRO B 1 97  ? 13.387  -13.763 42.810  1.00 56.93  ? 97  PRO B O     1 
ATOM   5967  C  CB    . PRO B 1 97  ? 16.191  -13.953 43.957  1.00 57.59  ? 97  PRO B CB    1 
ATOM   5968  C  CG    . PRO B 1 97  ? 16.200  -15.226 43.191  1.00 59.31  ? 97  PRO B CG    1 
ATOM   5969  C  CD    . PRO B 1 97  ? 15.684  -16.235 44.188  1.00 59.12  ? 97  PRO B CD    1 
ATOM   5970  N  N     . LEU B 1 98  ? 13.112  -12.317 44.501  1.00 56.95  ? 98  LEU B N     1 
ATOM   5971  C  CA    . LEU B 1 98  ? 12.008  -11.588 43.880  1.00 56.51  ? 98  LEU B CA    1 
ATOM   5972  C  C     . LEU B 1 98  ? 12.446  -10.273 43.229  1.00 56.75  ? 98  LEU B C     1 
ATOM   5973  O  O     . LEU B 1 98  ? 13.388  -9.623  43.694  1.00 57.00  ? 98  LEU B O     1 
ATOM   5974  C  CB    . LEU B 1 98  ? 10.925  -11.306 44.924  1.00 55.71  ? 98  LEU B CB    1 
ATOM   5975  C  CG    . LEU B 1 98  ? 9.817   -12.355 45.030  1.00 55.25  ? 98  LEU B CG    1 
ATOM   5976  C  CD1   . LEU B 1 98  ? 10.425  -13.743 45.109  1.00 55.08  ? 98  LEU B CD1   1 
ATOM   5977  C  CD2   . LEU B 1 98  ? 8.951   -12.064 46.244  1.00 55.27  ? 98  LEU B CD2   1 
ATOM   5978  N  N     . ASP B 1 99  ? 11.761  -9.881  42.156  1.00 55.88  ? 99  ASP B N     1 
ATOM   5979  C  CA    . ASP B 1 99  ? 12.107  -8.647  41.469  1.00 56.39  ? 99  ASP B CA    1 
ATOM   5980  C  C     . ASP B 1 99  ? 11.025  -7.581  41.547  1.00 57.03  ? 99  ASP B C     1 
ATOM   5981  O  O     . ASP B 1 99  ? 9.957   -7.707  40.950  1.00 56.86  ? 99  ASP B O     1 
ATOM   5982  C  CB    . ASP B 1 99  ? 12.458  -8.921  40.004  1.00 56.42  ? 99  ASP B CB    1 
ATOM   5983  C  CG    . ASP B 1 99  ? 12.932  -7.669  39.267  1.00 57.44  ? 99  ASP B CG    1 
ATOM   5984  O  OD1   . ASP B 1 99  ? 13.452  -6.734  39.917  1.00 56.24  ? 99  ASP B OD1   1 
ATOM   5985  O  OD2   . ASP B 1 99  ? 12.799  -7.625  38.025  1.00 60.80  ? 99  ASP B OD2   1 
ATOM   5986  N  N     . PRO B 1 100 ? 11.306  -6.501  42.288  1.00 57.48  ? 100 PRO B N     1 
ATOM   5987  C  CA    . PRO B 1 100 ? 10.390  -5.377  42.473  1.00 57.97  ? 100 PRO B CA    1 
ATOM   5988  C  C     . PRO B 1 100 ? 9.879   -4.878  41.131  1.00 60.10  ? 100 PRO B C     1 
ATOM   5989  O  O     . PRO B 1 100 ? 8.772   -4.372  41.033  1.00 61.24  ? 100 PRO B O     1 
ATOM   5990  C  CB    . PRO B 1 100 ? 11.261  -4.337  43.156  1.00 57.66  ? 100 PRO B CB    1 
ATOM   5991  C  CG    . PRO B 1 100 ? 12.252  -5.162  43.910  1.00 57.34  ? 100 PRO B CG    1 
ATOM   5992  C  CD    . PRO B 1 100 ? 12.601  -6.241  42.943  1.00 56.52  ? 100 PRO B CD    1 
ATOM   5993  N  N     . LYS B 1 101 ? 10.696  -5.022  40.092  1.00 62.47  ? 101 LYS B N     1 
ATOM   5994  C  CA    . LYS B 1 101 ? 10.316  -4.563  38.758  1.00 63.73  ? 101 LYS B CA    1 
ATOM   5995  C  C     . LYS B 1 101 ? 9.264   -5.406  38.069  1.00 64.69  ? 101 LYS B C     1 
ATOM   5996  O  O     . LYS B 1 101 ? 8.599   -4.935  37.152  1.00 66.39  ? 101 LYS B O     1 
ATOM   5997  C  CB    . LYS B 1 101 ? 11.542  -4.445  37.874  1.00 62.34  ? 101 LYS B CB    1 
ATOM   5998  C  CG    . LYS B 1 101 ? 12.326  -3.208  38.181  1.00 62.93  ? 101 LYS B CG    1 
ATOM   5999  C  CD    . LYS B 1 101 ? 13.792  -3.512  38.214  1.00 64.59  ? 101 LYS B CD    1 
ATOM   6000  C  CE    . LYS B 1 101 ? 14.261  -4.069  36.882  1.00 65.52  ? 101 LYS B CE    1 
ATOM   6001  N  NZ    . LYS B 1 101 ? 15.571  -3.474  36.501  1.00 66.38  ? 101 LYS B NZ    1 
ATOM   6002  N  N     . ASP B 1 102 ? 9.111   -6.652  38.486  1.00 64.82  ? 102 ASP B N     1 
ATOM   6003  C  CA    . ASP B 1 102 ? 8.084   -7.470  37.884  1.00 66.20  ? 102 ASP B CA    1 
ATOM   6004  C  C     . ASP B 1 102 ? 6.831   -7.309  38.728  1.00 66.11  ? 102 ASP B C     1 
ATOM   6005  O  O     . ASP B 1 102 ? 6.847   -7.593  39.921  1.00 65.24  ? 102 ASP B O     1 
ATOM   6006  C  CB    . ASP B 1 102 ? 8.494   -8.934  37.844  1.00 69.27  ? 102 ASP B CB    1 
ATOM   6007  C  CG    . ASP B 1 102 ? 7.309   -9.858  37.610  1.00 73.59  ? 102 ASP B CG    1 
ATOM   6008  O  OD1   . ASP B 1 102 ? 6.487   -9.570  36.700  1.00 76.00  ? 102 ASP B OD1   1 
ATOM   6009  O  OD2   . ASP B 1 102 ? 7.198   -10.872 38.338  1.00 74.43  ? 102 ASP B OD2   1 
ATOM   6010  N  N     . PRO B 1 103 ? 5.726   -6.854  38.115  1.00 66.53  ? 103 PRO B N     1 
ATOM   6011  C  CA    . PRO B 1 103 ? 4.450   -6.645  38.807  1.00 66.36  ? 103 PRO B CA    1 
ATOM   6012  C  C     . PRO B 1 103 ? 4.078   -7.846  39.659  1.00 66.11  ? 103 PRO B C     1 
ATOM   6013  O  O     . PRO B 1 103 ? 3.555   -7.715  40.769  1.00 65.34  ? 103 PRO B O     1 
ATOM   6014  C  CB    . PRO B 1 103 ? 3.469   -6.446  37.658  1.00 66.60  ? 103 PRO B CB    1 
ATOM   6015  C  CG    . PRO B 1 103 ? 4.311   -5.816  36.604  1.00 67.67  ? 103 PRO B CG    1 
ATOM   6016  C  CD    . PRO B 1 103 ? 5.560   -6.655  36.665  1.00 67.21  ? 103 PRO B CD    1 
ATOM   6017  N  N     . GLY B 1 104 ? 4.358   -9.023  39.118  1.00 65.87  ? 104 GLY B N     1 
ATOM   6018  C  CA    . GLY B 1 104 ? 4.037   -10.246 39.816  1.00 64.69  ? 104 GLY B CA    1 
ATOM   6019  C  C     . GLY B 1 104 ? 4.806   -10.439 41.104  1.00 64.38  ? 104 GLY B C     1 
ATOM   6020  O  O     . GLY B 1 104 ? 4.213   -10.446 42.180  1.00 64.85  ? 104 GLY B O     1 
ATOM   6021  N  N     . GLU B 1 105 ? 6.124   -10.594 40.992  1.00 63.53  ? 105 GLU B N     1 
ATOM   6022  C  CA    . GLU B 1 105 ? 6.986   -10.823 42.148  1.00 61.77  ? 105 GLU B CA    1 
ATOM   6023  C  C     . GLU B 1 105 ? 6.881   -9.723  43.169  1.00 59.90  ? 105 GLU B C     1 
ATOM   6024  O  O     . GLU B 1 105 ? 7.227   -9.883  44.333  1.00 60.59  ? 105 GLU B O     1 
ATOM   6025  C  CB    . GLU B 1 105 ? 8.438   -10.939 41.702  1.00 62.25  ? 105 GLU B CB    1 
ATOM   6026  C  CG    . GLU B 1 105 ? 8.680   -12.141 40.817  1.00 64.39  ? 105 GLU B CG    1 
ATOM   6027  C  CD    . GLU B 1 105 ? 10.155  -12.437 40.601  1.00 65.10  ? 105 GLU B CD    1 
ATOM   6028  O  OE1   . GLU B 1 105 ? 10.870  -11.553 40.089  1.00 65.81  ? 105 GLU B OE1   1 
ATOM   6029  O  OE2   . GLU B 1 105 ? 10.598  -13.556 40.940  1.00 64.59  ? 105 GLU B OE2   1 
ATOM   6030  N  N     . ARG B 1 106 ? 6.381   -8.596  42.719  1.00 57.03  ? 106 ARG B N     1 
ATOM   6031  C  CA    . ARG B 1 106 ? 6.267   -7.461  43.576  1.00 54.47  ? 106 ARG B CA    1 
ATOM   6032  C  C     . ARG B 1 106 ? 5.132   -7.551  44.571  1.00 52.80  ? 106 ARG B C     1 
ATOM   6033  O  O     . ARG B 1 106 ? 5.318   -7.288  45.763  1.00 53.29  ? 106 ARG B O     1 
ATOM   6034  C  CB    . ARG B 1 106 ? 6.102   -6.254  42.711  1.00 56.30  ? 106 ARG B CB    1 
ATOM   6035  C  CG    . ARG B 1 106 ? 6.513   -5.030  43.385  1.00 58.71  ? 106 ARG B CG    1 
ATOM   6036  C  CD    . ARG B 1 106 ? 6.640   -4.030  42.344  1.00 60.76  ? 106 ARG B CD    1 
ATOM   6037  N  NE    . ARG B 1 106 ? 6.169   -2.756  42.806  1.00 62.89  ? 106 ARG B NE    1 
ATOM   6038  C  CZ    . ARG B 1 106 ? 5.340   -2.005  42.103  1.00 65.09  ? 106 ARG B CZ    1 
ATOM   6039  N  NH1   . ARG B 1 106 ? 4.899   -2.423  40.914  1.00 65.19  ? 106 ARG B NH1   1 
ATOM   6040  N  NH2   . ARG B 1 106 ? 4.974   -0.827  42.583  1.00 66.12  ? 106 ARG B NH2   1 
ATOM   6041  N  N     . SER B 1 107 ? 3.952   -7.896  44.069  1.00 50.04  ? 107 SER B N     1 
ATOM   6042  C  CA    . SER B 1 107 ? 2.771   -8.052  44.899  1.00 47.22  ? 107 SER B CA    1 
ATOM   6043  C  C     . SER B 1 107 ? 3.149   -8.914  46.087  1.00 44.31  ? 107 SER B C     1 
ATOM   6044  O  O     . SER B 1 107 ? 2.696   -8.673  47.202  1.00 41.93  ? 107 SER B O     1 
ATOM   6045  C  CB    . SER B 1 107 ? 1.670   -8.715  44.086  1.00 48.38  ? 107 SER B CB    1 
ATOM   6046  O  OG    . SER B 1 107 ? 1.390   -7.914  42.956  1.00 53.77  ? 107 SER B OG    1 
ATOM   6047  N  N     . VAL B 1 108 ? 4.000   -9.906  45.840  1.00 41.77  ? 108 VAL B N     1 
ATOM   6048  C  CA    . VAL B 1 108 ? 4.461   -10.790 46.898  1.00 40.92  ? 108 VAL B CA    1 
ATOM   6049  C  C     . VAL B 1 108 ? 5.271   -10.004 47.935  1.00 40.69  ? 108 VAL B C     1 
ATOM   6050  O  O     . VAL B 1 108 ? 5.016   -10.105 49.138  1.00 40.95  ? 108 VAL B O     1 
ATOM   6051  C  CB    . VAL B 1 108 ? 5.326   -11.919 46.337  1.00 40.62  ? 108 VAL B CB    1 
ATOM   6052  C  CG1   . VAL B 1 108 ? 5.667   -12.904 47.438  1.00 40.89  ? 108 VAL B CG1   1 
ATOM   6053  C  CG2   . VAL B 1 108 ? 4.590   -12.622 45.220  1.00 42.38  ? 108 VAL B CG2   1 
ATOM   6054  N  N     . LEU B 1 109 ? 6.245   -9.222  47.475  1.00 39.31  ? 109 LEU B N     1 
ATOM   6055  C  CA    . LEU B 1 109 ? 7.048   -8.417  48.383  1.00 38.22  ? 109 LEU B CA    1 
ATOM   6056  C  C     . LEU B 1 109 ? 6.144   -7.437  49.143  1.00 38.16  ? 109 LEU B C     1 
ATOM   6057  O  O     . LEU B 1 109 ? 6.281   -7.273  50.355  1.00 39.78  ? 109 LEU B O     1 
ATOM   6058  C  CB    . LEU B 1 109 ? 8.135   -7.654  47.614  1.00 38.76  ? 109 LEU B CB    1 
ATOM   6059  C  CG    . LEU B 1 109 ? 9.298   -8.460  46.998  1.00 38.97  ? 109 LEU B CG    1 
ATOM   6060  C  CD1   . LEU B 1 109 ? 10.135  -7.566  46.123  1.00 38.59  ? 109 LEU B CD1   1 
ATOM   6061  C  CD2   . LEU B 1 109 ? 10.166  -9.056  48.075  1.00 38.35  ? 109 LEU B CD2   1 
ATOM   6062  N  N     . SER B 1 110 ? 5.213   -6.788  48.452  1.00 36.01  ? 110 SER B N     1 
ATOM   6063  C  CA    . SER B 1 110 ? 4.330   -5.860  49.145  1.00 33.29  ? 110 SER B CA    1 
ATOM   6064  C  C     . SER B 1 110 ? 3.548   -6.586  50.226  1.00 31.65  ? 110 SER B C     1 
ATOM   6065  O  O     . SER B 1 110 ? 3.507   -6.140  51.362  1.00 31.93  ? 110 SER B O     1 
ATOM   6066  C  CB    . SER B 1 110 ? 3.355   -5.178  48.175  1.00 32.75  ? 110 SER B CB    1 
ATOM   6067  O  OG    . SER B 1 110 ? 3.957   -4.095  47.485  1.00 31.01  ? 110 SER B OG    1 
ATOM   6068  N  N     . ALA B 1 111 ? 2.930   -7.705  49.882  1.00 31.14  ? 111 ALA B N     1 
ATOM   6069  C  CA    . ALA B 1 111 ? 2.155   -8.441  50.869  1.00 31.21  ? 111 ALA B CA    1 
ATOM   6070  C  C     . ALA B 1 111 ? 3.033   -8.722  52.057  1.00 32.50  ? 111 ALA B C     1 
ATOM   6071  O  O     . ALA B 1 111 ? 2.614   -8.529  53.187  1.00 34.45  ? 111 ALA B O     1 
ATOM   6072  C  CB    . ALA B 1 111 ? 1.659   -9.729  50.304  1.00 31.01  ? 111 ALA B CB    1 
ATOM   6073  N  N     . LEU B 1 112 ? 4.251   -9.187  51.800  1.00 32.00  ? 112 LEU B N     1 
ATOM   6074  C  CA    . LEU B 1 112 ? 5.191   -9.481  52.869  1.00 31.23  ? 112 LEU B CA    1 
ATOM   6075  C  C     . LEU B 1 112 ? 5.392   -8.260  53.746  1.00 32.59  ? 112 LEU B C     1 
ATOM   6076  O  O     . LEU B 1 112 ? 5.350   -8.336  54.970  1.00 33.27  ? 112 LEU B O     1 
ATOM   6077  C  CB    . LEU B 1 112 ? 6.542   -9.883  52.293  1.00 29.03  ? 112 LEU B CB    1 
ATOM   6078  C  CG    . LEU B 1 112 ? 6.725   -11.325 51.843  1.00 28.13  ? 112 LEU B CG    1 
ATOM   6079  C  CD1   . LEU B 1 112 ? 8.052   -11.460 51.136  1.00 27.13  ? 112 LEU B CD1   1 
ATOM   6080  C  CD2   . LEU B 1 112 ? 6.665   -12.247 53.037  1.00 26.68  ? 112 LEU B CD2   1 
ATOM   6081  N  N     . ALA B 1 113 ? 5.625   -7.127  53.105  1.00 34.36  ? 113 ALA B N     1 
ATOM   6082  C  CA    . ALA B 1 113 ? 5.856   -5.892  53.824  1.00 36.77  ? 113 ALA B CA    1 
ATOM   6083  C  C     . ALA B 1 113 ? 4.672   -5.544  54.700  1.00 39.70  ? 113 ALA B C     1 
ATOM   6084  O  O     . ALA B 1 113 ? 4.845   -5.100  55.830  1.00 40.85  ? 113 ALA B O     1 
ATOM   6085  C  CB    . ALA B 1 113 ? 6.122   -4.777  52.848  1.00 37.13  ? 113 ALA B CB    1 
ATOM   6086  N  N     . ARG B 1 114 ? 3.468   -5.740  54.173  1.00 42.29  ? 114 ARG B N     1 
ATOM   6087  C  CA    . ARG B 1 114 ? 2.258   -5.436  54.921  1.00 43.76  ? 114 ARG B CA    1 
ATOM   6088  C  C     . ARG B 1 114 ? 2.078   -6.404  56.078  1.00 42.62  ? 114 ARG B C     1 
ATOM   6089  O  O     . ARG B 1 114 ? 1.518   -6.062  57.116  1.00 42.06  ? 114 ARG B O     1 
ATOM   6090  C  CB    . ARG B 1 114 ? 1.041   -5.497  54.001  1.00 48.57  ? 114 ARG B CB    1 
ATOM   6091  C  CG    . ARG B 1 114 ? -0.260  -5.147  54.704  1.00 55.88  ? 114 ARG B CG    1 
ATOM   6092  C  CD    . ARG B 1 114 ? -1.400  -4.875  53.734  1.00 61.19  ? 114 ARG B CD    1 
ATOM   6093  N  NE    . ARG B 1 114 ? -2.628  -4.552  54.455  1.00 66.43  ? 114 ARG B NE    1 
ATOM   6094  C  CZ    . ARG B 1 114 ? -3.835  -4.517  53.901  1.00 69.68  ? 114 ARG B CZ    1 
ATOM   6095  N  NH1   . ARG B 1 114 ? -3.990  -4.787  52.603  1.00 71.74  ? 114 ARG B NH1   1 
ATOM   6096  N  NH2   . ARG B 1 114 ? -4.890  -4.213  54.648  1.00 71.42  ? 114 ARG B NH2   1 
ATOM   6097  N  N     . ARG B 1 115 ? 2.552   -7.625  55.893  1.00 41.99  ? 115 ARG B N     1 
ATOM   6098  C  CA    . ARG B 1 115 ? 2.441   -8.618  56.935  1.00 41.64  ? 115 ARG B CA    1 
ATOM   6099  C  C     . ARG B 1 115 ? 3.525   -8.313  57.971  1.00 40.42  ? 115 ARG B C     1 
ATOM   6100  O  O     . ARG B 1 115 ? 3.356   -8.596  59.154  1.00 41.09  ? 115 ARG B O     1 
ATOM   6101  C  CB    . ARG B 1 115 ? 2.640   -10.006 56.344  1.00 44.67  ? 115 ARG B CB    1 
ATOM   6102  C  CG    . ARG B 1 115 ? 2.302   -11.140 57.279  1.00 49.71  ? 115 ARG B CG    1 
ATOM   6103  C  CD    . ARG B 1 115 ? 0.878   -11.620 57.105  1.00 54.00  ? 115 ARG B CD    1 
ATOM   6104  N  NE    . ARG B 1 115 ? 0.586   -12.682 58.063  1.00 58.55  ? 115 ARG B NE    1 
ATOM   6105  C  CZ    . ARG B 1 115 ? 0.521   -12.494 59.379  1.00 60.82  ? 115 ARG B CZ    1 
ATOM   6106  N  NH1   . ARG B 1 115 ? 0.720   -11.283 59.891  1.00 59.76  ? 115 ARG B NH1   1 
ATOM   6107  N  NH2   . ARG B 1 115 ? 0.272   -13.520 60.187  1.00 62.47  ? 115 ARG B NH2   1 
ATOM   6108  N  N     . LEU B 1 116 ? 4.634   -7.724  57.530  1.00 37.28  ? 116 LEU B N     1 
ATOM   6109  C  CA    . LEU B 1 116 ? 5.711   -7.386  58.449  1.00 34.73  ? 116 LEU B CA    1 
ATOM   6110  C  C     . LEU B 1 116 ? 5.302   -6.253  59.359  1.00 34.59  ? 116 LEU B C     1 
ATOM   6111  O  O     . LEU B 1 116 ? 5.579   -6.280  60.550  1.00 36.39  ? 116 LEU B O     1 
ATOM   6112  C  CB    . LEU B 1 116 ? 6.972   -6.962  57.703  1.00 33.47  ? 116 LEU B CB    1 
ATOM   6113  C  CG    . LEU B 1 116 ? 8.155   -6.582  58.616  1.00 32.62  ? 116 LEU B CG    1 
ATOM   6114  C  CD1   . LEU B 1 116 ? 8.746   -7.849  59.243  1.00 30.27  ? 116 LEU B CD1   1 
ATOM   6115  C  CD2   . LEU B 1 116 ? 9.225   -5.836  57.814  1.00 29.44  ? 116 LEU B CD2   1 
ATOM   6116  N  N     . LEU B 1 117 ? 4.648   -5.253  58.783  1.00 33.81  ? 117 LEU B N     1 
ATOM   6117  C  CA    . LEU B 1 117 ? 4.206   -4.081  59.517  1.00 32.15  ? 117 LEU B CA    1 
ATOM   6118  C  C     . LEU B 1 117 ? 3.249   -4.491  60.601  1.00 34.30  ? 117 LEU B C     1 
ATOM   6119  O  O     . LEU B 1 117 ? 3.211   -3.902  61.669  1.00 35.06  ? 117 LEU B O     1 
ATOM   6120  C  CB    . LEU B 1 117 ? 3.487   -3.120  58.584  1.00 28.53  ? 117 LEU B CB    1 
ATOM   6121  C  CG    . LEU B 1 117 ? 3.687   -1.629  58.825  1.00 26.50  ? 117 LEU B CG    1 
ATOM   6122  C  CD1   . LEU B 1 117 ? 2.522   -0.850  58.244  1.00 24.92  ? 117 LEU B CD1   1 
ATOM   6123  C  CD2   . LEU B 1 117 ? 3.801   -1.367  60.294  1.00 26.15  ? 117 LEU B CD2   1 
ATOM   6124  N  N     . GLN B 1 118 ? 2.465   -5.514  60.326  1.00 37.80  ? 118 GLN B N     1 
ATOM   6125  C  CA    . GLN B 1 118 ? 1.483   -5.956  61.296  1.00 42.16  ? 118 GLN B CA    1 
ATOM   6126  C  C     . GLN B 1 118 ? 2.108   -6.696  62.468  1.00 43.34  ? 118 GLN B C     1 
ATOM   6127  O  O     . GLN B 1 118 ? 1.629   -6.586  63.595  1.00 44.47  ? 118 GLN B O     1 
ATOM   6128  C  CB    . GLN B 1 118 ? 0.436   -6.829  60.604  1.00 44.49  ? 118 GLN B CB    1 
ATOM   6129  C  CG    . GLN B 1 118 ? -1.008  -6.364  60.812  1.00 48.67  ? 118 GLN B CG    1 
ATOM   6130  C  CD    . GLN B 1 118 ? -1.954  -6.820  59.695  1.00 51.42  ? 118 GLN B CD    1 
ATOM   6131  O  OE1   . GLN B 1 118 ? -1.665  -7.776  58.961  1.00 53.46  ? 118 GLN B OE1   1 
ATOM   6132  N  NE2   . GLN B 1 118 ? -3.097  -6.141  59.574  1.00 50.21  ? 118 GLN B NE2   1 
ATOM   6133  N  N     . GLU B 1 119 ? 3.178   -7.441  62.212  1.00 43.91  ? 119 GLU B N     1 
ATOM   6134  C  CA    . GLU B 1 119 ? 3.832   -8.184  63.278  1.00 44.58  ? 119 GLU B CA    1 
ATOM   6135  C  C     . GLU B 1 119 ? 4.736   -7.264  64.068  1.00 43.99  ? 119 GLU B C     1 
ATOM   6136  O  O     . GLU B 1 119 ? 4.935   -7.460  65.258  1.00 45.43  ? 119 GLU B O     1 
ATOM   6137  C  CB    . GLU B 1 119 ? 4.651   -9.351  62.717  1.00 46.87  ? 119 GLU B CB    1 
ATOM   6138  C  CG    . GLU B 1 119 ? 3.819   -10.434 62.048  1.00 52.95  ? 119 GLU B CG    1 
ATOM   6139  C  CD    . GLU B 1 119 ? 2.719   -10.978 62.954  1.00 56.31  ? 119 GLU B CD    1 
ATOM   6140  O  OE1   . GLU B 1 119 ? 3.040   -11.675 63.943  1.00 57.96  ? 119 GLU B OE1   1 
ATOM   6141  O  OE2   . GLU B 1 119 ? 1.529   -10.700 62.681  1.00 57.60  ? 119 GLU B OE2   1 
ATOM   6142  N  N     . ARG B 1 120 ? 5.291   -6.259  63.403  1.00 42.92  ? 120 ARG B N     1 
ATOM   6143  C  CA    . ARG B 1 120 ? 6.175   -5.317  64.071  1.00 41.23  ? 120 ARG B CA    1 
ATOM   6144  C  C     . ARG B 1 120 ? 5.374   -4.415  65.002  1.00 41.34  ? 120 ARG B C     1 
ATOM   6145  O  O     . ARG B 1 120 ? 5.761   -4.210  66.144  1.00 41.64  ? 120 ARG B O     1 
ATOM   6146  C  CB    . ARG B 1 120 ? 6.926   -4.484  63.034  1.00 40.77  ? 120 ARG B CB    1 
ATOM   6147  C  CG    . ARG B 1 120 ? 8.110   -5.191  62.372  1.00 39.93  ? 120 ARG B CG    1 
ATOM   6148  C  CD    . ARG B 1 120 ? 9.423   -4.709  62.983  1.00 40.86  ? 120 ARG B CD    1 
ATOM   6149  N  NE    . ARG B 1 120 ? 10.616  -5.150  62.261  1.00 41.39  ? 120 ARG B NE    1 
ATOM   6150  C  CZ    . ARG B 1 120 ? 10.969  -6.425  62.095  1.00 43.26  ? 120 ARG B CZ    1 
ATOM   6151  N  NH1   . ARG B 1 120 ? 10.216  -7.402  62.591  1.00 43.00  ? 120 ARG B NH1   1 
ATOM   6152  N  NH2   . ARG B 1 120 ? 12.097  -6.728  61.463  1.00 41.63  ? 120 ARG B NH2   1 
ATOM   6153  N  N     . LEU B 1 121 ? 4.253   -3.888  64.520  1.00 41.67  ? 121 LEU B N     1 
ATOM   6154  C  CA    . LEU B 1 121 ? 3.410   -3.016  65.329  1.00 41.73  ? 121 LEU B CA    1 
ATOM   6155  C  C     . LEU B 1 121 ? 2.836   -3.746  66.507  1.00 43.50  ? 121 LEU B C     1 
ATOM   6156  O  O     . LEU B 1 121 ? 2.851   -3.250  67.637  1.00 45.77  ? 121 LEU B O     1 
ATOM   6157  C  CB    . LEU B 1 121 ? 2.243   -2.489  64.523  1.00 38.82  ? 121 LEU B CB    1 
ATOM   6158  C  CG    . LEU B 1 121 ? 2.622   -1.491  63.456  1.00 40.13  ? 121 LEU B CG    1 
ATOM   6159  C  CD1   . LEU B 1 121 ? 1.363   -1.112  62.722  1.00 42.02  ? 121 LEU B CD1   1 
ATOM   6160  C  CD2   . LEU B 1 121 ? 3.299   -0.272  64.063  1.00 37.89  ? 121 LEU B CD2   1 
ATOM   6161  N  N     . ARG B 1 122 ? 2.314   -4.930  66.225  1.00 43.86  ? 122 ARG B N     1 
ATOM   6162  C  CA    . ARG B 1 122 ? 1.686   -5.762  67.229  1.00 44.91  ? 122 ARG B CA    1 
ATOM   6163  C  C     . ARG B 1 122 ? 2.524   -6.066  68.463  1.00 46.13  ? 122 ARG B C     1 
ATOM   6164  O  O     . ARG B 1 122 ? 1.986   -6.473  69.484  1.00 46.59  ? 122 ARG B O     1 
ATOM   6165  C  CB    . ARG B 1 122 ? 1.259   -7.069  66.596  1.00 45.32  ? 122 ARG B CB    1 
ATOM   6166  C  CG    . ARG B 1 122 ? 0.254   -7.792  67.417  1.00 48.38  ? 122 ARG B CG    1 
ATOM   6167  C  CD    . ARG B 1 122 ? -0.076  -9.112  66.811  1.00 50.91  ? 122 ARG B CD    1 
ATOM   6168  N  NE    . ARG B 1 122 ? 1.082   -9.993  66.848  1.00 54.98  ? 122 ARG B NE    1 
ATOM   6169  C  CZ    . ARG B 1 122 ? 1.015   -11.307 66.674  1.00 55.93  ? 122 ARG B CZ    1 
ATOM   6170  N  NH1   . ARG B 1 122 ? -0.163  -11.885 66.454  1.00 56.90  ? 122 ARG B NH1   1 
ATOM   6171  N  NH2   . ARG B 1 122 ? 2.120   -12.040 66.723  1.00 54.43  ? 122 ARG B NH2   1 
ATOM   6172  N  N     . ARG B 1 123 ? 3.836   -5.869  68.363  1.00 47.44  ? 123 ARG B N     1 
ATOM   6173  C  CA    . ARG B 1 123 ? 4.768   -6.136  69.455  1.00 47.20  ? 123 ARG B CA    1 
ATOM   6174  C  C     . ARG B 1 123 ? 5.528   -4.889  69.882  1.00 46.47  ? 123 ARG B C     1 
ATOM   6175  O  O     . ARG B 1 123 ? 6.498   -4.954  70.641  1.00 46.19  ? 123 ARG B O     1 
ATOM   6176  C  CB    . ARG B 1 123 ? 5.772   -7.183  69.010  1.00 50.45  ? 123 ARG B CB    1 
ATOM   6177  C  CG    . ARG B 1 123 ? 5.487   -8.565  69.528  1.00 57.94  ? 123 ARG B CG    1 
ATOM   6178  C  CD    . ARG B 1 123 ? 4.181   -9.151  69.007  1.00 62.76  ? 123 ARG B CD    1 
ATOM   6179  N  NE    . ARG B 1 123 ? 3.999   -10.510 69.521  1.00 68.32  ? 123 ARG B NE    1 
ATOM   6180  C  CZ    . ARG B 1 123 ? 3.814   -10.810 70.808  1.00 70.71  ? 123 ARG B CZ    1 
ATOM   6181  N  NH1   . ARG B 1 123 ? 3.668   -12.082 71.176  1.00 71.13  ? 123 ARG B NH1   1 
ATOM   6182  N  NH2   . ARG B 1 123 ? 3.755   -9.842  71.726  1.00 70.46  ? 123 ARG B NH2   1 
ATOM   6183  N  N     . LEU B 1 124 ? 5.083   -3.747  69.388  1.00 44.64  ? 124 LEU B N     1 
ATOM   6184  C  CA    . LEU B 1 124 ? 5.740   -2.497  69.698  1.00 42.15  ? 124 LEU B CA    1 
ATOM   6185  C  C     . LEU B 1 124 ? 5.499   -2.161  71.167  1.00 41.75  ? 124 LEU B C     1 
ATOM   6186  O  O     . LEU B 1 124 ? 4.424   -2.452  71.701  1.00 40.79  ? 124 LEU B O     1 
ATOM   6187  C  CB    . LEU B 1 124 ? 5.176   -1.408  68.782  1.00 39.30  ? 124 LEU B CB    1 
ATOM   6188  C  CG    . LEU B 1 124 ? 6.172   -0.478  68.107  1.00 34.47  ? 124 LEU B CG    1 
ATOM   6189  C  CD1   . LEU B 1 124 ? 7.119   -1.276  67.271  1.00 30.84  ? 124 LEU B CD1   1 
ATOM   6190  C  CD2   . LEU B 1 124 ? 5.419   0.525   67.271  1.00 33.07  ? 124 LEU B CD2   1 
ATOM   6191  N  N     . GLU B 1 125 ? 6.502   -1.562  71.810  1.00 41.00  ? 125 GLU B N     1 
ATOM   6192  C  CA    . GLU B 1 125 ? 6.400   -1.177  73.217  1.00 40.20  ? 125 GLU B CA    1 
ATOM   6193  C  C     . GLU B 1 125 ? 6.118   0.301   73.382  1.00 37.50  ? 125 GLU B C     1 
ATOM   6194  O  O     . GLU B 1 125 ? 6.585   1.126   72.603  1.00 36.71  ? 125 GLU B O     1 
ATOM   6195  C  CB    . GLU B 1 125 ? 7.692   -1.475  73.970  1.00 43.52  ? 125 GLU B CB    1 
ATOM   6196  C  CG    . GLU B 1 125 ? 8.105   -2.918  74.032  1.00 48.29  ? 125 GLU B CG    1 
ATOM   6197  C  CD    . GLU B 1 125 ? 9.375   -3.105  74.854  1.00 52.80  ? 125 GLU B CD    1 
ATOM   6198  O  OE1   . GLU B 1 125 ? 10.432  -2.506  74.510  1.00 54.75  ? 125 GLU B OE1   1 
ATOM   6199  O  OE2   . GLU B 1 125 ? 9.314   -3.852  75.854  1.00 54.94  ? 125 GLU B OE2   1 
ATOM   6200  N  N     . GLY B 1 126 ? 5.373   0.623   74.426  1.00 36.60  ? 126 GLY B N     1 
ATOM   6201  C  CA    . GLY B 1 126 ? 5.041   2.005   74.713  1.00 37.14  ? 126 GLY B CA    1 
ATOM   6202  C  C     . GLY B 1 126 ? 4.085   2.578   73.700  1.00 36.72  ? 126 GLY B C     1 
ATOM   6203  O  O     . GLY B 1 126 ? 4.160   3.763   73.359  1.00 37.99  ? 126 GLY B O     1 
ATOM   6204  N  N     . VAL B 1 127 ? 3.163   1.735   73.245  1.00 35.35  ? 127 VAL B N     1 
ATOM   6205  C  CA    . VAL B 1 127 ? 2.199   2.124   72.227  1.00 34.45  ? 127 VAL B CA    1 
ATOM   6206  C  C     . VAL B 1 127 ? 0.916   1.275   72.228  1.00 35.62  ? 127 VAL B C     1 
ATOM   6207  O  O     . VAL B 1 127 ? 0.959   0.070   72.489  1.00 37.39  ? 127 VAL B O     1 
ATOM   6208  C  CB    . VAL B 1 127 ? 2.874   2.028   70.850  1.00 30.72  ? 127 VAL B CB    1 
ATOM   6209  C  CG1   . VAL B 1 127 ? 1.936   1.442   69.843  1.00 32.06  ? 127 VAL B CG1   1 
ATOM   6210  C  CG2   . VAL B 1 127 ? 3.334   3.391   70.425  1.00 29.62  ? 127 VAL B CG2   1 
ATOM   6211  N  N     . TRP B 1 128 ? -0.224  1.905   71.958  1.00 34.21  ? 128 TRP B N     1 
ATOM   6212  C  CA    . TRP B 1 128 ? -1.470  1.164   71.892  1.00 34.22  ? 128 TRP B CA    1 
ATOM   6213  C  C     . TRP B 1 128 ? -1.733  0.941   70.412  1.00 34.85  ? 128 TRP B C     1 
ATOM   6214  O  O     . TRP B 1 128 ? -1.893  1.892   69.644  1.00 35.22  ? 128 TRP B O     1 
ATOM   6215  C  CB    . TRP B 1 128 ? -2.624  1.939   72.520  1.00 35.96  ? 128 TRP B CB    1 
ATOM   6216  C  CG    . TRP B 1 128 ? -3.960  1.359   72.162  1.00 37.72  ? 128 TRP B CG    1 
ATOM   6217  C  CD1   . TRP B 1 128 ? -4.944  1.944   71.398  1.00 38.98  ? 128 TRP B CD1   1 
ATOM   6218  C  CD2   . TRP B 1 128 ? -4.421  0.045   72.467  1.00 37.64  ? 128 TRP B CD2   1 
ATOM   6219  N  NE1   . TRP B 1 128 ? -5.986  1.062   71.206  1.00 37.95  ? 128 TRP B NE1   1 
ATOM   6220  C  CE2   . TRP B 1 128 ? -5.690  -0.110  71.851  1.00 38.62  ? 128 TRP B CE2   1 
ATOM   6221  C  CE3   . TRP B 1 128 ? -3.888  -1.020  73.200  1.00 38.12  ? 128 TRP B CE3   1 
ATOM   6222  C  CZ2   . TRP B 1 128 ? -6.427  -1.292  71.947  1.00 40.04  ? 128 TRP B CZ2   1 
ATOM   6223  C  CZ3   . TRP B 1 128 ? -4.621  -2.196  73.298  1.00 40.98  ? 128 TRP B CZ3   1 
ATOM   6224  C  CH2   . TRP B 1 128 ? -5.881  -2.323  72.673  1.00 41.83  ? 128 TRP B CH2   1 
ATOM   6225  N  N     . VAL B 1 129 ? -1.780  -0.327  70.023  1.00 35.12  ? 129 VAL B N     1 
ATOM   6226  C  CA    . VAL B 1 129 ? -1.979  -0.725  68.631  1.00 34.64  ? 129 VAL B CA    1 
ATOM   6227  C  C     . VAL B 1 129 ? -3.366  -1.296  68.323  1.00 34.77  ? 129 VAL B C     1 
ATOM   6228  O  O     . VAL B 1 129 ? -4.031  -1.854  69.190  1.00 36.98  ? 129 VAL B O     1 
ATOM   6229  C  CB    . VAL B 1 129 ? -0.911  -1.785  68.228  1.00 33.40  ? 129 VAL B CB    1 
ATOM   6230  C  CG1   . VAL B 1 129 ? -1.242  -2.374  66.868  1.00 33.08  ? 129 VAL B CG1   1 
ATOM   6231  C  CG2   . VAL B 1 129 ? 0.488   -1.156  68.238  1.00 30.75  ? 129 VAL B CG2   1 
ATOM   6232  N  N     . GLU B 1 130 ? -3.808  -1.143  67.085  1.00 33.31  ? 130 GLU B N     1 
ATOM   6233  C  CA    . GLU B 1 130 ? -5.089  -1.695  66.684  1.00 32.94  ? 130 GLU B CA    1 
ATOM   6234  C  C     . GLU B 1 130 ? -5.038  -1.868  65.173  1.00 33.28  ? 130 GLU B C     1 
ATOM   6235  O  O     . GLU B 1 130 ? -5.382  -0.965  64.405  1.00 34.00  ? 130 GLU B O     1 
ATOM   6236  C  CB    . GLU B 1 130 ? -6.249  -0.783  67.104  1.00 31.95  ? 130 GLU B CB    1 
ATOM   6237  C  CG    . GLU B 1 130 ? -7.628  -1.346  66.776  0.00 32.11  ? 130 GLU B CG    1 
ATOM   6238  C  CD    . GLU B 1 130 ? -8.758  -0.429  67.208  0.00 31.93  ? 130 GLU B CD    1 
ATOM   6239  O  OE1   . GLU B 1 130 ? -8.849  -0.118  68.414  0.00 31.91  ? 130 GLU B OE1   1 
ATOM   6240  O  OE2   . GLU B 1 130 ? -9.559  -0.021  66.340  0.00 31.91  ? 130 GLU B OE2   1 
ATOM   6241  N  N     . GLY B 1 131 ? -4.582  -3.042  64.752  1.00 31.74  ? 131 GLY B N     1 
ATOM   6242  C  CA    . GLY B 1 131 ? -4.475  -3.317  63.335  1.00 32.17  ? 131 GLY B CA    1 
ATOM   6243  C  C     . GLY B 1 131 ? -3.260  -2.615  62.784  1.00 31.50  ? 131 GLY B C     1 
ATOM   6244  O  O     . GLY B 1 131 ? -2.157  -2.859  63.242  1.00 32.07  ? 131 GLY B O     1 
ATOM   6245  N  N     . LEU B 1 132 ? -3.455  -1.741  61.807  1.00 31.16  ? 132 LEU B N     1 
ATOM   6246  C  CA    . LEU B 1 132 ? -2.343  -1.009  61.240  1.00 30.52  ? 132 LEU B CA    1 
ATOM   6247  C  C     . LEU B 1 132 ? -2.307  0.395   61.796  1.00 32.72  ? 132 LEU B C     1 
ATOM   6248  O  O     . LEU B 1 132 ? -1.683  1.273   61.199  1.00 34.68  ? 132 LEU B O     1 
ATOM   6249  C  CB    . LEU B 1 132 ? -2.458  -0.923  59.730  1.00 28.61  ? 132 LEU B CB    1 
ATOM   6250  C  CG    . LEU B 1 132 ? -2.134  -2.178  58.950  1.00 27.84  ? 132 LEU B CG    1 
ATOM   6251  C  CD1   . LEU B 1 132 ? -2.096  -1.829  57.468  1.00 27.82  ? 132 LEU B CD1   1 
ATOM   6252  C  CD2   . LEU B 1 132 ? -0.802  -2.731  59.411  1.00 28.44  ? 132 LEU B CD2   1 
ATOM   6253  N  N     . ALA B 1 133 ? -2.984  0.618   62.921  1.00 33.51  ? 133 ALA B N     1 
ATOM   6254  C  CA    . ALA B 1 133 ? -3.003  1.943   63.545  1.00 34.43  ? 133 ALA B CA    1 
ATOM   6255  C  C     . ALA B 1 133 ? -2.258  1.925   64.873  1.00 35.11  ? 133 ALA B C     1 
ATOM   6256  O  O     . ALA B 1 133 ? -2.496  1.071   65.732  1.00 35.78  ? 133 ALA B O     1 
ATOM   6257  C  CB    . ALA B 1 133 ? -4.436  2.420   63.758  1.00 34.31  ? 133 ALA B CB    1 
ATOM   6258  N  N     . VAL B 1 134 ? -1.345  2.873   65.028  1.00 34.75  ? 134 VAL B N     1 
ATOM   6259  C  CA    . VAL B 1 134 ? -0.558  2.979   66.238  1.00 34.19  ? 134 VAL B CA    1 
ATOM   6260  C  C     . VAL B 1 134 ? -1.086  4.194   66.957  1.00 34.89  ? 134 VAL B C     1 
ATOM   6261  O  O     . VAL B 1 134 ? -1.478  5.164   66.316  1.00 34.63  ? 134 VAL B O     1 
ATOM   6262  C  CB    . VAL B 1 134 ? 0.929   3.215   65.923  1.00 34.04  ? 134 VAL B CB    1 
ATOM   6263  C  CG1   . VAL B 1 134 ? 1.744   3.124   67.187  1.00 32.02  ? 134 VAL B CG1   1 
ATOM   6264  C  CG2   . VAL B 1 134 ? 1.413   2.210   64.900  1.00 33.32  ? 134 VAL B CG2   1 
ATOM   6265  N  N     . TYR B 1 135 ? -1.111  4.128   68.284  1.00 34.93  ? 135 TYR B N     1 
ATOM   6266  C  CA    . TYR B 1 135 ? -1.572  5.233   69.106  1.00 34.62  ? 135 TYR B CA    1 
ATOM   6267  C  C     . TYR B 1 135 ? -0.465  5.522   70.111  1.00 36.48  ? 135 TYR B C     1 
ATOM   6268  O  O     . TYR B 1 135 ? 0.024   4.621   70.797  1.00 37.36  ? 135 TYR B O     1 
ATOM   6269  C  CB    . TYR B 1 135 ? -2.908  4.865   69.750  1.00 32.52  ? 135 TYR B CB    1 
ATOM   6270  C  CG    . TYR B 1 135 ? -3.985  4.758   68.694  1.00 31.81  ? 135 TYR B CG    1 
ATOM   6271  C  CD1   . TYR B 1 135 ? -4.332  3.526   68.128  1.00 31.35  ? 135 TYR B CD1   1 
ATOM   6272  C  CD2   . TYR B 1 135 ? -4.574  5.906   68.164  1.00 30.37  ? 135 TYR B CD2   1 
ATOM   6273  C  CE1   . TYR B 1 135 ? -5.241  3.448   67.046  1.00 27.45  ? 135 TYR B CE1   1 
ATOM   6274  C  CE2   . TYR B 1 135 ? -5.464  5.834   67.096  1.00 28.73  ? 135 TYR B CE2   1 
ATOM   6275  C  CZ    . TYR B 1 135 ? -5.792  4.609   66.542  1.00 26.67  ? 135 TYR B CZ    1 
ATOM   6276  O  OH    . TYR B 1 135 ? -6.661  4.576   65.477  1.00 24.27  ? 135 TYR B OH    1 
ATOM   6277  N  N     . ARG B 1 136 ? -0.061  6.786   70.173  1.00 38.14  ? 136 ARG B N     1 
ATOM   6278  C  CA    . ARG B 1 136 ? 1.057   7.203   71.010  1.00 39.52  ? 136 ARG B CA    1 
ATOM   6279  C  C     . ARG B 1 136 ? 0.805   8.057   72.217  1.00 41.45  ? 136 ARG B C     1 
ATOM   6280  O  O     . ARG B 1 136 ? 1.578   8.008   73.175  1.00 43.82  ? 136 ARG B O     1 
ATOM   6281  C  CB    . ARG B 1 136 ? 2.088   7.919   70.146  1.00 38.89  ? 136 ARG B CB    1 
ATOM   6282  C  CG    . ARG B 1 136 ? 3.047   6.997   69.457  1.00 37.91  ? 136 ARG B CG    1 
ATOM   6283  C  CD    . ARG B 1 136 ? 3.695   7.683   68.296  1.00 37.66  ? 136 ARG B CD    1 
ATOM   6284  N  NE    . ARG B 1 136 ? 2.754   7.793   67.191  0.00 37.77  ? 136 ARG B NE    1 
ATOM   6285  C  CZ    . ARG B 1 136 ? 3.081   8.175   65.964  0.00 37.77  ? 136 ARG B CZ    1 
ATOM   6286  N  NH1   . ARG B 1 136 ? 4.337   8.490   65.674  0.00 37.74  ? 136 ARG B NH1   1 
ATOM   6287  N  NH2   . ARG B 1 136 ? 2.146   8.234   65.027  0.00 37.74  ? 136 ARG B NH2   1 
ATOM   6288  N  N     . ARG B 1 137 ? -0.242  8.861   72.196  1.00 42.10  ? 137 ARG B N     1 
ATOM   6289  C  CA    . ARG B 1 137 ? -0.468  9.692   73.354  1.00 43.68  ? 137 ARG B CA    1 
ATOM   6290  C  C     . ARG B 1 137 ? -1.908  10.037  73.569  1.00 43.19  ? 137 ARG B C     1 
ATOM   6291  O  O     . ARG B 1 137 ? -2.725  9.919   72.666  1.00 44.26  ? 137 ARG B O     1 
ATOM   6292  C  CB    . ARG B 1 137 ? 0.366   10.961  73.226  1.00 47.67  ? 137 ARG B CB    1 
ATOM   6293  C  CG    . ARG B 1 137 ? 0.234   11.642  71.883  1.00 51.17  ? 137 ARG B CG    1 
ATOM   6294  C  CD    . ARG B 1 137 ? 1.593   11.897  71.274  1.00 55.16  ? 137 ARG B CD    1 
ATOM   6295  N  NE    . ARG B 1 137 ? 1.468   12.086  69.833  1.00 60.16  ? 137 ARG B NE    1 
ATOM   6296  C  CZ    . ARG B 1 137 ? 2.478   11.989  68.976  1.00 61.95  ? 137 ARG B CZ    1 
ATOM   6297  N  NH1   . ARG B 1 137 ? 2.261   12.173  67.675  1.00 62.25  ? 137 ARG B NH1   1 
ATOM   6298  N  NH2   . ARG B 1 137 ? 3.701   11.708  69.422  1.00 61.94  ? 137 ARG B NH2   1 
ATOM   6299  N  N     . GLU B 1 138 ? -2.227  10.458  74.780  1.00 43.50  ? 138 GLU B N     1 
ATOM   6300  C  CA    . GLU B 1 138 ? -3.593  10.829  75.071  1.00 44.26  ? 138 GLU B CA    1 
ATOM   6301  C  C     . GLU B 1 138 ? -3.788  12.262  74.621  1.00 44.79  ? 138 GLU B C     1 
ATOM   6302  O  O     . GLU B 1 138 ? -2.899  13.102  74.757  1.00 43.82  ? 138 GLU B O     1 
ATOM   6303  C  CB    . GLU B 1 138 ? -3.849  10.695  76.506  1.00 45.18  ? 138 GLU B CB    1 
ATOM   6304  N  N     . HIS B 1 139 ? -4.971  12.540  74.103  1.00 46.52  ? 139 HIS B N     1 
ATOM   6305  C  CA    . HIS B 1 139 ? -5.272  13.852  73.561  1.00 49.02  ? 139 HIS B CA    1 
ATOM   6306  C  C     . HIS B 1 139 ? -6.351  14.641  74.285  1.00 50.94  ? 139 HIS B C     1 
ATOM   6307  O  O     . HIS B 1 139 ? -6.289  15.859  74.362  1.00 51.39  ? 139 HIS B O     1 
ATOM   6308  C  CB    . HIS B 1 139 ? -5.639  13.663  72.098  1.00 50.14  ? 139 HIS B CB    1 
ATOM   6309  C  CG    . HIS B 1 139 ? -6.191  14.884  71.449  1.00 51.97  ? 139 HIS B CG    1 
ATOM   6310  N  ND1   . HIS B 1 139 ? -7.499  14.970  71.029  1.00 52.41  ? 139 HIS B ND1   1 
ATOM   6311  C  CD2   . HIS B 1 139 ? -5.622  16.080  71.174  1.00 52.91  ? 139 HIS B CD2   1 
ATOM   6312  C  CE1   . HIS B 1 139 ? -7.717  16.172  70.524  1.00 52.81  ? 139 HIS B CE1   1 
ATOM   6313  N  NE2   . HIS B 1 139 ? -6.595  16.865  70.602  1.00 54.21  ? 139 HIS B NE2   1 
ATOM   6314  N  N     . ALA B 1 140 ? -7.340  13.931  74.808  1.00 53.91  ? 140 ALA B N     1 
ATOM   6315  C  CA    . ALA B 1 140 ? -8.441  14.527  75.543  1.00 55.65  ? 140 ALA B CA    1 
ATOM   6316  C  C     . ALA B 1 140 ? -8.999  13.407  76.401  1.00 57.95  ? 140 ALA B C     1 
ATOM   6317  O  O     . ALA B 1 140 ? -8.938  12.238  76.023  1.00 57.95  ? 140 ALA B O     1 
ATOM   6318  C  CB    . ALA B 1 140 ? -9.497  15.027  74.586  1.00 53.77  ? 140 ALA B CB    1 
ATOM   6319  N  N     . ARG B 1 141 ? -9.506  13.767  77.571  1.00 60.85  ? 141 ARG B N     1 
ATOM   6320  C  CA    . ARG B 1 141 ? -10.101 12.803  78.474  1.00 63.36  ? 141 ARG B CA    1 
ATOM   6321  C  C     . ARG B 1 141 ? -11.329 13.434  79.106  1.00 64.42  ? 141 ARG B C     1 
ATOM   6322  O  O     . ARG B 1 141 ? -11.385 14.641  79.330  1.00 66.38  ? 141 ARG B O     1 
ATOM   6323  C  CB    . ARG B 1 141 ? -9.089  12.331  79.537  1.00 64.35  ? 141 ARG B CB    1 
ATOM   6324  C  CG    . ARG B 1 141 ? -7.923  13.263  79.817  1.00 68.02  ? 141 ARG B CG    1 
ATOM   6325  C  CD    . ARG B 1 141 ? -6.748  12.476  80.422  1.00 71.37  ? 141 ARG B CD    1 
ATOM   6326  N  NE    . ARG B 1 141 ? -5.960  11.718  79.439  1.00 75.35  ? 141 ARG B NE    1 
ATOM   6327  C  CZ    . ARG B 1 141 ? -5.010  10.838  79.770  1.00 76.82  ? 141 ARG B CZ    1 
ATOM   6328  N  NH1   . ARG B 1 141 ? -4.739  10.600  81.047  1.00 77.57  ? 141 ARG B NH1   1 
ATOM   6329  N  NH2   . ARG B 1 141 ? -4.312  10.202  78.841  1.00 76.75  ? 141 ARG B NH2   1 
ATOM   6330  N  N     . GLY B 1 142 ? -12.341 12.614  79.337  1.00 64.19  ? 142 GLY B N     1 
ATOM   6331  C  CA    . GLY B 1 142 ? -13.552 13.111  79.944  1.00 63.02  ? 142 GLY B CA    1 
ATOM   6332  C  C     . GLY B 1 142 ? -13.921 12.146  81.045  1.00 63.21  ? 142 GLY B C     1 
ATOM   6333  O  O     . GLY B 1 142 ? -13.081 11.342  81.467  1.00 62.64  ? 142 GLY B O     1 
ATOM   6334  N  N     . PRO B 1 143 ? -15.168 12.203  81.542  1.00 62.45  ? 143 PRO B N     1 
ATOM   6335  C  CA    . PRO B 1 143 ? -15.613 11.303  82.606  1.00 61.34  ? 143 PRO B CA    1 
ATOM   6336  C  C     . PRO B 1 143 ? -15.977 9.906   82.077  1.00 61.22  ? 143 PRO B C     1 
ATOM   6337  O  O     . PRO B 1 143 ? -17.106 9.674   81.627  1.00 59.55  ? 143 PRO B O     1 
ATOM   6338  C  CB    . PRO B 1 143 ? -16.809 12.044  83.188  1.00 60.37  ? 143 PRO B CB    1 
ATOM   6339  C  CG    . PRO B 1 143 ? -17.387 12.701  81.987  1.00 60.19  ? 143 PRO B CG    1 
ATOM   6340  C  CD    . PRO B 1 143 ? -16.174 13.253  81.294  1.00 61.15  ? 143 PRO B CD    1 
ATOM   6341  N  N     . GLY B 1 144 ? -15.007 8.988   82.126  1.00 61.12  ? 144 GLY B N     1 
ATOM   6342  C  CA    . GLY B 1 144 ? -15.236 7.625   81.664  1.00 59.45  ? 144 GLY B CA    1 
ATOM   6343  C  C     . GLY B 1 144 ? -14.899 7.342   80.206  1.00 58.21  ? 144 GLY B C     1 
ATOM   6344  O  O     . GLY B 1 144 ? -15.268 6.288   79.681  1.00 57.06  ? 144 GLY B O     1 
ATOM   6345  N  N     . TRP B 1 145 ? -14.208 8.280   79.553  1.00 57.37  ? 145 TRP B N     1 
ATOM   6346  C  CA    . TRP B 1 145 ? -13.810 8.141   78.149  1.00 55.05  ? 145 TRP B CA    1 
ATOM   6347  C  C     . TRP B 1 145 ? -12.508 8.886   77.854  1.00 52.03  ? 145 TRP B C     1 
ATOM   6348  O  O     . TRP B 1 145 ? -12.156 9.837   78.550  1.00 51.26  ? 145 TRP B O     1 
ATOM   6349  C  CB    . TRP B 1 145 ? -14.908 8.667   77.212  1.00 56.94  ? 145 TRP B CB    1 
ATOM   6350  C  CG    . TRP B 1 145 ? -15.202 10.144  77.356  1.00 60.89  ? 145 TRP B CG    1 
ATOM   6351  C  CD1   . TRP B 1 145 ? -16.280 10.702  77.967  1.00 61.79  ? 145 TRP B CD1   1 
ATOM   6352  C  CD2   . TRP B 1 145 ? -14.413 11.242  76.862  1.00 63.23  ? 145 TRP B CD2   1 
ATOM   6353  N  NE1   . TRP B 1 145 ? -16.218 12.073  77.890  1.00 62.55  ? 145 TRP B NE1   1 
ATOM   6354  C  CE2   . TRP B 1 145 ? -15.082 12.430  77.223  1.00 63.08  ? 145 TRP B CE2   1 
ATOM   6355  C  CE3   . TRP B 1 145 ? -13.204 11.336  76.163  1.00 64.32  ? 145 TRP B CE3   1 
ATOM   6356  C  CZ2   . TRP B 1 145 ? -14.590 13.694  76.894  1.00 64.46  ? 145 TRP B CZ2   1 
ATOM   6357  C  CZ3   . TRP B 1 145 ? -12.715 12.599  75.839  1.00 64.71  ? 145 TRP B CZ3   1 
ATOM   6358  C  CH2   . TRP B 1 145 ? -13.406 13.757  76.210  1.00 64.60  ? 145 TRP B CH2   1 
ATOM   6359  N  N     . ARG B 1 146 ? -11.808 8.448   76.811  1.00 48.84  ? 146 ARG B N     1 
ATOM   6360  C  CA    . ARG B 1 146 ? -10.549 9.062   76.386  1.00 45.92  ? 146 ARG B CA    1 
ATOM   6361  C  C     . ARG B 1 146 ? -10.424 9.134   74.862  1.00 44.46  ? 146 ARG B C     1 
ATOM   6362  O  O     . ARG B 1 146 ? -11.175 8.492   74.132  1.00 44.33  ? 146 ARG B O     1 
ATOM   6363  C  CB    . ARG B 1 146 ? -9.355  8.276   76.917  1.00 44.75  ? 146 ARG B CB    1 
ATOM   6364  C  CG    . ARG B 1 146 ? -8.937  8.612   78.320  1.00 44.57  ? 146 ARG B CG    1 
ATOM   6365  C  CD    . ARG B 1 146 ? -7.525  8.132   78.536  1.00 43.79  ? 146 ARG B CD    1 
ATOM   6366  N  NE    . ARG B 1 146 ? -7.419  6.696   78.335  1.00 45.08  ? 146 ARG B NE    1 
ATOM   6367  C  CZ    . ARG B 1 146 ? -6.268  6.052   78.183  1.00 47.63  ? 146 ARG B CZ    1 
ATOM   6368  N  NH1   . ARG B 1 146 ? -5.118  6.724   78.204  1.00 47.63  ? 146 ARG B NH1   1 
ATOM   6369  N  NH2   . ARG B 1 146 ? -6.266  4.733   78.022  1.00 48.68  ? 146 ARG B NH2   1 
ATOM   6370  N  N     . VAL B 1 147 ? -9.470  9.931   74.393  1.00 42.48  ? 147 VAL B N     1 
ATOM   6371  C  CA    . VAL B 1 147 ? -9.215  10.064  72.969  1.00 40.10  ? 147 VAL B CA    1 
ATOM   6372  C  C     . VAL B 1 147 ? -7.721  10.010  72.816  1.00 38.67  ? 147 VAL B C     1 
ATOM   6373  O  O     . VAL B 1 147 ? -7.004  10.808  73.400  1.00 40.24  ? 147 VAL B O     1 
ATOM   6374  C  CB    . VAL B 1 147 ? -9.747  11.388  72.399  1.00 39.70  ? 147 VAL B CB    1 
ATOM   6375  C  CG1   . VAL B 1 147 ? -9.198  11.608  70.997  1.00 40.13  ? 147 VAL B CG1   1 
ATOM   6376  C  CG2   . VAL B 1 147 ? -11.262 11.334  72.330  1.00 38.94  ? 147 VAL B CG2   1 
ATOM   6377  N  N     . LEU B 1 148 ? -7.250  9.039   72.054  1.00 36.82  ? 148 LEU B N     1 
ATOM   6378  C  CA    . LEU B 1 148 ? -5.827  8.880   71.855  1.00 35.30  ? 148 LEU B CA    1 
ATOM   6379  C  C     . LEU B 1 148 ? -5.442  9.340   70.465  1.00 34.05  ? 148 LEU B C     1 
ATOM   6380  O  O     . LEU B 1 148 ? -6.191  9.165   69.499  1.00 34.86  ? 148 LEU B O     1 
ATOM   6381  C  CB    . LEU B 1 148 ? -5.432  7.413   72.045  1.00 36.13  ? 148 LEU B CB    1 
ATOM   6382  C  CG    . LEU B 1 148 ? -5.767  6.701   73.370  1.00 36.13  ? 148 LEU B CG    1 
ATOM   6383  C  CD1   . LEU B 1 148 ? -5.314  5.266   73.282  1.00 36.40  ? 148 LEU B CD1   1 
ATOM   6384  C  CD2   . LEU B 1 148 ? -5.076  7.368   74.542  1.00 36.41  ? 148 LEU B CD2   1 
ATOM   6385  N  N     . GLY B 1 149 ? -4.267  9.938   70.368  1.00 31.85  ? 149 GLY B N     1 
ATOM   6386  C  CA    . GLY B 1 149 ? -3.790  10.408  69.083  1.00 29.03  ? 149 GLY B CA    1 
ATOM   6387  C  C     . GLY B 1 149 ? -2.661  9.531   68.596  1.00 27.49  ? 149 GLY B C     1 
ATOM   6388  O  O     . GLY B 1 149 ? -1.756  9.187   69.348  1.00 26.94  ? 149 GLY B O     1 
ATOM   6389  N  N     . GLY B 1 150 ? -2.734  9.156   67.329  1.00 27.10  ? 150 GLY B N     1 
ATOM   6390  C  CA    . GLY B 1 150 ? -1.717  8.317   66.733  1.00 26.76  ? 150 GLY B CA    1 
ATOM   6391  C  C     . GLY B 1 150 ? -1.837  8.471   65.235  1.00 27.27  ? 150 GLY B C     1 
ATOM   6392  O  O     . GLY B 1 150 ? -1.944  9.594   64.751  1.00 27.76  ? 150 GLY B O     1 
ATOM   6393  N  N     . ALA B 1 151 ? -1.835  7.359   64.502  1.00 27.02  ? 151 ALA B N     1 
ATOM   6394  C  CA    . ALA B 1 151 ? -1.958  7.403   63.048  1.00 27.60  ? 151 ALA B CA    1 
ATOM   6395  C  C     . ALA B 1 151 ? -2.226  6.028   62.426  1.00 28.36  ? 151 ALA B C     1 
ATOM   6396  O  O     . ALA B 1 151 ? -1.951  4.991   63.038  1.00 29.31  ? 151 ALA B O     1 
ATOM   6397  C  CB    . ALA B 1 151 ? -0.690  8.008   62.439  1.00 25.95  ? 151 ALA B CB    1 
ATOM   6398  N  N     . VAL B 1 152 ? -2.790  6.021   61.219  1.00 27.95  ? 152 VAL B N     1 
ATOM   6399  C  CA    . VAL B 1 152 ? -3.030  4.771   60.519  1.00 26.50  ? 152 VAL B CA    1 
ATOM   6400  C  C     . VAL B 1 152 ? -1.893  4.666   59.533  1.00 27.34  ? 152 VAL B C     1 
ATOM   6401  O  O     . VAL B 1 152 ? -1.541  5.647   58.871  1.00 26.21  ? 152 VAL B O     1 
ATOM   6402  C  CB    . VAL B 1 152 ? -4.312  4.760   59.718  1.00 25.08  ? 152 VAL B CB    1 
ATOM   6403  C  CG1   . VAL B 1 152 ? -4.587  3.343   59.280  1.00 23.80  ? 152 VAL B CG1   1 
ATOM   6404  C  CG2   . VAL B 1 152 ? -5.454  5.308   60.533  1.00 26.48  ? 152 VAL B CG2   1 
ATOM   6405  N  N     . LEU B 1 153 ? -1.328  3.470   59.427  1.00 28.04  ? 153 LEU B N     1 
ATOM   6406  C  CA    . LEU B 1 153 ? -0.198  3.255   58.547  1.00 27.77  ? 153 LEU B CA    1 
ATOM   6407  C  C     . LEU B 1 153 ? -0.437  2.144   57.555  1.00 29.03  ? 153 LEU B C     1 
ATOM   6408  O  O     . LEU B 1 153 ? -1.414  1.388   57.645  1.00 28.34  ? 153 LEU B O     1 
ATOM   6409  C  CB    . LEU B 1 153 ? 1.043   2.893   59.371  1.00 24.54  ? 153 LEU B CB    1 
ATOM   6410  C  CG    . LEU B 1 153 ? 1.350   3.727   60.603  1.00 21.20  ? 153 LEU B CG    1 
ATOM   6411  C  CD1   . LEU B 1 153 ? 2.309   2.961   61.452  1.00 22.50  ? 153 LEU B CD1   1 
ATOM   6412  C  CD2   . LEU B 1 153 ? 1.914   5.068   60.226  1.00 20.17  ? 153 LEU B CD2   1 
ATOM   6413  N  N     . ASP B 1 154 ? 0.485   2.073   56.604  1.00 30.61  ? 154 ASP B N     1 
ATOM   6414  C  CA    . ASP B 1 154 ? 0.490   1.047   55.592  1.00 31.76  ? 154 ASP B CA    1 
ATOM   6415  C  C     . ASP B 1 154 ? 1.875   0.942   54.998  1.00 31.28  ? 154 ASP B C     1 
ATOM   6416  O  O     . ASP B 1 154 ? 2.562   1.943   54.821  1.00 30.26  ? 154 ASP B O     1 
ATOM   6417  C  CB    . ASP B 1 154 ? -0.490  1.336   54.483  1.00 36.31  ? 154 ASP B CB    1 
ATOM   6418  C  CG    . ASP B 1 154 ? -0.788  0.097   53.682  1.00 43.26  ? 154 ASP B CG    1 
ATOM   6419  O  OD1   . ASP B 1 154 ? -1.515  0.194   52.664  1.00 47.43  ? 154 ASP B OD1   1 
ATOM   6420  O  OD2   . ASP B 1 154 ? -0.285  -0.987  54.092  1.00 44.96  ? 154 ASP B OD2   1 
ATOM   6421  N  N     . LEU B 1 155 ? 2.278   -0.276  54.675  1.00 29.74  ? 155 LEU B N     1 
ATOM   6422  C  CA    . LEU B 1 155 ? 3.590   -0.479  54.134  1.00 29.88  ? 155 LEU B CA    1 
ATOM   6423  C  C     . LEU B 1 155 ? 3.579   -1.417  52.937  1.00 33.18  ? 155 LEU B C     1 
ATOM   6424  O  O     . LEU B 1 155 ? 2.910   -2.458  52.952  1.00 34.06  ? 155 LEU B O     1 
ATOM   6425  C  CB    . LEU B 1 155 ? 4.495   -1.043  55.225  1.00 26.24  ? 155 LEU B CB    1 
ATOM   6426  C  CG    . LEU B 1 155 ? 5.984   -1.085  54.884  1.00 26.29  ? 155 LEU B CG    1 
ATOM   6427  C  CD1   . LEU B 1 155 ? 6.495   0.323   54.746  1.00 25.31  ? 155 LEU B CD1   1 
ATOM   6428  C  CD2   . LEU B 1 155 ? 6.765   -1.818  55.955  1.00 25.84  ? 155 LEU B CD2   1 
ATOM   6429  N  N     . TRP B 1 156 ? 4.314   -1.038  51.894  1.00 35.10  ? 156 TRP B N     1 
ATOM   6430  C  CA    . TRP B 1 156 ? 4.437   -1.866  50.701  1.00 37.08  ? 156 TRP B CA    1 
ATOM   6431  C  C     . TRP B 1 156 ? 5.782   -1.619  50.014  1.00 38.52  ? 156 TRP B C     1 
ATOM   6432  O  O     . TRP B 1 156 ? 6.641   -0.915  50.574  1.00 39.70  ? 156 TRP B O     1 
ATOM   6433  C  CB    . TRP B 1 156 ? 3.258   -1.631  49.748  1.00 37.14  ? 156 TRP B CB    1 
ATOM   6434  C  CG    . TRP B 1 156 ? 3.204   -0.319  49.040  1.00 37.93  ? 156 TRP B CG    1 
ATOM   6435  C  CD1   . TRP B 1 156 ? 3.888   0.026   47.920  1.00 37.61  ? 156 TRP B CD1   1 
ATOM   6436  C  CD2   . TRP B 1 156 ? 2.310   0.769   49.314  1.00 40.46  ? 156 TRP B CD2   1 
ATOM   6437  N  NE1   . TRP B 1 156 ? 3.470   1.249   47.465  1.00 38.46  ? 156 TRP B NE1   1 
ATOM   6438  C  CE2   . TRP B 1 156 ? 2.499   1.729   48.300  1.00 39.34  ? 156 TRP B CE2   1 
ATOM   6439  C  CE3   . TRP B 1 156 ? 1.360   1.023   50.318  1.00 42.72  ? 156 TRP B CE3   1 
ATOM   6440  C  CZ2   . TRP B 1 156 ? 1.771   2.930   48.251  1.00 40.07  ? 156 TRP B CZ2   1 
ATOM   6441  C  CZ3   . TRP B 1 156 ? 0.633   2.225   50.271  1.00 42.90  ? 156 TRP B CZ3   1 
ATOM   6442  C  CH2   . TRP B 1 156 ? 0.846   3.158   49.241  1.00 41.75  ? 156 TRP B CH2   1 
ATOM   6443  N  N     . VAL B 1 157 ? 5.977   -2.204  48.831  1.00 37.92  ? 157 VAL B N     1 
ATOM   6444  C  CA    . VAL B 1 157 ? 7.232   -2.050  48.106  1.00 39.56  ? 157 VAL B CA    1 
ATOM   6445  C  C     . VAL B 1 157 ? 7.086   -1.281  46.797  1.00 40.93  ? 157 VAL B C     1 
ATOM   6446  O  O     . VAL B 1 157 ? 6.133   -1.495  46.049  1.00 42.46  ? 157 VAL B O     1 
ATOM   6447  C  CB    . VAL B 1 157 ? 7.850   -3.423  47.813  1.00 40.94  ? 157 VAL B CB    1 
ATOM   6448  C  CG1   . VAL B 1 157 ? 9.208   -3.249  47.141  1.00 42.36  ? 157 VAL B CG1   1 
ATOM   6449  C  CG2   . VAL B 1 157 ? 7.981   -4.224  49.111  1.00 39.49  ? 157 VAL B CG2   1 
ATOM   6450  N  N     . SER B 1 158 ? 8.051   -0.406  46.515  1.00 42.01  ? 158 SER B N     1 
ATOM   6451  C  CA    . SER B 1 158 ? 8.025   0.429   45.311  1.00 43.47  ? 158 SER B CA    1 
ATOM   6452  C  C     . SER B 1 158 ? 8.606   -0.220  44.070  1.00 44.55  ? 158 SER B C     1 
ATOM   6453  O  O     . SER B 1 158 ? 8.847   -1.421  44.040  1.00 45.62  ? 158 SER B O     1 
ATOM   6454  C  CB    . SER B 1 158 ? 8.797   1.724   45.552  1.00 44.33  ? 158 SER B CB    1 
ATOM   6455  O  OG    . SER B 1 158 ? 10.196  1.509   45.462  1.00 41.06  ? 158 SER B OG    1 
ATOM   6456  N  N     . ASP B 1 159 ? 8.815   0.606   43.045  1.00 45.19  ? 159 ASP B N     1 
ATOM   6457  C  CA    . ASP B 1 159 ? 9.407   0.171   41.785  1.00 44.78  ? 159 ASP B CA    1 
ATOM   6458  C  C     . ASP B 1 159 ? 10.884  0.019   42.030  1.00 43.72  ? 159 ASP B C     1 
ATOM   6459  O  O     . ASP B 1 159 ? 11.489  -0.968  41.632  1.00 44.37  ? 159 ASP B O     1 
ATOM   6460  C  CB    . ASP B 1 159 ? 9.231   1.226   40.699  1.00 47.49  ? 159 ASP B CB    1 
ATOM   6461  C  CG    . ASP B 1 159 ? 7.902   1.131   40.013  1.00 50.14  ? 159 ASP B CG    1 
ATOM   6462  O  OD1   . ASP B 1 159 ? 7.670   1.870   39.033  1.00 51.55  ? 159 ASP B OD1   1 
ATOM   6463  O  OD2   . ASP B 1 159 ? 7.084   0.308   40.460  1.00 54.21  ? 159 ASP B OD2   1 
ATOM   6464  N  N     . SER B 1 160 ? 11.455  1.029   42.678  1.00 41.50  ? 160 SER B N     1 
ATOM   6465  C  CA    . SER B 1 160 ? 12.871  1.052   43.001  1.00 40.08  ? 160 SER B CA    1 
ATOM   6466  C  C     . SER B 1 160 ? 13.149  0.074   44.128  1.00 39.31  ? 160 SER B C     1 
ATOM   6467  O  O     . SER B 1 160 ? 14.085  0.261   44.912  1.00 40.43  ? 160 SER B O     1 
ATOM   6468  C  CB    . SER B 1 160 ? 13.277  2.464   43.421  1.00 40.14  ? 160 SER B CB    1 
ATOM   6469  O  OG    . SER B 1 160 ? 12.333  2.999   44.339  1.00 43.55  ? 160 SER B OG    1 
ATOM   6470  N  N     . GLY B 1 161 ? 12.332  -0.969  44.208  1.00 37.27  ? 161 GLY B N     1 
ATOM   6471  C  CA    . GLY B 1 161 ? 12.503  -1.953  45.254  1.00 37.26  ? 161 GLY B CA    1 
ATOM   6472  C  C     . GLY B 1 161 ? 12.825  -1.298  46.584  1.00 38.30  ? 161 GLY B C     1 
ATOM   6473  O  O     . GLY B 1 161 ? 13.747  -1.724  47.283  1.00 39.12  ? 161 GLY B O     1 
ATOM   6474  N  N     . ALA B 1 162 ? 12.070  -0.253  46.929  1.00 38.99  ? 162 ALA B N     1 
ATOM   6475  C  CA    . ALA B 1 162 ? 12.260  0.482   48.185  1.00 38.25  ? 162 ALA B CA    1 
ATOM   6476  C  C     . ALA B 1 162 ? 10.979  0.468   49.008  1.00 37.26  ? 162 ALA B C     1 
ATOM   6477  O  O     . ALA B 1 162 ? 9.884   0.508   48.446  1.00 37.38  ? 162 ALA B O     1 
ATOM   6478  C  CB    . ALA B 1 162 ? 12.665  1.921   47.894  1.00 38.68  ? 162 ALA B CB    1 
ATOM   6479  N  N     . PHE B 1 163 ? 11.118  0.399   50.333  1.00 35.68  ? 163 PHE B N     1 
ATOM   6480  C  CA    . PHE B 1 163 ? 9.960   0.397   51.231  1.00 32.96  ? 163 PHE B CA    1 
ATOM   6481  C  C     . PHE B 1 163 ? 9.239   1.720   51.091  1.00 33.52  ? 163 PHE B C     1 
ATOM   6482  O  O     . PHE B 1 163 ? 9.872   2.774   51.041  1.00 34.28  ? 163 PHE B O     1 
ATOM   6483  C  CB    . PHE B 1 163 ? 10.391  0.244   52.685  1.00 29.24  ? 163 PHE B CB    1 
ATOM   6484  C  CG    . PHE B 1 163 ? 10.724  -1.151  53.078  1.00 25.52  ? 163 PHE B CG    1 
ATOM   6485  C  CD1   . PHE B 1 163 ? 11.987  -1.465  53.544  1.00 24.29  ? 163 PHE B CD1   1 
ATOM   6486  C  CD2   . PHE B 1 163 ? 9.773   -2.149  53.004  1.00 25.94  ? 163 PHE B CD2   1 
ATOM   6487  C  CE1   . PHE B 1 163 ? 12.312  -2.753  53.938  1.00 23.65  ? 163 PHE B CE1   1 
ATOM   6488  C  CE2   . PHE B 1 163 ? 10.082  -3.450  53.395  1.00 27.12  ? 163 PHE B CE2   1 
ATOM   6489  C  CZ    . PHE B 1 163 ? 11.365  -3.751  53.866  1.00 24.76  ? 163 PHE B CZ    1 
ATOM   6490  N  N     . LEU B 1 164 ? 7.916   1.668   51.038  1.00 34.02  ? 164 LEU B N     1 
ATOM   6491  C  CA    . LEU B 1 164 ? 7.120   2.883   50.907  1.00 34.28  ? 164 LEU B CA    1 
ATOM   6492  C  C     . LEU B 1 164 ? 6.004   2.878   51.950  1.00 34.51  ? 164 LEU B C     1 
ATOM   6493  O  O     . LEU B 1 164 ? 5.307   1.874   52.115  1.00 34.17  ? 164 LEU B O     1 
ATOM   6494  C  CB    . LEU B 1 164 ? 6.554   2.960   49.504  1.00 35.13  ? 164 LEU B CB    1 
ATOM   6495  C  CG    . LEU B 1 164 ? 6.238   4.380   49.096  1.00 35.87  ? 164 LEU B CG    1 
ATOM   6496  C  CD1   . LEU B 1 164 ? 6.327   4.471   47.611  1.00 37.49  ? 164 LEU B CD1   1 
ATOM   6497  C  CD2   . LEU B 1 164 ? 4.876   4.781   49.611  1.00 37.90  ? 164 LEU B CD2   1 
ATOM   6498  N  N     . LEU B 1 165 ? 5.838   4.012   52.633  1.00 35.20  ? 165 LEU B N     1 
ATOM   6499  C  CA    . LEU B 1 165 ? 4.866   4.155   53.722  1.00 34.87  ? 165 LEU B CA    1 
ATOM   6500  C  C     . LEU B 1 165 ? 3.792   5.241   53.585  1.00 34.75  ? 165 LEU B C     1 
ATOM   6501  O  O     . LEU B 1 165 ? 4.070   6.343   53.102  1.00 34.23  ? 165 LEU B O     1 
ATOM   6502  C  CB    . LEU B 1 165 ? 5.641   4.396   55.026  1.00 34.77  ? 165 LEU B CB    1 
ATOM   6503  C  CG    . LEU B 1 165 ? 4.904   4.453   56.373  1.00 36.26  ? 165 LEU B CG    1 
ATOM   6504  C  CD1   . LEU B 1 165 ? 4.678   3.031   56.863  1.00 37.45  ? 165 LEU B CD1   1 
ATOM   6505  C  CD2   . LEU B 1 165 ? 5.701   5.227   57.415  1.00 32.53  ? 165 LEU B CD2   1 
ATOM   6506  N  N     . GLU B 1 166 ? 2.575   4.892   54.023  1.00 35.31  ? 166 GLU B N     1 
ATOM   6507  C  CA    . GLU B 1 166 ? 1.398   5.779   54.056  1.00 37.01  ? 166 GLU B CA    1 
ATOM   6508  C  C     . GLU B 1 166 ? 1.271   6.132   55.528  1.00 37.15  ? 166 GLU B C     1 
ATOM   6509  O  O     . GLU B 1 166 ? 1.424   5.277   56.397  1.00 37.66  ? 166 GLU B O     1 
ATOM   6510  C  CB    . GLU B 1 166 ? 0.096   5.065   53.632  1.00 39.23  ? 166 GLU B CB    1 
ATOM   6511  C  CG    . GLU B 1 166 ? -0.356  5.284   52.178  1.00 44.18  ? 166 GLU B CG    1 
ATOM   6512  C  CD    . GLU B 1 166 ? -1.808  5.769   52.051  1.00 46.67  ? 166 GLU B CD    1 
ATOM   6513  O  OE1   . GLU B 1 166 ? -2.261  6.551   52.915  1.00 46.68  ? 166 GLU B OE1   1 
ATOM   6514  O  OE2   . GLU B 1 166 ? -2.490  5.394   51.069  1.00 48.16  ? 166 GLU B OE2   1 
ATOM   6515  N  N     . VAL B 1 167 ? 0.977   7.390   55.810  1.00 36.68  ? 167 VAL B N     1 
ATOM   6516  C  CA    . VAL B 1 167 ? 0.851   7.842   57.174  1.00 34.62  ? 167 VAL B CA    1 
ATOM   6517  C  C     . VAL B 1 167 ? -0.187  8.954   57.242  1.00 36.44  ? 167 VAL B C     1 
ATOM   6518  O  O     . VAL B 1 167 ? 0.034   10.057  56.752  1.00 37.72  ? 167 VAL B O     1 
ATOM   6519  C  CB    . VAL B 1 167 ? 2.222   8.364   57.695  1.00 32.14  ? 167 VAL B CB    1 
ATOM   6520  C  CG1   . VAL B 1 167 ? 2.087   8.943   59.077  1.00 31.79  ? 167 VAL B CG1   1 
ATOM   6521  C  CG2   . VAL B 1 167 ? 3.224   7.238   57.728  1.00 30.86  ? 167 VAL B CG2   1 
ATOM   6522  N  N     . ASP B 1 168 ? -1.349  8.658   57.801  1.00 37.57  ? 168 ASP B N     1 
ATOM   6523  C  CA    . ASP B 1 168 ? -2.326  9.710   57.970  1.00 38.77  ? 168 ASP B CA    1 
ATOM   6524  C  C     . ASP B 1 168 ? -2.779  9.693   59.418  1.00 39.82  ? 168 ASP B C     1 
ATOM   6525  O  O     . ASP B 1 168 ? -3.340  8.707   59.900  1.00 40.25  ? 168 ASP B O     1 
ATOM   6526  C  CB    . ASP B 1 168 ? -3.526  9.561   57.045  1.00 38.64  ? 168 ASP B CB    1 
ATOM   6527  C  CG    . ASP B 1 168 ? -4.524  10.707  57.215  1.00 39.49  ? 168 ASP B CG    1 
ATOM   6528  O  OD1   . ASP B 1 168 ? -4.092  11.874  57.282  1.00 38.28  ? 168 ASP B OD1   1 
ATOM   6529  O  OD2   . ASP B 1 168 ? -5.741  10.454  57.282  1.00 42.24  ? 168 ASP B OD2   1 
ATOM   6530  N  N     . PRO B 1 169 ? -2.511  10.791  60.136  1.00 40.08  ? 169 PRO B N     1 
ATOM   6531  C  CA    . PRO B 1 169 ? -2.850  11.002  61.544  1.00 39.30  ? 169 PRO B CA    1 
ATOM   6532  C  C     . PRO B 1 169 ? -4.308  10.717  61.829  1.00 39.04  ? 169 PRO B C     1 
ATOM   6533  O  O     . PRO B 1 169 ? -5.185  11.148  61.087  1.00 38.97  ? 169 PRO B O     1 
ATOM   6534  C  CB    . PRO B 1 169 ? -2.524  12.472  61.754  1.00 39.38  ? 169 PRO B CB    1 
ATOM   6535  C  CG    . PRO B 1 169 ? -1.395  12.699  60.805  1.00 40.50  ? 169 PRO B CG    1 
ATOM   6536  C  CD    . PRO B 1 169 ? -1.846  11.980  59.573  1.00 40.23  ? 169 PRO B CD    1 
ATOM   6537  N  N     . ALA B 1 170 ? -4.573  9.996   62.908  1.00 39.88  ? 170 ALA B N     1 
ATOM   6538  C  CA    . ALA B 1 170 ? -5.952  9.687   63.278  1.00 41.68  ? 170 ALA B CA    1 
ATOM   6539  C  C     . ALA B 1 170 ? -6.146  9.687   64.791  1.00 42.47  ? 170 ALA B C     1 
ATOM   6540  O  O     . ALA B 1 170 ? -5.179  9.663   65.570  1.00 43.17  ? 170 ALA B O     1 
ATOM   6541  C  CB    . ALA B 1 170 ? -6.370  8.334   62.701  1.00 40.00  ? 170 ALA B CB    1 
ATOM   6542  N  N     . TYR B 1 171 ? -7.407  9.724   65.203  1.00 41.35  ? 171 TYR B N     1 
ATOM   6543  C  CA    . TYR B 1 171 ? -7.732  9.695   66.615  1.00 39.60  ? 171 TYR B CA    1 
ATOM   6544  C  C     . TYR B 1 171 ? -8.539  8.450   66.938  1.00 38.85  ? 171 TYR B C     1 
ATOM   6545  O  O     . TYR B 1 171 ? -9.140  7.835   66.061  1.00 37.29  ? 171 TYR B O     1 
ATOM   6546  C  CB    . TYR B 1 171 ? -8.522  10.938  66.999  1.00 38.86  ? 171 TYR B CB    1 
ATOM   6547  C  CG    . TYR B 1 171 ? -7.665  12.159  67.154  1.00 38.71  ? 171 TYR B CG    1 
ATOM   6548  C  CD1   . TYR B 1 171 ? -7.653  13.160  66.187  1.00 38.25  ? 171 TYR B CD1   1 
ATOM   6549  C  CD2   . TYR B 1 171 ? -6.882  12.333  68.295  1.00 39.73  ? 171 TYR B CD2   1 
ATOM   6550  C  CE1   . TYR B 1 171 ? -6.886  14.317  66.361  1.00 37.94  ? 171 TYR B CE1   1 
ATOM   6551  C  CE2   . TYR B 1 171 ? -6.110  13.481  68.474  1.00 38.53  ? 171 TYR B CE2   1 
ATOM   6552  C  CZ    . TYR B 1 171 ? -6.123  14.464  67.510  1.00 37.96  ? 171 TYR B CZ    1 
ATOM   6553  O  OH    . TYR B 1 171 ? -5.397  15.599  67.727  1.00 37.67  ? 171 TYR B OH    1 
ATOM   6554  N  N     . ARG B 1 172 ? -8.527  8.063   68.201  1.00 39.14  ? 172 ARG B N     1 
ATOM   6555  C  CA    . ARG B 1 172 ? -9.287  6.909   68.628  1.00 41.14  ? 172 ARG B CA    1 
ATOM   6556  C  C     . ARG B 1 172 ? -10.055 7.308   69.865  1.00 41.45  ? 172 ARG B C     1 
ATOM   6557  O  O     . ARG B 1 172 ? -9.468  7.836   70.814  1.00 41.96  ? 172 ARG B O     1 
ATOM   6558  C  CB    . ARG B 1 172 ? -8.370  5.736   68.970  1.00 43.83  ? 172 ARG B CB    1 
ATOM   6559  C  CG    . ARG B 1 172 ? -9.102  4.564   69.626  1.00 48.47  ? 172 ARG B CG    1 
ATOM   6560  C  CD    . ARG B 1 172 ? -9.462  3.498   68.621  1.00 54.48  ? 172 ARG B CD    1 
ATOM   6561  N  NE    . ARG B 1 172 ? -9.743  4.100   67.327  1.00 62.10  ? 172 ARG B NE    1 
ATOM   6562  C  CZ    . ARG B 1 172 ? -10.822 4.825   67.046  1.00 66.53  ? 172 ARG B CZ    1 
ATOM   6563  N  NH1   . ARG B 1 172 ? -11.756 5.040   67.972  1.00 69.14  ? 172 ARG B NH1   1 
ATOM   6564  N  NH2   . ARG B 1 172 ? -10.946 5.369   65.841  1.00 68.44  ? 172 ARG B NH2   1 
ATOM   6565  N  N     . ILE B 1 173 ? -11.362 7.070   69.860  1.00 41.28  ? 173 ILE B N     1 
ATOM   6566  C  CA    . ILE B 1 173 ? -12.174 7.400   71.022  1.00 41.65  ? 173 ILE B CA    1 
ATOM   6567  C  C     . ILE B 1 173 ? -12.471 6.130   71.809  1.00 40.41  ? 173 ILE B C     1 
ATOM   6568  O  O     . ILE B 1 173 ? -13.218 5.266   71.364  1.00 41.02  ? 173 ILE B O     1 
ATOM   6569  C  CB    . ILE B 1 173 ? -13.481 8.090   70.617  1.00 42.30  ? 173 ILE B CB    1 
ATOM   6570  C  CG1   . ILE B 1 173 ? -13.170 9.369   69.838  1.00 42.39  ? 173 ILE B CG1   1 
ATOM   6571  C  CG2   . ILE B 1 173 ? -14.268 8.450   71.853  1.00 42.58  ? 173 ILE B CG2   1 
ATOM   6572  C  CD1   . ILE B 1 173 ? -14.385 9.975   69.177  1.00 42.31  ? 173 ILE B CD1   1 
ATOM   6573  N  N     . LEU B 1 174 ? -11.870 6.033   72.987  1.00 39.90  ? 174 LEU B N     1 
ATOM   6574  C  CA    . LEU B 1 174 ? -12.019 4.872   73.847  1.00 40.31  ? 174 LEU B CA    1 
ATOM   6575  C  C     . LEU B 1 174 ? -13.035 5.050   74.949  1.00 40.03  ? 174 LEU B C     1 
ATOM   6576  O  O     . LEU B 1 174 ? -13.196 6.139   75.481  1.00 38.90  ? 174 LEU B O     1 
ATOM   6577  C  CB    . LEU B 1 174 ? -10.685 4.553   74.495  1.00 41.17  ? 174 LEU B CB    1 
ATOM   6578  C  CG    . LEU B 1 174 ? -9.533  4.329   73.533  1.00 43.45  ? 174 LEU B CG    1 
ATOM   6579  C  CD1   . LEU B 1 174 ? -8.247  4.350   74.328  1.00 44.72  ? 174 LEU B CD1   1 
ATOM   6580  C  CD2   . LEU B 1 174 ? -9.714  3.006   72.783  1.00 44.07  ? 174 LEU B CD2   1 
ATOM   6581  N  N     . CYS B 1 175 ? -13.710 3.969   75.307  1.00 40.90  ? 175 CYS B N     1 
ATOM   6582  C  CA    . CYS B 1 175 ? -14.679 4.046   76.385  1.00 43.57  ? 175 CYS B CA    1 
ATOM   6583  C  C     . CYS B 1 175 ? -14.210 3.249   77.583  1.00 43.96  ? 175 CYS B C     1 
ATOM   6584  O  O     . CYS B 1 175 ? -14.187 2.021   77.534  1.00 46.11  ? 175 CYS B O     1 
ATOM   6585  C  CB    . CYS B 1 175 ? -16.042 3.511   75.974  1.00 43.80  ? 175 CYS B CB    1 
ATOM   6586  S  SG    . CYS B 1 175 ? -17.099 3.417   77.446  1.00 46.04  ? 175 CYS B SG    1 
ATOM   6587  N  N     . GLU B 1 176 ? -13.880 3.934   78.671  1.00 43.32  ? 176 GLU B N     1 
ATOM   6588  C  CA    . GLU B 1 176 ? -13.388 3.252   79.861  1.00 44.25  ? 176 GLU B CA    1 
ATOM   6589  C  C     . GLU B 1 176 ? -14.418 2.499   80.711  1.00 45.50  ? 176 GLU B C     1 
ATOM   6590  O  O     . GLU B 1 176 ? -14.089 2.081   81.819  1.00 45.07  ? 176 GLU B O     1 
ATOM   6591  C  CB    . GLU B 1 176 ? -12.625 4.240   80.736  1.00 42.64  ? 176 GLU B CB    1 
ATOM   6592  N  N     . MET B 1 177 ? -15.643 2.309   80.212  1.00 46.91  ? 177 MET B N     1 
ATOM   6593  C  CA    . MET B 1 177 ? -16.678 1.597   80.985  1.00 49.02  ? 177 MET B CA    1 
ATOM   6594  C  C     . MET B 1 177 ? -17.349 0.470   80.198  1.00 48.70  ? 177 MET B C     1 
ATOM   6595  O  O     . MET B 1 177 ? -16.978 0.178   79.060  1.00 49.60  ? 177 MET B O     1 
ATOM   6596  C  CB    . MET B 1 177 ? -17.777 2.565   81.454  1.00 52.66  ? 177 MET B CB    1 
ATOM   6597  C  CG    . MET B 1 177 ? -17.288 3.811   82.192  1.00 57.07  ? 177 MET B CG    1 
ATOM   6598  S  SD    . MET B 1 177 ? -18.544 5.130   82.262  1.00 62.30  ? 177 MET B SD    1 
ATOM   6599  C  CE    . MET B 1 177 ? -17.966 6.070   83.716  1.00 62.93  ? 177 MET B CE    1 
ATOM   6600  N  N     . SER B 1 178 ? -18.347 -0.157  80.812  1.00 47.76  ? 178 SER B N     1 
ATOM   6601  C  CA    . SER B 1 178 ? -19.082 -1.243  80.170  1.00 46.55  ? 178 SER B CA    1 
ATOM   6602  C  C     . SER B 1 178 ? -20.325 -0.662  79.535  1.00 46.96  ? 178 SER B C     1 
ATOM   6603  O  O     . SER B 1 178 ? -20.755 0.432   79.905  1.00 46.96  ? 178 SER B O     1 
ATOM   6604  C  CB    . SER B 1 178 ? -19.514 -2.275  81.200  1.00 45.81  ? 178 SER B CB    1 
ATOM   6605  O  OG    . SER B 1 178 ? -20.436 -1.697  82.109  1.00 42.78  ? 178 SER B OG    1 
ATOM   6606  N  N     . LEU B 1 179 ? -20.911 -1.391  78.591  1.00 47.20  ? 179 LEU B N     1 
ATOM   6607  C  CA    . LEU B 1 179 ? -22.123 -0.915  77.938  1.00 47.92  ? 179 LEU B CA    1 
ATOM   6608  C  C     . LEU B 1 179 ? -23.108 -0.626  79.056  1.00 48.67  ? 179 LEU B C     1 
ATOM   6609  O  O     . LEU B 1 179 ? -23.773 0.404   79.052  1.00 48.79  ? 179 LEU B O     1 
ATOM   6610  C  CB    . LEU B 1 179 ? -22.711 -1.983  77.025  1.00 47.49  ? 179 LEU B CB    1 
ATOM   6611  C  CG    . LEU B 1 179 ? -23.486 -1.531  75.778  1.00 48.51  ? 179 LEU B CG    1 
ATOM   6612  C  CD1   . LEU B 1 179 ? -24.379 -2.691  75.343  1.00 47.72  ? 179 LEU B CD1   1 
ATOM   6613  C  CD2   . LEU B 1 179 ? -24.320 -0.283  76.034  1.00 46.61  ? 179 LEU B CD2   1 
ATOM   6614  N  N     . GLU B 1 180 ? -23.176 -1.547  80.017  1.00 49.17  ? 180 GLU B N     1 
ATOM   6615  C  CA    . GLU B 1 180 ? -24.058 -1.418  81.167  1.00 49.16  ? 180 GLU B CA    1 
ATOM   6616  C  C     . GLU B 1 180 ? -23.740 -0.147  81.932  1.00 49.46  ? 180 GLU B C     1 
ATOM   6617  O  O     . GLU B 1 180 ? -24.618 0.674   82.178  1.00 49.11  ? 180 GLU B O     1 
ATOM   6618  C  CB    . GLU B 1 180 ? -23.899 -2.612  82.099  1.00 48.79  ? 180 GLU B CB    1 
ATOM   6619  C  CG    . GLU B 1 180 ? -24.913 -2.610  83.219  1.00 51.19  ? 180 GLU B CG    1 
ATOM   6620  C  CD    . GLU B 1 180 ? -26.355 -2.512  82.699  1.00 52.45  ? 180 GLU B CD    1 
ATOM   6621  O  OE1   . GLU B 1 180 ? -26.948 -1.404  82.728  1.00 48.71  ? 180 GLU B OE1   1 
ATOM   6622  O  OE2   . GLU B 1 180 ? -26.886 -3.552  82.246  1.00 53.42  ? 180 GLU B OE2   1 
ATOM   6623  N  N     . ALA B 1 181 ? -22.475 0.004   82.309  1.00 50.36  ? 181 ALA B N     1 
ATOM   6624  C  CA    . ALA B 1 181 ? -22.025 1.187   83.035  1.00 51.60  ? 181 ALA B CA    1 
ATOM   6625  C  C     . ALA B 1 181 ? -22.367 2.448   82.252  1.00 52.00  ? 181 ALA B C     1 
ATOM   6626  O  O     . ALA B 1 181 ? -22.995 3.362   82.776  1.00 51.58  ? 181 ALA B O     1 
ATOM   6627  C  CB    . ALA B 1 181 ? -20.522 1.118   83.267  1.00 50.84  ? 181 ALA B CB    1 
ATOM   6628  N  N     . TRP B 1 182 ? -21.953 2.481   80.991  1.00 53.30  ? 182 TRP B N     1 
ATOM   6629  C  CA    . TRP B 1 182 ? -22.203 3.627   80.122  1.00 54.75  ? 182 TRP B CA    1 
ATOM   6630  C  C     . TRP B 1 182 ? -23.669 4.062   80.114  1.00 55.55  ? 182 TRP B C     1 
ATOM   6631  O  O     . TRP B 1 182 ? -23.980 5.236   80.309  1.00 54.78  ? 182 TRP B O     1 
ATOM   6632  C  CB    . TRP B 1 182 ? -21.761 3.307   78.690  1.00 53.25  ? 182 TRP B CB    1 
ATOM   6633  C  CG    . TRP B 1 182 ? -21.760 4.502   77.758  1.00 51.28  ? 182 TRP B CG    1 
ATOM   6634  C  CD1   . TRP B 1 182 ? -22.590 4.715   76.697  1.00 51.60  ? 182 TRP B CD1   1 
ATOM   6635  C  CD2   . TRP B 1 182 ? -20.848 5.608   77.777  1.00 50.18  ? 182 TRP B CD2   1 
ATOM   6636  N  NE1   . TRP B 1 182 ? -22.252 5.882   76.048  1.00 50.22  ? 182 TRP B NE1   1 
ATOM   6637  C  CE2   . TRP B 1 182 ? -21.189 6.451   76.694  1.00 49.64  ? 182 TRP B CE2   1 
ATOM   6638  C  CE3   . TRP B 1 182 ? -19.781 5.974   78.609  1.00 49.42  ? 182 TRP B CE3   1 
ATOM   6639  C  CZ2   . TRP B 1 182 ? -20.494 7.623   76.413  1.00 50.49  ? 182 TRP B CZ2   1 
ATOM   6640  C  CZ3   . TRP B 1 182 ? -19.089 7.143   78.330  1.00 49.36  ? 182 TRP B CZ3   1 
ATOM   6641  C  CH2   . TRP B 1 182 ? -19.452 7.956   77.244  1.00 50.12  ? 182 TRP B CH2   1 
ATOM   6642  N  N     . LEU B 1 183 ? -24.567 3.116   79.869  1.00 57.44  ? 183 LEU B N     1 
ATOM   6643  C  CA    . LEU B 1 183 ? -25.990 3.423   79.841  1.00 58.84  ? 183 LEU B CA    1 
ATOM   6644  C  C     . LEU B 1 183 ? -26.437 3.864   81.228  1.00 60.80  ? 183 LEU B C     1 
ATOM   6645  O  O     . LEU B 1 183 ? -27.328 4.702   81.356  1.00 61.70  ? 183 LEU B O     1 
ATOM   6646  C  CB    . LEU B 1 183 ? -26.797 2.196   79.395  1.00 57.06  ? 183 LEU B CB    1 
ATOM   6647  C  CG    . LEU B 1 183 ? -26.644 1.765   77.934  1.00 55.25  ? 183 LEU B CG    1 
ATOM   6648  C  CD1   . LEU B 1 183 ? -27.378 0.459   77.695  1.00 54.65  ? 183 LEU B CD1   1 
ATOM   6649  C  CD2   . LEU B 1 183 ? -27.184 2.855   77.031  1.00 55.53  ? 183 LEU B CD2   1 
ATOM   6650  N  N     . ALA B 1 184 ? -25.804 3.302   82.259  1.00 62.17  ? 184 ALA B N     1 
ATOM   6651  C  CA    . ALA B 1 184 ? -26.121 3.624   83.647  1.00 62.95  ? 184 ALA B CA    1 
ATOM   6652  C  C     . ALA B 1 184 ? -25.779 5.062   83.962  1.00 64.16  ? 184 ALA B C     1 
ATOM   6653  O  O     . ALA B 1 184 ? -26.156 5.577   85.003  1.00 65.50  ? 184 ALA B O     1 
ATOM   6654  C  CB    . ALA B 1 184 ? -25.365 2.707   84.586  1.00 62.33  ? 184 ALA B CB    1 
ATOM   6655  N  N     . GLN B 1 185 ? -25.054 5.712   83.066  1.00 66.14  ? 185 GLN B N     1 
ATOM   6656  C  CA    . GLN B 1 185 ? -24.686 7.104   83.277  1.00 68.52  ? 185 GLN B CA    1 
ATOM   6657  C  C     . GLN B 1 185 ? -25.659 8.010   82.531  1.00 69.56  ? 185 GLN B C     1 
ATOM   6658  O  O     . GLN B 1 185 ? -25.571 9.230   82.642  1.00 71.51  ? 185 GLN B O     1 
ATOM   6659  C  CB    . GLN B 1 185 ? -23.263 7.378   82.778  1.00 69.62  ? 185 GLN B CB    1 
ATOM   6660  C  CG    . GLN B 1 185 ? -22.175 6.484   83.377  1.00 71.73  ? 185 GLN B CG    1 
ATOM   6661  C  CD    . GLN B 1 185 ? -21.785 6.873   84.783  1.00 71.50  ? 185 GLN B CD    1 
ATOM   6662  O  OE1   . GLN B 1 185 ? -21.320 7.988   85.021  1.00 73.03  ? 185 GLN B OE1   1 
ATOM   6663  N  NE2   . GLN B 1 185 ? -21.964 5.953   85.725  1.00 70.71  ? 185 GLN B NE2   1 
ATOM   6664  N  N     . GLY B 1 186 ? -26.568 7.417   81.756  1.00 69.38  ? 186 GLY B N     1 
ATOM   6665  C  CA    . GLY B 1 186 ? -27.546 8.202   81.019  1.00 68.50  ? 186 GLY B CA    1 
ATOM   6666  C  C     . GLY B 1 186 ? -27.284 8.438   79.539  1.00 68.29  ? 186 GLY B C     1 
ATOM   6667  O  O     . GLY B 1 186 ? -28.093 9.079   78.865  1.00 69.42  ? 186 GLY B O     1 
ATOM   6668  N  N     . HIS B 1 187 ? -26.170 7.931   79.019  1.00 66.86  ? 187 HIS B N     1 
ATOM   6669  C  CA    . HIS B 1 187 ? -25.854 8.126   77.609  1.00 65.37  ? 187 HIS B CA    1 
ATOM   6670  C  C     . HIS B 1 187 ? -26.711 7.265   76.709  1.00 65.17  ? 187 HIS B C     1 
ATOM   6671  O  O     . HIS B 1 187 ? -27.100 6.162   77.082  1.00 65.73  ? 187 HIS B O     1 
ATOM   6672  C  CB    . HIS B 1 187 ? -24.399 7.782   77.313  1.00 64.97  ? 187 HIS B CB    1 
ATOM   6673  C  CG    . HIS B 1 187 ? -23.415 8.552   78.127  1.00 64.75  ? 187 HIS B CG    1 
ATOM   6674  N  ND1   . HIS B 1 187 ? -23.052 8.178   79.404  1.00 64.09  ? 187 HIS B ND1   1 
ATOM   6675  C  CD2   . HIS B 1 187 ? -22.727 9.685   77.857  1.00 64.30  ? 187 HIS B CD2   1 
ATOM   6676  C  CE1   . HIS B 1 187 ? -22.184 9.047   79.883  1.00 64.39  ? 187 HIS B CE1   1 
ATOM   6677  N  NE2   . HIS B 1 187 ? -21.970 9.973   78.964  1.00 64.80  ? 187 HIS B NE2   1 
ATOM   6678  N  N     . PRO B 1 188 ? -27.004 7.756   75.496  1.00 65.08  ? 188 PRO B N     1 
ATOM   6679  C  CA    . PRO B 1 188 ? -27.819 7.005   74.536  1.00 63.55  ? 188 PRO B CA    1 
ATOM   6680  C  C     . PRO B 1 188 ? -27.097 5.751   74.063  1.00 61.49  ? 188 PRO B C     1 
ATOM   6681  O  O     . PRO B 1 188 ? -25.865 5.684   74.068  1.00 60.41  ? 188 PRO B O     1 
ATOM   6682  C  CB    . PRO B 1 188 ? -28.017 8.002   73.399  1.00 64.85  ? 188 PRO B CB    1 
ATOM   6683  C  CG    . PRO B 1 188 ? -26.728 8.805   73.436  1.00 65.30  ? 188 PRO B CG    1 
ATOM   6684  C  CD    . PRO B 1 188 ? -26.598 9.057   74.929  1.00 65.80  ? 188 PRO B CD    1 
ATOM   6685  N  N     . LEU B 1 189 ? -27.871 4.763   73.644  1.00 59.84  ? 189 LEU B N     1 
ATOM   6686  C  CA    . LEU B 1 189 ? -27.284 3.530   73.181  1.00 59.07  ? 189 LEU B CA    1 
ATOM   6687  C  C     . LEU B 1 189 ? -26.264 3.769   72.100  1.00 57.88  ? 189 LEU B C     1 
ATOM   6688  O  O     . LEU B 1 189 ? -26.450 4.592   71.221  1.00 58.00  ? 189 LEU B O     1 
ATOM   6689  C  CB    . LEU B 1 189 ? -28.355 2.572   72.669  1.00 59.28  ? 189 LEU B CB    1 
ATOM   6690  C  CG    . LEU B 1 189 ? -29.029 1.718   73.744  1.00 60.08  ? 189 LEU B CG    1 
ATOM   6691  C  CD1   . LEU B 1 189 ? -29.755 2.612   74.770  1.00 59.99  ? 189 LEU B CD1   1 
ATOM   6692  C  CD2   . LEU B 1 189 ? -29.973 0.725   73.052  1.00 60.88  ? 189 LEU B CD2   1 
ATOM   6693  N  N     . PRO B 1 190 ? -25.138 3.078   72.186  1.00 57.50  ? 190 PRO B N     1 
ATOM   6694  C  CA    . PRO B 1 190 ? -24.118 3.260   71.162  1.00 57.54  ? 190 PRO B CA    1 
ATOM   6695  C  C     . PRO B 1 190 ? -24.633 2.713   69.838  1.00 57.01  ? 190 PRO B C     1 
ATOM   6696  O  O     . PRO B 1 190 ? -25.632 2.006   69.787  1.00 56.51  ? 190 PRO B O     1 
ATOM   6697  C  CB    . PRO B 1 190 ? -22.945 2.470   71.719  1.00 58.09  ? 190 PRO B CB    1 
ATOM   6698  C  CG    . PRO B 1 190 ? -23.095 2.689   73.194  1.00 58.48  ? 190 PRO B CG    1 
ATOM   6699  C  CD    . PRO B 1 190 ? -24.568 2.471   73.399  1.00 58.14  ? 190 PRO B CD    1 
ATOM   6700  N  N     . LYS B 1 191 ? -23.951 3.057   68.762  1.00 57.68  ? 191 LYS B N     1 
ATOM   6701  C  CA    . LYS B 1 191 ? -24.351 2.602   67.447  1.00 57.90  ? 191 LYS B CA    1 
ATOM   6702  C  C     . LYS B 1 191 ? -23.746 1.231   67.251  1.00 57.19  ? 191 LYS B C     1 
ATOM   6703  O  O     . LYS B 1 191 ? -24.297 0.381   66.550  1.00 57.51  ? 191 LYS B O     1 
ATOM   6704  C  CB    . LYS B 1 191 ? -23.805 3.549   66.387  1.00 60.03  ? 191 LYS B CB    1 
ATOM   6705  C  CG    . LYS B 1 191 ? -24.714 3.761   65.189  1.00 62.87  ? 191 LYS B CG    1 
ATOM   6706  C  CD    . LYS B 1 191 ? -25.399 5.137   65.242  1.00 64.46  ? 191 LYS B CD    1 
ATOM   6707  C  CE    . LYS B 1 191 ? -25.898 5.591   63.849  1.00 66.55  ? 191 LYS B CE    1 
ATOM   6708  N  NZ    . LYS B 1 191 ? -24.807 5.861   62.839  1.00 65.52  ? 191 LYS B NZ    1 
ATOM   6709  N  N     . ARG B 1 192 ? -22.588 1.033   67.866  1.00 55.53  ? 192 ARG B N     1 
ATOM   6710  C  CA    . ARG B 1 192 ? -21.899 -0.235  67.766  1.00 54.18  ? 192 ARG B CA    1 
ATOM   6711  C  C     . ARG B 1 192 ? -21.298 -0.541  69.106  1.00 51.62  ? 192 ARG B C     1 
ATOM   6712  O  O     . ARG B 1 192 ? -20.990 0.355   69.886  1.00 51.51  ? 192 ARG B O     1 
ATOM   6713  C  CB    . ARG B 1 192 ? -20.775 -0.196  66.733  1.00 57.22  ? 192 ARG B CB    1 
ATOM   6714  C  CG    . ARG B 1 192 ? -20.851 0.902   65.693  1.00 61.05  ? 192 ARG B CG    1 
ATOM   6715  C  CD    . ARG B 1 192 ? -19.987 0.522   64.496  1.00 63.99  ? 192 ARG B CD    1 
ATOM   6716  N  NE    . ARG B 1 192 ? -20.646 -0.466  63.633  1.00 68.06  ? 192 ARG B NE    1 
ATOM   6717  C  CZ    . ARG B 1 192 ? -20.095 -1.602  63.188  1.00 70.56  ? 192 ARG B CZ    1 
ATOM   6718  N  NH1   . ARG B 1 192 ? -18.854 -1.942  63.515  1.00 72.26  ? 192 ARG B NH1   1 
ATOM   6719  N  NH2   . ARG B 1 192 ? -20.783 -2.402  62.386  1.00 71.45  ? 192 ARG B NH2   1 
ATOM   6720  N  N     . VAL B 1 193 ? -21.101 -1.822  69.348  1.00 48.25  ? 193 VAL B N     1 
ATOM   6721  C  CA    . VAL B 1 193 ? -20.566 -2.264  70.600  1.00 46.24  ? 193 VAL B CA    1 
ATOM   6722  C  C     . VAL B 1 193 ? -19.423 -3.255  70.315  1.00 46.25  ? 193 VAL B C     1 
ATOM   6723  O  O     . VAL B 1 193 ? -19.372 -3.858  69.250  1.00 46.08  ? 193 VAL B O     1 
ATOM   6724  C  CB    . VAL B 1 193 ? -21.729 -2.861  71.398  1.00 44.73  ? 193 VAL B CB    1 
ATOM   6725  C  CG1   . VAL B 1 193 ? -22.080 -4.221  70.868  1.00 43.88  ? 193 VAL B CG1   1 
ATOM   6726  C  CG2   . VAL B 1 193 ? -21.416 -2.855  72.852  1.00 45.58  ? 193 VAL B CG2   1 
ATOM   6727  N  N     . ARG B 1 194 ? -18.497 -3.397  71.256  1.00 45.99  ? 194 ARG B N     1 
ATOM   6728  C  CA    . ARG B 1 194 ? -17.336 -4.273  71.088  1.00 47.38  ? 194 ARG B CA    1 
ATOM   6729  C  C     . ARG B 1 194 ? -17.347 -5.367  72.156  1.00 47.33  ? 194 ARG B C     1 
ATOM   6730  O  O     . ARG B 1 194 ? -17.817 -5.138  73.256  1.00 47.68  ? 194 ARG B O     1 
ATOM   6731  C  CB    . ARG B 1 194 ? -16.057 -3.415  71.199  1.00 48.10  ? 194 ARG B CB    1 
ATOM   6732  C  CG    . ARG B 1 194 ? -14.733 -4.072  70.791  1.00 49.47  ? 194 ARG B CG    1 
ATOM   6733  C  CD    . ARG B 1 194 ? -13.928 -4.580  71.980  1.00 51.68  ? 194 ARG B CD    1 
ATOM   6734  N  NE    . ARG B 1 194 ? -13.413 -3.517  72.841  1.00 54.42  ? 194 ARG B NE    1 
ATOM   6735  C  CZ    . ARG B 1 194 ? -12.854 -3.725  74.039  1.00 57.53  ? 194 ARG B CZ    1 
ATOM   6736  N  NH1   . ARG B 1 194 ? -12.736 -4.961  74.521  1.00 58.48  ? 194 ARG B NH1   1 
ATOM   6737  N  NH2   . ARG B 1 194 ? -12.415 -2.701  74.770  1.00 57.04  ? 194 ARG B NH2   1 
ATOM   6738  N  N     . ASN B 1 195 ? -16.849 -6.558  71.837  1.00 47.84  ? 195 ASN B N     1 
ATOM   6739  C  CA    . ASN B 1 195 ? -16.818 -7.630  72.827  1.00 49.30  ? 195 ASN B CA    1 
ATOM   6740  C  C     . ASN B 1 195 ? -15.840 -7.258  73.909  1.00 50.78  ? 195 ASN B C     1 
ATOM   6741  O  O     . ASN B 1 195 ? -14.660 -7.114  73.641  1.00 53.42  ? 195 ASN B O     1 
ATOM   6742  C  CB    . ASN B 1 195 ? -16.344 -8.949  72.223  1.00 49.74  ? 195 ASN B CB    1 
ATOM   6743  C  CG    . ASN B 1 195 ? -17.435 -9.689  71.496  1.00 51.09  ? 195 ASN B CG    1 
ATOM   6744  O  OD1   . ASN B 1 195 ? -18.609 -9.570  71.838  1.00 51.87  ? 195 ASN B OD1   1 
ATOM   6745  N  ND2   . ASN B 1 195 ? -17.053 -10.485 70.496  1.00 51.11  ? 195 ASN B ND2   1 
ATOM   6746  N  N     . ALA B 1 196 ? -16.301 -7.112  75.138  1.00 52.17  ? 196 ALA B N     1 
ATOM   6747  C  CA    . ALA B 1 196 ? -15.372 -6.762  76.201  1.00 53.50  ? 196 ALA B CA    1 
ATOM   6748  C  C     . ALA B 1 196 ? -14.204 -7.747  76.269  1.00 54.13  ? 196 ALA B C     1 
ATOM   6749  O  O     . ALA B 1 196 ? -13.084 -7.347  76.563  1.00 55.01  ? 196 ALA B O     1 
ATOM   6750  C  CB    . ALA B 1 196 ? -16.095 -6.721  77.546  1.00 53.89  ? 196 ALA B CB    1 
ATOM   6751  N  N     . TYR B 1 197 ? -14.461 -9.022  75.972  1.00 54.88  ? 197 TYR B N     1 
ATOM   6752  C  CA    . TYR B 1 197 ? -13.435 -10.069 76.044  1.00 55.56  ? 197 TYR B CA    1 
ATOM   6753  C  C     . TYR B 1 197 ? -12.534 -10.296 74.827  1.00 55.59  ? 197 TYR B C     1 
ATOM   6754  O  O     . TYR B 1 197 ? -11.644 -11.138 74.878  1.00 55.80  ? 197 TYR B O     1 
ATOM   6755  C  CB    . TYR B 1 197 ? -14.078 -11.393 76.424  1.00 56.28  ? 197 TYR B CB    1 
ATOM   6756  C  CG    . TYR B 1 197 ? -15.320 -11.644 75.631  1.00 58.55  ? 197 TYR B CG    1 
ATOM   6757  C  CD1   . TYR B 1 197 ? -16.550 -11.209 76.093  1.00 59.42  ? 197 TYR B CD1   1 
ATOM   6758  C  CD2   . TYR B 1 197 ? -15.256 -12.258 74.383  1.00 59.53  ? 197 TYR B CD2   1 
ATOM   6759  C  CE1   . TYR B 1 197 ? -17.690 -11.375 75.333  1.00 62.47  ? 197 TYR B CE1   1 
ATOM   6760  C  CE2   . TYR B 1 197 ? -16.384 -12.428 73.611  1.00 60.99  ? 197 TYR B CE2   1 
ATOM   6761  C  CZ    . TYR B 1 197 ? -17.604 -11.986 74.088  1.00 62.92  ? 197 TYR B CZ    1 
ATOM   6762  O  OH    . TYR B 1 197 ? -18.742 -12.157 73.325  1.00 64.98  ? 197 TYR B OH    1 
ATOM   6763  N  N     . ASP B 1 198 ? -12.776 -9.595  73.726  1.00 55.36  ? 198 ASP B N     1 
ATOM   6764  C  CA    . ASP B 1 198 ? -11.900 -9.720  72.573  1.00 54.91  ? 198 ASP B CA    1 
ATOM   6765  C  C     . ASP B 1 198 ? -11.972 -8.494  71.678  1.00 54.52  ? 198 ASP B C     1 
ATOM   6766  O  O     . ASP B 1 198 ? -12.224 -7.396  72.164  1.00 53.67  ? 198 ASP B O     1 
ATOM   6767  C  CB    . ASP B 1 198 ? -12.131 -11.034 71.794  1.00 57.40  ? 198 ASP B CB    1 
ATOM   6768  C  CG    . ASP B 1 198 ? -13.457 -11.092 71.057  1.00 60.61  ? 198 ASP B CG    1 
ATOM   6769  O  OD1   . ASP B 1 198 ? -13.764 -10.180 70.256  1.00 60.31  ? 198 ASP B OD1   1 
ATOM   6770  O  OD2   . ASP B 1 198 ? -14.184 -12.091 71.263  1.00 63.45  ? 198 ASP B OD2   1 
ATOM   6771  N  N     . ARG B 1 199 ? -11.746 -8.659  70.383  1.00 54.17  ? 199 ARG B N     1 
ATOM   6772  C  CA    . ARG B 1 199 ? -11.738 -7.517  69.489  1.00 54.51  ? 199 ARG B CA    1 
ATOM   6773  C  C     . ARG B 1 199 ? -12.976 -7.324  68.630  1.00 55.17  ? 199 ARG B C     1 
ATOM   6774  O  O     . ARG B 1 199 ? -13.176 -6.271  68.033  1.00 54.91  ? 199 ARG B O     1 
ATOM   6775  C  CB    . ARG B 1 199 ? -10.516 -7.616  68.596  1.00 56.13  ? 199 ARG B CB    1 
ATOM   6776  C  CG    . ARG B 1 199 ? -9.205  -7.352  69.300  1.00 57.80  ? 199 ARG B CG    1 
ATOM   6777  C  CD    . ARG B 1 199 ? -8.641  -6.013  68.849  1.00 60.90  ? 199 ARG B CD    1 
ATOM   6778  N  NE    . ARG B 1 199 ? -9.428  -4.876  69.327  1.00 63.04  ? 199 ARG B NE    1 
ATOM   6779  C  CZ    . ARG B 1 199 ? -9.333  -4.365  70.552  1.00 64.11  ? 199 ARG B CZ    1 
ATOM   6780  N  NH1   . ARG B 1 199 ? -8.482  -4.883  71.434  1.00 65.85  ? 199 ARG B NH1   1 
ATOM   6781  N  NH2   . ARG B 1 199 ? -10.084 -3.333  70.895  1.00 62.30  ? 199 ARG B NH2   1 
ATOM   6782  N  N     . ARG B 1 200 ? -13.815 -8.342  68.583  1.00 55.78  ? 200 ARG B N     1 
ATOM   6783  C  CA    . ARG B 1 200 ? -15.019 -8.318  67.775  1.00 55.73  ? 200 ARG B CA    1 
ATOM   6784  C  C     . ARG B 1 200 ? -16.050 -7.231  68.066  1.00 54.49  ? 200 ARG B C     1 
ATOM   6785  O  O     . ARG B 1 200 ? -16.340 -6.920  69.219  1.00 53.11  ? 200 ARG B O     1 
ATOM   6786  C  CB    . ARG B 1 200 ? -15.667 -9.682  67.871  1.00 58.75  ? 200 ARG B CB    1 
ATOM   6787  C  CG    . ARG B 1 200 ? -16.819 -9.876  66.953  1.00 63.05  ? 200 ARG B CG    1 
ATOM   6788  C  CD    . ARG B 1 200 ? -16.811 -11.306 66.550  1.00 66.66  ? 200 ARG B CD    1 
ATOM   6789  N  NE    . ARG B 1 200 ? -18.064 -11.709 65.941  1.00 69.96  ? 200 ARG B NE    1 
ATOM   6790  C  CZ    . ARG B 1 200 ? -18.133 -12.609 64.972  1.00 71.18  ? 200 ARG B CZ    1 
ATOM   6791  N  NH1   . ARG B 1 200 ? -17.011 -13.166 64.526  1.00 71.62  ? 200 ARG B NH1   1 
ATOM   6792  N  NH2   . ARG B 1 200 ? -19.308 -12.960 64.465  1.00 70.33  ? 200 ARG B NH2   1 
ATOM   6793  N  N     . THR B 1 201 ? -16.618 -6.677  66.997  1.00 53.86  ? 201 THR B N     1 
ATOM   6794  C  CA    . THR B 1 201 ? -17.620 -5.621  67.115  1.00 54.31  ? 201 THR B CA    1 
ATOM   6795  C  C     . THR B 1 201 ? -18.914 -5.996  66.404  1.00 54.03  ? 201 THR B C     1 
ATOM   6796  O  O     . THR B 1 201 ? -18.903 -6.791  65.465  1.00 54.01  ? 201 THR B O     1 
ATOM   6797  C  CB    . THR B 1 201 ? -17.127 -4.308  66.512  1.00 54.28  ? 201 THR B CB    1 
ATOM   6798  O  OG1   . THR B 1 201 ? -17.469 -4.266  65.125  1.00 55.21  ? 201 THR B OG1   1 
ATOM   6799  C  CG2   . THR B 1 201 ? -15.625 -4.201  66.644  1.00 55.71  ? 201 THR B CG2   1 
ATOM   6800  N  N     . TRP B 1 202 ? -20.022 -5.409  66.861  1.00 53.91  ? 202 TRP B N     1 
ATOM   6801  C  CA    . TRP B 1 202 ? -21.346 -5.672  66.306  1.00 53.09  ? 202 TRP B CA    1 
ATOM   6802  C  C     . TRP B 1 202 ? -22.129 -4.380  66.245  1.00 53.96  ? 202 TRP B C     1 
ATOM   6803  O  O     . TRP B 1 202 ? -21.637 -3.319  66.624  1.00 54.13  ? 202 TRP B O     1 
ATOM   6804  C  CB    . TRP B 1 202 ? -22.157 -6.614  67.202  1.00 53.01  ? 202 TRP B CB    1 
ATOM   6805  C  CG    . TRP B 1 202 ? -21.402 -7.677  67.948  1.00 52.12  ? 202 TRP B CG    1 
ATOM   6806  C  CD1   . TRP B 1 202 ? -20.489 -7.501  68.955  1.00 50.65  ? 202 TRP B CD1   1 
ATOM   6807  C  CD2   . TRP B 1 202 ? -21.489 -9.084  67.729  1.00 51.57  ? 202 TRP B CD2   1 
ATOM   6808  N  NE1   . TRP B 1 202 ? -20.000 -8.717  69.370  1.00 49.05  ? 202 TRP B NE1   1 
ATOM   6809  C  CE2   . TRP B 1 202 ? -20.598 -9.708  68.635  1.00 49.82  ? 202 TRP B CE2   1 
ATOM   6810  C  CE3   . TRP B 1 202 ? -22.239 -9.884  66.854  1.00 51.10  ? 202 TRP B CE3   1 
ATOM   6811  C  CZ2   . TRP B 1 202 ? -20.427 -11.087 68.688  1.00 50.16  ? 202 TRP B CZ2   1 
ATOM   6812  C  CZ3   . TRP B 1 202 ? -22.072 -11.260 66.906  1.00 52.57  ? 202 TRP B CZ3   1 
ATOM   6813  C  CH2   . TRP B 1 202 ? -21.171 -11.850 67.822  1.00 51.94  ? 202 TRP B CH2   1 
ATOM   6814  N  N     . GLU B 1 203 ? -23.372 -4.497  65.783  1.00 55.42  ? 203 GLU B N     1 
ATOM   6815  C  CA    . GLU B 1 203 ? -24.300 -3.371  65.701  1.00 56.68  ? 203 GLU B CA    1 
ATOM   6816  C  C     . GLU B 1 203 ? -25.169 -3.525  66.941  1.00 54.50  ? 203 GLU B C     1 
ATOM   6817  O  O     . GLU B 1 203 ? -25.712 -4.610  67.176  1.00 53.32  ? 203 GLU B O     1 
ATOM   6818  C  CB    . GLU B 1 203 ? -25.223 -3.504  64.489  1.00 62.10  ? 203 GLU B CB    1 
ATOM   6819  C  CG    . GLU B 1 203 ? -24.572 -3.982  63.204  1.00 70.68  ? 203 GLU B CG    1 
ATOM   6820  C  CD    . GLU B 1 203 ? -23.784 -2.892  62.502  1.00 75.41  ? 203 GLU B CD    1 
ATOM   6821  O  OE1   . GLU B 1 203 ? -23.848 -1.722  62.953  1.00 78.19  ? 203 GLU B OE1   1 
ATOM   6822  O  OE2   . GLU B 1 203 ? -23.110 -3.210  61.493  1.00 78.29  ? 203 GLU B OE2   1 
ATOM   6823  N  N     . LEU B 1 204 ? -25.307 -2.474  67.739  1.00 51.53  ? 204 LEU B N     1 
ATOM   6824  C  CA    . LEU B 1 204 ? -26.159 -2.591  68.912  1.00 49.44  ? 204 LEU B CA    1 
ATOM   6825  C  C     . LEU B 1 204 ? -27.575 -2.270  68.436  1.00 48.13  ? 204 LEU B C     1 
ATOM   6826  O  O     . LEU B 1 204 ? -27.812 -1.190  67.906  1.00 47.15  ? 204 LEU B O     1 
ATOM   6827  C  CB    . LEU B 1 204 ? -25.732 -1.610  69.996  1.00 48.93  ? 204 LEU B CB    1 
ATOM   6828  C  CG    . LEU B 1 204 ? -26.019 -2.055  71.437  1.00 49.01  ? 204 LEU B CG    1 
ATOM   6829  C  CD1   . LEU B 1 204 ? -26.183 -0.817  72.306  1.00 49.27  ? 204 LEU B CD1   1 
ATOM   6830  C  CD2   . LEU B 1 204 ? -27.279 -2.906  71.514  1.00 49.62  ? 204 LEU B CD2   1 
ATOM   6831  N  N     . LEU B 1 205 ? -28.503 -3.206  68.631  1.00 47.48  ? 205 LEU B N     1 
ATOM   6832  C  CA    . LEU B 1 205 ? -29.886 -3.052  68.171  1.00 48.54  ? 205 LEU B CA    1 
ATOM   6833  C  C     . LEU B 1 205 ? -30.802 -2.393  69.192  1.00 50.90  ? 205 LEU B C     1 
ATOM   6834  O  O     . LEU B 1 205 ? -31.391 -1.335  68.930  1.00 51.33  ? 205 LEU B O     1 
ATOM   6835  C  CB    . LEU B 1 205 ? -30.474 -4.422  67.782  1.00 45.95  ? 205 LEU B CB    1 
ATOM   6836  C  CG    . LEU B 1 205 ? -29.863 -5.321  66.688  1.00 42.65  ? 205 LEU B CG    1 
ATOM   6837  C  CD1   . LEU B 1 205 ? -30.617 -6.655  66.651  1.00 39.38  ? 205 LEU B CD1   1 
ATOM   6838  C  CD2   . LEU B 1 205 ? -29.914 -4.631  65.331  1.00 39.36  ? 205 LEU B CD2   1 
ATOM   6839  N  N     . ARG B 1 206 ? -30.947 -3.055  70.339  1.00 53.21  ? 206 ARG B N     1 
ATOM   6840  C  CA    . ARG B 1 206 ? -31.770 -2.570  71.449  1.00 54.87  ? 206 ARG B CA    1 
ATOM   6841  C  C     . ARG B 1 206 ? -31.479 -3.403  72.681  1.00 55.40  ? 206 ARG B C     1 
ATOM   6842  O  O     . ARG B 1 206 ? -30.739 -4.386  72.607  1.00 54.68  ? 206 ARG B O     1 
ATOM   6843  C  CB    . ARG B 1 206 ? -33.279 -2.647  71.139  1.00 55.73  ? 206 ARG B CB    1 
ATOM   6844  C  CG    . ARG B 1 206 ? -33.700 -3.390  69.862  1.00 57.31  ? 206 ARG B CG    1 
ATOM   6845  C  CD    . ARG B 1 206 ? -33.689 -4.908  69.997  1.00 58.47  ? 206 ARG B CD    1 
ATOM   6846  N  NE    . ARG B 1 206 ? -34.516 -5.400  71.097  1.00 59.45  ? 206 ARG B NE    1 
ATOM   6847  C  CZ    . ARG B 1 206 ? -34.991 -6.643  71.175  1.00 61.55  ? 206 ARG B CZ    1 
ATOM   6848  N  NH1   . ARG B 1 206 ? -34.727 -7.520  70.206  1.00 60.60  ? 206 ARG B NH1   1 
ATOM   6849  N  NH2   . ARG B 1 206 ? -35.713 -7.021  72.232  1.00 62.20  ? 206 ARG B NH2   1 
ATOM   6850  N  N     . LEU B 1 207 ? -32.049 -2.998  73.815  1.00 56.32  ? 207 LEU B N     1 
ATOM   6851  C  CA    . LEU B 1 207 ? -31.875 -3.731  75.063  1.00 57.34  ? 207 LEU B CA    1 
ATOM   6852  C  C     . LEU B 1 207 ? -32.992 -4.753  75.183  1.00 58.38  ? 207 LEU B C     1 
ATOM   6853  O  O     . LEU B 1 207 ? -33.805 -4.889  74.279  1.00 59.22  ? 207 LEU B O     1 
ATOM   6854  C  CB    . LEU B 1 207 ? -31.909 -2.777  76.247  1.00 57.64  ? 207 LEU B CB    1 
ATOM   6855  C  CG    . LEU B 1 207 ? -30.534 -2.428  76.819  1.00 59.58  ? 207 LEU B CG    1 
ATOM   6856  C  CD1   . LEU B 1 207 ? -29.639 -1.889  75.720  1.00 61.29  ? 207 LEU B CD1   1 
ATOM   6857  C  CD2   . LEU B 1 207 ? -30.681 -1.406  77.933  1.00 59.47  ? 207 LEU B CD2   1 
ATOM   6858  N  N     . GLY B 1 208 ? -33.043 -5.478  76.290  1.00 60.03  ? 208 GLY B N     1 
ATOM   6859  C  CA    . GLY B 1 208 ? -34.086 -6.479  76.436  1.00 61.83  ? 208 GLY B CA    1 
ATOM   6860  C  C     . GLY B 1 208 ? -34.441 -6.822  77.870  1.00 62.96  ? 208 GLY B C     1 
ATOM   6861  O  O     . GLY B 1 208 ? -33.556 -7.063  78.706  1.00 61.45  ? 208 GLY B O     1 
ATOM   6862  N  N     . GLU B 1 209 ? -35.745 -6.841  78.153  1.00 64.21  ? 209 GLU B N     1 
ATOM   6863  C  CA    . GLU B 1 209 ? -36.239 -7.158  79.486  1.00 64.50  ? 209 GLU B CA    1 
ATOM   6864  C  C     . GLU B 1 209 ? -36.015 -8.643  79.694  1.00 63.70  ? 209 GLU B C     1 
ATOM   6865  O  O     . GLU B 1 209 ? -36.071 -9.143  80.812  1.00 63.87  ? 209 GLU B O     1 
ATOM   6866  C  CB    . GLU B 1 209 ? -37.733 -6.825  79.619  1.00 66.23  ? 209 GLU B CB    1 
ATOM   6867  C  CG    . GLU B 1 209 ? -38.086 -5.345  79.470  1.00 69.61  ? 209 GLU B CG    1 
ATOM   6868  C  CD    . GLU B 1 209 ? -38.355 -4.915  78.019  1.00 72.28  ? 209 GLU B CD    1 
ATOM   6869  O  OE1   . GLU B 1 209 ? -38.095 -5.704  77.076  1.00 71.90  ? 209 GLU B OE1   1 
ATOM   6870  O  OE2   . GLU B 1 209 ? -38.829 -3.770  77.824  1.00 72.94  ? 209 GLU B OE2   1 
ATOM   6871  N  N     . GLU B 1 210 ? -35.736 -9.338  78.599  1.00 63.42  ? 210 GLU B N     1 
ATOM   6872  C  CA    . GLU B 1 210 ? -35.497 -10.774 78.636  1.00 63.49  ? 210 GLU B CA    1 
ATOM   6873  C  C     . GLU B 1 210 ? -34.485 -11.161 79.686  1.00 62.93  ? 210 GLU B C     1 
ATOM   6874  O  O     . GLU B 1 210 ? -33.512 -10.451 79.925  1.00 63.18  ? 210 GLU B O     1 
ATOM   6875  C  CB    . GLU B 1 210 ? -35.070 -11.247 77.258  1.00 62.62  ? 210 GLU B CB    1 
ATOM   6876  C  CG    . GLU B 1 210 ? -36.168 -10.946 76.287  1.00 65.56  ? 210 GLU B CG    1 
ATOM   6877  C  CD    . GLU B 1 210 ? -35.707 -10.856 74.879  1.00 67.37  ? 210 GLU B CD    1 
ATOM   6878  O  OE1   . GLU B 1 210 ? -35.392 -11.915 74.305  1.00 70.18  ? 210 GLU B OE1   1 
ATOM   6879  O  OE2   . GLU B 1 210 ? -35.664 -9.724  74.347  1.00 69.10  ? 210 GLU B OE2   1 
ATOM   6880  N  N     . ASP B 1 211 ? -34.748 -12.301 80.314  1.00 62.95  ? 211 ASP B N     1 
ATOM   6881  C  CA    . ASP B 1 211 ? -33.926 -12.837 81.390  1.00 61.52  ? 211 ASP B CA    1 
ATOM   6882  C  C     . ASP B 1 211 ? -32.715 -13.632 80.920  1.00 58.23  ? 211 ASP B C     1 
ATOM   6883  O  O     . ASP B 1 211 ? -32.846 -14.630 80.215  1.00 55.09  ? 211 ASP B O     1 
ATOM   6884  C  CB    . ASP B 1 211 ? -34.807 -13.705 82.290  1.00 66.23  ? 211 ASP B CB    1 
ATOM   6885  C  CG    . ASP B 1 211 ? -34.043 -14.345 83.426  1.00 69.50  ? 211 ASP B CG    1 
ATOM   6886  O  OD1   . ASP B 1 211 ? -33.425 -13.603 84.225  1.00 71.55  ? 211 ASP B OD1   1 
ATOM   6887  O  OD2   . ASP B 1 211 ? -34.076 -15.595 83.517  1.00 72.16  ? 211 ASP B OD2   1 
ATOM   6888  N  N     . PRO B 1 212 ? -31.511 -13.192 81.319  1.00 56.96  ? 212 PRO B N     1 
ATOM   6889  C  CA    . PRO B 1 212 ? -30.269 -13.860 80.942  1.00 57.21  ? 212 PRO B CA    1 
ATOM   6890  C  C     . PRO B 1 212 ? -30.270 -15.326 81.372  1.00 58.44  ? 212 PRO B C     1 
ATOM   6891  O  O     . PRO B 1 212 ? -29.925 -16.210 80.590  1.00 58.17  ? 212 PRO B O     1 
ATOM   6892  C  CB    . PRO B 1 212 ? -29.208 -13.041 81.672  1.00 54.96  ? 212 PRO B CB    1 
ATOM   6893  C  CG    . PRO B 1 212 ? -29.817 -11.687 81.732  1.00 54.13  ? 212 PRO B CG    1 
ATOM   6894  C  CD    . PRO B 1 212 ? -31.220 -12.004 82.139  1.00 55.87  ? 212 PRO B CD    1 
ATOM   6895  N  N     . LYS B 1 213 ? -30.674 -15.575 82.614  1.00 59.85  ? 213 LYS B N     1 
ATOM   6896  C  CA    . LYS B 1 213 ? -30.708 -16.927 83.157  1.00 61.95  ? 213 LYS B CA    1 
ATOM   6897  C  C     . LYS B 1 213 ? -31.660 -17.880 82.447  1.00 63.81  ? 213 LYS B C     1 
ATOM   6898  O  O     . LYS B 1 213 ? -31.579 -19.090 82.644  1.00 65.37  ? 213 LYS B O     1 
ATOM   6899  C  CB    . LYS B 1 213 ? -31.079 -16.900 84.641  1.00 62.49  ? 213 LYS B CB    1 
ATOM   6900  C  CG    . LYS B 1 213 ? -30.098 -16.165 85.530  1.00 62.71  ? 213 LYS B CG    1 
ATOM   6901  C  CD    . LYS B 1 213 ? -30.673 -14.842 86.006  1.00 62.50  ? 213 LYS B CD    1 
ATOM   6902  C  CE    . LYS B 1 213 ? -31.820 -15.058 86.978  1.00 62.00  ? 213 LYS B CE    1 
ATOM   6903  N  NZ    . LYS B 1 213 ? -32.288 -13.775 87.566  1.00 63.09  ? 213 LYS B NZ    1 
ATOM   6904  N  N     . GLU B 1 214 ? -32.568 -17.352 81.636  1.00 65.35  ? 214 GLU B N     1 
ATOM   6905  C  CA    . GLU B 1 214 ? -33.517 -18.207 80.934  1.00 66.70  ? 214 GLU B CA    1 
ATOM   6906  C  C     . GLU B 1 214 ? -33.698 -17.789 79.476  1.00 67.67  ? 214 GLU B C     1 
ATOM   6907  O  O     . GLU B 1 214 ? -34.759 -17.306 79.082  1.00 68.43  ? 214 GLU B O     1 
ATOM   6908  C  CB    . GLU B 1 214 ? -34.876 -18.204 81.671  1.00 65.67  ? 214 GLU B CB    1 
ATOM   6909  N  N     . LEU B 1 215 ? -32.649 -17.975 78.680  1.00 68.37  ? 215 LEU B N     1 
ATOM   6910  C  CA    . LEU B 1 215 ? -32.682 -17.640 77.257  1.00 68.69  ? 215 LEU B CA    1 
ATOM   6911  C  C     . LEU B 1 215 ? -31.911 -18.732 76.539  1.00 69.50  ? 215 LEU B C     1 
ATOM   6912  O  O     . LEU B 1 215 ? -30.709 -18.618 76.322  1.00 69.62  ? 215 LEU B O     1 
ATOM   6913  C  CB    . LEU B 1 215 ? -32.030 -16.283 77.013  1.00 67.34  ? 215 LEU B CB    1 
ATOM   6914  C  CG    . LEU B 1 215 ? -32.376 -15.656 75.665  1.00 66.39  ? 215 LEU B CG    1 
ATOM   6915  C  CD1   . LEU B 1 215 ? -32.197 -14.153 75.744  1.00 65.40  ? 215 LEU B CD1   1 
ATOM   6916  C  CD2   . LEU B 1 215 ? -31.527 -16.272 74.572  1.00 65.50  ? 215 LEU B CD2   1 
ATOM   6917  N  N     . PRO B 1 216 ? -32.607 -19.807 76.152  1.00 70.79  ? 216 PRO B N     1 
ATOM   6918  C  CA    . PRO B 1 216 ? -32.010 -20.952 75.462  1.00 71.78  ? 216 PRO B CA    1 
ATOM   6919  C  C     . PRO B 1 216 ? -31.229 -20.656 74.187  1.00 72.36  ? 216 PRO B C     1 
ATOM   6920  O  O     . PRO B 1 216 ? -31.744 -20.059 73.236  1.00 71.86  ? 216 PRO B O     1 
ATOM   6921  C  CB    . PRO B 1 216 ? -33.206 -21.874 75.230  1.00 72.66  ? 216 PRO B CB    1 
ATOM   6922  C  CG    . PRO B 1 216 ? -34.338 -20.908 75.049  1.00 73.35  ? 216 PRO B CG    1 
ATOM   6923  C  CD    . PRO B 1 216 ? -34.079 -19.895 76.144  1.00 71.62  ? 216 PRO B CD    1 
ATOM   6924  N  N     . LEU B 1 217 ? -29.972 -21.087 74.186  1.00 73.02  ? 217 LEU B N     1 
ATOM   6925  C  CA    . LEU B 1 217 ? -29.089 -20.902 73.044  1.00 73.25  ? 217 LEU B CA    1 
ATOM   6926  C  C     . LEU B 1 217 ? -29.061 -22.189 72.227  1.00 73.26  ? 217 LEU B C     1 
ATOM   6927  O  O     . LEU B 1 217 ? -29.232 -23.285 72.767  1.00 72.78  ? 217 LEU B O     1 
ATOM   6928  C  CB    . LEU B 1 217 ? -27.676 -20.542 73.525  1.00 73.40  ? 217 LEU B CB    1 
ATOM   6929  C  CG    . LEU B 1 217 ? -27.562 -19.229 74.320  1.00 74.33  ? 217 LEU B CG    1 
ATOM   6930  C  CD1   . LEU B 1 217 ? -26.173 -19.072 74.939  1.00 74.65  ? 217 LEU B CD1   1 
ATOM   6931  C  CD2   . LEU B 1 217 ? -27.864 -18.065 73.392  1.00 74.23  ? 217 LEU B CD2   1 
ATOM   6932  N  N     . PRO B 1 218 ? -28.847 -22.070 70.908  1.00 73.86  ? 218 PRO B N     1 
ATOM   6933  C  CA    . PRO B 1 218 ? -28.788 -23.187 69.958  1.00 73.98  ? 218 PRO B CA    1 
ATOM   6934  C  C     . PRO B 1 218 ? -28.109 -24.480 70.441  1.00 73.92  ? 218 PRO B C     1 
ATOM   6935  O  O     . PRO B 1 218 ? -28.407 -25.570 69.942  1.00 72.98  ? 218 PRO B O     1 
ATOM   6936  C  CB    . PRO B 1 218 ? -28.073 -22.562 68.764  1.00 73.63  ? 218 PRO B CB    1 
ATOM   6937  C  CG    . PRO B 1 218 ? -28.648 -21.176 68.753  1.00 72.97  ? 218 PRO B CG    1 
ATOM   6938  C  CD    . PRO B 1 218 ? -28.581 -20.791 70.217  1.00 73.85  ? 218 PRO B CD    1 
ATOM   6939  N  N     . GLY B 1 219 ? -27.208 -24.359 71.412  1.00 74.30  ? 219 GLY B N     1 
ATOM   6940  C  CA    . GLY B 1 219 ? -26.505 -25.527 71.907  1.00 73.80  ? 219 GLY B CA    1 
ATOM   6941  C  C     . GLY B 1 219 ? -26.883 -26.011 73.291  1.00 74.34  ? 219 GLY B C     1 
ATOM   6942  O  O     . GLY B 1 219 ? -26.050 -26.593 73.984  1.00 74.31  ? 219 GLY B O     1 
ATOM   6943  N  N     . GLY B 1 220 ? -28.127 -25.777 73.702  1.00 74.78  ? 220 GLY B N     1 
ATOM   6944  C  CA    . GLY B 1 220 ? -28.571 -26.225 75.013  1.00 75.77  ? 220 GLY B CA    1 
ATOM   6945  C  C     . GLY B 1 220 ? -27.957 -25.507 76.205  1.00 76.79  ? 220 GLY B C     1 
ATOM   6946  O  O     . GLY B 1 220 ? -27.998 -26.004 77.332  1.00 76.75  ? 220 GLY B O     1 
ATOM   6947  N  N     . LEU B 1 221 ? -27.379 -24.336 75.959  1.00 77.94  ? 221 LEU B N     1 
ATOM   6948  C  CA    . LEU B 1 221 ? -26.765 -23.535 77.021  1.00 77.36  ? 221 LEU B CA    1 
ATOM   6949  C  C     . LEU B 1 221 ? -27.626 -22.294 77.296  1.00 75.93  ? 221 LEU B C     1 
ATOM   6950  O  O     . LEU B 1 221 ? -28.450 -21.886 76.466  1.00 75.14  ? 221 LEU B O     1 
ATOM   6951  C  CB    . LEU B 1 221 ? -25.337 -23.102 76.620  1.00 78.19  ? 221 LEU B CB    1 
ATOM   6952  C  CG    . LEU B 1 221 ? -24.084 -23.891 77.052  1.00 78.69  ? 221 LEU B CG    1 
ATOM   6953  C  CD1   . LEU B 1 221 ? -23.942 -23.835 78.572  1.00 77.58  ? 221 LEU B CD1   1 
ATOM   6954  C  CD2   . LEU B 1 221 ? -24.152 -25.333 76.560  1.00 78.79  ? 221 LEU B CD2   1 
ATOM   6955  N  N     . SER B 1 222 ? -27.440 -21.706 78.471  1.00 73.77  ? 222 SER B N     1 
ATOM   6956  C  CA    . SER B 1 222 ? -28.182 -20.515 78.847  1.00 72.08  ? 222 SER B CA    1 
ATOM   6957  C  C     . SER B 1 222 ? -27.262 -19.313 78.657  1.00 71.57  ? 222 SER B C     1 
ATOM   6958  O  O     . SER B 1 222 ? -26.119 -19.334 79.119  1.00 72.29  ? 222 SER B O     1 
ATOM   6959  C  CB    . SER B 1 222 ? -28.633 -20.632 80.302  1.00 70.51  ? 222 SER B CB    1 
ATOM   6960  O  OG    . SER B 1 222 ? -29.151 -19.412 80.783  1.00 70.14  ? 222 SER B OG    1 
ATOM   6961  N  N     . LEU B 1 223 ? -27.750 -18.285 77.960  1.00 69.81  ? 223 LEU B N     1 
ATOM   6962  C  CA    . LEU B 1 223 ? -26.970 -17.073 77.697  1.00 67.52  ? 223 LEU B CA    1 
ATOM   6963  C  C     . LEU B 1 223 ? -25.954 -16.788 78.826  1.00 66.70  ? 223 LEU B C     1 
ATOM   6964  O  O     . LEU B 1 223 ? -24.746 -16.761 78.583  1.00 67.16  ? 223 LEU B O     1 
ATOM   6965  C  CB    . LEU B 1 223 ? -27.914 -15.871 77.522  1.00 66.80  ? 223 LEU B CB    1 
ATOM   6966  C  CG    . LEU B 1 223 ? -27.468 -14.622 76.746  1.00 65.24  ? 223 LEU B CG    1 
ATOM   6967  C  CD1   . LEU B 1 223 ? -28.494 -13.537 76.952  1.00 65.38  ? 223 LEU B CD1   1 
ATOM   6968  C  CD2   . LEU B 1 223 ? -26.125 -14.123 77.217  1.00 64.49  ? 223 LEU B CD2   1 
ATOM   6969  N  N     . LEU B 1 224 ? -26.437 -16.590 80.054  1.00 64.46  ? 224 LEU B N     1 
ATOM   6970  C  CA    . LEU B 1 224 ? -25.556 -16.308 81.190  1.00 61.81  ? 224 LEU B CA    1 
ATOM   6971  C  C     . LEU B 1 224 ? -24.597 -17.475 81.423  1.00 61.12  ? 224 LEU B C     1 
ATOM   6972  O  O     . LEU B 1 224 ? -23.396 -17.277 81.597  1.00 60.87  ? 224 LEU B O     1 
ATOM   6973  C  CB    . LEU B 1 224 ? -26.387 -16.040 82.455  1.00 60.16  ? 224 LEU B CB    1 
ATOM   6974  C  CG    . LEU B 1 224 ? -25.697 -15.544 83.735  1.00 58.11  ? 224 LEU B CG    1 
ATOM   6975  C  CD1   . LEU B 1 224 ? -25.170 -14.139 83.554  1.00 57.65  ? 224 LEU B CD1   1 
ATOM   6976  C  CD2   . LEU B 1 224 ? -26.694 -15.564 84.874  1.00 57.63  ? 224 LEU B CD2   1 
ATOM   6977  N  N     . ASP B 1 225 ? -25.129 -18.692 81.417  1.00 60.58  ? 225 ASP B N     1 
ATOM   6978  C  CA    . ASP B 1 225 ? -24.314 -19.883 81.620  1.00 60.30  ? 225 ASP B CA    1 
ATOM   6979  C  C     . ASP B 1 225 ? -23.143 -19.879 80.649  1.00 59.30  ? 225 ASP B C     1 
ATOM   6980  O  O     . ASP B 1 225 ? -21.992 -20.083 81.040  1.00 58.51  ? 225 ASP B O     1 
ATOM   6981  C  CB    . ASP B 1 225 ? -25.142 -21.148 81.381  1.00 62.86  ? 225 ASP B CB    1 
ATOM   6982  C  CG    . ASP B 1 225 ? -26.298 -21.297 82.363  1.00 65.51  ? 225 ASP B CG    1 
ATOM   6983  O  OD1   . ASP B 1 225 ? -27.198 -20.424 82.386  1.00 64.87  ? 225 ASP B OD1   1 
ATOM   6984  O  OD2   . ASP B 1 225 ? -26.302 -22.303 83.111  1.00 67.50  ? 225 ASP B OD2   1 
ATOM   6985  N  N     . TYR B 1 226 ? -23.465 -19.641 79.380  1.00 57.76  ? 226 TYR B N     1 
ATOM   6986  C  CA    . TYR B 1 226 ? -22.499 -19.610 78.284  1.00 56.59  ? 226 TYR B CA    1 
ATOM   6987  C  C     . TYR B 1 226 ? -21.263 -18.761 78.535  1.00 56.86  ? 226 TYR B C     1 
ATOM   6988  O  O     . TYR B 1 226 ? -20.139 -19.209 78.316  1.00 57.02  ? 226 TYR B O     1 
ATOM   6989  C  CB    . TYR B 1 226 ? -23.175 -19.102 77.029  1.00 55.15  ? 226 TYR B CB    1 
ATOM   6990  C  CG    . TYR B 1 226 ? -22.251 -18.972 75.860  1.00 54.77  ? 226 TYR B CG    1 
ATOM   6991  C  CD1   . TYR B 1 226 ? -21.714 -20.091 75.251  1.00 53.95  ? 226 TYR B CD1   1 
ATOM   6992  C  CD2   . TYR B 1 226 ? -21.993 -17.730 75.300  1.00 56.92  ? 226 TYR B CD2   1 
ATOM   6993  C  CE1   . TYR B 1 226 ? -20.956 -19.983 74.096  1.00 55.15  ? 226 TYR B CE1   1 
ATOM   6994  C  CE2   . TYR B 1 226 ? -21.233 -17.605 74.143  1.00 57.08  ? 226 TYR B CE2   1 
ATOM   6995  C  CZ    . TYR B 1 226 ? -20.726 -18.737 73.538  1.00 55.85  ? 226 TYR B CZ    1 
ATOM   6996  O  OH    . TYR B 1 226 ? -20.061 -18.622 72.337  1.00 54.14  ? 226 TYR B OH    1 
ATOM   6997  N  N     . HIS B 1 227 ? -21.478 -17.524 78.966  1.00 56.68  ? 227 HIS B N     1 
ATOM   6998  C  CA    . HIS B 1 227 ? -20.381 -16.613 79.248  1.00 55.41  ? 227 HIS B CA    1 
ATOM   6999  C  C     . HIS B 1 227 ? -19.764 -16.930 80.598  1.00 55.41  ? 227 HIS B C     1 
ATOM   7000  O  O     . HIS B 1 227 ? -18.618 -16.584 80.864  1.00 55.39  ? 227 HIS B O     1 
ATOM   7001  C  CB    . HIS B 1 227 ? -20.874 -15.166 79.207  1.00 55.39  ? 227 HIS B CB    1 
ATOM   7002  C  CG    . HIS B 1 227 ? -21.339 -14.735 77.852  1.00 55.55  ? 227 HIS B CG    1 
ATOM   7003  N  ND1   . HIS B 1 227 ? -20.576 -14.907 76.713  1.00 55.17  ? 227 HIS B ND1   1 
ATOM   7004  C  CD2   . HIS B 1 227 ? -22.497 -14.168 77.442  1.00 55.37  ? 227 HIS B CD2   1 
ATOM   7005  C  CE1   . HIS B 1 227 ? -21.246 -14.468 75.666  1.00 54.62  ? 227 HIS B CE1   1 
ATOM   7006  N  NE2   . HIS B 1 227 ? -22.416 -14.014 76.079  1.00 55.11  ? 227 HIS B NE2   1 
ATOM   7007  N  N     . ALA B 1 228 ? -20.525 -17.585 81.464  1.00 55.74  ? 228 ALA B N     1 
ATOM   7008  C  CA    . ALA B 1 228 ? -19.984 -17.967 82.757  1.00 55.90  ? 228 ALA B CA    1 
ATOM   7009  C  C     . ALA B 1 228 ? -19.010 -19.104 82.457  1.00 56.32  ? 228 ALA B C     1 
ATOM   7010  O  O     . ALA B 1 228 ? -17.895 -19.142 82.978  1.00 55.69  ? 228 ALA B O     1 
ATOM   7011  C  CB    . ALA B 1 228 ? -21.088 -18.454 83.659  1.00 56.40  ? 228 ALA B CB    1 
ATOM   7012  N  N     . SER B 1 229 ? -19.455 -20.014 81.590  1.00 56.17  ? 229 SER B N     1 
ATOM   7013  C  CA    . SER B 1 229 ? -18.680 -21.174 81.161  1.00 55.45  ? 229 SER B CA    1 
ATOM   7014  C  C     . SER B 1 229 ? -17.359 -20.817 80.460  1.00 53.53  ? 229 SER B C     1 
ATOM   7015  O  O     . SER B 1 229 ? -16.526 -21.689 80.232  1.00 53.77  ? 229 SER B O     1 
ATOM   7016  C  CB    . SER B 1 229 ? -19.544 -22.042 80.235  1.00 57.21  ? 229 SER B CB    1 
ATOM   7017  O  OG    . SER B 1 229 ? -18.822 -23.139 79.691  1.00 60.28  ? 229 SER B OG    1 
ATOM   7018  N  N     . LYS B 1 230 ? -17.166 -19.545 80.123  1.00 50.87  ? 230 LYS B N     1 
ATOM   7019  C  CA    . LYS B 1 230 ? -15.939 -19.111 79.456  1.00 48.61  ? 230 LYS B CA    1 
ATOM   7020  C  C     . LYS B 1 230 ? -15.130 -18.199 80.361  1.00 47.70  ? 230 LYS B C     1 
ATOM   7021  O  O     . LYS B 1 230 ? -14.179 -17.555 79.910  1.00 46.21  ? 230 LYS B O     1 
ATOM   7022  C  CB    . LYS B 1 230 ? -16.271 -18.348 78.185  1.00 48.14  ? 230 LYS B CB    1 
ATOM   7023  C  CG    . LYS B 1 230 ? -17.108 -19.117 77.199  1.00 47.61  ? 230 LYS B CG    1 
ATOM   7024  C  CD    . LYS B 1 230 ? -16.260 -19.826 76.183  1.00 44.75  ? 230 LYS B CD    1 
ATOM   7025  C  CE    . LYS B 1 230 ? -17.140 -20.343 75.074  1.00 44.99  ? 230 LYS B CE    1 
ATOM   7026  N  NZ    . LYS B 1 230 ? -16.402 -20.423 73.793  1.00 45.54  ? 230 LYS B NZ    1 
ATOM   7027  N  N     . GLY B 1 231 ? -15.522 -18.145 81.630  1.00 47.24  ? 231 GLY B N     1 
ATOM   7028  C  CA    . GLY B 1 231 ? -14.848 -17.296 82.592  1.00 48.30  ? 231 GLY B CA    1 
ATOM   7029  C  C     . GLY B 1 231 ? -14.928 -15.816 82.242  1.00 49.38  ? 231 GLY B C     1 
ATOM   7030  O  O     . GLY B 1 231 ? -14.125 -15.013 82.723  1.00 50.33  ? 231 GLY B O     1 
ATOM   7031  N  N     . ARG B 1 232 ? -15.891 -15.446 81.402  1.00 49.09  ? 232 ARG B N     1 
ATOM   7032  C  CA    . ARG B 1 232 ? -16.047 -14.058 80.993  1.00 48.30  ? 232 ARG B CA    1 
ATOM   7033  C  C     . ARG B 1 232 ? -16.598 -13.252 82.157  1.00 51.52  ? 232 ARG B C     1 
ATOM   7034  O  O     . ARG B 1 232 ? -16.197 -12.110 82.375  1.00 52.07  ? 232 ARG B O     1 
ATOM   7035  C  CB    . ARG B 1 232 ? -17.002 -13.961 79.808  1.00 44.59  ? 232 ARG B CB    1 
ATOM   7036  C  CG    . ARG B 1 232 ? -16.665 -14.866 78.635  1.00 41.61  ? 232 ARG B CG    1 
ATOM   7037  C  CD    . ARG B 1 232 ? -15.765 -14.172 77.642  1.00 41.21  ? 232 ARG B CD    1 
ATOM   7038  N  NE    . ARG B 1 232 ? -15.596 -14.899 76.382  1.00 39.54  ? 232 ARG B NE    1 
ATOM   7039  C  CZ    . ARG B 1 232 ? -16.598 -15.330 75.621  1.00 38.67  ? 232 ARG B CZ    1 
ATOM   7040  N  NH1   . ARG B 1 232 ? -17.854 -15.120 75.994  1.00 38.24  ? 232 ARG B NH1   1 
ATOM   7041  N  NH2   . ARG B 1 232 ? -16.344 -15.949 74.473  1.00 36.49  ? 232 ARG B NH2   1 
ATOM   7042  N  N     . LEU B 1 233 ? -17.520 -13.852 82.906  1.00 55.89  ? 233 LEU B N     1 
ATOM   7043  C  CA    . LEU B 1 233 ? -18.131 -13.177 84.057  1.00 59.90  ? 233 LEU B CA    1 
ATOM   7044  C  C     . LEU B 1 233 ? -17.175 -13.185 85.239  1.00 62.03  ? 233 LEU B C     1 
ATOM   7045  O  O     . LEU B 1 233 ? -17.435 -12.552 86.267  1.00 63.34  ? 233 LEU B O     1 
ATOM   7046  C  CB    . LEU B 1 233 ? -19.447 -13.858 84.462  1.00 59.56  ? 233 LEU B CB    1 
ATOM   7047  C  CG    . LEU B 1 233 ? -20.585 -13.832 83.440  1.00 60.30  ? 233 LEU B CG    1 
ATOM   7048  C  CD1   . LEU B 1 233 ? -21.807 -14.535 84.011  1.00 61.22  ? 233 LEU B CD1   1 
ATOM   7049  C  CD2   . LEU B 1 233 ? -20.916 -12.395 83.085  1.00 59.47  ? 233 LEU B CD2   1 
ATOM   7050  N  N     . GLN B 1 234 ? -16.074 -13.916 85.080  1.00 63.15  ? 234 GLN B N     1 
ATOM   7051  C  CA    . GLN B 1 234 ? -15.053 -14.021 86.106  1.00 64.04  ? 234 GLN B CA    1 
ATOM   7052  C  C     . GLN B 1 234 ? -14.500 -12.645 86.408  1.00 64.65  ? 234 GLN B C     1 
ATOM   7053  O  O     . GLN B 1 234 ? -14.324 -12.278 87.566  1.00 65.23  ? 234 GLN B O     1 
ATOM   7054  C  CB    . GLN B 1 234 ? -13.919 -14.896 85.619  1.00 64.87  ? 234 GLN B CB    1 
ATOM   7055  C  CG    . GLN B 1 234 ? -13.708 -16.137 86.424  1.00 66.55  ? 234 GLN B CG    1 
ATOM   7056  C  CD    . GLN B 1 234 ? -12.269 -16.581 86.371  1.00 67.45  ? 234 GLN B CD    1 
ATOM   7057  O  OE1   . GLN B 1 234 ? -11.708 -16.779 85.290  1.00 67.93  ? 234 GLN B OE1   1 
ATOM   7058  N  NE2   . GLN B 1 234 ? -11.654 -16.734 87.540  1.00 68.70  ? 234 GLN B NE2   1 
ATOM   7059  N  N     . GLY B 1 235 ? -14.212 -11.892 85.355  1.00 64.98  ? 235 GLY B N     1 
ATOM   7060  C  CA    . GLY B 1 235 ? -13.695 -10.555 85.545  1.00 66.51  ? 235 GLY B CA    1 
ATOM   7061  C  C     . GLY B 1 235 ? -14.770 -9.626  86.090  1.00 67.74  ? 235 GLY B C     1 
ATOM   7062  O  O     . GLY B 1 235 ? -14.624 -9.017  87.156  1.00 68.12  ? 235 GLY B O     1 
ATOM   7063  N  N     . ARG B 1 236 ? -15.872 -9.525  85.361  1.00 67.83  ? 236 ARG B N     1 
ATOM   7064  C  CA    . ARG B 1 236 ? -16.948 -8.654  85.781  1.00 67.51  ? 236 ARG B CA    1 
ATOM   7065  C  C     . ARG B 1 236 ? -18.318 -9.297  85.667  1.00 66.48  ? 236 ARG B C     1 
ATOM   7066  O  O     . ARG B 1 236 ? -18.464 -10.342 85.036  1.00 66.55  ? 236 ARG B O     1 
ATOM   7067  C  CB    . ARG B 1 236 ? -16.886 -7.358  84.976  1.00 68.78  ? 236 ARG B CB    1 
ATOM   7068  C  CG    . ARG B 1 236 ? -16.031 -6.308  85.642  1.00 70.10  ? 236 ARG B CG    1 
ATOM   7069  C  CD    . ARG B 1 236 ? -16.606 -6.021  87.013  1.00 71.95  ? 236 ARG B CD    1 
ATOM   7070  N  NE    . ARG B 1 236 ? -16.243 -4.698  87.501  1.00 74.42  ? 236 ARG B NE    1 
ATOM   7071  C  CZ    . ARG B 1 236 ? -17.008 -3.973  88.312  1.00 75.13  ? 236 ARG B CZ    1 
ATOM   7072  N  NH1   . ARG B 1 236 ? -18.179 -4.453  88.717  1.00 74.71  ? 236 ARG B NH1   1 
ATOM   7073  N  NH2   . ARG B 1 236 ? -16.606 -2.774  88.718  1.00 74.92  ? 236 ARG B NH2   1 
ATOM   7074  N  N     . GLU B 1 237 ? -19.311 -8.668  86.297  1.00 65.04  ? 237 GLU B N     1 
ATOM   7075  C  CA    . GLU B 1 237 ? -20.691 -9.159  86.296  1.00 62.83  ? 237 GLU B CA    1 
ATOM   7076  C  C     . GLU B 1 237 ? -21.492 -8.595  85.118  1.00 60.82  ? 237 GLU B C     1 
ATOM   7077  O  O     . GLU B 1 237 ? -21.607 -7.376  84.962  1.00 59.36  ? 237 GLU B O     1 
ATOM   7078  C  CB    . GLU B 1 237 ? -21.378 -8.803  87.628  1.00 62.75  ? 237 GLU B CB    1 
ATOM   7079  N  N     . GLY B 1 238 ? -22.038 -9.499  84.300  1.00 59.27  ? 238 GLY B N     1 
ATOM   7080  C  CA    . GLY B 1 238 ? -22.824 -9.115  83.132  1.00 57.59  ? 238 GLY B CA    1 
ATOM   7081  C  C     . GLY B 1 238 ? -24.199 -8.626  83.525  1.00 55.58  ? 238 GLY B C     1 
ATOM   7082  O  O     . GLY B 1 238 ? -24.817 -9.212  84.408  1.00 56.79  ? 238 GLY B O     1 
ATOM   7083  N  N     . GLY B 1 239 ? -24.691 -7.576  82.869  1.00 53.44  ? 239 GLY B N     1 
ATOM   7084  C  CA    . GLY B 1 239 ? -25.987 -7.019  83.232  1.00 51.32  ? 239 GLY B CA    1 
ATOM   7085  C  C     . GLY B 1 239 ? -27.254 -7.497  82.538  1.00 50.12  ? 239 GLY B C     1 
ATOM   7086  O  O     . GLY B 1 239 ? -27.676 -8.648  82.666  1.00 50.25  ? 239 GLY B O     1 
ATOM   7087  N  N     . ARG B 1 240 ? -27.884 -6.580  81.819  1.00 48.14  ? 240 ARG B N     1 
ATOM   7088  C  CA    . ARG B 1 240 ? -29.106 -6.871  81.097  1.00 46.65  ? 240 ARG B CA    1 
ATOM   7089  C  C     . ARG B 1 240 ? -28.802 -7.558  79.786  1.00 45.49  ? 240 ARG B C     1 
ATOM   7090  O  O     . ARG B 1 240 ? -27.646 -7.754  79.427  1.00 45.81  ? 240 ARG B O     1 
ATOM   7091  C  CB    . ARG B 1 240 ? -29.845 -5.570  80.833  1.00 47.98  ? 240 ARG B CB    1 
ATOM   7092  C  CG    . ARG B 1 240 ? -30.139 -4.809  82.108  1.00 50.75  ? 240 ARG B CG    1 
ATOM   7093  C  CD    . ARG B 1 240 ? -29.707 -3.359  82.020  1.00 52.70  ? 240 ARG B CD    1 
ATOM   7094  N  NE    . ARG B 1 240 ? -30.672 -2.502  81.339  1.00 55.75  ? 240 ARG B NE    1 
ATOM   7095  C  CZ    . ARG B 1 240 ? -30.520 -1.186  81.212  1.00 57.81  ? 240 ARG B CZ    1 
ATOM   7096  N  NH1   . ARG B 1 240 ? -29.443 -0.601  81.714  1.00 59.30  ? 240 ARG B NH1   1 
ATOM   7097  N  NH2   . ARG B 1 240 ? -31.446 -0.449  80.612  1.00 58.29  ? 240 ARG B NH2   1 
ATOM   7098  N  N     . VAL B 1 241 ? -29.843 -7.938  79.066  1.00 45.08  ? 241 VAL B N     1 
ATOM   7099  C  CA    . VAL B 1 241 ? -29.637 -8.586  77.778  1.00 44.53  ? 241 VAL B CA    1 
ATOM   7100  C  C     . VAL B 1 241 ? -29.577 -7.524  76.677  1.00 43.83  ? 241 VAL B C     1 
ATOM   7101  O  O     . VAL B 1 241 ? -30.490 -6.713  76.506  1.00 43.83  ? 241 VAL B O     1 
ATOM   7102  C  CB    . VAL B 1 241 ? -30.769 -9.600  77.458  1.00 44.37  ? 241 VAL B CB    1 
ATOM   7103  C  CG1   . VAL B 1 241 ? -30.534 -10.228 76.095  1.00 42.68  ? 241 VAL B CG1   1 
ATOM   7104  C  CG2   . VAL B 1 241 ? -30.829 -10.678 78.536  1.00 43.74  ? 241 VAL B CG2   1 
ATOM   7105  N  N     . ALA B 1 242 ? -28.481 -7.513  75.937  1.00 42.22  ? 242 ALA B N     1 
ATOM   7106  C  CA    . ALA B 1 242 ? -28.336 -6.554  74.862  1.00 40.86  ? 242 ALA B CA    1 
ATOM   7107  C  C     . ALA B 1 242 ? -28.547 -7.289  73.547  1.00 40.37  ? 242 ALA B C     1 
ATOM   7108  O  O     . ALA B 1 242 ? -27.900 -8.293  73.307  1.00 40.34  ? 242 ALA B O     1 
ATOM   7109  C  CB    . ALA B 1 242 ? -26.954 -5.954  74.910  1.00 39.70  ? 242 ALA B CB    1 
ATOM   7110  N  N     . TRP B 1 243 ? -29.469 -6.829  72.705  1.00 41.31  ? 243 TRP B N     1 
ATOM   7111  C  CA    . TRP B 1 243 ? -29.662 -7.502  71.418  1.00 42.96  ? 243 TRP B CA    1 
ATOM   7112  C  C     . TRP B 1 243 ? -28.754 -6.882  70.372  1.00 44.60  ? 243 TRP B C     1 
ATOM   7113  O  O     . TRP B 1 243 ? -28.887 -5.718  69.988  1.00 44.59  ? 243 TRP B O     1 
ATOM   7114  C  CB    . TRP B 1 243 ? -31.117 -7.467  70.954  1.00 39.98  ? 243 TRP B CB    1 
ATOM   7115  C  CG    . TRP B 1 243 ? -31.909 -8.526  71.607  1.00 39.45  ? 243 TRP B CG    1 
ATOM   7116  C  CD1   . TRP B 1 243 ? -32.674 -8.398  72.724  1.00 41.47  ? 243 TRP B CD1   1 
ATOM   7117  C  CD2   . TRP B 1 243 ? -31.948 -9.915  71.252  1.00 39.42  ? 243 TRP B CD2   1 
ATOM   7118  N  NE1   . TRP B 1 243 ? -33.185 -9.620  73.098  1.00 41.20  ? 243 TRP B NE1   1 
ATOM   7119  C  CE2   . TRP B 1 243 ? -32.753 -10.569 72.214  1.00 38.56  ? 243 TRP B CE2   1 
ATOM   7120  C  CE3   . TRP B 1 243 ? -31.373 -10.671 70.223  1.00 39.33  ? 243 TRP B CE3   1 
ATOM   7121  C  CZ2   . TRP B 1 243 ? -33.007 -11.939 72.176  1.00 37.06  ? 243 TRP B CZ2   1 
ATOM   7122  C  CZ3   . TRP B 1 243 ? -31.628 -12.042 70.183  1.00 39.27  ? 243 TRP B CZ3   1 
ATOM   7123  C  CH2   . TRP B 1 243 ? -32.437 -12.659 71.160  1.00 38.84  ? 243 TRP B CH2   1 
ATOM   7124  N  N     . VAL B 1 244 ? -27.823 -7.693  69.909  1.00 46.29  ? 244 VAL B N     1 
ATOM   7125  C  CA    . VAL B 1 244 ? -26.846 -7.233  68.969  1.00 48.69  ? 244 VAL B CA    1 
ATOM   7126  C  C     . VAL B 1 244 ? -26.932 -7.904  67.607  1.00 50.43  ? 244 VAL B C     1 
ATOM   7127  O  O     . VAL B 1 244 ? -27.421 -9.028  67.475  1.00 49.47  ? 244 VAL B O     1 
ATOM   7128  C  CB    . VAL B 1 244 ? -25.472 -7.441  69.578  1.00 48.51  ? 244 VAL B CB    1 
ATOM   7129  C  CG1   . VAL B 1 244 ? -24.889 -8.766  69.121  1.00 48.28  ? 244 VAL B CG1   1 
ATOM   7130  C  CG2   . VAL B 1 244 ? -24.604 -6.275  69.250  1.00 51.23  ? 244 VAL B CG2   1 
ATOM   7131  N  N     . ALA B 1 245 ? -26.445 -7.202  66.594  1.00 52.82  ? 245 ALA B N     1 
ATOM   7132  C  CA    . ALA B 1 245 ? -26.475 -7.723  65.247  1.00 57.72  ? 245 ALA B CA    1 
ATOM   7133  C  C     . ALA B 1 245 ? -25.082 -7.897  64.684  1.00 62.21  ? 245 ALA B C     1 
ATOM   7134  O  O     . ALA B 1 245 ? -24.144 -7.198  65.073  1.00 62.82  ? 245 ALA B O     1 
ATOM   7135  C  CB    . ALA B 1 245 ? -27.264 -6.800  64.365  1.00 57.54  ? 245 ALA B CB    1 
ATOM   7136  N  N     . ASP B 1 246 ? -24.955 -8.847  63.765  1.00 67.34  ? 246 ASP B N     1 
ATOM   7137  C  CA    . ASP B 1 246 ? -23.685 -9.123  63.102  1.00 71.65  ? 246 ASP B CA    1 
ATOM   7138  C  C     . ASP B 1 246 ? -23.703 -8.347  61.794  1.00 74.03  ? 246 ASP B C     1 
ATOM   7139  O  O     . ASP B 1 246 ? -24.458 -8.684  60.885  1.00 75.05  ? 246 ASP B O     1 
ATOM   7140  C  CB    . ASP B 1 246 ? -23.550 -10.612 62.817  1.00 72.02  ? 246 ASP B CB    1 
ATOM   7141  C  CG    . ASP B 1 246 ? -22.316 -10.928 62.035  1.00 72.33  ? 246 ASP B CG    1 
ATOM   7142  O  OD1   . ASP B 1 246 ? -21.237 -10.434 62.416  1.00 73.94  ? 246 ASP B OD1   1 
ATOM   7143  O  OD2   . ASP B 1 246 ? -22.423 -11.669 61.042  1.00 74.81  ? 246 ASP B OD2   1 
ATOM   7144  N  N     . PRO B 1 247 ? -22.862 -7.307  61.681  1.00 76.10  ? 247 PRO B N     1 
ATOM   7145  C  CA    . PRO B 1 247 ? -22.758 -6.443  60.501  1.00 77.93  ? 247 PRO B CA    1 
ATOM   7146  C  C     . PRO B 1 247 ? -22.969 -7.124  59.147  1.00 80.02  ? 247 PRO B C     1 
ATOM   7147  O  O     . PRO B 1 247 ? -23.568 -6.536  58.241  1.00 78.54  ? 247 PRO B O     1 
ATOM   7148  C  CB    . PRO B 1 247 ? -21.367 -5.833  60.650  1.00 77.71  ? 247 PRO B CB    1 
ATOM   7149  C  CG    . PRO B 1 247 ? -21.226 -5.709  62.124  1.00 76.87  ? 247 PRO B CG    1 
ATOM   7150  C  CD    . PRO B 1 247 ? -21.729 -7.060  62.593  1.00 76.83  ? 247 PRO B CD    1 
ATOM   7151  N  N     . LYS B 1 248 ? -22.480 -8.358  59.019  1.00 82.91  ? 248 LYS B N     1 
ATOM   7152  C  CA    . LYS B 1 248 ? -22.605 -9.128  57.777  1.00 85.55  ? 248 LYS B CA    1 
ATOM   7153  C  C     . LYS B 1 248 ? -24.062 -9.504  57.512  1.00 87.27  ? 248 LYS B C     1 
ATOM   7154  O  O     . LYS B 1 248 ? -24.435 -9.872  56.394  1.00 87.89  ? 248 LYS B O     1 
ATOM   7155  C  CB    . LYS B 1 248 ? -21.747 -10.383 57.855  1.00 85.39  ? 248 LYS B CB    1 
ATOM   7156  N  N     . ASP B 1 249 ? -24.871 -9.415  58.563  1.00 88.63  ? 249 ASP B N     1 
ATOM   7157  C  CA    . ASP B 1 249 ? -26.293 -9.706  58.499  1.00 89.58  ? 249 ASP B CA    1 
ATOM   7158  C  C     . ASP B 1 249 ? -26.936 -8.977  59.671  1.00 89.98  ? 249 ASP B C     1 
ATOM   7159  O  O     . ASP B 1 249 ? -27.129 -9.560  60.739  1.00 89.94  ? 249 ASP B O     1 
ATOM   7160  C  CB    . ASP B 1 249 ? -26.544 -11.203 58.634  1.00 90.52  ? 249 ASP B CB    1 
ATOM   7161  C  CG    . ASP B 1 249 ? -27.997 -11.568 58.404  1.00 91.93  ? 249 ASP B CG    1 
ATOM   7162  O  OD1   . ASP B 1 249 ? -28.887 -10.911 58.990  1.00 91.34  ? 249 ASP B OD1   1 
ATOM   7163  O  OD2   . ASP B 1 249 ? -28.252 -12.519 57.636  1.00 93.43  ? 249 ASP B OD2   1 
ATOM   7164  N  N     . PRO B 1 250 ? -27.262 -7.683  59.489  1.00 90.51  ? 250 PRO B N     1 
ATOM   7165  C  CA    . PRO B 1 250 ? -27.885 -6.828  60.512  1.00 90.40  ? 250 PRO B CA    1 
ATOM   7166  C  C     . PRO B 1 250 ? -29.357 -7.145  60.789  1.00 89.32  ? 250 PRO B C     1 
ATOM   7167  O  O     . PRO B 1 250 ? -29.972 -6.560  61.690  1.00 88.31  ? 250 PRO B O     1 
ATOM   7168  C  CB    . PRO B 1 250 ? -27.706 -5.423  59.937  1.00 90.97  ? 250 PRO B CB    1 
ATOM   7169  C  CG    . PRO B 1 250 ? -27.864 -5.663  58.463  1.00 91.03  ? 250 PRO B CG    1 
ATOM   7170  C  CD    . PRO B 1 250 ? -27.029 -6.920  58.246  1.00 91.00  ? 250 PRO B CD    1 
ATOM   7171  N  N     . ARG B 1 251 ? -29.910 -8.076  60.014  1.00 88.03  ? 251 ARG B N     1 
ATOM   7172  C  CA    . ARG B 1 251 ? -31.307 -8.453  60.158  1.00 85.86  ? 251 ARG B CA    1 
ATOM   7173  C  C     . ARG B 1 251 ? -31.545 -9.756  60.903  1.00 83.90  ? 251 ARG B C     1 
ATOM   7174  O  O     . ARG B 1 251 ? -32.611 -10.366 60.778  1.00 83.34  ? 251 ARG B O     1 
ATOM   7175  C  CB    . ARG B 1 251 ? -31.974 -8.499  58.788  1.00 86.03  ? 251 ARG B CB    1 
ATOM   7176  C  CG    . ARG B 1 251 ? -32.075 -7.135  58.156  1.00 87.12  ? 251 ARG B CG    1 
ATOM   7177  C  CD    . ARG B 1 251 ? -32.975 -7.168  56.948  1.00 89.91  ? 251 ARG B CD    1 
ATOM   7178  N  NE    . ARG B 1 251 ? -33.343 -5.823  56.520  1.00 92.17  ? 251 ARG B NE    1 
ATOM   7179  C  CZ    . ARG B 1 251 ? -34.252 -5.559  55.588  1.00 92.47  ? 251 ARG B CZ    1 
ATOM   7180  N  NH1   . ARG B 1 251 ? -34.889 -6.552  54.981  1.00 92.55  ? 251 ARG B NH1   1 
ATOM   7181  N  NH2   . ARG B 1 251 ? -34.535 -4.302  55.271  1.00 93.43  ? 251 ARG B NH2   1 
ATOM   7182  N  N     . LYS B 1 252 ? -30.546 -10.181 61.670  1.00 80.98  ? 252 LYS B N     1 
ATOM   7183  C  CA    . LYS B 1 252 ? -30.667 -11.385 62.479  1.00 78.26  ? 252 LYS B CA    1 
ATOM   7184  C  C     . LYS B 1 252 ? -30.184 -11.044 63.885  1.00 75.91  ? 252 LYS B C     1 
ATOM   7185  O  O     . LYS B 1 252 ? -28.987 -11.054 64.168  1.00 75.46  ? 252 LYS B O     1 
ATOM   7186  C  CB    . LYS B 1 252 ? -29.837 -12.533 61.915  1.00 78.44  ? 252 LYS B CB    1 
ATOM   7187  C  CG    . LYS B 1 252 ? -30.023 -13.802 62.720  1.00 78.91  ? 252 LYS B CG    1 
ATOM   7188  C  CD    . LYS B 1 252 ? -29.038 -14.887 62.335  1.00 80.69  ? 252 LYS B CD    1 
ATOM   7189  C  CE    . LYS B 1 252 ? -29.133 -16.055 63.317  1.00 81.23  ? 252 LYS B CE    1 
ATOM   7190  N  NZ    . LYS B 1 252 ? -28.253 -17.194 62.944  1.00 81.79  ? 252 LYS B NZ    1 
ATOM   7191  N  N     . PRO B 1 253 ? -31.121 -10.732 64.789  1.00 73.85  ? 253 PRO B N     1 
ATOM   7192  C  CA    . PRO B 1 253 ? -30.753 -10.384 66.161  1.00 71.03  ? 253 PRO B CA    1 
ATOM   7193  C  C     . PRO B 1 253 ? -29.892 -11.461 66.800  1.00 67.91  ? 253 PRO B C     1 
ATOM   7194  O  O     . PRO B 1 253 ? -30.014 -12.641 66.476  1.00 67.99  ? 253 PRO B O     1 
ATOM   7195  C  CB    . PRO B 1 253 ? -32.108 -10.246 66.859  1.00 71.92  ? 253 PRO B CB    1 
ATOM   7196  C  CG    . PRO B 1 253 ? -33.031 -9.858  65.749  1.00 73.16  ? 253 PRO B CG    1 
ATOM   7197  C  CD    . PRO B 1 253 ? -32.585 -10.769 64.635  1.00 73.42  ? 253 PRO B CD    1 
ATOM   7198  N  N     . ILE B 1 254 ? -29.017 -11.045 67.702  1.00 64.07  ? 254 ILE B N     1 
ATOM   7199  C  CA    . ILE B 1 254 ? -28.158 -11.976 68.412  1.00 60.50  ? 254 ILE B CA    1 
ATOM   7200  C  C     . ILE B 1 254 ? -28.109 -11.510 69.847  1.00 56.49  ? 254 ILE B C     1 
ATOM   7201  O  O     . ILE B 1 254 ? -27.862 -10.341 70.109  1.00 57.57  ? 254 ILE B O     1 
ATOM   7202  C  CB    . ILE B 1 254 ? -26.734 -11.979 67.855  1.00 62.21  ? 254 ILE B CB    1 
ATOM   7203  C  CG1   . ILE B 1 254 ? -26.761 -12.331 66.369  1.00 63.96  ? 254 ILE B CG1   1 
ATOM   7204  C  CG2   . ILE B 1 254 ? -25.889 -12.996 68.607  1.00 61.86  ? 254 ILE B CG2   1 
ATOM   7205  C  CD1   . ILE B 1 254 ? -27.321 -13.720 66.088  1.00 67.14  ? 254 ILE B CD1   1 
ATOM   7206  N  N     . PRO B 1 255 ? -28.346 -12.412 70.799  1.00 52.06  ? 255 PRO B N     1 
ATOM   7207  C  CA    . PRO B 1 255 ? -28.310 -11.991 72.193  1.00 49.50  ? 255 PRO B CA    1 
ATOM   7208  C  C     . PRO B 1 255 ? -26.896 -11.751 72.709  1.00 48.35  ? 255 PRO B C     1 
ATOM   7209  O  O     . PRO B 1 255 ? -25.914 -12.193 72.118  1.00 46.78  ? 255 PRO B O     1 
ATOM   7210  C  CB    . PRO B 1 255 ? -29.019 -13.136 72.905  1.00 48.33  ? 255 PRO B CB    1 
ATOM   7211  C  CG    . PRO B 1 255 ? -28.609 -14.302 72.114  1.00 49.54  ? 255 PRO B CG    1 
ATOM   7212  C  CD    . PRO B 1 255 ? -28.734 -13.826 70.689  1.00 51.15  ? 255 PRO B CD    1 
ATOM   7213  N  N     . HIS B 1 256 ? -26.809 -11.031 73.819  1.00 47.88  ? 256 HIS B N     1 
ATOM   7214  C  CA    . HIS B 1 256 ? -25.540 -10.728 74.441  1.00 47.50  ? 256 HIS B CA    1 
ATOM   7215  C  C     . HIS B 1 256 ? -25.808 -10.082 75.797  1.00 48.17  ? 256 HIS B C     1 
ATOM   7216  O  O     . HIS B 1 256 ? -26.968 -9.930  76.193  1.00 47.14  ? 256 HIS B O     1 
ATOM   7217  C  CB    . HIS B 1 256 ? -24.739 -9.795  73.549  1.00 47.71  ? 256 HIS B CB    1 
ATOM   7218  C  CG    . HIS B 1 256 ? -23.259 -9.984  73.661  1.00 49.45  ? 256 HIS B CG    1 
ATOM   7219  N  ND1   . HIS B 1 256 ? -22.445 -10.149 72.563  1.00 49.26  ? 256 HIS B ND1   1 
ATOM   7220  C  CD2   . HIS B 1 256 ? -22.450 -10.043 74.746  1.00 49.06  ? 256 HIS B CD2   1 
ATOM   7221  C  CE1   . HIS B 1 256 ? -21.195 -10.302 72.964  1.00 48.65  ? 256 HIS B CE1   1 
ATOM   7222  N  NE2   . HIS B 1 256 ? -21.172 -10.242 74.283  1.00 49.12  ? 256 HIS B NE2   1 
ATOM   7223  N  N     . LEU B 1 257 ? -24.749 -9.711  76.513  1.00 48.37  ? 257 LEU B N     1 
ATOM   7224  C  CA    . LEU B 1 257 ? -24.909 -9.094  77.827  1.00 49.68  ? 257 LEU B CA    1 
ATOM   7225  C  C     . LEU B 1 257 ? -24.188 -7.749  77.938  1.00 49.65  ? 257 LEU B C     1 
ATOM   7226  O  O     . LEU B 1 257 ? -23.020 -7.624  77.574  1.00 50.63  ? 257 LEU B O     1 
ATOM   7227  C  CB    . LEU B 1 257 ? -24.412 -10.045 78.914  1.00 51.64  ? 257 LEU B CB    1 
ATOM   7228  C  CG    . LEU B 1 257 ? -25.161 -11.373 79.039  1.00 54.09  ? 257 LEU B CG    1 
ATOM   7229  C  CD1   . LEU B 1 257 ? -24.477 -12.258 80.070  1.00 53.94  ? 257 LEU B CD1   1 
ATOM   7230  C  CD2   . LEU B 1 257 ? -26.614 -11.099 79.442  1.00 57.07  ? 257 LEU B CD2   1 
ATOM   7231  N  N     . THR B 1 258 ? -24.886 -6.747  78.464  1.00 47.65  ? 258 THR B N     1 
ATOM   7232  C  CA    . THR B 1 258 ? -24.329 -5.407  78.593  1.00 45.86  ? 258 THR B CA    1 
ATOM   7233  C  C     . THR B 1 258 ? -23.049 -5.285  79.407  1.00 44.80  ? 258 THR B C     1 
ATOM   7234  O  O     . THR B 1 258 ? -22.252 -4.382  79.178  1.00 45.56  ? 258 THR B O     1 
ATOM   7235  C  CB    . THR B 1 258 ? -25.354 -4.437  79.189  1.00 45.85  ? 258 THR B CB    1 
ATOM   7236  O  OG1   . THR B 1 258 ? -25.856 -4.973  80.414  1.00 45.40  ? 258 THR B OG1   1 
ATOM   7237  C  CG2   . THR B 1 258 ? -26.495 -4.217  78.225  1.00 46.53  ? 258 THR B CG2   1 
ATOM   7238  N  N     . GLY B 1 259 ? -22.845 -6.166  80.370  1.00 43.06  ? 259 GLY B N     1 
ATOM   7239  C  CA    . GLY B 1 259 ? -21.626 -6.058  81.145  1.00 41.69  ? 259 GLY B CA    1 
ATOM   7240  C  C     . GLY B 1 259 ? -20.431 -6.520  80.331  1.00 41.09  ? 259 GLY B C     1 
ATOM   7241  O  O     . GLY B 1 259 ? -19.299 -6.094  80.551  1.00 40.29  ? 259 GLY B O     1 
ATOM   7242  N  N     . LEU B 1 260 ? -20.694 -7.378  79.357  1.00 39.54  ? 260 LEU B N     1 
ATOM   7243  C  CA    . LEU B 1 260 ? -19.635 -7.926  78.540  1.00 38.02  ? 260 LEU B CA    1 
ATOM   7244  C  C     . LEU B 1 260 ? -19.447 -7.234  77.202  1.00 38.25  ? 260 LEU B C     1 
ATOM   7245  O  O     . LEU B 1 260 ? -18.923 -7.828  76.257  1.00 38.61  ? 260 LEU B O     1 
ATOM   7246  C  CB    . LEU B 1 260 ? -19.895 -9.412  78.317  1.00 38.14  ? 260 LEU B CB    1 
ATOM   7247  C  CG    . LEU B 1 260 ? -20.008 -10.301 79.562  1.00 37.42  ? 260 LEU B CG    1 
ATOM   7248  C  CD1   . LEU B 1 260 ? -20.230 -11.757 79.137  1.00 35.85  ? 260 LEU B CD1   1 
ATOM   7249  C  CD2   . LEU B 1 260 ? -18.750 -10.178 80.393  1.00 35.78  ? 260 LEU B CD2   1 
ATOM   7250  N  N     . LEU B 1 261 ? -19.867 -5.982  77.107  1.00 37.42  ? 261 LEU B N     1 
ATOM   7251  C  CA    . LEU B 1 261 ? -19.711 -5.249  75.854  1.00 37.34  ? 261 LEU B CA    1 
ATOM   7252  C  C     . LEU B 1 261 ? -19.204 -3.847  76.136  1.00 38.51  ? 261 LEU B C     1 
ATOM   7253  O  O     . LEU B 1 261 ? -19.561 -3.252  77.151  1.00 41.06  ? 261 LEU B O     1 
ATOM   7254  C  CB    . LEU B 1 261 ? -21.045 -5.158  75.103  1.00 34.40  ? 261 LEU B CB    1 
ATOM   7255  C  CG    . LEU B 1 261 ? -21.651 -6.399  74.451  1.00 32.02  ? 261 LEU B CG    1 
ATOM   7256  C  CD1   . LEU B 1 261 ? -23.123 -6.139  74.177  1.00 31.98  ? 261 LEU B CD1   1 
ATOM   7257  C  CD2   . LEU B 1 261 ? -20.897 -6.757  73.190  1.00 28.24  ? 261 LEU B CD2   1 
ATOM   7258  N  N     . VAL B 1 262 ? -18.373 -3.323  75.238  1.00 38.84  ? 262 VAL B N     1 
ATOM   7259  C  CA    . VAL B 1 262 ? -17.837 -1.981  75.390  1.00 38.67  ? 262 VAL B CA    1 
ATOM   7260  C  C     . VAL B 1 262 ? -18.311 -1.074  74.252  1.00 40.58  ? 262 VAL B C     1 
ATOM   7261  O  O     . VAL B 1 262 ? -18.185 -1.411  73.070  1.00 40.46  ? 262 VAL B O     1 
ATOM   7262  C  CB    . VAL B 1 262 ? -16.302 -1.996  75.417  1.00 36.97  ? 262 VAL B CB    1 
ATOM   7263  C  CG1   . VAL B 1 262 ? -15.787 -0.650  75.941  1.00 36.52  ? 262 VAL B CG1   1 
ATOM   7264  C  CG2   . VAL B 1 262 ? -15.810 -3.151  76.278  1.00 34.09  ? 262 VAL B CG2   1 
ATOM   7265  N  N     . PRO B 1 263 ? -18.874 0.094   74.600  1.00 41.72  ? 263 PRO B N     1 
ATOM   7266  C  CA    . PRO B 1 263 ? -19.359 1.028   73.586  1.00 43.60  ? 263 PRO B CA    1 
ATOM   7267  C  C     . PRO B 1 263 ? -18.254 1.471   72.630  1.00 45.62  ? 263 PRO B C     1 
ATOM   7268  O  O     . PRO B 1 263 ? -17.113 1.669   73.047  1.00 46.16  ? 263 PRO B O     1 
ATOM   7269  C  CB    . PRO B 1 263 ? -19.878 2.197   74.422  1.00 41.09  ? 263 PRO B CB    1 
ATOM   7270  C  CG    . PRO B 1 263 ? -20.279 1.556   75.681  1.00 39.59  ? 263 PRO B CG    1 
ATOM   7271  C  CD    . PRO B 1 263 ? -19.154 0.612   75.947  1.00 40.02  ? 263 PRO B CD    1 
ATOM   7272  N  N     . VAL B 1 264 ? -18.585 1.600   71.350  1.00 47.89  ? 264 VAL B N     1 
ATOM   7273  C  CA    . VAL B 1 264 ? -17.621 2.087   70.380  1.00 51.21  ? 264 VAL B CA    1 
ATOM   7274  C  C     . VAL B 1 264 ? -18.078 3.522   70.160  1.00 53.49  ? 264 VAL B C     1 
ATOM   7275  O  O     . VAL B 1 264 ? -18.897 3.797   69.284  1.00 53.35  ? 264 VAL B O     1 
ATOM   7276  C  CB    . VAL B 1 264 ? -17.677 1.311   69.056  1.00 51.20  ? 264 VAL B CB    1 
ATOM   7277  C  CG1   . VAL B 1 264 ? -16.609 1.844   68.110  1.00 53.63  ? 264 VAL B CG1   1 
ATOM   7278  C  CG2   . VAL B 1 264 ? -17.442 -0.161  69.306  1.00 51.71  ? 264 VAL B CG2   1 
ATOM   7279  N  N     . LEU B 1 265 ? -17.552 4.423   70.985  1.00 56.05  ? 265 LEU B N     1 
ATOM   7280  C  CA    . LEU B 1 265 ? -17.913 5.835   70.951  1.00 59.09  ? 265 LEU B CA    1 
ATOM   7281  C  C     . LEU B 1 265 ? -17.496 6.611   69.704  1.00 61.74  ? 265 LEU B C     1 
ATOM   7282  O  O     . LEU B 1 265 ? -16.375 6.473   69.209  1.00 61.83  ? 265 LEU B O     1 
ATOM   7283  C  CB    . LEU B 1 265 ? -17.354 6.522   72.196  1.00 58.83  ? 265 LEU B CB    1 
ATOM   7284  C  CG    . LEU B 1 265 ? -17.777 5.870   73.518  1.00 58.47  ? 265 LEU B CG    1 
ATOM   7285  C  CD1   . LEU B 1 265 ? -17.106 6.566   74.706  1.00 57.55  ? 265 LEU B CD1   1 
ATOM   7286  C  CD2   . LEU B 1 265 ? -19.290 5.931   73.634  1.00 57.65  ? 265 LEU B CD2   1 
ATOM   7287  N  N     . THR B 1 266 ? -18.414 7.445   69.218  1.00 64.48  ? 266 THR B N     1 
ATOM   7288  C  CA    . THR B 1 266 ? -18.172 8.251   68.030  1.00 66.77  ? 266 THR B CA    1 
ATOM   7289  C  C     . THR B 1 266 ? -18.511 9.714   68.271  1.00 67.41  ? 266 THR B C     1 
ATOM   7290  O  O     . THR B 1 266 ? -18.990 10.081  69.343  1.00 66.60  ? 266 THR B O     1 
ATOM   7291  C  CB    . THR B 1 266 ? -19.008 7.756   66.850  1.00 68.11  ? 266 THR B CB    1 
ATOM   7292  O  OG1   . THR B 1 266 ? -19.131 6.332   66.930  1.00 70.18  ? 266 THR B OG1   1 
ATOM   7293  C  CG2   . THR B 1 266 ? -18.326 8.123   65.517  1.00 70.10  ? 266 THR B CG2   1 
ATOM   7294  N  N     . LEU B 1 267 ? -18.257 10.535  67.254  1.00 69.17  ? 267 LEU B N     1 
ATOM   7295  C  CA    . LEU B 1 267 ? -18.501 11.974  67.298  1.00 70.32  ? 267 LEU B CA    1 
ATOM   7296  C  C     . LEU B 1 267 ? -19.790 12.350  68.019  1.00 71.98  ? 267 LEU B C     1 
ATOM   7297  O  O     . LEU B 1 267 ? -19.755 12.977  69.085  1.00 72.58  ? 267 LEU B O     1 
ATOM   7298  C  CB    . LEU B 1 267 ? -18.519 12.533  65.883  1.00 69.31  ? 267 LEU B CB    1 
ATOM   7299  N  N     . GLU B 1 268 ? -20.924 11.965  67.436  1.00 72.80  ? 268 GLU B N     1 
ATOM   7300  C  CA    . GLU B 1 268 ? -22.229 12.274  68.008  1.00 73.68  ? 268 GLU B CA    1 
ATOM   7301  C  C     . GLU B 1 268 ? -22.357 11.864  69.482  1.00 74.90  ? 268 GLU B C     1 
ATOM   7302  O  O     . GLU B 1 268 ? -22.985 12.568  70.274  1.00 75.80  ? 268 GLU B O     1 
ATOM   7303  C  CB    . GLU B 1 268 ? -23.329 11.611  67.174  1.00 71.84  ? 268 GLU B CB    1 
ATOM   7304  N  N     . ASP B 1 269 ? -21.745 10.744  69.851  1.00 75.73  ? 269 ASP B N     1 
ATOM   7305  C  CA    . ASP B 1 269 ? -21.821 10.235  71.219  1.00 76.65  ? 269 ASP B CA    1 
ATOM   7306  C  C     . ASP B 1 269 ? -21.281 11.110  72.346  1.00 76.95  ? 269 ASP B C     1 
ATOM   7307  O  O     . ASP B 1 269 ? -21.466 10.776  73.514  1.00 75.72  ? 269 ASP B O     1 
ATOM   7308  C  CB    . ASP B 1 269 ? -21.148 8.864   71.293  1.00 78.79  ? 269 ASP B CB    1 
ATOM   7309  C  CG    . ASP B 1 269 ? -22.147 7.723   71.253  1.00 80.80  ? 269 ASP B CG    1 
ATOM   7310  O  OD1   . ASP B 1 269 ? -22.874 7.547   72.258  1.00 82.43  ? 269 ASP B OD1   1 
ATOM   7311  O  OD2   . ASP B 1 269 ? -22.209 7.009   70.223  1.00 80.79  ? 269 ASP B OD2   1 
ATOM   7312  N  N     . LEU B 1 270 ? -20.611 12.212  72.013  1.00 78.46  ? 270 LEU B N     1 
ATOM   7313  C  CA    . LEU B 1 270 ? -20.061 13.103  73.043  1.00 79.94  ? 270 LEU B CA    1 
ATOM   7314  C  C     . LEU B 1 270 ? -20.599 14.538  72.989  1.00 80.06  ? 270 LEU B C     1 
ATOM   7315  O  O     . LEU B 1 270 ? -20.607 15.253  74.004  1.00 79.68  ? 270 LEU B O     1 
ATOM   7316  C  CB    . LEU B 1 270 ? -18.527 13.126  72.973  1.00 80.07  ? 270 LEU B CB    1 
ATOM   7317  C  CG    . LEU B 1 270 ? -17.815 12.012  73.749  1.00 81.18  ? 270 LEU B CG    1 
ATOM   7318  C  CD1   . LEU B 1 270 ? -18.152 10.668  73.120  1.00 81.77  ? 270 LEU B CD1   1 
ATOM   7319  C  CD2   . LEU B 1 270 ? -16.305 12.246  73.752  1.00 81.69  ? 270 LEU B CD2   1 
ATOM   7320  N  N     . HIS B 1 271 ? -21.049 14.947  71.805  1.00 79.46  ? 271 HIS B N     1 
ATOM   7321  C  CA    . HIS B 1 271 ? -21.596 16.283  71.597  1.00 78.41  ? 271 HIS B CA    1 
ATOM   7322  C  C     . HIS B 1 271 ? -22.564 16.658  72.707  1.00 77.60  ? 271 HIS B C     1 
ATOM   7323  O  O     . HIS B 1 271 ? -22.736 17.834  73.010  1.00 76.75  ? 271 HIS B O     1 
ATOM   7324  C  CB    . HIS B 1 271 ? -22.303 16.351  70.252  1.00 78.30  ? 271 HIS B CB    1 
ATOM   7325  N  N     . LEU B 1 277 ? -13.003 18.893  71.617  1.00 70.78  ? 277 LEU B N     1 
ATOM   7326  C  CA    . LEU B 1 277 ? -13.898 19.804  70.912  1.00 70.83  ? 277 LEU B CA    1 
ATOM   7327  C  C     . LEU B 1 277 ? -13.789 19.632  69.394  1.00 71.23  ? 277 LEU B C     1 
ATOM   7328  O  O     . LEU B 1 277 ? -14.621 20.151  68.642  1.00 71.08  ? 277 LEU B O     1 
ATOM   7329  C  CB    . LEU B 1 277 ? -13.586 21.239  71.298  1.00 70.05  ? 277 LEU B CB    1 
ATOM   7330  N  N     . ALA B 1 278 ? -12.767 18.898  68.949  1.00 71.03  ? 278 ALA B N     1 
ATOM   7331  C  CA    . ALA B 1 278 ? -12.562 18.665  67.519  1.00 70.80  ? 278 ALA B CA    1 
ATOM   7332  C  C     . ALA B 1 278 ? -11.527 17.575  67.222  1.00 70.35  ? 278 ALA B C     1 
ATOM   7333  O  O     . ALA B 1 278 ? -10.553 17.409  67.955  1.00 71.92  ? 278 ALA B O     1 
ATOM   7334  C  CB    . ALA B 1 278 ? -12.149 19.971  66.832  1.00 70.83  ? 278 ALA B CB    1 
ATOM   7335  N  N     . LEU B 1 279 ? -11.746 16.845  66.134  1.00 68.28  ? 279 LEU B N     1 
ATOM   7336  C  CA    . LEU B 1 279 ? -10.846 15.775  65.710  1.00 66.33  ? 279 LEU B CA    1 
ATOM   7337  C  C     . LEU B 1 279 ? -10.238 16.139  64.347  1.00 65.80  ? 279 LEU B C     1 
ATOM   7338  O  O     . LEU B 1 279 ? -9.618  15.318  63.664  1.00 65.18  ? 279 LEU B O     1 
ATOM   7339  C  CB    . LEU B 1 279 ? -11.634 14.471  65.605  1.00 65.92  ? 279 LEU B CB    1 
ATOM   7340  C  CG    . LEU B 1 279 ? -12.280 13.989  66.905  1.00 64.55  ? 279 LEU B CG    1 
ATOM   7341  C  CD1   . LEU B 1 279 ? -13.159 12.768  66.644  1.00 63.09  ? 279 LEU B CD1   1 
ATOM   7342  C  CD2   . LEU B 1 279 ? -11.183 13.668  67.904  1.00 65.07  ? 279 LEU B CD2   1 
ATOM   7343  N  N     . SER B 1 280 ? -10.424 17.400  63.977  1.00 64.66  ? 280 SER B N     1 
ATOM   7344  C  CA    . SER B 1 280 ? -9.956  17.946  62.715  1.00 62.54  ? 280 SER B CA    1 
ATOM   7345  C  C     . SER B 1 280 ? -8.640  18.706  62.897  1.00 61.51  ? 280 SER B C     1 
ATOM   7346  O  O     . SER B 1 280 ? -8.372  19.263  63.968  1.00 63.39  ? 280 SER B O     1 
ATOM   7347  C  CB    . SER B 1 280 ? -11.049 18.864  62.160  1.00 61.68  ? 280 SER B CB    1 
ATOM   7348  O  OG    . SER B 1 280 ? -10.565 19.707  61.142  1.00 64.21  ? 280 SER B OG    1 
ATOM   7349  N  N     . LEU B 1 281 ? -7.819  18.724  61.850  1.00 58.06  ? 281 LEU B N     1 
ATOM   7350  C  CA    . LEU B 1 281 ? -6.536  19.410  61.895  1.00 54.65  ? 281 LEU B CA    1 
ATOM   7351  C  C     . LEU B 1 281 ? -6.317  20.174  60.611  1.00 54.38  ? 281 LEU B C     1 
ATOM   7352  O  O     . LEU B 1 281 ? -6.472  19.623  59.531  1.00 54.15  ? 281 LEU B O     1 
ATOM   7353  C  CB    . LEU B 1 281 ? -5.393  18.408  62.030  1.00 52.23  ? 281 LEU B CB    1 
ATOM   7354  C  CG    . LEU B 1 281 ? -5.415  17.332  63.107  1.00 49.82  ? 281 LEU B CG    1 
ATOM   7355  C  CD1   . LEU B 1 281 ? -4.265  16.385  62.858  1.00 47.22  ? 281 LEU B CD1   1 
ATOM   7356  C  CD2   . LEU B 1 281 ? -5.316  17.951  64.487  1.00 51.07  ? 281 LEU B CD2   1 
ATOM   7357  N  N     . PRO B 1 282 ? -5.940  21.454  60.705  1.00 55.19  ? 282 PRO B N     1 
ATOM   7358  C  CA    . PRO B 1 282 ? -5.707  22.232  59.485  1.00 54.83  ? 282 PRO B CA    1 
ATOM   7359  C  C     . PRO B 1 282 ? -4.608  21.590  58.665  1.00 54.26  ? 282 PRO B C     1 
ATOM   7360  O  O     . PRO B 1 282 ? -3.630  21.086  59.207  1.00 53.47  ? 282 PRO B O     1 
ATOM   7361  C  CB    . PRO B 1 282 ? -5.312  23.604  60.017  1.00 55.84  ? 282 PRO B CB    1 
ATOM   7362  C  CG    . PRO B 1 282 ? -4.677  23.281  61.339  1.00 56.33  ? 282 PRO B CG    1 
ATOM   7363  C  CD    . PRO B 1 282 ? -5.635  22.254  61.901  1.00 55.66  ? 282 PRO B CD    1 
ATOM   7364  N  N     . TRP B 1 283 ? -4.781  21.617  57.353  1.00 55.22  ? 283 TRP B N     1 
ATOM   7365  C  CA    . TRP B 1 283 ? -3.830  21.011  56.438  1.00 56.21  ? 283 TRP B CA    1 
ATOM   7366  C  C     . TRP B 1 283 ? -2.376  21.129  56.870  1.00 54.80  ? 283 TRP B C     1 
ATOM   7367  O  O     . TRP B 1 283 ? -1.704  20.129  57.108  1.00 53.94  ? 283 TRP B O     1 
ATOM   7368  C  CB    . TRP B 1 283 ? -4.071  21.576  55.022  1.00 60.02  ? 283 TRP B CB    1 
ATOM   7369  C  CG    . TRP B 1 283 ? -3.008  22.454  54.367  1.00 64.37  ? 283 TRP B CG    1 
ATOM   7370  C  CD1   . TRP B 1 283 ? -1.728  22.091  54.012  1.00 65.15  ? 283 TRP B CD1   1 
ATOM   7371  C  CD2   . TRP B 1 283 ? -3.213  23.760  53.810  1.00 65.98  ? 283 TRP B CD2   1 
ATOM   7372  N  NE1   . TRP B 1 283 ? -1.140  23.081  53.258  1.00 64.72  ? 283 TRP B NE1   1 
ATOM   7373  C  CE2   . TRP B 1 283 ? -2.028  24.115  53.115  1.00 66.93  ? 283 TRP B CE2   1 
ATOM   7374  C  CE3   . TRP B 1 283 ? -4.288  24.661  53.820  1.00 67.78  ? 283 TRP B CE3   1 
ATOM   7375  C  CZ2   . TRP B 1 283 ? -1.891  25.342  52.431  1.00 68.57  ? 283 TRP B CZ2   1 
ATOM   7376  C  CZ3   . TRP B 1 283 ? -4.152  25.887  53.137  1.00 69.84  ? 283 TRP B CZ3   1 
ATOM   7377  C  CH2   . TRP B 1 283 ? -2.961  26.210  52.451  1.00 68.90  ? 283 TRP B CH2   1 
ATOM   7378  N  N     . GLU B 1 284 ? -1.895  22.347  57.011  1.00 53.80  ? 284 GLU B N     1 
ATOM   7379  C  CA    . GLU B 1 284 ? -0.517  22.526  57.381  1.00 53.95  ? 284 GLU B CA    1 
ATOM   7380  C  C     . GLU B 1 284 ? -0.080  21.738  58.630  1.00 52.12  ? 284 GLU B C     1 
ATOM   7381  O  O     . GLU B 1 284 ? 1.040   21.242  58.683  1.00 52.81  ? 284 GLU B O     1 
ATOM   7382  C  CB    . GLU B 1 284 ? -0.240  24.020  57.532  1.00 57.45  ? 284 GLU B CB    1 
ATOM   7383  C  CG    . GLU B 1 284 ? 1.218   24.354  57.790  1.00 64.07  ? 284 GLU B CG    1 
ATOM   7384  C  CD    . GLU B 1 284 ? 1.480   25.850  57.820  1.00 67.26  ? 284 GLU B CD    1 
ATOM   7385  O  OE1   . GLU B 1 284 ? 2.265   26.310  58.692  1.00 67.08  ? 284 GLU B OE1   1 
ATOM   7386  O  OE2   . GLU B 1 284 ? 0.900   26.554  56.958  1.00 69.51  ? 284 GLU B OE2   1 
ATOM   7387  N  N     . GLU B 1 285 ? -0.944  21.597  59.627  1.00 50.26  ? 285 GLU B N     1 
ATOM   7388  C  CA    . GLU B 1 285 ? -0.557  20.862  60.833  1.00 49.27  ? 285 GLU B CA    1 
ATOM   7389  C  C     . GLU B 1 285 ? -0.565  19.357  60.581  1.00 48.00  ? 285 GLU B C     1 
ATOM   7390  O  O     . GLU B 1 285 ? 0.334   18.637  61.029  1.00 46.44  ? 285 GLU B O     1 
ATOM   7391  C  CB    . GLU B 1 285 ? -1.502  21.202  61.995  1.00 51.76  ? 285 GLU B CB    1 
ATOM   7392  C  CG    . GLU B 1 285 ? -1.228  20.461  63.319  1.00 53.70  ? 285 GLU B CG    1 
ATOM   7393  C  CD    . GLU B 1 285 ? 0.021   20.943  64.067  1.00 55.78  ? 285 GLU B CD    1 
ATOM   7394  O  OE1   . GLU B 1 285 ? 0.399   20.280  65.056  1.00 57.12  ? 285 GLU B OE1   1 
ATOM   7395  O  OE2   . GLU B 1 285 ? 0.622   21.975  63.689  1.00 55.42  ? 285 GLU B OE2   1 
ATOM   7396  N  N     . ARG B 1 286 ? -1.586  18.892  59.858  1.00 46.36  ? 286 ARG B N     1 
ATOM   7397  C  CA    . ARG B 1 286 ? -1.731  17.472  59.528  1.00 44.00  ? 286 ARG B CA    1 
ATOM   7398  C  C     . ARG B 1 286 ? -0.527  17.017  58.712  1.00 44.13  ? 286 ARG B C     1 
ATOM   7399  O  O     . ARG B 1 286 ? -0.147  15.836  58.714  1.00 42.66  ? 286 ARG B O     1 
ATOM   7400  C  CB    . ARG B 1 286 ? -3.003  17.237  58.715  1.00 40.61  ? 286 ARG B CB    1 
ATOM   7401  C  CG    . ARG B 1 286 ? -3.493  15.828  58.854  1.00 38.93  ? 286 ARG B CG    1 
ATOM   7402  C  CD    . ARG B 1 286 ? -4.624  15.501  57.934  1.00 37.66  ? 286 ARG B CD    1 
ATOM   7403  N  NE    . ARG B 1 286 ? -5.196  14.217  58.310  1.00 37.17  ? 286 ARG B NE    1 
ATOM   7404  C  CZ    . ARG B 1 286 ? -5.922  14.027  59.403  1.00 36.25  ? 286 ARG B CZ    1 
ATOM   7405  N  NH1   . ARG B 1 286 ? -6.166  15.040  60.212  1.00 33.94  ? 286 ARG B NH1   1 
ATOM   7406  N  NH2   . ARG B 1 286 ? -6.387  12.822  59.698  1.00 37.83  ? 286 ARG B NH2   1 
ATOM   7407  N  N     . ARG B 1 287 ? 0.045   17.987  58.004  1.00 44.01  ? 287 ARG B N     1 
ATOM   7408  C  CA    . ARG B 1 287 ? 1.212   17.790  57.173  1.00 43.35  ? 287 ARG B CA    1 
ATOM   7409  C  C     . ARG B 1 287 ? 2.437   17.706  58.095  1.00 41.16  ? 287 ARG B C     1 
ATOM   7410  O  O     . ARG B 1 287 ? 3.358   16.951  57.818  1.00 40.34  ? 287 ARG B O     1 
ATOM   7411  C  CB    . ARG B 1 287 ? 1.316   18.956  56.176  1.00 46.55  ? 287 ARG B CB    1 
ATOM   7412  C  CG    . ARG B 1 287 ? 2.431   18.884  55.124  1.00 51.00  ? 287 ARG B CG    1 
ATOM   7413  C  CD    . ARG B 1 287 ? 3.781   19.413  55.645  1.00 56.89  ? 287 ARG B CD    1 
ATOM   7414  N  NE    . ARG B 1 287 ? 3.738   20.785  56.178  1.00 60.80  ? 287 ARG B NE    1 
ATOM   7415  C  CZ    . ARG B 1 287 ? 3.498   21.880  55.454  1.00 61.81  ? 287 ARG B CZ    1 
ATOM   7416  N  NH1   . ARG B 1 287 ? 3.270   21.781  54.144  1.00 61.58  ? 287 ARG B NH1   1 
ATOM   7417  N  NH2   . ARG B 1 287 ? 3.500   23.077  56.038  1.00 59.60  ? 287 ARG B NH2   1 
ATOM   7418  N  N     . ARG B 1 288 ? 2.471   18.448  59.198  1.00 38.95  ? 288 ARG B N     1 
ATOM   7419  C  CA    . ARG B 1 288 ? 3.650   18.307  60.031  1.00 39.70  ? 288 ARG B CA    1 
ATOM   7420  C  C     . ARG B 1 288 ? 3.552   17.043  60.861  1.00 39.55  ? 288 ARG B C     1 
ATOM   7421  O  O     . ARG B 1 288 ? 4.490   16.251  60.903  1.00 40.64  ? 288 ARG B O     1 
ATOM   7422  C  CB    . ARG B 1 288 ? 3.910   19.536  60.917  1.00 39.56  ? 288 ARG B CB    1 
ATOM   7423  C  CG    . ARG B 1 288 ? 2.899   19.846  61.989  1.00 42.36  ? 288 ARG B CG    1 
ATOM   7424  C  CD    . ARG B 1 288 ? 3.475   20.881  62.981  1.00 42.25  ? 288 ARG B CD    1 
ATOM   7425  N  NE    . ARG B 1 288 ? 4.405   20.262  63.921  1.00 42.78  ? 288 ARG B NE    1 
ATOM   7426  C  CZ    . ARG B 1 288 ? 4.043   19.427  64.897  1.00 43.29  ? 288 ARG B CZ    1 
ATOM   7427  N  NH1   . ARG B 1 288 ? 2.763   19.112  65.074  1.00 42.08  ? 288 ARG B NH1   1 
ATOM   7428  N  NH2   . ARG B 1 288 ? 4.962   18.880  65.686  1.00 41.61  ? 288 ARG B NH2   1 
ATOM   7429  N  N     . ARG B 1 289 ? 2.407   16.826  61.491  1.00 39.81  ? 289 ARG B N     1 
ATOM   7430  C  CA    . ARG B 1 289 ? 2.216   15.628  62.306  1.00 39.24  ? 289 ARG B CA    1 
ATOM   7431  C  C     . ARG B 1 289 ? 2.415   14.364  61.496  1.00 37.52  ? 289 ARG B C     1 
ATOM   7432  O  O     . ARG B 1 289 ? 2.910   13.365  61.996  1.00 36.26  ? 289 ARG B O     1 
ATOM   7433  C  CB    . ARG B 1 289 ? 0.815   15.625  62.910  1.00 41.36  ? 289 ARG B CB    1 
ATOM   7434  C  CG    . ARG B 1 289 ? 0.609   16.755  63.887  1.00 45.80  ? 289 ARG B CG    1 
ATOM   7435  C  CD    . ARG B 1 289 ? -0.828  16.904  64.325  1.00 48.60  ? 289 ARG B CD    1 
ATOM   7436  N  NE    . ARG B 1 289 ? -1.302  15.792  65.148  1.00 51.35  ? 289 ARG B NE    1 
ATOM   7437  C  CZ    . ARG B 1 289 ? -2.026  15.954  66.251  1.00 51.68  ? 289 ARG B CZ    1 
ATOM   7438  N  NH1   . ARG B 1 289 ? -2.337  17.188  66.647  1.00 52.66  ? 289 ARG B NH1   1 
ATOM   7439  N  NH2   . ARG B 1 289 ? -2.446  14.896  66.942  1.00 49.67  ? 289 ARG B NH2   1 
ATOM   7440  N  N     . THR B 1 290 ? 2.031   14.411  60.232  1.00 37.11  ? 290 THR B N     1 
ATOM   7441  C  CA    . THR B 1 290 ? 2.169   13.245  59.400  1.00 37.03  ? 290 THR B CA    1 
ATOM   7442  C  C     . THR B 1 290 ? 3.639   12.896  59.264  1.00 36.29  ? 290 THR B C     1 
ATOM   7443  O  O     . THR B 1 290 ? 3.985   11.737  59.079  1.00 37.10  ? 290 THR B O     1 
ATOM   7444  C  CB    . THR B 1 290 ? 1.548   13.481  58.016  1.00 37.54  ? 290 THR B CB    1 
ATOM   7445  O  OG1   . THR B 1 290 ? 1.678   12.303  57.211  1.00 38.87  ? 290 THR B OG1   1 
ATOM   7446  C  CG2   . THR B 1 290 ? 2.243   14.599  57.332  1.00 40.24  ? 290 THR B CG2   1 
ATOM   7447  N  N     . ARG B 1 291 ? 4.509   13.887  59.404  1.00 36.57  ? 291 ARG B N     1 
ATOM   7448  C  CA    . ARG B 1 291 ? 5.953   13.660  59.264  1.00 35.89  ? 291 ARG B CA    1 
ATOM   7449  C  C     . ARG B 1 291 ? 6.675   13.358  60.538  1.00 35.36  ? 291 ARG B C     1 
ATOM   7450  O  O     . ARG B 1 291 ? 7.639   12.588  60.561  1.00 34.05  ? 291 ARG B O     1 
ATOM   7451  C  CB    . ARG B 1 291 ? 6.604   14.870  58.677  1.00 35.31  ? 291 ARG B CB    1 
ATOM   7452  C  CG    . ARG B 1 291 ? 5.888   15.356  57.499  1.00 37.34  ? 291 ARG B CG    1 
ATOM   7453  C  CD    . ARG B 1 291 ? 6.897   15.677  56.481  1.00 40.92  ? 291 ARG B CD    1 
ATOM   7454  N  NE    . ARG B 1 291 ? 6.690   17.000  55.938  1.00 44.03  ? 291 ARG B NE    1 
ATOM   7455  C  CZ    . ARG B 1 291 ? 7.654   17.730  55.400  1.00 45.47  ? 291 ARG B CZ    1 
ATOM   7456  N  NH1   . ARG B 1 291 ? 8.899   17.257  55.343  1.00 44.16  ? 291 ARG B NH1   1 
ATOM   7457  N  NH2   . ARG B 1 291 ? 7.364   18.931  54.912  1.00 46.72  ? 291 ARG B NH2   1 
ATOM   7458  N  N     . GLU B 1 292 ? 6.247   14.006  61.606  1.00 35.98  ? 292 GLU B N     1 
ATOM   7459  C  CA    . GLU B 1 292 ? 6.901   13.730  62.848  1.00 37.66  ? 292 GLU B CA    1 
ATOM   7460  C  C     . GLU B 1 292 ? 6.633   12.233  63.064  1.00 36.19  ? 292 GLU B C     1 
ATOM   7461  O  O     . GLU B 1 292 ? 7.408   11.556  63.734  1.00 36.85  ? 292 GLU B O     1 
ATOM   7462  C  CB    . GLU B 1 292 ? 6.374   14.646  63.968  1.00 38.47  ? 292 GLU B CB    1 
ATOM   7463  C  CG    . GLU B 1 292 ? 4.945   14.447  64.362  1.00 47.56  ? 292 GLU B CG    1 
ATOM   7464  C  CD    . GLU B 1 292 ? 4.800   14.231  65.862  1.00 51.10  ? 292 GLU B CD    1 
ATOM   7465  O  OE1   . GLU B 1 292 ? 5.254   15.106  66.639  1.00 53.65  ? 292 GLU B OE1   1 
ATOM   7466  O  OE2   . GLU B 1 292 ? 4.234   13.185  66.261  1.00 51.51  ? 292 GLU B OE2   1 
ATOM   7467  N  N     . ILE B 1 293 ? 5.577   11.705  62.435  1.00 34.03  ? 293 ILE B N     1 
ATOM   7468  C  CA    . ILE B 1 293 ? 5.261   10.275  62.544  1.00 32.41  ? 293 ILE B CA    1 
ATOM   7469  C  C     . ILE B 1 293 ? 6.101   9.447   61.539  1.00 31.99  ? 293 ILE B C     1 
ATOM   7470  O  O     . ILE B 1 293 ? 6.655   8.400   61.887  1.00 30.34  ? 293 ILE B O     1 
ATOM   7471  C  CB    . ILE B 1 293 ? 3.747   9.967   62.275  1.00 31.63  ? 293 ILE B CB    1 
ATOM   7472  C  CG1   . ILE B 1 293 ? 2.839   10.869  63.108  1.00 31.76  ? 293 ILE B CG1   1 
ATOM   7473  C  CG2   . ILE B 1 293 ? 3.448   8.509   62.600  1.00 29.24  ? 293 ILE B CG2   1 
ATOM   7474  C  CD1   . ILE B 1 293 ? 3.057   10.821  64.593  1.00 33.30  ? 293 ILE B CD1   1 
ATOM   7475  N  N     . ALA B 1 294 ? 6.188   9.907   60.293  1.00 31.10  ? 294 ALA B N     1 
ATOM   7476  C  CA    . ALA B 1 294 ? 6.959   9.185   59.293  1.00 31.00  ? 294 ALA B CA    1 
ATOM   7477  C  C     . ALA B 1 294 ? 8.351   8.940   59.829  1.00 31.49  ? 294 ALA B C     1 
ATOM   7478  O  O     . ALA B 1 294 ? 8.806   7.806   59.849  1.00 31.83  ? 294 ALA B O     1 
ATOM   7479  C  CB    . ALA B 1 294 ? 7.036   9.971   58.003  1.00 32.05  ? 294 ALA B CB    1 
ATOM   7480  N  N     . SER B 1 295 ? 9.026   10.003  60.265  1.00 32.04  ? 295 SER B N     1 
ATOM   7481  C  CA    . SER B 1 295 ? 10.376  9.875   60.814  1.00 32.98  ? 295 SER B CA    1 
ATOM   7482  C  C     . SER B 1 295 ? 10.373  8.920   61.996  1.00 32.31  ? 295 SER B C     1 
ATOM   7483  O  O     . SER B 1 295 ? 11.179  8.008   62.069  1.00 33.23  ? 295 SER B O     1 
ATOM   7484  C  CB    . SER B 1 295 ? 10.904  11.228  61.288  1.00 34.76  ? 295 SER B CB    1 
ATOM   7485  O  OG    . SER B 1 295 ? 10.982  12.163  60.230  1.00 38.19  ? 295 SER B OG    1 
ATOM   7486  N  N     . TRP B 1 296 ? 9.453   9.128   62.923  1.00 31.28  ? 296 TRP B N     1 
ATOM   7487  C  CA    . TRP B 1 296 ? 9.379   8.277   64.086  1.00 31.03  ? 296 TRP B CA    1 
ATOM   7488  C  C     . TRP B 1 296 ? 9.253   6.817   63.707  1.00 31.02  ? 296 TRP B C     1 
ATOM   7489  O  O     . TRP B 1 296 ? 10.167  6.034   63.920  1.00 30.92  ? 296 TRP B O     1 
ATOM   7490  C  CB    . TRP B 1 296 ? 8.193   8.674   64.969  1.00 32.76  ? 296 TRP B CB    1 
ATOM   7491  C  CG    . TRP B 1 296 ? 8.088   7.831   66.197  1.00 33.39  ? 296 TRP B CG    1 
ATOM   7492  C  CD1   . TRP B 1 296 ? 8.910   7.861   67.276  1.00 32.75  ? 296 TRP B CD1   1 
ATOM   7493  C  CD2   . TRP B 1 296 ? 7.193   6.733   66.403  1.00 34.96  ? 296 TRP B CD2   1 
ATOM   7494  N  NE1   . TRP B 1 296 ? 8.596   6.844   68.140  1.00 34.35  ? 296 TRP B NE1   1 
ATOM   7495  C  CE2   . TRP B 1 296 ? 7.545   6.137   67.630  1.00 34.07  ? 296 TRP B CE2   1 
ATOM   7496  C  CE3   . TRP B 1 296 ? 6.125   6.196   65.665  1.00 35.89  ? 296 TRP B CE3   1 
ATOM   7497  C  CZ2   . TRP B 1 296 ? 6.878   5.021   68.136  1.00 35.34  ? 296 TRP B CZ2   1 
ATOM   7498  C  CZ3   . TRP B 1 296 ? 5.457   5.085   66.167  1.00 36.09  ? 296 TRP B CZ3   1 
ATOM   7499  C  CH2   . TRP B 1 296 ? 5.837   4.511   67.395  1.00 37.02  ? 296 TRP B CH2   1 
ATOM   7500  N  N     . ILE B 1 297 ? 8.112   6.457   63.138  1.00 31.85  ? 297 ILE B N     1 
ATOM   7501  C  CA    . ILE B 1 297 ? 7.848   5.075   62.758  1.00 32.47  ? 297 ILE B CA    1 
ATOM   7502  C  C     . ILE B 1 297 ? 8.982   4.498   61.895  1.00 31.08  ? 297 ILE B C     1 
ATOM   7503  O  O     . ILE B 1 297 ? 9.298   3.309   61.970  1.00 31.46  ? 297 ILE B O     1 
ATOM   7504  C  CB    . ILE B 1 297 ? 6.465   4.971   62.025  1.00 32.64  ? 297 ILE B CB    1 
ATOM   7505  C  CG1   . ILE B 1 297 ? 5.969   3.529   62.010  1.00 34.31  ? 297 ILE B CG1   1 
ATOM   7506  C  CG2   . ILE B 1 297 ? 6.589   5.443   60.614  1.00 33.49  ? 297 ILE B CG2   1 
ATOM   7507  C  CD1   . ILE B 1 297 ? 5.643   2.979   63.389  1.00 36.48  ? 297 ILE B CD1   1 
ATOM   7508  N  N     . GLY B 1 298 ? 9.611   5.346   61.096  1.00 29.28  ? 298 GLY B N     1 
ATOM   7509  C  CA    . GLY B 1 298 ? 10.690  4.878   60.256  1.00 29.20  ? 298 GLY B CA    1 
ATOM   7510  C  C     . GLY B 1 298 ? 11.834  4.304   61.061  1.00 30.71  ? 298 GLY B C     1 
ATOM   7511  O  O     . GLY B 1 298 ? 12.307  3.215   60.771  1.00 30.91  ? 298 GLY B O     1 
ATOM   7512  N  N     . ARG B 1 299 ? 12.288  5.037   62.069  1.00 32.16  ? 299 ARG B N     1 
ATOM   7513  C  CA    . ARG B 1 299 ? 13.392  4.583   62.916  1.00 35.09  ? 299 ARG B CA    1 
ATOM   7514  C  C     . ARG B 1 299 ? 12.942  3.424   63.819  1.00 35.28  ? 299 ARG B C     1 
ATOM   7515  O  O     . ARG B 1 299 ? 13.671  2.457   64.036  1.00 35.48  ? 299 ARG B O     1 
ATOM   7516  C  CB    . ARG B 1 299 ? 13.907  5.735   63.807  1.00 36.49  ? 299 ARG B CB    1 
ATOM   7517  C  CG    . ARG B 1 299 ? 14.171  7.070   63.100  1.00 37.00  ? 299 ARG B CG    1 
ATOM   7518  C  CD    . ARG B 1 299 ? 15.642  7.345   62.795  1.00 37.87  ? 299 ARG B CD    1 
ATOM   7519  N  NE    . ARG B 1 299 ? 16.186  6.498   61.731  1.00 38.15  ? 299 ARG B NE    1 
ATOM   7520  C  CZ    . ARG B 1 299 ? 17.374  6.687   61.156  1.00 36.21  ? 299 ARG B CZ    1 
ATOM   7521  N  NH1   . ARG B 1 299 ? 18.146  7.690   61.537  1.00 34.09  ? 299 ARG B NH1   1 
ATOM   7522  N  NH2   . ARG B 1 299 ? 17.788  5.876   60.197  1.00 35.50  ? 299 ARG B NH2   1 
ATOM   7523  N  N     . ARG B 1 300 ? 11.730  3.541   64.341  1.00 36.38  ? 300 ARG B N     1 
ATOM   7524  C  CA    . ARG B 1 300 ? 11.157  2.546   65.237  1.00 36.98  ? 300 ARG B CA    1 
ATOM   7525  C  C     . ARG B 1 300 ? 11.215  1.150   64.649  1.00 36.52  ? 300 ARG B C     1 
ATOM   7526  O  O     . ARG B 1 300 ? 11.555  0.200   65.352  1.00 38.24  ? 300 ARG B O     1 
ATOM   7527  C  CB    . ARG B 1 300 ? 9.702   2.914   65.552  1.00 38.55  ? 300 ARG B CB    1 
ATOM   7528  C  CG    . ARG B 1 300 ? 9.029   2.110   66.654  1.00 38.88  ? 300 ARG B CG    1 
ATOM   7529  C  CD    . ARG B 1 300 ? 9.432   2.601   68.012  1.00 40.59  ? 300 ARG B CD    1 
ATOM   7530  N  NE    . ARG B 1 300 ? 10.671  1.985   68.465  1.00 46.13  ? 300 ARG B NE    1 
ATOM   7531  C  CZ    . ARG B 1 300 ? 10.760  0.773   69.014  1.00 48.00  ? 300 ARG B CZ    1 
ATOM   7532  N  NH1   . ARG B 1 300 ? 9.668   0.030   69.187  1.00 47.01  ? 300 ARG B NH1   1 
ATOM   7533  N  NH2   . ARG B 1 300 ? 11.951  0.308   69.394  1.00 48.91  ? 300 ARG B NH2   1 
ATOM   7534  N  N     . LEU B 1 301 ? 10.891  1.027   63.365  1.00 35.19  ? 301 LEU B N     1 
ATOM   7535  C  CA    . LEU B 1 301 ? 10.890  -0.277  62.697  1.00 36.18  ? 301 LEU B CA    1 
ATOM   7536  C  C     . LEU B 1 301 ? 12.250  -0.661  62.082  1.00 36.55  ? 301 LEU B C     1 
ATOM   7537  O  O     . LEU B 1 301 ? 12.504  -1.828  61.769  1.00 34.64  ? 301 LEU B O     1 
ATOM   7538  C  CB    . LEU B 1 301 ? 9.806   -0.289  61.614  1.00 35.99  ? 301 LEU B CB    1 
ATOM   7539  C  CG    . LEU B 1 301 ? 8.405   0.140   62.062  1.00 35.48  ? 301 LEU B CG    1 
ATOM   7540  C  CD1   . LEU B 1 301 ? 7.500   0.280   60.864  1.00 34.86  ? 301 LEU B CD1   1 
ATOM   7541  C  CD2   . LEU B 1 301 ? 7.845   -0.871  63.032  1.00 35.76  ? 301 LEU B CD2   1 
ATOM   7542  N  N     . GLY B 1 302 ? 13.118  0.334   61.926  1.00 37.93  ? 302 GLY B N     1 
ATOM   7543  C  CA    . GLY B 1 302 ? 14.431  0.111   61.352  1.00 38.20  ? 302 GLY B CA    1 
ATOM   7544  C  C     . GLY B 1 302 ? 14.423  0.161   59.834  1.00 38.09  ? 302 GLY B C     1 
ATOM   7545  O  O     . GLY B 1 302 ? 15.243  -0.491  59.193  1.00 39.72  ? 302 GLY B O     1 
ATOM   7546  N  N     . LEU B 1 303 ? 13.518  0.947   59.259  1.00 36.72  ? 303 LEU B N     1 
ATOM   7547  C  CA    . LEU B 1 303 ? 13.410  1.045   57.815  1.00 36.29  ? 303 LEU B CA    1 
ATOM   7548  C  C     . LEU B 1 303 ? 14.031  2.302   57.240  1.00 37.60  ? 303 LEU B C     1 
ATOM   7549  O  O     . LEU B 1 303 ? 13.730  2.665   56.103  1.00 39.17  ? 303 LEU B O     1 
ATOM   7550  C  CB    . LEU B 1 303 ? 11.946  0.967   57.402  1.00 35.65  ? 303 LEU B CB    1 
ATOM   7551  C  CG    . LEU B 1 303 ? 11.229  -0.211  58.061  1.00 35.84  ? 303 LEU B CG    1 
ATOM   7552  C  CD1   . LEU B 1 303 ? 9.733   -0.160  57.791  1.00 34.96  ? 303 LEU B CD1   1 
ATOM   7553  C  CD2   . LEU B 1 303 ? 11.842  -1.501  57.561  1.00 34.78  ? 303 LEU B CD2   1 
ATOM   7554  N  N     . GLY B 1 304 ? 14.876  2.971   58.024  1.00 37.65  ? 304 GLY B N     1 
ATOM   7555  C  CA    . GLY B 1 304 ? 15.549  4.170   57.549  1.00 38.20  ? 304 GLY B CA    1 
ATOM   7556  C  C     . GLY B 1 304 ? 14.954  5.562   57.755  1.00 38.64  ? 304 GLY B C     1 
ATOM   7557  O  O     . GLY B 1 304 ? 14.183  5.829   58.667  1.00 39.74  ? 304 GLY B O     1 
ATOM   7558  N  N     . THR B 1 305 ? 15.350  6.469   56.879  1.00 38.80  ? 305 THR B N     1 
ATOM   7559  C  CA    . THR B 1 305 ? 14.906  7.847   56.924  1.00 38.86  ? 305 THR B CA    1 
ATOM   7560  C  C     . THR B 1 305 ? 13.837  8.035   55.844  1.00 38.89  ? 305 THR B C     1 
ATOM   7561  O  O     . THR B 1 305 ? 13.985  7.554   54.730  1.00 40.00  ? 305 THR B O     1 
ATOM   7562  C  CB    . THR B 1 305 ? 16.124  8.763   56.688  1.00 39.24  ? 305 THR B CB    1 
ATOM   7563  O  OG1   . THR B 1 305 ? 17.059  8.570   57.757  1.00 40.56  ? 305 THR B OG1   1 
ATOM   7564  C  CG2   . THR B 1 305 ? 15.721  10.216  56.636  1.00 40.49  ? 305 THR B CG2   1 
ATOM   7565  N  N     . PRO B 1 306 ? 12.725  8.701   56.171  1.00 38.79  ? 306 PRO B N     1 
ATOM   7566  C  CA    . PRO B 1 306 ? 11.682  8.893   55.156  1.00 40.24  ? 306 PRO B CA    1 
ATOM   7567  C  C     . PRO B 1 306 ? 11.943  10.021  54.165  1.00 41.89  ? 306 PRO B C     1 
ATOM   7568  O  O     . PRO B 1 306 ? 12.574  11.006  54.518  1.00 42.87  ? 306 PRO B O     1 
ATOM   7569  C  CB    . PRO B 1 306 ? 10.435  9.173   56.001  1.00 39.76  ? 306 PRO B CB    1 
ATOM   7570  C  CG    . PRO B 1 306 ? 10.998  9.830   57.213  1.00 38.93  ? 306 PRO B CG    1 
ATOM   7571  C  CD    . PRO B 1 306 ? 12.197  8.972   57.517  1.00 37.69  ? 306 PRO B CD    1 
ATOM   7572  N  N     . GLU B 1 307 ? 11.465  9.874   52.929  1.00 43.39  ? 307 GLU B N     1 
ATOM   7573  C  CA    . GLU B 1 307 ? 11.587  10.934  51.925  1.00 44.41  ? 307 GLU B CA    1 
ATOM   7574  C  C     . GLU B 1 307 ? 10.189  11.173  51.378  1.00 43.36  ? 307 GLU B C     1 
ATOM   7575  O  O     . GLU B 1 307 ? 9.511   10.232  50.996  1.00 41.73  ? 307 GLU B O     1 
ATOM   7576  C  CB    . GLU B 1 307 ? 12.531  10.540  50.789  1.00 48.66  ? 307 GLU B CB    1 
ATOM   7577  C  CG    . GLU B 1 307 ? 12.379  11.408  49.537  1.00 57.22  ? 307 GLU B CG    1 
ATOM   7578  C  CD    . GLU B 1 307 ? 12.244  12.897  49.857  1.00 62.91  ? 307 GLU B CD    1 
ATOM   7579  O  OE1   . GLU B 1 307 ? 11.524  13.618  49.115  1.00 62.74  ? 307 GLU B OE1   1 
ATOM   7580  O  OE2   . GLU B 1 307 ? 12.862  13.346  50.850  1.00 67.49  ? 307 GLU B OE2   1 
ATOM   7581  N  N     . ALA B 1 308 ? 9.754   12.429  51.357  1.00 44.16  ? 308 ALA B N     1 
ATOM   7582  C  CA    . ALA B 1 308 ? 8.416   12.763  50.877  1.00 44.31  ? 308 ALA B CA    1 
ATOM   7583  C  C     . ALA B 1 308 ? 8.228   12.454  49.402  1.00 44.87  ? 308 ALA B C     1 
ATOM   7584  O  O     . ALA B 1 308 ? 9.037   12.842  48.556  1.00 44.80  ? 308 ALA B O     1 
ATOM   7585  C  CB    . ALA B 1 308 ? 8.112   14.220  51.141  1.00 45.47  ? 308 ALA B CB    1 
ATOM   7586  N  N     . VAL B 1 309 ? 7.128   11.762  49.120  1.00 45.72  ? 309 VAL B N     1 
ATOM   7587  C  CA    . VAL B 1 309 ? 6.748   11.322  47.780  1.00 45.76  ? 309 VAL B CA    1 
ATOM   7588  C  C     . VAL B 1 309 ? 5.931   12.340  46.993  1.00 46.61  ? 309 VAL B C     1 
ATOM   7589  O  O     . VAL B 1 309 ? 4.784   12.611  47.340  1.00 46.81  ? 309 VAL B O     1 
ATOM   7590  C  CB    . VAL B 1 309 ? 5.903   10.032  47.860  1.00 44.66  ? 309 VAL B CB    1 
ATOM   7591  C  CG1   . VAL B 1 309 ? 5.353   9.693   46.501  1.00 45.25  ? 309 VAL B CG1   1 
ATOM   7592  C  CG2   . VAL B 1 309 ? 6.734   8.886   48.403  1.00 42.77  ? 309 VAL B CG2   1 
ATOM   7593  N  N     . ARG B 1 310 ? 6.507   12.883  45.924  1.00 47.61  ? 310 ARG B N     1 
ATOM   7594  C  CA    . ARG B 1 310 ? 5.795   13.851  45.097  1.00 48.16  ? 310 ARG B CA    1 
ATOM   7595  C  C     . ARG B 1 310 ? 4.961   13.107  44.076  1.00 47.70  ? 310 ARG B C     1 
ATOM   7596  O  O     . ARG B 1 310 ? 5.271   11.956  43.742  1.00 47.99  ? 310 ARG B O     1 
ATOM   7597  C  CB    . ARG B 1 310 ? 6.773   14.753  44.363  1.00 50.68  ? 310 ARG B CB    1 
ATOM   7598  C  CG    . ARG B 1 310 ? 7.534   15.675  45.267  1.00 56.97  ? 310 ARG B CG    1 
ATOM   7599  C  CD    . ARG B 1 310 ? 8.372   16.635  44.459  1.00 60.51  ? 310 ARG B CD    1 
ATOM   7600  N  NE    . ARG B 1 310 ? 8.807   17.760  45.272  1.00 63.69  ? 310 ARG B NE    1 
ATOM   7601  C  CZ    . ARG B 1 310 ? 9.321   18.879  44.777  1.00 65.63  ? 310 ARG B CZ    1 
ATOM   7602  N  NH1   . ARG B 1 310 ? 9.468   19.019  43.461  1.00 65.58  ? 310 ARG B NH1   1 
ATOM   7603  N  NH2   . ARG B 1 310 ? 9.672   19.863  45.601  1.00 66.15  ? 310 ARG B NH2   1 
ATOM   7604  N  N     . ALA B 1 311 ? 3.909   13.761  43.582  1.00 45.78  ? 311 ALA B N     1 
ATOM   7605  C  CA    . ALA B 1 311 ? 3.037   13.165  42.572  1.00 44.06  ? 311 ALA B CA    1 
ATOM   7606  C  C     . ALA B 1 311 ? 2.594   14.188  41.535  1.00 43.57  ? 311 ALA B C     1 
ATOM   7607  O  O     . ALA B 1 311 ? 2.348   15.351  41.861  1.00 43.07  ? 311 ALA B O     1 
ATOM   7608  C  CB    . ALA B 1 311 ? 1.829   12.542  43.227  1.00 42.84  ? 311 ALA B CB    1 
ATOM   7609  N  N     . GLN B 1 312 ? 2.513   13.748  40.282  1.00 43.17  ? 312 GLN B N     1 
ATOM   7610  C  CA    . GLN B 1 312 ? 2.085   14.609  39.191  1.00 42.60  ? 312 GLN B CA    1 
ATOM   7611  C  C     . GLN B 1 312 ? 0.584   14.665  39.303  1.00 42.09  ? 312 GLN B C     1 
ATOM   7612  O  O     . GLN B 1 312 ? -0.050  13.642  39.547  1.00 40.78  ? 312 GLN B O     1 
ATOM   7613  C  CB    . GLN B 1 312 ? 2.491   14.019  37.838  1.00 42.65  ? 312 GLN B CB    1 
ATOM   7614  N  N     . ALA B 1 313 ? 0.034   15.867  39.142  1.00 42.76  ? 313 ALA B N     1 
ATOM   7615  C  CA    . ALA B 1 313 ? -1.407  16.112  39.217  1.00 42.61  ? 313 ALA B CA    1 
ATOM   7616  C  C     . ALA B 1 313 ? -1.854  17.124  38.162  1.00 42.17  ? 313 ALA B C     1 
ATOM   7617  O  O     . ALA B 1 313 ? -1.129  18.055  37.826  1.00 42.37  ? 313 ALA B O     1 
ATOM   7618  C  CB    . ALA B 1 313 ? -1.778  16.617  40.599  1.00 41.52  ? 313 ALA B CB    1 
ATOM   7619  N  N     . TYR B 1 314 ? -3.059  16.941  37.643  1.00 41.83  ? 314 TYR B N     1 
ATOM   7620  C  CA    . TYR B 1 314 ? -3.584  17.836  36.634  1.00 40.89  ? 314 TYR B CA    1 
ATOM   7621  C  C     . TYR B 1 314 ? -4.844  18.432  37.160  1.00 41.01  ? 314 TYR B C     1 
ATOM   7622  O  O     . TYR B 1 314 ? -5.788  17.715  37.446  1.00 41.73  ? 314 TYR B O     1 
ATOM   7623  C  CB    . TYR B 1 314 ? -3.918  17.072  35.371  1.00 40.80  ? 314 TYR B CB    1 
ATOM   7624  C  CG    . TYR B 1 314 ? -2.836  16.131  34.947  1.00 42.26  ? 314 TYR B CG    1 
ATOM   7625  C  CD1   . TYR B 1 314 ? -1.756  16.566  34.178  1.00 42.15  ? 314 TYR B CD1   1 
ATOM   7626  C  CD2   . TYR B 1 314 ? -2.874  14.803  35.344  1.00 43.36  ? 314 TYR B CD2   1 
ATOM   7627  C  CE1   . TYR B 1 314 ? -0.730  15.683  33.814  1.00 43.54  ? 314 TYR B CE1   1 
ATOM   7628  C  CE2   . TYR B 1 314 ? -1.868  13.917  34.993  1.00 45.15  ? 314 TYR B CE2   1 
ATOM   7629  C  CZ    . TYR B 1 314 ? -0.795  14.353  34.227  1.00 44.82  ? 314 TYR B CZ    1 
ATOM   7630  O  OH    . TYR B 1 314 ? 0.179   13.437  33.878  1.00 41.57  ? 314 TYR B OH    1 
ATOM   7631  N  N     . ARG B 1 315 ? -4.864  19.745  37.292  1.00 42.66  ? 315 ARG B N     1 
ATOM   7632  C  CA    . ARG B 1 315 ? -6.054  20.418  37.772  1.00 44.77  ? 315 ARG B CA    1 
ATOM   7633  C  C     . ARG B 1 315 ? -7.070  20.409  36.625  1.00 46.10  ? 315 ARG B C     1 
ATOM   7634  O  O     . ARG B 1 315 ? -6.776  20.875  35.526  1.00 45.77  ? 315 ARG B O     1 
ATOM   7635  C  CB    . ARG B 1 315 ? -5.690  21.840  38.214  1.00 45.76  ? 315 ARG B CB    1 
ATOM   7636  C  CG    . ARG B 1 315 ? -6.518  22.929  37.616  1.00 46.62  ? 315 ARG B CG    1 
ATOM   7637  C  CD    . ARG B 1 315 ? -7.354  23.645  38.646  1.00 48.51  ? 315 ARG B CD    1 
ATOM   7638  N  NE    . ARG B 1 315 ? -6.632  24.730  39.302  1.00 52.09  ? 315 ARG B NE    1 
ATOM   7639  C  CZ    . ARG B 1 315 ? -7.232  25.793  39.841  1.00 53.42  ? 315 ARG B CZ    1 
ATOM   7640  N  NH1   . ARG B 1 315 ? -8.555  25.904  39.795  1.00 52.56  ? 315 ARG B NH1   1 
ATOM   7641  N  NH2   . ARG B 1 315 ? -6.521  26.746  40.433  1.00 53.08  ? 315 ARG B NH2   1 
ATOM   7642  N  N     . LEU B 1 316 ? -8.249  19.842  36.879  1.00 47.90  ? 316 LEU B N     1 
ATOM   7643  C  CA    . LEU B 1 316 ? -9.311  19.737  35.870  1.00 49.01  ? 316 LEU B CA    1 
ATOM   7644  C  C     . LEU B 1 316 ? -10.009 21.073  35.677  1.00 50.08  ? 316 LEU B C     1 
ATOM   7645  O  O     . LEU B 1 316 ? -10.005 21.920  36.575  1.00 50.17  ? 316 LEU B O     1 
ATOM   7646  C  CB    . LEU B 1 316 ? -10.333 18.666  36.281  1.00 48.68  ? 316 LEU B CB    1 
ATOM   7647  C  CG    . LEU B 1 316 ? -9.849  17.211  36.362  1.00 47.85  ? 316 LEU B CG    1 
ATOM   7648  C  CD1   . LEU B 1 316 ? -10.771 16.382  37.243  1.00 46.48  ? 316 LEU B CD1   1 
ATOM   7649  C  CD2   . LEU B 1 316 ? -9.777  16.637  34.960  1.00 49.16  ? 316 LEU B CD2   1 
ATOM   7650  N  N     . SER B 1 317 ? -10.616 21.255  34.510  1.00 51.12  ? 317 SER B N     1 
ATOM   7651  C  CA    . SER B 1 317 ? -11.291 22.506  34.195  1.00 53.03  ? 317 SER B CA    1 
ATOM   7652  C  C     . SER B 1 317 ? -12.608 22.760  34.927  1.00 53.58  ? 317 SER B C     1 
ATOM   7653  O  O     . SER B 1 317 ? -13.432 21.872  35.096  1.00 52.81  ? 317 SER B O     1 
ATOM   7654  C  CB    . SER B 1 317 ? -11.506 22.608  32.681  1.00 53.59  ? 317 SER B CB    1 
ATOM   7655  O  OG    . SER B 1 317 ? -12.167 21.465  32.175  1.00 54.47  ? 317 SER B OG    1 
ATOM   7656  N  N     . ILE B 1 318 ? -12.786 24.003  35.353  1.00 56.14  ? 318 ILE B N     1 
ATOM   7657  C  CA    . ILE B 1 318 ? -13.985 24.435  36.058  1.00 58.99  ? 318 ILE B CA    1 
ATOM   7658  C  C     . ILE B 1 318 ? -15.214 24.013  35.256  1.00 61.65  ? 318 ILE B C     1 
ATOM   7659  O  O     . ILE B 1 318 ? -15.382 24.429  34.110  1.00 61.43  ? 318 ILE B O     1 
ATOM   7660  C  CB    . ILE B 1 318 ? -14.014 25.977  36.200  1.00 59.40  ? 318 ILE B CB    1 
ATOM   7661  C  CG1   . ILE B 1 318 ? -12.604 26.517  36.510  1.00 61.00  ? 318 ILE B CG1   1 
ATOM   7662  C  CG2   . ILE B 1 318 ? -15.007 26.379  37.279  1.00 57.74  ? 318 ILE B CG2   1 
ATOM   7663  C  CD1   . ILE B 1 318 ? -11.989 26.024  37.827  1.00 62.30  ? 318 ILE B CD1   1 
ATOM   7664  N  N     . PRO B 1 319 ? -16.097 23.195  35.854  1.00 63.94  ? 319 PRO B N     1 
ATOM   7665  C  CA    . PRO B 1 319 ? -17.327 22.696  35.223  1.00 65.19  ? 319 PRO B CA    1 
ATOM   7666  C  C     . PRO B 1 319 ? -18.272 23.837  34.837  1.00 67.31  ? 319 PRO B C     1 
ATOM   7667  O  O     . PRO B 1 319 ? -18.378 24.831  35.562  1.00 66.58  ? 319 PRO B O     1 
ATOM   7668  C  CB    . PRO B 1 319 ? -17.925 21.819  36.309  1.00 65.05  ? 319 PRO B CB    1 
ATOM   7669  C  CG    . PRO B 1 319 ? -17.566 22.582  37.554  1.00 64.39  ? 319 PRO B CG    1 
ATOM   7670  C  CD    . PRO B 1 319 ? -16.107 22.900  37.298  1.00 64.41  ? 319 PRO B CD    1 
ATOM   7671  N  N     . LYS B 1 320 ? -18.961 23.695  33.706  1.00 69.84  ? 320 LYS B N     1 
ATOM   7672  C  CA    . LYS B 1 320 ? -19.890 24.734  33.262  1.00 72.56  ? 320 LYS B CA    1 
ATOM   7673  C  C     . LYS B 1 320 ? -21.306 24.532  33.799  1.00 74.26  ? 320 LYS B C     1 
ATOM   7674  O  O     . LYS B 1 320 ? -22.218 24.167  33.050  1.00 73.92  ? 320 LYS B O     1 
ATOM   7675  C  CB    . LYS B 1 320 ? -19.937 24.817  31.727  1.00 72.78  ? 320 LYS B CB    1 
ATOM   7676  C  CG    . LYS B 1 320 ? -19.166 26.001  31.124  1.00 73.07  ? 320 LYS B CG    1 
ATOM   7677  C  CD    . LYS B 1 320 ? -17.701 25.650  30.852  1.00 74.16  ? 320 LYS B CD    1 
ATOM   7678  C  CE    . LYS B 1 320 ? -16.863 26.862  30.420  1.00 72.60  ? 320 LYS B CE    1 
ATOM   7679  N  NZ    . LYS B 1 320 ? -15.449 26.469  30.123  1.00 70.46  ? 320 LYS B NZ    1 
ATOM   7680  N  N     . LEU B 1 321 ? -21.481 24.765  35.100  1.00 76.09  ? 321 LEU B N     1 
ATOM   7681  C  CA    . LEU B 1 321 ? -22.790 24.631  35.726  1.00 78.80  ? 321 LEU B CA    1 
ATOM   7682  C  C     . LEU B 1 321 ? -23.667 25.645  35.006  1.00 80.96  ? 321 LEU B C     1 
ATOM   7683  O  O     . LEU B 1 321 ? -23.214 26.750  34.716  1.00 81.44  ? 321 LEU B O     1 
ATOM   7684  C  CB    . LEU B 1 321 ? -22.705 24.953  37.221  1.00 77.02  ? 321 LEU B CB    1 
ATOM   7685  N  N     . MET B 1 322 ? -24.912 25.282  34.711  1.00 83.80  ? 322 MET B N     1 
ATOM   7686  C  CA    . MET B 1 322 ? -25.792 26.197  33.992  1.00 86.35  ? 322 MET B CA    1 
ATOM   7687  C  C     . MET B 1 322 ? -27.299 25.935  34.110  1.00 87.57  ? 322 MET B C     1 
ATOM   7688  O  O     . MET B 1 322 ? -27.756 24.789  34.059  1.00 88.19  ? 322 MET B O     1 
ATOM   7689  C  CB    . MET B 1 322 ? -25.400 26.193  32.513  1.00 87.39  ? 322 MET B CB    1 
ATOM   7690  C  CG    . MET B 1 322 ? -26.251 27.077  31.634  1.00 89.14  ? 322 MET B CG    1 
ATOM   7691  S  SD    . MET B 1 322 ? -25.900 26.778  29.901  1.00 91.92  ? 322 MET B SD    1 
ATOM   7692  C  CE    . MET B 1 322 ? -24.292 27.566  29.748  1.00 90.69  ? 322 MET B CE    1 
ATOM   7693  N  N     . GLY B 1 323 ? -28.060 27.016  34.267  1.00 88.14  ? 323 GLY B N     1 
ATOM   7694  C  CA    . GLY B 1 323 ? -29.509 26.923  34.342  1.00 88.08  ? 323 GLY B CA    1 
ATOM   7695  C  C     . GLY B 1 323 ? -30.012 27.416  32.998  1.00 88.16  ? 323 GLY B C     1 
ATOM   7696  O  O     . GLY B 1 323 ? -29.942 26.689  32.001  1.00 87.33  ? 323 GLY B O     1 
ATOM   7697  N  N     . ARG B 1 324 ? -30.517 28.648  32.963  1.00 88.51  ? 324 ARG B N     1 
ATOM   7698  C  CA    . ARG B 1 324 ? -30.977 29.254  31.709  1.00 89.27  ? 324 ARG B CA    1 
ATOM   7699  C  C     . ARG B 1 324 ? -29.703 29.810  31.067  1.00 89.68  ? 324 ARG B C     1 
ATOM   7700  O  O     . ARG B 1 324 ? -29.489 29.700  29.858  1.00 90.21  ? 324 ARG B O     1 
ATOM   7701  C  CB    . ARG B 1 324 ? -31.956 30.401  31.985  1.00 88.93  ? 324 ARG B CB    1 
ATOM   7702  C  CG    . ARG B 1 324 ? -32.426 31.176  30.749  1.00 88.51  ? 324 ARG B CG    1 
ATOM   7703  C  CD    . ARG B 1 324 ? -33.675 30.578  30.103  1.00 87.99  ? 324 ARG B CD    1 
ATOM   7704  N  NE    . ARG B 1 324 ? -34.493 31.612  29.465  1.00 88.91  ? 324 ARG B NE    1 
ATOM   7705  C  CZ    . ARG B 1 324 ? -34.330 32.069  28.223  1.00 88.98  ? 324 ARG B CZ    1 
ATOM   7706  N  NH1   . ARG B 1 324 ? -33.375 31.587  27.437  1.00 88.48  ? 324 ARG B NH1   1 
ATOM   7707  N  NH2   . ARG B 1 324 ? -35.119 33.034  27.773  1.00 88.99  ? 324 ARG B NH2   1 
ATOM   7708  N  N     . ARG B 1 325 ? -28.859 30.400  31.912  1.00 89.35  ? 325 ARG B N     1 
ATOM   7709  C  CA    . ARG B 1 325 ? -27.582 30.971  31.502  1.00 87.32  ? 325 ARG B CA    1 
ATOM   7710  C  C     . ARG B 1 325 ? -26.506 30.471  32.471  1.00 85.25  ? 325 ARG B C     1 
ATOM   7711  O  O     . ARG B 1 325 ? -26.810 30.121  33.611  1.00 84.64  ? 325 ARG B O     1 
ATOM   7712  C  CB    . ARG B 1 325 ? -27.663 32.492  31.550  1.00 89.09  ? 325 ARG B CB    1 
ATOM   7713  C  CG    . ARG B 1 325 ? -28.631 33.099  30.550  1.00 91.30  ? 325 ARG B CG    1 
ATOM   7714  C  CD    . ARG B 1 325 ? -29.315 34.298  31.171  1.00 94.15  ? 325 ARG B CD    1 
ATOM   7715  N  NE    . ARG B 1 325 ? -28.392 35.021  32.042  1.00 96.47  ? 325 ARG B NE    1 
ATOM   7716  C  CZ    . ARG B 1 325 ? -28.708 36.104  32.743  1.00 96.90  ? 325 ARG B CZ    1 
ATOM   7717  N  NH1   . ARG B 1 325 ? -29.938 36.600  32.680  1.00 96.45  ? 325 ARG B NH1   1 
ATOM   7718  N  NH2   . ARG B 1 325 ? -27.790 36.687  33.510  1.00 96.92  ? 325 ARG B NH2   1 
ATOM   7719  N  N     . ALA B 1 326 ? -25.258 30.432  32.012  1.00 82.87  ? 326 ALA B N     1 
ATOM   7720  C  CA    . ALA B 1 326 ? -24.141 29.978  32.835  1.00 81.14  ? 326 ALA B CA    1 
ATOM   7721  C  C     . ALA B 1 326 ? -24.250 30.512  34.259  1.00 80.18  ? 326 ALA B C     1 
ATOM   7722  O  O     . ALA B 1 326 ? -24.305 31.723  34.477  1.00 80.64  ? 326 ALA B O     1 
ATOM   7723  C  CB    . ALA B 1 326 ? -22.828 30.422  32.218  1.00 81.05  ? 326 ALA B CB    1 
ATOM   7724  N  N     . VAL B 1 327 ? -24.273 29.603  35.227  1.00 78.29  ? 327 VAL B N     1 
ATOM   7725  C  CA    . VAL B 1 327 ? -24.395 29.984  36.624  1.00 76.14  ? 327 VAL B CA    1 
ATOM   7726  C  C     . VAL B 1 327 ? -23.139 29.604  37.405  1.00 74.52  ? 327 VAL B C     1 
ATOM   7727  O  O     . VAL B 1 327 ? -22.392 28.716  37.001  1.00 73.90  ? 327 VAL B O     1 
ATOM   7728  C  CB    . VAL B 1 327 ? -25.617 29.290  37.268  1.00 76.36  ? 327 VAL B CB    1 
ATOM   7729  C  CG1   . VAL B 1 327 ? -26.031 30.035  38.511  1.00 76.99  ? 327 VAL B CG1   1 
ATOM   7730  C  CG2   . VAL B 1 327 ? -26.768 29.218  36.279  1.00 75.58  ? 327 VAL B CG2   1 
ATOM   7731  N  N     . SER B 1 328 ? -22.900 30.286  38.517  1.00 73.31  ? 328 SER B N     1 
ATOM   7732  C  CA    . SER B 1 328 ? -21.737 29.980  39.340  1.00 73.44  ? 328 SER B CA    1 
ATOM   7733  C  C     . SER B 1 328 ? -22.139 28.894  40.328  1.00 73.20  ? 328 SER B C     1 
ATOM   7734  O  O     . SER B 1 328 ? -21.540 27.820  40.365  1.00 73.88  ? 328 SER B O     1 
ATOM   7735  C  CB    . SER B 1 328 ? -21.276 31.221  40.101  1.00 74.20  ? 328 SER B CB    1 
ATOM   7736  O  OG    . SER B 1 328 ? -22.310 31.724  40.930  1.00 77.12  ? 328 SER B OG    1 
ATOM   7737  N  N     . LYS B 1 329 ? -23.165 29.191  41.121  1.00 72.44  ? 329 LYS B N     1 
ATOM   7738  C  CA    . LYS B 1 329 ? -23.705 28.268  42.117  1.00 70.93  ? 329 LYS B CA    1 
ATOM   7739  C  C     . LYS B 1 329 ? -25.133 27.898  41.703  1.00 70.19  ? 329 LYS B C     1 
ATOM   7740  O  O     . LYS B 1 329 ? -25.682 28.463  40.761  1.00 70.03  ? 329 LYS B O     1 
ATOM   7741  C  CB    . LYS B 1 329 ? -23.711 28.942  43.489  1.00 70.14  ? 329 LYS B CB    1 
ATOM   7742  C  CG    . LYS B 1 329 ? -24.322 30.326  43.456  1.00 69.99  ? 329 LYS B CG    1 
ATOM   7743  C  CD    . LYS B 1 329 ? -23.769 31.202  44.562  1.00 71.13  ? 329 LYS B CD    1 
ATOM   7744  C  CE    . LYS B 1 329 ? -24.024 32.679  44.264  1.00 71.93  ? 329 LYS B CE    1 
ATOM   7745  N  NZ    . LYS B 1 329 ? -23.240 33.592  45.154  1.00 72.77  ? 329 LYS B NZ    1 
ATOM   7746  N  N     . PRO B 1 330 ? -25.744 26.922  42.379  1.00 69.27  ? 330 PRO B N     1 
ATOM   7747  C  CA    . PRO B 1 330 ? -27.109 26.604  41.953  1.00 68.23  ? 330 PRO B CA    1 
ATOM   7748  C  C     . PRO B 1 330 ? -28.118 27.644  42.451  1.00 67.59  ? 330 PRO B C     1 
ATOM   7749  O  O     . PRO B 1 330 ? -29.202 27.784  41.886  1.00 65.80  ? 330 PRO B O     1 
ATOM   7750  C  CB    . PRO B 1 330 ? -27.340 25.220  42.552  1.00 68.14  ? 330 PRO B CB    1 
ATOM   7751  C  CG    . PRO B 1 330 ? -25.970 24.633  42.570  1.00 68.86  ? 330 PRO B CG    1 
ATOM   7752  C  CD    . PRO B 1 330 ? -25.142 25.784  43.089  1.00 69.01  ? 330 PRO B CD    1 
ATOM   7753  N  N     . ALA B 1 331 ? -27.752 28.376  43.501  1.00 67.34  ? 331 ALA B N     1 
ATOM   7754  C  CA    . ALA B 1 331 ? -28.623 29.402  44.063  1.00 68.48  ? 331 ALA B CA    1 
ATOM   7755  C  C     . ALA B 1 331 ? -28.908 30.501  43.047  1.00 70.09  ? 331 ALA B C     1 
ATOM   7756  O  O     . ALA B 1 331 ? -30.019 31.020  42.974  1.00 70.99  ? 331 ALA B O     1 
ATOM   7757  C  CB    . ALA B 1 331 ? -27.991 30.005  45.304  1.00 67.67  ? 331 ALA B CB    1 
ATOM   7758  N  N     . ASP B 1 332 ? -27.899 30.861  42.264  1.00 71.98  ? 332 ASP B N     1 
ATOM   7759  C  CA    . ASP B 1 332 ? -28.054 31.901  41.254  1.00 73.76  ? 332 ASP B CA    1 
ATOM   7760  C  C     . ASP B 1 332 ? -28.954 31.473  40.095  1.00 74.85  ? 332 ASP B C     1 
ATOM   7761  O  O     . ASP B 1 332 ? -28.804 31.949  38.969  1.00 75.43  ? 332 ASP B O     1 
ATOM   7762  C  CB    . ASP B 1 332 ? -26.681 32.320  40.720  1.00 74.43  ? 332 ASP B CB    1 
ATOM   7763  C  CG    . ASP B 1 332 ? -25.954 33.259  41.660  1.00 76.13  ? 332 ASP B CG    1 
ATOM   7764  O  OD1   . ASP B 1 332 ? -26.421 33.435  42.808  1.00 77.09  ? 332 ASP B OD1   1 
ATOM   7765  O  OD2   . ASP B 1 332 ? -24.913 33.820  41.250  1.00 76.71  ? 332 ASP B OD2   1 
ATOM   7766  N  N     . ALA B 1 333 ? -29.881 30.562  40.366  1.00 75.61  ? 333 ALA B N     1 
ATOM   7767  C  CA    . ALA B 1 333 ? -30.808 30.103  39.340  1.00 76.55  ? 333 ALA B CA    1 
ATOM   7768  C  C     . ALA B 1 333 ? -32.129 30.769  39.684  1.00 77.27  ? 333 ALA B C     1 
ATOM   7769  O  O     . ALA B 1 333 ? -33.020 30.911  38.840  1.00 77.25  ? 333 ALA B O     1 
ATOM   7770  C  CB    . ALA B 1 333 ? -30.942 28.583  39.378  1.00 77.16  ? 333 ALA B CB    1 
ATOM   7771  N  N     . LEU B 1 334 ? -32.232 31.177  40.946  1.00 77.38  ? 334 LEU B N     1 
ATOM   7772  C  CA    . LEU B 1 334 ? -33.413 31.858  41.443  1.00 78.09  ? 334 LEU B CA    1 
ATOM   7773  C  C     . LEU B 1 334 ? -33.442 33.272  40.864  1.00 79.81  ? 334 LEU B C     1 
ATOM   7774  O  O     . LEU B 1 334 ? -34.519 33.813  40.594  1.00 82.10  ? 334 LEU B O     1 
ATOM   7775  C  CB    . LEU B 1 334 ? -33.394 31.935  42.976  1.00 75.98  ? 334 LEU B CB    1 
ATOM   7776  C  CG    . LEU B 1 334 ? -33.668 30.671  43.797  1.00 74.69  ? 334 LEU B CG    1 
ATOM   7777  C  CD1   . LEU B 1 334 ? -33.605 31.020  45.275  1.00 72.89  ? 334 LEU B CD1   1 
ATOM   7778  C  CD2   . LEU B 1 334 ? -35.034 30.099  43.448  1.00 73.74  ? 334 LEU B CD2   1 
ATOM   7779  N  N     . ARG B 1 335 ? -32.259 33.860  40.666  1.00 79.85  ? 335 ARG B N     1 
ATOM   7780  C  CA    . ARG B 1 335 ? -32.141 35.220  40.130  1.00 77.95  ? 335 ARG B CA    1 
ATOM   7781  C  C     . ARG B 1 335 ? -31.815 35.289  38.634  1.00 76.64  ? 335 ARG B C     1 
ATOM   7782  O  O     . ARG B 1 335 ? -31.722 36.374  38.075  1.00 76.70  ? 335 ARG B O     1 
ATOM   7783  C  CB    . ARG B 1 335 ? -31.096 35.999  40.928  1.00 77.04  ? 335 ARG B CB    1 
ATOM   7784  N  N     . VAL B 1 336 ? -31.650 34.138  37.989  1.00 75.46  ? 336 VAL B N     1 
ATOM   7785  C  CA    . VAL B 1 336 ? -31.330 34.096  36.563  1.00 74.89  ? 336 VAL B CA    1 
ATOM   7786  C  C     . VAL B 1 336 ? -32.280 33.179  35.801  1.00 75.01  ? 336 VAL B C     1 
ATOM   7787  O  O     . VAL B 1 336 ? -32.420 33.301  34.586  1.00 75.38  ? 336 VAL B O     1 
ATOM   7788  C  CB    . VAL B 1 336 ? -29.868 33.602  36.320  1.00 75.18  ? 336 VAL B CB    1 
ATOM   7789  C  CG1   . VAL B 1 336 ? -29.581 33.475  34.819  1.00 74.60  ? 336 VAL B CG1   1 
ATOM   7790  C  CG2   . VAL B 1 336 ? -28.880 34.562  36.963  1.00 74.59  ? 336 VAL B CG2   1 
ATOM   7791  N  N     . GLY B 1 337 ? -32.922 32.253  36.508  1.00 75.19  ? 337 GLY B N     1 
ATOM   7792  C  CA    . GLY B 1 337 ? -33.846 31.337  35.854  1.00 75.88  ? 337 GLY B CA    1 
ATOM   7793  C  C     . GLY B 1 337 ? -33.310 29.921  35.733  1.00 76.52  ? 337 GLY B C     1 
ATOM   7794  O  O     . GLY B 1 337 ? -32.129 29.685  35.990  1.00 77.48  ? 337 GLY B O     1 
ATOM   7795  N  N     . PHE B 1 338 ? -34.158 28.976  35.327  1.00 76.96  ? 338 PHE B N     1 
ATOM   7796  C  CA    . PHE B 1 338 ? -33.718 27.586  35.208  1.00 77.33  ? 338 PHE B CA    1 
ATOM   7797  C  C     . PHE B 1 338 ? -33.565 27.016  33.820  1.00 77.83  ? 338 PHE B C     1 
ATOM   7798  O  O     . PHE B 1 338 ? -34.058 27.547  32.827  1.00 77.83  ? 338 PHE B O     1 
ATOM   7799  C  CB    . PHE B 1 338 ? -34.648 26.622  35.938  1.00 77.21  ? 338 PHE B CB    1 
ATOM   7800  C  CG    . PHE B 1 338 ? -35.320 27.203  37.128  1.00 76.97  ? 338 PHE B CG    1 
ATOM   7801  C  CD1   . PHE B 1 338 ? -36.689 27.406  37.111  1.00 76.64  ? 338 PHE B CD1   1 
ATOM   7802  C  CD2   . PHE B 1 338 ? -34.601 27.510  38.280  1.00 76.58  ? 338 PHE B CD2   1 
ATOM   7803  C  CE1   . PHE B 1 338 ? -37.337 27.911  38.220  1.00 77.34  ? 338 PHE B CE1   1 
ATOM   7804  C  CE2   . PHE B 1 338 ? -35.238 28.018  39.400  1.00 76.08  ? 338 PHE B CE2   1 
ATOM   7805  C  CZ    . PHE B 1 338 ? -36.611 28.216  39.373  1.00 76.81  ? 338 PHE B CZ    1 
ATOM   7806  N  N     . TYR B 1 339 ? -32.906 25.866  33.807  1.00 78.57  ? 339 TYR B N     1 
ATOM   7807  C  CA    . TYR B 1 339 ? -32.625 25.106  32.609  1.00 78.62  ? 339 TYR B CA    1 
ATOM   7808  C  C     . TYR B 1 339 ? -33.916 24.649  31.934  1.00 79.91  ? 339 TYR B C     1 
ATOM   7809  O  O     . TYR B 1 339 ? -34.373 25.252  30.967  1.00 80.65  ? 339 TYR B O     1 
ATOM   7810  C  CB    . TYR B 1 339 ? -31.770 23.886  32.977  1.00 75.63  ? 339 TYR B CB    1 
ATOM   7811  C  CG    . TYR B 1 339 ? -31.244 23.159  31.778  1.00 72.63  ? 339 TYR B CG    1 
ATOM   7812  C  CD1   . TYR B 1 339 ? -30.232 23.717  31.003  1.00 71.84  ? 339 TYR B CD1   1 
ATOM   7813  C  CD2   . TYR B 1 339 ? -31.810 21.956  31.366  1.00 71.47  ? 339 TYR B CD2   1 
ATOM   7814  C  CE1   . TYR B 1 339 ? -29.799 23.104  29.842  1.00 70.45  ? 339 TYR B CE1   1 
ATOM   7815  C  CE2   . TYR B 1 339 ? -31.386 21.331  30.202  1.00 70.69  ? 339 TYR B CE2   1 
ATOM   7816  C  CZ    . TYR B 1 339 ? -30.379 21.916  29.445  1.00 70.19  ? 339 TYR B CZ    1 
ATOM   7817  O  OH    . TYR B 1 339 ? -29.952 21.332  28.282  1.00 68.55  ? 339 TYR B OH    1 
ATOM   7818  N  N     . ARG B 1 340 ? -34.502 23.584  32.470  1.00 81.78  ? 340 ARG B N     1 
ATOM   7819  C  CA    . ARG B 1 340 ? -35.723 22.993  31.929  1.00 82.36  ? 340 ARG B CA    1 
ATOM   7820  C  C     . ARG B 1 340 ? -36.946 23.307  32.786  1.00 82.46  ? 340 ARG B C     1 
ATOM   7821  O  O     . ARG B 1 340 ? -37.505 22.410  33.418  1.00 81.63  ? 340 ARG B O     1 
ATOM   7822  C  CB    . ARG B 1 340 ? -35.552 21.477  31.847  1.00 83.48  ? 340 ARG B CB    1 
ATOM   7823  C  CG    . ARG B 1 340 ? -36.321 20.813  30.734  1.00 85.77  ? 340 ARG B CG    1 
ATOM   7824  C  CD    . ARG B 1 340 ? -36.824 19.450  31.178  1.00 88.21  ? 340 ARG B CD    1 
ATOM   7825  N  NE    . ARG B 1 340 ? -35.751 18.535  31.565  1.00 90.53  ? 340 ARG B NE    1 
ATOM   7826  C  CZ    . ARG B 1 340 ? -35.903 17.535  32.431  1.00 91.25  ? 340 ARG B CZ    1 
ATOM   7827  N  NH1   . ARG B 1 340 ? -37.080 17.326  33.008  1.00 91.16  ? 340 ARG B NH1   1 
ATOM   7828  N  NH2   . ARG B 1 340 ? -34.885 16.732  32.714  1.00 91.70  ? 340 ARG B NH2   1 
ATOM   7829  N  N     . ALA B 1 341 ? -37.357 24.573  32.813  1.00 83.42  ? 341 ALA B N     1 
ATOM   7830  C  CA    . ALA B 1 341 ? -38.525 24.969  33.595  1.00 84.42  ? 341 ALA B CA    1 
ATOM   7831  C  C     . ALA B 1 341 ? -39.792 24.416  32.942  1.00 84.97  ? 341 ALA B C     1 
ATOM   7832  O  O     . ALA B 1 341 ? -39.851 24.216  31.728  1.00 85.17  ? 341 ALA B O     1 
ATOM   7833  C  CB    . ALA B 1 341 ? -38.606 26.502  33.705  1.00 84.01  ? 341 ALA B CB    1 
ATOM   7834  N  N     . GLN B 1 342 ? -40.799 24.153  33.761  1.00 85.55  ? 342 GLN B N     1 
ATOM   7835  C  CA    . GLN B 1 342 ? -42.074 23.637  33.281  1.00 85.44  ? 342 GLN B CA    1 
ATOM   7836  C  C     . GLN B 1 342 ? -43.119 24.357  34.119  1.00 86.18  ? 342 GLN B C     1 
ATOM   7837  O  O     . GLN B 1 342 ? -42.850 24.684  35.277  1.00 86.73  ? 342 GLN B O     1 
ATOM   7838  C  CB    . GLN B 1 342 ? -42.133 22.116  33.495  1.00 84.22  ? 342 GLN B CB    1 
ATOM   7839  C  CG    . GLN B 1 342 ? -41.603 21.649  34.861  1.00 83.28  ? 342 GLN B CG    1 
ATOM   7840  C  CD    . GLN B 1 342 ? -41.104 20.203  34.854  1.00 82.00  ? 342 GLN B CD    1 
ATOM   7841  O  OE1   . GLN B 1 342 ? -40.138 19.866  34.162  1.00 80.11  ? 342 GLN B OE1   1 
ATOM   7842  N  NE2   . GLN B 1 342 ? -41.762 19.345  35.626  1.00 80.85  ? 342 GLN B NE2   1 
ATOM   7843  N  N     . GLU B 1 343 ? -44.280 24.659  33.542  1.00 86.30  ? 343 GLU B N     1 
ATOM   7844  C  CA    . GLU B 1 343 ? -45.310 25.322  34.326  1.00 86.45  ? 343 GLU B CA    1 
ATOM   7845  C  C     . GLU B 1 343 ? -45.736 24.311  35.393  1.00 85.64  ? 343 GLU B C     1 
ATOM   7846  O  O     . GLU B 1 343 ? -46.151 23.190  35.083  1.00 85.46  ? 343 GLU B O     1 
ATOM   7847  C  CB    . GLU B 1 343 ? -46.498 25.729  33.450  1.00 88.01  ? 343 GLU B CB    1 
ATOM   7848  C  CG    . GLU B 1 343 ? -47.814 25.049  33.821  1.00 89.54  ? 343 GLU B CG    1 
ATOM   7849  C  CD    . GLU B 1 343 ? -49.017 25.953  33.642  1.00 89.83  ? 343 GLU B CD    1 
ATOM   7850  O  OE1   . GLU B 1 343 ? -49.079 27.005  34.317  1.00 89.77  ? 343 GLU B OE1   1 
ATOM   7851  O  OE2   . GLU B 1 343 ? -49.898 25.607  32.828  1.00 90.13  ? 343 GLU B OE2   1 
ATOM   7852  N  N     . THR B 1 344 ? -45.603 24.714  36.652  1.00 84.20  ? 344 THR B N     1 
ATOM   7853  C  CA    . THR B 1 344 ? -45.927 23.855  37.780  1.00 82.92  ? 344 THR B CA    1 
ATOM   7854  C  C     . THR B 1 344 ? -46.668 24.636  38.858  1.00 81.64  ? 344 THR B C     1 
ATOM   7855  O  O     . THR B 1 344 ? -46.515 25.853  38.977  1.00 81.64  ? 344 THR B O     1 
ATOM   7856  C  CB    . THR B 1 344 ? -44.628 23.248  38.384  1.00 83.45  ? 344 THR B CB    1 
ATOM   7857  O  OG1   . THR B 1 344 ? -44.069 22.300  37.463  1.00 83.61  ? 344 THR B OG1   1 
ATOM   7858  C  CG2   . THR B 1 344 ? -44.907 22.554  39.709  1.00 83.93  ? 344 THR B CG2   1 
ATOM   7859  N  N     . ALA B 1 345 ? -47.479 23.925  39.633  1.00 79.33  ? 345 ALA B N     1 
ATOM   7860  C  CA    . ALA B 1 345 ? -48.242 24.532  40.708  1.00 76.71  ? 345 ALA B CA    1 
ATOM   7861  C  C     . ALA B 1 345 ? -47.779 23.954  42.046  1.00 74.56  ? 345 ALA B C     1 
ATOM   7862  O  O     . ALA B 1 345 ? -47.383 22.794  42.127  1.00 74.01  ? 345 ALA B O     1 
ATOM   7863  C  CB    . ALA B 1 345 ? -49.736 24.265  40.493  1.00 76.58  ? 345 ALA B CB    1 
ATOM   7864  N  N     . LEU B 1 346 ? -47.815 24.767  43.092  1.00 72.19  ? 346 LEU B N     1 
ATOM   7865  C  CA    . LEU B 1 346 ? -47.411 24.295  44.406  1.00 71.31  ? 346 LEU B CA    1 
ATOM   7866  C  C     . LEU B 1 346 ? -47.919 25.217  45.519  1.00 70.71  ? 346 LEU B C     1 
ATOM   7867  O  O     . LEU B 1 346 ? -47.690 26.427  45.503  1.00 70.77  ? 346 LEU B O     1 
ATOM   7868  C  CB    . LEU B 1 346 ? -45.881 24.132  44.458  1.00 71.08  ? 346 LEU B CB    1 
ATOM   7869  C  CG    . LEU B 1 346 ? -44.867 25.286  44.455  1.00 70.17  ? 346 LEU B CG    1 
ATOM   7870  C  CD1   . LEU B 1 346 ? -43.695 24.877  43.596  1.00 68.98  ? 346 LEU B CD1   1 
ATOM   7871  C  CD2   . LEU B 1 346 ? -45.465 26.557  43.908  1.00 71.77  ? 346 LEU B CD2   1 
ATOM   7872  N  N     . ALA B 1 347 ? -48.628 24.637  46.482  1.00 68.96  ? 347 ALA B N     1 
ATOM   7873  C  CA    . ALA B 1 347 ? -49.180 25.411  47.583  1.00 67.54  ? 347 ALA B CA    1 
ATOM   7874  C  C     . ALA B 1 347 ? -48.373 25.191  48.841  1.00 67.26  ? 347 ALA B C     1 
ATOM   7875  O  O     . ALA B 1 347 ? -47.616 24.226  48.922  1.00 67.08  ? 347 ALA B O     1 
ATOM   7876  C  CB    . ALA B 1 347 ? -50.606 25.001  47.819  1.00 68.08  ? 347 ALA B CB    1 
ATOM   7877  N  N     . LEU B 1 348 ? -48.530 26.083  49.822  1.00 67.31  ? 348 LEU B N     1 
ATOM   7878  C  CA    . LEU B 1 348 ? -47.809 25.946  51.095  1.00 67.23  ? 348 LEU B CA    1 
ATOM   7879  C  C     . LEU B 1 348 ? -48.745 25.430  52.182  1.00 68.01  ? 348 LEU B C     1 
ATOM   7880  O  O     . LEU B 1 348 ? -49.947 25.305  51.965  1.00 68.42  ? 348 LEU B O     1 
ATOM   7881  C  CB    . LEU B 1 348 ? -47.197 27.275  51.552  1.00 64.59  ? 348 LEU B CB    1 
ATOM   7882  C  CG    . LEU B 1 348 ? -48.070 28.247  52.329  1.00 62.42  ? 348 LEU B CG    1 
ATOM   7883  C  CD1   . LEU B 1 348 ? -47.192 29.223  53.066  1.00 62.31  ? 348 LEU B CD1   1 
ATOM   7884  C  CD2   . LEU B 1 348 ? -49.004 28.955  51.387  1.00 62.56  ? 348 LEU B CD2   1 
ATOM   7885  N  N     . LEU B 1 349 ? -48.196 25.135  53.354  1.00 68.70  ? 349 LEU B N     1 
ATOM   7886  C  CA    . LEU B 1 349 ? -49.008 24.614  54.441  1.00 69.93  ? 349 LEU B CA    1 
ATOM   7887  C  C     . LEU B 1 349 ? -48.590 25.253  55.751  1.00 71.24  ? 349 LEU B C     1 
ATOM   7888  O  O     . LEU B 1 349 ? -48.136 24.567  56.662  1.00 72.12  ? 349 LEU B O     1 
ATOM   7889  C  CB    . LEU B 1 349 ? -48.837 23.097  54.524  1.00 70.41  ? 349 LEU B CB    1 
ATOM   7890  C  CG    . LEU B 1 349 ? -49.976 22.239  55.082  1.00 71.08  ? 349 LEU B CG    1 
ATOM   7891  C  CD1   . LEU B 1 349 ? -49.573 20.778  55.019  1.00 70.46  ? 349 LEU B CD1   1 
ATOM   7892  C  CD2   . LEU B 1 349 ? -50.286 22.628  56.500  1.00 71.18  ? 349 LEU B CD2   1 
ATOM   7893  N  N     . ARG B 1 350 ? -48.743 26.569  55.842  1.00 72.35  ? 350 ARG B N     1 
ATOM   7894  C  CA    . ARG B 1 350 ? -48.369 27.301  57.045  1.00 74.10  ? 350 ARG B CA    1 
ATOM   7895  C  C     . ARG B 1 350 ? -48.949 26.620  58.295  1.00 75.27  ? 350 ARG B C     1 
ATOM   7896  O  O     . ARG B 1 350 ? -50.157 26.612  58.497  1.00 76.33  ? 350 ARG B O     1 
ATOM   7897  C  CB    . ARG B 1 350 ? -48.865 28.753  56.927  1.00 74.06  ? 350 ARG B CB    1 
ATOM   7898  C  CG    . ARG B 1 350 ? -47.887 29.809  57.450  1.00 74.95  ? 350 ARG B CG    1 
ATOM   7899  C  CD    . ARG B 1 350 ? -48.220 31.217  56.950  1.00 74.08  ? 350 ARG B CD    1 
ATOM   7900  N  NE    . ARG B 1 350 ? -47.078 32.123  57.086  1.00 74.53  ? 350 ARG B NE    1 
ATOM   7901  C  CZ    . ARG B 1 350 ? -46.640 32.619  58.240  1.00 73.99  ? 350 ARG B CZ    1 
ATOM   7902  N  NH1   . ARG B 1 350 ? -45.586 33.430  58.269  1.00 73.18  ? 350 ARG B NH1   1 
ATOM   7903  N  NH2   . ARG B 1 350 ? -47.271 32.320  59.363  1.00 72.99  ? 350 ARG B NH2   1 
ATOM   7904  N  N     . LEU B 1 351 ? -48.089 26.026  59.118  1.00 76.59  ? 351 LEU B N     1 
ATOM   7905  C  CA    . LEU B 1 351 ? -48.537 25.362  60.339  1.00 78.43  ? 351 LEU B CA    1 
ATOM   7906  C  C     . LEU B 1 351 ? -48.002 26.048  61.577  1.00 80.06  ? 351 LEU B C     1 
ATOM   7907  O  O     . LEU B 1 351 ? -47.238 25.490  62.365  1.00 79.67  ? 351 LEU B O     1 
ATOM   7908  C  CB    . LEU B 1 351 ? -48.124 23.901  60.353  1.00 79.74  ? 351 LEU B CB    1 
ATOM   7909  C  CG    . LEU B 1 351 ? -48.930 23.057  59.378  1.00 81.96  ? 351 LEU B CG    1 
ATOM   7910  C  CD1   . LEU B 1 351 ? -48.494 21.599  59.492  1.00 82.71  ? 351 LEU B CD1   1 
ATOM   7911  C  CD2   . LEU B 1 351 ? -50.421 23.220  59.685  1.00 83.49  ? 351 LEU B CD2   1 
ATOM   7912  N  N     . ASP B 1 352 ? -48.414 27.292  61.705  1.00 82.14  ? 352 ASP B N     1 
ATOM   7913  C  CA    . ASP B 1 352 ? -48.075 28.153  62.812  1.00 83.82  ? 352 ASP B CA    1 
ATOM   7914  C  C     . ASP B 1 352 ? -49.418 28.855  63.031  1.00 85.27  ? 352 ASP B C     1 
ATOM   7915  O  O     . ASP B 1 352 ? -50.365 28.211  63.491  1.00 85.54  ? 352 ASP B O     1 
ATOM   7916  C  CB    . ASP B 1 352 ? -46.941 29.118  62.416  1.00 83.71  ? 352 ASP B CB    1 
ATOM   7917  C  CG    . ASP B 1 352 ? -47.147 29.760  61.045  1.00 84.42  ? 352 ASP B CG    1 
ATOM   7918  O  OD1   . ASP B 1 352 ? -47.766 29.142  60.148  1.00 84.48  ? 352 ASP B OD1   1 
ATOM   7919  O  OD2   . ASP B 1 352 ? -46.659 30.890  60.864  1.00 83.49  ? 352 ASP B OD2   1 
ATOM   7920  N  N     . GLY B 1 353 ? -49.538 30.127  62.652  1.00 86.28  ? 353 GLY B N     1 
ATOM   7921  C  CA    . GLY B 1 353 ? -50.800 30.823  62.849  1.00 86.30  ? 353 GLY B CA    1 
ATOM   7922  C  C     . GLY B 1 353 ? -51.461 31.476  61.646  1.00 86.48  ? 353 GLY B C     1 
ATOM   7923  O  O     . GLY B 1 353 ? -52.662 31.311  61.435  1.00 87.05  ? 353 GLY B O     1 
ATOM   7924  N  N     . ALA B 1 354 ? -50.696 32.223  60.857  1.00 86.52  ? 354 ALA B N     1 
ATOM   7925  C  CA    . ALA B 1 354 ? -51.256 32.909  59.693  1.00 86.98  ? 354 ALA B CA    1 
ATOM   7926  C  C     . ALA B 1 354 ? -51.622 31.966  58.552  1.00 87.09  ? 354 ALA B C     1 
ATOM   7927  O  O     . ALA B 1 354 ? -51.362 30.764  58.614  1.00 87.27  ? 354 ALA B O     1 
ATOM   7928  C  CB    . ALA B 1 354 ? -50.280 33.969  59.196  1.00 86.51  ? 354 ALA B CB    1 
ATOM   7929  N  N     . GLN B 1 355 ? -52.243 32.521  57.518  1.00 86.98  ? 355 GLN B N     1 
ATOM   7930  C  CA    . GLN B 1 355 ? -52.632 31.742  56.351  1.00 87.61  ? 355 GLN B CA    1 
ATOM   7931  C  C     . GLN B 1 355 ? -52.074 32.434  55.114  1.00 88.17  ? 355 GLN B C     1 
ATOM   7932  O  O     . GLN B 1 355 ? -52.336 33.613  54.877  1.00 88.13  ? 355 GLN B O     1 
ATOM   7933  C  CB    . GLN B 1 355 ? -54.150 31.642  56.261  1.00 86.66  ? 355 GLN B CB    1 
ATOM   7934  N  N     . GLY B 1 356 ? -51.293 31.703  54.329  1.00 88.90  ? 356 GLY B N     1 
ATOM   7935  C  CA    . GLY B 1 356 ? -50.716 32.293  53.136  1.00 89.66  ? 356 GLY B CA    1 
ATOM   7936  C  C     . GLY B 1 356 ? -49.203 32.404  53.202  1.00 89.78  ? 356 GLY B C     1 
ATOM   7937  O  O     . GLY B 1 356 ? -48.581 32.038  54.201  1.00 89.46  ? 356 GLY B O     1 
ATOM   7938  N  N     . TRP B 1 357 ? -48.613 32.928  52.135  1.00 89.91  ? 357 TRP B N     1 
ATOM   7939  C  CA    . TRP B 1 357 ? -47.171 33.075  52.055  1.00 91.08  ? 357 TRP B CA    1 
ATOM   7940  C  C     . TRP B 1 357 ? -46.670 34.385  52.635  1.00 91.64  ? 357 TRP B C     1 
ATOM   7941  O  O     . TRP B 1 357 ? -47.430 35.330  52.824  1.00 90.63  ? 357 TRP B O     1 
ATOM   7942  C  CB    . TRP B 1 357 ? -46.717 33.008  50.603  1.00 91.86  ? 357 TRP B CB    1 
ATOM   7943  C  CG    . TRP B 1 357 ? -47.422 31.995  49.807  1.00 93.03  ? 357 TRP B CG    1 
ATOM   7944  C  CD1   . TRP B 1 357 ? -48.740 31.988  49.483  1.00 93.74  ? 357 TRP B CD1   1 
ATOM   7945  C  CD2   . TRP B 1 357 ? -46.850 30.839  49.200  1.00 94.54  ? 357 TRP B CD2   1 
ATOM   7946  N  NE1   . TRP B 1 357 ? -49.032 30.897  48.706  1.00 94.95  ? 357 TRP B NE1   1 
ATOM   7947  C  CE2   . TRP B 1 357 ? -47.886 30.170  48.517  1.00 95.29  ? 357 TRP B CE2   1 
ATOM   7948  C  CE3   . TRP B 1 357 ? -45.557 30.297  49.164  1.00 95.80  ? 357 TRP B CE3   1 
ATOM   7949  C  CZ2   . TRP B 1 357 ? -47.676 28.985  47.802  1.00 96.88  ? 357 TRP B CZ2   1 
ATOM   7950  C  CZ3   . TRP B 1 357 ? -45.343 29.116  48.451  1.00 96.18  ? 357 TRP B CZ3   1 
ATOM   7951  C  CH2   . TRP B 1 357 ? -46.400 28.474  47.781  1.00 97.14  ? 357 TRP B CH2   1 
ATOM   7952  N  N     . PRO B 1 358 ? -45.372 34.445  52.947  1.00 93.08  ? 358 PRO B N     1 
ATOM   7953  C  CA    . PRO B 1 358 ? -44.819 35.681  53.496  1.00 95.05  ? 358 PRO B CA    1 
ATOM   7954  C  C     . PRO B 1 358 ? -44.729 36.659  52.329  1.00 96.53  ? 358 PRO B C     1 
ATOM   7955  O  O     . PRO B 1 358 ? -45.003 36.288  51.186  1.00 96.46  ? 358 PRO B O     1 
ATOM   7956  C  CB    . PRO B 1 358 ? -43.449 35.247  54.011  1.00 94.57  ? 358 PRO B CB    1 
ATOM   7957  C  CG    . PRO B 1 358 ? -43.672 33.813  54.377  1.00 93.60  ? 358 PRO B CG    1 
ATOM   7958  C  CD    . PRO B 1 358 ? -44.455 33.320  53.187  1.00 93.25  ? 358 PRO B CD    1 
ATOM   7959  N  N     . GLU B 1 359 ? -44.343 37.896  52.606  1.00 98.12  ? 359 GLU B N     1 
ATOM   7960  C  CA    . GLU B 1 359 ? -44.258 38.891  51.551  1.00 99.57  ? 359 GLU B CA    1 
ATOM   7961  C  C     . GLU B 1 359 ? -43.302 38.511  50.419  1.00 100.05 ? 359 GLU B C     1 
ATOM   7962  O  O     . GLU B 1 359 ? -43.702 38.397  49.262  1.00 99.85  ? 359 GLU B O     1 
ATOM   7963  C  CB    . GLU B 1 359 ? -43.854 40.246  52.144  1.00 100.33 ? 359 GLU B CB    1 
ATOM   7964  C  CG    . GLU B 1 359 ? -42.525 40.250  52.892  1.00 101.93 ? 359 GLU B CG    1 
ATOM   7965  C  CD    . GLU B 1 359 ? -42.050 41.652  53.225  1.00 102.38 ? 359 GLU B CD    1 
ATOM   7966  O  OE1   . GLU B 1 359 ? -41.952 42.473  52.287  1.00 103.12 ? 359 GLU B OE1   1 
ATOM   7967  O  OE2   . GLU B 1 359 ? -41.771 41.931  54.413  1.00 101.68 ? 359 GLU B OE2   1 
ATOM   7968  N  N     . PHE B 1 360 ? -42.042 38.297  50.770  1.00 100.90 ? 360 PHE B N     1 
ATOM   7969  C  CA    . PHE B 1 360 ? -40.984 37.971  49.816  1.00 101.98 ? 360 PHE B CA    1 
ATOM   7970  C  C     . PHE B 1 360 ? -41.064 36.603  49.144  1.00 101.97 ? 360 PHE B C     1 
ATOM   7971  O  O     . PHE B 1 360 ? -40.953 36.491  47.924  1.00 101.21 ? 360 PHE B O     1 
ATOM   7972  C  CB    . PHE B 1 360 ? -39.640 38.077  50.532  1.00 103.14 ? 360 PHE B CB    1 
ATOM   7973  C  CG    . PHE B 1 360 ? -39.502 37.105  51.668  1.00 104.22 ? 360 PHE B CG    1 
ATOM   7974  C  CD1   . PHE B 1 360 ? -38.732 35.953  51.528  1.00 104.79 ? 360 PHE B CD1   1 
ATOM   7975  C  CD2   . PHE B 1 360 ? -40.198 37.306  52.855  1.00 104.77 ? 360 PHE B CD2   1 
ATOM   7976  C  CE1   . PHE B 1 360 ? -38.668 35.008  52.547  1.00 105.35 ? 360 PHE B CE1   1 
ATOM   7977  C  CE2   . PHE B 1 360 ? -40.142 36.369  53.880  1.00 106.06 ? 360 PHE B CE2   1 
ATOM   7978  C  CZ    . PHE B 1 360 ? -39.372 35.217  53.727  1.00 105.97 ? 360 PHE B CZ    1 
ATOM   7979  N  N     . LEU B 1 361 ? -41.229 35.567  49.959  1.00 102.32 ? 361 LEU B N     1 
ATOM   7980  C  CA    . LEU B 1 361 ? -41.276 34.193  49.483  1.00 101.79 ? 361 LEU B CA    1 
ATOM   7981  C  C     . LEU B 1 361 ? -42.050 34.050  48.181  1.00 102.27 ? 361 LEU B C     1 
ATOM   7982  O  O     . LEU B 1 361 ? -41.677 33.254  47.322  1.00 101.96 ? 361 LEU B O     1 
ATOM   7983  C  CB    . LEU B 1 361 ? -41.867 33.296  50.570  1.00 100.99 ? 361 LEU B CB    1 
ATOM   7984  C  CG    . LEU B 1 361 ? -41.355 31.854  50.599  1.00 100.61 ? 361 LEU B CG    1 
ATOM   7985  C  CD1   . LEU B 1 361 ? -41.519 31.274  51.992  1.00 100.19 ? 361 LEU B CD1   1 
ATOM   7986  C  CD2   . LEU B 1 361 ? -42.095 31.025  49.571  1.00 100.64 ? 361 LEU B CD2   1 
ATOM   7987  N  N     . ARG B 1 362 ? -43.114 34.834  48.027  1.00 103.03 ? 362 ARG B N     1 
ATOM   7988  C  CA    . ARG B 1 362 ? -43.923 34.782  46.813  1.00 103.55 ? 362 ARG B CA    1 
ATOM   7989  C  C     . ARG B 1 362 ? -43.182 35.380  45.609  1.00 103.77 ? 362 ARG B C     1 
ATOM   7990  O  O     . ARG B 1 362 ? -43.341 34.907  44.479  1.00 104.31 ? 362 ARG B O     1 
ATOM   7991  C  CB    . ARG B 1 362 ? -45.246 35.508  47.035  1.00 102.89 ? 362 ARG B CB    1 
ATOM   7992  N  N     . ARG B 1 363 ? -42.377 36.415  45.847  1.00 103.34 ? 363 ARG B N     1 
ATOM   7993  C  CA    . ARG B 1 363 ? -41.615 37.042  44.765  1.00 102.96 ? 363 ARG B CA    1 
ATOM   7994  C  C     . ARG B 1 363 ? -40.567 36.059  44.275  1.00 102.62 ? 363 ARG B C     1 
ATOM   7995  O  O     . ARG B 1 363 ? -40.678 35.524  43.175  1.00 102.81 ? 363 ARG B O     1 
ATOM   7996  C  CB    . ARG B 1 363 ? -40.893 38.295  45.246  1.00 102.77 ? 363 ARG B CB    1 
ATOM   7997  C  CG    . ARG B 1 363 ? -41.450 38.878  46.500  1.00 102.39 ? 363 ARG B CG    1 
ATOM   7998  C  CD    . ARG B 1 363 ? -40.698 40.120  46.859  1.00 102.55 ? 363 ARG B CD    1 
ATOM   7999  N  NE    . ARG B 1 363 ? -41.140 40.619  48.149  1.00 103.78 ? 363 ARG B NE    1 
ATOM   8000  C  CZ    . ARG B 1 363 ? -40.472 41.510  48.872  1.00 104.13 ? 363 ARG B CZ    1 
ATOM   8001  N  NH1   . ARG B 1 363 ? -39.324 42.006  48.428  1.00 103.75 ? 363 ARG B NH1   1 
ATOM   8002  N  NH2   . ARG B 1 363 ? -40.950 41.895  50.046  1.00 104.13 ? 363 ARG B NH2   1 
ATOM   8003  N  N     . ALA B 1 364 ? -39.545 35.842  45.102  1.00 101.30 ? 364 ALA B N     1 
ATOM   8004  C  CA    . ALA B 1 364 ? -38.468 34.918  44.779  1.00 100.21 ? 364 ALA B CA    1 
ATOM   8005  C  C     . ALA B 1 364 ? -38.996 33.862  43.814  1.00 99.61  ? 364 ALA B C     1 
ATOM   8006  O  O     . ALA B 1 364 ? -38.381 33.578  42.778  1.00 99.06  ? 364 ALA B O     1 
ATOM   8007  C  CB    . ALA B 1 364 ? -37.959 34.266  46.050  1.00 100.30 ? 364 ALA B CB    1 
ATOM   8008  N  N     . LEU B 1 365 ? -40.153 33.302  44.160  1.00 98.85  ? 365 LEU B N     1 
ATOM   8009  C  CA    . LEU B 1 365 ? -40.808 32.293  43.337  1.00 98.68  ? 365 LEU B CA    1 
ATOM   8010  C  C     . LEU B 1 365 ? -41.193 32.854  41.955  1.00 99.01  ? 365 LEU B C     1 
ATOM   8011  O  O     . LEU B 1 365 ? -40.849 32.273  40.919  1.00 98.50  ? 365 LEU B O     1 
ATOM   8012  C  CB    . LEU B 1 365 ? -42.042 31.742  44.071  1.00 97.05  ? 365 LEU B CB    1 
ATOM   8013  C  CG    . LEU B 1 365 ? -41.833 30.573  45.049  1.00 95.17  ? 365 LEU B CG    1 
ATOM   8014  C  CD1   . LEU B 1 365 ? -41.274 29.377  44.297  1.00 94.87  ? 365 LEU B CD1   1 
ATOM   8015  C  CD2   . LEU B 1 365 ? -40.892 30.961  46.157  1.00 93.10  ? 365 LEU B CD2   1 
ATOM   8016  N  N     . LEU B 1 366 ? -41.910 33.975  41.936  1.00 99.47  ? 366 LEU B N     1 
ATOM   8017  C  CA    . LEU B 1 366 ? -42.293 34.608  40.674  1.00 99.82  ? 366 LEU B CA    1 
ATOM   8018  C  C     . LEU B 1 366 ? -41.037 35.117  39.959  1.00 99.40  ? 366 LEU B C     1 
ATOM   8019  O  O     . LEU B 1 366 ? -40.851 34.893  38.761  1.00 99.53  ? 366 LEU B O     1 
ATOM   8020  C  CB    . LEU B 1 366 ? -43.243 35.783  40.926  0.00 99.75  ? 366 LEU B CB    1 
ATOM   8021  C  CG    . LEU B 1 366 ? -44.748 35.510  41.008  0.00 99.87  ? 366 LEU B CG    1 
ATOM   8022  C  CD1   . LEU B 1 366 ? -45.227 34.962  39.674  0.00 99.88  ? 366 LEU B CD1   1 
ATOM   8023  C  CD2   . LEU B 1 366 ? -45.053 34.535  42.131  0.00 99.88  ? 366 LEU B CD2   1 
ATOM   8024  N  N     . ARG B 1 367 ? -40.184 35.800  40.718  1.00 98.45  ? 367 ARG B N     1 
ATOM   8025  C  CA    . ARG B 1 367 ? -38.934 36.366  40.217  1.00 97.33  ? 367 ARG B CA    1 
ATOM   8026  C  C     . ARG B 1 367 ? -38.137 35.353  39.409  1.00 96.27  ? 367 ARG B C     1 
ATOM   8027  O  O     . ARG B 1 367 ? -37.428 35.719  38.472  1.00 95.75  ? 367 ARG B O     1 
ATOM   8028  C  CB    . ARG B 1 367 ? -38.094 36.847  41.401  1.00 97.86  ? 367 ARG B CB    1 
ATOM   8029  C  CG    . ARG B 1 367 ? -36.870 37.666  41.056  1.00 98.49  ? 367 ARG B CG    1 
ATOM   8030  C  CD    . ARG B 1 367 ? -36.300 38.255  42.341  1.00 100.32 ? 367 ARG B CD    1 
ATOM   8031  N  NE    . ARG B 1 367 ? -35.338 39.329  42.108  1.00 102.77 ? 367 ARG B NE    1 
ATOM   8032  C  CZ    . ARG B 1 367 ? -34.025 39.161  41.964  1.00 103.76 ? 367 ARG B CZ    1 
ATOM   8033  N  NH1   . ARG B 1 367 ? -33.483 37.949  42.029  1.00 103.89 ? 367 ARG B NH1   1 
ATOM   8034  N  NH2   . ARG B 1 367 ? -33.248 40.217  41.752  1.00 104.27 ? 367 ARG B NH2   1 
ATOM   8035  N  N     . ALA B 1 368 ? -38.269 34.081  39.773  1.00 94.88  ? 368 ALA B N     1 
ATOM   8036  C  CA    . ALA B 1 368 ? -37.547 33.004  39.106  1.00 93.31  ? 368 ALA B CA    1 
ATOM   8037  C  C     . ALA B 1 368 ? -38.226 32.447  37.853  1.00 91.80  ? 368 ALA B C     1 
ATOM   8038  O  O     . ALA B 1 368 ? -37.557 32.153  36.855  1.00 91.28  ? 368 ALA B O     1 
ATOM   8039  C  CB    . ALA B 1 368 ? -37.286 31.876  40.096  1.00 93.53  ? 368 ALA B CB    1 
ATOM   8040  N  N     . PHE B 1 369 ? -39.547 32.298  37.897  1.00 89.90  ? 369 PHE B N     1 
ATOM   8041  C  CA    . PHE B 1 369 ? -40.266 31.756  36.748  1.00 87.86  ? 369 PHE B CA    1 
ATOM   8042  C  C     . PHE B 1 369 ? -40.298 32.685  35.539  1.00 86.78  ? 369 PHE B C     1 
ATOM   8043  O  O     . PHE B 1 369 ? -41.308 32.801  34.838  1.00 85.57  ? 369 PHE B O     1 
ATOM   8044  C  CB    . PHE B 1 369 ? -41.680 31.338  37.157  1.00 86.27  ? 369 PHE B CB    1 
ATOM   8045  C  CG    . PHE B 1 369 ? -41.717 30.041  37.901  1.00 83.73  ? 369 PHE B CG    1 
ATOM   8046  C  CD1   . PHE B 1 369 ? -41.397 29.989  39.255  1.00 82.48  ? 369 PHE B CD1   1 
ATOM   8047  C  CD2   . PHE B 1 369 ? -42.008 28.857  37.230  1.00 82.81  ? 369 PHE B CD2   1 
ATOM   8048  C  CE1   . PHE B 1 369 ? -41.357 28.775  39.931  1.00 81.94  ? 369 PHE B CE1   1 
ATOM   8049  C  CE2   . PHE B 1 369 ? -41.972 27.637  37.893  1.00 83.36  ? 369 PHE B CE2   1 
ATOM   8050  C  CZ    . PHE B 1 369 ? -41.645 27.595  39.251  1.00 82.60  ? 369 PHE B CZ    1 
ATOM   8051  N  N     . GLY B 1 370 ? -39.159 33.326  35.302  1.00 85.96  ? 370 GLY B N     1 
ATOM   8052  C  CA    . GLY B 1 370 ? -39.011 34.234  34.188  1.00 84.93  ? 370 GLY B CA    1 
ATOM   8053  C  C     . GLY B 1 370 ? -37.572 34.236  33.720  1.00 83.33  ? 370 GLY B C     1 
ATOM   8054  O  O     . GLY B 1 370 ? -36.927 33.190  33.692  1.00 82.23  ? 370 GLY B O     1 
ATOM   8055  N  N     . GLY B 1 373 ? -38.726 31.587  32.289  1.00 85.34  ? 373 GLY B N     1 
ATOM   8056  C  CA    . GLY B 1 373 ? -39.814 31.685  31.333  1.00 86.72  ? 373 GLY B CA    1 
ATOM   8057  C  C     . GLY B 1 373 ? -41.178 31.293  31.881  1.00 86.63  ? 373 GLY B C     1 
ATOM   8058  O  O     . GLY B 1 373 ? -41.914 32.143  32.392  1.00 86.52  ? 373 GLY B O     1 
ATOM   8059  N  N     . ALA B 1 374 ? -41.510 30.006  31.771  1.00 86.54  ? 374 ALA B N     1 
ATOM   8060  C  CA    . ALA B 1 374 ? -42.789 29.469  32.245  1.00 85.93  ? 374 ALA B CA    1 
ATOM   8061  C  C     . ALA B 1 374 ? -43.268 30.110  33.552  1.00 85.25  ? 374 ALA B C     1 
ATOM   8062  O  O     . ALA B 1 374 ? -42.496 30.762  34.265  1.00 84.55  ? 374 ALA B O     1 
ATOM   8063  C  CB    . ALA B 1 374 ? -42.693 27.950  32.407  1.00 85.81  ? 374 ALA B CB    1 
ATOM   8064  N  N     . SER B 1 375 ? -44.545 29.913  33.868  1.00 84.50  ? 375 SER B N     1 
ATOM   8065  C  CA    . SER B 1 375 ? -45.116 30.505  35.073  1.00 83.30  ? 375 SER B CA    1 
ATOM   8066  C  C     . SER B 1 375 ? -45.566 29.534  36.154  1.00 81.97  ? 375 SER B C     1 
ATOM   8067  O  O     . SER B 1 375 ? -45.741 28.333  35.928  1.00 81.08  ? 375 SER B O     1 
ATOM   8068  C  CB    . SER B 1 375 ? -46.286 31.414  34.712  1.00 83.66  ? 375 SER B CB    1 
ATOM   8069  O  OG    . SER B 1 375 ? -47.328 30.662  34.121  1.00 83.06  ? 375 SER B OG    1 
ATOM   8070  N  N     . LEU B 1 376 ? -45.784 30.108  37.330  1.00 80.52  ? 376 LEU B N     1 
ATOM   8071  C  CA    . LEU B 1 376 ? -46.170 29.380  38.518  1.00 79.05  ? 376 LEU B CA    1 
ATOM   8072  C  C     . LEU B 1 376 ? -47.585 29.696  38.966  1.00 79.84  ? 376 LEU B C     1 
ATOM   8073  O  O     . LEU B 1 376 ? -48.216 30.631  38.480  1.00 79.68  ? 376 LEU B O     1 
ATOM   8074  C  CB    . LEU B 1 376 ? -45.205 29.742  39.639  1.00 76.84  ? 376 LEU B CB    1 
ATOM   8075  C  CG    . LEU B 1 376 ? -45.315 28.976  40.944  1.00 75.86  ? 376 LEU B CG    1 
ATOM   8076  C  CD1   . LEU B 1 376 ? -44.901 27.534  40.715  1.00 76.42  ? 376 LEU B CD1   1 
ATOM   8077  C  CD2   . LEU B 1 376 ? -44.431 29.631  41.979  1.00 75.18  ? 376 LEU B CD2   1 
ATOM   8078  N  N     . ARG B 1 377 ? -48.062 28.899  39.915  1.00 80.91  ? 377 ARG B N     1 
ATOM   8079  C  CA    . ARG B 1 377 ? -49.389 29.051  40.496  1.00 81.50  ? 377 ARG B CA    1 
ATOM   8080  C  C     . ARG B 1 377 ? -49.245 28.722  41.981  1.00 81.97  ? 377 ARG B C     1 
ATOM   8081  O  O     . ARG B 1 377 ? -48.857 27.611  42.332  1.00 82.70  ? 377 ARG B O     1 
ATOM   8082  C  CB    . ARG B 1 377 ? -50.368 28.085  39.828  1.00 81.29  ? 377 ARG B CB    1 
ATOM   8083  N  N     . LEU B 1 378 ? -49.540 29.681  42.854  1.00 82.44  ? 378 LEU B N     1 
ATOM   8084  C  CA    . LEU B 1 378 ? -49.414 29.433  44.289  1.00 83.19  ? 378 LEU B CA    1 
ATOM   8085  C  C     . LEU B 1 378 ? -50.753 29.303  45.005  1.00 83.81  ? 378 LEU B C     1 
ATOM   8086  O  O     . LEU B 1 378 ? -51.545 30.245  45.045  1.00 84.01  ? 378 LEU B O     1 
ATOM   8087  C  CB    . LEU B 1 378 ? -48.593 30.538  44.960  1.00 82.78  ? 378 LEU B CB    1 
ATOM   8088  C  CG    . LEU B 1 378 ? -47.158 30.707  44.467  1.00 82.84  ? 378 LEU B CG    1 
ATOM   8089  C  CD1   . LEU B 1 378 ? -47.184 31.374  43.106  1.00 83.76  ? 378 LEU B CD1   1 
ATOM   8090  C  CD2   . LEU B 1 378 ? -46.360 31.550  45.449  1.00 82.56  ? 378 LEU B CD2   1 
ATOM   8091  N  N     . HIS B 1 379 ? -50.998 28.127  45.574  1.00 84.21  ? 379 HIS B N     1 
ATOM   8092  C  CA    . HIS B 1 379 ? -52.228 27.873  46.307  1.00 84.50  ? 379 HIS B CA    1 
ATOM   8093  C  C     . HIS B 1 379 ? -51.902 27.849  47.793  1.00 84.52  ? 379 HIS B C     1 
ATOM   8094  O  O     . HIS B 1 379 ? -50.803 28.214  48.202  1.00 84.21  ? 379 HIS B O     1 
ATOM   8095  C  CB    . HIS B 1 379 ? -52.825 26.524  45.909  1.00 85.10  ? 379 HIS B CB    1 
ATOM   8096  C  CG    . HIS B 1 379 ? -52.977 26.339  44.433  1.00 86.57  ? 379 HIS B CG    1 
ATOM   8097  N  ND1   . HIS B 1 379 ? -53.486 27.320  43.609  1.00 87.57  ? 379 HIS B ND1   1 
ATOM   8098  C  CD2   . HIS B 1 379 ? -52.732 25.271  43.638  1.00 87.63  ? 379 HIS B CD2   1 
ATOM   8099  C  CE1   . HIS B 1 379 ? -53.548 26.863  42.371  1.00 87.92  ? 379 HIS B CE1   1 
ATOM   8100  N  NE2   . HIS B 1 379 ? -53.097 25.621  42.361  1.00 87.78  ? 379 HIS B NE2   1 
ATOM   8101  N  N     . THR B 1 380 ? -52.862 27.412  48.597  1.00 84.86  ? 380 THR B N     1 
ATOM   8102  C  CA    . THR B 1 380 ? -52.663 27.317  50.038  1.00 85.60  ? 380 THR B CA    1 
ATOM   8103  C  C     . THR B 1 380 ? -53.585 26.242  50.583  1.00 86.71  ? 380 THR B C     1 
ATOM   8104  O  O     . THR B 1 380 ? -54.787 26.276  50.337  1.00 86.83  ? 380 THR B O     1 
ATOM   8105  C  CB    . THR B 1 380 ? -52.993 28.648  50.768  1.00 84.84  ? 380 THR B CB    1 
ATOM   8106  O  OG1   . THR B 1 380 ? -52.176 29.699  50.243  1.00 83.60  ? 380 THR B OG1   1 
ATOM   8107  C  CG2   . THR B 1 380 ? -52.738 28.517  52.272  1.00 82.64  ? 380 THR B CG2   1 
ATOM   8108  N  N     . LEU B 1 381 ? -53.014 25.276  51.296  1.00 88.19  ? 381 LEU B N     1 
ATOM   8109  C  CA    . LEU B 1 381 ? -53.801 24.207  51.902  1.00 90.22  ? 381 LEU B CA    1 
ATOM   8110  C  C     . LEU B 1 381 ? -54.406 24.817  53.155  1.00 92.29  ? 381 LEU B C     1 
ATOM   8111  O  O     . LEU B 1 381 ? -53.675 25.225  54.064  1.00 92.92  ? 381 LEU B O     1 
ATOM   8112  C  CB    . LEU B 1 381 ? -52.912 23.023  52.289  1.00 89.30  ? 381 LEU B CB    1 
ATOM   8113  C  CG    . LEU B 1 381 ? -52.271 22.226  51.153  1.00 88.55  ? 381 LEU B CG    1 
ATOM   8114  C  CD1   . LEU B 1 381 ? -51.461 21.075  51.723  1.00 86.84  ? 381 LEU B CD1   1 
ATOM   8115  C  CD2   . LEU B 1 381 ? -53.356 21.699  50.232  1.00 88.66  ? 381 LEU B CD2   1 
ATOM   8116  N  N     . HIS B 1 382 ? -55.734 24.877  53.216  1.00 93.93  ? 382 HIS B N     1 
ATOM   8117  C  CA    . HIS B 1 382 ? -56.390 25.491  54.366  1.00 94.85  ? 382 HIS B CA    1 
ATOM   8118  C  C     . HIS B 1 382 ? -56.683 24.645  55.607  1.00 94.28  ? 382 HIS B C     1 
ATOM   8119  O  O     . HIS B 1 382 ? -56.959 25.194  56.674  1.00 93.86  ? 382 HIS B O     1 
ATOM   8120  C  CB    . HIS B 1 382 ? -57.661 26.216  53.904  1.00 96.20  ? 382 HIS B CB    1 
ATOM   8121  C  CG    . HIS B 1 382 ? -57.422 27.651  53.548  1.00 97.68  ? 382 HIS B CG    1 
ATOM   8122  N  ND1   . HIS B 1 382 ? -58.444 28.535  53.269  1.00 98.22  ? 382 HIS B ND1   1 
ATOM   8123  C  CD2   . HIS B 1 382 ? -56.274 28.364  53.461  1.00 98.27  ? 382 HIS B CD2   1 
ATOM   8124  C  CE1   . HIS B 1 382 ? -57.934 29.730  53.030  1.00 98.93  ? 382 HIS B CE1   1 
ATOM   8125  N  NE2   . HIS B 1 382 ? -56.619 29.655  53.140  1.00 98.97  ? 382 HIS B NE2   1 
ATOM   8126  N  N     . ALA B 1 383 ? -56.604 23.325  55.483  1.00 93.58  ? 383 ALA B N     1 
ATOM   8127  C  CA    . ALA B 1 383 ? -56.861 22.445  56.616  1.00 92.79  ? 383 ALA B CA    1 
ATOM   8128  C  C     . ALA B 1 383 ? -55.620 22.355  57.490  1.00 92.55  ? 383 ALA B C     1 
ATOM   8129  O  O     . ALA B 1 383 ? -54.510 22.533  57.019  1.00 92.72  ? 383 ALA B O     1 
ATOM   8130  C  CB    . ALA B 1 383 ? -57.229 21.050  56.118  1.00 91.35  ? 383 ALA B CB    1 
ATOM   8131  N  N     . HIS B 1 384 ? -55.783 22.147  58.784  1.00 93.47  ? 384 HIS B N     1 
ATOM   8132  C  CA    . HIS B 1 384 ? -54.585 21.942  59.568  1.00 94.14  ? 384 HIS B CA    1 
ATOM   8133  C  C     . HIS B 1 384 ? -54.647 20.439  59.409  1.00 94.47  ? 384 HIS B C     1 
ATOM   8134  O  O     . HIS B 1 384 ? -55.645 19.897  58.947  1.00 95.63  ? 384 HIS B O     1 
ATOM   8135  C  CB    . HIS B 1 384 ? -54.743 22.348  60.988  1.00 93.71  ? 384 HIS B CB    1 
ATOM   8136  N  N     . PRO B 1 385 ? -53.601 19.733  59.794  1.00 93.77  ? 385 PRO B N     1 
ATOM   8137  C  CA    . PRO B 1 385 ? -53.590 18.271  59.634  1.00 92.59  ? 385 PRO B CA    1 
ATOM   8138  C  C     . PRO B 1 385 ? -54.270 17.310  60.613  1.00 91.49  ? 385 PRO B C     1 
ATOM   8139  O  O     . PRO B 1 385 ? -54.376 16.108  60.336  1.00 91.15  ? 385 PRO B O     1 
ATOM   8140  C  CB    . PRO B 1 385 ? -52.095 17.971  59.472  1.00 92.91  ? 385 PRO B CB    1 
ATOM   8141  C  CG    . PRO B 1 385 ? -51.528 19.329  58.981  1.00 93.70  ? 385 PRO B CG    1 
ATOM   8142  C  CD    . PRO B 1 385 ? -52.238 20.263  59.874  1.00 94.02  ? 385 PRO B CD    1 
ATOM   8143  N  N     . SER B 1 386 ? -54.741 17.827  61.741  1.00 90.41  ? 386 SER B N     1 
ATOM   8144  C  CA    . SER B 1 386 ? -55.418 16.999  62.734  1.00 89.02  ? 386 SER B CA    1 
ATOM   8145  C  C     . SER B 1 386 ? -56.922 17.138  62.529  1.00 87.91  ? 386 SER B C     1 
ATOM   8146  O  O     . SER B 1 386 ? -57.685 17.345  63.467  1.00 87.66  ? 386 SER B O     1 
ATOM   8147  C  CB    . SER B 1 386 ? -55.020 17.433  64.135  1.00 88.10  ? 386 SER B CB    1 
ATOM   8148  N  N     . GLN B 1 387 ? -57.312 17.044  61.265  1.00 86.92  ? 387 GLN B N     1 
ATOM   8149  C  CA    . GLN B 1 387 ? -58.691 17.128  60.822  1.00 85.53  ? 387 GLN B CA    1 
ATOM   8150  C  C     . GLN B 1 387 ? -58.790 15.998  59.793  1.00 84.93  ? 387 GLN B C     1 
ATOM   8151  O  O     . GLN B 1 387 ? -59.196 16.204  58.647  1.00 84.63  ? 387 GLN B O     1 
ATOM   8152  C  CB    . GLN B 1 387 ? -58.951 18.485  60.172  1.00 85.05  ? 387 GLN B CB    1 
ATOM   8153  N  N     . GLY B 1 388 ? -58.375 14.810  60.239  1.00 83.90  ? 388 GLY B N     1 
ATOM   8154  C  CA    . GLY B 1 388 ? -58.366 13.595  59.436  1.00 82.75  ? 388 GLY B CA    1 
ATOM   8155  C  C     . GLY B 1 388 ? -59.092 13.577  58.105  1.00 82.55  ? 388 GLY B C     1 
ATOM   8156  O  O     . GLY B 1 388 ? -58.497 13.258  57.073  1.00 82.77  ? 388 GLY B O     1 
ATOM   8157  N  N     . LEU B 1 389 ? -60.380 13.903  58.129  1.00 81.42  ? 389 LEU B N     1 
ATOM   8158  C  CA    . LEU B 1 389 ? -61.210 13.919  56.931  1.00 79.93  ? 389 LEU B CA    1 
ATOM   8159  C  C     . LEU B 1 389 ? -61.073 15.241  56.181  1.00 79.48  ? 389 LEU B C     1 
ATOM   8160  O  O     . LEU B 1 389 ? -61.117 15.274  54.951  1.00 80.01  ? 389 LEU B O     1 
ATOM   8161  C  CB    . LEU B 1 389 ? -62.672 13.705  57.332  1.00 79.76  ? 389 LEU B CB    1 
ATOM   8162  C  CG    . LEU B 1 389 ? -63.848 13.592  56.353  1.00 79.03  ? 389 LEU B CG    1 
ATOM   8163  C  CD1   . LEU B 1 389 ? -65.088 13.494  57.202  1.00 78.96  ? 389 LEU B CD1   1 
ATOM   8164  C  CD2   . LEU B 1 389 ? -63.977 14.781  55.409  1.00 78.67  ? 389 LEU B CD2   1 
ATOM   8165  N  N     . ALA B 1 390 ? -60.918 16.330  56.925  1.00 78.67  ? 390 ALA B N     1 
ATOM   8166  C  CA    . ALA B 1 390 ? -60.796 17.656  56.329  1.00 78.59  ? 390 ALA B CA    1 
ATOM   8167  C  C     . ALA B 1 390 ? -59.518 17.796  55.522  1.00 79.39  ? 390 ALA B C     1 
ATOM   8168  O  O     . ALA B 1 390 ? -59.540 18.149  54.339  1.00 79.09  ? 390 ALA B O     1 
ATOM   8169  C  CB    . ALA B 1 390 ? -60.836 18.713  57.416  1.00 77.62  ? 390 ALA B CB    1 
ATOM   8170  N  N     . PHE B 1 391 ? -58.401 17.521  56.180  1.00 80.54  ? 391 PHE B N     1 
ATOM   8171  C  CA    . PHE B 1 391 ? -57.094 17.614  55.555  1.00 81.38  ? 391 PHE B CA    1 
ATOM   8172  C  C     . PHE B 1 391 ? -57.046 16.783  54.282  1.00 81.27  ? 391 PHE B C     1 
ATOM   8173  O  O     . PHE B 1 391 ? -56.721 17.288  53.215  1.00 80.86  ? 391 PHE B O     1 
ATOM   8174  C  CB    . PHE B 1 391 ? -56.023 17.130  56.537  1.00 82.76  ? 391 PHE B CB    1 
ATOM   8175  C  CG    . PHE B 1 391 ? -54.607 17.293  56.039  1.00 83.73  ? 391 PHE B CG    1 
ATOM   8176  C  CD1   . PHE B 1 391 ? -54.023 18.554  55.933  1.00 83.20  ? 391 PHE B CD1   1 
ATOM   8177  C  CD2   . PHE B 1 391 ? -53.860 16.180  55.672  1.00 83.81  ? 391 PHE B CD2   1 
ATOM   8178  C  CE1   . PHE B 1 391 ? -52.721 18.697  55.468  1.00 82.18  ? 391 PHE B CE1   1 
ATOM   8179  C  CE2   . PHE B 1 391 ? -52.557 16.318  55.207  1.00 83.01  ? 391 PHE B CE2   1 
ATOM   8180  C  CZ    . PHE B 1 391 ? -51.990 17.575  55.103  1.00 82.48  ? 391 PHE B CZ    1 
ATOM   8181  N  N     . ARG B 1 392 ? -57.379 15.507  54.393  1.00 82.22  ? 392 ARG B N     1 
ATOM   8182  C  CA    . ARG B 1 392 ? -57.348 14.629  53.234  1.00 84.22  ? 392 ARG B CA    1 
ATOM   8183  C  C     . ARG B 1 392 ? -58.205 15.158  52.078  1.00 83.52  ? 392 ARG B C     1 
ATOM   8184  O  O     . ARG B 1 392 ? -57.921 14.888  50.906  1.00 83.64  ? 392 ARG B O     1 
ATOM   8185  C  CB    . ARG B 1 392 ? -57.828 13.239  53.623  1.00 87.26  ? 392 ARG B CB    1 
ATOM   8186  C  CG    . ARG B 1 392 ? -59.321 13.144  53.684  1.00 93.18  ? 392 ARG B CG    1 
ATOM   8187  C  CD    . ARG B 1 392 ? -59.764 11.740  53.958  1.00 98.06  ? 392 ARG B CD    1 
ATOM   8188  N  NE    . ARG B 1 392 ? -58.728 10.740  53.720  1.00 102.12 ? 392 ARG B NE    1 
ATOM   8189  C  CZ    . ARG B 1 392 ? -58.989 9.496   53.330  1.00 103.90 ? 392 ARG B CZ    1 
ATOM   8190  N  NH1   . ARG B 1 392 ? -60.249 9.120   53.126  1.00 104.31 ? 392 ARG B NH1   1 
ATOM   8191  N  NH2   . ARG B 1 392 ? -58.002 8.621   53.170  1.00 105.02 ? 392 ARG B NH2   1 
ATOM   8192  N  N     . GLU B 1 393 ? -59.258 15.898  52.407  1.00 82.43  ? 393 GLU B N     1 
ATOM   8193  C  CA    . GLU B 1 393 ? -60.125 16.452  51.382  1.00 81.20  ? 393 GLU B CA    1 
ATOM   8194  C  C     . GLU B 1 393 ? -59.412 17.644  50.760  1.00 80.69  ? 393 GLU B C     1 
ATOM   8195  O  O     . GLU B 1 393 ? -59.436 17.822  49.547  1.00 80.08  ? 393 GLU B O     1 
ATOM   8196  C  CB    . GLU B 1 393 ? -61.452 16.877  51.987  1.00 81.28  ? 393 GLU B CB    1 
ATOM   8197  N  N     . ALA B 1 394 ? -58.767 18.455  51.595  1.00 80.57  ? 394 ALA B N     1 
ATOM   8198  C  CA    . ALA B 1 394 ? -58.033 19.620  51.107  1.00 80.47  ? 394 ALA B CA    1 
ATOM   8199  C  C     . ALA B 1 394 ? -56.903 19.168  50.185  1.00 80.95  ? 394 ALA B C     1 
ATOM   8200  O  O     . ALA B 1 394 ? -56.567 19.854  49.218  1.00 80.90  ? 394 ALA B O     1 
ATOM   8201  C  CB    . ALA B 1 394 ? -57.466 20.411  52.272  1.00 79.52  ? 394 ALA B CB    1 
ATOM   8202  N  N     . LEU B 1 395 ? -56.324 18.007  50.493  1.00 81.41  ? 395 LEU B N     1 
ATOM   8203  C  CA    . LEU B 1 395 ? -55.233 17.441  49.701  1.00 80.48  ? 395 LEU B CA    1 
ATOM   8204  C  C     . LEU B 1 395 ? -55.737 16.915  48.387  1.00 79.82  ? 395 LEU B C     1 
ATOM   8205  O  O     . LEU B 1 395 ? -55.193 17.231  47.339  1.00 79.43  ? 395 LEU B O     1 
ATOM   8206  C  CB    . LEU B 1 395 ? -54.570 16.300  50.447  1.00 81.05  ? 395 LEU B CB    1 
ATOM   8207  C  CG    . LEU B 1 395 ? -53.810 16.763  51.675  1.00 82.44  ? 395 LEU B CG    1 
ATOM   8208  C  CD1   . LEU B 1 395 ? -53.576 15.569  52.521  1.00 82.25  ? 395 LEU B CD1   1 
ATOM   8209  C  CD2   . LEU B 1 395 ? -52.504 17.448  51.293  1.00 83.29  ? 395 LEU B CD2   1 
ATOM   8210  N  N     . ARG B 1 396 ? -56.768 16.088  48.446  1.00 80.02  ? 396 ARG B N     1 
ATOM   8211  C  CA    . ARG B 1 396 ? -57.338 15.543  47.227  1.00 80.84  ? 396 ARG B CA    1 
ATOM   8212  C  C     . ARG B 1 396 ? -57.674 16.720  46.298  1.00 80.02  ? 396 ARG B C     1 
ATOM   8213  O  O     . ARG B 1 396 ? -57.654 16.587  45.070  1.00 79.93  ? 396 ARG B O     1 
ATOM   8214  C  CB    . ARG B 1 396 ? -58.602 14.744  47.551  1.00 82.86  ? 396 ARG B CB    1 
ATOM   8215  C  CG    . ARG B 1 396 ? -59.075 13.849  46.422  1.00 84.46  ? 396 ARG B CG    1 
ATOM   8216  C  CD    . ARG B 1 396 ? -60.574 13.650  46.479  1.00 86.72  ? 396 ARG B CD    1 
ATOM   8217  N  NE    . ARG B 1 396 ? -61.290 14.881  46.154  1.00 89.17  ? 396 ARG B NE    1 
ATOM   8218  C  CZ    . ARG B 1 396 ? -62.615 14.986  46.082  1.00 91.07  ? 396 ARG B CZ    1 
ATOM   8219  N  NH1   . ARG B 1 396 ? -63.386 13.931  46.312  1.00 91.78  ? 396 ARG B NH1   1 
ATOM   8220  N  NH2   . ARG B 1 396 ? -63.176 16.151  45.780  1.00 91.80  ? 396 ARG B NH2   1 
ATOM   8221  N  N     . LYS B 1 397 ? -57.974 17.874  46.894  1.00 78.93  ? 397 LYS B N     1 
ATOM   8222  C  CA    . LYS B 1 397 ? -58.299 19.074  46.129  1.00 77.94  ? 397 LYS B CA    1 
ATOM   8223  C  C     . LYS B 1 397 ? -57.040 19.642  45.482  1.00 78.46  ? 397 LYS B C     1 
ATOM   8224  O  O     . LYS B 1 397 ? -57.054 20.027  44.314  1.00 79.11  ? 397 LYS B O     1 
ATOM   8225  C  CB    . LYS B 1 397 ? -58.930 20.140  47.030  1.00 76.76  ? 397 LYS B CB    1 
ATOM   8226  C  CG    . LYS B 1 397 ? -59.254 21.440  46.308  1.00 75.16  ? 397 LYS B CG    1 
ATOM   8227  C  CD    . LYS B 1 397 ? -59.949 22.436  47.220  0.00 75.80  ? 397 LYS B CD    1 
ATOM   8228  C  CE    . LYS B 1 397 ? -60.322 23.698  46.459  0.00 75.70  ? 397 LYS B CE    1 
ATOM   8229  N  NZ    . LYS B 1 397 ? -60.935 24.725  47.345  0.00 75.81  ? 397 LYS B NZ    1 
ATOM   8230  N  N     . ALA B 1 398 ? -55.950 19.696  46.244  1.00 78.03  ? 398 ALA B N     1 
ATOM   8231  C  CA    . ALA B 1 398 ? -54.685 20.212  45.731  1.00 76.29  ? 398 ALA B CA    1 
ATOM   8232  C  C     . ALA B 1 398 ? -54.129 19.291  44.639  1.00 75.84  ? 398 ALA B C     1 
ATOM   8233  O  O     . ALA B 1 398 ? -53.491 19.752  43.694  1.00 75.45  ? 398 ALA B O     1 
ATOM   8234  C  CB    . ALA B 1 398 ? -53.692 20.356  46.860  1.00 75.47  ? 398 ALA B CB    1 
ATOM   8235  N  N     . LYS B 1 399 ? -54.357 17.987  44.768  1.00 75.55  ? 399 LYS B N     1 
ATOM   8236  C  CA    . LYS B 1 399 ? -53.888 17.067  43.741  1.00 75.12  ? 399 LYS B CA    1 
ATOM   8237  C  C     . LYS B 1 399 ? -54.618 17.509  42.495  1.00 74.53  ? 399 LYS B C     1 
ATOM   8238  O  O     . LYS B 1 399 ? -54.015 17.724  41.448  1.00 75.77  ? 399 LYS B O     1 
ATOM   8239  C  CB    . LYS B 1 399 ? -54.269 15.611  44.053  1.00 75.17  ? 399 LYS B CB    1 
ATOM   8240  C  CG    . LYS B 1 399 ? -53.099 14.713  44.471  1.00 75.36  ? 399 LYS B CG    1 
ATOM   8241  C  CD    . LYS B 1 399 ? -52.786 14.825  45.961  1.00 74.95  ? 399 LYS B CD    1 
ATOM   8242  C  CE    . LYS B 1 399 ? -53.892 14.208  46.817  1.00 75.39  ? 399 LYS B CE    1 
ATOM   8243  N  NZ    . LYS B 1 399 ? -54.100 12.751  46.554  1.00 74.92  ? 399 LYS B NZ    1 
ATOM   8244  N  N     . GLU B 1 400 ? -55.927 17.670  42.629  1.00 73.39  ? 400 GLU B N     1 
ATOM   8245  C  CA    . GLU B 1 400 ? -56.757 18.083  41.512  1.00 73.24  ? 400 GLU B CA    1 
ATOM   8246  C  C     . GLU B 1 400 ? -56.296 19.397  40.889  1.00 72.55  ? 400 GLU B C     1 
ATOM   8247  O  O     . GLU B 1 400 ? -56.289 19.536  39.667  1.00 71.31  ? 400 GLU B O     1 
ATOM   8248  C  CB    . GLU B 1 400 ? -58.200 18.193  41.961  1.00 74.08  ? 400 GLU B CB    1 
ATOM   8249  N  N     . GLU B 1 401 ? -55.913 20.354  41.729  1.00 72.83  ? 401 GLU B N     1 
ATOM   8250  C  CA    . GLU B 1 401 ? -55.454 21.657  41.254  1.00 74.29  ? 401 GLU B CA    1 
ATOM   8251  C  C     . GLU B 1 401 ? -54.062 21.563  40.644  1.00 74.06  ? 401 GLU B C     1 
ATOM   8252  O  O     . GLU B 1 401 ? -53.454 22.586  40.296  1.00 74.34  ? 401 GLU B O     1 
ATOM   8253  C  CB    . GLU B 1 401 ? -55.428 22.669  42.400  1.00 76.55  ? 401 GLU B CB    1 
ATOM   8254  C  CG    . GLU B 1 401 ? -56.786 23.022  42.961  1.00 80.34  ? 401 GLU B CG    1 
ATOM   8255  C  CD    . GLU B 1 401 ? -56.690 23.748  44.289  1.00 83.03  ? 401 GLU B CD    1 
ATOM   8256  O  OE1   . GLU B 1 401 ? -56.212 23.127  45.268  1.00 83.70  ? 401 GLU B OE1   1 
ATOM   8257  O  OE2   . GLU B 1 401 ? -57.090 24.935  44.352  1.00 85.33  ? 401 GLU B OE2   1 
ATOM   8258  N  N     . GLY B 1 402 ? -53.560 20.333  40.538  1.00 72.62  ? 402 GLY B N     1 
ATOM   8259  C  CA    . GLY B 1 402 ? -52.249 20.100  39.963  1.00 71.32  ? 402 GLY B CA    1 
ATOM   8260  C  C     . GLY B 1 402 ? -51.045 20.489  40.807  1.00 70.92  ? 402 GLY B C     1 
ATOM   8261  O  O     . GLY B 1 402 ? -49.956 20.700  40.261  1.00 70.41  ? 402 GLY B O     1 
ATOM   8262  N  N     . VAL B 1 403 ? -51.219 20.605  42.122  1.00 69.57  ? 403 VAL B N     1 
ATOM   8263  C  CA    . VAL B 1 403 ? -50.083 20.951  42.969  1.00 68.07  ? 403 VAL B CA    1 
ATOM   8264  C  C     . VAL B 1 403 ? -49.118 19.791  42.819  1.00 67.31  ? 403 VAL B C     1 
ATOM   8265  O  O     . VAL B 1 403 ? -49.545 18.654  42.598  1.00 66.01  ? 403 VAL B O     1 
ATOM   8266  C  CB    . VAL B 1 403 ? -50.485 21.110  44.452  1.00 67.72  ? 403 VAL B CB    1 
ATOM   8267  C  CG1   . VAL B 1 403 ? -49.246 21.285  45.322  1.00 65.79  ? 403 VAL B CG1   1 
ATOM   8268  C  CG2   . VAL B 1 403 ? -51.395 22.312  44.604  1.00 67.29  ? 403 VAL B CG2   1 
ATOM   8269  N  N     . GLN B 1 404 ? -47.822 20.079  42.913  1.00 66.98  ? 404 GLN B N     1 
ATOM   8270  C  CA    . GLN B 1 404 ? -46.810 19.040  42.759  1.00 66.77  ? 404 GLN B CA    1 
ATOM   8271  C  C     . GLN B 1 404 ? -45.854 18.979  43.944  1.00 65.34  ? 404 GLN B C     1 
ATOM   8272  O  O     . GLN B 1 404 ? -45.022 18.078  44.030  1.00 65.62  ? 404 GLN B O     1 
ATOM   8273  C  CB    . GLN B 1 404 ? -46.007 19.270  41.476  1.00 67.95  ? 404 GLN B CB    1 
ATOM   8274  C  CG    . GLN B 1 404 ? -45.653 17.993  40.746  1.00 71.45  ? 404 GLN B CG    1 
ATOM   8275  C  CD    . GLN B 1 404 ? -46.850 17.387  40.025  1.00 74.82  ? 404 GLN B CD    1 
ATOM   8276  O  OE1   . GLN B 1 404 ? -46.800 16.249  39.553  1.00 76.55  ? 404 GLN B OE1   1 
ATOM   8277  N  NE2   . GLN B 1 404 ? -47.932 18.153  39.926  1.00 76.65  ? 404 GLN B NE2   1 
ATOM   8278  N  N     . ALA B 1 405 ? -45.968 19.936  44.856  1.00 63.01  ? 405 ALA B N     1 
ATOM   8279  C  CA    . ALA B 1 405 ? -45.094 19.960  46.012  1.00 61.12  ? 405 ALA B CA    1 
ATOM   8280  C  C     . ALA B 1 405 ? -45.616 20.931  47.040  1.00 60.70  ? 405 ALA B C     1 
ATOM   8281  O  O     . ALA B 1 405 ? -46.199 21.962  46.709  1.00 60.15  ? 405 ALA B O     1 
ATOM   8282  C  CB    . ALA B 1 405 ? -43.696 20.347  45.598  1.00 62.43  ? 405 ALA B CB    1 
ATOM   8283  N  N     . VAL B 1 406 ? -45.388 20.601  48.300  1.00 60.04  ? 406 VAL B N     1 
ATOM   8284  C  CA    . VAL B 1 406 ? -45.866 21.428  49.384  1.00 59.39  ? 406 VAL B CA    1 
ATOM   8285  C  C     . VAL B 1 406 ? -44.716 21.954  50.195  1.00 58.63  ? 406 VAL B C     1 
ATOM   8286  O  O     . VAL B 1 406 ? -43.793 21.223  50.534  1.00 57.72  ? 406 VAL B O     1 
ATOM   8287  C  CB    . VAL B 1 406 ? -46.832 20.629  50.322  1.00 60.27  ? 406 VAL B CB    1 
ATOM   8288  C  CG1   . VAL B 1 406 ? -47.244 21.483  51.522  1.00 58.17  ? 406 VAL B CG1   1 
ATOM   8289  C  CG2   . VAL B 1 406 ? -48.071 20.164  49.535  1.00 59.51  ? 406 VAL B CG2   1 
ATOM   8290  N  N     . LEU B 1 407 ? -44.789 23.241  50.490  1.00 59.15  ? 407 LEU B N     1 
ATOM   8291  C  CA    . LEU B 1 407 ? -43.792 23.919  51.292  1.00 60.34  ? 407 LEU B CA    1 
ATOM   8292  C  C     . LEU B 1 407 ? -44.364 24.051  52.701  1.00 61.82  ? 407 LEU B C     1 
ATOM   8293  O  O     . LEU B 1 407 ? -45.107 24.990  52.992  1.00 64.35  ? 407 LEU B O     1 
ATOM   8294  C  CB    . LEU B 1 407 ? -43.526 25.309  50.726  1.00 59.58  ? 407 LEU B CB    1 
ATOM   8295  C  CG    . LEU B 1 407 ? -42.616 26.174  51.595  1.00 59.02  ? 407 LEU B CG    1 
ATOM   8296  C  CD1   . LEU B 1 407 ? -41.189 25.653  51.492  1.00 60.71  ? 407 LEU B CD1   1 
ATOM   8297  C  CD2   . LEU B 1 407 ? -42.695 27.622  51.145  1.00 58.53  ? 407 LEU B CD2   1 
ATOM   8298  N  N     . VAL B 1 408 ? -44.027 23.117  53.579  1.00 61.84  ? 408 VAL B N     1 
ATOM   8299  C  CA    . VAL B 1 408 ? -44.543 23.163  54.941  1.00 61.76  ? 408 VAL B CA    1 
ATOM   8300  C  C     . VAL B 1 408 ? -43.834 24.210  55.800  1.00 62.10  ? 408 VAL B C     1 
ATOM   8301  O  O     . VAL B 1 408 ? -42.642 24.104  56.083  1.00 61.47  ? 408 VAL B O     1 
ATOM   8302  C  CB    . VAL B 1 408 ? -44.432 21.781  55.599  1.00 61.24  ? 408 VAL B CB    1 
ATOM   8303  C  CG1   . VAL B 1 408 ? -45.308 21.719  56.842  1.00 60.62  ? 408 VAL B CG1   1 
ATOM   8304  C  CG2   . VAL B 1 408 ? -44.822 20.703  54.589  1.00 60.33  ? 408 VAL B CG2   1 
ATOM   8305  N  N     . LEU B 1 409 ? -44.587 25.220  56.214  1.00 63.13  ? 409 LEU B N     1 
ATOM   8306  C  CA    . LEU B 1 409 ? -44.048 26.303  57.028  1.00 65.73  ? 409 LEU B CA    1 
ATOM   8307  C  C     . LEU B 1 409 ? -44.417 26.133  58.517  1.00 66.90  ? 409 LEU B C     1 
ATOM   8308  O  O     . LEU B 1 409 ? -45.463 26.605  58.950  1.00 66.63  ? 409 LEU B O     1 
ATOM   8309  C  CB    . LEU B 1 409 ? -44.595 27.620  56.483  1.00 65.30  ? 409 LEU B CB    1 
ATOM   8310  C  CG    . LEU B 1 409 ? -43.652 28.812  56.357  1.00 64.96  ? 409 LEU B CG    1 
ATOM   8311  C  CD1   . LEU B 1 409 ? -44.209 29.770  55.327  1.00 64.32  ? 409 LEU B CD1   1 
ATOM   8312  C  CD2   . LEU B 1 409 ? -43.481 29.494  57.703  1.00 65.94  ? 409 LEU B CD2   1 
ATOM   8313  N  N     . THR B 1 410 ? -43.548 25.475  59.292  1.00 68.73  ? 410 THR B N     1 
ATOM   8314  C  CA    . THR B 1 410 ? -43.800 25.211  60.722  1.00 69.51  ? 410 THR B CA    1 
ATOM   8315  C  C     . THR B 1 410 ? -42.602 25.479  61.625  1.00 69.87  ? 410 THR B C     1 
ATOM   8316  O  O     . THR B 1 410 ? -41.497 25.678  61.151  1.00 69.18  ? 410 THR B O     1 
ATOM   8317  C  CB    . THR B 1 410 ? -44.176 23.732  60.976  1.00 70.09  ? 410 THR B CB    1 
ATOM   8318  O  OG1   . THR B 1 410 ? -42.982 22.970  61.218  1.00 67.26  ? 410 THR B OG1   1 
ATOM   8319  C  CG2   . THR B 1 410 ? -44.904 23.148  59.771  1.00 71.62  ? 410 THR B CG2   1 
ATOM   8320  N  N     . PRO B 1 411 ? -42.819 25.478  62.951  1.00 71.58  ? 411 PRO B N     1 
ATOM   8321  C  CA    . PRO B 1 411 ? -41.759 25.711  63.941  1.00 73.25  ? 411 PRO B CA    1 
ATOM   8322  C  C     . PRO B 1 411 ? -40.949 24.431  64.113  1.00 74.82  ? 411 PRO B C     1 
ATOM   8323  O  O     . PRO B 1 411 ? -41.468 23.335  63.882  1.00 75.49  ? 411 PRO B O     1 
ATOM   8324  C  CB    . PRO B 1 411 ? -42.532 26.051  65.216  1.00 72.58  ? 411 PRO B CB    1 
ATOM   8325  C  CG    . PRO B 1 411 ? -43.836 26.563  64.714  1.00 72.86  ? 411 PRO B CG    1 
ATOM   8326  C  CD    . PRO B 1 411 ? -44.139 25.615  63.585  1.00 72.70  ? 411 PRO B CD    1 
ATOM   8327  N  N     . PRO B 1 412 ? -39.678 24.550  64.538  1.00 75.29  ? 412 PRO B N     1 
ATOM   8328  C  CA    . PRO B 1 412 ? -38.812 23.383  64.733  1.00 75.39  ? 412 PRO B CA    1 
ATOM   8329  C  C     . PRO B 1 412 ? -39.567 22.140  65.199  1.00 75.90  ? 412 PRO B C     1 
ATOM   8330  O  O     . PRO B 1 412 ? -39.751 21.933  66.394  1.00 76.32  ? 412 PRO B O     1 
ATOM   8331  C  CB    . PRO B 1 412 ? -37.811 23.880  65.761  1.00 75.02  ? 412 PRO B CB    1 
ATOM   8332  C  CG    . PRO B 1 412 ? -37.612 25.308  65.320  1.00 75.51  ? 412 PRO B CG    1 
ATOM   8333  C  CD    . PRO B 1 412 ? -39.022 25.779  65.028  1.00 75.12  ? 412 PRO B CD    1 
ATOM   8334  N  N     . MET B 1 413 ? -39.998 21.316  64.246  1.00 76.04  ? 413 MET B N     1 
ATOM   8335  C  CA    . MET B 1 413 ? -40.736 20.100  64.559  1.00 76.76  ? 413 MET B CA    1 
ATOM   8336  C  C     . MET B 1 413 ? -39.868 19.036  65.193  1.00 77.19  ? 413 MET B C     1 
ATOM   8337  O  O     . MET B 1 413 ? -38.667 18.995  64.967  1.00 77.92  ? 413 MET B O     1 
ATOM   8338  C  CB    . MET B 1 413 ? -41.368 19.523  63.303  1.00 77.40  ? 413 MET B CB    1 
ATOM   8339  C  CG    . MET B 1 413 ? -42.413 20.408  62.687  1.00 79.95  ? 413 MET B CG    1 
ATOM   8340  S  SD    . MET B 1 413 ? -43.269 19.509  61.408  1.00 84.81  ? 413 MET B SD    1 
ATOM   8341  C  CE    . MET B 1 413 ? -42.070 19.558  60.112  1.00 82.98  ? 413 MET B CE    1 
ATOM   8342  N  N     . ALA B 1 414 ? -40.487 18.174  65.991  1.00 78.09  ? 414 ALA B N     1 
ATOM   8343  C  CA    . ALA B 1 414 ? -39.771 17.093  66.654  1.00 78.63  ? 414 ALA B CA    1 
ATOM   8344  C  C     . ALA B 1 414 ? -39.621 15.956  65.662  1.00 79.36  ? 414 ALA B C     1 
ATOM   8345  O  O     . ALA B 1 414 ? -40.576 15.580  64.988  1.00 79.33  ? 414 ALA B O     1 
ATOM   8346  C  CB    . ALA B 1 414 ? -40.540 16.624  67.872  1.00 78.76  ? 414 ALA B CB    1 
ATOM   8347  N  N     . TRP B 1 415 ? -38.414 15.414  65.579  1.00 80.99  ? 415 TRP B N     1 
ATOM   8348  C  CA    . TRP B 1 415 ? -38.110 14.329  64.657  1.00 82.48  ? 415 TRP B CA    1 
ATOM   8349  C  C     . TRP B 1 415 ? -39.278 13.383  64.344  1.00 82.44  ? 415 TRP B C     1 
ATOM   8350  O  O     . TRP B 1 415 ? -39.790 13.386  63.232  1.00 82.58  ? 415 TRP B O     1 
ATOM   8351  C  CB    . TRP B 1 415 ? -36.902 13.539  65.182  1.00 84.18  ? 415 TRP B CB    1 
ATOM   8352  C  CG    . TRP B 1 415 ? -36.542 12.325  64.359  1.00 86.80  ? 415 TRP B CG    1 
ATOM   8353  C  CD1   . TRP B 1 415 ? -37.191 11.116  64.343  1.00 87.44  ? 415 TRP B CD1   1 
ATOM   8354  C  CD2   . TRP B 1 415 ? -35.444 12.200  63.441  1.00 87.32  ? 415 TRP B CD2   1 
ATOM   8355  N  NE1   . TRP B 1 415 ? -36.564 10.252  63.475  1.00 87.74  ? 415 TRP B NE1   1 
ATOM   8356  C  CE2   . TRP B 1 415 ? -35.493 10.892  62.908  1.00 87.63  ? 415 TRP B CE2   1 
ATOM   8357  C  CE3   . TRP B 1 415 ? -34.428 13.066  63.016  1.00 87.11  ? 415 TRP B CE3   1 
ATOM   8358  C  CZ2   . TRP B 1 415 ? -34.558 10.430  61.975  1.00 87.97  ? 415 TRP B CZ2   1 
ATOM   8359  C  CZ3   . TRP B 1 415 ? -33.499 12.603  62.088  1.00 87.55  ? 415 TRP B CZ3   1 
ATOM   8360  C  CH2   . TRP B 1 415 ? -33.573 11.299  61.578  1.00 87.54  ? 415 TRP B CH2   1 
ATOM   8361  N  N     . GLU B 1 416 ? -39.703 12.587  65.320  1.00 82.79  ? 416 GLU B N     1 
ATOM   8362  C  CA    . GLU B 1 416 ? -40.786 11.621  65.116  1.00 82.75  ? 416 GLU B CA    1 
ATOM   8363  C  C     . GLU B 1 416 ? -41.984 12.096  64.311  1.00 82.37  ? 416 GLU B C     1 
ATOM   8364  O  O     . GLU B 1 416 ? -42.541 11.343  63.511  1.00 81.86  ? 416 GLU B O     1 
ATOM   8365  C  CB    . GLU B 1 416 ? -41.295 11.087  66.458  1.00 83.60  ? 416 GLU B CB    1 
ATOM   8366  C  CG    . GLU B 1 416 ? -40.649 9.784   66.901  1.00 85.40  ? 416 GLU B CG    1 
ATOM   8367  C  CD    . GLU B 1 416 ? -39.231 9.971   67.401  1.00 86.59  ? 416 GLU B CD    1 
ATOM   8368  O  OE1   . GLU B 1 416 ? -39.061 10.727  68.382  1.00 87.28  ? 416 GLU B OE1   1 
ATOM   8369  O  OE2   . GLU B 1 416 ? -38.294 9.368   66.821  1.00 86.29  ? 416 GLU B OE2   1 
ATOM   8370  N  N     . ASP B 1 417 ? -42.400 13.335  64.526  1.00 81.92  ? 417 ASP B N     1 
ATOM   8371  C  CA    . ASP B 1 417 ? -43.555 13.833  63.807  1.00 81.36  ? 417 ASP B CA    1 
ATOM   8372  C  C     . ASP B 1 417 ? -43.231 14.458  62.469  1.00 79.40  ? 417 ASP B C     1 
ATOM   8373  O  O     . ASP B 1 417 ? -44.131 14.743  61.674  1.00 79.75  ? 417 ASP B O     1 
ATOM   8374  C  CB    . ASP B 1 417 ? -44.339 14.797  64.692  1.00 84.21  ? 417 ASP B CB    1 
ATOM   8375  C  CG    . ASP B 1 417 ? -45.301 14.064  65.618  1.00 87.14  ? 417 ASP B CG    1 
ATOM   8376  O  OD1   . ASP B 1 417 ? -46.235 13.408  65.093  1.00 88.88  ? 417 ASP B OD1   1 
ATOM   8377  O  OD2   . ASP B 1 417 ? -45.121 14.128  66.857  1.00 87.44  ? 417 ASP B OD2   1 
ATOM   8378  N  N     . ARG B 1 418 ? -41.944 14.662  62.211  1.00 75.95  ? 418 ARG B N     1 
ATOM   8379  C  CA    . ARG B 1 418 ? -41.533 15.227  60.939  1.00 72.09  ? 418 ARG B CA    1 
ATOM   8380  C  C     . ARG B 1 418 ? -41.691 14.118  59.910  1.00 68.25  ? 418 ARG B C     1 
ATOM   8381  O  O     . ARG B 1 418 ? -42.169 14.344  58.801  1.00 67.06  ? 418 ARG B O     1 
ATOM   8382  C  CB    . ARG B 1 418 ? -40.072 15.679  60.976  1.00 73.73  ? 418 ARG B CB    1 
ATOM   8383  C  CG    . ARG B 1 418 ? -39.704 16.584  59.800  1.00 75.83  ? 418 ARG B CG    1 
ATOM   8384  C  CD    . ARG B 1 418 ? -38.345 16.261  59.184  1.00 76.57  ? 418 ARG B CD    1 
ATOM   8385  N  NE    . ARG B 1 418 ? -38.274 14.905  58.642  1.00 75.64  ? 418 ARG B NE    1 
ATOM   8386  C  CZ    . ARG B 1 418 ? -37.427 14.531  57.685  1.00 75.47  ? 418 ARG B CZ    1 
ATOM   8387  N  NH1   . ARG B 1 418 ? -36.586 15.419  57.162  1.00 74.63  ? 418 ARG B NH1   1 
ATOM   8388  N  NH2   . ARG B 1 418 ? -37.412 13.272  57.258  1.00 73.61  ? 418 ARG B NH2   1 
ATOM   8389  N  N     . ASN B 1 419 ? -41.288 12.914  60.293  1.00 64.39  ? 419 ASN B N     1 
ATOM   8390  C  CA    . ASN B 1 419 ? -41.386 11.769  59.405  1.00 62.76  ? 419 ASN B CA    1 
ATOM   8391  C  C     . ASN B 1 419 ? -42.857 11.473  59.156  1.00 62.02  ? 419 ASN B C     1 
ATOM   8392  O  O     . ASN B 1 419 ? -43.282 11.191  58.033  1.00 61.45  ? 419 ASN B O     1 
ATOM   8393  C  CB    . ASN B 1 419 ? -40.717 10.542  60.035  1.00 61.80  ? 419 ASN B CB    1 
ATOM   8394  C  CG    . ASN B 1 419 ? -39.279 10.808  60.467  1.00 61.30  ? 419 ASN B CG    1 
ATOM   8395  O  OD1   . ASN B 1 419 ? -39.031 11.589  61.381  1.00 60.46  ? 419 ASN B OD1   1 
ATOM   8396  N  ND2   . ASN B 1 419 ? -38.328 10.152  59.808  1.00 61.30  ? 419 ASN B ND2   1 
ATOM   8397  N  N     . ARG B 1 420 ? -43.629 11.546  60.230  1.00 61.58  ? 420 ARG B N     1 
ATOM   8398  C  CA    . ARG B 1 420 ? -45.058 11.290  60.183  1.00 60.14  ? 420 ARG B CA    1 
ATOM   8399  C  C     . ARG B 1 420 ? -45.680 12.178  59.115  1.00 59.01  ? 420 ARG B C     1 
ATOM   8400  O  O     . ARG B 1 420 ? -46.250 11.693  58.137  1.00 57.83  ? 420 ARG B O     1 
ATOM   8401  C  CB    . ARG B 1 420 ? -45.658 11.598  61.557  1.00 60.90  ? 420 ARG B CB    1 
ATOM   8402  C  CG    . ARG B 1 420 ? -47.021 10.990  61.826  1.00 60.78  ? 420 ARG B CG    1 
ATOM   8403  C  CD    . ARG B 1 420 ? -47.403 11.167  63.295  1.00 60.43  ? 420 ARG B CD    1 
ATOM   8404  N  NE    . ARG B 1 420 ? -46.377 10.601  64.162  1.00 62.14  ? 420 ARG B NE    1 
ATOM   8405  C  CZ    . ARG B 1 420 ? -46.034 9.313   64.187  1.00 63.60  ? 420 ARG B CZ    1 
ATOM   8406  N  NH1   . ARG B 1 420 ? -46.637 8.426   63.399  1.00 62.45  ? 420 ARG B NH1   1 
ATOM   8407  N  NH2   . ARG B 1 420 ? -45.054 8.915   64.987  1.00 65.48  ? 420 ARG B NH2   1 
ATOM   8408  N  N     . LEU B 1 421 ? -45.542 13.485  59.314  1.00 58.26  ? 421 LEU B N     1 
ATOM   8409  C  CA    . LEU B 1 421 ? -46.078 14.496  58.406  1.00 58.09  ? 421 LEU B CA    1 
ATOM   8410  C  C     . LEU B 1 421 ? -45.662 14.304  56.951  1.00 57.23  ? 421 LEU B C     1 
ATOM   8411  O  O     . LEU B 1 421 ? -46.479 14.406  56.043  1.00 55.95  ? 421 LEU B O     1 
ATOM   8412  C  CB    . LEU B 1 421 ? -45.639 15.884  58.876  1.00 59.30  ? 421 LEU B CB    1 
ATOM   8413  C  CG    . LEU B 1 421 ? -46.170 17.100  58.114  1.00 59.56  ? 421 LEU B CG    1 
ATOM   8414  C  CD1   . LEU B 1 421 ? -47.684 17.084  58.154  1.00 59.66  ? 421 LEU B CD1   1 
ATOM   8415  C  CD2   . LEU B 1 421 ? -45.630 18.390  58.741  1.00 59.54  ? 421 LEU B CD2   1 
ATOM   8416  N  N     . LYS B 1 422 ? -44.381 14.048  56.732  1.00 57.89  ? 422 LYS B N     1 
ATOM   8417  C  CA    . LYS B 1 422 ? -43.876 13.846  55.384  1.00 58.09  ? 422 LYS B CA    1 
ATOM   8418  C  C     . LYS B 1 422 ? -44.409 12.558  54.781  1.00 58.66  ? 422 LYS B C     1 
ATOM   8419  O  O     . LYS B 1 422 ? -44.738 12.519  53.597  1.00 59.71  ? 422 LYS B O     1 
ATOM   8420  C  CB    . LYS B 1 422 ? -42.348 13.820  55.384  1.00 57.65  ? 422 LYS B CB    1 
ATOM   8421  C  CG    . LYS B 1 422 ? -41.700 15.189  55.300  1.00 57.25  ? 422 LYS B CG    1 
ATOM   8422  C  CD    . LYS B 1 422 ? -40.188 15.090  55.376  1.00 55.76  ? 422 LYS B CD    1 
ATOM   8423  C  CE    . LYS B 1 422 ? -39.532 16.393  54.969  1.00 56.11  ? 422 LYS B CE    1 
ATOM   8424  N  NZ    . LYS B 1 422 ? -39.691 16.630  53.505  1.00 54.52  ? 422 LYS B NZ    1 
ATOM   8425  N  N     . ALA B 1 423 ? -44.494 11.505  55.590  1.00 58.57  ? 423 ALA B N     1 
ATOM   8426  C  CA    . ALA B 1 423 ? -44.994 10.224  55.102  1.00 58.35  ? 423 ALA B CA    1 
ATOM   8427  C  C     . ALA B 1 423 ? -46.465 10.344  54.709  1.00 58.20  ? 423 ALA B C     1 
ATOM   8428  O  O     . ALA B 1 423 ? -46.886 9.852   53.661  1.00 56.02  ? 423 ALA B O     1 
ATOM   8429  C  CB    . ALA B 1 423 ? -44.819 9.161   56.165  1.00 58.31  ? 423 ALA B CB    1 
ATOM   8430  N  N     . LEU B 1 424 ? -47.241 11.004  55.561  1.00 59.73  ? 424 LEU B N     1 
ATOM   8431  C  CA    . LEU B 1 424 ? -48.659 11.205  55.295  1.00 61.28  ? 424 LEU B CA    1 
ATOM   8432  C  C     . LEU B 1 424 ? -48.818 11.899  53.944  1.00 61.55  ? 424 LEU B C     1 
ATOM   8433  O  O     . LEU B 1 424 ? -49.604 11.468  53.099  1.00 62.24  ? 424 LEU B O     1 
ATOM   8434  C  CB    . LEU B 1 424 ? -49.284 12.058  56.402  1.00 61.60  ? 424 LEU B CB    1 
ATOM   8435  C  CG    . LEU B 1 424 ? -50.780 12.362  56.275  1.00 62.72  ? 424 LEU B CG    1 
ATOM   8436  C  CD1   . LEU B 1 424 ? -51.558 11.065  56.034  1.00 63.19  ? 424 LEU B CD1   1 
ATOM   8437  C  CD2   . LEU B 1 424 ? -51.262 13.063  57.546  1.00 63.40  ? 424 LEU B CD2   1 
ATOM   8438  N  N     . LEU B 1 425 ? -48.052 12.969  53.751  1.00 61.38  ? 425 LEU B N     1 
ATOM   8439  C  CA    . LEU B 1 425 ? -48.076 13.742  52.514  1.00 60.59  ? 425 LEU B CA    1 
ATOM   8440  C  C     . LEU B 1 425 ? -47.593 12.928  51.314  1.00 61.55  ? 425 LEU B C     1 
ATOM   8441  O  O     . LEU B 1 425 ? -48.169 13.002  50.234  1.00 60.42  ? 425 LEU B O     1 
ATOM   8442  C  CB    . LEU B 1 425 ? -47.210 14.991  52.676  1.00 58.12  ? 425 LEU B CB    1 
ATOM   8443  C  CG    . LEU B 1 425 ? -47.857 16.084  53.518  1.00 56.80  ? 425 LEU B CG    1 
ATOM   8444  C  CD1   . LEU B 1 425 ? -46.819 17.054  54.010  1.00 57.85  ? 425 LEU B CD1   1 
ATOM   8445  C  CD2   . LEU B 1 425 ? -48.902 16.781  52.687  1.00 54.87  ? 425 LEU B CD2   1 
ATOM   8446  N  N     . LEU B 1 426 ? -46.537 12.146  51.512  1.00 63.00  ? 426 LEU B N     1 
ATOM   8447  C  CA    . LEU B 1 426 ? -45.972 11.330  50.445  1.00 63.98  ? 426 LEU B CA    1 
ATOM   8448  C  C     . LEU B 1 426 ? -46.991 10.358  49.847  1.00 65.08  ? 426 LEU B C     1 
ATOM   8449  O  O     . LEU B 1 426 ? -47.271 10.424  48.654  1.00 65.56  ? 426 LEU B O     1 
ATOM   8450  C  CB    . LEU B 1 426 ? -44.743 10.565  50.960  1.00 63.80  ? 426 LEU B CB    1 
ATOM   8451  C  CG    . LEU B 1 426 ? -43.394 10.704  50.229  1.00 63.15  ? 426 LEU B CG    1 
ATOM   8452  C  CD1   . LEU B 1 426 ? -43.363 9.886   48.936  1.00 62.57  ? 426 LEU B CD1   1 
ATOM   8453  C  CD2   . LEU B 1 426 ? -43.144 12.173  49.948  1.00 62.99  ? 426 LEU B CD2   1 
ATOM   8454  N  N     . ARG B 1 427 ? -47.540 9.454   50.659  1.00 66.61  ? 427 ARG B N     1 
ATOM   8455  C  CA    . ARG B 1 427 ? -48.524 8.494   50.157  1.00 67.15  ? 427 ARG B CA    1 
ATOM   8456  C  C     . ARG B 1 427 ? -49.609 9.249   49.372  1.00 67.31  ? 427 ARG B C     1 
ATOM   8457  O  O     . ARG B 1 427 ? -49.979 8.834   48.276  1.00 66.36  ? 427 ARG B O     1 
ATOM   8458  C  CB    . ARG B 1 427 ? -49.153 7.713   51.315  1.00 68.38  ? 427 ARG B CB    1 
ATOM   8459  C  CG    . ARG B 1 427 ? -48.168 7.004   52.234  1.00 70.05  ? 427 ARG B CG    1 
ATOM   8460  C  CD    . ARG B 1 427 ? -48.889 6.617   53.518  1.00 72.63  ? 427 ARG B CD    1 
ATOM   8461  N  NE    . ARG B 1 427 ? -48.009 6.570   54.687  1.00 74.56  ? 427 ARG B NE    1 
ATOM   8462  C  CZ    . ARG B 1 427 ? -48.302 7.123   55.867  1.00 74.43  ? 427 ARG B CZ    1 
ATOM   8463  N  NH1   . ARG B 1 427 ? -49.452 7.768   56.035  1.00 74.19  ? 427 ARG B NH1   1 
ATOM   8464  N  NH2   . ARG B 1 427 ? -47.447 7.039   56.881  1.00 71.99  ? 427 ARG B NH2   1 
ATOM   8465  N  N     . GLU B 1 428 ? -50.101 10.364  49.921  1.00 67.78  ? 428 GLU B N     1 
ATOM   8466  C  CA    . GLU B 1 428 ? -51.120 11.179  49.246  1.00 68.07  ? 428 GLU B CA    1 
ATOM   8467  C  C     . GLU B 1 428 ? -50.516 11.809  47.981  1.00 69.42  ? 428 GLU B C     1 
ATOM   8468  O  O     . GLU B 1 428 ? -51.149 12.634  47.318  1.00 70.29  ? 428 GLU B O     1 
ATOM   8469  C  CB    . GLU B 1 428 ? -51.633 12.286  50.169  1.00 66.27  ? 428 GLU B CB    1 
ATOM   8470  C  CG    . GLU B 1 428 ? -52.103 11.797  51.519  0.00 67.06  ? 428 GLU B CG    1 
ATOM   8471  C  CD    . GLU B 1 428 ? -52.305 12.932  52.489  0.00 66.96  ? 428 GLU B CD    1 
ATOM   8472  O  OE1   . GLU B 1 428 ? -51.532 13.911  52.407  0.00 67.07  ? 428 GLU B OE1   1 
ATOM   8473  O  OE2   . GLU B 1 428 ? -53.219 12.847  53.337  0.00 67.07  ? 428 GLU B OE2   1 
ATOM   8474  N  N     . GLY B 1 429 ? -49.277 11.424  47.676  1.00 70.35  ? 429 GLY B N     1 
ATOM   8475  C  CA    . GLY B 1 429 ? -48.575 11.899  46.491  1.00 70.72  ? 429 GLY B CA    1 
ATOM   8476  C  C     . GLY B 1 429 ? -48.017 13.314  46.420  1.00 71.56  ? 429 GLY B C     1 
ATOM   8477  O  O     . GLY B 1 429 ? -47.863 13.833  45.320  1.00 72.16  ? 429 GLY B O     1 
ATOM   8478  N  N     . LEU B 1 430 ? -47.688 13.938  47.550  1.00 72.06  ? 430 LEU B N     1 
ATOM   8479  C  CA    . LEU B 1 430 ? -47.168 15.311  47.521  1.00 71.43  ? 430 LEU B CA    1 
ATOM   8480  C  C     . LEU B 1 430 ? -45.879 15.578  48.302  1.00 70.18  ? 430 LEU B C     1 
ATOM   8481  O  O     . LEU B 1 430 ? -45.908 15.737  49.524  1.00 70.97  ? 430 LEU B O     1 
ATOM   8482  C  CB    . LEU B 1 430 ? -48.225 16.292  48.027  1.00 72.79  ? 430 LEU B CB    1 
ATOM   8483  C  CG    . LEU B 1 430 ? -49.621 16.228  47.418  1.00 74.58  ? 430 LEU B CG    1 
ATOM   8484  C  CD1   . LEU B 1 430 ? -50.517 15.281  48.223  1.00 75.28  ? 430 LEU B CD1   1 
ATOM   8485  C  CD2   . LEU B 1 430 ? -50.202 17.627  47.431  1.00 76.42  ? 430 LEU B CD2   1 
ATOM   8486  N  N     . PRO B 1 431 ? -44.735 15.659  47.600  1.00 67.97  ? 431 PRO B N     1 
ATOM   8487  C  CA    . PRO B 1 431 ? -43.446 15.919  48.246  1.00 66.05  ? 431 PRO B CA    1 
ATOM   8488  C  C     . PRO B 1 431 ? -43.584 17.124  49.168  1.00 64.72  ? 431 PRO B C     1 
ATOM   8489  O  O     . PRO B 1 431 ? -44.501 17.931  49.010  1.00 63.96  ? 431 PRO B O     1 
ATOM   8490  C  CB    . PRO B 1 431 ? -42.531 16.200  47.065  1.00 66.28  ? 431 PRO B CB    1 
ATOM   8491  C  CG    . PRO B 1 431 ? -43.085 15.298  46.012  1.00 66.35  ? 431 PRO B CG    1 
ATOM   8492  C  CD    . PRO B 1 431 ? -44.569 15.520  46.143  1.00 67.01  ? 431 PRO B CD    1 
ATOM   8493  N  N     . SER B 1 432 ? -42.674 17.256  50.123  1.00 63.18  ? 432 SER B N     1 
ATOM   8494  C  CA    . SER B 1 432 ? -42.756 18.367  51.062  1.00 61.84  ? 432 SER B CA    1 
ATOM   8495  C  C     . SER B 1 432 ? -41.406 18.950  51.473  1.00 61.22  ? 432 SER B C     1 
ATOM   8496  O  O     . SER B 1 432 ? -40.460 18.215  51.758  1.00 62.24  ? 432 SER B O     1 
ATOM   8497  C  CB    . SER B 1 432 ? -43.534 17.911  52.303  1.00 61.55  ? 432 SER B CB    1 
ATOM   8498  O  OG    . SER B 1 432 ? -43.217 16.565  52.638  1.00 59.77  ? 432 SER B OG    1 
ATOM   8499  N  N     . GLN B 1 433 ? -41.324 20.276  51.498  1.00 59.36  ? 433 GLN B N     1 
ATOM   8500  C  CA    . GLN B 1 433 ? -40.100 20.964  51.885  1.00 58.80  ? 433 GLN B CA    1 
ATOM   8501  C  C     . GLN B 1 433 ? -40.392 21.741  53.138  1.00 60.08  ? 433 GLN B C     1 
ATOM   8502  O  O     . GLN B 1 433 ? -41.290 22.560  53.153  1.00 61.20  ? 433 GLN B O     1 
ATOM   8503  C  CB    . GLN B 1 433 ? -39.651 21.928  50.786  1.00 56.47  ? 433 GLN B CB    1 
ATOM   8504  C  CG    . GLN B 1 433 ? -38.517 22.877  51.180  1.00 53.61  ? 433 GLN B CG    1 
ATOM   8505  C  CD    . GLN B 1 433 ? -37.249 22.161  51.636  1.00 51.59  ? 433 GLN B CD    1 
ATOM   8506  O  OE1   . GLN B 1 433 ? -36.747 21.258  50.965  1.00 48.70  ? 433 GLN B OE1   1 
ATOM   8507  N  NE2   . GLN B 1 433 ? -36.723 22.577  52.781  1.00 50.15  ? 433 GLN B NE2   1 
ATOM   8508  N  N     . ILE B 1 434 ? -39.629 21.491  54.190  1.00 63.37  ? 434 ILE B N     1 
ATOM   8509  C  CA    . ILE B 1 434 ? -39.834 22.183  55.459  1.00 66.95  ? 434 ILE B CA    1 
ATOM   8510  C  C     . ILE B 1 434 ? -38.937 23.412  55.648  1.00 69.03  ? 434 ILE B C     1 
ATOM   8511  O  O     . ILE B 1 434 ? -37.747 23.385  55.330  1.00 68.82  ? 434 ILE B O     1 
ATOM   8512  C  CB    . ILE B 1 434 ? -39.577 21.230  56.665  1.00 67.48  ? 434 ILE B CB    1 
ATOM   8513  C  CG1   . ILE B 1 434 ? -40.563 20.056  56.652  1.00 67.10  ? 434 ILE B CG1   1 
ATOM   8514  C  CG2   . ILE B 1 434 ? -39.669 22.014  57.972  1.00 66.16  ? 434 ILE B CG2   1 
ATOM   8515  C  CD1   . ILE B 1 434 ? -41.978 20.453  56.978  1.00 68.91  ? 434 ILE B CD1   1 
ATOM   8516  N  N     . LEU B 1 435 ? -39.523 24.485  56.170  1.00 71.88  ? 435 LEU B N     1 
ATOM   8517  C  CA    . LEU B 1 435 ? -38.787 25.716  56.461  1.00 75.07  ? 435 LEU B CA    1 
ATOM   8518  C  C     . LEU B 1 435 ? -39.260 26.197  57.821  1.00 77.10  ? 435 LEU B C     1 
ATOM   8519  O  O     . LEU B 1 435 ? -40.404 26.630  57.968  1.00 77.17  ? 435 LEU B O     1 
ATOM   8520  C  CB    . LEU B 1 435 ? -39.058 26.807  55.419  1.00 75.26  ? 435 LEU B CB    1 
ATOM   8521  C  CG    . LEU B 1 435 ? -38.436 28.176  55.749  1.00 74.90  ? 435 LEU B CG    1 
ATOM   8522  C  CD1   . LEU B 1 435 ? -36.918 28.058  55.828  1.00 73.75  ? 435 LEU B CD1   1 
ATOM   8523  C  CD2   . LEU B 1 435 ? -38.850 29.197  54.695  1.00 74.68  ? 435 LEU B CD2   1 
ATOM   8524  N  N     . ASN B 1 436 ? -38.378 26.121  58.810  1.00 79.64  ? 436 ASN B N     1 
ATOM   8525  C  CA    . ASN B 1 436 ? -38.714 26.527  60.164  1.00 82.89  ? 436 ASN B CA    1 
ATOM   8526  C  C     . ASN B 1 436 ? -39.321 27.932  60.282  1.00 85.44  ? 436 ASN B C     1 
ATOM   8527  O  O     . ASN B 1 436 ? -38.787 28.909  59.750  1.00 85.10  ? 436 ASN B O     1 
ATOM   8528  C  CB    . ASN B 1 436 ? -37.487 26.379  61.069  1.00 82.55  ? 436 ASN B CB    1 
ATOM   8529  C  CG    . ASN B 1 436 ? -37.103 24.919  61.291  1.00 82.29  ? 436 ASN B CG    1 
ATOM   8530  O  OD1   . ASN B 1 436 ? -37.956 24.079  61.580  1.00 80.35  ? 436 ASN B OD1   1 
ATOM   8531  N  ND2   . ASN B 1 436 ? -35.813 24.616  61.168  1.00 82.62  ? 436 ASN B ND2   1 
ATOM   8532  N  N     . VAL B 1 437 ? -40.447 27.993  61.000  1.00 88.45  ? 437 VAL B N     1 
ATOM   8533  C  CA    . VAL B 1 437 ? -41.230 29.208  61.226  1.00 90.14  ? 437 VAL B CA    1 
ATOM   8534  C  C     . VAL B 1 437 ? -40.511 30.415  61.804  1.00 90.28  ? 437 VAL B C     1 
ATOM   8535  O  O     . VAL B 1 437 ? -40.783 31.536  61.377  1.00 91.83  ? 437 VAL B O     1 
ATOM   8536  C  CB    . VAL B 1 437 ? -42.484 28.901  62.085  1.00 91.62  ? 437 VAL B CB    1 
ATOM   8537  C  CG1   . VAL B 1 437 ? -42.917 30.138  62.890  1.00 91.98  ? 437 VAL B CG1   1 
ATOM   8538  C  CG2   . VAL B 1 437 ? -43.619 28.456  61.165  1.00 91.70  ? 437 VAL B CG2   1 
ATOM   8539  N  N     . PRO B 1 438 ? -39.642 30.230  62.814  1.00 89.16  ? 438 PRO B N     1 
ATOM   8540  C  CA    . PRO B 1 438 ? -39.004 31.470  63.268  1.00 89.33  ? 438 PRO B CA    1 
ATOM   8541  C  C     . PRO B 1 438 ? -38.098 31.900  62.101  1.00 89.98  ? 438 PRO B C     1 
ATOM   8542  O  O     . PRO B 1 438 ? -36.880 31.765  62.148  1.00 91.28  ? 438 PRO B O     1 
ATOM   8543  C  CB    . PRO B 1 438 ? -38.235 31.023  64.507  1.00 88.32  ? 438 PRO B CB    1 
ATOM   8544  C  CG    . PRO B 1 438 ? -39.091 29.917  65.043  1.00 87.98  ? 438 PRO B CG    1 
ATOM   8545  C  CD    . PRO B 1 438 ? -39.445 29.145  63.789  1.00 87.89  ? 438 PRO B CD    1 
ATOM   8546  N  N     . LEU B 1 439 ? -38.733 32.408  61.051  1.00 90.59  ? 439 LEU B N     1 
ATOM   8547  C  CA    . LEU B 1 439 ? -38.081 32.813  59.817  1.00 91.48  ? 439 LEU B CA    1 
ATOM   8548  C  C     . LEU B 1 439 ? -37.928 34.316  59.730  1.00 92.81  ? 439 LEU B C     1 
ATOM   8549  O  O     . LEU B 1 439 ? -38.519 35.050  60.515  1.00 93.36  ? 439 LEU B O     1 
ATOM   8550  C  CB    . LEU B 1 439 ? -38.927 32.310  58.645  1.00 91.51  ? 439 LEU B CB    1 
ATOM   8551  C  CG    . LEU B 1 439 ? -38.418 32.173  57.208  1.00 92.04  ? 439 LEU B CG    1 
ATOM   8552  C  CD1   . LEU B 1 439 ? -38.345 33.530  56.526  1.00 92.07  ? 439 LEU B CD1   1 
ATOM   8553  C  CD2   . LEU B 1 439 ? -37.077 31.457  57.228  1.00 92.06  ? 439 LEU B CD2   1 
ATOM   8554  N  N     . ARG B 1 440 ? -37.125 34.759  58.767  1.00 94.37  ? 440 ARG B N     1 
ATOM   8555  C  CA    . ARG B 1 440 ? -36.868 36.177  58.519  1.00 95.60  ? 440 ARG B CA    1 
ATOM   8556  C  C     . ARG B 1 440 ? -36.597 36.391  57.022  1.00 96.52  ? 440 ARG B C     1 
ATOM   8557  O  O     . ARG B 1 440 ? -36.051 35.518  56.349  1.00 96.48  ? 440 ARG B O     1 
ATOM   8558  C  CB    . ARG B 1 440 ? -35.656 36.654  59.340  1.00 95.55  ? 440 ARG B CB    1 
ATOM   8559  C  CG    . ARG B 1 440 ? -35.892 36.756  60.850  1.00 95.71  ? 440 ARG B CG    1 
ATOM   8560  C  CD    . ARG B 1 440 ? -36.089 38.207  61.291  1.00 96.35  ? 440 ARG B CD    1 
ATOM   8561  N  NE    . ARG B 1 440 ? -34.822 38.926  61.440  1.00 97.20  ? 440 ARG B NE    1 
ATOM   8562  C  CZ    . ARG B 1 440 ? -34.715 40.244  61.612  1.00 97.38  ? 440 ARG B CZ    1 
ATOM   8563  N  NH1   . ARG B 1 440 ? -35.801 41.007  61.654  1.00 97.79  ? 440 ARG B NH1   1 
ATOM   8564  N  NH2   . ARG B 1 440 ? -33.518 40.804  61.752  1.00 96.43  ? 440 ARG B NH2   1 
ATOM   8565  N  N     . GLU B 1 441 ? -36.991 37.544  56.497  1.00 97.57  ? 441 GLU B N     1 
ATOM   8566  C  CA    . GLU B 1 441 ? -36.752 37.840  55.092  1.00 98.41  ? 441 GLU B CA    1 
ATOM   8567  C  C     . GLU B 1 441 ? -35.250 38.008  54.876  1.00 98.70  ? 441 GLU B C     1 
ATOM   8568  O  O     . GLU B 1 441 ? -34.720 37.638  53.831  1.00 99.29  ? 441 GLU B O     1 
ATOM   8569  C  CB    . GLU B 1 441 ? -37.462 39.131  54.688  1.00 98.94  ? 441 GLU B CB    1 
ATOM   8570  C  CG    . GLU B 1 441 ? -37.158 39.578  53.268  1.00 100.14 ? 441 GLU B CG    1 
ATOM   8571  C  CD    . GLU B 1 441 ? -37.520 41.030  53.022  1.00 101.36 ? 441 GLU B CD    1 
ATOM   8572  O  OE1   . GLU B 1 441 ? -38.692 41.400  53.252  1.00 102.24 ? 441 GLU B OE1   1 
ATOM   8573  O  OE2   . GLU B 1 441 ? -36.631 41.801  52.598  1.00 101.55 ? 441 GLU B OE2   1 
ATOM   8574  N  N     . GLU B 1 442 ? -34.575 38.566  55.878  1.00 98.63  ? 442 GLU B N     1 
ATOM   8575  C  CA    . GLU B 1 442 ? -33.136 38.812  55.820  1.00 98.70  ? 442 GLU B CA    1 
ATOM   8576  C  C     . GLU B 1 442 ? -32.266 37.580  55.554  1.00 98.07  ? 442 GLU B C     1 
ATOM   8577  O  O     . GLU B 1 442 ? -31.344 37.635  54.732  1.00 98.60  ? 442 GLU B O     1 
ATOM   8578  C  CB    . GLU B 1 442 ? -32.670 39.470  57.119  1.00 100.32 ? 442 GLU B CB    1 
ATOM   8579  C  CG    . GLU B 1 442 ? -33.069 38.705  58.370  1.00 102.44 ? 442 GLU B CG    1 
ATOM   8580  C  CD    . GLU B 1 442 ? -32.132 38.951  59.540  1.00 103.93 ? 442 GLU B CD    1 
ATOM   8581  O  OE1   . GLU B 1 442 ? -31.799 40.129  59.817  1.00 104.33 ? 442 GLU B OE1   1 
ATOM   8582  O  OE2   . GLU B 1 442 ? -31.736 37.958  60.188  1.00 104.77 ? 442 GLU B OE2   1 
ATOM   8583  N  N     . GLU B 1 443 ? -32.546 36.482  56.258  1.00 95.90  ? 443 GLU B N     1 
ATOM   8584  C  CA    . GLU B 1 443 ? -31.782 35.244  56.106  1.00 93.35  ? 443 GLU B CA    1 
ATOM   8585  C  C     . GLU B 1 443 ? -32.014 34.601  54.736  1.00 91.92  ? 443 GLU B C     1 
ATOM   8586  O  O     . GLU B 1 443 ? -32.520 33.484  54.654  1.00 92.18  ? 443 GLU B O     1 
ATOM   8587  C  CB    . GLU B 1 443 ? -32.162 34.265  57.221  1.00 92.53  ? 443 GLU B CB    1 
ATOM   8588  N  N     . ARG B 1 444 ? -31.624 35.305  53.671  1.00 89.87  ? 444 ARG B N     1 
ATOM   8589  C  CA    . ARG B 1 444 ? -31.806 34.835  52.297  1.00 87.68  ? 444 ARG B CA    1 
ATOM   8590  C  C     . ARG B 1 444 ? -31.076 33.544  51.994  1.00 86.86  ? 444 ARG B C     1 
ATOM   8591  O  O     . ARG B 1 444 ? -31.103 33.053  50.868  1.00 85.75  ? 444 ARG B O     1 
ATOM   8592  C  CB    . ARG B 1 444 ? -31.361 35.907  51.323  1.00 87.02  ? 444 ARG B CB    1 
ATOM   8593  N  N     . HIS B 1 445 ? -30.425 32.981  52.998  1.00 86.86  ? 445 HIS B N     1 
ATOM   8594  C  CA    . HIS B 1 445 ? -29.695 31.760  52.759  1.00 86.21  ? 445 HIS B CA    1 
ATOM   8595  C  C     . HIS B 1 445 ? -30.435 30.443  52.906  1.00 84.49  ? 445 HIS B C     1 
ATOM   8596  O  O     . HIS B 1 445 ? -30.211 29.540  52.104  1.00 84.44  ? 445 HIS B O     1 
ATOM   8597  C  CB    . HIS B 1 445 ? -28.400 31.766  53.569  1.00 88.04  ? 445 HIS B CB    1 
ATOM   8598  C  CG    . HIS B 1 445 ? -27.250 32.337  52.801  1.00 89.71  ? 445 HIS B CG    1 
ATOM   8599  N  ND1   . HIS B 1 445 ? -25.940 32.231  53.209  1.00 90.50  ? 445 HIS B ND1   1 
ATOM   8600  C  CD2   . HIS B 1 445 ? -27.225 32.958  51.597  1.00 89.20  ? 445 HIS B CD2   1 
ATOM   8601  C  CE1   . HIS B 1 445 ? -25.153 32.754  52.282  1.00 90.34  ? 445 HIS B CE1   1 
ATOM   8602  N  NE2   . HIS B 1 445 ? -25.907 33.199  51.295  1.00 89.31  ? 445 HIS B NE2   1 
ATOM   8603  N  N     . ARG B 1 446 ? -31.314 30.313  53.897  1.00 82.02  ? 446 ARG B N     1 
ATOM   8604  C  CA    . ARG B 1 446 ? -32.050 29.062  54.041  1.00 78.70  ? 446 ARG B CA    1 
ATOM   8605  C  C     . ARG B 1 446 ? -33.206 29.039  53.070  1.00 76.86  ? 446 ARG B C     1 
ATOM   8606  O  O     . ARG B 1 446 ? -33.182 28.307  52.087  1.00 76.57  ? 446 ARG B O     1 
ATOM   8607  C  CB    . ARG B 1 446 ? -32.674 28.891  55.412  1.00 77.78  ? 446 ARG B CB    1 
ATOM   8608  C  CG    . ARG B 1 446 ? -31.834 29.114  56.607  1.00 77.45  ? 446 ARG B CG    1 
ATOM   8609  C  CD    . ARG B 1 446 ? -32.738 28.790  57.770  1.00 77.96  ? 446 ARG B CD    1 
ATOM   8610  N  NE    . ARG B 1 446 ? -33.056 29.955  58.590  1.00 79.17  ? 446 ARG B NE    1 
ATOM   8611  C  CZ    . ARG B 1 446 ? -34.239 30.177  59.162  1.00 78.78  ? 446 ARG B CZ    1 
ATOM   8612  N  NH1   . ARG B 1 446 ? -35.242 29.319  58.998  1.00 77.53  ? 446 ARG B NH1   1 
ATOM   8613  N  NH2   . ARG B 1 446 ? -34.409 31.247  59.927  1.00 77.51  ? 446 ARG B NH2   1 
ATOM   8614  N  N     . TRP B 1 447 ? -34.233 29.834  53.363  1.00 74.09  ? 447 TRP B N     1 
ATOM   8615  C  CA    . TRP B 1 447 ? -35.400 29.849  52.505  1.00 72.42  ? 447 TRP B CA    1 
ATOM   8616  C  C     . TRP B 1 447 ? -35.018 29.755  51.038  1.00 72.05  ? 447 TRP B C     1 
ATOM   8617  O  O     . TRP B 1 447 ? -35.754 29.180  50.243  1.00 72.19  ? 447 TRP B O     1 
ATOM   8618  C  CB    . TRP B 1 447 ? -36.294 31.062  52.773  1.00 71.45  ? 447 TRP B CB    1 
ATOM   8619  C  CG    . TRP B 1 447 ? -35.673 32.404  52.721  1.00 70.72  ? 447 TRP B CG    1 
ATOM   8620  C  CD1   . TRP B 1 447 ? -35.118 33.085  53.759  1.00 71.23  ? 447 TRP B CD1   1 
ATOM   8621  C  CD2   . TRP B 1 447 ? -35.680 33.302  51.609  1.00 70.07  ? 447 TRP B CD2   1 
ATOM   8622  N  NE1   . TRP B 1 447 ? -34.791 34.363  53.369  1.00 71.36  ? 447 TRP B NE1   1 
ATOM   8623  C  CE2   . TRP B 1 447 ? -35.123 34.521  52.049  1.00 70.06  ? 447 TRP B CE2   1 
ATOM   8624  C  CE3   . TRP B 1 447 ? -36.104 33.195  50.280  1.00 70.08  ? 447 TRP B CE3   1 
ATOM   8625  C  CZ2   . TRP B 1 447 ? -34.984 35.631  51.212  1.00 69.89  ? 447 TRP B CZ2   1 
ATOM   8626  C  CZ3   . TRP B 1 447 ? -35.966 34.301  49.442  1.00 69.62  ? 447 TRP B CZ3   1 
ATOM   8627  C  CH2   . TRP B 1 447 ? -35.408 35.501  49.913  1.00 69.89  ? 447 TRP B CH2   1 
ATOM   8628  N  N     . GLU B 1 448 ? -33.862 30.294  50.668  1.00 70.95  ? 448 GLU B N     1 
ATOM   8629  C  CA    . GLU B 1 448 ? -33.426 30.170  49.280  1.00 69.42  ? 448 GLU B CA    1 
ATOM   8630  C  C     . GLU B 1 448 ? -33.033 28.698  49.032  1.00 68.26  ? 448 GLU B C     1 
ATOM   8631  O  O     . GLU B 1 448 ? -33.219 28.170  47.933  1.00 68.49  ? 448 GLU B O     1 
ATOM   8632  C  CB    . GLU B 1 448 ? -32.252 31.091  49.006  1.00 69.90  ? 448 GLU B CB    1 
ATOM   8633  N  N     . ASN B 1 449 ? -32.479 28.040  50.049  1.00 65.75  ? 449 ASN B N     1 
ATOM   8634  C  CA    . ASN B 1 449 ? -32.121 26.632  49.924  1.00 63.30  ? 449 ASN B CA    1 
ATOM   8635  C  C     . ASN B 1 449 ? -33.452 25.905  49.971  1.00 62.06  ? 449 ASN B C     1 
ATOM   8636  O  O     . ASN B 1 449 ? -33.682 24.969  49.204  1.00 61.91  ? 449 ASN B O     1 
ATOM   8637  C  CB    . ASN B 1 449 ? -31.241 26.162  51.091  1.00 63.93  ? 449 ASN B CB    1 
ATOM   8638  C  CG    . ASN B 1 449 ? -29.773 25.962  50.692  1.00 64.23  ? 449 ASN B CG    1 
ATOM   8639  O  OD1   . ASN B 1 449 ? -29.469 25.410  49.629  1.00 63.07  ? 449 ASN B OD1   1 
ATOM   8640  N  ND2   . ASN B 1 449 ? -28.861 26.395  51.559  1.00 63.40  ? 449 ASN B ND2   1 
ATOM   8641  N  N     . ALA B 1 450 ? -34.329 26.353  50.870  1.00 59.99  ? 450 ALA B N     1 
ATOM   8642  C  CA    . ALA B 1 450 ? -35.657 25.763  51.019  1.00 58.20  ? 450 ALA B CA    1 
ATOM   8643  C  C     . ALA B 1 450 ? -36.337 25.770  49.664  1.00 57.65  ? 450 ALA B C     1 
ATOM   8644  O  O     . ALA B 1 450 ? -36.827 24.747  49.197  1.00 58.02  ? 450 ALA B O     1 
ATOM   8645  C  CB    . ALA B 1 450 ? -36.477 26.559  52.009  1.00 56.65  ? 450 ALA B CB    1 
ATOM   8646  N  N     . LEU B 1 451 ? -36.355 26.937  49.033  1.00 57.41  ? 451 LEU B N     1 
ATOM   8647  C  CA    . LEU B 1 451 ? -36.964 27.091  47.721  1.00 58.13  ? 451 LEU B CA    1 
ATOM   8648  C  C     . LEU B 1 451 ? -36.328 26.124  46.728  1.00 58.84  ? 451 LEU B C     1 
ATOM   8649  O  O     . LEU B 1 451 ? -37.014 25.491  45.908  1.00 58.33  ? 451 LEU B O     1 
ATOM   8650  C  CB    . LEU B 1 451 ? -36.790 28.534  47.243  1.00 57.89  ? 451 LEU B CB    1 
ATOM   8651  C  CG    . LEU B 1 451 ? -37.503 29.575  48.109  1.00 57.54  ? 451 LEU B CG    1 
ATOM   8652  C  CD1   . LEU B 1 451 ? -37.272 30.962  47.561  1.00 56.76  ? 451 LEU B CD1   1 
ATOM   8653  C  CD2   . LEU B 1 451 ? -38.991 29.256  48.144  1.00 58.18  ? 451 LEU B CD2   1 
ATOM   8654  N  N     . LEU B 1 452 ? -35.006 26.016  46.820  1.00 59.22  ? 452 LEU B N     1 
ATOM   8655  C  CA    . LEU B 1 452 ? -34.236 25.134  45.958  1.00 58.94  ? 452 LEU B CA    1 
ATOM   8656  C  C     . LEU B 1 452 ? -34.693 23.691  46.147  1.00 58.03  ? 452 LEU B C     1 
ATOM   8657  O  O     . LEU B 1 452 ? -34.916 22.972  45.175  1.00 58.23  ? 452 LEU B O     1 
ATOM   8658  C  CB    . LEU B 1 452 ? -32.744 25.283  46.277  1.00 60.08  ? 452 LEU B CB    1 
ATOM   8659  C  CG    . LEU B 1 452 ? -31.892 26.011  45.226  1.00 61.40  ? 452 LEU B CG    1 
ATOM   8660  C  CD1   . LEU B 1 452 ? -32.655 27.202  44.663  1.00 61.34  ? 452 LEU B CD1   1 
ATOM   8661  C  CD2   . LEU B 1 452 ? -30.573 26.454  45.844  1.00 61.06  ? 452 LEU B CD2   1 
ATOM   8662  N  N     . GLY B 1 453 ? -34.841 23.278  47.403  1.00 56.44  ? 453 GLY B N     1 
ATOM   8663  C  CA    . GLY B 1 453 ? -35.284 21.929  47.689  1.00 54.52  ? 453 GLY B CA    1 
ATOM   8664  C  C     . GLY B 1 453 ? -36.719 21.721  47.253  1.00 54.38  ? 453 GLY B C     1 
ATOM   8665  O  O     . GLY B 1 453 ? -37.061 20.661  46.732  1.00 54.66  ? 453 GLY B O     1 
ATOM   8666  N  N     . LEU B 1 454 ? -37.561 22.733  47.458  1.00 53.51  ? 454 LEU B N     1 
ATOM   8667  C  CA    . LEU B 1 454 ? -38.971 22.654  47.082  1.00 52.38  ? 454 LEU B CA    1 
ATOM   8668  C  C     . LEU B 1 454 ? -39.043 22.384  45.595  1.00 51.99  ? 454 LEU B C     1 
ATOM   8669  O  O     . LEU B 1 454 ? -39.646 21.412  45.145  1.00 50.79  ? 454 LEU B O     1 
ATOM   8670  C  CB    . LEU B 1 454 ? -39.679 23.979  47.404  1.00 52.87  ? 454 LEU B CB    1 
ATOM   8671  C  CG    . LEU B 1 454 ? -41.209 24.202  47.293  1.00 53.23  ? 454 LEU B CG    1 
ATOM   8672  C  CD1   . LEU B 1 454 ? -41.635 24.087  45.865  1.00 51.51  ? 454 LEU B CD1   1 
ATOM   8673  C  CD2   . LEU B 1 454 ? -41.993 23.219  48.148  1.00 53.15  ? 454 LEU B CD2   1 
ATOM   8674  N  N     . LEU B 1 455 ? -38.391 23.251  44.839  1.00 52.00  ? 455 LEU B N     1 
ATOM   8675  C  CA    . LEU B 1 455 ? -38.375 23.141  43.393  1.00 52.81  ? 455 LEU B CA    1 
ATOM   8676  C  C     . LEU B 1 455 ? -37.907 21.782  42.866  1.00 52.68  ? 455 LEU B C     1 
ATOM   8677  O  O     . LEU B 1 455 ? -38.375 21.321  41.825  1.00 52.27  ? 455 LEU B O     1 
ATOM   8678  C  CB    . LEU B 1 455 ? -37.511 24.270  42.819  1.00 54.12  ? 455 LEU B CB    1 
ATOM   8679  C  CG    . LEU B 1 455 ? -38.093 25.687  42.935  1.00 53.86  ? 455 LEU B CG    1 
ATOM   8680  C  CD1   . LEU B 1 455 ? -37.050 26.728  42.553  1.00 52.96  ? 455 LEU B CD1   1 
ATOM   8681  C  CD2   . LEU B 1 455 ? -39.321 25.787  42.036  1.00 53.81  ? 455 LEU B CD2   1 
ATOM   8682  N  N     . ALA B 1 456 ? -36.986 21.144  43.582  1.00 53.41  ? 456 ALA B N     1 
ATOM   8683  C  CA    . ALA B 1 456 ? -36.454 19.842  43.167  1.00 53.88  ? 456 ALA B CA    1 
ATOM   8684  C  C     . ALA B 1 456 ? -37.464 18.734  43.433  1.00 54.01  ? 456 ALA B C     1 
ATOM   8685  O  O     . ALA B 1 456 ? -37.622 17.801  42.641  1.00 51.92  ? 456 ALA B O     1 
ATOM   8686  C  CB    . ALA B 1 456 ? -35.152 19.545  43.910  1.00 53.10  ? 456 ALA B CB    1 
ATOM   8687  N  N     . LYS B 1 457 ? -38.144 18.847  44.566  1.00 54.94  ? 457 LYS B N     1 
ATOM   8688  C  CA    . LYS B 1 457 ? -39.141 17.868  44.946  1.00 55.46  ? 457 LYS B CA    1 
ATOM   8689  C  C     . LYS B 1 457 ? -40.333 18.007  44.002  1.00 56.59  ? 457 LYS B C     1 
ATOM   8690  O  O     . LYS B 1 457 ? -41.082 17.057  43.789  1.00 57.25  ? 457 LYS B O     1 
ATOM   8691  C  CB    . LYS B 1 457 ? -39.564 18.090  46.404  1.00 54.44  ? 457 LYS B CB    1 
ATOM   8692  C  CG    . LYS B 1 457 ? -38.448 17.865  47.437  1.00 51.23  ? 457 LYS B CG    1 
ATOM   8693  C  CD    . LYS B 1 457 ? -38.979 18.088  48.846  1.00 51.14  ? 457 LYS B CD    1 
ATOM   8694  C  CE    . LYS B 1 457 ? -37.950 17.797  49.928  1.00 50.74  ? 457 LYS B CE    1 
ATOM   8695  N  NZ    . LYS B 1 457 ? -36.950 18.885  50.061  1.00 52.29  ? 457 LYS B NZ    1 
ATOM   8696  N  N     . ALA B 1 458 ? -40.495 19.193  43.422  1.00 57.25  ? 458 ALA B N     1 
ATOM   8697  C  CA    . ALA B 1 458 ? -41.592 19.436  42.491  1.00 57.14  ? 458 ALA B CA    1 
ATOM   8698  C  C     . ALA B 1 458 ? -41.247 18.896  41.104  1.00 57.56  ? 458 ALA B C     1 
ATOM   8699  O  O     . ALA B 1 458 ? -42.120 18.759  40.251  1.00 57.01  ? 458 ALA B O     1 
ATOM   8700  C  CB    . ALA B 1 458 ? -41.895 20.928  42.419  1.00 56.33  ? 458 ALA B CB    1 
ATOM   8701  N  N     . GLY B 1 459 ? -39.968 18.603  40.879  1.00 58.79  ? 459 GLY B N     1 
ATOM   8702  C  CA    . GLY B 1 459 ? -39.545 18.062  39.596  1.00 59.50  ? 459 GLY B CA    1 
ATOM   8703  C  C     . GLY B 1 459 ? -38.895 19.010  38.598  1.00 59.78  ? 459 GLY B C     1 
ATOM   8704  O  O     . GLY B 1 459 ? -38.782 18.677  37.419  1.00 59.37  ? 459 GLY B O     1 
ATOM   8705  N  N     . LEU B 1 460 ? -38.454 20.178  39.050  1.00 60.46  ? 460 LEU B N     1 
ATOM   8706  C  CA    . LEU B 1 460 ? -37.828 21.139  38.150  1.00 62.03  ? 460 LEU B CA    1 
ATOM   8707  C  C     . LEU B 1 460 ? -36.306 21.001  38.065  1.00 63.14  ? 460 LEU B C     1 
ATOM   8708  O  O     . LEU B 1 460 ? -35.623 21.070  39.083  1.00 64.74  ? 460 LEU B O     1 
ATOM   8709  C  CB    . LEU B 1 460 ? -38.176 22.562  38.586  1.00 62.21  ? 460 LEU B CB    1 
ATOM   8710  C  CG    . LEU B 1 460 ? -39.558 23.112  38.230  1.00 63.94  ? 460 LEU B CG    1 
ATOM   8711  C  CD1   . LEU B 1 460 ? -40.654 22.219  38.795  1.00 64.60  ? 460 LEU B CD1   1 
ATOM   8712  C  CD2   . LEU B 1 460 ? -39.674 24.535  38.775  1.00 63.17  ? 460 LEU B CD2   1 
ATOM   8713  N  N     . GLN B 1 461 ? -35.777 20.805  36.855  1.00 63.28  ? 461 GLN B N     1 
ATOM   8714  C  CA    . GLN B 1 461 ? -34.325 20.693  36.647  1.00 62.76  ? 461 GLN B CA    1 
ATOM   8715  C  C     . GLN B 1 461 ? -33.735 22.098  36.659  1.00 61.41  ? 461 GLN B C     1 
ATOM   8716  O  O     . GLN B 1 461 ? -33.691 22.753  35.627  1.00 61.67  ? 461 GLN B O     1 
ATOM   8717  C  CB    . GLN B 1 461 ? -34.009 20.047  35.290  1.00 63.74  ? 461 GLN B CB    1 
ATOM   8718  C  CG    . GLN B 1 461 ? -34.423 18.585  35.160  1.00 65.98  ? 461 GLN B CG    1 
ATOM   8719  C  CD    . GLN B 1 461 ? -33.769 17.694  36.198  0.00 65.45  ? 461 GLN B CD    1 
ATOM   8720  O  OE1   . GLN B 1 461 ? -32.548 17.696  36.353  0.00 65.70  ? 461 GLN B OE1   1 
ATOM   8721  N  NE2   . GLN B 1 461 ? -34.579 16.919  36.910  0.00 65.70  ? 461 GLN B NE2   1 
ATOM   8722  N  N     . VAL B 1 462 ? -33.274 22.562  37.815  1.00 60.14  ? 462 VAL B N     1 
ATOM   8723  C  CA    . VAL B 1 462 ? -32.730 23.914  37.908  1.00 59.68  ? 462 VAL B CA    1 
ATOM   8724  C  C     . VAL B 1 462 ? -31.400 24.136  37.207  1.00 59.41  ? 462 VAL B C     1 
ATOM   8725  O  O     . VAL B 1 462 ? -31.218 25.120  36.484  1.00 59.80  ? 462 VAL B O     1 
ATOM   8726  C  CB    . VAL B 1 462 ? -32.581 24.357  39.376  1.00 59.17  ? 462 VAL B CB    1 
ATOM   8727  C  CG1   . VAL B 1 462 ? -33.952 24.657  39.963  1.00 60.85  ? 462 VAL B CG1   1 
ATOM   8728  C  CG2   . VAL B 1 462 ? -31.902 23.273  40.179  1.00 58.77  ? 462 VAL B CG2   1 
ATOM   8729  N  N     . VAL B 1 463 ? -30.470 23.218  37.418  1.00 57.95  ? 463 VAL B N     1 
ATOM   8730  C  CA    . VAL B 1 463 ? -29.156 23.333  36.822  1.00 56.02  ? 463 VAL B CA    1 
ATOM   8731  C  C     . VAL B 1 463 ? -28.890 22.131  35.946  1.00 55.91  ? 463 VAL B C     1 
ATOM   8732  O  O     . VAL B 1 463 ? -29.447 21.064  36.163  1.00 56.41  ? 463 VAL B O     1 
ATOM   8733  C  CB    . VAL B 1 463 ? -28.082 23.413  37.920  1.00 55.27  ? 463 VAL B CB    1 
ATOM   8734  C  CG1   . VAL B 1 463 ? -26.694 23.342  37.311  1.00 55.43  ? 463 VAL B CG1   1 
ATOM   8735  C  CG2   . VAL B 1 463 ? -28.257 24.698  38.720  1.00 54.49  ? 463 VAL B CG2   1 
ATOM   8736  N  N     . ALA B 1 464 ? -28.045 22.315  34.942  1.00 55.79  ? 464 ALA B N     1 
ATOM   8737  C  CA    . ALA B 1 464 ? -27.684 21.236  34.036  1.00 55.47  ? 464 ALA B CA    1 
ATOM   8738  C  C     . ALA B 1 464 ? -26.266 21.513  33.572  1.00 55.49  ? 464 ALA B C     1 
ATOM   8739  O  O     . ALA B 1 464 ? -25.762 22.623  33.745  1.00 53.86  ? 464 ALA B O     1 
ATOM   8740  C  CB    . ALA B 1 464 ? -28.632 21.200  32.858  1.00 55.63  ? 464 ALA B CB    1 
ATOM   8741  N  N     . LEU B 1 465 ? -25.615 20.512  32.995  1.00 56.08  ? 465 LEU B N     1 
ATOM   8742  C  CA    . LEU B 1 465 ? -24.246 20.713  32.541  1.00 57.80  ? 465 LEU B CA    1 
ATOM   8743  C  C     . LEU B 1 465 ? -24.120 20.876  31.033  1.00 59.19  ? 465 LEU B C     1 
ATOM   8744  O  O     . LEU B 1 465 ? -24.293 19.920  30.271  1.00 59.51  ? 465 LEU B O     1 
ATOM   8745  C  CB    . LEU B 1 465 ? -23.347 19.559  33.002  1.00 56.75  ? 465 LEU B CB    1 
ATOM   8746  C  CG    . LEU B 1 465 ? -22.931 19.476  34.473  1.00 54.73  ? 465 LEU B CG    1 
ATOM   8747  C  CD1   . LEU B 1 465 ? -22.042 18.256  34.640  1.00 53.75  ? 465 LEU B CD1   1 
ATOM   8748  C  CD2   . LEU B 1 465 ? -22.208 20.746  34.908  1.00 52.37  ? 465 LEU B CD2   1 
ATOM   8749  N  N     . SER B 1 466 ? -23.809 22.093  30.604  1.00 60.17  ? 466 SER B N     1 
ATOM   8750  C  CA    . SER B 1 466 ? -23.643 22.351  29.185  1.00 61.46  ? 466 SER B CA    1 
ATOM   8751  C  C     . SER B 1 466 ? -22.238 21.911  28.800  1.00 60.88  ? 466 SER B C     1 
ATOM   8752  O  O     . SER B 1 466 ? -21.257 22.527  29.213  1.00 60.77  ? 466 SER B O     1 
ATOM   8753  C  CB    . SER B 1 466 ? -23.833 23.840  28.879  1.00 62.99  ? 466 SER B CB    1 
ATOM   8754  O  OG    . SER B 1 466 ? -22.846 24.628  29.518  0.00 62.31  ? 466 SER B OG    1 
ATOM   8755  N  N     . GLY B 1 467 ? -22.158 20.837  28.018  1.00 60.09  ? 467 GLY B N     1 
ATOM   8756  C  CA    . GLY B 1 467 ? -20.879 20.302  27.579  1.00 59.54  ? 467 GLY B CA    1 
ATOM   8757  C  C     . GLY B 1 467 ? -21.085 18.896  27.043  1.00 59.72  ? 467 GLY B C     1 
ATOM   8758  O  O     . GLY B 1 467 ? -22.231 18.461  26.883  1.00 61.13  ? 467 GLY B O     1 
ATOM   8759  N  N     . ALA B 1 468 ? -19.998 18.177  26.769  1.00 57.91  ? 468 ALA B N     1 
ATOM   8760  C  CA    . ALA B 1 468 ? -20.108 16.812  26.248  1.00 56.08  ? 468 ALA B CA    1 
ATOM   8761  C  C     . ALA B 1 468 ? -19.344 15.799  27.104  1.00 54.27  ? 468 ALA B C     1 
ATOM   8762  O  O     . ALA B 1 468 ? -18.144 15.941  27.349  1.00 54.23  ? 468 ALA B O     1 
ATOM   8763  C  CB    . ALA B 1 468 ? -19.614 16.759  24.789  1.00 56.23  ? 468 ALA B CB    1 
ATOM   8764  N  N     . TYR B 1 469 ? -20.042 14.766  27.552  1.00 51.85  ? 469 TYR B N     1 
ATOM   8765  C  CA    . TYR B 1 469 ? -19.404 13.762  28.380  1.00 49.58  ? 469 TYR B CA    1 
ATOM   8766  C  C     . TYR B 1 469 ? -19.527 12.380  27.772  1.00 50.30  ? 469 TYR B C     1 
ATOM   8767  O  O     . TYR B 1 469 ? -20.502 12.089  27.076  1.00 50.25  ? 469 TYR B O     1 
ATOM   8768  C  CB    . TYR B 1 469 ? -20.020 13.777  29.784  1.00 45.84  ? 469 TYR B CB    1 
ATOM   8769  C  CG    . TYR B 1 469 ? -19.932 15.128  30.454  1.00 41.39  ? 469 TYR B CG    1 
ATOM   8770  C  CD1   . TYR B 1 469 ? -20.854 16.130  30.167  1.00 39.70  ? 469 TYR B CD1   1 
ATOM   8771  C  CD2   . TYR B 1 469 ? -18.885 15.424  31.323  1.00 39.89  ? 469 TYR B CD2   1 
ATOM   8772  C  CE1   . TYR B 1 469 ? -20.733 17.395  30.727  1.00 38.89  ? 469 TYR B CE1   1 
ATOM   8773  C  CE2   . TYR B 1 469 ? -18.751 16.682  31.885  1.00 38.81  ? 469 TYR B CE2   1 
ATOM   8774  C  CZ    . TYR B 1 469 ? -19.677 17.662  31.584  1.00 38.92  ? 469 TYR B CZ    1 
ATOM   8775  O  OH    . TYR B 1 469 ? -19.544 18.905  32.147  1.00 38.11  ? 469 TYR B OH    1 
ATOM   8776  N  N     . PRO B 1 470 ? -18.533 11.509  28.028  1.00 51.15  ? 470 PRO B N     1 
ATOM   8777  C  CA    . PRO B 1 470 ? -18.482 10.130  27.530  1.00 51.70  ? 470 PRO B CA    1 
ATOM   8778  C  C     . PRO B 1 470 ? -19.650 9.279   28.041  1.00 53.02  ? 470 PRO B C     1 
ATOM   8779  O  O     . PRO B 1 470 ? -19.843 8.138   27.610  1.00 53.71  ? 470 PRO B O     1 
ATOM   8780  C  CB    . PRO B 1 470 ? -17.136 9.632   28.044  1.00 50.98  ? 470 PRO B CB    1 
ATOM   8781  C  CG    . PRO B 1 470 ? -16.994 10.370  29.331  1.00 51.54  ? 470 PRO B CG    1 
ATOM   8782  C  CD    . PRO B 1 470 ? -17.395 11.768  28.926  1.00 51.42  ? 470 PRO B CD    1 
ATOM   8783  N  N     . ALA B 1 471 ? -20.427 9.837   28.963  1.00 53.86  ? 471 ALA B N     1 
ATOM   8784  C  CA    . ALA B 1 471 ? -21.569 9.130   29.512  1.00 53.66  ? 471 ALA B CA    1 
ATOM   8785  C  C     . ALA B 1 471 ? -22.808 10.015  29.481  1.00 54.19  ? 471 ALA B C     1 
ATOM   8786  O  O     . ALA B 1 471 ? -22.818 11.118  30.023  1.00 53.33  ? 471 ALA B O     1 
ATOM   8787  C  CB    . ALA B 1 471 ? -21.271 8.691   30.926  1.00 53.87  ? 471 ALA B CB    1 
ATOM   8788  N  N     . GLU B 1 472 ? -23.851 9.520   28.831  1.00 55.02  ? 472 GLU B N     1 
ATOM   8789  C  CA    . GLU B 1 472 ? -25.100 10.253  28.727  1.00 56.41  ? 472 GLU B CA    1 
ATOM   8790  C  C     . GLU B 1 472 ? -25.940 9.931   29.959  1.00 54.48  ? 472 GLU B C     1 
ATOM   8791  O  O     . GLU B 1 472 ? -26.772 10.727  30.404  1.00 53.79  ? 472 GLU B O     1 
ATOM   8792  C  CB    . GLU B 1 472 ? -25.842 9.826   27.461  1.00 60.99  ? 472 GLU B CB    1 
ATOM   8793  C  CG    . GLU B 1 472 ? -24.941 9.720   26.224  1.00 66.43  ? 472 GLU B CG    1 
ATOM   8794  C  CD    . GLU B 1 472 ? -25.727 9.554   24.927  1.00 68.49  ? 472 GLU B CD    1 
ATOM   8795  O  OE1   . GLU B 1 472 ? -26.467 10.491  24.543  1.00 69.58  ? 472 GLU B OE1   1 
ATOM   8796  O  OE2   . GLU B 1 472 ? -25.603 8.485   24.296  1.00 69.54  ? 472 GLU B OE2   1 
ATOM   8797  N  N     . LEU B 1 473 ? -25.712 8.746   30.507  1.00 51.33  ? 473 LEU B N     1 
ATOM   8798  C  CA    . LEU B 1 473 ? -26.436 8.313   31.683  1.00 48.34  ? 473 LEU B CA    1 
ATOM   8799  C  C     . LEU B 1 473 ? -25.445 7.860   32.735  1.00 46.26  ? 473 LEU B C     1 
ATOM   8800  O  O     . LEU B 1 473 ? -24.659 6.949   32.496  1.00 45.75  ? 473 LEU B O     1 
ATOM   8801  C  CB    . LEU B 1 473 ? -27.368 7.162   31.328  1.00 48.43  ? 473 LEU B CB    1 
ATOM   8802  C  CG    . LEU B 1 473 ? -28.267 6.697   32.469  1.00 48.67  ? 473 LEU B CG    1 
ATOM   8803  C  CD1   . LEU B 1 473 ? -29.125 7.869   32.928  1.00 49.43  ? 473 LEU B CD1   1 
ATOM   8804  C  CD2   . LEU B 1 473 ? -29.137 5.536   32.009  1.00 47.12  ? 473 LEU B CD2   1 
ATOM   8805  N  N     . ALA B 1 474 ? -25.477 8.512   33.891  1.00 44.01  ? 474 ALA B N     1 
ATOM   8806  C  CA    . ALA B 1 474 ? -24.587 8.177   34.994  1.00 42.18  ? 474 ALA B CA    1 
ATOM   8807  C  C     . ALA B 1 474 ? -25.429 7.825   36.209  1.00 41.89  ? 474 ALA B C     1 
ATOM   8808  O  O     . ALA B 1 474 ? -26.187 8.655   36.714  1.00 41.15  ? 474 ALA B O     1 
ATOM   8809  C  CB    . ALA B 1 474 ? -23.682 9.345   35.312  1.00 41.86  ? 474 ALA B CB    1 
ATOM   8810  N  N     . VAL B 1 475 ? -25.298 6.587   36.672  1.00 41.07  ? 475 VAL B N     1 
ATOM   8811  C  CA    . VAL B 1 475 ? -26.056 6.129   37.816  1.00 40.41  ? 475 VAL B CA    1 
ATOM   8812  C  C     . VAL B 1 475 ? -25.192 5.606   38.954  1.00 40.96  ? 475 VAL B C     1 
ATOM   8813  O  O     . VAL B 1 475 ? -24.265 4.830   38.748  1.00 40.35  ? 475 VAL B O     1 
ATOM   8814  C  CB    . VAL B 1 475 ? -27.098 5.053   37.396  1.00 40.73  ? 475 VAL B CB    1 
ATOM   8815  C  CG1   . VAL B 1 475 ? -26.520 4.132   36.338  1.00 38.41  ? 475 VAL B CG1   1 
ATOM   8816  C  CG2   . VAL B 1 475 ? -27.556 4.266   38.635  1.00 41.61  ? 475 VAL B CG2   1 
ATOM   8817  N  N     . GLY B 1 476 ? -25.512 6.060   40.160  1.00 42.36  ? 476 GLY B N     1 
ATOM   8818  C  CA    . GLY B 1 476 ? -24.786 5.651   41.343  1.00 44.35  ? 476 GLY B CA    1 
ATOM   8819  C  C     . GLY B 1 476 ? -25.634 4.731   42.199  1.00 46.55  ? 476 GLY B C     1 
ATOM   8820  O  O     . GLY B 1 476 ? -26.849 4.870   42.271  1.00 45.88  ? 476 GLY B O     1 
ATOM   8821  N  N     . PHE B 1 477 ? -24.985 3.783   42.857  1.00 48.86  ? 477 PHE B N     1 
ATOM   8822  C  CA    . PHE B 1 477 ? -25.687 2.832   43.695  1.00 50.97  ? 477 PHE B CA    1 
ATOM   8823  C  C     . PHE B 1 477 ? -25.270 2.972   45.140  1.00 53.47  ? 477 PHE B C     1 
ATOM   8824  O  O     . PHE B 1 477 ? -24.090 3.153   45.435  1.00 53.93  ? 477 PHE B O     1 
ATOM   8825  C  CB    . PHE B 1 477 ? -25.378 1.419   43.234  1.00 49.98  ? 477 PHE B CB    1 
ATOM   8826  C  CG    . PHE B 1 477 ? -25.725 1.165   41.809  1.00 50.01  ? 477 PHE B CG    1 
ATOM   8827  C  CD1   . PHE B 1 477 ? -24.908 1.631   40.780  1.00 49.64  ? 477 PHE B CD1   1 
ATOM   8828  C  CD2   . PHE B 1 477 ? -26.875 0.456   41.487  1.00 50.15  ? 477 PHE B CD2   1 
ATOM   8829  C  CE1   . PHE B 1 477 ? -25.229 1.385   39.446  1.00 49.00  ? 477 PHE B CE1   1 
ATOM   8830  C  CE2   . PHE B 1 477 ? -27.208 0.203   40.160  1.00 51.06  ? 477 PHE B CE2   1 
ATOM   8831  C  CZ    . PHE B 1 477 ? -26.382 0.671   39.134  1.00 50.08  ? 477 PHE B CZ    1 
ATOM   8832  N  N     . ASP B 1 478 ? -26.238 2.877   46.044  1.00 56.21  ? 478 ASP B N     1 
ATOM   8833  C  CA    . ASP B 1 478 ? -25.950 2.983   47.467  1.00 59.33  ? 478 ASP B CA    1 
ATOM   8834  C  C     . ASP B 1 478 ? -26.683 1.881   48.216  1.00 60.12  ? 478 ASP B C     1 
ATOM   8835  O  O     . ASP B 1 478 ? -27.889 1.683   48.037  1.00 60.21  ? 478 ASP B O     1 
ATOM   8836  C  CB    . ASP B 1 478 ? -26.381 4.350   48.006  1.00 62.40  ? 478 ASP B CB    1 
ATOM   8837  C  CG    . ASP B 1 478 ? -25.680 4.718   49.313  1.00 65.06  ? 478 ASP B CG    1 
ATOM   8838  O  OD1   . ASP B 1 478 ? -25.786 3.953   50.299  1.00 63.52  ? 478 ASP B OD1   1 
ATOM   8839  O  OD2   . ASP B 1 478 ? -25.022 5.785   49.346  1.00 68.01  ? 478 ASP B OD2   1 
ATOM   8840  N  N     . ALA B 1 479 ? -25.937 1.162   49.051  1.00 60.74  ? 479 ALA B N     1 
ATOM   8841  C  CA    . ALA B 1 479 ? -26.476 0.063   49.838  1.00 59.90  ? 479 ALA B CA    1 
ATOM   8842  C  C     . ALA B 1 479 ? -26.672 0.510   51.273  1.00 59.97  ? 479 ALA B C     1 
ATOM   8843  O  O     . ALA B 1 479 ? -26.500 -0.274  52.199  1.00 59.46  ? 479 ALA B O     1 
ATOM   8844  C  CB    . ALA B 1 479 ? -25.520 -1.113  49.791  1.00 59.22  ? 479 ALA B CB    1 
ATOM   8845  N  N     . GLY B 1 480 ? -27.022 1.779   51.450  1.00 61.10  ? 480 GLY B N     1 
ATOM   8846  C  CA    . GLY B 1 480 ? -27.223 2.309   52.786  1.00 62.04  ? 480 GLY B CA    1 
ATOM   8847  C  C     . GLY B 1 480 ? -26.003 2.142   53.675  1.00 62.55  ? 480 GLY B C     1 
ATOM   8848  O  O     . GLY B 1 480 ? -26.114 2.169   54.901  1.00 61.84  ? 480 GLY B O     1 
ATOM   8849  N  N     . GLY B 1 481 ? -24.838 1.974   53.057  1.00 63.29  ? 481 GLY B N     1 
ATOM   8850  C  CA    . GLY B 1 481 ? -23.618 1.803   53.822  1.00 64.74  ? 481 GLY B CA    1 
ATOM   8851  C  C     . GLY B 1 481 ? -23.447 0.373   54.297  1.00 65.52  ? 481 GLY B C     1 
ATOM   8852  O  O     . GLY B 1 481 ? -22.890 0.116   55.372  1.00 65.37  ? 481 GLY B O     1 
ATOM   8853  N  N     . ARG B 1 482 ? -23.931 -0.563  53.491  1.00 65.77  ? 482 ARG B N     1 
ATOM   8854  C  CA    . ARG B 1 482 ? -23.833 -1.972  53.825  1.00 65.72  ? 482 ARG B CA    1 
ATOM   8855  C  C     . ARG B 1 482 ? -22.696 -2.624  53.071  1.00 65.23  ? 482 ARG B C     1 
ATOM   8856  O  O     . ARG B 1 482 ? -22.051 -1.995  52.250  1.00 64.82  ? 482 ARG B O     1 
ATOM   8857  C  CB    . ARG B 1 482 ? -25.155 -2.681  53.520  1.00 66.73  ? 482 ARG B CB    1 
ATOM   8858  C  CG    . ARG B 1 482 ? -26.100 -2.752  54.728  1.00 69.19  ? 482 ARG B CG    1 
ATOM   8859  C  CD    . ARG B 1 482 ? -27.449 -3.432  54.416  1.00 70.82  ? 482 ARG B CD    1 
ATOM   8860  N  NE    . ARG B 1 482 ? -28.518 -2.488  54.058  1.00 71.60  ? 482 ARG B NE    1 
ATOM   8861  C  CZ    . ARG B 1 482 ? -28.991 -2.302  52.824  1.00 72.22  ? 482 ARG B CZ    1 
ATOM   8862  N  NH1   . ARG B 1 482 ? -28.497 -2.998  51.801  1.00 71.82  ? 482 ARG B NH1   1 
ATOM   8863  N  NH2   . ARG B 1 482 ? -29.965 -1.420  52.606  1.00 70.84  ? 482 ARG B NH2   1 
ATOM   8864  N  N     . GLU B 1 483 ? -22.451 -3.891  53.363  1.00 66.46  ? 483 GLU B N     1 
ATOM   8865  C  CA    . GLU B 1 483 ? -21.380 -4.637  52.715  1.00 67.90  ? 483 GLU B CA    1 
ATOM   8866  C  C     . GLU B 1 483 ? -21.760 -5.071  51.301  1.00 68.87  ? 483 GLU B C     1 
ATOM   8867  O  O     . GLU B 1 483 ? -20.888 -5.281  50.458  1.00 69.62  ? 483 GLU B O     1 
ATOM   8868  C  CB    . GLU B 1 483 ? -21.017 -5.859  53.554  1.00 68.28  ? 483 GLU B CB    1 
ATOM   8869  N  N     . SER B 1 484 ? -23.060 -5.214  51.047  1.00 69.07  ? 484 SER B N     1 
ATOM   8870  C  CA    . SER B 1 484 ? -23.550 -5.616  49.728  1.00 68.76  ? 484 SER B CA    1 
ATOM   8871  C  C     . SER B 1 484 ? -25.030 -5.261  49.570  1.00 68.58  ? 484 SER B C     1 
ATOM   8872  O  O     . SER B 1 484 ? -25.675 -4.823  50.523  1.00 68.88  ? 484 SER B O     1 
ATOM   8873  C  CB    . SER B 1 484 ? -23.360 -7.120  49.523  1.00 69.24  ? 484 SER B CB    1 
ATOM   8874  O  OG    . SER B 1 484 ? -24.303 -7.857  50.280  1.00 69.85  ? 484 SER B OG    1 
ATOM   8875  N  N     . PHE B 1 485 ? -25.569 -5.458  48.370  1.00 68.21  ? 485 PHE B N     1 
ATOM   8876  C  CA    . PHE B 1 485 ? -26.969 -5.136  48.117  1.00 68.14  ? 485 PHE B CA    1 
ATOM   8877  C  C     . PHE B 1 485 ? -27.954 -6.275  48.409  1.00 69.53  ? 485 PHE B C     1 
ATOM   8878  O  O     . PHE B 1 485 ? -29.132 -6.183  48.061  1.00 70.58  ? 485 PHE B O     1 
ATOM   8879  C  CB    . PHE B 1 485 ? -27.150 -4.664  46.669  1.00 66.06  ? 485 PHE B CB    1 
ATOM   8880  C  CG    . PHE B 1 485 ? -26.510 -3.333  46.370  1.00 63.89  ? 485 PHE B CG    1 
ATOM   8881  C  CD1   . PHE B 1 485 ? -25.177 -3.254  45.995  1.00 65.34  ? 485 PHE B CD1   1 
ATOM   8882  C  CD2   . PHE B 1 485 ? -27.240 -2.158  46.476  1.00 62.31  ? 485 PHE B CD2   1 
ATOM   8883  C  CE1   . PHE B 1 485 ? -24.582 -2.021  45.731  1.00 64.39  ? 485 PHE B CE1   1 
ATOM   8884  C  CE2   . PHE B 1 485 ? -26.656 -0.929  46.217  1.00 61.44  ? 485 PHE B CE2   1 
ATOM   8885  C  CZ    . PHE B 1 485 ? -25.326 -0.860  45.845  1.00 63.12  ? 485 PHE B CZ    1 
ATOM   8886  N  N     . ARG B 1 486 ? -27.483 -7.339  49.055  1.00 70.43  ? 486 ARG B N     1 
ATOM   8887  C  CA    . ARG B 1 486 ? -28.339 -8.480  49.385  1.00 70.81  ? 486 ARG B CA    1 
ATOM   8888  C  C     . ARG B 1 486 ? -29.282 -8.184  50.555  1.00 71.05  ? 486 ARG B C     1 
ATOM   8889  O  O     . ARG B 1 486 ? -29.655 -9.086  51.300  1.00 71.50  ? 486 ARG B O     1 
ATOM   8890  C  CB    . ARG B 1 486 ? -27.476 -9.701  49.711  1.00 70.66  ? 486 ARG B CB    1 
ATOM   8891  N  N     . PHE B 1 487 ? -29.656 -6.920  50.721  1.00 70.84  ? 487 PHE B N     1 
ATOM   8892  C  CA    . PHE B 1 487 ? -30.554 -6.524  51.795  1.00 70.28  ? 487 PHE B CA    1 
ATOM   8893  C  C     . PHE B 1 487 ? -31.369 -5.314  51.360  1.00 70.03  ? 487 PHE B C     1 
ATOM   8894  O  O     . PHE B 1 487 ? -32.150 -4.772  52.139  1.00 70.24  ? 487 PHE B O     1 
ATOM   8895  C  CB    . PHE B 1 487 ? -29.774 -6.171  53.075  1.00 70.81  ? 487 PHE B CB    1 
ATOM   8896  C  CG    . PHE B 1 487 ? -29.057 -7.334  53.709  1.00 70.57  ? 487 PHE B CG    1 
ATOM   8897  C  CD1   . PHE B 1 487 ? -27.730 -7.605  53.396  0.00 70.74  ? 487 PHE B CD1   1 
ATOM   8898  C  CD2   . PHE B 1 487 ? -29.711 -8.150  54.625  0.00 70.74  ? 487 PHE B CD2   1 
ATOM   8899  C  CE1   . PHE B 1 487 ? -27.061 -8.672  53.991  0.00 70.75  ? 487 PHE B CE1   1 
ATOM   8900  C  CE2   . PHE B 1 487 ? -29.053 -9.219  55.225  0.00 70.75  ? 487 PHE B CE2   1 
ATOM   8901  C  CZ    . PHE B 1 487 ? -27.725 -9.481  54.907  0.00 70.77  ? 487 PHE B CZ    1 
ATOM   8902  N  N     . GLY B 1 488 ? -31.179 -4.878  50.120  1.00 69.12  ? 488 GLY B N     1 
ATOM   8903  C  CA    . GLY B 1 488 ? -31.929 -3.732  49.643  1.00 69.07  ? 488 GLY B CA    1 
ATOM   8904  C  C     . GLY B 1 488 ? -31.062 -2.641  49.053  1.00 68.54  ? 488 GLY B C     1 
ATOM   8905  O  O     . GLY B 1 488 ? -30.048 -2.933  48.431  1.00 69.54  ? 488 GLY B O     1 
ATOM   8906  N  N     . GLY B 1 489 ? -31.458 -1.384  49.247  1.00 67.41  ? 489 GLY B N     1 
ATOM   8907  C  CA    . GLY B 1 489 ? -30.692 -0.274  48.707  1.00 65.33  ? 489 GLY B CA    1 
ATOM   8908  C  C     . GLY B 1 489 ? -31.378 0.352   47.508  1.00 63.68  ? 489 GLY B C     1 
ATOM   8909  O  O     . GLY B 1 489 ? -32.361 -0.188  46.993  1.00 63.79  ? 489 GLY B O     1 
ATOM   8910  N  N     . ALA B 1 490 ? -30.864 1.490   47.054  1.00 61.31  ? 490 ALA B N     1 
ATOM   8911  C  CA    . ALA B 1 490 ? -31.457 2.173   45.916  1.00 60.10  ? 490 ALA B CA    1 
ATOM   8912  C  C     . ALA B 1 490 ? -30.411 2.872   45.055  1.00 59.21  ? 490 ALA B C     1 
ATOM   8913  O  O     . ALA B 1 490 ? -29.226 2.863   45.380  1.00 59.84  ? 490 ALA B O     1 
ATOM   8914  C  CB    . ALA B 1 490 ? -32.485 3.172   46.402  1.00 59.78  ? 490 ALA B CB    1 
ATOM   8915  N  N     . ALA B 1 491 ? -30.860 3.484   43.959  1.00 57.87  ? 491 ALA B N     1 
ATOM   8916  C  CA    . ALA B 1 491 ? -29.962 4.184   43.043  1.00 55.17  ? 491 ALA B CA    1 
ATOM   8917  C  C     . ALA B 1 491 ? -30.515 5.504   42.498  1.00 52.86  ? 491 ALA B C     1 
ATOM   8918  O  O     . ALA B 1 491 ? -31.712 5.745   42.514  1.00 52.03  ? 491 ALA B O     1 
ATOM   8919  C  CB    . ALA B 1 491 ? -29.602 3.266   41.880  1.00 56.20  ? 491 ALA B CB    1 
ATOM   8920  N  N     . CYS B 1 492 ? -29.615 6.354   42.017  1.00 51.31  ? 492 CYS B N     1 
ATOM   8921  C  CA    . CYS B 1 492 ? -29.979 7.638   41.436  1.00 49.53  ? 492 CYS B CA    1 
ATOM   8922  C  C     . CYS B 1 492 ? -29.135 7.828   40.198  1.00 48.21  ? 492 CYS B C     1 
ATOM   8923  O  O     . CYS B 1 492 ? -27.983 7.411   40.165  1.00 48.35  ? 492 CYS B O     1 
ATOM   8924  C  CB    . CYS B 1 492 ? -29.718 8.766   42.416  1.00 50.31  ? 492 CYS B CB    1 
ATOM   8925  S  SG    . CYS B 1 492 ? -30.845 8.750   43.806  1.00 54.35  ? 492 CYS B SG    1 
ATOM   8926  N  N     . ALA B 1 493 ? -29.705 8.464   39.182  1.00 47.22  ? 493 ALA B N     1 
ATOM   8927  C  CA    . ALA B 1 493 ? -28.995 8.668   37.931  1.00 46.31  ? 493 ALA B CA    1 
ATOM   8928  C  C     . ALA B 1 493 ? -29.144 10.070  37.365  1.00 46.66  ? 493 ALA B C     1 
ATOM   8929  O  O     . ALA B 1 493 ? -30.160 10.728  37.578  1.00 44.55  ? 493 ALA B O     1 
ATOM   8930  C  CB    . ALA B 1 493 ? -29.474 7.652   36.919  1.00 46.40  ? 493 ALA B CB    1 
ATOM   8931  N  N     . VAL B 1 494 ? -28.114 10.509  36.638  1.00 48.37  ? 494 VAL B N     1 
ATOM   8932  C  CA    . VAL B 1 494 ? -28.080 11.829  36.003  1.00 50.15  ? 494 VAL B CA    1 
ATOM   8933  C  C     . VAL B 1 494 ? -27.892 11.679  34.502  1.00 51.39  ? 494 VAL B C     1 
ATOM   8934  O  O     . VAL B 1 494 ? -27.014 10.951  34.058  1.00 50.81  ? 494 VAL B O     1 
ATOM   8935  C  CB    . VAL B 1 494 ? -26.909 12.691  36.522  1.00 49.68  ? 494 VAL B CB    1 
ATOM   8936  C  CG1   . VAL B 1 494 ? -26.839 13.987  35.749  1.00 49.90  ? 494 VAL B CG1   1 
ATOM   8937  C  CG2   . VAL B 1 494 ? -27.085 12.981  37.986  1.00 50.40  ? 494 VAL B CG2   1 
ATOM   8938  N  N     . GLY B 1 495 ? -28.715 12.374  33.724  1.00 54.66  ? 495 GLY B N     1 
ATOM   8939  C  CA    . GLY B 1 495 ? -28.609 12.302  32.275  1.00 57.55  ? 495 GLY B CA    1 
ATOM   8940  C  C     . GLY B 1 495 ? -27.622 13.307  31.694  1.00 59.40  ? 495 GLY B C     1 
ATOM   8941  O  O     . GLY B 1 495 ? -26.400 13.122  31.753  1.00 60.62  ? 495 GLY B O     1 
ATOM   8942  N  N     . GLY B 1 498 ? -26.748 16.752  32.317  1.00 92.62  ? 498 GLY B N     1 
ATOM   8943  C  CA    . GLY B 1 498 ? -27.149 16.952  30.938  1.00 92.96  ? 498 GLY B CA    1 
ATOM   8944  C  C     . GLY B 1 498 ? -28.597 16.604  30.632  1.00 92.88  ? 498 GLY B C     1 
ATOM   8945  O  O     . GLY B 1 498 ? -28.870 15.826  29.722  1.00 93.40  ? 498 GLY B O     1 
ATOM   8946  N  N     . GLY B 1 499 ? -29.534 17.170  31.384  1.00 92.38  ? 499 GLY B N     1 
ATOM   8947  C  CA    . GLY B 1 499 ? -30.929 16.883  31.120  1.00 91.88  ? 499 GLY B CA    1 
ATOM   8948  C  C     . GLY B 1 499 ? -31.787 16.608  32.338  1.00 91.73  ? 499 GLY B C     1 
ATOM   8949  O  O     . GLY B 1 499 ? -32.433 17.515  32.870  1.00 92.77  ? 499 GLY B O     1 
ATOM   8950  N  N     . HIS B 1 500 ? -31.792 15.361  32.796  1.00 90.44  ? 500 HIS B N     1 
ATOM   8951  C  CA    . HIS B 1 500 ? -32.619 14.998  33.938  1.00 88.77  ? 500 HIS B CA    1 
ATOM   8952  C  C     . HIS B 1 500 ? -31.891 14.452  35.163  1.00 87.20  ? 500 HIS B C     1 
ATOM   8953  O  O     . HIS B 1 500 ? -30.665 14.379  35.215  1.00 87.55  ? 500 HIS B O     1 
ATOM   8954  C  CB    . HIS B 1 500 ? -33.685 13.999  33.490  1.00 89.18  ? 500 HIS B CB    1 
ATOM   8955  N  N     . LEU B 1 501 ? -32.695 14.082  36.153  1.00 85.14  ? 501 LEU B N     1 
ATOM   8956  C  CA    . LEU B 1 501 ? -32.239 13.511  37.410  1.00 82.63  ? 501 LEU B CA    1 
ATOM   8957  C  C     . LEU B 1 501 ? -33.320 12.503  37.795  1.00 81.24  ? 501 LEU B C     1 
ATOM   8958  O  O     . LEU B 1 501 ? -34.489 12.855  37.852  1.00 81.32  ? 501 LEU B O     1 
ATOM   8959  C  CB    . LEU B 1 501 ? -32.141 14.602  38.473  1.00 82.12  ? 501 LEU B CB    1 
ATOM   8960  C  CG    . LEU B 1 501 ? -30.962 15.565  38.373  1.00 81.91  ? 501 LEU B CG    1 
ATOM   8961  C  CD1   . LEU B 1 501 ? -31.228 16.797  39.215  1.00 82.83  ? 501 LEU B CD1   1 
ATOM   8962  C  CD2   . LEU B 1 501 ? -29.705 14.867  38.832  1.00 81.23  ? 501 LEU B CD2   1 
ATOM   8963  N  N     . LEU B 1 502 ? -32.941 11.255  38.047  1.00 80.20  ? 502 LEU B N     1 
ATOM   8964  C  CA    . LEU B 1 502 ? -33.918 10.225  38.410  1.00 79.27  ? 502 LEU B CA    1 
ATOM   8965  C  C     . LEU B 1 502 ? -33.526 9.438   39.664  1.00 78.35  ? 502 LEU B C     1 
ATOM   8966  O  O     . LEU B 1 502 ? -32.479 9.670   40.269  1.00 79.77  ? 502 LEU B O     1 
ATOM   8967  C  CB    . LEU B 1 502 ? -34.079 9.230   37.259  1.00 79.52  ? 502 LEU B CB    1 
ATOM   8968  C  CG    . LEU B 1 502 ? -34.265 9.749   35.834  1.00 80.54  ? 502 LEU B CG    1 
ATOM   8969  C  CD1   . LEU B 1 502 ? -34.212 8.575   34.849  1.00 80.38  ? 502 LEU B CD1   1 
ATOM   8970  C  CD2   . LEU B 1 502 ? -35.584 10.491  35.727  1.00 82.07  ? 502 LEU B CD2   1 
ATOM   8971  N  N     . TRP B 1 503 ? -34.383 8.500   40.044  1.00 75.85  ? 503 TRP B N     1 
ATOM   8972  C  CA    . TRP B 1 503 ? -34.122 7.640   41.182  1.00 73.87  ? 503 TRP B CA    1 
ATOM   8973  C  C     . TRP B 1 503 ? -35.003 6.426   41.086  1.00 74.57  ? 503 TRP B C     1 
ATOM   8974  O  O     . TRP B 1 503 ? -36.217 6.544   41.006  1.00 74.17  ? 503 TRP B O     1 
ATOM   8975  C  CB    . TRP B 1 503 ? -34.429 8.329   42.501  1.00 71.55  ? 503 TRP B CB    1 
ATOM   8976  C  CG    . TRP B 1 503 ? -35.804 8.879   42.565  1.00 70.12  ? 503 TRP B CG    1 
ATOM   8977  C  CD1   . TRP B 1 503 ? -36.192 10.114  42.172  1.00 70.33  ? 503 TRP B CD1   1 
ATOM   8978  C  CD2   . TRP B 1 503 ? -36.999 8.199   43.018  1.00 69.34  ? 503 TRP B CD2   1 
ATOM   8979  N  NE1   . TRP B 1 503 ? -37.547 10.261  42.346  1.00 69.40  ? 503 TRP B NE1   1 
ATOM   8980  C  CE2   . TRP B 1 503 ? -38.057 9.120   42.850  1.00 68.02  ? 503 TRP B CE2   1 
ATOM   8981  C  CE3   . TRP B 1 503 ? -37.257 6.929   43.529  1.00 69.63  ? 503 TRP B CE3   1 
ATOM   8982  C  CZ2   . TRP B 1 503 ? -39.375 8.780   43.190  1.00 67.58  ? 503 TRP B CZ2   1 
ATOM   8983  C  CZ3   . TRP B 1 503 ? -38.578 6.604   43.862  1.00 68.63  ? 503 TRP B CZ3   1 
ATOM   8984  C  CH2   . TRP B 1 503 ? -39.615 7.531   43.687  1.00 67.05  ? 503 TRP B CH2   1 
ATOM   8985  N  N     . THR B 1 504 ? -34.399 5.250   41.059  1.00 75.97  ? 504 THR B N     1 
ATOM   8986  C  CA    . THR B 1 504 ? -35.207 4.051   41.037  1.00 77.05  ? 504 THR B CA    1 
ATOM   8987  C  C     . THR B 1 504 ? -35.078 3.417   42.407  1.00 77.78  ? 504 THR B C     1 
ATOM   8988  O  O     . THR B 1 504 ? -34.156 3.698   43.178  1.00 77.16  ? 504 THR B O     1 
ATOM   8989  C  CB    . THR B 1 504 ? -34.759 3.017   39.988  1.00 76.71  ? 504 THR B CB    1 
ATOM   8990  O  OG1   . THR B 1 504 ? -34.165 1.891   40.648  1.00 76.37  ? 504 THR B OG1   1 
ATOM   8991  C  CG2   . THR B 1 504 ? -33.783 3.632   39.025  1.00 77.06  ? 504 THR B CG2   1 
ATOM   8992  N  N     . LEU B 1 505 ? -36.035 2.564   42.702  1.00 78.90  ? 505 LEU B N     1 
ATOM   8993  C  CA    . LEU B 1 505 ? -36.073 1.860   43.952  1.00 79.46  ? 505 LEU B CA    1 
ATOM   8994  C  C     . LEU B 1 505 ? -36.781 0.592   43.534  1.00 81.16  ? 505 LEU B C     1 
ATOM   8995  O  O     . LEU B 1 505 ? -37.716 0.630   42.731  1.00 82.28  ? 505 LEU B O     1 
ATOM   8996  C  CB    . LEU B 1 505 ? -36.890 2.656   44.970  1.00 76.89  ? 505 LEU B CB    1 
ATOM   8997  C  CG    . LEU B 1 505 ? -36.845 2.177   46.418  1.00 75.62  ? 505 LEU B CG    1 
ATOM   8998  C  CD1   . LEU B 1 505 ? -35.533 1.472   46.716  1.00 74.71  ? 505 LEU B CD1   1 
ATOM   8999  C  CD2   . LEU B 1 505 ? -37.029 3.374   47.322  1.00 74.23  ? 505 LEU B CD2   1 
ATOM   9000  N  N     . PRO B 1 506 ? -36.311 -0.556  44.019  1.00 82.48  ? 506 PRO B N     1 
ATOM   9001  C  CA    . PRO B 1 506 ? -36.971 -1.804  43.633  1.00 82.81  ? 506 PRO B CA    1 
ATOM   9002  C  C     . PRO B 1 506 ? -37.806 -2.377  44.776  1.00 82.26  ? 506 PRO B C     1 
ATOM   9003  O  O     . PRO B 1 506 ? -37.555 -2.078  45.943  1.00 80.87  ? 506 PRO B O     1 
ATOM   9004  C  CB    . PRO B 1 506 ? -35.796 -2.691  43.274  1.00 83.69  ? 506 PRO B CB    1 
ATOM   9005  C  CG    . PRO B 1 506 ? -34.814 -2.331  44.384  1.00 83.72  ? 506 PRO B CG    1 
ATOM   9006  C  CD    . PRO B 1 506 ? -34.953 -0.814  44.535  1.00 82.87  ? 506 PRO B CD    1 
ATOM   9007  N  N     . ARG B 1 513 ? -33.371 -11.539 48.509  1.00 71.99  ? 513 ARG B N     1 
ATOM   9008  C  CA    . ARG B 1 513 ? -33.108 -11.632 47.077  1.00 72.35  ? 513 ARG B CA    1 
ATOM   9009  C  C     . ARG B 1 513 ? -31.615 -11.686 46.830  1.00 72.38  ? 513 ARG B C     1 
ATOM   9010  O  O     . ARG B 1 513 ? -30.837 -11.060 47.541  1.00 71.43  ? 513 ARG B O     1 
ATOM   9011  C  CB    . ARG B 1 513 ? -33.712 -10.433 46.346  1.00 71.50  ? 513 ARG B CB    1 
ATOM   9012  N  N     . ILE B 1 514 ? -31.218 -12.443 45.817  1.00 73.61  ? 514 ILE B N     1 
ATOM   9013  C  CA    . ILE B 1 514 ? -29.809 -12.567 45.481  1.00 75.21  ? 514 ILE B CA    1 
ATOM   9014  C  C     . ILE B 1 514 ? -29.254 -11.193 45.107  1.00 75.57  ? 514 ILE B C     1 
ATOM   9015  O  O     . ILE B 1 514 ? -29.876 -10.458 44.338  1.00 76.86  ? 514 ILE B O     1 
ATOM   9016  C  CB    . ILE B 1 514 ? -29.611 -13.572 44.321  1.00 76.45  ? 514 ILE B CB    1 
ATOM   9017  C  CG1   . ILE B 1 514 ? -30.693 -13.373 43.248  1.00 77.10  ? 514 ILE B CG1   1 
ATOM   9018  C  CG2   . ILE B 1 514 ? -29.662 -14.991 44.866  1.00 76.94  ? 514 ILE B CG2   1 
ATOM   9019  C  CD1   . ILE B 1 514 ? -30.597 -14.354 42.077  1.00 77.11  ? 514 ILE B CD1   1 
ATOM   9020  N  N     . PRO B 1 515 ? -28.070 -10.834 45.645  1.00 75.03  ? 515 PRO B N     1 
ATOM   9021  C  CA    . PRO B 1 515 ? -27.390 -9.552  45.409  1.00 73.70  ? 515 PRO B CA    1 
ATOM   9022  C  C     . PRO B 1 515 ? -27.140 -9.180  43.953  1.00 72.79  ? 515 PRO B C     1 
ATOM   9023  O  O     . PRO B 1 515 ? -27.364 -8.039  43.549  1.00 72.58  ? 515 PRO B O     1 
ATOM   9024  C  CB    . PRO B 1 515 ? -26.094 -9.703  46.197  1.00 73.32  ? 515 PRO B CB    1 
ATOM   9025  C  CG    . PRO B 1 515 ? -25.815 -11.158 46.081  1.00 73.62  ? 515 PRO B CG    1 
ATOM   9026  C  CD    . PRO B 1 515 ? -27.173 -11.756 46.363  1.00 74.94  ? 515 PRO B CD    1 
ATOM   9027  N  N     . GLN B 1 516 ? -26.676 -10.136 43.163  1.00 71.62  ? 516 GLN B N     1 
ATOM   9028  C  CA    . GLN B 1 516 ? -26.407 -9.853  41.769  1.00 71.34  ? 516 GLN B CA    1 
ATOM   9029  C  C     . GLN B 1 516 ? -27.669 -9.420  41.048  1.00 70.66  ? 516 GLN B C     1 
ATOM   9030  O  O     . GLN B 1 516 ? -27.608 -8.731  40.033  1.00 70.61  ? 516 GLN B O     1 
ATOM   9031  C  CB    . GLN B 1 516 ? -25.803 -11.079 41.107  1.00 72.55  ? 516 GLN B CB    1 
ATOM   9032  C  CG    . GLN B 1 516 ? -24.515 -11.491 41.764  1.00 74.06  ? 516 GLN B CG    1 
ATOM   9033  C  CD    . GLN B 1 516 ? -23.825 -12.599 41.025  1.00 76.01  ? 516 GLN B CD    1 
ATOM   9034  O  OE1   . GLN B 1 516 ? -23.467 -12.457 39.848  1.00 76.85  ? 516 GLN B OE1   1 
ATOM   9035  N  NE2   . GLN B 1 516 ? -23.627 -13.719 41.707  1.00 76.32  ? 516 GLN B NE2   1 
ATOM   9036  N  N     . GLU B 1 517 ? -28.815 -9.814  41.586  1.00 69.83  ? 517 GLU B N     1 
ATOM   9037  C  CA    . GLU B 1 517 ? -30.098 -9.460  40.994  1.00 69.65  ? 517 GLU B CA    1 
ATOM   9038  C  C     . GLU B 1 517 ? -30.574 -8.065  41.422  1.00 69.22  ? 517 GLU B C     1 
ATOM   9039  O  O     . GLU B 1 517 ? -31.185 -7.337  40.637  1.00 69.39  ? 517 GLU B O     1 
ATOM   9040  C  CB    . GLU B 1 517 ? -31.141 -10.508 41.367  1.00 69.56  ? 517 GLU B CB    1 
ATOM   9041  N  N     . VAL B 1 518 ? -30.291 -7.696  42.667  1.00 68.27  ? 518 VAL B N     1 
ATOM   9042  C  CA    . VAL B 1 518 ? -30.695 -6.399  43.199  1.00 66.84  ? 518 VAL B CA    1 
ATOM   9043  C  C     . VAL B 1 518 ? -30.068 -5.257  42.413  1.00 66.09  ? 518 VAL B C     1 
ATOM   9044  O  O     . VAL B 1 518 ? -30.728 -4.270  42.097  1.00 65.17  ? 518 VAL B O     1 
ATOM   9045  C  CB    . VAL B 1 518 ? -30.274 -6.253  44.672  1.00 66.53  ? 518 VAL B CB    1 
ATOM   9046  C  CG1   . VAL B 1 518 ? -30.947 -5.030  45.293  1.00 66.08  ? 518 VAL B CG1   1 
ATOM   9047  C  CG2   . VAL B 1 518 ? -30.624 -7.514  45.432  1.00 65.87  ? 518 VAL B CG2   1 
ATOM   9048  N  N     . VAL B 1 519 ? -28.785 -5.396  42.112  1.00 65.70  ? 519 VAL B N     1 
ATOM   9049  C  CA    . VAL B 1 519 ? -28.069 -4.377  41.367  1.00 67.11  ? 519 VAL B CA    1 
ATOM   9050  C  C     . VAL B 1 519 ? -28.676 -4.174  39.989  1.00 68.06  ? 519 VAL B C     1 
ATOM   9051  O  O     . VAL B 1 519 ? -28.974 -3.048  39.588  1.00 68.16  ? 519 VAL B O     1 
ATOM   9052  C  CB    . VAL B 1 519 ? -26.591 -4.760  41.207  1.00 67.22  ? 519 VAL B CB    1 
ATOM   9053  C  CG1   . VAL B 1 519 ? -25.954 -3.953  40.077  1.00 67.44  ? 519 VAL B CG1   1 
ATOM   9054  C  CG2   . VAL B 1 519 ? -25.859 -4.518  42.522  1.00 66.73  ? 519 VAL B CG2   1 
ATOM   9055  N  N     . TRP B 1 520 ? -28.848 -5.276  39.269  1.00 69.15  ? 520 TRP B N     1 
ATOM   9056  C  CA    . TRP B 1 520 ? -29.425 -5.251  37.933  1.00 69.70  ? 520 TRP B CA    1 
ATOM   9057  C  C     . TRP B 1 520 ? -30.884 -4.756  37.950  1.00 68.63  ? 520 TRP B C     1 
ATOM   9058  O  O     . TRP B 1 520 ? -31.328 -4.086  37.014  1.00 69.56  ? 520 TRP B O     1 
ATOM   9059  C  CB    . TRP B 1 520 ? -29.319 -6.649  37.311  1.00 71.58  ? 520 TRP B CB    1 
ATOM   9060  C  CG    . TRP B 1 520 ? -30.155 -6.840  36.091  1.00 75.05  ? 520 TRP B CG    1 
ATOM   9061  C  CD1   . TRP B 1 520 ? -31.094 -7.814  35.888  1.00 76.28  ? 520 TRP B CD1   1 
ATOM   9062  C  CD2   . TRP B 1 520 ? -30.151 -6.033  34.906  1.00 75.92  ? 520 TRP B CD2   1 
ATOM   9063  N  NE1   . TRP B 1 520 ? -31.676 -7.661  34.652  1.00 77.09  ? 520 TRP B NE1   1 
ATOM   9064  C  CE2   . TRP B 1 520 ? -31.113 -6.576  34.027  1.00 76.75  ? 520 TRP B CE2   1 
ATOM   9065  C  CE3   . TRP B 1 520 ? -29.430 -4.903  34.501  1.00 75.95  ? 520 TRP B CE3   1 
ATOM   9066  C  CZ2   . TRP B 1 520 ? -31.373 -6.025  32.767  1.00 76.89  ? 520 TRP B CZ2   1 
ATOM   9067  C  CZ3   . TRP B 1 520 ? -29.692 -4.357  33.247  1.00 76.28  ? 520 TRP B CZ3   1 
ATOM   9068  C  CH2   . TRP B 1 520 ? -30.653 -4.919  32.397  1.00 76.43  ? 520 TRP B CH2   1 
ATOM   9069  N  N     . ASP B 1 521 ? -31.630 -5.072  39.004  1.00 66.54  ? 521 ASP B N     1 
ATOM   9070  C  CA    . ASP B 1 521 ? -33.018 -4.610  39.095  1.00 65.55  ? 521 ASP B CA    1 
ATOM   9071  C  C     . ASP B 1 521 ? -32.988 -3.096  39.051  1.00 64.08  ? 521 ASP B C     1 
ATOM   9072  O  O     . ASP B 1 521 ? -33.710 -2.450  38.289  1.00 63.67  ? 521 ASP B O     1 
ATOM   9073  C  CB    . ASP B 1 521 ? -33.652 -5.067  40.405  1.00 66.18  ? 521 ASP B CB    1 
ATOM   9074  N  N     . LEU B 1 522 ? -32.127 -2.549  39.897  1.00 62.65  ? 522 LEU B N     1 
ATOM   9075  C  CA    . LEU B 1 522 ? -31.932 -1.120  40.008  1.00 60.41  ? 522 LEU B CA    1 
ATOM   9076  C  C     . LEU B 1 522 ? -31.468 -0.560  38.667  1.00 60.63  ? 522 LEU B C     1 
ATOM   9077  O  O     . LEU B 1 522 ? -31.995 0.440   38.184  1.00 60.09  ? 522 LEU B O     1 
ATOM   9078  C  CB    . LEU B 1 522 ? -30.888 -0.834  41.096  1.00 56.72  ? 522 LEU B CB    1 
ATOM   9079  C  CG    . LEU B 1 522 ? -31.279 -1.194  42.532  1.00 53.18  ? 522 LEU B CG    1 
ATOM   9080  C  CD1   . LEU B 1 522 ? -30.047 -1.470  43.356  1.00 51.06  ? 522 LEU B CD1   1 
ATOM   9081  C  CD2   . LEU B 1 522 ? -32.093 -0.066  43.133  1.00 50.70  ? 522 LEU B CD2   1 
ATOM   9082  N  N     . LEU B 1 523 ? -30.492 -1.210  38.050  1.00 60.99  ? 523 LEU B N     1 
ATOM   9083  C  CA    . LEU B 1 523 ? -29.993 -0.704  36.788  1.00 62.82  ? 523 LEU B CA    1 
ATOM   9084  C  C     . LEU B 1 523 ? -31.021 -0.722  35.670  1.00 65.06  ? 523 LEU B C     1 
ATOM   9085  O  O     . LEU B 1 523 ? -31.013 0.169   34.821  1.00 65.84  ? 523 LEU B O     1 
ATOM   9086  C  CB    . LEU B 1 523 ? -28.741 -1.464  36.340  1.00 61.18  ? 523 LEU B CB    1 
ATOM   9087  C  CG    . LEU B 1 523 ? -28.169 -0.970  34.999  1.00 60.64  ? 523 LEU B CG    1 
ATOM   9088  C  CD1   . LEU B 1 523 ? -27.865 0.509   35.081  1.00 59.28  ? 523 LEU B CD1   1 
ATOM   9089  C  CD2   . LEU B 1 523 ? -26.915 -1.744  34.641  1.00 59.97  ? 523 LEU B CD2   1 
ATOM   9090  N  N     . GLU B 1 524 ? -31.903 -1.719  35.648  1.00 67.03  ? 524 GLU B N     1 
ATOM   9091  C  CA    . GLU B 1 524 ? -32.887 -1.757  34.575  1.00 68.61  ? 524 GLU B CA    1 
ATOM   9092  C  C     . GLU B 1 524 ? -33.949 -0.689  34.742  1.00 68.94  ? 524 GLU B C     1 
ATOM   9093  O  O     . GLU B 1 524 ? -34.126 0.145   33.864  1.00 69.56  ? 524 GLU B O     1 
ATOM   9094  C  CB    . GLU B 1 524 ? -33.585 -3.107  34.472  1.00 69.14  ? 524 GLU B CB    1 
ATOM   9095  C  CG    . GLU B 1 524 ? -34.792 -3.033  33.536  1.00 71.98  ? 524 GLU B CG    1 
ATOM   9096  C  CD    . GLU B 1 524 ? -34.495 -3.423  32.087  1.00 73.96  ? 524 GLU B CD    1 
ATOM   9097  O  OE1   . GLU B 1 524 ? -34.439 -4.643  31.832  1.00 74.68  ? 524 GLU B OE1   1 
ATOM   9098  O  OE2   . GLU B 1 524 ? -34.328 -2.533  31.210  1.00 73.21  ? 524 GLU B OE2   1 
ATOM   9099  N  N     . GLU B 1 525 ? -34.664 -0.716  35.861  1.00 69.20  ? 525 GLU B N     1 
ATOM   9100  C  CA    . GLU B 1 525 ? -35.714 0.271   36.100  1.00 69.25  ? 525 GLU B CA    1 
ATOM   9101  C  C     . GLU B 1 525 ? -35.191 1.686   35.845  1.00 69.52  ? 525 GLU B C     1 
ATOM   9102  O  O     . GLU B 1 525 ? -35.969 2.614   35.618  1.00 69.06  ? 525 GLU B O     1 
ATOM   9103  C  CB    . GLU B 1 525 ? -36.226 0.145   37.529  1.00 69.05  ? 525 GLU B CB    1 
ATOM   9104  C  CG    . GLU B 1 525 ? -37.524 0.868   37.782  1.00 68.19  ? 525 GLU B CG    1 
ATOM   9105  C  CD    . GLU B 1 525 ? -37.964 0.743   39.223  0.00 68.52  ? 525 GLU B CD    1 
ATOM   9106  O  OE1   . GLU B 1 525 ? -37.139 1.002   40.126  0.00 68.46  ? 525 GLU B OE1   1 
ATOM   9107  O  OE2   . GLU B 1 525 ? -39.142 0.402   39.455  0.00 68.46  ? 525 GLU B OE2   1 
ATOM   9108  N  N     . THR B 1 526 ? -33.865 1.826   35.893  1.00 70.34  ? 526 THR B N     1 
ATOM   9109  C  CA    . THR B 1 526 ? -33.170 3.088   35.646  1.00 70.10  ? 526 THR B CA    1 
ATOM   9110  C  C     . THR B 1 526 ? -33.104 3.255   34.140  1.00 71.22  ? 526 THR B C     1 
ATOM   9111  O  O     . THR B 1 526 ? -33.385 4.321   33.604  1.00 70.55  ? 526 THR B O     1 
ATOM   9112  C  CB    . THR B 1 526 ? -31.724 3.046   36.164  1.00 69.17  ? 526 THR B CB    1 
ATOM   9113  O  OG1   . THR B 1 526 ? -31.723 2.888   37.584  1.00 66.93  ? 526 THR B OG1   1 
ATOM   9114  C  CG2   . THR B 1 526 ? -30.995 4.321   35.801  1.00 70.07  ? 526 THR B CG2   1 
ATOM   9115  N  N     . LEU B 1 527 ? -32.715 2.174   33.474  1.00 73.58  ? 527 LEU B N     1 
ATOM   9116  C  CA    . LEU B 1 527 ? -32.606 2.139   32.026  1.00 76.13  ? 527 LEU B CA    1 
ATOM   9117  C  C     . LEU B 1 527 ? -33.983 2.234   31.368  1.00 78.12  ? 527 LEU B C     1 
ATOM   9118  O  O     . LEU B 1 527 ? -34.107 2.781   30.279  1.00 79.85  ? 527 LEU B O     1 
ATOM   9119  C  CB    . LEU B 1 527 ? -31.899 0.850   31.586  1.00 76.02  ? 527 LEU B CB    1 
ATOM   9120  C  CG    . LEU B 1 527 ? -30.390 0.750   31.837  1.00 76.00  ? 527 LEU B CG    1 
ATOM   9121  C  CD1   . LEU B 1 527 ? -29.917 -0.690  31.681  1.00 75.91  ? 527 LEU B CD1   1 
ATOM   9122  C  CD2   . LEU B 1 527 ? -29.665 1.670   30.866  1.00 75.38  ? 527 LEU B CD2   1 
ATOM   9123  N  N     . TRP B 1 528 ? -35.014 1.699   32.018  1.00 79.85  ? 528 TRP B N     1 
ATOM   9124  C  CA    . TRP B 1 528 ? -36.364 1.757   31.467  1.00 81.38  ? 528 TRP B CA    1 
ATOM   9125  C  C     . TRP B 1 528 ? -36.881 3.175   31.574  1.00 79.88  ? 528 TRP B C     1 
ATOM   9126  O  O     . TRP B 1 528 ? -37.328 3.760   30.589  1.00 80.21  ? 528 TRP B O     1 
ATOM   9127  C  CB    . TRP B 1 528 ? -37.312 0.817   32.222  1.00 86.66  ? 528 TRP B CB    1 
ATOM   9128  C  CG    . TRP B 1 528 ? -37.322 -0.623  31.733  1.00 93.29  ? 528 TRP B CG    1 
ATOM   9129  C  CD1   . TRP B 1 528 ? -37.446 -1.747  32.507  1.00 94.91  ? 528 TRP B CD1   1 
ATOM   9130  C  CD2   . TRP B 1 528 ? -37.228 -1.086  30.374  1.00 96.01  ? 528 TRP B CD2   1 
ATOM   9131  N  NE1   . TRP B 1 528 ? -37.427 -2.876  31.719  1.00 96.24  ? 528 TRP B NE1   1 
ATOM   9132  C  CE2   . TRP B 1 528 ? -37.295 -2.500  30.409  1.00 96.83  ? 528 TRP B CE2   1 
ATOM   9133  C  CE3   . TRP B 1 528 ? -37.095 -0.446  29.135  1.00 97.48  ? 528 TRP B CE3   1 
ATOM   9134  C  CZ2   . TRP B 1 528 ? -37.232 -3.281  29.251  1.00 97.34  ? 528 TRP B CZ2   1 
ATOM   9135  C  CZ3   . TRP B 1 528 ? -37.035 -1.228  27.985  1.00 98.31  ? 528 TRP B CZ3   1 
ATOM   9136  C  CH2   . TRP B 1 528 ? -37.102 -2.629  28.054  1.00 98.10  ? 528 TRP B CH2   1 
ATOM   9137  N  N     . ALA B 1 529 ? -36.815 3.725   32.780  1.00 78.26  ? 529 ALA B N     1 
ATOM   9138  C  CA    . ALA B 1 529 ? -37.279 5.082   33.027  1.00 77.60  ? 529 ALA B CA    1 
ATOM   9139  C  C     . ALA B 1 529 ? -36.595 6.052   32.072  1.00 76.80  ? 529 ALA B C     1 
ATOM   9140  O  O     . ALA B 1 529 ? -37.159 7.069   31.667  1.00 76.34  ? 529 ALA B O     1 
ATOM   9141  C  CB    . ALA B 1 529 ? -36.983 5.467   34.460  1.00 77.47  ? 529 ALA B CB    1 
ATOM   9142  N  N     . PHE B 1 530 ? -35.367 5.716   31.715  1.00 76.12  ? 530 PHE B N     1 
ATOM   9143  C  CA    . PHE B 1 530 ? -34.573 6.529   30.816  1.00 75.85  ? 530 PHE B CA    1 
ATOM   9144  C  C     . PHE B 1 530 ? -35.061 6.430   29.371  1.00 77.24  ? 530 PHE B C     1 
ATOM   9145  O  O     . PHE B 1 530 ? -35.267 7.448   28.721  1.00 77.87  ? 530 PHE B O     1 
ATOM   9146  C  CB    . PHE B 1 530 ? -33.108 6.092   30.899  1.00 73.83  ? 530 PHE B CB    1 
ATOM   9147  C  CG    . PHE B 1 530 ? -32.175 6.930   30.081  1.00 71.02  ? 530 PHE B CG    1 
ATOM   9148  C  CD1   . PHE B 1 530 ? -31.733 8.162   30.546  1.00 70.24  ? 530 PHE B CD1   1 
ATOM   9149  C  CD2   . PHE B 1 530 ? -31.757 6.497   28.833  1.00 69.76  ? 530 PHE B CD2   1 
ATOM   9150  C  CE1   . PHE B 1 530 ? -30.889 8.947   29.779  1.00 69.69  ? 530 PHE B CE1   1 
ATOM   9151  C  CE2   . PHE B 1 530 ? -30.914 7.273   28.058  1.00 69.10  ? 530 PHE B CE2   1 
ATOM   9152  C  CZ    . PHE B 1 530 ? -30.479 8.501   28.529  1.00 68.94  ? 530 PHE B CZ    1 
ATOM   9153  N  N     . ARG B 1 531 ? -35.246 5.212   28.864  1.00 78.97  ? 531 ARG B N     1 
ATOM   9154  C  CA    . ARG B 1 531 ? -35.689 5.034   27.479  1.00 80.44  ? 531 ARG B CA    1 
ATOM   9155  C  C     . ARG B 1 531 ? -37.067 5.611   27.200  1.00 79.77  ? 531 ARG B C     1 
ATOM   9156  O  O     . ARG B 1 531 ? -37.398 5.908   26.048  1.00 80.24  ? 531 ARG B O     1 
ATOM   9157  C  CB    . ARG B 1 531 ? -35.678 3.552   27.062  1.00 83.12  ? 531 ARG B CB    1 
ATOM   9158  C  CG    . ARG B 1 531 ? -36.432 3.284   25.730  1.00 86.19  ? 531 ARG B CG    1 
ATOM   9159  C  CD    . ARG B 1 531 ? -35.541 2.869   24.534  1.00 87.55  ? 531 ARG B CD    1 
ATOM   9160  N  NE    . ARG B 1 531 ? -35.086 1.471   24.539  1.00 88.68  ? 531 ARG B NE    1 
ATOM   9161  C  CZ    . ARG B 1 531 ? -35.523 0.512   25.357  1.00 88.26  ? 531 ARG B CZ    1 
ATOM   9162  N  NH1   . ARG B 1 531 ? -35.031 -0.709  25.249  1.00 87.40  ? 531 ARG B NH1   1 
ATOM   9163  N  NH2   . ARG B 1 531 ? -36.433 0.762   26.287  1.00 87.98  ? 531 ARG B NH2   1 
ATOM   9164  N  N     . ARG B 1 532 ? -37.875 5.760   28.245  1.00 78.29  ? 532 ARG B N     1 
ATOM   9165  C  CA    . ARG B 1 532 ? -39.211 6.316   28.078  1.00 76.46  ? 532 ARG B CA    1 
ATOM   9166  C  C     . ARG B 1 532 ? -39.101 7.829   27.950  1.00 75.38  ? 532 ARG B C     1 
ATOM   9167  O  O     . ARG B 1 532 ? -39.477 8.411   26.938  1.00 74.19  ? 532 ARG B O     1 
ATOM   9168  C  CB    . ARG B 1 532 ? -40.084 6.005   29.289  1.00 76.42  ? 532 ARG B CB    1 
ATOM   9169  C  CG    . ARG B 1 532 ? -40.105 4.564   29.732  1.00 75.96  ? 532 ARG B CG    1 
ATOM   9170  C  CD    . ARG B 1 532 ? -40.617 4.531   31.153  1.00 76.32  ? 532 ARG B CD    1 
ATOM   9171  N  NE    . ARG B 1 532 ? -40.457 3.235   31.797  1.00 77.09  ? 532 ARG B NE    1 
ATOM   9172  C  CZ    . ARG B 1 532 ? -40.563 3.047   33.110  1.00 77.23  ? 532 ARG B CZ    1 
ATOM   9173  N  NH1   . ARG B 1 532 ? -40.824 4.072   33.912  1.00 75.82  ? 532 ARG B NH1   1 
ATOM   9174  N  NH2   . ARG B 1 532 ? -40.408 1.834   33.622  1.00 77.73  ? 532 ARG B NH2   1 
ATOM   9175  N  N     . LYS B 1 533 ? -38.572 8.453   28.996  1.00 75.80  ? 533 LYS B N     1 
ATOM   9176  C  CA    . LYS B 1 533 ? -38.423 9.903   29.053  1.00 76.33  ? 533 LYS B CA    1 
ATOM   9177  C  C     . LYS B 1 533 ? -37.265 10.458  28.230  1.00 76.42  ? 533 LYS B C     1 
ATOM   9178  O  O     . LYS B 1 533 ? -36.809 11.576  28.478  1.00 77.07  ? 533 LYS B O     1 
ATOM   9179  C  CB    . LYS B 1 533 ? -38.285 10.350  30.512  1.00 75.27  ? 533 LYS B CB    1 
ATOM   9180  N  N     . ALA B 1 534 ? -36.799 9.689   27.249  1.00 76.05  ? 534 ALA B N     1 
ATOM   9181  C  CA    . ALA B 1 534 ? -35.697 10.126  26.399  1.00 76.00  ? 534 ALA B CA    1 
ATOM   9182  C  C     . ALA B 1 534 ? -35.914 9.705   24.955  1.00 75.91  ? 534 ALA B C     1 
ATOM   9183  O  O     . ALA B 1 534 ? -35.519 10.409  24.027  1.00 76.23  ? 534 ALA B O     1 
ATOM   9184  C  CB    . ALA B 1 534 ? -34.388 9.558   26.909  1.00 76.36  ? 534 ALA B CB    1 
ATOM   9185  N  N     . GLY B 1 535 ? -36.540 8.548   24.771  1.00 75.75  ? 535 GLY B N     1 
ATOM   9186  C  CA    . GLY B 1 535 ? -36.807 8.055   23.432  1.00 75.11  ? 535 GLY B CA    1 
ATOM   9187  C  C     . GLY B 1 535 ? -35.716 7.129   22.954  1.00 74.78  ? 535 GLY B C     1 
ATOM   9188  O  O     . GLY B 1 535 ? -35.934 6.274   22.097  1.00 75.26  ? 535 GLY B O     1 
ATOM   9189  N  N     . ARG B 1 536 ? -34.528 7.304   23.515  1.00 73.92  ? 536 ARG B N     1 
ATOM   9190  C  CA    . ARG B 1 536 ? -33.390 6.475   23.157  1.00 72.50  ? 536 ARG B CA    1 
ATOM   9191  C  C     . ARG B 1 536 ? -33.127 5.486   24.262  1.00 71.57  ? 536 ARG B C     1 
ATOM   9192  O  O     . ARG B 1 536 ? -33.941 5.183   25.114  1.00 72.39  ? 536 ARG B O     1 
ATOM   9193  C  CB    . ARG B 1 536 ? -32.095 7.280   23.081  1.00 73.54  ? 536 ARG B CB    1 
ATOM   9194  C  CG    . ARG B 1 536 ? -31.930 8.320   22.022  1.00 75.06  ? 536 ARG B CG    1 
ATOM   9195  C  CD    . ARG B 1 536 ? -30.571 8.993   22.235  1.00 75.09  ? 536 ARG B CD    1 
ATOM   9196  N  NE    . ARG B 1 536 ? -29.446 8.201   21.731  1.00 77.50  ? 536 ARG B NE    1 
ATOM   9197  C  CZ    . ARG B 1 536 ? -28.225 8.209   22.265  1.00 78.28  ? 536 ARG B CZ    1 
ATOM   9198  N  NH1   . ARG B 1 536 ? -27.976 8.955   23.332  1.00 77.29  ? 536 ARG B NH1   1 
ATOM   9199  N  NH2   . ARG B 1 536 ? -27.239 7.509   21.708  1.00 78.83  ? 536 ARG B NH2   1 
ATOM   9200  N  N     . LEU B 1 537 ? -31.891 5.050   24.227  1.00 69.79  ? 537 LEU B N     1 
ATOM   9201  C  CA    . LEU B 1 537 ? -31.319 4.172   25.185  1.00 67.24  ? 537 LEU B CA    1 
ATOM   9202  C  C     . LEU B 1 537 ? -29.932 4.766   25.120  1.00 64.86  ? 537 LEU B C     1 
ATOM   9203  O  O     . LEU B 1 537 ? -29.458 5.088   24.041  1.00 64.08  ? 537 LEU B O     1 
ATOM   9204  C  CB    . LEU B 1 537 ? -31.336 2.777   24.639  1.00 68.06  ? 537 LEU B CB    1 
ATOM   9205  C  CG    . LEU B 1 537 ? -31.253 1.602   25.583  1.00 67.91  ? 537 LEU B CG    1 
ATOM   9206  C  CD1   . LEU B 1 537 ? -32.386 1.491   26.607  1.00 65.99  ? 537 LEU B CD1   1 
ATOM   9207  C  CD2   . LEU B 1 537 ? -31.331 0.492   24.605  1.00 66.75  ? 537 LEU B CD2   1 
ATOM   9208  N  N     . PRO B 1 538 ? -29.260 4.909   26.262  1.00 62.26  ? 538 PRO B N     1 
ATOM   9209  C  CA    . PRO B 1 538 ? -27.920 5.493   26.275  1.00 60.19  ? 538 PRO B CA    1 
ATOM   9210  C  C     . PRO B 1 538 ? -26.829 4.789   25.483  1.00 58.65  ? 538 PRO B C     1 
ATOM   9211  O  O     . PRO B 1 538 ? -26.815 3.576   25.353  1.00 57.13  ? 538 PRO B O     1 
ATOM   9212  C  CB    . PRO B 1 538 ? -27.604 5.544   27.756  1.00 61.00  ? 538 PRO B CB    1 
ATOM   9213  C  CG    . PRO B 1 538 ? -28.236 4.271   28.238  1.00 61.17  ? 538 PRO B CG    1 
ATOM   9214  C  CD    . PRO B 1 538 ? -29.573 4.289   27.563  1.00 61.66  ? 538 PRO B CD    1 
ATOM   9215  N  N     . SER B 1 539 ? -25.898 5.573   24.962  1.00 59.41  ? 539 SER B N     1 
ATOM   9216  C  CA    . SER B 1 539 ? -24.790 5.014   24.207  1.00 60.80  ? 539 SER B CA    1 
ATOM   9217  C  C     . SER B 1 539 ? -23.806 4.437   25.209  1.00 61.48  ? 539 SER B C     1 
ATOM   9218  O  O     . SER B 1 539 ? -23.309 3.326   25.023  1.00 62.36  ? 539 SER B O     1 
ATOM   9219  C  CB    . SER B 1 539 ? -24.088 6.093   23.374  1.00 60.83  ? 539 SER B CB    1 
ATOM   9220  O  OG    . SER B 1 539 ? -23.490 7.070   24.211  1.00 62.68  ? 539 SER B OG    1 
ATOM   9221  N  N     . ARG B 1 540 ? -23.542 5.185   26.282  1.00 61.03  ? 540 ARG B N     1 
ATOM   9222  C  CA    . ARG B 1 540 ? -22.592 4.743   27.302  1.00 60.28  ? 540 ARG B CA    1 
ATOM   9223  C  C     . ARG B 1 540 ? -23.040 5.127   28.702  1.00 59.78  ? 540 ARG B C     1 
ATOM   9224  O  O     . ARG B 1 540 ? -23.454 6.269   28.929  1.00 61.45  ? 540 ARG B O     1 
ATOM   9225  C  CB    . ARG B 1 540 ? -21.234 5.374   27.022  1.00 60.55  ? 540 ARG B CB    1 
ATOM   9226  C  CG    . ARG B 1 540 ? -20.061 4.657   27.631  1.00 61.51  ? 540 ARG B CG    1 
ATOM   9227  C  CD    . ARG B 1 540 ? -18.791 5.231   27.046  1.00 63.27  ? 540 ARG B CD    1 
ATOM   9228  N  NE    . ARG B 1 540 ? -17.593 4.528   27.492  1.00 67.28  ? 540 ARG B NE    1 
ATOM   9229  C  CZ    . ARG B 1 540 ? -17.238 3.309   27.094  1.00 68.65  ? 540 ARG B CZ    1 
ATOM   9230  N  NH1   . ARG B 1 540 ? -17.993 2.650   26.235  1.00 69.85  ? 540 ARG B NH1   1 
ATOM   9231  N  NH2   . ARG B 1 540 ? -16.122 2.749   27.552  1.00 70.20  ? 540 ARG B NH2   1 
ATOM   9232  N  N     . VAL B 1 541 ? -22.962 4.184   29.639  1.00 57.51  ? 541 VAL B N     1 
ATOM   9233  C  CA    . VAL B 1 541 ? -23.356 4.478   31.018  1.00 54.86  ? 541 VAL B CA    1 
ATOM   9234  C  C     . VAL B 1 541 ? -22.189 4.485   31.972  1.00 53.67  ? 541 VAL B C     1 
ATOM   9235  O  O     . VAL B 1 541 ? -21.210 3.754   31.807  1.00 53.41  ? 541 VAL B O     1 
ATOM   9236  C  CB    . VAL B 1 541 ? -24.361 3.480   31.591  1.00 53.86  ? 541 VAL B CB    1 
ATOM   9237  C  CG1   . VAL B 1 541 ? -25.702 3.653   30.923  1.00 53.93  ? 541 VAL B CG1   1 
ATOM   9238  C  CG2   . VAL B 1 541 ? -23.820 2.076   31.450  1.00 53.28  ? 541 VAL B CG2   1 
ATOM   9239  N  N     . LEU B 1 542 ? -22.324 5.318   32.990  1.00 52.18  ? 542 LEU B N     1 
ATOM   9240  C  CA    . LEU B 1 542 ? -21.310 5.458   34.003  1.00 51.43  ? 542 LEU B CA    1 
ATOM   9241  C  C     . LEU B 1 542 ? -21.827 4.894   35.303  1.00 50.87  ? 542 LEU B C     1 
ATOM   9242  O  O     . LEU B 1 542 ? -22.696 5.485   35.939  1.00 50.23  ? 542 LEU B O     1 
ATOM   9243  C  CB    . LEU B 1 542 ? -20.969 6.927   34.192  1.00 51.68  ? 542 LEU B CB    1 
ATOM   9244  C  CG    . LEU B 1 542 ? -19.849 7.198   35.185  1.00 51.69  ? 542 LEU B CG    1 
ATOM   9245  C  CD1   . LEU B 1 542 ? -18.603 6.417   34.774  1.00 51.96  ? 542 LEU B CD1   1 
ATOM   9246  C  CD2   . LEU B 1 542 ? -19.577 8.696   35.230  1.00 51.84  ? 542 LEU B CD2   1 
ATOM   9247  N  N     . LEU B 1 543 ? -21.276 3.752   35.698  1.00 50.69  ? 543 LEU B N     1 
ATOM   9248  C  CA    . LEU B 1 543 ? -21.671 3.090   36.932  1.00 49.41  ? 543 LEU B CA    1 
ATOM   9249  C  C     . LEU B 1 543 ? -20.774 3.479   38.110  1.00 49.22  ? 543 LEU B C     1 
ATOM   9250  O  O     . LEU B 1 543 ? -19.583 3.188   38.116  1.00 49.31  ? 543 LEU B O     1 
ATOM   9251  C  CB    . LEU B 1 543 ? -21.646 1.581   36.716  1.00 46.89  ? 543 LEU B CB    1 
ATOM   9252  C  CG    . LEU B 1 543 ? -22.525 1.165   35.538  1.00 43.40  ? 543 LEU B CG    1 
ATOM   9253  C  CD1   . LEU B 1 543 ? -22.443 -0.323  35.350  1.00 42.98  ? 543 LEU B CD1   1 
ATOM   9254  C  CD2   . LEU B 1 543 ? -23.952 1.591   35.787  1.00 41.45  ? 543 LEU B CD2   1 
ATOM   9255  N  N     . LEU B 1 544 ? -21.375 4.143   39.095  1.00 49.48  ? 544 LEU B N     1 
ATOM   9256  C  CA    . LEU B 1 544 ? -20.694 4.603   40.302  1.00 50.16  ? 544 LEU B CA    1 
ATOM   9257  C  C     . LEU B 1 544 ? -21.210 3.857   41.522  1.00 51.92  ? 544 LEU B C     1 
ATOM   9258  O  O     . LEU B 1 544 ? -22.398 3.921   41.829  1.00 53.29  ? 544 LEU B O     1 
ATOM   9259  C  CB    . LEU B 1 544 ? -20.961 6.087   40.507  1.00 48.67  ? 544 LEU B CB    1 
ATOM   9260  C  CG    . LEU B 1 544 ? -20.379 6.968   39.424  1.00 48.01  ? 544 LEU B CG    1 
ATOM   9261  C  CD1   . LEU B 1 544 ? -20.762 8.416   39.645  1.00 47.18  ? 544 LEU B CD1   1 
ATOM   9262  C  CD2   . LEU B 1 544 ? -18.881 6.777   39.449  1.00 48.16  ? 544 LEU B CD2   1 
ATOM   9263  N  N     . ARG B 1 545 ? -20.324 3.178   42.239  1.00 52.99  ? 545 ARG B N     1 
ATOM   9264  C  CA    . ARG B 1 545 ? -20.734 2.422   43.422  1.00 54.58  ? 545 ARG B CA    1 
ATOM   9265  C  C     . ARG B 1 545 ? -19.763 2.654   44.566  1.00 55.46  ? 545 ARG B C     1 
ATOM   9266  O  O     . ARG B 1 545 ? -18.658 3.122   44.335  1.00 56.33  ? 545 ARG B O     1 
ATOM   9267  C  CB    . ARG B 1 545 ? -20.745 0.937   43.086  1.00 53.83  ? 545 ARG B CB    1 
ATOM   9268  C  CG    . ARG B 1 545 ? -19.365 0.408   42.838  1.00 52.95  ? 545 ARG B CG    1 
ATOM   9269  C  CD    . ARG B 1 545 ? -19.375 -0.826  41.981  1.00 54.06  ? 545 ARG B CD    1 
ATOM   9270  N  NE    . ARG B 1 545 ? -18.059 -1.456  41.958  1.00 54.09  ? 545 ARG B NE    1 
ATOM   9271  C  CZ    . ARG B 1 545 ? -17.412 -1.839  43.053  1.00 54.18  ? 545 ARG B CZ    1 
ATOM   9272  N  NH1   . ARG B 1 545 ? -17.964 -1.648  44.242  1.00 55.30  ? 545 ARG B NH1   1 
ATOM   9273  N  NH2   . ARG B 1 545 ? -16.229 -2.424  42.968  1.00 54.09  ? 545 ARG B NH2   1 
ATOM   9274  N  N     . ASP B 1 546 ? -20.161 2.326   45.794  1.00 57.52  ? 546 ASP B N     1 
ATOM   9275  C  CA    . ASP B 1 546 ? -19.256 2.490   46.934  1.00 59.26  ? 546 ASP B CA    1 
ATOM   9276  C  C     . ASP B 1 546 ? -18.259 1.343   46.848  1.00 59.65  ? 546 ASP B C     1 
ATOM   9277  O  O     . ASP B 1 546 ? -18.646 0.190   46.682  1.00 60.55  ? 546 ASP B O     1 
ATOM   9278  C  CB    . ASP B 1 546 ? -20.000 2.416   48.268  1.00 61.76  ? 546 ASP B CB    1 
ATOM   9279  C  CG    . ASP B 1 546 ? -19.127 2.847   49.447  1.00 64.62  ? 546 ASP B CG    1 
ATOM   9280  O  OD1   . ASP B 1 546 ? -19.519 2.625   50.617  1.00 66.08  ? 546 ASP B OD1   1 
ATOM   9281  O  OD2   . ASP B 1 546 ? -18.044 3.423   49.205  1.00 66.82  ? 546 ASP B OD2   1 
ATOM   9282  N  N     . GLY B 1 547 ? -16.981 1.668   46.971  1.00 60.06  ? 547 GLY B N     1 
ATOM   9283  C  CA    . GLY B 1 547 ? -15.933 0.671   46.856  1.00 62.41  ? 547 GLY B CA    1 
ATOM   9284  C  C     . GLY B 1 547 ? -15.984 -0.592  47.691  1.00 64.21  ? 547 GLY B C     1 
ATOM   9285  O  O     . GLY B 1 547 ? -15.322 -1.582  47.346  1.00 64.05  ? 547 GLY B O     1 
ATOM   9286  N  N     . ARG B 1 548 ? -16.767 -0.574  48.768  1.00 65.80  ? 548 ARG B N     1 
ATOM   9287  C  CA    . ARG B 1 548 ? -16.873 -1.715  49.681  1.00 67.06  ? 548 ARG B CA    1 
ATOM   9288  C  C     . ARG B 1 548 ? -17.687 -2.901  49.202  1.00 66.45  ? 548 ARG B C     1 
ATOM   9289  O  O     . ARG B 1 548 ? -17.377 -4.046  49.529  1.00 65.68  ? 548 ARG B O     1 
ATOM   9290  C  CB    . ARG B 1 548 ? -17.416 -1.239  51.016  1.00 69.49  ? 548 ARG B CB    1 
ATOM   9291  C  CG    . ARG B 1 548 ? -16.614 -0.087  51.563  1.00 72.70  ? 548 ARG B CG    1 
ATOM   9292  C  CD    . ARG B 1 548 ? -16.199 -0.325  52.997  1.00 75.55  ? 548 ARG B CD    1 
ATOM   9293  N  NE    . ARG B 1 548 ? -16.657 0.779   53.830  1.00 77.33  ? 548 ARG B NE    1 
ATOM   9294  C  CZ    . ARG B 1 548 ? -17.724 0.730   54.618  1.00 77.56  ? 548 ARG B CZ    1 
ATOM   9295  N  NH1   . ARG B 1 548 ? -18.451 -0.382  54.695  1.00 77.90  ? 548 ARG B NH1   1 
ATOM   9296  N  NH2   . ARG B 1 548 ? -18.073 1.805   55.312  1.00 77.16  ? 548 ARG B NH2   1 
ATOM   9297  N  N     . VAL B 1 549 ? -18.745 -2.628  48.454  1.00 66.38  ? 549 VAL B N     1 
ATOM   9298  C  CA    . VAL B 1 549 ? -19.554 -3.702  47.921  1.00 66.06  ? 549 VAL B CA    1 
ATOM   9299  C  C     . VAL B 1 549 ? -18.666 -4.383  46.884  1.00 65.87  ? 549 VAL B C     1 
ATOM   9300  O  O     . VAL B 1 549 ? -18.261 -3.757  45.908  1.00 65.92  ? 549 VAL B O     1 
ATOM   9301  C  CB    . VAL B 1 549 ? -20.813 -3.154  47.239  1.00 65.69  ? 549 VAL B CB    1 
ATOM   9302  C  CG1   . VAL B 1 549 ? -21.693 -4.297  46.767  1.00 66.01  ? 549 VAL B CG1   1 
ATOM   9303  C  CG2   . VAL B 1 549 ? -21.564 -2.272  48.202  1.00 65.30  ? 549 VAL B CG2   1 
ATOM   9304  N  N     . PRO B 1 550 ? -18.324 -5.666  47.098  1.00 66.00  ? 550 PRO B N     1 
ATOM   9305  C  CA    . PRO B 1 550 ? -17.475 -6.402  46.151  1.00 65.38  ? 550 PRO B CA    1 
ATOM   9306  C  C     . PRO B 1 550 ? -18.076 -6.296  44.763  1.00 64.64  ? 550 PRO B C     1 
ATOM   9307  O  O     . PRO B 1 550 ? -19.285 -6.437  44.596  1.00 65.20  ? 550 PRO B O     1 
ATOM   9308  C  CB    . PRO B 1 550 ? -17.495 -7.824  46.704  1.00 66.26  ? 550 PRO B CB    1 
ATOM   9309  C  CG    . PRO B 1 550 ? -18.825 -7.890  47.430  1.00 66.48  ? 550 PRO B CG    1 
ATOM   9310  C  CD    . PRO B 1 550 ? -18.862 -6.567  48.131  1.00 66.09  ? 550 PRO B CD    1 
ATOM   9311  N  N     . GLN B 1 551 ? -17.240 -6.053  43.766  1.00 63.93  ? 551 GLN B N     1 
ATOM   9312  C  CA    . GLN B 1 551 ? -17.747 -5.878  42.412  1.00 64.70  ? 551 GLN B CA    1 
ATOM   9313  C  C     . GLN B 1 551 ? -18.472 -7.057  41.757  1.00 65.15  ? 551 GLN B C     1 
ATOM   9314  O  O     . GLN B 1 551 ? -18.875 -6.969  40.595  1.00 64.10  ? 551 GLN B O     1 
ATOM   9315  C  CB    . GLN B 1 551 ? -16.622 -5.405  41.497  1.00 63.79  ? 551 GLN B CB    1 
ATOM   9316  C  CG    . GLN B 1 551 ? -15.554 -6.429  41.240  1.00 62.23  ? 551 GLN B CG    1 
ATOM   9317  C  CD    . GLN B 1 551 ? -14.639 -5.989  40.134  1.00 61.62  ? 551 GLN B CD    1 
ATOM   9318  O  OE1   . GLN B 1 551 ? -13.755 -6.727  39.704  1.00 62.13  ? 551 GLN B OE1   1 
ATOM   9319  N  NE2   . GLN B 1 551 ? -14.845 -4.770  39.660  1.00 61.14  ? 551 GLN B NE2   1 
ATOM   9320  N  N     . ASP B 1 552 ? -18.645 -8.154  42.486  1.00 66.24  ? 552 ASP B N     1 
ATOM   9321  C  CA    . ASP B 1 552 ? -19.336 -9.307  41.923  1.00 67.48  ? 552 ASP B CA    1 
ATOM   9322  C  C     . ASP B 1 552 ? -20.829 -9.069  41.876  1.00 66.48  ? 552 ASP B C     1 
ATOM   9323  O  O     . ASP B 1 552 ? -21.570 -9.828  41.249  1.00 67.14  ? 552 ASP B O     1 
ATOM   9324  C  CB    . ASP B 1 552 ? -19.043 -10.572 42.730  1.00 70.67  ? 552 ASP B CB    1 
ATOM   9325  C  CG    . ASP B 1 552 ? -17.845 -11.334 42.196  1.00 74.51  ? 552 ASP B CG    1 
ATOM   9326  O  OD1   . ASP B 1 552 ? -16.745 -10.736 42.093  1.00 75.78  ? 552 ASP B OD1   1 
ATOM   9327  O  OD2   . ASP B 1 552 ? -18.010 -12.533 41.874  1.00 77.32  ? 552 ASP B OD2   1 
ATOM   9328  N  N     . GLU B 1 553 ? -21.272 -8.010  42.540  1.00 64.43  ? 553 GLU B N     1 
ATOM   9329  C  CA    . GLU B 1 553 ? -22.685 -7.693  42.551  1.00 63.12  ? 553 GLU B CA    1 
ATOM   9330  C  C     . GLU B 1 553 ? -23.058 -6.986  41.255  1.00 62.94  ? 553 GLU B C     1 
ATOM   9331  O  O     . GLU B 1 553 ? -24.201 -6.579  41.078  1.00 63.83  ? 553 GLU B O     1 
ATOM   9332  C  CB    . GLU B 1 553 ? -23.018 -6.817  43.748  1.00 62.50  ? 553 GLU B CB    1 
ATOM   9333  N  N     . PHE B 1 554 ? -22.102 -6.845  40.339  1.00 61.64  ? 554 PHE B N     1 
ATOM   9334  C  CA    . PHE B 1 554 ? -22.380 -6.166  39.076  1.00 60.81  ? 554 PHE B CA    1 
ATOM   9335  C  C     . PHE B 1 554 ? -22.142 -7.014  37.842  1.00 62.13  ? 554 PHE B C     1 
ATOM   9336  O  O     . PHE B 1 554 ? -22.394 -6.568  36.724  1.00 63.23  ? 554 PHE B O     1 
ATOM   9337  C  CB    . PHE B 1 554 ? -21.539 -4.896  38.956  1.00 58.01  ? 554 PHE B CB    1 
ATOM   9338  C  CG    . PHE B 1 554 ? -21.922 -3.830  39.923  1.00 53.90  ? 554 PHE B CG    1 
ATOM   9339  C  CD1   . PHE B 1 554 ? -21.662 -3.977  41.275  1.00 52.89  ? 554 PHE B CD1   1 
ATOM   9340  C  CD2   . PHE B 1 554 ? -22.584 -2.701  39.488  1.00 51.34  ? 554 PHE B CD2   1 
ATOM   9341  C  CE1   . PHE B 1 554 ? -22.066 -3.016  42.175  1.00 52.35  ? 554 PHE B CE1   1 
ATOM   9342  C  CE2   . PHE B 1 554 ? -22.988 -1.740  40.378  1.00 50.25  ? 554 PHE B CE2   1 
ATOM   9343  C  CZ    . PHE B 1 554 ? -22.731 -1.893  41.724  1.00 51.27  ? 554 PHE B CZ    1 
ATOM   9344  N  N     . ALA B 1 555 ? -21.650 -8.230  38.041  1.00 63.10  ? 555 ALA B N     1 
ATOM   9345  C  CA    . ALA B 1 555 ? -21.363 -9.132  36.929  1.00 63.89  ? 555 ALA B CA    1 
ATOM   9346  C  C     . ALA B 1 555 ? -22.535 -9.284  35.947  1.00 64.12  ? 555 ALA B C     1 
ATOM   9347  O  O     . ALA B 1 555 ? -22.367 -9.105  34.734  1.00 62.73  ? 555 ALA B O     1 
ATOM   9348  C  CB    . ALA B 1 555 ? -20.953 -10.499 37.477  1.00 63.95  ? 555 ALA B CB    1 
ATOM   9349  N  N     . LEU B 1 556 ? -23.709 -9.615  36.489  1.00 64.03  ? 556 LEU B N     1 
ATOM   9350  C  CA    . LEU B 1 556 ? -24.924 -9.811  35.705  1.00 64.32  ? 556 LEU B CA    1 
ATOM   9351  C  C     . LEU B 1 556 ? -25.420 -8.539  35.026  1.00 65.41  ? 556 LEU B C     1 
ATOM   9352  O  O     . LEU B 1 556 ? -25.952 -8.591  33.915  1.00 66.71  ? 556 LEU B O     1 
ATOM   9353  C  CB    . LEU B 1 556 ? -26.036 -10.369 36.595  1.00 64.64  ? 556 LEU B CB    1 
ATOM   9354  C  CG    . LEU B 1 556 ? -27.439 -10.403 35.970  1.00 65.25  ? 556 LEU B CG    1 
ATOM   9355  C  CD1   . LEU B 1 556 ? -27.471 -11.451 34.870  1.00 64.50  ? 556 LEU B CD1   1 
ATOM   9356  C  CD2   . LEU B 1 556 ? -28.495 -10.705 37.037  1.00 64.47  ? 556 LEU B CD2   1 
ATOM   9357  N  N     . ALA B 1 557 ? -25.269 -7.403  35.701  1.00 65.63  ? 557 ALA B N     1 
ATOM   9358  C  CA    . ALA B 1 557 ? -25.686 -6.124  35.145  1.00 65.34  ? 557 ALA B CA    1 
ATOM   9359  C  C     . ALA B 1 557 ? -24.718 -5.720  34.020  1.00 66.90  ? 557 ALA B C     1 
ATOM   9360  O  O     . ALA B 1 557 ? -25.098 -5.024  33.077  1.00 67.34  ? 557 ALA B O     1 
ATOM   9361  C  CB    . ALA B 1 557 ? -25.703 -5.073  36.232  1.00 64.47  ? 557 ALA B CB    1 
ATOM   9362  N  N     . LEU B 1 558 ? -23.466 -6.160  34.118  1.00 67.59  ? 558 LEU B N     1 
ATOM   9363  C  CA    . LEU B 1 558 ? -22.479 -5.853  33.092  1.00 68.79  ? 558 LEU B CA    1 
ATOM   9364  C  C     . LEU B 1 558 ? -22.736 -6.718  31.872  1.00 70.63  ? 558 LEU B C     1 
ATOM   9365  O  O     . LEU B 1 558 ? -22.392 -6.344  30.747  1.00 71.00  ? 558 LEU B O     1 
ATOM   9366  C  CB    . LEU B 1 558 ? -21.067 -6.135  33.594  1.00 68.28  ? 558 LEU B CB    1 
ATOM   9367  C  CG    . LEU B 1 558 ? -20.534 -5.312  34.759  1.00 67.56  ? 558 LEU B CG    1 
ATOM   9368  C  CD1   . LEU B 1 558 ? -19.075 -5.658  34.964  1.00 66.70  ? 558 LEU B CD1   1 
ATOM   9369  C  CD2   . LEU B 1 558 ? -20.688 -3.833  34.470  1.00 66.84  ? 558 LEU B CD2   1 
ATOM   9370  N  N     . GLU B 1 559 ? -23.331 -7.886  32.115  1.00 72.26  ? 559 GLU B N     1 
ATOM   9371  C  CA    . GLU B 1 559 ? -23.652 -8.850  31.065  1.00 73.54  ? 559 GLU B CA    1 
ATOM   9372  C  C     . GLU B 1 559 ? -24.866 -8.392  30.266  1.00 72.58  ? 559 GLU B C     1 
ATOM   9373  O  O     . GLU B 1 559 ? -24.879 -8.468  29.034  1.00 72.74  ? 559 GLU B O     1 
ATOM   9374  C  CB    . GLU B 1 559 ? -23.932 -10.221 31.686  1.00 75.79  ? 559 GLU B CB    1 
ATOM   9375  C  CG    . GLU B 1 559 ? -22.772 -10.783 32.511  1.00 80.36  ? 559 GLU B CG    1 
ATOM   9376  C  CD    . GLU B 1 559 ? -21.972 -11.860 31.781  1.00 82.82  ? 559 GLU B CD    1 
ATOM   9377  O  OE1   . GLU B 1 559 ? -20.982 -12.361 32.369  1.00 83.18  ? 559 GLU B OE1   1 
ATOM   9378  O  OE2   . GLU B 1 559 ? -22.334 -12.209 30.630  1.00 83.48  ? 559 GLU B OE2   1 
ATOM   9379  N  N     . ALA B 1 560 ? -25.880 -7.917  30.983  1.00 70.64  ? 560 ALA B N     1 
ATOM   9380  C  CA    . ALA B 1 560 ? -27.107 -7.429  30.367  1.00 68.78  ? 560 ALA B CA    1 
ATOM   9381  C  C     . ALA B 1 560 ? -26.840 -6.155  29.558  1.00 67.52  ? 560 ALA B C     1 
ATOM   9382  O  O     . ALA B 1 560 ? -27.406 -5.966  28.480  1.00 67.08  ? 560 ALA B O     1 
ATOM   9383  C  CB    . ALA B 1 560 ? -28.150 -7.164  31.450  1.00 69.23  ? 560 ALA B CB    1 
ATOM   9384  N  N     . LEU B 1 561 ? -25.978 -5.290  30.089  1.00 66.39  ? 561 LEU B N     1 
ATOM   9385  C  CA    . LEU B 1 561 ? -25.617 -4.037  29.434  1.00 64.84  ? 561 LEU B CA    1 
ATOM   9386  C  C     . LEU B 1 561 ? -24.952 -4.317  28.100  1.00 65.53  ? 561 LEU B C     1 
ATOM   9387  O  O     . LEU B 1 561 ? -25.244 -3.671  27.094  1.00 64.86  ? 561 LEU B O     1 
ATOM   9388  C  CB    . LEU B 1 561 ? -24.654 -3.237  30.310  1.00 62.70  ? 561 LEU B CB    1 
ATOM   9389  C  CG    . LEU B 1 561 ? -25.218 -2.536  31.542  1.00 61.27  ? 561 LEU B CG    1 
ATOM   9390  C  CD1   . LEU B 1 561 ? -24.106 -1.830  32.274  1.00 60.55  ? 561 LEU B CD1   1 
ATOM   9391  C  CD2   . LEU B 1 561 ? -26.265 -1.534  31.122  1.00 62.78  ? 561 LEU B CD2   1 
ATOM   9392  N  N     . ALA B 1 562 ? -24.046 -5.286  28.111  1.00 66.59  ? 562 ALA B N     1 
ATOM   9393  C  CA    . ALA B 1 562 ? -23.311 -5.678  26.917  1.00 67.76  ? 562 ALA B CA    1 
ATOM   9394  C  C     . ALA B 1 562 ? -24.238 -6.348  25.919  1.00 67.73  ? 562 ALA B C     1 
ATOM   9395  O  O     . ALA B 1 562 ? -24.103 -6.174  24.710  1.00 67.30  ? 562 ALA B O     1 
ATOM   9396  C  CB    . ALA B 1 562 ? -22.191 -6.631  27.297  1.00 68.44  ? 562 ALA B CB    1 
ATOM   9397  N  N     . ARG B 1 563 ? -25.176 -7.118  26.454  1.00 68.30  ? 563 ARG B N     1 
ATOM   9398  C  CA    . ARG B 1 563 ? -26.158 -7.858  25.666  1.00 69.32  ? 563 ARG B CA    1 
ATOM   9399  C  C     . ARG B 1 563 ? -27.091 -6.895  24.947  1.00 68.54  ? 563 ARG B C     1 
ATOM   9400  O  O     . ARG B 1 563 ? -27.431 -7.081  23.779  1.00 67.50  ? 563 ARG B O     1 
ATOM   9401  C  CB    . ARG B 1 563 ? -26.981 -8.750  26.600  1.00 71.72  ? 563 ARG B CB    1 
ATOM   9402  C  CG    . ARG B 1 563 ? -27.130 -10.197 26.173  1.00 73.13  ? 563 ARG B CG    1 
ATOM   9403  C  CD    . ARG B 1 563 ? -28.009 -10.949 27.168  1.00 75.37  ? 563 ARG B CD    1 
ATOM   9404  N  NE    . ARG B 1 563 ? -27.299 -11.351 28.383  1.00 77.29  ? 563 ARG B NE    1 
ATOM   9405  C  CZ    . ARG B 1 563 ? -27.907 -11.631 29.534  1.00 78.56  ? 563 ARG B CZ    1 
ATOM   9406  N  NH1   . ARG B 1 563 ? -29.227 -11.536 29.614  1.00 78.31  ? 563 ARG B NH1   1 
ATOM   9407  N  NH2   . ARG B 1 563 ? -27.207 -12.024 30.597  1.00 78.14  ? 563 ARG B NH2   1 
ATOM   9408  N  N     . GLU B 1 564 ? -27.498 -5.864  25.674  1.00 68.14  ? 564 GLU B N     1 
ATOM   9409  C  CA    . GLU B 1 564 ? -28.402 -4.857  25.159  1.00 68.07  ? 564 GLU B CA    1 
ATOM   9410  C  C     . GLU B 1 564 ? -27.643 -3.795  24.349  1.00 67.61  ? 564 GLU B C     1 
ATOM   9411  O  O     . GLU B 1 564 ? -28.173 -2.720  24.060  1.00 67.93  ? 564 GLU B O     1 
ATOM   9412  C  CB    . GLU B 1 564 ? -29.142 -4.227  26.335  1.00 68.37  ? 564 GLU B CB    1 
ATOM   9413  C  CG    . GLU B 1 564 ? -30.547 -3.768  26.030  1.00 70.82  ? 564 GLU B CG    1 
ATOM   9414  C  CD    . GLU B 1 564 ? -31.301 -3.368  27.285  1.00 72.83  ? 564 GLU B CD    1 
ATOM   9415  O  OE1   . GLU B 1 564 ? -32.447 -2.873  27.161  1.00 73.52  ? 564 GLU B OE1   1 
ATOM   9416  O  OE2   . GLU B 1 564 ? -30.747 -3.555  28.396  1.00 73.10  ? 564 GLU B OE2   1 
ATOM   9417  N  N     . GLY B 1 565 ? -26.401 -4.106  23.983  1.00 66.29  ? 565 GLY B N     1 
ATOM   9418  C  CA    . GLY B 1 565 ? -25.597 -3.179  23.201  1.00 64.55  ? 565 GLY B CA    1 
ATOM   9419  C  C     . GLY B 1 565 ? -25.358 -1.830  23.855  1.00 63.89  ? 565 GLY B C     1 
ATOM   9420  O  O     . GLY B 1 565 ? -25.281 -0.805  23.167  1.00 63.82  ? 565 GLY B O     1 
ATOM   9421  N  N     . ILE B 1 566 ? -25.235 -1.832  25.183  1.00 61.92  ? 566 ILE B N     1 
ATOM   9422  C  CA    . ILE B 1 566 ? -25.001 -0.616  25.949  1.00 58.92  ? 566 ILE B CA    1 
ATOM   9423  C  C     . ILE B 1 566 ? -23.586 -0.614  26.515  1.00 56.79  ? 566 ILE B C     1 
ATOM   9424  O  O     . ILE B 1 566 ? -23.175 -1.572  27.165  1.00 55.41  ? 566 ILE B O     1 
ATOM   9425  C  CB    . ILE B 1 566 ? -26.019 -0.499  27.108  1.00 59.05  ? 566 ILE B CB    1 
ATOM   9426  C  CG1   . ILE B 1 566 ? -27.432 -0.333  26.547  1.00 58.59  ? 566 ILE B CG1   1 
ATOM   9427  C  CG2   . ILE B 1 566 ? -25.675 0.685   27.992  1.00 60.66  ? 566 ILE B CG2   1 
ATOM   9428  C  CD1   . ILE B 1 566 ? -28.515 -0.411  27.592  1.00 58.66  ? 566 ILE B CD1   1 
ATOM   9429  N  N     . ALA B 1 567 ? -22.841 0.455   26.239  1.00 55.62  ? 567 ALA B N     1 
ATOM   9430  C  CA    . ALA B 1 567 ? -21.473 0.596   26.730  1.00 54.60  ? 567 ALA B CA    1 
ATOM   9431  C  C     . ALA B 1 567 ? -21.500 1.181   28.140  1.00 54.54  ? 567 ALA B C     1 
ATOM   9432  O  O     . ALA B 1 567 ? -22.387 1.970   28.496  1.00 52.77  ? 567 ALA B O     1 
ATOM   9433  C  CB    . ALA B 1 567 ? -20.669 1.483   25.811  1.00 53.74  ? 567 ALA B CB    1 
ATOM   9434  N  N     . TYR B 1 568 ? -20.500 0.816   28.930  1.00 54.27  ? 568 TYR B N     1 
ATOM   9435  C  CA    . TYR B 1 568 ? -20.459 1.243   30.312  1.00 52.81  ? 568 TYR B CA    1 
ATOM   9436  C  C     . TYR B 1 568 ? -19.056 1.409   30.843  1.00 51.19  ? 568 TYR B C     1 
ATOM   9437  O  O     . TYR B 1 568 ? -18.076 1.153   30.153  1.00 50.59  ? 568 TYR B O     1 
ATOM   9438  C  CB    . TYR B 1 568 ? -21.145 0.182   31.158  1.00 54.96  ? 568 TYR B CB    1 
ATOM   9439  C  CG    . TYR B 1 568 ? -20.491 -1.184  31.002  1.00 56.99  ? 568 TYR B CG    1 
ATOM   9440  C  CD1   . TYR B 1 568 ? -21.081 -2.184  30.226  1.00 56.93  ? 568 TYR B CD1   1 
ATOM   9441  C  CD2   . TYR B 1 568 ? -19.273 -1.471  31.628  1.00 58.24  ? 568 TYR B CD2   1 
ATOM   9442  C  CE1   . TYR B 1 568 ? -20.477 -3.432  30.083  1.00 58.63  ? 568 TYR B CE1   1 
ATOM   9443  C  CE2   . TYR B 1 568 ? -18.662 -2.712  31.489  1.00 59.32  ? 568 TYR B CE2   1 
ATOM   9444  C  CZ    . TYR B 1 568 ? -19.270 -3.689  30.718  1.00 60.04  ? 568 TYR B CZ    1 
ATOM   9445  O  OH    . TYR B 1 568 ? -18.684 -4.929  30.605  1.00 61.84  ? 568 TYR B OH    1 
ATOM   9446  N  N     . ASP B 1 569 ? -18.999 1.809   32.109  1.00 50.64  ? 569 ASP B N     1 
ATOM   9447  C  CA    . ASP B 1 569 ? -17.764 1.990   32.866  1.00 49.37  ? 569 ASP B CA    1 
ATOM   9448  C  C     . ASP B 1 569 ? -18.106 1.822   34.340  1.00 48.18  ? 569 ASP B C     1 
ATOM   9449  O  O     . ASP B 1 569 ? -18.982 2.515   34.870  1.00 46.91  ? 569 ASP B O     1 
ATOM   9450  C  CB    . ASP B 1 569 ? -17.162 3.383   32.649  1.00 50.25  ? 569 ASP B CB    1 
ATOM   9451  C  CG    . ASP B 1 569 ? -16.447 3.515   31.317  1.00 51.21  ? 569 ASP B CG    1 
ATOM   9452  O  OD1   . ASP B 1 569 ? -15.429 2.813   31.091  1.00 48.97  ? 569 ASP B OD1   1 
ATOM   9453  O  OD2   . ASP B 1 569 ? -16.917 4.337   30.500  1.00 52.05  ? 569 ASP B OD2   1 
ATOM   9454  N  N     . LEU B 1 570 ? -17.434 0.883   34.997  1.00 47.89  ? 570 LEU B N     1 
ATOM   9455  C  CA    . LEU B 1 570 ? -17.668 0.652   36.416  1.00 47.25  ? 570 LEU B CA    1 
ATOM   9456  C  C     . LEU B 1 570 ? -16.518 1.271   37.192  1.00 47.14  ? 570 LEU B C     1 
ATOM   9457  O  O     . LEU B 1 570 ? -15.351 0.891   37.008  1.00 46.76  ? 570 LEU B O     1 
ATOM   9458  C  CB    . LEU B 1 570 ? -17.745 -0.842  36.730  1.00 46.19  ? 570 LEU B CB    1 
ATOM   9459  C  CG    . LEU B 1 570 ? -18.035 -1.151  38.204  1.00 46.05  ? 570 LEU B CG    1 
ATOM   9460  C  CD1   . LEU B 1 570 ? -19.428 -0.691  38.587  1.00 44.19  ? 570 LEU B CD1   1 
ATOM   9461  C  CD2   . LEU B 1 570 ? -17.888 -2.633  38.438  1.00 46.53  ? 570 LEU B CD2   1 
ATOM   9462  N  N     . VAL B 1 571 ? -16.864 2.224   38.053  1.00 45.98  ? 571 VAL B N     1 
ATOM   9463  C  CA    . VAL B 1 571 ? -15.899 2.931   38.880  1.00 44.71  ? 571 VAL B CA    1 
ATOM   9464  C  C     . VAL B 1 571 ? -16.287 2.906   40.341  1.00 44.75  ? 571 VAL B C     1 
ATOM   9465  O  O     . VAL B 1 571 ? -17.390 3.308   40.684  1.00 46.16  ? 571 VAL B O     1 
ATOM   9466  C  CB    . VAL B 1 571 ? -15.810 4.380   38.475  1.00 43.97  ? 571 VAL B CB    1 
ATOM   9467  C  CG1   . VAL B 1 571 ? -14.808 5.095   39.367  1.00 43.59  ? 571 VAL B CG1   1 
ATOM   9468  C  CG2   . VAL B 1 571 ? -15.433 4.472   37.012  1.00 42.88  ? 571 VAL B CG2   1 
ATOM   9469  N  N     . SER B 1 572 ? -15.377 2.450   41.199  1.00 45.65  ? 572 SER B N     1 
ATOM   9470  C  CA    . SER B 1 572 ? -15.632 2.383   42.643  1.00 45.07  ? 572 SER B CA    1 
ATOM   9471  C  C     . SER B 1 572 ? -15.038 3.599   43.332  1.00 45.67  ? 572 SER B C     1 
ATOM   9472  O  O     . SER B 1 572 ? -13.899 3.987   43.061  1.00 46.59  ? 572 SER B O     1 
ATOM   9473  C  CB    . SER B 1 572 ? -15.027 1.114   43.247  1.00 44.03  ? 572 SER B CB    1 
ATOM   9474  O  OG    . SER B 1 572 ? -13.621 1.090   43.084  1.00 43.71  ? 572 SER B OG    1 
ATOM   9475  N  N     . VAL B 1 573 ? -15.820 4.192   44.227  1.00 46.15  ? 573 VAL B N     1 
ATOM   9476  C  CA    . VAL B 1 573 ? -15.413 5.390   44.958  1.00 46.79  ? 573 VAL B CA    1 
ATOM   9477  C  C     . VAL B 1 573 ? -15.139 5.101   46.424  1.00 46.35  ? 573 VAL B C     1 
ATOM   9478  O  O     . VAL B 1 573 ? -15.968 4.485   47.087  1.00 46.50  ? 573 VAL B O     1 
ATOM   9479  C  CB    . VAL B 1 573 ? -16.523 6.481   44.887  1.00 46.63  ? 573 VAL B CB    1 
ATOM   9480  C  CG1   . VAL B 1 573 ? -16.112 7.715   45.693  1.00 47.06  ? 573 VAL B CG1   1 
ATOM   9481  C  CG2   . VAL B 1 573 ? -16.796 6.853   43.440  1.00 45.28  ? 573 VAL B CG2   1 
ATOM   9482  N  N     . ARG B 1 574 ? -13.991 5.547   46.934  1.00 46.33  ? 574 ARG B N     1 
ATOM   9483  C  CA    . ARG B 1 574 ? -13.676 5.329   48.342  1.00 46.64  ? 574 ARG B CA    1 
ATOM   9484  C  C     . ARG B 1 574 ? -13.793 6.638   49.107  1.00 46.65  ? 574 ARG B C     1 
ATOM   9485  O  O     . ARG B 1 574 ? -12.880 7.448   49.104  1.00 46.89  ? 574 ARG B O     1 
ATOM   9486  C  CB    . ARG B 1 574 ? -12.277 4.739   48.513  1.00 47.14  ? 574 ARG B CB    1 
ATOM   9487  C  CG    . ARG B 1 574 ? -11.978 4.380   49.957  1.00 50.92  ? 574 ARG B CG    1 
ATOM   9488  C  CD    . ARG B 1 574 ? -10.726 3.522   50.130  1.00 53.13  ? 574 ARG B CD    1 
ATOM   9489  N  NE    . ARG B 1 574 ? -10.424 3.301   51.549  1.00 55.77  ? 574 ARG B NE    1 
ATOM   9490  C  CZ    . ARG B 1 574 ? -9.347  2.661   52.009  1.00 56.11  ? 574 ARG B CZ    1 
ATOM   9491  N  NH1   . ARG B 1 574 ? -8.446  2.158   51.173  1.00 55.13  ? 574 ARG B NH1   1 
ATOM   9492  N  NH2   . ARG B 1 574 ? -9.160  2.539   53.316  1.00 55.57  ? 574 ARG B NH2   1 
ATOM   9493  N  N     . LYS B 1 575 ? -14.934 6.831   49.764  1.00 47.74  ? 575 LYS B N     1 
ATOM   9494  C  CA    . LYS B 1 575 ? -15.215 8.042   50.527  1.00 47.43  ? 575 LYS B CA    1 
ATOM   9495  C  C     . LYS B 1 575 ? -14.162 8.387   51.569  1.00 47.54  ? 575 LYS B C     1 
ATOM   9496  O  O     . LYS B 1 575 ? -13.710 9.521   51.619  1.00 49.49  ? 575 LYS B O     1 
ATOM   9497  C  CB    . LYS B 1 575 ? -16.587 7.926   51.196  1.00 48.34  ? 575 LYS B CB    1 
ATOM   9498  C  CG    . LYS B 1 575 ? -17.671 7.458   50.232  1.00 49.96  ? 575 LYS B CG    1 
ATOM   9499  C  CD    . LYS B 1 575 ? -19.015 7.249   50.897  0.00 49.48  ? 575 LYS B CD    1 
ATOM   9500  C  CE    . LYS B 1 575 ? -20.012 6.702   49.886  0.00 49.63  ? 575 LYS B CE    1 
ATOM   9501  N  NZ    . LYS B 1 575 ? -21.328 6.375   50.496  0.00 49.55  ? 575 LYS B NZ    1 
ATOM   9502  N  N     . SER B 1 576 ? -13.758 7.434   52.403  1.00 46.54  ? 576 SER B N     1 
ATOM   9503  C  CA    . SER B 1 576 ? -12.753 7.753   53.412  1.00 45.59  ? 576 SER B CA    1 
ATOM   9504  C  C     . SER B 1 576 ? -11.518 6.879   53.319  1.00 45.69  ? 576 SER B C     1 
ATOM   9505  O  O     . SER B 1 576 ? -11.595 5.711   52.924  1.00 46.58  ? 576 SER B O     1 
ATOM   9506  C  CB    . SER B 1 576 ? -13.345 7.643   54.819  1.00 44.86  ? 576 SER B CB    1 
ATOM   9507  O  OG    . SER B 1 576 ? -13.792 6.323   55.080  0.00 45.12  ? 576 SER B OG    1 
ATOM   9508  N  N     . GLY B 1 577 ? -10.379 7.467   53.680  1.00 44.54  ? 577 GLY B N     1 
ATOM   9509  C  CA    . GLY B 1 577 ? -9.110  6.755   53.671  1.00 43.57  ? 577 GLY B CA    1 
ATOM   9510  C  C     . GLY B 1 577 ? -8.376  6.603   52.351  1.00 43.13  ? 577 GLY B C     1 
ATOM   9511  O  O     . GLY B 1 577 ? -7.490  5.755   52.224  1.00 42.36  ? 577 GLY B O     1 
ATOM   9512  N  N     . GLY B 1 578 ? -8.732  7.419   51.365  1.00 43.55  ? 578 GLY B N     1 
ATOM   9513  C  CA    . GLY B 1 578 ? -8.082  7.331   50.068  1.00 40.78  ? 578 GLY B CA    1 
ATOM   9514  C  C     . GLY B 1 578 ? -6.681  7.889   50.113  1.00 38.79  ? 578 GLY B C     1 
ATOM   9515  O  O     . GLY B 1 578 ? -5.844  7.559   49.273  1.00 37.75  ? 578 GLY B O     1 
ATOM   9516  N  N     . GLY B 1 579 ? -6.434  8.725   51.115  1.00 37.29  ? 579 GLY B N     1 
ATOM   9517  C  CA    . GLY B 1 579 ? -5.141  9.345   51.279  1.00 37.37  ? 579 GLY B CA    1 
ATOM   9518  C  C     . GLY B 1 579 ? -5.302  10.846  51.255  1.00 38.25  ? 579 GLY B C     1 
ATOM   9519  O  O     . GLY B 1 579 ? -6.380  11.345  50.950  1.00 39.50  ? 579 GLY B O     1 
ATOM   9520  N  N     . ARG B 1 580 ? -4.244  11.580  51.587  1.00 38.63  ? 580 ARG B N     1 
ATOM   9521  C  CA    . ARG B 1 580 ? -4.328  13.032  51.574  1.00 36.61  ? 580 ARG B CA    1 
ATOM   9522  C  C     . ARG B 1 580 ? -3.411  13.579  50.486  1.00 36.13  ? 580 ARG B C     1 
ATOM   9523  O  O     . ARG B 1 580 ? -2.581  12.866  49.920  1.00 35.63  ? 580 ARG B O     1 
ATOM   9524  C  CB    . ARG B 1 580 ? -3.928  13.627  52.925  1.00 35.31  ? 580 ARG B CB    1 
ATOM   9525  C  CG    . ARG B 1 580 ? -4.061  12.702  54.125  1.00 36.42  ? 580 ARG B CG    1 
ATOM   9526  C  CD    . ARG B 1 580 ? -5.493  12.353  54.513  1.00 34.83  ? 580 ARG B CD    1 
ATOM   9527  N  NE    . ARG B 1 580 ? -6.287  13.541  54.795  1.00 35.39  ? 580 ARG B NE    1 
ATOM   9528  C  CZ    . ARG B 1 580 ? -7.219  13.627  55.741  1.00 34.88  ? 580 ARG B CZ    1 
ATOM   9529  N  NH1   . ARG B 1 580 ? -7.491  12.600  56.536  1.00 33.56  ? 580 ARG B NH1   1 
ATOM   9530  N  NH2   . ARG B 1 580 ? -7.903  14.748  55.868  1.00 33.67  ? 580 ARG B NH2   1 
ATOM   9531  N  N     . VAL B 1 581 ? -3.576  14.861  50.202  1.00 35.67  ? 581 VAL B N     1 
ATOM   9532  C  CA    . VAL B 1 581 ? -2.800  15.544  49.181  1.00 33.64  ? 581 VAL B CA    1 
ATOM   9533  C  C     . VAL B 1 581 ? -2.419  16.919  49.720  1.00 34.96  ? 581 VAL B C     1 
ATOM   9534  O  O     . VAL B 1 581 ? -3.270  17.654  50.247  1.00 35.00  ? 581 VAL B O     1 
ATOM   9535  C  CB    . VAL B 1 581 ? -3.631  15.687  47.892  1.00 30.47  ? 581 VAL B CB    1 
ATOM   9536  C  CG1   . VAL B 1 581 ? -3.100  16.796  47.042  1.00 29.42  ? 581 VAL B CG1   1 
ATOM   9537  C  CG2   . VAL B 1 581 ? -3.581  14.401  47.127  1.00 27.43  ? 581 VAL B CG2   1 
ATOM   9538  N  N     . TYR B 1 582 ? -1.140  17.258  49.593  1.00 34.49  ? 582 TYR B N     1 
ATOM   9539  C  CA    . TYR B 1 582 ? -0.639  18.532  50.084  1.00 35.66  ? 582 TYR B CA    1 
ATOM   9540  C  C     . TYR B 1 582 ? 0.067   19.262  48.949  1.00 36.62  ? 582 TYR B C     1 
ATOM   9541  O  O     . TYR B 1 582 ? 0.775   18.652  48.148  1.00 35.00  ? 582 TYR B O     1 
ATOM   9542  C  CB    . TYR B 1 582 ? 0.321   18.306  51.274  1.00 36.34  ? 582 TYR B CB    1 
ATOM   9543  C  CG    . TYR B 1 582 ? -0.274  17.484  52.421  1.00 38.26  ? 582 TYR B CG    1 
ATOM   9544  C  CD1   . TYR B 1 582 ? -1.387  17.939  53.133  1.00 38.84  ? 582 TYR B CD1   1 
ATOM   9545  C  CD2   . TYR B 1 582 ? 0.240   16.231  52.756  1.00 37.87  ? 582 TYR B CD2   1 
ATOM   9546  C  CE1   . TYR B 1 582 ? -1.975  17.166  54.138  1.00 38.14  ? 582 TYR B CE1   1 
ATOM   9547  C  CE2   . TYR B 1 582 ? -0.343  15.456  53.758  1.00 38.89  ? 582 TYR B CE2   1 
ATOM   9548  C  CZ    . TYR B 1 582 ? -1.454  15.929  54.442  1.00 39.14  ? 582 TYR B CZ    1 
ATOM   9549  O  OH    . TYR B 1 582 ? -2.073  15.141  55.397  1.00 40.35  ? 582 TYR B OH    1 
ATOM   9550  N  N     . PRO B 1 583 ? -0.133  20.588  48.852  1.00 39.15  ? 583 PRO B N     1 
ATOM   9551  C  CA    . PRO B 1 583 ? 0.515   21.352  47.780  1.00 39.74  ? 583 PRO B CA    1 
ATOM   9552  C  C     . PRO B 1 583 ? 2.022   21.414  47.966  1.00 40.51  ? 583 PRO B C     1 
ATOM   9553  O  O     . PRO B 1 583 ? 2.521   21.360  49.090  1.00 39.86  ? 583 PRO B O     1 
ATOM   9554  C  CB    . PRO B 1 583 ? -0.146  22.725  47.888  1.00 39.38  ? 583 PRO B CB    1 
ATOM   9555  C  CG    . PRO B 1 583 ? -0.423  22.843  49.364  1.00 39.14  ? 583 PRO B CG    1 
ATOM   9556  C  CD    . PRO B 1 583 ? -0.954  21.468  49.711  1.00 39.29  ? 583 PRO B CD    1 
ATOM   9557  N  N     . VAL B 1 584 ? 2.747   21.513  46.861  1.00 41.74  ? 584 VAL B N     1 
ATOM   9558  C  CA    . VAL B 1 584 ? 4.192   21.587  46.940  1.00 44.09  ? 584 VAL B CA    1 
ATOM   9559  C  C     . VAL B 1 584 ? 4.588   23.022  47.180  1.00 46.00  ? 584 VAL B C     1 
ATOM   9560  O  O     . VAL B 1 584 ? 5.504   23.310  47.945  1.00 48.52  ? 584 VAL B O     1 
ATOM   9561  C  CB    . VAL B 1 584 ? 4.852   21.095  45.654  1.00 44.14  ? 584 VAL B CB    1 
ATOM   9562  C  CG1   . VAL B 1 584 ? 4.706   19.579  45.543  1.00 42.51  ? 584 VAL B CG1   1 
ATOM   9563  C  CG2   . VAL B 1 584 ? 4.232   21.806  44.454  1.00 45.80  ? 584 VAL B CG2   1 
ATOM   9564  N  N     . GLN B 1 585 ? 3.886   23.923  46.520  1.00 47.71  ? 585 GLN B N     1 
ATOM   9565  C  CA    . GLN B 1 585 ? 4.140   25.342  46.665  1.00 50.56  ? 585 GLN B CA    1 
ATOM   9566  C  C     . GLN B 1 585 ? 2.918   26.029  46.094  1.00 52.47  ? 585 GLN B C     1 
ATOM   9567  O  O     . GLN B 1 585 ? 2.761   26.123  44.868  1.00 53.81  ? 585 GLN B O     1 
ATOM   9568  C  CB    . GLN B 1 585 ? 5.402   25.750  45.894  1.00 49.86  ? 585 GLN B CB    1 
ATOM   9569  N  N     . GLY B 1 586 ? 2.031   26.469  46.980  1.00 52.65  ? 586 GLY B N     1 
ATOM   9570  C  CA    . GLY B 1 586 ? 0.849   27.151  46.511  1.00 54.06  ? 586 GLY B CA    1 
ATOM   9571  C  C     . GLY B 1 586 ? -0.442  26.817  47.209  1.00 55.68  ? 586 GLY B C     1 
ATOM   9572  O  O     . GLY B 1 586 ? -0.514  26.650  48.424  1.00 56.02  ? 586 GLY B O     1 
ATOM   9573  N  N     . ARG B 1 587 ? -1.482  26.694  46.408  1.00 56.94  ? 587 ARG B N     1 
ATOM   9574  C  CA    . ARG B 1 587 ? -2.793  26.432  46.937  1.00 58.02  ? 587 ARG B CA    1 
ATOM   9575  C  C     . ARG B 1 587 ? -3.436  25.231  46.276  1.00 58.87  ? 587 ARG B C     1 
ATOM   9576  O  O     . ARG B 1 587 ? -3.246  24.992  45.089  1.00 59.14  ? 587 ARG B O     1 
ATOM   9577  C  CB    . ARG B 1 587 ? -3.639  27.649  46.669  1.00 59.64  ? 587 ARG B CB    1 
ATOM   9578  C  CG    . ARG B 1 587 ? -4.313  28.223  47.846  1.00 61.02  ? 587 ARG B CG    1 
ATOM   9579  C  CD    . ARG B 1 587 ? -5.416  29.111  47.335  1.00 64.64  ? 587 ARG B CD    1 
ATOM   9580  N  NE    . ARG B 1 587 ? -6.357  29.417  48.396  1.00 69.50  ? 587 ARG B NE    1 
ATOM   9581  C  CZ    . ARG B 1 587 ? -6.064  30.169  49.451  1.00 72.19  ? 587 ARG B CZ    1 
ATOM   9582  N  NH1   . ARG B 1 587 ? -4.847  30.698  49.575  1.00 72.85  ? 587 ARG B NH1   1 
ATOM   9583  N  NH2   . ARG B 1 587 ? -6.982  30.382  50.390  1.00 72.32  ? 587 ARG B NH2   1 
ATOM   9584  N  N     . LEU B 1 588 ? -4.204  24.473  47.042  1.00 59.77  ? 588 LEU B N     1 
ATOM   9585  C  CA    . LEU B 1 588 ? -4.890  23.330  46.470  1.00 61.31  ? 588 LEU B CA    1 
ATOM   9586  C  C     . LEU B 1 588 ? -6.077  23.877  45.691  1.00 61.88  ? 588 LEU B C     1 
ATOM   9587  O  O     . LEU B 1 588 ? -6.709  24.839  46.124  1.00 62.53  ? 588 LEU B O     1 
ATOM   9588  C  CB    . LEU B 1 588 ? -5.385  22.405  47.573  1.00 62.53  ? 588 LEU B CB    1 
ATOM   9589  C  CG    . LEU B 1 588 ? -4.294  21.611  48.279  1.00 64.54  ? 588 LEU B CG    1 
ATOM   9590  C  CD1   . LEU B 1 588 ? -4.905  20.804  49.438  1.00 65.72  ? 588 LEU B CD1   1 
ATOM   9591  C  CD2   . LEU B 1 588 ? -3.606  20.703  47.253  1.00 63.50  ? 588 LEU B CD2   1 
ATOM   9592  N  N     . ALA B 1 589 ? -6.376  23.271  44.546  1.00 62.24  ? 589 ALA B N     1 
ATOM   9593  C  CA    . ALA B 1 589 ? -7.496  23.706  43.711  1.00 62.39  ? 589 ALA B CA    1 
ATOM   9594  C  C     . ALA B 1 589 ? -8.557  22.611  43.604  1.00 62.67  ? 589 ALA B C     1 
ATOM   9595  O  O     . ALA B 1 589 ? -8.269  21.438  43.835  1.00 63.30  ? 589 ALA B O     1 
ATOM   9596  C  CB    . ALA B 1 589 ? -6.992  24.069  42.328  1.00 62.48  ? 589 ALA B CB    1 
ATOM   9597  N  N     . ASP B 1 590 ? -9.788  22.989  43.269  1.00 62.14  ? 590 ASP B N     1 
ATOM   9598  C  CA    . ASP B 1 590 ? -10.842 21.995  43.114  1.00 61.07  ? 590 ASP B CA    1 
ATOM   9599  C  C     . ASP B 1 590 ? -10.548 21.198  41.849  1.00 59.75  ? 590 ASP B C     1 
ATOM   9600  O  O     . ASP B 1 590 ? -9.779  21.626  40.987  1.00 61.05  ? 590 ASP B O     1 
ATOM   9601  C  CB    . ASP B 1 590 ? -12.224 22.654  42.989  1.00 62.68  ? 590 ASP B CB    1 
ATOM   9602  C  CG    . ASP B 1 590 ? -12.862 22.965  44.341  1.00 65.03  ? 590 ASP B CG    1 
ATOM   9603  O  OD1   . ASP B 1 590 ? -12.974 22.055  45.194  1.00 64.75  ? 590 ASP B OD1   1 
ATOM   9604  O  OD2   . ASP B 1 590 ? -13.268 24.126  44.549  1.00 67.88  ? 590 ASP B OD2   1 
ATOM   9605  N  N     . GLY B 1 591 ? -11.155 20.028  41.740  1.00 57.68  ? 591 GLY B N     1 
ATOM   9606  C  CA    . GLY B 1 591 ? -10.942 19.223  40.558  1.00 54.67  ? 591 GLY B CA    1 
ATOM   9607  C  C     . GLY B 1 591 ? -9.490  18.908  40.292  1.00 52.40  ? 591 GLY B C     1 
ATOM   9608  O  O     . GLY B 1 591 ? -9.049  18.887  39.144  1.00 52.60  ? 591 GLY B O     1 
ATOM   9609  N  N     . LEU B 1 592 ? -8.732  18.679  41.353  1.00 50.24  ? 592 LEU B N     1 
ATOM   9610  C  CA    . LEU B 1 592 ? -7.337  18.321  41.184  1.00 48.21  ? 592 LEU B CA    1 
ATOM   9611  C  C     . LEU B 1 592 ? -7.379  16.810  40.985  1.00 46.13  ? 592 LEU B C     1 
ATOM   9612  O  O     . LEU B 1 592 ? -7.842  16.069  41.854  1.00 45.09  ? 592 LEU B O     1 
ATOM   9613  C  CB    . LEU B 1 592 ? -6.538  18.702  42.424  1.00 48.77  ? 592 LEU B CB    1 
ATOM   9614  C  CG    . LEU B 1 592 ? -5.065  18.971  42.154  1.00 47.70  ? 592 LEU B CG    1 
ATOM   9615  C  CD1   . LEU B 1 592 ? -4.640  20.235  42.872  1.00 47.40  ? 592 LEU B CD1   1 
ATOM   9616  C  CD2   . LEU B 1 592 ? -4.257  17.779  42.594  1.00 47.56  ? 592 LEU B CD2   1 
ATOM   9617  N  N     . TYR B 1 593 ? -6.932  16.380  39.810  1.00 44.20  ? 593 TYR B N     1 
ATOM   9618  C  CA    . TYR B 1 593 ? -6.927  14.977  39.405  1.00 42.57  ? 593 TYR B CA    1 
ATOM   9619  C  C     . TYR B 1 593 ? -5.555  14.361  39.564  1.00 41.63  ? 593 TYR B C     1 
ATOM   9620  O  O     . TYR B 1 593 ? -4.627  14.756  38.885  1.00 44.48  ? 593 TYR B O     1 
ATOM   9621  C  CB    . TYR B 1 593 ? -7.367  14.899  37.945  1.00 41.97  ? 593 TYR B CB    1 
ATOM   9622  C  CG    . TYR B 1 593 ? -6.953  13.651  37.209  1.00 41.33  ? 593 TYR B CG    1 
ATOM   9623  C  CD1   . TYR B 1 593 ? -7.366  12.391  37.637  1.00 41.65  ? 593 TYR B CD1   1 
ATOM   9624  C  CD2   . TYR B 1 593 ? -6.184  13.736  36.056  1.00 40.63  ? 593 TYR B CD2   1 
ATOM   9625  C  CE1   . TYR B 1 593 ? -7.027  11.247  36.933  1.00 40.77  ? 593 TYR B CE1   1 
ATOM   9626  C  CE2   . TYR B 1 593 ? -5.839  12.601  35.344  1.00 41.11  ? 593 TYR B CE2   1 
ATOM   9627  C  CZ    . TYR B 1 593 ? -6.264  11.360  35.787  1.00 41.62  ? 593 TYR B CZ    1 
ATOM   9628  O  OH    . TYR B 1 593 ? -5.927  10.233  35.073  1.00 44.68  ? 593 TYR B OH    1 
ATOM   9629  N  N     . VAL B 1 594 ? -5.410  13.381  40.439  1.00 40.46  ? 594 VAL B N     1 
ATOM   9630  C  CA    . VAL B 1 594 ? -4.087  12.791  40.630  1.00 40.32  ? 594 VAL B CA    1 
ATOM   9631  C  C     . VAL B 1 594 ? -3.976  11.341  40.217  1.00 39.75  ? 594 VAL B C     1 
ATOM   9632  O  O     . VAL B 1 594 ? -4.262  10.445  41.004  1.00 38.44  ? 594 VAL B O     1 
ATOM   9633  C  CB    . VAL B 1 594 ? -3.637  12.885  42.096  1.00 41.17  ? 594 VAL B CB    1 
ATOM   9634  C  CG1   . VAL B 1 594 ? -2.363  12.094  42.297  1.00 40.05  ? 594 VAL B CG1   1 
ATOM   9635  C  CG2   . VAL B 1 594 ? -3.433  14.342  42.484  1.00 41.71  ? 594 VAL B CG2   1 
ATOM   9636  N  N     . PRO B 1 595 ? -3.536  11.086  38.977  1.00 40.31  ? 595 PRO B N     1 
ATOM   9637  C  CA    . PRO B 1 595 ? -3.408  9.695   38.528  1.00 40.99  ? 595 PRO B CA    1 
ATOM   9638  C  C     . PRO B 1 595 ? -2.640  8.952   39.603  1.00 42.52  ? 595 PRO B C     1 
ATOM   9639  O  O     . PRO B 1 595 ? -1.731  9.505   40.209  1.00 44.46  ? 595 PRO B O     1 
ATOM   9640  C  CB    . PRO B 1 595 ? -2.605  9.814   37.245  1.00 40.46  ? 595 PRO B CB    1 
ATOM   9641  C  CG    . PRO B 1 595 ? -2.961  11.190  36.751  1.00 41.61  ? 595 PRO B CG    1 
ATOM   9642  C  CD    . PRO B 1 595 ? -2.960  12.021  37.997  1.00 39.75  ? 595 PRO B CD    1 
ATOM   9643  N  N     . LEU B 1 596 ? -2.993  7.709   39.865  1.00 43.46  ? 596 LEU B N     1 
ATOM   9644  C  CA    . LEU B 1 596 ? -2.277  7.000   40.903  1.00 44.01  ? 596 LEU B CA    1 
ATOM   9645  C  C     . LEU B 1 596 ? -1.648  5.769   40.318  1.00 45.44  ? 596 LEU B C     1 
ATOM   9646  O  O     . LEU B 1 596 ? -1.099  5.845   39.232  1.00 46.27  ? 596 LEU B O     1 
ATOM   9647  C  CB    . LEU B 1 596 ? -3.221  6.664   42.048  1.00 42.99  ? 596 LEU B CB    1 
ATOM   9648  C  CG    . LEU B 1 596 ? -2.647  6.893   43.444  1.00 41.36  ? 596 LEU B CG    1 
ATOM   9649  C  CD1   . LEU B 1 596 ? -1.817  8.166   43.502  1.00 40.44  ? 596 LEU B CD1   1 
ATOM   9650  C  CD2   . LEU B 1 596 ? -3.784  6.950   44.406  1.00 41.13  ? 596 LEU B CD2   1 
ATOM   9651  N  N     . GLU B 1 597 ? -1.713  4.636   41.003  1.00 47.71  ? 597 GLU B N     1 
ATOM   9652  C  CA    . GLU B 1 597 ? -1.079  3.445   40.456  1.00 50.13  ? 597 GLU B CA    1 
ATOM   9653  C  C     . GLU B 1 597 ? -1.562  3.183   39.060  1.00 52.06  ? 597 GLU B C     1 
ATOM   9654  O  O     . GLU B 1 597 ? -1.049  3.731   38.083  1.00 55.22  ? 597 GLU B O     1 
ATOM   9655  C  CB    . GLU B 1 597 ? -1.352  2.232   41.300  1.00 48.93  ? 597 GLU B CB    1 
ATOM   9656  N  N     . ASP B 1 598 ? -2.566  2.336   38.961  1.00 51.85  ? 598 ASP B N     1 
ATOM   9657  C  CA    . ASP B 1 598 ? -3.059  1.988   37.659  1.00 52.92  ? 598 ASP B CA    1 
ATOM   9658  C  C     . ASP B 1 598 ? -4.488  1.555   37.770  1.00 53.57  ? 598 ASP B C     1 
ATOM   9659  O  O     . ASP B 1 598 ? -4.803  0.556   38.425  1.00 53.31  ? 598 ASP B O     1 
ATOM   9660  C  CB    . ASP B 1 598 ? -2.218  0.884   37.092  1.00 53.48  ? 598 ASP B CB    1 
ATOM   9661  N  N     . LYS B 1 599 ? -5.342  2.331   37.112  1.00 53.19  ? 599 LYS B N     1 
ATOM   9662  C  CA    . LYS B 1 599 ? -6.772  2.115   37.102  1.00 51.94  ? 599 LYS B CA    1 
ATOM   9663  C  C     . LYS B 1 599 ? -7.405  2.841   38.286  1.00 49.53  ? 599 LYS B C     1 
ATOM   9664  O  O     . LYS B 1 599 ? -8.625  3.025   38.323  1.00 50.45  ? 599 LYS B O     1 
ATOM   9665  C  CB    . LYS B 1 599 ? -7.092  0.616   37.115  1.00 54.10  ? 599 LYS B CB    1 
ATOM   9666  C  CG    . LYS B 1 599 ? -7.860  0.190   35.873  1.00 57.24  ? 599 LYS B CG    1 
ATOM   9667  C  CD    . LYS B 1 599 ? -7.638  -1.266  35.495  1.00 59.98  ? 599 LYS B CD    1 
ATOM   9668  C  CE    . LYS B 1 599 ? -6.922  -1.349  34.150  1.00 60.29  ? 599 LYS B CE    1 
ATOM   9669  N  NZ    . LYS B 1 599 ? -7.577  -0.455  33.151  1.00 60.75  ? 599 LYS B NZ    1 
ATOM   9670  N  N     . THR B 1 600 ? -6.577  3.263   39.245  1.00 45.36  ? 600 THR B N     1 
ATOM   9671  C  CA    . THR B 1 600 ? -7.081  4.005   40.402  1.00 40.43  ? 600 THR B CA    1 
ATOM   9672  C  C     . THR B 1 600 ? -6.481  5.399   40.362  1.00 36.35  ? 600 THR B C     1 
ATOM   9673  O  O     . THR B 1 600 ? -5.373  5.592   39.867  1.00 34.50  ? 600 THR B O     1 
ATOM   9674  C  CB    . THR B 1 600 ? -6.702  3.351   41.784  1.00 41.29  ? 600 THR B CB    1 
ATOM   9675  O  OG1   . THR B 1 600 ? -5.356  3.698   42.137  1.00 43.28  ? 600 THR B OG1   1 
ATOM   9676  C  CG2   . THR B 1 600 ? -6.822  1.831   41.733  1.00 39.35  ? 600 THR B CG2   1 
ATOM   9677  N  N     . PHE B 1 601 ? -7.237  6.371   40.855  1.00 33.24  ? 601 PHE B N     1 
ATOM   9678  C  CA    . PHE B 1 601 ? -6.766  7.742   40.925  1.00 32.20  ? 601 PHE B CA    1 
ATOM   9679  C  C     . PHE B 1 601 ? -7.428  8.465   42.097  1.00 33.47  ? 601 PHE B C     1 
ATOM   9680  O  O     . PHE B 1 601 ? -8.361  7.947   42.718  1.00 35.10  ? 601 PHE B O     1 
ATOM   9681  C  CB    . PHE B 1 601 ? -7.024  8.499   39.614  1.00 29.71  ? 601 PHE B CB    1 
ATOM   9682  C  CG    . PHE B 1 601 ? -8.473  8.749   39.312  1.00 28.91  ? 601 PHE B CG    1 
ATOM   9683  C  CD1   . PHE B 1 601 ? -9.246  7.790   38.646  1.00 29.31  ? 601 PHE B CD1   1 
ATOM   9684  C  CD2   . PHE B 1 601 ? -9.069  9.957   39.666  1.00 29.33  ? 601 PHE B CD2   1 
ATOM   9685  C  CE1   . PHE B 1 601 ? -10.599 8.033   38.329  1.00 27.70  ? 601 PHE B CE1   1 
ATOM   9686  C  CE2   . PHE B 1 601 ? -10.424 10.215  39.360  1.00 30.15  ? 601 PHE B CE2   1 
ATOM   9687  C  CZ    . PHE B 1 601 ? -11.189 9.246   38.687  1.00 28.51  ? 601 PHE B CZ    1 
ATOM   9688  N  N     . LEU B 1 602 ? -6.913  9.650   42.413  1.00 32.93  ? 602 LEU B N     1 
ATOM   9689  C  CA    . LEU B 1 602 ? -7.436  10.482  43.491  1.00 30.82  ? 602 LEU B CA    1 
ATOM   9690  C  C     . LEU B 1 602 ? -8.091  11.702  42.872  1.00 30.94  ? 602 LEU B C     1 
ATOM   9691  O  O     . LEU B 1 602 ? -7.572  12.275  41.905  1.00 31.12  ? 602 LEU B O     1 
ATOM   9692  C  CB    . LEU B 1 602 ? -6.304  10.966  44.398  1.00 30.29  ? 602 LEU B CB    1 
ATOM   9693  C  CG    . LEU B 1 602 ? -5.574  9.999   45.321  1.00 29.35  ? 602 LEU B CG    1 
ATOM   9694  C  CD1   . LEU B 1 602 ? -4.355  10.695  45.854  1.00 26.58  ? 602 LEU B CD1   1 
ATOM   9695  C  CD2   . LEU B 1 602 ? -6.489  9.548   46.462  1.00 28.38  ? 602 LEU B CD2   1 
ATOM   9696  N  N     . LEU B 1 603 ? -9.220  12.114  43.437  1.00 30.66  ? 603 LEU B N     1 
ATOM   9697  C  CA    . LEU B 1 603 ? -9.925  13.288  42.940  1.00 29.46  ? 603 LEU B CA    1 
ATOM   9698  C  C     . LEU B 1 603 ? -10.248 14.207  44.110  1.00 29.14  ? 603 LEU B C     1 
ATOM   9699  O  O     . LEU B 1 603 ? -10.807 13.778  45.119  1.00 26.62  ? 603 LEU B O     1 
ATOM   9700  C  CB    . LEU B 1 603 ? -11.204 12.865  42.218  1.00 28.12  ? 603 LEU B CB    1 
ATOM   9701  C  CG    . LEU B 1 603 ? -11.831 13.882  41.269  1.00 27.71  ? 603 LEU B CG    1 
ATOM   9702  C  CD1   . LEU B 1 603 ? -10.849 14.273  40.170  1.00 26.69  ? 603 LEU B CD1   1 
ATOM   9703  C  CD2   . LEU B 1 603 ? -13.077 13.273  40.664  1.00 28.44  ? 603 LEU B CD2   1 
ATOM   9704  N  N     . LEU B 1 604 ? -9.866  15.469  43.985  1.00 30.71  ? 604 LEU B N     1 
ATOM   9705  C  CA    . LEU B 1 604 ? -10.130 16.418  45.046  1.00 34.38  ? 604 LEU B CA    1 
ATOM   9706  C  C     . LEU B 1 604 ? -11.223 17.342  44.560  1.00 36.99  ? 604 LEU B C     1 
ATOM   9707  O  O     . LEU B 1 604 ? -10.953 18.358  43.930  1.00 35.89  ? 604 LEU B O     1 
ATOM   9708  C  CB    . LEU B 1 604 ? -8.865  17.201  45.384  1.00 35.96  ? 604 LEU B CB    1 
ATOM   9709  C  CG    . LEU B 1 604 ? -8.868  17.767  46.808  1.00 37.97  ? 604 LEU B CG    1 
ATOM   9710  C  CD1   . LEU B 1 604 ? -7.443  18.033  47.240  1.00 40.37  ? 604 LEU B CD1   1 
ATOM   9711  C  CD2   . LEU B 1 604 ? -9.725  19.025  46.883  1.00 38.56  ? 604 LEU B CD2   1 
ATOM   9712  N  N     . THR B 1 605 ? -12.464 16.980  44.874  1.00 41.39  ? 605 THR B N     1 
ATOM   9713  C  CA    . THR B 1 605 ? -13.631 17.735  44.426  1.00 44.12  ? 605 THR B CA    1 
ATOM   9714  C  C     . THR B 1 605 ? -14.005 18.970  45.207  1.00 46.01  ? 605 THR B C     1 
ATOM   9715  O  O     . THR B 1 605 ? -14.590 19.894  44.644  1.00 48.16  ? 605 THR B O     1 
ATOM   9716  C  CB    . THR B 1 605 ? -14.889 16.852  44.368  1.00 42.58  ? 605 THR B CB    1 
ATOM   9717  O  OG1   . THR B 1 605 ? -15.194 16.372  45.674  1.00 42.05  ? 605 THR B OG1   1 
ATOM   9718  C  CG2   . THR B 1 605 ? -14.667 15.672  43.466  1.00 43.95  ? 605 THR B CG2   1 
ATOM   9719  N  N     . VAL B 1 606 ? -13.676 19.015  46.487  1.00 46.76  ? 606 VAL B N     1 
ATOM   9720  C  CA    . VAL B 1 606 ? -14.069 20.180  47.257  1.00 49.47  ? 606 VAL B CA    1 
ATOM   9721  C  C     . VAL B 1 606 ? -12.966 20.609  48.218  1.00 50.29  ? 606 VAL B C     1 
ATOM   9722  O  O     . VAL B 1 606 ? -12.517 19.817  49.043  1.00 51.35  ? 606 VAL B O     1 
ATOM   9723  C  CB    . VAL B 1 606 ? -15.422 19.873  48.011  1.00 49.15  ? 606 VAL B CB    1 
ATOM   9724  C  CG1   . VAL B 1 606 ? -15.238 18.702  48.952  1.00 49.68  ? 606 VAL B CG1   1 
ATOM   9725  C  CG2   . VAL B 1 606 ? -15.921 21.096  48.762  1.00 49.24  ? 606 VAL B CG2   1 
ATOM   9726  N  N     . HIS B 1 607 ? -12.520 21.859  48.099  1.00 51.26  ? 607 HIS B N     1 
ATOM   9727  C  CA    . HIS B 1 607 ? -11.460 22.383  48.971  1.00 52.17  ? 607 HIS B CA    1 
ATOM   9728  C  C     . HIS B 1 607 ? -11.988 23.495  49.867  1.00 52.80  ? 607 HIS B C     1 
ATOM   9729  O  O     . HIS B 1 607 ? -12.426 23.240  50.988  1.00 54.44  ? 607 HIS B O     1 
ATOM   9730  C  CB    . HIS B 1 607 ? -10.277 22.903  48.137  1.00 51.38  ? 607 HIS B CB    1 
ATOM   9731  N  N     . GLY B 1 612 ? -9.858  22.082  59.121  1.00 50.33  ? 612 GLY B N     1 
ATOM   9732  C  CA    . GLY B 1 612 ? -10.050 20.790  58.481  1.00 50.11  ? 612 GLY B CA    1 
ATOM   9733  C  C     . GLY B 1 612 ? -9.279  20.609  57.178  1.00 49.35  ? 612 GLY B C     1 
ATOM   9734  O  O     . GLY B 1 612 ? -9.252  21.507  56.336  1.00 51.51  ? 612 GLY B O     1 
ATOM   9735  N  N     . THR B 1 613 ? -8.660  19.444  57.006  1.00 46.35  ? 613 THR B N     1 
ATOM   9736  C  CA    . THR B 1 613 ? -7.887  19.146  55.801  1.00 42.88  ? 613 THR B CA    1 
ATOM   9737  C  C     . THR B 1 613 ? -8.712  18.323  54.796  1.00 40.55  ? 613 THR B C     1 
ATOM   9738  O  O     . THR B 1 613 ? -9.249  17.279  55.132  1.00 39.46  ? 613 THR B O     1 
ATOM   9739  C  CB    . THR B 1 613 ? -6.561  18.385  56.174  1.00 42.75  ? 613 THR B CB    1 
ATOM   9740  O  OG1   . THR B 1 613 ? -5.963  17.816  55.000  1.00 41.92  ? 613 THR B OG1   1 
ATOM   9741  C  CG2   . THR B 1 613 ? -6.838  17.290  57.180  1.00 40.20  ? 613 THR B CG2   1 
ATOM   9742  N  N     . PRO B 1 614 ? -8.822  18.795  53.545  1.00 38.78  ? 614 PRO B N     1 
ATOM   9743  C  CA    . PRO B 1 614 ? -9.593  18.055  52.546  1.00 38.52  ? 614 PRO B CA    1 
ATOM   9744  C  C     . PRO B 1 614 ? -9.300  16.551  52.490  1.00 39.10  ? 614 PRO B C     1 
ATOM   9745  O  O     . PRO B 1 614 ? -8.181  16.123  52.744  1.00 39.52  ? 614 PRO B O     1 
ATOM   9746  C  CB    . PRO B 1 614 ? -9.254  18.786  51.241  1.00 36.56  ? 614 PRO B CB    1 
ATOM   9747  C  CG    . PRO B 1 614 ? -7.983  19.516  51.539  1.00 35.37  ? 614 PRO B CG    1 
ATOM   9748  C  CD    . PRO B 1 614 ? -8.196  19.977  52.935  1.00 37.50  ? 614 PRO B CD    1 
ATOM   9749  N  N     . ARG B 1 615 ? -10.326 15.764  52.170  1.00 39.96  ? 615 ARG B N     1 
ATOM   9750  C  CA    . ARG B 1 615 ? -10.223 14.309  52.067  1.00 42.27  ? 615 ARG B CA    1 
ATOM   9751  C  C     . ARG B 1 615 ? -10.553 13.922  50.636  1.00 42.50  ? 615 ARG B C     1 
ATOM   9752  O  O     . ARG B 1 615 ? -11.701 13.618  50.337  1.00 45.34  ? 615 ARG B O     1 
ATOM   9753  C  CB    . ARG B 1 615 ? -11.239 13.619  52.996  1.00 44.73  ? 615 ARG B CB    1 
ATOM   9754  C  CG    . ARG B 1 615 ? -10.985 13.787  54.506  1.00 48.76  ? 615 ARG B CG    1 
ATOM   9755  C  CD    . ARG B 1 615 ? -12.082 13.135  55.362  1.00 49.03  ? 615 ARG B CD    1 
ATOM   9756  N  NE    . ARG B 1 615 ? -13.386 13.782  55.199  1.00 50.93  ? 615 ARG B NE    1 
ATOM   9757  C  CZ    . ARG B 1 615 ? -14.544 13.244  55.578  1.00 51.34  ? 615 ARG B CZ    1 
ATOM   9758  N  NH1   . ARG B 1 615 ? -14.565 12.040  56.145  1.00 50.73  ? 615 ARG B NH1   1 
ATOM   9759  N  NH2   . ARG B 1 615 ? -15.680 13.908  55.389  1.00 50.12  ? 615 ARG B NH2   1 
ATOM   9760  N  N     . PRO B 1 616 ? -9.555  13.904  49.733  1.00 41.81  ? 616 PRO B N     1 
ATOM   9761  C  CA    . PRO B 1 616 ? -9.858  13.540  48.341  1.00 40.38  ? 616 PRO B CA    1 
ATOM   9762  C  C     . PRO B 1 616 ? -10.528 12.176  48.186  1.00 38.89  ? 616 PRO B C     1 
ATOM   9763  O  O     . PRO B 1 616 ? -10.442 11.333  49.081  1.00 40.08  ? 616 PRO B O     1 
ATOM   9764  C  CB    . PRO B 1 616 ? -8.485  13.602  47.664  1.00 39.58  ? 616 PRO B CB    1 
ATOM   9765  C  CG    . PRO B 1 616 ? -7.550  13.232  48.760  1.00 40.30  ? 616 PRO B CG    1 
ATOM   9766  C  CD    . PRO B 1 616 ? -8.098  13.997  49.946  1.00 41.01  ? 616 PRO B CD    1 
ATOM   9767  N  N     . LEU B 1 617 ? -11.213 11.971  47.066  1.00 36.55  ? 617 LEU B N     1 
ATOM   9768  C  CA    . LEU B 1 617 ? -11.850 10.685  46.796  1.00 35.65  ? 617 LEU B CA    1 
ATOM   9769  C  C     . LEU B 1 617 ? -10.808 9.786   46.139  1.00 35.84  ? 617 LEU B C     1 
ATOM   9770  O  O     . LEU B 1 617 ? -9.876  10.288  45.512  1.00 37.10  ? 617 LEU B O     1 
ATOM   9771  C  CB    . LEU B 1 617 ? -13.025 10.850  45.837  1.00 34.33  ? 617 LEU B CB    1 
ATOM   9772  C  CG    . LEU B 1 617 ? -14.214 11.640  46.373  1.00 35.81  ? 617 LEU B CG    1 
ATOM   9773  C  CD1   . LEU B 1 617 ? -15.242 11.867  45.282  1.00 35.20  ? 617 LEU B CD1   1 
ATOM   9774  C  CD2   . LEU B 1 617 ? -14.830 10.880  47.523  1.00 37.71  ? 617 LEU B CD2   1 
ATOM   9775  N  N     . LYS B 1 618 ? -10.946 8.470   46.294  1.00 35.37  ? 618 LYS B N     1 
ATOM   9776  C  CA    . LYS B 1 618 ? -10.020 7.521   45.670  1.00 35.29  ? 618 LYS B CA    1 
ATOM   9777  C  C     . LYS B 1 618 ? -10.829 6.627   44.746  1.00 35.54  ? 618 LYS B C     1 
ATOM   9778  O  O     . LYS B 1 618 ? -11.476 5.682   45.193  1.00 36.60  ? 618 LYS B O     1 
ATOM   9779  C  CB    . LYS B 1 618 ? -9.299  6.662   46.713  1.00 34.41  ? 618 LYS B CB    1 
ATOM   9780  C  CG    . LYS B 1 618 ? -8.260  5.763   46.080  1.00 37.37  ? 618 LYS B CG    1 
ATOM   9781  C  CD    . LYS B 1 618 ? -7.136  5.390   47.026  1.00 40.47  ? 618 LYS B CD    1 
ATOM   9782  C  CE    . LYS B 1 618 ? -6.132  4.436   46.347  1.00 41.93  ? 618 LYS B CE    1 
ATOM   9783  N  NZ    . LYS B 1 618 ? -5.102  3.921   47.313  1.00 41.95  ? 618 LYS B NZ    1 
ATOM   9784  N  N     . LEU B 1 619 ? -10.799 6.917   43.453  1.00 34.84  ? 619 LEU B N     1 
ATOM   9785  C  CA    . LEU B 1 619 ? -11.596 6.131   42.536  1.00 36.69  ? 619 LEU B CA    1 
ATOM   9786  C  C     . LEU B 1 619 ? -10.821 5.040   41.831  1.00 37.87  ? 619 LEU B C     1 
ATOM   9787  O  O     . LEU B 1 619 ? -9.627  5.180   41.560  1.00 37.76  ? 619 LEU B O     1 
ATOM   9788  C  CB    . LEU B 1 619 ? -12.276 7.040   41.506  1.00 37.08  ? 619 LEU B CB    1 
ATOM   9789  C  CG    . LEU B 1 619 ? -13.093 8.225   42.033  1.00 38.14  ? 619 LEU B CG    1 
ATOM   9790  C  CD1   . LEU B 1 619 ? -12.158 9.388   42.279  1.00 38.09  ? 619 LEU B CD1   1 
ATOM   9791  C  CD2   . LEU B 1 619 ? -14.171 8.635   41.029  1.00 39.14  ? 619 LEU B CD2   1 
ATOM   9792  N  N     . VAL B 1 620 ? -11.523 3.949   41.539  1.00 38.68  ? 620 VAL B N     1 
ATOM   9793  C  CA    . VAL B 1 620 ? -10.930 2.808   40.866  1.00 40.00  ? 620 VAL B CA    1 
ATOM   9794  C  C     . VAL B 1 620 ? -11.766 2.348   39.693  1.00 41.72  ? 620 VAL B C     1 
ATOM   9795  O  O     . VAL B 1 620 ? -12.867 1.822   39.892  1.00 40.62  ? 620 VAL B O     1 
ATOM   9796  C  CB    . VAL B 1 620 ? -10.786 1.616   41.810  1.00 40.97  ? 620 VAL B CB    1 
ATOM   9797  C  CG1   . VAL B 1 620 ? -10.240 0.415   41.046  1.00 38.66  ? 620 VAL B CG1   1 
ATOM   9798  C  CG2   . VAL B 1 620 ? -9.879  1.989   42.977  1.00 40.83  ? 620 VAL B CG2   1 
ATOM   9799  N  N     . HIS B 1 621 ? -11.220 2.544   38.485  1.00 43.50  ? 621 HIS B N     1 
ATOM   9800  C  CA    . HIS B 1 621 ? -11.841 2.155   37.209  1.00 44.32  ? 621 HIS B CA    1 
ATOM   9801  C  C     . HIS B 1 621 ? -11.683 0.648   37.116  1.00 44.73  ? 621 HIS B C     1 
ATOM   9802  O  O     . HIS B 1 621 ? -10.594 0.149   36.833  1.00 43.46  ? 621 HIS B O     1 
ATOM   9803  C  CB    . HIS B 1 621 ? -11.104 2.837   36.052  1.00 46.06  ? 621 HIS B CB    1 
ATOM   9804  C  CG    . HIS B 1 621 ? -11.729 2.621   34.707  1.00 47.14  ? 621 HIS B CG    1 
ATOM   9805  N  ND1   . HIS B 1 621 ? -13.087 2.716   34.492  1.00 48.09  ? 621 HIS B ND1   1 
ATOM   9806  C  CD2   . HIS B 1 621 ? -11.173 2.389   33.495  1.00 46.63  ? 621 HIS B CD2   1 
ATOM   9807  C  CE1   . HIS B 1 621 ? -13.339 2.557   33.205  1.00 47.96  ? 621 HIS B CE1   1 
ATOM   9808  N  NE2   . HIS B 1 621 ? -12.195 2.358   32.578  1.00 46.99  ? 621 HIS B NE2   1 
ATOM   9809  N  N     . GLU B 1 622 ? -12.776 -0.072  37.355  1.00 46.02  ? 622 GLU B N     1 
ATOM   9810  C  CA    . GLU B 1 622 ? -12.741 -1.528  37.362  1.00 47.54  ? 622 GLU B CA    1 
ATOM   9811  C  C     . GLU B 1 622 ? -13.230 -2.215  36.100  1.00 47.98  ? 622 GLU B C     1 
ATOM   9812  O  O     . GLU B 1 622 ? -12.900 -3.376  35.850  1.00 47.41  ? 622 GLU B O     1 
ATOM   9813  C  CB    . GLU B 1 622 ? -13.534 -2.029  38.562  1.00 48.53  ? 622 GLU B CB    1 
ATOM   9814  C  CG    . GLU B 1 622 ? -12.984 -1.521  39.889  1.00 51.60  ? 622 GLU B CG    1 
ATOM   9815  C  CD    . GLU B 1 622 ? -13.811 -1.975  41.067  1.00 52.77  ? 622 GLU B CD    1 
ATOM   9816  O  OE1   . GLU B 1 622 ? -15.001 -1.598  41.104  1.00 54.10  ? 622 GLU B OE1   1 
ATOM   9817  O  OE2   . GLU B 1 622 ? -13.279 -2.705  41.941  1.00 51.34  ? 622 GLU B OE2   1 
ATOM   9818  N  N     . ALA B 1 623 ? -14.011 -1.499  35.303  1.00 48.39  ? 623 ALA B N     1 
ATOM   9819  C  CA    . ALA B 1 623 ? -14.539 -2.062  34.077  1.00 48.11  ? 623 ALA B CA    1 
ATOM   9820  C  C     . ALA B 1 623 ? -14.820 -0.935  33.110  1.00 48.40  ? 623 ALA B C     1 
ATOM   9821  O  O     . ALA B 1 623 ? -15.230 0.145   33.525  1.00 49.12  ? 623 ALA B O     1 
ATOM   9822  C  CB    . ALA B 1 623 ? -15.813 -2.821  34.379  1.00 48.71  ? 623 ALA B CB    1 
ATOM   9823  N  N     . GLY B 1 624 ? -14.610 -1.191  31.823  1.00 47.93  ? 624 GLY B N     1 
ATOM   9824  C  CA    . GLY B 1 624 ? -14.843 -0.170  30.815  1.00 47.31  ? 624 GLY B CA    1 
ATOM   9825  C  C     . GLY B 1 624 ? -13.514 0.255   30.235  1.00 47.41  ? 624 GLY B C     1 
ATOM   9826  O  O     . GLY B 1 624 ? -12.481 -0.031  30.828  1.00 49.44  ? 624 GLY B O     1 
ATOM   9827  N  N     . ASP B 1 625 ? -13.516 0.926   29.089  1.00 47.05  ? 625 ASP B N     1 
ATOM   9828  C  CA    . ASP B 1 625 ? -12.259 1.356   28.476  1.00 46.51  ? 625 ASP B CA    1 
ATOM   9829  C  C     . ASP B 1 625 ? -12.285 2.818   28.057  1.00 45.95  ? 625 ASP B C     1 
ATOM   9830  O  O     . ASP B 1 625 ? -12.152 3.135   26.879  1.00 46.38  ? 625 ASP B O     1 
ATOM   9831  C  CB    . ASP B 1 625 ? -11.930 0.476   27.268  1.00 46.84  ? 625 ASP B CB    1 
ATOM   9832  N  N     . THR B 1 626 ? -12.451 3.698   29.041  1.00 44.94  ? 626 THR B N     1 
ATOM   9833  C  CA    . THR B 1 626 ? -12.494 5.144   28.833  1.00 42.08  ? 626 THR B CA    1 
ATOM   9834  C  C     . THR B 1 626 ? -11.317 5.765   29.583  1.00 40.87  ? 626 THR B C     1 
ATOM   9835  O  O     . THR B 1 626 ? -11.097 5.496   30.766  1.00 40.45  ? 626 THR B O     1 
ATOM   9836  C  CB    . THR B 1 626 ? -13.801 5.740   29.405  1.00 41.38  ? 626 THR B CB    1 
ATOM   9837  O  OG1   . THR B 1 626 ? -14.882 4.868   29.077  1.00 40.45  ? 626 THR B OG1   1 
ATOM   9838  C  CG2   . THR B 1 626 ? -14.081 7.135   28.841  1.00 38.45  ? 626 THR B CG2   1 
ATOM   9839  N  N     . PRO B 1 627 ? -10.529 6.590   28.903  1.00 39.48  ? 627 PRO B N     1 
ATOM   9840  C  CA    . PRO B 1 627 ? -9.413  7.181   29.634  1.00 39.63  ? 627 PRO B CA    1 
ATOM   9841  C  C     . PRO B 1 627 ? -9.802  7.746   31.009  1.00 39.84  ? 627 PRO B C     1 
ATOM   9842  O  O     . PRO B 1 627 ? -10.888 8.302   31.185  1.00 37.75  ? 627 PRO B O     1 
ATOM   9843  C  CB    . PRO B 1 627 ? -8.893  8.251   28.664  1.00 39.37  ? 627 PRO B CB    1 
ATOM   9844  C  CG    . PRO B 1 627 ? -10.003 8.403   27.621  1.00 38.73  ? 627 PRO B CG    1 
ATOM   9845  C  CD    . PRO B 1 627 ? -10.530 7.016   27.500  1.00 38.28  ? 627 PRO B CD    1 
ATOM   9846  N  N     . LEU B 1 628 ? -8.907  7.574   31.982  1.00 41.54  ? 628 LEU B N     1 
ATOM   9847  C  CA    . LEU B 1 628 ? -9.118  8.075   33.340  1.00 42.34  ? 628 LEU B CA    1 
ATOM   9848  C  C     . LEU B 1 628 ? -9.386  9.569   33.350  1.00 43.30  ? 628 LEU B C     1 
ATOM   9849  O  O     . LEU B 1 628 ? -10.432 10.001  33.830  1.00 43.72  ? 628 LEU B O     1 
ATOM   9850  C  CB    . LEU B 1 628 ? -7.898  7.810   34.216  1.00 42.26  ? 628 LEU B CB    1 
ATOM   9851  C  CG    . LEU B 1 628 ? -7.608  6.368   34.613  1.00 44.03  ? 628 LEU B CG    1 
ATOM   9852  C  CD1   . LEU B 1 628 ? -6.269  6.312   35.346  1.00 43.09  ? 628 LEU B CD1   1 
ATOM   9853  C  CD2   . LEU B 1 628 ? -8.749  5.833   35.477  1.00 43.08  ? 628 LEU B CD2   1 
ATOM   9854  N  N     . GLU B 1 629 ? -8.451  10.362  32.823  1.00 43.30  ? 629 GLU B N     1 
ATOM   9855  C  CA    . GLU B 1 629 ? -8.654  11.799  32.825  1.00 43.76  ? 629 GLU B CA    1 
ATOM   9856  C  C     . GLU B 1 629 ? -10.078 12.124  32.358  1.00 42.32  ? 629 GLU B C     1 
ATOM   9857  O  O     . GLU B 1 629 ? -10.676 13.092  32.817  1.00 42.18  ? 629 GLU B O     1 
ATOM   9858  C  CB    . GLU B 1 629 ? -7.606  12.524  31.964  1.00 46.94  ? 629 GLU B CB    1 
ATOM   9859  C  CG    . GLU B 1 629 ? -7.685  14.072  32.101  1.00 54.69  ? 629 GLU B CG    1 
ATOM   9860  C  CD    . GLU B 1 629 ? -6.543  14.859  31.422  1.00 59.38  ? 629 GLU B CD    1 
ATOM   9861  O  OE1   . GLU B 1 629 ? -6.300  14.672  30.200  1.00 62.45  ? 629 GLU B OE1   1 
ATOM   9862  O  OE2   . GLU B 1 629 ? -5.898  15.686  32.117  1.00 60.15  ? 629 GLU B OE2   1 
ATOM   9863  N  N     . ALA B 1 630 ? -10.636 11.296  31.478  1.00 40.87  ? 630 ALA B N     1 
ATOM   9864  C  CA    . ALA B 1 630 ? -11.997 11.520  30.986  1.00 40.01  ? 630 ALA B CA    1 
ATOM   9865  C  C     . ALA B 1 630 ? -13.001 11.293  32.108  1.00 39.69  ? 630 ALA B C     1 
ATOM   9866  O  O     . ALA B 1 630 ? -13.865 12.133  32.372  1.00 38.70  ? 630 ALA B O     1 
ATOM   9867  C  CB    . ALA B 1 630 ? -12.300 10.582  29.840  1.00 39.85  ? 630 ALA B CB    1 
ATOM   9868  N  N     . LEU B 1 631 ? -12.875 10.140  32.755  1.00 39.32  ? 631 LEU B N     1 
ATOM   9869  C  CA    . LEU B 1 631 ? -13.743 9.751   33.860  1.00 39.36  ? 631 LEU B CA    1 
ATOM   9870  C  C     . LEU B 1 631 ? -13.680 10.777  34.995  1.00 40.70  ? 631 LEU B C     1 
ATOM   9871  O  O     . LEU B 1 631 ? -14.706 11.217  35.524  1.00 40.89  ? 631 LEU B O     1 
ATOM   9872  C  CB    . LEU B 1 631 ? -13.322 8.369   34.372  1.00 37.13  ? 631 LEU B CB    1 
ATOM   9873  C  CG    . LEU B 1 631 ? -14.230 7.162   34.115  1.00 36.27  ? 631 LEU B CG    1 
ATOM   9874  C  CD1   . LEU B 1 631 ? -15.001 7.319   32.822  1.00 37.01  ? 631 LEU B CD1   1 
ATOM   9875  C  CD2   . LEU B 1 631 ? -13.375 5.912   34.075  1.00 35.18  ? 631 LEU B CD2   1 
ATOM   9876  N  N     . ALA B 1 632 ? -12.466 11.157  35.368  1.00 40.91  ? 632 ALA B N     1 
ATOM   9877  C  CA    . ALA B 1 632 ? -12.274 12.126  36.429  1.00 40.43  ? 632 ALA B CA    1 
ATOM   9878  C  C     . ALA B 1 632 ? -13.056 13.394  36.101  1.00 39.88  ? 632 ALA B C     1 
ATOM   9879  O  O     . ALA B 1 632 ? -13.761 13.937  36.958  1.00 38.07  ? 632 ALA B O     1 
ATOM   9880  C  CB    . ALA B 1 632 ? -10.778 12.442  36.575  1.00 41.44  ? 632 ALA B CB    1 
ATOM   9881  N  N     . HIS B 1 633 ? -12.919 13.840  34.851  1.00 39.56  ? 633 HIS B N     1 
ATOM   9882  C  CA    . HIS B 1 633 ? -13.570 15.042  34.352  1.00 39.73  ? 633 HIS B CA    1 
ATOM   9883  C  C     . HIS B 1 633 ? -15.069 15.002  34.559  1.00 39.75  ? 633 HIS B C     1 
ATOM   9884  O  O     . HIS B 1 633 ? -15.657 15.955  35.071  1.00 39.51  ? 633 HIS B O     1 
ATOM   9885  C  CB    . HIS B 1 633 ? -13.266 15.226  32.872  1.00 42.67  ? 633 HIS B CB    1 
ATOM   9886  C  CG    . HIS B 1 633 ? -13.792 16.507  32.305  1.00 46.47  ? 633 HIS B CG    1 
ATOM   9887  N  ND1   . HIS B 1 633 ? -14.935 16.569  31.536  1.00 48.11  ? 633 HIS B ND1   1 
ATOM   9888  C  CD2   . HIS B 1 633 ? -13.334 17.778  32.406  1.00 46.79  ? 633 HIS B CD2   1 
ATOM   9889  C  CE1   . HIS B 1 633 ? -15.159 17.825  31.185  1.00 47.98  ? 633 HIS B CE1   1 
ATOM   9890  N  NE2   . HIS B 1 633 ? -14.204 18.577  31.700  1.00 48.50  ? 633 HIS B NE2   1 
ATOM   9891  N  N     . GLN B 1 634 ? -15.698 13.904  34.158  1.00 39.46  ? 634 GLN B N     1 
ATOM   9892  C  CA    . GLN B 1 634 ? -17.133 13.792  34.340  1.00 39.52  ? 634 GLN B CA    1 
ATOM   9893  C  C     . GLN B 1 634 ? -17.480 13.653  35.829  1.00 39.91  ? 634 GLN B C     1 
ATOM   9894  O  O     . GLN B 1 634 ? -18.274 14.441  36.363  1.00 39.90  ? 634 GLN B O     1 
ATOM   9895  C  CB    . GLN B 1 634 ? -17.688 12.612  33.545  1.00 38.27  ? 634 GLN B CB    1 
ATOM   9896  C  CG    . GLN B 1 634 ? -19.155 12.387  33.811  1.00 40.15  ? 634 GLN B CG    1 
ATOM   9897  C  CD    . GLN B 1 634 ? -19.860 11.710  32.677  1.00 41.99  ? 634 GLN B CD    1 
ATOM   9898  O  OE1   . GLN B 1 634 ? -19.283 10.876  31.980  1.00 44.20  ? 634 GLN B OE1   1 
ATOM   9899  N  NE2   . GLN B 1 634 ? -21.127 12.051  32.488  1.00 42.23  ? 634 GLN B NE2   1 
ATOM   9900  N  N     . ILE B 1 635 ? -16.879 12.664  36.494  1.00 39.26  ? 635 ILE B N     1 
ATOM   9901  C  CA    . ILE B 1 635 ? -17.115 12.425  37.922  1.00 38.62  ? 635 ILE B CA    1 
ATOM   9902  C  C     . ILE B 1 635 ? -17.036 13.733  38.704  1.00 38.34  ? 635 ILE B C     1 
ATOM   9903  O  O     . ILE B 1 635 ? -17.879 14.001  39.549  1.00 38.69  ? 635 ILE B O     1 
ATOM   9904  C  CB    . ILE B 1 635 ? -16.067 11.460  38.529  1.00 39.31  ? 635 ILE B CB    1 
ATOM   9905  C  CG1   . ILE B 1 635 ? -16.120 10.090  37.842  1.00 38.36  ? 635 ILE B CG1   1 
ATOM   9906  C  CG2   . ILE B 1 635 ? -16.310 11.315  40.023  1.00 38.33  ? 635 ILE B CG2   1 
ATOM   9907  C  CD1   . ILE B 1 635 ? -16.965 9.088   38.548  1.00 37.66  ? 635 ILE B CD1   1 
ATOM   9908  N  N     . PHE B 1 636 ? -16.009 14.535  38.426  1.00 37.60  ? 636 PHE B N     1 
ATOM   9909  C  CA    . PHE B 1 636 ? -15.827 15.825  39.093  1.00 36.71  ? 636 PHE B CA    1 
ATOM   9910  C  C     . PHE B 1 636 ? -16.961 16.809  38.793  1.00 37.65  ? 636 PHE B C     1 
ATOM   9911  O  O     . PHE B 1 636 ? -17.425 17.541  39.678  1.00 37.12  ? 636 PHE B O     1 
ATOM   9912  C  CB    . PHE B 1 636 ? -14.496 16.447  38.665  1.00 33.91  ? 636 PHE B CB    1 
ATOM   9913  C  CG    . PHE B 1 636 ? -14.367 17.916  38.999  1.00 30.44  ? 636 PHE B CG    1 
ATOM   9914  C  CD1   . PHE B 1 636 ? -14.685 18.391  40.279  1.00 29.57  ? 636 PHE B CD1   1 
ATOM   9915  C  CD2   . PHE B 1 636 ? -13.870 18.809  38.052  1.00 26.04  ? 636 PHE B CD2   1 
ATOM   9916  C  CE1   . PHE B 1 636 ? -14.510 19.730  40.609  1.00 26.98  ? 636 PHE B CE1   1 
ATOM   9917  C  CE2   . PHE B 1 636 ? -13.691 20.142  38.369  1.00 25.41  ? 636 PHE B CE2   1 
ATOM   9918  C  CZ    . PHE B 1 636 ? -14.008 20.604  39.652  1.00 26.33  ? 636 PHE B CZ    1 
ATOM   9919  N  N     . HIS B 1 637 ? -17.394 16.832  37.538  1.00 37.91  ? 637 HIS B N     1 
ATOM   9920  C  CA    . HIS B 1 637 ? -18.450 17.735  37.136  1.00 38.47  ? 637 HIS B CA    1 
ATOM   9921  C  C     . HIS B 1 637 ? -19.793 17.379  37.759  1.00 39.48  ? 637 HIS B C     1 
ATOM   9922  O  O     . HIS B 1 637 ? -20.533 18.270  38.204  1.00 39.64  ? 637 HIS B O     1 
ATOM   9923  C  CB    . HIS B 1 637 ? -18.516 17.783  35.609  1.00 37.71  ? 637 HIS B CB    1 
ATOM   9924  C  CG    . HIS B 1 637 ? -17.412 18.595  35.001  1.00 39.72  ? 637 HIS B CG    1 
ATOM   9925  N  ND1   . HIS B 1 637 ? -17.362 18.913  33.658  1.00 39.12  ? 637 HIS B ND1   1 
ATOM   9926  C  CD2   . HIS B 1 637 ? -16.336 19.200  35.564  1.00 38.79  ? 637 HIS B CD2   1 
ATOM   9927  C  CE1   . HIS B 1 637 ? -16.311 19.680  33.428  1.00 37.85  ? 637 HIS B CE1   1 
ATOM   9928  N  NE2   . HIS B 1 637 ? -15.672 19.871  34.567  1.00 36.40  ? 637 HIS B NE2   1 
ATOM   9929  N  N     . LEU B 1 638 ? -20.088 16.080  37.820  1.00 39.26  ? 638 LEU B N     1 
ATOM   9930  C  CA    . LEU B 1 638 ? -21.337 15.595  38.396  1.00 38.63  ? 638 LEU B CA    1 
ATOM   9931  C  C     . LEU B 1 638 ? -21.464 16.053  39.838  1.00 40.52  ? 638 LEU B C     1 
ATOM   9932  O  O     . LEU B 1 638 ? -22.521 15.960  40.453  1.00 41.63  ? 638 LEU B O     1 
ATOM   9933  C  CB    . LEU B 1 638 ? -21.385 14.075  38.342  1.00 36.21  ? 638 LEU B CB    1 
ATOM   9934  C  CG    . LEU B 1 638 ? -21.533 13.430  36.964  1.00 35.04  ? 638 LEU B CG    1 
ATOM   9935  C  CD1   . LEU B 1 638 ? -21.283 11.929  37.061  1.00 34.58  ? 638 LEU B CD1   1 
ATOM   9936  C  CD2   . LEU B 1 638 ? -22.925 13.697  36.426  1.00 34.27  ? 638 LEU B CD2   1 
ATOM   9937  N  N     . THR B 1 639 ? -20.376 16.554  40.388  1.00 41.90  ? 639 THR B N     1 
ATOM   9938  C  CA    . THR B 1 639 ? -20.409 17.024  41.753  1.00 44.17  ? 639 THR B CA    1 
ATOM   9939  C  C     . THR B 1 639 ? -21.258 18.276  41.875  1.00 45.32  ? 639 THR B C     1 
ATOM   9940  O  O     . THR B 1 639 ? -21.957 18.471  42.868  1.00 44.90  ? 639 THR B O     1 
ATOM   9941  C  CB    . THR B 1 639 ? -19.007 17.337  42.229  1.00 45.10  ? 639 THR B CB    1 
ATOM   9942  O  OG1   . THR B 1 639 ? -18.354 16.118  42.604  1.00 47.81  ? 639 THR B OG1   1 
ATOM   9943  C  CG2   . THR B 1 639 ? -19.046 18.287  43.395  1.00 46.80  ? 639 THR B CG2   1 
ATOM   9944  N  N     . ARG B 1 640 ? -21.188 19.120  40.852  1.00 46.80  ? 640 ARG B N     1 
ATOM   9945  C  CA    . ARG B 1 640 ? -21.921 20.371  40.842  1.00 48.60  ? 640 ARG B CA    1 
ATOM   9946  C  C     . ARG B 1 640 ? -23.361 20.239  40.354  1.00 49.79  ? 640 ARG B C     1 
ATOM   9947  O  O     . ARG B 1 640 ? -24.097 21.217  40.251  1.00 50.28  ? 640 ARG B O     1 
ATOM   9948  C  CB    . ARG B 1 640 ? -21.163 21.399  39.999  1.00 48.84  ? 640 ARG B CB    1 
ATOM   9949  C  CG    . ARG B 1 640 ? -19.928 21.990  40.705  1.00 50.86  ? 640 ARG B CG    1 
ATOM   9950  C  CD    . ARG B 1 640 ? -18.639 21.191  40.466  1.00 52.13  ? 640 ARG B CD    1 
ATOM   9951  N  NE    . ARG B 1 640 ? -17.819 21.031  41.675  1.00 51.50  ? 640 ARG B NE    1 
ATOM   9952  C  CZ    . ARG B 1 640 ? -17.159 22.005  42.305  1.00 50.94  ? 640 ARG B CZ    1 
ATOM   9953  N  NH1   . ARG B 1 640 ? -17.189 23.255  41.865  1.00 49.28  ? 640 ARG B NH1   1 
ATOM   9954  N  NH2   . ARG B 1 640 ? -16.467 21.725  43.398  1.00 51.04  ? 640 ARG B NH2   1 
ATOM   9955  N  N     . LEU B 1 641 ? -23.780 19.016  40.091  1.00 50.51  ? 641 LEU B N     1 
ATOM   9956  C  CA    . LEU B 1 641 ? -25.127 18.787  39.606  1.00 51.70  ? 641 LEU B CA    1 
ATOM   9957  C  C     . LEU B 1 641 ? -26.134 18.493  40.735  1.00 53.29  ? 641 LEU B C     1 
ATOM   9958  O  O     . LEU B 1 641 ? -27.159 17.851  40.513  1.00 54.97  ? 641 LEU B O     1 
ATOM   9959  C  CB    . LEU B 1 641 ? -25.075 17.633  38.596  1.00 50.86  ? 641 LEU B CB    1 
ATOM   9960  C  CG    . LEU B 1 641 ? -25.670 17.828  37.204  1.00 49.56  ? 641 LEU B CG    1 
ATOM   9961  C  CD1   . LEU B 1 641 ? -27.139 17.461  37.220  1.00 51.53  ? 641 LEU B CD1   1 
ATOM   9962  C  CD2   . LEU B 1 641 ? -25.466 19.254  36.756  1.00 48.71  ? 641 LEU B CD2   1 
ATOM   9963  N  N     . TYR B 1 642 ? -25.860 18.967  41.946  1.00 54.33  ? 642 TYR B N     1 
ATOM   9964  C  CA    . TYR B 1 642 ? -26.767 18.706  43.067  1.00 54.29  ? 642 TYR B CA    1 
ATOM   9965  C  C     . TYR B 1 642 ? -27.695 19.882  43.302  1.00 56.05  ? 642 TYR B C     1 
ATOM   9966  O  O     . TYR B 1 642 ? -27.267 20.944  43.755  1.00 56.17  ? 642 TYR B O     1 
ATOM   9967  C  CB    . TYR B 1 642 ? -25.979 18.425  44.336  1.00 52.50  ? 642 TYR B CB    1 
ATOM   9968  C  CG    . TYR B 1 642 ? -26.831 18.025  45.508  1.00 50.82  ? 642 TYR B CG    1 
ATOM   9969  C  CD1   . TYR B 1 642 ? -27.576 16.852  45.477  1.00 52.08  ? 642 TYR B CD1   1 
ATOM   9970  C  CD2   . TYR B 1 642 ? -26.855 18.793  46.668  1.00 49.80  ? 642 TYR B CD2   1 
ATOM   9971  C  CE1   . TYR B 1 642 ? -28.323 16.445  46.576  1.00 52.50  ? 642 TYR B CE1   1 
ATOM   9972  C  CE2   . TYR B 1 642 ? -27.588 18.404  47.768  1.00 50.44  ? 642 TYR B CE2   1 
ATOM   9973  C  CZ    . TYR B 1 642 ? -28.322 17.224  47.722  1.00 52.62  ? 642 TYR B CZ    1 
ATOM   9974  O  OH    . TYR B 1 642 ? -29.040 16.808  48.825  1.00 53.64  ? 642 TYR B OH    1 
ATOM   9975  N  N     . PRO B 1 643 ? -28.993 19.688  43.029  1.00 57.75  ? 643 PRO B N     1 
ATOM   9976  C  CA    . PRO B 1 643 ? -30.075 20.674  43.164  1.00 58.48  ? 643 PRO B CA    1 
ATOM   9977  C  C     . PRO B 1 643 ? -30.290 21.398  44.498  1.00 58.65  ? 643 PRO B C     1 
ATOM   9978  O  O     . PRO B 1 643 ? -30.471 22.615  44.531  1.00 58.11  ? 643 PRO B O     1 
ATOM   9979  C  CB    . PRO B 1 643 ? -31.312 19.873  42.751  1.00 58.51  ? 643 PRO B CB    1 
ATOM   9980  C  CG    . PRO B 1 643 ? -30.964 18.479  43.215  1.00 58.10  ? 643 PRO B CG    1 
ATOM   9981  C  CD    . PRO B 1 643 ? -29.546 18.352  42.728  1.00 57.66  ? 643 PRO B CD    1 
ATOM   9982  N  N     . ALA B 1 644 ? -30.255 20.657  45.595  1.00 59.16  ? 644 ALA B N     1 
ATOM   9983  C  CA    . ALA B 1 644 ? -30.532 21.241  46.892  1.00 60.07  ? 644 ALA B CA    1 
ATOM   9984  C  C     . ALA B 1 644 ? -29.442 21.941  47.693  1.00 61.12  ? 644 ALA B C     1 
ATOM   9985  O  O     . ALA B 1 644 ? -29.456 21.850  48.916  1.00 62.25  ? 644 ALA B O     1 
ATOM   9986  C  CB    . ALA B 1 644 ? -31.187 20.187  47.764  1.00 60.47  ? 644 ALA B CB    1 
ATOM   9987  N  N     . SER B 1 645 ? -28.508 22.649  47.068  1.00 61.85  ? 645 SER B N     1 
ATOM   9988  C  CA    . SER B 1 645 ? -27.518 23.312  47.905  1.00 61.84  ? 645 SER B CA    1 
ATOM   9989  C  C     . SER B 1 645 ? -26.821 24.548  47.387  1.00 61.76  ? 645 SER B C     1 
ATOM   9990  O  O     . SER B 1 645 ? -25.837 24.959  47.976  1.00 63.96  ? 645 SER B O     1 
ATOM   9991  C  CB    . SER B 1 645 ? -26.457 22.321  48.363  1.00 61.89  ? 645 SER B CB    1 
ATOM   9992  O  OG    . SER B 1 645 ? -25.735 22.867  49.454  1.00 63.38  ? 645 SER B OG    1 
ATOM   9993  N  N     . GLY B 1 646 ? -27.340 25.141  46.318  1.00 60.56  ? 646 GLY B N     1 
ATOM   9994  C  CA    . GLY B 1 646 ? -26.768 26.345  45.722  1.00 58.80  ? 646 GLY B CA    1 
ATOM   9995  C  C     . GLY B 1 646 ? -25.801 27.260  46.466  1.00 57.21  ? 646 GLY B C     1 
ATOM   9996  O  O     . GLY B 1 646 ? -25.661 28.423  46.107  1.00 58.40  ? 646 GLY B O     1 
ATOM   9997  N  N     . PHE B 1 647 ? -25.130 26.746  47.486  1.00 55.30  ? 647 PHE B N     1 
ATOM   9998  C  CA    . PHE B 1 647 ? -24.162 27.498  48.261  1.00 53.35  ? 647 PHE B CA    1 
ATOM   9999  C  C     . PHE B 1 647 ? -22.947 26.626  48.528  1.00 51.96  ? 647 PHE B C     1 
ATOM   10000 O  O     . PHE B 1 647 ? -21.860 27.130  48.816  1.00 52.01  ? 647 PHE B O     1 
ATOM   10001 C  CB    . PHE B 1 647 ? -24.770 27.936  49.580  1.00 55.25  ? 647 PHE B CB    1 
ATOM   10002 C  CG    . PHE B 1 647 ? -25.937 28.836  49.420  1.00 57.47  ? 647 PHE B CG    1 
ATOM   10003 C  CD1   . PHE B 1 647 ? -27.200 28.320  49.153  1.00 58.16  ? 647 PHE B CD1   1 
ATOM   10004 C  CD2   . PHE B 1 647 ? -25.772 30.209  49.483  1.00 58.50  ? 647 PHE B CD2   1 
ATOM   10005 C  CE1   . PHE B 1 647 ? -28.285 29.165  48.955  1.00 58.17  ? 647 PHE B CE1   1 
ATOM   10006 C  CE2   . PHE B 1 647 ? -26.848 31.060  49.285  1.00 59.61  ? 647 PHE B CE2   1 
ATOM   10007 C  CZ    . PHE B 1 647 ? -28.109 30.538  49.018  1.00 58.71  ? 647 PHE B CZ    1 
ATOM   10008 N  N     . ALA B 1 648 ? -23.137 25.314  48.430  1.00 49.20  ? 648 ALA B N     1 
ATOM   10009 C  CA    . ALA B 1 648 ? -22.055 24.370  48.660  1.00 47.55  ? 648 ALA B CA    1 
ATOM   10010 C  C     . ALA B 1 648 ? -22.279 23.049  47.929  1.00 47.08  ? 648 ALA B C     1 
ATOM   10011 O  O     . ALA B 1 648 ? -23.292 22.389  48.133  1.00 48.41  ? 648 ALA B O     1 
ATOM   10012 C  CB    . ALA B 1 648 ? -21.909 24.115  50.148  1.00 46.85  ? 648 ALA B CB    1 
ATOM   10013 N  N     . PHE B 1 649 ? -21.334 22.663  47.079  1.00 45.39  ? 649 PHE B N     1 
ATOM   10014 C  CA    . PHE B 1 649 ? -21.453 21.406  46.360  1.00 43.54  ? 649 PHE B CA    1 
ATOM   10015 C  C     . PHE B 1 649 ? -21.051 20.236  47.254  1.00 41.55  ? 649 PHE B C     1 
ATOM   10016 O  O     . PHE B 1 649 ? -20.289 20.398  48.202  1.00 40.99  ? 649 PHE B O     1 
ATOM   10017 C  CB    . PHE B 1 649 ? -20.542 21.396  45.134  1.00 46.31  ? 649 PHE B CB    1 
ATOM   10018 C  CG    . PHE B 1 649 ? -20.731 22.560  44.226  1.00 49.10  ? 649 PHE B CG    1 
ATOM   10019 C  CD1   . PHE B 1 649 ? -19.816 23.603  44.220  1.00 50.57  ? 649 PHE B CD1   1 
ATOM   10020 C  CD2   . PHE B 1 649 ? -21.828 22.620  43.374  1.00 52.20  ? 649 PHE B CD2   1 
ATOM   10021 C  CE1   . PHE B 1 649 ? -19.990 24.701  43.380  1.00 51.81  ? 649 PHE B CE1   1 
ATOM   10022 C  CE2   . PHE B 1 649 ? -22.021 23.715  42.526  1.00 53.50  ? 649 PHE B CE2   1 
ATOM   10023 C  CZ    . PHE B 1 649 ? -21.094 24.759  42.528  1.00 53.86  ? 649 PHE B CZ    1 
ATOM   10024 N  N     . PRO B 1 650 ? -21.577 19.040  46.968  1.00 40.29  ? 650 PRO B N     1 
ATOM   10025 C  CA    . PRO B 1 650 ? -21.267 17.829  47.732  1.00 39.21  ? 650 PRO B CA    1 
ATOM   10026 C  C     . PRO B 1 650 ? -19.922 17.300  47.275  1.00 38.00  ? 650 PRO B C     1 
ATOM   10027 O  O     . PRO B 1 650 ? -19.506 17.560  46.158  1.00 35.81  ? 650 PRO B O     1 
ATOM   10028 C  CB    . PRO B 1 650 ? -22.388 16.877  47.346  1.00 40.50  ? 650 PRO B CB    1 
ATOM   10029 C  CG    . PRO B 1 650 ? -23.516 17.816  46.998  1.00 41.38  ? 650 PRO B CG    1 
ATOM   10030 C  CD    . PRO B 1 650 ? -22.812 18.856  46.194  1.00 40.30  ? 650 PRO B CD    1 
ATOM   10031 N  N     . ARG B 1 651 ? -19.249 16.547  48.134  1.00 38.70  ? 651 ARG B N     1 
ATOM   10032 C  CA    . ARG B 1 651 ? -17.948 15.991  47.783  1.00 38.37  ? 651 ARG B CA    1 
ATOM   10033 C  C     . ARG B 1 651 ? -18.096 14.880  46.744  1.00 37.48  ? 651 ARG B C     1 
ATOM   10034 O  O     . ARG B 1 651 ? -17.194 14.652  45.932  1.00 36.02  ? 651 ARG B O     1 
ATOM   10035 C  CB    . ARG B 1 651 ? -17.236 15.450  49.035  1.00 39.21  ? 651 ARG B CB    1 
ATOM   10036 C  CG    . ARG B 1 651 ? -15.825 14.932  48.757  1.00 40.54  ? 651 ARG B CG    1 
ATOM   10037 C  CD    . ARG B 1 651 ? -15.017 14.763  50.016  1.00 42.23  ? 651 ARG B CD    1 
ATOM   10038 N  NE    . ARG B 1 651 ? -15.593 13.746  50.883  1.00 46.67  ? 651 ARG B NE    1 
ATOM   10039 C  CZ    . ARG B 1 651 ? -14.974 12.623  51.238  1.00 47.12  ? 651 ARG B CZ    1 
ATOM   10040 N  NH1   . ARG B 1 651 ? -13.749 12.373  50.804  1.00 46.88  ? 651 ARG B NH1   1 
ATOM   10041 N  NH2   . ARG B 1 651 ? -15.592 11.737  52.014  1.00 48.81  ? 651 ARG B NH2   1 
ATOM   10042 N  N     . LEU B 1 652 ? -19.241 14.199  46.764  1.00 36.88  ? 652 LEU B N     1 
ATOM   10043 C  CA    . LEU B 1 652 ? -19.487 13.117  45.823  1.00 36.00  ? 652 LEU B CA    1 
ATOM   10044 C  C     . LEU B 1 652 ? -20.321 13.509  44.619  1.00 36.51  ? 652 LEU B C     1 
ATOM   10045 O  O     . LEU B 1 652 ? -20.967 14.558  44.600  1.00 37.18  ? 652 LEU B O     1 
ATOM   10046 C  CB    . LEU B 1 652 ? -20.199 11.963  46.507  1.00 34.46  ? 652 LEU B CB    1 
ATOM   10047 C  CG    . LEU B 1 652 ? -19.493 11.344  47.685  1.00 33.39  ? 652 LEU B CG    1 
ATOM   10048 C  CD1   . LEU B 1 652 ? -19.864 12.122  48.934  1.00 33.71  ? 652 LEU B CD1   1 
ATOM   10049 C  CD2   . LEU B 1 652 ? -19.902 9.903   47.793  1.00 33.52  ? 652 LEU B CD2   1 
ATOM   10050 N  N     . PRO B 1 653 ? -20.307 12.658  43.584  1.00 36.67  ? 653 PRO B N     1 
ATOM   10051 C  CA    . PRO B 1 653 ? -21.079 12.909  42.368  1.00 37.34  ? 653 PRO B CA    1 
ATOM   10052 C  C     . PRO B 1 653 ? -22.573 12.829  42.687  1.00 38.78  ? 653 PRO B C     1 
ATOM   10053 O  O     . PRO B 1 653 ? -23.020 11.884  43.348  1.00 37.57  ? 653 PRO B O     1 
ATOM   10054 C  CB    . PRO B 1 653 ? -20.641 11.777  41.445  1.00 35.91  ? 653 PRO B CB    1 
ATOM   10055 C  CG    . PRO B 1 653 ? -19.251 11.523  41.867  1.00 34.42  ? 653 PRO B CG    1 
ATOM   10056 C  CD    . PRO B 1 653 ? -19.342 11.565  43.367  1.00 34.93  ? 653 PRO B CD    1 
ATOM   10057 N  N     . ALA B 1 654 ? -23.333 13.819  42.218  1.00 40.69  ? 654 ALA B N     1 
ATOM   10058 C  CA    . ALA B 1 654 ? -24.783 13.861  42.429  1.00 41.15  ? 654 ALA B CA    1 
ATOM   10059 C  C     . ALA B 1 654 ? -25.399 12.459  42.441  1.00 41.25  ? 654 ALA B C     1 
ATOM   10060 O  O     . ALA B 1 654 ? -26.126 12.102  43.367  1.00 41.65  ? 654 ALA B O     1 
ATOM   10061 C  CB    . ALA B 1 654 ? -25.448 14.711  41.350  1.00 40.82  ? 654 ALA B CB    1 
ATOM   10062 N  N     . PRO B 1 655 ? -25.115 11.642  41.413  1.00 41.04  ? 655 PRO B N     1 
ATOM   10063 C  CA    . PRO B 1 655 ? -25.674 10.284  41.372  1.00 41.20  ? 655 PRO B CA    1 
ATOM   10064 C  C     . PRO B 1 655 ? -25.495 9.505   42.695  1.00 41.57  ? 655 PRO B C     1 
ATOM   10065 O  O     . PRO B 1 655 ? -26.407 8.799   43.138  1.00 42.09  ? 655 PRO B O     1 
ATOM   10066 C  CB    . PRO B 1 655 ? -24.905 9.639   40.227  1.00 40.85  ? 655 PRO B CB    1 
ATOM   10067 C  CG    . PRO B 1 655 ? -24.622 10.778  39.325  1.00 40.26  ? 655 PRO B CG    1 
ATOM   10068 C  CD    . PRO B 1 655 ? -24.232 11.880  40.258  1.00 39.46  ? 655 PRO B CD    1 
ATOM   10069 N  N     . LEU B 1 656 ? -24.316 9.633   43.306  1.00 39.74  ? 656 LEU B N     1 
ATOM   10070 C  CA    . LEU B 1 656 ? -24.017 8.950   44.553  1.00 37.86  ? 656 LEU B CA    1 
ATOM   10071 C  C     . LEU B 1 656 ? -24.535 9.727   45.740  1.00 38.48  ? 656 LEU B C     1 
ATOM   10072 O  O     . LEU B 1 656 ? -25.045 9.155   46.702  1.00 40.81  ? 656 LEU B O     1 
ATOM   10073 C  CB    . LEU B 1 656 ? -22.517 8.760   44.717  1.00 36.21  ? 656 LEU B CB    1 
ATOM   10074 C  CG    . LEU B 1 656 ? -21.932 7.628   43.896  1.00 36.35  ? 656 LEU B CG    1 
ATOM   10075 C  CD1   . LEU B 1 656 ? -20.435 7.599   44.063  1.00 35.52  ? 656 LEU B CD1   1 
ATOM   10076 C  CD2   . LEU B 1 656 ? -22.555 6.322   44.338  1.00 36.37  ? 656 LEU B CD2   1 
ATOM   10077 N  N     . HIS B 1 657 ? -24.404 11.039  45.683  1.00 37.18  ? 657 HIS B N     1 
ATOM   10078 C  CA    . HIS B 1 657 ? -24.856 11.852  46.792  1.00 36.67  ? 657 HIS B CA    1 
ATOM   10079 C  C     . HIS B 1 657 ? -26.367 11.769  46.963  1.00 38.44  ? 657 HIS B C     1 
ATOM   10080 O  O     . HIS B 1 657 ? -26.880 11.907  48.065  1.00 37.98  ? 657 HIS B O     1 
ATOM   10081 C  CB    . HIS B 1 657 ? -24.435 13.291  46.575  1.00 34.18  ? 657 HIS B CB    1 
ATOM   10082 C  CG    . HIS B 1 657 ? -24.823 14.191  47.685  1.00 32.55  ? 657 HIS B CG    1 
ATOM   10083 N  ND1   . HIS B 1 657 ? -24.287 14.082  48.951  1.00 33.21  ? 657 HIS B ND1   1 
ATOM   10084 C  CD2   . HIS B 1 657 ? -25.721 15.197  47.749  1.00 34.68  ? 657 HIS B CD2   1 
ATOM   10085 C  CE1   . HIS B 1 657 ? -24.840 14.981  49.739  1.00 33.70  ? 657 HIS B CE1   1 
ATOM   10086 N  NE2   . HIS B 1 657 ? -25.718 15.676  49.033  1.00 33.32  ? 657 HIS B NE2   1 
ATOM   10087 N  N     . LEU B 1 658 ? -27.065 11.531  45.857  1.00 41.36  ? 658 LEU B N     1 
ATOM   10088 C  CA    . LEU B 1 658 ? -28.523 11.426  45.834  1.00 42.85  ? 658 LEU B CA    1 
ATOM   10089 C  C     . LEU B 1 658 ? -29.009 10.060  46.287  1.00 44.54  ? 658 LEU B C     1 
ATOM   10090 O  O     . LEU B 1 658 ? -30.027 9.944   46.979  1.00 43.72  ? 658 LEU B O     1 
ATOM   10091 C  CB    . LEU B 1 658 ? -29.031 11.679  44.424  1.00 41.12  ? 658 LEU B CB    1 
ATOM   10092 C  CG    . LEU B 1 658 ? -28.998 13.127  43.989  1.00 39.37  ? 658 LEU B CG    1 
ATOM   10093 C  CD1   . LEU B 1 658 ? -28.927 13.206  42.483  1.00 39.48  ? 658 LEU B CD1   1 
ATOM   10094 C  CD2   . LEU B 1 658 ? -30.228 13.811  44.529  1.00 40.99  ? 658 LEU B CD2   1 
ATOM   10095 N  N     . ALA B 1 659 ? -28.296 9.025   45.865  1.00 46.57  ? 659 ALA B N     1 
ATOM   10096 C  CA    . ALA B 1 659 ? -28.659 7.676   46.252  1.00 50.59  ? 659 ALA B CA    1 
ATOM   10097 C  C     . ALA B 1 659 ? -28.520 7.569   47.768  1.00 52.79  ? 659 ALA B C     1 
ATOM   10098 O  O     . ALA B 1 659 ? -29.337 6.940   48.441  1.00 53.65  ? 659 ALA B O     1 
ATOM   10099 C  CB    . ALA B 1 659 ? -27.759 6.671   45.559  1.00 51.05  ? 659 ALA B CB    1 
ATOM   10100 N  N     . ASP B 1 660 ? -27.483 8.198   48.305  1.00 54.57  ? 660 ASP B N     1 
ATOM   10101 C  CA    . ASP B 1 660 ? -27.261 8.186   49.737  1.00 56.46  ? 660 ASP B CA    1 
ATOM   10102 C  C     . ASP B 1 660 ? -28.489 8.740   50.468  1.00 57.04  ? 660 ASP B C     1 
ATOM   10103 O  O     . ASP B 1 660 ? -28.880 8.221   51.513  1.00 57.45  ? 660 ASP B O     1 
ATOM   10104 C  CB    . ASP B 1 660 ? -26.023 9.016   50.061  1.00 58.28  ? 660 ASP B CB    1 
ATOM   10105 C  CG    . ASP B 1 660 ? -25.871 9.282   51.536  1.00 60.92  ? 660 ASP B CG    1 
ATOM   10106 O  OD1   . ASP B 1 660 ? -25.914 8.304   52.321  1.00 62.88  ? 660 ASP B OD1   1 
ATOM   10107 O  OD2   . ASP B 1 660 ? -25.705 10.471  51.899  1.00 60.61  ? 660 ASP B OD2   1 
ATOM   10108 N  N     . ARG B 1 661 ? -29.100 9.786   49.916  1.00 57.25  ? 661 ARG B N     1 
ATOM   10109 C  CA    . ARG B 1 661 ? -30.280 10.375  50.538  1.00 57.56  ? 661 ARG B CA    1 
ATOM   10110 C  C     . ARG B 1 661 ? -31.476 9.484   50.250  1.00 57.52  ? 661 ARG B C     1 
ATOM   10111 O  O     . ARG B 1 661 ? -32.283 9.209   51.132  1.00 56.92  ? 661 ARG B O     1 
ATOM   10112 C  CB    . ARG B 1 661 ? -30.555 11.778  49.996  1.00 58.14  ? 661 ARG B CB    1 
ATOM   10113 C  CG    . ARG B 1 661 ? -29.312 12.561  49.621  1.00 61.17  ? 661 ARG B CG    1 
ATOM   10114 C  CD    . ARG B 1 661 ? -28.375 12.795  50.788  1.00 61.26  ? 661 ARG B CD    1 
ATOM   10115 N  NE    . ARG B 1 661 ? -28.736 13.993  51.530  1.00 63.49  ? 661 ARG B NE    1 
ATOM   10116 C  CZ    . ARG B 1 661 ? -27.924 14.605  52.385  1.00 65.62  ? 661 ARG B CZ    1 
ATOM   10117 N  NH1   . ARG B 1 661 ? -26.703 14.125  52.601  1.00 66.43  ? 661 ARG B NH1   1 
ATOM   10118 N  NH2   . ARG B 1 661 ? -28.330 15.703  53.014  1.00 65.59  ? 661 ARG B NH2   1 
ATOM   10119 N  N     . LEU B 1 662 ? -31.595 9.021   49.014  1.00 58.29  ? 662 LEU B N     1 
ATOM   10120 C  CA    . LEU B 1 662 ? -32.717 8.149   48.676  1.00 58.94  ? 662 LEU B CA    1 
ATOM   10121 C  C     . LEU B 1 662 ? -32.844 7.014   49.695  1.00 58.59  ? 662 LEU B C     1 
ATOM   10122 O  O     . LEU B 1 662 ? -33.951 6.619   50.064  1.00 58.34  ? 662 LEU B O     1 
ATOM   10123 C  CB    . LEU B 1 662 ? -32.549 7.553   47.273  1.00 59.43  ? 662 LEU B CB    1 
ATOM   10124 C  CG    . LEU B 1 662 ? -33.682 6.616   46.817  1.00 59.29  ? 662 LEU B CG    1 
ATOM   10125 C  CD1   . LEU B 1 662 ? -35.018 7.352   46.884  1.00 58.40  ? 662 LEU B CD1   1 
ATOM   10126 C  CD2   . LEU B 1 662 ? -33.414 6.112   45.400  1.00 58.80  ? 662 LEU B CD2   1 
ATOM   10127 N  N     . VAL B 1 663 ? -31.704 6.499   50.146  1.00 57.61  ? 663 VAL B N     1 
ATOM   10128 C  CA    . VAL B 1 663 ? -31.685 5.412   51.114  1.00 56.93  ? 663 VAL B CA    1 
ATOM   10129 C  C     . VAL B 1 663 ? -31.968 5.933   52.517  1.00 56.60  ? 663 VAL B C     1 
ATOM   10130 O  O     . VAL B 1 663 ? -32.844 5.434   53.210  1.00 55.65  ? 663 VAL B O     1 
ATOM   10131 C  CB    . VAL B 1 663 ? -30.317 4.687   51.100  1.00 56.65  ? 663 VAL B CB    1 
ATOM   10132 C  CG1   . VAL B 1 663 ? -30.289 3.607   52.138  1.00 57.34  ? 663 VAL B CG1   1 
ATOM   10133 C  CG2   . VAL B 1 663 ? -30.076 4.070   49.751  1.00 57.60  ? 663 VAL B CG2   1 
ATOM   10134 N  N     . LYS B 1 664 ? -31.226 6.951   52.927  1.00 57.41  ? 664 LYS B N     1 
ATOM   10135 C  CA    . LYS B 1 664 ? -31.402 7.523   54.249  1.00 58.72  ? 664 LYS B CA    1 
ATOM   10136 C  C     . LYS B 1 664 ? -32.829 8.024   54.513  1.00 60.02  ? 664 LYS B C     1 
ATOM   10137 O  O     . LYS B 1 664 ? -33.515 7.509   55.392  1.00 61.03  ? 664 LYS B O     1 
ATOM   10138 C  CB    . LYS B 1 664 ? -30.386 8.657   54.472  1.00 56.06  ? 664 LYS B CB    1 
ATOM   10139 N  N     . GLU B 1 665 ? -33.288 9.016   53.761  1.00 61.38  ? 665 GLU B N     1 
ATOM   10140 C  CA    . GLU B 1 665 ? -34.622 9.552   53.998  1.00 62.71  ? 665 GLU B CA    1 
ATOM   10141 C  C     . GLU B 1 665 ? -35.736 8.553   53.735  1.00 62.49  ? 665 GLU B C     1 
ATOM   10142 O  O     . GLU B 1 665 ? -36.884 8.818   54.073  1.00 62.60  ? 665 GLU B O     1 
ATOM   10143 C  CB    . GLU B 1 665 ? -34.864 10.825  53.172  1.00 65.49  ? 665 GLU B CB    1 
ATOM   10144 C  CG    . GLU B 1 665 ? -34.008 12.046  53.578  1.00 69.37  ? 665 GLU B CG    1 
ATOM   10145 C  CD    . GLU B 1 665 ? -32.591 12.021  52.994  1.00 71.59  ? 665 GLU B CD    1 
ATOM   10146 O  OE1   . GLU B 1 665 ? -32.254 11.049  52.294  1.00 73.48  ? 665 GLU B OE1   1 
ATOM   10147 O  OE2   . GLU B 1 665 ? -31.812 12.973  53.227  1.00 72.03  ? 665 GLU B OE2   1 
ATOM   10148 N  N     . VAL B 1 666 ? -35.409 7.411   53.132  1.00 62.65  ? 666 VAL B N     1 
ATOM   10149 C  CA    . VAL B 1 666 ? -36.422 6.384   52.860  1.00 62.91  ? 666 VAL B CA    1 
ATOM   10150 C  C     . VAL B 1 666 ? -36.564 5.533   54.112  1.00 63.49  ? 666 VAL B C     1 
ATOM   10151 O  O     . VAL B 1 666 ? -37.656 5.358   54.640  1.00 64.23  ? 666 VAL B O     1 
ATOM   10152 C  CB    . VAL B 1 666 ? -36.011 5.509   51.675  1.00 61.42  ? 666 VAL B CB    1 
ATOM   10153 N  N     . GLY B 1 667 ? -35.445 5.002   54.588  1.00 64.46  ? 667 GLY B N     1 
ATOM   10154 C  CA    . GLY B 1 667 ? -35.477 4.204   55.794  1.00 64.17  ? 667 GLY B CA    1 
ATOM   10155 C  C     . GLY B 1 667 ? -36.028 5.032   56.938  1.00 65.04  ? 667 GLY B C     1 
ATOM   10156 O  O     . GLY B 1 667 ? -36.502 4.475   57.914  1.00 65.41  ? 667 GLY B O     1 
ATOM   10157 N  N     . ARG B 1 668 ? -35.963 6.359   56.828  1.00 65.95  ? 668 ARG B N     1 
ATOM   10158 C  CA    . ARG B 1 668 ? -36.481 7.244   57.868  1.00 66.82  ? 668 ARG B CA    1 
ATOM   10159 C  C     . ARG B 1 668 ? -38.005 7.233   57.840  1.00 68.89  ? 668 ARG B C     1 
ATOM   10160 O  O     . ARG B 1 668 ? -38.664 7.149   58.874  1.00 69.56  ? 668 ARG B O     1 
ATOM   10161 C  CB    . ARG B 1 668 ? -36.006 8.683   57.659  1.00 65.86  ? 668 ARG B CB    1 
ATOM   10162 C  CG    . ARG B 1 668 ? -34.535 8.950   57.921  1.00 66.11  ? 668 ARG B CG    1 
ATOM   10163 C  CD    . ARG B 1 668 ? -34.378 10.344  58.522  1.00 67.14  ? 668 ARG B CD    1 
ATOM   10164 N  NE    . ARG B 1 668 ? -32.996 10.816  58.574  1.00 68.74  ? 668 ARG B NE    1 
ATOM   10165 C  CZ    . ARG B 1 668 ? -32.306 11.226  57.513  1.00 69.12  ? 668 ARG B CZ    1 
ATOM   10166 N  NH1   . ARG B 1 668 ? -32.871 11.221  56.312  1.00 69.11  ? 668 ARG B NH1   1 
ATOM   10167 N  NH2   . ARG B 1 668 ? -31.057 11.655  57.655  1.00 68.45  ? 668 ARG B NH2   1 
ATOM   10168 N  N     . LEU B 1 669 ? -38.560 7.319   56.640  1.00 71.27  ? 669 LEU B N     1 
ATOM   10169 C  CA    . LEU B 1 669 ? -40.005 7.330   56.459  1.00 72.96  ? 669 LEU B CA    1 
ATOM   10170 C  C     . LEU B 1 669 ? -40.630 5.951   56.692  1.00 74.42  ? 669 LEU B C     1 
ATOM   10171 O  O     . LEU B 1 669 ? -41.847 5.831   56.838  1.00 74.82  ? 669 LEU B O     1 
ATOM   10172 C  CB    . LEU B 1 669 ? -40.345 7.834   55.049  1.00 71.73  ? 669 LEU B CB    1 
ATOM   10173 N  N     . GLY B 1 670 ? -39.802 4.911   56.737  1.00 75.82  ? 670 GLY B N     1 
ATOM   10174 C  CA    . GLY B 1 670 ? -40.333 3.576   56.940  1.00 78.01  ? 670 GLY B CA    1 
ATOM   10175 C  C     . GLY B 1 670 ? -40.926 3.050   55.647  1.00 79.76  ? 670 GLY B C     1 
ATOM   10176 O  O     . GLY B 1 670 ? -41.181 1.853   55.506  1.00 79.56  ? 670 GLY B O     1 
ATOM   10177 N  N     . ILE B 1 671 ? -41.161 3.957   54.703  1.00 81.86  ? 671 ILE B N     1 
ATOM   10178 C  CA    . ILE B 1 671 ? -41.703 3.588   53.400  1.00 83.64  ? 671 ILE B CA    1 
ATOM   10179 C  C     . ILE B 1 671 ? -40.566 2.912   52.652  1.00 84.48  ? 671 ILE B C     1 
ATOM   10180 O  O     . ILE B 1 671 ? -39.462 3.441   52.585  1.00 85.42  ? 671 ILE B O     1 
ATOM   10181 C  CB    . ILE B 1 671 ? -42.165 4.832   52.637  1.00 82.08  ? 671 ILE B CB    1 
ATOM   10182 N  N     . ARG B 1 672 ? -40.818 1.736   52.103  1.00 85.28  ? 672 ARG B N     1 
ATOM   10183 C  CA    . ARG B 1 672 ? -39.771 1.048   51.378  1.00 86.56  ? 672 ARG B CA    1 
ATOM   10184 C  C     . ARG B 1 672 ? -40.344 0.548   50.071  1.00 87.88  ? 672 ARG B C     1 
ATOM   10185 O  O     . ARG B 1 672 ? -39.663 0.531   49.043  1.00 88.09  ? 672 ARG B O     1 
ATOM   10186 C  CB    . ARG B 1 672 ? -39.239 -0.120  52.204  1.00 86.09  ? 672 ARG B CB    1 
ATOM   10187 N  N     . HIS B 1 673 ? -41.618 0.174   50.112  1.00 88.83  ? 673 HIS B N     1 
ATOM   10188 C  CA    . HIS B 1 673 ? -42.285 -0.374  48.944  1.00 89.71  ? 673 HIS B CA    1 
ATOM   10189 C  C     . HIS B 1 673 ? -43.265 0.544   48.210  1.00 90.19  ? 673 HIS B C     1 
ATOM   10190 O  O     . HIS B 1 673 ? -43.965 0.077   47.308  1.00 91.55  ? 673 HIS B O     1 
ATOM   10191 C  CB    . HIS B 1 673 ? -42.995 -1.673  49.339  1.00 89.35  ? 673 HIS B CB    1 
ATOM   10192 N  N     . LEU B 1 674 ? -43.323 1.829   48.565  1.00 89.19  ? 674 LEU B N     1 
ATOM   10193 C  CA    . LEU B 1 674 ? -44.260 2.750   47.901  1.00 87.86  ? 674 LEU B CA    1 
ATOM   10194 C  C     . LEU B 1 674 ? -43.607 3.700   46.886  1.00 86.43  ? 674 LEU B C     1 
ATOM   10195 O  O     . LEU B 1 674 ? -42.598 4.339   47.173  1.00 85.61  ? 674 LEU B O     1 
ATOM   10196 C  CB    . LEU B 1 674 ? -45.043 3.556   48.956  1.00 87.77  ? 674 LEU B CB    1 
ATOM   10197 N  N     . LYS B 1 675 ? -44.201 3.809   45.702  1.00 84.87  ? 675 LYS B N     1 
ATOM   10198 C  CA    . LYS B 1 675 ? -43.639 4.668   44.675  1.00 84.53  ? 675 LYS B CA    1 
ATOM   10199 C  C     . LYS B 1 675 ? -44.607 5.110   43.590  1.00 85.07  ? 675 LYS B C     1 
ATOM   10200 O  O     . LYS B 1 675 ? -44.297 5.023   42.398  1.00 85.63  ? 675 LYS B O     1 
ATOM   10201 C  CB    . LYS B 1 675 ? -42.439 3.972   44.036  1.00 84.26  ? 675 LYS B CB    1 
ATOM   10202 C  CG    . LYS B 1 675 ? -42.638 2.479   43.813  1.00 82.86  ? 675 LYS B CG    1 
ATOM   10203 C  CD    . LYS B 1 675 ? -41.344 1.816   43.381  1.00 81.22  ? 675 LYS B CD    1 
ATOM   10204 C  CE    . LYS B 1 675 ? -41.411 0.313   43.554  1.00 80.22  ? 675 LYS B CE    1 
ATOM   10205 N  NZ    . LYS B 1 675 ? -40.103 -0.319  43.245  1.00 78.83  ? 675 LYS B NZ    1 
ATOM   10206 N  N     . GLU B 1 676 ? -45.780 5.581   44.006  1.00 85.24  ? 676 GLU B N     1 
ATOM   10207 C  CA    . GLU B 1 676 ? -46.788 6.082   43.075  1.00 84.96  ? 676 GLU B CA    1 
ATOM   10208 C  C     . GLU B 1 676 ? -46.380 7.507   42.698  1.00 83.98  ? 676 GLU B C     1 
ATOM   10209 O  O     . GLU B 1 676 ? -47.038 8.166   41.886  1.00 83.66  ? 676 GLU B O     1 
ATOM   10210 C  CB    . GLU B 1 676 ? -48.170 6.091   43.734  1.00 86.28  ? 676 GLU B CB    1 
ATOM   10211 C  CG    . GLU B 1 676 ? -48.234 6.763   45.112  1.00 88.63  ? 676 GLU B CG    1 
ATOM   10212 C  CD    . GLU B 1 676 ? -47.560 5.941   46.214  1.00 90.33  ? 676 GLU B CD    1 
ATOM   10213 O  OE1   . GLU B 1 676 ? -47.350 4.724   46.009  1.00 90.98  ? 676 GLU B OE1   1 
ATOM   10214 O  OE2   . GLU B 1 676 ? -47.252 6.503   47.292  1.00 90.39  ? 676 GLU B OE2   1 
ATOM   10215 N  N     . VAL B 1 677 ? -45.278 7.957   43.303  1.00 82.35  ? 677 VAL B N     1 
ATOM   10216 C  CA    . VAL B 1 677 ? -44.707 9.287   43.086  1.00 79.49  ? 677 VAL B CA    1 
ATOM   10217 C  C     . VAL B 1 677 ? -43.788 9.307   41.851  1.00 77.01  ? 677 VAL B C     1 
ATOM   10218 O  O     . VAL B 1 677 ? -43.048 8.348   41.593  1.00 76.29  ? 677 VAL B O     1 
ATOM   10219 C  CB    . VAL B 1 677 ? -43.892 9.733   44.322  1.00 79.87  ? 677 VAL B CB    1 
ATOM   10220 C  CG1   . VAL B 1 677 ? -43.627 11.226  44.263  1.00 80.46  ? 677 VAL B CG1   1 
ATOM   10221 C  CG2   . VAL B 1 677 ? -44.638 9.368   45.593  1.00 79.75  ? 677 VAL B CG2   1 
ATOM   10222 N  N     . ASP B 1 678 ? -43.845 10.406  41.100  1.00 73.77  ? 678 ASP B N     1 
ATOM   10223 C  CA    . ASP B 1 678 ? -43.048 10.576  39.885  1.00 70.59  ? 678 ASP B CA    1 
ATOM   10224 C  C     . ASP B 1 678 ? -41.554 10.497  40.167  1.00 67.99  ? 678 ASP B C     1 
ATOM   10225 O  O     . ASP B 1 678 ? -41.086 10.961  41.200  1.00 68.23  ? 678 ASP B O     1 
ATOM   10226 C  CB    . ASP B 1 678 ? -43.393 11.916  39.225  1.00 71.44  ? 678 ASP B CB    1 
ATOM   10227 C  CG    . ASP B 1 678 ? -42.527 12.215  38.015  1.00 71.69  ? 678 ASP B CG    1 
ATOM   10228 O  OD1   . ASP B 1 678 ? -42.379 11.320  37.155  1.00 71.92  ? 678 ASP B OD1   1 
ATOM   10229 O  OD2   . ASP B 1 678 ? -42.003 13.349  37.919  1.00 71.36  ? 678 ASP B OD2   1 
ATOM   10230 N  N     . ARG B 1 679 ? -40.804 9.930   39.231  1.00 65.06  ? 679 ARG B N     1 
ATOM   10231 C  CA    . ARG B 1 679 ? -39.365 9.769   39.401  1.00 63.10  ? 679 ARG B CA    1 
ATOM   10232 C  C     . ARG B 1 679 ? -38.478 10.990  39.203  1.00 61.10  ? 679 ARG B C     1 
ATOM   10233 O  O     . ARG B 1 679 ? -37.289 10.934  39.512  1.00 60.83  ? 679 ARG B O     1 
ATOM   10234 C  CB    . ARG B 1 679 ? -38.875 8.655   38.494  1.00 64.02  ? 679 ARG B CB    1 
ATOM   10235 C  CG    . ARG B 1 679 ? -39.664 7.400   38.692  1.00 65.10  ? 679 ARG B CG    1 
ATOM   10236 C  CD    . ARG B 1 679 ? -38.966 6.211   38.108  1.00 65.17  ? 679 ARG B CD    1 
ATOM   10237 N  NE    . ARG B 1 679 ? -39.113 5.096   39.025  1.00 65.03  ? 679 ARG B NE    1 
ATOM   10238 C  CZ    . ARG B 1 679 ? -38.650 3.875   38.809  1.00 65.33  ? 679 ARG B CZ    1 
ATOM   10239 N  NH1   . ARG B 1 679 ? -37.997 3.597   37.684  1.00 64.60  ? 679 ARG B NH1   1 
ATOM   10240 N  NH2   . ARG B 1 679 ? -38.844 2.942   39.735  1.00 63.91  ? 679 ARG B NH2   1 
ATOM   10241 N  N     . GLU B 1 680 ? -39.035 12.079  38.684  1.00 59.19  ? 680 GLU B N     1 
ATOM   10242 C  CA    . GLU B 1 680 ? -38.262 13.301  38.464  1.00 56.46  ? 680 GLU B CA    1 
ATOM   10243 C  C     . GLU B 1 680 ? -38.438 14.181  39.676  1.00 54.75  ? 680 GLU B C     1 
ATOM   10244 O  O     . GLU B 1 680 ? -37.827 15.239  39.786  1.00 53.36  ? 680 GLU B O     1 
ATOM   10245 C  CB    . GLU B 1 680 ? -38.750 14.028  37.219  1.00 57.46  ? 680 GLU B CB    1 
ATOM   10246 N  N     . LYS B 1 681 ? -39.303 13.729  40.574  1.00 54.03  ? 681 LYS B N     1 
ATOM   10247 C  CA    . LYS B 1 681 ? -39.590 14.436  41.805  1.00 54.28  ? 681 LYS B CA    1 
ATOM   10248 C  C     . LYS B 1 681 ? -38.652 13.874  42.863  1.00 54.07  ? 681 LYS B C     1 
ATOM   10249 O  O     . LYS B 1 681 ? -38.776 12.723  43.272  1.00 54.02  ? 681 LYS B O     1 
ATOM   10250 C  CB    . LYS B 1 681 ? -41.036 14.198  42.216  1.00 55.64  ? 681 LYS B CB    1 
ATOM   10251 C  CG    . LYS B 1 681 ? -42.073 14.635  41.198  1.00 56.35  ? 681 LYS B CG    1 
ATOM   10252 C  CD    . LYS B 1 681 ? -43.462 14.403  41.776  1.00 59.10  ? 681 LYS B CD    1 
ATOM   10253 C  CE    . LYS B 1 681 ? -44.565 14.939  40.884  1.00 60.65  ? 681 LYS B CE    1 
ATOM   10254 N  NZ    . LYS B 1 681 ? -45.918 14.790  41.512  1.00 61.65  ? 681 LYS B NZ    1 
ATOM   10255 N  N     . LEU B 1 682 ? -37.708 14.693  43.302  1.00 54.17  ? 682 LEU B N     1 
ATOM   10256 C  CA    . LEU B 1 682 ? -36.728 14.262  44.284  1.00 53.45  ? 682 LEU B CA    1 
ATOM   10257 C  C     . LEU B 1 682 ? -37.222 14.560  45.690  1.00 52.33  ? 682 LEU B C     1 
ATOM   10258 O  O     . LEU B 1 682 ? -36.716 15.445  46.377  1.00 53.03  ? 682 LEU B O     1 
ATOM   10259 C  CB    . LEU B 1 682 ? -35.393 14.970  44.013  1.00 55.06  ? 682 LEU B CB    1 
ATOM   10260 C  CG    . LEU B 1 682 ? -34.807 14.872  42.589  1.00 55.17  ? 682 LEU B CG    1 
ATOM   10261 C  CD1   . LEU B 1 682 ? -33.559 15.739  42.511  1.00 54.93  ? 682 LEU B CD1   1 
ATOM   10262 C  CD2   . LEU B 1 682 ? -34.473 13.420  42.225  1.00 54.48  ? 682 LEU B CD2   1 
ATOM   10263 N  N     . PHE B 1 683 ? -38.222 13.811  46.116  1.00 50.46  ? 683 PHE B N     1 
ATOM   10264 C  CA    . PHE B 1 683 ? -38.784 14.014  47.435  1.00 49.14  ? 683 PHE B CA    1 
ATOM   10265 C  C     . PHE B 1 683 ? -37.727 13.925  48.517  1.00 49.49  ? 683 PHE B C     1 
ATOM   10266 O  O     . PHE B 1 683 ? -37.758 14.693  49.478  1.00 50.43  ? 683 PHE B O     1 
ATOM   10267 C  CB    . PHE B 1 683 ? -39.859 12.970  47.727  1.00 46.39  ? 683 PHE B CB    1 
ATOM   10268 C  CG    . PHE B 1 683 ? -39.353 11.557  47.692  1.00 43.37  ? 683 PHE B CG    1 
ATOM   10269 C  CD1   . PHE B 1 683 ? -39.151 10.906  46.481  1.00 40.98  ? 683 PHE B CD1   1 
ATOM   10270 C  CD2   . PHE B 1 683 ? -39.056 10.883  48.868  1.00 41.81  ? 683 PHE B CD2   1 
ATOM   10271 C  CE1   . PHE B 1 683 ? -38.664 9.610   46.441  1.00 39.37  ? 683 PHE B CE1   1 
ATOM   10272 C  CE2   . PHE B 1 683 ? -38.567 9.585   48.829  1.00 41.05  ? 683 PHE B CE2   1 
ATOM   10273 C  CZ    . PHE B 1 683 ? -38.371 8.950   47.611  1.00 38.45  ? 683 PHE B CZ    1 
ATOM   10274 N  N     . PHE B 1 684 ? -36.783 13.004  48.343  1.00 49.06  ? 684 PHE B N     1 
ATOM   10275 C  CA    . PHE B 1 684 ? -35.751 12.759  49.340  1.00 48.92  ? 684 PHE B CA    1 
ATOM   10276 C  C     . PHE B 1 684 ? -34.657 13.796  49.601  1.00 49.68  ? 684 PHE B C     1 
ATOM   10277 O  O     . PHE B 1 684 ? -33.874 13.629  50.527  1.00 49.66  ? 684 PHE B O     1 
ATOM   10278 C  CB    . PHE B 1 684 ? -35.120 11.407  49.060  1.00 47.72  ? 684 PHE B CB    1 
ATOM   10279 C  CG    . PHE B 1 684 ? -34.521 11.303  47.706  1.00 47.71  ? 684 PHE B CG    1 
ATOM   10280 C  CD1   . PHE B 1 684 ? -33.177 11.631  47.496  1.00 48.69  ? 684 PHE B CD1   1 
ATOM   10281 C  CD2   . PHE B 1 684 ? -35.294 10.894  46.633  1.00 46.11  ? 684 PHE B CD2   1 
ATOM   10282 C  CE1   . PHE B 1 684 ? -32.616 11.555  46.226  1.00 48.84  ? 684 PHE B CE1   1 
ATOM   10283 C  CE2   . PHE B 1 684 ? -34.751 10.813  45.360  1.00 47.09  ? 684 PHE B CE2   1 
ATOM   10284 C  CZ    . PHE B 1 684 ? -33.408 11.141  45.150  1.00 48.45  ? 684 PHE B CZ    1 
ATOM   10285 N  N     . VAL B 1 685 ? -34.590 14.867  48.816  1.00 51.42  ? 685 VAL B N     1 
ATOM   10286 C  CA    . VAL B 1 685 ? -33.562 15.885  49.056  1.00 52.06  ? 685 VAL B CA    1 
ATOM   10287 C  C     . VAL B 1 685 ? -33.914 16.811  50.234  1.00 53.09  ? 685 VAL B C     1 
ATOM   10288 O  O     . VAL B 1 685 ? -34.877 16.488  50.973  1.00 53.21  ? 685 VAL B O     1 
ATOM   10289 C  CB    . VAL B 1 685 ? -33.290 16.743  47.787  1.00 50.30  ? 685 VAL B CB    1 
ATOM   10290 C  CG1   . VAL B 1 685 ? -32.800 15.855  46.686  1.00 51.19  ? 685 VAL B CG1   1 
ATOM   10291 C  CG2   . VAL B 1 685 ? -34.535 17.478  47.353  1.00 48.62  ? 685 VAL B CG2   1 
ATOM   10292 O  OXT   . VAL B 1 685 ? -33.212 17.839  50.414  1.00 53.08  ? 685 VAL B OXT   1 
ATOM   10293 O  OP3   . DT  C 2 1   ? 1.417   -15.751 5.490   1.00 66.65  ? 1   DT  X OP3   1 
ATOM   10294 P  P     . DT  C 2 1   ? 0.451   -16.201 6.587   1.00 65.10  ? 1   DT  X P     1 
ATOM   10295 O  OP1   . DT  C 2 1   ? 0.577   -15.399 7.862   1.00 64.78  ? 1   DT  X OP1   1 
ATOM   10296 O  OP2   . DT  C 2 1   ? -0.981  -16.294 6.111   1.00 64.73  ? 1   DT  X OP2   1 
ATOM   10297 O  "O5'" . DT  C 2 1   ? 0.862   -17.721 6.986   1.00 64.02  ? 1   DT  X "O5'" 1 
ATOM   10298 C  "C5'" . DT  C 2 1   ? 2.038   -18.332 6.439   1.00 64.73  ? 1   DT  X "C5'" 1 
ATOM   10299 C  "C4'" . DT  C 2 1   ? 1.666   -19.438 5.472   1.00 64.93  ? 1   DT  X "C4'" 1 
ATOM   10300 O  "O4'" . DT  C 2 1   ? 1.405   -18.930 4.151   1.00 66.91  ? 1   DT  X "O4'" 1 
ATOM   10301 C  "C3'" . DT  C 2 1   ? 2.749   -20.501 5.306   1.00 64.14  ? 1   DT  X "C3'" 1 
ATOM   10302 O  "O3'" . DT  C 2 1   ? 2.246   -21.688 5.928   1.00 57.39  ? 1   DT  X "O3'" 1 
ATOM   10303 C  "C2'" . DT  C 2 1   ? 2.855   -20.744 3.799   1.00 66.59  ? 1   DT  X "C2'" 1 
ATOM   10304 C  "C1'" . DT  C 2 1   ? 1.652   -19.977 3.261   1.00 68.29  ? 1   DT  X "C1'" 1 
ATOM   10305 N  N1    . DT  C 2 1   ? 1.701   -19.498 1.890   1.00 70.38  ? 1   DT  X N1    1 
ATOM   10306 C  C2    . DT  C 2 1   ? 0.905   -20.171 0.988   1.00 72.07  ? 1   DT  X C2    1 
ATOM   10307 O  O2    . DT  C 2 1   ? 0.215   -21.132 1.290   1.00 71.95  ? 1   DT  X O2    1 
ATOM   10308 N  N3    . DT  C 2 1   ? 0.947   -19.682 -0.286  1.00 74.44  ? 1   DT  X N3    1 
ATOM   10309 C  C4    . DT  C 2 1   ? 1.701   -18.621 -0.743  1.00 75.46  ? 1   DT  X C4    1 
ATOM   10310 O  O4    . DT  C 2 1   ? 1.627   -18.286 -1.923  1.00 76.60  ? 1   DT  X O4    1 
ATOM   10311 C  C5    . DT  C 2 1   ? 2.537   -17.978 0.257   1.00 74.62  ? 1   DT  X C5    1 
ATOM   10312 C  C7    . DT  C 2 1   ? 3.416   -16.842 -0.154  1.00 74.53  ? 1   DT  X C7    1 
ATOM   10313 C  C6    . DT  C 2 1   ? 2.488   -18.440 1.511   1.00 72.24  ? 1   DT  X C6    1 
ATOM   10314 P  P     . DG  C 2 2   ? 3.240   -22.842 6.417   1.00 53.14  ? 2   DG  X P     1 
ATOM   10315 O  OP1   . DG  C 2 2   ? 4.421   -22.899 5.526   1.00 51.78  ? 2   DG  X OP1   1 
ATOM   10316 O  OP2   . DG  C 2 2   ? 2.404   -24.050 6.611   1.00 52.74  ? 2   DG  X OP2   1 
ATOM   10317 O  "O5'" . DG  C 2 2   ? 3.743   -22.325 7.835   1.00 53.34  ? 2   DG  X "O5'" 1 
ATOM   10318 C  "C5'" . DG  C 2 2   ? 2.850   -21.668 8.741   1.00 51.02  ? 2   DG  X "C5'" 1 
ATOM   10319 C  "C4'" . DG  C 2 2   ? 3.591   -20.613 9.532   1.00 50.20  ? 2   DG  X "C4'" 1 
ATOM   10320 O  "O4'" . DG  C 2 2   ? 4.722   -21.249 10.171  1.00 50.79  ? 2   DG  X "O4'" 1 
ATOM   10321 C  "C3'" . DG  C 2 2   ? 4.169   -19.480 8.687   1.00 49.79  ? 2   DG  X "C3'" 1 
ATOM   10322 O  "O3'" . DG  C 2 2   ? 4.076   -18.221 9.353   1.00 50.40  ? 2   DG  X "O3'" 1 
ATOM   10323 C  "C2'" . DG  C 2 2   ? 5.619   -19.869 8.472   1.00 49.21  ? 2   DG  X "C2'" 1 
ATOM   10324 C  "C1'" . DG  C 2 2   ? 5.955   -20.749 9.661   1.00 49.14  ? 2   DG  X "C1'" 1 
ATOM   10325 N  N9    . DG  C 2 2   ? 6.757   -21.897 9.246   1.00 47.48  ? 2   DG  X N9    1 
ATOM   10326 C  C8    . DG  C 2 2   ? 6.678   -22.542 8.040   1.00 47.24  ? 2   DG  X C8    1 
ATOM   10327 N  N7    . DG  C 2 2   ? 7.534   -23.517 7.926   1.00 47.76  ? 2   DG  X N7    1 
ATOM   10328 C  C5    . DG  C 2 2   ? 8.208   -23.521 9.133   1.00 47.53  ? 2   DG  X C5    1 
ATOM   10329 C  C6    . DG  C 2 2   ? 9.237   -24.358 9.590   1.00 48.13  ? 2   DG  X C6    1 
ATOM   10330 O  O6    . DG  C 2 2   ? 9.773   -25.296 8.998   1.00 50.88  ? 2   DG  X O6    1 
ATOM   10331 N  N1    . DG  C 2 2   ? 9.640   -24.024 10.874  1.00 48.03  ? 2   DG  X N1    1 
ATOM   10332 C  C2    . DG  C 2 2   ? 9.112   -23.011 11.625  1.00 47.61  ? 2   DG  X C2    1 
ATOM   10333 N  N2    . DG  C 2 2   ? 9.647   -22.836 12.839  1.00 48.71  ? 2   DG  X N2    1 
ATOM   10334 N  N3    . DG  C 2 2   ? 8.136   -22.224 11.214  1.00 47.30  ? 2   DG  X N3    1 
ATOM   10335 C  C4    . DG  C 2 2   ? 7.739   -22.531 9.966   1.00 47.22  ? 2   DG  X C4    1 
ATOM   10336 P  P     . DA  C 2 3   ? 4.860   -16.958 8.750   1.00 49.18  ? 3   DA  X P     1 
ATOM   10337 O  OP1   . DA  C 2 3   ? 4.180   -15.693 9.127   1.00 45.31  ? 3   DA  X OP1   1 
ATOM   10338 O  OP2   . DA  C 2 3   ? 5.095   -17.264 7.316   1.00 49.36  ? 3   DA  X OP2   1 
ATOM   10339 O  "O5'" . DA  C 2 3   ? 6.253   -17.026 9.517   1.00 47.88  ? 3   DA  X "O5'" 1 
ATOM   10340 C  "C5'" . DA  C 2 3   ? 6.288   -17.058 10.938  1.00 45.49  ? 3   DA  X "C5'" 1 
ATOM   10341 C  "C4'" . DA  C 2 3   ? 7.706   -16.909 11.430  1.00 43.78  ? 3   DA  X "C4'" 1 
ATOM   10342 O  "O4'" . DA  C 2 3   ? 8.351   -18.205 11.390  1.00 42.59  ? 3   DA  X "O4'" 1 
ATOM   10343 C  "C3'" . DA  C 2 3   ? 8.562   -15.965 10.587  1.00 43.54  ? 3   DA  X "C3'" 1 
ATOM   10344 O  "O3'" . DA  C 2 3   ? 8.987   -14.802 11.281  1.00 45.03  ? 3   DA  X "O3'" 1 
ATOM   10345 C  "C2'" . DA  C 2 3   ? 9.778   -16.782 10.187  1.00 42.89  ? 3   DA  X "C2'" 1 
ATOM   10346 C  "C1'" . DA  C 2 3   ? 9.687   -18.096 10.936  1.00 39.88  ? 3   DA  X "C1'" 1 
ATOM   10347 N  N9    . DA  C 2 3   ? 9.927   -19.179 9.978   1.00 37.15  ? 3   DA  X N9    1 
ATOM   10348 C  C8    . DA  C 2 3   ? 9.384   -19.228 8.725   1.00 36.79  ? 3   DA  X C8    1 
ATOM   10349 N  N7    . DA  C 2 3   ? 9.818   -20.228 7.998   1.00 37.11  ? 3   DA  X N7    1 
ATOM   10350 C  C5    . DA  C 2 3   ? 10.682  -20.897 8.835   1.00 37.21  ? 3   DA  X C5    1 
ATOM   10351 C  C6    . DA  C 2 3   ? 11.475  -22.037 8.647   1.00 36.59  ? 3   DA  X C6    1 
ATOM   10352 N  N6    . DA  C 2 3   ? 11.540  -22.701 7.489   1.00 36.18  ? 3   DA  X N6    1 
ATOM   10353 N  N1    . DA  C 2 3   ? 12.215  -22.468 9.687   1.00 35.87  ? 3   DA  X N1    1 
ATOM   10354 C  C2    . DA  C 2 3   ? 12.170  -21.775 10.840  1.00 36.35  ? 3   DA  X C2    1 
ATOM   10355 N  N3    . DA  C 2 3   ? 11.481  -20.676 11.135  1.00 36.67  ? 3   DA  X N3    1 
ATOM   10356 C  C4    . DA  C 2 3   ? 10.750  -20.281 10.084  1.00 37.48  ? 3   DA  X C4    1 
ATOM   10357 P  P     . DG  C 2 4   ? 9.692   -13.613 10.456  1.00 46.32  ? 4   DG  X P     1 
ATOM   10358 O  OP1   . DG  C 2 4   ? 9.256   -12.324 11.070  1.00 43.79  ? 4   DG  X OP1   1 
ATOM   10359 O  OP2   . DG  C 2 4   ? 9.489   -13.841 9.004   1.00 44.22  ? 4   DG  X OP2   1 
ATOM   10360 O  "O5'" . DG  C 2 4   ? 11.227  -13.848 10.788  1.00 44.62  ? 4   DG  X "O5'" 1 
ATOM   10361 C  "C5'" . DG  C 2 4   ? 11.647  -13.828 12.140  1.00 43.20  ? 4   DG  X "C5'" 1 
ATOM   10362 C  "C4'" . DG  C 2 4   ? 13.071  -14.297 12.263  1.00 41.70  ? 4   DG  X "C4'" 1 
ATOM   10363 O  "O4'" . DG  C 2 4   ? 13.093  -15.697 11.926  1.00 44.00  ? 4   DG  X "O4'" 1 
ATOM   10364 C  "C3'" . DG  C 2 4   ? 14.014  -13.623 11.286  1.00 41.27  ? 4   DG  X "C3'" 1 
ATOM   10365 O  "O3'" . DG  C 2 4   ? 14.883  -12.718 11.892  1.00 40.51  ? 4   DG  X "O3'" 1 
ATOM   10366 C  "C2'" . DG  C 2 4   ? 14.855  -14.736 10.698  1.00 43.01  ? 4   DG  X "C2'" 1 
ATOM   10367 C  "C1'" . DG  C 2 4   ? 14.252  -16.031 11.178  1.00 44.88  ? 4   DG  X "C1'" 1 
ATOM   10368 N  N9    . DG  C 2 4   ? 13.812  -16.720 9.976   1.00 46.98  ? 4   DG  X N9    1 
ATOM   10369 C  C8    . DG  C 2 4   ? 13.088  -16.151 8.952   1.00 48.63  ? 4   DG  X C8    1 
ATOM   10370 N  N7    . DG  C 2 4   ? 12.875  -16.963 7.956   1.00 49.46  ? 4   DG  X N7    1 
ATOM   10371 C  C5    . DG  C 2 4   ? 13.481  -18.149 8.351   1.00 49.00  ? 4   DG  X C5    1 
ATOM   10372 C  C6    . DG  C 2 4   ? 13.581  -19.391 7.677   1.00 48.39  ? 4   DG  X C6    1 
ATOM   10373 O  O6    . DG  C 2 4   ? 13.153  -19.694 6.555   1.00 47.40  ? 4   DG  X O6    1 
ATOM   10374 N  N1    . DG  C 2 4   ? 14.272  -20.330 8.438   1.00 47.87  ? 4   DG  X N1    1 
ATOM   10375 C  C2    . DG  C 2 4   ? 14.810  -20.098 9.684   1.00 48.32  ? 4   DG  X C2    1 
ATOM   10376 N  N2    . DG  C 2 4   ? 15.448  -21.133 10.251  1.00 48.42  ? 4   DG  X N2    1 
ATOM   10377 N  N3    . DG  C 2 4   ? 14.731  -18.938 10.323  1.00 48.10  ? 4   DG  X N3    1 
ATOM   10378 C  C4    . DG  C 2 4   ? 14.056  -18.016 9.604   1.00 48.06  ? 4   DG  X C4    1 
ATOM   10379 P  P     . DG  C 2 5   ? 15.624  -11.660 10.966  1.00 41.38  ? 5   DG  X P     1 
ATOM   10380 O  OP1   . DG  C 2 5   ? 15.618  -10.359 11.676  1.00 42.67  ? 5   DG  X OP1   1 
ATOM   10381 O  OP2   . DG  C 2 5   ? 15.040  -11.761 9.611   1.00 41.38  ? 5   DG  X OP2   1 
ATOM   10382 O  "O5'" . DG  C 2 5   ? 17.095  -12.232 10.930  1.00 39.80  ? 5   DG  X "O5'" 1 
ATOM   10383 C  "C5'" . DG  C 2 5   ? 17.706  -12.617 12.137  1.00 40.90  ? 5   DG  X "C5'" 1 
ATOM   10384 C  "C4'" . DG  C 2 5   ? 19.077  -13.159 11.856  1.00 42.89  ? 5   DG  X "C4'" 1 
ATOM   10385 O  "O4'" . DG  C 2 5   ? 18.947  -14.503 11.339  1.00 45.79  ? 5   DG  X "O4'" 1 
ATOM   10386 C  "C3'" . DG  C 2 5   ? 19.786  -12.332 10.793  1.00 42.75  ? 5   DG  X "C3'" 1 
ATOM   10387 O  "O3'" . DG  C 2 5   ? 21.100  -11.974 11.192  1.00 39.48  ? 5   DG  X "O3'" 1 
ATOM   10388 C  "C2'" . DG  C 2 5   ? 19.805  -13.224 9.568   1.00 46.78  ? 5   DG  X "C2'" 1 
ATOM   10389 C  "C1'" . DG  C 2 5   ? 19.594  -14.638 10.089  1.00 49.12  ? 5   DG  X "C1'" 1 
ATOM   10390 N  N9    . DG  C 2 5   ? 18.692  -15.359 9.202   1.00 54.39  ? 5   DG  X N9    1 
ATOM   10391 C  C8    . DG  C 2 5   ? 17.846  -14.773 8.284   1.00 57.24  ? 5   DG  X C8    1 
ATOM   10392 N  N7    . DG  C 2 5   ? 17.146  -15.634 7.600   1.00 59.13  ? 5   DG  X N7    1 
ATOM   10393 C  C5    . DG  C 2 5   ? 17.545  -16.873 8.091   1.00 60.03  ? 5   DG  X C5    1 
ATOM   10394 C  C6    . DG  C 2 5   ? 17.128  -18.182 7.722   1.00 60.20  ? 5   DG  X C6    1 
ATOM   10395 O  O6    . DG  C 2 5   ? 16.301  -18.512 6.859   1.00 61.89  ? 5   DG  X O6    1 
ATOM   10396 N  N1    . DG  C 2 5   ? 17.781  -19.156 8.468   1.00 58.72  ? 5   DG  X N1    1 
ATOM   10397 C  C2    . DG  C 2 5   ? 18.714  -18.906 9.447   1.00 59.83  ? 5   DG  X C2    1 
ATOM   10398 N  N2    . DG  C 2 5   ? 19.217  -19.985 10.069  1.00 59.82  ? 5   DG  X N2    1 
ATOM   10399 N  N3    . DG  C 2 5   ? 19.123  -17.688 9.799   1.00 59.09  ? 5   DG  X N3    1 
ATOM   10400 C  C4    . DG  C 2 5   ? 18.499  -16.723 9.083   1.00 58.05  ? 5   DG  X C4    1 
ATOM   10401 P  P     . DT  C 2 6   ? 21.869  -10.816 10.402  1.00 34.29  ? 6   DT  X P     1 
ATOM   10402 O  OP1   . DT  C 2 6   ? 22.949  -10.383 11.315  1.00 35.65  ? 6   DT  X OP1   1 
ATOM   10403 O  OP2   . DT  C 2 6   ? 20.875  -9.838  9.913   1.00 35.97  ? 6   DT  X OP2   1 
ATOM   10404 O  "O5'" . DT  C 2 6   ? 22.506  -11.575 9.160   1.00 32.40  ? 6   DT  X "O5'" 1 
ATOM   10405 C  "C5'" . DT  C 2 6   ? 23.474  -12.584 9.381   1.00 31.40  ? 6   DT  X "C5'" 1 
ATOM   10406 C  "C4'" . DT  C 2 6   ? 24.149  -12.961 8.090   1.00 31.71  ? 6   DT  X "C4'" 1 
ATOM   10407 O  "O4'" . DT  C 2 6   ? 23.204  -13.641 7.245   1.00 32.81  ? 6   DT  X "O4'" 1 
ATOM   10408 C  "C3'" . DT  C 2 6   ? 24.695  -11.801 7.262   1.00 32.29  ? 6   DT  X "C3'" 1 
ATOM   10409 O  "O3'" . DT  C 2 6   ? 25.892  -12.237 6.635   1.00 31.85  ? 6   DT  X "O3'" 1 
ATOM   10410 C  "C2'" . DT  C 2 6   ? 23.622  -11.583 6.212   1.00 31.87  ? 6   DT  X "C2'" 1 
ATOM   10411 C  "C1'" . DT  C 2 6   ? 23.110  -12.989 5.989   1.00 32.14  ? 6   DT  X "C1'" 1 
ATOM   10412 N  N1    . DT  C 2 6   ? 21.705  -13.054 5.565   1.00 32.51  ? 6   DT  X N1    1 
ATOM   10413 C  C2    . DT  C 2 6   ? 21.412  -13.786 4.444   1.00 32.12  ? 6   DT  X C2    1 
ATOM   10414 O  O2    . DT  C 2 6   ? 22.266  -14.411 3.823   1.00 32.16  ? 6   DT  X O2    1 
ATOM   10415 N  N3    . DT  C 2 6   ? 20.079  -13.771 4.084   1.00 30.47  ? 6   DT  X N3    1 
ATOM   10416 C  C4    . DT  C 2 6   ? 19.045  -13.120 4.738   1.00 29.98  ? 6   DT  X C4    1 
ATOM   10417 O  O4    . DT  C 2 6   ? 17.908  -13.178 4.298   1.00 30.27  ? 6   DT  X O4    1 
ATOM   10418 C  C5    . DT  C 2 6   ? 19.422  -12.399 5.924   1.00 31.09  ? 6   DT  X C5    1 
ATOM   10419 C  C7    . DT  C 2 6   ? 18.362  -11.690 6.708   1.00 31.15  ? 6   DT  X C7    1 
ATOM   10420 C  C6    . DT  C 2 6   ? 20.717  -12.396 6.274   1.00 32.74  ? 6   DT  X C6    1 
ATOM   10421 P  P     . DA  C 2 7   ? 26.795  -11.200 5.827   1.00 32.76  ? 7   DA  X P     1 
ATOM   10422 O  OP1   . DA  C 2 7   ? 27.905  -12.027 5.317   1.00 35.49  ? 7   DA  X OP1   1 
ATOM   10423 O  OP2   . DA  C 2 7   ? 27.105  -10.000 6.611   1.00 34.59  ? 7   DA  X OP2   1 
ATOM   10424 O  "O5'" . DA  C 2 7   ? 25.899  -10.756 4.586   1.00 35.43  ? 7   DA  X "O5'" 1 
ATOM   10425 C  "C5'" . DA  C 2 7   ? 26.343  -11.103 3.290   1.00 37.28  ? 7   DA  X "C5'" 1 
ATOM   10426 C  "C4'" . DA  C 2 7   ? 25.378  -10.678 2.210   1.00 36.95  ? 7   DA  X "C4'" 1 
ATOM   10427 O  "O4'" . DA  C 2 7   ? 24.028  -11.127 2.480   1.00 37.92  ? 7   DA  X "O4'" 1 
ATOM   10428 C  "C3'" . DA  C 2 7   ? 25.267  -9.190  1.927   1.00 36.53  ? 7   DA  X "C3'" 1 
ATOM   10429 O  "O3'" . DA  C 2 7   ? 25.878  -8.844  0.701   1.00 34.23  ? 7   DA  X "O3'" 1 
ATOM   10430 C  "C2'" . DA  C 2 7   ? 23.778  -8.964  1.737   1.00 39.71  ? 7   DA  X "C2'" 1 
ATOM   10431 C  "C1'" . DA  C 2 7   ? 23.171  -10.349 1.681   1.00 36.07  ? 7   DA  X "C1'" 1 
ATOM   10432 N  N9    . DA  C 2 7   ? 21.848  -10.301 2.305   1.00 33.80  ? 7   DA  X N9    1 
ATOM   10433 C  C8    . DA  C 2 7   ? 21.512  -9.519  3.372   1.00 32.82  ? 7   DA  X C8    1 
ATOM   10434 N  N7    . DA  C 2 7   ? 20.236  -9.527  3.647   1.00 32.14  ? 7   DA  X N7    1 
ATOM   10435 C  C5    . DA  C 2 7   ? 19.705  -10.406 2.730   1.00 32.85  ? 7   DA  X C5    1 
ATOM   10436 C  C6    . DA  C 2 7   ? 18.395  -10.831 2.488   1.00 33.84  ? 7   DA  X C6    1 
ATOM   10437 N  N6    . DA  C 2 7   ? 17.342  -10.407 3.197   1.00 38.04  ? 7   DA  X N6    1 
ATOM   10438 N  N1    . DA  C 2 7   ? 18.192  -11.708 1.488   1.00 32.82  ? 7   DA  X N1    1 
ATOM   10439 C  C2    . DA  C 2 7   ? 19.250  -12.133 0.786   1.00 33.18  ? 7   DA  X C2    1 
ATOM   10440 N  N3    . DA  C 2 7   ? 20.533  -11.806 0.916   1.00 32.45  ? 7   DA  X N3    1 
ATOM   10441 C  C4    . DA  C 2 7   ? 20.692  -10.927 1.908   1.00 32.84  ? 7   DA  X C4    1 
ATOM   10442 P  P     . DG  C 2 8   ? 26.468  -7.376  0.542   1.00 33.74  ? 8   DG  X P     1 
ATOM   10443 O  OP1   . DG  C 2 8   ? 27.838  -7.509  -0.001  1.00 34.19  ? 8   DG  X OP1   1 
ATOM   10444 O  OP2   . DG  C 2 8   ? 26.247  -6.680  1.840   1.00 32.06  ? 8   DG  X OP2   1 
ATOM   10445 O  "O5'" . DG  C 2 8   ? 25.538  -6.721  -0.559  1.00 33.52  ? 8   DG  X "O5'" 1 
ATOM   10446 C  "C5'" . DG  C 2 8   ? 25.365  -7.356  -1.807  1.00 35.24  ? 8   DG  X "C5'" 1 
ATOM   10447 C  "C4'" . DG  C 2 8   ? 24.216  -6.726  -2.553  1.00 37.89  ? 8   DG  X "C4'" 1 
ATOM   10448 O  "O4'" . DG  C 2 8   ? 22.970  -7.085  -1.904  1.00 36.54  ? 8   DG  X "O4'" 1 
ATOM   10449 C  "C3'" . DG  C 2 8   ? 24.282  -5.199  -2.603  1.00 39.30  ? 8   DG  X "C3'" 1 
ATOM   10450 O  "O3'" . DG  C 2 8   ? 24.203  -4.720  -3.947  1.00 40.40  ? 8   DG  X "O3'" 1 
ATOM   10451 C  "C2'" . DG  C 2 8   ? 23.111  -4.726  -1.761  1.00 39.46  ? 8   DG  X "C2'" 1 
ATOM   10452 C  "C1'" . DG  C 2 8   ? 22.216  -5.941  -1.537  1.00 39.79  ? 8   DG  X "C1'" 1 
ATOM   10453 N  N9    . DG  C 2 8   ? 21.886  -6.053  -0.116  1.00 42.22  ? 8   DG  X N9    1 
ATOM   10454 C  C8    . DG  C 2 8   ? 22.768  -5.885  0.922   1.00 41.30  ? 8   DG  X C8    1 
ATOM   10455 N  N7    . DG  C 2 8   ? 22.206  -5.947  2.095   1.00 42.93  ? 8   DG  X N7    1 
ATOM   10456 C  C5    . DG  C 2 8   ? 20.867  -6.196  1.829   1.00 44.90  ? 8   DG  X C5    1 
ATOM   10457 C  C6    . DG  C 2 8   ? 19.763  -6.349  2.722   1.00 46.01  ? 8   DG  X C6    1 
ATOM   10458 O  O6    . DG  C 2 8   ? 19.753  -6.285  3.952   1.00 47.94  ? 8   DG  X O6    1 
ATOM   10459 N  N1    . DG  C 2 8   ? 18.578  -6.588  2.038   1.00 46.52  ? 8   DG  X N1    1 
ATOM   10460 C  C2    . DG  C 2 8   ? 18.459  -6.661  0.671   1.00 48.12  ? 8   DG  X C2    1 
ATOM   10461 N  N2    . DG  C 2 8   ? 17.229  -6.883  0.206   1.00 48.71  ? 8   DG  X N2    1 
ATOM   10462 N  N3    . DG  C 2 8   ? 19.477  -6.518  -0.179  1.00 49.16  ? 8   DG  X N3    1 
ATOM   10463 C  C4    . DG  C 2 8   ? 20.650  -6.285  0.470   1.00 45.79  ? 8   DG  X C4    1 
ATOM   10464 P  P     . DT  C 2 9   ? 24.021  -3.160  -4.224  1.00 35.98  ? 9   DT  X P     1 
ATOM   10465 O  OP1   . DT  C 2 9   ? 24.370  -2.957  -5.644  1.00 36.95  ? 9   DT  X OP1   1 
ATOM   10466 O  OP2   . DT  C 2 9   ? 24.711  -2.381  -3.187  1.00 37.09  ? 9   DT  X OP2   1 
ATOM   10467 O  "O5'" . DT  C 2 9   ? 22.463  -2.955  -4.014  1.00 40.92  ? 9   DT  X "O5'" 1 
ATOM   10468 C  "C5'" . DT  C 2 9   ? 21.558  -3.107  -5.090  1.00 46.91  ? 9   DT  X "C5'" 1 
ATOM   10469 C  "C4'" . DT  C 2 9   ? 20.429  -2.120  -4.939  1.00 52.51  ? 9   DT  X "C4'" 1 
ATOM   10470 O  "O4'" . DT  C 2 9   ? 19.506  -2.608  -3.933  1.00 52.20  ? 9   DT  X "O4'" 1 
ATOM   10471 C  "C3'" . DT  C 2 9   ? 20.912  -0.747  -4.470  1.00 56.63  ? 9   DT  X "C3'" 1 
ATOM   10472 O  "O3'" . DT  C 2 9   ? 20.492  0.297   -5.345  1.00 64.75  ? 9   DT  X "O3'" 1 
ATOM   10473 C  "C2'" . DT  C 2 9   ? 20.300  -0.584  -3.090  1.00 55.85  ? 9   DT  X "C2'" 1 
ATOM   10474 C  "C1'" . DT  C 2 9   ? 19.131  -1.552  -3.075  1.00 53.78  ? 9   DT  X "C1'" 1 
ATOM   10475 N  N1    . DT  C 2 9   ? 18.877  -2.112  -1.728  1.00 54.59  ? 9   DT  X N1    1 
ATOM   10476 C  C2    . DT  C 2 9   ? 17.635  -2.645  -1.423  1.00 55.46  ? 9   DT  X C2    1 
ATOM   10477 O  O2    . DT  C 2 9   ? 16.718  -2.734  -2.228  1.00 55.40  ? 9   DT  X O2    1 
ATOM   10478 N  N3    . DT  C 2 9   ? 17.507  -3.078  -0.120  1.00 55.20  ? 9   DT  X N3    1 
ATOM   10479 C  C4    . DT  C 2 9   ? 18.470  -3.041  0.877   1.00 53.32  ? 9   DT  X C4    1 
ATOM   10480 O  O4    . DT  C 2 9   ? 18.209  -3.454  2.006   1.00 50.83  ? 9   DT  X O4    1 
ATOM   10481 C  C5    . DT  C 2 9   ? 19.743  -2.499  0.479   1.00 53.31  ? 9   DT  X C5    1 
ATOM   10482 C  C7    . DT  C 2 9   ? 20.848  -2.439  1.484   1.00 53.47  ? 9   DT  X C7    1 
ATOM   10483 C  C6    . DT  C 2 9   ? 19.882  -2.070  -0.782  1.00 53.98  ? 9   DT  X C6    1 
ATOM   10484 P  P     . DA  C 2 10  ? 21.377  1.635   -5.463  1.00 68.98  ? 10  DA  X P     1 
ATOM   10485 O  OP1   . DA  C 2 10  ? 21.728  1.849   -6.891